2UVHA

Structure of a periplasmic oligogalacturonide binding protein from yersinia enterocolitica in complex with saturated digalacturonic acid
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
404
structure length
404
Chain Sequence
EVNLRMSWWGGNGRHQVTLKALEEFHKQHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTARIFYFNDATWAKAGLEYPKTWDELLAAGKVFKEKLGDQYYPVVLEHQDTLALIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASFGKSNMYEMKPWINGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFKPAQMLSIGKSTKHPQESAMLINFLLNSKEGVEALGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHKMTTSPYFDDPQIVSLFGDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC TYPE PERIPLASMIC SUGAR-BINDING PROTEIN
publication title Specific Recognition of Saturated and 4,5-Unsaturated Hexuronate Sugars by a Periplasmic Binding Protein Involved in Pectin Catabolism.
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Sugar binding protein
total genus 137
structure length 404
sequence length 404
ec nomenclature
pdb deposition date 2007-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uvhA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uvhA02
2UYFA 3CFLA 4MH5A 2RC8A 2P1SA 4GIZA 3PUVE 4FEBA 1NNFA 1SW5A 3ONMA 1B5JA 2PVUA 4XKRA 4XKPA 3OMBA 2F7BA 1LAHE 3RPWA 2RKMA 4WEDA 3H6WA 3CG1A 3PGFA 1B7UA 2OBGA 4EUOA 1J1NA 3PUZE 1DPEA 4R6KA 1NNPA 1MQDA 3U8QA 1B9JA 4F1UA 3MVYA 2F6GA 1TWYA 1ZU0A 2H98A 1GVCA 4G68B 3C4MA 3FATA 4YKJA 3K6UA 3EF7A 1LBCA 3N6UA 5ITPA 4NF5A 2AL4A 1I6BA 2DXYA 2YLNA 2PMSA 1FTLA 5JTYB 1PDAA 1UIUA 4GWOA 4BLAA 3MVXA 5DEXB 1NNTA 1ELJA 5AA4B 1MDP1 2O7IA 2XXPA 1MDQA 1SQYA 2PT2A 1JVYA 3UA8A 3OOAA 4GL0A 3SEYA 1PC3A 4C1TA 2DSFA 5CI5A 2Q89A 4O3BA 4P11A 4XIGQ 4LP2B 1YPNA 3T22A 1D3KA 3KSXA 1POY1 3HCQA 1B3GA 4AQ4A 2XHDA 3O6IA 4Q0CA 3RY3A 1UIVA 2I0BA 2I48A 3FGSA 3B6QA 3IK6B 2HXWA 4BDMA 3QAXA 1NMUA 3TFLA 3TTNA 1UTHA 1LFHA 1B2HA 4RK2A 4QF9A 4GOTA 3FJGA 3S4UA 3K0VA 5ICTA 4EQ7A 4IY6A 4MLQA 4OYVA 1B1XA 3TEPA 3FVGA 1PB8A 2F36A 4YB6A 1B7HA 4FECA 4GF8A 1KWHA 3DP4A 4C0RA 1TFAA 4OFJA 3T9UA 3IO6A 3EPEA 4LQ5A 1MY1A 2XXRA 4XTCQ 4ND9A 3SERA 5AA3A 2I3VA 4KYEA 1N3WA 3TCHA 4IY5A 3OEKA 3TAJA 1B05A 2ZNTA 5H8HB 1MQJA 5K2XA 3UGWA 1I6QA 2FA7A 4F3SA 2G93A 1IXIA 3S9NC 3HPIA 2Y7IA 1B46A 1LB9A 3KG2A 2Z8FA 3K2DA 4KR5A 3OO9A 2X7PA 1MM6A 4X48A 3TMGA 3KN8A 3O29A 4RNSA 5H8NB 3FV1A 3PPRA 4EDPA 2FYIA 4QFNA 4ELOA 4RXLA 3RT6B 3HO7A 1R6ZA 1FQDA 1MS7A 3CVGA 3PV0E 2I0CA 2A5TB 2DVCA 2D3IA 4OENA 3H6UA 3TODA 5B7DA 1UTBA 1USYE 5FHMA 3MWBA 5CC2A 2XXQA 4LONB 4EF1A 2DWIA 5I57A 3RGYA 4H8JA 5DVFA 1A54A 2REGA 2HCAA 3TUSA 5B70A 2UVHA 3PPPA 1GGGA 4DCXA 1IXHA 1QKBA 2D21A 3QSLA 1LLSA 1MXUA 2XXTA 4TOZA 1PEBA 2H99A 1MH3A 3TPAA 2V3QA 2F7AA 3VVDA 4AB6A 2AIXA 3K6WA 1US5A 2G29A 4F2QA 5CBSA 3MAMA 5KDTB 3H03A 1MXXA 4N13A 1Y4CA 4F3PA 2XXHA 4HCYA 4EXKA 1LFIA 4NF6A 3GBAA 3G3HA 2IA4A 1R1NA 3USDA 5AE4A 4F3GA 3IB0A 4JDFA 4F1YA 2WKYA 3O66A 4HW8A 1IXGA 4PE5B 4OERA 1FQAA 2OWSA 4L17A 3IOUA 4H5GA 1O64A 5TU0A 3Q28A 4MLVA 5AA1A 3A3UA 1FTKA 1MPDA 3E9XA 1NKXA 5FHNA 1LCFA 1A8EA 3MPLA 3OENA 3IAZA 3MBPA 3CFXA 1S50A 4Q5TA 1LB8A 1S7YA 4MBPA 1H76A 1Y4TA 3PPNA 5I59A 2Q88A 4DLDA 4PFUA 3C32A 1URDA 4JBZA 4OQOA 1QKAA 2XD3A 3LSFB 4QFOA 1BTJA 3C9HA 1MPCA 2QPQA 3FXQA 4I1DA 1MXWA 4O3AA 4P0GA 3TCGA 5I56B 1B1HA 4ELRA 1FQFA 1MY4A 3HHFA 1IIWA 1UQWA 2CMOA 1MY2A 2XX8A 3S9LC 5CMKA 1MQIA 2OJTA 4WKMA 3ECRA 1MG1A 5CM6A 3E13X 1LBBA 4IO2A 3TDJA 1OLAA 1FTMA 4DIGA 2DWAA 3K6XA 4G68A 3O28A 4DZ1A 2Z8DA 4KD5A 3BKIB 1Y1ZA 1GTKA 3OSRA 4LZ8A 3EQ1A 1P1NA 2H9BA 3JV9A 4OVJA 5JTYA 1HSEA 3KSJA 2ZXTA 4FAJA 3IB1A 4O3CA 3HV1A 5DEXA 2NXOA 5AA4A 5ELVA 4OXVA 2XX9A 3VE1B 3CSBA 3W9VA 4YB7A 4I8CA 1A40A 3FD3A 5EYFA 2X26A 5HBCA 3VV5A 3MZBA 1PBQA 2RC7A 3FVOA 3Q27A 1US4A 2F78A 3B6TA 3IORA 2GHBA 3K4UA 3TELA 2D5WA 4PQJA 1Z7ME 2HAVA 3S9MC 1MM7A 1B51A 2OK2A 4GXAA 4ISUA 3ZKLA 1MXZA 1O63A 4R73A 3IX1A 3SDFA 3SEUA 3T93B 4G2ZA 3E4RA 5IAIA 1IXCA 4H5FA 4WXJA 1ZBMA 4IO4A 4X1DA 4KYDA 3B7DA 4QFKA 1QULA 2O69A 3EHSA 1OQGA 4R74A 3GBBA 3RQTA 4ZZAA 2B3FA 1P1QA 4YKIA 1BKAA 1Y3NA 5H8FB 3TQWA 1H43A 3IJXB 1OMPA 1NL5A 3U92A 4YZZA 2QRYA 5KCJB 3A3CA 1LAFE 3KJTA 5TP9B 1VFEA 3G3GA 3MW0A 1M5EA 4LUBA 3G3FA 4K3FA 2HZKA 2UYEA 4H67A 2ZYNA 1Y20A 4U4SA 3W9WA 2DWJA 3PUXE 3TQLA 3G3JA 2ZYOA 4G8MA 5F1QA 3VLVA 2O1MA 4DXUA 4IO7A 1T0KA 1TXFA 5H8HA 3VVEA 3RNNA 2YPNA 4KCDA 4BDNA 4R72A 4NF4B 3BFTA 2B3BA 1LAXA 4YKKA 5LOMA 1OQHA 4OHNA 3ODBA 3VXCA 4F2OA 3LSLA 4XKQA 4ZEIA 5H8NA 1I6AA 2UVGA 1YAEA 1WVJA 4YKPA 1SD3A 1GR2A 4JXIA 2NOOA 4KI0E 2ABHA 2F8DA 3MJNA 2A5TA 3KEIA 5FTHA 1Z7NE 1B4ZA 1OIBA 5A5XB 1H44A 4OESA 2HQ0A 1XHYA 2XXUA 3M3FA 4ZS9A 1B3FA 1SW4A 1DOTA 1AH5A 4UACA 3O2AA 3M8UA 3P7IA 2UVJA 3OEMA 4POWA 4Z7EA 3FZVA 2ZNSA 1Y3PA 5TPAB 1FQBA 1D4NA 1D9YA 5DYHA 4ZEDA 3JYRA 1B58A 4QSEA 3GZGA 5DT6A 3U93A 3PUWE 1XT8A 3MPKA 3I3VA 2R71A 1LAGE 1POTA 4OTEA 4IO5A 1QVSA 2PX1A 3C31A 1URSA 4IO6A 4Z0IA 2F35A 1B5IA 4EXLA 3VVFA 2E1SA 5KDTA 1BP5A 2Z23A 1A99A 4OEVA 1EZ9A 4JSDA 1B3LA 2RINA 2F34A 1PB7A 1URGA 2DS9A 3FIRA 1MRPA 4LATA 3M3LA 1EU8A 4F3BA 1DTGA 5K2YA 3DM0A 1MY0A 2PBWA 1QW0A 4PFTA 3IL1B 4R2BA 1H3DA 2ONKE 3K00A 4EQBA 1N7WA 4R6HA 4DE8A 4FATA 3C35A 3F11A 3RLFE 3T96B 3CR9A 4U4XA 1LGBC 4NF5B 2UXAA 4GFRA 3RTWB 3QYTA 4ZZEA 1VR5A 4HCWA 3V83A 2HFBA 2RCAA 4DXBA 3OELA 1F9BA 1SDXA 5AA2D 4QHQA 5AA2B 4E0XA 3MP8A 4NWCA 3LSXA 2PYYA 3KN3A 4YAHX 2Y7WA 4IB2A 1VE4A 3K1NA 2QS1A 3JZJA 4MFIA 4LZ7A 3R6UA 4OFLA 2ESNA 2QS3A 1EH3A 1N04A 2ONSA 4U21A 5I56A 5M2VA 1Q35A 2XXIA 4FORA 1QUJA 3VLWA 1B7ZA 5I2NB 1TFDA 4TQUQ 4G4PA 2I4CA 2I49A 4R2FA 1XVYA 2O51A 3S2VA 2NWJA 1CE2A 1XS5A 4PFWA 4F18A 3K1MA 2Y84A 3ILTB 1MPBA 1OVTA 4H0WA 5DVJA 3U94A 2VGQA 2F7CA 1XC1A 1AL3A 3HHGA 2Q8JA 1OVBA 3SETA 4HS7A 3SKPA 1YCJA 1YTVA 3OD7A 1FW0A 3TZAA 1WDNA 4JB7A 4XXUA 4ZDMA 5H8QB 3OO8A 3H6TA 1D9VA 1SW2A 3PPQA 2AL5A 3PU5A 4ESXA 3S9EA 1MY3A 1B4HA 3G3IA 1TT1A 2RCBA 1B52A 3IR1A 3T9VA 1JNFA 5IKBA 2KLFA 4ONYA 4BDQA 2RF1A 3SEVA 4M4GA 3KBRA 3T9HB 3CFZA 3K6VA 1ZTYA 3K1PA 4P0IA 3IOWA 3IOTA 2V3TA 4JSOA 5L9SA 3LUYA 1NNKA 3TCFA 4F19A 4KPTA 2DQVA 3VDFA 3GLBA 2IEEA 3V89B 2RC9A 1A55A 3AXFA 3DELB 1S9TA 1JQFA 2ONRA 5I57B 4FIMA 5H8FA 2W7YA 4OETA 3C33A 4LQ2A 4QFLA 3FJMA 1NFTA 5FHOA 1ZMGA 5KCJA 1A8FA 1MQHA 5TP9A 2FNCA 3FV2A 4G8NA 4QFPA 1SYIA 4LVQA 1LCTA 4NF8B 2LAOA 4YMAA 4Q30B 1Q1KA 4EF2A 4NTLA 4WEPA 4QSDA 5DTBA 4QRZA 2Q2CA 4IO3A 3V8XB 2QL3A 2QS2A 3QK6A 3WAEA 5I2KB 3LC8A 4NF4A 2NVUB 1JW5A 1L5TA 1Y1MA 4IGRA 1NH7A 1M5FA 3KOTA 4JWXA 3TKDA 3U1OA 1MXYA 3GXAA 4RPNA 4YMBA 2ZNUA 4RYAA 2GH9A 3D4GA 2BJJX 1M5CA 2VOZA 4KCCA 1IZ1A 3RUMA 2DXRA 3H4ZA 3TTKA 2I4BA 2DE2A 2HAUA 3PUYE 1B6HA 2R9JA 4FJPA 4OWDA 1BIYA 3I5OA 2I6EA 3G3KA 3O6GA 3MVWA 2I3WA 1IUDA 4ELPA 2QJEA 5A5XA 1XVXA 1FQCA 2ALUA 2XXXA 3OSQA 4LA9A 1O7TA 3UORA 3H7MA 4F29A 3PMWA 1M5DA 2M8CA 1AMFA 1IEJA 5I58B 2A5SA 1HSJA 2Y7RA 4ZECA 5TPAA 3T9XB 3PPOA 3B6WA 3MUQA 5ITOA 3SEWA 5CRYA 2V93A 4ZEFA 4OEUA 1JW4A 5HM4B 4H8IA 2V84A 5I59B 5CMMA 1CB6A 4NMYA 2HEUA 3I6VA 4NEDA 2Y7PA 1SVXB 2V3UA 2UVIA 3BBRA 3CI8A 1SBPA 1P1UA 1ZJLA 4R75A 3MVZA 2ANJA 2O68A 1ANFA 4NE4A 2QSXA 1FCKA 3DP6A 3PD8A 1RYXA 1SW1A 1GV8A 1N84A 3HSTA 3IB2A 1FTJA 4GD5A 1SI1A 4U23A 4PP0A 2OZZA 3LR1A 1DTZA 1B0LA 3TYHA 2XXYA 4OZ9A 4PFYA 4PETA 4RK9A 1JVXA 3KFMA 3H3GA 4RY1A 3IO4A 1RKMA 3FVKA 3OO6A 4DXCA 1FQEA 3RT8A 2REJA 1AOVA 3UK4A 1QUIA 1B3HA 3EHUA 3DP8A 4IGTA 5AA2A 2XXVA 2ZMBA 1R9QA 4QSCA 5FTIA 3UIFA 2XX7A 4R9GA 3L6HA 5J1DA 4GL8A 3KGCA 4R6YA 3FUZA 2R6GE 3R7XA 2ZYKA 3FASA 3E3KA 4F39A 3WAFA 4KYSA 3TTRA 4DDDA 1PBPA 2AYSA 1JEVA 2YJPA 4ELQA 1R9LA 2E0SA 4KHZE 3KZGA 5L9MA 2P2AA 3ZSFA 3U72A 1SYHA 2GHAA 2V25A 5I2NA 2DOJA 2CZLA 1B32A 3FXRA 3MQ9A 2XXWA 1B0HA 2O1LA 3L6GA 3M3KA 1SI0A 4I9DA 4TLLB 3VLUA 1LFGA 3BFUA 3KJ7A 3IOVA 3SEXA 5CBRA 2PT1A 2NUVA 4G68C 5H8QA 3VXBA 4G77A 2QMWA 3QUJA 3KN7A 1DMBA 1PB9A 2Q9TA 4FEDA 4OFOA 5BUUA 4H65A 4RPOA 4X1BA 4NWDA 4BDOA 1ATGA 5ISUA 3QUFA 3LBSA 4DCYA 5JK4A 3OO7A 2H4IA 4GRKA 3N94A 1AIVA 1ZIUA 1EZPA 2GFEA 4POXA 1P99A 4GQOA 1B5HA 3KOSA 4THIA 1OLCA 3G7WA 4N07A 2O7UA 5F7VA 3N5LA 2XD2A 3QIMA 2THIA 4YB5A 1JEUA 2DYXA 2Z22A 1M5BA 3T66A 4JWYA 1A7LA 1P1OA 1DPPA 3MZ1A 3THIA 4RA1A 3MP1A 1JW1A 4U1ZA 4R9FA 5I84A 4M1VA 3C36A 3MP6A 2P0SA 3TTMA 2VD3A 3N26A 3UP9A 2F97A 4F22A 3RN8A 3VFJA 4KQPA 3CIJA 3PD9A 4H1XA 3O9PA 2H5YA 1ZKBA 1UTHB 4NF8A 2X7QA 5DVIA 1N76A 3DLNA 3RTFB 1MQGA 5BWJA 5EHSA 3SESA 3FJ7A 4KFQA 1N0TA 1MH4A 3IJOB 4FE8A 2OLBA 2O84X 3D4CA 5I2KA 2OCUA 3FXUA 3ZKKA 2OWTA 2QMXA 3HN0A 4OMBA 5L8DA 2VHAA 2F6PA 3CRBA 4ESWA 1IITA 4GVOA 4G8HA 5EHMA 4U22A 4I62A 2DE4A 4GLIA 2I58A 4BDRA 1B40A 3V5AA 1QUKA 3TTLA 2DWHA 2B65A 3A09A 1N7XA 3CSGA 2DP8A 4XKNA 1FTOA 3FVNA 4JWOA 1VFDA 4U2RA 4E0WA 3QXMA 5I58A 4TLMB 4YU0A 1B3EA 3LSWA 2DE3A 2VD2A 3C34A 2H25A 2QS4A 3EN3A 4EQ9A 4YICA 3K02A 3UN6A 2F5XA 4LZ5A 1WODA 1UTBB 4ECFA 4N6PA 4F1VA 4C1UA 2Q2AA 1II5A 2GRVA 3CG3A 5KZTA 3OXNA 1VSOA 1QJMA 5CMCA 1LSTA 5HPQA 1NH8A 4UA8A 2DVZA 1MXVA 2HZLA 4RJZA 2ZYMA 5JEIA 4Q8RA 4BDLA 1XOCA 4ZE9A 1H45A 4HTGA 4GXSB 1BLFA 3PMVA 1JETA 2O6AA 1EZOA 4AB5A 1N3XA 3MC2A 4H6DA 3K01A 3H6VA 3N6TA 5L9OA 1IQ7A 1DSNA 4NF6B 3PMXA 1P1WA 3MZ9A 2Z8EA 3ZS6A 3H06B 2VP1A 1RYOA 4F31B 1USYH 3O6HA 4ZEBA 1I69A 4ZEKA 3ILUB 3Q26A 3EHTA 2Y7KA 1HSLA 3W15C 4U1OA 3O97A 3Q29A 4ZE8A 4X9TA 5ICQA 5H8SA 1Y9UA 3R26A 3Q25A 1ZLQA 1Y3QA 5CMBA 4MF3A
chains in the Genus database with same CATH superfamily
2UYFA 4N8GA 3CFLA 4MH5A 4NF0A 2RC8A 2P1SA 4GIZA 3PUVE 2XXKA 4FEBA 1NNFA 1SW5A 3ONMA 2HXRA 1B5JA 2PVUA 4XKRA 4XKPA 3KC1A 3OMBA 2F7BA 1LEVA 1LAHE 4GBWA 3RPWA 2RKMA 4WEDA 3H6WA 3CG1A 3PGFA 3LUZA 1B7UA 2OBGA 4EUOA 1J1NA 3PUZE 4GWSA 1DPEA 4R6KA 1NNPA 1MQDA 3U8QA 1B9JA 4F1UA 3MVYA 2F6GA 1TWYA 3E78A 3B8BA 1ZU0A 2H98A 1GVCA 2KR0A 4G68B 3C4MA 3FATA 4YKJA 3K6UA 3EF7A 1LBCA 2VPOA 3N6UA 5ITPA 4NF5A 5J16A 2AL4A 1I6BA 2DXYA 2YLNA 2PMSA 1EYKA 1FTLA 5JTYB 1PDAA 1UIUA 4GWOA 4BLAA 3MVXA 4AS5A 5DEXB 1NNTA 1ELJA 5AA4B 1MDP1 2O7IA 2XXPA 1MDQA 1SQYA 2PT2A 1JVYA 3UA8A 3OOAA 4GL0A 3SEYA 1PC3A 4C1TA 2DSFA 5IZ3B 5CI5A 4H46A 1KA0A 2Q89A 4O3BA 4P11A 4XIGQ 4LP2B 1YPNA 3T22A 1D3KA 3KSXA 4PAIA 1POY1 3HCQA 1B3GA 4AQ4A 4O7IA 2XHDA 3O6IA 4Q0CA 3RY3A 1UIVA 2I0BA 2I48A 1NUYA 3FGSA 4P1EA 2XWIA 3B6QA 3IK6B 2HPGA 2HXWA 4BDMA 3QAXA 1NMUA 3TFLA 3ROJA 3TTNA 1UTHA 1LFHA 1B2HA 4PTKA 4RK2A 4QF9A 4GOTA 3FJGA 4O8MA 3S4UA 3K0VA 5ICTA 4EQ7A 4IY6A 4MLQA 4OYVA 1B1XA 5ESYA 3TEPA 3FVGA 1PB8A 2F36A 4YB6A 1B7HA 4FECA 2FHYA 4GF8A 2FVZA 1KWHA 2OX3A 3DP4A 4C0RA 5A5LA 1TFAA 4OFJA 1SPIA 3T9UA 3IO6A 3EPEA 4LQ5A 1MY1A 2XXRA 4XTCQ 4ND9A 3SERA 5IM2A 5AA3A 2I3VA 4KYEA 1N3WA 3TCHA 4IY5A 3OEKA 3TAJA 1B05A 2ZNTA 5H8HB 1MQJA 5K2XA 3UGWA 1I6QA 2FA7A 4F3SA 2G93A 4P56A 1QGXA 1IXIA 3S9NC 3HPIA 2Y7IA 3RYDA 1B46A 1LB9A 3KG2A 2Z8FA 3K2DA 4KR5A 3OO9A 2X7PA 1MM6A 4X48A 1CNQA 3TMGA 3KN8A 3O29A 4RNSA 5H8NB 3FV1A 2B4LA 3PPRA 4EDPA 2FYIA 4QFNA 4ELOA 4RXLA 3RT6B 3HO7A 1R6ZA 1FQDA 1MS7A 3CVGA 3PV0E 2I0CA 2A5TB 2DVCA 2D3IA 4OENA 3H6UA 3TODA 5B7DA 1UTBA 1USYE 5FHMA 3MWBA 5CC2A 2XXQA 4LONB 4EF1A 2DWIA 5I57A 4PAKA 3RGYA 4H8JA 5DVFA 1A54A 2REGA 2HCAA 3TUSA 5B70A 2UVHA 3PPPA 1GGGA 1FPIA 4DCXA 1IXHA 1QKBA 4MMPA 2D21A 3QSLA 1LLSA 1MXUA 2XXTA 4TOZA 1PEBA 2H99A 1MH3A 3TPAA 2V3QA 2F7AA 3VVDA 4AB6A 2AIXA 3K6WA 4PCDA 1US5A 2G29A 4F2QA 5CBSA 3MAMA 5KDTB 3H03A 1MXXA 2PCRA 4N13A 1Y4CA 4F3PA 2XXHA 4HCYA 4EXKA 1LFIA 4NF6A 3GBAA 1KA1A 3G3HA 2IA4A 1R1NA 3USDA 5AE4A 4F3GA 3IB0A 4JDFA 2HHMA 4F1YA 2WKYA 3O66A 2ZZWA 4HW8A 1IXGA 4PE5B 4OERA 1FQAA 2OWSA 4L17A 3IOUA 4H5GA 1O64A 5TU0A 3Q28A 4MLVA 4XEQA 3KBZA 5AA1A 3A3UA 1FTKA 1MPDA 3E9XA 1NKXA 5FHNA 1LCFA 1A8EA 1RDZA 3MPLA 3OENA 4PE3A 2F3DA 3IAZA 3MBPA 3CFXA 1S50A 4Q5TA 1LB8A 1S7YA 4MBPA 1H76A 1Y4TA 3PPNA 5I59A 2Q88A 4DLDA 4PFUA 1NV1A 3C32A 4DI3D 1URDA 4JBZA 4OQOA 1QKAA 2XD3A 3LSFB 4QFOA 1BTJA 3C9HA 1JP4A 1MPCA 2QPQA 3FXQA 4I1DA 1MXWA 4O3AA 4P0GA 3TCGA 5I56B 4N81A 1B1HA 4ELRA 1FQFA 1MY4A 3HHFA 1IIWA 1UQWA 2CMOA 1MY2A 1FPGA 2XX8A 3S9LC 5CMKA 2WEFA 1MQIA 4MX6A 2OJTA 2CZHA 4WKMA 3ECRA 1MG1A 5CM6A 1NV6A 1RDYA 1NV5A 3E13X 1LBBA 4IO2A 4UABA 1OLAA 3TDJA 4PDDA 1FTMA 4DIGA 2DWAA 3K6XA 4G68A 3O28A 5IZ1A 4DZ1A 2Z8DA 4KD5A 3BKIB 1Y1ZA 1GTKA 3OSRA 1XI6A 4LZ8A 3EQ1A 1P1NA 2H9BA 3JV9A 4OVJA 5JTYA 1HSEA 3KSJA 5DW8A 2ZXTA 4FAJA 1FPBA 3IB1A 2WBDA 4O3CA 3HV1A 5DEXA 2NXOA 5AA4A 5ELVA 4JVDA 4OXVA 2XX9A 3VE1B 3CSBA 3W9VA 2V4CA 4YB7A 4I8CA 1A40A 3FD3A 5EYFA 1D9QA 2X26A 5HBCA 3VV5A 3MZBA 1PBQA 2RC7A 5IZ3A 4P47A 2QVUA 3FVOA 5FBPA 3Q27A 1US4A 2F78A 3B6TA 5I3SA 3IORA 5LDZA 2GHBA 3K4UA 3TELA 2D5WA 4PQJA 2XA5A 1Z7ME 2HAVA 3S9MC 1MM7A 1B51A 2OK2A 4GXAA 4ISUA 3ZKLA 1MXZA 1O63A 4R73A 3IX1A 3SDFA 3SEUA 3T93B 4G2ZA 3E4RA 5IAIA 1IXCA 4H5FA 4WXJA 1ZBMA 4IO4A 4X1DA 4KYDA 1FPDA 3B7DA 4QFKA 1G0IA 2Y5LA 5EYHA 1FBHA 1QULA 2O69A 3EHSA 1OQGA 4R74A 3GBBA 3RQTA 4ZZAA 2B3FA 1P1QA 4YKIA 1BKAA 1Y3NA 5H8FB 3TQWA 1H43A 4N6DA 3IJXB 1OMPA 1NL5A 3U92A 4YZZA 2QRYA 5KCJB 3A3CA 1LAFE 3KJTA 5TP9B 1DCUA 1VFEA 3CHGA 3G3GA 3MW0A 1M5EA 4LUBA 3G3FA 4K3FA 2HZKA 2UYEA 4H67A 2ZYNA 1Y20A 4U4SA 3W9WA 2DWJA 3PUXE 3TQLA 3G3JA 2ZYOA 4G8MA 5F1QA 3VLVA 2O1MA 4DXUA 4IO7A 1T0KA 1TXFA 5H8HA 3VVEA 3RNNA 2YPNA 4KCDA 1NI9A 4BDNA 4R72A 4NF4B 3BFTA 2B3BA 1LAXA 4MNCA 4XFEA 4YKKA 3PTYA 4QXDA 5LOMA 1OQHA 4OHNA 3ODBA 3VXCA 4F2OA 3LSLA 4XKQA 4I3YA 4ZEIA 5H8NA 4N15A 4JVCA 1I6AA 2UVGA 1YAEA 1WVJA 4YKPA 1SD3A 1GR2A 4PGPA 4JXIA 4DI4B 2NOOA 4KI0E 4X04A 2ABHA 2F8DA 3MJNA 2A5TA 1FBFA 3KEIA 5FTHA 1Z7NE 1B4ZA 1OIBA 5A5XB 1H44A 4PFRA 4OESA 2HQ0A 1XHYA 2XXUA 3M3FA 4ZS9A 1B3FA 1SW4A 1DOTA 1AH5A 4UACA 3O2AA 3M8UA 2WYKA 3P7IA 2UVJA 3OEMA 4POWA 4Z7EA 3FZVA 2ZNSA 1Y3PA 5TPAB 5IZZA 1FQBA 1D4NA 1D9YA 4LN5A 5DYHA 4ZEDA 3JYRA 1B58A 4QSEA 3GZGA 5DT6A 3U93A 3PUWE 1XT8A 3MPKA 2QVRA 4P3LA 3I3VA 2R71A 1LAGE 1POTA 1K9YA 4OTEA 1FJ9A 4IO5A 1QVSA 2PX1A 3C31A 1URSA 4IO6A 4Z0IA 2F35A 1B5IA 3GYYA 4EXLA 3VVFA 2P3VA 2E1SA 4NG7A 5KDTA 1BP5A 2Z23A 1A99A 4OEVA 1EZ9A 1NV4A 4JSDA 1B3LA 2RINA 2F34A 2XWKA 1PB7A 1URGA 2CZIA 2DS9A 4MHFA 3FIRA 1MRPA 2XWOA 4LATA 3M3LA 1EU8A 1FBGA 1DTGA 4F3BA 1FTAA 5K2YA 3DM0A 4O94A 4GX4A 1EYJA 1MY0A 2PBWA 1FPJA 1QW0A 4PFTA 3IL1B 4R2BA 1H3DA 2ONKE 1FBPA 3K00A 4EQBA 1N7WA 1YXIA 4R6HA 5T3JA 4DE8A 4FATA 3C35A 3F11A 3RLFE 1K9ZA 3T96B 3CR9A 5ET5A 4U4XA 1LGBC 4NF5B 1BK4A 2UXAA 4GFRA 2QVVA 3RTWB 1FPEA 3QYTA 4P9KA 4ZZEA 1VR5A 4HCWA 3V83A 2HFBA 4AS4A 2RCAA 4DXBA 3OELA 3EKIA 4MNPA 1F9BA 1SDXA 5AA2D 4QHQA 5AA2B 4E0XA 3MP8A 4NWCA 3LSXA 2PYYA 3KN3A 4YAHX 2Y7WA 4IB2A 4N91A 1VE4A 3K1NA 2QS1A 3JZJA 4MEVA 4MFIA 4LZ7A 3R6UA 4OFLA 2ESNA 2QS3A 4GWWA 1EH3A 1N04A 4NAPA 4OVTA 2P3NA 2ONSA 4U21A 5I56A 3BIGA 5M2VA 1Q35A 2XXIA 4FORA 1QUJA 3QMFA 3IFCA 3VLWA 1B7ZA 5I2NB 1TFDA 4TQUQ 4G4PA 2I4CA 2I49A 4R2FA 1XVYA 2O51A 3S2VA 2FIXA 2NWJA 1CE2A 1XS5A 4PFWA 4F18A 3K1MA 2Y84A 3ILTB 4PAFA 5EQAA 1MPBA 1OVTA 4H0WA 5DVJA 3U94A 2VGQA 2F7CA 1XC1A 1AL3A 3HHGA 2Q8JA 4GWUA 1OVBA 5F24A 2VPNA 3SETA 4HS7A 3SKPA 1YCJA 1YTVA 3OD7A 1FW0A 5ET6A 2XWVA 3TZAA 1WDNA 4JB7A 3FBPA 4XXUA 4ZDMA 5H8QB 2FBPA 3OO8A 3H6TA 1D9VA 1SW2A 3PPQA 2AL5A 3PU5A 4ESXA 3S9EA 4MIJA 1MY3A 1B4HA 3G3IA 1TT1A 2RCBA 2B4MA 1B52A 3IR1A 3T9VA 1JNFA 4GWXA 4MJOA 5IKBA 2KLFA 4ONYA 4PFBA 4BDQA 1Q9DA 2RF1A 3SEVA 4JVIA 4M4GA 3KBRA 3T9HB 3RPLB 3CFZA 3K6VA 1ZTYA 3K1PA 4P0IA 3IOWA 2KQZA 3IOTA 4HE2A 2V3TA 4JSOA 5L9SA 3LUYA 1NNKA 1IMFA 3TCFA 4F19A 4KPTA 2DQVA 3VDFA 3GLBA 2IEEA 4GWYA 4HE0A 3V89B 2RC9A 1A55A 4PF8A 3AXFA 3DELB 4OANA 1S9TA 4N4UA 1JQFA 2ONRA 5I57B 4FIMA 4G61A 5H8FA 2W7YA 2CEXA 4OETA 3C33A 4LQ2A 4QFLA 3FJMA 1NFTA 5FHOA 1KZ8A 1ZMGA 4N17A 5KCJA 3D1RA 4I40A 1A8FA 1MQHA 2FNCA 3FV2A 5TP9A 4G8NA 4QFPA 1SYIA 2PFYA 4LVQA 1LCTA 4NF8B 2LAOA 4YMAA 4HXVA 4Q30B 1Q1KA 4EF2A 4NTLA 4WEPA 4QSDA 5DTBA 4QRZA 2Q2CA 4IO3A 3V8XB 2QL3A 2QS2A 3QK6A 3T0JA 3WAEA 5I2KB 3LC8A 4NF4A 2NVUB 1JW5A 4XF5A 1L5TA 1Y1MA 4IGRA 1NH7A 1M5FA 3KOTA 4JWXA 3TKDA 3U1OA 1MXYA 3GXAA 4RPNA 4YMBA 2MKZA 2ZNUA 4RYAA 2ZZVA 5EQ7A 2GH9A 3D4GA 2BJJX 1M5CA 4OVQA 2VOZA 4KCCA 1FBDA 1IZ1A 3RUMA 2DXRA 3H4ZA 3TTKA 2I4BA 2DE2A 2HAUA 3PUYE 1B6HA 2R9JA 4FJPA 4OWDA 1BIYA 3I5OA 2I6EA 3G3KA 3O6GA 3MVWA 2I3WA 1IUDA 4ELPA 2QJEA 5A5XA 1XVXA 1FQCA 4MNIA 2ALUA 3IFAA 2XXXA 3OSQA 4LA9A 1O7TA 3UORA 3H7MA 4F29A 4NX1A 3PMWA 1M5DA 2M8CA 1AMFA 1IEJA 5I58B 2A5SA 4OA4A 1HSJA 2Y7RA 4ZECA 5TPAA 3T9XB 3PPOA 3B6WA 3MUQA 5ITOA 3SEWA 5CRYA 2V93A 4ZEFA 4OEUA 1JW4A 5HM4B 4H8IA 5LTCA 2V84A 5I59B 5CMMA 1CB6A 4P8BA 1LBZA 4NMYA 2HEUA 3I6VA 4NEDA 5I5PA 4GBVA 4GX6A 2Y7PA 2L5VA 1SVXB 2V3UA 2UVIA 3BBRA 3CI8A 1SBPA 1P1UA 1INPA 1ZJLA 4R75A 3MVZA 2ANJA 1IMEA 4X8RA 2O68A 1ANFA 4NE4A 2QSXA 1FCKA 3DP6A 3PD8A 1RYXA 1SW1A 4PFIA 1GV8A 1N84A 3HSTA 3IB2A 1FTJA 4GD5A 1SI1A 4U23A 4PP0A 1IMBA 2OZZA 1FBEA 1DBZA 3LR1A 1DTZA 1B0LA 1FJ6A 3TYHA 2XXYA 2OWZA 2Y5KA 4OZ9A 4PBQA 4PFYA 4PETA 2QFLA 4RK9A 4PBHA 1JVXA 3KFMA 3H3GA 4RY1A 3IO4A 2GQ1A 1RKMA 3FVKA 2CZKA 3OO6A 4DXCA 5ET8A 1FQEA 3RT8A 2WYPA 2REJA 2WBBA 1AOVA 3UK4A 3B50A 1QUIA 1B3HA 3EHUA 3DP8A 4IGTA 5AA2A 1G0HA 2XXVA 2ZMBA 1R9QA 4QSCA 5FTIA 3UIFA 2XX7A 1NV7A 4R9GA 3L6HA 5J1DA 3MSTA 4GL8A 3KGCA 4R6YA 3FUZA 2R6GE 3R7XA 2ZYKA 3FASA 3E3KA 4F39A 3WAFA 4KYSA 4O7MA 3TTRA 4DDDA 1PBPA 2AYSA 1JEVA 2YJPA 4ELQA 1R9LA 2E0SA 4KHZE 3KZGA 5L9MA 2P2AA 3ZSFA 3U72A 1SYHA 2GHAA 2V25A 5I2NA 2DOJA 2CZLA 1B32A 3FXRA 1IMDA 3MQ9A 2XXWA 3HFUA 1B0HA 2O1LA 3L6GA 1LBVA 4NQ8A 3M3KA 1SI0A 4I9DA 4TLLB 3VLUA 5I7IA 1LFGA 3BFUA 3KJ7A 3IOVA 3SEXA 1YZ0A 5CBRA 2PT1A 2NUVA 4G68C 5H8QA 3VXBA 1FBCA 4QBAA 3LV0A 4G77A 2QMWA 3QUJA 2FIEA 3KN7A 1DMBA 1PB9A 2Q9TA 4FEDA 4OFOA 5BUUA 4H65A 4RPOA 4X1BA 4NWDA 4BDOA 1ATGA 4GWZA 5ISUA 3QUFA 3LBSA 4DCYA 3BIHA 5JK4A 3OO7A 1NV2A 2H4IA 4GRKA 3N94A 1AIVA 1ZIUA 1EZPA 2GFEA 4POXA 1P99A 4GQOA 4P1LA 1B5HA 3RPLA 3KOSA 4THIA 1OLCA 3E79A 2WX9A 3G7WA 4N07A 2O7UA 5F7VA 3N5LA 4PDHA 2XD2A 3QIMA 2THIA 4YB5A 1JEUA 2DYXA 2Z22A 1M5BA 3T66A 4JWYA 1A7LA 1AWBA 1P1OA 1DPPA 3MZ1A 3THIA 4RA1A 3MP1A 1JW1A 4U1ZA 4R9FA 5I84A 4MAGA 4M1VA 3C36A 1IMAA 3MP6A 2P0SA 3TTMA 2VD3A 3N26A 3UP9A 2F97A 4F22A 3RN8A 3VFJA 5EQ8A 4KQPA 3CIJA 3PD9A 1NV0A 4H1XA 3O9PA 5EQ9A 4PF6A 2H5YA 1ZKBA 4OVPA 1IMCA 1UTHB 4NHBA 4NF8A 2X7QA 5DVIA 1N76A 3DLNA 3RTFB 1MQGA 5BWJA 1FRPA 5EHSA 3SESA 3FJ7A 4KFQA 1N0TA 1MH4A 3IJOB 4FE8A 2OLBA 2O84X 3D4CA 5I2KA 2OCUA 3FXUA 3ZKKA 4PC9A 2OWTA 2QMXA 3HN0A 4OMBA 2DDKA 4MCOA 5L8DA 2VHAA 2F6PA 3CRBA 4ESWA 1IITA 4GVOA 4G8HA 4PGNA 1FSAA 5EHMA 4U22A 4I62A 1LBYA 2DE4A 4GLIA 2VT5A 2I58A 4BDRA 3KC0A 1B40A 2JJKA 3V5AA 1QUKA 3TTLA 2DWHA 2B65A 3A09A 2CEYA 1N7XA 3CSGA 2DP8A 4XKNA 1FTOA 1NUWA 4IR8A 3FVNA 4JWOA 1VFDA 4U2RA 4E0WA 2R8TA 3QXMA 3ISPA 5I58A 4TLMB 4YU0A 1B3EA 3LSWA 2DE3A 2VD2A 4H45A 3C34A 5EYGA 2H25A 1NV3A 2BJIA 2QS4A 3EN3A 4EQ9A 4YICA 3FXBA 3K02A 3UN6A 2F5XA 4LZ5A 4NGUA 4N8YA 1WODA 1UTBB 4ECFA 4N6PA 4F1VA 4C1UA 2Q2AA 2ZZXA 3SZPA 1II5A 2GRVA 3NOHA 3CG3A 5KZTA 3OXNA 1VSOA 1QJMA 5CMCA 1LSTA 5HPQA 1NH8A 4UA8A 2DVZA 1MXVA 2HZLA 4RJZA 2ZYMA 1DK4A 5JEIA 4HE1A 4Q8RA 2PFZA 2F3BA 4BDLA 1XOCA 4ZE9A 1H45A 4HTGA 4GXSB 1BLFA 3PMVA 1JETA 2O6AA 1EZOA 5ET7A 4AB5A 1N3XA 3MC2A 4H6DA 3K01A 3H6VA 4FBPA 3N6TA 5L9OA 1IQ7A 1VDWA 4OVRA 1DSNA 4NF6B 1RDXA 4NN3A 4KXPA 3T1BA 3PMXA 3A29A 5IGAA 1P1WA 3MZ9A 2Z8EA 3ZS6A 3H06B 2Q74A 4OVSA 2VP1A 1FPLA 1LBWA 4GX3A 1RYOA 4I3EA 4F31B 1USYH 3O6HA 4ZEBA 1I69A 1YYZA 1LBXA 1EYIA 4ZEKA 1NUXA 3ILUB 4N6KA 3Q26A 3EHTA 2Y7KA 1HSLA 3W15C 4U1OA 3O97A 3Q29A 4ZE8A 3U65A 4X9TA 5ICQA 5H8SA 1FPFA 2Q8MA 1Y9UA 3MYUA 3R26A 3Q25A 1NUZA 1FPKA 1ZLQA 1Y3QA 5CMBA 4MF3A
chains in the Genus database with same CATH topology
2UYFA 3CFLA 4MH5A 2RC8A 2P1SA 4GIZA 3PUVE 4FEBA 1NNFA 1SW5A 3ONMA 1B5JA 2PVUA 4XKRA 4XKPA 3OMBA 2F7BA 1LAHE 3RPWA 2RKMA 4WEDA 3H6WA 3CG1A 3PGFA 1B7UA 2OBGA 4EUOA 1J1NA 3PUZE 1DPEA 4R6KA 1NNPA 1MQDA 3U8QA 1B9JA 4F1UA 3MVYA 2F6GA 1TWYA 1ZU0A 2H98A 1GVCA 4G68B 3C4MA 3FATA 4YKJA 3K6UA 3EF7A 1LBCA 3N6UA 5ITPA 4NF5A 2AL4A 1I6BA 2DXYA 2YLNA 2PMSA 1FTLA 5JTYB 1PDAA 1UIUA 4GWOA 4BLAA 3MVXA 5DEXB 1NNTA 1ELJA 5AA4B 1MDP1 2O7IA 2XXPA 1MDQA 1SQYA 2PT2A 1JVYA 3UA8A 3OOAA 4GL0A 3SEYA 1PC3A 4C1TA 2DSFA 5CI5A 2Q89A 4O3BA 4P11A 4XIGQ 4LP2B 1YPNA 3T22A 1D3KA 3KSXA 1POY1 3HCQA 1B3GA 4AQ4A 2XHDA 3O6IA 4Q0CA 3RY3A 1UIVA 2I0BA 2I48A 3FGSA 3B6QA 3IK6B 2HXWA 4BDMA 3QAXA 1NMUA 3TFLA 3TTNA 1UTHA 1LFHA 1B2HA 4RK2A 4QF9A 4GOTA 3FJGA 3S4UA 3K0VA 5ICTA 4EQ7A 4IY6A 4MLQA 4OYVA 1B1XA 3TEPA 3FVGA 1PB8A 2F36A 4YB6A 1B7HA 4FECA 4GF8A 1KWHA 3DP4A 4C0RA 1TFAA 4OFJA 3T9UA 3IO6A 3EPEA 4LQ5A 1MY1A 2XXRA 4XTCQ 4ND9A 3SERA 5AA3A 2I3VA 4KYEA 1N3WA 3TCHA 4IY5A 3OEKA 3TAJA 1B05A 2ZNTA 5H8HB 1MQJA 5K2XA 3UGWA 1I6QA 2FA7A 4F3SA 2G93A 1IXIA 3S9NC 3HPIA 2Y7IA 1B46A 1LB9A 3KG2A 2Z8FA 3K2DA 4KR5A 3OO9A 2X7PA 1MM6A 4X48A 3TMGA 3KN8A 3O29A 4RNSA 5H8NB 3FV1A 3PPRA 4EDPA 2FYIA 4QFNA 4ELOA 4RXLA 3RT6B 3HO7A 1R6ZA 1FQDA 1MS7A 3CVGA 3PV0E 2I0CA 2A5TB 2DVCA 2D3IA 4OENA 3H6UA 3TODA 5B7DA 1UTBA 1USYE 5FHMA 3MWBA 5CC2A 2XXQA 4LONB 4EF1A 2DWIA 5I57A 3RGYA 4H8JA 5DVFA 1A54A 2REGA 2HCAA 3TUSA 5B70A 2UVHA 3PPPA 1GGGA 4DCXA 1IXHA 1QKBA 2D21A 3QSLA 1LLSA 1MXUA 2XXTA 4TOZA 1PEBA 2H99A 1MH3A 3TPAA 2V3QA 2F7AA 3VVDA 4AB6A 2AIXA 3K6WA 1US5A 2G29A 4F2QA 5CBSA 3MAMA 5KDTB 3H03A 1MXXA 4N13A 1Y4CA 4F3PA 2XXHA 4HCYA 4EXKA 1LFIA 4NF6A 3GBAA 3G3HA 2IA4A 1R1NA 3USDA 5AE4A 4F3GA 3IB0A 4JDFA 4F1YA 2WKYA 3O66A 4HW8A 1IXGA 4PE5B 4OERA 1FQAA 2OWSA 4L17A 3IOUA 4H5GA 1O64A 5TU0A 3Q28A 4MLVA 5AA1A 3A3UA 1FTKA 1MPDA 3E9XA 1NKXA 5FHNA 1LCFA 1A8EA 3MPLA 3OENA 3IAZA 3MBPA 3CFXA 1S50A 4Q5TA 1LB8A 1S7YA 4MBPA 1H76A 1Y4TA 3PPNA 5I59A 2Q88A 4DLDA 4PFUA 3C32A 1URDA 4JBZA 4OQOA 1QKAA 2XD3A 3LSFB 4QFOA 1BTJA 3C9HA 1MPCA 2QPQA 3FXQA 4I1DA 1MXWA 4O3AA 4P0GA 3TCGA 5I56B 1B1HA 4ELRA 1FQFA 1MY4A 3HHFA 1IIWA 1UQWA 2CMOA 1MY2A 2XX8A 3S9LC 5CMKA 1MQIA 2OJTA 4WKMA 3ECRA 1MG1A 5CM6A 3E13X 1LBBA 4IO2A 3TDJA 1OLAA 1FTMA 4DIGA 2DWAA 3K6XA 4G68A 3O28A 4DZ1A 2Z8DA 4KD5A 3BKIB 1Y1ZA 1GTKA 3OSRA 4LZ8A 3EQ1A 1P1NA 2H9BA 3JV9A 4OVJA 5JTYA 1HSEA 3KSJA 2ZXTA 4FAJA 3IB1A 4O3CA 3HV1A 5DEXA 2NXOA 5AA4A 5ELVA 4OXVA 2XX9A 3VE1B 3CSBA 3W9VA 4YB7A 4I8CA 1A40A 3FD3A 5EYFA 2X26A 5HBCA 3VV5A 3MZBA 1PBQA 2RC7A 3FVOA 3Q27A 1US4A 2F78A 3B6TA 3IORA 2GHBA 3K4UA 3TELA 2D5WA 4PQJA 1Z7ME 2HAVA 3S9MC 1MM7A 1B51A 2OK2A 4GXAA 4ISUA 3ZKLA 1MXZA 1O63A 4R73A 3IX1A 3SDFA 3SEUA 3T93B 4G2ZA 3E4RA 5IAIA 1IXCA 4H5FA 4WXJA 1ZBMA 4IO4A 4X1DA 4KYDA 3B7DA 4QFKA 1QULA 2O69A 3EHSA 1OQGA 4R74A 3GBBA 3RQTA 4ZZAA 2B3FA 1P1QA 4YKIA 1BKAA 1Y3NA 5H8FB 3TQWA 1H43A 3IJXB 1OMPA 1NL5A 3U92A 4YZZA 2QRYA 5KCJB 3A3CA 1LAFE 3KJTA 5TP9B 1VFEA 3G3GA 3MW0A 1M5EA 4LUBA 3G3FA 4K3FA 2HZKA 2UYEA 4H67A 2ZYNA 1Y20A 4U4SA 3W9WA 2DWJA 3PUXE 3TQLA 3G3JA 2ZYOA 4G8MA 5F1QA 3VLVA 2O1MA 4DXUA 4IO7A 1T0KA 1TXFA 5H8HA 3VVEA 3RNNA 2YPNA 4KCDA 4BDNA 4R72A 4NF4B 3BFTA 2B3BA 1LAXA 4YKKA 5LOMA 1OQHA 4OHNA 3ODBA 3VXCA 4F2OA 3LSLA 4XKQA 4ZEIA 5H8NA 1I6AA 2UVGA 1YAEA 1WVJA 4YKPA 1SD3A 1GR2A 4JXIA 2NOOA 4KI0E 2ABHA 2F8DA 3MJNA 2A5TA 3KEIA 5FTHA 1Z7NE 1B4ZA 1OIBA 5A5XB 1H44A 4OESA 2HQ0A 1XHYA 2XXUA 3M3FA 4ZS9A 1B3FA 1SW4A 1DOTA 1AH5A 4UACA 3O2AA 3M8UA 3P7IA 2UVJA 3OEMA 4POWA 4Z7EA 3FZVA 2ZNSA 1Y3PA 5TPAB 1FQBA 1D4NA 1D9YA 5DYHA 4ZEDA 3JYRA 1B58A 4QSEA 3GZGA 5DT6A 3U93A 3PUWE 1XT8A 3MPKA 3I3VA 2R71A 1LAGE 1POTA 4OTEA 4IO5A 1QVSA 2PX1A 3C31A 1URSA 4IO6A 4Z0IA 2F35A 1B5IA 4EXLA 3VVFA 2E1SA 5KDTA 1BP5A 2Z23A 1A99A 4OEVA 1EZ9A 4JSDA 1B3LA 2RINA 2F34A 1PB7A 1URGA 2DS9A 3FIRA 1MRPA 4LATA 3M3LA 1EU8A 4F3BA 1DTGA 5K2YA 3DM0A 1MY0A 2PBWA 1QW0A 4PFTA 3IL1B 4R2BA 1H3DA 2ONKE 3K00A 4EQBA 1N7WA 4R6HA 4DE8A 4FATA 3C35A 3F11A 3RLFE 3T96B 3CR9A 4U4XA 1LGBC 4NF5B 2UXAA 4GFRA 3RTWB 3QYTA 4ZZEA 1VR5A 4HCWA 3V83A 2HFBA 2RCAA 4DXBA 3OELA 1F9BA 1SDXA 5AA2D 4QHQA 5AA2B 4E0XA 3MP8A 4NWCA 3LSXA 2PYYA 3KN3A 4YAHX 2Y7WA 4IB2A 1VE4A 3K1NA 2QS1A 3JZJA 4MFIA 4LZ7A 3R6UA 4OFLA 2ESNA 2QS3A 1EH3A 1N04A 2ONSA 4U21A 5I56A 5M2VA 1Q35A 2XXIA 4FORA 1QUJA 3VLWA 1B7ZA 5I2NB 1TFDA 4TQUQ 4G4PA 2I4CA 2I49A 4R2FA 1XVYA 2O51A 3S2VA 2NWJA 1CE2A 1XS5A 4PFWA 4F18A 3K1MA 2Y84A 3ILTB 1MPBA 1OVTA 4H0WA 5DVJA 3U94A 2VGQA 2F7CA 1XC1A 1AL3A 3HHGA 2Q8JA 1OVBA 3SETA 4HS7A 3SKPA 1YCJA 1YTVA 3OD7A 1FW0A 3TZAA 1WDNA 4JB7A 4XXUA 4ZDMA 5H8QB 3OO8A 3H6TA 1D9VA 1SW2A 3PPQA 2AL5A 3PU5A 4ESXA 3S9EA 1MY3A 1B4HA 3G3IA 1TT1A 2RCBA 1B52A 3IR1A 3T9VA 1JNFA 5IKBA 2KLFA 4ONYA 4BDQA 2RF1A 3SEVA 4M4GA 3KBRA 3T9HB 3CFZA 3K6VA 1ZTYA 3K1PA 4P0IA 3IOWA 3IOTA 2V3TA 4JSOA 5L9SA 3LUYA 1NNKA 3TCFA 4F19A 4KPTA 2DQVA 3VDFA 3GLBA 2IEEA 3V89B 2RC9A 1A55A 3AXFA 3DELB 1S9TA 1JQFA 2ONRA 5I57B 4FIMA 5H8FA 2W7YA 4OETA 3C33A 4LQ2A 4QFLA 3FJMA 1NFTA 5FHOA 1ZMGA 5KCJA 1A8FA 1MQHA 5TP9A 2FNCA 3FV2A 4G8NA 4QFPA 1SYIA 4LVQA 1LCTA 4NF8B 2LAOA 4YMAA 4Q30B 1Q1KA 4EF2A 4NTLA 4WEPA 4QSDA 5DTBA 4QRZA 2Q2CA 4IO3A 3V8XB 2QL3A 2QS2A 3QK6A 3WAEA 5I2KB 3LC8A 4NF4A 2NVUB 1JW5A 1L5TA 1Y1MA 4IGRA 1NH7A 1M5FA 3KOTA 4JWXA 3TKDA 3U1OA 1MXYA 3GXAA 4RPNA 4YMBA 2ZNUA 4RYAA 2GH9A 3D4GA 2BJJX 1M5CA 2VOZA 4KCCA 1IZ1A 3RUMA 2DXRA 3H4ZA 3TTKA 2I4BA 2DE2A 2HAUA 3PUYE 1B6HA 2R9JA 4FJPA 4OWDA 1BIYA 3I5OA 2I6EA 3G3KA 3O6GA 3MVWA 2I3WA 1IUDA 4ELPA 2QJEA 5A5XA 1XVXA 1FQCA 2ALUA 2XXXA 3OSQA 4LA9A 1O7TA 3UORA 3H7MA 4F29A 3PMWA 1M5DA 2M8CA 1AMFA 1IEJA 5I58B 2A5SA 1HSJA 2Y7RA 4ZECA 5TPAA 3T9XB 3PPOA 3B6WA 3MUQA 5ITOA 3SEWA 5CRYA 2V93A 4ZEFA 4OEUA 1JW4A 5HM4B 4H8IA 2V84A 5I59B 5CMMA 1CB6A 4NMYA 2HEUA 3I6VA 4NEDA 2Y7PA 1SVXB 2V3UA 2UVIA 3BBRA 3CI8A 1SBPA 1P1UA 1ZJLA 4R75A 3MVZA 2ANJA 2O68A 1ANFA 4NE4A 2QSXA 1FCKA 3DP6A 3PD8A 1RYXA 1SW1A 1GV8A 1N84A 3HSTA 3IB2A 1FTJA 4GD5A 1SI1A 4U23A 4PP0A 2OZZA 3LR1A 1DTZA 1B0LA 3TYHA 2XXYA 4OZ9A 4PFYA 4PETA 4RK9A 1JVXA 3KFMA 3H3GA 4RY1A 3IO4A 1RKMA 3FVKA 3OO6A 4DXCA 1FQEA 3RT8A 2REJA 1AOVA 3UK4A 1QUIA 1B3HA 3EHUA 3DP8A 4IGTA 5AA2A 2XXVA 2ZMBA 1R9QA 4QSCA 5FTIA 3UIFA 2XX7A 4R9GA 3L6HA 5J1DA 4GL8A 3KGCA 4R6YA 3FUZA 2R6GE 3R7XA 2ZYKA 3FASA 3E3KA 4F39A 3WAFA 4KYSA 3TTRA 4DDDA 1PBPA 2AYSA 1JEVA 2YJPA 4ELQA 1R9LA 2E0SA 4KHZE 3KZGA 5L9MA 2P2AA 3ZSFA 3U72A 1SYHA 2GHAA 2V25A 5I2NA 2DOJA 2CZLA 1B32A 3FXRA 3MQ9A 2XXWA 1B0HA 2O1LA 3L6GA 3M3KA 1SI0A 4I9DA 4TLLB 3VLUA 1LFGA 3BFUA 3KJ7A 3IOVA 3SEXA 5CBRA 2PT1A 2NUVA 4G68C 5H8QA 3VXBA 4G77A 2QMWA 3QUJA 3KN7A 1DMBA 1PB9A 2Q9TA 4FEDA 4OFOA 5BUUA 4H65A 4RPOA 4X1BA 4NWDA 4BDOA 1ATGA 5ISUA 3QUFA 3LBSA 4DCYA 5JK4A 3OO7A 2H4IA 4GRKA 3N94A 1AIVA 1ZIUA 1EZPA 2GFEA 4POXA 1P99A 4GQOA 1B5HA 3KOSA 4THIA 1OLCA 3G7WA 4N07A 2O7UA 5F7VA 3N5LA 2XD2A 3QIMA 2THIA 4YB5A 1JEUA 2DYXA 2Z22A 1M5BA 3T66A 4JWYA 1A7LA 1P1OA 1DPPA 3MZ1A 3THIA 4RA1A 3MP1A 1JW1A 4U1ZA 4R9FA 5I84A 4M1VA 3C36A 3MP6A 2P0SA 3TTMA 2VD3A 3N26A 3UP9A 2F97A 4F22A 3RN8A 3VFJA 4KQPA 3CIJA 3PD9A 4H1XA 3O9PA 2H5YA 1ZKBA 1UTHB 4NF8A 2X7QA 5DVIA 1N76A 3DLNA 3RTFB 1MQGA 5BWJA 5EHSA 3SESA 3FJ7A 4KFQA 1N0TA 1MH4A 3IJOB 4FE8A 2OLBA 2O84X 3D4CA 5I2KA 2OCUA 3FXUA 3ZKKA 2OWTA 2QMXA 3HN0A 4OMBA 5L8DA 2VHAA 2F6PA 3CRBA 4ESWA 1IITA 4GVOA 4G8HA 5EHMA 4U22A 4I62A 2DE4A 4GLIA 2I58A 4BDRA 1B40A 3V5AA 1QUKA 3TTLA 2DWHA 2B65A 3A09A 1N7XA 3CSGA 2DP8A 4XKNA 1FTOA 3FVNA 4JWOA 1VFDA 4U2RA 4E0WA 3QXMA 5I58A 4TLMB 4YU0A 1B3EA 3LSWA 2DE3A 2VD2A 3C34A 2H25A 2QS4A 3EN3A 4EQ9A 4YICA 3K02A 3UN6A 2F5XA 4LZ5A 1WODA 1UTBB 4ECFA 4N6PA 4F1VA 4C1UA 2Q2AA 1II5A 2GRVA 3CG3A 5KZTA 3OXNA 1VSOA 1QJMA 5CMCA 1LSTA 5HPQA 1NH8A 4UA8A 2DVZA 1MXVA 2HZLA 4RJZA 2ZYMA 5JEIA 4Q8RA 4BDLA 1XOCA 4ZE9A 1H45A 4HTGA 4GXSB 1BLFA 3PMVA 1JETA 2O6AA 1EZOA 4AB5A 1N3XA 3MC2A 4H6DA 3K01A 3H6VA 3N6TA 5L9OA 1IQ7A 1DSNA 4NF6B 3PMXA 1P1WA 3MZ9A 2Z8EA 3ZS6A 3H06B 2VP1A 1RYOA 4F31B 1USYH 3O6HA 4ZEBA 1I69A 4ZEKA 3ILUB 3Q26A 3EHTA 2Y7KA 1HSLA 3W15C 4U1OA 3O97A 3Q29A 4ZE8A 4X9TA 5ICQA 5H8SA 1Y9UA 3R26A 3Q25A 1ZLQA 1Y3QA 5CMBA 4MF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYF A;  3CFL A;  4MH5 A;  2RC8 A;  2P1S A;  4GIZ A;  3PUV E;  4FEB A;  1NNF A;  1SW5 A;  3ONM A;  1B5J A;  2PVU A;  4XKR A;  4XKP A;  3OMB A;  2F7B A;  1LAH E;  3RPW A;  2RKM A;  4WED A;  3H6W A;  3CG1 A;  3PGF A;  1B7U A;  2OBG A;  4EUO A;  1J1N A;  3PUZ E;  1DPE A;  4R6K A;  1NNP A;  1MQD A;  3U8Q A;  1B9J A;  4F1U A;  3MVY A;  2F6G A;  1TWY A;  1ZU0 A;  2H98 A;  1GVC A;  4G68 B;  3C4M A;  3FAT A;  4YKJ A;  3K6U A;  3EF7 A;  1LBC A;  3N6U A;  5ITP A;  4NF5 A;  2AL4 A;  1I6B A;  2DXY A;  2YLN A;  2PMS A;  1FTL A;  5JTY B;  1PDA A;  1UIU A;  4GWO A;  4BLA A;  3MVX A;  5DEX B;  1NNT A;  1ELJ A;  5AA4 B;  1MDP 1;  2O7I A;  2XXP A;  1MDQ A;  1SQY A;  2PT2 A;  1JVY A;  3UA8 A;  3OOA A;  4GL0 A;  3SEY A;  1PC3 A;  4C1T A;  2DSF A;  5CI5 A;  2Q89 A;  4O3B A;  4P11 A;  4XIG Q;  4LP2 B;  1YPN A;  3T22 A;  1D3K A;  3KSX A;  1POY 1;  3HCQ A;  1B3G A;  4AQ4 A;  2XHD A;  3O6I A;  4Q0C A;  3RY3 A;  1UIV A;  2I0B A;  2I48 A;  3FGS A;  3B6Q A;  3IK6 B;  2HXW A;  4BDM A;  3QAX A;  1NMU A;  3TFL A;  3TTN A;  1UTH A;  1LFH A;  1B2H A;  4RK2 A;  4QF9 A;  4GOT A;  3FJG A;  3S4U A;  3K0V A;  5ICT A;  4EQ7 A;  4IY6 A;  4MLQ A;  4OYV A;  1B1X A;  3TEP A;  3FVG A;  1PB8 A;  2F36 A;  4YB6 A;  1B7H A;  4FEC A;  4GF8 A;  1KWH A;  3DP4 A;  4C0R A;  1TFA A;  4OFJ A;  3T9U A;  3IO6 A;  3EPE A;  4LQ5 A;  1MY1 A;  2XXR A;  4XTC Q;  4ND9 A;  3SER A;  5AA3 A;  2I3V A;  4KYE A;  1N3W A;  3TCH A;  4IY5 A;  3OEK A;  3TAJ A;  1B05 A;  2ZNT A;  5H8H B;  1MQJ A;  5K2X A;  3UGW A;  1I6Q A;  2FA7 A;  4F3S A;  2G93 A;  1IXI A;  3S9N C;  3HPI A;  2Y7I A;  1B46 A;  1LB9 A;  3KG2 A;  2Z8F A;  3K2D A;  4KR5 A;  3OO9 A;  2X7P A;  1MM6 A;  4X48 A;  3TMG A;  3KN8 A;  3O29 A;  4RNS A;  5H8N B;  3FV1 A;  3PPR A;  4EDP A;  2FYI A;  4QFN A;  4ELO A;  4RXL A;  3RT6 B;  3HO7 A;  1R6Z A;  1FQD A;  1MS7 A;  3CVG A;  3PV0 E;  2I0C A;  2A5T B;  2DVC A;  2D3I A;  4OEN A;  3H6U A;  3TOD A;  5B7D A;  1UTB A;  1USY E;  5FHM A;  3MWB A;  5CC2 A;  2XXQ A;  4LON B;  4EF1 A;  2DWI A;  5I57 A;  3RGY A;  4H8J A;  5DVF A;  1A54 A;  2REG A;  2HCA A;  3TUS A;  5B70 A;  2UVH A;  3PPP A;  1GGG A;  4DCX A;  1IXH A;  1QKB A;  2D21 A;  3QSL A;  1LLS A;  1MXU A;  2XXT A;  4TOZ A;  1PEB A;  2H99 A;  1MH3 A;  3TPA A;  2V3Q A;  2F7A A;  3VVD A;  4AB6 A;  2AIX A;  3K6W A;  1US5 A;  2G29 A;  4F2Q A;  5CBS A;  3MAM A;  5KDT B;  3H03 A;  1MXX A;  4N13 A;  1Y4C A;  4F3P A;  2XXH A;  4HCY A;  4EXK A;  1LFI A;  4NF6 A;  3GBA A;  3G3H A;  2IA4 A;  1R1N A;  3USD A;  5AE4 A;  4F3G A;  3IB0 A;  4JDF A;  4F1Y A;  2WKY A;  3O66 A;  4HW8 A;  1IXG A;  4PE5 B;  4OER A;  1FQA A;  2OWS A;  4L17 A;  3IOU A;  4H5G A;  1O64 A;  5TU0 A;  3Q28 A;  4MLV A;  5AA1 A;  3A3U A;  1FTK A;  1MPD A;  3E9X A;  1NKX A;  5FHN A;  1LCF A;  1A8E A;  3MPL A;  3OEN A;  3IAZ A;  3MBP A;  3CFX A;  1S50 A;  4Q5T A;  1LB8 A;  1S7Y A;  4MBP A;  1H76 A;  1Y4T A;  3PPN A;  5I59 A;  2Q88 A;  4DLD A;  4PFU A;  3C32 A;  1URD A;  4JBZ A;  4OQO A;  1QKA A;  2XD3 A;  3LSF B;  4QFO A;  1BTJ A;  3C9H A;  1MPC A;  2QPQ A;  3FXQ A;  4I1D A;  1MXW A;  4O3A A;  4P0G A;  3TCG A;  5I56 B;  1B1H A;  4ELR A;  1FQF A;  1MY4 A;  3HHF A;  1IIW A;  1UQW A;  2CMO A;  1MY2 A;  2XX8 A;  3S9L C;  5CMK A;  1MQI A;  2OJT A;  4WKM A;  3ECR A;  1MG1 A;  5CM6 A;  3E13 X;  1LBB A;  4IO2 A;  3TDJ A;  1OLA A;  1FTM A;  4DIG A;  2DWA A;  3K6X A;  4G68 A;  3O28 A;  4DZ1 A;  2Z8D A;  4KD5 A;  3BKI B;  1Y1Z A;  1GTK A;  3OSR A;  4LZ8 A;  3EQ1 A;  1P1N A;  2H9B A;  3JV9 A;  4OVJ A;  5JTY A;  1HSE A;  3KSJ A;  2ZXT A;  4FAJ A;  3IB1 A;  4O3C A;  3HV1 A;  5DEX A;  2NXO A;  5AA4 A;  5ELV A;  4OXV A;  2XX9 A;  3VE1 B;  3CSB A;  3W9V A;  4YB7 A;  4I8C A;  1A40 A;  3FD3 A;  5EYF A;  2X26 A;  5HBC A;  3VV5 A;  3MZB A;  1PBQ A;  2RC7 A;  3FVO A;  3Q27 A;  1US4 A;  2F78 A;  3B6T A;  3IOR A;  2GHB A;  3K4U A;  3TEL A;  2D5W A;  4PQJ A;  1Z7M E;  2HAV A;  3S9M C;  1MM7 A;  1B51 A;  2OK2 A;  4GXA A;  4ISU A;  3ZKL A;  1MXZ A;  1O63 A;  4R73 A;  3IX1 A;  3SDF A;  3SEU A;  3T93 B;  4G2Z A;  3E4R A;  5IAI A;  1IXC A;  4H5F A;  4WXJ A;  1ZBM A;  4IO4 A;  4X1D A;  4KYD A;  3B7D A;  4QFK A;  1QUL A;  2O69 A;  3EHS A;  1OQG A;  4R74 A;  3GBB A;  3RQT A;  4ZZA A;  2B3F A;  1P1Q A;  4YKI A;  1BKA A;  1Y3N A;  5H8F B;  3TQW A;  1H43 A;  3IJX B;  1OMP A;  1NL5 A;  3U92 A;  4YZZ A;  2QRY A;  5KCJ B;  3A3C A;  1LAF E;  3KJT A;  5TP9 B;  1VFE A;  3G3G A;  3MW0 A;  1M5E A;  4LUB A;  3G3F A;  4K3F A;  2HZK A;  2UYE A;  4H67 A;  2ZYN A;  1Y20 A;  4U4S A;  3W9W A;  2DWJ A;  3PUX E;  3TQL A;  3G3J A;  2ZYO A;  4G8M A;  5F1Q A;  3VLV A;  2O1M A;  4DXU A;  4IO7 A;  1T0K A;  1TXF A;  5H8H A;  3VVE A;  3RNN A;  2YPN A;  4KCD A;  4BDN A;  4R72 A;  4NF4 B;  3BFT A;  2B3B A;  1LAX A;  4YKK A;  5LOM A;  1OQH A;  4OHN A;  3ODB A;  3VXC A;  4F2O A;  3LSL A;  4XKQ A;  4ZEI A;  5H8N A;  1I6A A;  2UVG A;  1YAE A;  1WVJ A;  4YKP A;  1SD3 A;  1GR2 A;  4JXI A;  2NOO A;  4KI0 E;  2ABH A;  2F8D A;  3MJN A;  2A5T A;  3KEI A;  5FTH A;  1Z7N E;  1B4Z A;  1OIB A;  5A5X B;  1H44 A;  4OES A;  2HQ0 A;  1XHY A;  2XXU A;  3M3F A;  4ZS9 A;  1B3F A;  1SW4 A;  1DOT A;  1AH5 A;  4UAC A;  3O2A A;  3M8U A;  3P7I A;  2UVJ A;  3OEM A;  4POW A;  4Z7E A;  3FZV A;  2ZNS A;  1Y3P A;  5TPA B;  1FQB A;  1D4N A;  1D9Y A;  5DYH A;  4ZED A;  3JYR A;  1B58 A;  4QSE A;  3GZG A;  5DT6 A;  3U93 A;  3PUW E;  1XT8 A;  3MPK A;  3I3V A;  2R71 A;  1LAG E;  1POT A;  4OTE A;  4IO5 A;  1QVS A;  2PX1 A;  3C31 A;  1URS A;  4IO6 A;  4Z0I A;  2F35 A;  1B5I A;  4EXL A;  3VVF A;  2E1S A;  5KDT A;  1BP5 A;  2Z23 A;  1A99 A;  4OEV A;  1EZ9 A;  4JSD A;  1B3L A;  2RIN A;  2F34 A;  1PB7 A;  1URG A;  2DS9 A;  3FIR A;  1MRP A;  4LAT A;  3M3L A;  1EU8 A;  4F3B A;  1DTG A;  5K2Y A;  3DM0 A;  1MY0 A;  2PBW A;  1QW0 A;  4PFT A;  3IL1 B;  4R2B A;  1H3D A;  2ONK E;  3K00 A;  4EQB A;  1N7W A;  4R6H A;  4DE8 A;  4FAT A;  3C35 A;  3F11 A;  3RLF E;  3T96 B;  3CR9 A;  4U4X A;  1LGB C;  4NF5 B;  2UXA A;  4GFR A;  3RTW B;  3QYT A;  4ZZE A;  1VR5 A;  4HCW A;  3V83 A;  2HFB A;  2RCA A;  4DXB A;  3OEL A;  1F9B A;  1SDX A;  5AA2 D;  4QHQ A;  5AA2 B;  4E0X A;  3MP8 A;  4NWC A;  3LSX A;  2PYY A;  3KN3 A;  4YAH X;  2Y7W A;  4IB2 A;  1VE4 A;  3K1N A;  2QS1 A;  3JZJ A;  4MFI A;  4LZ7 A;  3R6U A;  4OFL A;  2ESN A;  2QS3 A;  1EH3 A;  1N04 A;  2ONS A;  4U21 A;  5I56 A;  5M2V A;  1Q35 A;  2XXI A;  4FOR A;  1QUJ A;  3VLW A;  1B7Z A;  5I2N B;  1TFD A;  4TQU Q;  4G4P A;  2I4C A;  2I49 A;  4R2F A;  1XVY A;  2O51 A;  3S2V A;  2NWJ A;  1CE2 A;  1XS5 A;  4PFW A;  4F18 A;  3K1M A;  2Y84 A;  3ILT B;  1MPB A;  1OVT A;  4H0W A;  5DVJ A;  3U94 A;  2VGQ A;  2F7C A;  1XC1 A;  1AL3 A;  3HHG A;  2Q8J A;  1OVB A;  3SET A;  4HS7 A;  3SKP A;  1YCJ A;  1YTV A;  3OD7 A;  1FW0 A;  3TZA A;  1WDN A;  4JB7 A;  4XXU A;  4ZDM A;  5H8Q B;  3OO8 A;  3H6T A;  1D9V A;  1SW2 A;  3PPQ A;  2AL5 A;  3PU5 A;  4ESX A;  3S9E A;  1MY3 A;  1B4H A;  3G3I A;  1TT1 A;  2RCB A;  1B52 A;  3IR1 A;  3T9V A;  1JNF A;  5IKB A;  2KLF A;  4ONY A;  4BDQ A;  2RF1 A;  3SEV A;  4M4G A;  3KBR A;  3T9H B;  3CFZ A;  3K6V A;  1ZTY A;  3K1P A;  4P0I A;  3IOW A;  3IOT A;  2V3T A;  4JSO A;  5L9S A;  3LUY A;  1NNK A;  3TCF A;  4F19 A;  4KPT A;  2DQV A;  3VDF A;  3GLB A;  2IEE A;  3V89 B;  2RC9 A;  1A55 A;  3AXF A;  3DEL B;  1S9T A;  1JQF A;  2ONR A;  5I57 B;  4FIM A;  5H8F A;  2W7Y A;  4OET A;  3C33 A;  4LQ2 A;  4QFL A;  3FJM A;  1NFT A;  5FHO A;  1ZMG A;  5KCJ A;  1A8F A;  1MQH A;  5TP9 A;  2FNC A;  3FV2 A;  4G8N A;  4QFP A;  1SYI A;  4LVQ A;  1LCT A;  4NF8 B;  2LAO A;  4YMA A;  4Q30 B;  1Q1K A;  4EF2 A;  4NTL A;  4WEP A;  4QSD A;  5DTB A;  4QRZ A;  2Q2C A;  4IO3 A;  3V8X B;  2QL3 A;  2QS2 A;  3QK6 A;  3WAE A;  5I2K B;  3LC8 A;  4NF4 A;  2NVU B;  1JW5 A;  1L5T A;  1Y1M A;  4IGR A;  1NH7 A;  1M5F A;  3KOT A;  4JWX A;  3TKD A;  3U1O A;  1MXY A;  3GXA A;  4RPN A;  4YMB A;  2ZNU A;  4RYA A;  2GH9 A;  3D4G A;  2BJJ X;  1M5C A;  2VOZ A;  4KCC A;  1IZ1 A;  3RUM A;  2DXR A;  3H4Z A;  3TTK A;  2I4B A;  2DE2 A;  2HAU A;  3PUY E;  1B6H A;  2R9J A;  4FJP A;  4OWD A;  1BIY A;  3I5O A;  2I6E A;  3G3K A;  3O6G A;  3MVW A;  2I3W A;  1IUD A;  4ELP A;  2QJE A;  5A5X A;  1XVX A;  1FQC A;  2ALU A;  2XXX A;  3OSQ A;  4LA9 A;  1O7T A;  3UOR A;  3H7M A;  4F29 A;  3PMW A;  1M5D A;  2M8C A;  1AMF A;  1IEJ A;  5I58 B;  2A5S A;  1HSJ A;  2Y7R A;  4ZEC A;  5TPA A;  3T9X B;  3PPO A;  3B6W A;  3MUQ A;  5ITO A;  3SEW A;  5CRY A;  2V93 A;  4ZEF A;  4OEU A;  1JW4 A;  5HM4 B;  4H8I A;  2V84 A;  5I59 B;  5CMM A;  1CB6 A;  4NMY A;  2HEU A;  3I6V A;  4NED A;  2Y7P A;  1SVX B;  2V3U A;  2UVI A;  3BBR A;  3CI8 A;  1SBP A;  1P1U A;  1ZJL A;  4R75 A;  3MVZ A;  2ANJ A;  2O68 A;  1ANF A;  4NE4 A;  2QSX A;  1FCK A;  3DP6 A;  3PD8 A;  1RYX A;  1SW1 A;  1GV8 A;  1N84 A;  3HST A;  3IB2 A;  1FTJ A;  4GD5 A;  1SI1 A;  4U23 A;  4PP0 A;  2OZZ A;  3LR1 A;  1DTZ A;  1B0L A;  3TYH A;  2XXY A;  4OZ9 A;  4PFY A;  4PET A;  4RK9 A;  1JVX A;  3KFM A;  3H3G A;  4RY1 A;  3IO4 A;  1RKM A;  3FVK A;  3OO6 A;  4DXC A;  1FQE A;  3RT8 A;  2REJ A;  1AOV A;  3UK4 A;  1QUI A;  1B3H A;  3EHU A;  3DP8 A;  4IGT A;  5AA2 A;  2XXV A;  2ZMB A;  1R9Q A;  4QSC A;  5FTI A;  3UIF A;  2XX7 A;  4R9G A;  3L6H A;  5J1D A;  4GL8 A;  3KGC A;  4R6Y A;  3FUZ A;  2R6G E;  3R7X A;  2ZYK A;  3FAS A;  3E3K A;  4F39 A;  3WAF A;  4KYS A;  3TTR A;  4DDD A;  1PBP A;  2AYS A;  1JEV A;  2YJP A;  4ELQ A;  1R9L A;  2E0S A;  4KHZ E;  3KZG A;  5L9M A;  2P2A A;  3ZSF A;  3U72 A;  1SYH A;  2GHA A;  2V25 A;  5I2N A;  2DOJ A;  2CZL A;  1B32 A;  3FXR A;  3MQ9 A;  2XXW A;  1B0H A;  2O1L A;  3L6G A;  3M3K A;  1SI0 A;  4I9D A;  4TLL B;  3VLU A;  1LFG A;  3BFU A;  3KJ7 A;  3IOV A;  3SEX A;  5CBR A;  2PT1 A;  2NUV A;  4G68 C;  5H8Q A;  3VXB A;  4G77 A;  2QMW A;  3QUJ A;  3KN7 A;  1DMB A;  1PB9 A;  2Q9T A;  4FED A;  4OFO A;  5BUU A;  4H65 A;  4RPO A;  4X1B A;  4NWD A;  4BDO A;  1ATG A;  5ISU A;  3QUF A;  3LBS A;  4DCY A;  5JK4 A;  3OO7 A;  2H4I A;  4GRK A;  3N94 A;  1AIV A;  1ZIU A;  1EZP A;  2GFE A;  4POX A;  1P99 A;  4GQO A;  1B5H A;  3KOS A;  4THI A;  1OLC A;  3G7W A;  4N07 A;  2O7U A;  5F7V A;  3N5L A;  2XD2 A;  3QIM A;  2THI A;  4YB5 A;  1JEU A;  2DYX A;  2Z22 A;  1M5B A;  3T66 A;  4JWY A;  1A7L A;  1P1O A;  1DPP A;  3MZ1 A;  3THI A;  4RA1 A;  3MP1 A;  1JW1 A;  4U1Z A;  4R9F A;  5I84 A;  4M1V A;  3C36 A;  3MP6 A;  2P0S A;  3TTM A;  2VD3 A;  3N26 A;  3UP9 A;  2F97 A;  4F22 A;  3RN8 A;  3VFJ A;  4KQP A;  3CIJ A;  3PD9 A;  4H1X A;  3O9P A;  2H5Y A;  1ZKB A;  1UTH B;  4NF8 A;  2X7Q A;  5DVI A;  1N76 A;  3DLN A;  3RTF B;  1MQG A;  5BWJ A;  5EHS A;  3SES A;  3FJ7 A;  4KFQ A;  1N0T A;  1MH4 A;  3IJO B;  4FE8 A;  2OLB A;  2O84 X;  3D4C A;  5I2K A;  2OCU A;  3FXU A;  3ZKK A;  2OWT A;  2QMX A;  3HN0 A;  4OMB A;  5L8D A;  2VHA A;  2F6P A;  3CRB A;  4ESW A;  1IIT A;  4GVO A;  4G8H A;  5EHM A;  4U22 A;  4I62 A;  2DE4 A;  4GLI A;  2I58 A;  4BDR A;  1B40 A;  3V5A A;  1QUK A;  3TTL A;  2DWH A;  2B65 A;  3A09 A;  1N7X A;  3CSG A;  2DP8 A;  4XKN A;  1FTO A;  3FVN A;  4JWO A;  1VFD A;  4U2R A;  4E0W A;  3QXM A;  5I58 A;  4TLM B;  4YU0 A;  1B3E A;  3LSW A;  2DE3 A;  2VD2 A;  3C34 A;  2H25 A;  2QS4 A;  3EN3 A;  4EQ9 A;  4YIC A;  3K02 A;  3UN6 A;  2F5X A;  4LZ5 A;  1WOD A;  1UTB B;  4ECF A;  4N6P A;  4F1V A;  4C1U A;  2Q2A A;  1II5 A;  2GRV A;  3CG3 A;  5KZT A;  3OXN A;  1VSO A;  1QJM A;  5CMC A;  1LST A;  5HPQ A;  1NH8 A;  4UA8 A;  2DVZ A;  1MXV A;  2HZL A;  4RJZ A;  2ZYM A;  5JEI A;  4Q8R A;  4BDL A;  1XOC A;  4ZE9 A;  1H45 A;  4HTG A;  4GXS B;  1BLF A;  3PMV A;  1JET A;  2O6A A;  1EZO A;  4AB5 A;  1N3X A;  3MC2 A;  4H6D A;  3K01 A;  3H6V A;  3N6T A;  5L9O A;  1IQ7 A;  1DSN A;  4NF6 B;  3PMX A;  1P1W A;  3MZ9 A;  2Z8E A;  3ZS6 A;  3H06 B;  2VP1 A;  1RYO A;  4F31 B;  1USY H;  3O6H A;  4ZEB A;  1I69 A;  4ZEK A;  3ILU B;  3Q26 A;  3EHT A;  2Y7K A;  1HSL A;  3W15 C;  4U1O A;  3O97 A;  3Q29 A;  4ZE8 A;  4X9T A;  5ICQ A;  5H8S A;  1Y9U A;  3R26 A;  3Q25 A;  1ZLQ A;  1Y3Q A;  5CMB A;  4MF3 A; 
#chains in the Genus database with same CATH topology
 2UYF A;  4N8G A;  3CFL A;  4MH5 A;  4NF0 A;  2RC8 A;  2P1S A;  4GIZ A;  3PUV E;  2XXK A;  4FEB A;  1NNF A;  1SW5 A;  3ONM A;  2HXR A;  1B5J A;  2PVU A;  4XKR A;  4XKP A;  3KC1 A;  3OMB A;  2F7B A;  1LEV A;  1LAH E;  4GBW A;  3RPW A;  2RKM A;  4WED A;  3H6W A;  3CG1 A;  3PGF A;  3LUZ A;  1B7U A;  2OBG A;  4EUO A;  1J1N A;  3PUZ E;  4GWS A;  1DPE A;  4R6K A;  1NNP A;  1MQD A;  3U8Q A;  1B9J A;  4F1U A;  3MVY A;  2F6G A;  1TWY A;  3E78 A;  3B8B A;  1ZU0 A;  2H98 A;  1GVC A;  2KR0 A;  4G68 B;  3C4M A;  3FAT A;  4YKJ A;  3K6U A;  3EF7 A;  1LBC A;  2VPO A;  3N6U A;  5ITP A;  4NF5 A;  5J16 A;  2AL4 A;  1I6B A;  2DXY A;  2YLN A;  2PMS A;  1EYK A;  1FTL A;  5JTY B;  1PDA A;  1UIU A;  4GWO A;  4BLA A;  3MVX A;  4AS5 A;  5DEX B;  1NNT A;  1ELJ A;  5AA4 B;  1MDP 1;  2O7I A;  2XXP A;  1MDQ A;  1SQY A;  2PT2 A;  1JVY A;  3UA8 A;  3OOA A;  4GL0 A;  3SEY A;  1PC3 A;  4C1T A;  2DSF A;  5IZ3 B;  5CI5 A;  4H46 A;  1KA0 A;  2Q89 A;  4O3B A;  4P11 A;  4XIG Q;  4LP2 B;  1YPN A;  3T22 A;  1D3K A;  3KSX A;  4PAI A;  1POY 1;  3HCQ A;  1B3G A;  4AQ4 A;  4O7I A;  2XHD A;  3O6I A;  4Q0C A;  3RY3 A;  1UIV A;  2I0B A;  2I48 A;  1NUY A;  3FGS A;  4P1E A;  2XWI A;  3B6Q A;  3IK6 B;  2HPG A;  2HXW A;  4BDM A;  3QAX A;  1NMU A;  3TFL A;  3ROJ A;  3TTN A;  1UTH A;  1LFH A;  1B2H A;  4PTK A;  4RK2 A;  4QF9 A;  4GOT A;  3FJG A;  4O8M A;  3S4U A;  3K0V A;  5ICT A;  4EQ7 A;  4IY6 A;  4MLQ A;  4OYV A;  1B1X A;  5ESY A;  3TEP A;  3FVG A;  1PB8 A;  2F36 A;  4YB6 A;  1B7H A;  4FEC A;  2FHY A;  4GF8 A;  2FVZ A;  1KWH A;  2OX3 A;  3DP4 A;  4C0R A;  5A5L A;  1TFA A;  4OFJ A;  1SPI A;  3T9U A;  3IO6 A;  3EPE A;  4LQ5 A;  1MY1 A;  2XXR A;  4XTC Q;  4ND9 A;  3SER A;  5IM2 A;  5AA3 A;  2I3V A;  4KYE A;  1N3W A;  3TCH A;  4IY5 A;  3OEK A;  3TAJ A;  1B05 A;  2ZNT A;  5H8H B;  1MQJ A;  5K2X A;  3UGW A;  1I6Q A;  2FA7 A;  4F3S A;  2G93 A;  4P56 A;  1QGX A;  1IXI A;  3S9N C;  3HPI A;  2Y7I A;  3RYD A;  1B46 A;  1LB9 A;  3KG2 A;  2Z8F A;  3K2D A;  4KR5 A;  3OO9 A;  2X7P A;  1MM6 A;  4X48 A;  1CNQ A;  3TMG A;  3KN8 A;  3O29 A;  4RNS A;  5H8N B;  3FV1 A;  2B4L A;  3PPR A;  4EDP A;  2FYI A;  4QFN A;  4ELO A;  4RXL A;  3RT6 B;  3HO7 A;  1R6Z A;  1FQD A;  1MS7 A;  3CVG A;  3PV0 E;  2I0C A;  2A5T B;  2DVC A;  2D3I A;  4OEN A;  3H6U A;  3TOD A;  5B7D A;  1UTB A;  1USY E;  5FHM A;  3MWB A;  5CC2 A;  2XXQ A;  4LON B;  4EF1 A;  2DWI A;  5I57 A;  4PAK A;  3RGY A;  4H8J A;  5DVF A;  1A54 A;  2REG A;  2HCA A;  3TUS A;  5B70 A;  2UVH A;  3PPP A;  1GGG A;  1FPI A;  4DCX A;  1IXH A;  1QKB A;  4MMP A;  2D21 A;  3QSL A;  1LLS A;  1MXU A;  2XXT A;  4TOZ A;  1PEB A;  2H99 A;  1MH3 A;  3TPA A;  2V3Q A;  2F7A A;  3VVD A;  4AB6 A;  2AIX A;  3K6W A;  4PCD A;  1US5 A;  2G29 A;  4F2Q A;  5CBS A;  3MAM A;  5KDT B;  3H03 A;  1MXX A;  2PCR A;  4N13 A;  1Y4C A;  4F3P A;  2XXH A;  4HCY A;  4EXK A;  1LFI A;  4NF6 A;  3GBA A;  1KA1 A;  3G3H A;  2IA4 A;  1R1N A;  3USD A;  5AE4 A;  4F3G A;  3IB0 A;  4JDF A;  2HHM A;  4F1Y A;  2WKY A;  3O66 A;  2ZZW A;  4HW8 A;  1IXG A;  4PE5 B;  4OER A;  1FQA A;  2OWS A;  4L17 A;  3IOU A;  4H5G A;  1O64 A;  5TU0 A;  3Q28 A;  4MLV A;  4XEQ A;  3KBZ A;  5AA1 A;  3A3U A;  1FTK A;  1MPD A;  3E9X A;  1NKX A;  5FHN A;  1LCF A;  1A8E A;  1RDZ A;  3MPL A;  3OEN A;  4PE3 A;  2F3D A;  3IAZ A;  3MBP A;  3CFX A;  1S50 A;  4Q5T A;  1LB8 A;  1S7Y A;  4MBP A;  1H76 A;  1Y4T A;  3PPN A;  5I59 A;  2Q88 A;  4DLD A;  4PFU A;  1NV1 A;  3C32 A;  4DI3 D;  1URD A;  4JBZ A;  4OQO A;  1QKA A;  2XD3 A;  3LSF B;  4QFO A;  1BTJ A;  3C9H A;  1JP4 A;  1MPC A;  2QPQ A;  3FXQ A;  4I1D A;  1MXW A;  4O3A A;  4P0G A;  3TCG A;  5I56 B;  4N81 A;  1B1H A;  4ELR A;  1FQF A;  1MY4 A;  3HHF A;  1IIW A;  1UQW A;  2CMO A;  1MY2 A;  1FPG A;  2XX8 A;  3S9L C;  5CMK A;  2WEF A;  1MQI A;  4MX6 A;  2OJT A;  2CZH A;  4WKM A;  3ECR A;  1MG1 A;  5CM6 A;  1NV6 A;  1RDY A;  1NV5 A;  3E13 X;  1LBB A;  4IO2 A;  4UAB A;  1OLA A;  3TDJ A;  4PDD A;  1FTM A;  4DIG A;  2DWA A;  3K6X A;  4G68 A;  3O28 A;  5IZ1 A;  4DZ1 A;  2Z8D A;  4KD5 A;  3BKI B;  1Y1Z A;  1GTK A;  3OSR A;  1XI6 A;  4LZ8 A;  3EQ1 A;  1P1N A;  2H9B A;  3JV9 A;  4OVJ A;  5JTY A;  1HSE A;  3KSJ A;  5DW8 A;  2ZXT A;  4FAJ A;  1FPB A;  3IB1 A;  2WBD A;  4O3C A;  3HV1 A;  5DEX A;  2NXO A;  5AA4 A;  5ELV A;  4JVD A;  4OXV A;  2XX9 A;  3VE1 B;  3CSB A;  3W9V A;  2V4C A;  4YB7 A;  4I8C A;  1A40 A;  3FD3 A;  5EYF A;  1D9Q A;  2X26 A;  5HBC A;  3VV5 A;  3MZB A;  1PBQ A;  2RC7 A;  5IZ3 A;  4P47 A;  2QVU A;  3FVO A;  5FBP A;  3Q27 A;  1US4 A;  2F78 A;  3B6T A;  5I3S A;  3IOR A;  5LDZ A;  2GHB A;  3K4U A;  3TEL A;  2D5W A;  4PQJ A;  2XA5 A;  1Z7M E;  2HAV A;  3S9M C;  1MM7 A;  1B51 A;  2OK2 A;  4GXA A;  4ISU A;  3ZKL A;  1MXZ A;  1O63 A;  4R73 A;  3IX1 A;  3SDF A;  3SEU A;  3T93 B;  4G2Z A;  3E4R A;  5IAI A;  1IXC A;  4H5F A;  4WXJ A;  1ZBM A;  4IO4 A;  4X1D A;  4KYD A;  1FPD A;  3B7D A;  4QFK A;  1G0I A;  2Y5L A;  5EYH A;  1FBH A;  1QUL A;  2O69 A;  3EHS A;  1OQG A;  4R74 A;  3GBB A;  3RQT A;  4ZZA A;  2B3F A;  1P1Q A;  4YKI A;  1BKA A;  1Y3N A;  5H8F B;  3TQW A;  1H43 A;  4N6D A;  3IJX B;  1OMP A;  1NL5 A;  3U92 A;  4YZZ A;  2QRY A;  5KCJ B;  3A3C A;  1LAF E;  3KJT A;  5TP9 B;  1DCU A;  1VFE A;  3CHG A;  3G3G A;  3MW0 A;  1M5E A;  4LUB A;  3G3F A;  4K3F A;  2HZK A;  2UYE A;  4H67 A;  2ZYN A;  1Y20 A;  4U4S A;  3W9W A;  2DWJ A;  3PUX E;  3TQL A;  3G3J A;  2ZYO A;  4G8M A;  5F1Q A;  3VLV A;  2O1M A;  4DXU A;  4IO7 A;  1T0K A;  1TXF A;  5H8H A;  3VVE A;  3RNN A;  2YPN A;  4KCD A;  1NI9 A;  4BDN A;  4R72 A;  4NF4 B;  3BFT A;  2B3B A;  1LAX A;  4MNC A;  4XFE A;  4YKK A;  3PTY A;  4QXD A;  5LOM A;  1OQH A;  4OHN A;  3ODB A;  3VXC A;  4F2O A;  3LSL A;  4XKQ A;  4I3Y A;  4ZEI A;  5H8N A;  4N15 A;  4JVC A;  1I6A A;  2UVG A;  1YAE A;  1WVJ A;  4YKP A;  1SD3 A;  1GR2 A;  4PGP A;  4JXI A;  4DI4 B;  2NOO A;  4KI0 E;  4X04 A;  2ABH A;  2F8D A;  3MJN A;  2A5T A;  1FBF A;  3KEI A;  5FTH A;  1Z7N E;  1B4Z A;  1OIB A;  5A5X B;  1H44 A;  4PFR A;  4OES A;  2HQ0 A;  1XHY A;  2XXU A;  3M3F A;  4ZS9 A;  1B3F A;  1SW4 A;  1DOT A;  1AH5 A;  4UAC A;  3O2A A;  3M8U A;  2WYK A;  3P7I A;  2UVJ A;  3OEM A;  4POW A;  4Z7E A;  3FZV A;  2ZNS A;  1Y3P A;  5TPA B;  5IZZ A;  1FQB A;  1D4N A;  1D9Y A;  4LN5 A;  5DYH A;  4ZED A;  3JYR A;  1B58 A;  4QSE A;  3GZG A;  5DT6 A;  3U93 A;  3PUW E;  1XT8 A;  3MPK A;  2QVR A;  4P3L A;  3I3V A;  2R71 A;  1LAG E;  1POT A;  1K9Y A;  4OTE A;  1FJ9 A;  4IO5 A;  1QVS A;  2PX1 A;  3C31 A;  1URS A;  4IO6 A;  4Z0I A;  2F35 A;  1B5I A;  3GYY A;  4EXL A;  3VVF A;  2P3V A;  2E1S A;  4NG7 A;  5KDT A;  1BP5 A;  2Z23 A;  1A99 A;  4OEV A;  1EZ9 A;  1NV4 A;  4JSD A;  1B3L A;  2RIN A;  2F34 A;  2XWK A;  1PB7 A;  1URG A;  2CZI A;  2DS9 A;  4MHF A;  3FIR A;  1MRP A;  2XWO A;  4LAT A;  3M3L A;  1EU8 A;  1FBG A;  1DTG A;  4F3B A;  1FTA A;  5K2Y A;  3DM0 A;  4O94 A;  4GX4 A;  1EYJ A;  1MY0 A;  2PBW A;  1FPJ A;  1QW0 A;  4PFT A;  3IL1 B;  4R2B A;  1H3D A;  2ONK E;  1FBP A;  3K00 A;  4EQB A;  1N7W A;  1YXI A;  4R6H A;  5T3J A;  4DE8 A;  4FAT A;  3C35 A;  3F11 A;  3RLF E;  1K9Z A;  3T96 B;  3CR9 A;  5ET5 A;  4U4X A;  1LGB C;  4NF5 B;  1BK4 A;  2UXA A;  4GFR A;  2QVV A;  3RTW B;  1FPE A;  3QYT A;  4P9K A;  4ZZE A;  1VR5 A;  4HCW A;  3V83 A;  2HFB A;  4AS4 A;  2RCA A;  4DXB A;  3OEL A;  3EKI A;  4MNP A;  1F9B A;  1SDX A;  5AA2 D;  4QHQ A;  5AA2 B;  4E0X A;  3MP8 A;  4NWC A;  3LSX A;  2PYY A;  3KN3 A;  4YAH X;  2Y7W A;  4IB2 A;  4N91 A;  1VE4 A;  3K1N A;  2QS1 A;  3JZJ A;  4MEV A;  4MFI A;  4LZ7 A;  3R6U A;  4OFL A;  2ESN A;  2QS3 A;  4GWW A;  1EH3 A;  1N04 A;  4NAP A;  4OVT A;  2P3N A;  2ONS A;  4U21 A;  5I56 A;  3BIG A;  5M2V A;  1Q35 A;  2XXI A;  4FOR A;  1QUJ A;  3QMF A;  3IFC A;  3VLW A;  1B7Z A;  5I2N B;  1TFD A;  4TQU Q;  4G4P A;  2I4C A;  2I49 A;  4R2F A;  1XVY A;  2O51 A;  3S2V A;  2FIX A;  2NWJ A;  1CE2 A;  1XS5 A;  4PFW A;  4F18 A;  3K1M A;  2Y84 A;  3ILT B;  4PAF A;  5EQA A;  1MPB A;  1OVT A;  4H0W A;  5DVJ A;  3U94 A;  2VGQ A;  2F7C A;  1XC1 A;  1AL3 A;  3HHG A;  2Q8J A;  4GWU A;  1OVB A;  5F24 A;  2VPN A;  3SET A;  4HS7 A;  3SKP A;  1YCJ A;  1YTV A;  3OD7 A;  1FW0 A;  5ET6 A;  2XWV A;  3TZA A;  1WDN A;  4JB7 A;  3FBP A;  4XXU A;  4ZDM A;  5H8Q B;  2FBP A;  3OO8 A;  3H6T A;  1D9V A;  1SW2 A;  3PPQ A;  2AL5 A;  3PU5 A;  4ESX A;  3S9E A;  4MIJ A;  1MY3 A;  1B4H A;  3G3I A;  1TT1 A;  2RCB A;  2B4M A;  1B52 A;  3IR1 A;  3T9V A;  1JNF A;  4GWX A;  4MJO A;  5IKB A;  2KLF A;  4ONY A;  4PFB A;  4BDQ A;  1Q9D A;  2RF1 A;  3SEV A;  4JVI A;  4M4G A;  3KBR A;  3T9H B;  3RPL B;  3CFZ A;  3K6V A;  1ZTY A;  3K1P A;  4P0I A;  3IOW A;  2KQZ A;  3IOT A;  4HE2 A;  2V3T A;  4JSO A;  5L9S A;  3LUY A;  1NNK A;  1IMF A;  3TCF A;  4F19 A;  4KPT A;  2DQV A;  3VDF A;  3GLB A;  2IEE A;  4GWY A;  4HE0 A;  3V89 B;  2RC9 A;  1A55 A;  4PF8 A;  3AXF A;  3DEL B;  4OAN A;  1S9T A;  4N4U A;  1JQF A;  2ONR A;  5I57 B;  4FIM A;  4G61 A;  5H8F A;  2W7Y A;  2CEX A;  4OET A;  3C33 A;  4LQ2 A;  4QFL A;  3FJM A;  1NFT A;  5FHO A;  1KZ8 A;  1ZMG A;  4N17 A;  5KCJ A;  3D1R A;  4I40 A;  1A8F A;  1MQH A;  2FNC A;  3FV2 A;  5TP9 A;  4G8N A;  4QFP A;  1SYI A;  2PFY A;  4LVQ A;  1LCT A;  4NF8 B;  2LAO A;  4YMA A;  4HXV A;  4Q30 B;  1Q1K A;  4EF2 A;  4NTL A;  4WEP A;  4QSD A;  5DTB A;  4QRZ A;  2Q2C A;  4IO3 A;  3V8X B;  2QL3 A;  2QS2 A;  3QK6 A;  3T0J A;  3WAE A;  5I2K B;  3LC8 A;  4NF4 A;  2NVU B;  1JW5 A;  4XF5 A;  1L5T A;  1Y1M A;  4IGR A;  1NH7 A;  1M5F A;  3KOT A;  4JWX A;  3TKD A;  3U1O A;  1MXY A;  3GXA A;  4RPN A;  4YMB A;  2MKZ A;  2ZNU A;  4RYA A;  2ZZV A;  5EQ7 A;  2GH9 A;  3D4G A;  2BJJ X;  1M5C A;  4OVQ A;  2VOZ A;  4KCC A;  1FBD A;  1IZ1 A;  3RUM A;  2DXR A;  3H4Z A;  3TTK A;  2I4B A;  2DE2 A;  2HAU A;  3PUY E;  1B6H A;  2R9J A;  4FJP A;  4OWD A;  1BIY A;  3I5O A;  2I6E A;  3G3K A;  3O6G A;  3MVW A;  2I3W A;  1IUD A;  4ELP A;  2QJE A;  5A5X A;  1XVX A;  1FQC A;  4MNI A;  2ALU A;  3IFA A;  2XXX A;  3OSQ A;  4LA9 A;  1O7T A;  3UOR A;  3H7M A;  4F29 A;  4NX1 A;  3PMW A;  1M5D A;  2M8C A;  1AMF A;  1IEJ A;  5I58 B;  2A5S A;  4OA4 A;  1HSJ A;  2Y7R A;  4ZEC A;  5TPA A;  3T9X B;  3PPO A;  3B6W A;  3MUQ A;  5ITO A;  3SEW A;  5CRY A;  2V93 A;  4ZEF A;  4OEU A;  1JW4 A;  5HM4 B;  4H8I A;  5LTC A;  2V84 A;  5I59 B;  5CMM A;  1CB6 A;  4P8B A;  1LBZ A;  4NMY A;  2HEU A;  3I6V A;  4NED A;  5I5P A;  4GBV A;  4GX6 A;  2Y7P A;  2L5V A;  1SVX B;  2V3U A;  2UVI A;  3BBR A;  3CI8 A;  1SBP A;  1P1U A;  1INP A;  1ZJL A;  4R75 A;  3MVZ A;  2ANJ A;  1IME A;  4X8R A;  2O68 A;  1ANF A;  4NE4 A;  2QSX A;  1FCK A;  3DP6 A;  3PD8 A;  1RYX A;  1SW1 A;  4PFI A;  1GV8 A;  1N84 A;  3HST A;  3IB2 A;  1FTJ A;  4GD5 A;  1SI1 A;  4U23 A;  4PP0 A;  1IMB A;  2OZZ A;  1FBE A;  1DBZ A;  3LR1 A;  1DTZ A;  1B0L A;  1FJ6 A;  3TYH A;  2XXY A;  2OWZ A;  2Y5K A;  4OZ9 A;  4PBQ A;  4PFY A;  4PET A;  2QFL A;  4RK9 A;  4PBH A;  1JVX A;  3KFM A;  3H3G A;  4RY1 A;  3IO4 A;  2GQ1 A;  1RKM A;  3FVK A;  2CZK A;  3OO6 A;  4DXC A;  5ET8 A;  1FQE A;  3RT8 A;  2WYP A;  2REJ A;  2WBB A;  1AOV A;  3UK4 A;  3B50 A;  1QUI A;  1B3H A;  3EHU A;  3DP8 A;  4IGT A;  5AA2 A;  1G0H A;  2XXV A;  2ZMB A;  1R9Q A;  4QSC A;  5FTI A;  3UIF A;  2XX7 A;  1NV7 A;  4R9G A;  3L6H A;  5J1D A;  3MST A;  4GL8 A;  3KGC A;  4R6Y A;  3FUZ A;  2R6G E;  3R7X A;  2ZYK A;  3FAS A;  3E3K A;  4F39 A;  3WAF A;  4KYS A;  4O7M A;  3TTR A;  4DDD A;  1PBP A;  2AYS A;  1JEV A;  2YJP A;  4ELQ A;  1R9L A;  2E0S A;  4KHZ E;  3KZG A;  5L9M A;  2P2A A;  3ZSF A;  3U72 A;  1SYH A;  2GHA A;  2V25 A;  5I2N A;  2DOJ A;  2CZL A;  1B32 A;  3FXR A;  1IMD A;  3MQ9 A;  2XXW A;  3HFU A;  1B0H A;  2O1L A;  3L6G A;  1LBV A;  4NQ8 A;  3M3K A;  1SI0 A;  4I9D A;  4TLL B;  3VLU A;  5I7I A;  1LFG A;  3BFU A;  3KJ7 A;  3IOV A;  3SEX A;  1YZ0 A;  5CBR A;  2PT1 A;  2NUV A;  4G68 C;  5H8Q A;  3VXB A;  1FBC A;  4QBA A;  3LV0 A;  4G77 A;  2QMW A;  3QUJ A;  2FIE A;  3KN7 A;  1DMB A;  1PB9 A;  2Q9T A;  4FED A;  4OFO A;  5BUU A;  4H65 A;  4RPO A;  4X1B A;  4NWD A;  4BDO A;  1ATG A;  4GWZ A;  5ISU A;  3QUF A;  3LBS A;  4DCY A;  3BIH A;  5JK4 A;  3OO7 A;  1NV2 A;  2H4I A;  4GRK A;  3N94 A;  1AIV A;  1ZIU A;  1EZP A;  2GFE A;  4POX A;  1P99 A;  4GQO A;  4P1L A;  1B5H A;  3RPL A;  3KOS A;  4THI A;  1OLC A;  3E79 A;  2WX9 A;  3G7W A;  4N07 A;  2O7U A;  5F7V A;  3N5L A;  4PDH A;  2XD2 A;  3QIM A;  2THI A;  4YB5 A;  1JEU A;  2DYX A;  2Z22 A;  1M5B A;  3T66 A;  4JWY A;  1A7L A;  1AWB A;  1P1O A;  1DPP A;  3MZ1 A;  3THI A;  4RA1 A;  3MP1 A;  1JW1 A;  4U1Z A;  4R9F A;  5I84 A;  4MAG A;  4M1V A;  3C36 A;  1IMA A;  3MP6 A;  2P0S A;  3TTM A;  2VD3 A;  3N26 A;  3UP9 A;  2F97 A;  4F22 A;  3RN8 A;  3VFJ A;  5EQ8 A;  4KQP A;  3CIJ A;  3PD9 A;  1NV0 A;  4H1X A;  3O9P A;  5EQ9 A;  4PF6 A;  2H5Y A;  1ZKB A;  4OVP A;  1IMC A;  1UTH B;  4NHB A;  4NF8 A;  2X7Q A;  5DVI A;  1N76 A;  3DLN A;  3RTF B;  1MQG A;  5BWJ A;  1FRP A;  5EHS A;  3SES A;  3FJ7 A;  4KFQ A;  1N0T A;  1MH4 A;  3IJO B;  4FE8 A;  2OLB A;  2O84 X;  3D4C A;  5I2K A;  2OCU A;  3FXU A;  3ZKK A;  4PC9 A;  2OWT A;  2QMX A;  3HN0 A;  4OMB A;  2DDK A;  4MCO A;  5L8D A;  2VHA A;  2F6P A;  3CRB A;  4ESW A;  1IIT A;  4GVO A;  4G8H A;  4PGN A;  1FSA A;  5EHM A;  4U22 A;  4I62 A;  1LBY A;  2DE4 A;  4GLI A;  2VT5 A;  2I58 A;  4BDR A;  3KC0 A;  1B40 A;  2JJK A;  3V5A A;  1QUK A;  3TTL A;  2DWH A;  2B65 A;  3A09 A;  2CEY A;  1N7X A;  3CSG A;  2DP8 A;  4XKN A;  1FTO A;  1NUW A;  4IR8 A;  3FVN A;  4JWO A;  1VFD A;  4U2R A;  4E0W A;  2R8T A;  3QXM A;  3ISP A;  5I58 A;  4TLM B;  4YU0 A;  1B3E A;  3LSW A;  2DE3 A;  2VD2 A;  4H45 A;  3C34 A;  5EYG A;  2H25 A;  1NV3 A;  2BJI A;  2QS4 A;  3EN3 A;  4EQ9 A;  4YIC A;  3FXB A;  3K02 A;  3UN6 A;  2F5X A;  4LZ5 A;  4NGU A;  4N8Y A;  1WOD A;  1UTB B;  4ECF A;  4N6P A;  4F1V A;  4C1U A;  2Q2A A;  2ZZX A;  3SZP A;  1II5 A;  2GRV A;  3NOH A;  3CG3 A;  5KZT A;  3OXN A;  1VSO A;  1QJM A;  5CMC A;  1LST A;  5HPQ A;  1NH8 A;  4UA8 A;  2DVZ A;  1MXV A;  2HZL A;  4RJZ A;  2ZYM A;  1DK4 A;  5JEI A;  4HE1 A;  4Q8R A;  2PFZ A;  2F3B A;  4BDL A;  1XOC A;  4ZE9 A;  1H45 A;  4HTG A;  4GXS B;  1BLF A;  3PMV A;  1JET A;  2O6A A;  1EZO A;  5ET7 A;  4AB5 A;  1N3X A;  3MC2 A;  4H6D A;  3K01 A;  3H6V A;  4FBP A;  3N6T A;  5L9O A;  1IQ7 A;  1VDW A;  4OVR A;  1DSN A;  4NF6 B;  1RDX A;  4NN3 A;  4KXP A;  3T1B A;  3PMX A;  3A29 A;  5IGA A;  1P1W A;  3MZ9 A;  2Z8E A;  3ZS6 A;  3H06 B;  2Q74 A;  4OVS A;  2VP1 A;  1FPL A;  1LBW A;  4GX3 A;  1RYO A;  4I3E A;  4F31 B;  1USY H;  3O6H A;  4ZEB A;  1I69 A;  1YYZ A;  1LBX A;  1EYI A;  4ZEK A;  1NUX A;  3ILU B;  4N6K A;  3Q26 A;  3EHT A;  2Y7K A;  1HSL A;  3W15 C;  4U1O A;  3O97 A;  3Q29 A;  4ZE8 A;  3U65 A;  4X9T A;  5ICQ A;  5H8S A;  1FPF A;  2Q8M A;  1Y9U A;  3MYU A;  3R26 A;  3Q25 A;  1NUZ A;  1FPK A;  1ZLQ A;  1Y3Q A;  5CMB A;  4MF3 A; 
#chains in the Genus database with same CATH homology
 2UYF A;  3CFL A;  4MH5 A;  2RC8 A;  2P1S A;  4GIZ A;  3PUV E;  4FEB A;  1NNF A;  1SW5 A;  3ONM A;  1B5J A;  2PVU A;  4XKR A;  4XKP A;  3OMB A;  2F7B A;  1LAH E;  3RPW A;  2RKM A;  4WED A;  3H6W A;  3CG1 A;  3PGF A;  1B7U A;  2OBG A;  4EUO A;  1J1N A;  3PUZ E;  1DPE A;  4R6K A;  1NNP A;  1MQD A;  3U8Q A;  1B9J A;  4F1U A;  3MVY A;  2F6G A;  1TWY A;  1ZU0 A;  2H98 A;  1GVC A;  4G68 B;  3C4M A;  3FAT A;  4YKJ A;  3K6U A;  3EF7 A;  1LBC A;  3N6U A;  5ITP A;  4NF5 A;  2AL4 A;  1I6B A;  2DXY A;  2YLN A;  2PMS A;  1FTL A;  5JTY B;  1PDA A;  1UIU A;  4GWO A;  4BLA A;  3MVX A;  5DEX B;  1NNT A;  1ELJ A;  5AA4 B;  1MDP 1;  2O7I A;  2XXP A;  1MDQ A;  1SQY A;  2PT2 A;  1JVY A;  3UA8 A;  3OOA A;  4GL0 A;  3SEY A;  1PC3 A;  4C1T A;  2DSF A;  5CI5 A;  2Q89 A;  4O3B A;  4P11 A;  4XIG Q;  4LP2 B;  1YPN A;  3T22 A;  1D3K A;  3KSX A;  1POY 1;  3HCQ A;  1B3G A;  4AQ4 A;  2XHD A;  3O6I A;  4Q0C A;  3RY3 A;  1UIV A;  2I0B A;  2I48 A;  3FGS A;  3B6Q A;  3IK6 B;  2HXW A;  4BDM A;  3QAX A;  1NMU A;  3TFL A;  3TTN A;  1UTH A;  1LFH A;  1B2H A;  4RK2 A;  4QF9 A;  4GOT A;  3FJG A;  3S4U A;  3K0V A;  5ICT A;  4EQ7 A;  4IY6 A;  4MLQ A;  4OYV A;  1B1X A;  3TEP A;  3FVG A;  1PB8 A;  2F36 A;  4YB6 A;  1B7H A;  4FEC A;  4GF8 A;  1KWH A;  3DP4 A;  4C0R A;  1TFA A;  4OFJ A;  3T9U A;  3IO6 A;  3EPE A;  4LQ5 A;  1MY1 A;  2XXR A;  4XTC Q;  4ND9 A;  3SER A;  5AA3 A;  2I3V A;  4KYE A;  1N3W A;  3TCH A;  4IY5 A;  3OEK A;  3TAJ A;  1B05 A;  2ZNT A;  5H8H B;  1MQJ A;  5K2X A;  3UGW A;  1I6Q A;  2FA7 A;  4F3S A;  2G93 A;  1IXI A;  3S9N C;  3HPI A;  2Y7I A;  1B46 A;  1LB9 A;  3KG2 A;  2Z8F A;  3K2D A;  4KR5 A;  3OO9 A;  2X7P A;  1MM6 A;  4X48 A;  3TMG A;  3KN8 A;  3O29 A;  4RNS A;  5H8N B;  3FV1 A;  3PPR A;  4EDP A;  2FYI A;  4QFN A;  4ELO A;  4RXL A;  3RT6 B;  3HO7 A;  1R6Z A;  1FQD A;  1MS7 A;  3CVG A;  3PV0 E;  2I0C A;  2A5T B;  2DVC A;  2D3I A;  4OEN A;  3H6U A;  3TOD A;  5B7D A;  1UTB A;  1USY E;  5FHM A;  3MWB A;  5CC2 A;  2XXQ A;  4LON B;  4EF1 A;  2DWI A;  5I57 A;  3RGY A;  4H8J A;  5DVF A;  1A54 A;  2REG A;  2HCA A;  3TUS A;  5B70 A;  2UVH A;  3PPP A;  1GGG A;  4DCX A;  1IXH A;  1QKB A;  2D21 A;  3QSL A;  1LLS A;  1MXU A;  2XXT A;  4TOZ A;  1PEB A;  2H99 A;  1MH3 A;  3TPA A;  2V3Q A;  2F7A A;  3VVD A;  4AB6 A;  2AIX A;  3K6W A;  1US5 A;  2G29 A;  4F2Q A;  5CBS A;  3MAM A;  5KDT B;  3H03 A;  1MXX A;  4N13 A;  1Y4C A;  4F3P A;  2XXH A;  4HCY A;  4EXK A;  1LFI A;  4NF6 A;  3GBA A;  3G3H A;  2IA4 A;  1R1N A;  3USD A;  5AE4 A;  4F3G A;  3IB0 A;  4JDF A;  4F1Y A;  2WKY A;  3O66 A;  4HW8 A;  1IXG A;  4PE5 B;  4OER A;  1FQA A;  2OWS A;  4L17 A;  3IOU A;  4H5G A;  1O64 A;  5TU0 A;  3Q28 A;  4MLV A;  5AA1 A;  3A3U A;  1FTK A;  1MPD A;  3E9X A;  1NKX A;  5FHN A;  1LCF A;  1A8E A;  3MPL A;  3OEN A;  3IAZ A;  3MBP A;  3CFX A;  1S50 A;  4Q5T A;  1LB8 A;  1S7Y A;  4MBP A;  1H76 A;  1Y4T A;  3PPN A;  5I59 A;  2Q88 A;  4DLD A;  4PFU A;  3C32 A;  1URD A;  4JBZ A;  4OQO A;  1QKA A;  2XD3 A;  3LSF B;  4QFO A;  1BTJ A;  3C9H A;  1MPC A;  2QPQ A;  3FXQ A;  4I1D A;  1MXW A;  4O3A A;  4P0G A;  3TCG A;  5I56 B;  1B1H A;  4ELR A;  1FQF A;  1MY4 A;  3HHF A;  1IIW A;  1UQW A;  2CMO A;  1MY2 A;  2XX8 A;  3S9L C;  5CMK A;  1MQI A;  2OJT A;  4WKM A;  3ECR A;  1MG1 A;  5CM6 A;  3E13 X;  1LBB A;  4IO2 A;  3TDJ A;  1OLA A;  1FTM A;  4DIG A;  2DWA A;  3K6X A;  4G68 A;  3O28 A;  4DZ1 A;  2Z8D A;  4KD5 A;  3BKI B;  1Y1Z A;  1GTK A;  3OSR A;  4LZ8 A;  3EQ1 A;  1P1N A;  2H9B A;  3JV9 A;  4OVJ A;  5JTY A;  1HSE A;  3KSJ A;  2ZXT A;  4FAJ A;  3IB1 A;  4O3C A;  3HV1 A;  5DEX A;  2NXO A;  5AA4 A;  5ELV A;  4OXV A;  2XX9 A;  3VE1 B;  3CSB A;  3W9V A;  4YB7 A;  4I8C A;  1A40 A;  3FD3 A;  5EYF A;  2X26 A;  5HBC A;  3VV5 A;  3MZB A;  1PBQ A;  2RC7 A;  3FVO A;  3Q27 A;  1US4 A;  2F78 A;  3B6T A;  3IOR A;  2GHB A;  3K4U A;  3TEL A;  2D5W A;  4PQJ A;  1Z7M E;  2HAV A;  3S9M C;  1MM7 A;  1B51 A;  2OK2 A;  4GXA A;  4ISU A;  3ZKL A;  1MXZ A;  1O63 A;  4R73 A;  3IX1 A;  3SDF A;  3SEU A;  3T93 B;  4G2Z A;  3E4R A;  5IAI A;  1IXC A;  4H5F A;  4WXJ A;  1ZBM A;  4IO4 A;  4X1D A;  4KYD A;  3B7D A;  4QFK A;  1QUL A;  2O69 A;  3EHS A;  1OQG A;  4R74 A;  3GBB A;  3RQT A;  4ZZA A;  2B3F A;  1P1Q A;  4YKI A;  1BKA A;  1Y3N A;  5H8F B;  3TQW A;  1H43 A;  3IJX B;  1OMP A;  1NL5 A;  3U92 A;  4YZZ A;  2QRY A;  5KCJ B;  3A3C A;  1LAF E;  3KJT A;  5TP9 B;  1VFE A;  3G3G A;  3MW0 A;  1M5E A;  4LUB A;  3G3F A;  4K3F A;  2HZK A;  2UYE A;  4H67 A;  2ZYN A;  1Y20 A;  4U4S A;  3W9W A;  2DWJ A;  3PUX E;  3TQL A;  3G3J A;  2ZYO A;  4G8M A;  5F1Q A;  3VLV A;  2O1M A;  4DXU A;  4IO7 A;  1T0K A;  1TXF A;  5H8H A;  3VVE A;  3RNN A;  2YPN A;  4KCD A;  4BDN A;  4R72 A;  4NF4 B;  3BFT A;  2B3B A;  1LAX A;  4YKK A;  5LOM A;  1OQH A;  4OHN A;  3ODB A;  3VXC A;  4F2O A;  3LSL A;  4XKQ A;  4ZEI A;  5H8N A;  1I6A A;  2UVG A;  1YAE A;  1WVJ A;  4YKP A;  1SD3 A;  1GR2 A;  4JXI A;  2NOO A;  4KI0 E;  2ABH A;  2F8D A;  3MJN A;  2A5T A;  3KEI A;  5FTH A;  1Z7N E;  1B4Z A;  1OIB A;  5A5X B;  1H44 A;  4OES A;  2HQ0 A;  1XHY A;  2XXU A;  3M3F A;  4ZS9 A;  1B3F A;  1SW4 A;  1DOT A;  1AH5 A;  4UAC A;  3O2A A;  3M8U A;  3P7I A;  2UVJ A;  3OEM A;  4POW A;  4Z7E A;  3FZV A;  2ZNS A;  1Y3P A;  5TPA B;  1FQB A;  1D4N A;  1D9Y A;  5DYH A;  4ZED A;  3JYR A;  1B58 A;  4QSE A;  3GZG A;  5DT6 A;  3U93 A;  3PUW E;  1XT8 A;  3MPK A;  3I3V A;  2R71 A;  1LAG E;  1POT A;  4OTE A;  4IO5 A;  1QVS A;  2PX1 A;  3C31 A;  1URS A;  4IO6 A;  4Z0I A;  2F35 A;  1B5I A;  4EXL A;  3VVF A;  2E1S A;  5KDT A;  1BP5 A;  2Z23 A;  1A99 A;  4OEV A;  1EZ9 A;  4JSD A;  1B3L A;  2RIN A;  2F34 A;  1PB7 A;  1URG A;  2DS9 A;  3FIR A;  1MRP A;  4LAT A;  3M3L A;  1EU8 A;  4F3B A;  1DTG A;  5K2Y A;  3DM0 A;  1MY0 A;  2PBW A;  1QW0 A;  4PFT A;  3IL1 B;  4R2B A;  1H3D A;  2ONK E;  3K00 A;  4EQB A;  1N7W A;  4R6H A;  4DE8 A;  4FAT A;  3C35 A;  3F11 A;  3RLF E;  3T96 B;  3CR9 A;  4U4X A;  1LGB C;  4NF5 B;  2UXA A;  4GFR A;  3RTW B;  3QYT A;  4ZZE A;  1VR5 A;  4HCW A;  3V83 A;  2HFB A;  2RCA A;  4DXB A;  3OEL A;  1F9B A;  1SDX A;  5AA2 D;  4QHQ A;  5AA2 B;  4E0X A;  3MP8 A;  4NWC A;  3LSX A;  2PYY A;  3KN3 A;  4YAH X;  2Y7W A;  4IB2 A;  1VE4 A;  3K1N A;  2QS1 A;  3JZJ A;  4MFI A;  4LZ7 A;  3R6U A;  4OFL A;  2ESN A;  2QS3 A;  1EH3 A;  1N04 A;  2ONS A;  4U21 A;  5I56 A;  5M2V A;  1Q35 A;  2XXI A;  4FOR A;  1QUJ A;  3VLW A;  1B7Z A;  5I2N B;  1TFD A;  4TQU Q;  4G4P A;  2I4C A;  2I49 A;  4R2F A;  1XVY A;  2O51 A;  3S2V A;  2NWJ A;  1CE2 A;  1XS5 A;  4PFW A;  4F18 A;  3K1M A;  2Y84 A;  3ILT B;  1MPB A;  1OVT A;  4H0W A;  5DVJ A;  3U94 A;  2VGQ A;  2F7C A;  1XC1 A;  1AL3 A;  3HHG A;  2Q8J A;  1OVB A;  3SET A;  4HS7 A;  3SKP A;  1YCJ A;  1YTV A;  3OD7 A;  1FW0 A;  3TZA A;  1WDN A;  4JB7 A;  4XXU A;  4ZDM A;  5H8Q B;  3OO8 A;  3H6T A;  1D9V A;  1SW2 A;  3PPQ A;  2AL5 A;  3PU5 A;  4ESX A;  3S9E A;  1MY3 A;  1B4H A;  3G3I A;  1TT1 A;  2RCB A;  1B52 A;  3IR1 A;  3T9V A;  1JNF A;  5IKB A;  2KLF A;  4ONY A;  4BDQ A;  2RF1 A;  3SEV A;  4M4G A;  3KBR A;  3T9H B;  3CFZ A;  3K6V A;  1ZTY A;  3K1P A;  4P0I A;  3IOW A;  3IOT A;  2V3T A;  4JSO A;  5L9S A;  3LUY A;  1NNK A;  3TCF A;  4F19 A;  4KPT A;  2DQV A;  3VDF A;  3GLB A;  2IEE A;  3V89 B;  2RC9 A;  1A55 A;  3AXF A;  3DEL B;  1S9T A;  1JQF A;  2ONR A;  5I57 B;  4FIM A;  5H8F A;  2W7Y A;  4OET A;  3C33 A;  4LQ2 A;  4QFL A;  3FJM A;  1NFT A;  5FHO A;  1ZMG A;  5KCJ A;  1A8F A;  1MQH A;  5TP9 A;  2FNC A;  3FV2 A;  4G8N A;  4QFP A;  1SYI A;  4LVQ A;  1LCT A;  4NF8 B;  2LAO A;  4YMA A;  4Q30 B;  1Q1K A;  4EF2 A;  4NTL A;  4WEP A;  4QSD A;  5DTB A;  4QRZ A;  2Q2C A;  4IO3 A;  3V8X B;  2QL3 A;  2QS2 A;  3QK6 A;  3WAE A;  5I2K B;  3LC8 A;  4NF4 A;  2NVU B;  1JW5 A;  1L5T A;  1Y1M A;  4IGR A;  1NH7 A;  1M5F A;  3KOT A;  4JWX A;  3TKD A;  3U1O A;  1MXY A;  3GXA A;  4RPN A;  4YMB A;  2ZNU A;  4RYA A;  2GH9 A;  3D4G A;  2BJJ X;  1M5C A;  2VOZ A;  4KCC A;  1IZ1 A;  3RUM A;  2DXR A;  3H4Z A;  3TTK A;  2I4B A;  2DE2 A;  2HAU A;  3PUY E;  1B6H A;  2R9J A;  4FJP A;  4OWD A;  1BIY A;  3I5O A;  2I6E A;  3G3K A;  3O6G A;  3MVW A;  2I3W A;  1IUD A;  4ELP A;  2QJE A;  5A5X A;  1XVX A;  1FQC A;  2ALU A;  2XXX A;  3OSQ A;  4LA9 A;  1O7T A;  3UOR A;  3H7M A;  4F29 A;  3PMW A;  1M5D A;  2M8C A;  1AMF A;  1IEJ A;  5I58 B;  2A5S A;  1HSJ A;  2Y7R A;  4ZEC A;  5TPA A;  3T9X B;  3PPO A;  3B6W A;  3MUQ A;  5ITO A;  3SEW A;  5CRY A;  2V93 A;  4ZEF A;  4OEU A;  1JW4 A;  5HM4 B;  4H8I A;  2V84 A;  5I59 B;  5CMM A;  1CB6 A;  4NMY A;  2HEU A;  3I6V A;  4NED A;  2Y7P A;  1SVX B;  2V3U A;  2UVI A;  3BBR A;  3CI8 A;  1SBP A;  1P1U A;  1ZJL A;  4R75 A;  3MVZ A;  2ANJ A;  2O68 A;  1ANF A;  4NE4 A;  2QSX A;  1FCK A;  3DP6 A;  3PD8 A;  1RYX A;  1SW1 A;  1GV8 A;  1N84 A;  3HST A;  3IB2 A;  1FTJ A;  4GD5 A;  1SI1 A;  4U23 A;  4PP0 A;  2OZZ A;  3LR1 A;  1DTZ A;  1B0L A;  3TYH A;  2XXY A;  4OZ9 A;  4PFY A;  4PET A;  4RK9 A;  1JVX A;  3KFM A;  3H3G A;  4RY1 A;  3IO4 A;  1RKM A;  3FVK A;  3OO6 A;  4DXC A;  1FQE A;  3RT8 A;  2REJ A;  1AOV A;  3UK4 A;  1QUI A;  1B3H A;  3EHU A;  3DP8 A;  4IGT A;  5AA2 A;  2XXV A;  2ZMB A;  1R9Q A;  4QSC A;  5FTI A;  3UIF A;  2XX7 A;  4R9G A;  3L6H A;  5J1D A;  4GL8 A;  3KGC A;  4R6Y A;  3FUZ A;  2R6G E;  3R7X A;  2ZYK A;  3FAS A;  3E3K A;  4F39 A;  3WAF A;  4KYS A;  3TTR A;  4DDD A;  1PBP A;  2AYS A;  1JEV A;  2YJP A;  4ELQ A;  1R9L A;  2E0S A;  4KHZ E;  3KZG A;  5L9M A;  2P2A A;  3ZSF A;  3U72 A;  1SYH A;  2GHA A;  2V25 A;  5I2N A;  2DOJ A;  2CZL A;  1B32 A;  3FXR A;  3MQ9 A;  2XXW A;  1B0H A;  2O1L A;  3L6G A;  3M3K A;  1SI0 A;  4I9D A;  4TLL B;  3VLU A;  1LFG A;  3BFU A;  3KJ7 A;  3IOV A;  3SEX A;  5CBR A;  2PT1 A;  2NUV A;  4G68 C;  5H8Q A;  3VXB A;  4G77 A;  2QMW A;  3QUJ A;  3KN7 A;  1DMB A;  1PB9 A;  2Q9T A;  4FED A;  4OFO A;  5BUU A;  4H65 A;  4RPO A;  4X1B A;  4NWD A;  4BDO A;  1ATG A;  5ISU A;  3QUF A;  3LBS A;  4DCY A;  5JK4 A;  3OO7 A;  2H4I A;  4GRK A;  3N94 A;  1AIV A;  1ZIU A;  1EZP A;  2GFE A;  4POX A;  1P99 A;  4GQO A;  1B5H A;  3KOS A;  4THI A;  1OLC A;  3G7W A;  4N07 A;  2O7U A;  5F7V A;  3N5L A;  2XD2 A;  3QIM A;  2THI A;  4YB5 A;  1JEU A;  2DYX A;  2Z22 A;  1M5B A;  3T66 A;  4JWY A;  1A7L A;  1P1O A;  1DPP A;  3MZ1 A;  3THI A;  4RA1 A;  3MP1 A;  1JW1 A;  4U1Z A;  4R9F A;  5I84 A;  4M1V A;  3C36 A;  3MP6 A;  2P0S A;  3TTM A;  2VD3 A;  3N26 A;  3UP9 A;  2F97 A;  4F22 A;  3RN8 A;  3VFJ A;  4KQP A;  3CIJ A;  3PD9 A;  4H1X A;  3O9P A;  2H5Y A;  1ZKB A;  1UTH B;  4NF8 A;  2X7Q A;  5DVI A;  1N76 A;  3DLN A;  3RTF B;  1MQG A;  5BWJ A;  5EHS A;  3SES A;  3FJ7 A;  4KFQ A;  1N0T A;  1MH4 A;  3IJO B;  4FE8 A;  2OLB A;  2O84 X;  3D4C A;  5I2K A;  2OCU A;  3FXU A;  3ZKK A;  2OWT A;  2QMX A;  3HN0 A;  4OMB A;  5L8D A;  2VHA A;  2F6P A;  3CRB A;  4ESW A;  1IIT A;  4GVO A;  4G8H A;  5EHM A;  4U22 A;  4I62 A;  2DE4 A;  4GLI A;  2I58 A;  4BDR A;  1B40 A;  3V5A A;  1QUK A;  3TTL A;  2DWH A;  2B65 A;  3A09 A;  1N7X A;  3CSG A;  2DP8 A;  4XKN A;  1FTO A;  3FVN A;  4JWO A;  1VFD A;  4U2R A;  4E0W A;  3QXM A;  5I58 A;  4TLM B;  4YU0 A;  1B3E A;  3LSW A;  2DE3 A;  2VD2 A;  3C34 A;  2H25 A;  2QS4 A;  3EN3 A;  4EQ9 A;  4YIC A;  3K02 A;  3UN6 A;  2F5X A;  4LZ5 A;  1WOD A;  1UTB B;  4ECF A;  4N6P A;  4F1V A;  4C1U A;  2Q2A A;  1II5 A;  2GRV A;  3CG3 A;  5KZT A;  3OXN A;  1VSO A;  1QJM A;  5CMC A;  1LST A;  5HPQ A;  1NH8 A;  4UA8 A;  2DVZ A;  1MXV A;  2HZL A;  4RJZ A;  2ZYM A;  5JEI A;  4Q8R A;  4BDL A;  1XOC A;  4ZE9 A;  1H45 A;  4HTG A;  4GXS B;  1BLF A;  3PMV A;  1JET A;  2O6A A;  1EZO A;  4AB5 A;  1N3X A;  3MC2 A;  4H6D A;  3K01 A;  3H6V A;  3N6T A;  5L9O A;  1IQ7 A;  1DSN A;  4NF6 B;  3PMX A;  1P1W A;  3MZ9 A;  2Z8E A;  3ZS6 A;  3H06 B;  2VP1 A;  1RYO A;  4F31 B;  1USY H;  3O6H A;  4ZEB A;  1I69 A;  4ZEK A;  3ILU B;  3Q26 A;  3EHT A;  2Y7K A;  1HSL A;  3W15 C;  4U1O A;  3O97 A;  3Q29 A;  4ZE8 A;  4X9T A;  5ICQ A;  5H8S A;  1Y9U A;  3R26 A;  3Q25 A;  1ZLQ A;  1Y3Q A;  5CMB A;  4MF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...