2UVHA

Structure of a periplasmic oligogalacturonide binding protein from yersinia enterocolitica in complex with saturated digalacturonic acid
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
404
structure length
404
Chain Sequence
EVNLRMSWWGGNGRHQVTLKALEEFHKQHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTARIFYFNDATWAKAGLEYPKTWDELLAAGKVFKEKLGDQYYPVVLEHQDTLALIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASFGKSNMYEMKPWINGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFKPAQMLSIGKSTKHPQESAMLINFLLNSKEGVEALGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHKMTTSPYFDDPQIVSLFGDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific Recognition of Saturated and 4,5-Unsaturated Hexuronate Sugars by a Periplasmic Binding Protein Involved in Pectin Catabolism.
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Sugar binding protein
molecule keywords ABC TYPE PERIPLASMIC SUGAR-BINDING PROTEIN
total genus 137
structure length 404
sequence length 404
ec nomenclature
pdb deposition date 2007-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uvhA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uvhA02
2O84X 4NWDA 3VLWA 1LFIA 1AL3A 2A5TA 3K1NA 5KCJB 1LCTA 1FCKA 2CZLA 1TFDA 5FHOA 4GWOA 2ANJA 3PPRA 1B3HA 1HSJA 3TKDA 1EZ9A 3KZGA 3KBRA 3VLUA 3ZS6A 3KN8A 1R9LA 2OZZA 4IO5A 2XD2A 3H3GA 2O7IA 4F2OA 1A55A 4FE8A 2UYFA 4JDFA 4ZEKA 1A99A 1MS7A 3IORA 4QF9A 4EF2A 5AA4B 5FTHA 4XKRA 4JWXA 4YKJA 3HO7A 1B6HA 4O3BA 1OMPA 1PB7A 5AA2A 3IO6A 3K4UA 5HM4B 5ICQA 1VFEA 4P11A 2OCUA 3IB1A 2V93A 1MH4A 3OOAA 2VGQA 2H99A 3OO9A 3D4GA 4LP2B 1IXGA 1MXXA 1IXIA 3TAJA 1TT1A 2AL5A 2GHBA 1IIWA 2H9BA 4OFOA 1MXVA 4IO2A 4H8IA 1BIYA 1LSTA 2QPQA 2I0BA 1B3GA 3PUVE 2O69A 3TFLA 3WAFA 5DVJA 4DCYA 5EHSA 1ZMGA 3TODA 2V3TA 2DVZA 3OXNA 5A5XB 1SW2A 4HTGA 4KPTA 4OMBA 2P2AA 1N84A 3TPAA 1PDAA 1N3XA 4F1YA 2Y7WA 4U2RA 1AH5A 3PU5A 2OLBA 2DE3A 4FEBA 3S9EA 2A5SA 3G7WA 4I62A 3GXAA 1IITA 1URDA 4ZECA 2I49A 1CE2A 3MP8A 2UYEA 4OENA 3V8XB 2Z22A 3USDA 1FTOA 3T93B 1DOTA 1MG1A 1M5BA 3B6QA 3O6IA 5TP9B 3UA8A 4C0RA 1FQEA 1WODA 2UVGA 4I9DA 2KLFA 4JXIA 2RINA 1FQBA 3O2AA 3FZVA 3K1MA 4NF8A 3TYHA 4DZ1A 2GHAA 3FXUA 4KFQA 2UXAA 2RCBA 1RKMA 3A3CA 3CFLA 1B4ZA 3MUQA 4MLQA 4R75A 3DP6A 5TPAA 3QK6A 3P7IA 2AIXA 4NMYA 4TLLB 3OMBA 5CMBA 3SEYA 4PFWA 4YMAA 3I3VA 5I84A 1ANFA 1N0TA 3C32A 1MY2A 3MAMA 4H65A 4NEDA 2Q9TA 1B7HA 5K2YA 2O1MA 3KSJA 3K2DA 4X1DA 3EHUA 4PFUA 5DYHA 3UGWA 2E1SA 2D3IA 1Y3PA 1SQYA 4YKKA 1URSA 1UIVA 2DSFA 4F3BA 2F34A 3RN8A 1Z7ME 5H8HA 2F7BA 2F7CA 2QL3A 3N26A 4KYDA 1R6ZA 3MQ9A 5F1QA 3TCGA 4YAHX 1EH3A 3CRBA 3PPQA 2REJA 4LATA 3G3IA 4ZEFA 3UK4A 3TCFA 3Q28A 3LBSA 5H8QA 4BLAA 4NF8B 4F19A 1JVYA 1UTBA 3JZJA 3TTLA 5I57A 1MM6A 3N6UA 1TFAA 3OELA 3O97A 3C31A 4Q30B 1SVXB 3ONMA 1D9YA 3MPKA 3N94A 3VXCA 1B1HA 2IA4A 4ZEIA 1GV8A 1UTHA 4FAJA 2PVUA 3B6WA 3SEUA 1JW5A 3K6UA 4ECFA 3FXQA 4NF6A 4QFNA 5TPAB 1SDXA 3RT6B 3VVFA 4OFLA 4ESXA 4U1ZA 2VD2A 3K01A 3MZBA 3V83A 4OEVA 2I3VA 5CMKA 1USYE 4RPNA 3PUYE 2X7QA 2NUVA 4IB2A 3R7XA 4C1UA 1IUDA 1IZ1A 2P1SA 4YZZA 2GRVA 5I2NB 2HFBA 2AYSA 3H03A 2DE4A 3LR1A 4L17A 2DWHA 4DXCA 2XXPA 2AL4A 2F6PA 2ZYKA 4OFJA 2Z8DA 4GOTA 4P0GA 2HQ0A 2X26A 2DQVA 1ATGA 2F8DA 3S4UA 1MM7A 2ONSA 3T96B 2HZLA 4KQPA 1B7ZA 2Y7RA 3K1PA 3OEKA 3L6HA 3HCQA 4XKQA 3RLFE 1NKXA 3GBBA 5H8FA 2D21A 4MFIA 5H8NB 1O7TA 3DM0A 4N6PA 1PBQA 4PFTA 2Y7PA 3HN0A 3SKPA 3TUSA 2I6EA 4FECA 4R73A 5IAIA 2XXRA 4NF4B 3C34A 1Y3NA 4ZE9A 1B1XA 3MW0A 5AA2B 4R6YA 5JK4A 3ODBA 4Z0IA 2ZNUA 2Q2CA 4HCYA 1QUKA 2CMOA 3BBRA 3PV0E 3QUJA 4HS7A 4X9TA 4Q8RA 3TTNA 3G3JA 4GRKA 1MXUA 3D4CA 1DSNA 4PFYA 5F7VA 2UVJA 5H8HB 5JTYB 1XOCA 4DE8A 5HPQA 4Q5TA 3IOTA 4NF5A 3W15C 4ZZAA 3ILTB 5TP9A 4ELRA 2DWAA 3CIJA 4ELPA 2P0SA 4GL8A 4RNSA 4OXVA 2V84A 3HSTA 4ND9A 1S50A 5CM6A 1B4HA 3H6TA 2RCAA 2NVUB 3MZ1A 5KZTA 4LZ7A 4AB5A 2RC8A 4M4GA 4EQBA 4JWOA 3K02A 3MJNA 3RQTA 4YB7A 1Y1MA 4LUBA 4JBZA 1D4NA 3G3KA 4RPOA 4U21A 5EHMA 4H5FA 4U23A 3U72A 4E0WA 1LBBA 4QFKA 1B0HA 1I6BA 4FATA 2XX9A 1B32A 2XXIA 3KFMA 4GFRA 4OETA 3TDJA 3PPPA 4G68B 3U93A 3Q29A 3K0VA 3LUYA 1T0KA 1LAXA 3G3GA 2R6GE 4OHNA 2GFEA 2OBGA 1D3KA 2UVHA 4G77A 1BP5A 3JYRA 5CMCA 3VFJA 2PMSA 3WAEA 4RA1A 4TLMB 5DEXB 3Q27A 1JNFA 3BKIB 3E4RA 1MPCA 1HSEA 3A09A 5I56B 1PEBA 1LGBC 1II5A 1QKBA 1SW1A 3EHTA 2Y84A 1SBPA 3QIMA 4G8HA 1OVBA 3W9VA 1Y20A 3B7DA 4IO6A 1J1NA 1ZIUA 2PX1A 5DT6A 3TQLA 4AQ4A 3FD3A 3IJOB 4QSCA 1MQJA 4RXLA 1MXYA 5CI5A 1URGA 4WEDA 3SEWA 4P0IA 3IR1A 3TELA 3EF7A 3HHFA 3LSFB 3CG3A 2NWJA 4G68A 2DP8A 3HPIA 3FVNA 1S9TA 3B6TA 1KWHA 4M1VA 1O64A 5FHNA 3TQWA 5CBSA 4MF3A 1SYHA 2UVIA 1OLCA 4EQ9A 4YKIA 3AXFA 1N76A 3CSGA 2DWIA 1FQAA 3KGCA 4IY5A 3OD7A 4F3PA 2XD3A 1B5IA 5DVIA 3HV1A 4LQ5A 1D9VA 3FXRA 4GVOA 2XXWA 5H8QB 2OWSA 3DP4A 3MC2A 4GXSB 1JW4A 4G8NA 1Q1KA 4U4SA 2X7PA 3OSRA 1FQDA 3CSBA 1OVTA 1I69A 1RYOA 3M8UA 3MPLA 3PPOA 3V89B 3VVDA 3LSWA 2QMXA 4R9FA 3MBPA 3K6VA 4LZ5A 4RJZA 4U22A 1H43A 3ZKLA 4R72A 5I58B 2VOZA 4UACA 3MWBA 1YTVA 2HEUA 1Y3QA 1M5FA 1MXZA 4BDQA 1R1NA 4U4XA 2HAVA 3T66A 3KOTA 4DXBA 4OQOA 2ALUA 1NNKA 3E9XA 3OSQA 3VXBA 1P99A 4GD5A 4PE5B 4PETA 2LAOA 4IO4A 1PBPA 1GR2A 2PYYA 2R71A 3O28A 3PGFA 3JV9A 4R74A 1FTKA 4YB6A 1XC1A 3OO8A 1POTA 1P1WA 4EQ7A 1ZBMA 4QFOA 1ZJLA 2NXOA 3CR9A 3PUXE 1UIUA 3RNNA 2ZYOA 3UN6A 1GGGA 5L9OA 1H44A 4ISUA 3ECRA 3GBAA 3LSXA 3C9HA 4KCDA 1WDNA 1OLAA 1B52A 1BTJA 5H8NA 1P1QA 2QS4A 1PB9A 3LC8A 3C35A 4E0XA 2I0CA 2A5TB 4K3FA 2XXXA 4F18A 3H7MA 4PQJA 5HBCA 5KDTA 2F78A 5ITOA 3K6XA 1IQ7A 3FVKA 3C36A 4KI0E 4LONB 3MVWA 4THIA 4ZEDA 1B40A 1M5CA 4GF8A 1DPEA 4NWCA 3RPWA 2VD3A 4Q0CA 4OWDA 4H1XA 4F1VA 1DMBA 1FQCA 2DOJA 4DCXA 2YPNA 1B5JA 3QXMA 4JB7A 1LBCA 2Q88A 4N07A 4FJPA 4XTCQ 5CRYA 3OEMA 4NTLA 2F36A 2HAUA 3H4ZA 3SEVA 4X48A 2PBWA 1AMFA 5JEIA 4F3SA 2F97A 3U94A 4ELQA 3MVYA 4MBPA 1ZKBA 1N04A 1Q35A 1EU8A 1B58A 4IO3A 3RGYA 1YPNA 3IK6B 1L5TA 3SEXA 4QSDA 4ZDMA 3KEIA 1B3LA 1Y4TA 3DP8A 3GZGA 4FIMA 1N7XA 2Q8JA 3SESA 4HW8A 4QFLA 3VLVA 4BDMA 4WEPA 1N7WA 3PUZE 4RK2A 2ZXTA 3G3FA 1XVYA 4BDOA 1LAGE 4I1DA 3GLBA 1P1OA 1MY0A 1Y9UA 2E0SA 2QMWA 3CFZA 3T9XB 2NOOA 4H8JA 2REGA 2DYXA 5CMMA 2PT1A 1ZLQA 3N6TA 4EXKA 3FVGA 1QUJA 2VHAA 3CVGA 2XXYA 3H06B 3H6VA 3I6VA 3IAZA 3M3KA 4ZE8A 2F6GA 2XXVA 2THIA 1CB6A 2ZMBA 3M3FA 5B70A 2R9JA 5CC2A 1P1NA 4QRZA 4ZS9A 3G3HA 1A40A 1LFHA 3KN3A 4F31B 2B3FA 2I4BA 3FJGA 3L6GA 4QHQA 4GQOA 3UORA 1POY1 3T9UA 5AA3A 3Q26A 4R6HA 4DLDA 5I59B 5FHMA 4EF1A 3R26A 1RYXA 5BUUA 3KN7A 1FTLA 3OO6A 3U8QA 3H6UA 1NL5A 5ICTA 3S9NC 3TEPA 1FQFA 2XX7A 3T9VA 1YAEA 1A8EA 1H45A 3TZAA 3QAXA 1VFDA 3PD9A 4ELOA 2M8CA 1ZU0A 1B3EA 1NH7A 2QRYA 1XVXA 1SI0A 3C33A 3CFXA 2DE2A 3VV5A 4TQUQ 5JTYA 1IXCA 2OWTA 3MZ9A 2ONRA 1PB8A 3S2VA 3V5AA 1NNPA 4JWYA 3CG1A 3MP1A 1QW0A 4PP0A 4IGTA 3TTRA 1Y4CA 1MXWA 5I2KB 2FYIA 3KOSA 3KSXA 1M5EA 1UTBB 2OK2A 1H76A 2O6AA 2I58A 1QJMA 1B2HA 4IGRA 1GVCA 2Z23A 2QJEA 2I4CA 3TTMA 2I3WA 5I58A 3EQ1A 1I6QA 2G93A 2GH9A 2HXWA 4RY1A 2HZKA 3QYTA 2HCAA 3E3KA 3U92A 1USYH 3IB2A 1SYIA 4OVJA 4RK9A 1BKAA 3FV1A 4JSOA 5ELVA 4OEUA 4JSDA 2ZYMA 1QUIA 2BJJX 2RF1A 3BFTA 3S9LC 1MH3A 4XKPA 1A8FA 5I2NA 1PC3A 1B9JA 2H5YA 2ZNTA 1B51A 4IY6A 4NE4A 2XXTA 1SW5A 1Z7NE 3QUFA 1XT8A 3CI8A 3ZSFA 1A54A 1H3DA 2O51A 1FTMA 2W7YA 1NH8A 4LVQA 4EDPA 3IB0A 5H8SA 3UP9A 1EZOA 5I2KA 1FW0A 4IO7A 1NNFA 1ELJA 2ESNA 4DXUA 3FUZA 3EPEA 4H0WA 2WKYA 3F11A 3IX1A 1NNTA 3KG2A 4MH5A 4WXJA 1OIBA 2Z8FA 3TMGA 1R9QA 2V25A 2Q89A 3PMWA 4ONYA 2DXRA 2RC7A 3Q25A 1LAHE 4I8CA 3SDFA 4KHZE 2Y7IA 2B65A 1B3FA 1BLFA 1S7YA 1MRPA 4H67A 1I6AA 3EN3A 1N3WA 1MQGA 4OZ9A 4R6KA 3O9PA 5FTIA 1JEUA 3VDFA 2DS9A 4BDRA 5ISUA 4Z7EA 1MPDA 5EYFA 5IKBA 3IOWA 4OTEA 4OYVA 3W9WA 1AIVA 2YJPA 3PMVA 2G29A 3FJ7A 2PT2A 4HCWA 3FVOA 3UIFA 3FGSA 4NF5B 4POWA 5TU0A 3RY3A 4G8MA 2XHDA 1JEVA 1VE4A 2O7UA 2DWJA 2O68A 4O3AA 5L9SA 4GXAA 2DXYA 2ABHA 4GLIA 4YICA 5LOMA 1QKAA 5I56A 2ZYNA 4G4PA 2OJTA 3FATA 4KR5A 1LAFE 2Y7KA 4WKMA 4KCCA 3MVZA 1DTZA 1SW4A 5KCJA 4YKPA 5I57B 1JQFA 1MDQA 1MDP1 1SD3A 1B7UA 2V3UA 3OENA 4GL0A 4TOZA 3O66A 3PUWE 4X1BA 4YB5A 2IEEA 3PPNA 4ZEBA 4ZZEA 3FJMA 2FNCA 4FEDA 5K2XA 4POXA 3FIRA 2FA7A 3U1OA 4BDNA 2QS1A 3O29A 4H6DA 4AB6A 2Z8EA 3LSLA 2XXQA 5KDTB 3TTKA 3C4MA 4NF4A 4LZ8A 5ITPA 1US5A 2QS3A 1LB9A 2YLNA 3KJ7A 1JW1A 1OQGA 4XKNA 4DIGA 1QVSA 3ZKKA 4C1TA 3BFUA 2ZNSA 1WVJA 5DVFA 3VVEA 1US4A 2O1LA 4R2FA 4G2ZA 2QS2A 2RKMA 4KD5A 1B5HA 3ILUB 2F7AA 1DTGA 1MQIA 3K6WA 3KJTA 4UA8A 1LFGA 3RUMA 3R6UA 1LLSA 5DEXA 3FASA 3IO4A 4XXUA 4G68C 1JETA 5B7DA 2D5WA 3MP6A 5AA2D 1TXFA 3RTWB 1FTJA 2RC9A 1P1UA 1SI1A 2H25A 3E13X 3IOVA 1MY3A 1UTHB 3IL1B 4F1UA 1HSLA 5BWJA 1XHYA 1MQHA 5L9MA 5A5XA 3DELB 1OQHA 4NF6B 4GIZA 2B3BA 3FV2A 4U1OA 4RYAA 3HHGA 2Q2AA 3I5OA 4YU0A 4XIGQ 4H5GA 1UQWA 4N13A 4F39A 2XXHA 1IXHA 1LB8A 1VR5A 1TWYA 2H98A 3DLNA 3IJXB 3K00A 1LCFA 4OERA 5AA4A 5AA1A 1B05A 3EHSA 3T9HB 4QFPA 4F3GA 4KYSA 1EZPA 4KYEA 1JVXA 1M5DA 4O3CA 5AE4A 4OESA 2VP1A 1IEJA 1NFTA 2H4IA 3PD8A 2QSXA 1O63A 3SETA 4EXLA 5CBRA 5H8FB 1B0LA 1MY4A 1GTKA 3O6GA 3VE1B 1DPPA 3H6WA 3RTFB 1XS5A 3S9MC 3SERA 3M3LA 2ONKE 3QSLA 2XX8A 1MY1A 1Y1ZA 5DTBA 4F22A 1QULA 3RT8A 1AOVA 5I59A 2F5XA 3PMXA 4FORA 1VSOA 4YMBA 1NMUA 1YCJA 3MVXA 4R9GA 1MQDA 5J1DA 1B46A 3TCHA 2XXUA 3T22A 1F9BA 3A3UA 4R2BA 5L8DA 1ZTYA 3O6HA 5M2VA 1MPBA 4MLVA 4LA9A 2F35A 4LQ2A 2DVCA 2V3QA 3THIA 4EUOA 4ESWA 1A7LA 2I48A 3N5LA 4BDLA 4F29A 3IOUA 3OO7A 4DDDA 4QSEA 4F2QA
chains in the Genus database with same CATH superfamily
2O84X 1TFDA 5FHOA 4QBAA 3KBRA 3VLUA 1R9LA 1FPFA 3MYUA 1A55A 2VT5A 4XKRA 4JWXA 4YKJA 1B6HA 5ICQA 4P11A 2OCUA 3OO9A 2GHBA 2AL5A 4O7IA 1BIYA 3PUVE 4PF8A 3WAFA 1DCUA 1FBFA 4NQ8A 3OXNA 5A5XB 1N84A 1N3XA 2A5SA 3G7WA 5EYGA 4OENA 3O6IA 3UA8A 2KLFA 2RINA 1FQBA 3O2AA 3K1MA 4DZ1A 2UXAA 3A3CA 1RKMA 3CFLA 1B4ZA 3DP6A 3QK6A 4TLLB 4NMYA 3I3VA 1ANFA 3C32A 4H65A 1LBVA 2O1MA 5DYHA 1QGXA 2E1SA 4YKKA 4F3BA 2F34A 2QL3A 3N26A 3RYDA 2WYKA 4G61A 3G3IA 4ZEFA 3UK4A 3TCFA 5EQ9A 1UTBA 3T0JA 3N6UA 3OELA 4FBPA 2IA4A 4FAJA 1UTHA 4PTKA 1FSAA 3K6UA 3FXQA 3RT6B 4OFLA 4OEVA 2I3VA 1USYE 3PUYE 2X7QA 3R7XA 4YZZA 1IZ1A 3H03A 2AYSA 2XXPA 3S4UA 2DQVA 2HZLA 2Y5KA 1B7ZA 4XKQA 3L6HA 1NKXA 2D21A 5H8NB 1O7TA 1PBQA 2Y7PA 2XXRA 4NF4B 1NV1A 5A5LA 4PFBA 5AA2B 4HCYA 1QUKA 4HS7A 2CEXA 4GRKA 3D4CA 1DSNA 4MEVA 1XOCA 5HPQA 4ZZAA 5TP9A 4GBWA 4OXVA 3HSTA 1S50A 4YB7A 4H5FA 4E0WA 1I6BA 2QVVA 4OETA 3LUYA 2R6GE 4OHNA 1CNQA 2OBGA 4G77A 4P9KA 3VFJA 3WAEA 2Q8MA 3Q27A 5I56B 1LGBC 1QKBA 3EHTA 1Y20A 3IJOB 5CI5A 1MQJA 1MXYA 3MSTA 3EF7A 3LSFB 3CG3A 2NWJA 2DP8A 3FVNA 5FHNA 4EQ9A 4YKIA 2XXWA 5H8QB 2OWSA 3MC2A 1JW4A 1OVTA 3VVDA 4U22A 3MBPA 3MWBA 2FVZA 4U4XA 2ALUA 1P99A 4PE5B 4IO4A 1PBPA 1ZBMA 4QFOA 2WX9A 2NXOA 2ZYOA 2WBDA 4GX6A 5IM2A 1B52A 3LC8A 2I0CA 5I7IA 2XXXA 5F24A 2P3VA 5ITOA 1IQ7A 3FVKA 3C36A 4KI0E 1M5CA 1DPEA 4NWCA 1DMBA 2F3DA 4PDHA 2Q88A 4XTCQ 3OEMA 2F36A 2PBWA 5JEIA 3MVYA 1N04A 3RGYA 1YPNA 1L5TA 3DP8A 4QFLA 4WEPA 3PUZE 1P1OA 3CFZA 1Y9UA 2QMWA 2KQZA 5CMMA 1CB6A 3M3FA 5B70A 3BIHA 1A40A 4F31B 4PC9A 3UORA 5ICTA 4N17A 1H45A 4HE1A 4X1BA 3ZKLA 3CFXA 4O8MA 5JTYA 3S2VA 1NNPA 3KBZA 3CG1A 2OK2A 2I58A 3TTMA 5I58A 1YYZA 1I6QA 3E78A 2G93A 2GH9A 1IMBA 3IB2A 4AS4A 1SYIA 5ELVA 4JSDA 4I3YA 1A8FA 1B9JA 2H5YA 1B51A 2F3BA 3HFUA 3IB0A 4GX4A 2ESNA 3FUZA 3EPEA 4H0WA 3IX1A 3F11A 1FPJA 1FRPA 2Q74A 1NV2A 2V25A 2Q89A 1LAHE 4I8CA 3SDFA 4OVJA 4POXA 3EN3A 4OANA 2QVUA 4BDRA 4OTEA 4OYVA 3W9WA 4HCWA 4I40A 4NF5B 4G8MA 2JJKA 5L9SA 2DXYA 2ABHA 4GLIA 5LOMA 1XI6A 4KR5A 2Y7KA 4N8YA 2R8TA 1MDP1 3O66A 2IEEA 3U1OA 2FNCA 4H6DA 3LSLA 2L5VA 3TTKA 5ITPA 2YLNA 2ZNSA 1WVJA 4R2FA 4UA8A 1DTGA 3KJTA 3IO4A 4XXUA 1SI1A 1UTHB 3IL1B 4F1UA 1XHYA 1OQHA 4PBHA 2B3BA 4U1OA 4RYAA 3HHGA 2Q2AA 3I5OA 4XIGQ 1UQWA 3IJXB 5IZ1A 4KYEA 1JVXA 2XWOA 4O3CA 1FBPA 1O63A 3SETA 5H8FB 1B0LA 1MY4A 3VE1B 1NI9A 1DPPA 3H6WA 3RTFB 3SERA 1G0IA 3BIGA 1MY1A 2F5XA 3RPLB 4FORA 3MVXA 4MHFA 2XXUA 1F9BA 3A3UA 5L8DA 2DVCA 2I48A 3N5LA 4F29A 2CEYA 1FBGA 1LFIA 2A5TA 1LCTA 1B3HA 3TKDA 1EZ9A 5EQ8A 3ZS6A 1FPGA 1FPBA 4FE8A 4ZEKA 3IORA 5FTHA 4O3BA 3K4UA 3OOAA 4XF5A 1NV0A 1IXGA 3TAJA 2HPGA 1MXVA 1B3GA 2O69A 1VDWA 2P2AA 1PDAA 1LEVA 3PU5A 3S9EA 2FHYA 4I62A 1IITA 1URDA 1CE2A 4DI3D 2UYEA 3B6QA 5TP9B 4I9DA 4NF8A 3FXUA 4KFQA 4R75A 3P7IA 4PFWA 1MY2A 3MAMA 4X1DA 3EHUA 3UGWA 2D3IA 1Y3PA 1SQYA 2F7BA 2F7CA 4KYDA 3MQ9A 5F1QA 1EH3A 3CRBA 2OX3A 4GWZA 2REJA 4LATA 3LBSA 4BLAA 4NF8B 1MM6A 1D9YA 3MPKA 4QXDA 2PVUA 3SEUA 1JW5A 4ECFA 4QFNA 1K9YA 4ESXA 4MJOA 5CMKA 2P1SA 2DE4A 4DXCA 2Z8DA 2FIXA 2HQ0A 2X26A 3K1PA 3OEKA 3RLFE 3HCQA 4OVPA 5H8FA 3GBBA 5J16A 5ET6A 4MFIA 3SKPA 1Y3NA 4ZE9A 4R6YA 3ODBA 2ZNUA 5FBPA 3BBRA 3FBPA 1MXUA 4PFYA 5F7VA 5H8HB 1IMCA 3ILTB 5CM6A 1NUWA 2RCAA 5KZTA 4LZ7A 2RC8A 4M4GA 1FBEA 4EQBA 3G3KA 4U23A 3U72A 4P47A 2CZHA 1B32A 4N15A 4KXPA 1IMEA 5ET7A 3U93A 3Q29A 1LAXA 2Y5LA 2HXRA 2GFEA 5CMCA 1YZ0A 5T3JA 2PMSA 1SBPA 3QIMA 1OVBA 3B7DA 4IO6A 1ZIUA 2PX1A 5DT6A 4RXLA 3HHFA 1FPEA 4G68A 1S9TA 3TQWA 1O64A 1SYHA 3CSGA 1N76A 3KGCA 1LBYA 1FQAA 4UABA 3OD7A 2XD3A 1B5IA 5DVIA 3HV1A 4GWUA 1D9VA 3DP4A 4GXSB 4U4SA 4G8NA 3CSBA 1I69A 3M8UA 4NF0A 4RJZA 4R9FA 4LZ5A 1H43A 4UACA 1YTVA 1Y3QA 1MXZA 4BDQA 3T66A 4DXBA 3E9XA 3VXBA 5EQAA 4PETA 1NV5A 3O28A 2PYYA 3PGFA 4R74A 5EQ7A 1P1WA 4OVQA 1KA1A 3PUXE 1UIUA 3RNNA 3UN6A 4NAPA 3ECRA 3LSXA 1WDNA 1OLAA 2QS4A 1RDXA 4E0XA 4PQJA 2F78A 3K6XA 4LONB 3MVWA 2VD3A 4Q0CA 3QXMA 4FJPA 5CRYA 2HAUA 3H4ZA 5DW8A 1NUXA 3U94A 4ELQA 4MBPA 1Q35A 1B58A 3IK6B 1B3LA 3GZGA 3SESA 1N7XA 4PFRA 2ZXTA 1XVYA 4BDOA 1LAGE 1MY0A 2E0SA 2DYXA 1ZLQA 3H6VA 3I6VA 3IAZA 5ET8A 3M3KA 5CC2A 4QRZA 3G3HA 4X8RA 2B3FA 3Q26A 4R6HA 4EF1A 3R26A 1RYXA 4PGNA 3OO6A 1FTLA 5BUUA 1NL5A 1YAEA 3PD9A 4ELOA 1SI0A 4TQUQ 4HXVA 5I2KB 1MXWA 4MMPA 3KSXA 1UTBB 1H76A 4IGRA 1B2HA 2Z23A 2QJEA 2I4CA 4RY1A 2HZKA 3QYTA 2HCAA 2WBBA 4RK9A 4OEUA 2BJJX 2RF1A 3S9LC 4XKPA 5I2NA 1SW5A 1INPA 3CI8A 4PBQA 4X04A 1NH8A 5I2KA 1FW0A 1NNFA 1ELJA 3NOHA 2PCRA 3KG2A 4WXJA 4MH5A 1OIBA 2DDKA 2Z8FA 1R9QA 3TMGA 4I3EA 1NUYA 2DXRA 2RC7A 4LVQA 2B65A 1BLFA 2XWVA 4H67A 4OZ9A 1DBZA 1MQGA 3O9PA 4Z7EA 1MPDA 5EYFA 5I5PA 1AIVA 2YJPA 1KA0A 3FJ7A 2PT2A 3FVOA 3FGSA 4POWA 2XHDA 1VE4A 2O7UA 2O68A 4YICA 4MNIA 1FPLA 3MVZA 4YKPA 5I57B 1JQFA 4NGUA 1MDQA 2MKZA 2V3UA 3OENA 5IZ3B 3PPNA 4ZZEA 2QS1A 3O29A 2Z8EA 3C4MA 1US5A 2QS3A 3KJ7A 4DIGA 4C1TA 1US4A 1B5HA 3ILUB 2F7AA 3K6WA 3FASA 3MP6A 3CHGA 3RTWB 3E13X 4AS5A 3IOVA 1MY3A 1HSLA 3DELB 4NF6B 4GIZA 4N6DA 3FV2A 4YU0A 4P1EA 3DLNA 1IXHA 1LB8A 3K00A 3T93B 1B05A 4F3GA 1EZPA 2VP1A 2H4IA 4EXLA 3O6GA 1FJ9A 4OVRA 1AOVA 3PMXA 4GWXA 5J1DA 1B46A 4P3LA 5M2VA 1ZTYA 1MPBA 4LA9A 2V3QA 4EUOA 4DDDA 4QSEA 2WEFA 4NWDA 3VLWA 1AL3A 3K1NA 1FCKA 2CZLA 1IMFA 1LBWA 4GWOA 3PPRA 1HSJA 3KZGA 3KN8A 2OZZA 4IO5A 2O7IA 2UYFA 4JDFA 1A99A 1MS7A 4GX3A 4EF2A 5AA4B 3HO7A 5AA2A 3IO6A 5HM4B 1VFEA 3IB1A 2VGQA 2H99A 3D4GA 1MXXA 1IXIA 1TT1A 2H9BA 4OFOA 4IO2A 3EKIA 2PFZA 2I0BA 5DVJA 3TODA 2DVZA 3TPAA 4PAIA 4F1YA 2Y7WA 4U2RA 2OLBA 4FEBA 1G0HA 3GXAA 4ZECA 2I49A 3MP8A 3V8XB 3USDA 1FTOA 1MG1A 1FJ6A 4C0RA 1FQEA 2UVGA 4JXIA 1NV4A 2GHAA 3KC0A 4MLQA 2AIXA 5CMBA 4YMAA 2ZZXA 5I84A 1N0TA 5IZ3A 4NEDA 2Q9TA 1B7HA 3K2DA 4PFUA 1UIVA 1DK4A 3RN8A 1Z7ME 5H8HA 3TCGA 4YAHX 1NV3A 1RDZA 3Q28A 3IFAA 5H8QA 4Q30B 3N94A 3VXCA 1B1HA 4ZEIA 3B6WA 2CZKA 2XWIA 4NF6A 5TPAB 1SDXA 2VD2A 3K01A 4C1UA 2NUVA 1IUDA 4L17A 2AL4A 4OFJA 4P0GA 4GOTA 5I56A 1EYJA 1ATGA 2F8DA 1MM7A 3T96B 2Y7RA 3TUSA 3DM0A 3U65A 3HN0A 4R73A 5IAIA 4NX1A 5JK4A 4Z0IA 3QUJA 2WYPA 4Q8RA 3TTNA 3G3JA 2UVJA 5JTYB 1FPDA 3QMFA 4NF5A 4ELRA 4GL8A 4RNSA 3H6TA 4AB5A 4JWOA 3MJNA 3RQTA 1Y1MA 4JBZA 4RPOA 4U21A 5EHMA 4PAKA 4PE3A 3D1RA 1B0HA 2XXIA 3KFMA 3TDJA 3PPPA 4G68B 3G3GA 4NHBA 3JYRA 5DEXB 1JNFA 5ET5A 3A09A 1PEBA 1FPKA 3W9VA 3FD3A 4P8BA 4QSCA 3SEWA 1URGA 5I3SA 4P0IA 4P1LA 3T1BA 4MX6A 5CBSA 1KWHA 4IY5A 2GQ1A 4LQ5A 1AWBA 1Q1KA 2X7PA 1FQDA 1RYOA 3MPLA 3PPOA 3V89B 3K6VA 5EYHA 5I58B 2HAVA 1NNKA 4GD5A 2R71A 3JV9A 4EQ7A 1XC1A 1ZJLA 3CR9A 1H44A 4NG7A 4ISUA 3GBAA 4KCDA 4O94A 3A29A 1LBZA 1NUZA 5H8NA 4K3FA 4F18A 4XEQA 4P56A 5HBCA 4ZEDA 4H1XA 2DOJA 2YPNA 1B5JA 4JB7A 3SEVA 4X48A 1AMFA 1ZKBA 3SEXA 3KEIA 4FIMA 2Q8JA 1D9QA 4HW8A 3VLVA 4BDMA 3KC1A 4RK2A 3G3FA 2NOOA 4H8JA 1YXIA 3N6TA 4EXKA 3CVGA 3H06B 2F6GA 2XXVA 1P1NA 4ZS9A 1LFHA 3FJGA 2I4BA 3L6GA 4N91A 4GQOA 4QHQA 4XFEA 1POY1 5I59B 4MCOA 4LN5A 3KN7A 3S9NC 3U8QA 1Q9DA 2KR0A 3T9VA 1A8EA 1VFDA 3C33A 1ZU0A 3VV5A 1XVXA 2OWTA 4N4UA 3V5AA 5LTCA 4JWYA 1QW0A 4IR8A 1Y4CA 2FYIA 4JVDA 2O6AA 1GVCA 2HXWA 2XXKA 2ZYMA 3BFTA 3V83A 4IY6A 2XXTA 1Z7NE 3QUFA 1XT8A 1A54A 2O51A 4EDPA 2W7YA 2XWKA 5H8SA 1EZOA 2WKYA 4HE0A 1RDYA 3Q25A 4KHZE 2Y7IA 4R6KA 1JEUA 2HHMA 5ISUA 1FBHA 3IOWA 3PMVA 2G29A 3RY3A 1JEVA 2DWJA 4MIJA 4PAFA 1QKAA 2ZYNA 2OJTA 3FATA 1LAFE 4TOZA 3PUWE 4YB5A 3FJMA 3FIRA 2FA7A 1KZ8A 3RPLA 2XXQA 1LB9A 1JW1A 1OQGA 4XKNA 1QVSA 3ZKKA 3VVEA 5DVFA 2O1LA 4G2ZA 2QS2A 2RKMA 1MQIA 1LFGA 3R6UA 4PFIA 4MAGA 1LLSA 1JETA 2D5WA 1TXFA 2VPNA 2RC9A 1P1UA 5BWJA 3LUZA 4GWYA 4N13A 1VR5A 4OERA 1TWYA 1LCFA 3T9HB 3GYYA 1IEJA 1NFTA 1FPIA 3S9MC 1FBDA 2XX8A 4F22A 3RT8A 5I59A 1VSOA 1NMUA 3ROJA 2PFYA 4R9GA 4MNPA 3SZPA 3T22A 4ESWA 3OO7A 5KCJB 2ANJA 4OA4A 2XD2A 1K9ZA 3H3GA 4N6KA 4QF9A 2FIEA 3IFCA 1OMPA 1PB7A 2V93A 1MH4A 4LP2B 1IIWA 4H8IA 1LSTA 2QPQA 3TFLA 4DCYA 5EHSA 1ZMGA 2V3TA 1SW2A 4HTGA 4KPTA 4OMBA 4GBVA 1AH5A 2DE3A 4PDDA 2B4LA 2Z22A 1DOTA 1M5BA 1WODA 3FZVA 2RCBA 3TYHA 3MUQA 3SEYA 3OMBA 5K2YA 3KSJA 1URSA 2DSFA 3FXBA 1R6ZA 3PPQA 2VPOA 4F19A 1JVYA 3JZJA 3TTLA 5I57A 1TFAA 4JVCA 3O97A 3C31A 1SVXB 3ONMA 1GV8A 1NV7A 1FTAA 3B50A 3E79A 3VVFA 4U1ZA 3MZBA 4RPNA 4IB2A 5I2NB 2GRVA 4DI4B 2HFBA 3LR1A 2DWHA 5IZZA 2ZYKA 2F6PA 2ONSA 4JVIA 4KQPA 2B4MA 4N8GA 4N6PA 4PFTA 2I6EA 4FECA 3C34A 1B1XA 3MW0A 3B8BA 2Q2CA 3PV0E 2CMOA 4X9TA 4DE8A 4Q5TA 3IOTA 3W15C 4H46A 2DWAA 3CIJA 4ELPA 2P0SA 2V84A 4ND9A 1B4HA 2NVUB 3MZ1A 3K02A 4LUBA 1D4NA 1LBBA 4QFKA 4FATA 2XX9A 4GFRA 4GWWA 3K0VA 1T0KA 2UVHA 1D3KA 1BP5A 4RA1A 4TLMB 3BKIB 3E4RA 1MPCA 1HSEA 4G8HA 1II5A 1SW1A 2Y84A 4OVSA 4PF6A 1EYIA 1J1NA 3TQLA 4AQ4A 4MNCA 1FBCA 4F1VA 3TELA 4WEDA 3IR1A 3HPIA 4M1VA 3B6TA 2QFLA 4MF3A 2UVIA 1OLCA 3AXFA 2DWIA 4F3PA 3FXRA 4GVOA 3OSRA 2CZIA 2V4CA 4PGPA 5IGAA 3LSWA 1BK4A 2QMXA 4R72A 2VOZA 2HEUA 1M5FA 1R1NA 3KOTA 2BJIA 4OQOA 3OSQA 2LAOA 1GR2A 4YB6A 1FTKA 3OO8A 1POTA 5LDZA 1NV6A 1GGGA 5L9OA 4NN3A 3C9HA 1BTJA 4O7MA 1P1QA 1PB9A 3C35A 2A5TB 3ISPA 3H7MA 5KDTA 4THIA 1B40A 4GF8A 3RPWA 4OWDA 1FQCA 4DCXA 2ZZVA 1LBCA 4N07A 4NTLA 4F3SA 2F97A 1EYKA 1EU8A 4IO3A 4QSDA 4ZDMA 1Y4TA 1N7WA 4I1DA 3GLBA 3T9XB 2REGA 2PT1A 3FVGA 1QUJA 2VHAA 2XXYA 4ZE8A 1IMAA 2THIA 2ZMBA 2R9JA 3LV0A 3KN3A 2OWZA 5ESYA 3T9UA 5AA3A 4DLDA 5FHMA 3H6UA 3TEPA 1FQFA 2XX7A 3TZAA 3QAXA 2M8CA 1B3EA 1NH7A 2QRYA 3EHSA 2DE2A 1IXCA 3MZ9A 2ONRA 1PB8A 2XA5A 3MP1A 4PP0A 4IGTA 3TTRA 3KOSA 1M5EA 1QJMA 2I3WA 1JP4A 3EQ1A 2P3NA 3U92A 3E3KA 1USYH 1BKAA 3FV1A 2FBPA 4JSOA 1QUIA 1MH3A 4H45A 4OVTA 4NE4A 1PC3A 2ZNTA 5TPAA 3ZSFA 1H3DA 1FTMA 3UP9A 4IO7A 4DXUA 1NNTA 4HE2A 3PMWA 4ONYA 4F2OA 1B3FA 1S7YA 1MRPA 1I6AA 5FTIA 1N3WA 3VDFA 2DS9A 5IKBA 3UIFA 5TU0A 2QVRA 1IMDA 4O3AA 4GXAA 4N81A 4G4PA 4WKMA 4KCCA 1DTZA 1SW4A 5KCJA 1SD3A 1B7UA 4GL0A 5K2XA 4ZEBA 4BDNA 4FEDA 4AB6A 5KDTB 4NF4A 4LZ8A 3BFUA 4KD5A 3RUMA 5DEXA 4G68C 5B7DA 5AA2D 1FTJA 2H25A 1MQHA 5L9MA 5A5XA 4H5GA 4F39A 2XXHA 2H98A 5AA4A 5AA1A 4QFPA 4KYSA 1M5DA 5AE4A 4OESA 3PD8A 2QSXA 5CBRA 1GTKA 4GWSA 1XS5A 3M3LA 2ONKE 3QSLA 1Y1ZA 5DTBA 1QULA 4PCDA 4YMBA 1YCJA 1MQDA 3TCHA 1LBXA 4R2BA 3O6HA 4MLVA 2F35A 4LQ2A 3THIA 1A7LA 1SPIA 4BDLA 2ZZWA 3IOUA 3PTYA 4F2QA
chains in the Genus database with same CATH topology
2O84X 4NWDA 3VLWA 1LFIA 1AL3A 2A5TA 3K1NA 5KCJB 1LCTA 1FCKA 2CZLA 1TFDA 5FHOA 4GWOA 2ANJA 3PPRA 1B3HA 1HSJA 3TKDA 1EZ9A 3KZGA 3KBRA 3VLUA 3ZS6A 3KN8A 1R9LA 2OZZA 4IO5A 2XD2A 3H3GA 2O7IA 4F2OA 1A55A 4FE8A 2UYFA 4JDFA 4ZEKA 1A99A 1MS7A 3IORA 4QF9A 4EF2A 5AA4B 5FTHA 4XKRA 4JWXA 4YKJA 3HO7A 1B6HA 4O3BA 1OMPA 1PB7A 5AA2A 3IO6A 3K4UA 5HM4B 5ICQA 1VFEA 4P11A 2OCUA 3IB1A 2V93A 1MH4A 3OOAA 2VGQA 2H99A 3OO9A 3D4GA 4LP2B 1IXGA 1MXXA 1IXIA 3TAJA 1TT1A 2AL5A 2GHBA 1IIWA 2H9BA 4OFOA 1MXVA 4IO2A 4H8IA 1BIYA 1LSTA 2QPQA 2I0BA 1B3GA 3PUVE 2O69A 3TFLA 3WAFA 5DVJA 4DCYA 5EHSA 1ZMGA 3TODA 2V3TA 2DVZA 3OXNA 5A5XB 1SW2A 4HTGA 4KPTA 4OMBA 2P2AA 1N84A 3TPAA 1PDAA 1N3XA 4F1YA 2Y7WA 4U2RA 1AH5A 3PU5A 2OLBA 2DE3A 4FEBA 3S9EA 2A5SA 3G7WA 4I62A 3GXAA 1IITA 1URDA 4ZECA 2I49A 1CE2A 3MP8A 2UYEA 4OENA 3V8XB 2Z22A 3USDA 1FTOA 3T93B 1DOTA 1MG1A 1M5BA 3B6QA 3O6IA 5TP9B 3UA8A 4C0RA 1FQEA 1WODA 2UVGA 4I9DA 2KLFA 4JXIA 2RINA 1FQBA 3O2AA 3FZVA 3K1MA 4NF8A 3TYHA 4DZ1A 2GHAA 3FXUA 4KFQA 2UXAA 2RCBA 1RKMA 3A3CA 3CFLA 1B4ZA 3MUQA 4MLQA 4R75A 3DP6A 5TPAA 3QK6A 3P7IA 2AIXA 4NMYA 4TLLB 3OMBA 5CMBA 3SEYA 4PFWA 4YMAA 3I3VA 5I84A 1ANFA 1N0TA 3C32A 1MY2A 3MAMA 4H65A 4NEDA 2Q9TA 1B7HA 5K2YA 2O1MA 3KSJA 3K2DA 4X1DA 3EHUA 4PFUA 5DYHA 3UGWA 2E1SA 2D3IA 1Y3PA 1SQYA 4YKKA 1URSA 1UIVA 2DSFA 4F3BA 2F34A 3RN8A 1Z7ME 5H8HA 2F7BA 2F7CA 2QL3A 3N26A 4KYDA 1R6ZA 3MQ9A 5F1QA 3TCGA 4YAHX 1EH3A 3CRBA 3PPQA 2REJA 4LATA 3G3IA 4ZEFA 3UK4A 3TCFA 3Q28A 3LBSA 5H8QA 4BLAA 4NF8B 4F19A 1JVYA 1UTBA 3JZJA 3TTLA 5I57A 1MM6A 3N6UA 1TFAA 3OELA 3O97A 3C31A 4Q30B 1SVXB 3ONMA 1D9YA 3MPKA 3N94A 3VXCA 1B1HA 2IA4A 4ZEIA 1GV8A 1UTHA 4FAJA 2PVUA 3B6WA 3SEUA 1JW5A 3K6UA 4ECFA 3FXQA 4NF6A 4QFNA 5TPAB 1SDXA 3RT6B 3VVFA 4OFLA 4ESXA 4U1ZA 2VD2A 3K01A 3MZBA 3V83A 4OEVA 2I3VA 5CMKA 1USYE 4RPNA 3PUYE 2X7QA 2NUVA 4IB2A 3R7XA 4C1UA 1IUDA 1IZ1A 2P1SA 4YZZA 2GRVA 5I2NB 2HFBA 2AYSA 3H03A 2DE4A 3LR1A 4L17A 2DWHA 4DXCA 2XXPA 2AL4A 2F6PA 2ZYKA 4OFJA 2Z8DA 4GOTA 4P0GA 2HQ0A 2X26A 2DQVA 1ATGA 2F8DA 3S4UA 1MM7A 2ONSA 3T96B 2HZLA 4KQPA 1B7ZA 2Y7RA 3K1PA 3OEKA 3L6HA 3HCQA 4XKQA 3RLFE 1NKXA 3GBBA 5H8FA 2D21A 4MFIA 5H8NB 1O7TA 3DM0A 4N6PA 1PBQA 4PFTA 2Y7PA 3HN0A 3SKPA 3TUSA 2I6EA 4FECA 4R73A 5IAIA 2XXRA 4NF4B 3C34A 1Y3NA 4ZE9A 1B1XA 3MW0A 5AA2B 4R6YA 5JK4A 3ODBA 4Z0IA 2ZNUA 2Q2CA 4HCYA 1QUKA 2CMOA 3BBRA 3PV0E 3QUJA 4HS7A 4X9TA 4Q8RA 3TTNA 3G3JA 4GRKA 1MXUA 3D4CA 1DSNA 4PFYA 5F7VA 2UVJA 5H8HB 5JTYB 1XOCA 4DE8A 5HPQA 4Q5TA 3IOTA 4NF5A 3W15C 4ZZAA 3ILTB 5TP9A 4ELRA 2DWAA 3CIJA 4ELPA 2P0SA 4GL8A 4RNSA 4OXVA 2V84A 3HSTA 4ND9A 1S50A 5CM6A 1B4HA 3H6TA 2RCAA 2NVUB 3MZ1A 5KZTA 4LZ7A 4AB5A 2RC8A 4M4GA 4EQBA 4JWOA 3K02A 3MJNA 3RQTA 4YB7A 1Y1MA 4LUBA 4JBZA 1D4NA 3G3KA 4RPOA 4U21A 5EHMA 4H5FA 4U23A 3U72A 4E0WA 1LBBA 4QFKA 1B0HA 1I6BA 4FATA 2XX9A 1B32A 2XXIA 3KFMA 4GFRA 4OETA 3TDJA 3PPPA 4G68B 3U93A 3Q29A 3K0VA 3LUYA 1T0KA 1LAXA 3G3GA 2R6GE 4OHNA 2GFEA 2OBGA 1D3KA 2UVHA 4G77A 1BP5A 3JYRA 5CMCA 3VFJA 2PMSA 3WAEA 4RA1A 4TLMB 5DEXB 3Q27A 1JNFA 3BKIB 3E4RA 1MPCA 1HSEA 3A09A 5I56B 1PEBA 1LGBC 1II5A 1QKBA 1SW1A 3EHTA 2Y84A 1SBPA 3QIMA 4G8HA 1OVBA 3W9VA 1Y20A 3B7DA 4IO6A 1J1NA 1ZIUA 2PX1A 5DT6A 3TQLA 4AQ4A 3FD3A 3IJOB 4QSCA 1MQJA 4RXLA 1MXYA 5CI5A 1URGA 4WEDA 3SEWA 4P0IA 3IR1A 3TELA 3EF7A 3HHFA 3LSFB 3CG3A 2NWJA 4G68A 2DP8A 3HPIA 3FVNA 1S9TA 3B6TA 1KWHA 4M1VA 1O64A 5FHNA 3TQWA 5CBSA 4MF3A 1SYHA 2UVIA 1OLCA 4EQ9A 4YKIA 3AXFA 1N76A 3CSGA 2DWIA 1FQAA 3KGCA 4IY5A 3OD7A 4F3PA 2XD3A 1B5IA 5DVIA 3HV1A 4LQ5A 1D9VA 3FXRA 4GVOA 2XXWA 5H8QB 2OWSA 3DP4A 3MC2A 4GXSB 1JW4A 4G8NA 1Q1KA 4U4SA 2X7PA 3OSRA 1FQDA 3CSBA 1OVTA 1I69A 1RYOA 3M8UA 3MPLA 3PPOA 3V89B 3VVDA 3LSWA 2QMXA 4R9FA 3MBPA 3K6VA 4LZ5A 4RJZA 4U22A 1H43A 3ZKLA 4R72A 5I58B 2VOZA 4UACA 3MWBA 1YTVA 2HEUA 1Y3QA 1M5FA 1MXZA 4BDQA 1R1NA 4U4XA 2HAVA 3T66A 3KOTA 4DXBA 4OQOA 2ALUA 1NNKA 3E9XA 3OSQA 3VXBA 1P99A 4GD5A 4PE5B 4PETA 2LAOA 4IO4A 1PBPA 1GR2A 2PYYA 2R71A 3O28A 3PGFA 3JV9A 4R74A 1FTKA 4YB6A 1XC1A 3OO8A 1POTA 1P1WA 4EQ7A 1ZBMA 4QFOA 1ZJLA 2NXOA 3CR9A 3PUXE 1UIUA 3RNNA 2ZYOA 3UN6A 1GGGA 5L9OA 1H44A 4ISUA 3ECRA 3GBAA 3LSXA 3C9HA 4KCDA 1WDNA 1OLAA 1B52A 1BTJA 5H8NA 1P1QA 2QS4A 1PB9A 3LC8A 3C35A 4E0XA 2I0CA 2A5TB 4K3FA 2XXXA 4F18A 3H7MA 4PQJA 5HBCA 5KDTA 2F78A 5ITOA 3K6XA 1IQ7A 3FVKA 3C36A 4KI0E 4LONB 3MVWA 4THIA 4ZEDA 1B40A 1M5CA 4GF8A 1DPEA 4NWCA 3RPWA 2VD3A 4Q0CA 4OWDA 4H1XA 4F1VA 1DMBA 1FQCA 2DOJA 4DCXA 2YPNA 1B5JA 3QXMA 4JB7A 1LBCA 2Q88A 4N07A 4FJPA 4XTCQ 5CRYA 3OEMA 4NTLA 2F36A 2HAUA 3H4ZA 3SEVA 4X48A 2PBWA 1AMFA 5JEIA 4F3SA 2F97A 3U94A 4ELQA 3MVYA 4MBPA 1ZKBA 1N04A 1Q35A 1EU8A 1B58A 4IO3A 3RGYA 1YPNA 3IK6B 1L5TA 3SEXA 4QSDA 4ZDMA 3KEIA 1B3LA 1Y4TA 3DP8A 3GZGA 4FIMA 1N7XA 2Q8JA 3SESA 4HW8A 4QFLA 3VLVA 4BDMA 4WEPA 1N7WA 3PUZE 4RK2A 2ZXTA 3G3FA 1XVYA 4BDOA 1LAGE 4I1DA 3GLBA 1P1OA 1MY0A 1Y9UA 2E0SA 2QMWA 3CFZA 3T9XB 2NOOA 4H8JA 2REGA 2DYXA 5CMMA 2PT1A 1ZLQA 3N6TA 4EXKA 3FVGA 1QUJA 2VHAA 3CVGA 2XXYA 3H06B 3H6VA 3I6VA 3IAZA 3M3KA 4ZE8A 2F6GA 2XXVA 2THIA 1CB6A 2ZMBA 3M3FA 5B70A 2R9JA 5CC2A 1P1NA 4QRZA 4ZS9A 3G3HA 1A40A 1LFHA 3KN3A 4F31B 2B3FA 2I4BA 3FJGA 3L6GA 4QHQA 4GQOA 3UORA 1POY1 3T9UA 5AA3A 3Q26A 4R6HA 4DLDA 5I59B 5FHMA 4EF1A 3R26A 1RYXA 5BUUA 3KN7A 1FTLA 3OO6A 3U8QA 3H6UA 1NL5A 5ICTA 3S9NC 3TEPA 1FQFA 2XX7A 3T9VA 1YAEA 1A8EA 1H45A 3TZAA 3QAXA 1VFDA 3PD9A 4ELOA 2M8CA 1ZU0A 1B3EA 1NH7A 2QRYA 1XVXA 1SI0A 3C33A 3CFXA 2DE2A 3VV5A 4TQUQ 5JTYA 1IXCA 2OWTA 3MZ9A 2ONRA 1PB8A 3S2VA 3V5AA 1NNPA 4JWYA 3CG1A 3MP1A 1QW0A 4PP0A 4IGTA 3TTRA 1Y4CA 1MXWA 5I2KB 2FYIA 3KOSA 3KSXA 1M5EA 1UTBB 2OK2A 1H76A 2O6AA 2I58A 1QJMA 1B2HA 4IGRA 1GVCA 2Z23A 2QJEA 2I4CA 3TTMA 2I3WA 5I58A 3EQ1A 1I6QA 2G93A 2GH9A 2HXWA 4RY1A 2HZKA 3QYTA 2HCAA 3E3KA 3U92A 1USYH 3IB2A 1SYIA 4OVJA 4RK9A 1BKAA 3FV1A 4JSOA 5ELVA 4OEUA 4JSDA 2ZYMA 1QUIA 2BJJX 2RF1A 3BFTA 3S9LC 1MH3A 4XKPA 1A8FA 5I2NA 1PC3A 1B9JA 2H5YA 2ZNTA 1B51A 4IY6A 4NE4A 2XXTA 1SW5A 1Z7NE 3QUFA 1XT8A 3CI8A 3ZSFA 1A54A 1H3DA 2O51A 1FTMA 2W7YA 1NH8A 4LVQA 4EDPA 3IB0A 5H8SA 3UP9A 1EZOA 5I2KA 1FW0A 4IO7A 1NNFA 1ELJA 2ESNA 4DXUA 3FUZA 3EPEA 4H0WA 2WKYA 3F11A 3IX1A 1NNTA 3KG2A 4MH5A 4WXJA 1OIBA 2Z8FA 3TMGA 1R9QA 2V25A 2Q89A 3PMWA 4ONYA 2DXRA 2RC7A 3Q25A 1LAHE 4I8CA 3SDFA 4KHZE 2Y7IA 2B65A 1B3FA 1BLFA 1S7YA 1MRPA 4H67A 1I6AA 3EN3A 1N3WA 1MQGA 4OZ9A 4R6KA 3O9PA 5FTIA 1JEUA 3VDFA 2DS9A 4BDRA 5ISUA 4Z7EA 1MPDA 5EYFA 5IKBA 3IOWA 4OTEA 4OYVA 3W9WA 1AIVA 2YJPA 3PMVA 2G29A 3FJ7A 2PT2A 4HCWA 3FVOA 3UIFA 3FGSA 4NF5B 4POWA 5TU0A 3RY3A 4G8MA 2XHDA 1JEVA 1VE4A 2O7UA 2DWJA 2O68A 4O3AA 5L9SA 4GXAA 2DXYA 2ABHA 4GLIA 4YICA 5LOMA 1QKAA 5I56A 2ZYNA 4G4PA 2OJTA 3FATA 4KR5A 1LAFE 2Y7KA 4WKMA 4KCCA 3MVZA 1DTZA 1SW4A 5KCJA 4YKPA 5I57B 1JQFA 1MDQA 1MDP1 1SD3A 1B7UA 2V3UA 3OENA 4GL0A 4TOZA 3O66A 3PUWE 4X1BA 4YB5A 2IEEA 3PPNA 4ZEBA 4ZZEA 3FJMA 2FNCA 4FEDA 5K2XA 4POXA 3FIRA 2FA7A 3U1OA 4BDNA 2QS1A 3O29A 4H6DA 4AB6A 2Z8EA 3LSLA 2XXQA 5KDTB 3TTKA 3C4MA 4NF4A 4LZ8A 5ITPA 1US5A 2QS3A 1LB9A 2YLNA 3KJ7A 1JW1A 1OQGA 4XKNA 4DIGA 1QVSA 3ZKKA 4C1TA 3BFUA 2ZNSA 1WVJA 5DVFA 3VVEA 1US4A 2O1LA 4R2FA 4G2ZA 2QS2A 2RKMA 4KD5A 1B5HA 3ILUB 2F7AA 1DTGA 1MQIA 3K6WA 3KJTA 4UA8A 1LFGA 3RUMA 3R6UA 1LLSA 5DEXA 3FASA 3IO4A 4XXUA 4G68C 1JETA 5B7DA 2D5WA 3MP6A 5AA2D 1TXFA 3RTWB 1FTJA 2RC9A 1P1UA 1SI1A 2H25A 3E13X 3IOVA 1MY3A 1UTHB 3IL1B 4F1UA 1HSLA 5BWJA 1XHYA 1MQHA 5L9MA 5A5XA 3DELB 1OQHA 4NF6B 4GIZA 2B3BA 3FV2A 4U1OA 4RYAA 3HHGA 2Q2AA 3I5OA 4YU0A 4XIGQ 4H5GA 1UQWA 4N13A 4F39A 2XXHA 1IXHA 1LB8A 1VR5A 1TWYA 2H98A 3DLNA 3IJXB 3K00A 1LCFA 4OERA 5AA4A 5AA1A 1B05A 3EHSA 3T9HB 4QFPA 4F3GA 4KYSA 1EZPA 4KYEA 1JVXA 1M5DA 4O3CA 5AE4A 4OESA 2VP1A 1IEJA 1NFTA 2H4IA 3PD8A 2QSXA 1O63A 3SETA 4EXLA 5CBRA 5H8FB 1B0LA 1MY4A 1GTKA 3O6GA 3VE1B 1DPPA 3H6WA 3RTFB 1XS5A 3S9MC 3SERA 3M3LA 2ONKE 3QSLA 2XX8A 1MY1A 1Y1ZA 5DTBA 4F22A 1QULA 3RT8A 1AOVA 5I59A 2F5XA 3PMXA 4FORA 1VSOA 4YMBA 1NMUA 1YCJA 3MVXA 4R9GA 1MQDA 5J1DA 1B46A 3TCHA 2XXUA 3T22A 1F9BA 3A3UA 4R2BA 5L8DA 1ZTYA 3O6HA 5M2VA 1MPBA 4MLVA 4LA9A 2F35A 4LQ2A 2DVCA 2V3QA 3THIA 4EUOA 4ESWA 1A7LA 2I48A 3N5LA 4BDLA 4F29A 3IOUA 3OO7A 4DDDA 4QSEA 4F2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O84 X;  4NWD A;  3VLW A;  1LFI A;  1AL3 A;  2A5T A;  3K1N A;  5KCJ B;  1LCT A;  1FCK A;  2CZL A;  1TFD A;  5FHO A;  4GWO A;  2ANJ A;  3PPR A;  1B3H A;  1HSJ A;  3TKD A;  1EZ9 A;  3KZG A;  3KBR A;  3VLU A;  3ZS6 A;  3KN8 A;  1R9L A;  2OZZ A;  4IO5 A;  2XD2 A;  3H3G A;  2O7I A;  4F2O A;  1A55 A;  4FE8 A;  2UYF A;  4JDF A;  4ZEK A;  1A99 A;  1MS7 A;  3IOR A;  4QF9 A;  4EF2 A;  5AA4 B;  5FTH A;  4XKR A;  4JWX A;  4YKJ A;  3HO7 A;  1B6H A;  4O3B A;  1OMP A;  1PB7 A;  5AA2 A;  3IO6 A;  3K4U A;  5HM4 B;  5ICQ A;  1VFE A;  4P11 A;  2OCU A;  3IB1 A;  2V93 A;  1MH4 A;  3OOA A;  2VGQ A;  2H99 A;  3OO9 A;  3D4G A;  4LP2 B;  1IXG A;  1MXX A;  1IXI A;  3TAJ A;  1TT1 A;  2AL5 A;  2GHB A;  1IIW A;  2H9B A;  4OFO A;  1MXV A;  4IO2 A;  4H8I A;  1BIY A;  1LST A;  2QPQ A;  2I0B A;  1B3G A;  3PUV E;  2O69 A;  3TFL A;  3WAF A;  5DVJ A;  4DCY A;  5EHS A;  1ZMG A;  3TOD A;  2V3T A;  2DVZ A;  3OXN A;  5A5X B;  1SW2 A;  4HTG A;  4KPT A;  4OMB A;  2P2A A;  1N84 A;  3TPA A;  1PDA A;  1N3X A;  4F1Y A;  2Y7W A;  4U2R A;  1AH5 A;  3PU5 A;  2OLB A;  2DE3 A;  4FEB A;  3S9E A;  2A5S A;  3G7W A;  4I62 A;  3GXA A;  1IIT A;  1URD A;  4ZEC A;  2I49 A;  1CE2 A;  3MP8 A;  2UYE A;  4OEN A;  3V8X B;  2Z22 A;  3USD A;  1FTO A;  3T93 B;  1DOT A;  1MG1 A;  1M5B A;  3B6Q A;  3O6I A;  5TP9 B;  3UA8 A;  4C0R A;  1FQE A;  1WOD A;  2UVG A;  4I9D A;  2KLF A;  4JXI A;  2RIN A;  1FQB A;  3O2A A;  3FZV A;  3K1M A;  4NF8 A;  3TYH A;  4DZ1 A;  2GHA A;  3FXU A;  4KFQ A;  2UXA A;  2RCB A;  1RKM A;  3A3C A;  3CFL A;  1B4Z A;  3MUQ A;  4MLQ A;  4R75 A;  3DP6 A;  5TPA A;  3QK6 A;  3P7I A;  2AIX A;  4NMY A;  4TLL B;  3OMB A;  5CMB A;  3SEY A;  4PFW A;  4YMA A;  3I3V A;  5I84 A;  1ANF A;  1N0T A;  3C32 A;  1MY2 A;  3MAM A;  4H65 A;  4NED A;  2Q9T A;  1B7H A;  5K2Y A;  2O1M A;  3KSJ A;  3K2D A;  4X1D A;  3EHU A;  4PFU A;  5DYH A;  3UGW A;  2E1S A;  2D3I A;  1Y3P A;  1SQY A;  4YKK A;  1URS A;  1UIV A;  2DSF A;  4F3B A;  2F34 A;  3RN8 A;  1Z7M E;  5H8H A;  2F7B A;  2F7C A;  2QL3 A;  3N26 A;  4KYD A;  1R6Z A;  3MQ9 A;  5F1Q A;  3TCG A;  4YAH X;  1EH3 A;  3CRB A;  3PPQ A;  2REJ A;  4LAT A;  3G3I A;  4ZEF A;  3UK4 A;  3TCF A;  3Q28 A;  3LBS A;  5H8Q A;  4BLA A;  4NF8 B;  4F19 A;  1JVY A;  1UTB A;  3JZJ A;  3TTL A;  5I57 A;  1MM6 A;  3N6U A;  1TFA A;  3OEL A;  3O97 A;  3C31 A;  4Q30 B;  1SVX B;  3ONM A;  1D9Y A;  3MPK A;  3N94 A;  3VXC A;  1B1H A;  2IA4 A;  4ZEI A;  1GV8 A;  1UTH A;  4FAJ A;  2PVU A;  3B6W A;  3SEU A;  1JW5 A;  3K6U A;  4ECF A;  3FXQ A;  4NF6 A;  4QFN A;  5TPA B;  1SDX A;  3RT6 B;  3VVF A;  4OFL A;  4ESX A;  4U1Z A;  2VD2 A;  3K01 A;  3MZB A;  3V83 A;  4OEV A;  2I3V A;  5CMK A;  1USY E;  4RPN A;  3PUY E;  2X7Q A;  2NUV A;  4IB2 A;  3R7X A;  4C1U A;  1IUD A;  1IZ1 A;  2P1S A;  4YZZ A;  2GRV A;  5I2N B;  2HFB A;  2AYS A;  3H03 A;  2DE4 A;  3LR1 A;  4L17 A;  2DWH A;  4DXC A;  2XXP A;  2AL4 A;  2F6P A;  2ZYK A;  4OFJ A;  2Z8D A;  4GOT A;  4P0G A;  2HQ0 A;  2X26 A;  2DQV A;  1ATG A;  2F8D A;  3S4U A;  1MM7 A;  2ONS A;  3T96 B;  2HZL A;  4KQP A;  1B7Z A;  2Y7R A;  3K1P A;  3OEK A;  3L6H A;  3HCQ A;  4XKQ A;  3RLF E;  1NKX A;  3GBB A;  5H8F A;  2D21 A;  4MFI A;  5H8N B;  1O7T A;  3DM0 A;  4N6P A;  1PBQ A;  4PFT A;  2Y7P A;  3HN0 A;  3SKP A;  3TUS A;  2I6E A;  4FEC A;  4R73 A;  5IAI A;  2XXR A;  4NF4 B;  3C34 A;  1Y3N A;  4ZE9 A;  1B1X A;  3MW0 A;  5AA2 B;  4R6Y A;  5JK4 A;  3ODB A;  4Z0I A;  2ZNU A;  2Q2C A;  4HCY A;  1QUK A;  2CMO A;  3BBR A;  3PV0 E;  3QUJ A;  4HS7 A;  4X9T A;  4Q8R A;  3TTN A;  3G3J A;  4GRK A;  1MXU A;  3D4C A;  1DSN A;  4PFY A;  5F7V A;  2UVJ A;  5H8H B;  5JTY B;  1XOC A;  4DE8 A;  5HPQ A;  4Q5T A;  3IOT A;  4NF5 A;  3W15 C;  4ZZA A;  3ILT B;  5TP9 A;  4ELR A;  2DWA A;  3CIJ A;  4ELP A;  2P0S A;  4GL8 A;  4RNS A;  4OXV A;  2V84 A;  3HST A;  4ND9 A;  1S50 A;  5CM6 A;  1B4H A;  3H6T A;  2RCA A;  2NVU B;  3MZ1 A;  5KZT A;  4LZ7 A;  4AB5 A;  2RC8 A;  4M4G A;  4EQB A;  4JWO A;  3K02 A;  3MJN A;  3RQT A;  4YB7 A;  1Y1M A;  4LUB A;  4JBZ A;  1D4N A;  3G3K A;  4RPO A;  4U21 A;  5EHM A;  4H5F A;  4U23 A;  3U72 A;  4E0W A;  1LBB A;  4QFK A;  1B0H A;  1I6B A;  4FAT A;  2XX9 A;  1B32 A;  2XXI A;  3KFM A;  4GFR A;  4OET A;  3TDJ A;  3PPP A;  4G68 B;  3U93 A;  3Q29 A;  3K0V A;  3LUY A;  1T0K A;  1LAX A;  3G3G A;  2R6G E;  4OHN A;  2GFE A;  2OBG A;  1D3K A;  2UVH A;  4G77 A;  1BP5 A;  3JYR A;  5CMC A;  3VFJ A;  2PMS A;  3WAE A;  4RA1 A;  4TLM B;  5DEX B;  3Q27 A;  1JNF A;  3BKI B;  3E4R A;  1MPC A;  1HSE A;  3A09 A;  5I56 B;  1PEB A;  1LGB C;  1II5 A;  1QKB A;  1SW1 A;  3EHT A;  2Y84 A;  1SBP A;  3QIM A;  4G8H A;  1OVB A;  3W9V A;  1Y20 A;  3B7D A;  4IO6 A;  1J1N A;  1ZIU A;  2PX1 A;  5DT6 A;  3TQL A;  4AQ4 A;  3FD3 A;  3IJO B;  4QSC A;  1MQJ A;  4RXL A;  1MXY A;  5CI5 A;  1URG A;  4WED A;  3SEW A;  4P0I A;  3IR1 A;  3TEL A;  3EF7 A;  3HHF A;  3LSF B;  3CG3 A;  2NWJ A;  4G68 A;  2DP8 A;  3HPI A;  3FVN A;  1S9T A;  3B6T A;  1KWH A;  4M1V A;  1O64 A;  5FHN A;  3TQW A;  5CBS A;  4MF3 A;  1SYH A;  2UVI A;  1OLC A;  4EQ9 A;  4YKI A;  3AXF A;  1N76 A;  3CSG A;  2DWI A;  1FQA A;  3KGC A;  4IY5 A;  3OD7 A;  4F3P A;  2XD3 A;  1B5I A;  5DVI A;  3HV1 A;  4LQ5 A;  1D9V A;  3FXR A;  4GVO A;  2XXW A;  5H8Q B;  2OWS A;  3DP4 A;  3MC2 A;  4GXS B;  1JW4 A;  4G8N A;  1Q1K A;  4U4S A;  2X7P A;  3OSR A;  1FQD A;  3CSB A;  1OVT A;  1I69 A;  1RYO A;  3M8U A;  3MPL A;  3PPO A;  3V89 B;  3VVD A;  3LSW A;  2QMX A;  4R9F A;  3MBP A;  3K6V A;  4LZ5 A;  4RJZ A;  4U22 A;  1H43 A;  3ZKL A;  4R72 A;  5I58 B;  2VOZ A;  4UAC A;  3MWB A;  1YTV A;  2HEU A;  1Y3Q A;  1M5F A;  1MXZ A;  4BDQ A;  1R1N A;  4U4X A;  2HAV A;  3T66 A;  3KOT A;  4DXB A;  4OQO A;  2ALU A;  1NNK A;  3E9X A;  3OSQ A;  3VXB A;  1P99 A;  4GD5 A;  4PE5 B;  4PET A;  2LAO A;  4IO4 A;  1PBP A;  1GR2 A;  2PYY A;  2R71 A;  3O28 A;  3PGF A;  3JV9 A;  4R74 A;  1FTK A;  4YB6 A;  1XC1 A;  3OO8 A;  1POT A;  1P1W A;  4EQ7 A;  1ZBM A;  4QFO A;  1ZJL A;  2NXO A;  3CR9 A;  3PUX E;  1UIU A;  3RNN A;  2ZYO A;  3UN6 A;  1GGG A;  5L9O A;  1H44 A;  4ISU A;  3ECR A;  3GBA A;  3LSX A;  3C9H A;  4KCD A;  1WDN A;  1OLA A;  1B52 A;  1BTJ A;  5H8N A;  1P1Q A;  2QS4 A;  1PB9 A;  3LC8 A;  3C35 A;  4E0X A;  2I0C A;  2A5T B;  4K3F A;  2XXX A;  4F18 A;  3H7M A;  4PQJ A;  5HBC A;  5KDT A;  2F78 A;  5ITO A;  3K6X A;  1IQ7 A;  3FVK A;  3C36 A;  4KI0 E;  4LON B;  3MVW A;  4THI A;  4ZED A;  1B40 A;  1M5C A;  4GF8 A;  1DPE A;  4NWC A;  3RPW A;  2VD3 A;  4Q0C A;  4OWD A;  4H1X A;  4F1V A;  1DMB A;  1FQC A;  2DOJ A;  4DCX A;  2YPN A;  1B5J A;  3QXM A;  4JB7 A;  1LBC A;  2Q88 A;  4N07 A;  4FJP A;  4XTC Q;  5CRY A;  3OEM A;  4NTL A;  2F36 A;  2HAU A;  3H4Z A;  3SEV A;  4X48 A;  2PBW A;  1AMF A;  5JEI A;  4F3S A;  2F97 A;  3U94 A;  4ELQ A;  3MVY A;  4MBP A;  1ZKB A;  1N04 A;  1Q35 A;  1EU8 A;  1B58 A;  4IO3 A;  3RGY A;  1YPN A;  3IK6 B;  1L5T A;  3SEX A;  4QSD A;  4ZDM A;  3KEI A;  1B3L A;  1Y4T A;  3DP8 A;  3GZG A;  4FIM A;  1N7X A;  2Q8J A;  3SES A;  4HW8 A;  4QFL A;  3VLV A;  4BDM A;  4WEP A;  1N7W A;  3PUZ E;  4RK2 A;  2ZXT A;  3G3F A;  1XVY A;  4BDO A;  1LAG E;  4I1D A;  3GLB A;  1P1O A;  1MY0 A;  1Y9U A;  2E0S A;  2QMW A;  3CFZ A;  3T9X B;  2NOO A;  4H8J A;  2REG A;  2DYX A;  5CMM A;  2PT1 A;  1ZLQ A;  3N6T A;  4EXK A;  3FVG A;  1QUJ A;  2VHA A;  3CVG A;  2XXY A;  3H06 B;  3H6V A;  3I6V A;  3IAZ A;  3M3K A;  4ZE8 A;  2F6G A;  2XXV A;  2THI A;  1CB6 A;  2ZMB A;  3M3F A;  5B70 A;  2R9J A;  5CC2 A;  1P1N A;  4QRZ A;  4ZS9 A;  3G3H A;  1A40 A;  1LFH A;  3KN3 A;  4F31 B;  2B3F A;  2I4B A;  3FJG A;  3L6G A;  4QHQ A;  4GQO A;  3UOR A;  1POY 1;  3T9U A;  5AA3 A;  3Q26 A;  4R6H A;  4DLD A;  5I59 B;  5FHM A;  4EF1 A;  3R26 A;  1RYX A;  5BUU A;  3KN7 A;  1FTL A;  3OO6 A;  3U8Q A;  3H6U A;  1NL5 A;  5ICT A;  3S9N C;  3TEP A;  1FQF A;  2XX7 A;  3T9V A;  1YAE A;  1A8E A;  1H45 A;  3TZA A;  3QAX A;  1VFD A;  3PD9 A;  4ELO A;  2M8C A;  1ZU0 A;  1B3E A;  1NH7 A;  2QRY A;  1XVX A;  1SI0 A;  3C33 A;  3CFX A;  2DE2 A;  3VV5 A;  4TQU Q;  5JTY A;  1IXC A;  2OWT A;  3MZ9 A;  2ONR A;  1PB8 A;  3S2V A;  3V5A A;  1NNP A;  4JWY A;  3CG1 A;  3MP1 A;  1QW0 A;  4PP0 A;  4IGT A;  3TTR A;  1Y4C A;  1MXW A;  5I2K B;  2FYI A;  3KOS A;  3KSX A;  1M5E A;  1UTB B;  2OK2 A;  1H76 A;  2O6A A;  2I58 A;  1QJM A;  1B2H A;  4IGR A;  1GVC A;  2Z23 A;  2QJE A;  2I4C A;  3TTM A;  2I3W A;  5I58 A;  3EQ1 A;  1I6Q A;  2G93 A;  2GH9 A;  2HXW A;  4RY1 A;  2HZK A;  3QYT A;  2HCA A;  3E3K A;  3U92 A;  1USY H;  3IB2 A;  1SYI A;  4OVJ A;  4RK9 A;  1BKA A;  3FV1 A;  4JSO A;  5ELV A;  4OEU A;  4JSD A;  2ZYM A;  1QUI A;  2BJJ X;  2RF1 A;  3BFT A;  3S9L C;  1MH3 A;  4XKP A;  1A8F A;  5I2N A;  1PC3 A;  1B9J A;  2H5Y A;  2ZNT A;  1B51 A;  4IY6 A;  4NE4 A;  2XXT A;  1SW5 A;  1Z7N E;  3QUF A;  1XT8 A;  3CI8 A;  3ZSF A;  1A54 A;  1H3D A;  2O51 A;  1FTM A;  2W7Y A;  1NH8 A;  4LVQ A;  4EDP A;  3IB0 A;  5H8S A;  3UP9 A;  1EZO A;  5I2K A;  1FW0 A;  4IO7 A;  1NNF A;  1ELJ A;  2ESN A;  4DXU A;  3FUZ A;  3EPE A;  4H0W A;  2WKY A;  3F11 A;  3IX1 A;  1NNT A;  3KG2 A;  4MH5 A;  4WXJ A;  1OIB A;  2Z8F A;  3TMG A;  1R9Q A;  2V25 A;  2Q89 A;  3PMW A;  4ONY A;  2DXR A;  2RC7 A;  3Q25 A;  1LAH E;  4I8C A;  3SDF A;  4KHZ E;  2Y7I A;  2B65 A;  1B3F A;  1BLF A;  1S7Y A;  1MRP A;  4H67 A;  1I6A A;  3EN3 A;  1N3W A;  1MQG A;  4OZ9 A;  4R6K A;  3O9P A;  5FTI A;  1JEU A;  3VDF A;  2DS9 A;  4BDR A;  5ISU A;  4Z7E A;  1MPD A;  5EYF A;  5IKB A;  3IOW A;  4OTE A;  4OYV A;  3W9W A;  1AIV A;  2YJP A;  3PMV A;  2G29 A;  3FJ7 A;  2PT2 A;  4HCW A;  3FVO A;  3UIF A;  3FGS A;  4NF5 B;  4POW A;  5TU0 A;  3RY3 A;  4G8M A;  2XHD A;  1JEV A;  1VE4 A;  2O7U A;  2DWJ A;  2O68 A;  4O3A A;  5L9S A;  4GXA A;  2DXY A;  2ABH A;  4GLI A;  4YIC A;  5LOM A;  1QKA A;  5I56 A;  2ZYN A;  4G4P A;  2OJT A;  3FAT A;  4KR5 A;  1LAF E;  2Y7K A;  4WKM A;  4KCC A;  3MVZ A;  1DTZ A;  1SW4 A;  5KCJ A;  4YKP A;  5I57 B;  1JQF A;  1MDQ A;  1MDP 1;  1SD3 A;  1B7U A;  2V3U A;  3OEN A;  4GL0 A;  4TOZ A;  3O66 A;  3PUW E;  4X1B A;  4YB5 A;  2IEE A;  3PPN A;  4ZEB A;  4ZZE A;  3FJM A;  2FNC A;  4FED A;  5K2X A;  4POX A;  3FIR A;  2FA7 A;  3U1O A;  4BDN A;  2QS1 A;  3O29 A;  4H6D A;  4AB6 A;  2Z8E A;  3LSL A;  2XXQ A;  5KDT B;  3TTK A;  3C4M A;  4NF4 A;  4LZ8 A;  5ITP A;  1US5 A;  2QS3 A;  1LB9 A;  2YLN A;  3KJ7 A;  1JW1 A;  1OQG A;  4XKN A;  4DIG A;  1QVS A;  3ZKK A;  4C1T A;  3BFU A;  2ZNS A;  1WVJ A;  5DVF A;  3VVE A;  1US4 A;  2O1L A;  4R2F A;  4G2Z A;  2QS2 A;  2RKM A;  4KD5 A;  1B5H A;  3ILU B;  2F7A A;  1DTG A;  1MQI A;  3K6W A;  3KJT A;  4UA8 A;  1LFG A;  3RUM A;  3R6U A;  1LLS A;  5DEX A;  3FAS A;  3IO4 A;  4XXU A;  4G68 C;  1JET A;  5B7D A;  2D5W A;  3MP6 A;  5AA2 D;  1TXF A;  3RTW B;  1FTJ A;  2RC9 A;  1P1U A;  1SI1 A;  2H25 A;  3E13 X;  3IOV A;  1MY3 A;  1UTH B;  3IL1 B;  4F1U A;  1HSL A;  5BWJ A;  1XHY A;  1MQH A;  5L9M A;  5A5X A;  3DEL B;  1OQH A;  4NF6 B;  4GIZ A;  2B3B A;  3FV2 A;  4U1O A;  4RYA A;  3HHG A;  2Q2A A;  3I5O A;  4YU0 A;  4XIG Q;  4H5G A;  1UQW A;  4N13 A;  4F39 A;  2XXH A;  1IXH A;  1LB8 A;  1VR5 A;  1TWY A;  2H98 A;  3DLN A;  3IJX B;  3K00 A;  1LCF A;  4OER A;  5AA4 A;  5AA1 A;  1B05 A;  3EHS A;  3T9H B;  4QFP A;  4F3G A;  4KYS A;  1EZP A;  4KYE A;  1JVX A;  1M5D A;  4O3C A;  5AE4 A;  4OES A;  2VP1 A;  1IEJ A;  1NFT A;  2H4I A;  3PD8 A;  2QSX A;  1O63 A;  3SET A;  4EXL A;  5CBR A;  5H8F B;  1B0L A;  1MY4 A;  1GTK A;  3O6G A;  3VE1 B;  1DPP A;  3H6W A;  3RTF B;  1XS5 A;  3S9M C;  3SER A;  3M3L A;  2ONK E;  3QSL A;  2XX8 A;  1MY1 A;  1Y1Z A;  5DTB A;  4F22 A;  1QUL A;  3RT8 A;  1AOV A;  5I59 A;  2F5X A;  3PMX A;  4FOR A;  1VSO A;  4YMB A;  1NMU A;  1YCJ A;  3MVX A;  4R9G A;  1MQD A;  5J1D A;  1B46 A;  3TCH A;  2XXU A;  3T22 A;  1F9B A;  3A3U A;  4R2B A;  5L8D A;  1ZTY A;  3O6H A;  5M2V A;  1MPB A;  4MLV A;  4LA9 A;  2F35 A;  4LQ2 A;  2DVC A;  2V3Q A;  3THI A;  4EUO A;  4ESW A;  1A7L A;  2I48 A;  3N5L A;  4BDL A;  4F29 A;  3IOU A;  3OO7 A;  4DDD A;  4QSE A;  4F2Q A; 
#chains in the Genus database with same CATH topology
 2O84 X;  1TFD A;  5FHO A;  4QBA A;  3KBR A;  3VLU A;  1R9L A;  1FPF A;  3MYU A;  1A55 A;  2VT5 A;  4XKR A;  4JWX A;  4YKJ A;  1B6H A;  5ICQ A;  4P11 A;  2OCU A;  3OO9 A;  2GHB A;  2AL5 A;  4O7I A;  1BIY A;  3PUV E;  4PF8 A;  3WAF A;  1DCU A;  1FBF A;  4NQ8 A;  3OXN A;  5A5X B;  1N84 A;  1N3X A;  2A5S A;  3G7W A;  5EYG A;  4OEN A;  3O6I A;  3UA8 A;  2KLF A;  2RIN A;  1FQB A;  3O2A A;  3K1M A;  4DZ1 A;  2UXA A;  3A3C A;  1RKM A;  3CFL A;  1B4Z A;  3DP6 A;  3QK6 A;  4TLL B;  4NMY A;  3I3V A;  1ANF A;  3C32 A;  4H65 A;  1LBV A;  2O1M A;  5DYH A;  1QGX A;  2E1S A;  4YKK A;  4F3B A;  2F34 A;  2QL3 A;  3N26 A;  3RYD A;  2WYK A;  4G61 A;  3G3I A;  4ZEF A;  3UK4 A;  3TCF A;  5EQ9 A;  1UTB A;  3T0J A;  3N6U A;  3OEL A;  4FBP A;  2IA4 A;  4FAJ A;  1UTH A;  4PTK A;  1FSA A;  3K6U A;  3FXQ A;  3RT6 B;  4OFL A;  4OEV A;  2I3V A;  1USY E;  3PUY E;  2X7Q A;  3R7X A;  4YZZ A;  1IZ1 A;  3H03 A;  2AYS A;  2XXP A;  3S4U A;  2DQV A;  2HZL A;  2Y5K A;  1B7Z A;  4XKQ A;  3L6H A;  1NKX A;  2D21 A;  5H8N B;  1O7T A;  1PBQ A;  2Y7P A;  2XXR A;  4NF4 B;  1NV1 A;  5A5L A;  4PFB A;  5AA2 B;  4HCY A;  1QUK A;  4HS7 A;  2CEX A;  4GRK A;  3D4C A;  1DSN A;  4MEV A;  1XOC A;  5HPQ A;  4ZZA A;  5TP9 A;  4GBW A;  4OXV A;  3HST A;  1S50 A;  4YB7 A;  4H5F A;  4E0W A;  1I6B A;  2QVV A;  4OET A;  3LUY A;  2R6G E;  4OHN A;  1CNQ A;  2OBG A;  4G77 A;  4P9K A;  3VFJ A;  3WAE A;  2Q8M A;  3Q27 A;  5I56 B;  1LGB C;  1QKB A;  3EHT A;  1Y20 A;  3IJO B;  5CI5 A;  1MQJ A;  1MXY A;  3MST A;  3EF7 A;  3LSF B;  3CG3 A;  2NWJ A;  2DP8 A;  3FVN A;  5FHN A;  4EQ9 A;  4YKI A;  2XXW A;  5H8Q B;  2OWS A;  3MC2 A;  1JW4 A;  1OVT A;  3VVD A;  4U22 A;  3MBP A;  3MWB A;  2FVZ A;  4U4X A;  2ALU A;  1P99 A;  4PE5 B;  4IO4 A;  1PBP A;  1ZBM A;  4QFO A;  2WX9 A;  2NXO A;  2ZYO A;  2WBD A;  4GX6 A;  5IM2 A;  1B52 A;  3LC8 A;  2I0C A;  5I7I A;  2XXX A;  5F24 A;  2P3V A;  5ITO A;  1IQ7 A;  3FVK A;  3C36 A;  4KI0 E;  1M5C A;  1DPE A;  4NWC A;  1DMB A;  2F3D A;  4PDH A;  2Q88 A;  4XTC Q;  3OEM A;  2F36 A;  2PBW A;  5JEI A;  3MVY A;  1N04 A;  3RGY A;  1YPN A;  1L5T A;  3DP8 A;  4QFL A;  4WEP A;  3PUZ E;  1P1O A;  3CFZ A;  1Y9U A;  2QMW A;  2KQZ A;  5CMM A;  1CB6 A;  3M3F A;  5B70 A;  3BIH A;  1A40 A;  4F31 B;  4PC9 A;  3UOR A;  5ICT A;  4N17 A;  1H45 A;  4HE1 A;  4X1B A;  3ZKL A;  3CFX A;  4O8M A;  5JTY A;  3S2V A;  1NNP A;  3KBZ A;  3CG1 A;  2OK2 A;  2I58 A;  3TTM A;  5I58 A;  1YYZ A;  1I6Q A;  3E78 A;  2G93 A;  2GH9 A;  1IMB A;  3IB2 A;  4AS4 A;  1SYI A;  5ELV A;  4JSD A;  4I3Y A;  1A8F A;  1B9J A;  2H5Y A;  1B51 A;  2F3B A;  3HFU A;  3IB0 A;  4GX4 A;  2ESN A;  3FUZ A;  3EPE A;  4H0W A;  3IX1 A;  3F11 A;  1FPJ A;  1FRP A;  2Q74 A;  1NV2 A;  2V25 A;  2Q89 A;  1LAH E;  4I8C A;  3SDF A;  4OVJ A;  4POX A;  3EN3 A;  4OAN A;  2QVU A;  4BDR A;  4OTE A;  4OYV A;  3W9W A;  4HCW A;  4I40 A;  4NF5 B;  4G8M A;  2JJK A;  5L9S A;  2DXY A;  2ABH A;  4GLI A;  5LOM A;  1XI6 A;  4KR5 A;  2Y7K A;  4N8Y A;  2R8T A;  1MDP 1;  3O66 A;  2IEE A;  3U1O A;  2FNC A;  4H6D A;  3LSL A;  2L5V A;  3TTK A;  5ITP A;  2YLN A;  2ZNS A;  1WVJ A;  4R2F A;  4UA8 A;  1DTG A;  3KJT A;  3IO4 A;  4XXU A;  1SI1 A;  1UTH B;  3IL1 B;  4F1U A;  1XHY A;  1OQH A;  4PBH A;  2B3B A;  4U1O A;  4RYA A;  3HHG A;  2Q2A A;  3I5O A;  4XIG Q;  1UQW A;  3IJX B;  5IZ1 A;  4KYE A;  1JVX A;  2XWO A;  4O3C A;  1FBP A;  1O63 A;  3SET A;  5H8F B;  1B0L A;  1MY4 A;  3VE1 B;  1NI9 A;  1DPP A;  3H6W A;  3RTF B;  3SER A;  1G0I A;  3BIG A;  1MY1 A;  2F5X A;  3RPL B;  4FOR A;  3MVX A;  4MHF A;  2XXU A;  1F9B A;  3A3U A;  5L8D A;  2DVC A;  2I48 A;  3N5L A;  4F29 A;  2CEY A;  1FBG A;  1LFI A;  2A5T A;  1LCT A;  1B3H A;  3TKD A;  1EZ9 A;  5EQ8 A;  3ZS6 A;  1FPG A;  1FPB A;  4FE8 A;  4ZEK A;  3IOR A;  5FTH A;  4O3B A;  3K4U A;  3OOA A;  4XF5 A;  1NV0 A;  1IXG A;  3TAJ A;  2HPG A;  1MXV A;  1B3G A;  2O69 A;  1VDW A;  2P2A A;  1PDA A;  1LEV A;  3PU5 A;  3S9E A;  2FHY A;  4I62 A;  1IIT A;  1URD A;  1CE2 A;  4DI3 D;  2UYE A;  3B6Q A;  5TP9 B;  4I9D A;  4NF8 A;  3FXU A;  4KFQ A;  4R75 A;  3P7I A;  4PFW A;  1MY2 A;  3MAM A;  4X1D A;  3EHU A;  3UGW A;  2D3I A;  1Y3P A;  1SQY A;  2F7B A;  2F7C A;  4KYD A;  3MQ9 A;  5F1Q A;  1EH3 A;  3CRB A;  2OX3 A;  4GWZ A;  2REJ A;  4LAT A;  3LBS A;  4BLA A;  4NF8 B;  1MM6 A;  1D9Y A;  3MPK A;  4QXD A;  2PVU A;  3SEU A;  1JW5 A;  4ECF A;  4QFN A;  1K9Y A;  4ESX A;  4MJO A;  5CMK A;  2P1S A;  2DE4 A;  4DXC A;  2Z8D A;  2FIX A;  2HQ0 A;  2X26 A;  3K1P A;  3OEK A;  3RLF E;  3HCQ A;  4OVP A;  5H8F A;  3GBB A;  5J16 A;  5ET6 A;  4MFI A;  3SKP A;  1Y3N A;  4ZE9 A;  4R6Y A;  3ODB A;  2ZNU A;  5FBP A;  3BBR A;  3FBP A;  1MXU A;  4PFY A;  5F7V A;  5H8H B;  1IMC A;  3ILT B;  5CM6 A;  1NUW A;  2RCA A;  5KZT A;  4LZ7 A;  2RC8 A;  4M4G A;  1FBE A;  4EQB A;  3G3K A;  4U23 A;  3U72 A;  4P47 A;  2CZH A;  1B32 A;  4N15 A;  4KXP A;  1IME A;  5ET7 A;  3U93 A;  3Q29 A;  1LAX A;  2Y5L A;  2HXR A;  2GFE A;  5CMC A;  1YZ0 A;  5T3J A;  2PMS A;  1SBP A;  3QIM A;  1OVB A;  3B7D A;  4IO6 A;  1ZIU A;  2PX1 A;  5DT6 A;  4RXL A;  3HHF A;  1FPE A;  4G68 A;  1S9T A;  3TQW A;  1O64 A;  1SYH A;  3CSG A;  1N76 A;  3KGC A;  1LBY A;  1FQA A;  4UAB A;  3OD7 A;  2XD3 A;  1B5I A;  5DVI A;  3HV1 A;  4GWU A;  1D9V A;  3DP4 A;  4GXS B;  4U4S A;  4G8N A;  3CSB A;  1I69 A;  3M8U A;  4NF0 A;  4RJZ A;  4R9F A;  4LZ5 A;  1H43 A;  4UAC A;  1YTV A;  1Y3Q A;  1MXZ A;  4BDQ A;  3T66 A;  4DXB A;  3E9X A;  3VXB A;  5EQA A;  4PET A;  1NV5 A;  3O28 A;  2PYY A;  3PGF A;  4R74 A;  5EQ7 A;  1P1W A;  4OVQ A;  1KA1 A;  3PUX E;  1UIU A;  3RNN A;  3UN6 A;  4NAP A;  3ECR A;  3LSX A;  1WDN A;  1OLA A;  2QS4 A;  1RDX A;  4E0X A;  4PQJ A;  2F78 A;  3K6X A;  4LON B;  3MVW A;  2VD3 A;  4Q0C A;  3QXM A;  4FJP A;  5CRY A;  2HAU A;  3H4Z A;  5DW8 A;  1NUX A;  3U94 A;  4ELQ A;  4MBP A;  1Q35 A;  1B58 A;  3IK6 B;  1B3L A;  3GZG A;  3SES A;  1N7X A;  4PFR A;  2ZXT A;  1XVY A;  4BDO A;  1LAG E;  1MY0 A;  2E0S A;  2DYX A;  1ZLQ A;  3H6V A;  3I6V A;  3IAZ A;  5ET8 A;  3M3K A;  5CC2 A;  4QRZ A;  3G3H A;  4X8R A;  2B3F A;  3Q26 A;  4R6H A;  4EF1 A;  3R26 A;  1RYX A;  4PGN A;  3OO6 A;  1FTL A;  5BUU A;  1NL5 A;  1YAE A;  3PD9 A;  4ELO A;  1SI0 A;  4TQU Q;  4HXV A;  5I2K B;  1MXW A;  4MMP A;  3KSX A;  1UTB B;  1H76 A;  4IGR A;  1B2H A;  2Z23 A;  2QJE A;  2I4C A;  4RY1 A;  2HZK A;  3QYT A;  2HCA A;  2WBB A;  4RK9 A;  4OEU A;  2BJJ X;  2RF1 A;  3S9L C;  4XKP A;  5I2N A;  1SW5 A;  1INP A;  3CI8 A;  4PBQ A;  4X04 A;  1NH8 A;  5I2K A;  1FW0 A;  1NNF A;  1ELJ A;  3NOH A;  2PCR A;  3KG2 A;  4WXJ A;  4MH5 A;  1OIB A;  2DDK A;  2Z8F A;  1R9Q A;  3TMG A;  4I3E A;  1NUY A;  2DXR A;  2RC7 A;  4LVQ A;  2B65 A;  1BLF A;  2XWV A;  4H67 A;  4OZ9 A;  1DBZ A;  1MQG A;  3O9P A;  4Z7E A;  1MPD A;  5EYF A;  5I5P A;  1AIV A;  2YJP A;  1KA0 A;  3FJ7 A;  2PT2 A;  3FVO A;  3FGS A;  4POW A;  2XHD A;  1VE4 A;  2O7U A;  2O68 A;  4YIC A;  4MNI A;  1FPL A;  3MVZ A;  4YKP A;  5I57 B;  1JQF A;  4NGU A;  1MDQ A;  2MKZ A;  2V3U A;  3OEN A;  5IZ3 B;  3PPN A;  4ZZE A;  2QS1 A;  3O29 A;  2Z8E A;  3C4M A;  1US5 A;  2QS3 A;  3KJ7 A;  4DIG A;  4C1T A;  1US4 A;  1B5H A;  3ILU B;  2F7A A;  3K6W A;  3FAS A;  3MP6 A;  3CHG A;  3RTW B;  3E13 X;  4AS5 A;  3IOV A;  1MY3 A;  1HSL A;  3DEL B;  4NF6 B;  4GIZ A;  4N6D A;  3FV2 A;  4YU0 A;  4P1E A;  3DLN A;  1IXH A;  1LB8 A;  3K00 A;  3T93 B;  1B05 A;  4F3G A;  1EZP A;  2VP1 A;  2H4I A;  4EXL A;  3O6G A;  1FJ9 A;  4OVR A;  1AOV A;  3PMX A;  4GWX A;  5J1D A;  1B46 A;  4P3L A;  5M2V A;  1ZTY A;  1MPB A;  4LA9 A;  2V3Q A;  4EUO A;  4DDD A;  4QSE A;  2WEF A;  4NWD A;  3VLW A;  1AL3 A;  3K1N A;  1FCK A;  2CZL A;  1IMF A;  1LBW A;  4GWO A;  3PPR A;  1HSJ A;  3KZG A;  3KN8 A;  2OZZ A;  4IO5 A;  2O7I A;  2UYF A;  4JDF A;  1A99 A;  1MS7 A;  4GX3 A;  4EF2 A;  5AA4 B;  3HO7 A;  5AA2 A;  3IO6 A;  5HM4 B;  1VFE A;  3IB1 A;  2VGQ A;  2H99 A;  3D4G A;  1MXX A;  1IXI A;  1TT1 A;  2H9B A;  4OFO A;  4IO2 A;  3EKI A;  2PFZ A;  2I0B A;  5DVJ A;  3TOD A;  2DVZ A;  3TPA A;  4PAI A;  4F1Y A;  2Y7W A;  4U2R A;  2OLB A;  4FEB A;  1G0H A;  3GXA A;  4ZEC A;  2I49 A;  3MP8 A;  3V8X B;  3USD A;  1FTO A;  1MG1 A;  1FJ6 A;  4C0R A;  1FQE A;  2UVG A;  4JXI A;  1NV4 A;  2GHA A;  3KC0 A;  4MLQ A;  2AIX A;  5CMB A;  4YMA A;  2ZZX A;  5I84 A;  1N0T A;  5IZ3 A;  4NED A;  2Q9T A;  1B7H A;  3K2D A;  4PFU A;  1UIV A;  1DK4 A;  3RN8 A;  1Z7M E;  5H8H A;  3TCG A;  4YAH X;  1NV3 A;  1RDZ A;  3Q28 A;  3IFA A;  5H8Q A;  4Q30 B;  3N94 A;  3VXC A;  1B1H A;  4ZEI A;  3B6W A;  2CZK A;  2XWI A;  4NF6 A;  5TPA B;  1SDX A;  2VD2 A;  3K01 A;  4C1U A;  2NUV A;  1IUD A;  4L17 A;  2AL4 A;  4OFJ A;  4P0G A;  4GOT A;  5I56 A;  1EYJ A;  1ATG A;  2F8D A;  1MM7 A;  3T96 B;  2Y7R A;  3TUS A;  3DM0 A;  3U65 A;  3HN0 A;  4R73 A;  5IAI A;  4NX1 A;  5JK4 A;  4Z0I A;  3QUJ A;  2WYP A;  4Q8R A;  3TTN A;  3G3J A;  2UVJ A;  5JTY B;  1FPD A;  3QMF A;  4NF5 A;  4ELR A;  4GL8 A;  4RNS A;  3H6T A;  4AB5 A;  4JWO A;  3MJN A;  3RQT A;  1Y1M A;  4JBZ A;  4RPO A;  4U21 A;  5EHM A;  4PAK A;  4PE3 A;  3D1R A;  1B0H A;  2XXI A;  3KFM A;  3TDJ A;  3PPP A;  4G68 B;  3G3G A;  4NHB A;  3JYR A;  5DEX B;  1JNF A;  5ET5 A;  3A09 A;  1PEB A;  1FPK A;  3W9V A;  3FD3 A;  4P8B A;  4QSC A;  3SEW A;  1URG A;  5I3S A;  4P0I A;  4P1L A;  3T1B A;  4MX6 A;  5CBS A;  1KWH A;  4IY5 A;  2GQ1 A;  4LQ5 A;  1AWB A;  1Q1K A;  2X7P A;  1FQD A;  1RYO A;  3MPL A;  3PPO A;  3V89 B;  3K6V A;  5EYH A;  5I58 B;  2HAV A;  1NNK A;  4GD5 A;  2R71 A;  3JV9 A;  4EQ7 A;  1XC1 A;  1ZJL A;  3CR9 A;  1H44 A;  4NG7 A;  4ISU A;  3GBA A;  4KCD A;  4O94 A;  3A29 A;  1LBZ A;  1NUZ A;  5H8N A;  4K3F A;  4F18 A;  4XEQ A;  4P56 A;  5HBC A;  4ZED A;  4H1X A;  2DOJ A;  2YPN A;  1B5J A;  4JB7 A;  3SEV A;  4X48 A;  1AMF A;  1ZKB A;  3SEX A;  3KEI A;  4FIM A;  2Q8J A;  1D9Q A;  4HW8 A;  3VLV A;  4BDM A;  3KC1 A;  4RK2 A;  3G3F A;  2NOO A;  4H8J A;  1YXI A;  3N6T A;  4EXK A;  3CVG A;  3H06 B;  2F6G A;  2XXV A;  1P1N A;  4ZS9 A;  1LFH A;  3FJG A;  2I4B A;  3L6G A;  4N91 A;  4GQO A;  4QHQ A;  4XFE A;  1POY 1;  5I59 B;  4MCO A;  4LN5 A;  3KN7 A;  3S9N C;  3U8Q A;  1Q9D A;  2KR0 A;  3T9V A;  1A8E A;  1VFD A;  3C33 A;  1ZU0 A;  3VV5 A;  1XVX A;  2OWT A;  4N4U A;  3V5A A;  5LTC A;  4JWY A;  1QW0 A;  4IR8 A;  1Y4C A;  2FYI A;  4JVD A;  2O6A A;  1GVC A;  2HXW A;  2XXK A;  2ZYM A;  3BFT A;  3V83 A;  4IY6 A;  2XXT A;  1Z7N E;  3QUF A;  1XT8 A;  1A54 A;  2O51 A;  4EDP A;  2W7Y A;  2XWK A;  5H8S A;  1EZO A;  2WKY A;  4HE0 A;  1RDY A;  3Q25 A;  4KHZ E;  2Y7I A;  4R6K A;  1JEU A;  2HHM A;  5ISU A;  1FBH A;  3IOW A;  3PMV A;  2G29 A;  3RY3 A;  1JEV A;  2DWJ A;  4MIJ A;  4PAF A;  1QKA A;  2ZYN A;  2OJT A;  3FAT A;  1LAF E;  4TOZ A;  3PUW E;  4YB5 A;  3FJM A;  3FIR A;  2FA7 A;  1KZ8 A;  3RPL A;  2XXQ A;  1LB9 A;  1JW1 A;  1OQG A;  4XKN A;  1QVS A;  3ZKK A;  3VVE A;  5DVF A;  2O1L A;  4G2Z A;  2QS2 A;  2RKM A;  1MQI A;  1LFG A;  3R6U A;  4PFI A;  4MAG A;  1LLS A;  1JET A;  2D5W A;  1TXF A;  2VPN A;  2RC9 A;  1P1U A;  5BWJ A;  3LUZ A;  4GWY A;  4N13 A;  1VR5 A;  4OER A;  1TWY A;  1LCF A;  3T9H B;  3GYY A;  1IEJ A;  1NFT A;  1FPI A;  3S9M C;  1FBD A;  2XX8 A;  4F22 A;  3RT8 A;  5I59 A;  1VSO A;  1NMU A;  3ROJ A;  2PFY A;  4R9G A;  4MNP A;  3SZP A;  3T22 A;  4ESW A;  3OO7 A;  5KCJ B;  2ANJ A;  4OA4 A;  2XD2 A;  1K9Z A;  3H3G A;  4N6K A;  4QF9 A;  2FIE A;  3IFC A;  1OMP A;  1PB7 A;  2V93 A;  1MH4 A;  4LP2 B;  1IIW A;  4H8I A;  1LST A;  2QPQ A;  3TFL A;  4DCY A;  5EHS A;  1ZMG A;  2V3T A;  1SW2 A;  4HTG A;  4KPT A;  4OMB A;  4GBV A;  1AH5 A;  2DE3 A;  4PDD A;  2B4L A;  2Z22 A;  1DOT A;  1M5B A;  1WOD A;  3FZV A;  2RCB A;  3TYH A;  3MUQ A;  3SEY A;  3OMB A;  5K2Y A;  3KSJ A;  1URS A;  2DSF A;  3FXB A;  1R6Z A;  3PPQ A;  2VPO A;  4F19 A;  1JVY A;  3JZJ A;  3TTL A;  5I57 A;  1TFA A;  4JVC A;  3O97 A;  3C31 A;  1SVX B;  3ONM A;  1GV8 A;  1NV7 A;  1FTA A;  3B50 A;  3E79 A;  3VVF A;  4U1Z A;  3MZB A;  4RPN A;  4IB2 A;  5I2N B;  2GRV A;  4DI4 B;  2HFB A;  3LR1 A;  2DWH A;  5IZZ A;  2ZYK A;  2F6P A;  2ONS A;  4JVI A;  4KQP A;  2B4M A;  4N8G A;  4N6P A;  4PFT A;  2I6E A;  4FEC A;  3C34 A;  1B1X A;  3MW0 A;  3B8B A;  2Q2C A;  3PV0 E;  2CMO A;  4X9T A;  4DE8 A;  4Q5T A;  3IOT A;  3W15 C;  4H46 A;  2DWA A;  3CIJ A;  4ELP A;  2P0S A;  2V84 A;  4ND9 A;  1B4H A;  2NVU B;  3MZ1 A;  3K02 A;  4LUB A;  1D4N A;  1LBB A;  4QFK A;  4FAT A;  2XX9 A;  4GFR A;  4GWW A;  3K0V A;  1T0K A;  2UVH A;  1D3K A;  1BP5 A;  4RA1 A;  4TLM B;  3BKI B;  3E4R A;  1MPC A;  1HSE A;  4G8H A;  1II5 A;  1SW1 A;  2Y84 A;  4OVS A;  4PF6 A;  1EYI A;  1J1N A;  3TQL A;  4AQ4 A;  4MNC A;  1FBC A;  4F1V A;  3TEL A;  4WED A;  3IR1 A;  3HPI A;  4M1V A;  3B6T A;  2QFL A;  4MF3 A;  2UVI A;  1OLC A;  3AXF A;  2DWI A;  4F3P A;  3FXR A;  4GVO A;  3OSR A;  2CZI A;  2V4C A;  4PGP A;  5IGA A;  3LSW A;  1BK4 A;  2QMX A;  4R72 A;  2VOZ A;  2HEU A;  1M5F A;  1R1N A;  3KOT A;  2BJI A;  4OQO A;  3OSQ A;  2LAO A;  1GR2 A;  4YB6 A;  1FTK A;  3OO8 A;  1POT A;  5LDZ A;  1NV6 A;  1GGG A;  5L9O A;  4NN3 A;  3C9H A;  1BTJ A;  4O7M A;  1P1Q A;  1PB9 A;  3C35 A;  2A5T B;  3ISP A;  3H7M A;  5KDT A;  4THI A;  1B40 A;  4GF8 A;  3RPW A;  4OWD A;  1FQC A;  4DCX A;  2ZZV A;  1LBC A;  4N07 A;  4NTL A;  4F3S A;  2F97 A;  1EYK A;  1EU8 A;  4IO3 A;  4QSD A;  4ZDM A;  1Y4T A;  1N7W A;  4I1D A;  3GLB A;  3T9X B;  2REG A;  2PT1 A;  3FVG A;  1QUJ A;  2VHA A;  2XXY A;  4ZE8 A;  1IMA A;  2THI A;  2ZMB A;  2R9J A;  3LV0 A;  3KN3 A;  2OWZ A;  5ESY A;  3T9U A;  5AA3 A;  4DLD A;  5FHM A;  3H6U A;  3TEP A;  1FQF A;  2XX7 A;  3TZA A;  3QAX A;  2M8C A;  1B3E A;  1NH7 A;  2QRY A;  3EHS A;  2DE2 A;  1IXC A;  3MZ9 A;  2ONR A;  1PB8 A;  2XA5 A;  3MP1 A;  4PP0 A;  4IGT A;  3TTR A;  3KOS A;  1M5E A;  1QJM A;  2I3W A;  1JP4 A;  3EQ1 A;  2P3N A;  3U92 A;  3E3K A;  1USY H;  1BKA A;  3FV1 A;  2FBP A;  4JSO A;  1QUI A;  1MH3 A;  4H45 A;  4OVT A;  4NE4 A;  1PC3 A;  2ZNT A;  5TPA A;  3ZSF A;  1H3D A;  1FTM A;  3UP9 A;  4IO7 A;  4DXU A;  1NNT A;  4HE2 A;  3PMW A;  4ONY A;  4F2O A;  1B3F A;  1S7Y A;  1MRP A;  1I6A A;  5FTI A;  1N3W A;  3VDF A;  2DS9 A;  5IKB A;  3UIF A;  5TU0 A;  2QVR A;  1IMD A;  4O3A A;  4GXA A;  4N81 A;  4G4P A;  4WKM A;  4KCC A;  1DTZ A;  1SW4 A;  5KCJ A;  1SD3 A;  1B7U A;  4GL0 A;  5K2X A;  4ZEB A;  4BDN A;  4FED A;  4AB6 A;  5KDT B;  4NF4 A;  4LZ8 A;  3BFU A;  4KD5 A;  3RUM A;  5DEX A;  4G68 C;  5B7D A;  5AA2 D;  1FTJ A;  2H25 A;  1MQH A;  5L9M A;  5A5X A;  4H5G A;  4F39 A;  2XXH A;  2H98 A;  5AA4 A;  5AA1 A;  4QFP A;  4KYS A;  1M5D A;  5AE4 A;  4OES A;  3PD8 A;  2QSX A;  5CBR A;  1GTK A;  4GWS A;  1XS5 A;  3M3L A;  2ONK E;  3QSL A;  1Y1Z A;  5DTB A;  1QUL A;  4PCD A;  4YMB A;  1YCJ A;  1MQD A;  3TCH A;  1LBX A;  4R2B A;  3O6H A;  4MLV A;  2F35 A;  4LQ2 A;  3THI A;  1A7L A;  1SPI A;  4BDL A;  2ZZW A;  3IOU A;  3PTY A;  4F2Q A; 
#chains in the Genus database with same CATH homology
 2O84 X;  4NWD A;  3VLW A;  1LFI A;  1AL3 A;  2A5T A;  3K1N A;  5KCJ B;  1LCT A;  1FCK A;  2CZL A;  1TFD A;  5FHO A;  4GWO A;  2ANJ A;  3PPR A;  1B3H A;  1HSJ A;  3TKD A;  1EZ9 A;  3KZG A;  3KBR A;  3VLU A;  3ZS6 A;  3KN8 A;  1R9L A;  2OZZ A;  4IO5 A;  2XD2 A;  3H3G A;  2O7I A;  4F2O A;  1A55 A;  4FE8 A;  2UYF A;  4JDF A;  4ZEK A;  1A99 A;  1MS7 A;  3IOR A;  4QF9 A;  4EF2 A;  5AA4 B;  5FTH A;  4XKR A;  4JWX A;  4YKJ A;  3HO7 A;  1B6H A;  4O3B A;  1OMP A;  1PB7 A;  5AA2 A;  3IO6 A;  3K4U A;  5HM4 B;  5ICQ A;  1VFE A;  4P11 A;  2OCU A;  3IB1 A;  2V93 A;  1MH4 A;  3OOA A;  2VGQ A;  2H99 A;  3OO9 A;  3D4G A;  4LP2 B;  1IXG A;  1MXX A;  1IXI A;  3TAJ A;  1TT1 A;  2AL5 A;  2GHB A;  1IIW A;  2H9B A;  4OFO A;  1MXV A;  4IO2 A;  4H8I A;  1BIY A;  1LST A;  2QPQ A;  2I0B A;  1B3G A;  3PUV E;  2O69 A;  3TFL A;  3WAF A;  5DVJ A;  4DCY A;  5EHS A;  1ZMG A;  3TOD A;  2V3T A;  2DVZ A;  3OXN A;  5A5X B;  1SW2 A;  4HTG A;  4KPT A;  4OMB A;  2P2A A;  1N84 A;  3TPA A;  1PDA A;  1N3X A;  4F1Y A;  2Y7W A;  4U2R A;  1AH5 A;  3PU5 A;  2OLB A;  2DE3 A;  4FEB A;  3S9E A;  2A5S A;  3G7W A;  4I62 A;  3GXA A;  1IIT A;  1URD A;  4ZEC A;  2I49 A;  1CE2 A;  3MP8 A;  2UYE A;  4OEN A;  3V8X B;  2Z22 A;  3USD A;  1FTO A;  3T93 B;  1DOT A;  1MG1 A;  1M5B A;  3B6Q A;  3O6I A;  5TP9 B;  3UA8 A;  4C0R A;  1FQE A;  1WOD A;  2UVG A;  4I9D A;  2KLF A;  4JXI A;  2RIN A;  1FQB A;  3O2A A;  3FZV A;  3K1M A;  4NF8 A;  3TYH A;  4DZ1 A;  2GHA A;  3FXU A;  4KFQ A;  2UXA A;  2RCB A;  1RKM A;  3A3C A;  3CFL A;  1B4Z A;  3MUQ A;  4MLQ A;  4R75 A;  3DP6 A;  5TPA A;  3QK6 A;  3P7I A;  2AIX A;  4NMY A;  4TLL B;  3OMB A;  5CMB A;  3SEY A;  4PFW A;  4YMA A;  3I3V A;  5I84 A;  1ANF A;  1N0T A;  3C32 A;  1MY2 A;  3MAM A;  4H65 A;  4NED A;  2Q9T A;  1B7H A;  5K2Y A;  2O1M A;  3KSJ A;  3K2D A;  4X1D A;  3EHU A;  4PFU A;  5DYH A;  3UGW A;  2E1S A;  2D3I A;  1Y3P A;  1SQY A;  4YKK A;  1URS A;  1UIV A;  2DSF A;  4F3B A;  2F34 A;  3RN8 A;  1Z7M E;  5H8H A;  2F7B A;  2F7C A;  2QL3 A;  3N26 A;  4KYD A;  1R6Z A;  3MQ9 A;  5F1Q A;  3TCG A;  4YAH X;  1EH3 A;  3CRB A;  3PPQ A;  2REJ A;  4LAT A;  3G3I A;  4ZEF A;  3UK4 A;  3TCF A;  3Q28 A;  3LBS A;  5H8Q A;  4BLA A;  4NF8 B;  4F19 A;  1JVY A;  1UTB A;  3JZJ A;  3TTL A;  5I57 A;  1MM6 A;  3N6U A;  1TFA A;  3OEL A;  3O97 A;  3C31 A;  4Q30 B;  1SVX B;  3ONM A;  1D9Y A;  3MPK A;  3N94 A;  3VXC A;  1B1H A;  2IA4 A;  4ZEI A;  1GV8 A;  1UTH A;  4FAJ A;  2PVU A;  3B6W A;  3SEU A;  1JW5 A;  3K6U A;  4ECF A;  3FXQ A;  4NF6 A;  4QFN A;  5TPA B;  1SDX A;  3RT6 B;  3VVF A;  4OFL A;  4ESX A;  4U1Z A;  2VD2 A;  3K01 A;  3MZB A;  3V83 A;  4OEV A;  2I3V A;  5CMK A;  1USY E;  4RPN A;  3PUY E;  2X7Q A;  2NUV A;  4IB2 A;  3R7X A;  4C1U A;  1IUD A;  1IZ1 A;  2P1S A;  4YZZ A;  2GRV A;  5I2N B;  2HFB A;  2AYS A;  3H03 A;  2DE4 A;  3LR1 A;  4L17 A;  2DWH A;  4DXC A;  2XXP A;  2AL4 A;  2F6P A;  2ZYK A;  4OFJ A;  2Z8D A;  4GOT A;  4P0G A;  2HQ0 A;  2X26 A;  2DQV A;  1ATG A;  2F8D A;  3S4U A;  1MM7 A;  2ONS A;  3T96 B;  2HZL A;  4KQP A;  1B7Z A;  2Y7R A;  3K1P A;  3OEK A;  3L6H A;  3HCQ A;  4XKQ A;  3RLF E;  1NKX A;  3GBB A;  5H8F A;  2D21 A;  4MFI A;  5H8N B;  1O7T A;  3DM0 A;  4N6P A;  1PBQ A;  4PFT A;  2Y7P A;  3HN0 A;  3SKP A;  3TUS A;  2I6E A;  4FEC A;  4R73 A;  5IAI A;  2XXR A;  4NF4 B;  3C34 A;  1Y3N A;  4ZE9 A;  1B1X A;  3MW0 A;  5AA2 B;  4R6Y A;  5JK4 A;  3ODB A;  4Z0I A;  2ZNU A;  2Q2C A;  4HCY A;  1QUK A;  2CMO A;  3BBR A;  3PV0 E;  3QUJ A;  4HS7 A;  4X9T A;  4Q8R A;  3TTN A;  3G3J A;  4GRK A;  1MXU A;  3D4C A;  1DSN A;  4PFY A;  5F7V A;  2UVJ A;  5H8H B;  5JTY B;  1XOC A;  4DE8 A;  5HPQ A;  4Q5T A;  3IOT A;  4NF5 A;  3W15 C;  4ZZA A;  3ILT B;  5TP9 A;  4ELR A;  2DWA A;  3CIJ A;  4ELP A;  2P0S A;  4GL8 A;  4RNS A;  4OXV A;  2V84 A;  3HST A;  4ND9 A;  1S50 A;  5CM6 A;  1B4H A;  3H6T A;  2RCA A;  2NVU B;  3MZ1 A;  5KZT A;  4LZ7 A;  4AB5 A;  2RC8 A;  4M4G A;  4EQB A;  4JWO A;  3K02 A;  3MJN A;  3RQT A;  4YB7 A;  1Y1M A;  4LUB A;  4JBZ A;  1D4N A;  3G3K A;  4RPO A;  4U21 A;  5EHM A;  4H5F A;  4U23 A;  3U72 A;  4E0W A;  1LBB A;  4QFK A;  1B0H A;  1I6B A;  4FAT A;  2XX9 A;  1B32 A;  2XXI A;  3KFM A;  4GFR A;  4OET A;  3TDJ A;  3PPP A;  4G68 B;  3U93 A;  3Q29 A;  3K0V A;  3LUY A;  1T0K A;  1LAX A;  3G3G A;  2R6G E;  4OHN A;  2GFE A;  2OBG A;  1D3K A;  2UVH A;  4G77 A;  1BP5 A;  3JYR A;  5CMC A;  3VFJ A;  2PMS A;  3WAE A;  4RA1 A;  4TLM B;  5DEX B;  3Q27 A;  1JNF A;  3BKI B;  3E4R A;  1MPC A;  1HSE A;  3A09 A;  5I56 B;  1PEB A;  1LGB C;  1II5 A;  1QKB A;  1SW1 A;  3EHT A;  2Y84 A;  1SBP A;  3QIM A;  4G8H A;  1OVB A;  3W9V A;  1Y20 A;  3B7D A;  4IO6 A;  1J1N A;  1ZIU A;  2PX1 A;  5DT6 A;  3TQL A;  4AQ4 A;  3FD3 A;  3IJO B;  4QSC A;  1MQJ A;  4RXL A;  1MXY A;  5CI5 A;  1URG A;  4WED A;  3SEW A;  4P0I A;  3IR1 A;  3TEL A;  3EF7 A;  3HHF A;  3LSF B;  3CG3 A;  2NWJ A;  4G68 A;  2DP8 A;  3HPI A;  3FVN A;  1S9T A;  3B6T A;  1KWH A;  4M1V A;  1O64 A;  5FHN A;  3TQW A;  5CBS A;  4MF3 A;  1SYH A;  2UVI A;  1OLC A;  4EQ9 A;  4YKI A;  3AXF A;  1N76 A;  3CSG A;  2DWI A;  1FQA A;  3KGC A;  4IY5 A;  3OD7 A;  4F3P A;  2XD3 A;  1B5I A;  5DVI A;  3HV1 A;  4LQ5 A;  1D9V A;  3FXR A;  4GVO A;  2XXW A;  5H8Q B;  2OWS A;  3DP4 A;  3MC2 A;  4GXS B;  1JW4 A;  4G8N A;  1Q1K A;  4U4S A;  2X7P A;  3OSR A;  1FQD A;  3CSB A;  1OVT A;  1I69 A;  1RYO A;  3M8U A;  3MPL A;  3PPO A;  3V89 B;  3VVD A;  3LSW A;  2QMX A;  4R9F A;  3MBP A;  3K6V A;  4LZ5 A;  4RJZ A;  4U22 A;  1H43 A;  3ZKL A;  4R72 A;  5I58 B;  2VOZ A;  4UAC A;  3MWB A;  1YTV A;  2HEU A;  1Y3Q A;  1M5F A;  1MXZ A;  4BDQ A;  1R1N A;  4U4X A;  2HAV A;  3T66 A;  3KOT A;  4DXB A;  4OQO A;  2ALU A;  1NNK A;  3E9X A;  3OSQ A;  3VXB A;  1P99 A;  4GD5 A;  4PE5 B;  4PET A;  2LAO A;  4IO4 A;  1PBP A;  1GR2 A;  2PYY A;  2R71 A;  3O28 A;  3PGF A;  3JV9 A;  4R74 A;  1FTK A;  4YB6 A;  1XC1 A;  3OO8 A;  1POT A;  1P1W A;  4EQ7 A;  1ZBM A;  4QFO A;  1ZJL A;  2NXO A;  3CR9 A;  3PUX E;  1UIU A;  3RNN A;  2ZYO A;  3UN6 A;  1GGG A;  5L9O A;  1H44 A;  4ISU A;  3ECR A;  3GBA A;  3LSX A;  3C9H A;  4KCD A;  1WDN A;  1OLA A;  1B52 A;  1BTJ A;  5H8N A;  1P1Q A;  2QS4 A;  1PB9 A;  3LC8 A;  3C35 A;  4E0X A;  2I0C A;  2A5T B;  4K3F A;  2XXX A;  4F18 A;  3H7M A;  4PQJ A;  5HBC A;  5KDT A;  2F78 A;  5ITO A;  3K6X A;  1IQ7 A;  3FVK A;  3C36 A;  4KI0 E;  4LON B;  3MVW A;  4THI A;  4ZED A;  1B40 A;  1M5C A;  4GF8 A;  1DPE A;  4NWC A;  3RPW A;  2VD3 A;  4Q0C A;  4OWD A;  4H1X A;  4F1V A;  1DMB A;  1FQC A;  2DOJ A;  4DCX A;  2YPN A;  1B5J A;  3QXM A;  4JB7 A;  1LBC A;  2Q88 A;  4N07 A;  4FJP A;  4XTC Q;  5CRY A;  3OEM A;  4NTL A;  2F36 A;  2HAU A;  3H4Z A;  3SEV A;  4X48 A;  2PBW A;  1AMF A;  5JEI A;  4F3S A;  2F97 A;  3U94 A;  4ELQ A;  3MVY A;  4MBP A;  1ZKB A;  1N04 A;  1Q35 A;  1EU8 A;  1B58 A;  4IO3 A;  3RGY A;  1YPN A;  3IK6 B;  1L5T A;  3SEX A;  4QSD A;  4ZDM A;  3KEI A;  1B3L A;  1Y4T A;  3DP8 A;  3GZG A;  4FIM A;  1N7X A;  2Q8J A;  3SES A;  4HW8 A;  4QFL A;  3VLV A;  4BDM A;  4WEP A;  1N7W A;  3PUZ E;  4RK2 A;  2ZXT A;  3G3F A;  1XVY A;  4BDO A;  1LAG E;  4I1D A;  3GLB A;  1P1O A;  1MY0 A;  1Y9U A;  2E0S A;  2QMW A;  3CFZ A;  3T9X B;  2NOO A;  4H8J A;  2REG A;  2DYX A;  5CMM A;  2PT1 A;  1ZLQ A;  3N6T A;  4EXK A;  3FVG A;  1QUJ A;  2VHA A;  3CVG A;  2XXY A;  3H06 B;  3H6V A;  3I6V A;  3IAZ A;  3M3K A;  4ZE8 A;  2F6G A;  2XXV A;  2THI A;  1CB6 A;  2ZMB A;  3M3F A;  5B70 A;  2R9J A;  5CC2 A;  1P1N A;  4QRZ A;  4ZS9 A;  3G3H A;  1A40 A;  1LFH A;  3KN3 A;  4F31 B;  2B3F A;  2I4B A;  3FJG A;  3L6G A;  4QHQ A;  4GQO A;  3UOR A;  1POY 1;  3T9U A;  5AA3 A;  3Q26 A;  4R6H A;  4DLD A;  5I59 B;  5FHM A;  4EF1 A;  3R26 A;  1RYX A;  5BUU A;  3KN7 A;  1FTL A;  3OO6 A;  3U8Q A;  3H6U A;  1NL5 A;  5ICT A;  3S9N C;  3TEP A;  1FQF A;  2XX7 A;  3T9V A;  1YAE A;  1A8E A;  1H45 A;  3TZA A;  3QAX A;  1VFD A;  3PD9 A;  4ELO A;  2M8C A;  1ZU0 A;  1B3E A;  1NH7 A;  2QRY A;  1XVX A;  1SI0 A;  3C33 A;  3CFX A;  2DE2 A;  3VV5 A;  4TQU Q;  5JTY A;  1IXC A;  2OWT A;  3MZ9 A;  2ONR A;  1PB8 A;  3S2V A;  3V5A A;  1NNP A;  4JWY A;  3CG1 A;  3MP1 A;  1QW0 A;  4PP0 A;  4IGT A;  3TTR A;  1Y4C A;  1MXW A;  5I2K B;  2FYI A;  3KOS A;  3KSX A;  1M5E A;  1UTB B;  2OK2 A;  1H76 A;  2O6A A;  2I58 A;  1QJM A;  1B2H A;  4IGR A;  1GVC A;  2Z23 A;  2QJE A;  2I4C A;  3TTM A;  2I3W A;  5I58 A;  3EQ1 A;  1I6Q A;  2G93 A;  2GH9 A;  2HXW A;  4RY1 A;  2HZK A;  3QYT A;  2HCA A;  3E3K A;  3U92 A;  1USY H;  3IB2 A;  1SYI A;  4OVJ A;  4RK9 A;  1BKA A;  3FV1 A;  4JSO A;  5ELV A;  4OEU A;  4JSD A;  2ZYM A;  1QUI A;  2BJJ X;  2RF1 A;  3BFT A;  3S9L C;  1MH3 A;  4XKP A;  1A8F A;  5I2N A;  1PC3 A;  1B9J A;  2H5Y A;  2ZNT A;  1B51 A;  4IY6 A;  4NE4 A;  2XXT A;  1SW5 A;  1Z7N E;  3QUF A;  1XT8 A;  3CI8 A;  3ZSF A;  1A54 A;  1H3D A;  2O51 A;  1FTM A;  2W7Y A;  1NH8 A;  4LVQ A;  4EDP A;  3IB0 A;  5H8S A;  3UP9 A;  1EZO A;  5I2K A;  1FW0 A;  4IO7 A;  1NNF A;  1ELJ A;  2ESN A;  4DXU A;  3FUZ A;  3EPE A;  4H0W A;  2WKY A;  3F11 A;  3IX1 A;  1NNT A;  3KG2 A;  4MH5 A;  4WXJ A;  1OIB A;  2Z8F A;  3TMG A;  1R9Q A;  2V25 A;  2Q89 A;  3PMW A;  4ONY A;  2DXR A;  2RC7 A;  3Q25 A;  1LAH E;  4I8C A;  3SDF A;  4KHZ E;  2Y7I A;  2B65 A;  1B3F A;  1BLF A;  1S7Y A;  1MRP A;  4H67 A;  1I6A A;  3EN3 A;  1N3W A;  1MQG A;  4OZ9 A;  4R6K A;  3O9P A;  5FTI A;  1JEU A;  3VDF A;  2DS9 A;  4BDR A;  5ISU A;  4Z7E A;  1MPD A;  5EYF A;  5IKB A;  3IOW A;  4OTE A;  4OYV A;  3W9W A;  1AIV A;  2YJP A;  3PMV A;  2G29 A;  3FJ7 A;  2PT2 A;  4HCW A;  3FVO A;  3UIF A;  3FGS A;  4NF5 B;  4POW A;  5TU0 A;  3RY3 A;  4G8M A;  2XHD A;  1JEV A;  1VE4 A;  2O7U A;  2DWJ A;  2O68 A;  4O3A A;  5L9S A;  4GXA A;  2DXY A;  2ABH A;  4GLI A;  4YIC A;  5LOM A;  1QKA A;  5I56 A;  2ZYN A;  4G4P A;  2OJT A;  3FAT A;  4KR5 A;  1LAF E;  2Y7K A;  4WKM A;  4KCC A;  3MVZ A;  1DTZ A;  1SW4 A;  5KCJ A;  4YKP A;  5I57 B;  1JQF A;  1MDQ A;  1MDP 1;  1SD3 A;  1B7U A;  2V3U A;  3OEN A;  4GL0 A;  4TOZ A;  3O66 A;  3PUW E;  4X1B A;  4YB5 A;  2IEE A;  3PPN A;  4ZEB A;  4ZZE A;  3FJM A;  2FNC A;  4FED A;  5K2X A;  4POX A;  3FIR A;  2FA7 A;  3U1O A;  4BDN A;  2QS1 A;  3O29 A;  4H6D A;  4AB6 A;  2Z8E A;  3LSL A;  2XXQ A;  5KDT B;  3TTK A;  3C4M A;  4NF4 A;  4LZ8 A;  5ITP A;  1US5 A;  2QS3 A;  1LB9 A;  2YLN A;  3KJ7 A;  1JW1 A;  1OQG A;  4XKN A;  4DIG A;  1QVS A;  3ZKK A;  4C1T A;  3BFU A;  2ZNS A;  1WVJ A;  5DVF A;  3VVE A;  1US4 A;  2O1L A;  4R2F A;  4G2Z A;  2QS2 A;  2RKM A;  4KD5 A;  1B5H A;  3ILU B;  2F7A A;  1DTG A;  1MQI A;  3K6W A;  3KJT A;  4UA8 A;  1LFG A;  3RUM A;  3R6U A;  1LLS A;  5DEX A;  3FAS A;  3IO4 A;  4XXU A;  4G68 C;  1JET A;  5B7D A;  2D5W A;  3MP6 A;  5AA2 D;  1TXF A;  3RTW B;  1FTJ A;  2RC9 A;  1P1U A;  1SI1 A;  2H25 A;  3E13 X;  3IOV A;  1MY3 A;  1UTH B;  3IL1 B;  4F1U A;  1HSL A;  5BWJ A;  1XHY A;  1MQH A;  5L9M A;  5A5X A;  3DEL B;  1OQH A;  4NF6 B;  4GIZ A;  2B3B A;  3FV2 A;  4U1O A;  4RYA A;  3HHG A;  2Q2A A;  3I5O A;  4YU0 A;  4XIG Q;  4H5G A;  1UQW A;  4N13 A;  4F39 A;  2XXH A;  1IXH A;  1LB8 A;  1VR5 A;  1TWY A;  2H98 A;  3DLN A;  3IJX B;  3K00 A;  1LCF A;  4OER A;  5AA4 A;  5AA1 A;  1B05 A;  3EHS A;  3T9H B;  4QFP A;  4F3G A;  4KYS A;  1EZP A;  4KYE A;  1JVX A;  1M5D A;  4O3C A;  5AE4 A;  4OES A;  2VP1 A;  1IEJ A;  1NFT A;  2H4I A;  3PD8 A;  2QSX A;  1O63 A;  3SET A;  4EXL A;  5CBR A;  5H8F B;  1B0L A;  1MY4 A;  1GTK A;  3O6G A;  3VE1 B;  1DPP A;  3H6W A;  3RTF B;  1XS5 A;  3S9M C;  3SER A;  3M3L A;  2ONK E;  3QSL A;  2XX8 A;  1MY1 A;  1Y1Z A;  5DTB A;  4F22 A;  1QUL A;  3RT8 A;  1AOV A;  5I59 A;  2F5X A;  3PMX A;  4FOR A;  1VSO A;  4YMB A;  1NMU A;  1YCJ A;  3MVX A;  4R9G A;  1MQD A;  5J1D A;  1B46 A;  3TCH A;  2XXU A;  3T22 A;  1F9B A;  3A3U A;  4R2B A;  5L8D A;  1ZTY A;  3O6H A;  5M2V A;  1MPB A;  4MLV A;  4LA9 A;  2F35 A;  4LQ2 A;  2DVC A;  2V3Q A;  3THI A;  4EUO A;  4ESW A;  1A7L A;  2I48 A;  3N5L A;  4BDL A;  4F29 A;  3IOU A;  3OO7 A;  4DDD A;  4QSE A;  4F2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...