2UVHA

Structure of a periplasmic oligogalacturonide binding protein from yersinia enterocolitica in complex with saturated digalacturonic acid
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
404
structure length
404
Chain Sequence
EVNLRMSWWGGNGRHQVTLKALEEFHKQHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTARIFYFNDATWAKAGLEYPKTWDELLAAGKVFKEKLGDQYYPVVLEHQDTLALIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASFGKSNMYEMKPWINGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFKPAQMLSIGKSTKHPQESAMLINFLLNSKEGVEALGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHKMTTSPYFDDPQIVSLFGDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords ABC TYPE PERIPLASMIC SUGAR-BINDING PROTEIN
publication title Specific Recognition of Saturated and 4,5-Unsaturated Hexuronate Sugars by a Periplasmic Binding Protein Involved in Pectin Catabolism.
pubmed doi rcsb
source organism Yersinia enterocolitica
total genus 137
structure length 404
sequence length 404
ec nomenclature
pdb deposition date 2007-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uvhA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uvhA02
3T9VA 4H8IA 3MZ9A 3C33A 3HO7A 1GTKA 3EHSA 3KSXA 2Z8DA 4N13A 1MH4A 4IO4A 4RA1A 3PGFA 4NF6B 2OCUA 4LQ5A 3FUZA 4NF8A 4RYAA 5FTIA 1SW5A 1NKXA 4DLDA 2CMOA 1MY4A 3OEMA 3BKIB 4I8CA 1FQFA 1OLCA 5AA2A 2ONSA 4F2OA 4ISUA 4YU0A 3MP6A 1XHYA 4OEUA 3PMWA 1IXGA 3PPNA 3FXQA 4EDPA 5CMKA 1N84A 3ZS6A 1N3XA 2QMWA 5M2VA 3SKPA 4QRZA 3G3IA 3SEVA 5A5XB 3O28A 3USDA 1MY0A 5DYHA 5H8SA 4KD5A 4ELOA 4MLQA 1PEBA 3L6HA 1MDP1 3LR1A 2W7YA 3E9XA 4XKNA 2I49A 3S9MC 4RK2A 1IQ7A 3EPEA 2QS1A 5I59A 4LZ5A 3V83A 1MPBA 4QF9A 4QHQA 1P1OA 4G8NA 3KN7A 1N7XA 3OOAA 3ODBA 4F1UA 2AL5A 1SW4A 1S50A 1P1NA 4GVOA 1B46A 2FYIA 1DMBA 3DP4A 1JW4A 4KYEA 3PD9A 2PMSA 1P1WA 3UORA 3M3KA 5KZTA 2XHDA 1UTHA 2DXRA 3VLUA 4Q5TA 1QKBA 2HCAA 1FQAA 1PB7A 3TTNA 1VFDA 1SDXA 4YMBA 2NXOA 3BFUA 2XXTA 1NMUA 4PP0A 1EZOA 2D5WA 3S2VA 1B3LA 3H6TA 5DEXA 4JXIA 4C0RA 4KR5A 1VR5A 3E13X 4NTLA 4GRKA 1LAFE 1HSJA 5FTHA 3KOTA 4DCXA 2UVGA 3OSRA 4R6YA 1MQIA 3SDFA 5CC2A 4RY1A 3MAMA 4ELQA 1P99A 1SQYA 3DP6A 3PMVA 3CG3A 4TLLB 2VGQA 1P1UA 4TLMB 2VHAA 2F8DA 4YB5A 4MFIA 3U72A 2DYXA 4JWYA 1N3WA 2O7IA 1UTBA 4OVJA 3P7IA 1QUKA 3PMXA 1FW0A 2ONRA 3PUYE 2QS3A 2PYYA 5I57A 3VLWA 3IK6B 3TQLA 1OVBA 1S7YA 3MJNA 4JSDA 3D4GA 5I58B 1Y20A 2A5SA 1B5JA 3PU5A 3IB2A 3KFMA 1HSLA 4QFNA 4OMBA 4E0WA 1SI0A 4DXUA 4ONYA 1AL3A 3K2DA 4NF6A 5DVJA 3S9EA 4NF5B 1JVXA 2ZYOA 1POTA 1II5A 5ITOA 1B0LA 2YPNA 3D4CA 3HHGA 1YPNA 3O66A 3OO8A 3V5AA 1B32A 4RK9A 3MP8A 4IO6A 3I6VA 4I1DA 3MW0A 1LGBC 2G29A 2ABHA 2UVIA 1QVSA 1ZU0A 1Y4CA 2B3FA 1USYE 2REGA 5I84A 4U1ZA 1B40A 5HBCA 5DVFA 3CFLA 4OERA 1UQWA 1MPCA 2PT2A 4KCCA 3TCHA 5A5XA 4ZE9A 2Y7RA 4IY6A 4R74A 5I56A 4FAJA 2CZLA 1ZJLA 1Y1ZA 4KFQA 3CI8A 3I3VA 1MM7A 3MZBA 1LFGA 2P1SA 3GXAA 1IEJA 2XXPA 4DCYA 4FEDA 2OZZA 1JETA 1FTMA 1H44A 2HQ0A 3JYRA 1B7HA 3KBRA 2Q2CA 4Z7EA 2THIA 3B6WA 3TTLA 1H43A 4HS7A 2HAVA 1ZLQA 2XXVA 1FQDA 3TTKA 3UIFA 1DSNA 1B4ZA 2WKYA 3PUZE 3DELB 2HZKA 3IOWA 1LAXA 4QSEA 1BTJA 4GOTA 4GL0A 1B1XA 3IJOB 4F22A 4KCDA 3WAFA 3ILTB 3IO6A 2BJJX 4R72A 3KEIA 1SYHA 4RXLA 2GHAA 4G2ZA 1US5A 3TEPA 1I6QA 2V3TA 3H7MA 1EU8A 5CMBA 5BWJA 2ZYNA 1OQGA 2D21A 2F7CA 5EHSA 3QUFA 2H9BA 4U22A 4R75A 3K6UA 1NFTA 1UTHB 2ANJA 4NMYA 2F6GA 4MH5A 4QFKA 4RPNA 4U21A 5ELVA 2DS9A 3W15C 2F97A 3OMBA 3R7XA 1MRPA 1ATGA 1JEVA 3Q27A 1B1HA 5ICTA 3TUSA 1N76A 3UP9A 3MBPA 4PFTA 2XX8A 3TDJA 5AA2D 3OEKA 4TQUQ 3KG2A 3JV9A 2I48A 1LBBA 3T22A 3U94A 3HN0A 3RUMA 3TPAA 2B65A 4R2BA 4YZZA 2REJA 4BDMA 3RQTA 1FCKA 4R6KA 2I58A 1LFIA 2P2AA 3FV2A 3OXNA 1M5EA 2XXHA 2QPQA 4P11A 3UGWA 3CRBA 3FGSA 3O2AA 4YB6A 2H99A 1A7LA 4GXAA 3IL1B 4OYVA 5I58A 3PPQA 3VDFA 3SEUA 3LSWA 4IO7A 3ZKLA 3U93A 4FORA 3RTWB 2DE2A 5CBRA 2V3UA 4GFRA 3MPLA 3B6QA 2OJTA 2V3QA 1VFEA 1URGA 2Y7IA 2R6GE 1RYXA 4NF5A 4KYDA 2RC7A 3F11A 1B0HA 3G3JA 4FEBA 1XVXA 4YMAA 4THIA 2B3BA 4YKPA 5CRYA 3KSJA 3MZ1A 1OLAA 4EF1A 2QS4A 3T9XB 2Q88A 2FNCA 3G7WA 2HFBA 4R6HA 1LSTA 2PBWA 5L9MA 3O6HA 4YKIA 3TZAA 1PB8A 1A99A 2NOOA 1TFAA 3C35A 3WAEA 3EN3A 3SETA 4NWDA 3VVFA 1MQGA 3L6GA 4PFYA 2X7PA 3Q29A 5CI5A 4XIGQ 3RT6B 3K01A 5F1QA 4NEDA 3ILUB 3RGYA 1B7UA 1MDQA 3TCGA 4EQ7A 3VLVA 1FQBA 4IO2A 1SD3A 3TODA 4QFLA 4IY5A 4GXSB 3RTFB 3VV5A 3CFXA 5I56B 3MUQA 3K4UA 2F36A 2OWTA 5H8FB 3M8UA 4FECA 5CMMA 3R6UA 4EUOA 3I5OA 3R26A 5EYFA 2I0CA 3FATA 1A40A 3K1PA 1AIVA 2ZNTA 1SI1A 1USYH 4XKRA 1LB9A 2GRVA 1AH5A 1GVCA 2I3WA 2KLFA 1ZBMA 4N6PA 2NWJA 1DPPA 4OFLA 3SEWA 2HEUA 1P1QA 4U4SA 2YJPA 3IX1A 4JSOA 4NF4A 3CR9A 4C1TA 4OXVA 2ZXTA 5DTBA 4XKQA 3E3KA 2XX9A 4H1XA 5FHOA 1B4HA 3U8QA 5KDTB 1MH3A 1N04A 4ELRA 1TXFA 1BLFA 3IB0A 1B51A 3KOSA 3ONMA 3FVGA 3K6XA 1XC1A 1DPEA 2F78A 4BDRA 1I69A 1PC3A 2XXIA 4AB5A 1IZ1A 1A54A 4IO3A 2QMXA 5BUUA 2RF1A 3EHUA 4NE4A 4Q8RA 2Q8JA 5JTYB 2OLBA 3DP8A 4G8MA 3U1OA 3TTMA 4OESA 2O51A 1VE4A 4ZEIA 5H8NB 1T0KA 3TFLA 3TCFA 4OZ9A 1B05A 4NWCA 3UA8A 2I3VA 3H6WA 1MQJA 3RN8A 4YKKA 1LBCA 2R9JA 4C1UA 1TFDA 4EQBA 1O63A 2OK2A 4F3BA 3G3HA 4IGTA 4JB7A 4FATA 5FHMA 5J1DA 2XXWA 4F18A 3W9VA 3VE1B 2PT1A 3EF7A 1HSEA 4EQ9A 1A8EA 3H3GA 1FTJA 1SW1A 2Z22A 4OFJA 1DTGA 3MWBA 1I6BA 2ONKE 4YKJA 4KI0E 4UA8A 2QJEA 3VFJA 5F7VA 1SBPA 4F19A 1UIUA 4QFPA 4GLIA 5CM6A 4OQOA 1B9JA 2RCBA 4XXUA 2Y7WA 1LCFA 3K6WA 3B6TA 1PB9A 4G8HA 3T9HB 3CIJA 3C32A 3G3FA 4LONB 3C9HA 3KN8A 3IORA 3MVYA 1GV8A 4IGRA 3O9PA 4M1VA 1I6AA 1FQCA 1PDAA 4X48A 2DVCA 1H45A 2R71A 5L9OA 1LB8A 2YLNA 4XTCQ 1DTZA 4OHNA 3H4ZA 4RJZA 1B6HA 4JDFA 2I4BA 3UN6A 4MBPA 5H8FA 3RNNA 4ZDMA 2F34A 1ANFA 2O6AA 5HPQA 3FJ7A 3LSXA 2QL3A 2NVUB 4F39A 3Q25A 1RYOA 4PFUA 1XOCA 4X9TA 2V84A 2DQVA 4Z0IA 2Z8EA 2XXXA 1S9TA 4X1DA 3THIA 3FJMA 1MG1A 3CVGA 3V89B 3CSGA 2DE4A 3IOVA 2DE3A 3IR1A 5AA1A 4ZEBA 3HSTA 3MQ9A 5ICQA 1URSA 1B58A 3EQ1A 3MPKA 1NH7A 1TT1A 5KCJB 1D9YA 5KDTA 1B3GA 2D3IA 4JWOA 2I6EA 2I0BA 3GLBA 4NF4B 2V93A 2QS2A 4UACA 4G4PA 1RKMA 1Y3PA 4DIGA 4R73A 3LUYA 4OTEA 1MY2A 3KZGA 4G68B 4OWDA 3A3CA 3K1MA 3C34A 1NNTA 4DZ1A 1BIYA 1LAHE 4JBZA 5IAIA 3N5LA 4QSDA 1QULA 4H6DA 3O97A 1NNPA 4ELPA 2RKMA 4ZZAA 3M3FA 1JW5A 1NNFA 1PBQA 3QAXA 5JTYA 5K2XA 4BDLA 4KQPA 3KJTA 3S9LC 4F1YA 1D3KA 2PX1A 4F31B 3H6VA 1M5FA 4RNSA 3T93B 3EHTA 4GIZA 1QKAA 4OEVA 5JK4A 4H65A 5H8NA 1Y1MA 3ECRA 4LZ8A 2UYFA 3JZJA 3TQWA 3N6UA 1BP5A 4BDOA 4H67A 3B7DA 1B5IA 4M4GA 3K6VA 3A09A 3IO4A 1JEUA 2Y84A 1IITA 1B3HA 3UK4A 3PPRA 4Q0CA 1IXHA 2RC9A 1Y9UA 3SEXA 3Q26A 3HV1A 5ITPA 2XXUA 4H5FA 4POXA 3T66A 4ZEDA 2GH9A 3TAJA 3A3UA 2XD3A 4R2FA 3C4MA 3SESA 3OO6A 1MY3A 3FXUA 3MP1A 1ZTYA 4OETA 3FZVA 3CFZA 4YB7A 4F1VA 2HZLA 3O6GA 4WEDA 4GF8A 3QIMA 2AYSA 4ZEFA 4MLVA 5DVIA 1FTLA 1AOVA 2Q89A 3FD3A 2AL4A 1R1NA 4O3BA 4R9GA 5I2KB 1J1NA 1CE2A 3PUXE 3QUJA 4F2QA 4H0WA 4ZECA 1LLSA 4HW8A 3OO9A 3V8XB 4TOZA 1D4NA 5H8HB 4ECFA 5FHNA 4Q30B 4U2RA 3S9NC 3IOUA 4YAHX 2RCAA 3SERA 3FVKA 4FJPA 1M5CA 4AB6A 1H76A 1Q1KA 1Q35A 4PE5B 2PVUA 2O84X 2O1LA 1UIVA 4H8JA 3HHFA 1IUDA 3TKDA 1XT8A 5TPAB 2F5XA 4EXKA 4DDDA 3VXCA 4WKMA 2XX7A 5DT6A 2G93A 2P0SA 4I62A 5H8QB 4E0XA 4F3SA 1MS7A 2ESNA 2DP8A 1IXCA 3OSQA 4GQOA 1OQHA 2A5TB 2XXQA 2Y7PA 4X1BA 2E0SA 4GWOA 5KCJA 3G3GA 3O29A 4HCWA 2Q9TA 1Z7NE 2XXRA 4F3GA 3OENA 3SEYA 1D9VA 4P0IA 4LZ7A 4G68A 3CG1A 5I2NB 1BKAA 2O69A 1GGGA 3T9UA 3KGCA 1SYIA 1MM6A 2RC8A 3OO7A 3MVWA 1IXIA 4QSCA 2O68A 2XXYA 1B3EA 1DOTA 1FTOA 3N6TA 1EZ9A 3DM0A 1B7ZA 1O64A 1WODA 2X26A 3HCQA 5ISUA 2GFEA 3DLNA 3CSBA 4ZEKA 3VVDA 3H03A 4IO5A 3W9WA 4O3AA 4MF3A 2FA7A 3U92A 1LCTA 3PUVE 5CBSA 3IAZA 3KN3A 1URDA 4DXBA 5B7DA 4YICA 4N07A 1JNFA 2HAUA 1XS5A 4R9FA 3LSLA 1US4A 4U1OA 1QUIA 1WVJA 3MC2A 1TWYA 3QYTA 1ELJA 2ZNUA 2O1MA 2VP1A 5JEIA 1O7TA 1OMPA 3FXRA 2DSFA 4I9DA 2DWHA 3T96B 1JVYA 3E4RA 1A55A 4K3FA 4U4XA 5TP9B 4HTGA 1KWHA 2IEEA 3FASA 4AQ4A 3RLFE 3M3LA 4ZZEA 3RT8A 3LC8A 4DXCA 3TELA 4PETA 2DVZA 5AA4A 1JQFA 1FQEA 4ESXA 5L9SA 3BBRA 3HPIA 2QSXA 2RINA 2DWIA 4U23A 3IB1A 4POWA 3PD8A 5I2KA 1B2HA 3TYHA 2ZMBA 5IKBA 4BDQA 3VXBA 3VVEA 5H8HA 2F7AA 2E1SA 2F7BA 4OENA 2ZNSA 1SW2A 4NF8B 1YTVA 3MVZA 1R9LA 3PPPA 4RPOA 4ZE8A 1EH3A 4KYSA 2DXYA 2QRYA 2F6PA 1QW0A 5EHMA 1ZMGA 5AA2B 5TPAA 2F35A 3S4UA 2OBGA 3K02A 3FIRA 3H06B 4GD5A 4PFWA 1M5BA 1MXYA 2OWSA 4LA9A 1R6ZA 5H8QA 1SVXB 2UYEA 2UVHA 1NH8A 3FVOA 1FTKA 1MXZA 4IB2A 4EXLA 4GL8A 1EZPA 2A5TA 3QSLA 2NUVA 2VOZA 4LP2B 1LAGE 2DWJA 1YCJA 1NL5A 2DWAA 4PQJA 1YAEA 3OD7A 3BFTA 4G77A 3PUWE 4EF2A 3IJXB 2VD2A 1L5TA 1ZIUA 3G3KA 1Y3NA 1Y4TA 1OIBA 1WDNA 5I59B 3QXMA 3O6IA 5I2NA 2LAOA 2VD3A 4H5GA 4L17A 4WXJA 1LFHA 1H3DA 1CB6A 2V25A 1QJMA 1MPDA 4JWXA 2Z8FA 4XKPA 3LSFB 1POY1 1N7WA 4QFOA 5TU0A 2Q2AA 1AMFA 3PV0E 4ND9A 4ZS9A 4G68C 1ZKBA 3GZGA 2GHBA 3GBBA 3K00A 2X7QA 5L8DA 2IA4A 5K2YA 3QK6A 2UVJA 4LUBA 4O3CA 2I4CA 1N0TA 2XD2A 3N94A 4ESWA 1MXWA 2AIXA 3K0VA 1B52A 4LVQA 2ZYKA 4P0GA 4KHZE 4LATA 3ZKKA 3GBAA 1JW1A 4LQ2A 1Y3QA 1NNKA 4KPTA 3C31A 3MVXA 2O7UA 4DE8A 5DEXB 4F29A 1MQDA 1OVTA 3TMGA 3N26A 4BLAA 3ZSFA 4OFOA 1PBPA 3AXFA 4BDNA 3TTRA 5TP9A 2UXAA 5AE4A 3K1NA 3RY3A 1B3FA 2Z23A 2Y7KA 1F9BA 5AA3A 2H4IA 1MQHA 2ZYMA 1B5HA 3IOTA 5HM4B 1VSOA 3LBSA 2M8CA 3KJ7A 1MXUA 3Q28A 3FVNA 5B70A 2DOJA 4WEPA 3H6UA 2H25A 1QUJA 1Z7ME 3OELA 1IIWA 1UTBB 2HXWA 1A8FA 3PPOA 2H5YA 3FV1A 1M5DA 1R9QA 4FIMA 5AA4B 5LOMA 3C36A 1GR2A 2H98A 2ALUA 1MXXA 4F3PA 5I57B 4HCYA 1MY1A 3FJGA 5CMCA 1XVYA 4FE8A 1MXVA 3RPWA
chains in the Genus database with same CATH superfamily
3T9VA 4H8IA 3MZ9A 3C33A 3HO7A 1GTKA 2P3NA 3EHSA 3KSXA 2Z8DA 4N13A 5IZ3B 4PDDA 1MH4A 4IO4A 4RA1A 3PGFA 4NF6B 2OCUA 4LQ5A 1LEVA 3FUZA 4GWSA 4NF8A 4RYAA 5FTIA 1SW5A 4PCDA 1NKXA 4DLDA 2CMOA 1MY4A 3OEMA 3BKIB 4I8CA 1FQFA 1OLCA 5AA2A 2ONSA 4F2OA 4ISUA 4YU0A 1LBZA 1XHYA 3MP6A 4OEUA 3PMWA 4PF6A 1IXGA 3PPNA 3FXQA 4EDPA 5CMKA 1N84A 3ZS6A 1N3XA 2QMWA 5M2VA 3SKPA 2XWIA 4QRZA 4X04A 3G3IA 3SEVA 4NF0A 5A5XB 1JP4A 3O28A 2HPGA 3USDA 1MY0A 5DYHA 5H8SA 4NQ8A 4KD5A 4ELOA 4MLQA 1PEBA 3L6HA 2WYPA 1MDP1 2VPOA 3LR1A 2WBDA 2W7YA 3E9XA 4XKNA 1IMBA 2I49A 3S9MC 1NI9A 4RK2A 1IQ7A 3EPEA 2QS1A 5I59A 4LZ5A 3V83A 1RDXA 1MPBA 4QF9A 4QHQA 3HFUA 1P1OA 4G8NA 3KN7A 1N7XA 3OOAA 3ODBA 1FPEA 4F1UA 2AL5A 1SW4A 1S50A 4MCOA 1VDWA 1P1NA 4GVOA 1B46A 2FYIA 1DMBA 3DP4A 1JW4A 4I3EA 4KYEA 3PD9A 3BIHA 2PMSA 1P1WA 3UORA 3M3KA 5KZTA 2XHDA 1UTHA 2DXRA 3VLUA 4Q5TA 1QKBA 2HCAA 1FQAA 1PB7A 3TTNA 1VFDA 1SDXA 4YMBA 2NXOA 3BFUA 2XXTA 1NMUA 4PP0A 1EZOA 2D5WA 1FPJA 5IM2A 3RYDA 3S2VA 1B3LA 3H6TA 5DEXA 4JXIA 4MIJA 4C0RA 4KR5A 1VR5A 3E13X 4NTLA 4GRKA 1LAFE 1HSJA 4MHFA 5FTHA 2JJKA 3KOTA 4DCXA 2UVGA 3OSRA 4R6YA 1MQIA 3SDFA 5CC2A 4RY1A 3LUZA 3MAMA 4PF8A 2VT5A 4ELQA 1P99A 1SQYA 3DP6A 3PMVA 3CG3A 4TLLB 5EYHA 2VGQA 3BIGA 1P1UA 4TLMB 2VHAA 2F8DA 4YB5A 4MFIA 1FBPA 3U72A 2DYXA 4JWYA 1N3WA 2O7IA 1UTBA 4OVJA 1NV3A 3P7IA 1QUKA 3PMXA 1FW0A 2ONRA 2F3BA 3PUYE 3RPLB 2QS3A 2PYYA 5I57A 2FIEA 3VLWA 3IK6B 3TQLA 1OVBA 1S7YA 3MJNA 4N6KA 4JSDA 3D4GA 2FBPA 5I58B 4PFRA 1Y20A 2A5SA 1B5JA 1NUYA 3PU5A 3IB2A 3KFMA 1HSLA 4QFNA 4OMBA 4E0WA 1SI0A 2MKZA 4DXUA 5IZ3A 4ONYA 1AL3A 3K2DA 4NF6A 5DVJA 3S9EA 4NF5B 1JVXA 2ZYOA 1POTA 1II5A 5ITOA 1B0LA 2YPNA 3D4CA 3HHGA 1YPNA 3O66A 3OO8A 5F24A 3V5AA 1B32A 4RK9A 3MP8A 4IO6A 3I6VA 4I1DA 3MW0A 1LGBC 2G29A 2ABHA 2UVIA 4N8YA 1QVSA 1ZU0A 1Y4CA 2B3FA 1USYE 2REGA 5I84A 4U1ZA 1B40A 5HBCA 2ZZXA 5DVFA 3CFLA 4OERA 4XEQA 3E79A 1UQWA 1MPCA 2PT2A 1FRPA 1K9YA 4KCCA 3TCHA 5A5XA 4ZE9A 4GWZA 2Y7RA 4IY6A 3CHGA 4R74A 5I56A 4FAJA 2CZLA 1ZJLA 1FJ6A 1Y1ZA 4KFQA 3CI8A 3I3VA 1MM7A 3MZBA 1LFGA 3KC0A 2P1SA 1NUXA 2WX9A 1IMFA 1NV6A 3GXAA 1IEJA 1FBEA 2XXPA 4DCYA 4FEDA 2OZZA 4G61A 1JETA 1FTMA 1H44A 2HQ0A 3JYRA 1B7HA 1KZ8A 3KBRA 2Q2CA 4Z7EA 2THIA 3B6WA 3TTLA 4AS5A 1H43A 4HS7A 2HAVA 1ZLQA 2V4CA 1NV1A 2XXVA 1FQDA 3TTKA 3UIFA 1DSNA 1B4ZA 2WKYA 3PUZE 1EYIA 3DELB 2HZKA 3IOWA 1LAXA 4NHBA 4QSEA 1BTJA 4GOTA 4PAIA 4GL0A 4PDHA 1B1XA 3IJOB 4F22A 4KCDA 3WAFA 3ILTB 3IO6A 2BJJX 1FPIA 4R72A 4RXLA 3KEIA 1AWBA 1SYHA 2GHAA 4G2ZA 1US5A 3TEPA 1I6QA 2V3TA 3H7MA 1EU8A 1NV2A 5CMBA 5BWJA 2R8TA 2ZYNA 1OQGA 2D21A 2XWOA 2F7CA 5EHSA 3QUFA 2H9BA 4U22A 4R75A 3K6UA 1NFTA 1UTHB 2ANJA 4NMYA 2F6GA 4MH5A 1D9QA 4QFKA 4RPNA 4U21A 5ELVA 4O7IA 2DS9A 4GX3A 4PE3A 3W15C 4H46A 2F97A 3OMBA 3R7XA 1MRPA 1ATGA 1JEVA 3Q27A 1B1HA 4O94A 1LBVA 5ICTA 3TUSA 1N76A 3UP9A 3MBPA 4PFTA 5J16A 2XX8A 4GWUA 3TDJA 5AA2D 3OEKA 4TQUQ 3KG2A 4P8BA 3JV9A 2I48A 1LBBA 3T22A 3U94A 1FBGA 3U65A 3HN0A 3RUMA 4NX1A 1EYJA 3TPAA 2B65A 2CZHA 4R2BA 4N6DA 4YZZA 2REJA 3LV0A 4BDMA 3RQTA 1FCKA 4R6KA 2I58A 1LFIA 1BK4A 2P2AA 4PBQA 3FV2A 3OXNA 1M5EA 2XXHA 2QPQA 4P11A 3UGWA 3CRBA 3FGSA 3O2AA 4YB6A 2H99A 1A7LA 1SPIA 4GXAA 3IL1B 4OYVA 5I58A 1RDZA 3PPQA 3VDFA 3SEUA 3LSWA 4IO7A 3ZKLA 3U93A 4FORA 3RTWB 2DE2A 5CBRA 2V3UA 4GFRA 3MPLA 3B6QA 2OJTA 2V3QA 1VFEA 4HXVA 1URGA 2QVVA 2R6GE 2Y7IA 1RYXA 4NF5A 4KYDA 2RC7A 3F11A 1B0HA 3G3JA 4FEBA 1XVXA 4YMAA 4THIA 2B3BA 4YKPA 5CRYA 3KSJA 3MZ1A 1OLAA 4EF1A 2QS4A 3T9XB 2Q88A 2FNCA 3G7WA 2HFBA 4R6HA 1LSTA 2PBWA 4IR8A 5L9MA 3O6HA 4YKIA 3TZAA 1PB8A 1A99A 2WBBA 2NOOA 1TFAA 3C35A 3WAEA 3EN3A 3SETA 4NWDA 3VVFA 1MQGA 3L6GA 4PFYA 5ET7A 5I5PA 2X7PA 3Q29A 4OVPA 4XIGQ 5CI5A 1KA0A 3RT6B 2OWZA 3K01A 5EQ9A 5F1QA 4NEDA 3ILUB 3RGYA 1B7UA 1MDQA 3TCGA 5EQ7A 4EQ7A 3VLVA 1FQBA 4IO2A 1SD3A 3TODA 4QFLA 4IY5A 4GXSB 3RTFB 3VV5A 3CFXA 5I56B 3MUQA 3K4UA 2F36A 2OWTA 2OX3A 5H8FB 3M8UA 4FECA 5CMMA 3R6UA 4N91A 4EUOA 3I5OA 3R26A 5EYFA 2I0CA 4PC9A 3FATA 1A40A 4JVDA 4PAFA 5ET6A 3K1PA 3KBZA 3MYUA 2ZNTA 1AIVA 1SI1A 1USYH 4XKRA 1LB9A 2Y5KA 2GRVA 1AH5A 1FPLA 4P1LA 1GVCA 2QVRA 2I3WA 2KLFA 1ZBMA 4N6PA 2NWJA 1DPPA 1CNQA 4OFLA 3SEWA 2HEUA 1IMCA 3T0JA 1P1QA 4U4SA 2YJPA 5EQ8A 3IX1A 4JSOA 2FIXA 4N15A 4NF4A 3CR9A 4C1TA 4OXVA 2ZXTA 5DTBA 4XKQA 4AS4A 3E3KA 2XX9A 4H1XA 5FHOA 1B4HA 3U8QA 5KDTB 1MH3A 1N04A 1XI6A 4ELRA 1TXFA 1BLFA 4MEVA 3IB0A 1B51A 3KOSA 3ONMA 3FVGA 3K6XA 1XC1A 1DPEA 2F78A 4BDRA 1I69A 1PC3A 2XXIA 4AB5A 5ET5A 2XWKA 1IZ1A 1A54A 4MAGA 4IO3A 2QMXA 5BUUA 2WYKA 4NG7A 2RF1A 3EHUA 4NE4A 4Q8RA 2ZZVA 2Q8MA 2L5VA 2Q8JA 5JTYB 2OLBA 3DP8A 4G8MA 4P3LA 3U1OA 3TTMA 4OESA 2O51A 1VE4A 4ZEIA 5H8NB 1T0KA 3TFLA 4OVTA 3TCFA 4OZ9A 1B05A 4NWCA 3UA8A 2I3VA 3H6WA 1YYZA 1LBXA 1MQJA 3RN8A 4LN5A 1NV4A 4YKKA 1LBCA 1NV7A 1FBHA 2R9JA 1QGXA 2HHMA 4C1UA 3GYYA 1TFDA 4EQBA 1O63A 2OK2A 4F3BA 3G3HA 4IGTA 4JB7A 4FATA 5FHMA 5J1DA 2XXWA 4F18A 2VPNA 3W9VA 3VE1B 2PT1A 3ROJA 3EF7A 1HSEA 4EQ9A 5IZ1A 1A8EA 3H3GA 1FTJA 4MMPA 1SW1A 2Z22A 4OFJA 1DTGA 3MWBA 5ESYA 1I6BA 2ONKE 4YKJA 1NV5A 4KI0E 4UA8A 2QJEA 3VFJA 5F7VA 1SBPA 4F19A 3FBPA 1UIUA 4QFPA 4GLIA 5CM6A 2PFZA 4OQOA 1B9JA 2RCBA 1FTAA 4XXUA 2Y7WA 1LCFA 3K6WA 4NGUA 3B6TA 5I7IA 1PB9A 4G8HA 4JVCA 3T9HB 3CIJA 3C32A 3G3FA 4LONB 3C9HA 3FXBA 3KN8A 1FBFA 3IORA 3MVYA 1G0HA 1GV8A 4IGRA 3O9PA 4M1VA 1I6AA 1FQCA 1PDAA 4X48A 2DVCA 1H45A 2R71A 2KR0A 5L9OA 1LB8A 2YLNA 4NAPA 4XTCQ 1DTZA 4OHNA 2B4LA 3H4ZA 4RJZA 1B6HA 4JDFA 1KA1A 4P1EA 2I4BA 3UN6A 4MBPA 3QMFA 5H8FA 3RNNA 1DK4A 2F3DA 4ZDMA 1IMAA 5DW8A 2F34A 1ANFA 2O6AA 1FPKA 5HPQA 3FJ7A 5IZZA 2CZIA 3LSXA 2QL3A 4GWYA 2NVUB 4F39A 3Q25A 1RYOA 4PFUA 1XOCA 4X9TA 2V84A 2DQVA 1NUZA 4Z0IA 1IMEA 4N17A 2Z8EA 2XXXA 4HE1A 1S9TA 4X1DA 3THIA 2CEYA 3FJMA 1MG1A 3CVGA 5EYGA 4GWWA 3V89B 3CSGA 2DE4A 3IOVA 2DE3A 3IR1A 5AA1A 4ZEBA 3HSTA 4FBPA 3MQ9A 5ICQA 1URSA 1B58A 3EQ1A 3MPKA 1NV0A 1NH7A 1TT1A 5KCJB 1INPA 1D9YA 5KDTA 1B3GA 2D3IA 4JWOA 4X8RA 2I6EA 2I0BA 3GLBA 4NF4B 2V93A 2QS2A 4UACA 4G4PA 1RKMA 1Y3PA 4DIGA 2BJIA 4R73A 4OTEA 3LUYA 4O8MA 1YXIA 1MY2A 4P56A 3KZGA 4G68B 4OWDA 3A3CA 3K1MA 3C34A 1NNTA 4DZ1A 1BIYA 1LAHE 4JBZA 5IAIA 3N5LA 4QSDA 1QULA 4H6DA 3O97A 1NNPA 4ELPA 2RKMA 4ZZAA 3M3FA 1JW5A 1NNFA 1PBQA 3QAXA 5JTYA 5K2XA 4BDLA 4KQPA 3KJTA 3S9LC 4F1YA 4I3YA 1D3KA 2PX1A 4F31B 3H6VA 1M5FA 4RNSA 3T93B 3EHTA 4GIZA 3A29A 1QKAA 4OEVA 5JK4A 4H65A 5H8NA 1Y1MA 3ECRA 4LZ8A 2UYFA 3JZJA 3TQWA 3N6UA 1FSAA 1BP5A 4BDOA 4H67A 3B7DA 1B5IA 4M4GA 3K6VA 4GX6A 3A09A 3IO4A 1JEUA 2Y84A 1IITA 1B3HA 2QVUA 3UK4A 3PPRA 4Q0CA 4XFEA 1IXHA 2P3VA 2RC9A 1Y9UA 3SEXA 3Q26A 3HV1A 5ITPA 2XXUA 1YZ0A 4H5FA 4POXA 3T66A 2PCRA 4ZEDA 2GH9A 3TAJA 3A3UA 2XD3A 4R2FA 3C4MA 3SESA 3OO6A 1MY3A 3FXUA 3MP1A 1ZTYA 4OETA 5FBPA 3FZVA 3CFZA 4YB7A 4F1VA 2HZLA 3O6GA 4WEDA 2CEXA 4GF8A 3QIMA 2AYSA 4ZEFA 4MLVA 5DVIA 1FTLA 1AOVA 2HXRA 2Q89A 3FD3A 2AL4A 4GBWA 1R1NA 4GWXA 4O3BA 4R9GA 5I2KB 1J1NA 2FHYA 1CE2A 3PUXE 3QUJA 4F2QA 4H0WA 4PGNA 4ZECA 1LLSA 4HW8A 3OO9A 4HE2A 3V8XB 4TOZA 1D4NA 4UABA 4PGPA 5H8HB 4ECFA 4N8GA 4I40A 4GBVA 5FHNA 4Q30B 4U2RA 3S9NC 3IOUA 4YAHX 2RCAA 1FPGA 3SERA 3FVKA 4FJPA 1M5CA 4AB6A 1H76A 1Q1KA 1Q35A 4PE5B 2PVUA 2O84X 2O1LA 1UIVA 4KXPA 4H8JA 3HHFA 1IUDA 3TKDA 1XT8A 5TPAB 2F5XA 4EXKA 4MNIA 4DDDA 3VXCA 4MX6A 4WKMA 2XX7A 5DT6A 2G93A 2P0SA 4I62A 5H8QB 4E0XA 4F3SA 1MS7A 2ESNA 2DP8A 1IXCA 3OSQA 4GQOA 1OQHA 2A5TB 2XXQA 2Y7PA 4X1BA 4MNCA 2E0SA 4GWOA 5KCJA 3G3GA 3SZPA 1DCUA 3O29A 4HCWA 2Q9TA 1Z7NE 2XXRA 4F3GA 3OENA 3SEYA 1D9VA 4P0IA 4LZ7A 4G68A 1RDYA 3CG1A 5I2NB 1BKAA 2O69A 1GGGA 3T9UA 3KGCA 1SYIA 1MM6A 2RC8A 3OO7A 3MVWA 1IXIA 4QSCA 2O68A 4XF5A 2XXYA 1B3EA 1DOTA 1FTOA 3N6TA 1EZ9A 3DM0A 1B7ZA 1O64A 1WODA 2X26A 2Y5LA 3HCQA 5ISUA 2GFEA 3DLNA 3CSBA 4ZEKA 1EYKA 1FBDA 3VVDA 3H03A 4IO5A 3W9WA 4O3AA 4MF3A 4NN3A 2FA7A 3U92A 1LCTA 4P47A 3PUVE 5CBSA 3IAZA 2PFYA 2QFLA 1FPBA 3KN3A 1URDA 4DXBA 1FPFA 5B7DA 4YICA 4N07A 1JNFA 2HAUA 1XS5A 4R9FA 3LSLA 1US4A 4U1OA 1QUIA 1WVJA 4O7MA 4HE0A 3MC2A 1TWYA 3QYTA 1ELJA 2ZNUA 2O1MA 2VP1A 5JEIA 1O7TA 1OMPA 3FXRA 2DSFA 4I9DA 2DWHA 3T96B 1JVYA 3E4RA 1A55A 4K3FA 4U4XA 5TP9B 4HTGA 3IFAA 1KWHA 2IEEA 3FASA 4AQ4A 1NUWA 3RLFE 3B50A 3M3LA 4ZZEA 3RT8A 3LC8A 1FJ9A 4DXCA 1Q9DA 3TELA 4PETA 4PBHA 2DVZA 5AA4A 1JQFA 3ISPA 1FQEA 4ESXA 5L9SA 3BBRA 3HPIA 2QSXA 2RINA 2DWIA 4OANA 2WEFA 4U23A 3IB1A 4POWA 3PD8A 5I2KA 1B2HA 4JVIA 3TYHA 2ZMBA 5IKBA 4BDQA 5LDZA 3VXBA 3VVEA 5H8HA 2F7AA 1DBZA 2E1SA 2F7BA 2XWVA 3D1RA 4OENA 2ZNSA 1SW2A 4NF8B 1YTVA 3MVZA 1R9LA 3PPPA 4RPOA 4ZE8A 1EH3A 4KYSA 2DXYA 2QRYA 2F6PA 1QW0A 5EHMA 1ZMGA 1G0IA 5AA2B 5TPAA 2F35A 3S4UA 2OBGA 3K02A 3FIRA 3B8BA 3H06B 4GD5A 4PFWA 1K9ZA 1M5BA 1MXYA 2OWSA 5I3SA 4LA9A 1R6ZA 5H8QA 1SVXB 2UYEA 2UVHA 3MSTA 1NH8A 3EKIA 3FVOA 5IGAA 1FTKA 1MXZA 4IB2A 4EXLA 2B4MA 2FVZA 4GL8A 1EZPA 2A5TA 3QSLA 2NUVA 2VOZA 4LP2B 1LAGE 2DWJA 1YCJA 1NL5A 2DWAA 4PQJA 1YAEA 3OD7A 2XXKA 4PFBA 3PTYA 4OVSA 3BFTA 4G77A 3PUWE 4EF2A 3IJXB 2VD2A 1L5TA 1ZIUA 3G3KA 1Y3NA 4GX4A 1Y4TA 1OIBA 1WDNA 5I59B 3QXMA 2KQZA 3O6IA 5I2NA 2LAOA 2VD3A 4H5GA 4MJOA 4QBAA 4L17A 4WXJA 3T1BA 1LFHA 1H3DA 1CB6A 2V25A 1QJMA 1LBWA 1MPDA 4JWXA 2Z8FA 4XKPA 3LSFB 5EQAA 5A5LA 1POY1 1N7WA 4QFOA 4N4UA 5TU0A 2Q2AA 1AMFA 3PV0E 4ND9A 4ZS9A 4G68C 1ZKBA 3GZGA 2GHBA 3GBBA 3K00A 2X7QA 5L8DA 2IA4A 5K2YA 3QK6A 2UVJA 4LUBA 4O3CA 4OVQA 2I4CA 1N0TA 2XA5A 2XD2A 4PTKA 5LTCA 1LBYA 4PFIA 3E78A 3N94A 4ESWA 1MXWA 2AIXA 3K0VA 1B52A 4LVQA 5T3JA 4H45A 2ZYKA 4P0GA 4KHZE 4LATA 3ZKKA 3GBAA 4OVRA 1JW1A 4LQ2A 1Y3QA 4PAKA 1NNKA 4KPTA 3C31A 3MVXA 2O7UA 4DE8A 5DEXB 4F29A 1MQDA 1OVTA 3TMGA 3N26A 4BLAA 1FPDA 4N81A 3ZSFA 2Q74A 4OFOA 1PBPA 3AXFA 4BDNA 3TTRA 5TP9A 2UXAA 5AE4A 3K1NA 3RY3A 4OA4A 1B3FA 2Z23A 2Y7KA 4MNPA 1F9BA 3NOHA 5AA3A 2H4IA 1MQHA 2ZYMA 1B5HA 3IOTA 5HM4B 1VSOA 4QXDA 3LBSA 1FBCA 2M8CA 4DI4B 3KJ7A 1MXUA 3Q28A 2GQ1A 3FVNA 3RPLA 5B70A 2DOJA 4WEPA 4P9KA 3H6UA 2CZKA 4DI3D 2H25A 1QUJA 1Z7ME 3OELA 1IIWA 1UTBB 2HXWA 1A8FA 3PPOA 2H5YA 3FV1A 1M5DA 1R9QA 4FIMA 5AA4B 5LOMA 2DDKA 3C36A 1GR2A 3KC1A 2H98A 2ALUA 1MXXA 4F3PA 5I57B 4HCYA 1MY1A 3IFCA 2ZZWA 3FJGA 5ET8A 5CMCA 1IMDA 1XVYA 4FE8A 1MXVA 3RPWA
chains in the Genus database with same CATH topology
3T9VA 4H8IA 3MZ9A 3C33A 3HO7A 1GTKA 3EHSA 3KSXA 2Z8DA 4N13A 1MH4A 4IO4A 4RA1A 3PGFA 4NF6B 2OCUA 4LQ5A 3FUZA 4NF8A 4RYAA 5FTIA 1SW5A 1NKXA 4DLDA 2CMOA 1MY4A 3OEMA 3BKIB 4I8CA 1FQFA 1OLCA 5AA2A 2ONSA 4F2OA 4ISUA 4YU0A 3MP6A 1XHYA 4OEUA 3PMWA 1IXGA 3PPNA 3FXQA 4EDPA 5CMKA 1N84A 3ZS6A 1N3XA 2QMWA 5M2VA 3SKPA 4QRZA 3G3IA 3SEVA 5A5XB 3O28A 3USDA 1MY0A 5DYHA 5H8SA 4KD5A 4ELOA 4MLQA 1PEBA 3L6HA 1MDP1 3LR1A 2W7YA 3E9XA 4XKNA 2I49A 3S9MC 4RK2A 1IQ7A 3EPEA 2QS1A 5I59A 4LZ5A 3V83A 1MPBA 4QF9A 4QHQA 1P1OA 4G8NA 3KN7A 1N7XA 3OOAA 3ODBA 4F1UA 2AL5A 1SW4A 1S50A 1P1NA 4GVOA 1B46A 2FYIA 1DMBA 3DP4A 1JW4A 4KYEA 3PD9A 2PMSA 1P1WA 3UORA 3M3KA 5KZTA 2XHDA 1UTHA 2DXRA 3VLUA 4Q5TA 1QKBA 2HCAA 1FQAA 1PB7A 3TTNA 1VFDA 1SDXA 4YMBA 2NXOA 3BFUA 2XXTA 1NMUA 4PP0A 1EZOA 2D5WA 3S2VA 1B3LA 3H6TA 5DEXA 4JXIA 4C0RA 4KR5A 1VR5A 3E13X 4NTLA 4GRKA 1LAFE 1HSJA 5FTHA 3KOTA 4DCXA 2UVGA 3OSRA 4R6YA 1MQIA 3SDFA 5CC2A 4RY1A 3MAMA 4ELQA 1P99A 1SQYA 3DP6A 3PMVA 3CG3A 4TLLB 2VGQA 1P1UA 4TLMB 2VHAA 2F8DA 4YB5A 4MFIA 3U72A 2DYXA 4JWYA 1N3WA 2O7IA 1UTBA 4OVJA 3P7IA 1QUKA 3PMXA 1FW0A 2ONRA 3PUYE 2QS3A 2PYYA 5I57A 3VLWA 3IK6B 3TQLA 1OVBA 1S7YA 3MJNA 4JSDA 3D4GA 5I58B 1Y20A 2A5SA 1B5JA 3PU5A 3IB2A 3KFMA 1HSLA 4QFNA 4OMBA 4E0WA 1SI0A 4DXUA 4ONYA 1AL3A 3K2DA 4NF6A 5DVJA 3S9EA 4NF5B 1JVXA 2ZYOA 1POTA 1II5A 5ITOA 1B0LA 2YPNA 3D4CA 3HHGA 1YPNA 3O66A 3OO8A 3V5AA 1B32A 4RK9A 3MP8A 4IO6A 3I6VA 4I1DA 3MW0A 1LGBC 2G29A 2ABHA 2UVIA 1QVSA 1ZU0A 1Y4CA 2B3FA 1USYE 2REGA 5I84A 4U1ZA 1B40A 5HBCA 5DVFA 3CFLA 4OERA 1UQWA 1MPCA 2PT2A 4KCCA 3TCHA 5A5XA 4ZE9A 2Y7RA 4IY6A 4R74A 5I56A 4FAJA 2CZLA 1ZJLA 1Y1ZA 4KFQA 3CI8A 3I3VA 1MM7A 3MZBA 1LFGA 2P1SA 3GXAA 1IEJA 2XXPA 4DCYA 4FEDA 2OZZA 1JETA 1FTMA 1H44A 2HQ0A 3JYRA 1B7HA 3KBRA 2Q2CA 4Z7EA 2THIA 3B6WA 3TTLA 1H43A 4HS7A 2HAVA 1ZLQA 2XXVA 1FQDA 3TTKA 3UIFA 1DSNA 1B4ZA 2WKYA 3PUZE 3DELB 2HZKA 3IOWA 1LAXA 4QSEA 1BTJA 4GOTA 4GL0A 1B1XA 3IJOB 4F22A 4KCDA 3WAFA 3ILTB 3IO6A 2BJJX 4R72A 3KEIA 1SYHA 4RXLA 2GHAA 4G2ZA 1US5A 3TEPA 1I6QA 2V3TA 3H7MA 1EU8A 5CMBA 5BWJA 2ZYNA 1OQGA 2D21A 2F7CA 5EHSA 3QUFA 2H9BA 4U22A 4R75A 3K6UA 1NFTA 1UTHB 2ANJA 4NMYA 2F6GA 4MH5A 4QFKA 4RPNA 4U21A 5ELVA 2DS9A 3W15C 2F97A 3OMBA 3R7XA 1MRPA 1ATGA 1JEVA 3Q27A 1B1HA 5ICTA 3TUSA 1N76A 3UP9A 3MBPA 4PFTA 2XX8A 3TDJA 5AA2D 3OEKA 4TQUQ 3KG2A 3JV9A 2I48A 1LBBA 3T22A 3U94A 3HN0A 3RUMA 3TPAA 2B65A 4R2BA 4YZZA 2REJA 4BDMA 3RQTA 1FCKA 4R6KA 2I58A 1LFIA 2P2AA 3FV2A 3OXNA 1M5EA 2XXHA 2QPQA 4P11A 3UGWA 3CRBA 3FGSA 3O2AA 4YB6A 2H99A 1A7LA 4GXAA 3IL1B 4OYVA 5I58A 3PPQA 3VDFA 3SEUA 3LSWA 4IO7A 3ZKLA 3U93A 4FORA 3RTWB 2DE2A 5CBRA 2V3UA 4GFRA 3MPLA 3B6QA 2OJTA 2V3QA 1VFEA 1URGA 2Y7IA 2R6GE 1RYXA 4NF5A 4KYDA 2RC7A 3F11A 1B0HA 3G3JA 4FEBA 1XVXA 4YMAA 4THIA 2B3BA 4YKPA 5CRYA 3KSJA 3MZ1A 1OLAA 4EF1A 2QS4A 3T9XB 2Q88A 2FNCA 3G7WA 2HFBA 4R6HA 1LSTA 2PBWA 5L9MA 3O6HA 4YKIA 3TZAA 1PB8A 1A99A 2NOOA 1TFAA 3C35A 3WAEA 3EN3A 3SETA 4NWDA 3VVFA 1MQGA 3L6GA 4PFYA 2X7PA 3Q29A 5CI5A 4XIGQ 3RT6B 3K01A 5F1QA 4NEDA 3ILUB 3RGYA 1B7UA 1MDQA 3TCGA 4EQ7A 3VLVA 1FQBA 4IO2A 1SD3A 3TODA 4QFLA 4IY5A 4GXSB 3RTFB 3VV5A 3CFXA 5I56B 3MUQA 3K4UA 2F36A 2OWTA 5H8FB 3M8UA 4FECA 5CMMA 3R6UA 4EUOA 3I5OA 3R26A 5EYFA 2I0CA 3FATA 1A40A 3K1PA 1AIVA 2ZNTA 1SI1A 1USYH 4XKRA 1LB9A 2GRVA 1AH5A 1GVCA 2I3WA 2KLFA 1ZBMA 4N6PA 2NWJA 1DPPA 4OFLA 3SEWA 2HEUA 1P1QA 4U4SA 2YJPA 3IX1A 4JSOA 4NF4A 3CR9A 4C1TA 4OXVA 2ZXTA 5DTBA 4XKQA 3E3KA 2XX9A 4H1XA 5FHOA 1B4HA 3U8QA 5KDTB 1MH3A 1N04A 4ELRA 1TXFA 1BLFA 3IB0A 1B51A 3KOSA 3ONMA 3FVGA 3K6XA 1XC1A 1DPEA 2F78A 4BDRA 1I69A 1PC3A 2XXIA 4AB5A 1IZ1A 1A54A 4IO3A 2QMXA 5BUUA 2RF1A 3EHUA 4NE4A 4Q8RA 2Q8JA 5JTYB 2OLBA 3DP8A 4G8MA 3U1OA 3TTMA 4OESA 2O51A 1VE4A 4ZEIA 5H8NB 1T0KA 3TFLA 3TCFA 4OZ9A 1B05A 4NWCA 3UA8A 2I3VA 3H6WA 1MQJA 3RN8A 4YKKA 1LBCA 2R9JA 4C1UA 1TFDA 4EQBA 1O63A 2OK2A 4F3BA 3G3HA 4IGTA 4JB7A 4FATA 5FHMA 5J1DA 2XXWA 4F18A 3W9VA 3VE1B 2PT1A 3EF7A 1HSEA 4EQ9A 1A8EA 3H3GA 1FTJA 1SW1A 2Z22A 4OFJA 1DTGA 3MWBA 1I6BA 2ONKE 4YKJA 4KI0E 4UA8A 2QJEA 3VFJA 5F7VA 1SBPA 4F19A 1UIUA 4QFPA 4GLIA 5CM6A 4OQOA 1B9JA 2RCBA 4XXUA 2Y7WA 1LCFA 3K6WA 3B6TA 1PB9A 4G8HA 3T9HB 3CIJA 3C32A 3G3FA 4LONB 3C9HA 3KN8A 3IORA 3MVYA 1GV8A 4IGRA 3O9PA 4M1VA 1I6AA 1FQCA 1PDAA 4X48A 2DVCA 1H45A 2R71A 5L9OA 1LB8A 2YLNA 4XTCQ 1DTZA 4OHNA 3H4ZA 4RJZA 1B6HA 4JDFA 2I4BA 3UN6A 4MBPA 5H8FA 3RNNA 4ZDMA 2F34A 1ANFA 2O6AA 5HPQA 3FJ7A 3LSXA 2QL3A 2NVUB 4F39A 3Q25A 1RYOA 4PFUA 1XOCA 4X9TA 2V84A 2DQVA 4Z0IA 2Z8EA 2XXXA 1S9TA 4X1DA 3THIA 3FJMA 1MG1A 3CVGA 3V89B 3CSGA 2DE4A 3IOVA 2DE3A 3IR1A 5AA1A 4ZEBA 3HSTA 3MQ9A 5ICQA 1URSA 1B58A 3EQ1A 3MPKA 1NH7A 1TT1A 5KCJB 1D9YA 5KDTA 1B3GA 2D3IA 4JWOA 2I6EA 2I0BA 3GLBA 4NF4B 2V93A 2QS2A 4UACA 4G4PA 1RKMA 1Y3PA 4DIGA 4R73A 3LUYA 4OTEA 1MY2A 3KZGA 4G68B 4OWDA 3A3CA 3K1MA 3C34A 1NNTA 4DZ1A 1BIYA 1LAHE 4JBZA 5IAIA 3N5LA 4QSDA 1QULA 4H6DA 3O97A 1NNPA 4ELPA 2RKMA 4ZZAA 3M3FA 1JW5A 1NNFA 1PBQA 3QAXA 5JTYA 5K2XA 4BDLA 4KQPA 3KJTA 3S9LC 4F1YA 1D3KA 2PX1A 4F31B 3H6VA 1M5FA 4RNSA 3T93B 3EHTA 4GIZA 1QKAA 4OEVA 5JK4A 4H65A 5H8NA 1Y1MA 3ECRA 4LZ8A 2UYFA 3JZJA 3TQWA 3N6UA 1BP5A 4BDOA 4H67A 3B7DA 1B5IA 4M4GA 3K6VA 3A09A 3IO4A 1JEUA 2Y84A 1IITA 1B3HA 3UK4A 3PPRA 4Q0CA 1IXHA 2RC9A 1Y9UA 3SEXA 3Q26A 3HV1A 5ITPA 2XXUA 4H5FA 4POXA 3T66A 4ZEDA 2GH9A 3TAJA 3A3UA 2XD3A 4R2FA 3C4MA 3SESA 3OO6A 1MY3A 3FXUA 3MP1A 1ZTYA 4OETA 3FZVA 3CFZA 4YB7A 4F1VA 2HZLA 3O6GA 4WEDA 4GF8A 3QIMA 2AYSA 4ZEFA 4MLVA 5DVIA 1FTLA 1AOVA 2Q89A 3FD3A 2AL4A 1R1NA 4O3BA 4R9GA 5I2KB 1J1NA 1CE2A 3PUXE 3QUJA 4F2QA 4H0WA 4ZECA 1LLSA 4HW8A 3OO9A 3V8XB 4TOZA 1D4NA 5H8HB 4ECFA 5FHNA 4Q30B 4U2RA 3S9NC 3IOUA 4YAHX 2RCAA 3SERA 3FVKA 4FJPA 1M5CA 4AB6A 1H76A 1Q1KA 1Q35A 4PE5B 2PVUA 2O84X 2O1LA 1UIVA 4H8JA 3HHFA 1IUDA 3TKDA 1XT8A 5TPAB 2F5XA 4EXKA 4DDDA 3VXCA 4WKMA 2XX7A 5DT6A 2G93A 2P0SA 4I62A 5H8QB 4E0XA 4F3SA 1MS7A 2ESNA 2DP8A 1IXCA 3OSQA 4GQOA 1OQHA 2A5TB 2XXQA 2Y7PA 4X1BA 2E0SA 4GWOA 5KCJA 3G3GA 3O29A 4HCWA 2Q9TA 1Z7NE 2XXRA 4F3GA 3OENA 3SEYA 1D9VA 4P0IA 4LZ7A 4G68A 3CG1A 5I2NB 1BKAA 2O69A 1GGGA 3T9UA 3KGCA 1SYIA 1MM6A 2RC8A 3OO7A 3MVWA 1IXIA 4QSCA 2O68A 2XXYA 1B3EA 1DOTA 1FTOA 3N6TA 1EZ9A 3DM0A 1B7ZA 1O64A 1WODA 2X26A 3HCQA 5ISUA 2GFEA 3DLNA 3CSBA 4ZEKA 3VVDA 3H03A 4IO5A 3W9WA 4O3AA 4MF3A 2FA7A 3U92A 1LCTA 3PUVE 5CBSA 3IAZA 3KN3A 1URDA 4DXBA 5B7DA 4YICA 4N07A 1JNFA 2HAUA 1XS5A 4R9FA 3LSLA 1US4A 4U1OA 1QUIA 1WVJA 3MC2A 1TWYA 3QYTA 1ELJA 2ZNUA 2O1MA 2VP1A 5JEIA 1O7TA 1OMPA 3FXRA 2DSFA 4I9DA 2DWHA 3T96B 1JVYA 3E4RA 1A55A 4K3FA 4U4XA 5TP9B 4HTGA 1KWHA 2IEEA 3FASA 4AQ4A 3RLFE 3M3LA 4ZZEA 3RT8A 3LC8A 4DXCA 3TELA 4PETA 2DVZA 5AA4A 1JQFA 1FQEA 4ESXA 5L9SA 3BBRA 3HPIA 2QSXA 2RINA 2DWIA 4U23A 3IB1A 4POWA 3PD8A 5I2KA 1B2HA 3TYHA 2ZMBA 5IKBA 4BDQA 3VXBA 3VVEA 5H8HA 2F7AA 2E1SA 2F7BA 4OENA 2ZNSA 1SW2A 4NF8B 1YTVA 3MVZA 1R9LA 3PPPA 4RPOA 4ZE8A 1EH3A 4KYSA 2DXYA 2QRYA 2F6PA 1QW0A 5EHMA 1ZMGA 5AA2B 5TPAA 2F35A 3S4UA 2OBGA 3K02A 3FIRA 3H06B 4GD5A 4PFWA 1M5BA 1MXYA 2OWSA 4LA9A 1R6ZA 5H8QA 1SVXB 2UYEA 2UVHA 1NH8A 3FVOA 1FTKA 1MXZA 4IB2A 4EXLA 4GL8A 1EZPA 2A5TA 3QSLA 2NUVA 2VOZA 4LP2B 1LAGE 2DWJA 1YCJA 1NL5A 2DWAA 4PQJA 1YAEA 3OD7A 3BFTA 4G77A 3PUWE 4EF2A 3IJXB 2VD2A 1L5TA 1ZIUA 3G3KA 1Y3NA 1Y4TA 1OIBA 1WDNA 5I59B 3QXMA 3O6IA 5I2NA 2LAOA 2VD3A 4H5GA 4L17A 4WXJA 1LFHA 1H3DA 1CB6A 2V25A 1QJMA 1MPDA 4JWXA 2Z8FA 4XKPA 3LSFB 1POY1 1N7WA 4QFOA 5TU0A 2Q2AA 1AMFA 3PV0E 4ND9A 4ZS9A 4G68C 1ZKBA 3GZGA 2GHBA 3GBBA 3K00A 2X7QA 5L8DA 2IA4A 5K2YA 3QK6A 2UVJA 4LUBA 4O3CA 2I4CA 1N0TA 2XD2A 3N94A 4ESWA 1MXWA 2AIXA 3K0VA 1B52A 4LVQA 2ZYKA 4P0GA 4KHZE 4LATA 3ZKKA 3GBAA 1JW1A 4LQ2A 1Y3QA 1NNKA 4KPTA 3C31A 3MVXA 2O7UA 4DE8A 5DEXB 4F29A 1MQDA 1OVTA 3TMGA 3N26A 4BLAA 3ZSFA 4OFOA 1PBPA 3AXFA 4BDNA 3TTRA 5TP9A 2UXAA 5AE4A 3K1NA 3RY3A 1B3FA 2Z23A 2Y7KA 1F9BA 5AA3A 2H4IA 1MQHA 2ZYMA 1B5HA 3IOTA 5HM4B 1VSOA 3LBSA 2M8CA 3KJ7A 1MXUA 3Q28A 3FVNA 5B70A 2DOJA 4WEPA 3H6UA 2H25A 1QUJA 1Z7ME 3OELA 1IIWA 1UTBB 2HXWA 1A8FA 3PPOA 2H5YA 3FV1A 1M5DA 1R9QA 4FIMA 5AA4B 5LOMA 3C36A 1GR2A 2H98A 2ALUA 1MXXA 4F3PA 5I57B 4HCYA 1MY1A 3FJGA 5CMCA 1XVYA 4FE8A 1MXVA 3RPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9V A;  4H8I A;  3MZ9 A;  3C33 A;  3HO7 A;  1GTK A;  3EHS A;  3KSX A;  2Z8D A;  4N13 A;  1MH4 A;  4IO4 A;  4RA1 A;  3PGF A;  4NF6 B;  2OCU A;  4LQ5 A;  3FUZ A;  4NF8 A;  4RYA A;  5FTI A;  1SW5 A;  1NKX A;  4DLD A;  2CMO A;  1MY4 A;  3OEM A;  3BKI B;  4I8C A;  1FQF A;  1OLC A;  5AA2 A;  2ONS A;  4F2O A;  4ISU A;  4YU0 A;  3MP6 A;  1XHY A;  4OEU A;  3PMW A;  1IXG A;  3PPN A;  3FXQ A;  4EDP A;  5CMK A;  1N84 A;  3ZS6 A;  1N3X A;  2QMW A;  5M2V A;  3SKP A;  4QRZ A;  3G3I A;  3SEV A;  5A5X B;  3O28 A;  3USD A;  1MY0 A;  5DYH A;  5H8S A;  4KD5 A;  4ELO A;  4MLQ A;  1PEB A;  3L6H A;  1MDP 1;  3LR1 A;  2W7Y A;  3E9X A;  4XKN A;  2I49 A;  3S9M C;  4RK2 A;  1IQ7 A;  3EPE A;  2QS1 A;  5I59 A;  4LZ5 A;  3V83 A;  1MPB A;  4QF9 A;  4QHQ A;  1P1O A;  4G8N A;  3KN7 A;  1N7X A;  3OOA A;  3ODB A;  4F1U A;  2AL5 A;  1SW4 A;  1S50 A;  1P1N A;  4GVO A;  1B46 A;  2FYI A;  1DMB A;  3DP4 A;  1JW4 A;  4KYE A;  3PD9 A;  2PMS A;  1P1W A;  3UOR A;  3M3K A;  5KZT A;  2XHD A;  1UTH A;  2DXR A;  3VLU A;  4Q5T A;  1QKB A;  2HCA A;  1FQA A;  1PB7 A;  3TTN A;  1VFD A;  1SDX A;  4YMB A;  2NXO A;  3BFU A;  2XXT A;  1NMU A;  4PP0 A;  1EZO A;  2D5W A;  3S2V A;  1B3L A;  3H6T A;  5DEX A;  4JXI A;  4C0R A;  4KR5 A;  1VR5 A;  3E13 X;  4NTL A;  4GRK A;  1LAF E;  1HSJ A;  5FTH A;  3KOT A;  4DCX A;  2UVG A;  3OSR A;  4R6Y A;  1MQI A;  3SDF A;  5CC2 A;  4RY1 A;  3MAM A;  4ELQ A;  1P99 A;  1SQY A;  3DP6 A;  3PMV A;  3CG3 A;  4TLL B;  2VGQ A;  1P1U A;  4TLM B;  2VHA A;  2F8D A;  4YB5 A;  4MFI A;  3U72 A;  2DYX A;  4JWY A;  1N3W A;  2O7I A;  1UTB A;  4OVJ A;  3P7I A;  1QUK A;  3PMX A;  1FW0 A;  2ONR A;  3PUY E;  2QS3 A;  2PYY A;  5I57 A;  3VLW A;  3IK6 B;  3TQL A;  1OVB A;  1S7Y A;  3MJN A;  4JSD A;  3D4G A;  5I58 B;  1Y20 A;  2A5S A;  1B5J A;  3PU5 A;  3IB2 A;  3KFM A;  1HSL A;  4QFN A;  4OMB A;  4E0W A;  1SI0 A;  4DXU A;  4ONY A;  1AL3 A;  3K2D A;  4NF6 A;  5DVJ A;  3S9E A;  4NF5 B;  1JVX A;  2ZYO A;  1POT A;  1II5 A;  5ITO A;  1B0L A;  2YPN A;  3D4C A;  3HHG A;  1YPN A;  3O66 A;  3OO8 A;  3V5A A;  1B32 A;  4RK9 A;  3MP8 A;  4IO6 A;  3I6V A;  4I1D A;  3MW0 A;  1LGB C;  2G29 A;  2ABH A;  2UVI A;  1QVS A;  1ZU0 A;  1Y4C A;  2B3F A;  1USY E;  2REG A;  5I84 A;  4U1Z A;  1B40 A;  5HBC A;  5DVF A;  3CFL A;  4OER A;  1UQW A;  1MPC A;  2PT2 A;  4KCC A;  3TCH A;  5A5X A;  4ZE9 A;  2Y7R A;  4IY6 A;  4R74 A;  5I56 A;  4FAJ A;  2CZL A;  1ZJL A;  1Y1Z A;  4KFQ A;  3CI8 A;  3I3V A;  1MM7 A;  3MZB A;  1LFG A;  2P1S A;  3GXA A;  1IEJ A;  2XXP A;  4DCY A;  4FED A;  2OZZ A;  1JET A;  1FTM A;  1H44 A;  2HQ0 A;  3JYR A;  1B7H A;  3KBR A;  2Q2C A;  4Z7E A;  2THI A;  3B6W A;  3TTL A;  1H43 A;  4HS7 A;  2HAV A;  1ZLQ A;  2XXV A;  1FQD A;  3TTK A;  3UIF A;  1DSN A;  1B4Z A;  2WKY A;  3PUZ E;  3DEL B;  2HZK A;  3IOW A;  1LAX A;  4QSE A;  1BTJ A;  4GOT A;  4GL0 A;  1B1X A;  3IJO B;  4F22 A;  4KCD A;  3WAF A;  3ILT B;  3IO6 A;  2BJJ X;  4R72 A;  3KEI A;  1SYH A;  4RXL A;  2GHA A;  4G2Z A;  1US5 A;  3TEP A;  1I6Q A;  2V3T A;  3H7M A;  1EU8 A;  5CMB A;  5BWJ A;  2ZYN A;  1OQG A;  2D21 A;  2F7C A;  5EHS A;  3QUF A;  2H9B A;  4U22 A;  4R75 A;  3K6U A;  1NFT A;  1UTH B;  2ANJ A;  4NMY A;  2F6G A;  4MH5 A;  4QFK A;  4RPN A;  4U21 A;  5ELV A;  2DS9 A;  3W15 C;  2F97 A;  3OMB A;  3R7X A;  1MRP A;  1ATG A;  1JEV A;  3Q27 A;  1B1H A;  5ICT A;  3TUS A;  1N76 A;  3UP9 A;  3MBP A;  4PFT A;  2XX8 A;  3TDJ A;  5AA2 D;  3OEK A;  4TQU Q;  3KG2 A;  3JV9 A;  2I48 A;  1LBB A;  3T22 A;  3U94 A;  3HN0 A;  3RUM A;  3TPA A;  2B65 A;  4R2B A;  4YZZ A;  2REJ A;  4BDM A;  3RQT A;  1FCK A;  4R6K A;  2I58 A;  1LFI A;  2P2A A;  3FV2 A;  3OXN A;  1M5E A;  2XXH A;  2QPQ A;  4P11 A;  3UGW A;  3CRB A;  3FGS A;  3O2A A;  4YB6 A;  2H99 A;  1A7L A;  4GXA A;  3IL1 B;  4OYV A;  5I58 A;  3PPQ A;  3VDF A;  3SEU A;  3LSW A;  4IO7 A;  3ZKL A;  3U93 A;  4FOR A;  3RTW B;  2DE2 A;  5CBR A;  2V3U A;  4GFR A;  3MPL A;  3B6Q A;  2OJT A;  2V3Q A;  1VFE A;  1URG A;  2Y7I A;  2R6G E;  1RYX A;  4NF5 A;  4KYD A;  2RC7 A;  3F11 A;  1B0H A;  3G3J A;  4FEB A;  1XVX A;  4YMA A;  4THI A;  2B3B A;  4YKP A;  5CRY A;  3KSJ A;  3MZ1 A;  1OLA A;  4EF1 A;  2QS4 A;  3T9X B;  2Q88 A;  2FNC A;  3G7W A;  2HFB A;  4R6H A;  1LST A;  2PBW A;  5L9M A;  3O6H A;  4YKI A;  3TZA A;  1PB8 A;  1A99 A;  2NOO A;  1TFA A;  3C35 A;  3WAE A;  3EN3 A;  3SET A;  4NWD A;  3VVF A;  1MQG A;  3L6G A;  4PFY A;  2X7P A;  3Q29 A;  5CI5 A;  4XIG Q;  3RT6 B;  3K01 A;  5F1Q A;  4NED A;  3ILU B;  3RGY A;  1B7U A;  1MDQ A;  3TCG A;  4EQ7 A;  3VLV A;  1FQB A;  4IO2 A;  1SD3 A;  3TOD A;  4QFL A;  4IY5 A;  4GXS B;  3RTF B;  3VV5 A;  3CFX A;  5I56 B;  3MUQ A;  3K4U A;  2F36 A;  2OWT A;  5H8F B;  3M8U A;  4FEC A;  5CMM A;  3R6U A;  4EUO A;  3I5O A;  3R26 A;  5EYF A;  2I0C A;  3FAT A;  1A40 A;  3K1P A;  1AIV A;  2ZNT A;  1SI1 A;  1USY H;  4XKR A;  1LB9 A;  2GRV A;  1AH5 A;  1GVC A;  2I3W A;  2KLF A;  1ZBM A;  4N6P A;  2NWJ A;  1DPP A;  4OFL A;  3SEW A;  2HEU A;  1P1Q A;  4U4S A;  2YJP A;  3IX1 A;  4JSO A;  4NF4 A;  3CR9 A;  4C1T A;  4OXV A;  2ZXT A;  5DTB A;  4XKQ A;  3E3K A;  2XX9 A;  4H1X A;  5FHO A;  1B4H A;  3U8Q A;  5KDT B;  1MH3 A;  1N04 A;  4ELR A;  1TXF A;  1BLF A;  3IB0 A;  1B51 A;  3KOS A;  3ONM A;  3FVG A;  3K6X A;  1XC1 A;  1DPE A;  2F78 A;  4BDR A;  1I69 A;  1PC3 A;  2XXI A;  4AB5 A;  1IZ1 A;  1A54 A;  4IO3 A;  2QMX A;  5BUU A;  2RF1 A;  3EHU A;  4NE4 A;  4Q8R A;  2Q8J A;  5JTY B;  2OLB A;  3DP8 A;  4G8M A;  3U1O A;  3TTM A;  4OES A;  2O51 A;  1VE4 A;  4ZEI A;  5H8N B;  1T0K A;  3TFL A;  3TCF A;  4OZ9 A;  1B05 A;  4NWC A;  3UA8 A;  2I3V A;  3H6W A;  1MQJ A;  3RN8 A;  4YKK A;  1LBC A;  2R9J A;  4C1U A;  1TFD A;  4EQB A;  1O63 A;  2OK2 A;  4F3B A;  3G3H A;  4IGT A;  4JB7 A;  4FAT A;  5FHM A;  5J1D A;  2XXW A;  4F18 A;  3W9V A;  3VE1 B;  2PT1 A;  3EF7 A;  1HSE A;  4EQ9 A;  1A8E A;  3H3G A;  1FTJ A;  1SW1 A;  2Z22 A;  4OFJ A;  1DTG A;  3MWB A;  1I6B A;  2ONK E;  4YKJ A;  4KI0 E;  4UA8 A;  2QJE A;  3VFJ A;  5F7V A;  1SBP A;  4F19 A;  1UIU A;  4QFP A;  4GLI A;  5CM6 A;  4OQO A;  1B9J A;  2RCB A;  4XXU A;  2Y7W A;  1LCF A;  3K6W A;  3B6T A;  1PB9 A;  4G8H A;  3T9H B;  3CIJ A;  3C32 A;  3G3F A;  4LON B;  3C9H A;  3KN8 A;  3IOR A;  3MVY A;  1GV8 A;  4IGR A;  3O9P A;  4M1V A;  1I6A A;  1FQC A;  1PDA A;  4X48 A;  2DVC A;  1H45 A;  2R71 A;  5L9O A;  1LB8 A;  2YLN A;  4XTC Q;  1DTZ A;  4OHN A;  3H4Z A;  4RJZ A;  1B6H A;  4JDF A;  2I4B A;  3UN6 A;  4MBP A;  5H8F A;  3RNN A;  4ZDM A;  2F34 A;  1ANF A;  2O6A A;  5HPQ A;  3FJ7 A;  3LSX A;  2QL3 A;  2NVU B;  4F39 A;  3Q25 A;  1RYO A;  4PFU A;  1XOC A;  4X9T A;  2V84 A;  2DQV A;  4Z0I A;  2Z8E A;  2XXX A;  1S9T A;  4X1D A;  3THI A;  3FJM A;  1MG1 A;  3CVG A;  3V89 B;  3CSG A;  2DE4 A;  3IOV A;  2DE3 A;  3IR1 A;  5AA1 A;  4ZEB A;  3HST A;  3MQ9 A;  5ICQ A;  1URS A;  1B58 A;  3EQ1 A;  3MPK A;  1NH7 A;  1TT1 A;  5KCJ B;  1D9Y A;  5KDT A;  1B3G A;  2D3I A;  4JWO A;  2I6E A;  2I0B A;  3GLB A;  4NF4 B;  2V93 A;  2QS2 A;  4UAC A;  4G4P A;  1RKM A;  1Y3P A;  4DIG A;  4R73 A;  3LUY A;  4OTE A;  1MY2 A;  3KZG A;  4G68 B;  4OWD A;  3A3C A;  3K1M A;  3C34 A;  1NNT A;  4DZ1 A;  1BIY A;  1LAH E;  4JBZ A;  5IAI A;  3N5L A;  4QSD A;  1QUL A;  4H6D A;  3O97 A;  1NNP A;  4ELP A;  2RKM A;  4ZZA A;  3M3F A;  1JW5 A;  1NNF A;  1PBQ A;  3QAX A;  5JTY A;  5K2X A;  4BDL A;  4KQP A;  3KJT A;  3S9L C;  4F1Y A;  1D3K A;  2PX1 A;  4F31 B;  3H6V A;  1M5F A;  4RNS A;  3T93 B;  3EHT A;  4GIZ A;  1QKA A;  4OEV A;  5JK4 A;  4H65 A;  5H8N A;  1Y1M A;  3ECR A;  4LZ8 A;  2UYF A;  3JZJ A;  3TQW A;  3N6U A;  1BP5 A;  4BDO A;  4H67 A;  3B7D A;  1B5I A;  4M4G A;  3K6V A;  3A09 A;  3IO4 A;  1JEU A;  2Y84 A;  1IIT A;  1B3H A;  3UK4 A;  3PPR A;  4Q0C A;  1IXH A;  2RC9 A;  1Y9U A;  3SEX A;  3Q26 A;  3HV1 A;  5ITP A;  2XXU A;  4H5F A;  4POX A;  3T66 A;  4ZED A;  2GH9 A;  3TAJ A;  3A3U A;  2XD3 A;  4R2F A;  3C4M A;  3SES A;  3OO6 A;  1MY3 A;  3FXU A;  3MP1 A;  1ZTY A;  4OET A;  3FZV A;  3CFZ A;  4YB7 A;  4F1V A;  2HZL A;  3O6G A;  4WED A;  4GF8 A;  3QIM A;  2AYS A;  4ZEF A;  4MLV A;  5DVI A;  1FTL A;  1AOV A;  2Q89 A;  3FD3 A;  2AL4 A;  1R1N A;  4O3B A;  4R9G A;  5I2K B;  1J1N A;  1CE2 A;  3PUX E;  3QUJ A;  4F2Q A;  4H0W A;  4ZEC A;  1LLS A;  4HW8 A;  3OO9 A;  3V8X B;  4TOZ A;  1D4N A;  5H8H B;  4ECF A;  5FHN A;  4Q30 B;  4U2R A;  3S9N C;  3IOU A;  4YAH X;  2RCA A;  3SER A;  3FVK A;  4FJP A;  1M5C A;  4AB6 A;  1H76 A;  1Q1K A;  1Q35 A;  4PE5 B;  2PVU A;  2O84 X;  2O1L A;  1UIV A;  4H8J A;  3HHF A;  1IUD A;  3TKD A;  1XT8 A;  5TPA B;  2F5X A;  4EXK A;  4DDD A;  3VXC A;  4WKM A;  2XX7 A;  5DT6 A;  2G93 A;  2P0S A;  4I62 A;  5H8Q B;  4E0X A;  4F3S A;  1MS7 A;  2ESN A;  2DP8 A;  1IXC A;  3OSQ A;  4GQO A;  1OQH A;  2A5T B;  2XXQ A;  2Y7P A;  4X1B A;  2E0S A;  4GWO A;  5KCJ A;  3G3G A;  3O29 A;  4HCW A;  2Q9T A;  1Z7N E;  2XXR A;  4F3G A;  3OEN A;  3SEY A;  1D9V A;  4P0I A;  4LZ7 A;  4G68 A;  3CG1 A;  5I2N B;  1BKA A;  2O69 A;  1GGG A;  3T9U A;  3KGC A;  1SYI A;  1MM6 A;  2RC8 A;  3OO7 A;  3MVW A;  1IXI A;  4QSC A;  2O68 A;  2XXY A;  1B3E A;  1DOT A;  1FTO A;  3N6T A;  1EZ9 A;  3DM0 A;  1B7Z A;  1O64 A;  1WOD A;  2X26 A;  3HCQ A;  5ISU A;  2GFE A;  3DLN A;  3CSB A;  4ZEK A;  3VVD A;  3H03 A;  4IO5 A;  3W9W A;  4O3A A;  4MF3 A;  2FA7 A;  3U92 A;  1LCT A;  3PUV E;  5CBS A;  3IAZ A;  3KN3 A;  1URD A;  4DXB A;  5B7D A;  4YIC A;  4N07 A;  1JNF A;  2HAU A;  1XS5 A;  4R9F A;  3LSL A;  1US4 A;  4U1O A;  1QUI A;  1WVJ A;  3MC2 A;  1TWY A;  3QYT A;  1ELJ A;  2ZNU A;  2O1M A;  2VP1 A;  5JEI A;  1O7T A;  1OMP A;  3FXR A;  2DSF A;  4I9D A;  2DWH A;  3T96 B;  1JVY A;  3E4R A;  1A55 A;  4K3F A;  4U4X A;  5TP9 B;  4HTG A;  1KWH A;  2IEE A;  3FAS A;  4AQ4 A;  3RLF E;  3M3L A;  4ZZE A;  3RT8 A;  3LC8 A;  4DXC A;  3TEL A;  4PET A;  2DVZ A;  5AA4 A;  1JQF A;  1FQE A;  4ESX A;  5L9S A;  3BBR A;  3HPI A;  2QSX A;  2RIN A;  2DWI A;  4U23 A;  3IB1 A;  4POW A;  3PD8 A;  5I2K A;  1B2H A;  3TYH A;  2ZMB A;  5IKB A;  4BDQ A;  3VXB A;  3VVE A;  5H8H A;  2F7A A;  2E1S A;  2F7B A;  4OEN A;  2ZNS A;  1SW2 A;  4NF8 B;  1YTV A;  3MVZ A;  1R9L A;  3PPP A;  4RPO A;  4ZE8 A;  1EH3 A;  4KYS A;  2DXY A;  2QRY A;  2F6P A;  1QW0 A;  5EHM A;  1ZMG A;  5AA2 B;  5TPA A;  2F35 A;  3S4U A;  2OBG A;  3K02 A;  3FIR A;  3H06 B;  4GD5 A;  4PFW A;  1M5B A;  1MXY A;  2OWS A;  4LA9 A;  1R6Z A;  5H8Q A;  1SVX B;  2UYE A;  2UVH A;  1NH8 A;  3FVO A;  1FTK A;  1MXZ A;  4IB2 A;  4EXL A;  4GL8 A;  1EZP A;  2A5T A;  3QSL A;  2NUV A;  2VOZ A;  4LP2 B;  1LAG E;  2DWJ A;  1YCJ A;  1NL5 A;  2DWA A;  4PQJ A;  1YAE A;  3OD7 A;  3BFT A;  4G77 A;  3PUW E;  4EF2 A;  3IJX B;  2VD2 A;  1L5T A;  1ZIU A;  3G3K A;  1Y3N A;  1Y4T A;  1OIB A;  1WDN A;  5I59 B;  3QXM A;  3O6I A;  5I2N A;  2LAO A;  2VD3 A;  4H5G A;  4L17 A;  4WXJ A;  1LFH A;  1H3D A;  1CB6 A;  2V25 A;  1QJM A;  1MPD A;  4JWX A;  2Z8F A;  4XKP A;  3LSF B;  1POY 1;  1N7W A;  4QFO A;  5TU0 A;  2Q2A A;  1AMF A;  3PV0 E;  4ND9 A;  4ZS9 A;  4G68 C;  1ZKB A;  3GZG A;  2GHB A;  3GBB A;  3K00 A;  2X7Q A;  5L8D A;  2IA4 A;  5K2Y A;  3QK6 A;  2UVJ A;  4LUB A;  4O3C A;  2I4C A;  1N0T A;  2XD2 A;  3N94 A;  4ESW A;  1MXW A;  2AIX A;  3K0V A;  1B52 A;  4LVQ A;  2ZYK A;  4P0G A;  4KHZ E;  4LAT A;  3ZKK A;  3GBA A;  1JW1 A;  4LQ2 A;  1Y3Q A;  1NNK A;  4KPT A;  3C31 A;  3MVX A;  2O7U A;  4DE8 A;  5DEX B;  4F29 A;  1MQD A;  1OVT A;  3TMG A;  3N26 A;  4BLA A;  3ZSF A;  4OFO A;  1PBP A;  3AXF A;  4BDN A;  3TTR A;  5TP9 A;  2UXA A;  5AE4 A;  3K1N A;  3RY3 A;  1B3F A;  2Z23 A;  2Y7K A;  1F9B A;  5AA3 A;  2H4I A;  1MQH A;  2ZYM A;  1B5H A;  3IOT A;  5HM4 B;  1VSO A;  3LBS A;  2M8C A;  3KJ7 A;  1MXU A;  3Q28 A;  3FVN A;  5B70 A;  2DOJ A;  4WEP A;  3H6U A;  2H25 A;  1QUJ A;  1Z7M E;  3OEL A;  1IIW A;  1UTB B;  2HXW A;  1A8F A;  3PPO A;  2H5Y A;  3FV1 A;  1M5D A;  1R9Q A;  4FIM A;  5AA4 B;  5LOM A;  3C36 A;  1GR2 A;  2H98 A;  2ALU A;  1MXX A;  4F3P A;  5I57 B;  4HCY A;  1MY1 A;  3FJG A;  5CMC A;  1XVY A;  4FE8 A;  1MXV A;  3RPW A; 
#chains in the Genus database with same CATH topology
 3T9V A;  4H8I A;  3MZ9 A;  3C33 A;  3HO7 A;  1GTK A;  2P3N A;  3EHS A;  3KSX A;  2Z8D A;  4N13 A;  5IZ3 B;  4PDD A;  1MH4 A;  4IO4 A;  4RA1 A;  3PGF A;  4NF6 B;  2OCU A;  4LQ5 A;  1LEV A;  3FUZ A;  4GWS A;  4NF8 A;  4RYA A;  5FTI A;  1SW5 A;  4PCD A;  1NKX A;  4DLD A;  2CMO A;  1MY4 A;  3OEM A;  3BKI B;  4I8C A;  1FQF A;  1OLC A;  5AA2 A;  2ONS A;  4F2O A;  4ISU A;  4YU0 A;  1LBZ A;  1XHY A;  3MP6 A;  4OEU A;  3PMW A;  4PF6 A;  1IXG A;  3PPN A;  3FXQ A;  4EDP A;  5CMK A;  1N84 A;  3ZS6 A;  1N3X A;  2QMW A;  5M2V A;  3SKP A;  2XWI A;  4QRZ A;  4X04 A;  3G3I A;  3SEV A;  4NF0 A;  5A5X B;  1JP4 A;  3O28 A;  2HPG A;  3USD A;  1MY0 A;  5DYH A;  5H8S A;  4NQ8 A;  4KD5 A;  4ELO A;  4MLQ A;  1PEB A;  3L6H A;  2WYP A;  1MDP 1;  2VPO A;  3LR1 A;  2WBD A;  2W7Y A;  3E9X A;  4XKN A;  1IMB A;  2I49 A;  3S9M C;  1NI9 A;  4RK2 A;  1IQ7 A;  3EPE A;  2QS1 A;  5I59 A;  4LZ5 A;  3V83 A;  1RDX A;  1MPB A;  4QF9 A;  4QHQ A;  3HFU A;  1P1O A;  4G8N A;  3KN7 A;  1N7X A;  3OOA A;  3ODB A;  1FPE A;  4F1U A;  2AL5 A;  1SW4 A;  1S50 A;  4MCO A;  1VDW A;  1P1N A;  4GVO A;  1B46 A;  2FYI A;  1DMB A;  3DP4 A;  1JW4 A;  4I3E A;  4KYE A;  3PD9 A;  3BIH A;  2PMS A;  1P1W A;  3UOR A;  3M3K A;  5KZT A;  2XHD A;  1UTH A;  2DXR A;  3VLU A;  4Q5T A;  1QKB A;  2HCA A;  1FQA A;  1PB7 A;  3TTN A;  1VFD A;  1SDX A;  4YMB A;  2NXO A;  3BFU A;  2XXT A;  1NMU A;  4PP0 A;  1EZO A;  2D5W A;  1FPJ A;  5IM2 A;  3RYD A;  3S2V A;  1B3L A;  3H6T A;  5DEX A;  4JXI A;  4MIJ A;  4C0R A;  4KR5 A;  1VR5 A;  3E13 X;  4NTL A;  4GRK A;  1LAF E;  1HSJ A;  4MHF A;  5FTH A;  2JJK A;  3KOT A;  4DCX A;  2UVG A;  3OSR A;  4R6Y A;  1MQI A;  3SDF A;  5CC2 A;  4RY1 A;  3LUZ A;  3MAM A;  4PF8 A;  2VT5 A;  4ELQ A;  1P99 A;  1SQY A;  3DP6 A;  3PMV A;  3CG3 A;  4TLL B;  5EYH A;  2VGQ A;  3BIG A;  1P1U A;  4TLM B;  2VHA A;  2F8D A;  4YB5 A;  4MFI A;  1FBP A;  3U72 A;  2DYX A;  4JWY A;  1N3W A;  2O7I A;  1UTB A;  4OVJ A;  1NV3 A;  3P7I A;  1QUK A;  3PMX A;  1FW0 A;  2ONR A;  2F3B A;  3PUY E;  3RPL B;  2QS3 A;  2PYY A;  5I57 A;  2FIE A;  3VLW A;  3IK6 B;  3TQL A;  1OVB A;  1S7Y A;  3MJN A;  4N6K A;  4JSD A;  3D4G A;  2FBP A;  5I58 B;  4PFR A;  1Y20 A;  2A5S A;  1B5J A;  1NUY A;  3PU5 A;  3IB2 A;  3KFM A;  1HSL A;  4QFN A;  4OMB A;  4E0W A;  1SI0 A;  2MKZ A;  4DXU A;  5IZ3 A;  4ONY A;  1AL3 A;  3K2D A;  4NF6 A;  5DVJ A;  3S9E A;  4NF5 B;  1JVX A;  2ZYO A;  1POT A;  1II5 A;  5ITO A;  1B0L A;  2YPN A;  3D4C A;  3HHG A;  1YPN A;  3O66 A;  3OO8 A;  5F24 A;  3V5A A;  1B32 A;  4RK9 A;  3MP8 A;  4IO6 A;  3I6V A;  4I1D A;  3MW0 A;  1LGB C;  2G29 A;  2ABH A;  2UVI A;  4N8Y A;  1QVS A;  1ZU0 A;  1Y4C A;  2B3F A;  1USY E;  2REG A;  5I84 A;  4U1Z A;  1B40 A;  5HBC A;  2ZZX A;  5DVF A;  3CFL A;  4OER A;  4XEQ A;  3E79 A;  1UQW A;  1MPC A;  2PT2 A;  1FRP A;  1K9Y A;  4KCC A;  3TCH A;  5A5X A;  4ZE9 A;  4GWZ A;  2Y7R A;  4IY6 A;  3CHG A;  4R74 A;  5I56 A;  4FAJ A;  2CZL A;  1ZJL A;  1FJ6 A;  1Y1Z A;  4KFQ A;  3CI8 A;  3I3V A;  1MM7 A;  3MZB A;  1LFG A;  3KC0 A;  2P1S A;  1NUX A;  2WX9 A;  1IMF A;  1NV6 A;  3GXA A;  1IEJ A;  1FBE A;  2XXP A;  4DCY A;  4FED A;  2OZZ A;  4G61 A;  1JET A;  1FTM A;  1H44 A;  2HQ0 A;  3JYR A;  1B7H A;  1KZ8 A;  3KBR A;  2Q2C A;  4Z7E A;  2THI A;  3B6W A;  3TTL A;  4AS5 A;  1H43 A;  4HS7 A;  2HAV A;  1ZLQ A;  2V4C A;  1NV1 A;  2XXV A;  1FQD A;  3TTK A;  3UIF A;  1DSN A;  1B4Z A;  2WKY A;  3PUZ E;  1EYI A;  3DEL B;  2HZK A;  3IOW A;  1LAX A;  4NHB A;  4QSE A;  1BTJ A;  4GOT A;  4PAI A;  4GL0 A;  4PDH A;  1B1X A;  3IJO B;  4F22 A;  4KCD A;  3WAF A;  3ILT B;  3IO6 A;  2BJJ X;  1FPI A;  4R72 A;  4RXL A;  3KEI A;  1AWB A;  1SYH A;  2GHA A;  4G2Z A;  1US5 A;  3TEP A;  1I6Q A;  2V3T A;  3H7M A;  1EU8 A;  1NV2 A;  5CMB A;  5BWJ A;  2R8T A;  2ZYN A;  1OQG A;  2D21 A;  2XWO A;  2F7C A;  5EHS A;  3QUF A;  2H9B A;  4U22 A;  4R75 A;  3K6U A;  1NFT A;  1UTH B;  2ANJ A;  4NMY A;  2F6G A;  4MH5 A;  1D9Q A;  4QFK A;  4RPN A;  4U21 A;  5ELV A;  4O7I A;  2DS9 A;  4GX3 A;  4PE3 A;  3W15 C;  4H46 A;  2F97 A;  3OMB A;  3R7X A;  1MRP A;  1ATG A;  1JEV A;  3Q27 A;  1B1H A;  4O94 A;  1LBV A;  5ICT A;  3TUS A;  1N76 A;  3UP9 A;  3MBP A;  4PFT A;  5J16 A;  2XX8 A;  4GWU A;  3TDJ A;  5AA2 D;  3OEK A;  4TQU Q;  3KG2 A;  4P8B A;  3JV9 A;  2I48 A;  1LBB A;  3T22 A;  3U94 A;  1FBG A;  3U65 A;  3HN0 A;  3RUM A;  4NX1 A;  1EYJ A;  3TPA A;  2B65 A;  2CZH A;  4R2B A;  4N6D A;  4YZZ A;  2REJ A;  3LV0 A;  4BDM A;  3RQT A;  1FCK A;  4R6K A;  2I58 A;  1LFI A;  1BK4 A;  2P2A A;  4PBQ A;  3FV2 A;  3OXN A;  1M5E A;  2XXH A;  2QPQ A;  4P11 A;  3UGW A;  3CRB A;  3FGS A;  3O2A A;  4YB6 A;  2H99 A;  1A7L A;  1SPI A;  4GXA A;  3IL1 B;  4OYV A;  5I58 A;  1RDZ A;  3PPQ A;  3VDF A;  3SEU A;  3LSW A;  4IO7 A;  3ZKL A;  3U93 A;  4FOR A;  3RTW B;  2DE2 A;  5CBR A;  2V3U A;  4GFR A;  3MPL A;  3B6Q A;  2OJT A;  2V3Q A;  1VFE A;  4HXV A;  1URG A;  2QVV A;  2R6G E;  2Y7I A;  1RYX A;  4NF5 A;  4KYD A;  2RC7 A;  3F11 A;  1B0H A;  3G3J A;  4FEB A;  1XVX A;  4YMA A;  4THI A;  2B3B A;  4YKP A;  5CRY A;  3KSJ A;  3MZ1 A;  1OLA A;  4EF1 A;  2QS4 A;  3T9X B;  2Q88 A;  2FNC A;  3G7W A;  2HFB A;  4R6H A;  1LST A;  2PBW A;  4IR8 A;  5L9M A;  3O6H A;  4YKI A;  3TZA A;  1PB8 A;  1A99 A;  2WBB A;  2NOO A;  1TFA A;  3C35 A;  3WAE A;  3EN3 A;  3SET A;  4NWD A;  3VVF A;  1MQG A;  3L6G A;  4PFY A;  5ET7 A;  5I5P A;  2X7P A;  3Q29 A;  4OVP A;  4XIG Q;  5CI5 A;  1KA0 A;  3RT6 B;  2OWZ A;  3K01 A;  5EQ9 A;  5F1Q A;  4NED A;  3ILU B;  3RGY A;  1B7U A;  1MDQ A;  3TCG A;  5EQ7 A;  4EQ7 A;  3VLV A;  1FQB A;  4IO2 A;  1SD3 A;  3TOD A;  4QFL A;  4IY5 A;  4GXS B;  3RTF B;  3VV5 A;  3CFX A;  5I56 B;  3MUQ A;  3K4U A;  2F36 A;  2OWT A;  2OX3 A;  5H8F B;  3M8U A;  4FEC A;  5CMM A;  3R6U A;  4N91 A;  4EUO A;  3I5O A;  3R26 A;  5EYF A;  2I0C A;  4PC9 A;  3FAT A;  1A40 A;  4JVD A;  4PAF A;  5ET6 A;  3K1P A;  3KBZ A;  3MYU A;  2ZNT A;  1AIV A;  1SI1 A;  1USY H;  4XKR A;  1LB9 A;  2Y5K A;  2GRV A;  1AH5 A;  1FPL A;  4P1L A;  1GVC A;  2QVR A;  2I3W A;  2KLF A;  1ZBM A;  4N6P A;  2NWJ A;  1DPP A;  1CNQ A;  4OFL A;  3SEW A;  2HEU A;  1IMC A;  3T0J A;  1P1Q A;  4U4S A;  2YJP A;  5EQ8 A;  3IX1 A;  4JSO A;  2FIX A;  4N15 A;  4NF4 A;  3CR9 A;  4C1T A;  4OXV A;  2ZXT A;  5DTB A;  4XKQ A;  4AS4 A;  3E3K A;  2XX9 A;  4H1X A;  5FHO A;  1B4H A;  3U8Q A;  5KDT B;  1MH3 A;  1N04 A;  1XI6 A;  4ELR A;  1TXF A;  1BLF A;  4MEV A;  3IB0 A;  1B51 A;  3KOS A;  3ONM A;  3FVG A;  3K6X A;  1XC1 A;  1DPE A;  2F78 A;  4BDR A;  1I69 A;  1PC3 A;  2XXI A;  4AB5 A;  5ET5 A;  2XWK A;  1IZ1 A;  1A54 A;  4MAG A;  4IO3 A;  2QMX A;  5BUU A;  2WYK A;  4NG7 A;  2RF1 A;  3EHU A;  4NE4 A;  4Q8R A;  2ZZV A;  2Q8M A;  2L5V A;  2Q8J A;  5JTY B;  2OLB A;  3DP8 A;  4G8M A;  4P3L A;  3U1O A;  3TTM A;  4OES A;  2O51 A;  1VE4 A;  4ZEI A;  5H8N B;  1T0K A;  3TFL A;  4OVT A;  3TCF A;  4OZ9 A;  1B05 A;  4NWC A;  3UA8 A;  2I3V A;  3H6W A;  1YYZ A;  1LBX A;  1MQJ A;  3RN8 A;  4LN5 A;  1NV4 A;  4YKK A;  1LBC A;  1NV7 A;  1FBH A;  2R9J A;  1QGX A;  2HHM A;  4C1U A;  3GYY A;  1TFD A;  4EQB A;  1O63 A;  2OK2 A;  4F3B A;  3G3H A;  4IGT A;  4JB7 A;  4FAT A;  5FHM A;  5J1D A;  2XXW A;  4F18 A;  2VPN A;  3W9V A;  3VE1 B;  2PT1 A;  3ROJ A;  3EF7 A;  1HSE A;  4EQ9 A;  5IZ1 A;  1A8E A;  3H3G A;  1FTJ A;  4MMP A;  1SW1 A;  2Z22 A;  4OFJ A;  1DTG A;  3MWB A;  5ESY A;  1I6B A;  2ONK E;  4YKJ A;  1NV5 A;  4KI0 E;  4UA8 A;  2QJE A;  3VFJ A;  5F7V A;  1SBP A;  4F19 A;  3FBP A;  1UIU A;  4QFP A;  4GLI A;  5CM6 A;  2PFZ A;  4OQO A;  1B9J A;  2RCB A;  1FTA A;  4XXU A;  2Y7W A;  1LCF A;  3K6W A;  4NGU A;  3B6T A;  5I7I A;  1PB9 A;  4G8H A;  4JVC A;  3T9H B;  3CIJ A;  3C32 A;  3G3F A;  4LON B;  3C9H A;  3FXB A;  3KN8 A;  1FBF A;  3IOR A;  3MVY A;  1G0H A;  1GV8 A;  4IGR A;  3O9P A;  4M1V A;  1I6A A;  1FQC A;  1PDA A;  4X48 A;  2DVC A;  1H45 A;  2R71 A;  2KR0 A;  5L9O A;  1LB8 A;  2YLN A;  4NAP A;  4XTC Q;  1DTZ A;  4OHN A;  2B4L A;  3H4Z A;  4RJZ A;  1B6H A;  4JDF A;  1KA1 A;  4P1E A;  2I4B A;  3UN6 A;  4MBP A;  3QMF A;  5H8F A;  3RNN A;  1DK4 A;  2F3D A;  4ZDM A;  1IMA A;  5DW8 A;  2F34 A;  1ANF A;  2O6A A;  1FPK A;  5HPQ A;  3FJ7 A;  5IZZ A;  2CZI A;  3LSX A;  2QL3 A;  4GWY A;  2NVU B;  4F39 A;  3Q25 A;  1RYO A;  4PFU A;  1XOC A;  4X9T A;  2V84 A;  2DQV A;  1NUZ A;  4Z0I A;  1IME A;  4N17 A;  2Z8E A;  2XXX A;  4HE1 A;  1S9T A;  4X1D A;  3THI A;  2CEY A;  3FJM A;  1MG1 A;  3CVG A;  5EYG A;  4GWW A;  3V89 B;  3CSG A;  2DE4 A;  3IOV A;  2DE3 A;  3IR1 A;  5AA1 A;  4ZEB A;  3HST A;  4FBP A;  3MQ9 A;  5ICQ A;  1URS A;  1B58 A;  3EQ1 A;  3MPK A;  1NV0 A;  1NH7 A;  1TT1 A;  5KCJ B;  1INP A;  1D9Y A;  5KDT A;  1B3G A;  2D3I A;  4JWO A;  4X8R A;  2I6E A;  2I0B A;  3GLB A;  4NF4 B;  2V93 A;  2QS2 A;  4UAC A;  4G4P A;  1RKM A;  1Y3P A;  4DIG A;  2BJI A;  4R73 A;  4OTE A;  3LUY A;  4O8M A;  1YXI A;  1MY2 A;  4P56 A;  3KZG A;  4G68 B;  4OWD A;  3A3C A;  3K1M A;  3C34 A;  1NNT A;  4DZ1 A;  1BIY A;  1LAH E;  4JBZ A;  5IAI A;  3N5L A;  4QSD A;  1QUL A;  4H6D A;  3O97 A;  1NNP A;  4ELP A;  2RKM A;  4ZZA A;  3M3F A;  1JW5 A;  1NNF A;  1PBQ A;  3QAX A;  5JTY A;  5K2X A;  4BDL A;  4KQP A;  3KJT A;  3S9L C;  4F1Y A;  4I3Y A;  1D3K A;  2PX1 A;  4F31 B;  3H6V A;  1M5F A;  4RNS A;  3T93 B;  3EHT A;  4GIZ A;  3A29 A;  1QKA A;  4OEV A;  5JK4 A;  4H65 A;  5H8N A;  1Y1M A;  3ECR A;  4LZ8 A;  2UYF A;  3JZJ A;  3TQW A;  3N6U A;  1FSA A;  1BP5 A;  4BDO A;  4H67 A;  3B7D A;  1B5I A;  4M4G A;  3K6V A;  4GX6 A;  3A09 A;  3IO4 A;  1JEU A;  2Y84 A;  1IIT A;  1B3H A;  2QVU A;  3UK4 A;  3PPR A;  4Q0C A;  4XFE A;  1IXH A;  2P3V A;  2RC9 A;  1Y9U A;  3SEX A;  3Q26 A;  3HV1 A;  5ITP A;  2XXU A;  1YZ0 A;  4H5F A;  4POX A;  3T66 A;  2PCR A;  4ZED A;  2GH9 A;  3TAJ A;  3A3U A;  2XD3 A;  4R2F A;  3C4M A;  3SES A;  3OO6 A;  1MY3 A;  3FXU A;  3MP1 A;  1ZTY A;  4OET A;  5FBP A;  3FZV A;  3CFZ A;  4YB7 A;  4F1V A;  2HZL A;  3O6G A;  4WED A;  2CEX A;  4GF8 A;  3QIM A;  2AYS A;  4ZEF A;  4MLV A;  5DVI A;  1FTL A;  1AOV A;  2HXR A;  2Q89 A;  3FD3 A;  2AL4 A;  4GBW A;  1R1N A;  4GWX A;  4O3B A;  4R9G A;  5I2K B;  1J1N A;  2FHY A;  1CE2 A;  3PUX E;  3QUJ A;  4F2Q A;  4H0W A;  4PGN A;  4ZEC A;  1LLS A;  4HW8 A;  3OO9 A;  4HE2 A;  3V8X B;  4TOZ A;  1D4N A;  4UAB A;  4PGP A;  5H8H B;  4ECF A;  4N8G A;  4I40 A;  4GBV A;  5FHN A;  4Q30 B;  4U2R A;  3S9N C;  3IOU A;  4YAH X;  2RCA A;  1FPG A;  3SER A;  3FVK A;  4FJP A;  1M5C A;  4AB6 A;  1H76 A;  1Q1K A;  1Q35 A;  4PE5 B;  2PVU A;  2O84 X;  2O1L A;  1UIV A;  4KXP A;  4H8J A;  3HHF A;  1IUD A;  3TKD A;  1XT8 A;  5TPA B;  2F5X A;  4EXK A;  4MNI A;  4DDD A;  3VXC A;  4MX6 A;  4WKM A;  2XX7 A;  5DT6 A;  2G93 A;  2P0S A;  4I62 A;  5H8Q B;  4E0X A;  4F3S A;  1MS7 A;  2ESN A;  2DP8 A;  1IXC A;  3OSQ A;  4GQO A;  1OQH A;  2A5T B;  2XXQ A;  2Y7P A;  4X1B A;  4MNC A;  2E0S A;  4GWO A;  5KCJ A;  3G3G A;  3SZP A;  1DCU A;  3O29 A;  4HCW A;  2Q9T A;  1Z7N E;  2XXR A;  4F3G A;  3OEN A;  3SEY A;  1D9V A;  4P0I A;  4LZ7 A;  4G68 A;  1RDY A;  3CG1 A;  5I2N B;  1BKA A;  2O69 A;  1GGG A;  3T9U A;  3KGC A;  1SYI A;  1MM6 A;  2RC8 A;  3OO7 A;  3MVW A;  1IXI A;  4QSC A;  2O68 A;  4XF5 A;  2XXY A;  1B3E A;  1DOT A;  1FTO A;  3N6T A;  1EZ9 A;  3DM0 A;  1B7Z A;  1O64 A;  1WOD A;  2X26 A;  2Y5L A;  3HCQ A;  5ISU A;  2GFE A;  3DLN A;  3CSB A;  4ZEK A;  1EYK A;  1FBD A;  3VVD A;  3H03 A;  4IO5 A;  3W9W A;  4O3A A;  4MF3 A;  4NN3 A;  2FA7 A;  3U92 A;  1LCT A;  4P47 A;  3PUV E;  5CBS A;  3IAZ A;  2PFY A;  2QFL A;  1FPB A;  3KN3 A;  1URD A;  4DXB A;  1FPF A;  5B7D A;  4YIC A;  4N07 A;  1JNF A;  2HAU A;  1XS5 A;  4R9F A;  3LSL A;  1US4 A;  4U1O A;  1QUI A;  1WVJ A;  4O7M A;  4HE0 A;  3MC2 A;  1TWY A;  3QYT A;  1ELJ A;  2ZNU A;  2O1M A;  2VP1 A;  5JEI A;  1O7T A;  1OMP A;  3FXR A;  2DSF A;  4I9D A;  2DWH A;  3T96 B;  1JVY A;  3E4R A;  1A55 A;  4K3F A;  4U4X A;  5TP9 B;  4HTG A;  3IFA A;  1KWH A;  2IEE A;  3FAS A;  4AQ4 A;  1NUW A;  3RLF E;  3B50 A;  3M3L A;  4ZZE A;  3RT8 A;  3LC8 A;  1FJ9 A;  4DXC A;  1Q9D A;  3TEL A;  4PET A;  4PBH A;  2DVZ A;  5AA4 A;  1JQF A;  3ISP A;  1FQE A;  4ESX A;  5L9S A;  3BBR A;  3HPI A;  2QSX A;  2RIN A;  2DWI A;  4OAN A;  2WEF A;  4U23 A;  3IB1 A;  4POW A;  3PD8 A;  5I2K A;  1B2H A;  4JVI A;  3TYH A;  2ZMB A;  5IKB A;  4BDQ A;  5LDZ A;  3VXB A;  3VVE A;  5H8H A;  2F7A A;  1DBZ A;  2E1S A;  2F7B A;  2XWV A;  3D1R A;  4OEN A;  2ZNS A;  1SW2 A;  4NF8 B;  1YTV A;  3MVZ A;  1R9L A;  3PPP A;  4RPO A;  4ZE8 A;  1EH3 A;  4KYS A;  2DXY A;  2QRY A;  2F6P A;  1QW0 A;  5EHM A;  1ZMG A;  1G0I A;  5AA2 B;  5TPA A;  2F35 A;  3S4U A;  2OBG A;  3K02 A;  3FIR A;  3B8B A;  3H06 B;  4GD5 A;  4PFW A;  1K9Z A;  1M5B A;  1MXY A;  2OWS A;  5I3S A;  4LA9 A;  1R6Z A;  5H8Q A;  1SVX B;  2UYE A;  2UVH A;  3MST A;  1NH8 A;  3EKI A;  3FVO A;  5IGA A;  1FTK A;  1MXZ A;  4IB2 A;  4EXL A;  2B4M A;  2FVZ A;  4GL8 A;  1EZP A;  2A5T A;  3QSL A;  2NUV A;  2VOZ A;  4LP2 B;  1LAG E;  2DWJ A;  1YCJ A;  1NL5 A;  2DWA A;  4PQJ A;  1YAE A;  3OD7 A;  2XXK A;  4PFB A;  3PTY A;  4OVS A;  3BFT A;  4G77 A;  3PUW E;  4EF2 A;  3IJX B;  2VD2 A;  1L5T A;  1ZIU A;  3G3K A;  1Y3N A;  4GX4 A;  1Y4T A;  1OIB A;  1WDN A;  5I59 B;  3QXM A;  2KQZ A;  3O6I A;  5I2N A;  2LAO A;  2VD3 A;  4H5G A;  4MJO A;  4QBA A;  4L17 A;  4WXJ A;  3T1B A;  1LFH A;  1H3D A;  1CB6 A;  2V25 A;  1QJM A;  1LBW A;  1MPD A;  4JWX A;  2Z8F A;  4XKP A;  3LSF B;  5EQA A;  5A5L A;  1POY 1;  1N7W A;  4QFO A;  4N4U A;  5TU0 A;  2Q2A A;  1AMF A;  3PV0 E;  4ND9 A;  4ZS9 A;  4G68 C;  1ZKB A;  3GZG A;  2GHB A;  3GBB A;  3K00 A;  2X7Q A;  5L8D A;  2IA4 A;  5K2Y A;  3QK6 A;  2UVJ A;  4LUB A;  4O3C A;  4OVQ A;  2I4C A;  1N0T A;  2XA5 A;  2XD2 A;  4PTK A;  5LTC A;  1LBY A;  4PFI A;  3E78 A;  3N94 A;  4ESW A;  1MXW A;  2AIX A;  3K0V A;  1B52 A;  4LVQ A;  5T3J A;  4H45 A;  2ZYK A;  4P0G A;  4KHZ E;  4LAT A;  3ZKK A;  3GBA A;  4OVR A;  1JW1 A;  4LQ2 A;  1Y3Q A;  4PAK A;  1NNK A;  4KPT A;  3C31 A;  3MVX A;  2O7U A;  4DE8 A;  5DEX B;  4F29 A;  1MQD A;  1OVT A;  3TMG A;  3N26 A;  4BLA A;  1FPD A;  4N81 A;  3ZSF A;  2Q74 A;  4OFO A;  1PBP A;  3AXF A;  4BDN A;  3TTR A;  5TP9 A;  2UXA A;  5AE4 A;  3K1N A;  3RY3 A;  4OA4 A;  1B3F A;  2Z23 A;  2Y7K A;  4MNP A;  1F9B A;  3NOH A;  5AA3 A;  2H4I A;  1MQH A;  2ZYM A;  1B5H A;  3IOT A;  5HM4 B;  1VSO A;  4QXD A;  3LBS A;  1FBC A;  2M8C A;  4DI4 B;  3KJ7 A;  1MXU A;  3Q28 A;  2GQ1 A;  3FVN A;  3RPL A;  5B70 A;  2DOJ A;  4WEP A;  4P9K A;  3H6U A;  2CZK A;  4DI3 D;  2H25 A;  1QUJ A;  1Z7M E;  3OEL A;  1IIW A;  1UTB B;  2HXW A;  1A8F A;  3PPO A;  2H5Y A;  3FV1 A;  1M5D A;  1R9Q A;  4FIM A;  5AA4 B;  5LOM A;  2DDK A;  3C36 A;  1GR2 A;  3KC1 A;  2H98 A;  2ALU A;  1MXX A;  4F3P A;  5I57 B;  4HCY A;  1MY1 A;  3IFC A;  2ZZW A;  3FJG A;  5ET8 A;  5CMC A;  1IMD A;  1XVY A;  4FE8 A;  1MXV A;  3RPW A; 
#chains in the Genus database with same CATH homology
 3T9V A;  4H8I A;  3MZ9 A;  3C33 A;  3HO7 A;  1GTK A;  3EHS A;  3KSX A;  2Z8D A;  4N13 A;  1MH4 A;  4IO4 A;  4RA1 A;  3PGF A;  4NF6 B;  2OCU A;  4LQ5 A;  3FUZ A;  4NF8 A;  4RYA A;  5FTI A;  1SW5 A;  1NKX A;  4DLD A;  2CMO A;  1MY4 A;  3OEM A;  3BKI B;  4I8C A;  1FQF A;  1OLC A;  5AA2 A;  2ONS A;  4F2O A;  4ISU A;  4YU0 A;  3MP6 A;  1XHY A;  4OEU A;  3PMW A;  1IXG A;  3PPN A;  3FXQ A;  4EDP A;  5CMK A;  1N84 A;  3ZS6 A;  1N3X A;  2QMW A;  5M2V A;  3SKP A;  4QRZ A;  3G3I A;  3SEV A;  5A5X B;  3O28 A;  3USD A;  1MY0 A;  5DYH A;  5H8S A;  4KD5 A;  4ELO A;  4MLQ A;  1PEB A;  3L6H A;  1MDP 1;  3LR1 A;  2W7Y A;  3E9X A;  4XKN A;  2I49 A;  3S9M C;  4RK2 A;  1IQ7 A;  3EPE A;  2QS1 A;  5I59 A;  4LZ5 A;  3V83 A;  1MPB A;  4QF9 A;  4QHQ A;  1P1O A;  4G8N A;  3KN7 A;  1N7X A;  3OOA A;  3ODB A;  4F1U A;  2AL5 A;  1SW4 A;  1S50 A;  1P1N A;  4GVO A;  1B46 A;  2FYI A;  1DMB A;  3DP4 A;  1JW4 A;  4KYE A;  3PD9 A;  2PMS A;  1P1W A;  3UOR A;  3M3K A;  5KZT A;  2XHD A;  1UTH A;  2DXR A;  3VLU A;  4Q5T A;  1QKB A;  2HCA A;  1FQA A;  1PB7 A;  3TTN A;  1VFD A;  1SDX A;  4YMB A;  2NXO A;  3BFU A;  2XXT A;  1NMU A;  4PP0 A;  1EZO A;  2D5W A;  3S2V A;  1B3L A;  3H6T A;  5DEX A;  4JXI A;  4C0R A;  4KR5 A;  1VR5 A;  3E13 X;  4NTL A;  4GRK A;  1LAF E;  1HSJ A;  5FTH A;  3KOT A;  4DCX A;  2UVG A;  3OSR A;  4R6Y A;  1MQI A;  3SDF A;  5CC2 A;  4RY1 A;  3MAM A;  4ELQ A;  1P99 A;  1SQY A;  3DP6 A;  3PMV A;  3CG3 A;  4TLL B;  2VGQ A;  1P1U A;  4TLM B;  2VHA A;  2F8D A;  4YB5 A;  4MFI A;  3U72 A;  2DYX A;  4JWY A;  1N3W A;  2O7I A;  1UTB A;  4OVJ A;  3P7I A;  1QUK A;  3PMX A;  1FW0 A;  2ONR A;  3PUY E;  2QS3 A;  2PYY A;  5I57 A;  3VLW A;  3IK6 B;  3TQL A;  1OVB A;  1S7Y A;  3MJN A;  4JSD A;  3D4G A;  5I58 B;  1Y20 A;  2A5S A;  1B5J A;  3PU5 A;  3IB2 A;  3KFM A;  1HSL A;  4QFN A;  4OMB A;  4E0W A;  1SI0 A;  4DXU A;  4ONY A;  1AL3 A;  3K2D A;  4NF6 A;  5DVJ A;  3S9E A;  4NF5 B;  1JVX A;  2ZYO A;  1POT A;  1II5 A;  5ITO A;  1B0L A;  2YPN A;  3D4C A;  3HHG A;  1YPN A;  3O66 A;  3OO8 A;  3V5A A;  1B32 A;  4RK9 A;  3MP8 A;  4IO6 A;  3I6V A;  4I1D A;  3MW0 A;  1LGB C;  2G29 A;  2ABH A;  2UVI A;  1QVS A;  1ZU0 A;  1Y4C A;  2B3F A;  1USY E;  2REG A;  5I84 A;  4U1Z A;  1B40 A;  5HBC A;  5DVF A;  3CFL A;  4OER A;  1UQW A;  1MPC A;  2PT2 A;  4KCC A;  3TCH A;  5A5X A;  4ZE9 A;  2Y7R A;  4IY6 A;  4R74 A;  5I56 A;  4FAJ A;  2CZL A;  1ZJL A;  1Y1Z A;  4KFQ A;  3CI8 A;  3I3V A;  1MM7 A;  3MZB A;  1LFG A;  2P1S A;  3GXA A;  1IEJ A;  2XXP A;  4DCY A;  4FED A;  2OZZ A;  1JET A;  1FTM A;  1H44 A;  2HQ0 A;  3JYR A;  1B7H A;  3KBR A;  2Q2C A;  4Z7E A;  2THI A;  3B6W A;  3TTL A;  1H43 A;  4HS7 A;  2HAV A;  1ZLQ A;  2XXV A;  1FQD A;  3TTK A;  3UIF A;  1DSN A;  1B4Z A;  2WKY A;  3PUZ E;  3DEL B;  2HZK A;  3IOW A;  1LAX A;  4QSE A;  1BTJ A;  4GOT A;  4GL0 A;  1B1X A;  3IJO B;  4F22 A;  4KCD A;  3WAF A;  3ILT B;  3IO6 A;  2BJJ X;  4R72 A;  3KEI A;  1SYH A;  4RXL A;  2GHA A;  4G2Z A;  1US5 A;  3TEP A;  1I6Q A;  2V3T A;  3H7M A;  1EU8 A;  5CMB A;  5BWJ A;  2ZYN A;  1OQG A;  2D21 A;  2F7C A;  5EHS A;  3QUF A;  2H9B A;  4U22 A;  4R75 A;  3K6U A;  1NFT A;  1UTH B;  2ANJ A;  4NMY A;  2F6G A;  4MH5 A;  4QFK A;  4RPN A;  4U21 A;  5ELV A;  2DS9 A;  3W15 C;  2F97 A;  3OMB A;  3R7X A;  1MRP A;  1ATG A;  1JEV A;  3Q27 A;  1B1H A;  5ICT A;  3TUS A;  1N76 A;  3UP9 A;  3MBP A;  4PFT A;  2XX8 A;  3TDJ A;  5AA2 D;  3OEK A;  4TQU Q;  3KG2 A;  3JV9 A;  2I48 A;  1LBB A;  3T22 A;  3U94 A;  3HN0 A;  3RUM A;  3TPA A;  2B65 A;  4R2B A;  4YZZ A;  2REJ A;  4BDM A;  3RQT A;  1FCK A;  4R6K A;  2I58 A;  1LFI A;  2P2A A;  3FV2 A;  3OXN A;  1M5E A;  2XXH A;  2QPQ A;  4P11 A;  3UGW A;  3CRB A;  3FGS A;  3O2A A;  4YB6 A;  2H99 A;  1A7L A;  4GXA A;  3IL1 B;  4OYV A;  5I58 A;  3PPQ A;  3VDF A;  3SEU A;  3LSW A;  4IO7 A;  3ZKL A;  3U93 A;  4FOR A;  3RTW B;  2DE2 A;  5CBR A;  2V3U A;  4GFR A;  3MPL A;  3B6Q A;  2OJT A;  2V3Q A;  1VFE A;  1URG A;  2Y7I A;  2R6G E;  1RYX A;  4NF5 A;  4KYD A;  2RC7 A;  3F11 A;  1B0H A;  3G3J A;  4FEB A;  1XVX A;  4YMA A;  4THI A;  2B3B A;  4YKP A;  5CRY A;  3KSJ A;  3MZ1 A;  1OLA A;  4EF1 A;  2QS4 A;  3T9X B;  2Q88 A;  2FNC A;  3G7W A;  2HFB A;  4R6H A;  1LST A;  2PBW A;  5L9M A;  3O6H A;  4YKI A;  3TZA A;  1PB8 A;  1A99 A;  2NOO A;  1TFA A;  3C35 A;  3WAE A;  3EN3 A;  3SET A;  4NWD A;  3VVF A;  1MQG A;  3L6G A;  4PFY A;  2X7P A;  3Q29 A;  5CI5 A;  4XIG Q;  3RT6 B;  3K01 A;  5F1Q A;  4NED A;  3ILU B;  3RGY A;  1B7U A;  1MDQ A;  3TCG A;  4EQ7 A;  3VLV A;  1FQB A;  4IO2 A;  1SD3 A;  3TOD A;  4QFL A;  4IY5 A;  4GXS B;  3RTF B;  3VV5 A;  3CFX A;  5I56 B;  3MUQ A;  3K4U A;  2F36 A;  2OWT A;  5H8F B;  3M8U A;  4FEC A;  5CMM A;  3R6U A;  4EUO A;  3I5O A;  3R26 A;  5EYF A;  2I0C A;  3FAT A;  1A40 A;  3K1P A;  1AIV A;  2ZNT A;  1SI1 A;  1USY H;  4XKR A;  1LB9 A;  2GRV A;  1AH5 A;  1GVC A;  2I3W A;  2KLF A;  1ZBM A;  4N6P A;  2NWJ A;  1DPP A;  4OFL A;  3SEW A;  2HEU A;  1P1Q A;  4U4S A;  2YJP A;  3IX1 A;  4JSO A;  4NF4 A;  3CR9 A;  4C1T A;  4OXV A;  2ZXT A;  5DTB A;  4XKQ A;  3E3K A;  2XX9 A;  4H1X A;  5FHO A;  1B4H A;  3U8Q A;  5KDT B;  1MH3 A;  1N04 A;  4ELR A;  1TXF A;  1BLF A;  3IB0 A;  1B51 A;  3KOS A;  3ONM A;  3FVG A;  3K6X A;  1XC1 A;  1DPE A;  2F78 A;  4BDR A;  1I69 A;  1PC3 A;  2XXI A;  4AB5 A;  1IZ1 A;  1A54 A;  4IO3 A;  2QMX A;  5BUU A;  2RF1 A;  3EHU A;  4NE4 A;  4Q8R A;  2Q8J A;  5JTY B;  2OLB A;  3DP8 A;  4G8M A;  3U1O A;  3TTM A;  4OES A;  2O51 A;  1VE4 A;  4ZEI A;  5H8N B;  1T0K A;  3TFL A;  3TCF A;  4OZ9 A;  1B05 A;  4NWC A;  3UA8 A;  2I3V A;  3H6W A;  1MQJ A;  3RN8 A;  4YKK A;  1LBC A;  2R9J A;  4C1U A;  1TFD A;  4EQB A;  1O63 A;  2OK2 A;  4F3B A;  3G3H A;  4IGT A;  4JB7 A;  4FAT A;  5FHM A;  5J1D A;  2XXW A;  4F18 A;  3W9V A;  3VE1 B;  2PT1 A;  3EF7 A;  1HSE A;  4EQ9 A;  1A8E A;  3H3G A;  1FTJ A;  1SW1 A;  2Z22 A;  4OFJ A;  1DTG A;  3MWB A;  1I6B A;  2ONK E;  4YKJ A;  4KI0 E;  4UA8 A;  2QJE A;  3VFJ A;  5F7V A;  1SBP A;  4F19 A;  1UIU A;  4QFP A;  4GLI A;  5CM6 A;  4OQO A;  1B9J A;  2RCB A;  4XXU A;  2Y7W A;  1LCF A;  3K6W A;  3B6T A;  1PB9 A;  4G8H A;  3T9H B;  3CIJ A;  3C32 A;  3G3F A;  4LON B;  3C9H A;  3KN8 A;  3IOR A;  3MVY A;  1GV8 A;  4IGR A;  3O9P A;  4M1V A;  1I6A A;  1FQC A;  1PDA A;  4X48 A;  2DVC A;  1H45 A;  2R71 A;  5L9O A;  1LB8 A;  2YLN A;  4XTC Q;  1DTZ A;  4OHN A;  3H4Z A;  4RJZ A;  1B6H A;  4JDF A;  2I4B A;  3UN6 A;  4MBP A;  5H8F A;  3RNN A;  4ZDM A;  2F34 A;  1ANF A;  2O6A A;  5HPQ A;  3FJ7 A;  3LSX A;  2QL3 A;  2NVU B;  4F39 A;  3Q25 A;  1RYO A;  4PFU A;  1XOC A;  4X9T A;  2V84 A;  2DQV A;  4Z0I A;  2Z8E A;  2XXX A;  1S9T A;  4X1D A;  3THI A;  3FJM A;  1MG1 A;  3CVG A;  3V89 B;  3CSG A;  2DE4 A;  3IOV A;  2DE3 A;  3IR1 A;  5AA1 A;  4ZEB A;  3HST A;  3MQ9 A;  5ICQ A;  1URS A;  1B58 A;  3EQ1 A;  3MPK A;  1NH7 A;  1TT1 A;  5KCJ B;  1D9Y A;  5KDT A;  1B3G A;  2D3I A;  4JWO A;  2I6E A;  2I0B A;  3GLB A;  4NF4 B;  2V93 A;  2QS2 A;  4UAC A;  4G4P A;  1RKM A;  1Y3P A;  4DIG A;  4R73 A;  3LUY A;  4OTE A;  1MY2 A;  3KZG A;  4G68 B;  4OWD A;  3A3C A;  3K1M A;  3C34 A;  1NNT A;  4DZ1 A;  1BIY A;  1LAH E;  4JBZ A;  5IAI A;  3N5L A;  4QSD A;  1QUL A;  4H6D A;  3O97 A;  1NNP A;  4ELP A;  2RKM A;  4ZZA A;  3M3F A;  1JW5 A;  1NNF A;  1PBQ A;  3QAX A;  5JTY A;  5K2X A;  4BDL A;  4KQP A;  3KJT A;  3S9L C;  4F1Y A;  1D3K A;  2PX1 A;  4F31 B;  3H6V A;  1M5F A;  4RNS A;  3T93 B;  3EHT A;  4GIZ A;  1QKA A;  4OEV A;  5JK4 A;  4H65 A;  5H8N A;  1Y1M A;  3ECR A;  4LZ8 A;  2UYF A;  3JZJ A;  3TQW A;  3N6U A;  1BP5 A;  4BDO A;  4H67 A;  3B7D A;  1B5I A;  4M4G A;  3K6V A;  3A09 A;  3IO4 A;  1JEU A;  2Y84 A;  1IIT A;  1B3H A;  3UK4 A;  3PPR A;  4Q0C A;  1IXH A;  2RC9 A;  1Y9U A;  3SEX A;  3Q26 A;  3HV1 A;  5ITP A;  2XXU A;  4H5F A;  4POX A;  3T66 A;  4ZED A;  2GH9 A;  3TAJ A;  3A3U A;  2XD3 A;  4R2F A;  3C4M A;  3SES A;  3OO6 A;  1MY3 A;  3FXU A;  3MP1 A;  1ZTY A;  4OET A;  3FZV A;  3CFZ A;  4YB7 A;  4F1V A;  2HZL A;  3O6G A;  4WED A;  4GF8 A;  3QIM A;  2AYS A;  4ZEF A;  4MLV A;  5DVI A;  1FTL A;  1AOV A;  2Q89 A;  3FD3 A;  2AL4 A;  1R1N A;  4O3B A;  4R9G A;  5I2K B;  1J1N A;  1CE2 A;  3PUX E;  3QUJ A;  4F2Q A;  4H0W A;  4ZEC A;  1LLS A;  4HW8 A;  3OO9 A;  3V8X B;  4TOZ A;  1D4N A;  5H8H B;  4ECF A;  5FHN A;  4Q30 B;  4U2R A;  3S9N C;  3IOU A;  4YAH X;  2RCA A;  3SER A;  3FVK A;  4FJP A;  1M5C A;  4AB6 A;  1H76 A;  1Q1K A;  1Q35 A;  4PE5 B;  2PVU A;  2O84 X;  2O1L A;  1UIV A;  4H8J A;  3HHF A;  1IUD A;  3TKD A;  1XT8 A;  5TPA B;  2F5X A;  4EXK A;  4DDD A;  3VXC A;  4WKM A;  2XX7 A;  5DT6 A;  2G93 A;  2P0S A;  4I62 A;  5H8Q B;  4E0X A;  4F3S A;  1MS7 A;  2ESN A;  2DP8 A;  1IXC A;  3OSQ A;  4GQO A;  1OQH A;  2A5T B;  2XXQ A;  2Y7P A;  4X1B A;  2E0S A;  4GWO A;  5KCJ A;  3G3G A;  3O29 A;  4HCW A;  2Q9T A;  1Z7N E;  2XXR A;  4F3G A;  3OEN A;  3SEY A;  1D9V A;  4P0I A;  4LZ7 A;  4G68 A;  3CG1 A;  5I2N B;  1BKA A;  2O69 A;  1GGG A;  3T9U A;  3KGC A;  1SYI A;  1MM6 A;  2RC8 A;  3OO7 A;  3MVW A;  1IXI A;  4QSC A;  2O68 A;  2XXY A;  1B3E A;  1DOT A;  1FTO A;  3N6T A;  1EZ9 A;  3DM0 A;  1B7Z A;  1O64 A;  1WOD A;  2X26 A;  3HCQ A;  5ISU A;  2GFE A;  3DLN A;  3CSB A;  4ZEK A;  3VVD A;  3H03 A;  4IO5 A;  3W9W A;  4O3A A;  4MF3 A;  2FA7 A;  3U92 A;  1LCT A;  3PUV E;  5CBS A;  3IAZ A;  3KN3 A;  1URD A;  4DXB A;  5B7D A;  4YIC A;  4N07 A;  1JNF A;  2HAU A;  1XS5 A;  4R9F A;  3LSL A;  1US4 A;  4U1O A;  1QUI A;  1WVJ A;  3MC2 A;  1TWY A;  3QYT A;  1ELJ A;  2ZNU A;  2O1M A;  2VP1 A;  5JEI A;  1O7T A;  1OMP A;  3FXR A;  2DSF A;  4I9D A;  2DWH A;  3T96 B;  1JVY A;  3E4R A;  1A55 A;  4K3F A;  4U4X A;  5TP9 B;  4HTG A;  1KWH A;  2IEE A;  3FAS A;  4AQ4 A;  3RLF E;  3M3L A;  4ZZE A;  3RT8 A;  3LC8 A;  4DXC A;  3TEL A;  4PET A;  2DVZ A;  5AA4 A;  1JQF A;  1FQE A;  4ESX A;  5L9S A;  3BBR A;  3HPI A;  2QSX A;  2RIN A;  2DWI A;  4U23 A;  3IB1 A;  4POW A;  3PD8 A;  5I2K A;  1B2H A;  3TYH A;  2ZMB A;  5IKB A;  4BDQ A;  3VXB A;  3VVE A;  5H8H A;  2F7A A;  2E1S A;  2F7B A;  4OEN A;  2ZNS A;  1SW2 A;  4NF8 B;  1YTV A;  3MVZ A;  1R9L A;  3PPP A;  4RPO A;  4ZE8 A;  1EH3 A;  4KYS A;  2DXY A;  2QRY A;  2F6P A;  1QW0 A;  5EHM A;  1ZMG A;  5AA2 B;  5TPA A;  2F35 A;  3S4U A;  2OBG A;  3K02 A;  3FIR A;  3H06 B;  4GD5 A;  4PFW A;  1M5B A;  1MXY A;  2OWS A;  4LA9 A;  1R6Z A;  5H8Q A;  1SVX B;  2UYE A;  2UVH A;  1NH8 A;  3FVO A;  1FTK A;  1MXZ A;  4IB2 A;  4EXL A;  4GL8 A;  1EZP A;  2A5T A;  3QSL A;  2NUV A;  2VOZ A;  4LP2 B;  1LAG E;  2DWJ A;  1YCJ A;  1NL5 A;  2DWA A;  4PQJ A;  1YAE A;  3OD7 A;  3BFT A;  4G77 A;  3PUW E;  4EF2 A;  3IJX B;  2VD2 A;  1L5T A;  1ZIU A;  3G3K A;  1Y3N A;  1Y4T A;  1OIB A;  1WDN A;  5I59 B;  3QXM A;  3O6I A;  5I2N A;  2LAO A;  2VD3 A;  4H5G A;  4L17 A;  4WXJ A;  1LFH A;  1H3D A;  1CB6 A;  2V25 A;  1QJM A;  1MPD A;  4JWX A;  2Z8F A;  4XKP A;  3LSF B;  1POY 1;  1N7W A;  4QFO A;  5TU0 A;  2Q2A A;  1AMF A;  3PV0 E;  4ND9 A;  4ZS9 A;  4G68 C;  1ZKB A;  3GZG A;  2GHB A;  3GBB A;  3K00 A;  2X7Q A;  5L8D A;  2IA4 A;  5K2Y A;  3QK6 A;  2UVJ A;  4LUB A;  4O3C A;  2I4C A;  1N0T A;  2XD2 A;  3N94 A;  4ESW A;  1MXW A;  2AIX A;  3K0V A;  1B52 A;  4LVQ A;  2ZYK A;  4P0G A;  4KHZ E;  4LAT A;  3ZKK A;  3GBA A;  1JW1 A;  4LQ2 A;  1Y3Q A;  1NNK A;  4KPT A;  3C31 A;  3MVX A;  2O7U A;  4DE8 A;  5DEX B;  4F29 A;  1MQD A;  1OVT A;  3TMG A;  3N26 A;  4BLA A;  3ZSF A;  4OFO A;  1PBP A;  3AXF A;  4BDN A;  3TTR A;  5TP9 A;  2UXA A;  5AE4 A;  3K1N A;  3RY3 A;  1B3F A;  2Z23 A;  2Y7K A;  1F9B A;  5AA3 A;  2H4I A;  1MQH A;  2ZYM A;  1B5H A;  3IOT A;  5HM4 B;  1VSO A;  3LBS A;  2M8C A;  3KJ7 A;  1MXU A;  3Q28 A;  3FVN A;  5B70 A;  2DOJ A;  4WEP A;  3H6U A;  2H25 A;  1QUJ A;  1Z7M E;  3OEL A;  1IIW A;  1UTB B;  2HXW A;  1A8F A;  3PPO A;  2H5Y A;  3FV1 A;  1M5D A;  1R9Q A;  4FIM A;  5AA4 B;  5LOM A;  3C36 A;  1GR2 A;  2H98 A;  2ALU A;  1MXX A;  4F3P A;  5I57 B;  4HCY A;  1MY1 A;  3FJG A;  5CMC A;  1XVY A;  4FE8 A;  1MXV A;  3RPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...