3CR9A

Crystal structure of the complex of lactoferrin with 6-(hydroxymethyl)oxane-2,3,4,5-tetrol at 3.49 a resolution
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antibiotic
molecule keywords Lactotransferrin
publication title Crystal structure of the complex of Lactoferrin with 6-(Hydroxymethyl)oxane-2,3,4,5-tetrol at 3.49 A resolution
rcsb
total genus 204
structure length 689
sequence length 689
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cr9A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cr9A04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cr9A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cr9A03
3FUZA 2XXWA 2I3WA 2XXYA 3AXFA 3VXBA 1NFTA 1SW5A 2F78A 4N13A 4LZ8A 3IB2A 4FORA 2Q2AA 5H8FA 4QSCA 3ILTB 4IY6A 3IJOB 3KSXA 4LQ2A 1Z7ME 2AYSA 3K00A 2XX9A 3FXRA 3TTKA 3TTNA 1DTZA 1S50A 4M4GA 3UORA 4XKNA 1IITA 3T9VA 4WKMA 4THIA 3K1MA 3RNNA 1OVTA 4ND9A 4ZEFA 4U2RA 3H7MA 3ZKLA 4PQJA 3ZS6A 3R6UA 3MAMA 1B7UA 1ZKBA 2R9JA 2VD2A 3PMXA 2ESNA 2HZLA 5TU0A 2PT2A 2DWIA 1JVXA 1EZOA 4EQ7A 1JVYA 4OHNA 1WODA 5H8FB 4ZEKA 3U93A 5AE4A 1ZBMA 4FAJA 3FATA 1Y20A 2ONRA 3FXQA 1UIUA 3EHUA 3VVFA 5HPQA 2HAVA 3H6UA 3I6VA 2ONSA 3V89B 3QUFA 2XX8A 4YMBA 1AL3A 3EHTA 3EPEA 1SBPA 1WDNA 2XX7A 2O6AA 4MLQA 4X1BA 4YB5A 3LUYA 3T9HB 3UN6A 3U94A 3WAEA 1O63A 4RA1A 3KN8A 5TPAA 3IR1A 1YPNA 1AMFA 2QMXA 3MZBA 4BDRA 1EH3A 4ISUA 2Q9TA 3FZVA 3IOUA 4F1VA 3LSXA 3O6HA 4F3PA 1MQJA 4G8NA 2XD3A 1I6BA 3CRBA 4OFJA 2GFEA 2UVHA 1B7ZA 3U8QA 3FJ7A 1Y3QA 4FEBA 4BDQA 3RTFB 3JV9A 4LZ7A 3FV2A 2I49A 3EQ1A 2GHAA 2B3BA 3RLFE 1Y3NA 1B4HA 3MVYA 3I3VA 2F7CA 4NWDA 2DWJA 1M5BA 3FD3A 3HHGA 2VHAA 3KN3A 5TPAB 3LR1A 5A5XA 1XT8A 3BFTA 3FVKA 3IX1A 1LAFE 3VVDA 3VE1B 1H45A 3G3IA 4DXCA 4GXAA 1TFDA 4JXIA 4IO5A 2O68A 3JZJA 3ILUB 3TMGA 5ITPA 4R72A 3F11A 3K01A 4GWOA 2Z8EA 1P1NA 3PPPA 4POWA 4OVJA 1Y4CA 5CMBA 5CMMA 2XXRA 3MPKA 1HSJA 2H25A 2V3UA 3KOTA 2FNCA 4TOZA 4IGTA 1LBCA 1EZ9A 3JYRA 4DLDA 1CE2A 3M3LA 1FQBA 2Q2CA 3LSFB 3G3FA 3O6GA 5FHOA 2VP1A 2ZMBA 1POY1 4DDDA 1KWHA 3RQTA 2PBWA 5A5XB 2XXPA 3KSJA 3LSWA 3VXCA 3K1PA 1R9QA 2O1MA 3MW0A 3V5AA 4KYEA 5CRYA 3W9WA 2DXRA 1ZTYA 4KPTA 1BKAA 2RINA 4OFLA 4LA9A 1NH8A 4KQPA 2H99A 4U1ZA 4KD5A 4LUBA 2XXTA 2I0BA 3SETA 1BLFA 1DOTA 2O69A 1R9LA 2GHBA 4G8HA 4JWYA 3K4UA 1B6HA 1ZLQA 1H76A 1ATGA 5I56A 3T9UA 4HCWA 3CFZA 2UYEA 2YPNA 5IAIA 3S9MC 4BDLA 4NMYA 3TPAA 1MH3A 3C35A 2RC7A 3OEMA 4YU0A 3OO8A 1B05A 2RKMA 3N94A 5H8SA 4PFYA 2OWTA 4F3BA 4DIGA 1A40A 1LB8A 3VLUA 4MFIA 4OFOA 2CZLA 4KYSA 2DSFA 4OMBA 3C34A 2HZKA 2O1LA 1MRPA 5I56B 5L8DA 4NTLA 4QFNA 4DE8A 3G3JA 4H65A 1USYH 3DP6A 2DVCA 2UVGA 2DQVA 1IUDA 3KZGA 4ECFA 1JNFA 1H44A 3QYTA 2Z8DA 1Y1MA 2IEEA 3Q29A 4KCCA 1WVJA 2DS9A 2HXWA 4ZZAA 3B6WA 4FATA 4DXBA 4R6YA 1USYE 4LONB 4KI0E 1UTBA 3K6WA 2Y84A 4H8IA 1LSTA 4Q30B 1SQYA 4G68C 2G29A 4HTGA 1B4ZA 1NNTA 2DE4A 3KFMA 1MS7A 3K2DA 4UA8A 4DCXA 1P1WA 1OQGA 3BBRA 4AB6A 2ZYNA 3W9VA 5CC2A 1B3HA 1A99A 1IZ1A 1GV8A 3FVGA 1PEBA 2PYYA 1LCFA 1OLCA 5B70A 3GLBA 2BJJX 1JEVA 1B52A 4IO4A 1VR5A 3TCHA 3FXUA 2QS2A 3TKDA 4QFLA 4GRKA 4GFRA 1MY0A 4DZ1A 1N7WA 3H6TA 3CIJA 1UTBB 3S9EA 4IB2A 4AQ4A 4F18A 4AB5A 4F19A 1B9JA 5JTYA 2Q89A 1NH7A 3MPLA 3VLWA 3RY3A 1FTLA 1MXZA 2I3VA 3DM0A 3IAZA 4NF5A 4O3BA 5ISUA 2P1SA 3GBAA 3MZ9A 3FIRA 2B3FA 1PBQA 1SVXB 4JB7A 2DOJA 1B7HA 1JW4A 1N84A 5ELVA 4ZEIA 4NF4A 2DE3A 3HO7A 3PU5A 4E0WA 3IOTA 3FJMA 2ZNSA 2HFBA 3WAFA 4KCDA 1QKAA 4R74A 4O3CA 1CB6A 2R71A 2FYIA 3MC2A 4LATA 3MVWA 2XXUA 1P99A 2ZXTA 3OO7A 5L9SA 1N04A 5FTHA 3E9XA 2UVIA 3OO9A 4ZE8A 3H03A 4GL8A 3B6TA 3PUVE 5JTYB 1DTGA 4ZDMA 1DPEA 1M5DA 3H4ZA 4R9FA 2UVJA 4NF5B 2GH9A 3CI8A 4M1VA 1QULA 3A3UA 1POTA 2OBGA 3RUMA 4RK2A 1B0HA 2RC9A 1ZU0A 4GLIA 4ESWA 4NF4B 2ZYMA 4JBZA 4F1UA 4GIZA 4WEPA 3OSRA 2I58A 2AL4A 3MZ1A 4G8MA 2XD2A 2WKYA 4F3SA 4QSEA 3G7WA 1MXYA 2PVUA 4Q0CA 2NXOA 3PMVA 2NWJA 2OK2A 3HCQA 4GD5A 3MP8A 2NOOA 2O51A 3M8UA 4MH5A 4ELQA 2Y7PA 4MLVA 3KEIA 1GGGA 3RT6B 1II5A 3ZSFA 1B40A 4R6KA 4YKKA 4NEDA 3MP6A 2RC8A 3K6VA 1GR2A 1SDXA 2F5XA 1B5IA 1MPDA 1IIWA 3A3CA 1FTJA 4HW8A 1I6AA 3HSTA 5AA2D 3G3HA 3DP8A 1D9VA 4ZZEA 4EQ9A 4ZECA 4QF9A 1LCTA 3UGWA 5H8QA 2AL5A 2FA7A 5HBCA 1LBBA 2B65A 3K6UA 4XIGQ 3PPRA 2YJPA 2KLFA 1MQHA 4OQOA 3TAJA 5KDTA 3TFLA 3H06B 5H8NA 4R9GA 3HV1A 3T96B 4JSDA 4Z0IA 4QSDA 3MBPA 3TTRA 1MXXA 3C4MA 4EUOA 5H8QB 3DELB 3Q27A 2Z22A 5I59A 3S2VA 1R6ZA 3LC8A 1B3GA 4NWCA 5AA2A 3OOAA 3PUZE 1N76A 3CR9A 3CFXA 3MWBA 4U22A 2RCBA 1PB8A 2F34A 1FQEA 4N6PA 4HS7A 5KDTB 3UP9A 5H8NB 4RPNA 3C31A 4GXSB 4YICA 3C36A 2V3TA 5I84A 4L17A 3K6XA 4Q8RA 4BDOA 1JEUA 2DP8A 4DCYA 2HCAA 3T22A 1NNKA 4XTCQ 3QXMA 2P2AA 1DSNA 1MXUA 3C33A 4OTEA 3MVZA 1PB9A 4R6HA 5I59B 4OZ9A 1RYXA 1Y1ZA 3ZKKA 3N6UA 3QSLA 5AA2B 2R6GE 4KHZE 1D4NA 3KN7A 2V84A 1MXWA 5EHMA 3ODBA 1B2HA 1B5JA 3B6QA 1FW0A 1LLSA 3PD9A 4EDPA 2Y7IA 5CM6A 1LFIA 2H9BA 4GVOA 5DTBA 1MM7A 3KGCA 4XKPA 2A5TA 2RF1A 2D21A 2Y7RA 2X7QA 1A54A 1XVYA 3I5OA 3TCFA 3U1OA 3HN0A 4ELRA 1A7LA 4FECA 2QSXA 3OO6A 2PX1A 2ALUA 2OJTA 4BLAA 1IXHA 4GL0A 4ONYA 4X1DA 1OQHA 3OELA 1FQFA 2GRVA 5J1DA 3L6HA 1MPCA 3PPQA 1XOCA 1M5CA 3PV0E 3U92A 1S9TA 3FV1A 3VV5A 3TODA 4IO7A 1MM6A 5CMKA 2PT1A 1MY1A 4GQOA 3D4CA 4K3FA 1HSEA 2A5TB 1BP5A 4RK9A 4YKIA 1ANFA 3C32A 1LFHA 3K1NA 1MY2A 2OLBA 1QVSA 2F7BA 1TXFA 3PPNA 4OERA 4GOTA 2I48A 4JWOA 3O28A 4PFTA 4OXVA 3IB0A 1MPBA 2XXQA 4OYVA 3SEYA 3EN3A 4ZEBA 1OVBA 4WXJA 5JK4A 4PFWA 3PUXE 1NNFA 1QUIA 1B51A 5I57A 1LAGE 3O9PA 2ONKE 4LQ5A 4LP2B 2AIXA 1A55A 1Q35A 4E0XA 4XXUA 4X9TA 3O6IA 3H3GA 4RXLA 1H43A 1B1XA 3MJNA 3IL1B 1A8FA 2Y7WA 5LOMA 5B7DA 5ICQA 1N3XA 1VSOA 4YAHX 3FJGA 4RNSA 1QJMA 3L6GA 3UK4A 3SEUA 1EZPA 1B0LA 2F36A 1SW1A 3QUJA 1FQCA 5DEXA 3CFLA 4H5GA 4OEUA 1I69A 5H8HA 2QS1A 3MQ9A 3LSLA 3S4UA 1B3FA 2HQ0A 3S9LC 3MVXA 1QW0A 5I57B 2M8CA 3D4GA 2Y7KA 4RPOA 3TYHA 4MBPA 2ZNTA 2ZYKA 4QFOA 2NVUB 4YZZA 3RN8A 4R2FA 4UACA 3PUWE 4C1UA 3OENA 3VLVA 1F9BA 3BFUA 3SDFA 3MUQA 3CG1A 1GVCA 1AIVA 2OCUA 4YKPA 2F97A 2XXVA 5DVIA 5I58A 3OEKA 5DT6A 4BDMA 5DEXB 4P11A 3IO4A 5H8HB 3VFJA 4NF6A 3EHSA 3N6TA 5I2NA 1B58A 4TLMB 5EYFA 1J1NA 3A09A 4U4SA 4F2OA 4R2BA 3W15C 3GBBA 2QMWA 3G3GA 3N26A 4H1XA 1D3KA 3CSGA 3TQLA 3KOSA 3ONMA 1UTHA 5CBSA 4ZS9A 5M2VA 2F6GA 1FTMA 3KG2A 2NUVA 1Q1KA 3C9HA 2P0SA 4KFQA 2H4IA 5I58B 1YCJA 1IQ7A 1D9YA 3IJXB 2PMSA 5K2XA 5I2KA 3TELA 4YMAA 3THIA 4NF6B 4EXLA 2OWSA 4P0GA 2F8DA 4C0RA 2DVZA 3IO6A 1SYHA 3TCGA 4KR5A 5I2NB 1QUJA 1B5HA 2Q88A 3PPOA 4JDFA 3O66A 3SEWA 1SYIA 1LFGA 4FE8A 4OETA 3K02A 2V25A 4IGRA 1LAXA 1O64A 1Z7NE 2DE2A 4F3GA 4LZ5A 1UTHB 3H6VA 2W7YA 1MY3A 2O7UA 5AA3A 1AOVA 2I4CA 3R7XA 4YB6A 5FHNA 3FVNA 3E4RA 3O29A 2ANJA 3IOVA 5I2KB 5FTIA 4ESXA 4I9DA 2O84X 1I6QA 1NNPA 4IO2A 1B3EA 4F1YA 4RJZA 4I8CA 4OENA 4QHQA 1VE4A 4H5FA 1ZIUA 4QFKA 4TLLB 4PFUA 1ZMGA 1S7YA 2XXXA 1ELJA 5CI5A 4YKJA 3TDJA 3GXAA 1N7XA 1FQDA 1B1HA 1PDAA 4NE4A 1SI0A 5KZTA 1BIYA 4F39A 3K0VA 2H5YA 3PUYE 4EXKA 3P7IA 3FASA 3E3KA 1B3LA 3TTMA 2E1SA 2ABHA 1UIVA 1FQAA 2QJEA 1L5TA 1FTOA 1YTVA 4R75A 4I62A 3O97A 2X26A 4H0WA 2DXYA 4OEVA 1P1QA 4PE5B 1IXIA 4RYAA 3KJ7A 1PC3A 4Z7EA 4HCYA 3UA8A 5AA4A 4PETA 4LVQA 5HM4B 1MQIA 3OMBA 2O7IA 5ITOA 4ZE9A 3OD7A 2UXAA 5EHSA 4N07A 2UYFA 1T0KA 4IO6A 1HSLA 2D3IA 4G68A 3FVOA 3TEPA 3S9NC 5CBRA 4FEDA 5F7VA 1MH4A 1GTKA 1SD3A 4XKRA 2F35A 1M5EA 5JEIA 4U1OA 2X7PA 1NL5A 5IKBA 4G77A 4G4PA 3OXNA 2QL3A 2VGQA 3RGYA 1JETA 2RCAA 1EU8A 5AA4B 4U21A 1BTJA 1Y4TA 4EF1A 4X48A 3BKIB 1A8EA 2CMOA 3SESA 3SKPA 5KCJA 1UQWA 5K2YA 2ZYOA 1URGA 1XVXA 4C1TA 2REJA 2DWHA 1AH5A 1URSA 2D5WA 3B7DA 3LBSA 4G68B 1P1OA 2ZNUA 1MDQA 1TT1A 1SW2A 5DYHA 2THIA 3VVEA 4P0IA 4KYDA 3OSQA 2HAUA 4U4XA 4ELPA 2E0SA 4I1DA 4F29A 3O2AA 5CMCA 1B46A 3R26A 4O3AA 2QPQA 2QS3A 5ICTA 1QUKA 3H6WA 3T66A 4GF8A 1N3WA 4IY5A 2REGA 4U23A 3VDFA 4TQUQ 5L9MA 3TQWA 2Z23A 1JW1A 2XXHA 2Z8FA 1QKBA 3N5LA 5KCJB 2OZZA 1N0TA 1JQFA 3PD8A 1URDA 1US4A 3Q28A 2V3QA 4R73A 4POXA 1DPPA 2DYXA 2HEUA 1R1NA 4FJPA 3RPWA 1MG1A 3HPIA 3PGFA 4FIMA 1IXCA 3UIFA 2A5SA 4ZEDA 3KJTA 1RKMA 3DLNA 1US5A 3T9XB 3V83A 1MDP1 5FHMA 1XC1A 2YLNA 3USDA 1SW4A 2Q8JA 3Q25A 2XXIA 4H6DA 1IEJA 1PBPA 3MP1A 2V93A 1O7TA 3SEXA 5DVFA 3HHFA 2I4BA 1NKXA 3Q26A 1B32A 4MF3A 1M5FA 4XKQA 3DP4A 2F6PA 2XHDA 1FTKA 4WEDA 1MQGA 4QRZA 2G93A 4F31B 1ZJLA 3TUSA 1Y3PA 2VD3A 3CG3A 3CSBA 3IK6B 3E13X 3QIMA 1NMUA 1TWYA 2QS4A 4H67A 3SEVA 1RYOA 2H98A 3TZAA 4NF8A 5BWJA 1OMPA 1H3DA 3U72A 3RTWB 4BDNA 4DXUA 3IORA 3M3KA 4OESA 4EF2A 5TP9A 5BUUA 3GZGA 1XS5A 3KBRA 3RT8A 2I0CA 3CVGA 4EQBA 1LGBC 2LAOA 4OWDA 1JW5A 3M3FA 4IO3A 4F2QA 4YB7A 4G2ZA 1XHYA 4Q5TA 5AA1A 2VOZA 3FGSA 1P1UA 3G3KA 3ECRA 4NF8B 3T93B 3V8XB 2DWAA 3IB1A 1FCKA 1Y9UA 2I6EA 1MY4A 1PB7A 5F1QA 1SI1A 1LB9A 5TP9B 1OLAA 5DVJA 1LAHE 5L9OA 4H8JA 3EF7A 2IA4A 4PP0A 1DMBA 1IXGA 4F22A 1VFDA 2QRYA 3IOWA 1MXVA 1VFEA 4RY1A 3SERA 1TFAA 3PMWA 4QFPA 4JSOA 3TTLA 3QAXA 1MQDA 3QK6A 4ELOA 1YAEA 2F7AA 4JWXA 1OIBA
chains in the Genus database with same CATH superfamily
3LV0A 3FUZA 5LDZA 1IMCA 2XXWA 2I3WA 2XXYA 3AXFA 3VXBA 1NFTA 1NUWA 1SW5A 2F78A 4N13A 4LZ8A 3IB2A 4FORA 2Q2AA 5H8FA 4QSCA 3ILTB 1EYKA 4I40A 4IY6A 3IJOB 3KSXA 4LQ2A 1Z7ME 2AYSA 3K00A 2XX9A 3FXRA 3TTKA 3TTNA 1DTZA 1S50A 4M4GA 3UORA 4XKNA 1IITA 3T9VA 4WKMA 4PDDA 4THIA 3K1MA 3RNNA 4P1LA 1OVTA 4ND9A 4ZEFA 4U2RA 3H7MA 3ZKLA 2XWIA 4PQJA 3ZS6A 3R6UA 3MAMA 1B7UA 1ZKBA 2R9JA 2VD2A 3PMXA 2ESNA 2HZLA 5TU0A 2PT2A 2DWIA 1JVXA 1EZOA 4EQ7A 1JVYA 2B4LA 4OHNA 1WODA 5H8FB 4ZEKA 3U93A 5AE4A 1ZBMA 1FJ6A 4FAJA 3RYDA 3FATA 1Y20A 2ONRA 3FXQA 1UIUA 3EHUA 3VVFA 5HPQA 3QMFA 2HAVA 2CEXA 5A5LA 3H6UA 3I6VA 2ONSA 3V89B 3QUFA 5EYGA 4JVCA 2XX8A 4YMBA 1AL3A 3EHTA 3EPEA 4MHFA 1SBPA 1WDNA 2XX7A 2O6AA 4MLQA 4X1BA 4YB5A 4MX6A 3LUYA 3T9HB 3UN6A 3U94A 3WAEA 1O63A 4RA1A 4XF5A 3KN8A 5TPAA 3KC1A 2HHMA 3IR1A 1YPNA 1AMFA 2QMXA 3MZBA 1FPIA 4BDRA 1EH3A 4ISUA 4O7IA 4AS4A 2Q9TA 3FZVA 3IOUA 4F1VA 3LSXA 3O6HA 4F3PA 1FSAA 1MQJA 4G8NA 2XD3A 1I6BA 3CRBA 4PBHA 4OFJA 2GFEA 2UVHA 1B7ZA 3U8QA 3FJ7A 1Y3QA 4FEBA 4BDQA 2KQZA 4JVDA 3RTFB 3IFCA 3JV9A 4LZ7A 3FV2A 2I49A 3EQ1A 2GHAA 2B3BA 4OVQA 3RLFE 1Y3NA 1B4HA 1NV1A 2XA5A 3MVYA 3I3VA 2F7CA 4NWDA 1NV4A 2DWJA 1M5BA 3FD3A 3HHGA 2VHAA 3KN3A 2Q74A 5TPAB 3LR1A 5A5XA 1XT8A 3BFTA 1KA0A 3FVKA 3IX1A 1LAFE 3VVDA 2ZZXA 1SPIA 3VE1B 1FBCA 1H45A 3G3IA 2FBPA 4DXCA 4GXAA 1TFDA 4JXIA 4NN3A 4IO5A 2O68A 2F3BA 3JZJA 3ILUB 3TMGA 5ITPA 4R72A 3F11A 3K01A 4GWOA 2Z8EA 5ET7A 1P1NA 3PPPA 4POWA 4OVJA 1Y4CA 5CMBA 5CMMA 2WYKA 2XXRA 3MPKA 1HSJA 2H25A 2V3UA 3KOTA 2FNCA 4TOZA 4IGTA 1LBCA 1NUXA 1EZ9A 3JYRA 4DLDA 4GWUA 1CE2A 1LEVA 3M3LA 1FQBA 4OANA 2Q2CA 3LSFB 3G3FA 3O6GA 5FHOA 2VP1A 2ZMBA 1POY1 4DDDA 1KWHA 3IFAA 3RQTA 2PBWA 5A5XB 2XXPA 3KSJA 3LSWA 3VXCA 3K1PA 1R9QA 2O1MA 3MW0A 1DCUA 3V5AA 1FPLA 1DK4A 4KYEA 5CRYA 3W9WA 2DXRA 1ZTYA 3MSTA 4KPTA 1BKAA 2RINA 4OFLA 3D1RA 4LA9A 1NH8A 3MYUA 4KQPA 2H99A 4U1ZA 4KD5A 4GBVA 4LUBA 2XXTA 2I0BA 5DW8A 3SETA 1BLFA 2PFZA 1DOTA 2O69A 1R9LA 2GHBA 4G8HA 4JWYA 3K4UA 1B6HA 1ZLQA 1H76A 4PAIA 1FPGA 1ATGA 5I56A 2WBBA 1NV7A 4NGUA 4O7MA 3T9UA 4HCWA 3CFZA 2UYEA 3FXBA 2YPNA 5IAIA 3S9MC 4BDLA 4NMYA 1D9QA 3TPAA 1MH3A 3C35A 2RC7A 3OEMA 4YU0A 3OO8A 1B05A 5EQ8A 2RKMA 4PFIA 3N94A 5H8SA 4PFYA 1NI9A 2OWTA 4N6DA 4F3BA 2ZZVA 1JP4A 4DIGA 1A40A 1LB8A 1LBYA 3VLUA 4MFIA 4OFOA 2CZLA 4PAFA 2OWZA 4KYSA 2DSFA 4FBPA 4OMBA 3C34A 2HZKA 2O1LA 1MRPA 5I56B 5L8DA 4NTLA 4QFNA 4DE8A 1RDYA 3G3JA 4JVIA 4H65A 1USYH 2PCRA 3DP6A 2DVCA 4PAKA 2UVGA 2DQVA 1IUDA 3KZGA 4ECFA 1JNFA 1H44A 2CEYA 3HFUA 3QYTA 2Z8DA 1Y1MA 2IEEA 3Q29A 4KCCA 1WVJA 2DS9A 2HXWA 4ZZAA 3B6WA 4FATA 4DXBA 4R6YA 1USYE 4LONB 2L5VA 4KI0E 1UTBA 3K6WA 2Y84A 1LBVA 4H8IA 1LSTA 4Q30B 2JJKA 1SQYA 4G68C 2G29A 4HTGA 1B4ZA 4GWYA 1NNTA 2DE4A 3KFMA 1MS7A 4N8YA 3K2DA 4UA8A 1IMEA 4DCXA 1NV2A 1P1WA 1OQGA 3BBRA 4AB6A 2ZYNA 3W9VA 5CC2A 1B3HA 1A99A 1IZ1A 1GV8A 3FVGA 1PEBA 2PYYA 1LCFA 1OLCA 5B70A 2KR0A 1BK4A 3GLBA 2BJJX 1JEVA 1B52A 4IO4A 1VR5A 5J16A 3TCHA 2QFLA 3FXUA 2QS2A 3TKDA 4QFLA 4GRKA 4GFRA 1MY0A 4DZ1A 4P56A 1N7WA 3H6TA 3CIJA 3ROJA 1UTBB 4DI4B 3S9EA 4IB2A 4AQ4A 4F18A 4AB5A 4F19A 1B9JA 5JTYA 2Q89A 1NH7A 3MPLA 2CZHA 3VLWA 3RY3A 1FTLA 1MXZA 2I3VA 3DM0A 3IAZA 4NF5A 4O3BA 5ISUA 2P1SA 3GBAA 3MZ9A 3FIRA 2B3FA 1PBQA 1SVXB 4JB7A 2DOJA 1B7HA 4GWXA 1JW4A 1N84A 5ELVA 4ZEIA 5EQ7A 4NF4A 1FBHA 2DE3A 3HO7A 3PU5A 4E0WA 3IOTA 3CHGA 5T3JA 3FJMA 2ZNSA 2HFBA 3WAFA 4KCDA 1QKAA 4R74A 4O3CA 1CB6A 2R71A 2FYIA 3MC2A 4LATA 3MVWA 2PFYA 2XXUA 1P99A 2ZXTA 3OO7A 5L9SA 1N04A 5FTHA 3E9XA 2UVIA 3OO9A 4ZE8A 3H03A 4GL8A 3B6TA 3PUVE 5JTYB 1DTGA 4ZDMA 1DPEA 1M5DA 3H4ZA 4R9FA 2UVJA 4NF5B 2GH9A 3CI8A 4M1VA 1QULA 3A3UA 1POTA 2OBGA 3RUMA 2Q8MA 4RK2A 1B0HA 2RC9A 1ZU0A 1NUZA 4GLIA 4ESWA 4NF4B 2ZYMA 4JBZA 4F1UA 4GIZA 4WEPA 5IZ3A 3OSRA 2I58A 2AL4A 3MZ1A 4G8MA 4P1EA 5EYHA 2XD2A 2WKYA 4F3SA 4O94A 4QSEA 3G7WA 1MXYA 2PVUA 4Q0CA 2NXOA 3PMVA 2NWJA 2OK2A 3HCQA 4GD5A 3MP8A 2NOOA 1K9ZA 2O51A 3M8UA 4MH5A 5I5PA 4ELQA 2Y7PA 4MLVA 2HPGA 3KEIA 1GGGA 3RT6B 3SZPA 1II5A 3ZSFA 1B40A 4R6KA 4YKKA 4NEDA 3MP6A 2RC8A 3K6VA 4LN5A 4NAPA 1GR2A 1SDXA 2F5XA 1B5IA 1MPDA 4OVRA 1IIWA 3A3CA 1CNQA 1FTJA 4HW8A 1I6AA 3HSTA 5AA2D 1Q9DA 4N4UA 5IZ3B 3G3HA 3DP8A 1D9VA 4ZZEA 4EQ9A 4ZECA 4QF9A 2XXKA 1LCTA 3UGWA 4HXVA 5H8QA 2AL5A 2FA7A 5HBCA 3T1BA 2ZZWA 1LBBA 2B65A 3K6UA 2FIEA 4XIGQ 3PPRA 2YJPA 2KLFA 1MQHA 4OQOA 3TAJA 5KDTA 3TFLA 3H06B 5H8NA 4MEVA 4R9GA 3HV1A 5EQ9A 3T96B 4JSDA 2HXRA 4Z0IA 4QSDA 3MBPA 3TTRA 4MIJA 5IZZA 1MXXA 2WEFA 3C4MA 4EUOA 5H8QB 3DELB 3Q27A 2Z22A 5I59A 3S2VA 1R6ZA 1IMBA 3LC8A 1B3GA 4OA4A 4NWCA 5AA2A 2VPNA 3OOAA 3PUZE 1N76A 3CR9A 3CFXA 1NV6A 3MWBA 4U22A 2RCBA 1LBWA 3KBZA 1PB8A 2F34A 1FQEA 4N6PA 4HS7A 5KDTB 3UP9A 5H8NB 4UABA 4RPNA 3C31A 1QGXA 4GXSB 4YICA 3C36A 2V3TA 1FPFA 5I84A 4L17A 3K6XA 5FBPA 4Q8RA 2VPOA 4BDOA 1EYIA 1JEUA 2DP8A 1VDWA 4DCYA 2HCAA 3T22A 1NNKA 4XTCQ 2WYPA 3QXMA 2P2AA 1DSNA 1MXUA 3C33A 4OTEA 3MVZA 1PB9A 4R6HA 5I59B 4OZ9A 1RYXA 1Y1ZA 3ZKKA 3N6UA 3QSLA 5AA2B 4GWWA 1IMDA 2R6GE 4KHZE 1D4NA 3KN7A 1RDXA 2B4MA 2V84A 1MXWA 5EHMA 3ODBA 1B2HA 1B5JA 4HE0A 1FBPA 3B6QA 1FW0A 1LLSA 3PD9A 4EDPA 2Y7IA 5CM6A 1LFIA 2H9BA 4GVOA 5DTBA 1MM7A 3KGCA 4XKPA 2A5TA 2RF1A 2D21A 2Y7RA 2X7QA 2FVZA 4MNPA 1A54A 1XVYA 3I5OA 3TCFA 3U1OA 4GBWA 3HN0A 4ELRA 1A7LA 4FECA 2QSXA 3OO6A 3B50A 2PX1A 2ALUA 2OJTA 4BLAA 1IXHA 4GL0A 4ONYA 4X1DA 1OQHA 3OELA 1FQFA 2GRVA 5J1DA 3L6HA 1MPCA 3PPQA 1XOCA 1M5CA 3PV0E 3U92A 1S9TA 1FPJA 3FV1A 3VV5A 3TODA 4IO7A 1MM6A 5EQAA 5CMKA 2PT1A 1MY1A 4GQOA 3D4CA 4K3FA 1HSEA 5IM2A 2A5TB 1BP5A 4RK9A 4YKIA 1ANFA 3C32A 1LFHA 3K1NA 1MY2A 2OLBA 1QVSA 2F7BA 2WX9A 1TXFA 3PPNA 4OERA 4GOTA 2I48A 4JWOA 3O28A 4PFTA 4OXVA 3IB0A 1FPDA 1MPBA 4GX4A 2XXQA 4OYVA 3SEYA 3EN3A 4ZEBA 1OVBA 4WXJA 3RPLA 5JK4A 5I7IA 4P3LA 4PFWA 3PUXE 1NNFA 4N8GA 1QUIA 1B51A 5I57A 1LAGE 3O9PA 2ONKE 4LQ5A 4LP2B 4QBAA 2AIXA 1A55A 1Q35A 4E0XA 4XXUA 4X9TA 3O6IA 3H3GA 4RXLA 1H43A 1B1XA 3MJNA 3IL1B 1A8FA 2Y7WA 1FTAA 5LOMA 5B7DA 4N17A 5ICQA 1N3XA 1VSOA 4YAHX 3FJGA 4RNSA 1QJMA 3L6GA 4PFBA 3UK4A 3SEUA 1EZPA 1B0LA 4NHBA 2F36A 1SW1A 3QUJA 1FQCA 5DEXA 3CFLA 4H5GA 4OEUA 1I69A 5H8HA 2QS1A 3MQ9A 2QVRA 3LSLA 3S4UA 1B3FA 3RPLB 2HQ0A 3S9LC 3MVXA 1QW0A 5I57B 2M8CA 3D4GA 2Y7KA 4RPOA 3TYHA 4MBPA 4X04A 2ZNTA 2ZYKA 4QFOA 2NVUB 4N81A 4YZZA 3RN8A 4R2FA 4UACA 3PUWE 4C1UA 3OENA 3VLVA 1F9BA 4DI3D 3BFUA 3SDFA 3MUQA 4NX1A 3CG1A 3KC0A 1GVCA 1AIVA 2OCUA 4YKPA 2F97A 2XXVA 5DVIA 5I58A 3OEKA 5DT6A 4BDMA 5DEXB 4P11A 3IO4A 5H8HB 3VFJA 4NF6A 3EHSA 3N6TA 5I2NA 1B58A 4TLMB 3E79A 2WBDA 5EYFA 1J1NA 3A09A 1NV0A 2V4CA 4U4SA 4PGNA 3T0JA 4F2OA 4R2BA 3W15C 3GBBA 4GWSA 2QMWA 2QVUA 1NV5A 3G3GA 3N26A 4NQ8A 4H1XA 4IR8A 1D3KA 3CSGA 3TQLA 3KOSA 3ONMA 1IMFA 1UTHA 1FPBA 4ZS9A 5CBSA 4MAGA 5M2VA 2F6GA 1XI6A 1FTMA 3KG2A 2NUVA 1Q1KA 1NV3A 3C9HA 2P0SA 4G61A 4KFQA 4O8MA 1FBFA 4NF0A 2H4IA 5I58B 1YCJA 1IQ7A 1D9YA 3IJXB 2PMSA 5K2XA 5I2KA 3TELA 4YMAA 3THIA 4NF6B 4EXLA 2OWSA 4P0GA 2F8DA 4QXDA 5I3SA 4C0RA 2DVZA 3IO6A 1INPA 1SYHA 3TCGA 4KR5A 5I2NB 1QUJA 1B5HA 1FBDA 2Q88A 3PPOA 4JDFA 1FPKA 3O66A 3SEWA 1SYIA 1LFGA 4FE8A 4MCOA 3FBPA 4OETA 3K02A 2V25A 4IGRA 4PBQA 1LAXA 1O64A 1Z7NE 2DE2A 4F3GA 4LZ5A 1UTHB 3H6VA 2W7YA 4I3YA 1FRPA 1MY3A 4PF6A 2O7UA 5AA3A 3E78A 1AOVA 4AS5A 2I4CA 3R7XA 4YB6A 5FHNA 4PGPA 5ESYA 3FVNA 3E4RA 4GWZA 1IMAA 3O29A 2ANJA 3IOVA 5I2KB 1FBGA 4HE1A 3EKIA 5FTIA 4ESXA 4I9DA 4P9KA 2O84X 1I6QA 1NNPA 4IO2A 5ET5A 4HE2A 1B3EA 4F1YA 3LUZA 4I8CA 4RJZA 4OENA 3ISPA 4QHQA 1VE4A 3GYYA 3BIHA 4H5FA 1ZIUA 4QFKA 4TLLB 4PFUA 1ZMGA 1EYJA 1S7YA 2XXXA 1ELJA 5CI5A 4YKJA 5F24A 3TDJA 3GXAA 1N7XA 4PCDA 1FQDA 1B1HA 1PDAA 4NE4A 1SI0A 5KZTA 1BIYA 1DBZA 4F39A 2Y5KA 1YYZA 3K0VA 2H5YA 2P3VA 3PUYE 2R8TA 4EXKA 3P7IA 3PTYA 3FASA 3E3KA 1B3LA 3TTMA 2E1SA 2ABHA 1UIVA 1FQAA 2QJEA 1L5TA 1FTOA 1YTVA 4R75A 4I62A 3O97A 2X26A 4X8RA 4GX3A 4H0WA 2DXYA 4OEVA 1P1QA 4PE5B 1IXIA 1FJ9A 4RYAA 4PFRA 3KJ7A 1PC3A 4Z7EA 4HCYA 3UA8A 5AA4A 4PETA 4LVQA 5HM4B 1MQIA 3OMBA 2O7IA 5ITOA 4ZE9A 3OD7A 2UXAA 5EHSA 4N07A 2UYFA 1T0KA 4IO6A 1HSLA 2D3IA 4G68A 3FVOA 3TEPA 3S9NC 2P3NA 5CBRA 4FEDA 5F7VA 1G0IA 2VT5A 1MH4A 1GTKA 1SD3A 4XKRA 2F35A 1M5EA 5JEIA 1LBZA 4U1OA 2X7PA 1NL5A 5IKBA 2Y5LA 4G77A 4G4PA 3OXNA 2QL3A 2VGQA 3RGYA 1KA1A 1JETA 2RCAA 1EU8A 5AA4B 1RDZA 4U21A 1BTJA 1Y4TA 4EF1A 4X48A 3BKIB 1A8EA 2CMOA 3SESA 2XWKA 3SKPA 5KCJA 1UQWA 5K2YA 2XWVA 2ZYOA 1URGA 5LTCA 2DDKA 1XVXA 4C1TA 2REJA 2DWHA 1AH5A 1URSA 2D5WA 3B7DA 3LBSA 4G68B 1P1OA 2ZNUA 1MDQA 1TT1A 1SW2A 5DYHA 2THIA 3VVEA 4P0IA 4KYDA 5IGAA 3OSQA 4XEQA 4MNIA 2HAUA 4U4XA 4ELPA 2E0SA 4I1DA 4F29A 4MNCA 3O2AA 5CMCA 1B46A 2GQ1A 2F3DA 4NG7A 3R26A 4O3AA 2QPQA 2QS3A 5ICTA 1QUKA 3H6WA 3B8BA 3T66A 4GF8A 1N3WA 4IY5A 2REGA 4U23A 4TQUQ 5L9MA 3TQWA 3VDFA 2Z23A 1JW1A 3BIGA 2XXHA 4PC9A 2Z8FA 1QKBA 3N5LA 5KCJB 4N15A 2OZZA 1N0TA 1JQFA 2MKZA 3PD8A 1URDA 1US4A 2OX3A 3Q28A 2V3QA 4N91A 5ET6A 4R73A 4POXA 1DPPA 2DYXA 2HEUA 4PE3A 1R1NA 4FJPA 3RPWA 4P47A 1MG1A 3HPIA 3PGFA 2BJIA 4KXPA 4FIMA 1IXCA 3UIFA 2A5SA 4ZEDA 3U65A 4MJOA 3KJTA 1RKMA 3DLNA 1US5A 3T9XB 3V83A 1MDP1 5FHMA 1XC1A 4OVSA 2YLNA 3USDA 1SW4A 2Q8JA 1AWBA 4PF8A 3Q25A 2XXIA 4H6DA 1IEJA 1PBPA 4XFEA 2CZIA 1YXIA 3MP1A 2V93A 1O7TA 1K9YA 3SEXA 5DVFA 3HHFA 2I4BA 1NKXA 3Q26A 1B32A 4MF3A 1M5FA 4XKQA 3DP4A 2F6PA 4OVPA 2XHDA 1FTKA 4WEDA 2CZKA 2FHYA 1MQGA 5IZ1A 2FIXA 4QRZA 3NOHA 2G93A 4F31B 1ZJLA 1FBEA 3TUSA 1Y3PA 2VD3A 1NUYA 3CG3A 1YZ0A 3CSBA 3IK6B 3E13X 3QIMA 1NMUA 1TWYA 2QS4A 4H67A 3SEVA 1RYOA 2H98A 3TZAA 4NF8A 5BWJA 1OMPA 1H3DA 3U72A 4I3EA 3RTWB 4BDNA 4DXUA 3IORA 4N6KA 3M3KA 4OESA 4EF2A 5TP9A 5BUUA 3GZGA 1XS5A 3KBRA 3RT8A 1G0HA 2I0CA 3CVGA 4EQBA 1LGBC 2LAOA 4OWDA 1JW5A 3M3FA 4IO3A 5ET8A 4F2QA 4YB7A 4G2ZA 1XHYA 4Q5TA 5AA1A 1FPEA 2VOZA 4PDHA 3FGSA 2QVVA 1P1UA 3A29A 4OVTA 3G3KA 3ECRA 4NF8B 4H45A 3T93B 3V8XB 2DWAA 3IB1A 1FCKA 1Y9UA 2I6EA 1KZ8A 1MY4A 1PB7A 5F1QA 1SI1A 1LB9A 5TP9B 4H46A 4GX6A 1OLAA 4PTKA 5DVJA 1LAHE 4MMPA 5L9OA 4H8JA 3EF7A 2IA4A 4PP0A 1DMBA 1IXGA 4F22A 1VFDA 2QRYA 3IOWA 1MXVA 4P8BA 1VFEA 4RY1A 3SERA 1TFAA 3PMWA 1LBXA 4QFPA 4JSOA 3TTLA 3QAXA 1MQDA 3QK6A 4ELOA 1YAEA 2F7AA 4JWXA 2XWOA 1OIBA
chains in the Genus database with same CATH topology
3FUZA 2XXWA 2I3WA 2XXYA 3AXFA 3VXBA 1NFTA 1SW5A 2F78A 4N13A 4LZ8A 3IB2A 4FORA 2Q2AA 5H8FA 4QSCA 3ILTB 4IY6A 3IJOB 3KSXA 4LQ2A 1Z7ME 2AYSA 3K00A 2XX9A 3FXRA 3TTKA 3TTNA 1DTZA 1S50A 4M4GA 3UORA 4XKNA 1IITA 3T9VA 4WKMA 4THIA 3K1MA 3RNNA 1OVTA 4ND9A 4ZEFA 4U2RA 3H7MA 3ZKLA 4PQJA 3ZS6A 3R6UA 3MAMA 1B7UA 1ZKBA 2R9JA 2VD2A 3PMXA 2ESNA 2HZLA 5TU0A 2PT2A 2DWIA 1JVXA 1EZOA 4EQ7A 1JVYA 4OHNA 1WODA 5H8FB 4ZEKA 3U93A 5AE4A 1ZBMA 4FAJA 3FATA 1Y20A 2ONRA 3FXQA 1UIUA 3EHUA 3VVFA 5HPQA 2HAVA 3H6UA 3I6VA 2ONSA 3V89B 3QUFA 2XX8A 4YMBA 1AL3A 3EHTA 3EPEA 1SBPA 1WDNA 2XX7A 2O6AA 4MLQA 4X1BA 4YB5A 3LUYA 3T9HB 3UN6A 3U94A 3WAEA 1O63A 4RA1A 3KN8A 5TPAA 3IR1A 1YPNA 1AMFA 2QMXA 3MZBA 4BDRA 1EH3A 4ISUA 2Q9TA 3FZVA 3IOUA 4F1VA 3LSXA 3O6HA 4F3PA 1MQJA 4G8NA 2XD3A 1I6BA 3CRBA 4OFJA 2GFEA 2UVHA 1B7ZA 3U8QA 3FJ7A 1Y3QA 4FEBA 4BDQA 3RTFB 3JV9A 4LZ7A 3FV2A 2I49A 3EQ1A 2GHAA 2B3BA 3RLFE 1Y3NA 1B4HA 3MVYA 3I3VA 2F7CA 4NWDA 2DWJA 1M5BA 3FD3A 3HHGA 2VHAA 3KN3A 5TPAB 3LR1A 5A5XA 1XT8A 3BFTA 3FVKA 3IX1A 1LAFE 3VVDA 3VE1B 1H45A 3G3IA 4DXCA 4GXAA 1TFDA 4JXIA 4IO5A 2O68A 3JZJA 3ILUB 3TMGA 5ITPA 4R72A 3F11A 3K01A 4GWOA 2Z8EA 1P1NA 3PPPA 4POWA 4OVJA 1Y4CA 5CMBA 5CMMA 2XXRA 3MPKA 1HSJA 2H25A 2V3UA 3KOTA 2FNCA 4TOZA 4IGTA 1LBCA 1EZ9A 3JYRA 4DLDA 1CE2A 3M3LA 1FQBA 2Q2CA 3LSFB 3G3FA 3O6GA 5FHOA 2VP1A 2ZMBA 1POY1 4DDDA 1KWHA 3RQTA 2PBWA 5A5XB 2XXPA 3KSJA 3LSWA 3VXCA 3K1PA 1R9QA 2O1MA 3MW0A 3V5AA 4KYEA 5CRYA 3W9WA 2DXRA 1ZTYA 4KPTA 1BKAA 2RINA 4OFLA 4LA9A 1NH8A 4KQPA 2H99A 4U1ZA 4KD5A 4LUBA 2XXTA 2I0BA 3SETA 1BLFA 1DOTA 2O69A 1R9LA 2GHBA 4G8HA 4JWYA 3K4UA 1B6HA 1ZLQA 1H76A 1ATGA 5I56A 3T9UA 4HCWA 3CFZA 2UYEA 2YPNA 5IAIA 3S9MC 4BDLA 4NMYA 3TPAA 1MH3A 3C35A 2RC7A 3OEMA 4YU0A 3OO8A 1B05A 2RKMA 3N94A 5H8SA 4PFYA 2OWTA 4F3BA 4DIGA 1A40A 1LB8A 3VLUA 4MFIA 4OFOA 2CZLA 4KYSA 2DSFA 4OMBA 3C34A 2HZKA 2O1LA 1MRPA 5I56B 5L8DA 4NTLA 4QFNA 4DE8A 3G3JA 4H65A 1USYH 3DP6A 2DVCA 2UVGA 2DQVA 1IUDA 3KZGA 4ECFA 1JNFA 1H44A 3QYTA 2Z8DA 1Y1MA 2IEEA 3Q29A 4KCCA 1WVJA 2DS9A 2HXWA 4ZZAA 3B6WA 4FATA 4DXBA 4R6YA 1USYE 4LONB 4KI0E 1UTBA 3K6WA 2Y84A 4H8IA 1LSTA 4Q30B 1SQYA 4G68C 2G29A 4HTGA 1B4ZA 1NNTA 2DE4A 3KFMA 1MS7A 3K2DA 4UA8A 4DCXA 1P1WA 1OQGA 3BBRA 4AB6A 2ZYNA 3W9VA 5CC2A 1B3HA 1A99A 1IZ1A 1GV8A 3FVGA 1PEBA 2PYYA 1LCFA 1OLCA 5B70A 3GLBA 2BJJX 1JEVA 1B52A 4IO4A 1VR5A 3TCHA 3FXUA 2QS2A 3TKDA 4QFLA 4GRKA 4GFRA 1MY0A 4DZ1A 1N7WA 3H6TA 3CIJA 1UTBB 3S9EA 4IB2A 4AQ4A 4F18A 4AB5A 4F19A 1B9JA 5JTYA 2Q89A 1NH7A 3MPLA 3VLWA 3RY3A 1FTLA 1MXZA 2I3VA 3DM0A 3IAZA 4NF5A 4O3BA 5ISUA 2P1SA 3GBAA 3MZ9A 3FIRA 2B3FA 1PBQA 1SVXB 4JB7A 2DOJA 1B7HA 1JW4A 1N84A 5ELVA 4ZEIA 4NF4A 2DE3A 3HO7A 3PU5A 4E0WA 3IOTA 3FJMA 2ZNSA 2HFBA 3WAFA 4KCDA 1QKAA 4R74A 4O3CA 1CB6A 2R71A 2FYIA 3MC2A 4LATA 3MVWA 2XXUA 1P99A 2ZXTA 3OO7A 5L9SA 1N04A 5FTHA 3E9XA 2UVIA 3OO9A 4ZE8A 3H03A 4GL8A 3B6TA 3PUVE 5JTYB 1DTGA 4ZDMA 1DPEA 1M5DA 3H4ZA 4R9FA 2UVJA 4NF5B 2GH9A 3CI8A 4M1VA 1QULA 3A3UA 1POTA 2OBGA 3RUMA 4RK2A 1B0HA 2RC9A 1ZU0A 4GLIA 4ESWA 4NF4B 2ZYMA 4JBZA 4F1UA 4GIZA 4WEPA 3OSRA 2I58A 2AL4A 3MZ1A 4G8MA 2XD2A 2WKYA 4F3SA 4QSEA 3G7WA 1MXYA 2PVUA 4Q0CA 2NXOA 3PMVA 2NWJA 2OK2A 3HCQA 4GD5A 3MP8A 2NOOA 2O51A 3M8UA 4MH5A 4ELQA 2Y7PA 4MLVA 3KEIA 1GGGA 3RT6B 1II5A 3ZSFA 1B40A 4R6KA 4YKKA 4NEDA 3MP6A 2RC8A 3K6VA 1GR2A 1SDXA 2F5XA 1B5IA 1MPDA 1IIWA 3A3CA 1FTJA 4HW8A 1I6AA 3HSTA 5AA2D 3G3HA 3DP8A 1D9VA 4ZZEA 4EQ9A 4ZECA 4QF9A 1LCTA 3UGWA 5H8QA 2AL5A 2FA7A 5HBCA 1LBBA 2B65A 3K6UA 4XIGQ 3PPRA 2YJPA 2KLFA 1MQHA 4OQOA 3TAJA 5KDTA 3TFLA 3H06B 5H8NA 4R9GA 3HV1A 3T96B 4JSDA 4Z0IA 4QSDA 3MBPA 3TTRA 1MXXA 3C4MA 4EUOA 5H8QB 3DELB 3Q27A 2Z22A 5I59A 3S2VA 1R6ZA 3LC8A 1B3GA 4NWCA 5AA2A 3OOAA 3PUZE 1N76A 3CR9A 3CFXA 3MWBA 4U22A 2RCBA 1PB8A 2F34A 1FQEA 4N6PA 4HS7A 5KDTB 3UP9A 5H8NB 4RPNA 3C31A 4GXSB 4YICA 3C36A 2V3TA 5I84A 4L17A 3K6XA 4Q8RA 4BDOA 1JEUA 2DP8A 4DCYA 2HCAA 3T22A 1NNKA 4XTCQ 3QXMA 2P2AA 1DSNA 1MXUA 3C33A 4OTEA 3MVZA 1PB9A 4R6HA 5I59B 4OZ9A 1RYXA 1Y1ZA 3ZKKA 3N6UA 3QSLA 5AA2B 2R6GE 4KHZE 1D4NA 3KN7A 2V84A 1MXWA 5EHMA 3ODBA 1B2HA 1B5JA 3B6QA 1FW0A 1LLSA 3PD9A 4EDPA 2Y7IA 5CM6A 1LFIA 2H9BA 4GVOA 5DTBA 1MM7A 3KGCA 4XKPA 2A5TA 2RF1A 2D21A 2Y7RA 2X7QA 1A54A 1XVYA 3I5OA 3TCFA 3U1OA 3HN0A 4ELRA 1A7LA 4FECA 2QSXA 3OO6A 2PX1A 2ALUA 2OJTA 4BLAA 1IXHA 4GL0A 4ONYA 4X1DA 1OQHA 3OELA 1FQFA 2GRVA 5J1DA 3L6HA 1MPCA 3PPQA 1XOCA 1M5CA 3PV0E 3U92A 1S9TA 3FV1A 3VV5A 3TODA 4IO7A 1MM6A 5CMKA 2PT1A 1MY1A 4GQOA 3D4CA 4K3FA 1HSEA 2A5TB 1BP5A 4RK9A 4YKIA 1ANFA 3C32A 1LFHA 3K1NA 1MY2A 2OLBA 1QVSA 2F7BA 1TXFA 3PPNA 4OERA 4GOTA 2I48A 4JWOA 3O28A 4PFTA 4OXVA 3IB0A 1MPBA 2XXQA 4OYVA 3SEYA 3EN3A 4ZEBA 1OVBA 4WXJA 5JK4A 4PFWA 3PUXE 1NNFA 1QUIA 1B51A 5I57A 1LAGE 3O9PA 2ONKE 4LQ5A 4LP2B 2AIXA 1A55A 1Q35A 4E0XA 4XXUA 4X9TA 3O6IA 3H3GA 4RXLA 1H43A 1B1XA 3MJNA 3IL1B 1A8FA 2Y7WA 5LOMA 5B7DA 5ICQA 1N3XA 1VSOA 4YAHX 3FJGA 4RNSA 1QJMA 3L6GA 3UK4A 3SEUA 1EZPA 1B0LA 2F36A 1SW1A 3QUJA 1FQCA 5DEXA 3CFLA 4H5GA 4OEUA 1I69A 5H8HA 2QS1A 3MQ9A 3LSLA 3S4UA 1B3FA 2HQ0A 3S9LC 3MVXA 1QW0A 5I57B 2M8CA 3D4GA 2Y7KA 4RPOA 3TYHA 4MBPA 2ZNTA 2ZYKA 4QFOA 2NVUB 4YZZA 3RN8A 4R2FA 4UACA 3PUWE 4C1UA 3OENA 3VLVA 1F9BA 3BFUA 3SDFA 3MUQA 3CG1A 1GVCA 1AIVA 2OCUA 4YKPA 2F97A 2XXVA 5DVIA 5I58A 3OEKA 5DT6A 4BDMA 5DEXB 4P11A 3IO4A 5H8HB 3VFJA 4NF6A 3EHSA 3N6TA 5I2NA 1B58A 4TLMB 5EYFA 1J1NA 3A09A 4U4SA 4F2OA 4R2BA 3W15C 3GBBA 2QMWA 3G3GA 3N26A 4H1XA 1D3KA 3CSGA 3TQLA 3KOSA 3ONMA 1UTHA 5CBSA 4ZS9A 5M2VA 2F6GA 1FTMA 3KG2A 2NUVA 1Q1KA 3C9HA 2P0SA 4KFQA 2H4IA 5I58B 1YCJA 1IQ7A 1D9YA 3IJXB 2PMSA 5K2XA 5I2KA 3TELA 4YMAA 3THIA 4NF6B 4EXLA 2OWSA 4P0GA 2F8DA 4C0RA 2DVZA 3IO6A 1SYHA 3TCGA 4KR5A 5I2NB 1QUJA 1B5HA 2Q88A 3PPOA 4JDFA 3O66A 3SEWA 1SYIA 1LFGA 4FE8A 4OETA 3K02A 2V25A 4IGRA 1LAXA 1O64A 1Z7NE 2DE2A 4F3GA 4LZ5A 1UTHB 3H6VA 2W7YA 1MY3A 2O7UA 5AA3A 1AOVA 2I4CA 3R7XA 4YB6A 5FHNA 3FVNA 3E4RA 3O29A 2ANJA 3IOVA 5I2KB 5FTIA 4ESXA 4I9DA 2O84X 1I6QA 1NNPA 4IO2A 1B3EA 4F1YA 4RJZA 4I8CA 4OENA 4QHQA 1VE4A 4H5FA 1ZIUA 4QFKA 4TLLB 4PFUA 1ZMGA 1S7YA 2XXXA 1ELJA 5CI5A 4YKJA 3TDJA 3GXAA 1N7XA 1FQDA 1B1HA 1PDAA 4NE4A 1SI0A 5KZTA 1BIYA 4F39A 3K0VA 2H5YA 3PUYE 4EXKA 3P7IA 3FASA 3E3KA 1B3LA 3TTMA 2E1SA 2ABHA 1UIVA 1FQAA 2QJEA 1L5TA 1FTOA 1YTVA 4R75A 4I62A 3O97A 2X26A 4H0WA 2DXYA 4OEVA 1P1QA 4PE5B 1IXIA 4RYAA 3KJ7A 1PC3A 4Z7EA 4HCYA 3UA8A 5AA4A 4PETA 4LVQA 5HM4B 1MQIA 3OMBA 2O7IA 5ITOA 4ZE9A 3OD7A 2UXAA 5EHSA 4N07A 2UYFA 1T0KA 4IO6A 1HSLA 2D3IA 4G68A 3FVOA 3TEPA 3S9NC 5CBRA 4FEDA 5F7VA 1MH4A 1GTKA 1SD3A 4XKRA 2F35A 1M5EA 5JEIA 4U1OA 2X7PA 1NL5A 5IKBA 4G77A 4G4PA 3OXNA 2QL3A 2VGQA 3RGYA 1JETA 2RCAA 1EU8A 5AA4B 4U21A 1BTJA 1Y4TA 4EF1A 4X48A 3BKIB 1A8EA 2CMOA 3SESA 3SKPA 5KCJA 1UQWA 5K2YA 2ZYOA 1URGA 1XVXA 4C1TA 2REJA 2DWHA 1AH5A 1URSA 2D5WA 3B7DA 3LBSA 4G68B 1P1OA 2ZNUA 1MDQA 1TT1A 1SW2A 5DYHA 2THIA 3VVEA 4P0IA 4KYDA 3OSQA 2HAUA 4U4XA 4ELPA 2E0SA 4I1DA 4F29A 3O2AA 5CMCA 1B46A 3R26A 4O3AA 2QPQA 2QS3A 5ICTA 1QUKA 3H6WA 3T66A 4GF8A 1N3WA 4IY5A 2REGA 4U23A 3VDFA 4TQUQ 5L9MA 3TQWA 2Z23A 1JW1A 2XXHA 2Z8FA 1QKBA 3N5LA 5KCJB 2OZZA 1N0TA 1JQFA 3PD8A 1URDA 1US4A 3Q28A 2V3QA 4R73A 4POXA 1DPPA 2DYXA 2HEUA 1R1NA 4FJPA 3RPWA 1MG1A 3HPIA 3PGFA 4FIMA 1IXCA 3UIFA 2A5SA 4ZEDA 3KJTA 1RKMA 3DLNA 1US5A 3T9XB 3V83A 1MDP1 5FHMA 1XC1A 2YLNA 3USDA 1SW4A 2Q8JA 3Q25A 2XXIA 4H6DA 1IEJA 1PBPA 3MP1A 2V93A 1O7TA 3SEXA 5DVFA 3HHFA 2I4BA 1NKXA 3Q26A 1B32A 4MF3A 1M5FA 4XKQA 3DP4A 2F6PA 2XHDA 1FTKA 4WEDA 1MQGA 4QRZA 2G93A 4F31B 1ZJLA 3TUSA 1Y3PA 2VD3A 3CG3A 3CSBA 3IK6B 3E13X 3QIMA 1NMUA 1TWYA 2QS4A 4H67A 3SEVA 1RYOA 2H98A 3TZAA 4NF8A 5BWJA 1OMPA 1H3DA 3U72A 3RTWB 4BDNA 4DXUA 3IORA 3M3KA 4OESA 4EF2A 5TP9A 5BUUA 3GZGA 1XS5A 3KBRA 3RT8A 2I0CA 3CVGA 4EQBA 1LGBC 2LAOA 4OWDA 1JW5A 3M3FA 4IO3A 4F2QA 4YB7A 4G2ZA 1XHYA 4Q5TA 5AA1A 2VOZA 3FGSA 1P1UA 3G3KA 3ECRA 4NF8B 3T93B 3V8XB 2DWAA 3IB1A 1FCKA 1Y9UA 2I6EA 1MY4A 1PB7A 5F1QA 1SI1A 1LB9A 5TP9B 1OLAA 5DVJA 1LAHE 5L9OA 4H8JA 3EF7A 2IA4A 4PP0A 1DMBA 1IXGA 4F22A 1VFDA 2QRYA 3IOWA 1MXVA 1VFEA 4RY1A 3SERA 1TFAA 3PMWA 4QFPA 4JSOA 3TTLA 3QAXA 1MQDA 3QK6A 4ELOA 1YAEA 2F7AA 4JWXA 1OIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FUZ A;  2XXW A;  2I3W A;  2XXY A;  3AXF A;  3VXB A;  1NFT A;  1SW5 A;  2F78 A;  4N13 A;  4LZ8 A;  3IB2 A;  4FOR A;  2Q2A A;  5H8F A;  4QSC A;  3ILT B;  4IY6 A;  3IJO B;  3KSX A;  4LQ2 A;  1Z7M E;  2AYS A;  3K00 A;  2XX9 A;  3FXR A;  3TTK A;  3TTN A;  1DTZ A;  1S50 A;  4M4G A;  3UOR A;  4XKN A;  1IIT A;  3T9V A;  4WKM A;  4THI A;  3K1M A;  3RNN A;  1OVT A;  4ND9 A;  4ZEF A;  4U2R A;  3H7M A;  3ZKL A;  4PQJ A;  3ZS6 A;  3R6U A;  3MAM A;  1B7U A;  1ZKB A;  2R9J A;  2VD2 A;  3PMX A;  2ESN A;  2HZL A;  5TU0 A;  2PT2 A;  2DWI A;  1JVX A;  1EZO A;  4EQ7 A;  1JVY A;  4OHN A;  1WOD A;  5H8F B;  4ZEK A;  3U93 A;  5AE4 A;  1ZBM A;  4FAJ A;  3FAT A;  1Y20 A;  2ONR A;  3FXQ A;  1UIU A;  3EHU A;  3VVF A;  5HPQ A;  2HAV A;  3H6U A;  3I6V A;  2ONS A;  3V89 B;  3QUF A;  2XX8 A;  4YMB A;  1AL3 A;  3EHT A;  3EPE A;  1SBP A;  1WDN A;  2XX7 A;  2O6A A;  4MLQ A;  4X1B A;  4YB5 A;  3LUY A;  3T9H B;  3UN6 A;  3U94 A;  3WAE A;  1O63 A;  4RA1 A;  3KN8 A;  5TPA A;  3IR1 A;  1YPN A;  1AMF A;  2QMX A;  3MZB A;  4BDR A;  1EH3 A;  4ISU A;  2Q9T A;  3FZV A;  3IOU A;  4F1V A;  3LSX A;  3O6H A;  4F3P A;  1MQJ A;  4G8N A;  2XD3 A;  1I6B A;  3CRB A;  4OFJ A;  2GFE A;  2UVH A;  1B7Z A;  3U8Q A;  3FJ7 A;  1Y3Q A;  4FEB A;  4BDQ A;  3RTF B;  3JV9 A;  4LZ7 A;  3FV2 A;  2I49 A;  3EQ1 A;  2GHA A;  2B3B A;  3RLF E;  1Y3N A;  1B4H A;  3MVY A;  3I3V A;  2F7C A;  4NWD A;  2DWJ A;  1M5B A;  3FD3 A;  3HHG A;  2VHA A;  3KN3 A;  5TPA B;  3LR1 A;  5A5X A;  1XT8 A;  3BFT A;  3FVK A;  3IX1 A;  1LAF E;  3VVD A;  3VE1 B;  1H45 A;  3G3I A;  4DXC A;  4GXA A;  1TFD A;  4JXI A;  4IO5 A;  2O68 A;  3JZJ A;  3ILU B;  3TMG A;  5ITP A;  4R72 A;  3F11 A;  3K01 A;  4GWO A;  2Z8E A;  1P1N A;  3PPP A;  4POW A;  4OVJ A;  1Y4C A;  5CMB A;  5CMM A;  2XXR A;  3MPK A;  1HSJ A;  2H25 A;  2V3U A;  3KOT A;  2FNC A;  4TOZ A;  4IGT A;  1LBC A;  1EZ9 A;  3JYR A;  4DLD A;  1CE2 A;  3M3L A;  1FQB A;  2Q2C A;  3LSF B;  3G3F A;  3O6G A;  5FHO A;  2VP1 A;  2ZMB A;  1POY 1;  4DDD A;  1KWH A;  3RQT A;  2PBW A;  5A5X B;  2XXP A;  3KSJ A;  3LSW A;  3VXC A;  3K1P A;  1R9Q A;  2O1M A;  3MW0 A;  3V5A A;  4KYE A;  5CRY A;  3W9W A;  2DXR A;  1ZTY A;  4KPT A;  1BKA A;  2RIN A;  4OFL A;  4LA9 A;  1NH8 A;  4KQP A;  2H99 A;  4U1Z A;  4KD5 A;  4LUB A;  2XXT A;  2I0B A;  3SET A;  1BLF A;  1DOT A;  2O69 A;  1R9L A;  2GHB A;  4G8H A;  4JWY A;  3K4U A;  1B6H A;  1ZLQ A;  1H76 A;  1ATG A;  5I56 A;  3T9U A;  4HCW A;  3CFZ A;  2UYE A;  2YPN A;  5IAI A;  3S9M C;  4BDL A;  4NMY A;  3TPA A;  1MH3 A;  3C35 A;  2RC7 A;  3OEM A;  4YU0 A;  3OO8 A;  1B05 A;  2RKM A;  3N94 A;  5H8S A;  4PFY A;  2OWT A;  4F3B A;  4DIG A;  1A40 A;  1LB8 A;  3VLU A;  4MFI A;  4OFO A;  2CZL A;  4KYS A;  2DSF A;  4OMB A;  3C34 A;  2HZK A;  2O1L A;  1MRP A;  5I56 B;  5L8D A;  4NTL A;  4QFN A;  4DE8 A;  3G3J A;  4H65 A;  1USY H;  3DP6 A;  2DVC A;  2UVG A;  2DQV A;  1IUD A;  3KZG A;  4ECF A;  1JNF A;  1H44 A;  3QYT A;  2Z8D A;  1Y1M A;  2IEE A;  3Q29 A;  4KCC A;  1WVJ A;  2DS9 A;  2HXW A;  4ZZA A;  3B6W A;  4FAT A;  4DXB A;  4R6Y A;  1USY E;  4LON B;  4KI0 E;  1UTB A;  3K6W A;  2Y84 A;  4H8I A;  1LST A;  4Q30 B;  1SQY A;  4G68 C;  2G29 A;  4HTG A;  1B4Z A;  1NNT A;  2DE4 A;  3KFM A;  1MS7 A;  3K2D A;  4UA8 A;  4DCX A;  1P1W A;  1OQG A;  3BBR A;  4AB6 A;  2ZYN A;  3W9V A;  5CC2 A;  1B3H A;  1A99 A;  1IZ1 A;  1GV8 A;  3FVG A;  1PEB A;  2PYY A;  1LCF A;  1OLC A;  5B70 A;  3GLB A;  2BJJ X;  1JEV A;  1B52 A;  4IO4 A;  1VR5 A;  3TCH A;  3FXU A;  2QS2 A;  3TKD A;  4QFL A;  4GRK A;  4GFR A;  1MY0 A;  4DZ1 A;  1N7W A;  3H6T A;  3CIJ A;  1UTB B;  3S9E A;  4IB2 A;  4AQ4 A;  4F18 A;  4AB5 A;  4F19 A;  1B9J A;  5JTY A;  2Q89 A;  1NH7 A;  3MPL A;  3VLW A;  3RY3 A;  1FTL A;  1MXZ A;  2I3V A;  3DM0 A;  3IAZ A;  4NF5 A;  4O3B A;  5ISU A;  2P1S A;  3GBA A;  3MZ9 A;  3FIR A;  2B3F A;  1PBQ A;  1SVX B;  4JB7 A;  2DOJ A;  1B7H A;  1JW4 A;  1N84 A;  5ELV A;  4ZEI A;  4NF4 A;  2DE3 A;  3HO7 A;  3PU5 A;  4E0W A;  3IOT A;  3FJM A;  2ZNS A;  2HFB A;  3WAF A;  4KCD A;  1QKA A;  4R74 A;  4O3C A;  1CB6 A;  2R71 A;  2FYI A;  3MC2 A;  4LAT A;  3MVW A;  2XXU A;  1P99 A;  2ZXT A;  3OO7 A;  5L9S A;  1N04 A;  5FTH A;  3E9X A;  2UVI A;  3OO9 A;  4ZE8 A;  3H03 A;  4GL8 A;  3B6T A;  3PUV E;  5JTY B;  1DTG A;  4ZDM A;  1DPE A;  1M5D A;  3H4Z A;  4R9F A;  2UVJ A;  4NF5 B;  2GH9 A;  3CI8 A;  4M1V A;  1QUL A;  3A3U A;  1POT A;  2OBG A;  3RUM A;  4RK2 A;  1B0H A;  2RC9 A;  1ZU0 A;  4GLI A;  4ESW A;  4NF4 B;  2ZYM A;  4JBZ A;  4F1U A;  4GIZ A;  4WEP A;  3OSR A;  2I58 A;  2AL4 A;  3MZ1 A;  4G8M A;  2XD2 A;  2WKY A;  4F3S A;  4QSE A;  3G7W A;  1MXY A;  2PVU A;  4Q0C A;  2NXO A;  3PMV A;  2NWJ A;  2OK2 A;  3HCQ A;  4GD5 A;  3MP8 A;  2NOO A;  2O51 A;  3M8U A;  4MH5 A;  4ELQ A;  2Y7P A;  4MLV A;  3KEI A;  1GGG A;  3RT6 B;  1II5 A;  3ZSF A;  1B40 A;  4R6K A;  4YKK A;  4NED A;  3MP6 A;  2RC8 A;  3K6V A;  1GR2 A;  1SDX A;  2F5X A;  1B5I A;  1MPD A;  1IIW A;  3A3C A;  1FTJ A;  4HW8 A;  1I6A A;  3HST A;  5AA2 D;  3G3H A;  3DP8 A;  1D9V A;  4ZZE A;  4EQ9 A;  4ZEC A;  4QF9 A;  1LCT A;  3UGW A;  5H8Q A;  2AL5 A;  2FA7 A;  5HBC A;  1LBB A;  2B65 A;  3K6U A;  4XIG Q;  3PPR A;  2YJP A;  2KLF A;  1MQH A;  4OQO A;  3TAJ A;  5KDT A;  3TFL A;  3H06 B;  5H8N A;  4R9G A;  3HV1 A;  3T96 B;  4JSD A;  4Z0I A;  4QSD A;  3MBP A;  3TTR A;  1MXX A;  3C4M A;  4EUO A;  5H8Q B;  3DEL B;  3Q27 A;  2Z22 A;  5I59 A;  3S2V A;  1R6Z A;  3LC8 A;  1B3G A;  4NWC A;  5AA2 A;  3OOA A;  3PUZ E;  1N76 A;  3CR9 A;  3CFX A;  3MWB A;  4U22 A;  2RCB A;  1PB8 A;  2F34 A;  1FQE A;  4N6P A;  4HS7 A;  5KDT B;  3UP9 A;  5H8N B;  4RPN A;  3C31 A;  4GXS B;  4YIC A;  3C36 A;  2V3T A;  5I84 A;  4L17 A;  3K6X A;  4Q8R A;  4BDO A;  1JEU A;  2DP8 A;  4DCY A;  2HCA A;  3T22 A;  1NNK A;  4XTC Q;  3QXM A;  2P2A A;  1DSN A;  1MXU A;  3C33 A;  4OTE A;  3MVZ A;  1PB9 A;  4R6H A;  5I59 B;  4OZ9 A;  1RYX A;  1Y1Z A;  3ZKK A;  3N6U A;  3QSL A;  5AA2 B;  2R6G E;  4KHZ E;  1D4N A;  3KN7 A;  2V84 A;  1MXW A;  5EHM A;  3ODB A;  1B2H A;  1B5J A;  3B6Q A;  1FW0 A;  1LLS A;  3PD9 A;  4EDP A;  2Y7I A;  5CM6 A;  1LFI A;  2H9B A;  4GVO A;  5DTB A;  1MM7 A;  3KGC A;  4XKP A;  2A5T A;  2RF1 A;  2D21 A;  2Y7R A;  2X7Q A;  1A54 A;  1XVY A;  3I5O A;  3TCF A;  3U1O A;  3HN0 A;  4ELR A;  1A7L A;  4FEC A;  2QSX A;  3OO6 A;  2PX1 A;  2ALU A;  2OJT A;  4BLA A;  1IXH A;  4GL0 A;  4ONY A;  4X1D A;  1OQH A;  3OEL A;  1FQF A;  2GRV A;  5J1D A;  3L6H A;  1MPC A;  3PPQ A;  1XOC A;  1M5C A;  3PV0 E;  3U92 A;  1S9T A;  3FV1 A;  3VV5 A;  3TOD A;  4IO7 A;  1MM6 A;  5CMK A;  2PT1 A;  1MY1 A;  4GQO A;  3D4C A;  4K3F A;  1HSE A;  2A5T B;  1BP5 A;  4RK9 A;  4YKI A;  1ANF A;  3C32 A;  1LFH A;  3K1N A;  1MY2 A;  2OLB A;  1QVS A;  2F7B A;  1TXF A;  3PPN A;  4OER A;  4GOT A;  2I48 A;  4JWO A;  3O28 A;  4PFT A;  4OXV A;  3IB0 A;  1MPB A;  2XXQ A;  4OYV A;  3SEY A;  3EN3 A;  4ZEB A;  1OVB A;  4WXJ A;  5JK4 A;  4PFW A;  3PUX E;  1NNF A;  1QUI A;  1B51 A;  5I57 A;  1LAG E;  3O9P A;  2ONK E;  4LQ5 A;  4LP2 B;  2AIX A;  1A55 A;  1Q35 A;  4E0X A;  4XXU A;  4X9T A;  3O6I A;  3H3G A;  4RXL A;  1H43 A;  1B1X A;  3MJN A;  3IL1 B;  1A8F A;  2Y7W A;  5LOM A;  5B7D A;  5ICQ A;  1N3X A;  1VSO A;  4YAH X;  3FJG A;  4RNS A;  1QJM A;  3L6G A;  3UK4 A;  3SEU A;  1EZP A;  1B0L A;  2F36 A;  1SW1 A;  3QUJ A;  1FQC A;  5DEX A;  3CFL A;  4H5G A;  4OEU A;  1I69 A;  5H8H A;  2QS1 A;  3MQ9 A;  3LSL A;  3S4U A;  1B3F A;  2HQ0 A;  3S9L C;  3MVX A;  1QW0 A;  5I57 B;  2M8C A;  3D4G A;  2Y7K A;  4RPO A;  3TYH A;  4MBP A;  2ZNT A;  2ZYK A;  4QFO A;  2NVU B;  4YZZ A;  3RN8 A;  4R2F A;  4UAC A;  3PUW E;  4C1U A;  3OEN A;  3VLV A;  1F9B A;  3BFU A;  3SDF A;  3MUQ A;  3CG1 A;  1GVC A;  1AIV A;  2OCU A;  4YKP A;  2F97 A;  2XXV A;  5DVI A;  5I58 A;  3OEK A;  5DT6 A;  4BDM A;  5DEX B;  4P11 A;  3IO4 A;  5H8H B;  3VFJ A;  4NF6 A;  3EHS A;  3N6T A;  5I2N A;  1B58 A;  4TLM B;  5EYF A;  1J1N A;  3A09 A;  4U4S A;  4F2O A;  4R2B A;  3W15 C;  3GBB A;  2QMW A;  3G3G A;  3N26 A;  4H1X A;  1D3K A;  3CSG A;  3TQL A;  3KOS A;  3ONM A;  1UTH A;  5CBS A;  4ZS9 A;  5M2V A;  2F6G A;  1FTM A;  3KG2 A;  2NUV A;  1Q1K A;  3C9H A;  2P0S A;  4KFQ A;  2H4I A;  5I58 B;  1YCJ A;  1IQ7 A;  1D9Y A;  3IJX B;  2PMS A;  5K2X A;  5I2K A;  3TEL A;  4YMA A;  3THI A;  4NF6 B;  4EXL A;  2OWS A;  4P0G A;  2F8D A;  4C0R A;  2DVZ A;  3IO6 A;  1SYH A;  3TCG A;  4KR5 A;  5I2N B;  1QUJ A;  1B5H A;  2Q88 A;  3PPO A;  4JDF A;  3O66 A;  3SEW A;  1SYI A;  1LFG A;  4FE8 A;  4OET A;  3K02 A;  2V25 A;  4IGR A;  1LAX A;  1O64 A;  1Z7N E;  2DE2 A;  4F3G A;  4LZ5 A;  1UTH B;  3H6V A;  2W7Y A;  1MY3 A;  2O7U A;  5AA3 A;  1AOV A;  2I4C A;  3R7X A;  4YB6 A;  5FHN A;  3FVN A;  3E4R A;  3O29 A;  2ANJ A;  3IOV A;  5I2K B;  5FTI A;  4ESX A;  4I9D A;  2O84 X;  1I6Q A;  1NNP A;  4IO2 A;  1B3E A;  4F1Y A;  4RJZ A;  4I8C A;  4OEN A;  4QHQ A;  1VE4 A;  4H5F A;  1ZIU A;  4QFK A;  4TLL B;  4PFU A;  1ZMG A;  1S7Y A;  2XXX A;  1ELJ A;  5CI5 A;  4YKJ A;  3TDJ A;  3GXA A;  1N7X A;  1FQD A;  1B1H A;  1PDA A;  4NE4 A;  1SI0 A;  5KZT A;  1BIY A;  4F39 A;  3K0V A;  2H5Y A;  3PUY E;  4EXK A;  3P7I A;  3FAS A;  3E3K A;  1B3L A;  3TTM A;  2E1S A;  2ABH A;  1UIV A;  1FQA A;  2QJE A;  1L5T A;  1FTO A;  1YTV A;  4R75 A;  4I62 A;  3O97 A;  2X26 A;  4H0W A;  2DXY A;  4OEV A;  1P1Q A;  4PE5 B;  1IXI A;  4RYA A;  3KJ7 A;  1PC3 A;  4Z7E A;  4HCY A;  3UA8 A;  5AA4 A;  4PET A;  4LVQ A;  5HM4 B;  1MQI A;  3OMB A;  2O7I A;  5ITO A;  4ZE9 A;  3OD7 A;  2UXA A;  5EHS A;  4N07 A;  2UYF A;  1T0K A;  4IO6 A;  1HSL A;  2D3I A;  4G68 A;  3FVO A;  3TEP A;  3S9N C;  5CBR A;  4FED A;  5F7V A;  1MH4 A;  1GTK A;  1SD3 A;  4XKR A;  2F35 A;  1M5E A;  5JEI A;  4U1O A;  2X7P A;  1NL5 A;  5IKB A;  4G77 A;  4G4P A;  3OXN A;  2QL3 A;  2VGQ A;  3RGY A;  1JET A;  2RCA A;  1EU8 A;  5AA4 B;  4U21 A;  1BTJ A;  1Y4T A;  4EF1 A;  4X48 A;  3BKI B;  1A8E A;  2CMO A;  3SES A;  3SKP A;  5KCJ A;  1UQW A;  5K2Y A;  2ZYO A;  1URG A;  1XVX A;  4C1T A;  2REJ A;  2DWH A;  1AH5 A;  1URS A;  2D5W A;  3B7D A;  3LBS A;  4G68 B;  1P1O A;  2ZNU A;  1MDQ A;  1TT1 A;  1SW2 A;  5DYH A;  2THI A;  3VVE A;  4P0I A;  4KYD A;  3OSQ A;  2HAU A;  4U4X A;  4ELP A;  2E0S A;  4I1D A;  4F29 A;  3O2A A;  5CMC A;  1B46 A;  3R26 A;  4O3A A;  2QPQ A;  2QS3 A;  5ICT A;  1QUK A;  3H6W A;  3T66 A;  4GF8 A;  1N3W A;  4IY5 A;  2REG A;  4U23 A;  3VDF A;  4TQU Q;  5L9M A;  3TQW A;  2Z23 A;  1JW1 A;  2XXH A;  2Z8F A;  1QKB A;  3N5L A;  5KCJ B;  2OZZ A;  1N0T A;  1JQF A;  3PD8 A;  1URD A;  1US4 A;  3Q28 A;  2V3Q A;  4R73 A;  4POX A;  1DPP A;  2DYX A;  2HEU A;  1R1N A;  4FJP A;  3RPW A;  1MG1 A;  3HPI A;  3PGF A;  4FIM A;  1IXC A;  3UIF A;  2A5S A;  4ZED A;  3KJT A;  1RKM A;  3DLN A;  1US5 A;  3T9X B;  3V83 A;  1MDP 1;  5FHM A;  1XC1 A;  2YLN A;  3USD A;  1SW4 A;  2Q8J A;  3Q25 A;  2XXI A;  4H6D A;  1IEJ A;  1PBP A;  3MP1 A;  2V93 A;  1O7T A;  3SEX A;  5DVF A;  3HHF A;  2I4B A;  1NKX A;  3Q26 A;  1B32 A;  4MF3 A;  1M5F A;  4XKQ A;  3DP4 A;  2F6P A;  2XHD A;  1FTK A;  4WED A;  1MQG A;  4QRZ A;  2G93 A;  4F31 B;  1ZJL A;  3TUS A;  1Y3P A;  2VD3 A;  3CG3 A;  3CSB A;  3IK6 B;  3E13 X;  3QIM A;  1NMU A;  1TWY A;  2QS4 A;  4H67 A;  3SEV A;  1RYO A;  2H98 A;  3TZA A;  4NF8 A;  5BWJ A;  1OMP A;  1H3D A;  3U72 A;  3RTW B;  4BDN A;  4DXU A;  3IOR A;  3M3K A;  4OES A;  4EF2 A;  5TP9 A;  5BUU A;  3GZG A;  1XS5 A;  3KBR A;  3RT8 A;  2I0C A;  3CVG A;  4EQB A;  1LGB C;  2LAO A;  4OWD A;  1JW5 A;  3M3F A;  4IO3 A;  4F2Q A;  4YB7 A;  4G2Z A;  1XHY A;  4Q5T A;  5AA1 A;  2VOZ A;  3FGS A;  1P1U A;  3G3K A;  3ECR A;  4NF8 B;  3T93 B;  3V8X B;  2DWA A;  3IB1 A;  1FCK A;  1Y9U A;  2I6E A;  1MY4 A;  1PB7 A;  5F1Q A;  1SI1 A;  1LB9 A;  5TP9 B;  1OLA A;  5DVJ A;  1LAH E;  5L9O A;  4H8J A;  3EF7 A;  2IA4 A;  4PP0 A;  1DMB A;  1IXG A;  4F22 A;  1VFD A;  2QRY A;  3IOW A;  1MXV A;  1VFE A;  4RY1 A;  3SER A;  1TFA A;  3PMW A;  4QFP A;  4JSO A;  3TTL A;  3QAX A;  1MQD A;  3QK6 A;  4ELO A;  1YAE A;  2F7A A;  4JWX A;  1OIB A; 
#chains in the Genus database with same CATH topology
 3LV0 A;  3FUZ A;  5LDZ A;  1IMC A;  2XXW A;  2I3W A;  2XXY A;  3AXF A;  3VXB A;  1NFT A;  1NUW A;  1SW5 A;  2F78 A;  4N13 A;  4LZ8 A;  3IB2 A;  4FOR A;  2Q2A A;  5H8F A;  4QSC A;  3ILT B;  1EYK A;  4I40 A;  4IY6 A;  3IJO B;  3KSX A;  4LQ2 A;  1Z7M E;  2AYS A;  3K00 A;  2XX9 A;  3FXR A;  3TTK A;  3TTN A;  1DTZ A;  1S50 A;  4M4G A;  3UOR A;  4XKN A;  1IIT A;  3T9V A;  4WKM A;  4PDD A;  4THI A;  3K1M A;  3RNN A;  4P1L A;  1OVT A;  4ND9 A;  4ZEF A;  4U2R A;  3H7M A;  3ZKL A;  2XWI A;  4PQJ A;  3ZS6 A;  3R6U A;  3MAM A;  1B7U A;  1ZKB A;  2R9J A;  2VD2 A;  3PMX A;  2ESN A;  2HZL A;  5TU0 A;  2PT2 A;  2DWI A;  1JVX A;  1EZO A;  4EQ7 A;  1JVY A;  2B4L A;  4OHN A;  1WOD A;  5H8F B;  4ZEK A;  3U93 A;  5AE4 A;  1ZBM A;  1FJ6 A;  4FAJ A;  3RYD A;  3FAT A;  1Y20 A;  2ONR A;  3FXQ A;  1UIU A;  3EHU A;  3VVF A;  5HPQ A;  3QMF A;  2HAV A;  2CEX A;  5A5L A;  3H6U A;  3I6V A;  2ONS A;  3V89 B;  3QUF A;  5EYG A;  4JVC A;  2XX8 A;  4YMB A;  1AL3 A;  3EHT A;  3EPE A;  4MHF A;  1SBP A;  1WDN A;  2XX7 A;  2O6A A;  4MLQ A;  4X1B A;  4YB5 A;  4MX6 A;  3LUY A;  3T9H B;  3UN6 A;  3U94 A;  3WAE A;  1O63 A;  4RA1 A;  4XF5 A;  3KN8 A;  5TPA A;  3KC1 A;  2HHM A;  3IR1 A;  1YPN A;  1AMF A;  2QMX A;  3MZB A;  1FPI A;  4BDR A;  1EH3 A;  4ISU A;  4O7I A;  4AS4 A;  2Q9T A;  3FZV A;  3IOU A;  4F1V A;  3LSX A;  3O6H A;  4F3P A;  1FSA A;  1MQJ A;  4G8N A;  2XD3 A;  1I6B A;  3CRB A;  4PBH A;  4OFJ A;  2GFE A;  2UVH A;  1B7Z A;  3U8Q A;  3FJ7 A;  1Y3Q A;  4FEB A;  4BDQ A;  2KQZ A;  4JVD A;  3RTF B;  3IFC A;  3JV9 A;  4LZ7 A;  3FV2 A;  2I49 A;  3EQ1 A;  2GHA A;  2B3B A;  4OVQ A;  3RLF E;  1Y3N A;  1B4H A;  1NV1 A;  2XA5 A;  3MVY A;  3I3V A;  2F7C A;  4NWD A;  1NV4 A;  2DWJ A;  1M5B A;  3FD3 A;  3HHG A;  2VHA A;  3KN3 A;  2Q74 A;  5TPA B;  3LR1 A;  5A5X A;  1XT8 A;  3BFT A;  1KA0 A;  3FVK A;  3IX1 A;  1LAF E;  3VVD A;  2ZZX A;  1SPI A;  3VE1 B;  1FBC A;  1H45 A;  3G3I A;  2FBP A;  4DXC A;  4GXA A;  1TFD A;  4JXI A;  4NN3 A;  4IO5 A;  2O68 A;  2F3B A;  3JZJ A;  3ILU B;  3TMG A;  5ITP A;  4R72 A;  3F11 A;  3K01 A;  4GWO A;  2Z8E A;  5ET7 A;  1P1N A;  3PPP A;  4POW A;  4OVJ A;  1Y4C A;  5CMB A;  5CMM A;  2WYK A;  2XXR A;  3MPK A;  1HSJ A;  2H25 A;  2V3U A;  3KOT A;  2FNC A;  4TOZ A;  4IGT A;  1LBC A;  1NUX A;  1EZ9 A;  3JYR A;  4DLD A;  4GWU A;  1CE2 A;  1LEV A;  3M3L A;  1FQB A;  4OAN A;  2Q2C A;  3LSF B;  3G3F A;  3O6G A;  5FHO A;  2VP1 A;  2ZMB A;  1POY 1;  4DDD A;  1KWH A;  3IFA A;  3RQT A;  2PBW A;  5A5X B;  2XXP A;  3KSJ A;  3LSW A;  3VXC A;  3K1P A;  1R9Q A;  2O1M A;  3MW0 A;  1DCU A;  3V5A A;  1FPL A;  1DK4 A;  4KYE A;  5CRY A;  3W9W A;  2DXR A;  1ZTY A;  3MST A;  4KPT A;  1BKA A;  2RIN A;  4OFL A;  3D1R A;  4LA9 A;  1NH8 A;  3MYU A;  4KQP A;  2H99 A;  4U1Z A;  4KD5 A;  4GBV A;  4LUB A;  2XXT A;  2I0B A;  5DW8 A;  3SET A;  1BLF A;  2PFZ A;  1DOT A;  2O69 A;  1R9L A;  2GHB A;  4G8H A;  4JWY A;  3K4U A;  1B6H A;  1ZLQ A;  1H76 A;  4PAI A;  1FPG A;  1ATG A;  5I56 A;  2WBB A;  1NV7 A;  4NGU A;  4O7M A;  3T9U A;  4HCW A;  3CFZ A;  2UYE A;  3FXB A;  2YPN A;  5IAI A;  3S9M C;  4BDL A;  4NMY A;  1D9Q A;  3TPA A;  1MH3 A;  3C35 A;  2RC7 A;  3OEM A;  4YU0 A;  3OO8 A;  1B05 A;  5EQ8 A;  2RKM A;  4PFI A;  3N94 A;  5H8S A;  4PFY A;  1NI9 A;  2OWT A;  4N6D A;  4F3B A;  2ZZV A;  1JP4 A;  4DIG A;  1A40 A;  1LB8 A;  1LBY A;  3VLU A;  4MFI A;  4OFO A;  2CZL A;  4PAF A;  2OWZ A;  4KYS A;  2DSF A;  4FBP A;  4OMB A;  3C34 A;  2HZK A;  2O1L A;  1MRP A;  5I56 B;  5L8D A;  4NTL A;  4QFN A;  4DE8 A;  1RDY A;  3G3J A;  4JVI A;  4H65 A;  1USY H;  2PCR A;  3DP6 A;  2DVC A;  4PAK A;  2UVG A;  2DQV A;  1IUD A;  3KZG A;  4ECF A;  1JNF A;  1H44 A;  2CEY A;  3HFU A;  3QYT A;  2Z8D A;  1Y1M A;  2IEE A;  3Q29 A;  4KCC A;  1WVJ A;  2DS9 A;  2HXW A;  4ZZA A;  3B6W A;  4FAT A;  4DXB A;  4R6Y A;  1USY E;  4LON B;  2L5V A;  4KI0 E;  1UTB A;  3K6W A;  2Y84 A;  1LBV A;  4H8I A;  1LST A;  4Q30 B;  2JJK A;  1SQY A;  4G68 C;  2G29 A;  4HTG A;  1B4Z A;  4GWY A;  1NNT A;  2DE4 A;  3KFM A;  1MS7 A;  4N8Y A;  3K2D A;  4UA8 A;  1IME A;  4DCX A;  1NV2 A;  1P1W A;  1OQG A;  3BBR A;  4AB6 A;  2ZYN A;  3W9V A;  5CC2 A;  1B3H A;  1A99 A;  1IZ1 A;  1GV8 A;  3FVG A;  1PEB A;  2PYY A;  1LCF A;  1OLC A;  5B70 A;  2KR0 A;  1BK4 A;  3GLB A;  2BJJ X;  1JEV A;  1B52 A;  4IO4 A;  1VR5 A;  5J16 A;  3TCH A;  2QFL A;  3FXU A;  2QS2 A;  3TKD A;  4QFL A;  4GRK A;  4GFR A;  1MY0 A;  4DZ1 A;  4P56 A;  1N7W A;  3H6T A;  3CIJ A;  3ROJ A;  1UTB B;  4DI4 B;  3S9E A;  4IB2 A;  4AQ4 A;  4F18 A;  4AB5 A;  4F19 A;  1B9J A;  5JTY A;  2Q89 A;  1NH7 A;  3MPL A;  2CZH A;  3VLW A;  3RY3 A;  1FTL A;  1MXZ A;  2I3V A;  3DM0 A;  3IAZ A;  4NF5 A;  4O3B A;  5ISU A;  2P1S A;  3GBA A;  3MZ9 A;  3FIR A;  2B3F A;  1PBQ A;  1SVX B;  4JB7 A;  2DOJ A;  1B7H A;  4GWX A;  1JW4 A;  1N84 A;  5ELV A;  4ZEI A;  5EQ7 A;  4NF4 A;  1FBH A;  2DE3 A;  3HO7 A;  3PU5 A;  4E0W A;  3IOT A;  3CHG A;  5T3J A;  3FJM A;  2ZNS A;  2HFB A;  3WAF A;  4KCD A;  1QKA A;  4R74 A;  4O3C A;  1CB6 A;  2R71 A;  2FYI A;  3MC2 A;  4LAT A;  3MVW A;  2PFY A;  2XXU A;  1P99 A;  2ZXT A;  3OO7 A;  5L9S A;  1N04 A;  5FTH A;  3E9X A;  2UVI A;  3OO9 A;  4ZE8 A;  3H03 A;  4GL8 A;  3B6T A;  3PUV E;  5JTY B;  1DTG A;  4ZDM A;  1DPE A;  1M5D A;  3H4Z A;  4R9F A;  2UVJ A;  4NF5 B;  2GH9 A;  3CI8 A;  4M1V A;  1QUL A;  3A3U A;  1POT A;  2OBG A;  3RUM A;  2Q8M A;  4RK2 A;  1B0H A;  2RC9 A;  1ZU0 A;  1NUZ A;  4GLI A;  4ESW A;  4NF4 B;  2ZYM A;  4JBZ A;  4F1U A;  4GIZ A;  4WEP A;  5IZ3 A;  3OSR A;  2I58 A;  2AL4 A;  3MZ1 A;  4G8M A;  4P1E A;  5EYH A;  2XD2 A;  2WKY A;  4F3S A;  4O94 A;  4QSE A;  3G7W A;  1MXY A;  2PVU A;  4Q0C A;  2NXO A;  3PMV A;  2NWJ A;  2OK2 A;  3HCQ A;  4GD5 A;  3MP8 A;  2NOO A;  1K9Z A;  2O51 A;  3M8U A;  4MH5 A;  5I5P A;  4ELQ A;  2Y7P A;  4MLV A;  2HPG A;  3KEI A;  1GGG A;  3RT6 B;  3SZP A;  1II5 A;  3ZSF A;  1B40 A;  4R6K A;  4YKK A;  4NED A;  3MP6 A;  2RC8 A;  3K6V A;  4LN5 A;  4NAP A;  1GR2 A;  1SDX A;  2F5X A;  1B5I A;  1MPD A;  4OVR A;  1IIW A;  3A3C A;  1CNQ A;  1FTJ A;  4HW8 A;  1I6A A;  3HST A;  5AA2 D;  1Q9D A;  4N4U A;  5IZ3 B;  3G3H A;  3DP8 A;  1D9V A;  4ZZE A;  4EQ9 A;  4ZEC A;  4QF9 A;  2XXK A;  1LCT A;  3UGW A;  4HXV A;  5H8Q A;  2AL5 A;  2FA7 A;  5HBC A;  3T1B A;  2ZZW A;  1LBB A;  2B65 A;  3K6U A;  2FIE A;  4XIG Q;  3PPR A;  2YJP A;  2KLF A;  1MQH A;  4OQO A;  3TAJ A;  5KDT A;  3TFL A;  3H06 B;  5H8N A;  4MEV A;  4R9G A;  3HV1 A;  5EQ9 A;  3T96 B;  4JSD A;  2HXR A;  4Z0I A;  4QSD A;  3MBP A;  3TTR A;  4MIJ A;  5IZZ A;  1MXX A;  2WEF A;  3C4M A;  4EUO A;  5H8Q B;  3DEL B;  3Q27 A;  2Z22 A;  5I59 A;  3S2V A;  1R6Z A;  1IMB A;  3LC8 A;  1B3G A;  4OA4 A;  4NWC A;  5AA2 A;  2VPN A;  3OOA A;  3PUZ E;  1N76 A;  3CR9 A;  3CFX A;  1NV6 A;  3MWB A;  4U22 A;  2RCB A;  1LBW A;  3KBZ A;  1PB8 A;  2F34 A;  1FQE A;  4N6P A;  4HS7 A;  5KDT B;  3UP9 A;  5H8N B;  4UAB A;  4RPN A;  3C31 A;  1QGX A;  4GXS B;  4YIC A;  3C36 A;  2V3T A;  1FPF A;  5I84 A;  4L17 A;  3K6X A;  5FBP A;  4Q8R A;  2VPO A;  4BDO A;  1EYI A;  1JEU A;  2DP8 A;  1VDW A;  4DCY A;  2HCA A;  3T22 A;  1NNK A;  4XTC Q;  2WYP A;  3QXM A;  2P2A A;  1DSN A;  1MXU A;  3C33 A;  4OTE A;  3MVZ A;  1PB9 A;  4R6H A;  5I59 B;  4OZ9 A;  1RYX A;  1Y1Z A;  3ZKK A;  3N6U A;  3QSL A;  5AA2 B;  4GWW A;  1IMD A;  2R6G E;  4KHZ E;  1D4N A;  3KN7 A;  1RDX A;  2B4M A;  2V84 A;  1MXW A;  5EHM A;  3ODB A;  1B2H A;  1B5J A;  4HE0 A;  1FBP A;  3B6Q A;  1FW0 A;  1LLS A;  3PD9 A;  4EDP A;  2Y7I A;  5CM6 A;  1LFI A;  2H9B A;  4GVO A;  5DTB A;  1MM7 A;  3KGC A;  4XKP A;  2A5T A;  2RF1 A;  2D21 A;  2Y7R A;  2X7Q A;  2FVZ A;  4MNP A;  1A54 A;  1XVY A;  3I5O A;  3TCF A;  3U1O A;  4GBW A;  3HN0 A;  4ELR A;  1A7L A;  4FEC A;  2QSX A;  3OO6 A;  3B50 A;  2PX1 A;  2ALU A;  2OJT A;  4BLA A;  1IXH A;  4GL0 A;  4ONY A;  4X1D A;  1OQH A;  3OEL A;  1FQF A;  2GRV A;  5J1D A;  3L6H A;  1MPC A;  3PPQ A;  1XOC A;  1M5C A;  3PV0 E;  3U92 A;  1S9T A;  1FPJ A;  3FV1 A;  3VV5 A;  3TOD A;  4IO7 A;  1MM6 A;  5EQA A;  5CMK A;  2PT1 A;  1MY1 A;  4GQO A;  3D4C A;  4K3F A;  1HSE A;  5IM2 A;  2A5T B;  1BP5 A;  4RK9 A;  4YKI A;  1ANF A;  3C32 A;  1LFH A;  3K1N A;  1MY2 A;  2OLB A;  1QVS A;  2F7B A;  2WX9 A;  1TXF A;  3PPN A;  4OER A;  4GOT A;  2I48 A;  4JWO A;  3O28 A;  4PFT A;  4OXV A;  3IB0 A;  1FPD A;  1MPB A;  4GX4 A;  2XXQ A;  4OYV A;  3SEY A;  3EN3 A;  4ZEB A;  1OVB A;  4WXJ A;  3RPL A;  5JK4 A;  5I7I A;  4P3L A;  4PFW A;  3PUX E;  1NNF A;  4N8G A;  1QUI A;  1B51 A;  5I57 A;  1LAG E;  3O9P A;  2ONK E;  4LQ5 A;  4LP2 B;  4QBA A;  2AIX A;  1A55 A;  1Q35 A;  4E0X A;  4XXU A;  4X9T A;  3O6I A;  3H3G A;  4RXL A;  1H43 A;  1B1X A;  3MJN A;  3IL1 B;  1A8F A;  2Y7W A;  1FTA A;  5LOM A;  5B7D A;  4N17 A;  5ICQ A;  1N3X A;  1VSO A;  4YAH X;  3FJG A;  4RNS A;  1QJM A;  3L6G A;  4PFB A;  3UK4 A;  3SEU A;  1EZP A;  1B0L A;  4NHB A;  2F36 A;  1SW1 A;  3QUJ A;  1FQC A;  5DEX A;  3CFL A;  4H5G A;  4OEU A;  1I69 A;  5H8H A;  2QS1 A;  3MQ9 A;  2QVR A;  3LSL A;  3S4U A;  1B3F A;  3RPL B;  2HQ0 A;  3S9L C;  3MVX A;  1QW0 A;  5I57 B;  2M8C A;  3D4G A;  2Y7K A;  4RPO A;  3TYH A;  4MBP A;  4X04 A;  2ZNT A;  2ZYK A;  4QFO A;  2NVU B;  4N81 A;  4YZZ A;  3RN8 A;  4R2F A;  4UAC A;  3PUW E;  4C1U A;  3OEN A;  3VLV A;  1F9B A;  4DI3 D;  3BFU A;  3SDF A;  3MUQ A;  4NX1 A;  3CG1 A;  3KC0 A;  1GVC A;  1AIV A;  2OCU A;  4YKP A;  2F97 A;  2XXV A;  5DVI A;  5I58 A;  3OEK A;  5DT6 A;  4BDM A;  5DEX B;  4P11 A;  3IO4 A;  5H8H B;  3VFJ A;  4NF6 A;  3EHS A;  3N6T A;  5I2N A;  1B58 A;  4TLM B;  3E79 A;  2WBD A;  5EYF A;  1J1N A;  3A09 A;  1NV0 A;  2V4C A;  4U4S A;  4PGN A;  3T0J A;  4F2O A;  4R2B A;  3W15 C;  3GBB A;  4GWS A;  2QMW A;  2QVU A;  1NV5 A;  3G3G A;  3N26 A;  4NQ8 A;  4H1X A;  4IR8 A;  1D3K A;  3CSG A;  3TQL A;  3KOS A;  3ONM A;  1IMF A;  1UTH A;  1FPB A;  4ZS9 A;  5CBS A;  4MAG A;  5M2V A;  2F6G A;  1XI6 A;  1FTM A;  3KG2 A;  2NUV A;  1Q1K A;  1NV3 A;  3C9H A;  2P0S A;  4G61 A;  4KFQ A;  4O8M A;  1FBF A;  4NF0 A;  2H4I A;  5I58 B;  1YCJ A;  1IQ7 A;  1D9Y A;  3IJX B;  2PMS A;  5K2X A;  5I2K A;  3TEL A;  4YMA A;  3THI A;  4NF6 B;  4EXL A;  2OWS A;  4P0G A;  2F8D A;  4QXD A;  5I3S A;  4C0R A;  2DVZ A;  3IO6 A;  1INP A;  1SYH A;  3TCG A;  4KR5 A;  5I2N B;  1QUJ A;  1B5H A;  1FBD A;  2Q88 A;  3PPO A;  4JDF A;  1FPK A;  3O66 A;  3SEW A;  1SYI A;  1LFG A;  4FE8 A;  4MCO A;  3FBP A;  4OET A;  3K02 A;  2V25 A;  4IGR A;  4PBQ A;  1LAX A;  1O64 A;  1Z7N E;  2DE2 A;  4F3G A;  4LZ5 A;  1UTH B;  3H6V A;  2W7Y A;  4I3Y A;  1FRP A;  1MY3 A;  4PF6 A;  2O7U A;  5AA3 A;  3E78 A;  1AOV A;  4AS5 A;  2I4C A;  3R7X A;  4YB6 A;  5FHN A;  4PGP A;  5ESY A;  3FVN A;  3E4R A;  4GWZ A;  1IMA A;  3O29 A;  2ANJ A;  3IOV A;  5I2K B;  1FBG A;  4HE1 A;  3EKI A;  5FTI A;  4ESX A;  4I9D A;  4P9K A;  2O84 X;  1I6Q A;  1NNP A;  4IO2 A;  5ET5 A;  4HE2 A;  1B3E A;  4F1Y A;  3LUZ A;  4I8C A;  4RJZ A;  4OEN A;  3ISP A;  4QHQ A;  1VE4 A;  3GYY A;  3BIH A;  4H5F A;  1ZIU A;  4QFK A;  4TLL B;  4PFU A;  1ZMG A;  1EYJ A;  1S7Y A;  2XXX A;  1ELJ A;  5CI5 A;  4YKJ A;  5F24 A;  3TDJ A;  3GXA A;  1N7X A;  4PCD A;  1FQD A;  1B1H A;  1PDA A;  4NE4 A;  1SI0 A;  5KZT A;  1BIY A;  1DBZ A;  4F39 A;  2Y5K A;  1YYZ A;  3K0V A;  2H5Y A;  2P3V A;  3PUY E;  2R8T A;  4EXK A;  3P7I A;  3PTY A;  3FAS A;  3E3K A;  1B3L A;  3TTM A;  2E1S A;  2ABH A;  1UIV A;  1FQA A;  2QJE A;  1L5T A;  1FTO A;  1YTV A;  4R75 A;  4I62 A;  3O97 A;  2X26 A;  4X8R A;  4GX3 A;  4H0W A;  2DXY A;  4OEV A;  1P1Q A;  4PE5 B;  1IXI A;  1FJ9 A;  4RYA A;  4PFR A;  3KJ7 A;  1PC3 A;  4Z7E A;  4HCY A;  3UA8 A;  5AA4 A;  4PET A;  4LVQ A;  5HM4 B;  1MQI A;  3OMB A;  2O7I A;  5ITO A;  4ZE9 A;  3OD7 A;  2UXA A;  5EHS A;  4N07 A;  2UYF A;  1T0K A;  4IO6 A;  1HSL A;  2D3I A;  4G68 A;  3FVO A;  3TEP A;  3S9N C;  2P3N A;  5CBR A;  4FED A;  5F7V A;  1G0I A;  2VT5 A;  1MH4 A;  1GTK A;  1SD3 A;  4XKR A;  2F35 A;  1M5E A;  5JEI A;  1LBZ A;  4U1O A;  2X7P A;  1NL5 A;  5IKB A;  2Y5L A;  4G77 A;  4G4P A;  3OXN A;  2QL3 A;  2VGQ A;  3RGY A;  1KA1 A;  1JET A;  2RCA A;  1EU8 A;  5AA4 B;  1RDZ A;  4U21 A;  1BTJ A;  1Y4T A;  4EF1 A;  4X48 A;  3BKI B;  1A8E A;  2CMO A;  3SES A;  2XWK A;  3SKP A;  5KCJ A;  1UQW A;  5K2Y A;  2XWV A;  2ZYO A;  1URG A;  5LTC A;  2DDK A;  1XVX A;  4C1T A;  2REJ A;  2DWH A;  1AH5 A;  1URS A;  2D5W A;  3B7D A;  3LBS A;  4G68 B;  1P1O A;  2ZNU A;  1MDQ A;  1TT1 A;  1SW2 A;  5DYH A;  2THI A;  3VVE A;  4P0I A;  4KYD A;  5IGA A;  3OSQ A;  4XEQ A;  4MNI A;  2HAU A;  4U4X A;  4ELP A;  2E0S A;  4I1D A;  4F29 A;  4MNC A;  3O2A A;  5CMC A;  1B46 A;  2GQ1 A;  2F3D A;  4NG7 A;  3R26 A;  4O3A A;  2QPQ A;  2QS3 A;  5ICT A;  1QUK A;  3H6W A;  3B8B A;  3T66 A;  4GF8 A;  1N3W A;  4IY5 A;  2REG A;  4U23 A;  4TQU Q;  5L9M A;  3TQW A;  3VDF A;  2Z23 A;  1JW1 A;  3BIG A;  2XXH A;  4PC9 A;  2Z8F A;  1QKB A;  3N5L A;  5KCJ B;  4N15 A;  2OZZ A;  1N0T A;  1JQF A;  2MKZ A;  3PD8 A;  1URD A;  1US4 A;  2OX3 A;  3Q28 A;  2V3Q A;  4N91 A;  5ET6 A;  4R73 A;  4POX A;  1DPP A;  2DYX A;  2HEU A;  4PE3 A;  1R1N A;  4FJP A;  3RPW A;  4P47 A;  1MG1 A;  3HPI A;  3PGF A;  2BJI A;  4KXP A;  4FIM A;  1IXC A;  3UIF A;  2A5S A;  4ZED A;  3U65 A;  4MJO A;  3KJT A;  1RKM A;  3DLN A;  1US5 A;  3T9X B;  3V83 A;  1MDP 1;  5FHM A;  1XC1 A;  4OVS A;  2YLN A;  3USD A;  1SW4 A;  2Q8J A;  1AWB A;  4PF8 A;  3Q25 A;  2XXI A;  4H6D A;  1IEJ A;  1PBP A;  4XFE A;  2CZI A;  1YXI A;  3MP1 A;  2V93 A;  1O7T A;  1K9Y A;  3SEX A;  5DVF A;  3HHF A;  2I4B A;  1NKX A;  3Q26 A;  1B32 A;  4MF3 A;  1M5F A;  4XKQ A;  3DP4 A;  2F6P A;  4OVP A;  2XHD A;  1FTK A;  4WED A;  2CZK A;  2FHY A;  1MQG A;  5IZ1 A;  2FIX A;  4QRZ A;  3NOH A;  2G93 A;  4F31 B;  1ZJL A;  1FBE A;  3TUS A;  1Y3P A;  2VD3 A;  1NUY A;  3CG3 A;  1YZ0 A;  3CSB A;  3IK6 B;  3E13 X;  3QIM A;  1NMU A;  1TWY A;  2QS4 A;  4H67 A;  3SEV A;  1RYO A;  2H98 A;  3TZA A;  4NF8 A;  5BWJ A;  1OMP A;  1H3D A;  3U72 A;  4I3E A;  3RTW B;  4BDN A;  4DXU A;  3IOR A;  4N6K A;  3M3K A;  4OES A;  4EF2 A;  5TP9 A;  5BUU A;  3GZG A;  1XS5 A;  3KBR A;  3RT8 A;  1G0H A;  2I0C A;  3CVG A;  4EQB A;  1LGB C;  2LAO A;  4OWD A;  1JW5 A;  3M3F A;  4IO3 A;  5ET8 A;  4F2Q A;  4YB7 A;  4G2Z A;  1XHY A;  4Q5T A;  5AA1 A;  1FPE A;  2VOZ A;  4PDH A;  3FGS A;  2QVV A;  1P1U A;  3A29 A;  4OVT A;  3G3K A;  3ECR A;  4NF8 B;  4H45 A;  3T93 B;  3V8X B;  2DWA A;  3IB1 A;  1FCK A;  1Y9U A;  2I6E A;  1KZ8 A;  1MY4 A;  1PB7 A;  5F1Q A;  1SI1 A;  1LB9 A;  5TP9 B;  4H46 A;  4GX6 A;  1OLA A;  4PTK A;  5DVJ A;  1LAH E;  4MMP A;  5L9O A;  4H8J A;  3EF7 A;  2IA4 A;  4PP0 A;  1DMB A;  1IXG A;  4F22 A;  1VFD A;  2QRY A;  3IOW A;  1MXV A;  4P8B A;  1VFE A;  4RY1 A;  3SER A;  1TFA A;  3PMW A;  1LBX A;  4QFP A;  4JSO A;  3TTL A;  3QAX A;  1MQD A;  3QK6 A;  4ELO A;  1YAE A;  2F7A A;  4JWX A;  2XWO A;  1OIB A; 
#chains in the Genus database with same CATH homology
 3FUZ A;  2XXW A;  2I3W A;  2XXY A;  3AXF A;  3VXB A;  1NFT A;  1SW5 A;  2F78 A;  4N13 A;  4LZ8 A;  3IB2 A;  4FOR A;  2Q2A A;  5H8F A;  4QSC A;  3ILT B;  4IY6 A;  3IJO B;  3KSX A;  4LQ2 A;  1Z7M E;  2AYS A;  3K00 A;  2XX9 A;  3FXR A;  3TTK A;  3TTN A;  1DTZ A;  1S50 A;  4M4G A;  3UOR A;  4XKN A;  1IIT A;  3T9V A;  4WKM A;  4THI A;  3K1M A;  3RNN A;  1OVT A;  4ND9 A;  4ZEF A;  4U2R A;  3H7M A;  3ZKL A;  4PQJ A;  3ZS6 A;  3R6U A;  3MAM A;  1B7U A;  1ZKB A;  2R9J A;  2VD2 A;  3PMX A;  2ESN A;  2HZL A;  5TU0 A;  2PT2 A;  2DWI A;  1JVX A;  1EZO A;  4EQ7 A;  1JVY A;  4OHN A;  1WOD A;  5H8F B;  4ZEK A;  3U93 A;  5AE4 A;  1ZBM A;  4FAJ A;  3FAT A;  1Y20 A;  2ONR A;  3FXQ A;  1UIU A;  3EHU A;  3VVF A;  5HPQ A;  2HAV A;  3H6U A;  3I6V A;  2ONS A;  3V89 B;  3QUF A;  2XX8 A;  4YMB A;  1AL3 A;  3EHT A;  3EPE A;  1SBP A;  1WDN A;  2XX7 A;  2O6A A;  4MLQ A;  4X1B A;  4YB5 A;  3LUY A;  3T9H B;  3UN6 A;  3U94 A;  3WAE A;  1O63 A;  4RA1 A;  3KN8 A;  5TPA A;  3IR1 A;  1YPN A;  1AMF A;  2QMX A;  3MZB A;  4BDR A;  1EH3 A;  4ISU A;  2Q9T A;  3FZV A;  3IOU A;  4F1V A;  3LSX A;  3O6H A;  4F3P A;  1MQJ A;  4G8N A;  2XD3 A;  1I6B A;  3CRB A;  4OFJ A;  2GFE A;  2UVH A;  1B7Z A;  3U8Q A;  3FJ7 A;  1Y3Q A;  4FEB A;  4BDQ A;  3RTF B;  3JV9 A;  4LZ7 A;  3FV2 A;  2I49 A;  3EQ1 A;  2GHA A;  2B3B A;  3RLF E;  1Y3N A;  1B4H A;  3MVY A;  3I3V A;  2F7C A;  4NWD A;  2DWJ A;  1M5B A;  3FD3 A;  3HHG A;  2VHA A;  3KN3 A;  5TPA B;  3LR1 A;  5A5X A;  1XT8 A;  3BFT A;  3FVK A;  3IX1 A;  1LAF E;  3VVD A;  3VE1 B;  1H45 A;  3G3I A;  4DXC A;  4GXA A;  1TFD A;  4JXI A;  4IO5 A;  2O68 A;  3JZJ A;  3ILU B;  3TMG A;  5ITP A;  4R72 A;  3F11 A;  3K01 A;  4GWO A;  2Z8E A;  1P1N A;  3PPP A;  4POW A;  4OVJ A;  1Y4C A;  5CMB A;  5CMM A;  2XXR A;  3MPK A;  1HSJ A;  2H25 A;  2V3U A;  3KOT A;  2FNC A;  4TOZ A;  4IGT A;  1LBC A;  1EZ9 A;  3JYR A;  4DLD A;  1CE2 A;  3M3L A;  1FQB A;  2Q2C A;  3LSF B;  3G3F A;  3O6G A;  5FHO A;  2VP1 A;  2ZMB A;  1POY 1;  4DDD A;  1KWH A;  3RQT A;  2PBW A;  5A5X B;  2XXP A;  3KSJ A;  3LSW A;  3VXC A;  3K1P A;  1R9Q A;  2O1M A;  3MW0 A;  3V5A A;  4KYE A;  5CRY A;  3W9W A;  2DXR A;  1ZTY A;  4KPT A;  1BKA A;  2RIN A;  4OFL A;  4LA9 A;  1NH8 A;  4KQP A;  2H99 A;  4U1Z A;  4KD5 A;  4LUB A;  2XXT A;  2I0B A;  3SET A;  1BLF A;  1DOT A;  2O69 A;  1R9L A;  2GHB A;  4G8H A;  4JWY A;  3K4U A;  1B6H A;  1ZLQ A;  1H76 A;  1ATG A;  5I56 A;  3T9U A;  4HCW A;  3CFZ A;  2UYE A;  2YPN A;  5IAI A;  3S9M C;  4BDL A;  4NMY A;  3TPA A;  1MH3 A;  3C35 A;  2RC7 A;  3OEM A;  4YU0 A;  3OO8 A;  1B05 A;  2RKM A;  3N94 A;  5H8S A;  4PFY A;  2OWT A;  4F3B A;  4DIG A;  1A40 A;  1LB8 A;  3VLU A;  4MFI A;  4OFO A;  2CZL A;  4KYS A;  2DSF A;  4OMB A;  3C34 A;  2HZK A;  2O1L A;  1MRP A;  5I56 B;  5L8D A;  4NTL A;  4QFN A;  4DE8 A;  3G3J A;  4H65 A;  1USY H;  3DP6 A;  2DVC A;  2UVG A;  2DQV A;  1IUD A;  3KZG A;  4ECF A;  1JNF A;  1H44 A;  3QYT A;  2Z8D A;  1Y1M A;  2IEE A;  3Q29 A;  4KCC A;  1WVJ A;  2DS9 A;  2HXW A;  4ZZA A;  3B6W A;  4FAT A;  4DXB A;  4R6Y A;  1USY E;  4LON B;  4KI0 E;  1UTB A;  3K6W A;  2Y84 A;  4H8I A;  1LST A;  4Q30 B;  1SQY A;  4G68 C;  2G29 A;  4HTG A;  1B4Z A;  1NNT A;  2DE4 A;  3KFM A;  1MS7 A;  3K2D A;  4UA8 A;  4DCX A;  1P1W A;  1OQG A;  3BBR A;  4AB6 A;  2ZYN A;  3W9V A;  5CC2 A;  1B3H A;  1A99 A;  1IZ1 A;  1GV8 A;  3FVG A;  1PEB A;  2PYY A;  1LCF A;  1OLC A;  5B70 A;  3GLB A;  2BJJ X;  1JEV A;  1B52 A;  4IO4 A;  1VR5 A;  3TCH A;  3FXU A;  2QS2 A;  3TKD A;  4QFL A;  4GRK A;  4GFR A;  1MY0 A;  4DZ1 A;  1N7W A;  3H6T A;  3CIJ A;  1UTB B;  3S9E A;  4IB2 A;  4AQ4 A;  4F18 A;  4AB5 A;  4F19 A;  1B9J A;  5JTY A;  2Q89 A;  1NH7 A;  3MPL A;  3VLW A;  3RY3 A;  1FTL A;  1MXZ A;  2I3V A;  3DM0 A;  3IAZ A;  4NF5 A;  4O3B A;  5ISU A;  2P1S A;  3GBA A;  3MZ9 A;  3FIR A;  2B3F A;  1PBQ A;  1SVX B;  4JB7 A;  2DOJ A;  1B7H A;  1JW4 A;  1N84 A;  5ELV A;  4ZEI A;  4NF4 A;  2DE3 A;  3HO7 A;  3PU5 A;  4E0W A;  3IOT A;  3FJM A;  2ZNS A;  2HFB A;  3WAF A;  4KCD A;  1QKA A;  4R74 A;  4O3C A;  1CB6 A;  2R71 A;  2FYI A;  3MC2 A;  4LAT A;  3MVW A;  2XXU A;  1P99 A;  2ZXT A;  3OO7 A;  5L9S A;  1N04 A;  5FTH A;  3E9X A;  2UVI A;  3OO9 A;  4ZE8 A;  3H03 A;  4GL8 A;  3B6T A;  3PUV E;  5JTY B;  1DTG A;  4ZDM A;  1DPE A;  1M5D A;  3H4Z A;  4R9F A;  2UVJ A;  4NF5 B;  2GH9 A;  3CI8 A;  4M1V A;  1QUL A;  3A3U A;  1POT A;  2OBG A;  3RUM A;  4RK2 A;  1B0H A;  2RC9 A;  1ZU0 A;  4GLI A;  4ESW A;  4NF4 B;  2ZYM A;  4JBZ A;  4F1U A;  4GIZ A;  4WEP A;  3OSR A;  2I58 A;  2AL4 A;  3MZ1 A;  4G8M A;  2XD2 A;  2WKY A;  4F3S A;  4QSE A;  3G7W A;  1MXY A;  2PVU A;  4Q0C A;  2NXO A;  3PMV A;  2NWJ A;  2OK2 A;  3HCQ A;  4GD5 A;  3MP8 A;  2NOO A;  2O51 A;  3M8U A;  4MH5 A;  4ELQ A;  2Y7P A;  4MLV A;  3KEI A;  1GGG A;  3RT6 B;  1II5 A;  3ZSF A;  1B40 A;  4R6K A;  4YKK A;  4NED A;  3MP6 A;  2RC8 A;  3K6V A;  1GR2 A;  1SDX A;  2F5X A;  1B5I A;  1MPD A;  1IIW A;  3A3C A;  1FTJ A;  4HW8 A;  1I6A A;  3HST A;  5AA2 D;  3G3H A;  3DP8 A;  1D9V A;  4ZZE A;  4EQ9 A;  4ZEC A;  4QF9 A;  1LCT A;  3UGW A;  5H8Q A;  2AL5 A;  2FA7 A;  5HBC A;  1LBB A;  2B65 A;  3K6U A;  4XIG Q;  3PPR A;  2YJP A;  2KLF A;  1MQH A;  4OQO A;  3TAJ A;  5KDT A;  3TFL A;  3H06 B;  5H8N A;  4R9G A;  3HV1 A;  3T96 B;  4JSD A;  4Z0I A;  4QSD A;  3MBP A;  3TTR A;  1MXX A;  3C4M A;  4EUO A;  5H8Q B;  3DEL B;  3Q27 A;  2Z22 A;  5I59 A;  3S2V A;  1R6Z A;  3LC8 A;  1B3G A;  4NWC A;  5AA2 A;  3OOA A;  3PUZ E;  1N76 A;  3CR9 A;  3CFX A;  3MWB A;  4U22 A;  2RCB A;  1PB8 A;  2F34 A;  1FQE A;  4N6P A;  4HS7 A;  5KDT B;  3UP9 A;  5H8N B;  4RPN A;  3C31 A;  4GXS B;  4YIC A;  3C36 A;  2V3T A;  5I84 A;  4L17 A;  3K6X A;  4Q8R A;  4BDO A;  1JEU A;  2DP8 A;  4DCY A;  2HCA A;  3T22 A;  1NNK A;  4XTC Q;  3QXM A;  2P2A A;  1DSN A;  1MXU A;  3C33 A;  4OTE A;  3MVZ A;  1PB9 A;  4R6H A;  5I59 B;  4OZ9 A;  1RYX A;  1Y1Z A;  3ZKK A;  3N6U A;  3QSL A;  5AA2 B;  2R6G E;  4KHZ E;  1D4N A;  3KN7 A;  2V84 A;  1MXW A;  5EHM A;  3ODB A;  1B2H A;  1B5J A;  3B6Q A;  1FW0 A;  1LLS A;  3PD9 A;  4EDP A;  2Y7I A;  5CM6 A;  1LFI A;  2H9B A;  4GVO A;  5DTB A;  1MM7 A;  3KGC A;  4XKP A;  2A5T A;  2RF1 A;  2D21 A;  2Y7R A;  2X7Q A;  1A54 A;  1XVY A;  3I5O A;  3TCF A;  3U1O A;  3HN0 A;  4ELR A;  1A7L A;  4FEC A;  2QSX A;  3OO6 A;  2PX1 A;  2ALU A;  2OJT A;  4BLA A;  1IXH A;  4GL0 A;  4ONY A;  4X1D A;  1OQH A;  3OEL A;  1FQF A;  2GRV A;  5J1D A;  3L6H A;  1MPC A;  3PPQ A;  1XOC A;  1M5C A;  3PV0 E;  3U92 A;  1S9T A;  3FV1 A;  3VV5 A;  3TOD A;  4IO7 A;  1MM6 A;  5CMK A;  2PT1 A;  1MY1 A;  4GQO A;  3D4C A;  4K3F A;  1HSE A;  2A5T B;  1BP5 A;  4RK9 A;  4YKI A;  1ANF A;  3C32 A;  1LFH A;  3K1N A;  1MY2 A;  2OLB A;  1QVS A;  2F7B A;  1TXF A;  3PPN A;  4OER A;  4GOT A;  2I48 A;  4JWO A;  3O28 A;  4PFT A;  4OXV A;  3IB0 A;  1MPB A;  2XXQ A;  4OYV A;  3SEY A;  3EN3 A;  4ZEB A;  1OVB A;  4WXJ A;  5JK4 A;  4PFW A;  3PUX E;  1NNF A;  1QUI A;  1B51 A;  5I57 A;  1LAG E;  3O9P A;  2ONK E;  4LQ5 A;  4LP2 B;  2AIX A;  1A55 A;  1Q35 A;  4E0X A;  4XXU A;  4X9T A;  3O6I A;  3H3G A;  4RXL A;  1H43 A;  1B1X A;  3MJN A;  3IL1 B;  1A8F A;  2Y7W A;  5LOM A;  5B7D A;  5ICQ A;  1N3X A;  1VSO A;  4YAH X;  3FJG A;  4RNS A;  1QJM A;  3L6G A;  3UK4 A;  3SEU A;  1EZP A;  1B0L A;  2F36 A;  1SW1 A;  3QUJ A;  1FQC A;  5DEX A;  3CFL A;  4H5G A;  4OEU A;  1I69 A;  5H8H A;  2QS1 A;  3MQ9 A;  3LSL A;  3S4U A;  1B3F A;  2HQ0 A;  3S9L C;  3MVX A;  1QW0 A;  5I57 B;  2M8C A;  3D4G A;  2Y7K A;  4RPO A;  3TYH A;  4MBP A;  2ZNT A;  2ZYK A;  4QFO A;  2NVU B;  4YZZ A;  3RN8 A;  4R2F A;  4UAC A;  3PUW E;  4C1U A;  3OEN A;  3VLV A;  1F9B A;  3BFU A;  3SDF A;  3MUQ A;  3CG1 A;  1GVC A;  1AIV A;  2OCU A;  4YKP A;  2F97 A;  2XXV A;  5DVI A;  5I58 A;  3OEK A;  5DT6 A;  4BDM A;  5DEX B;  4P11 A;  3IO4 A;  5H8H B;  3VFJ A;  4NF6 A;  3EHS A;  3N6T A;  5I2N A;  1B58 A;  4TLM B;  5EYF A;  1J1N A;  3A09 A;  4U4S A;  4F2O A;  4R2B A;  3W15 C;  3GBB A;  2QMW A;  3G3G A;  3N26 A;  4H1X A;  1D3K A;  3CSG A;  3TQL A;  3KOS A;  3ONM A;  1UTH A;  5CBS A;  4ZS9 A;  5M2V A;  2F6G A;  1FTM A;  3KG2 A;  2NUV A;  1Q1K A;  3C9H A;  2P0S A;  4KFQ A;  2H4I A;  5I58 B;  1YCJ A;  1IQ7 A;  1D9Y A;  3IJX B;  2PMS A;  5K2X A;  5I2K A;  3TEL A;  4YMA A;  3THI A;  4NF6 B;  4EXL A;  2OWS A;  4P0G A;  2F8D A;  4C0R A;  2DVZ A;  3IO6 A;  1SYH A;  3TCG A;  4KR5 A;  5I2N B;  1QUJ A;  1B5H A;  2Q88 A;  3PPO A;  4JDF A;  3O66 A;  3SEW A;  1SYI A;  1LFG A;  4FE8 A;  4OET A;  3K02 A;  2V25 A;  4IGR A;  1LAX A;  1O64 A;  1Z7N E;  2DE2 A;  4F3G A;  4LZ5 A;  1UTH B;  3H6V A;  2W7Y A;  1MY3 A;  2O7U A;  5AA3 A;  1AOV A;  2I4C A;  3R7X A;  4YB6 A;  5FHN A;  3FVN A;  3E4R A;  3O29 A;  2ANJ A;  3IOV A;  5I2K B;  5FTI A;  4ESX A;  4I9D A;  2O84 X;  1I6Q A;  1NNP A;  4IO2 A;  1B3E A;  4F1Y A;  4RJZ A;  4I8C A;  4OEN A;  4QHQ A;  1VE4 A;  4H5F A;  1ZIU A;  4QFK A;  4TLL B;  4PFU A;  1ZMG A;  1S7Y A;  2XXX A;  1ELJ A;  5CI5 A;  4YKJ A;  3TDJ A;  3GXA A;  1N7X A;  1FQD A;  1B1H A;  1PDA A;  4NE4 A;  1SI0 A;  5KZT A;  1BIY A;  4F39 A;  3K0V A;  2H5Y A;  3PUY E;  4EXK A;  3P7I A;  3FAS A;  3E3K A;  1B3L A;  3TTM A;  2E1S A;  2ABH A;  1UIV A;  1FQA A;  2QJE A;  1L5T A;  1FTO A;  1YTV A;  4R75 A;  4I62 A;  3O97 A;  2X26 A;  4H0W A;  2DXY A;  4OEV A;  1P1Q A;  4PE5 B;  1IXI A;  4RYA A;  3KJ7 A;  1PC3 A;  4Z7E A;  4HCY A;  3UA8 A;  5AA4 A;  4PET A;  4LVQ A;  5HM4 B;  1MQI A;  3OMB A;  2O7I A;  5ITO A;  4ZE9 A;  3OD7 A;  2UXA A;  5EHS A;  4N07 A;  2UYF A;  1T0K A;  4IO6 A;  1HSL A;  2D3I A;  4G68 A;  3FVO A;  3TEP A;  3S9N C;  5CBR A;  4FED A;  5F7V A;  1MH4 A;  1GTK A;  1SD3 A;  4XKR A;  2F35 A;  1M5E A;  5JEI A;  4U1O A;  2X7P A;  1NL5 A;  5IKB A;  4G77 A;  4G4P A;  3OXN A;  2QL3 A;  2VGQ A;  3RGY A;  1JET A;  2RCA A;  1EU8 A;  5AA4 B;  4U21 A;  1BTJ A;  1Y4T A;  4EF1 A;  4X48 A;  3BKI B;  1A8E A;  2CMO A;  3SES A;  3SKP A;  5KCJ A;  1UQW A;  5K2Y A;  2ZYO A;  1URG A;  1XVX A;  4C1T A;  2REJ A;  2DWH A;  1AH5 A;  1URS A;  2D5W A;  3B7D A;  3LBS A;  4G68 B;  1P1O A;  2ZNU A;  1MDQ A;  1TT1 A;  1SW2 A;  5DYH A;  2THI A;  3VVE A;  4P0I A;  4KYD A;  3OSQ A;  2HAU A;  4U4X A;  4ELP A;  2E0S A;  4I1D A;  4F29 A;  3O2A A;  5CMC A;  1B46 A;  3R26 A;  4O3A A;  2QPQ A;  2QS3 A;  5ICT A;  1QUK A;  3H6W A;  3T66 A;  4GF8 A;  1N3W A;  4IY5 A;  2REG A;  4U23 A;  3VDF A;  4TQU Q;  5L9M A;  3TQW A;  2Z23 A;  1JW1 A;  2XXH A;  2Z8F A;  1QKB A;  3N5L A;  5KCJ B;  2OZZ A;  1N0T A;  1JQF A;  3PD8 A;  1URD A;  1US4 A;  3Q28 A;  2V3Q A;  4R73 A;  4POX A;  1DPP A;  2DYX A;  2HEU A;  1R1N A;  4FJP A;  3RPW A;  1MG1 A;  3HPI A;  3PGF A;  4FIM A;  1IXC A;  3UIF A;  2A5S A;  4ZED A;  3KJT A;  1RKM A;  3DLN A;  1US5 A;  3T9X B;  3V83 A;  1MDP 1;  5FHM A;  1XC1 A;  2YLN A;  3USD A;  1SW4 A;  2Q8J A;  3Q25 A;  2XXI A;  4H6D A;  1IEJ A;  1PBP A;  3MP1 A;  2V93 A;  1O7T A;  3SEX A;  5DVF A;  3HHF A;  2I4B A;  1NKX A;  3Q26 A;  1B32 A;  4MF3 A;  1M5F A;  4XKQ A;  3DP4 A;  2F6P A;  2XHD A;  1FTK A;  4WED A;  1MQG A;  4QRZ A;  2G93 A;  4F31 B;  1ZJL A;  3TUS A;  1Y3P A;  2VD3 A;  3CG3 A;  3CSB A;  3IK6 B;  3E13 X;  3QIM A;  1NMU A;  1TWY A;  2QS4 A;  4H67 A;  3SEV A;  1RYO A;  2H98 A;  3TZA A;  4NF8 A;  5BWJ A;  1OMP A;  1H3D A;  3U72 A;  3RTW B;  4BDN A;  4DXU A;  3IOR A;  3M3K A;  4OES A;  4EF2 A;  5TP9 A;  5BUU A;  3GZG A;  1XS5 A;  3KBR A;  3RT8 A;  2I0C A;  3CVG A;  4EQB A;  1LGB C;  2LAO A;  4OWD A;  1JW5 A;  3M3F A;  4IO3 A;  4F2Q A;  4YB7 A;  4G2Z A;  1XHY A;  4Q5T A;  5AA1 A;  2VOZ A;  3FGS A;  1P1U A;  3G3K A;  3ECR A;  4NF8 B;  3T93 B;  3V8X B;  2DWA A;  3IB1 A;  1FCK A;  1Y9U A;  2I6E A;  1MY4 A;  1PB7 A;  5F1Q A;  1SI1 A;  1LB9 A;  5TP9 B;  1OLA A;  5DVJ A;  1LAH E;  5L9O A;  4H8J A;  3EF7 A;  2IA4 A;  4PP0 A;  1DMB A;  1IXG A;  4F22 A;  1VFD A;  2QRY A;  3IOW A;  1MXV A;  1VFE A;  4RY1 A;  3SER A;  1TFA A;  3PMW A;  4QFP A;  4JSO A;  3TTL A;  3QAX A;  1MQD A;  3QK6 A;  4ELO A;  1YAE A;  2F7A A;  4JWX A;  1OIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...