3CR9A

Crystal structure of the complex of lactoferrin with 6-(hydroxymethyl)oxane-2,3,4,5-tetrol at 3.49 a resolution
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the complex of Lactoferrin with 6-(Hydroxymethyl)oxane-2,3,4,5-tetrol at 3.49 A resolution
rcsb
molecule tags Antibiotic
molecule keywords Lactotransferrin
total genus 204
structure length 689
sequence length 689
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cr9A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cr9A04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cr9A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cr9A03
4LZ8A 1LGBC 2F7AA 2OCUA 4NF8A 4PQJA 4F18A 2YPNA 4F29A 1Y4TA 1ZMGA 1MDQA 4KD5A 1YAEA 2F6GA 2XXVA 3FVKA 5TPAB 1AOVA 1UTHB 3CFLA 1ZTYA 1B6HA 3C36A 1KWHA 1MXVA 2H4IA 3K4UA 2UVIA 3O9PA 2I6EA 2Q2CA 2Q89A 2RC7A 4GD5A 2OWTA 1LBCA 2VP1A 2W7YA 5EHSA 4EQBA 1SW5A 5I2NA 5JTYB 4MLQA 3TDJA 3M3LA 4F31B 4NTLA 3TKDA 4X48A 3PD8A 4P0IA 1UQWA 1FTLA 3QUJA 3G3IA 3G3JA 3IOVA 1MQIA 2B65A 3V5AA 3OOAA 4DXBA 2QL3A 2V25A 1TFDA 1B3LA 1OQHA 2M8CA 3T66A 5AA3A 3HHFA 3U1OA 3IO6A 4OHNA 2DE3A 2RC8A 3MVYA 4EDPA 1OLAA 4XKNA 3MP8A 2Z23A 2V3QA 2FNCA 1D9YA 1MXUA 4ONYA 1USYE 1MPBA 1A7LA 4GL0A 3RT6B 1DPPA 4H5FA 3RPWA 3LC8A 1XC1A 3T9UA 4YB7A 5KDTA 2ALUA 3OSQA 3DP6A 2RCAA 2O1MA 3OEKA 4KFQA 3SEXA 2NVUB 2XHDA 3PUXE 4ELRA 4Z7EA 1D9VA 2ESNA 2DQVA 5B7DA 3BBRA 4F3SA 4JWOA 5CMMA 5H8NA 2XX7A 1P1WA 1N3WA 3KEIA 4H8IA 2YLNA 2XX9A 4O3AA 4EQ9A 4Q8RA 4XKRA 3PPRA 4ESXA 3TCHA 5I58A 3EHTA 4OFJA 4C1TA 4PFYA 4EUOA 5ICTA 4U4SA 1ZLQA 3H3GA 2XX8A 4IY6A 3TMGA 3TUSA 3ILTB 3KBRA 4RJZA 4YKPA 1YTVA 5I84A 2F35A 5KCJA 4PFWA 3TCFA 4ZE9A 3LUYA 3N5LA 4FE8A 3S9LC 4G8HA 3WAFA 3IJOB 3IX1A 3DP4A 1L5TA 3VVDA 3MWBA 1PB7A 4ZZEA 4PFTA 4FEDA 1N7WA 4JXIA 3C34A 5CC2A 3VVEA 1TFAA 4ELOA 1RKMA 3IJXB 4GXAA 1XT8A 4OENA 3LSWA 1A54A 1IITA 1F9BA 3VDFA 1NMUA 3T22A 1DTGA 1LFIA 3T9HB 4OESA 1B40A 3Q26A 4GFRA 5TP9A 5FTHA 1PC3A 1IQ7A 2P2AA 3G3HA 3SKPA 3G3FA 1QUIA 2QSXA 3T93B 4ZEDA 4GIZA 1B58A 1MPDA 1I6AA 1XHYA 2I0CA 4R6YA 3RGYA 3U93A 5I56B 2UVGA 2Q2AA 1VSOA 3QAXA 2DSFA 4I9DA 4GVOA 3RTFB 4GLIA 3OSRA 3IORA 4NE4A 3D4GA 1MQHA 1LAGE 2O69A 4LVQA 2I4BA 5DVFA 2F34A 5F7VA 4EF1A 1OLCA 4BDLA 5DEXB 3OD7A 4EF2A 2XXPA 4PFUA 5AA2B 4BDOA 3KJTA 3SERA 4E0WA 5CMCA 5LOMA 1UIUA 5KZTA 4KI0E 2O84X 1R1NA 3EPEA 5FHMA 1R9QA 2I4CA 1BLFA 2QPQA 3KN3A 4NEDA 4RA1A 1I6BA 3MPKA 3VLVA 3ZKLA 1GV8A 3HHGA 4GL8A 2QS2A 4TLMB 2DYXA 4XXUA 3R26A 2IA4A 1LSTA 3O6IA 2ZNSA 1NFTA 4H67A 4KQPA 1QUKA 2HQ0A 4JSDA 1FQDA 1MY4A 1IXCA 1HSLA 1SI1A 4NF6A 3TFLA 3TQLA 2ANJA 4IGTA 1B9JA 1RYOA 5A5XA 1T0KA 5J1DA 1PBPA 2OLBA 3HPIA 2QS3A 3QIMA 4ZEBA 2F36A 1DSNA 3TTRA 3MPLA 1O63A 2Q9TA 5F1QA 4ELPA 5CMBA 3FJMA 4OERA 5ITOA 1PB8A 4C0RA 4F1YA 1NNTA 3OO6A 3FIRA 4I8CA 3H03A 4MLVA 3W15C 3Q29A 2QS1A 3KFMA 5H8QB 1JW4A 4FECA 1PBQA 3KSXA 4M4GA 1MM7A 1B1HA 1JETA 2X7QA 4Q5TA 3JYRA 5TU0A 2OK2A 3GZGA 4AB5A 1UTHA 4HCYA 1LFHA 2A5TA 4DE8A 1H43A 1ZIUA 1JVXA 3FATA 4NWDA 4R2BA 2HFBA 2Y7IA 3RY3A 4NWCA 4NF4A 3SETA 4MF3A 4NF8B 3UN6A 2Y7KA 3H6VA 3BFTA 2UXAA 1N0TA 4JSOA 3TTNA 4G68A 3IB0A 4H65A 4KPTA 4Q0CA 3RQTA 1GR2A 3TCGA 1MG1A 4PETA 1DPEA 1B46A 5I59A 1FQFA 2GFEA 3CSGA 1GTKA 2F6PA 4N07A 3RT8A 3H6UA 3PMWA 1MY0A 1LLSA 1NL5A 4POWA 1R6ZA 3MQ9A 3PMVA 3T9VA 1WODA 1P1UA 1Q35A 1FQCA 1US5A 3KOTA 1IXIA 4G4PA 4FJPA 4IGRA 1MQGA 4R6HA 3E4RA 4M1VA 3CR9A 4DIGA 4ESWA 2DWJA 2IEEA 3EHUA 1GVCA 4H0WA 2PT1A 4QFOA 3RUMA 3O6HA 3PMXA 2HCAA 3TPAA 4GQOA 4XIGQ 3B6TA 4U1ZA 2DE2A 5KCJB 4ZDMA 1EZ9A 2QS4A 3SEYA 1M5BA 1LCFA 3KOSA 1LCTA 2P1SA 2XXUA 3CG3A 3CSBA 3DLNA 3HN0A 4JBZA 5FHOA 4F39A 3FV2A 5ISUA 3TTLA 5BWJA 4JB7A 3TTMA 2XXWA 1DOTA 1LB9A 1NH7A 4NF5B 5I56A 2RKMA 2XXQA 4LA9A 3TAJA 3PUYE 4OFLA 2Y84A 4R9GA 1M5EA 3LR1A 1B5IA 2ONSA 4DCYA 2XD2A 4O3CA 5I58B 1N7XA 2AIXA 1D3KA 1SVXB 1B7UA 5CI5A 5K2YA 5L8DA 4H6DA 3CVGA 1B4HA 1VFEA 1XS5A 3FXQA 3R7XA 3RTWB 1PB9A 1ZKBA 3ILUB 5AA4A 4ZE8A 4F2OA 2XXTA 4OEUA 4E0XA 2V3TA 1MXYA 1MXZA 2DWHA 3DP8A 4YB6A 2A5SA 3F11A 3IB2A 5L9SA 3CRBA 1P1OA 1OVBA 3S9EA 3AXFA 4R74A 2DS9A 3M3KA 4KYEA 1B7ZA 2E0SA 2RCBA 2I48A 3QUFA 4KYDA 3TQWA 1Z7ME 3CG1A 4R9FA 1NNFA 3SDFA 3EHSA 4FAJA 1LAXA 3K0VA 1Y1ZA 2B3BA 2VD3A 4G8NA 4F2QA 4ELQA 4LP2B 4RPOA 1S7YA 3I3VA 3C32A 2E1SA 1Q1KA 2F8DA 2HAUA 1II5A 3KZGA 3LSXA 4RXLA 1IEJA 1MY2A 4OQOA 5H8SA 4YAHX 5B70A 3EQ1A 2NXOA 4N6PA 1YPNA 2XXYA 3EF7A 3UP9A 4YZZA 3MUQA 4DXUA 5JTYA 3B7DA 3W9WA 5IKBA 4FATA 2DXRA 1IXHA 4ND9A 1B0HA 1JQFA 2YJPA 4OMBA 2AL5A 1NNPA 1B51A 3KSJA 5DEXA 3HSTA 1POTA 2UYEA 3C35A 3MZ1A 5TPAA 3ZSFA 3FVGA 4R2FA 1OVTA 2GH9A 1B32A 1UTBB 2FYIA 3K02A 4OWDA 2Y7RA 4FEBA 3N94A 3VLWA 4F1UA 3A3UA 4FIMA 4HS7A 4ISUA 1URDA 4H8JA 4MH5A 4QFKA 4R72A 4HTGA 5I57B 4R73A 4MFIA 5FTIA 1MH4A 3SEVA 2I3WA 4U21A 5CRYA 4G68C 4ZECA 3Q27A 3PU5A 5CM6A 2RC9A 3MJNA 5HPQA 2UVJA 1P99A 2Y7WA 1I69A 1B05A 2NUVA 3DELB 3HO7A 3K6WA 4JWYA 4X1BA 2V84A 5FHNA 2HZKA 2DVZA 3UK4A 4KHZE 4NMYA 1LFGA 3L6HA 3MAMA 1SW1A 2O7IA 4HW8A 1FQBA 1B4ZA 1B3EA 3PPOA 5EHMA 4AB6A 3RLFE 2ZNTA 3H4ZA 4QSCA 3THIA 2BJJX 3U94A 2OZZA 2DXYA 1MRPA 1Y20A 5H8HA 3U8QA 3G3GA 2LAOA 1SW4A 3U92A 2PX1A 4RNSA 3O66A 3IK6B 4G2ZA 2A5TB 4GRKA 2P0SA 3TELA 3V83A 2ONRA 4OXVA 4JWXA 4WEDA 1ZJLA 4P11A 2ZYKA 3H6TA 4QFNA 1AMFA 3C4MA 1HSJA 5I2NB 1S9TA 4JDFA 3IB1A 4QSEA 3OMBA 4LZ7A 1B7HA 3RNNA 1LB8A 3CFZA 1UIVA 2I3VA 1FW0A 3OXNA 2XXHA 5IAIA 2VHAA 2DWIA 1PDAA 1XVYA 3FJGA 1AH5A 2O51A 3K1NA 4NF4B 4YU0A 3KN7A 5AA2D 1FTMA 1MS7A 1Y3QA 3B6QA 5DYHA 1TWYA 1MPCA 1LBBA 1JEVA 4QFPA 3QXMA 3W9VA 1CB6A 2Z8DA 4R6KA 2ZYNA 4IO6A 1O64A 4QSDA 4ZZAA 4U4XA 4YMAA 4LZ5A 5A5XB 3OEMA 3O6GA 1B5HA 3KGCA 3FXUA 4EXLA 5I59B 4POXA 5L9OA 2DOJA 3FXRA 3ECRA 4QFLA 3H06B 3LBSA 1WDNA 1GGGA 3VVFA 3E9XA 2OJTA 2GRVA 3O29A 4NF6B 1SW2A 4OFOA 1URGA 4TLLB 4U1OA 1SBPA 2VGQA 1N3XA 1OQGA 2DWAA 1SYIA 3R6UA 2QMXA 5H8FA 1SQYA 3MVWA 3UA8A 5HM4B 3RN8A 2I58A 3KJ7A 3L6GA 4OZ9A 3TEPA 4RK9A 1TT1A 2OBGA 5TP9B 3KG2A 1M5FA 2XD3A 2Y7PA 3LSFB 3GLBA 5DVIA 3IOTA 3S4UA 5AE4A 1FQEA 4RYAA 4DCXA 1SD3A 2HXWA 4IY5A 4U2RA 4DLDA 4P0GA 1OIBA 3SEWA 1QVSA 4DZ1A 3N6UA 2VD2A 3G3KA 1XVXA 2ZYMA 3GBAA 3K6UA 3FVNA 2ZYOA 4NF5A 4R75A 5L9MA 1MQDA 2CZLA 1FQAA 4KCDA 1R9LA 2ZMBA 3C31A 4QRZA 1Y9UA 4BLAA 1M5DA 3N26A 1MY3A 3CI8A 3VXCA 3UIFA 5AA2A 1FCKA 2F7BA 4OVJA 3S9MC 2H5YA 3S9NC 3B6WA 2NWJA 3IAZA 3KN8A 4KCCA 1POY1 4WEPA 1SYHA 2Z22A 3H7MA 4G68B 3BKIB 4K3FA 4IB2A 4X1DA 4Q30B 3VLUA 4EXKA 2THIA 4X9TA 1NKXA 1Y1MA 2O6AA 2NOOA 1JW5A 3C9HA 2REJA 3T9XB 4TOZA 4YKIA 2H25A 2HEUA 3GXAA 4IO5A 4YMBA 4GF8A 5H8NB 4G77A 4IO3A 1NNKA 4MBPA 3PD9A 1JVYA 3U72A 1QW0A 2Q8JA 1WVJA 3MP1A 5H8QA 4F3GA 3HV1A 4H5GA 4L17A 1MM6A 3O97A 2V93A 5DT6A 3V8XB 4F1VA 4RPNA 3PUZE 2VOZA 2DP8A 1P1QA 3USDA 4ZEFA 4ZEKA 3P7IA 3FASA 4KYSA 1MXXA 4YICA 3TZAA 4ZEIA 1IIWA 2O1LA 5AA1A 2Z8FA 3A09A 2UYFA 4LATA 2UVHA 3IOWA 1B3FA 2ABHA 2CMOA 5DVJA 2QMWA 3QK6A 3K00A 1RYXA 3LSLA 3O28A 4UACA 3VFJA 3FV1A 3N6TA 4GWOA 1VE4A 4N13A 5EYFA 2ONKE 3FUZA 2PYYA 4WKMA 4YB5A 1URSA 5I2KB 1A55A 3K2DA 3MBPA 2RF1A 3EN3A 1QJMA 3MVXA 3TYHA 3V89B 4PE5B 2D3IA 2I0BA 2GHBA 4EQ7A 1IZ1A 1QKAA 3FGSA 5JEIA 5HBCA 1SDXA 3WAEA 1H44A 1B2HA 2AYSA 2HZLA 3I5OA 5KDTB 1FTOA 2FA7A 5K2XA 2O7UA 3FJ7A 4KR5A 2H98A 3GBBA 3OO8A 3ZKKA 2GHAA 3PPQA 4LQ5A 4Z0IA 2F78A 1ELJA 4XTCQ 3H6WA 3I6VA 2RINA 4GOTA 4F3BA 2G93A 3VV5A 1N04A 3K01A 3MZBA 1H3DA 1JW1A 4I1DA 2X7PA 1H76A 3JZJA 3Q25A 1EU8A 2XXRA 4IO4A 3MW0A 4QF9A 4HCWA 4IO2A 1IXGA 2PT2A 2Q88A 3FVOA 4O3BA 3PPPA 4YKJA 4LQ2A 4BDRA 1Z7NE 2QRYA 3BFUA 4OEVA 2F5XA 1DMBA 4FORA 1SI0A 2AL4A 3K1MA 2DVCA 2KLFA 4WXJA 2OWSA 1NH8A 3IO4A 3MC2A 1BIYA 4THIA 2B3FA 4XKQA 5CBSA 2R6GE 1H45A 2ZNUA 4U23A 5BUUA 1HSEA 2QJEA 4UA8A 1AIVA 1LAFE 1QULA 1S50A 3VXBA 3PGFA 3PUVE 5H8HB 4BDQA 1US4A 1BTJA 4OYVA 4ECFA 3D4CA 4OETA 4YKKA 3M3FA 5ITPA 1EH3A 4GXSB 1UTBA 2R71A 4U22A 5AA4B 1ANFA 3A3CA 4XKPA 1I6QA 1JNFA 1A8FA 2PBWA 1Y3PA 1D4NA 1MY1A 3PV0E 2D5WA 1MH3A 4LONB 4TQUQ 1B0LA 2O68A 1ZU0A 1J1NA 1FTJA 2G29A 3IOUA 3OO9A 1TXFA 1OMPA 1N84A 3IR1A 2H9BA 3E3KA 3ODBA 5H8FB 4IO7A 3T96B 2V3UA 1IUDA 3IL1B 3UORA 4BDNA 4F3PA 5I2KA 5JK4A 4RK2A 2X26A 3MVZA 5CBRA 1VFDA 1JEUA 3JV9A 1B3HA 3MP6A 3ONMA 3FZVA 4PP0A 3ZS6A 4G8MA 4DXCA 4BDMA 1B5JA 3O2AA 1O7TA 2I49A 3OO7A 4QHQA 3DM0A 1YCJA 2WKYA 3UGWA 1ATGA 5M2VA 4AQ4A 1FTKA 3E13X 5DTBA 3TODA 2REGA 2PVUA 1VR5A 3S2VA 3PUWE 1A99A 1M5CA 3HCQA 1P1NA 1USYH 2XXIA 2Z8EA 3G7WA 3K1PA 3M8UA 3QSLA 2ZXTA 1XOCA 3C33A 1QKBA 4DDDA 1EZPA 4LUBA 1N76A 3OENA 2R9JA 3MZ9A 5CMKA 5ELVA 1EZOA 1Y3NA 1QUJA 5ICQA 2H99A 2XXXA 3K6VA 4C1UA 1PEBA 1Y4CA 4F22A 1A8EA 2F97A 2D21A 1MQJA 4I62A 3SESA 3SEUA 4RY1A 1CE2A 3CIJA 2DE4A 1B52A 3OELA 1LAHE 1B1XA 2F7CA 2HAVA 1A40A 3PPNA 4OTEA 3Q28A 4H1XA 5I57A 1B3GA 1DTZA 3QYTA 3VE1B 1ZBMA 1BKAA 4ZS9A 3K6XA 4F19A 1BP5A 3CFXA 2PMSA 1AL3A 3FD3A 1MXWA 3TTKA 1MDP1
chains in the Genus database with same CATH superfamily
2PCRA 4F29A 4PGNA 1UTHB 4YB7A 2UVIA 4HE2A 4MLQA 3M3LA 4X48A 3G3IA 1MQIA 2B65A 3OOAA 1FPJA 1B3LA 1OQHA 2M8CA 1KA1A 3IO6A 4EDPA 2Z23A 2WBDA 4ONYA 1A7LA 3MSTA 2RCAA 4ELRA 3PUXE 4Z7EA 4I40A 1FBGA 3BBRA 4F3SA 5H8NA 1N3WA 4EQ9A 5ICTA 4GWZA 1NV6A 3H3GA 3TMGA 3ILTB 4YKPA 4ZE9A 4G8HA 4MCOA 3DP4A 4MMPA 1PB7A 5DW8A 4PFTA 1N7WA 3VVEA 1TFAA 2WYKA 1FPBA 4OENA 1A54A 1IITA 3KC0A 3T22A 1LFIA 4PAIA 2CZKA 1B40A 3G3FA 1QUIA 4GIZA 1B58A 2I0CA 1I6AA 2FIEA 2Q2AA 3QAXA 4I9DA 3OSRA 2O69A 5DVFA 3OD7A 5AA2B 2HHMA 2O84X 1R1NA 1R9QA 2I4CA 4NEDA 2Y5LA 2DYXA 3R26A 4NF6A 4O8MA 1SI1A 4G61A 5A5XA 2QS3A 3QIMA 3TTRA 4OERA 4C0RA 1PB8A 1NNTA 4MLVA 3H03A 3KFMA 5H8QB 1PBQA 3KSXA 1MM7A 3KC1A 3GZGA 2A5TA 1H43A 2XWVA 2Y7KA 3BFTA 4H65A 5ET6A 1DPEA 1LLSA 3KBZA 1WODA 4R6HA 3E4RA 3EHUA 3GYYA 3RUMA 3O6HA 3TPAA 2XXKA 5ET7A 2XXUA 3HN0A 5FHOA 4JBZA 2XXWA 1DOTA 2RKMA 2Y84A 1M5EA 3LR1A 5I58B 1N7XA 1D3KA 1SVXB 3CVGA 4I3EA 1XS5A 3R7XA 1PB9A 1ZKBA 4ZE8A 1MXYA 1MXZA 4YB6A 3F11A 3IB2A 3CRBA 3AXFA 3M3KA 2E0SA 2RCBA 1NV4A 3TQWA 1NNFA 3SDFA 4FAJA 1FBHA 4RPOA 4P8BA 3I3VA 1II5A 5EQAA 4OQOA 1NV5A 5A5LA 4N6PA 4YZZA 1FBDA 5JTYA 3B7DA 4OVQA 4FATA 1G0HA 1IXHA 4OMBA 1FPFA 1B51A 1POTA 3MZ1A 5TPAA 3FVGA 1B32A 1UTBB 2FYIA 4FEBA 3VLWA 4F1UA 3A3UA 5I57B 4H8JA 1MH4A 2I3WA 4U21A 4ZECA 2UVJA 1FTAA 2NUVA 3DELB 4OVSA 2DVZA 4KHZE 3MAMA 3RLFE 2ZNTA 1LBVA 1MRPA 5H8HA 3U8QA 2PX1A 3IK6B 4GRKA 2P0SA 4OXVA 4JWXA 4P11A 3H6TA 3C4MA 1S9TA 4JDFA 4QSEA 1FPEA 3CFZA 3ROJA 1FW0A 3T0JA 5IAIA 2VHAA 3FJGA 3K1NA 5AA2D 5DYHA 1LBBA 1JEVA 4QFPA 2Z8DA 1B5HA 5L9OA 3FXUA 2DOJA 4U1OA 2DWAA 1SYIA 3RN8A 2I58A 3TEPA 5EQ7A 1TT1A 1NV0A 5TP9B 3LSFB 3GLBA 4KXPA 1FQEA 4RYAA 4DLDA 3SEWA 2VD2A 2ZYMA 5L9MA 3FVNA 2ZYOA 1FQAA 1R9LA 4QRZA 3VXCA 1MY3A 3IAZA 1POY1 4WEPA 4G68B 4X1DA 4IB2A 3D1RA 5H8NB 4YKIA 4G77A 4IO3A 1NNKA 4X04A 3MP1A 4F3GA 4H5GA 1MM6A 3V8XB 1P1QA 4XFEA 1IIWA 2CZHA 3HFUA 2QMWA 3QK6A 2B4LA 1FJ6A 4UACA 5IZ3B 4YB5A 3K2DA 3V89B 3MVXA 1IMAA 2I0BA 2GHBA 4EQ7A 3FGSA 3BIGA 1B2HA 3I5OA 2FA7A 5K2XA 3ZKKA 1N04A 1EYJA 1JW1A 4QF9A 4IO2A 4YKJA 3IFCA 3A29A 3BFUA 2AL4A 2B3FA 3CHGA 1H45A 1HSEA 2QJEA 4UA8A 1LAFE 1QULA 4GWUA 3VXBA 3PGFA 2CZIA 2Q74A 3D4CA 5ITPA 1EH3A 1FPKA 4GBWA 4U22A 3ISPA 5AA4B 1I6QA 1MY1A 2XWIA 3PV0E 2F3DA 2O68A 1N84A 3IR1A 3UN6A 3ODBA 4F3PA 5JK4A 4BDNA 3MP6A 2I49A 1FTKA 1VR5A 3PUWE 1M5CA 1USYH 2Z8EA 4O7MA 1QKBA 3MZ9A 3K6VA 4C1UA 4F22A 1Y4CA 1A8EA 2F97A 3CIJA 2DE4A 2F7CA 2P3VA 2XA5A 3PPNA 2DDKA 1DTZA 3E79A 3VE1B 1BKAA 3K6XA 1AL3A 1M5FA 4NF8A 1LGBC 4PQJA 4F18A 1ZMGA 4KD5A 1YAEA 5TPAB 1EZOA 3O9PA 1ZTYA 1KWHA 4PFYA 4P56A 2Q2CA 2KQZA 2RC7A 2OWTA 1LBCA 2VP1A 2W7YA 5EHSA 5ESYA 5JTYB 4F31B 2VPOA 3PD8A 3V5AA 2V25A 5AA3A 3IFAA 4XKNA 2FNCA 1D9YA 1MXUA 1USYE 1MPBA 1XC1A 1FPDA 3DP6A 4Q8RA 1ZLQA 4IY6A 1DCUA 2WEFA 4RJZA 2F35A 5KCJA 1NI9A 3N5LA 3IJOB 3IX1A 4NF0A 4HXVA 1RKMA 3LUZA 4XF5A 3VDFA 1DTGA 3Q26A 4GFRA 5FTHA 3SKPA 2P2AA 4ZEDA 1MPDA 2UVGA 4P9KA 2DSFA 4JVIA 3IORA 4NE4A 4JVDA 4PF8A 1MQHA 2I4BA 2F34A 4BDLA 4E0WA 5LOMA 2HPGA 4KI0E 4RA1A 1I6BA 4GL8A 4XXUA 1NFTA 4JSDA 1FQDA 3TQLA 1B9JA 1T0KA 1SPIA 3HPIA 5ET8A 5ITOA 4F1YA 3OO6A 3FIRA 4I8CA 3Q29A 2QS1A 1JW4A 4FECA 1B1HA 2X7QA 4Q5TA 5I7IA 3JYRA 4X8RA 5TU0A 2OK2A 4AB5A 4HCYA 3UP9A 4NWDA 1JVXA 2HFBA 2Y7IA 3RY3A 4NF8B 4QXDA 3H6VA 3TTNA 4KPTA 3IB0A 4Q0CA 3TCGA 1MG1A 5IZ1A 1B46A 1FQFA 2GFEA 3CSGA 1GTKA 3RT8A 2MKZA 4POWA 3T9VA 3KOTA 4G4PA 4FJPA 1MQGA 4DIGA 3CR9A 4AS5A 1GVCA 4H0WA 4PGPA 3PMXA 4GQOA 4GWXA 3B6TA 1EZ9A 3SEYA 1M5BA 2QVVA 1LCFA 4N6KA 1LCTA 2P1SA 4F39A 5BWJA 4JB7A 1LB9A 5I56A 3TAJA 2ONSA 5K2YA 5CI5A 5L8DA 4H6DA 4OANA 3FXQA 3RPLA 3ILUB 5AA4A 1INPA 4E0XA 3DP8A 2A5SA 1OVBA 2XWKA 4P1LA 3QUFA 5I5PA 1Z7ME 2GQ1A 4R9FA 5IGAA 3E78A 2B3BA 2VD3A 4PBHA 1S7YA 3C32A 1Q1KA 5H8SA 2NXOA 1YPNA 2P3NA 3EF7A 1JP4A 2YJPA 4LN5A 2ZZXA 4FBPA 3KSJA 3C35A 1OVTA 2GH9A 3K02A 2Y7RA 4FIMA 4MH5A 1DBZA 1URDA 4R73A 3MJNA 1P99A 1I69A 4GX6A 4JWYA 2V84A 4NMYA 2O7IA 1FQBA 4JVCA 3THIA 2BJJX 3U94A 2OZZA 3LV0A 1Y20A 1SW4A 2ZZWA 4WEDA 2ONRA 3ZKLA 2ZYKA 4QFNA 3OMBA 1B7HA 3RNNA 1UIVA 2I3VA 4N91A 1AH5A 4YU0A 1MS7A 1Y3QA 1MPCA 2ZYNA 4ZZAA 1RDYA 4LZ5A 3OEMA 3KGCA 4POXA 3FXRA 4QFLA 3H06B 1WDNA 2GRVA 4TLLB 4OFOA 1URGA 1SBPA 4GWYA 2QMXA 5H8FA 2FBPA 3L6GA 2OBGA 1NV1A 3KG2A 2Y7PA 5AE4A 4P0GA 1OIBA 1QVSA 4NF5A 3GBAA 2CZLA 2ZMBA 4BLAA 5AA2A 3S9MC 3S9NC 1XI6A 4KCCA 2Z22A 1Y1MA 2NOOA 2REJA 2H25A 2HEUA 4PE3A 4HE0A 3PD9A 1QW0A 3O97A 2V93A 5DT6A 4F1VA 1IMCA 3PUZE 2VOZA 3TZAA 1B3FA 2CMOA 5DVJA 3B8BA 1RYXA 3O28A 1G0IA 4GWOA 5EYFA 3FUZA 4WKMA 5I2KB 1A55A 2FIXA 3EN3A 3TYHA 4PE5B 2D3IA 5JEIA 1H44A 4OVRA 2AYSA 2HZLA 3FJ7A 3PPQA 1ELJA 3H6WA 4GOTA 3K01A 3MZBA 3RPLB 2X7PA 1H76A 1NV2A 4IO4A 2PT2A 4PF6A 3PPPA 4OEVA 2F5XA 1DMBA 4AS4A 1SI0A 1FPLA 3K1MA 2KLFA 4THIA 1NH8A 3IO4A 5CBSA 1BIYA 1AIVA 5BUUA 2WYPA 1BTJA 4GXSB 1FPIA 1LBZA 1A8FA 1B0LA 2G29A 1TXFA 1OMPA 3T96B 2V3UA 1IUDA 3IL1B 3UORA 2X26A 3MVZA 1JEUA 3FZVA 4PP0A 3ZS6A 3OO7A 4QHQA 2WKYA 2OX3A 3E13X 4GWWA 1A99A 4N4UA 1P1NA 3M8UA 1XOCA 4LUBA 2ZZVA 5CMKA 2QVUA 5ICQA 1PEBA 4RY1A 1CE2A 3OELA 4OTEA 5I57A 1B3GA 1NUYA 3QYTA 1RDXA 3CFXA 3FD3A 3T93B 1FPGA 2F7AA 2OCUA 4MIJA 1MDQA 2F6GA 2XXVA 4N6DA 3FVKA 1AOVA 1L5TA 1MXVA 4OZ9A 4EF1A 4GD5A 4EQBA 4NTLA 4P0IA 1UQWA 1FTLA 2QL3A 1TFDA 3HHFA 4OHNA 1FRPA 4NQ8A 2RC8A 1OLAA 2V3QA 4GL0A 3RT6B 1DPPA 3LC8A 2ALUA 3SEXA 4KFQA 2O1MA 3OEKA 2PFZA 2XHDA 1D9VA 2ESNA 4JWOA 5CMMA 2XX7A 1P1WA 1CNQA 2YLNA 2XX9A 4O3AA 4XKRA 3PPRA 5I58A 3TCHA 3EHTA 4C1TA 4EUOA 3KBRA 3S9LC 1IMBA 3LUYA 4FE8A 1EYKA 3VVDA 3MWBA 4ZZEA 4JXIA 3C34A 4ELOA 4GXAA 4PAFA 3MYUA 1F9BA 1NMUA 2OWZA 3T9HB 2WBBA 1IQ7A 1XHYA 5EQ9A 3RGYA 4R6YA 1VSOA 3T1BA 3D4GA 4LVQA 1OLCA 4PFUA 5FHMA 2QPQA 3MPKA 2QS2A 4TLMB 2ZNSA 4H67A 4KQPA 1QUKA 2HQ0A 3TFLA 1MY4A 4QBAA 1RYOA 5J1DA 1PBPA 2OLBA 1O63A 5F1QA 5CMBA 3FJMA 3B50A 1NUXA 1JETA 3BIHA 2FVZA 5IZ3A 1UTHA 1LFHA 3SETA 4MF3A 2UXAA 4JSOA 3RQTA 1GR2A 1FJ9A 4PETA 1EYIA 4N07A 3H6UA 3PMWA 1MY0A 4N17A 3PMVA 1Q35A 1US5A 1FQCA 4PDHA 4ESWA 2DWJA 4QFOA 1IMEA 2HCAA 1FBEA 2HXRA 4U1ZA 5KCJB 5F24A 1NUZA 4NAPA 3CG3A 3CSBA 4N81A 3TTLA 1NH7A 4NF5B 2XXQA 3PUYE 4OFLA 4R9GA 4DCYA 2XD2A 4O3CA 1B7UA 1B4HA 1VFEA 2BJIA 2XXTA 4OEUA 2V3TA 2DWHA 5L9SA 3S9EA 2VT5A 4R74A 4KYEA 4KYDA 2I48A 4PFRA 1Y1ZA 4LP2B 4RXLA 2F8DA 2HAUA 3KZGA 1IEJA 1MY2A 5B70A 3EQ1A 3MUQA 2DXRA 1B0HA 1JQFA 5DEXA 2UYEA 3ZSFA 4NX1A 4ISUA 4HS7A 4QFKA 1AWBA 3SEVA 5CRYA 4G68C 3Q27A 5CM6A 4N8GA 2Y7WA 1B05A 5FHNA 2HZKA 1LFGA 1SW1A 4MAGA 5EHMA 3H4ZA 1YYZA 4QSCA 4GX3A 2DXYA 4DI3D 3G3GA 2LAOA 1FBPA 3O66A 4G2ZA 3TELA 3V83A 4PAKA 1ZJLA 1AMFA 1HSJA 4LZ7A 3OXNA 2XXHA 1NV7A 1PDAA 1XVYA 4NF4B 2O51A 2FHYA 1FTMA 1TWYA 3QXMA 1CB6A 4O94A 4R6KA 4QSDA 4YMAA 4U4XA 3O6GA 5I59B 3ECRA 1K9ZA 3VVFA 3E9XA 3O29A 4NF6B 1N3XA 1SQYA 3MVWA 3UA8A 3KJ7A 3U93A 4DCXA 1SD3A 2HXWA 4IY5A 4U2RA 3G3KA 1XVXA 3K6UA 3C31A 4PC9A 1M5DA 3UIFA 2F7BA 4OVJA 2H5YA 3B6WA 3KN8A 4K3FA 4Q30B 3PTYA 4X9TA 2O6AA 3T9XB 1JW5A 3C9HA 4TOZA 4IO5A 4YMBA 4GF8A 4MBPA 3U72A 4L17A 4ZEKA 3FXBA 2QVRA 3P7IA 4KYSA 4YICA 1MXXA 4ZEIA 3A09A 2UYFA 4LATA 2UVHA 3IOWA 2ABHA 3VFJA 1VE4A 4O7IA 2XWOA 1URSA 3MBPA 1QJMA 3FBPA 1QKAA 5KDTB 1FTOA 4KR5A 2H98A 3OO8A 4LQ5A 2F78A 2RINA 3VV5A 4P3LA 3JZJA 1EU8A 2F3BA 4HCWA 2Q88A 3FVOA 4O3BA 4LQ2A 1Z7NE 2QRYA 1FBCA 4FORA 2DVCA 4WXJA 2OWSA 3MC2A 4XKQA 2R6GE 3QMFA 4OYVA 4ECFA 4OETA 1UTBA 2B4MA 4XKPA 1JNFA 2PBWA 4LONB 2D5WA 1MH3A 3OO9A 1ZU0A 3IOUA 2Q8MA 4H45A 4RK2A 1VFDA 1B3HA 3ONMA 4G8MA 4BDMA 1O7TA 1YCJA 5EYGA 5M2VA 4GX4A 3TODA 2PVUA 4PTKA 3C33A 4IR8A 4DDDA 1N76A 3OENA 5ELVA 1Y3NA 2D21A 1MQJA 4I62A 3SEUA 1RDZA 4MX6A 1B52A 4OVTA 1B1XA 2HAVA 4H1XA 4ZS9A 5EYHA 4F19A 1MXWA 3TTKA 4LZ8A 2YPNA 4GWSA 1Y4TA 4PBQA 3CFLA 3K4UA 3K6WA 1B6HA 3C36A 2H4IA 5J16A 2I6EA 2Q89A 1SW5A 3TDJA 3TKDA 3QUJA 3G3JA 3IOVA 3T66A 4XEQA 3U1OA 2DE3A 3MVYA 3MP8A 4MNPA 2QFLA 4H5FA 3RPWA 3T9UA 5KDTA 3OSQA 2NVUB 2DQVA 5B7DA 4I3YA 4H8IA 3KEIA 4MJOA 4ESXA 4OFJA 4U4SA 2XX8A 3TUSA 1YTVA 5I84A 2L5VA 4PFWA 3TCFA 3WAFA 4FEDA 5CC2A 3IJXB 1XT8A 3LSWA 4N8YA 4OESA 5TP9A 1PC3A 3G3HA 5LTCA 2QSXA 5I56B 4OVPA 4GVOA 3RTFB 4GLIA 1LAGE 4GBVA 5F7VA 1IMFA 4EF2A 5DEXB 2XXPA 4BDOA 3KJTA 3SERA 5CMCA 5LDZA 1UIUA 5KZTA 3EPEA 1BLFA 2CEXA 3KN3A 3VLVA 1GV8A 3HHGA 1LBYA 2IA4A 1LSTA 3O6IA 1IXCA 1HSLA 2ANJA 1QGXA 4IGTA 1DK4A 5EQ8A 4ZEBA 2F36A 4DI4B 1DSNA 3MPLA 2Q9TA 4ELPA 3W15C 1KA0A 4M4GA 1Q9DA 4DE8A 1ZIUA 3FATA 4R2BA 4NWCA 4NF4A 4PCDA 1N0TA 2VPNA 4G68A 1NV3A 5FBPA 5I59A 2F6PA 1NL5A 1R6ZA 2KR0A 3MQ9A 3USDA 1P1UA 4IGRA 1IXIA 4M1VA 2Y5KA 2IEEA 2PT1A 4XIGQ 2DE2A 4ZDMA 2QS4A 3KOSA 3NOHA 3DLNA 1VDWA 3FV2A 5ISUA 3TTMA 4LA9A 1B5IA 2AIXA 4MEVA 4HE1A 3RTWB 4F2OA 4NN3A 1P1OA 4OA4A 2DS9A 1B7ZA 1BK4A 1YXIA 3CG1A 3EHSA 1LAXA 1LBXA 3K0VA 4G8NA 4F2QA 4ELQA 2E1SA 3LSXA 4YAHX 2XXYA 4DXUA 3W9WA 5IKBA 4ND9A 5T3JA 2R8TA 1NNPA 2AL5A 3HSTA 4R2FA 4OWDA 3N94A 4R72A 4HTGA 3SZPA 4MFIA 5FTIA 5HPQA 3PU5A 2RC9A 4X1BA 3HO7A 3UK4A 4HW8A 3L6HA 1B4ZA 1B3EA 3PPOA 4MNIA 4AB6A 5IM2A 3U92A 4RNSA 2A5TB 2V4CA 5I2NB 3IB1A 1LB8A 2DWIA 1LBWA 3KN7A 3B6QA 4DXBA 2JJKA 1LEVA 3W9VA 4IO6A 1O64A 5A5XB 4EXLA 1FSAA 3LBSA 1GGGA 2OJTA 1SW2A 2VGQA 3R6UA 1OQGA 3RYDA 5HM4B 4MHFA 4RK9A 2XD3A 5DVIA 3S4UA 3IOTA 4PFBA 4DZ1A 3N6UA 4R75A 1MQDA 4KCDA 1NUWA 1Y9UA 3N26A 3CI8A 1FCKA 2NWJA 3EKIA 1SYHA 3H7MA 3BKIB 3VLUA 4PFIA 2THIA 1NKXA 3GXAA 1JVYA 2Q8JA 1WVJA 5H8QA 3HV1A 4NG7A 1YZ0A 4RPNA 2DP8A 4ZEFA 3FASA 2O1LA 5AA1A 2Z8FA 3K00A 4P47A 3LSLA 3FV1A 3N6TA 4MNCA 4N13A 2ONKE 2PYYA 4NHBA 2RF1A 1KZ8A 1IZ1A 5HBCA 1SDXA 3WAEA 5I3SA 2O7UA 3GBBA 2GHAA 4Z0IA 4XTCQ 3I6VA 4F3BA 2G93A 1H3DA 4UABA 4I1DA 3Q25A 2XXRA 3MW0A 1IXGA 4BDRA 5I2NA 4NGUA 2ZNUA 4U23A 1S50A 3PUVE 5H8HB 4BDQA 1US4A 4YKKA 3M3FA 2R71A 1FBFA 1ANFA 3A3CA 5ET5A 1Y3PA 1D4NA 4TQUQ 1J1NA 1FTJA 5H8FB 2H9BA 3E3KA 4IO7A 4P1EA 5I2KA 5CBRA 4H46A 3JV9A 2CEYA 4DXCA 1B5JA 3O2AA 3UGWA 3DM0A 4N15A 1ATGA 4AQ4A 5DTBA 2PFYA 1D9QA 2REGA 2WX9A 3S2VA 3HCQA 3G7WA 3QSLA 2XXIA 3K1PA 1EZPA 2ZXTA 2R9JA 1QUJA 3U65A 2H99A 2XXXA 4PDDA 3SESA 1LAHE 5IZZA 1A40A 3Q28A 1IMDA 1ZBMA 1BP5A 2PMSA 4EXKA 1MDP1 1K9YA
chains in the Genus database with same CATH topology
4LZ8A 1LGBC 2F7AA 2OCUA 4NF8A 4PQJA 4F18A 2YPNA 4F29A 1Y4TA 1ZMGA 1MDQA 4KD5A 1YAEA 2F6GA 2XXVA 3FVKA 5TPAB 1AOVA 1UTHB 3CFLA 1ZTYA 1B6HA 3C36A 1KWHA 1MXVA 2H4IA 3K4UA 2UVIA 3O9PA 2I6EA 2Q2CA 2Q89A 2RC7A 4GD5A 2OWTA 1LBCA 2VP1A 2W7YA 5EHSA 4EQBA 1SW5A 5I2NA 5JTYB 4MLQA 3TDJA 3M3LA 4F31B 4NTLA 3TKDA 4X48A 3PD8A 4P0IA 1UQWA 1FTLA 3QUJA 3G3IA 3G3JA 3IOVA 1MQIA 2B65A 3V5AA 3OOAA 4DXBA 2QL3A 2V25A 1TFDA 1B3LA 1OQHA 2M8CA 3T66A 5AA3A 3HHFA 3U1OA 3IO6A 4OHNA 2DE3A 2RC8A 3MVYA 4EDPA 1OLAA 4XKNA 3MP8A 2Z23A 2V3QA 2FNCA 1D9YA 1MXUA 4ONYA 1USYE 1MPBA 1A7LA 4GL0A 3RT6B 1DPPA 4H5FA 3RPWA 3LC8A 1XC1A 3T9UA 4YB7A 5KDTA 2ALUA 3OSQA 3DP6A 2RCAA 2O1MA 3OEKA 4KFQA 3SEXA 2NVUB 2XHDA 3PUXE 4ELRA 4Z7EA 1D9VA 2ESNA 2DQVA 5B7DA 3BBRA 4F3SA 4JWOA 5CMMA 5H8NA 2XX7A 1P1WA 1N3WA 3KEIA 4H8IA 2YLNA 2XX9A 4O3AA 4EQ9A 4Q8RA 4XKRA 3PPRA 4ESXA 3TCHA 5I58A 3EHTA 4OFJA 4C1TA 4PFYA 4EUOA 5ICTA 4U4SA 1ZLQA 3H3GA 2XX8A 4IY6A 3TMGA 3TUSA 3ILTB 3KBRA 4RJZA 4YKPA 1YTVA 5I84A 2F35A 5KCJA 4PFWA 3TCFA 4ZE9A 3LUYA 3N5LA 4FE8A 3S9LC 4G8HA 3WAFA 3IJOB 3IX1A 3DP4A 1L5TA 3VVDA 3MWBA 1PB7A 4ZZEA 4PFTA 4FEDA 1N7WA 4JXIA 3C34A 5CC2A 3VVEA 1TFAA 4ELOA 1RKMA 3IJXB 4GXAA 1XT8A 4OENA 3LSWA 1A54A 1IITA 1F9BA 3VDFA 1NMUA 3T22A 1DTGA 1LFIA 3T9HB 4OESA 1B40A 3Q26A 4GFRA 5TP9A 5FTHA 1PC3A 1IQ7A 2P2AA 3G3HA 3SKPA 3G3FA 1QUIA 2QSXA 3T93B 4ZEDA 4GIZA 1B58A 1MPDA 1I6AA 1XHYA 2I0CA 4R6YA 3RGYA 3U93A 5I56B 2UVGA 2Q2AA 1VSOA 3QAXA 2DSFA 4I9DA 4GVOA 3RTFB 4GLIA 3OSRA 3IORA 4NE4A 3D4GA 1MQHA 1LAGE 2O69A 4LVQA 2I4BA 5DVFA 2F34A 5F7VA 4EF1A 1OLCA 4BDLA 5DEXB 3OD7A 4EF2A 2XXPA 4PFUA 5AA2B 4BDOA 3KJTA 3SERA 4E0WA 5CMCA 5LOMA 1UIUA 5KZTA 4KI0E 2O84X 1R1NA 3EPEA 5FHMA 1R9QA 2I4CA 1BLFA 2QPQA 3KN3A 4NEDA 4RA1A 1I6BA 3MPKA 3VLVA 3ZKLA 1GV8A 3HHGA 4GL8A 2QS2A 4TLMB 2DYXA 4XXUA 3R26A 2IA4A 1LSTA 3O6IA 2ZNSA 1NFTA 4H67A 4KQPA 1QUKA 2HQ0A 4JSDA 1FQDA 1MY4A 1IXCA 1HSLA 1SI1A 4NF6A 3TFLA 3TQLA 2ANJA 4IGTA 1B9JA 1RYOA 5A5XA 1T0KA 5J1DA 1PBPA 2OLBA 3HPIA 2QS3A 3QIMA 4ZEBA 2F36A 1DSNA 3TTRA 3MPLA 1O63A 2Q9TA 5F1QA 4ELPA 5CMBA 3FJMA 4OERA 5ITOA 1PB8A 4C0RA 4F1YA 1NNTA 3OO6A 3FIRA 4I8CA 3H03A 4MLVA 3W15C 3Q29A 2QS1A 3KFMA 5H8QB 1JW4A 4FECA 1PBQA 3KSXA 4M4GA 1MM7A 1B1HA 1JETA 2X7QA 4Q5TA 3JYRA 5TU0A 2OK2A 3GZGA 4AB5A 1UTHA 4HCYA 1LFHA 2A5TA 4DE8A 1H43A 1ZIUA 1JVXA 3FATA 4NWDA 4R2BA 2HFBA 2Y7IA 3RY3A 4NWCA 4NF4A 3SETA 4MF3A 4NF8B 3UN6A 2Y7KA 3H6VA 3BFTA 2UXAA 1N0TA 4JSOA 3TTNA 4G68A 3IB0A 4H65A 4KPTA 4Q0CA 3RQTA 1GR2A 3TCGA 1MG1A 4PETA 1DPEA 1B46A 5I59A 1FQFA 2GFEA 3CSGA 1GTKA 2F6PA 4N07A 3RT8A 3H6UA 3PMWA 1MY0A 1LLSA 1NL5A 4POWA 1R6ZA 3MQ9A 3PMVA 3T9VA 1WODA 1P1UA 1Q35A 1FQCA 1US5A 3KOTA 1IXIA 4G4PA 4FJPA 4IGRA 1MQGA 4R6HA 3E4RA 4M1VA 3CR9A 4DIGA 4ESWA 2DWJA 2IEEA 3EHUA 1GVCA 4H0WA 2PT1A 4QFOA 3RUMA 3O6HA 3PMXA 2HCAA 3TPAA 4GQOA 4XIGQ 3B6TA 4U1ZA 2DE2A 5KCJB 4ZDMA 1EZ9A 2QS4A 3SEYA 1M5BA 1LCFA 3KOSA 1LCTA 2P1SA 2XXUA 3CG3A 3CSBA 3DLNA 3HN0A 4JBZA 5FHOA 4F39A 3FV2A 5ISUA 3TTLA 5BWJA 4JB7A 3TTMA 2XXWA 1DOTA 1LB9A 1NH7A 4NF5B 5I56A 2RKMA 2XXQA 4LA9A 3TAJA 3PUYE 4OFLA 2Y84A 4R9GA 1M5EA 3LR1A 1B5IA 2ONSA 4DCYA 2XD2A 4O3CA 5I58B 1N7XA 2AIXA 1D3KA 1SVXB 1B7UA 5CI5A 5K2YA 5L8DA 4H6DA 3CVGA 1B4HA 1VFEA 1XS5A 3FXQA 3R7XA 3RTWB 1PB9A 1ZKBA 3ILUB 5AA4A 4ZE8A 4F2OA 2XXTA 4OEUA 4E0XA 2V3TA 1MXYA 1MXZA 2DWHA 3DP8A 4YB6A 2A5SA 3F11A 3IB2A 5L9SA 3CRBA 1P1OA 1OVBA 3S9EA 3AXFA 4R74A 2DS9A 3M3KA 4KYEA 1B7ZA 2E0SA 2RCBA 2I48A 3QUFA 4KYDA 3TQWA 1Z7ME 3CG1A 4R9FA 1NNFA 3SDFA 3EHSA 4FAJA 1LAXA 3K0VA 1Y1ZA 2B3BA 2VD3A 4G8NA 4F2QA 4ELQA 4LP2B 4RPOA 1S7YA 3I3VA 3C32A 2E1SA 1Q1KA 2F8DA 2HAUA 1II5A 3KZGA 3LSXA 4RXLA 1IEJA 1MY2A 4OQOA 5H8SA 4YAHX 5B70A 3EQ1A 2NXOA 4N6PA 1YPNA 2XXYA 3EF7A 3UP9A 4YZZA 3MUQA 4DXUA 5JTYA 3B7DA 3W9WA 5IKBA 4FATA 2DXRA 1IXHA 4ND9A 1B0HA 1JQFA 2YJPA 4OMBA 2AL5A 1NNPA 1B51A 3KSJA 5DEXA 3HSTA 1POTA 2UYEA 3C35A 3MZ1A 5TPAA 3ZSFA 3FVGA 4R2FA 1OVTA 2GH9A 1B32A 1UTBB 2FYIA 3K02A 4OWDA 2Y7RA 4FEBA 3N94A 3VLWA 4F1UA 3A3UA 4FIMA 4HS7A 4ISUA 1URDA 4H8JA 4MH5A 4QFKA 4R72A 4HTGA 5I57B 4R73A 4MFIA 5FTIA 1MH4A 3SEVA 2I3WA 4U21A 5CRYA 4G68C 4ZECA 3Q27A 3PU5A 5CM6A 2RC9A 3MJNA 5HPQA 2UVJA 1P99A 2Y7WA 1I69A 1B05A 2NUVA 3DELB 3HO7A 3K6WA 4JWYA 4X1BA 2V84A 5FHNA 2HZKA 2DVZA 3UK4A 4KHZE 4NMYA 1LFGA 3L6HA 3MAMA 1SW1A 2O7IA 4HW8A 1FQBA 1B4ZA 1B3EA 3PPOA 5EHMA 4AB6A 3RLFE 2ZNTA 3H4ZA 4QSCA 3THIA 2BJJX 3U94A 2OZZA 2DXYA 1MRPA 1Y20A 5H8HA 3U8QA 3G3GA 2LAOA 1SW4A 3U92A 2PX1A 4RNSA 3O66A 3IK6B 4G2ZA 2A5TB 4GRKA 2P0SA 3TELA 3V83A 2ONRA 4OXVA 4JWXA 4WEDA 1ZJLA 4P11A 2ZYKA 3H6TA 4QFNA 1AMFA 3C4MA 1HSJA 5I2NB 1S9TA 4JDFA 3IB1A 4QSEA 3OMBA 4LZ7A 1B7HA 3RNNA 1LB8A 3CFZA 1UIVA 2I3VA 1FW0A 3OXNA 2XXHA 5IAIA 2VHAA 2DWIA 1PDAA 1XVYA 3FJGA 1AH5A 2O51A 3K1NA 4NF4B 4YU0A 3KN7A 5AA2D 1FTMA 1MS7A 1Y3QA 3B6QA 5DYHA 1TWYA 1MPCA 1LBBA 1JEVA 4QFPA 3QXMA 3W9VA 1CB6A 2Z8DA 4R6KA 2ZYNA 4IO6A 1O64A 4QSDA 4ZZAA 4U4XA 4YMAA 4LZ5A 5A5XB 3OEMA 3O6GA 1B5HA 3KGCA 3FXUA 4EXLA 5I59B 4POXA 5L9OA 2DOJA 3FXRA 3ECRA 4QFLA 3H06B 3LBSA 1WDNA 1GGGA 3VVFA 3E9XA 2OJTA 2GRVA 3O29A 4NF6B 1SW2A 4OFOA 1URGA 4TLLB 4U1OA 1SBPA 2VGQA 1N3XA 1OQGA 2DWAA 1SYIA 3R6UA 2QMXA 5H8FA 1SQYA 3MVWA 3UA8A 5HM4B 3RN8A 2I58A 3KJ7A 3L6GA 4OZ9A 3TEPA 4RK9A 1TT1A 2OBGA 5TP9B 3KG2A 1M5FA 2XD3A 2Y7PA 3LSFB 3GLBA 5DVIA 3IOTA 3S4UA 5AE4A 1FQEA 4RYAA 4DCXA 1SD3A 2HXWA 4IY5A 4U2RA 4DLDA 4P0GA 1OIBA 3SEWA 1QVSA 4DZ1A 3N6UA 2VD2A 3G3KA 1XVXA 2ZYMA 3GBAA 3K6UA 3FVNA 2ZYOA 4NF5A 4R75A 5L9MA 1MQDA 2CZLA 1FQAA 4KCDA 1R9LA 2ZMBA 3C31A 4QRZA 1Y9UA 4BLAA 1M5DA 3N26A 1MY3A 3CI8A 3VXCA 3UIFA 5AA2A 1FCKA 2F7BA 4OVJA 3S9MC 2H5YA 3S9NC 3B6WA 2NWJA 3IAZA 3KN8A 4KCCA 1POY1 4WEPA 1SYHA 2Z22A 3H7MA 4G68B 3BKIB 4K3FA 4IB2A 4X1DA 4Q30B 3VLUA 4EXKA 2THIA 4X9TA 1NKXA 1Y1MA 2O6AA 2NOOA 1JW5A 3C9HA 2REJA 3T9XB 4TOZA 4YKIA 2H25A 2HEUA 3GXAA 4IO5A 4YMBA 4GF8A 5H8NB 4G77A 4IO3A 1NNKA 4MBPA 3PD9A 1JVYA 3U72A 1QW0A 2Q8JA 1WVJA 3MP1A 5H8QA 4F3GA 3HV1A 4H5GA 4L17A 1MM6A 3O97A 2V93A 5DT6A 3V8XB 4F1VA 4RPNA 3PUZE 2VOZA 2DP8A 1P1QA 3USDA 4ZEFA 4ZEKA 3P7IA 3FASA 4KYSA 1MXXA 4YICA 3TZAA 4ZEIA 1IIWA 2O1LA 5AA1A 2Z8FA 3A09A 2UYFA 4LATA 2UVHA 3IOWA 1B3FA 2ABHA 2CMOA 5DVJA 2QMWA 3QK6A 3K00A 1RYXA 3LSLA 3O28A 4UACA 3VFJA 3FV1A 3N6TA 4GWOA 1VE4A 4N13A 5EYFA 2ONKE 3FUZA 2PYYA 4WKMA 4YB5A 1URSA 5I2KB 1A55A 3K2DA 3MBPA 2RF1A 3EN3A 1QJMA 3MVXA 3TYHA 3V89B 4PE5B 2D3IA 2I0BA 2GHBA 4EQ7A 1IZ1A 1QKAA 3FGSA 5JEIA 5HBCA 1SDXA 3WAEA 1H44A 1B2HA 2AYSA 2HZLA 3I5OA 5KDTB 1FTOA 2FA7A 5K2XA 2O7UA 3FJ7A 4KR5A 2H98A 3GBBA 3OO8A 3ZKKA 2GHAA 3PPQA 4LQ5A 4Z0IA 2F78A 1ELJA 4XTCQ 3H6WA 3I6VA 2RINA 4GOTA 4F3BA 2G93A 3VV5A 1N04A 3K01A 3MZBA 1H3DA 1JW1A 4I1DA 2X7PA 1H76A 3JZJA 3Q25A 1EU8A 2XXRA 4IO4A 3MW0A 4QF9A 4HCWA 4IO2A 1IXGA 2PT2A 2Q88A 3FVOA 4O3BA 3PPPA 4YKJA 4LQ2A 4BDRA 1Z7NE 2QRYA 3BFUA 4OEVA 2F5XA 1DMBA 4FORA 1SI0A 2AL4A 3K1MA 2DVCA 2KLFA 4WXJA 2OWSA 1NH8A 3IO4A 3MC2A 1BIYA 4THIA 2B3FA 4XKQA 5CBSA 2R6GE 1H45A 2ZNUA 4U23A 5BUUA 1HSEA 2QJEA 4UA8A 1AIVA 1LAFE 1QULA 1S50A 3VXBA 3PGFA 3PUVE 5H8HB 4BDQA 1US4A 1BTJA 4OYVA 4ECFA 3D4CA 4OETA 4YKKA 3M3FA 5ITPA 1EH3A 4GXSB 1UTBA 2R71A 4U22A 5AA4B 1ANFA 3A3CA 4XKPA 1I6QA 1JNFA 1A8FA 2PBWA 1Y3PA 1D4NA 1MY1A 3PV0E 2D5WA 1MH3A 4LONB 4TQUQ 1B0LA 2O68A 1ZU0A 1J1NA 1FTJA 2G29A 3IOUA 3OO9A 1TXFA 1OMPA 1N84A 3IR1A 2H9BA 3E3KA 3ODBA 5H8FB 4IO7A 3T96B 2V3UA 1IUDA 3IL1B 3UORA 4BDNA 4F3PA 5I2KA 5JK4A 4RK2A 2X26A 3MVZA 5CBRA 1VFDA 1JEUA 3JV9A 1B3HA 3MP6A 3ONMA 3FZVA 4PP0A 3ZS6A 4G8MA 4DXCA 4BDMA 1B5JA 3O2AA 1O7TA 2I49A 3OO7A 4QHQA 3DM0A 1YCJA 2WKYA 3UGWA 1ATGA 5M2VA 4AQ4A 1FTKA 3E13X 5DTBA 3TODA 2REGA 2PVUA 1VR5A 3S2VA 3PUWE 1A99A 1M5CA 3HCQA 1P1NA 1USYH 2XXIA 2Z8EA 3G7WA 3K1PA 3M8UA 3QSLA 2ZXTA 1XOCA 3C33A 1QKBA 4DDDA 1EZPA 4LUBA 1N76A 3OENA 2R9JA 3MZ9A 5CMKA 5ELVA 1EZOA 1Y3NA 1QUJA 5ICQA 2H99A 2XXXA 3K6VA 4C1UA 1PEBA 1Y4CA 4F22A 1A8EA 2F97A 2D21A 1MQJA 4I62A 3SESA 3SEUA 4RY1A 1CE2A 3CIJA 2DE4A 1B52A 3OELA 1LAHE 1B1XA 2F7CA 2HAVA 1A40A 3PPNA 4OTEA 3Q28A 4H1XA 5I57A 1B3GA 1DTZA 3QYTA 3VE1B 1ZBMA 1BKAA 4ZS9A 3K6XA 4F19A 1BP5A 3CFXA 2PMSA 1AL3A 3FD3A 1MXWA 3TTKA 1MDP1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LZ8 A;  1LGB C;  2F7A A;  2OCU A;  4NF8 A;  4PQJ A;  4F18 A;  2YPN A;  4F29 A;  1Y4T A;  1ZMG A;  1MDQ A;  4KD5 A;  1YAE A;  2F6G A;  2XXV A;  3FVK A;  5TPA B;  1AOV A;  1UTH B;  3CFL A;  1ZTY A;  1B6H A;  3C36 A;  1KWH A;  1MXV A;  2H4I A;  3K4U A;  2UVI A;  3O9P A;  2I6E A;  2Q2C A;  2Q89 A;  2RC7 A;  4GD5 A;  2OWT A;  1LBC A;  2VP1 A;  2W7Y A;  5EHS A;  4EQB A;  1SW5 A;  5I2N A;  5JTY B;  4MLQ A;  3TDJ A;  3M3L A;  4F31 B;  4NTL A;  3TKD A;  4X48 A;  3PD8 A;  4P0I A;  1UQW A;  1FTL A;  3QUJ A;  3G3I A;  3G3J A;  3IOV A;  1MQI A;  2B65 A;  3V5A A;  3OOA A;  4DXB A;  2QL3 A;  2V25 A;  1TFD A;  1B3L A;  1OQH A;  2M8C A;  3T66 A;  5AA3 A;  3HHF A;  3U1O A;  3IO6 A;  4OHN A;  2DE3 A;  2RC8 A;  3MVY A;  4EDP A;  1OLA A;  4XKN A;  3MP8 A;  2Z23 A;  2V3Q A;  2FNC A;  1D9Y A;  1MXU A;  4ONY A;  1USY E;  1MPB A;  1A7L A;  4GL0 A;  3RT6 B;  1DPP A;  4H5F A;  3RPW A;  3LC8 A;  1XC1 A;  3T9U A;  4YB7 A;  5KDT A;  2ALU A;  3OSQ A;  3DP6 A;  2RCA A;  2O1M A;  3OEK A;  4KFQ A;  3SEX A;  2NVU B;  2XHD A;  3PUX E;  4ELR A;  4Z7E A;  1D9V A;  2ESN A;  2DQV A;  5B7D A;  3BBR A;  4F3S A;  4JWO A;  5CMM A;  5H8N A;  2XX7 A;  1P1W A;  1N3W A;  3KEI A;  4H8I A;  2YLN A;  2XX9 A;  4O3A A;  4EQ9 A;  4Q8R A;  4XKR A;  3PPR A;  4ESX A;  3TCH A;  5I58 A;  3EHT A;  4OFJ A;  4C1T A;  4PFY A;  4EUO A;  5ICT A;  4U4S A;  1ZLQ A;  3H3G A;  2XX8 A;  4IY6 A;  3TMG A;  3TUS A;  3ILT B;  3KBR A;  4RJZ A;  4YKP A;  1YTV A;  5I84 A;  2F35 A;  5KCJ A;  4PFW A;  3TCF A;  4ZE9 A;  3LUY A;  3N5L A;  4FE8 A;  3S9L C;  4G8H A;  3WAF A;  3IJO B;  3IX1 A;  3DP4 A;  1L5T A;  3VVD A;  3MWB A;  1PB7 A;  4ZZE A;  4PFT A;  4FED A;  1N7W A;  4JXI A;  3C34 A;  5CC2 A;  3VVE A;  1TFA A;  4ELO A;  1RKM A;  3IJX B;  4GXA A;  1XT8 A;  4OEN A;  3LSW A;  1A54 A;  1IIT A;  1F9B A;  3VDF A;  1NMU A;  3T22 A;  1DTG A;  1LFI A;  3T9H B;  4OES A;  1B40 A;  3Q26 A;  4GFR A;  5TP9 A;  5FTH A;  1PC3 A;  1IQ7 A;  2P2A A;  3G3H A;  3SKP A;  3G3F A;  1QUI A;  2QSX A;  3T93 B;  4ZED A;  4GIZ A;  1B58 A;  1MPD A;  1I6A A;  1XHY A;  2I0C A;  4R6Y A;  3RGY A;  3U93 A;  5I56 B;  2UVG A;  2Q2A A;  1VSO A;  3QAX A;  2DSF A;  4I9D A;  4GVO A;  3RTF B;  4GLI A;  3OSR A;  3IOR A;  4NE4 A;  3D4G A;  1MQH A;  1LAG E;  2O69 A;  4LVQ A;  2I4B A;  5DVF A;  2F34 A;  5F7V A;  4EF1 A;  1OLC A;  4BDL A;  5DEX B;  3OD7 A;  4EF2 A;  2XXP A;  4PFU A;  5AA2 B;  4BDO A;  3KJT A;  3SER A;  4E0W A;  5CMC A;  5LOM A;  1UIU A;  5KZT A;  4KI0 E;  2O84 X;  1R1N A;  3EPE A;  5FHM A;  1R9Q A;  2I4C A;  1BLF A;  2QPQ A;  3KN3 A;  4NED A;  4RA1 A;  1I6B A;  3MPK A;  3VLV A;  3ZKL A;  1GV8 A;  3HHG A;  4GL8 A;  2QS2 A;  4TLM B;  2DYX A;  4XXU A;  3R26 A;  2IA4 A;  1LST A;  3O6I A;  2ZNS A;  1NFT A;  4H67 A;  4KQP A;  1QUK A;  2HQ0 A;  4JSD A;  1FQD A;  1MY4 A;  1IXC A;  1HSL A;  1SI1 A;  4NF6 A;  3TFL A;  3TQL A;  2ANJ A;  4IGT A;  1B9J A;  1RYO A;  5A5X A;  1T0K A;  5J1D A;  1PBP A;  2OLB A;  3HPI A;  2QS3 A;  3QIM A;  4ZEB A;  2F36 A;  1DSN A;  3TTR A;  3MPL A;  1O63 A;  2Q9T A;  5F1Q A;  4ELP A;  5CMB A;  3FJM A;  4OER A;  5ITO A;  1PB8 A;  4C0R A;  4F1Y A;  1NNT A;  3OO6 A;  3FIR A;  4I8C A;  3H03 A;  4MLV A;  3W15 C;  3Q29 A;  2QS1 A;  3KFM A;  5H8Q B;  1JW4 A;  4FEC A;  1PBQ A;  3KSX A;  4M4G A;  1MM7 A;  1B1H A;  1JET A;  2X7Q A;  4Q5T A;  3JYR A;  5TU0 A;  2OK2 A;  3GZG A;  4AB5 A;  1UTH A;  4HCY A;  1LFH A;  2A5T A;  4DE8 A;  1H43 A;  1ZIU A;  1JVX A;  3FAT A;  4NWD A;  4R2B A;  2HFB A;  2Y7I A;  3RY3 A;  4NWC A;  4NF4 A;  3SET A;  4MF3 A;  4NF8 B;  3UN6 A;  2Y7K A;  3H6V A;  3BFT A;  2UXA A;  1N0T A;  4JSO A;  3TTN A;  4G68 A;  3IB0 A;  4H65 A;  4KPT A;  4Q0C A;  3RQT A;  1GR2 A;  3TCG A;  1MG1 A;  4PET A;  1DPE A;  1B46 A;  5I59 A;  1FQF A;  2GFE A;  3CSG A;  1GTK A;  2F6P A;  4N07 A;  3RT8 A;  3H6U A;  3PMW A;  1MY0 A;  1LLS A;  1NL5 A;  4POW A;  1R6Z A;  3MQ9 A;  3PMV A;  3T9V A;  1WOD A;  1P1U A;  1Q35 A;  1FQC A;  1US5 A;  3KOT A;  1IXI A;  4G4P A;  4FJP A;  4IGR A;  1MQG A;  4R6H A;  3E4R A;  4M1V A;  3CR9 A;  4DIG A;  4ESW A;  2DWJ A;  2IEE A;  3EHU A;  1GVC A;  4H0W A;  2PT1 A;  4QFO A;  3RUM A;  3O6H A;  3PMX A;  2HCA A;  3TPA A;  4GQO A;  4XIG Q;  3B6T A;  4U1Z A;  2DE2 A;  5KCJ B;  4ZDM A;  1EZ9 A;  2QS4 A;  3SEY A;  1M5B A;  1LCF A;  3KOS A;  1LCT A;  2P1S A;  2XXU A;  3CG3 A;  3CSB A;  3DLN A;  3HN0 A;  4JBZ A;  5FHO A;  4F39 A;  3FV2 A;  5ISU A;  3TTL A;  5BWJ A;  4JB7 A;  3TTM A;  2XXW A;  1DOT A;  1LB9 A;  1NH7 A;  4NF5 B;  5I56 A;  2RKM A;  2XXQ A;  4LA9 A;  3TAJ A;  3PUY E;  4OFL A;  2Y84 A;  4R9G A;  1M5E A;  3LR1 A;  1B5I A;  2ONS A;  4DCY A;  2XD2 A;  4O3C A;  5I58 B;  1N7X A;  2AIX A;  1D3K A;  1SVX B;  1B7U A;  5CI5 A;  5K2Y A;  5L8D A;  4H6D A;  3CVG A;  1B4H A;  1VFE A;  1XS5 A;  3FXQ A;  3R7X A;  3RTW B;  1PB9 A;  1ZKB A;  3ILU B;  5AA4 A;  4ZE8 A;  4F2O A;  2XXT A;  4OEU A;  4E0X A;  2V3T A;  1MXY A;  1MXZ A;  2DWH A;  3DP8 A;  4YB6 A;  2A5S A;  3F11 A;  3IB2 A;  5L9S A;  3CRB A;  1P1O A;  1OVB A;  3S9E A;  3AXF A;  4R74 A;  2DS9 A;  3M3K A;  4KYE A;  1B7Z A;  2E0S A;  2RCB A;  2I48 A;  3QUF A;  4KYD A;  3TQW A;  1Z7M E;  3CG1 A;  4R9F A;  1NNF A;  3SDF A;  3EHS A;  4FAJ A;  1LAX A;  3K0V A;  1Y1Z A;  2B3B A;  2VD3 A;  4G8N A;  4F2Q A;  4ELQ A;  4LP2 B;  4RPO A;  1S7Y A;  3I3V A;  3C32 A;  2E1S A;  1Q1K A;  2F8D A;  2HAU A;  1II5 A;  3KZG A;  3LSX A;  4RXL A;  1IEJ A;  1MY2 A;  4OQO A;  5H8S A;  4YAH X;  5B70 A;  3EQ1 A;  2NXO A;  4N6P A;  1YPN A;  2XXY A;  3EF7 A;  3UP9 A;  4YZZ A;  3MUQ A;  4DXU A;  5JTY A;  3B7D A;  3W9W A;  5IKB A;  4FAT A;  2DXR A;  1IXH A;  4ND9 A;  1B0H A;  1JQF A;  2YJP A;  4OMB A;  2AL5 A;  1NNP A;  1B51 A;  3KSJ A;  5DEX A;  3HST A;  1POT A;  2UYE A;  3C35 A;  3MZ1 A;  5TPA A;  3ZSF A;  3FVG A;  4R2F A;  1OVT A;  2GH9 A;  1B32 A;  1UTB B;  2FYI A;  3K02 A;  4OWD A;  2Y7R A;  4FEB A;  3N94 A;  3VLW A;  4F1U A;  3A3U A;  4FIM A;  4HS7 A;  4ISU A;  1URD A;  4H8J A;  4MH5 A;  4QFK A;  4R72 A;  4HTG A;  5I57 B;  4R73 A;  4MFI A;  5FTI A;  1MH4 A;  3SEV A;  2I3W A;  4U21 A;  5CRY A;  4G68 C;  4ZEC A;  3Q27 A;  3PU5 A;  5CM6 A;  2RC9 A;  3MJN A;  5HPQ A;  2UVJ A;  1P99 A;  2Y7W A;  1I69 A;  1B05 A;  2NUV A;  3DEL B;  3HO7 A;  3K6W A;  4JWY A;  4X1B A;  2V84 A;  5FHN A;  2HZK A;  2DVZ A;  3UK4 A;  4KHZ E;  4NMY A;  1LFG A;  3L6H A;  3MAM A;  1SW1 A;  2O7I A;  4HW8 A;  1FQB A;  1B4Z A;  1B3E A;  3PPO A;  5EHM A;  4AB6 A;  3RLF E;  2ZNT A;  3H4Z A;  4QSC A;  3THI A;  2BJJ X;  3U94 A;  2OZZ A;  2DXY A;  1MRP A;  1Y20 A;  5H8H A;  3U8Q A;  3G3G A;  2LAO A;  1SW4 A;  3U92 A;  2PX1 A;  4RNS A;  3O66 A;  3IK6 B;  4G2Z A;  2A5T B;  4GRK A;  2P0S A;  3TEL A;  3V83 A;  2ONR A;  4OXV A;  4JWX A;  4WED A;  1ZJL A;  4P11 A;  2ZYK A;  3H6T A;  4QFN A;  1AMF A;  3C4M A;  1HSJ A;  5I2N B;  1S9T A;  4JDF A;  3IB1 A;  4QSE A;  3OMB A;  4LZ7 A;  1B7H A;  3RNN A;  1LB8 A;  3CFZ A;  1UIV A;  2I3V A;  1FW0 A;  3OXN A;  2XXH A;  5IAI A;  2VHA A;  2DWI A;  1PDA A;  1XVY A;  3FJG A;  1AH5 A;  2O51 A;  3K1N A;  4NF4 B;  4YU0 A;  3KN7 A;  5AA2 D;  1FTM A;  1MS7 A;  1Y3Q A;  3B6Q A;  5DYH A;  1TWY A;  1MPC A;  1LBB A;  1JEV A;  4QFP A;  3QXM A;  3W9V A;  1CB6 A;  2Z8D A;  4R6K A;  2ZYN A;  4IO6 A;  1O64 A;  4QSD A;  4ZZA A;  4U4X A;  4YMA A;  4LZ5 A;  5A5X B;  3OEM A;  3O6G A;  1B5H A;  3KGC A;  3FXU A;  4EXL A;  5I59 B;  4POX A;  5L9O A;  2DOJ A;  3FXR A;  3ECR A;  4QFL A;  3H06 B;  3LBS A;  1WDN A;  1GGG A;  3VVF A;  3E9X A;  2OJT A;  2GRV A;  3O29 A;  4NF6 B;  1SW2 A;  4OFO A;  1URG A;  4TLL B;  4U1O A;  1SBP A;  2VGQ A;  1N3X A;  1OQG A;  2DWA A;  1SYI A;  3R6U A;  2QMX A;  5H8F A;  1SQY A;  3MVW A;  3UA8 A;  5HM4 B;  3RN8 A;  2I58 A;  3KJ7 A;  3L6G A;  4OZ9 A;  3TEP A;  4RK9 A;  1TT1 A;  2OBG A;  5TP9 B;  3KG2 A;  1M5F A;  2XD3 A;  2Y7P A;  3LSF B;  3GLB A;  5DVI A;  3IOT A;  3S4U A;  5AE4 A;  1FQE A;  4RYA A;  4DCX A;  1SD3 A;  2HXW A;  4IY5 A;  4U2R A;  4DLD A;  4P0G A;  1OIB A;  3SEW A;  1QVS A;  4DZ1 A;  3N6U A;  2VD2 A;  3G3K A;  1XVX A;  2ZYM A;  3GBA A;  3K6U A;  3FVN A;  2ZYO A;  4NF5 A;  4R75 A;  5L9M A;  1MQD A;  2CZL A;  1FQA A;  4KCD A;  1R9L A;  2ZMB A;  3C31 A;  4QRZ A;  1Y9U A;  4BLA A;  1M5D A;  3N26 A;  1MY3 A;  3CI8 A;  3VXC A;  3UIF A;  5AA2 A;  1FCK A;  2F7B A;  4OVJ A;  3S9M C;  2H5Y A;  3S9N C;  3B6W A;  2NWJ A;  3IAZ A;  3KN8 A;  4KCC A;  1POY 1;  4WEP A;  1SYH A;  2Z22 A;  3H7M A;  4G68 B;  3BKI B;  4K3F A;  4IB2 A;  4X1D A;  4Q30 B;  3VLU A;  4EXK A;  2THI A;  4X9T A;  1NKX A;  1Y1M A;  2O6A A;  2NOO A;  1JW5 A;  3C9H A;  2REJ A;  3T9X B;  4TOZ A;  4YKI A;  2H25 A;  2HEU A;  3GXA A;  4IO5 A;  4YMB A;  4GF8 A;  5H8N B;  4G77 A;  4IO3 A;  1NNK A;  4MBP A;  3PD9 A;  1JVY A;  3U72 A;  1QW0 A;  2Q8J A;  1WVJ A;  3MP1 A;  5H8Q A;  4F3G A;  3HV1 A;  4H5G A;  4L17 A;  1MM6 A;  3O97 A;  2V93 A;  5DT6 A;  3V8X B;  4F1V A;  4RPN A;  3PUZ E;  2VOZ A;  2DP8 A;  1P1Q A;  3USD A;  4ZEF A;  4ZEK A;  3P7I A;  3FAS A;  4KYS A;  1MXX A;  4YIC A;  3TZA A;  4ZEI A;  1IIW A;  2O1L A;  5AA1 A;  2Z8F A;  3A09 A;  2UYF A;  4LAT A;  2UVH A;  3IOW A;  1B3F A;  2ABH A;  2CMO A;  5DVJ A;  2QMW A;  3QK6 A;  3K00 A;  1RYX A;  3LSL A;  3O28 A;  4UAC A;  3VFJ A;  3FV1 A;  3N6T A;  4GWO A;  1VE4 A;  4N13 A;  5EYF A;  2ONK E;  3FUZ A;  2PYY A;  4WKM A;  4YB5 A;  1URS A;  5I2K B;  1A55 A;  3K2D A;  3MBP A;  2RF1 A;  3EN3 A;  1QJM A;  3MVX A;  3TYH A;  3V89 B;  4PE5 B;  2D3I A;  2I0B A;  2GHB A;  4EQ7 A;  1IZ1 A;  1QKA A;  3FGS A;  5JEI A;  5HBC A;  1SDX A;  3WAE A;  1H44 A;  1B2H A;  2AYS A;  2HZL A;  3I5O A;  5KDT B;  1FTO A;  2FA7 A;  5K2X A;  2O7U A;  3FJ7 A;  4KR5 A;  2H98 A;  3GBB A;  3OO8 A;  3ZKK A;  2GHA A;  3PPQ A;  4LQ5 A;  4Z0I A;  2F78 A;  1ELJ A;  4XTC Q;  3H6W A;  3I6V A;  2RIN A;  4GOT A;  4F3B A;  2G93 A;  3VV5 A;  1N04 A;  3K01 A;  3MZB A;  1H3D A;  1JW1 A;  4I1D A;  2X7P A;  1H76 A;  3JZJ A;  3Q25 A;  1EU8 A;  2XXR A;  4IO4 A;  3MW0 A;  4QF9 A;  4HCW A;  4IO2 A;  1IXG A;  2PT2 A;  2Q88 A;  3FVO A;  4O3B A;  3PPP A;  4YKJ A;  4LQ2 A;  4BDR A;  1Z7N E;  2QRY A;  3BFU A;  4OEV A;  2F5X A;  1DMB A;  4FOR A;  1SI0 A;  2AL4 A;  3K1M A;  2DVC A;  2KLF A;  4WXJ A;  2OWS A;  1NH8 A;  3IO4 A;  3MC2 A;  1BIY A;  4THI A;  2B3F A;  4XKQ A;  5CBS A;  2R6G E;  1H45 A;  2ZNU A;  4U23 A;  5BUU A;  1HSE A;  2QJE A;  4UA8 A;  1AIV A;  1LAF E;  1QUL A;  1S50 A;  3VXB A;  3PGF A;  3PUV E;  5H8H B;  4BDQ A;  1US4 A;  1BTJ A;  4OYV A;  4ECF A;  3D4C A;  4OET A;  4YKK A;  3M3F A;  5ITP A;  1EH3 A;  4GXS B;  1UTB A;  2R71 A;  4U22 A;  5AA4 B;  1ANF A;  3A3C A;  4XKP A;  1I6Q A;  1JNF A;  1A8F A;  2PBW A;  1Y3P A;  1D4N A;  1MY1 A;  3PV0 E;  2D5W A;  1MH3 A;  4LON B;  4TQU Q;  1B0L A;  2O68 A;  1ZU0 A;  1J1N A;  1FTJ A;  2G29 A;  3IOU A;  3OO9 A;  1TXF A;  1OMP A;  1N84 A;  3IR1 A;  2H9B A;  3E3K A;  3ODB A;  5H8F B;  4IO7 A;  3T96 B;  2V3U A;  1IUD A;  3IL1 B;  3UOR A;  4BDN A;  4F3P A;  5I2K A;  5JK4 A;  4RK2 A;  2X26 A;  3MVZ A;  5CBR A;  1VFD A;  1JEU A;  3JV9 A;  1B3H A;  3MP6 A;  3ONM A;  3FZV A;  4PP0 A;  3ZS6 A;  4G8M A;  4DXC A;  4BDM A;  1B5J A;  3O2A A;  1O7T A;  2I49 A;  3OO7 A;  4QHQ A;  3DM0 A;  1YCJ A;  2WKY A;  3UGW A;  1ATG A;  5M2V A;  4AQ4 A;  1FTK A;  3E13 X;  5DTB A;  3TOD A;  2REG A;  2PVU A;  1VR5 A;  3S2V A;  3PUW E;  1A99 A;  1M5C A;  3HCQ A;  1P1N A;  1USY H;  2XXI A;  2Z8E A;  3G7W A;  3K1P A;  3M8U A;  3QSL A;  2ZXT A;  1XOC A;  3C33 A;  1QKB A;  4DDD A;  1EZP A;  4LUB A;  1N76 A;  3OEN A;  2R9J A;  3MZ9 A;  5CMK A;  5ELV A;  1EZO A;  1Y3N A;  1QUJ A;  5ICQ A;  2H99 A;  2XXX A;  3K6V A;  4C1U A;  1PEB A;  1Y4C A;  4F22 A;  1A8E A;  2F97 A;  2D21 A;  1MQJ A;  4I62 A;  3SES A;  3SEU A;  4RY1 A;  1CE2 A;  3CIJ A;  2DE4 A;  1B52 A;  3OEL A;  1LAH E;  1B1X A;  2F7C A;  2HAV A;  1A40 A;  3PPN A;  4OTE A;  3Q28 A;  4H1X A;  5I57 A;  1B3G A;  1DTZ A;  3QYT A;  3VE1 B;  1ZBM A;  1BKA A;  4ZS9 A;  3K6X A;  4F19 A;  1BP5 A;  3CFX A;  2PMS A;  1AL3 A;  3FD3 A;  1MXW A;  3TTK A;  1MDP 1; 
#chains in the Genus database with same CATH topology
 2PCR A;  4F29 A;  4PGN A;  1UTH B;  4YB7 A;  2UVI A;  4HE2 A;  4MLQ A;  3M3L A;  4X48 A;  3G3I A;  1MQI A;  2B65 A;  3OOA A;  1FPJ A;  1B3L A;  1OQH A;  2M8C A;  1KA1 A;  3IO6 A;  4EDP A;  2Z23 A;  2WBD A;  4ONY A;  1A7L A;  3MST A;  2RCA A;  4ELR A;  3PUX E;  4Z7E A;  4I40 A;  1FBG A;  3BBR A;  4F3S A;  5H8N A;  1N3W A;  4EQ9 A;  5ICT A;  4GWZ A;  1NV6 A;  3H3G A;  3TMG A;  3ILT B;  4YKP A;  4ZE9 A;  4G8H A;  4MCO A;  3DP4 A;  4MMP A;  1PB7 A;  5DW8 A;  4PFT A;  1N7W A;  3VVE A;  1TFA A;  2WYK A;  1FPB A;  4OEN A;  1A54 A;  1IIT A;  3KC0 A;  3T22 A;  1LFI A;  4PAI A;  2CZK A;  1B40 A;  3G3F A;  1QUI A;  4GIZ A;  1B58 A;  2I0C A;  1I6A A;  2FIE A;  2Q2A A;  3QAX A;  4I9D A;  3OSR A;  2O69 A;  5DVF A;  3OD7 A;  5AA2 B;  2HHM A;  2O84 X;  1R1N A;  1R9Q A;  2I4C A;  4NED A;  2Y5L A;  2DYX A;  3R26 A;  4NF6 A;  4O8M A;  1SI1 A;  4G61 A;  5A5X A;  2QS3 A;  3QIM A;  3TTR A;  4OER A;  4C0R A;  1PB8 A;  1NNT A;  4MLV A;  3H03 A;  3KFM A;  5H8Q B;  1PBQ A;  3KSX A;  1MM7 A;  3KC1 A;  3GZG A;  2A5T A;  1H43 A;  2XWV A;  2Y7K A;  3BFT A;  4H65 A;  5ET6 A;  1DPE A;  1LLS A;  3KBZ A;  1WOD A;  4R6H A;  3E4R A;  3EHU A;  3GYY A;  3RUM A;  3O6H A;  3TPA A;  2XXK A;  5ET7 A;  2XXU A;  3HN0 A;  5FHO A;  4JBZ A;  2XXW A;  1DOT A;  2RKM A;  2Y84 A;  1M5E A;  3LR1 A;  5I58 B;  1N7X A;  1D3K A;  1SVX B;  3CVG A;  4I3E A;  1XS5 A;  3R7X A;  1PB9 A;  1ZKB A;  4ZE8 A;  1MXY A;  1MXZ A;  4YB6 A;  3F11 A;  3IB2 A;  3CRB A;  3AXF A;  3M3K A;  2E0S A;  2RCB A;  1NV4 A;  3TQW A;  1NNF A;  3SDF A;  4FAJ A;  1FBH A;  4RPO A;  4P8B A;  3I3V A;  1II5 A;  5EQA A;  4OQO A;  1NV5 A;  5A5L A;  4N6P A;  4YZZ A;  1FBD A;  5JTY A;  3B7D A;  4OVQ A;  4FAT A;  1G0H A;  1IXH A;  4OMB A;  1FPF A;  1B51 A;  1POT A;  3MZ1 A;  5TPA A;  3FVG A;  1B32 A;  1UTB B;  2FYI A;  4FEB A;  3VLW A;  4F1U A;  3A3U A;  5I57 B;  4H8J A;  1MH4 A;  2I3W A;  4U21 A;  4ZEC A;  2UVJ A;  1FTA A;  2NUV A;  3DEL B;  4OVS A;  2DVZ A;  4KHZ E;  3MAM A;  3RLF E;  2ZNT A;  1LBV A;  1MRP A;  5H8H A;  3U8Q A;  2PX1 A;  3IK6 B;  4GRK A;  2P0S A;  4OXV A;  4JWX A;  4P11 A;  3H6T A;  3C4M A;  1S9T A;  4JDF A;  4QSE A;  1FPE A;  3CFZ A;  3ROJ A;  1FW0 A;  3T0J A;  5IAI A;  2VHA A;  3FJG A;  3K1N A;  5AA2 D;  5DYH A;  1LBB A;  1JEV A;  4QFP A;  2Z8D A;  1B5H A;  5L9O A;  3FXU A;  2DOJ A;  4U1O A;  2DWA A;  1SYI A;  3RN8 A;  2I58 A;  3TEP A;  5EQ7 A;  1TT1 A;  1NV0 A;  5TP9 B;  3LSF B;  3GLB A;  4KXP A;  1FQE A;  4RYA A;  4DLD A;  3SEW A;  2VD2 A;  2ZYM A;  5L9M A;  3FVN A;  2ZYO A;  1FQA A;  1R9L A;  4QRZ A;  3VXC A;  1MY3 A;  3IAZ A;  1POY 1;  4WEP A;  4G68 B;  4X1D A;  4IB2 A;  3D1R A;  5H8N B;  4YKI A;  4G77 A;  4IO3 A;  1NNK A;  4X04 A;  3MP1 A;  4F3G A;  4H5G A;  1MM6 A;  3V8X B;  1P1Q A;  4XFE A;  1IIW A;  2CZH A;  3HFU A;  2QMW A;  3QK6 A;  2B4L A;  1FJ6 A;  4UAC A;  5IZ3 B;  4YB5 A;  3K2D A;  3V89 B;  3MVX A;  1IMA A;  2I0B A;  2GHB A;  4EQ7 A;  3FGS A;  3BIG A;  1B2H A;  3I5O A;  2FA7 A;  5K2X A;  3ZKK A;  1N04 A;  1EYJ A;  1JW1 A;  4QF9 A;  4IO2 A;  4YKJ A;  3IFC A;  3A29 A;  3BFU A;  2AL4 A;  2B3F A;  3CHG A;  1H45 A;  1HSE A;  2QJE A;  4UA8 A;  1LAF E;  1QUL A;  4GWU A;  3VXB A;  3PGF A;  2CZI A;  2Q74 A;  3D4C A;  5ITP A;  1EH3 A;  1FPK A;  4GBW A;  4U22 A;  3ISP A;  5AA4 B;  1I6Q A;  1MY1 A;  2XWI A;  3PV0 E;  2F3D A;  2O68 A;  1N84 A;  3IR1 A;  3UN6 A;  3ODB A;  4F3P A;  5JK4 A;  4BDN A;  3MP6 A;  2I49 A;  1FTK A;  1VR5 A;  3PUW E;  1M5C A;  1USY H;  2Z8E A;  4O7M A;  1QKB A;  3MZ9 A;  3K6V A;  4C1U A;  4F22 A;  1Y4C A;  1A8E A;  2F97 A;  3CIJ A;  2DE4 A;  2F7C A;  2P3V A;  2XA5 A;  3PPN A;  2DDK A;  1DTZ A;  3E79 A;  3VE1 B;  1BKA A;  3K6X A;  1AL3 A;  1M5F A;  4NF8 A;  1LGB C;  4PQJ A;  4F18 A;  1ZMG A;  4KD5 A;  1YAE A;  5TPA B;  1EZO A;  3O9P A;  1ZTY A;  1KWH A;  4PFY A;  4P56 A;  2Q2C A;  2KQZ A;  2RC7 A;  2OWT A;  1LBC A;  2VP1 A;  2W7Y A;  5EHS A;  5ESY A;  5JTY B;  4F31 B;  2VPO A;  3PD8 A;  3V5A A;  2V25 A;  5AA3 A;  3IFA A;  4XKN A;  2FNC A;  1D9Y A;  1MXU A;  1USY E;  1MPB A;  1XC1 A;  1FPD A;  3DP6 A;  4Q8R A;  1ZLQ A;  4IY6 A;  1DCU A;  2WEF A;  4RJZ A;  2F35 A;  5KCJ A;  1NI9 A;  3N5L A;  3IJO B;  3IX1 A;  4NF0 A;  4HXV A;  1RKM A;  3LUZ A;  4XF5 A;  3VDF A;  1DTG A;  3Q26 A;  4GFR A;  5FTH A;  3SKP A;  2P2A A;  4ZED A;  1MPD A;  2UVG A;  4P9K A;  2DSF A;  4JVI A;  3IOR A;  4NE4 A;  4JVD A;  4PF8 A;  1MQH A;  2I4B A;  2F34 A;  4BDL A;  4E0W A;  5LOM A;  2HPG A;  4KI0 E;  4RA1 A;  1I6B A;  4GL8 A;  4XXU A;  1NFT A;  4JSD A;  1FQD A;  3TQL A;  1B9J A;  1T0K A;  1SPI A;  3HPI A;  5ET8 A;  5ITO A;  4F1Y A;  3OO6 A;  3FIR A;  4I8C A;  3Q29 A;  2QS1 A;  1JW4 A;  4FEC A;  1B1H A;  2X7Q A;  4Q5T A;  5I7I A;  3JYR A;  4X8R A;  5TU0 A;  2OK2 A;  4AB5 A;  4HCY A;  3UP9 A;  4NWD A;  1JVX A;  2HFB A;  2Y7I A;  3RY3 A;  4NF8 B;  4QXD A;  3H6V A;  3TTN A;  4KPT A;  3IB0 A;  4Q0C A;  3TCG A;  1MG1 A;  5IZ1 A;  1B46 A;  1FQF A;  2GFE A;  3CSG A;  1GTK A;  3RT8 A;  2MKZ A;  4POW A;  3T9V A;  3KOT A;  4G4P A;  4FJP A;  1MQG A;  4DIG A;  3CR9 A;  4AS5 A;  1GVC A;  4H0W A;  4PGP A;  3PMX A;  4GQO A;  4GWX A;  3B6T A;  1EZ9 A;  3SEY A;  1M5B A;  2QVV A;  1LCF A;  4N6K A;  1LCT A;  2P1S A;  4F39 A;  5BWJ A;  4JB7 A;  1LB9 A;  5I56 A;  3TAJ A;  2ONS A;  5K2Y A;  5CI5 A;  5L8D A;  4H6D A;  4OAN A;  3FXQ A;  3RPL A;  3ILU B;  5AA4 A;  1INP A;  4E0X A;  3DP8 A;  2A5S A;  1OVB A;  2XWK A;  4P1L A;  3QUF A;  5I5P A;  1Z7M E;  2GQ1 A;  4R9F A;  5IGA A;  3E78 A;  2B3B A;  2VD3 A;  4PBH A;  1S7Y A;  3C32 A;  1Q1K A;  5H8S A;  2NXO A;  1YPN A;  2P3N A;  3EF7 A;  1JP4 A;  2YJP A;  4LN5 A;  2ZZX A;  4FBP A;  3KSJ A;  3C35 A;  1OVT A;  2GH9 A;  3K02 A;  2Y7R A;  4FIM A;  4MH5 A;  1DBZ A;  1URD A;  4R73 A;  3MJN A;  1P99 A;  1I69 A;  4GX6 A;  4JWY A;  2V84 A;  4NMY A;  2O7I A;  1FQB A;  4JVC A;  3THI A;  2BJJ X;  3U94 A;  2OZZ A;  3LV0 A;  1Y20 A;  1SW4 A;  2ZZW A;  4WED A;  2ONR A;  3ZKL A;  2ZYK A;  4QFN A;  3OMB A;  1B7H A;  3RNN A;  1UIV A;  2I3V A;  4N91 A;  1AH5 A;  4YU0 A;  1MS7 A;  1Y3Q A;  1MPC A;  2ZYN A;  4ZZA A;  1RDY A;  4LZ5 A;  3OEM A;  3KGC A;  4POX A;  3FXR A;  4QFL A;  3H06 B;  1WDN A;  2GRV A;  4TLL B;  4OFO A;  1URG A;  1SBP A;  4GWY A;  2QMX A;  5H8F A;  2FBP A;  3L6G A;  2OBG A;  1NV1 A;  3KG2 A;  2Y7P A;  5AE4 A;  4P0G A;  1OIB A;  1QVS A;  4NF5 A;  3GBA A;  2CZL A;  2ZMB A;  4BLA A;  5AA2 A;  3S9M C;  3S9N C;  1XI6 A;  4KCC A;  2Z22 A;  1Y1M A;  2NOO A;  2REJ A;  2H25 A;  2HEU A;  4PE3 A;  4HE0 A;  3PD9 A;  1QW0 A;  3O97 A;  2V93 A;  5DT6 A;  4F1V A;  1IMC A;  3PUZ E;  2VOZ A;  3TZA A;  1B3F A;  2CMO A;  5DVJ A;  3B8B A;  1RYX A;  3O28 A;  1G0I A;  4GWO A;  5EYF A;  3FUZ A;  4WKM A;  5I2K B;  1A55 A;  2FIX A;  3EN3 A;  3TYH A;  4PE5 B;  2D3I A;  5JEI A;  1H44 A;  4OVR A;  2AYS A;  2HZL A;  3FJ7 A;  3PPQ A;  1ELJ A;  3H6W A;  4GOT A;  3K01 A;  3MZB A;  3RPL B;  2X7P A;  1H76 A;  1NV2 A;  4IO4 A;  2PT2 A;  4PF6 A;  3PPP A;  4OEV A;  2F5X A;  1DMB A;  4AS4 A;  1SI0 A;  1FPL A;  3K1M A;  2KLF A;  4THI A;  1NH8 A;  3IO4 A;  5CBS A;  1BIY A;  1AIV A;  5BUU A;  2WYP A;  1BTJ A;  4GXS B;  1FPI A;  1LBZ A;  1A8F A;  1B0L A;  2G29 A;  1TXF A;  1OMP A;  3T96 B;  2V3U A;  1IUD A;  3IL1 B;  3UOR A;  2X26 A;  3MVZ A;  1JEU A;  3FZV A;  4PP0 A;  3ZS6 A;  3OO7 A;  4QHQ A;  2WKY A;  2OX3 A;  3E13 X;  4GWW A;  1A99 A;  4N4U A;  1P1N A;  3M8U A;  1XOC A;  4LUB A;  2ZZV A;  5CMK A;  2QVU A;  5ICQ A;  1PEB A;  4RY1 A;  1CE2 A;  3OEL A;  4OTE A;  5I57 A;  1B3G A;  1NUY A;  3QYT A;  1RDX A;  3CFX A;  3FD3 A;  3T93 B;  1FPG A;  2F7A A;  2OCU A;  4MIJ A;  1MDQ A;  2F6G A;  2XXV A;  4N6D A;  3FVK A;  1AOV A;  1L5T A;  1MXV A;  4OZ9 A;  4EF1 A;  4GD5 A;  4EQB A;  4NTL A;  4P0I A;  1UQW A;  1FTL A;  2QL3 A;  1TFD A;  3HHF A;  4OHN A;  1FRP A;  4NQ8 A;  2RC8 A;  1OLA A;  2V3Q A;  4GL0 A;  3RT6 B;  1DPP A;  3LC8 A;  2ALU A;  3SEX A;  4KFQ A;  2O1M A;  3OEK A;  2PFZ A;  2XHD A;  1D9V A;  2ESN A;  4JWO A;  5CMM A;  2XX7 A;  1P1W A;  1CNQ A;  2YLN A;  2XX9 A;  4O3A A;  4XKR A;  3PPR A;  5I58 A;  3TCH A;  3EHT A;  4C1T A;  4EUO A;  3KBR A;  3S9L C;  1IMB A;  3LUY A;  4FE8 A;  1EYK A;  3VVD A;  3MWB A;  4ZZE A;  4JXI A;  3C34 A;  4ELO A;  4GXA A;  4PAF A;  3MYU A;  1F9B A;  1NMU A;  2OWZ A;  3T9H B;  2WBB A;  1IQ7 A;  1XHY A;  5EQ9 A;  3RGY A;  4R6Y A;  1VSO A;  3T1B A;  3D4G A;  4LVQ A;  1OLC A;  4PFU A;  5FHM A;  2QPQ A;  3MPK A;  2QS2 A;  4TLM B;  2ZNS A;  4H67 A;  4KQP A;  1QUK A;  2HQ0 A;  3TFL A;  1MY4 A;  4QBA A;  1RYO A;  5J1D A;  1PBP A;  2OLB A;  1O63 A;  5F1Q A;  5CMB A;  3FJM A;  3B50 A;  1NUX A;  1JET A;  3BIH A;  2FVZ A;  5IZ3 A;  1UTH A;  1LFH A;  3SET A;  4MF3 A;  2UXA A;  4JSO A;  3RQT A;  1GR2 A;  1FJ9 A;  4PET A;  1EYI A;  4N07 A;  3H6U A;  3PMW A;  1MY0 A;  4N17 A;  3PMV A;  1Q35 A;  1US5 A;  1FQC A;  4PDH A;  4ESW A;  2DWJ A;  4QFO A;  1IME A;  2HCA A;  1FBE A;  2HXR A;  4U1Z A;  5KCJ B;  5F24 A;  1NUZ A;  4NAP A;  3CG3 A;  3CSB A;  4N81 A;  3TTL A;  1NH7 A;  4NF5 B;  2XXQ A;  3PUY E;  4OFL A;  4R9G A;  4DCY A;  2XD2 A;  4O3C A;  1B7U A;  1B4H A;  1VFE A;  2BJI A;  2XXT A;  4OEU A;  2V3T A;  2DWH A;  5L9S A;  3S9E A;  2VT5 A;  4R74 A;  4KYE A;  4KYD A;  2I48 A;  4PFR A;  1Y1Z A;  4LP2 B;  4RXL A;  2F8D A;  2HAU A;  3KZG A;  1IEJ A;  1MY2 A;  5B70 A;  3EQ1 A;  3MUQ A;  2DXR A;  1B0H A;  1JQF A;  5DEX A;  2UYE A;  3ZSF A;  4NX1 A;  4ISU A;  4HS7 A;  4QFK A;  1AWB A;  3SEV A;  5CRY A;  4G68 C;  3Q27 A;  5CM6 A;  4N8G A;  2Y7W A;  1B05 A;  5FHN A;  2HZK A;  1LFG A;  1SW1 A;  4MAG A;  5EHM A;  3H4Z A;  1YYZ A;  4QSC A;  4GX3 A;  2DXY A;  4DI3 D;  3G3G A;  2LAO A;  1FBP A;  3O66 A;  4G2Z A;  3TEL A;  3V83 A;  4PAK A;  1ZJL A;  1AMF A;  1HSJ A;  4LZ7 A;  3OXN A;  2XXH A;  1NV7 A;  1PDA A;  1XVY A;  4NF4 B;  2O51 A;  2FHY A;  1FTM A;  1TWY A;  3QXM A;  1CB6 A;  4O94 A;  4R6K A;  4QSD A;  4YMA A;  4U4X A;  3O6G A;  5I59 B;  3ECR A;  1K9Z A;  3VVF A;  3E9X A;  3O29 A;  4NF6 B;  1N3X A;  1SQY A;  3MVW A;  3UA8 A;  3KJ7 A;  3U93 A;  4DCX A;  1SD3 A;  2HXW A;  4IY5 A;  4U2R A;  3G3K A;  1XVX A;  3K6U A;  3C31 A;  4PC9 A;  1M5D A;  3UIF A;  2F7B A;  4OVJ A;  2H5Y A;  3B6W A;  3KN8 A;  4K3F A;  4Q30 B;  3PTY A;  4X9T A;  2O6A A;  3T9X B;  1JW5 A;  3C9H A;  4TOZ A;  4IO5 A;  4YMB A;  4GF8 A;  4MBP A;  3U72 A;  4L17 A;  4ZEK A;  3FXB A;  2QVR A;  3P7I A;  4KYS A;  4YIC A;  1MXX A;  4ZEI A;  3A09 A;  2UYF A;  4LAT A;  2UVH A;  3IOW A;  2ABH A;  3VFJ A;  1VE4 A;  4O7I A;  2XWO A;  1URS A;  3MBP A;  1QJM A;  3FBP A;  1QKA A;  5KDT B;  1FTO A;  4KR5 A;  2H98 A;  3OO8 A;  4LQ5 A;  2F78 A;  2RIN A;  3VV5 A;  4P3L A;  3JZJ A;  1EU8 A;  2F3B A;  4HCW A;  2Q88 A;  3FVO A;  4O3B A;  4LQ2 A;  1Z7N E;  2QRY A;  1FBC A;  4FOR A;  2DVC A;  4WXJ A;  2OWS A;  3MC2 A;  4XKQ A;  2R6G E;  3QMF A;  4OYV A;  4ECF A;  4OET A;  1UTB A;  2B4M A;  4XKP A;  1JNF A;  2PBW A;  4LON B;  2D5W A;  1MH3 A;  3OO9 A;  1ZU0 A;  3IOU A;  2Q8M A;  4H45 A;  4RK2 A;  1VFD A;  1B3H A;  3ONM A;  4G8M A;  4BDM A;  1O7T A;  1YCJ A;  5EYG A;  5M2V A;  4GX4 A;  3TOD A;  2PVU A;  4PTK A;  3C33 A;  4IR8 A;  4DDD A;  1N76 A;  3OEN A;  5ELV A;  1Y3N A;  2D21 A;  1MQJ A;  4I62 A;  3SEU A;  1RDZ A;  4MX6 A;  1B52 A;  4OVT A;  1B1X A;  2HAV A;  4H1X A;  4ZS9 A;  5EYH A;  4F19 A;  1MXW A;  3TTK A;  4LZ8 A;  2YPN A;  4GWS A;  1Y4T A;  4PBQ A;  3CFL A;  3K4U A;  3K6W A;  1B6H A;  3C36 A;  2H4I A;  5J16 A;  2I6E A;  2Q89 A;  1SW5 A;  3TDJ A;  3TKD A;  3QUJ A;  3G3J A;  3IOV A;  3T66 A;  4XEQ A;  3U1O A;  2DE3 A;  3MVY A;  3MP8 A;  4MNP A;  2QFL A;  4H5F A;  3RPW A;  3T9U A;  5KDT A;  3OSQ A;  2NVU B;  2DQV A;  5B7D A;  4I3Y A;  4H8I A;  3KEI A;  4MJO A;  4ESX A;  4OFJ A;  4U4S A;  2XX8 A;  3TUS A;  1YTV A;  5I84 A;  2L5V A;  4PFW A;  3TCF A;  3WAF A;  4FED A;  5CC2 A;  3IJX B;  1XT8 A;  3LSW A;  4N8Y A;  4OES A;  5TP9 A;  1PC3 A;  3G3H A;  5LTC A;  2QSX A;  5I56 B;  4OVP A;  4GVO A;  3RTF B;  4GLI A;  1LAG E;  4GBV A;  5F7V A;  1IMF A;  4EF2 A;  5DEX B;  2XXP A;  4BDO A;  3KJT A;  3SER A;  5CMC A;  5LDZ A;  1UIU A;  5KZT A;  3EPE A;  1BLF A;  2CEX A;  3KN3 A;  3VLV A;  1GV8 A;  3HHG A;  1LBY A;  2IA4 A;  1LST A;  3O6I A;  1IXC A;  1HSL A;  2ANJ A;  1QGX A;  4IGT A;  1DK4 A;  5EQ8 A;  4ZEB A;  2F36 A;  4DI4 B;  1DSN A;  3MPL A;  2Q9T A;  4ELP A;  3W15 C;  1KA0 A;  4M4G A;  1Q9D A;  4DE8 A;  1ZIU A;  3FAT A;  4R2B A;  4NWC A;  4NF4 A;  4PCD A;  1N0T A;  2VPN A;  4G68 A;  1NV3 A;  5FBP A;  5I59 A;  2F6P A;  1NL5 A;  1R6Z A;  2KR0 A;  3MQ9 A;  3USD A;  1P1U A;  4IGR A;  1IXI A;  4M1V A;  2Y5K A;  2IEE A;  2PT1 A;  4XIG Q;  2DE2 A;  4ZDM A;  2QS4 A;  3KOS A;  3NOH A;  3DLN A;  1VDW A;  3FV2 A;  5ISU A;  3TTM A;  4LA9 A;  1B5I A;  2AIX A;  4MEV A;  4HE1 A;  3RTW B;  4F2O A;  4NN3 A;  1P1O A;  4OA4 A;  2DS9 A;  1B7Z A;  1BK4 A;  1YXI A;  3CG1 A;  3EHS A;  1LAX A;  1LBX A;  3K0V A;  4G8N A;  4F2Q A;  4ELQ A;  2E1S A;  3LSX A;  4YAH X;  2XXY A;  4DXU A;  3W9W A;  5IKB A;  4ND9 A;  5T3J A;  2R8T A;  1NNP A;  2AL5 A;  3HST A;  4R2F A;  4OWD A;  3N94 A;  4R72 A;  4HTG A;  3SZP A;  4MFI A;  5FTI A;  5HPQ A;  3PU5 A;  2RC9 A;  4X1B A;  3HO7 A;  3UK4 A;  4HW8 A;  3L6H A;  1B4Z A;  1B3E A;  3PPO A;  4MNI A;  4AB6 A;  5IM2 A;  3U92 A;  4RNS A;  2A5T B;  2V4C A;  5I2N B;  3IB1 A;  1LB8 A;  2DWI A;  1LBW A;  3KN7 A;  3B6Q A;  4DXB A;  2JJK A;  1LEV A;  3W9V A;  4IO6 A;  1O64 A;  5A5X B;  4EXL A;  1FSA A;  3LBS A;  1GGG A;  2OJT A;  1SW2 A;  2VGQ A;  3R6U A;  1OQG A;  3RYD A;  5HM4 B;  4MHF A;  4RK9 A;  2XD3 A;  5DVI A;  3S4U A;  3IOT A;  4PFB A;  4DZ1 A;  3N6U A;  4R75 A;  1MQD A;  4KCD A;  1NUW A;  1Y9U A;  3N26 A;  3CI8 A;  1FCK A;  2NWJ A;  3EKI A;  1SYH A;  3H7M A;  3BKI B;  3VLU A;  4PFI A;  2THI A;  1NKX A;  3GXA A;  1JVY A;  2Q8J A;  1WVJ A;  5H8Q A;  3HV1 A;  4NG7 A;  1YZ0 A;  4RPN A;  2DP8 A;  4ZEF A;  3FAS A;  2O1L A;  5AA1 A;  2Z8F A;  3K00 A;  4P47 A;  3LSL A;  3FV1 A;  3N6T A;  4MNC A;  4N13 A;  2ONK E;  2PYY A;  4NHB A;  2RF1 A;  1KZ8 A;  1IZ1 A;  5HBC A;  1SDX A;  3WAE A;  5I3S A;  2O7U A;  3GBB A;  2GHA A;  4Z0I A;  4XTC Q;  3I6V A;  4F3B A;  2G93 A;  1H3D A;  4UAB A;  4I1D A;  3Q25 A;  2XXR A;  3MW0 A;  1IXG A;  4BDR A;  5I2N A;  4NGU A;  2ZNU A;  4U23 A;  1S50 A;  3PUV E;  5H8H B;  4BDQ A;  1US4 A;  4YKK A;  3M3F A;  2R71 A;  1FBF A;  1ANF A;  3A3C A;  5ET5 A;  1Y3P A;  1D4N A;  4TQU Q;  1J1N A;  1FTJ A;  5H8F B;  2H9B A;  3E3K A;  4IO7 A;  4P1E A;  5I2K A;  5CBR A;  4H46 A;  3JV9 A;  2CEY A;  4DXC A;  1B5J A;  3O2A A;  3UGW A;  3DM0 A;  4N15 A;  1ATG A;  4AQ4 A;  5DTB A;  2PFY A;  1D9Q A;  2REG A;  2WX9 A;  3S2V A;  3HCQ A;  3G7W A;  3QSL A;  2XXI A;  3K1P A;  1EZP A;  2ZXT A;  2R9J A;  1QUJ A;  3U65 A;  2H99 A;  2XXX A;  4PDD A;  3SES A;  1LAH E;  5IZZ A;  1A40 A;  3Q28 A;  1IMD A;  1ZBM A;  1BP5 A;  2PMS A;  4EXK A;  1MDP 1;  1K9Y A; 
#chains in the Genus database with same CATH homology
 4LZ8 A;  1LGB C;  2F7A A;  2OCU A;  4NF8 A;  4PQJ A;  4F18 A;  2YPN A;  4F29 A;  1Y4T A;  1ZMG A;  1MDQ A;  4KD5 A;  1YAE A;  2F6G A;  2XXV A;  3FVK A;  5TPA B;  1AOV A;  1UTH B;  3CFL A;  1ZTY A;  1B6H A;  3C36 A;  1KWH A;  1MXV A;  2H4I A;  3K4U A;  2UVI A;  3O9P A;  2I6E A;  2Q2C A;  2Q89 A;  2RC7 A;  4GD5 A;  2OWT A;  1LBC A;  2VP1 A;  2W7Y A;  5EHS A;  4EQB A;  1SW5 A;  5I2N A;  5JTY B;  4MLQ A;  3TDJ A;  3M3L A;  4F31 B;  4NTL A;  3TKD A;  4X48 A;  3PD8 A;  4P0I A;  1UQW A;  1FTL A;  3QUJ A;  3G3I A;  3G3J A;  3IOV A;  1MQI A;  2B65 A;  3V5A A;  3OOA A;  4DXB A;  2QL3 A;  2V25 A;  1TFD A;  1B3L A;  1OQH A;  2M8C A;  3T66 A;  5AA3 A;  3HHF A;  3U1O A;  3IO6 A;  4OHN A;  2DE3 A;  2RC8 A;  3MVY A;  4EDP A;  1OLA A;  4XKN A;  3MP8 A;  2Z23 A;  2V3Q A;  2FNC A;  1D9Y A;  1MXU A;  4ONY A;  1USY E;  1MPB A;  1A7L A;  4GL0 A;  3RT6 B;  1DPP A;  4H5F A;  3RPW A;  3LC8 A;  1XC1 A;  3T9U A;  4YB7 A;  5KDT A;  2ALU A;  3OSQ A;  3DP6 A;  2RCA A;  2O1M A;  3OEK A;  4KFQ A;  3SEX A;  2NVU B;  2XHD A;  3PUX E;  4ELR A;  4Z7E A;  1D9V A;  2ESN A;  2DQV A;  5B7D A;  3BBR A;  4F3S A;  4JWO A;  5CMM A;  5H8N A;  2XX7 A;  1P1W A;  1N3W A;  3KEI A;  4H8I A;  2YLN A;  2XX9 A;  4O3A A;  4EQ9 A;  4Q8R A;  4XKR A;  3PPR A;  4ESX A;  3TCH A;  5I58 A;  3EHT A;  4OFJ A;  4C1T A;  4PFY A;  4EUO A;  5ICT A;  4U4S A;  1ZLQ A;  3H3G A;  2XX8 A;  4IY6 A;  3TMG A;  3TUS A;  3ILT B;  3KBR A;  4RJZ A;  4YKP A;  1YTV A;  5I84 A;  2F35 A;  5KCJ A;  4PFW A;  3TCF A;  4ZE9 A;  3LUY A;  3N5L A;  4FE8 A;  3S9L C;  4G8H A;  3WAF A;  3IJO B;  3IX1 A;  3DP4 A;  1L5T A;  3VVD A;  3MWB A;  1PB7 A;  4ZZE A;  4PFT A;  4FED A;  1N7W A;  4JXI A;  3C34 A;  5CC2 A;  3VVE A;  1TFA A;  4ELO A;  1RKM A;  3IJX B;  4GXA A;  1XT8 A;  4OEN A;  3LSW A;  1A54 A;  1IIT A;  1F9B A;  3VDF A;  1NMU A;  3T22 A;  1DTG A;  1LFI A;  3T9H B;  4OES A;  1B40 A;  3Q26 A;  4GFR A;  5TP9 A;  5FTH A;  1PC3 A;  1IQ7 A;  2P2A A;  3G3H A;  3SKP A;  3G3F A;  1QUI A;  2QSX A;  3T93 B;  4ZED A;  4GIZ A;  1B58 A;  1MPD A;  1I6A A;  1XHY A;  2I0C A;  4R6Y A;  3RGY A;  3U93 A;  5I56 B;  2UVG A;  2Q2A A;  1VSO A;  3QAX A;  2DSF A;  4I9D A;  4GVO A;  3RTF B;  4GLI A;  3OSR A;  3IOR A;  4NE4 A;  3D4G A;  1MQH A;  1LAG E;  2O69 A;  4LVQ A;  2I4B A;  5DVF A;  2F34 A;  5F7V A;  4EF1 A;  1OLC A;  4BDL A;  5DEX B;  3OD7 A;  4EF2 A;  2XXP A;  4PFU A;  5AA2 B;  4BDO A;  3KJT A;  3SER A;  4E0W A;  5CMC A;  5LOM A;  1UIU A;  5KZT A;  4KI0 E;  2O84 X;  1R1N A;  3EPE A;  5FHM A;  1R9Q A;  2I4C A;  1BLF A;  2QPQ A;  3KN3 A;  4NED A;  4RA1 A;  1I6B A;  3MPK A;  3VLV A;  3ZKL A;  1GV8 A;  3HHG A;  4GL8 A;  2QS2 A;  4TLM B;  2DYX A;  4XXU A;  3R26 A;  2IA4 A;  1LST A;  3O6I A;  2ZNS A;  1NFT A;  4H67 A;  4KQP A;  1QUK A;  2HQ0 A;  4JSD A;  1FQD A;  1MY4 A;  1IXC A;  1HSL A;  1SI1 A;  4NF6 A;  3TFL A;  3TQL A;  2ANJ A;  4IGT A;  1B9J A;  1RYO A;  5A5X A;  1T0K A;  5J1D A;  1PBP A;  2OLB A;  3HPI A;  2QS3 A;  3QIM A;  4ZEB A;  2F36 A;  1DSN A;  3TTR A;  3MPL A;  1O63 A;  2Q9T A;  5F1Q A;  4ELP A;  5CMB A;  3FJM A;  4OER A;  5ITO A;  1PB8 A;  4C0R A;  4F1Y A;  1NNT A;  3OO6 A;  3FIR A;  4I8C A;  3H03 A;  4MLV A;  3W15 C;  3Q29 A;  2QS1 A;  3KFM A;  5H8Q B;  1JW4 A;  4FEC A;  1PBQ A;  3KSX A;  4M4G A;  1MM7 A;  1B1H A;  1JET A;  2X7Q A;  4Q5T A;  3JYR A;  5TU0 A;  2OK2 A;  3GZG A;  4AB5 A;  1UTH A;  4HCY A;  1LFH A;  2A5T A;  4DE8 A;  1H43 A;  1ZIU A;  1JVX A;  3FAT A;  4NWD A;  4R2B A;  2HFB A;  2Y7I A;  3RY3 A;  4NWC A;  4NF4 A;  3SET A;  4MF3 A;  4NF8 B;  3UN6 A;  2Y7K A;  3H6V A;  3BFT A;  2UXA A;  1N0T A;  4JSO A;  3TTN A;  4G68 A;  3IB0 A;  4H65 A;  4KPT A;  4Q0C A;  3RQT A;  1GR2 A;  3TCG A;  1MG1 A;  4PET A;  1DPE A;  1B46 A;  5I59 A;  1FQF A;  2GFE A;  3CSG A;  1GTK A;  2F6P A;  4N07 A;  3RT8 A;  3H6U A;  3PMW A;  1MY0 A;  1LLS A;  1NL5 A;  4POW A;  1R6Z A;  3MQ9 A;  3PMV A;  3T9V A;  1WOD A;  1P1U A;  1Q35 A;  1FQC A;  1US5 A;  3KOT A;  1IXI A;  4G4P A;  4FJP A;  4IGR A;  1MQG A;  4R6H A;  3E4R A;  4M1V A;  3CR9 A;  4DIG A;  4ESW A;  2DWJ A;  2IEE A;  3EHU A;  1GVC A;  4H0W A;  2PT1 A;  4QFO A;  3RUM A;  3O6H A;  3PMX A;  2HCA A;  3TPA A;  4GQO A;  4XIG Q;  3B6T A;  4U1Z A;  2DE2 A;  5KCJ B;  4ZDM A;  1EZ9 A;  2QS4 A;  3SEY A;  1M5B A;  1LCF A;  3KOS A;  1LCT A;  2P1S A;  2XXU A;  3CG3 A;  3CSB A;  3DLN A;  3HN0 A;  4JBZ A;  5FHO A;  4F39 A;  3FV2 A;  5ISU A;  3TTL A;  5BWJ A;  4JB7 A;  3TTM A;  2XXW A;  1DOT A;  1LB9 A;  1NH7 A;  4NF5 B;  5I56 A;  2RKM A;  2XXQ A;  4LA9 A;  3TAJ A;  3PUY E;  4OFL A;  2Y84 A;  4R9G A;  1M5E A;  3LR1 A;  1B5I A;  2ONS A;  4DCY A;  2XD2 A;  4O3C A;  5I58 B;  1N7X A;  2AIX A;  1D3K A;  1SVX B;  1B7U A;  5CI5 A;  5K2Y A;  5L8D A;  4H6D A;  3CVG A;  1B4H A;  1VFE A;  1XS5 A;  3FXQ A;  3R7X A;  3RTW B;  1PB9 A;  1ZKB A;  3ILU B;  5AA4 A;  4ZE8 A;  4F2O A;  2XXT A;  4OEU A;  4E0X A;  2V3T A;  1MXY A;  1MXZ A;  2DWH A;  3DP8 A;  4YB6 A;  2A5S A;  3F11 A;  3IB2 A;  5L9S A;  3CRB A;  1P1O A;  1OVB A;  3S9E A;  3AXF A;  4R74 A;  2DS9 A;  3M3K A;  4KYE A;  1B7Z A;  2E0S A;  2RCB A;  2I48 A;  3QUF A;  4KYD A;  3TQW A;  1Z7M E;  3CG1 A;  4R9F A;  1NNF A;  3SDF A;  3EHS A;  4FAJ A;  1LAX A;  3K0V A;  1Y1Z A;  2B3B A;  2VD3 A;  4G8N A;  4F2Q A;  4ELQ A;  4LP2 B;  4RPO A;  1S7Y A;  3I3V A;  3C32 A;  2E1S A;  1Q1K A;  2F8D A;  2HAU A;  1II5 A;  3KZG A;  3LSX A;  4RXL A;  1IEJ A;  1MY2 A;  4OQO A;  5H8S A;  4YAH X;  5B70 A;  3EQ1 A;  2NXO A;  4N6P A;  1YPN A;  2XXY A;  3EF7 A;  3UP9 A;  4YZZ A;  3MUQ A;  4DXU A;  5JTY A;  3B7D A;  3W9W A;  5IKB A;  4FAT A;  2DXR A;  1IXH A;  4ND9 A;  1B0H A;  1JQF A;  2YJP A;  4OMB A;  2AL5 A;  1NNP A;  1B51 A;  3KSJ A;  5DEX A;  3HST A;  1POT A;  2UYE A;  3C35 A;  3MZ1 A;  5TPA A;  3ZSF A;  3FVG A;  4R2F A;  1OVT A;  2GH9 A;  1B32 A;  1UTB B;  2FYI A;  3K02 A;  4OWD A;  2Y7R A;  4FEB A;  3N94 A;  3VLW A;  4F1U A;  3A3U A;  4FIM A;  4HS7 A;  4ISU A;  1URD A;  4H8J A;  4MH5 A;  4QFK A;  4R72 A;  4HTG A;  5I57 B;  4R73 A;  4MFI A;  5FTI A;  1MH4 A;  3SEV A;  2I3W A;  4U21 A;  5CRY A;  4G68 C;  4ZEC A;  3Q27 A;  3PU5 A;  5CM6 A;  2RC9 A;  3MJN A;  5HPQ A;  2UVJ A;  1P99 A;  2Y7W A;  1I69 A;  1B05 A;  2NUV A;  3DEL B;  3HO7 A;  3K6W A;  4JWY A;  4X1B A;  2V84 A;  5FHN A;  2HZK A;  2DVZ A;  3UK4 A;  4KHZ E;  4NMY A;  1LFG A;  3L6H A;  3MAM A;  1SW1 A;  2O7I A;  4HW8 A;  1FQB A;  1B4Z A;  1B3E A;  3PPO A;  5EHM A;  4AB6 A;  3RLF E;  2ZNT A;  3H4Z A;  4QSC A;  3THI A;  2BJJ X;  3U94 A;  2OZZ A;  2DXY A;  1MRP A;  1Y20 A;  5H8H A;  3U8Q A;  3G3G A;  2LAO A;  1SW4 A;  3U92 A;  2PX1 A;  4RNS A;  3O66 A;  3IK6 B;  4G2Z A;  2A5T B;  4GRK A;  2P0S A;  3TEL A;  3V83 A;  2ONR A;  4OXV A;  4JWX A;  4WED A;  1ZJL A;  4P11 A;  2ZYK A;  3H6T A;  4QFN A;  1AMF A;  3C4M A;  1HSJ A;  5I2N B;  1S9T A;  4JDF A;  3IB1 A;  4QSE A;  3OMB A;  4LZ7 A;  1B7H A;  3RNN A;  1LB8 A;  3CFZ A;  1UIV A;  2I3V A;  1FW0 A;  3OXN A;  2XXH A;  5IAI A;  2VHA A;  2DWI A;  1PDA A;  1XVY A;  3FJG A;  1AH5 A;  2O51 A;  3K1N A;  4NF4 B;  4YU0 A;  3KN7 A;  5AA2 D;  1FTM A;  1MS7 A;  1Y3Q A;  3B6Q A;  5DYH A;  1TWY A;  1MPC A;  1LBB A;  1JEV A;  4QFP A;  3QXM A;  3W9V A;  1CB6 A;  2Z8D A;  4R6K A;  2ZYN A;  4IO6 A;  1O64 A;  4QSD A;  4ZZA A;  4U4X A;  4YMA A;  4LZ5 A;  5A5X B;  3OEM A;  3O6G A;  1B5H A;  3KGC A;  3FXU A;  4EXL A;  5I59 B;  4POX A;  5L9O A;  2DOJ A;  3FXR A;  3ECR A;  4QFL A;  3H06 B;  3LBS A;  1WDN A;  1GGG A;  3VVF A;  3E9X A;  2OJT A;  2GRV A;  3O29 A;  4NF6 B;  1SW2 A;  4OFO A;  1URG A;  4TLL B;  4U1O A;  1SBP A;  2VGQ A;  1N3X A;  1OQG A;  2DWA A;  1SYI A;  3R6U A;  2QMX A;  5H8F A;  1SQY A;  3MVW A;  3UA8 A;  5HM4 B;  3RN8 A;  2I58 A;  3KJ7 A;  3L6G A;  4OZ9 A;  3TEP A;  4RK9 A;  1TT1 A;  2OBG A;  5TP9 B;  3KG2 A;  1M5F A;  2XD3 A;  2Y7P A;  3LSF B;  3GLB A;  5DVI A;  3IOT A;  3S4U A;  5AE4 A;  1FQE A;  4RYA A;  4DCX A;  1SD3 A;  2HXW A;  4IY5 A;  4U2R A;  4DLD A;  4P0G A;  1OIB A;  3SEW A;  1QVS A;  4DZ1 A;  3N6U A;  2VD2 A;  3G3K A;  1XVX A;  2ZYM A;  3GBA A;  3K6U A;  3FVN A;  2ZYO A;  4NF5 A;  4R75 A;  5L9M A;  1MQD A;  2CZL A;  1FQA A;  4KCD A;  1R9L A;  2ZMB A;  3C31 A;  4QRZ A;  1Y9U A;  4BLA A;  1M5D A;  3N26 A;  1MY3 A;  3CI8 A;  3VXC A;  3UIF A;  5AA2 A;  1FCK A;  2F7B A;  4OVJ A;  3S9M C;  2H5Y A;  3S9N C;  3B6W A;  2NWJ A;  3IAZ A;  3KN8 A;  4KCC A;  1POY 1;  4WEP A;  1SYH A;  2Z22 A;  3H7M A;  4G68 B;  3BKI B;  4K3F A;  4IB2 A;  4X1D A;  4Q30 B;  3VLU A;  4EXK A;  2THI A;  4X9T A;  1NKX A;  1Y1M A;  2O6A A;  2NOO A;  1JW5 A;  3C9H A;  2REJ A;  3T9X B;  4TOZ A;  4YKI A;  2H25 A;  2HEU A;  3GXA A;  4IO5 A;  4YMB A;  4GF8 A;  5H8N B;  4G77 A;  4IO3 A;  1NNK A;  4MBP A;  3PD9 A;  1JVY A;  3U72 A;  1QW0 A;  2Q8J A;  1WVJ A;  3MP1 A;  5H8Q A;  4F3G A;  3HV1 A;  4H5G A;  4L17 A;  1MM6 A;  3O97 A;  2V93 A;  5DT6 A;  3V8X B;  4F1V A;  4RPN A;  3PUZ E;  2VOZ A;  2DP8 A;  1P1Q A;  3USD A;  4ZEF A;  4ZEK A;  3P7I A;  3FAS A;  4KYS A;  1MXX A;  4YIC A;  3TZA A;  4ZEI A;  1IIW A;  2O1L A;  5AA1 A;  2Z8F A;  3A09 A;  2UYF A;  4LAT A;  2UVH A;  3IOW A;  1B3F A;  2ABH A;  2CMO A;  5DVJ A;  2QMW A;  3QK6 A;  3K00 A;  1RYX A;  3LSL A;  3O28 A;  4UAC A;  3VFJ A;  3FV1 A;  3N6T A;  4GWO A;  1VE4 A;  4N13 A;  5EYF A;  2ONK E;  3FUZ A;  2PYY A;  4WKM A;  4YB5 A;  1URS A;  5I2K B;  1A55 A;  3K2D A;  3MBP A;  2RF1 A;  3EN3 A;  1QJM A;  3MVX A;  3TYH A;  3V89 B;  4PE5 B;  2D3I A;  2I0B A;  2GHB A;  4EQ7 A;  1IZ1 A;  1QKA A;  3FGS A;  5JEI A;  5HBC A;  1SDX A;  3WAE A;  1H44 A;  1B2H A;  2AYS A;  2HZL A;  3I5O A;  5KDT B;  1FTO A;  2FA7 A;  5K2X A;  2O7U A;  3FJ7 A;  4KR5 A;  2H98 A;  3GBB A;  3OO8 A;  3ZKK A;  2GHA A;  3PPQ A;  4LQ5 A;  4Z0I A;  2F78 A;  1ELJ A;  4XTC Q;  3H6W A;  3I6V A;  2RIN A;  4GOT A;  4F3B A;  2G93 A;  3VV5 A;  1N04 A;  3K01 A;  3MZB A;  1H3D A;  1JW1 A;  4I1D A;  2X7P A;  1H76 A;  3JZJ A;  3Q25 A;  1EU8 A;  2XXR A;  4IO4 A;  3MW0 A;  4QF9 A;  4HCW A;  4IO2 A;  1IXG A;  2PT2 A;  2Q88 A;  3FVO A;  4O3B A;  3PPP A;  4YKJ A;  4LQ2 A;  4BDR A;  1Z7N E;  2QRY A;  3BFU A;  4OEV A;  2F5X A;  1DMB A;  4FOR A;  1SI0 A;  2AL4 A;  3K1M A;  2DVC A;  2KLF A;  4WXJ A;  2OWS A;  1NH8 A;  3IO4 A;  3MC2 A;  1BIY A;  4THI A;  2B3F A;  4XKQ A;  5CBS A;  2R6G E;  1H45 A;  2ZNU A;  4U23 A;  5BUU A;  1HSE A;  2QJE A;  4UA8 A;  1AIV A;  1LAF E;  1QUL A;  1S50 A;  3VXB A;  3PGF A;  3PUV E;  5H8H B;  4BDQ A;  1US4 A;  1BTJ A;  4OYV A;  4ECF A;  3D4C A;  4OET A;  4YKK A;  3M3F A;  5ITP A;  1EH3 A;  4GXS B;  1UTB A;  2R71 A;  4U22 A;  5AA4 B;  1ANF A;  3A3C A;  4XKP A;  1I6Q A;  1JNF A;  1A8F A;  2PBW A;  1Y3P A;  1D4N A;  1MY1 A;  3PV0 E;  2D5W A;  1MH3 A;  4LON B;  4TQU Q;  1B0L A;  2O68 A;  1ZU0 A;  1J1N A;  1FTJ A;  2G29 A;  3IOU A;  3OO9 A;  1TXF A;  1OMP A;  1N84 A;  3IR1 A;  2H9B A;  3E3K A;  3ODB A;  5H8F B;  4IO7 A;  3T96 B;  2V3U A;  1IUD A;  3IL1 B;  3UOR A;  4BDN A;  4F3P A;  5I2K A;  5JK4 A;  4RK2 A;  2X26 A;  3MVZ A;  5CBR A;  1VFD A;  1JEU A;  3JV9 A;  1B3H A;  3MP6 A;  3ONM A;  3FZV A;  4PP0 A;  3ZS6 A;  4G8M A;  4DXC A;  4BDM A;  1B5J A;  3O2A A;  1O7T A;  2I49 A;  3OO7 A;  4QHQ A;  3DM0 A;  1YCJ A;  2WKY A;  3UGW A;  1ATG A;  5M2V A;  4AQ4 A;  1FTK A;  3E13 X;  5DTB A;  3TOD A;  2REG A;  2PVU A;  1VR5 A;  3S2V A;  3PUW E;  1A99 A;  1M5C A;  3HCQ A;  1P1N A;  1USY H;  2XXI A;  2Z8E A;  3G7W A;  3K1P A;  3M8U A;  3QSL A;  2ZXT A;  1XOC A;  3C33 A;  1QKB A;  4DDD A;  1EZP A;  4LUB A;  1N76 A;  3OEN A;  2R9J A;  3MZ9 A;  5CMK A;  5ELV A;  1EZO A;  1Y3N A;  1QUJ A;  5ICQ A;  2H99 A;  2XXX A;  3K6V A;  4C1U A;  1PEB A;  1Y4C A;  4F22 A;  1A8E A;  2F97 A;  2D21 A;  1MQJ A;  4I62 A;  3SES A;  3SEU A;  4RY1 A;  1CE2 A;  3CIJ A;  2DE4 A;  1B52 A;  3OEL A;  1LAH E;  1B1X A;  2F7C A;  2HAV A;  1A40 A;  3PPN A;  4OTE A;  3Q28 A;  4H1X A;  5I57 A;  1B3G A;  1DTZ A;  3QYT A;  3VE1 B;  1ZBM A;  1BKA A;  4ZS9 A;  3K6X A;  4F19 A;  1BP5 A;  3CFX A;  2PMS A;  1AL3 A;  3FD3 A;  1MXW A;  3TTK A;  1MDP 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...