3CR9A

Crystal structure of the complex of lactoferrin with 6-(hydroxymethyl)oxane-2,3,4,5-tetrol at 3.49 a resolution
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lactotransferrin
publication title Crystal structure of the complex of Lactoferrin with 6-(Hydroxymethyl)oxane-2,3,4,5-tetrol at 3.49 A resolution
rcsb
molecule tags Antibiotic
total genus 204
structure length 689
sequence length 689
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cr9A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cr9A04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cr9A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cr9A03
1I69A 3WAEA 1URGA 4WEDA 5FHOA 3ILTB 1MY0A 4I9DA 1LB8A 3EF7A 4YKIA 1MY3A 5FTIA 2QPQA 2RC9A 1GV8A 4YAHX 1B40A 3D4GA 3RT8A 5I56A 3C32A 2DXYA 3TQWA 2O84X 1LFGA 3CFXA 4QFOA 4KD5A 4EQ9A 3B6WA 4QSDA 4XKNA 1F9BA 4MFIA 1QKBA 5DVJA 1MPDA 1O7TA 1US4A 2VOZA 5I59A 3H6WA 3KN3A 4GF8A 4F19A 3UP9A 4R72A 4AQ4A 1XT8A 1DOTA 2I48A 1NH7A 3JV9A 4I62A 4YMAA 1MXVA 3TYHA 2F7BA 2V25A 4JWOA 4ZECA 1B05A 4NF4B 3KGCA 3MWBA 1GGGA 4U1ZA 1TFDA 4G4PA 2V3QA 3PV0E 3OOAA 3MVWA 4R74A 2OZZA 4U21A 1BTJA 3G3HA 3KSJA 3THIA 2H98A 1B3HA 2XXXA 3IR1A 3U94A 4R6KA 3ZSFA 1DTZA 1IXIA 5ELVA 4DXBA 1B32A 4QFNA 5KCJB 1B5HA 3PGFA 1XS5A 3Q28A 1EZPA 1B4HA 3IJXB 3SESA 4H5FA 2Y7WA 1DPEA 5AA4B 2DVCA 2E0SA 5CI5A 4MLVA 3K01A 2AYSA 5HM4B 3TTNA 2XXWA 3IB0A 3PPOA 3QK6A 4LP2B 3M8UA 4HS7A 4FEDA 4QFKA 2I49A 4QHQA 4C1TA 2GHBA 1MM6A 5HBCA 1RKMA 2FYIA 3PMVA 2OWSA 3BKIB 3FVGA 4E0WA 1R9QA 2F7AA 4R2BA 3MUQA 3T22A 3L6GA 4KCCA 5I56B 2QL3A 2I6EA 1VR5A 4TQUQ 3TUSA 3OSRA 2NWJA 1SYHA 4OVJA 2P1SA 3VFJA 4YB6A 5TU0A 2H25A 5AA2D 1VFDA 4TLLB 1MXYA 2REGA 4GRKA 5EHMA 4PETA 5I59B 3TEPA 3G7WA 4LONB 5TPAB 1A99A 5EYFA 3DELB 1LB9A 2A5TA 3QYTA 3CSGA 1YAEA 3GBAA 4F29A 3CI8A 1FTKA 3K2DA 4KI0E 3M3LA 1A40A 2F6GA 3HPIA 1P1WA 4WKMA 2PX1A 4I1DA 1MQDA 3PUYE 4C0RA 4NF5A 4KYSA 1R9LA 3V8XB 4FATA 1QW0A 1SDXA 1SW1A 3ODBA 3UORA 4NF6A 1FQFA 3TMGA 4NF8B 2F36A 4F18A 4E0XA 4NWDA 4BDMA 2XXUA 3UGWA 1YPNA 4F1VA 4X9TA 1IIWA 3G3FA 1LGBC 1POTA 1D9VA 1GTKA 4DE8A 5AA3A 4ESWA 3TKDA 3LSFB 3KEIA 2CMOA 1WDNA 1S7YA 3VE1B 1AL3A 5AA2B 4X1DA 2O51A 1HSEA 3W9VA 2F6PA 1FQEA 3N6TA 2OCUA 4U22A 4G2ZA 2BJJX 4Q0CA 3CFLA 2DWHA 4BDQA 3RT6B 3V5AA 1MS7A 2DWJA 1JW4A 1MRPA 4Z0IA 5ITPA 4IO6A 3EHUA 2HAUA 1JQFA 2R9JA 3HV1A 1PB7A 3S9EA 1P99A 4F2OA 2HEUA 3SEVA 1A55A 1WODA 3C36A 1MPBA 3HN0A 3MVZA 4GQOA 3N26A 5DT6A 3N5LA 1P1QA 1EZ9A 2A5TB 4HW8A 3DP6A 5KZTA 3GBBA 3TTMA 2VGQA 1Q35A 4EF2A 1MY2A 2ONSA 3K1PA 3IK6B 4HCWA 1URSA 4GD5A 3HHFA 5H8FA 5ICTA 4FIMA 5I2NA 3CR9A 4KYEA 2PT1A 4NF5B 1P1UA 3H6TA 3K02A 2PBWA 3TAJA 4MF3A 4O3CA 5TP9A 1MPCA 4NF6B 1QJMA 4OXVA 3MP1A 1B4ZA 2ZMBA 3UIFA 4RJZA 1H44A 2X7QA 3MZ1A 3UK4A 3HCQA 3TTLA 1QKAA 5CMBA 3FV2A 4M4GA 5L9MA 3O6IA 1MQHA 4GXAA 4RYAA 1FW0A 3KOSA 2F78A 3S2VA 3RUMA 4N6PA 2D5WA 4OTEA 3VVFA 3OO8A 4OQOA 3K6UA 1EZOA 4OEVA 1B1HA 1UIVA 4H8IA 4XXUA 4P0IA 1NKXA 1UIUA 3OO9A 4QF9A 3VVEA 5ICQA 4TOZA 3M3KA 3K6VA 4YZZA 3S9MC 1SBPA 1OQHA 4GWOA 3TPAA 4GFRA 4YKJA 3Q25A 2Y7KA 1BP5A 1PBQA 3IB2A 4DLDA 4JBZA 2LAOA 1Y20A 4HCYA 4PE5B 4AB5A 3QUJA 1LAHE 1B6HA 3KZGA 1LCFA 3N6UA 3FXRA 2VP1A 4ZEIA 5ISUA 4F3BA 1AMFA 2W7YA 5L8DA 1LSTA 5I2NB 2DE4A 1JVXA 1B51A 3PD9A 3QXMA 4I8CA 3K6XA 1L5TA 1MXZA 4LZ8A 1SYIA 1I6AA 3PPRA 5TP9B 3IOWA 3TCGA 4NWCA 1PBPA 1FTJA 2H4IA 4R2FA 1XVXA 1A8FA 3B6TA 1Y4CA 3PPNA 4G8NA 3KN8A 2V3TA 1SD3A 1ZTYA 2QJEA 1N04A 3RLFE 3K1NA 1TXFA 3IB1A 1JW1A 4LZ7A 1I6BA 3H7MA 4KHZE 3I5OA 3FJGA 1BKAA 4IGRA 4IB2A 3PMWA 3MAMA 4YKKA 3FZVA 4OFLA 3IOUA 1UQWA 3AXFA 5K2YA 1ZJLA 3PPQA 3O29A 3W9WA 5TPAA 5A5XB 4F1YA 5J1DA 3S9LC 4OENA 3RTWB 1SQYA 3O6GA 5CBRA 4ZE9A 2FNCA 3FIRA 3FUZA 3FVNA 4THIA 1IUDA 3LR1A 1ZKBA 4ZDMA 3O6HA 2Q9TA 3U72A 4G8HA 1N84A 4YB5A 4U4XA 1OLCA 2QS2A 1LAXA 5I84A 4NTLA 4GL8A 1US5A 4U4SA 1MH3A 4DIGA 2RC8A 2G29A 3T9HB 4EQBA 4F2QA 3KG2A 3U92A 1YCJA 4JB7A 4IY5A 4NF8A 4Q30B 2XD3A 2B3FA 3QIMA 1B0LA 4KYDA 1LLSA 1D3KA 3FXQA 3KJTA 3Q26A 3TFLA 4EF1A 1A54A 4RPNA 4X48A 1JEUA 1QVSA 4R73A 3OEKA 1M5DA 2RCAA 2RCBA 2QS3A 2Q2AA 4P11A 5AA2A 2ANJA 3VVDA 1AOVA 4OZ9A 1MQJA 3DP4A 3Q29A 3P7IA 1MG1A 5JEIA 1Y3PA 2Q2CA 2RC7A 4TLMB 2GHAA 4H6DA 1ELJA 4RK9A 3F11A 4AB6A 5F7VA 2E1SA 1NH8A 2DS9A 3KN7A 4PFTA 3KBRA 1EH3A 4YKPA 4ELOA 1LAFE 3MZ9A 5H8QA 4N13A 3R26A 1O63A 3TODA 1ZMGA 3DLNA 4ISUA 2XXIA 1QUJA 2H9BA 2HZKA 1JNFA 2D21A 2V84A 2I4BA 2VHAA 4FECA 4NE4A 3LC8A 3H4ZA 3U1OA 1B3EA 1J1NA 2ONKE 2OLBA 4PFWA 4WEPA 3CIJA 1DMBA 4MLQA 3V89B 2X7PA 3JYRA 2H99A 3IORA 2DWIA 2O7UA 2DE2A 2DSFA 2XXRA 4IO3A 3OO7A 2OK2A 4OEUA 4ONYA 3A3CA 1P1OA 3FVKA 2I0CA 1B7ZA 3OELA 5CBSA 3TELA 2I4CA 1I6QA 1B3LA 1OVBA 1NL5A 3SETA 1B7HA 3TCHA 1N3XA 3MZBA 4IO4A 1QUIA 2HAVA 3UN6A 3SEUA 2ZYMA 3E3KA 2V3UA 1Y1ZA 4OESA 4RNSA 2NXOA 4XIGQ 4U2RA 4LATA 1M5CA 5JK4A 3FXUA 4F3PA 3BBRA 1N0TA 3V83A 1SI1A 2ALUA 4R9GA 4RA1A 1DPPA 3IJOB 3T9VA 2F8DA 4JWYA 1B52A 3TTKA 4F3GA 4BDLA 4KCDA 4QRZA 1URDA 3BFTA 3ZKKA 1ZU0A 4BDRA 4O3AA 4POXA 2Z22A 2AIXA 5H8QB 2XXTA 2PMSA 4F31B 2IEEA 3B7DA 3FASA 3TQLA 3CVGA 2Z23A 1PDAA 4ZEFA 2I58A 1B5JA 3ZKLA 3S9NC 2XXHA 4FE8A 3TZAA 2HXWA 4OFOA 1DSNA 5FTHA 3MJNA 4ZZAA 2O68A 4LUBA 3IX1A 1BIYA 5DYHA 2DYXA 3H06B 4EQ7A 2UVGA 3K00A 4R6HA 2DE3A 1II5A 1PB9A 3MPLA 3MPKA 2GFEA 2ZYNA 3CFZA 3A09A 2O1LA 3H03A 3FD3A 1CE2A 3T66A 4WXJA 4ECFA 1ATGA 1B5IA 1RYOA 3LSWA 2Y7RA 1N3WA 1A7LA 1MY1A 2YPNA 1A8EA 1HSLA 2F97A 5DEXA 3M3FA 2YLNA 2UYEA 2F7CA 3S4UA 4LQ5A 3Q27A 4DDDA 3SEYA 5JTYB 4F22A 3K0VA 4MH5A 4YICA 1SI0A 3OENA 4RY1A 3C33A 3PUZE 3MVXA 1N76A 5KDTA 3O2AA 3G3JA 4DCYA 1AIVA 4OHNA 4XKRA 4F1UA 4IO5A 5L9SA 5AA1A 5IKBA 4KQPA 4H67A 5H8SA 3C9HA 1OQGA 1Y3QA 2REJA 4ELPA 1NMUA 4GLIA 5A5XA 3EPEA 4O3BA 2ZNSA 1IXHA 5EHSA 1B9JA 1MY4A 1SW2A 3PPPA 1D4NA 4YU0A 3D4CA 2ZXTA 1DTGA 1QULA 3R6UA 2Z8DA 4XKQA 2I0BA 3LUYA 2IA4A 3LSXA 4QFLA 3VXBA 4LA9A 5H8NB 4GOTA 1OMPA 4KR5A 1PC3A 2YJPA 3RPWA 1LBCA 4KFQA 3HHGA 3SKPA 2HQ0A 3MQ9A 3JZJA 4H1XA 3FJ7A 4NEDA 4GVOA 1Z7NE 3GLBA 4PFYA 3CSBA 1WVJA 2ZYOA 4GIZA 3SDFA 1VSOA 1B58A 4IGTA 3BFUA 4X1BA 2QMWA 1R1NA 1XC1A 3VXCA 4K3FA 2Y7PA 2NOOA 1IQ7A 3PD8A 4F3SA 5FHMA 4U1OA 1UTHB 2Z8FA 5H8HA 4F39A 1IITA 2DP8A 4MBPA 2R71A 1FCKA 2D3IA 1PB8A 1OVTA 3FATA 3KSXA 1JETA 5DEXB 2ABHA 4Q5TA 4XTCQ 3PUWE 3MW0A 3OXNA 1FTMA 3KFMA 2QS4A 3FJMA 2ESNA 2VD3A 1N7XA 4FEBA 5KDTB 1VFEA 1Z7ME 1B0HA 1LCTA 1B2HA 2Q8JA 3KJ7A 2O69A 1FQDA 1H3DA 4HTGA 1B3FA 3K1MA 2V93A 3RGYA 1Y3NA 2ZYKA 3OO6A 1P1NA 2DOJA 1FQCA 1LFIA 3IOVA 2UXAA 1B3GA 1TFAA 3K6WA 3QAXA 2I3WA 4DXCA 1D9YA 3TTRA 3RY3A 2XX8A 3CRBA 2F5XA 3IL1B 5BWJA 2F35A 3C31A 2QMXA 4R9FA 2PYYA 4QSCA 4JSDA 2NUVA 2ZNUA 4XKPA 3VLVA 4C1UA 3LBSA 3TDJA 4LVQA 1SW5A 4UA8A 2OWTA 5F1QA 2RKMA 3PUVE 5L9OA 4ZS9A 4H65A 2ZNTA 1TT1A 1Y9UA 3B6QA 3U8QA 3MVYA 3RTFB 5CRYA 3T96B 5DVFA 3ILUB 4POWA 4ND9A 1BLFA 4L17A 3DP8A 3OSQA 4DXUA 2P0SA 1NNTA 1TWYA 4H5GA 4PQJA 4EXKA 5CMCA 5H8HB 1JW5A 3MP8A 2GH9A 1B1XA 2XXPA 4LZ5A 1RYXA 3EN3A 4UACA 1B46A 3C4MA 2FA7A 2Q89A 2DQVA 3O66A 4RPOA 2UYFA 3N94A 2XXQA 3PUXE 1PEBA 1R6ZA 3H6UA 3VDFA 2QSXA 5B70A 3FGSA 1SVXB 2HCAA 2UVIA 3OEMA 1UTBA 1H43A 4KPTA 3ZS6A 4ELRA 1GVCA 4OWDA 3VLUA 2OBGA 4FJPA 4JSOA 1XOCA 2G93A 1XHYA 4LQ2A 4EUOA 1VE4A 1M5FA 3DM0A 3T93B 2PVUA 4ZEBA 3O97A 3FV1A 2GRVA 2F34A 2Y84A 3SERA 4ELQA 2AL5A 3IO6A 3U93A 4RXLA 3H3GA 4M1VA 3PMXA 3EQ1A 2XXYA 4BDNA 2QRYA 2A5SA 3E9XA 3ECRA 4ZEKA 2QS1A 3IOTA 5B7DA 5JTYA 1OLAA 3QUFA 1S50A 4JDFA 1YTVA 5I58A 1H45A 3A3UA 3VLWA 3HO7A 1NNFA 4G8MA 3C34A 4IO2A 2OJTA 2UVJA 3CG1A 5CM6A 2ONRA 2XXVA 3KOTA 1MDP1 5DTBA 5IAIA 1GR2A 1MH4A 2KLFA 2H5YA 4JWXA 4N07A 1Y1MA 4G77A 4P0GA 3GXAA 2O1MA 4QSEA 1MDQA 3OD7A 5I2KA 1FQAA 3IO4A 4Z7EA 3USDA 3RN8A 2XD2A 2M8CA 2P2AA 3VV5A 3EHTA 3E4RA 2CZLA 5I57A 1UTBB 2VD2A 2I3VA 3T9UA 4DZ1A 1POY1 3W15C 1MXXA 5BUUA 2XX9A 5H8NA 2Y7IA 3GZGA 3I3VA 1M5BA 5CC2A 4H8JA 2X26A 1JVYA 2DWAA 4EXLA 2RF1A 2UVHA 1FTOA 1USYH 4NMYA 3H6VA 4G68A 1KWHA 4OYVA 1MM7A 1H76A 4PFUA 3EHSA 1MQGA 5CMMA 1LAGE 2RINA 3RNNA 1T0KA 1NNPA 3G3GA 4RK2A 2WKYA 2HZLA 1HSJA 2B3BA 1N7WA 2HFBA 4FAJA 1LFHA 3K4UA 3SEWA 1UTHA 1MXWA 4H0WA 4U23A 2AL4A 4PP0A 3L6HA 1M5EA 3R7XA 1NFTA 3E13X 1USYE 1ANFA 2O6AA 1XVYA 3G3KA 5I58B 5DVIA 2O7IA 3OMBA 1IEJA 1B7UA 1O64A 1MQIA 4OETA 3MC2A 3I6VA 3FVOA 1LBBA 2R6GE 4BLAA 1SW4A 4YMBA 3G3IA 1IZ1A 2XX7A 3HSTA 1NNKA 4GL0A 1ZIUA 5I2KB 2B65A 1ZLQA 4R6YA 1MXUA 1EU8A 1Y4TA 4YB7A 5FHNA 2DVZA 1FQBA 1CB6A 4IO7A 1QUKA 3TCFA 3UA8A 4ESXA 3C35A 3PU5A 5I57B 3MBPA 4ZE8A 1AH5A 4QFPA 2DXRA 4JXIA 3MP6A 2THIA 5HPQA 4NF4A 4DCXA 5CMKA 4OFJA 1JEVA 3LSLA 5LOMA 2Z8EA 4G68B 5ITOA 1ZBMA 3ONMA 3T9XB 4ZEDA 5AE4A 4BDOA 1IXCA 5M2VA 5K2XA 3O28A 1IXGA 4IY6A 2PT2A 1S9TA 5KCJA 4GXSB 3CG3A 3O9PA 1OIBA 5H8FB 3QSLA 4R75A 4OMBA 5AA4A 2Q88A 3SEXA 4Q8RA 3IAZA 4EDPA 1Q1KA 4G68C 4ZZEA 3RQTA 3WAFA 2XHDA 2NVUB 4FORA 4OERA 1FTLA
chains in the Genus database with same CATH superfamily
1I69A 3WAEA 1URGA 4WEDA 5FHOA 3ILTB 1MY0A 4I9DA 1LB8A 3EF7A 4UABA 4YKIA 1MY3A 5FTIA 2QPQA 2RC9A 1GV8A 4YAHX 4N8GA 1FPEA 1B40A 3D4GA 3RT8A 5I56A 1DK4A 3C32A 2DXYA 3TQWA 2O84X 1LFGA 3CFXA 4QFOA 3U65A 4KD5A 4EQ9A 3B6WA 4QSDA 4XKNA 1F9BA 4MFIA 1QKBA 4PAFA 5DVJA 4PTKA 1MPDA 1O7TA 1US4A 2VOZA 4OVTA 5I59A 3ISPA 3H6WA 3KN3A 4GF8A 4F19A 4PDHA 3UP9A 4R72A 4AQ4A 1RDYA 1XT8A 4PF6A 1DOTA 2I48A 1NH7A 3JV9A 4I62A 4P1EA 4YMAA 1MXVA 3TYHA 2F7BA 2V25A 4JWOA 4ZECA 1B05A 4NF4B 5T3JA 3KGCA 3MWBA 1LBXA 1GGGA 4PGNA 4U1ZA 4GWWA 3FXBA 1TFDA 4G4PA 2V3QA 3PV0E 3OOAA 4OVRA 3MVWA 1NUYA 4R74A 5EQAA 2OZZA 4U21A 1BTJA 3G3HA 3KSJA 3THIA 2H98A 1B3HA 5IZZA 2XXXA 3IR1A 3U94A 4R6KA 3ZSFA 1DTZA 1IXIA 4H45A 5ELVA 4DXBA 1B32A 4QFNA 5KCJB 4OVPA 1B5HA 3PGFA 4N81A 3T0JA 1XS5A 3Q28A 1EZPA 1B4HA 3IJXB 3SESA 4H5FA 2Y7WA 1INPA 1DPEA 5AA4B 1FBHA 2DVCA 2E0SA 5CI5A 4MLVA 3K01A 2AYSA 5HM4B 3TTNA 2XXWA 3IB0A 3PPOA 3QK6A 4N91A 4LP2B 1LBWA 3M8UA 2WYKA 4HS7A 4FEDA 4QFKA 2I49A 4QHQA 4C1TA 2GHBA 1MM6A 5HBCA 1RKMA 4PBHA 4NHBA 2FYIA 3PMVA 2OWSA 3BKIB 3FVGA 4E0WA 1R9QA 2F7AA 4R2BA 3MUQA 3T22A 2ZZWA 3L6GA 4KCCA 5I56B 2QL3A 2I6EA 4O7IA 1VR5A 4TQUQ 3TUSA 3OSRA 2NWJA 1SYHA 4OVJA 2P1SA 3KC0A 4PAIA 3VFJA 4YB6A 5TU0A 4PE3A 2H25A 5AA2D 3KC1A 1VFDA 4P56A 4TLLB 1MXYA 2REGA 4GRKA 4N8YA 5EHMA 4PETA 5I59B 3TEPA 3G7WA 4LONB 5TPAB 1A99A 5EYFA 3DELB 1LB9A 2A5TA 3QYTA 3CSGA 1KA0A 4X04A 1YAEA 3GBAA 2FBPA 4F29A 3CI8A 1FTKA 3K2DA 5IM2A 4KI0E 3M3LA 4GWXA 2PFYA 1A40A 1FTAA 2F6GA 3HPIA 1P1WA 4WKMA 2PX1A 1FBPA 4I1DA 1MQDA 3PUYE 4C0RA 3BIHA 4NF5A 4KYSA 1R9LA 3V8XB 4FATA 1QW0A 1SDXA 1SW1A 2Y5LA 3ODBA 3UORA 4GBWA 4NF6A 1FQFA 5ET6A 3TMGA 4NF8B 2F36A 4F18A 4E0XA 4NWDA 4BDMA 1FPJA 2XXUA 3UGWA 1YPNA 4F1VA 4X9TA 1IIWA 3G3FA 1LGBC 3LV0A 1POTA 5EQ7A 1D9VA 1GTKA 4HE0A 4DE8A 5AA3A 4ESWA 3TKDA 2L5VA 3LSFB 3KEIA 2CMOA 4O94A 1WDNA 2KR0A 1S7YA 3VE1B 1AL3A 5AA2B 4X1DA 2O51A 1HSEA 3W9VA 2F6PA 4P1LA 1FQEA 3D1RA 4O7MA 3N6TA 2OCUA 4U22A 4G2ZA 4LN5A 2BJJX 4Q0CA 1LEVA 2DWHA 3CFLA 4BDQA 3RT6B 3V5AA 4GWUA 1MS7A 1DBZA 2DWJA 1JW4A 1MRPA 4Z0IA 5ITPA 4IO6A 3EHUA 2HAUA 1JQFA 2R9JA 3HV1A 1XI6A 1PB7A 3S9EA 2WEFA 1P99A 4G61A 4F2OA 2HEUA 3SEVA 1A55A 1WODA 3C36A 1MPBA 3HN0A 4O8MA 3MVZA 4GQOA 3N26A 5DT6A 3SZPA 3N5LA 1P1QA 1EZ9A 2A5TB 4HW8A 3DP6A 5KZTA 2CEXA 4PFIA 3GBBA 3TTMA 2VGQA 1Q35A 4EF2A 1MY2A 2ONSA 3K1PA 3IK6B 4HCWA 1URSA 4GD5A 3HHFA 3T1BA 5H8FA 5ICTA 4FIMA 5I2NA 3CR9A 4DI4B 4KYEA 2PT1A 4NF5B 1P1UA 3H6TA 2XA5A 3K02A 2PBWA 4QBAA 3TAJA 4MF3A 4O3CA 5TP9A 1MPCA 4NF6B 1QJMA 4OXVA 1KZ8A 3MP1A 1B4ZA 2ZMBA 3UIFA 4RJZA 1H44A 2X7QA 3MZ1A 3UK4A 1NI9A 3HCQA 3TTLA 1QKAA 4N6KA 5CMBA 3FV2A 4M4GA 2CZIA 5L9MA 3O6IA 1MQHA 4GXAA 4RYAA 1FW0A 3KOSA 2F78A 3S2VA 3RUMA 1BK4A 4N6PA 2D5WA 4XEQA 4OTEA 3VVFA 3OO8A 4IR8A 4OQOA 3K6UA 1EZOA 4OEVA 4OVSA 1B1HA 1UIVA 4H8IA 4XXUA 4P0IA 1NKXA 1EYJA 4MNCA 3MSTA 1UIUA 3OO9A 4MMPA 4QF9A 3VVEA 5ICQA 2FVZA 4TOZA 3M3KA 1LBZA 3K6VA 4YZZA 3S9MC 1SBPA 1OQHA 4GWOA 3TPAA 4MCOA 4GFRA 4YKJA 3Q25A 2Y7KA 1BP5A 2QVVA 1PBQA 4N15A 3IB2A 4DLDA 3E78A 4JBZA 2LAOA 1Y20A 1FJ6A 4HCYA 4PE5B 4AB5A 3QUJA 1LAHE 1B6HA 3KZGA 1LCFA 3N6UA 3FXRA 4KXPA 4FBPA 2F3BA 2VP1A 1NV6A 2XWVA 4ZEIA 5ISUA 4F3BA 1AMFA 2W7YA 2XWKA 5L8DA 1LSTA 5I2NB 2DE4A 1JVXA 1B51A 1SPIA 3PD9A 3QXMA 4I8CA 3K6XA 1L5TA 1MXZA 4LZ8A 1NV7A 1SYIA 1I6AA 3PPRA 5TP9B 3IOWA 3TCGA 4NWCA 1PBPA 1FTJA 2H4IA 4R2FA 1XVXA 1A8FA 3B6TA 1Y4CA 3PPNA 4G8NA 3KN8A 4AS5A 2HPGA 2V3TA 1SD3A 1ZTYA 2QJEA 1N04A 3RLFE 3K1NA 1TXFA 3IB1A 1JW1A 4LZ7A 1I6BA 3H7MA 4KHZE 3I5OA 3FJGA 1BKAA 4PAKA 4IGRA 4IB2A 3PMWA 3MAMA 4YKKA 3FZVA 4NX1A 4OFLA 3IOUA 4P3LA 1UQWA 3AXFA 5K2YA 1ZJLA 4PCDA 5LTCA 3PPQA 3O29A 3W9WA 2WX9A 4MX6A 5TPAA 5A5XB 4F1YA 5J1DA 3S9LC 2VPNA 4OENA 3RTWB 1SQYA 3O6GA 5CBRA 4ZE9A 2FNCA 3FIRA 4THIA 3FUZA 3FVNA 1IUDA 1FPBA 3LR1A 1ZKBA 4ZDMA 3O6HA 2Q9TA 3U72A 4G8HA 3NOHA 1N84A 4YB5A 4U4XA 1OLCA 2QS2A 1LAXA 5I84A 4NTLA 4GL8A 1US5A 4U4SA 1MH3A 5EQ8A 4DIGA 2RC8A 2G29A 3T9HB 4EQBA 4F2QA 1YXIA 3KG2A 3U92A 1YCJA 2P3VA 4JB7A 1IMCA 2XWIA 4IY5A 4NF8A 4Q30B 2XD3A 2B3FA 3QIMA 1B0LA 4KYDA 1LLSA 1D3KA 2ZZXA 3FXQA 3KJTA 3Q26A 3TFLA 4EF1A 1A54A 4RPNA 4X48A 4NG7A 1FBDA 1JEUA 1QVSA 4R73A 2XXKA 3OEKA 1M5DA 2RCAA 2RCBA 2QS3A 2Q2AA 4P11A 1EYIA 1IMFA 5AA2A 2ANJA 4MAGA 1FJ9A 3VVDA 1AOVA 4OZ9A 1MQJA 3DP4A 3Q29A 3B8BA 2WYPA 3P7IA 1MG1A 5JEIA 1Y3PA 2Q2CA 2RC7A 4TLMB 2GHAA 4H6DA 1ELJA 4RK9A 3F11A 4AB6A 5F7VA 2E1SA 1NH8A 4JVDA 1FSAA 2DS9A 1FBFA 3KN7A 4PFTA 3KBRA 2WBDA 1EH3A 4YKPA 4ELOA 1LAFE 3MZ9A 5H8QA 4N13A 3R26A 1O63A 3TODA 1ZMGA 2R8TA 3DLNA 4ISUA 2XXIA 2KQZA 1QUJA 2H9BA 2HZKA 1JNFA 2D21A 2V84A 2I4BA 2VHAA 1LBVA 4FECA 4NE4A 3LC8A 3H4ZA 3U1OA 5IZ3B 1B3EA 3LUZA 1J1NA 4I3EA 2ONKE 2OLBA 4PFWA 4WEPA 3CIJA 1DMBA 4MLQA 3V89B 2X7PA 3JYRA 2H99A 3IORA 2DWIA 2O7UA 2DE2A 2GQ1A 2DSFA 2XXRA 4N6DA 5IGAA 4IO3A 3OO7A 2OK2A 4OEUA 2FHYA 4ONYA 3A3CA 1P1OA 3FVKA 2I0CA 1B7ZA 3OELA 5CBSA 1FRPA 4PC9A 3TELA 1KA1A 2I4CA 1I6QA 1B3LA 4GX6A 1OVBA 4HE2A 1NL5A 5EYGA 3SETA 1B7HA 4P9KA 4MNPA 3TCHA 1N3XA 4JVIA 3MZBA 4IO4A 1QUIA 2HAVA 3UN6A 3SEUA 2ZYMA 3E3KA 4I40A 2V3UA 1Y1ZA 4OESA 4RNSA 2NXOA 5I3SA 4XIGQ 4U2RA 4LATA 1M5CA 5JK4A 3FXUA 4F3PA 3BBRA 1N0TA 3V83A 1NV5A 5J16A 1SI1A 2ALUA 4NGUA 4R9GA 4RA1A 1DPPA 3IJOB 1FPFA 1YYZA 1K9YA 3PTYA 3T9VA 1FBEA 2F8DA 4JWYA 4H46A 1B52A 3TTKA 1Q9DA 4F3GA 4BDLA 4KCDA 4QRZA 1URDA 3BFTA 3ZKKA 1ZU0A 5F24A 4BDRA 4O3AA 4POXA 2Z22A 2AIXA 5H8QB 4NN3A 2XXTA 2PMSA 4F31B 4QXDA 2IEEA 3B7DA 3FASA 3TQLA 3CVGA 2Z23A 1PDAA 4ZEFA 2I58A 1B5JA 3ZKLA 3S9NC 2XXHA 4FE8A 4P8BA 3TZAA 2HXWA 4OFOA 1DSNA 5FTHA 3MJNA 4ZZAA 2O68A 4LUBA 3IX1A 1BIYA 5DYHA 3E79A 2DYXA 3H06B 4EQ7A 2UVGA 3K00A 4R6HA 2DE3A 1II5A 1PB9A 3MPLA 3MPKA 2GFEA 2ZYNA 3CFZA 3A09A 2O1LA 4X8RA 3H03A 3FD3A 1CE2A 3T66A 5FBPA 4WXJA 1NV2A 4ECFA 1ATGA 1B5IA 1RYOA 3LSWA 2Y7RA 5ESYA 1N3WA 5I5PA 1A7LA 1MY1A 5ET5A 2YPNA 1A8EA 1HSLA 2F97A 5DEXA 3GYYA 3M3FA 2YLNA 2UYEA 2F7CA 3S4UA 4LQ5A 3Q27A 5ET8A 3CHGA 4DDDA 3SEYA 5JTYB 4NF0A 4F22A 3K0VA 1FBGA 3IFCA 1IMBA 4MH5A 4YICA 1SI0A 3OENA 4RY1A 3C33A 3PUZE 3MVXA 1N76A 5KDTA 1RDXA 2CZHA 3O2AA 3G3JA 4DCYA 1AIVA 4OHNA 4XKRA 3MYUA 4F1UA 4IO5A 5L9SA 5AA1A 5IKBA 4KQPA 4H67A 2WBBA 5H8SA 1DCUA 3C9HA 1OQGA 1Y3QA 2REJA 4ELPA 1NMUA 4GLIA 5A5XA 3EPEA 4O3BA 2ZNSA 1IXHA 5EHSA 1B9JA 1MY4A 1SW2A 3PPPA 1D4NA 4YU0A 3D4CA 2ZXTA 1DTGA 1QULA 3R6UA 2Z8DA 4XKQA 2I0BA 3LUYA 2IA4A 3LSXA 4QFLA 3VXBA 4LA9A 5H8NB 4GOTA 1OMPA 4KR5A 1PC3A 2YJPA 3RPWA 1LBCA 4KFQA 3HHGA 3SKPA 2HQ0A 3MQ9A 3JZJA 5EYHA 4H1XA 3FJ7A 5ET7A 4NEDA 4GVOA 1Z7NE 2CZKA 3GLBA 4PFYA 3CSBA 1WVJA 4GIZA 2ZYOA 3SDFA 2QVUA 1VSOA 1B58A 4IGTA 3BFUA 4X1BA 4JVCA 2QMWA 3KBZA 5A5LA 1IMDA 1R1NA 1XC1A 1NV4A 3VXCA 4K3FA 2Y7PA 2NOOA 1IQ7A 1FPIA 3PD8A 4F3SA 5FHMA 4U1OA 1UTHB 4HXVA 2Z8FA 5H8HA 4F39A 1IITA 2DP8A 4MBPA 2R71A 1FCKA 2D3IA 1PB8A 1OVTA 3FATA 3KSXA 1JETA 5DEXB 2ABHA 4Q5TA 4XTCQ 3PUWE 1FPKA 3MW0A 3OXNA 1FTMA 3KFMA 2QS4A 3FJMA 2ESNA 4PF8A 2VD3A 4XF5A 1N7XA 4NAPA 4FEBA 5KDTB 1VFEA 1Z7ME 2B4MA 1B0HA 1LCTA 1B2HA 2Q8JA 3KJ7A 2O69A 1FQDA 1H3DA 1JP4A 4HTGA 1B3FA 3K1MA 2V93A 3RGYA 1Y3NA 2ZYKA 3OO6A 1P1NA 3EKIA 2DOJA 1RDZA 4MNIA 1FQCA 1LFIA 3IOVA 2UXAA 1B3GA 1TFAA 3K6WA 3QAXA 2I3WA 4DXCA 1D9YA 3TTRA 3RY3A 2XX8A 3CRBA 5IZ3A 4GWSA 2ZZVA 2F5XA 3IL1B 5BWJA 2F35A 3C31A 2QMXA 4R9FA 2PYYA 4QSCA 2QFLA 4MEVA 4JSDA 2NUVA 1EYKA 2ZNUA 4XKPA 4HE1A 3VLVA 4C1UA 3LBSA 5I7IA 3TDJA 4LVQA 1SW5A 4UA8A 2OWTA 5F1QA 1VDWA 2P3NA 2RKMA 1NV0A 3PUVE 5L9OA 4ZS9A 4H65A 2ZNTA 1TT1A 1Y9UA 3B6QA 3U8QA 3MVYA 3QMFA 3RTFB 5CRYA 3B50A 3T96B 5DVFA 3ILUB 4POWA 4ND9A 2HHMA 1BLFA 2DDKA 4L17A 3DP8A 3OSQA 4DXUA 2P0SA 1NNTA 1TWYA 4H5GA 4PQJA 4EXKA 5CMCA 2QVRA 1IMEA 2JJKA 5H8HB 1JW5A 3MP8A 2GH9A 1B1XA 2XXPA 4GX3A 2PFZA 4LZ5A 1RYXA 3EN3A 4UACA 1B46A 2B4LA 3C4MA 2FA7A 2Q89A 2HXRA 2DQVA 4OANA 3O66A 4RPOA 2UYFA 3N94A 2XXQA 3PUXE 1PEBA 1R6ZA 3H6UA 3VDFA 2QSXA 5B70A 3FGSA 1SVXB 2HCAA 2UVIA 3OEMA 1UTBA 1H43A 4KPTA 3ZS6A 1FPGA 4ELRA 1GVCA 3HFUA 4OWDA 3VLUA 2OBGA 1D9QA 4PDDA 4FJPA 4JSOA 1XOCA 2G93A 1XHYA 4LQ2A 4EUOA 4PBQA 1VE4A 4PFRA 1M5FA 4MJOA 3DM0A 3T93B 2PVUA 4ZEBA 3O97A 3FV1A 2GRVA 2F34A 2Y84A 2OWZA 3SERA 4ELQA 2AL5A 3IO6A 3U93A 2VT5A 1LBYA 4RXLA 3H3GA 5DW8A 1CNQA 2V4CA 4GBVA 3A29A 4M1VA 1G0IA 3PMXA 3EQ1A 2XXYA 4BDNA 4MHFA 2QRYA 2MKZA 2A5SA 3E9XA 3ECRA 4ZEKA 2QS1A 3IOTA 3RPLA 4PFBA 4GX4A 5B7DA 5JTYA 1OLAA 3QUFA 1FPDA 1S50A 3RYDA 1AWBA 4JDFA 1YTVA 5I58A 1H45A 3A3UA 3VLWA 3HO7A 1NNFA 1NV3A 4G8MA 3C34A 2Q74A 2VPOA 4IO2A 2OJTA 2UVJA 3CG1A 5CM6A 4P47A 2ONRA 2XXVA 2FIEA 3KOTA 1MDP1 5DTBA 5IAIA 1GR2A 1MH4A 2KLFA 2H5YA 4JWXA 4N07A 1Y1MA 4G77A 4P0GA 3GXAA 2O1MA 4QSEA 1MDQA 3OD7A 5I2KA 1FQAA 4I3YA 3IO4A 4Z7EA 1NUWA 3USDA 3RN8A 2XD2A 2M8CA 2P2AA 3VV5A 3EHTA 3E4RA 2CZLA 5I57A 1UTBB 2VD2A 2I3VA 3T9UA 4DZ1A 1NUXA 1POY1 3W15C 1MXXA 5BUUA 2XX9A 5H8NA 2Y7IA 4GWZA 3GZGA 3I3VA 1M5BA 5CC2A 4H8JA 2X26A 2Y5KA 1JVYA 2DWAA 4EXLA 2RF1A 2UVHA 4N4UA 1FTOA 1USYH 4NMYA 1NUZA 3H6VA 4G68A 4DI3D 1KWHA 4OYVA 1MM7A 1H76A 4PFUA 3EHSA 1MQGA 5CMMA 1LAGE 2RINA 3RNNA 1T0KA 1NNPA 3G3GA 4RK2A 2WKYA 2HZLA 1HSJA 2B3BA 1N7WA 2HFBA 4GWYA 4FAJA 1LFHA 3K4UA 3SEWA 1UTHA 1MXWA 4H0WA 4U23A 2AL4A 4PP0A 3L6HA 1M5EA 3R7XA 3RPLB 1NFTA 3E13X 1USYE 1ANFA 2O6AA 1XVYA 2Q8MA 3G3KA 5I58B 5DVIA 2O7IA 3FBPA 1QGXA 5IZ1A 3OMBA 1IEJA 2FIXA 1B7UA 1O64A 1MQIA 4OETA 3MC2A 1G0HA 5LDZA 3I6VA 3FVOA 1LBBA 2CEYA 5EQ9A 2R6GE 4BLAA 2F3DA 1SW4A 4YMBA 1YZ0A 3G3IA 1IZ1A 2XX7A 1K9ZA 3HSTA 1NNKA 4GL0A 1ZIUA 5I2KB 2B65A 1ZLQA 4R6YA 1MXUA 3ROJA 1EU8A 1Y4TA 4YB7A 5FHNA 2DVZA 1FQBA 1CB6A 4IO7A 1QUKA 4N17A 3TCFA 3UA8A 4ESXA 3C35A 3PU5A 5I57B 1IMAA 3MBPA 3BIGA 1NV1A 4ZE8A 1AH5A 4QFPA 2DXRA 2BJIA 4JXIA 3MP6A 2THIA 5HPQA 2XWOA 4NF4A 4DCXA 5CMKA 4OFJA 4PGPA 1JEVA 1FBCA 3LSLA 5LOMA 2Z8EA 4G68B 5ITOA 1ZBMA 3ONMA 3T9XB 4ZEDA 5AE4A 4BDOA 4NQ8A 1IXCA 5M2VA 5K2XA 3O28A 2PCRA 3IFAA 1IXGA 4IY6A 2OX3A 2PT2A 4XFEA 1S9TA 1FPLA 5KCJA 4OVQA 4GXSB 3CG3A 3O9PA 1OIBA 4OA4A 5H8FB 3QSLA 4R75A 4OMBA 4MIJA 5AA4A 2Q88A 3SEXA 4Q8RA 3IAZA 4EDPA 1Q1KA 4G68C 4ZZEA 3RQTA 3WAFA 2XHDA 2NVUB 4AS4A 4FORA 4OERA 1FTLA
chains in the Genus database with same CATH topology
1I69A 3WAEA 1URGA 4WEDA 5FHOA 3ILTB 1MY0A 4I9DA 1LB8A 3EF7A 4YKIA 1MY3A 5FTIA 2QPQA 2RC9A 1GV8A 4YAHX 1B40A 3D4GA 3RT8A 5I56A 3C32A 2DXYA 3TQWA 2O84X 1LFGA 3CFXA 4QFOA 4KD5A 4EQ9A 3B6WA 4QSDA 4XKNA 1F9BA 4MFIA 1QKBA 5DVJA 1MPDA 1O7TA 1US4A 2VOZA 5I59A 3H6WA 3KN3A 4GF8A 4F19A 3UP9A 4R72A 4AQ4A 1XT8A 1DOTA 2I48A 1NH7A 3JV9A 4I62A 4YMAA 1MXVA 3TYHA 2F7BA 2V25A 4JWOA 4ZECA 1B05A 4NF4B 3KGCA 3MWBA 1GGGA 4U1ZA 1TFDA 4G4PA 2V3QA 3PV0E 3OOAA 3MVWA 4R74A 2OZZA 4U21A 1BTJA 3G3HA 3KSJA 3THIA 2H98A 1B3HA 2XXXA 3IR1A 3U94A 4R6KA 3ZSFA 1DTZA 1IXIA 5ELVA 4DXBA 1B32A 4QFNA 5KCJB 1B5HA 3PGFA 1XS5A 3Q28A 1EZPA 1B4HA 3IJXB 3SESA 4H5FA 2Y7WA 1DPEA 5AA4B 2DVCA 2E0SA 5CI5A 4MLVA 3K01A 2AYSA 5HM4B 3TTNA 2XXWA 3IB0A 3PPOA 3QK6A 4LP2B 3M8UA 4HS7A 4FEDA 4QFKA 2I49A 4QHQA 4C1TA 2GHBA 1MM6A 5HBCA 1RKMA 2FYIA 3PMVA 2OWSA 3BKIB 3FVGA 4E0WA 1R9QA 2F7AA 4R2BA 3MUQA 3T22A 3L6GA 4KCCA 5I56B 2QL3A 2I6EA 1VR5A 4TQUQ 3TUSA 3OSRA 2NWJA 1SYHA 4OVJA 2P1SA 3VFJA 4YB6A 5TU0A 2H25A 5AA2D 1VFDA 4TLLB 1MXYA 2REGA 4GRKA 5EHMA 4PETA 5I59B 3TEPA 3G7WA 4LONB 5TPAB 1A99A 5EYFA 3DELB 1LB9A 2A5TA 3QYTA 3CSGA 1YAEA 3GBAA 4F29A 3CI8A 1FTKA 3K2DA 4KI0E 3M3LA 1A40A 2F6GA 3HPIA 1P1WA 4WKMA 2PX1A 4I1DA 1MQDA 3PUYE 4C0RA 4NF5A 4KYSA 1R9LA 3V8XB 4FATA 1QW0A 1SDXA 1SW1A 3ODBA 3UORA 4NF6A 1FQFA 3TMGA 4NF8B 2F36A 4F18A 4E0XA 4NWDA 4BDMA 2XXUA 3UGWA 1YPNA 4F1VA 4X9TA 1IIWA 3G3FA 1LGBC 1POTA 1D9VA 1GTKA 4DE8A 5AA3A 4ESWA 3TKDA 3LSFB 3KEIA 2CMOA 1WDNA 1S7YA 3VE1B 1AL3A 5AA2B 4X1DA 2O51A 1HSEA 3W9VA 2F6PA 1FQEA 3N6TA 2OCUA 4U22A 4G2ZA 2BJJX 4Q0CA 3CFLA 2DWHA 4BDQA 3RT6B 3V5AA 1MS7A 2DWJA 1JW4A 1MRPA 4Z0IA 5ITPA 4IO6A 3EHUA 2HAUA 1JQFA 2R9JA 3HV1A 1PB7A 3S9EA 1P99A 4F2OA 2HEUA 3SEVA 1A55A 1WODA 3C36A 1MPBA 3HN0A 3MVZA 4GQOA 3N26A 5DT6A 3N5LA 1P1QA 1EZ9A 2A5TB 4HW8A 3DP6A 5KZTA 3GBBA 3TTMA 2VGQA 1Q35A 4EF2A 1MY2A 2ONSA 3K1PA 3IK6B 4HCWA 1URSA 4GD5A 3HHFA 5H8FA 5ICTA 4FIMA 5I2NA 3CR9A 4KYEA 2PT1A 4NF5B 1P1UA 3H6TA 3K02A 2PBWA 3TAJA 4MF3A 4O3CA 5TP9A 1MPCA 4NF6B 1QJMA 4OXVA 3MP1A 1B4ZA 2ZMBA 3UIFA 4RJZA 1H44A 2X7QA 3MZ1A 3UK4A 3HCQA 3TTLA 1QKAA 5CMBA 3FV2A 4M4GA 5L9MA 3O6IA 1MQHA 4GXAA 4RYAA 1FW0A 3KOSA 2F78A 3S2VA 3RUMA 4N6PA 2D5WA 4OTEA 3VVFA 3OO8A 4OQOA 3K6UA 1EZOA 4OEVA 1B1HA 1UIVA 4H8IA 4XXUA 4P0IA 1NKXA 1UIUA 3OO9A 4QF9A 3VVEA 5ICQA 4TOZA 3M3KA 3K6VA 4YZZA 3S9MC 1SBPA 1OQHA 4GWOA 3TPAA 4GFRA 4YKJA 3Q25A 2Y7KA 1BP5A 1PBQA 3IB2A 4DLDA 4JBZA 2LAOA 1Y20A 4HCYA 4PE5B 4AB5A 3QUJA 1LAHE 1B6HA 3KZGA 1LCFA 3N6UA 3FXRA 2VP1A 4ZEIA 5ISUA 4F3BA 1AMFA 2W7YA 5L8DA 1LSTA 5I2NB 2DE4A 1JVXA 1B51A 3PD9A 3QXMA 4I8CA 3K6XA 1L5TA 1MXZA 4LZ8A 1SYIA 1I6AA 3PPRA 5TP9B 3IOWA 3TCGA 4NWCA 1PBPA 1FTJA 2H4IA 4R2FA 1XVXA 1A8FA 3B6TA 1Y4CA 3PPNA 4G8NA 3KN8A 2V3TA 1SD3A 1ZTYA 2QJEA 1N04A 3RLFE 3K1NA 1TXFA 3IB1A 1JW1A 4LZ7A 1I6BA 3H7MA 4KHZE 3I5OA 3FJGA 1BKAA 4IGRA 4IB2A 3PMWA 3MAMA 4YKKA 3FZVA 4OFLA 3IOUA 1UQWA 3AXFA 5K2YA 1ZJLA 3PPQA 3O29A 3W9WA 5TPAA 5A5XB 4F1YA 5J1DA 3S9LC 4OENA 3RTWB 1SQYA 3O6GA 5CBRA 4ZE9A 2FNCA 3FIRA 3FUZA 3FVNA 4THIA 1IUDA 3LR1A 1ZKBA 4ZDMA 3O6HA 2Q9TA 3U72A 4G8HA 1N84A 4YB5A 4U4XA 1OLCA 2QS2A 1LAXA 5I84A 4NTLA 4GL8A 1US5A 4U4SA 1MH3A 4DIGA 2RC8A 2G29A 3T9HB 4EQBA 4F2QA 3KG2A 3U92A 1YCJA 4JB7A 4IY5A 4NF8A 4Q30B 2XD3A 2B3FA 3QIMA 1B0LA 4KYDA 1LLSA 1D3KA 3FXQA 3KJTA 3Q26A 3TFLA 4EF1A 1A54A 4RPNA 4X48A 1JEUA 1QVSA 4R73A 3OEKA 1M5DA 2RCAA 2RCBA 2QS3A 2Q2AA 4P11A 5AA2A 2ANJA 3VVDA 1AOVA 4OZ9A 1MQJA 3DP4A 3Q29A 3P7IA 1MG1A 5JEIA 1Y3PA 2Q2CA 2RC7A 4TLMB 2GHAA 4H6DA 1ELJA 4RK9A 3F11A 4AB6A 5F7VA 2E1SA 1NH8A 2DS9A 3KN7A 4PFTA 3KBRA 1EH3A 4YKPA 4ELOA 1LAFE 3MZ9A 5H8QA 4N13A 3R26A 1O63A 3TODA 1ZMGA 3DLNA 4ISUA 2XXIA 1QUJA 2H9BA 2HZKA 1JNFA 2D21A 2V84A 2I4BA 2VHAA 4FECA 4NE4A 3LC8A 3H4ZA 3U1OA 1B3EA 1J1NA 2ONKE 2OLBA 4PFWA 4WEPA 3CIJA 1DMBA 4MLQA 3V89B 2X7PA 3JYRA 2H99A 3IORA 2DWIA 2O7UA 2DE2A 2DSFA 2XXRA 4IO3A 3OO7A 2OK2A 4OEUA 4ONYA 3A3CA 1P1OA 3FVKA 2I0CA 1B7ZA 3OELA 5CBSA 3TELA 2I4CA 1I6QA 1B3LA 1OVBA 1NL5A 3SETA 1B7HA 3TCHA 1N3XA 3MZBA 4IO4A 1QUIA 2HAVA 3UN6A 3SEUA 2ZYMA 3E3KA 2V3UA 1Y1ZA 4OESA 4RNSA 2NXOA 4XIGQ 4U2RA 4LATA 1M5CA 5JK4A 3FXUA 4F3PA 3BBRA 1N0TA 3V83A 1SI1A 2ALUA 4R9GA 4RA1A 1DPPA 3IJOB 3T9VA 2F8DA 4JWYA 1B52A 3TTKA 4F3GA 4BDLA 4KCDA 4QRZA 1URDA 3BFTA 3ZKKA 1ZU0A 4BDRA 4O3AA 4POXA 2Z22A 2AIXA 5H8QB 2XXTA 2PMSA 4F31B 2IEEA 3B7DA 3FASA 3TQLA 3CVGA 2Z23A 1PDAA 4ZEFA 2I58A 1B5JA 3ZKLA 3S9NC 2XXHA 4FE8A 3TZAA 2HXWA 4OFOA 1DSNA 5FTHA 3MJNA 4ZZAA 2O68A 4LUBA 3IX1A 1BIYA 5DYHA 2DYXA 3H06B 4EQ7A 2UVGA 3K00A 4R6HA 2DE3A 1II5A 1PB9A 3MPLA 3MPKA 2GFEA 2ZYNA 3CFZA 3A09A 2O1LA 3H03A 3FD3A 1CE2A 3T66A 4WXJA 4ECFA 1ATGA 1B5IA 1RYOA 3LSWA 2Y7RA 1N3WA 1A7LA 1MY1A 2YPNA 1A8EA 1HSLA 2F97A 5DEXA 3M3FA 2YLNA 2UYEA 2F7CA 3S4UA 4LQ5A 3Q27A 4DDDA 3SEYA 5JTYB 4F22A 3K0VA 4MH5A 4YICA 1SI0A 3OENA 4RY1A 3C33A 3PUZE 3MVXA 1N76A 5KDTA 3O2AA 3G3JA 4DCYA 1AIVA 4OHNA 4XKRA 4F1UA 4IO5A 5L9SA 5AA1A 5IKBA 4KQPA 4H67A 5H8SA 3C9HA 1OQGA 1Y3QA 2REJA 4ELPA 1NMUA 4GLIA 5A5XA 3EPEA 4O3BA 2ZNSA 1IXHA 5EHSA 1B9JA 1MY4A 1SW2A 3PPPA 1D4NA 4YU0A 3D4CA 2ZXTA 1DTGA 1QULA 3R6UA 2Z8DA 4XKQA 2I0BA 3LUYA 2IA4A 3LSXA 4QFLA 3VXBA 4LA9A 5H8NB 4GOTA 1OMPA 4KR5A 1PC3A 2YJPA 3RPWA 1LBCA 4KFQA 3HHGA 3SKPA 2HQ0A 3MQ9A 3JZJA 4H1XA 3FJ7A 4NEDA 4GVOA 1Z7NE 3GLBA 4PFYA 3CSBA 1WVJA 2ZYOA 4GIZA 3SDFA 1VSOA 1B58A 4IGTA 3BFUA 4X1BA 2QMWA 1R1NA 1XC1A 3VXCA 4K3FA 2Y7PA 2NOOA 1IQ7A 3PD8A 4F3SA 5FHMA 4U1OA 1UTHB 2Z8FA 5H8HA 4F39A 1IITA 2DP8A 4MBPA 2R71A 1FCKA 2D3IA 1PB8A 1OVTA 3FATA 3KSXA 1JETA 5DEXB 2ABHA 4Q5TA 4XTCQ 3PUWE 3MW0A 3OXNA 1FTMA 3KFMA 2QS4A 3FJMA 2ESNA 2VD3A 1N7XA 4FEBA 5KDTB 1VFEA 1Z7ME 1B0HA 1LCTA 1B2HA 2Q8JA 3KJ7A 2O69A 1FQDA 1H3DA 4HTGA 1B3FA 3K1MA 2V93A 3RGYA 1Y3NA 2ZYKA 3OO6A 1P1NA 2DOJA 1FQCA 1LFIA 3IOVA 2UXAA 1B3GA 1TFAA 3K6WA 3QAXA 2I3WA 4DXCA 1D9YA 3TTRA 3RY3A 2XX8A 3CRBA 2F5XA 3IL1B 5BWJA 2F35A 3C31A 2QMXA 4R9FA 2PYYA 4QSCA 4JSDA 2NUVA 2ZNUA 4XKPA 3VLVA 4C1UA 3LBSA 3TDJA 4LVQA 1SW5A 4UA8A 2OWTA 5F1QA 2RKMA 3PUVE 5L9OA 4ZS9A 4H65A 2ZNTA 1TT1A 1Y9UA 3B6QA 3U8QA 3MVYA 3RTFB 5CRYA 3T96B 5DVFA 3ILUB 4POWA 4ND9A 1BLFA 4L17A 3DP8A 3OSQA 4DXUA 2P0SA 1NNTA 1TWYA 4H5GA 4PQJA 4EXKA 5CMCA 5H8HB 1JW5A 3MP8A 2GH9A 1B1XA 2XXPA 4LZ5A 1RYXA 3EN3A 4UACA 1B46A 3C4MA 2FA7A 2Q89A 2DQVA 3O66A 4RPOA 2UYFA 3N94A 2XXQA 3PUXE 1PEBA 1R6ZA 3H6UA 3VDFA 2QSXA 5B70A 3FGSA 1SVXB 2HCAA 2UVIA 3OEMA 1UTBA 1H43A 4KPTA 3ZS6A 4ELRA 1GVCA 4OWDA 3VLUA 2OBGA 4FJPA 4JSOA 1XOCA 2G93A 1XHYA 4LQ2A 4EUOA 1VE4A 1M5FA 3DM0A 3T93B 2PVUA 4ZEBA 3O97A 3FV1A 2GRVA 2F34A 2Y84A 3SERA 4ELQA 2AL5A 3IO6A 3U93A 4RXLA 3H3GA 4M1VA 3PMXA 3EQ1A 2XXYA 4BDNA 2QRYA 2A5SA 3E9XA 3ECRA 4ZEKA 2QS1A 3IOTA 5B7DA 5JTYA 1OLAA 3QUFA 1S50A 4JDFA 1YTVA 5I58A 1H45A 3A3UA 3VLWA 3HO7A 1NNFA 4G8MA 3C34A 4IO2A 2OJTA 2UVJA 3CG1A 5CM6A 2ONRA 2XXVA 3KOTA 1MDP1 5DTBA 5IAIA 1GR2A 1MH4A 2KLFA 2H5YA 4JWXA 4N07A 1Y1MA 4G77A 4P0GA 3GXAA 2O1MA 4QSEA 1MDQA 3OD7A 5I2KA 1FQAA 3IO4A 4Z7EA 3USDA 3RN8A 2XD2A 2M8CA 2P2AA 3VV5A 3EHTA 3E4RA 2CZLA 5I57A 1UTBB 2VD2A 2I3VA 3T9UA 4DZ1A 1POY1 3W15C 1MXXA 5BUUA 2XX9A 5H8NA 2Y7IA 3GZGA 3I3VA 1M5BA 5CC2A 4H8JA 2X26A 1JVYA 2DWAA 4EXLA 2RF1A 2UVHA 1FTOA 1USYH 4NMYA 3H6VA 4G68A 1KWHA 4OYVA 1MM7A 1H76A 4PFUA 3EHSA 1MQGA 5CMMA 1LAGE 2RINA 3RNNA 1T0KA 1NNPA 3G3GA 4RK2A 2WKYA 2HZLA 1HSJA 2B3BA 1N7WA 2HFBA 4FAJA 1LFHA 3K4UA 3SEWA 1UTHA 1MXWA 4H0WA 4U23A 2AL4A 4PP0A 3L6HA 1M5EA 3R7XA 1NFTA 3E13X 1USYE 1ANFA 2O6AA 1XVYA 3G3KA 5I58B 5DVIA 2O7IA 3OMBA 1IEJA 1B7UA 1O64A 1MQIA 4OETA 3MC2A 3I6VA 3FVOA 1LBBA 2R6GE 4BLAA 1SW4A 4YMBA 3G3IA 1IZ1A 2XX7A 3HSTA 1NNKA 4GL0A 1ZIUA 5I2KB 2B65A 1ZLQA 4R6YA 1MXUA 1EU8A 1Y4TA 4YB7A 5FHNA 2DVZA 1FQBA 1CB6A 4IO7A 1QUKA 3TCFA 3UA8A 4ESXA 3C35A 3PU5A 5I57B 3MBPA 4ZE8A 1AH5A 4QFPA 2DXRA 4JXIA 3MP6A 2THIA 5HPQA 4NF4A 4DCXA 5CMKA 4OFJA 1JEVA 3LSLA 5LOMA 2Z8EA 4G68B 5ITOA 1ZBMA 3ONMA 3T9XB 4ZEDA 5AE4A 4BDOA 1IXCA 5M2VA 5K2XA 3O28A 1IXGA 4IY6A 2PT2A 1S9TA 5KCJA 4GXSB 3CG3A 3O9PA 1OIBA 5H8FB 3QSLA 4R75A 4OMBA 5AA4A 2Q88A 3SEXA 4Q8RA 3IAZA 4EDPA 1Q1KA 4G68C 4ZZEA 3RQTA 3WAFA 2XHDA 2NVUB 4FORA 4OERA 1FTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I69 A;  3WAE A;  1URG A;  4WED A;  5FHO A;  3ILT B;  1MY0 A;  4I9D A;  1LB8 A;  3EF7 A;  4YKI A;  1MY3 A;  5FTI A;  2QPQ A;  2RC9 A;  1GV8 A;  4YAH X;  1B40 A;  3D4G A;  3RT8 A;  5I56 A;  3C32 A;  2DXY A;  3TQW A;  2O84 X;  1LFG A;  3CFX A;  4QFO A;  4KD5 A;  4EQ9 A;  3B6W A;  4QSD A;  4XKN A;  1F9B A;  4MFI A;  1QKB A;  5DVJ A;  1MPD A;  1O7T A;  1US4 A;  2VOZ A;  5I59 A;  3H6W A;  3KN3 A;  4GF8 A;  4F19 A;  3UP9 A;  4R72 A;  4AQ4 A;  1XT8 A;  1DOT A;  2I48 A;  1NH7 A;  3JV9 A;  4I62 A;  4YMA A;  1MXV A;  3TYH A;  2F7B A;  2V25 A;  4JWO A;  4ZEC A;  1B05 A;  4NF4 B;  3KGC A;  3MWB A;  1GGG A;  4U1Z A;  1TFD A;  4G4P A;  2V3Q A;  3PV0 E;  3OOA A;  3MVW A;  4R74 A;  2OZZ A;  4U21 A;  1BTJ A;  3G3H A;  3KSJ A;  3THI A;  2H98 A;  1B3H A;  2XXX A;  3IR1 A;  3U94 A;  4R6K A;  3ZSF A;  1DTZ A;  1IXI A;  5ELV A;  4DXB A;  1B32 A;  4QFN A;  5KCJ B;  1B5H A;  3PGF A;  1XS5 A;  3Q28 A;  1EZP A;  1B4H A;  3IJX B;  3SES A;  4H5F A;  2Y7W A;  1DPE A;  5AA4 B;  2DVC A;  2E0S A;  5CI5 A;  4MLV A;  3K01 A;  2AYS A;  5HM4 B;  3TTN A;  2XXW A;  3IB0 A;  3PPO A;  3QK6 A;  4LP2 B;  3M8U A;  4HS7 A;  4FED A;  4QFK A;  2I49 A;  4QHQ A;  4C1T A;  2GHB A;  1MM6 A;  5HBC A;  1RKM A;  2FYI A;  3PMV A;  2OWS A;  3BKI B;  3FVG A;  4E0W A;  1R9Q A;  2F7A A;  4R2B A;  3MUQ A;  3T22 A;  3L6G A;  4KCC A;  5I56 B;  2QL3 A;  2I6E A;  1VR5 A;  4TQU Q;  3TUS A;  3OSR A;  2NWJ A;  1SYH A;  4OVJ A;  2P1S A;  3VFJ A;  4YB6 A;  5TU0 A;  2H25 A;  5AA2 D;  1VFD A;  4TLL B;  1MXY A;  2REG A;  4GRK A;  5EHM A;  4PET A;  5I59 B;  3TEP A;  3G7W A;  4LON B;  5TPA B;  1A99 A;  5EYF A;  3DEL B;  1LB9 A;  2A5T A;  3QYT A;  3CSG A;  1YAE A;  3GBA A;  4F29 A;  3CI8 A;  1FTK A;  3K2D A;  4KI0 E;  3M3L A;  1A40 A;  2F6G A;  3HPI A;  1P1W A;  4WKM A;  2PX1 A;  4I1D A;  1MQD A;  3PUY E;  4C0R A;  4NF5 A;  4KYS A;  1R9L A;  3V8X B;  4FAT A;  1QW0 A;  1SDX A;  1SW1 A;  3ODB A;  3UOR A;  4NF6 A;  1FQF A;  3TMG A;  4NF8 B;  2F36 A;  4F18 A;  4E0X A;  4NWD A;  4BDM A;  2XXU A;  3UGW A;  1YPN A;  4F1V A;  4X9T A;  1IIW A;  3G3F A;  1LGB C;  1POT A;  1D9V A;  1GTK A;  4DE8 A;  5AA3 A;  4ESW A;  3TKD A;  3LSF B;  3KEI A;  2CMO A;  1WDN A;  1S7Y A;  3VE1 B;  1AL3 A;  5AA2 B;  4X1D A;  2O51 A;  1HSE A;  3W9V A;  2F6P A;  1FQE A;  3N6T A;  2OCU A;  4U22 A;  4G2Z A;  2BJJ X;  4Q0C A;  3CFL A;  2DWH A;  4BDQ A;  3RT6 B;  3V5A A;  1MS7 A;  2DWJ A;  1JW4 A;  1MRP A;  4Z0I A;  5ITP A;  4IO6 A;  3EHU A;  2HAU A;  1JQF A;  2R9J A;  3HV1 A;  1PB7 A;  3S9E A;  1P99 A;  4F2O A;  2HEU A;  3SEV A;  1A55 A;  1WOD A;  3C36 A;  1MPB A;  3HN0 A;  3MVZ A;  4GQO A;  3N26 A;  5DT6 A;  3N5L A;  1P1Q A;  1EZ9 A;  2A5T B;  4HW8 A;  3DP6 A;  5KZT A;  3GBB A;  3TTM A;  2VGQ A;  1Q35 A;  4EF2 A;  1MY2 A;  2ONS A;  3K1P A;  3IK6 B;  4HCW A;  1URS A;  4GD5 A;  3HHF A;  5H8F A;  5ICT A;  4FIM A;  5I2N A;  3CR9 A;  4KYE A;  2PT1 A;  4NF5 B;  1P1U A;  3H6T A;  3K02 A;  2PBW A;  3TAJ A;  4MF3 A;  4O3C A;  5TP9 A;  1MPC A;  4NF6 B;  1QJM A;  4OXV A;  3MP1 A;  1B4Z A;  2ZMB A;  3UIF A;  4RJZ A;  1H44 A;  2X7Q A;  3MZ1 A;  3UK4 A;  3HCQ A;  3TTL A;  1QKA A;  5CMB A;  3FV2 A;  4M4G A;  5L9M A;  3O6I A;  1MQH A;  4GXA A;  4RYA A;  1FW0 A;  3KOS A;  2F78 A;  3S2V A;  3RUM A;  4N6P A;  2D5W A;  4OTE A;  3VVF A;  3OO8 A;  4OQO A;  3K6U A;  1EZO A;  4OEV A;  1B1H A;  1UIV A;  4H8I A;  4XXU A;  4P0I A;  1NKX A;  1UIU A;  3OO9 A;  4QF9 A;  3VVE A;  5ICQ A;  4TOZ A;  3M3K A;  3K6V A;  4YZZ A;  3S9M C;  1SBP A;  1OQH A;  4GWO A;  3TPA A;  4GFR A;  4YKJ A;  3Q25 A;  2Y7K A;  1BP5 A;  1PBQ A;  3IB2 A;  4DLD A;  4JBZ A;  2LAO A;  1Y20 A;  4HCY A;  4PE5 B;  4AB5 A;  3QUJ A;  1LAH E;  1B6H A;  3KZG A;  1LCF A;  3N6U A;  3FXR A;  2VP1 A;  4ZEI A;  5ISU A;  4F3B A;  1AMF A;  2W7Y A;  5L8D A;  1LST A;  5I2N B;  2DE4 A;  1JVX A;  1B51 A;  3PD9 A;  3QXM A;  4I8C A;  3K6X A;  1L5T A;  1MXZ A;  4LZ8 A;  1SYI A;  1I6A A;  3PPR A;  5TP9 B;  3IOW A;  3TCG A;  4NWC A;  1PBP A;  1FTJ A;  2H4I A;  4R2F A;  1XVX A;  1A8F A;  3B6T A;  1Y4C A;  3PPN A;  4G8N A;  3KN8 A;  2V3T A;  1SD3 A;  1ZTY A;  2QJE A;  1N04 A;  3RLF E;  3K1N A;  1TXF A;  3IB1 A;  1JW1 A;  4LZ7 A;  1I6B A;  3H7M A;  4KHZ E;  3I5O A;  3FJG A;  1BKA A;  4IGR A;  4IB2 A;  3PMW A;  3MAM A;  4YKK A;  3FZV A;  4OFL A;  3IOU A;  1UQW A;  3AXF A;  5K2Y A;  1ZJL A;  3PPQ A;  3O29 A;  3W9W A;  5TPA A;  5A5X B;  4F1Y A;  5J1D A;  3S9L C;  4OEN A;  3RTW B;  1SQY A;  3O6G A;  5CBR A;  4ZE9 A;  2FNC A;  3FIR A;  3FUZ A;  3FVN A;  4THI A;  1IUD A;  3LR1 A;  1ZKB A;  4ZDM A;  3O6H A;  2Q9T A;  3U72 A;  4G8H A;  1N84 A;  4YB5 A;  4U4X A;  1OLC A;  2QS2 A;  1LAX A;  5I84 A;  4NTL A;  4GL8 A;  1US5 A;  4U4S A;  1MH3 A;  4DIG A;  2RC8 A;  2G29 A;  3T9H B;  4EQB A;  4F2Q A;  3KG2 A;  3U92 A;  1YCJ A;  4JB7 A;  4IY5 A;  4NF8 A;  4Q30 B;  2XD3 A;  2B3F A;  3QIM A;  1B0L A;  4KYD A;  1LLS A;  1D3K A;  3FXQ A;  3KJT A;  3Q26 A;  3TFL A;  4EF1 A;  1A54 A;  4RPN A;  4X48 A;  1JEU A;  1QVS A;  4R73 A;  3OEK A;  1M5D A;  2RCA A;  2RCB A;  2QS3 A;  2Q2A A;  4P11 A;  5AA2 A;  2ANJ A;  3VVD A;  1AOV A;  4OZ9 A;  1MQJ A;  3DP4 A;  3Q29 A;  3P7I A;  1MG1 A;  5JEI A;  1Y3P A;  2Q2C A;  2RC7 A;  4TLM B;  2GHA A;  4H6D A;  1ELJ A;  4RK9 A;  3F11 A;  4AB6 A;  5F7V A;  2E1S A;  1NH8 A;  2DS9 A;  3KN7 A;  4PFT A;  3KBR A;  1EH3 A;  4YKP A;  4ELO A;  1LAF E;  3MZ9 A;  5H8Q A;  4N13 A;  3R26 A;  1O63 A;  3TOD A;  1ZMG A;  3DLN A;  4ISU A;  2XXI A;  1QUJ A;  2H9B A;  2HZK A;  1JNF A;  2D21 A;  2V84 A;  2I4B A;  2VHA A;  4FEC A;  4NE4 A;  3LC8 A;  3H4Z A;  3U1O A;  1B3E A;  1J1N A;  2ONK E;  2OLB A;  4PFW A;  4WEP A;  3CIJ A;  1DMB A;  4MLQ A;  3V89 B;  2X7P A;  3JYR A;  2H99 A;  3IOR A;  2DWI A;  2O7U A;  2DE2 A;  2DSF A;  2XXR A;  4IO3 A;  3OO7 A;  2OK2 A;  4OEU A;  4ONY A;  3A3C A;  1P1O A;  3FVK A;  2I0C A;  1B7Z A;  3OEL A;  5CBS A;  3TEL A;  2I4C A;  1I6Q A;  1B3L A;  1OVB A;  1NL5 A;  3SET A;  1B7H A;  3TCH A;  1N3X A;  3MZB A;  4IO4 A;  1QUI A;  2HAV A;  3UN6 A;  3SEU A;  2ZYM A;  3E3K A;  2V3U A;  1Y1Z A;  4OES A;  4RNS A;  2NXO A;  4XIG Q;  4U2R A;  4LAT A;  1M5C A;  5JK4 A;  3FXU A;  4F3P A;  3BBR A;  1N0T A;  3V83 A;  1SI1 A;  2ALU A;  4R9G A;  4RA1 A;  1DPP A;  3IJO B;  3T9V A;  2F8D A;  4JWY A;  1B52 A;  3TTK A;  4F3G A;  4BDL A;  4KCD A;  4QRZ A;  1URD A;  3BFT A;  3ZKK A;  1ZU0 A;  4BDR A;  4O3A A;  4POX A;  2Z22 A;  2AIX A;  5H8Q B;  2XXT A;  2PMS A;  4F31 B;  2IEE A;  3B7D A;  3FAS A;  3TQL A;  3CVG A;  2Z23 A;  1PDA A;  4ZEF A;  2I58 A;  1B5J A;  3ZKL A;  3S9N C;  2XXH A;  4FE8 A;  3TZA A;  2HXW A;  4OFO A;  1DSN A;  5FTH A;  3MJN A;  4ZZA A;  2O68 A;  4LUB A;  3IX1 A;  1BIY A;  5DYH A;  2DYX A;  3H06 B;  4EQ7 A;  2UVG A;  3K00 A;  4R6H A;  2DE3 A;  1II5 A;  1PB9 A;  3MPL A;  3MPK A;  2GFE A;  2ZYN A;  3CFZ A;  3A09 A;  2O1L A;  3H03 A;  3FD3 A;  1CE2 A;  3T66 A;  4WXJ A;  4ECF A;  1ATG A;  1B5I A;  1RYO A;  3LSW A;  2Y7R A;  1N3W A;  1A7L A;  1MY1 A;  2YPN A;  1A8E A;  1HSL A;  2F97 A;  5DEX A;  3M3F A;  2YLN A;  2UYE A;  2F7C A;  3S4U A;  4LQ5 A;  3Q27 A;  4DDD A;  3SEY A;  5JTY B;  4F22 A;  3K0V A;  4MH5 A;  4YIC A;  1SI0 A;  3OEN A;  4RY1 A;  3C33 A;  3PUZ E;  3MVX A;  1N76 A;  5KDT A;  3O2A A;  3G3J A;  4DCY A;  1AIV A;  4OHN A;  4XKR A;  4F1U A;  4IO5 A;  5L9S A;  5AA1 A;  5IKB A;  4KQP A;  4H67 A;  5H8S A;  3C9H A;  1OQG A;  1Y3Q A;  2REJ A;  4ELP A;  1NMU A;  4GLI A;  5A5X A;  3EPE A;  4O3B A;  2ZNS A;  1IXH A;  5EHS A;  1B9J A;  1MY4 A;  1SW2 A;  3PPP A;  1D4N A;  4YU0 A;  3D4C A;  2ZXT A;  1DTG A;  1QUL A;  3R6U A;  2Z8D A;  4XKQ A;  2I0B A;  3LUY A;  2IA4 A;  3LSX A;  4QFL A;  3VXB A;  4LA9 A;  5H8N B;  4GOT A;  1OMP A;  4KR5 A;  1PC3 A;  2YJP A;  3RPW A;  1LBC A;  4KFQ A;  3HHG A;  3SKP A;  2HQ0 A;  3MQ9 A;  3JZJ A;  4H1X A;  3FJ7 A;  4NED A;  4GVO A;  1Z7N E;  3GLB A;  4PFY A;  3CSB A;  1WVJ A;  2ZYO A;  4GIZ A;  3SDF A;  1VSO A;  1B58 A;  4IGT A;  3BFU A;  4X1B A;  2QMW A;  1R1N A;  1XC1 A;  3VXC A;  4K3F A;  2Y7P A;  2NOO A;  1IQ7 A;  3PD8 A;  4F3S A;  5FHM A;  4U1O A;  1UTH B;  2Z8F A;  5H8H A;  4F39 A;  1IIT A;  2DP8 A;  4MBP A;  2R71 A;  1FCK A;  2D3I A;  1PB8 A;  1OVT A;  3FAT A;  3KSX A;  1JET A;  5DEX B;  2ABH A;  4Q5T A;  4XTC Q;  3PUW E;  3MW0 A;  3OXN A;  1FTM A;  3KFM A;  2QS4 A;  3FJM A;  2ESN A;  2VD3 A;  1N7X A;  4FEB A;  5KDT B;  1VFE A;  1Z7M E;  1B0H A;  1LCT A;  1B2H A;  2Q8J A;  3KJ7 A;  2O69 A;  1FQD A;  1H3D A;  4HTG A;  1B3F A;  3K1M A;  2V93 A;  3RGY A;  1Y3N A;  2ZYK A;  3OO6 A;  1P1N A;  2DOJ A;  1FQC A;  1LFI A;  3IOV A;  2UXA A;  1B3G A;  1TFA A;  3K6W A;  3QAX A;  2I3W A;  4DXC A;  1D9Y A;  3TTR A;  3RY3 A;  2XX8 A;  3CRB A;  2F5X A;  3IL1 B;  5BWJ A;  2F35 A;  3C31 A;  2QMX A;  4R9F A;  2PYY A;  4QSC A;  4JSD A;  2NUV A;  2ZNU A;  4XKP A;  3VLV A;  4C1U A;  3LBS A;  3TDJ A;  4LVQ A;  1SW5 A;  4UA8 A;  2OWT A;  5F1Q A;  2RKM A;  3PUV E;  5L9O A;  4ZS9 A;  4H65 A;  2ZNT A;  1TT1 A;  1Y9U A;  3B6Q A;  3U8Q A;  3MVY A;  3RTF B;  5CRY A;  3T96 B;  5DVF A;  3ILU B;  4POW A;  4ND9 A;  1BLF A;  4L17 A;  3DP8 A;  3OSQ A;  4DXU A;  2P0S A;  1NNT A;  1TWY A;  4H5G A;  4PQJ A;  4EXK A;  5CMC A;  5H8H B;  1JW5 A;  3MP8 A;  2GH9 A;  1B1X A;  2XXP A;  4LZ5 A;  1RYX A;  3EN3 A;  4UAC A;  1B46 A;  3C4M A;  2FA7 A;  2Q89 A;  2DQV A;  3O66 A;  4RPO A;  2UYF A;  3N94 A;  2XXQ A;  3PUX E;  1PEB A;  1R6Z A;  3H6U A;  3VDF A;  2QSX A;  5B70 A;  3FGS A;  1SVX B;  2HCA A;  2UVI A;  3OEM A;  1UTB A;  1H43 A;  4KPT A;  3ZS6 A;  4ELR A;  1GVC A;  4OWD A;  3VLU A;  2OBG A;  4FJP A;  4JSO A;  1XOC A;  2G93 A;  1XHY A;  4LQ2 A;  4EUO A;  1VE4 A;  1M5F A;  3DM0 A;  3T93 B;  2PVU A;  4ZEB A;  3O97 A;  3FV1 A;  2GRV A;  2F34 A;  2Y84 A;  3SER A;  4ELQ A;  2AL5 A;  3IO6 A;  3U93 A;  4RXL A;  3H3G A;  4M1V A;  3PMX A;  3EQ1 A;  2XXY A;  4BDN A;  2QRY A;  2A5S A;  3E9X A;  3ECR A;  4ZEK A;  2QS1 A;  3IOT A;  5B7D A;  5JTY A;  1OLA A;  3QUF A;  1S50 A;  4JDF A;  1YTV A;  5I58 A;  1H45 A;  3A3U A;  3VLW A;  3HO7 A;  1NNF A;  4G8M A;  3C34 A;  4IO2 A;  2OJT A;  2UVJ A;  3CG1 A;  5CM6 A;  2ONR A;  2XXV A;  3KOT A;  1MDP 1;  5DTB A;  5IAI A;  1GR2 A;  1MH4 A;  2KLF A;  2H5Y A;  4JWX A;  4N07 A;  1Y1M A;  4G77 A;  4P0G A;  3GXA A;  2O1M A;  4QSE A;  1MDQ A;  3OD7 A;  5I2K A;  1FQA A;  3IO4 A;  4Z7E A;  3USD A;  3RN8 A;  2XD2 A;  2M8C A;  2P2A A;  3VV5 A;  3EHT A;  3E4R A;  2CZL A;  5I57 A;  1UTB B;  2VD2 A;  2I3V A;  3T9U A;  4DZ1 A;  1POY 1;  3W15 C;  1MXX A;  5BUU A;  2XX9 A;  5H8N A;  2Y7I A;  3GZG A;  3I3V A;  1M5B A;  5CC2 A;  4H8J A;  2X26 A;  1JVY A;  2DWA A;  4EXL A;  2RF1 A;  2UVH A;  1FTO A;  1USY H;  4NMY A;  3H6V A;  4G68 A;  1KWH A;  4OYV A;  1MM7 A;  1H76 A;  4PFU A;  3EHS A;  1MQG A;  5CMM A;  1LAG E;  2RIN A;  3RNN A;  1T0K A;  1NNP A;  3G3G A;  4RK2 A;  2WKY A;  2HZL A;  1HSJ A;  2B3B A;  1N7W A;  2HFB A;  4FAJ A;  1LFH A;  3K4U A;  3SEW A;  1UTH A;  1MXW A;  4H0W A;  4U23 A;  2AL4 A;  4PP0 A;  3L6H A;  1M5E A;  3R7X A;  1NFT A;  3E13 X;  1USY E;  1ANF A;  2O6A A;  1XVY A;  3G3K A;  5I58 B;  5DVI A;  2O7I A;  3OMB A;  1IEJ A;  1B7U A;  1O64 A;  1MQI A;  4OET A;  3MC2 A;  3I6V A;  3FVO A;  1LBB A;  2R6G E;  4BLA A;  1SW4 A;  4YMB A;  3G3I A;  1IZ1 A;  2XX7 A;  3HST A;  1NNK A;  4GL0 A;  1ZIU A;  5I2K B;  2B65 A;  1ZLQ A;  4R6Y A;  1MXU A;  1EU8 A;  1Y4T A;  4YB7 A;  5FHN A;  2DVZ A;  1FQB A;  1CB6 A;  4IO7 A;  1QUK A;  3TCF A;  3UA8 A;  4ESX A;  3C35 A;  3PU5 A;  5I57 B;  3MBP A;  4ZE8 A;  1AH5 A;  4QFP A;  2DXR A;  4JXI A;  3MP6 A;  2THI A;  5HPQ A;  4NF4 A;  4DCX A;  5CMK A;  4OFJ A;  1JEV A;  3LSL A;  5LOM A;  2Z8E A;  4G68 B;  5ITO A;  1ZBM A;  3ONM A;  3T9X B;  4ZED A;  5AE4 A;  4BDO A;  1IXC A;  5M2V A;  5K2X A;  3O28 A;  1IXG A;  4IY6 A;  2PT2 A;  1S9T A;  5KCJ A;  4GXS B;  3CG3 A;  3O9P A;  1OIB A;  5H8F B;  3QSL A;  4R75 A;  4OMB A;  5AA4 A;  2Q88 A;  3SEX A;  4Q8R A;  3IAZ A;  4EDP A;  1Q1K A;  4G68 C;  4ZZE A;  3RQT A;  3WAF A;  2XHD A;  2NVU B;  4FOR A;  4OER A;  1FTL A; 
#chains in the Genus database with same CATH topology
 1I69 A;  3WAE A;  1URG A;  4WED A;  5FHO A;  3ILT B;  1MY0 A;  4I9D A;  1LB8 A;  3EF7 A;  4UAB A;  4YKI A;  1MY3 A;  5FTI A;  2QPQ A;  2RC9 A;  1GV8 A;  4YAH X;  4N8G A;  1FPE A;  1B40 A;  3D4G A;  3RT8 A;  5I56 A;  1DK4 A;  3C32 A;  2DXY A;  3TQW A;  2O84 X;  1LFG A;  3CFX A;  4QFO A;  3U65 A;  4KD5 A;  4EQ9 A;  3B6W A;  4QSD A;  4XKN A;  1F9B A;  4MFI A;  1QKB A;  4PAF A;  5DVJ A;  4PTK A;  1MPD A;  1O7T A;  1US4 A;  2VOZ A;  4OVT A;  5I59 A;  3ISP A;  3H6W A;  3KN3 A;  4GF8 A;  4F19 A;  4PDH A;  3UP9 A;  4R72 A;  4AQ4 A;  1RDY A;  1XT8 A;  4PF6 A;  1DOT A;  2I48 A;  1NH7 A;  3JV9 A;  4I62 A;  4P1E A;  4YMA A;  1MXV A;  3TYH A;  2F7B A;  2V25 A;  4JWO A;  4ZEC A;  1B05 A;  4NF4 B;  5T3J A;  3KGC A;  3MWB A;  1LBX A;  1GGG A;  4PGN A;  4U1Z A;  4GWW A;  3FXB A;  1TFD A;  4G4P A;  2V3Q A;  3PV0 E;  3OOA A;  4OVR A;  3MVW A;  1NUY A;  4R74 A;  5EQA A;  2OZZ A;  4U21 A;  1BTJ A;  3G3H A;  3KSJ A;  3THI A;  2H98 A;  1B3H A;  5IZZ A;  2XXX A;  3IR1 A;  3U94 A;  4R6K A;  3ZSF A;  1DTZ A;  1IXI A;  4H45 A;  5ELV A;  4DXB A;  1B32 A;  4QFN A;  5KCJ B;  4OVP A;  1B5H A;  3PGF A;  4N81 A;  3T0J A;  1XS5 A;  3Q28 A;  1EZP A;  1B4H A;  3IJX B;  3SES A;  4H5F A;  2Y7W A;  1INP A;  1DPE A;  5AA4 B;  1FBH A;  2DVC A;  2E0S A;  5CI5 A;  4MLV A;  3K01 A;  2AYS A;  5HM4 B;  3TTN A;  2XXW A;  3IB0 A;  3PPO A;  3QK6 A;  4N91 A;  4LP2 B;  1LBW A;  3M8U A;  2WYK A;  4HS7 A;  4FED A;  4QFK A;  2I49 A;  4QHQ A;  4C1T A;  2GHB A;  1MM6 A;  5HBC A;  1RKM A;  4PBH A;  4NHB A;  2FYI A;  3PMV A;  2OWS A;  3BKI B;  3FVG A;  4E0W A;  1R9Q A;  2F7A A;  4R2B A;  3MUQ A;  3T22 A;  2ZZW A;  3L6G A;  4KCC A;  5I56 B;  2QL3 A;  2I6E A;  4O7I A;  1VR5 A;  4TQU Q;  3TUS A;  3OSR A;  2NWJ A;  1SYH A;  4OVJ A;  2P1S A;  3KC0 A;  4PAI A;  3VFJ A;  4YB6 A;  5TU0 A;  4PE3 A;  2H25 A;  5AA2 D;  3KC1 A;  1VFD A;  4P56 A;  4TLL B;  1MXY A;  2REG A;  4GRK A;  4N8Y A;  5EHM A;  4PET A;  5I59 B;  3TEP A;  3G7W A;  4LON B;  5TPA B;  1A99 A;  5EYF A;  3DEL B;  1LB9 A;  2A5T A;  3QYT A;  3CSG A;  1KA0 A;  4X04 A;  1YAE A;  3GBA A;  2FBP A;  4F29 A;  3CI8 A;  1FTK A;  3K2D A;  5IM2 A;  4KI0 E;  3M3L A;  4GWX A;  2PFY A;  1A40 A;  1FTA A;  2F6G A;  3HPI A;  1P1W A;  4WKM A;  2PX1 A;  1FBP A;  4I1D A;  1MQD A;  3PUY E;  4C0R A;  3BIH A;  4NF5 A;  4KYS A;  1R9L A;  3V8X B;  4FAT A;  1QW0 A;  1SDX A;  1SW1 A;  2Y5L A;  3ODB A;  3UOR A;  4GBW A;  4NF6 A;  1FQF A;  5ET6 A;  3TMG A;  4NF8 B;  2F36 A;  4F18 A;  4E0X A;  4NWD A;  4BDM A;  1FPJ A;  2XXU A;  3UGW A;  1YPN A;  4F1V A;  4X9T A;  1IIW A;  3G3F A;  1LGB C;  3LV0 A;  1POT A;  5EQ7 A;  1D9V A;  1GTK A;  4HE0 A;  4DE8 A;  5AA3 A;  4ESW A;  3TKD A;  2L5V A;  3LSF B;  3KEI A;  2CMO A;  4O94 A;  1WDN A;  2KR0 A;  1S7Y A;  3VE1 B;  1AL3 A;  5AA2 B;  4X1D A;  2O51 A;  1HSE A;  3W9V A;  2F6P A;  4P1L A;  1FQE A;  3D1R A;  4O7M A;  3N6T A;  2OCU A;  4U22 A;  4G2Z A;  4LN5 A;  2BJJ X;  4Q0C A;  1LEV A;  2DWH A;  3CFL A;  4BDQ A;  3RT6 B;  3V5A A;  4GWU A;  1MS7 A;  1DBZ A;  2DWJ A;  1JW4 A;  1MRP A;  4Z0I A;  5ITP A;  4IO6 A;  3EHU A;  2HAU A;  1JQF A;  2R9J A;  3HV1 A;  1XI6 A;  1PB7 A;  3S9E A;  2WEF A;  1P99 A;  4G61 A;  4F2O A;  2HEU A;  3SEV A;  1A55 A;  1WOD A;  3C36 A;  1MPB A;  3HN0 A;  4O8M A;  3MVZ A;  4GQO A;  3N26 A;  5DT6 A;  3SZP A;  3N5L A;  1P1Q A;  1EZ9 A;  2A5T B;  4HW8 A;  3DP6 A;  5KZT A;  2CEX A;  4PFI A;  3GBB A;  3TTM A;  2VGQ A;  1Q35 A;  4EF2 A;  1MY2 A;  2ONS A;  3K1P A;  3IK6 B;  4HCW A;  1URS A;  4GD5 A;  3HHF A;  3T1B A;  5H8F A;  5ICT A;  4FIM A;  5I2N A;  3CR9 A;  4DI4 B;  4KYE A;  2PT1 A;  4NF5 B;  1P1U A;  3H6T A;  2XA5 A;  3K02 A;  2PBW A;  4QBA A;  3TAJ A;  4MF3 A;  4O3C A;  5TP9 A;  1MPC A;  4NF6 B;  1QJM A;  4OXV A;  1KZ8 A;  3MP1 A;  1B4Z A;  2ZMB A;  3UIF A;  4RJZ A;  1H44 A;  2X7Q A;  3MZ1 A;  3UK4 A;  1NI9 A;  3HCQ A;  3TTL A;  1QKA A;  4N6K A;  5CMB A;  3FV2 A;  4M4G A;  2CZI A;  5L9M A;  3O6I A;  1MQH A;  4GXA A;  4RYA A;  1FW0 A;  3KOS A;  2F78 A;  3S2V A;  3RUM A;  1BK4 A;  4N6P A;  2D5W A;  4XEQ A;  4OTE A;  3VVF A;  3OO8 A;  4IR8 A;  4OQO A;  3K6U A;  1EZO A;  4OEV A;  4OVS A;  1B1H A;  1UIV A;  4H8I A;  4XXU A;  4P0I A;  1NKX A;  1EYJ A;  4MNC A;  3MST A;  1UIU A;  3OO9 A;  4MMP A;  4QF9 A;  3VVE A;  5ICQ A;  2FVZ A;  4TOZ A;  3M3K A;  1LBZ A;  3K6V A;  4YZZ A;  3S9M C;  1SBP A;  1OQH A;  4GWO A;  3TPA A;  4MCO A;  4GFR A;  4YKJ A;  3Q25 A;  2Y7K A;  1BP5 A;  2QVV A;  1PBQ A;  4N15 A;  3IB2 A;  4DLD A;  3E78 A;  4JBZ A;  2LAO A;  1Y20 A;  1FJ6 A;  4HCY A;  4PE5 B;  4AB5 A;  3QUJ A;  1LAH E;  1B6H A;  3KZG A;  1LCF A;  3N6U A;  3FXR A;  4KXP A;  4FBP A;  2F3B A;  2VP1 A;  1NV6 A;  2XWV A;  4ZEI A;  5ISU A;  4F3B A;  1AMF A;  2W7Y A;  2XWK A;  5L8D A;  1LST A;  5I2N B;  2DE4 A;  1JVX A;  1B51 A;  1SPI A;  3PD9 A;  3QXM A;  4I8C A;  3K6X A;  1L5T A;  1MXZ A;  4LZ8 A;  1NV7 A;  1SYI A;  1I6A A;  3PPR A;  5TP9 B;  3IOW A;  3TCG A;  4NWC A;  1PBP A;  1FTJ A;  2H4I A;  4R2F A;  1XVX A;  1A8F A;  3B6T A;  1Y4C A;  3PPN A;  4G8N A;  3KN8 A;  4AS5 A;  2HPG A;  2V3T A;  1SD3 A;  1ZTY A;  2QJE A;  1N04 A;  3RLF E;  3K1N A;  1TXF A;  3IB1 A;  1JW1 A;  4LZ7 A;  1I6B A;  3H7M A;  4KHZ E;  3I5O A;  3FJG A;  1BKA A;  4PAK A;  4IGR A;  4IB2 A;  3PMW A;  3MAM A;  4YKK A;  3FZV A;  4NX1 A;  4OFL A;  3IOU A;  4P3L A;  1UQW A;  3AXF A;  5K2Y A;  1ZJL A;  4PCD A;  5LTC A;  3PPQ A;  3O29 A;  3W9W A;  2WX9 A;  4MX6 A;  5TPA A;  5A5X B;  4F1Y A;  5J1D A;  3S9L C;  2VPN A;  4OEN A;  3RTW B;  1SQY A;  3O6G A;  5CBR A;  4ZE9 A;  2FNC A;  3FIR A;  4THI A;  3FUZ A;  3FVN A;  1IUD A;  1FPB A;  3LR1 A;  1ZKB A;  4ZDM A;  3O6H A;  2Q9T A;  3U72 A;  4G8H A;  3NOH A;  1N84 A;  4YB5 A;  4U4X A;  1OLC A;  2QS2 A;  1LAX A;  5I84 A;  4NTL A;  4GL8 A;  1US5 A;  4U4S A;  1MH3 A;  5EQ8 A;  4DIG A;  2RC8 A;  2G29 A;  3T9H B;  4EQB A;  4F2Q A;  1YXI A;  3KG2 A;  3U92 A;  1YCJ A;  2P3V A;  4JB7 A;  1IMC A;  2XWI A;  4IY5 A;  4NF8 A;  4Q30 B;  2XD3 A;  2B3F A;  3QIM A;  1B0L A;  4KYD A;  1LLS A;  1D3K A;  2ZZX A;  3FXQ A;  3KJT A;  3Q26 A;  3TFL A;  4EF1 A;  1A54 A;  4RPN A;  4X48 A;  4NG7 A;  1FBD A;  1JEU A;  1QVS A;  4R73 A;  2XXK A;  3OEK A;  1M5D A;  2RCA A;  2RCB A;  2QS3 A;  2Q2A A;  4P11 A;  1EYI A;  1IMF A;  5AA2 A;  2ANJ A;  4MAG A;  1FJ9 A;  3VVD A;  1AOV A;  4OZ9 A;  1MQJ A;  3DP4 A;  3Q29 A;  3B8B A;  2WYP A;  3P7I A;  1MG1 A;  5JEI A;  1Y3P A;  2Q2C A;  2RC7 A;  4TLM B;  2GHA A;  4H6D A;  1ELJ A;  4RK9 A;  3F11 A;  4AB6 A;  5F7V A;  2E1S A;  1NH8 A;  4JVD A;  1FSA A;  2DS9 A;  1FBF A;  3KN7 A;  4PFT A;  3KBR A;  2WBD A;  1EH3 A;  4YKP A;  4ELO A;  1LAF E;  3MZ9 A;  5H8Q A;  4N13 A;  3R26 A;  1O63 A;  3TOD A;  1ZMG A;  2R8T A;  3DLN A;  4ISU A;  2XXI A;  2KQZ A;  1QUJ A;  2H9B A;  2HZK A;  1JNF A;  2D21 A;  2V84 A;  2I4B A;  2VHA A;  1LBV A;  4FEC A;  4NE4 A;  3LC8 A;  3H4Z A;  3U1O A;  5IZ3 B;  1B3E A;  3LUZ A;  1J1N A;  4I3E A;  2ONK E;  2OLB A;  4PFW A;  4WEP A;  3CIJ A;  1DMB A;  4MLQ A;  3V89 B;  2X7P A;  3JYR A;  2H99 A;  3IOR A;  2DWI A;  2O7U A;  2DE2 A;  2GQ1 A;  2DSF A;  2XXR A;  4N6D A;  5IGA A;  4IO3 A;  3OO7 A;  2OK2 A;  4OEU A;  2FHY A;  4ONY A;  3A3C A;  1P1O A;  3FVK A;  2I0C A;  1B7Z A;  3OEL A;  5CBS A;  1FRP A;  4PC9 A;  3TEL A;  1KA1 A;  2I4C A;  1I6Q A;  1B3L A;  4GX6 A;  1OVB A;  4HE2 A;  1NL5 A;  5EYG A;  3SET A;  1B7H A;  4P9K A;  4MNP A;  3TCH A;  1N3X A;  4JVI A;  3MZB A;  4IO4 A;  1QUI A;  2HAV A;  3UN6 A;  3SEU A;  2ZYM A;  3E3K A;  4I40 A;  2V3U A;  1Y1Z A;  4OES A;  4RNS A;  2NXO A;  5I3S A;  4XIG Q;  4U2R A;  4LAT A;  1M5C A;  5JK4 A;  3FXU A;  4F3P A;  3BBR A;  1N0T A;  3V83 A;  1NV5 A;  5J16 A;  1SI1 A;  2ALU A;  4NGU A;  4R9G A;  4RA1 A;  1DPP A;  3IJO B;  1FPF A;  1YYZ A;  1K9Y A;  3PTY A;  3T9V A;  1FBE A;  2F8D A;  4JWY A;  4H46 A;  1B52 A;  3TTK A;  1Q9D A;  4F3G A;  4BDL A;  4KCD A;  4QRZ A;  1URD A;  3BFT A;  3ZKK A;  1ZU0 A;  5F24 A;  4BDR A;  4O3A A;  4POX A;  2Z22 A;  2AIX A;  5H8Q B;  4NN3 A;  2XXT A;  2PMS A;  4F31 B;  4QXD A;  2IEE A;  3B7D A;  3FAS A;  3TQL A;  3CVG A;  2Z23 A;  1PDA A;  4ZEF A;  2I58 A;  1B5J A;  3ZKL A;  3S9N C;  2XXH A;  4FE8 A;  4P8B A;  3TZA A;  2HXW A;  4OFO A;  1DSN A;  5FTH A;  3MJN A;  4ZZA A;  2O68 A;  4LUB A;  3IX1 A;  1BIY A;  5DYH A;  3E79 A;  2DYX A;  3H06 B;  4EQ7 A;  2UVG A;  3K00 A;  4R6H A;  2DE3 A;  1II5 A;  1PB9 A;  3MPL A;  3MPK A;  2GFE A;  2ZYN A;  3CFZ A;  3A09 A;  2O1L A;  4X8R A;  3H03 A;  3FD3 A;  1CE2 A;  3T66 A;  5FBP A;  4WXJ A;  1NV2 A;  4ECF A;  1ATG A;  1B5I A;  1RYO A;  3LSW A;  2Y7R A;  5ESY A;  1N3W A;  5I5P A;  1A7L A;  1MY1 A;  5ET5 A;  2YPN A;  1A8E A;  1HSL A;  2F97 A;  5DEX A;  3GYY A;  3M3F A;  2YLN A;  2UYE A;  2F7C A;  3S4U A;  4LQ5 A;  3Q27 A;  5ET8 A;  3CHG A;  4DDD A;  3SEY A;  5JTY B;  4NF0 A;  4F22 A;  3K0V A;  1FBG A;  3IFC A;  1IMB A;  4MH5 A;  4YIC A;  1SI0 A;  3OEN A;  4RY1 A;  3C33 A;  3PUZ E;  3MVX A;  1N76 A;  5KDT A;  1RDX A;  2CZH A;  3O2A A;  3G3J A;  4DCY A;  1AIV A;  4OHN A;  4XKR A;  3MYU A;  4F1U A;  4IO5 A;  5L9S A;  5AA1 A;  5IKB A;  4KQP A;  4H67 A;  2WBB A;  5H8S A;  1DCU A;  3C9H A;  1OQG A;  1Y3Q A;  2REJ A;  4ELP A;  1NMU A;  4GLI A;  5A5X A;  3EPE A;  4O3B A;  2ZNS A;  1IXH A;  5EHS A;  1B9J A;  1MY4 A;  1SW2 A;  3PPP A;  1D4N A;  4YU0 A;  3D4C A;  2ZXT A;  1DTG A;  1QUL A;  3R6U A;  2Z8D A;  4XKQ A;  2I0B A;  3LUY A;  2IA4 A;  3LSX A;  4QFL A;  3VXB A;  4LA9 A;  5H8N B;  4GOT A;  1OMP A;  4KR5 A;  1PC3 A;  2YJP A;  3RPW A;  1LBC A;  4KFQ A;  3HHG A;  3SKP A;  2HQ0 A;  3MQ9 A;  3JZJ A;  5EYH A;  4H1X A;  3FJ7 A;  5ET7 A;  4NED A;  4GVO A;  1Z7N E;  2CZK A;  3GLB A;  4PFY A;  3CSB A;  1WVJ A;  4GIZ A;  2ZYO A;  3SDF A;  2QVU A;  1VSO A;  1B58 A;  4IGT A;  3BFU A;  4X1B A;  4JVC A;  2QMW A;  3KBZ A;  5A5L A;  1IMD A;  1R1N A;  1XC1 A;  1NV4 A;  3VXC A;  4K3F A;  2Y7P A;  2NOO A;  1IQ7 A;  1FPI A;  3PD8 A;  4F3S A;  5FHM A;  4U1O A;  1UTH B;  4HXV A;  2Z8F A;  5H8H A;  4F39 A;  1IIT A;  2DP8 A;  4MBP A;  2R71 A;  1FCK A;  2D3I A;  1PB8 A;  1OVT A;  3FAT A;  3KSX A;  1JET A;  5DEX B;  2ABH A;  4Q5T A;  4XTC Q;  3PUW E;  1FPK A;  3MW0 A;  3OXN A;  1FTM A;  3KFM A;  2QS4 A;  3FJM A;  2ESN A;  4PF8 A;  2VD3 A;  4XF5 A;  1N7X A;  4NAP A;  4FEB A;  5KDT B;  1VFE A;  1Z7M E;  2B4M A;  1B0H A;  1LCT A;  1B2H A;  2Q8J A;  3KJ7 A;  2O69 A;  1FQD A;  1H3D A;  1JP4 A;  4HTG A;  1B3F A;  3K1M A;  2V93 A;  3RGY A;  1Y3N A;  2ZYK A;  3OO6 A;  1P1N A;  3EKI A;  2DOJ A;  1RDZ A;  4MNI A;  1FQC A;  1LFI A;  3IOV A;  2UXA A;  1B3G A;  1TFA A;  3K6W A;  3QAX A;  2I3W A;  4DXC A;  1D9Y A;  3TTR A;  3RY3 A;  2XX8 A;  3CRB A;  5IZ3 A;  4GWS A;  2ZZV A;  2F5X A;  3IL1 B;  5BWJ A;  2F35 A;  3C31 A;  2QMX A;  4R9F A;  2PYY A;  4QSC A;  2QFL A;  4MEV A;  4JSD A;  2NUV A;  1EYK A;  2ZNU A;  4XKP A;  4HE1 A;  3VLV A;  4C1U A;  3LBS A;  5I7I A;  3TDJ A;  4LVQ A;  1SW5 A;  4UA8 A;  2OWT A;  5F1Q A;  1VDW A;  2P3N A;  2RKM A;  1NV0 A;  3PUV E;  5L9O A;  4ZS9 A;  4H65 A;  2ZNT A;  1TT1 A;  1Y9U A;  3B6Q A;  3U8Q A;  3MVY A;  3QMF A;  3RTF B;  5CRY A;  3B50 A;  3T96 B;  5DVF A;  3ILU B;  4POW A;  4ND9 A;  2HHM A;  1BLF A;  2DDK A;  4L17 A;  3DP8 A;  3OSQ A;  4DXU A;  2P0S A;  1NNT A;  1TWY A;  4H5G A;  4PQJ A;  4EXK A;  5CMC A;  2QVR A;  1IME A;  2JJK A;  5H8H B;  1JW5 A;  3MP8 A;  2GH9 A;  1B1X A;  2XXP A;  4GX3 A;  2PFZ A;  4LZ5 A;  1RYX A;  3EN3 A;  4UAC A;  1B46 A;  2B4L A;  3C4M A;  2FA7 A;  2Q89 A;  2HXR A;  2DQV A;  4OAN A;  3O66 A;  4RPO A;  2UYF A;  3N94 A;  2XXQ A;  3PUX E;  1PEB A;  1R6Z A;  3H6U A;  3VDF A;  2QSX A;  5B70 A;  3FGS A;  1SVX B;  2HCA A;  2UVI A;  3OEM A;  1UTB A;  1H43 A;  4KPT A;  3ZS6 A;  1FPG A;  4ELR A;  1GVC A;  3HFU A;  4OWD A;  3VLU A;  2OBG A;  1D9Q A;  4PDD A;  4FJP A;  4JSO A;  1XOC A;  2G93 A;  1XHY A;  4LQ2 A;  4EUO A;  4PBQ A;  1VE4 A;  4PFR A;  1M5F A;  4MJO A;  3DM0 A;  3T93 B;  2PVU A;  4ZEB A;  3O97 A;  3FV1 A;  2GRV A;  2F34 A;  2Y84 A;  2OWZ A;  3SER A;  4ELQ A;  2AL5 A;  3IO6 A;  3U93 A;  2VT5 A;  1LBY A;  4RXL A;  3H3G A;  5DW8 A;  1CNQ A;  2V4C A;  4GBV A;  3A29 A;  4M1V A;  1G0I A;  3PMX A;  3EQ1 A;  2XXY A;  4BDN A;  4MHF A;  2QRY A;  2MKZ A;  2A5S A;  3E9X A;  3ECR A;  4ZEK A;  2QS1 A;  3IOT A;  3RPL A;  4PFB A;  4GX4 A;  5B7D A;  5JTY A;  1OLA A;  3QUF A;  1FPD A;  1S50 A;  3RYD A;  1AWB A;  4JDF A;  1YTV A;  5I58 A;  1H45 A;  3A3U A;  3VLW A;  3HO7 A;  1NNF A;  1NV3 A;  4G8M A;  3C34 A;  2Q74 A;  2VPO A;  4IO2 A;  2OJT A;  2UVJ A;  3CG1 A;  5CM6 A;  4P47 A;  2ONR A;  2XXV A;  2FIE A;  3KOT A;  1MDP 1;  5DTB A;  5IAI A;  1GR2 A;  1MH4 A;  2KLF A;  2H5Y A;  4JWX A;  4N07 A;  1Y1M A;  4G77 A;  4P0G A;  3GXA A;  2O1M A;  4QSE A;  1MDQ A;  3OD7 A;  5I2K A;  1FQA A;  4I3Y A;  3IO4 A;  4Z7E A;  1NUW A;  3USD A;  3RN8 A;  2XD2 A;  2M8C A;  2P2A A;  3VV5 A;  3EHT A;  3E4R A;  2CZL A;  5I57 A;  1UTB B;  2VD2 A;  2I3V A;  3T9U A;  4DZ1 A;  1NUX A;  1POY 1;  3W15 C;  1MXX A;  5BUU A;  2XX9 A;  5H8N A;  2Y7I A;  4GWZ A;  3GZG A;  3I3V A;  1M5B A;  5CC2 A;  4H8J A;  2X26 A;  2Y5K A;  1JVY A;  2DWA A;  4EXL A;  2RF1 A;  2UVH A;  4N4U A;  1FTO A;  1USY H;  4NMY A;  1NUZ A;  3H6V A;  4G68 A;  4DI3 D;  1KWH A;  4OYV A;  1MM7 A;  1H76 A;  4PFU A;  3EHS A;  1MQG A;  5CMM A;  1LAG E;  2RIN A;  3RNN A;  1T0K A;  1NNP A;  3G3G A;  4RK2 A;  2WKY A;  2HZL A;  1HSJ A;  2B3B A;  1N7W A;  2HFB A;  4GWY A;  4FAJ A;  1LFH A;  3K4U A;  3SEW A;  1UTH A;  1MXW A;  4H0W A;  4U23 A;  2AL4 A;  4PP0 A;  3L6H A;  1M5E A;  3R7X A;  3RPL B;  1NFT A;  3E13 X;  1USY E;  1ANF A;  2O6A A;  1XVY A;  2Q8M A;  3G3K A;  5I58 B;  5DVI A;  2O7I A;  3FBP A;  1QGX A;  5IZ1 A;  3OMB A;  1IEJ A;  2FIX A;  1B7U A;  1O64 A;  1MQI A;  4OET A;  3MC2 A;  1G0H A;  5LDZ A;  3I6V A;  3FVO A;  1LBB A;  2CEY A;  5EQ9 A;  2R6G E;  4BLA A;  2F3D A;  1SW4 A;  4YMB A;  1YZ0 A;  3G3I A;  1IZ1 A;  2XX7 A;  1K9Z A;  3HST A;  1NNK A;  4GL0 A;  1ZIU A;  5I2K B;  2B65 A;  1ZLQ A;  4R6Y A;  1MXU A;  3ROJ A;  1EU8 A;  1Y4T A;  4YB7 A;  5FHN A;  2DVZ A;  1FQB A;  1CB6 A;  4IO7 A;  1QUK A;  4N17 A;  3TCF A;  3UA8 A;  4ESX A;  3C35 A;  3PU5 A;  5I57 B;  1IMA A;  3MBP A;  3BIG A;  1NV1 A;  4ZE8 A;  1AH5 A;  4QFP A;  2DXR A;  2BJI A;  4JXI A;  3MP6 A;  2THI A;  5HPQ A;  2XWO A;  4NF4 A;  4DCX A;  5CMK A;  4OFJ A;  4PGP A;  1JEV A;  1FBC A;  3LSL A;  5LOM A;  2Z8E A;  4G68 B;  5ITO A;  1ZBM A;  3ONM A;  3T9X B;  4ZED A;  5AE4 A;  4BDO A;  4NQ8 A;  1IXC A;  5M2V A;  5K2X A;  3O28 A;  2PCR A;  3IFA A;  1IXG A;  4IY6 A;  2OX3 A;  2PT2 A;  4XFE A;  1S9T A;  1FPL A;  5KCJ A;  4OVQ A;  4GXS B;  3CG3 A;  3O9P A;  1OIB A;  4OA4 A;  5H8F B;  3QSL A;  4R75 A;  4OMB A;  4MIJ A;  5AA4 A;  2Q88 A;  3SEX A;  4Q8R A;  3IAZ A;  4EDP A;  1Q1K A;  4G68 C;  4ZZE A;  3RQT A;  3WAF A;  2XHD A;  2NVU B;  4AS4 A;  4FOR A;  4OER A;  1FTL A; 
#chains in the Genus database with same CATH homology
 1I69 A;  3WAE A;  1URG A;  4WED A;  5FHO A;  3ILT B;  1MY0 A;  4I9D A;  1LB8 A;  3EF7 A;  4YKI A;  1MY3 A;  5FTI A;  2QPQ A;  2RC9 A;  1GV8 A;  4YAH X;  1B40 A;  3D4G A;  3RT8 A;  5I56 A;  3C32 A;  2DXY A;  3TQW A;  2O84 X;  1LFG A;  3CFX A;  4QFO A;  4KD5 A;  4EQ9 A;  3B6W A;  4QSD A;  4XKN A;  1F9B A;  4MFI A;  1QKB A;  5DVJ A;  1MPD A;  1O7T A;  1US4 A;  2VOZ A;  5I59 A;  3H6W A;  3KN3 A;  4GF8 A;  4F19 A;  3UP9 A;  4R72 A;  4AQ4 A;  1XT8 A;  1DOT A;  2I48 A;  1NH7 A;  3JV9 A;  4I62 A;  4YMA A;  1MXV A;  3TYH A;  2F7B A;  2V25 A;  4JWO A;  4ZEC A;  1B05 A;  4NF4 B;  3KGC A;  3MWB A;  1GGG A;  4U1Z A;  1TFD A;  4G4P A;  2V3Q A;  3PV0 E;  3OOA A;  3MVW A;  4R74 A;  2OZZ A;  4U21 A;  1BTJ A;  3G3H A;  3KSJ A;  3THI A;  2H98 A;  1B3H A;  2XXX A;  3IR1 A;  3U94 A;  4R6K A;  3ZSF A;  1DTZ A;  1IXI A;  5ELV A;  4DXB A;  1B32 A;  4QFN A;  5KCJ B;  1B5H A;  3PGF A;  1XS5 A;  3Q28 A;  1EZP A;  1B4H A;  3IJX B;  3SES A;  4H5F A;  2Y7W A;  1DPE A;  5AA4 B;  2DVC A;  2E0S A;  5CI5 A;  4MLV A;  3K01 A;  2AYS A;  5HM4 B;  3TTN A;  2XXW A;  3IB0 A;  3PPO A;  3QK6 A;  4LP2 B;  3M8U A;  4HS7 A;  4FED A;  4QFK A;  2I49 A;  4QHQ A;  4C1T A;  2GHB A;  1MM6 A;  5HBC A;  1RKM A;  2FYI A;  3PMV A;  2OWS A;  3BKI B;  3FVG A;  4E0W A;  1R9Q A;  2F7A A;  4R2B A;  3MUQ A;  3T22 A;  3L6G A;  4KCC A;  5I56 B;  2QL3 A;  2I6E A;  1VR5 A;  4TQU Q;  3TUS A;  3OSR A;  2NWJ A;  1SYH A;  4OVJ A;  2P1S A;  3VFJ A;  4YB6 A;  5TU0 A;  2H25 A;  5AA2 D;  1VFD A;  4TLL B;  1MXY A;  2REG A;  4GRK A;  5EHM A;  4PET A;  5I59 B;  3TEP A;  3G7W A;  4LON B;  5TPA B;  1A99 A;  5EYF A;  3DEL B;  1LB9 A;  2A5T A;  3QYT A;  3CSG A;  1YAE A;  3GBA A;  4F29 A;  3CI8 A;  1FTK A;  3K2D A;  4KI0 E;  3M3L A;  1A40 A;  2F6G A;  3HPI A;  1P1W A;  4WKM A;  2PX1 A;  4I1D A;  1MQD A;  3PUY E;  4C0R A;  4NF5 A;  4KYS A;  1R9L A;  3V8X B;  4FAT A;  1QW0 A;  1SDX A;  1SW1 A;  3ODB A;  3UOR A;  4NF6 A;  1FQF A;  3TMG A;  4NF8 B;  2F36 A;  4F18 A;  4E0X A;  4NWD A;  4BDM A;  2XXU A;  3UGW A;  1YPN A;  4F1V A;  4X9T A;  1IIW A;  3G3F A;  1LGB C;  1POT A;  1D9V A;  1GTK A;  4DE8 A;  5AA3 A;  4ESW A;  3TKD A;  3LSF B;  3KEI A;  2CMO A;  1WDN A;  1S7Y A;  3VE1 B;  1AL3 A;  5AA2 B;  4X1D A;  2O51 A;  1HSE A;  3W9V A;  2F6P A;  1FQE A;  3N6T A;  2OCU A;  4U22 A;  4G2Z A;  2BJJ X;  4Q0C A;  3CFL A;  2DWH A;  4BDQ A;  3RT6 B;  3V5A A;  1MS7 A;  2DWJ A;  1JW4 A;  1MRP A;  4Z0I A;  5ITP A;  4IO6 A;  3EHU A;  2HAU A;  1JQF A;  2R9J A;  3HV1 A;  1PB7 A;  3S9E A;  1P99 A;  4F2O A;  2HEU A;  3SEV A;  1A55 A;  1WOD A;  3C36 A;  1MPB A;  3HN0 A;  3MVZ A;  4GQO A;  3N26 A;  5DT6 A;  3N5L A;  1P1Q A;  1EZ9 A;  2A5T B;  4HW8 A;  3DP6 A;  5KZT A;  3GBB A;  3TTM A;  2VGQ A;  1Q35 A;  4EF2 A;  1MY2 A;  2ONS A;  3K1P A;  3IK6 B;  4HCW A;  1URS A;  4GD5 A;  3HHF A;  5H8F A;  5ICT A;  4FIM A;  5I2N A;  3CR9 A;  4KYE A;  2PT1 A;  4NF5 B;  1P1U A;  3H6T A;  3K02 A;  2PBW A;  3TAJ A;  4MF3 A;  4O3C A;  5TP9 A;  1MPC A;  4NF6 B;  1QJM A;  4OXV A;  3MP1 A;  1B4Z A;  2ZMB A;  3UIF A;  4RJZ A;  1H44 A;  2X7Q A;  3MZ1 A;  3UK4 A;  3HCQ A;  3TTL A;  1QKA A;  5CMB A;  3FV2 A;  4M4G A;  5L9M A;  3O6I A;  1MQH A;  4GXA A;  4RYA A;  1FW0 A;  3KOS A;  2F78 A;  3S2V A;  3RUM A;  4N6P A;  2D5W A;  4OTE A;  3VVF A;  3OO8 A;  4OQO A;  3K6U A;  1EZO A;  4OEV A;  1B1H A;  1UIV A;  4H8I A;  4XXU A;  4P0I A;  1NKX A;  1UIU A;  3OO9 A;  4QF9 A;  3VVE A;  5ICQ A;  4TOZ A;  3M3K A;  3K6V A;  4YZZ A;  3S9M C;  1SBP A;  1OQH A;  4GWO A;  3TPA A;  4GFR A;  4YKJ A;  3Q25 A;  2Y7K A;  1BP5 A;  1PBQ A;  3IB2 A;  4DLD A;  4JBZ A;  2LAO A;  1Y20 A;  4HCY A;  4PE5 B;  4AB5 A;  3QUJ A;  1LAH E;  1B6H A;  3KZG A;  1LCF A;  3N6U A;  3FXR A;  2VP1 A;  4ZEI A;  5ISU A;  4F3B A;  1AMF A;  2W7Y A;  5L8D A;  1LST A;  5I2N B;  2DE4 A;  1JVX A;  1B51 A;  3PD9 A;  3QXM A;  4I8C A;  3K6X A;  1L5T A;  1MXZ A;  4LZ8 A;  1SYI A;  1I6A A;  3PPR A;  5TP9 B;  3IOW A;  3TCG A;  4NWC A;  1PBP A;  1FTJ A;  2H4I A;  4R2F A;  1XVX A;  1A8F A;  3B6T A;  1Y4C A;  3PPN A;  4G8N A;  3KN8 A;  2V3T A;  1SD3 A;  1ZTY A;  2QJE A;  1N04 A;  3RLF E;  3K1N A;  1TXF A;  3IB1 A;  1JW1 A;  4LZ7 A;  1I6B A;  3H7M A;  4KHZ E;  3I5O A;  3FJG A;  1BKA A;  4IGR A;  4IB2 A;  3PMW A;  3MAM A;  4YKK A;  3FZV A;  4OFL A;  3IOU A;  1UQW A;  3AXF A;  5K2Y A;  1ZJL A;  3PPQ A;  3O29 A;  3W9W A;  5TPA A;  5A5X B;  4F1Y A;  5J1D A;  3S9L C;  4OEN A;  3RTW B;  1SQY A;  3O6G A;  5CBR A;  4ZE9 A;  2FNC A;  3FIR A;  3FUZ A;  3FVN A;  4THI A;  1IUD A;  3LR1 A;  1ZKB A;  4ZDM A;  3O6H A;  2Q9T A;  3U72 A;  4G8H A;  1N84 A;  4YB5 A;  4U4X A;  1OLC A;  2QS2 A;  1LAX A;  5I84 A;  4NTL A;  4GL8 A;  1US5 A;  4U4S A;  1MH3 A;  4DIG A;  2RC8 A;  2G29 A;  3T9H B;  4EQB A;  4F2Q A;  3KG2 A;  3U92 A;  1YCJ A;  4JB7 A;  4IY5 A;  4NF8 A;  4Q30 B;  2XD3 A;  2B3F A;  3QIM A;  1B0L A;  4KYD A;  1LLS A;  1D3K A;  3FXQ A;  3KJT A;  3Q26 A;  3TFL A;  4EF1 A;  1A54 A;  4RPN A;  4X48 A;  1JEU A;  1QVS A;  4R73 A;  3OEK A;  1M5D A;  2RCA A;  2RCB A;  2QS3 A;  2Q2A A;  4P11 A;  5AA2 A;  2ANJ A;  3VVD A;  1AOV A;  4OZ9 A;  1MQJ A;  3DP4 A;  3Q29 A;  3P7I A;  1MG1 A;  5JEI A;  1Y3P A;  2Q2C A;  2RC7 A;  4TLM B;  2GHA A;  4H6D A;  1ELJ A;  4RK9 A;  3F11 A;  4AB6 A;  5F7V A;  2E1S A;  1NH8 A;  2DS9 A;  3KN7 A;  4PFT A;  3KBR A;  1EH3 A;  4YKP A;  4ELO A;  1LAF E;  3MZ9 A;  5H8Q A;  4N13 A;  3R26 A;  1O63 A;  3TOD A;  1ZMG A;  3DLN A;  4ISU A;  2XXI A;  1QUJ A;  2H9B A;  2HZK A;  1JNF A;  2D21 A;  2V84 A;  2I4B A;  2VHA A;  4FEC A;  4NE4 A;  3LC8 A;  3H4Z A;  3U1O A;  1B3E A;  1J1N A;  2ONK E;  2OLB A;  4PFW A;  4WEP A;  3CIJ A;  1DMB A;  4MLQ A;  3V89 B;  2X7P A;  3JYR A;  2H99 A;  3IOR A;  2DWI A;  2O7U A;  2DE2 A;  2DSF A;  2XXR A;  4IO3 A;  3OO7 A;  2OK2 A;  4OEU A;  4ONY A;  3A3C A;  1P1O A;  3FVK A;  2I0C A;  1B7Z A;  3OEL A;  5CBS A;  3TEL A;  2I4C A;  1I6Q A;  1B3L A;  1OVB A;  1NL5 A;  3SET A;  1B7H A;  3TCH A;  1N3X A;  3MZB A;  4IO4 A;  1QUI A;  2HAV A;  3UN6 A;  3SEU A;  2ZYM A;  3E3K A;  2V3U A;  1Y1Z A;  4OES A;  4RNS A;  2NXO A;  4XIG Q;  4U2R A;  4LAT A;  1M5C A;  5JK4 A;  3FXU A;  4F3P A;  3BBR A;  1N0T A;  3V83 A;  1SI1 A;  2ALU A;  4R9G A;  4RA1 A;  1DPP A;  3IJO B;  3T9V A;  2F8D A;  4JWY A;  1B52 A;  3TTK A;  4F3G A;  4BDL A;  4KCD A;  4QRZ A;  1URD A;  3BFT A;  3ZKK A;  1ZU0 A;  4BDR A;  4O3A A;  4POX A;  2Z22 A;  2AIX A;  5H8Q B;  2XXT A;  2PMS A;  4F31 B;  2IEE A;  3B7D A;  3FAS A;  3TQL A;  3CVG A;  2Z23 A;  1PDA A;  4ZEF A;  2I58 A;  1B5J A;  3ZKL A;  3S9N C;  2XXH A;  4FE8 A;  3TZA A;  2HXW A;  4OFO A;  1DSN A;  5FTH A;  3MJN A;  4ZZA A;  2O68 A;  4LUB A;  3IX1 A;  1BIY A;  5DYH A;  2DYX A;  3H06 B;  4EQ7 A;  2UVG A;  3K00 A;  4R6H A;  2DE3 A;  1II5 A;  1PB9 A;  3MPL A;  3MPK A;  2GFE A;  2ZYN A;  3CFZ A;  3A09 A;  2O1L A;  3H03 A;  3FD3 A;  1CE2 A;  3T66 A;  4WXJ A;  4ECF A;  1ATG A;  1B5I A;  1RYO A;  3LSW A;  2Y7R A;  1N3W A;  1A7L A;  1MY1 A;  2YPN A;  1A8E A;  1HSL A;  2F97 A;  5DEX A;  3M3F A;  2YLN A;  2UYE A;  2F7C A;  3S4U A;  4LQ5 A;  3Q27 A;  4DDD A;  3SEY A;  5JTY B;  4F22 A;  3K0V A;  4MH5 A;  4YIC A;  1SI0 A;  3OEN A;  4RY1 A;  3C33 A;  3PUZ E;  3MVX A;  1N76 A;  5KDT A;  3O2A A;  3G3J A;  4DCY A;  1AIV A;  4OHN A;  4XKR A;  4F1U A;  4IO5 A;  5L9S A;  5AA1 A;  5IKB A;  4KQP A;  4H67 A;  5H8S A;  3C9H A;  1OQG A;  1Y3Q A;  2REJ A;  4ELP A;  1NMU A;  4GLI A;  5A5X A;  3EPE A;  4O3B A;  2ZNS A;  1IXH A;  5EHS A;  1B9J A;  1MY4 A;  1SW2 A;  3PPP A;  1D4N A;  4YU0 A;  3D4C A;  2ZXT A;  1DTG A;  1QUL A;  3R6U A;  2Z8D A;  4XKQ A;  2I0B A;  3LUY A;  2IA4 A;  3LSX A;  4QFL A;  3VXB A;  4LA9 A;  5H8N B;  4GOT A;  1OMP A;  4KR5 A;  1PC3 A;  2YJP A;  3RPW A;  1LBC A;  4KFQ A;  3HHG A;  3SKP A;  2HQ0 A;  3MQ9 A;  3JZJ A;  4H1X A;  3FJ7 A;  4NED A;  4GVO A;  1Z7N E;  3GLB A;  4PFY A;  3CSB A;  1WVJ A;  2ZYO A;  4GIZ A;  3SDF A;  1VSO A;  1B58 A;  4IGT A;  3BFU A;  4X1B A;  2QMW A;  1R1N A;  1XC1 A;  3VXC A;  4K3F A;  2Y7P A;  2NOO A;  1IQ7 A;  3PD8 A;  4F3S A;  5FHM A;  4U1O A;  1UTH B;  2Z8F A;  5H8H A;  4F39 A;  1IIT A;  2DP8 A;  4MBP A;  2R71 A;  1FCK A;  2D3I A;  1PB8 A;  1OVT A;  3FAT A;  3KSX A;  1JET A;  5DEX B;  2ABH A;  4Q5T A;  4XTC Q;  3PUW E;  3MW0 A;  3OXN A;  1FTM A;  3KFM A;  2QS4 A;  3FJM A;  2ESN A;  2VD3 A;  1N7X A;  4FEB A;  5KDT B;  1VFE A;  1Z7M E;  1B0H A;  1LCT A;  1B2H A;  2Q8J A;  3KJ7 A;  2O69 A;  1FQD A;  1H3D A;  4HTG A;  1B3F A;  3K1M A;  2V93 A;  3RGY A;  1Y3N A;  2ZYK A;  3OO6 A;  1P1N A;  2DOJ A;  1FQC A;  1LFI A;  3IOV A;  2UXA A;  1B3G A;  1TFA A;  3K6W A;  3QAX A;  2I3W A;  4DXC A;  1D9Y A;  3TTR A;  3RY3 A;  2XX8 A;  3CRB A;  2F5X A;  3IL1 B;  5BWJ A;  2F35 A;  3C31 A;  2QMX A;  4R9F A;  2PYY A;  4QSC A;  4JSD A;  2NUV A;  2ZNU A;  4XKP A;  3VLV A;  4C1U A;  3LBS A;  3TDJ A;  4LVQ A;  1SW5 A;  4UA8 A;  2OWT A;  5F1Q A;  2RKM A;  3PUV E;  5L9O A;  4ZS9 A;  4H65 A;  2ZNT A;  1TT1 A;  1Y9U A;  3B6Q A;  3U8Q A;  3MVY A;  3RTF B;  5CRY A;  3T96 B;  5DVF A;  3ILU B;  4POW A;  4ND9 A;  1BLF A;  4L17 A;  3DP8 A;  3OSQ A;  4DXU A;  2P0S A;  1NNT A;  1TWY A;  4H5G A;  4PQJ A;  4EXK A;  5CMC A;  5H8H B;  1JW5 A;  3MP8 A;  2GH9 A;  1B1X A;  2XXP A;  4LZ5 A;  1RYX A;  3EN3 A;  4UAC A;  1B46 A;  3C4M A;  2FA7 A;  2Q89 A;  2DQV A;  3O66 A;  4RPO A;  2UYF A;  3N94 A;  2XXQ A;  3PUX E;  1PEB A;  1R6Z A;  3H6U A;  3VDF A;  2QSX A;  5B70 A;  3FGS A;  1SVX B;  2HCA A;  2UVI A;  3OEM A;  1UTB A;  1H43 A;  4KPT A;  3ZS6 A;  4ELR A;  1GVC A;  4OWD A;  3VLU A;  2OBG A;  4FJP A;  4JSO A;  1XOC A;  2G93 A;  1XHY A;  4LQ2 A;  4EUO A;  1VE4 A;  1M5F A;  3DM0 A;  3T93 B;  2PVU A;  4ZEB A;  3O97 A;  3FV1 A;  2GRV A;  2F34 A;  2Y84 A;  3SER A;  4ELQ A;  2AL5 A;  3IO6 A;  3U93 A;  4RXL A;  3H3G A;  4M1V A;  3PMX A;  3EQ1 A;  2XXY A;  4BDN A;  2QRY A;  2A5S A;  3E9X A;  3ECR A;  4ZEK A;  2QS1 A;  3IOT A;  5B7D A;  5JTY A;  1OLA A;  3QUF A;  1S50 A;  4JDF A;  1YTV A;  5I58 A;  1H45 A;  3A3U A;  3VLW A;  3HO7 A;  1NNF A;  4G8M A;  3C34 A;  4IO2 A;  2OJT A;  2UVJ A;  3CG1 A;  5CM6 A;  2ONR A;  2XXV A;  3KOT A;  1MDP 1;  5DTB A;  5IAI A;  1GR2 A;  1MH4 A;  2KLF A;  2H5Y A;  4JWX A;  4N07 A;  1Y1M A;  4G77 A;  4P0G A;  3GXA A;  2O1M A;  4QSE A;  1MDQ A;  3OD7 A;  5I2K A;  1FQA A;  3IO4 A;  4Z7E A;  3USD A;  3RN8 A;  2XD2 A;  2M8C A;  2P2A A;  3VV5 A;  3EHT A;  3E4R A;  2CZL A;  5I57 A;  1UTB B;  2VD2 A;  2I3V A;  3T9U A;  4DZ1 A;  1POY 1;  3W15 C;  1MXX A;  5BUU A;  2XX9 A;  5H8N A;  2Y7I A;  3GZG A;  3I3V A;  1M5B A;  5CC2 A;  4H8J A;  2X26 A;  1JVY A;  2DWA A;  4EXL A;  2RF1 A;  2UVH A;  1FTO A;  1USY H;  4NMY A;  3H6V A;  4G68 A;  1KWH A;  4OYV A;  1MM7 A;  1H76 A;  4PFU A;  3EHS A;  1MQG A;  5CMM A;  1LAG E;  2RIN A;  3RNN A;  1T0K A;  1NNP A;  3G3G A;  4RK2 A;  2WKY A;  2HZL A;  1HSJ A;  2B3B A;  1N7W A;  2HFB A;  4FAJ A;  1LFH A;  3K4U A;  3SEW A;  1UTH A;  1MXW A;  4H0W A;  4U23 A;  2AL4 A;  4PP0 A;  3L6H A;  1M5E A;  3R7X A;  1NFT A;  3E13 X;  1USY E;  1ANF A;  2O6A A;  1XVY A;  3G3K A;  5I58 B;  5DVI A;  2O7I A;  3OMB A;  1IEJ A;  1B7U A;  1O64 A;  1MQI A;  4OET A;  3MC2 A;  3I6V A;  3FVO A;  1LBB A;  2R6G E;  4BLA A;  1SW4 A;  4YMB A;  3G3I A;  1IZ1 A;  2XX7 A;  3HST A;  1NNK A;  4GL0 A;  1ZIU A;  5I2K B;  2B65 A;  1ZLQ A;  4R6Y A;  1MXU A;  1EU8 A;  1Y4T A;  4YB7 A;  5FHN A;  2DVZ A;  1FQB A;  1CB6 A;  4IO7 A;  1QUK A;  3TCF A;  3UA8 A;  4ESX A;  3C35 A;  3PU5 A;  5I57 B;  3MBP A;  4ZE8 A;  1AH5 A;  4QFP A;  2DXR A;  4JXI A;  3MP6 A;  2THI A;  5HPQ A;  4NF4 A;  4DCX A;  5CMK A;  4OFJ A;  1JEV A;  3LSL A;  5LOM A;  2Z8E A;  4G68 B;  5ITO A;  1ZBM A;  3ONM A;  3T9X B;  4ZED A;  5AE4 A;  4BDO A;  1IXC A;  5M2V A;  5K2X A;  3O28 A;  1IXG A;  4IY6 A;  2PT2 A;  1S9T A;  5KCJ A;  4GXS B;  3CG3 A;  3O9P A;  1OIB A;  5H8F B;  3QSL A;  4R75 A;  4OMB A;  5AA4 A;  2Q88 A;  3SEX A;  4Q8R A;  3IAZ A;  4EDP A;  1Q1K A;  4G68 C;  4ZZE A;  3RQT A;  3WAF A;  2XHD A;  2NVU B;  4FOR A;  4OER A;  1FTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...