2QSXA

Crystal structure of putative transcriptional regulator lysr from vibrio parahaemolyticus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
197
structure length
180
Chain Sequence
b'ELLVVDVTPSFASLWLVPNINDFHQRHPNIRVKILTGDGAVESDLHVRCLPLSTHYEYSQLLCEETLLLIGNTNLPISHYPFIPQTTRPQLWEQFKQENITYHSVGFEHFYLACEAVRMEKGLALLPDFMAQFSILRGDIQHIGNLKLHSGYGYYVVIPNFRLTSRKVALFHDWLKDKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator, LysR family
publication title The Crystal Structure of Putative Transcriptional Regulator LysR From Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transcription
total genus 48
structure length 180
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qsxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qsxA02
4BDLA 1NKXA 2Q88A 3KEIA 4BDRA 3K2DA 1B51A 3WAFA 1FQEA 3CG3A 4UA8A 3UA8A 4RK2A 4F18A 4O3BA 1DSNA 1CB6A 3OEKA 2OWSA 2HQ0A 2QS2A 5CRYA 5K2YA 3A3CA 4G68A 3FJMA 4LA9A 1II5A 3DP6A 5KCJA 1XHYA 4FIMA 5I2NA 3G3JA 3Q28A 2A5TA 1LBBA 1ATGA 3SETA 1YTVA 4EDPA 5AA4A 1IXCA 5ICTA 3F11A 1Y3NA 3FV1A 4KQPA 2UYFA 3S9NC 4HW8A 4KCDA 4G68C 4KI0E 1USYE 4ZDMA 1UTHB 1FTJA 1GVCA 3HO7A 5ELVA 5CMBA 1R9LA 4LONB 3H6UA 3G3HA 1OVTA 2F78A 4RYAA 1SQYA 2QMWA 2VD2A 1J1NA 3U93A 5HPQA 1UQWA 1EZPA 1B52A 1VFEA 1MM7A 2CMOA 3RN8A 2I6EA 3MBPA 3TTMA 2P0SA 4EUOA 3PPPA 4M1VA 1NNKA 5B70A 3JV9A 2NUVA 3KN3A 2XX7A 1Y9UA 2O6AA 3IO4A 1R9QA 3UK4A 4HTGA 4QSEA 3K1NA 3MVZA 1MPBA 2Z22A 4F2OA 4JB7A 3MWBA 4NWDA 3QUFA 1WODA 5CC2A 4U1OA 3KBRA 3VV5A 4BLAA 2ZNUA 1JEUA 4R74A 1HSLA 5IKBA 3T96B 3TCFA 5CBSA 4ISUA 1USYH 2DS9A 4YKIA 4YKJA 3ILTB 5AA3A 4LQ5A 1B5HA 5A5XA 2UVIA 4R73A 2ZNTA 3LSWA 5K2XA 2XXHA 2ESNA 5DVFA 3OD7A 3B6WA 4O3AA 4F2QA 2XX8A 3CSBA 1OMPA 3Q25A 4GD5A 3PGFA 1N76A 4PE5B 3O2AA 4LZ5A 3IJXB 3N94A 3VVDA 2ZYKA 1VFDA 2O69A 1GGGA 2O1LA 3MQ9A 4XXUA 1WVJA 2RINA 3E13X 4GF8A 3Q27A 1PB8A 4OYVA 4LP2B 3O9PA 4G68B 5ITOA 5FTIA 2A5SA 4DIGA 2GH9A 5KCJB 3S2VA 4F1VA 5I2NB 3A09A 1N7WA 3B6TA 2QMXA 2O7UA 2F8DA 3PUYE 4NE4A 3V89B 2PMSA 2NOOA 1R6ZA 3PPRA 1M5BA 1BLFA 1TWYA 4K3FA 4FEDA 3T66A 1JQFA 4XKNA 1IITA 2OWTA 2YPNA 2P1SA 3W9VA 4ZE8A 3MP6A 1KWHA 1Y1ZA 5FHMA 1ZJLA 4RK9A 3LR1A 2H4IA 1IQ7A 2DQVA 4LZ8A 3H3GA 1LAXA 1ANFA 2I0BA 1CE2A 4QFKA 3S9EA 5CBRA 1YPNA 5I58A 2VOZA 4G77A 4POXA 1Y4CA 2V25A 2ZMBA 1ZMGA 3FATA 3VE1B 2Z8FA 4ELRA 4FEBA 1DOTA 3PU5A 1MY1A 3OMBA 3MW0A 2KLFA 3QAXA 1LAGE 3IR1A 5L9MA 3TTLA 2ONKE 3U1OA 3K4UA 4XKRA 2F6PA 4NF8B 4AQ4A 1M5EA 3CVGA 3D4CA 5DTBA 3QXMA 5H8QB 2XXQA 3EHTA 3JYRA 1MXXA 3TELA 4YU0A 3IB1A 4H5GA 5I2KA 4RXLA 4TLMB 1XC1A 4I62A 3HHFA 5FHOA 1MDP1 2XD3A 3T22A 3GZGA 3B6QA 1MQHA 1B32A 1OQHA 2ANJA 3PPOA 1QVSA 3SERA 1AH5A 4NEDA 2PBWA 5JEIA 2XHDA 1JVYA 2H25A 4OEUA 3CG1A 3ECRA 4IO7A 4JWYA 2Q89A 1MPCA 2HFBA 1M5CA 2HEUA 2RC9A 1B2HA 3MZBA 1RYOA 3FXRA 3SESA 1OVBA 2Y7PA 1D9VA 1MY4A 5CI5A 4H65A 2RF1A 3PV0E 5ISUA 1IXIA 1ELJA 4F22A 2ZNSA 2ZYOA 2UVGA 1OIBA 1DPPA 1MPDA 3EHSA 4OFJA 4YMBA 3U72A 3QIMA 5TPAB 2V93A 1UTBA 3LBSA 3T9XB 3L6HA 4LZ7A 3DP4A 3M8UA 4X1DA 2M8CA 5J1DA 4KCCA 3LC8A 4ZEFA 3FVNA 2OZZA 4ZEKA 2XXPA 2DOJA 3N6UA 1I6QA 3OO6A 2DWHA 1MQGA 1SI0A 4NTLA 2NWJA 1MS7A 4G8MA 4E0XA 4YB7A 1FTMA 2NVUB 4IO3A 2QRYA 4Z0IA 3FD3A 3W15C 3BFUA 4EXKA 3RTFB 1LLSA 2GHAA 1P1QA 3TCHA 4QRZA 3U94A 1PBQA 1POY1 1B3LA 2F7BA 2THIA 1PC3A 3Q29A 1GR2A 4JBZA 1EZ9A 1PB7A 3KZGA 4G4PA 1N0TA 1OQGA 2OJTA 3O66A 3RT6B 3KSXA 4QHQA 1JNFA 1JETA 1XT8A 4G8NA 4XKQA 4ZEDA 2ONRA 4IY6A 4MLVA 2QS4A 4OESA 4WKMA 1PDAA 4NF5B 4EXLA 1HSJA 4F1UA 4JWXA 4OEVA 3TAJA 2I48A 2E0SA 1SW4A 1EZOA 1MY2A 3H03A 4F31B 4HCWA 1NFTA 1HSEA 5H8FA 3N6TA 3KOTA 4RPOA 3H06B 4YZZA 4GXAA 3UIFA 3GXAA 1B3GA 5AA2D 4NF6B 4ESXA 1MRPA 1Y3QA 5DT6A 3MZ1A 1P1OA 3KFMA 2UXAA 1URDA 4EQBA 4R2BA 2HAUA 4N07A 1IUDA 3MUQA 1SYHA 1AOVA 3RNNA 4F3PA 2XXWA 4GL0A 3IOVA 2UVHA 4RY1A 1VR5A 2QL3A 2HZKA 4Z7EA 1SBPA 4R9FA 1XVYA 2ABHA 1I6BA 1NL5A 3BKIB 3OSRA 5IAIA 3FIRA 2I4BA 1LAHE 4H8JA 5DEXA 2DE2A 3OEMA 1B40A 2HZLA 1QUKA 1O64A 4TOZA 2ONSA 3O6GA 3P7IA 4PETA 3TYHA 1QJMA 1IXHA 3FXUA 1MH3A 3UN6A 3TTKA 3OENA 3OO9A 3KN7A 4ESWA 3IL1B 4OQOA 5JTYA 3TMGA 1YCJA 3TTRA 4IB2A 2VP1A 4ZZEA 3IB2A 1N04A 5JK4A 1P1UA 4QFOA 2VHAA 3EHUA 3RUMA 3I6VA 3ZKLA 4H6DA 1XS5A 2Z23A 3ZKKA 1A8EA 4XTCQ 3CSGA 2IEEA 1B5IA 1B58A 5M2VA 1BKAA 4JSDA 5EHSA 2VD3A 3TDJA 4DCXA 1A99A 1FQBA 4QFLA 4HS7A 2NXOA 4C1UA 4RNSA 4TLLB 4OWDA 3TTNA 1ZTYA 1LFIA 1JW4A 4U4XA 5TP9A 1ZBMA 3RQTA 2F7CA 3RLFE 3ONMA 4X48A 1NH7A 2QPQA 2Q8JA 2PVUA 4ELQA 1OLAA 3ZSFA 4JXIA 1NMUA 1B7ZA 4KYDA 3IOTA 3R6UA 4U22A 1US4A 3VLVA 1US5A 2IA4A 4PP0A 2Y7IA 1Q35A 4GVOA 4U4SA 1XVXA 4X9TA 4MBPA 1MQIA 1B4HA 1YAEA 3I5OA 2A5TB 3K0VA 1LB8A 4QSDA 1SI1A 4LQ2A 5AA4B 2LAOA 2GFEA 2FNCA 3HHGA 3G3FA 1F9BA 5H8SA 4GQOA 1ZIUA 4EQ9A 4GLIA 2DP8A 3MPKA 2X26A 1VE4A 3USDA 1S7YA 2Q2CA 3K01A 1TFDA 1SW1A 3D4GA 4QSCA 1FQDA 5H8HA 1H45A 1T0KA 3OELA 4U1ZA 5B7DA 3RT8A 3R26A 5CMMA 3PPNA 1N3WA 3KSJA 3MVXA 4PFTA 1D3KA 4H0WA 1A54A 1B1XA 5FHNA 2QJEA 4H8IA 5H8NA 1MG1A 3K1MA 4XIGQ 4R6KA 2QS1A 3GBBA 5DEXB 4YB5A 2XXUA 1URSA 3FVOA 3RGYA 3S9MC 5DVJA 1QKAA 3W9WA 1O7TA 3IB0A 3KN8A 4LVQA 5DVIA 1B9JA 5I59A 3CRBA 4L17A 3WAEA 4I1DA 1TXFA 3VLWA 2PX1A 5JTYB 2ZYNA 5CM6A 2CZLA 3IORA 2W7YA 4OERA 1IZ1A 3TFLA 2UVJA 4H67A 5L8DA 3MC2A 3MAMA 4IO2A 3M3KA 2E1SA 3G3KA 1GV8A 2QS3A 4QFNA 1FTLA 3DLNA 1Y20A 3CI8A 3EN3A 1H44A 4OENA 5A5XB 2RC8A 3LUYA 4PQJA 3SEVA 2DWAA 3DP8A 4FECA 2V3TA 3IAZA 3PMVA 4KFQA 5TP9B 3BBRA 4H1XA 1L5TA 2F5XA 4OXVA 1ZKBA 2P2AA 3O97A 1SYIA 1P1NA 3H4ZA 1LB9A 2X7PA 2D5WA 5DYHA 3UORA 2ZXTA 4X1BA 3KG2A 1FQFA 1POTA 1JVXA 4C1TA 1DPEA 3K1PA 3QK6A 4G2ZA 4F3SA 4DXBA 1DTZA 2DVCA 5HBCA 4GFRA 4ELOA 2I49A 4NF4A 2H9BA 1FTOA 2D3IA 1B3HA 1LSTA 3O6IA 1RYXA 2F35A 1QULA 3S9LC 1Y4TA 4U21A 2V3QA 1JEVA 3U8QA 4KYSA 2FA7A 1Y3PA 2DXRA 3TKDA 2O51A 3IK6B 4BDMA 3O6HA 1AL3A 1Y1MA 1MQDA 3VVEA 3OSQA 4M4GA 1B3EA 4ZS9A 3FUZA 4FORA 1LCTA 5BUUA 4N6PA 3HSTA 3O29A 1URGA 1UIUA 3CFLA 5H8HB 3T9HB 5I56A 2O1MA 4IO4A 4GXSB 1MXYA 2UYEA 2G93A 2H99A 4IGRA 5I58B 3S4UA 4LUBA 1DMBA 3N5LA 5H8NB 4WXJA 4QF9A 4P11A 1I69A 4GRKA 5AE4A 3TCGA 3HV1A 4KPTA 5ITPA 2R6GE 4OHNA 5LOMA 5L9SA 4POWA 1B7HA 1FTKA 4GOTA 3PD8A 2WKYA 4OETA 1ZU0A 1B3FA 1SVXB 5I84A 1B4ZA 4IO6A 4RA1A 2R9JA 2GRVA 3EF7A 5I57A 5I2KB 3UGWA 4I8CA 3VDFA 1SW2A 4WEPA 1LGBC 3E3KA 2YJPA 3FVKA 3VFJA 4THIA 1MDQA 1MQJA 4ELPA 1SW5A 1GTKA 1PB9A 1MXVA 1N3XA 3VVFA 1OLCA 3EPEA 4EF2A 3TODA 5L9OA 4NMYA 3MZ9A 3MP1A 3LSXA 4UACA 2HCAA 2PT1A 2OBGA 2V84A 4EQ7A 1PEBA 4ND9A 1NNTA 4HCYA 3PUWE 2XD2A 2RCAA 3FV2A 1A8FA 2OLBA 3K00A 4YB6A 1IXGA 3G3GA 3Q26A 1MXZA 4NF4B 1ZLQA 2QSXA 1N7XA 2ZYMA 3QUJA 1FW0A 2H98A 4G8HA 2OCUA 3GBAA 1UTBB 2D21A 2B3BA 1M5FA 3RY3A 2XXXA 1R1NA 5HM4B 3VLUA 1RKMA 4ZECA 3VXCA 3GLBA 3IO6A 4FE8A 2DWIA 3E9XA 1FQCA 3LSLA 1A40A 1H43A 4U2RA 3M3FA 1EU8A 3H7MA 3ILUB 5I56B 1H76A 1NNFA 3H6VA 1VSOA 4DLDA 4YICA 2Y7WA 4NWCA 3THIA 3I3VA 4R9GA 3SEWA 4ECFA 3FASA 4QFPA 4NF8A 4DE8A 5CMKA 4P0GA 5AA2A 4FAJA 2DWJA 1MY3A 4OFOA 2Z8DA 4MFIA 4GIZA 1H3DA 4Q30B 5H8QA 3PUXE 2DXYA 4ONYA 4H5FA 3TQWA 4ZZAA 3CFXA 3KOSA 4PFWA 1FCKA 4F3BA 4I9DA 1A55A 3IOWA 4F1YA 1IIWA 1QW0A 3N26A 2Y7KA 3PUZE 2XXVA 4TQUQ 3RPWA 3SEUA 3BFTA 1TFAA 3ZS6A 1LAFE 1TT1A 3TUSA 4YKPA 5KDTA 1FQAA 4FATA 1PBPA 3MPLA 5I57B 3C9HA 3K6VA 2RC7A 1LFGA 4AB5A 1P1WA 2Y84A 3PMWA 3V5AA 2G29A 3IJOB 3C34A 4BDOA 1N84A 2REJA 1QUJA 4Q0CA 3V83A 5KZTA 1O63A 1B0HA 5H8FB 1LFHA 1MH4A 3AXFA 3FVGA 4DXCA 2AIXA 2XX9A 4OTEA 4OMBA 3SDFA 3OO8A 4ZE9A 5F1QA 3TEPA 3SEXA 3PD9A 4KHZE 4R2FA 3FGSA 4GWOA 3C33A 1I6AA 3MVWA 3K6WA 2Q2AA 1XOCA 1DTGA 5FTHA 1B5JA 1UIVA 3C35A 4PFYA 5TPAA 3ODBA 2F6GA 4Q5TA 3DM0A 4R6YA 3PUVE 4MF3A 3RTWB 3KGCA 2HAVA 3VXBA 2HXWA 3H6TA 1Q1KA 4IY5A 3CFZA 5F7VA 2AL4A 2ALUA 2RCBA 1Z7NE 3E4RA 4AB6A 3C36A 4BDNA 4IO5A 1QKBA 2Y7RA 1JW1A 4ZEBA 3A3UA 2O68A 3C32A 3G3IA 4RJZA 2I4CA 4DDDA 3CIJA 2Q9TA 3OXNA 4LATA 4N13A 3SEYA 2O7IA 4XKPA 4F39A 4OVJA 2REGA 1B6HA 2VGQA 5BWJA 1B7UA 4YMAA 4FJPA 2I3VA 4GL8A 3FZVA 5AA2B 4OFLA 3MJNA 3QYTA 3C31A 1P99A 4IGTA 3PPQA 1S50A 4P0IA 1BP5A 4R6HA 5TU0A 1MXUA 2F36A 4PFUA 2I58A 1B0LA 2X7QA 1M5DA 4NF5A 1BTJA 2B3FA 5KDTB 4F19A 3UP9A 5EHMA 3DELB 1B46A 3QSLA 3MVYA 2DYXA 1NH8A 4C0RA 1MXWA 1WDNA 3V8XB 2PT2A 3C4MA 1A7LA 3KJTA 3OO7A 2DE4A 4NF6A 4Q8RA 3HPIA 2F7AA 2R71A 2RKMA 1MM6A 3K02A 3HN0A 3HCQA 2BJJX 4KR5A 2H5YA 1EH3A 2GHBA 1AMFA 1UTHA 4U23A 4MH5A 4JDFA 3T9UA 1SD3A 4EF1A 3R7XA 3T9VA 1NNPA 2FYIA 5ICQA 1LCFA 2YLNA 4RPNA 4YKKA 4OZ9A 2DSFA 2AL5A 4KYEA 1BIYA 1B1HA 2B65A 4F3GA 4MLQA 1SDXA 3FXQA 2F34A 2PYYA 3H6WA 3T93B 3KJ7A 4R72A 1B05A 1AIVA 3O28A 3SKPA 3K6XA 1QUIA 1MY0A 3FJ7A 4O3CA 1S9TA 4BDQA 3G7WA 5AA1A 1LBCA 3CR9A 4ZEIA 1JW5A 2XXIA 2DE3A 1D9YA 4E0WA 3FJGA 2XXRA 2Z8EA 1IEJA 4WEDA 4R75A 2OK2A 3OOAA 3B7DA 2V3UA 2DVZA 5I59B 3TQLA 4JSOA 3MP8A 3K6UA 2XXTA 4YAHX 5CMCA 4DXUA 2I3WA 4KD5A 2I0CA 3EQ1A 3L6GA 4DCYA 4DZ1A 3LSFB 2F97A 3U92A 3TPAA 1D4NA 3IX1A 1Z7ME 3PMXA 3IOUA 3M3LA 4JWOA 2O84X 2AYSA 3JZJA 5EYFA 4F29A 2XXYA 3TZAA
chains in the Genus database with same CATH superfamily
4BDLA 1NKXA 2Q88A 3KEIA 4BDRA 3K2DA 1B51A 3B8BA 3WAFA 4N8GA 1FQEA 3CG3A 4UA8A 3UA8A 4RK2A 4F18A 4O3BA 1DSNA 1CB6A 3OEKA 2OWSA 2HQ0A 2QS2A 5CRYA 5K2YA 4OANA 3A3CA 5EYHA 4G68A 3FJMA 4LA9A 1II5A 5FBPA 3DP6A 5KCJA 4PBQA 1XHYA 4FIMA 5I2NA 3G3JA 3Q28A 2A5TA 1LBBA 1ATGA 3SETA 2PFZA 1EYJA 1YTVA 4EDPA 5IZ3B 5AA4A 1IXCA 1KA1A 5ICTA 3F11A 1Y3NA 3FV1A 4KQPA 2UYFA 3S9NC 4HW8A 4KCDA 4G68C 3QMFA 4KI0E 1USYE 4ZDMA 1UTHB 1FTJA 3RPLA 4I40A 1GVCA 3HO7A 5ELVA 2OX3A 5CMBA 3ISPA 1R9LA 4LONB 3A29A 3H6UA 3G3HA 5T3JA 1OVTA 2F78A 4RYAA 1SQYA 1NV6A 2QMWA 2VD2A 1J1NA 3U93A 5HPQA 1UQWA 1EZPA 1B52A 1VFEA 3IFCA 1MM7A 2CMOA 3RN8A 2I6EA 3MBPA 3TTMA 2P0SA 3MSTA 4EUOA 3PPPA 4M1VA 1NNKA 4P3LA 5B70A 3JV9A 1INPA 2NUVA 4PGPA 3KN3A 2XX7A 4I3EA 4GX3A 4IR8A 1Y9UA 2O6AA 3IO4A 1R9QA 1IMDA 3UK4A 4HTGA 1IMBA 4MMPA 4QSEA 3K1NA 3MVZA 2B4MA 2F3BA 2ZZWA 1MPBA 4PE3A 2Z22A 4F2OA 4JB7A 3MWBA 4NWDA 3QUFA 1WODA 5CC2A 4U1OA 3KBRA 3VV5A 4BLAA 2ZNUA 1JEUA 4R74A 1HSLA 5IKBA 1FPBA 3T96B 3TCFA 5CBSA 4ISUA 2FHYA 1CNQA 1USYH 2DS9A 4YKIA 4PFIA 4YKJA 3ILTB 5AA3A 4LQ5A 1B5HA 4OA4A 5A5XA 2UVIA 4R73A 2ZNTA 3LSWA 5K2XA 2XXHA 2ESNA 5DVFA 3OD7A 3B6WA 4O3AA 4F2QA 2XX8A 3CSBA 1OMPA 3Q25A 4KXPA 4GD5A 3PGFA 1N76A 4PE5B 3O2AA 4LZ5A 3IJXB 3N94A 3VVDA 2ZYKA 1VFDA 2O69A 1FPEA 2VPNA 1GGGA 2O1LA 3MQ9A 4XXUA 1WVJA 2RINA 3E13X 4GF8A 3Q27A 1PB8A 4OYVA 2WEFA 4LP2B 3EKIA 3O9PA 4G68B 5ITOA 5FTIA 2A5SA 4DIGA 2GH9A 5KCJB 4P47A 3S2VA 4F1VA 5I2NB 3A09A 1N7WA 3B6TA 2QMXA 2O7UA 2F8DA 3PUYE 4NE4A 1NUZA 3V89B 2PMSA 2NOOA 1R6ZA 3PPRA 1M5BA 1BLFA 1TWYA 4K3FA 4FEDA 3T66A 1JQFA 4XKNA 1JP4A 1IITA 2MKZA 2OWTA 2YPNA 1NV7A 2P1SA 3RPLB 3W9VA 4MHFA 4ZE8A 1IMEA 3MP6A 1KWHA 1Y1ZA 5FHMA 1ZJLA 4RK9A 3LR1A 2H4IA 4H45A 1IQ7A 1FJ6A 1G0IA 2DQVA 4LZ8A 3H3GA 1LAXA 1ANFA 4PGNA 2I0BA 1CE2A 4QFKA 3S9EA 5CBRA 1YPNA 5I58A 2VOZA 5I7IA 4G77A 4POXA 4PC9A 1Y4CA 2V25A 2ZMBA 1EYKA 1ZMGA 3FATA 3VE1B 2Z8FA 4ELRA 4FEBA 1DOTA 3PU5A 2KR0A 1MY1A 3OMBA 3MW0A 2KLFA 3SZPA 4GWYA 3QAXA 1LAGE 3IR1A 5L9MA 3TTLA 2ONKE 5A5LA 3U1OA 3K4UA 4XKRA 2F6PA 4NF8B 4AQ4A 1M5EA 3CVGA 3D4CA 5DTBA 3QXMA 5H8QB 3T1BA 2XXQA 3EHTA 3JYRA 4O7IA 1MXXA 2WYPA 3TELA 4YU0A 3IB1A 1QGXA 4H5GA 5I2KA 4RXLA 4TLMB 2OWZA 1XC1A 3NOHA 3KBZA 4I62A 3HHFA 5FHOA 1MDP1 2XD3A 3T22A 3GZGA 3B6QA 5DW8A 4GBVA 1MQHA 1B32A 1OQHA 2ANJA 3PPOA 1QVSA 3SERA 1AH5A 4NEDA 5IZZA 2PBWA 5JEIA 2XHDA 1JVYA 2H25A 4OEUA 3CG1A 3ECRA 4IO7A 4JWYA 2Q89A 2HPGA 1MPCA 1NV5A 2HFBA 1M5CA 2HEUA 2RC9A 1B2HA 3MZBA 4N4UA 1RYOA 4PDHA 3FXRA 3SESA 1OVBA 2Y7PA 1D9VA 1MY4A 5CI5A 4H65A 2RF1A 4N91A 3PV0E 1FPIA 3LUZA 5ISUA 1IXIA 1ELJA 4F22A 4OVPA 2ZNSA 2ZYOA 2UVGA 1OIBA 1DPPA 1MPDA 3EHSA 4OFJA 4YMBA 3U72A 3QIMA 5TPAB 2V93A 1UTBA 3MYUA 3LBSA 3T9XB 3L6HA 3U65A 4LZ7A 3DP4A 3M8UA 4X1DA 2M8CA 1RDXA 5J1DA 4KCCA 3LC8A 4ZEFA 3FVNA 4N6DA 2OZZA 4ZEKA 2XXPA 2DOJA 3N6UA 1I6QA 3OO6A 2Q8MA 2DWHA 1MQGA 5ET6A 4LN5A 1SI0A 4NTLA 2NWJA 2BJIA 1MS7A 4G8MA 4E0XA 4YB7A 1FTMA 2NVUB 4IO3A 4X04A 4GWWA 2QRYA 4PFRA 4Z0IA 3FD3A 3W15C 3BFUA 4EXKA 3RTFB 1LLSA 2GHAA 5EQ8A 1P1QA 2FVZA 3TCHA 4QRZA 3U94A 1PBQA 3IFAA 1POY1 1B3LA 2F7BA 2THIA 1PC3A 3Q29A 1GR2A 4JBZA 1EZ9A 1PB7A 4HE0A 2ZZVA 3KZGA 4G4PA 1N0TA 1OQGA 2OJTA 3O66A 3RT6B 3KSXA 1D9QA 4N81A 4QHQA 1JNFA 1JETA 1XT8A 1LBYA 4G8NA 4XKQA 4ZEDA 2ONRA 4IY6A 4MLVA 4O8MA 2QS4A 4OESA 4WKMA 1PDAA 4NF5B 4EXLA 4OVQA 1NV3A 1HSJA 4F1UA 4JWXA 4OEVA 3TAJA 4GWXA 2I48A 2E0SA 1SW4A 1EZOA 1MY2A 3H03A 4F31B 4XFEA 4HCWA 3RYDA 1NFTA 4HE1A 1HSEA 3D1RA 5H8FA 3N6TA 3KOTA 4RPOA 3H06B 4YZZA 4GXAA 4NG7A 3UIFA 3GXAA 1B3GA 5AA2D 4NF6B 4ESXA 1MRPA 1Y3QA 5DT6A 3MZ1A 1P1OA 3KFMA 4MNCA 4MEVA 2UXAA 1URDA 4EQBA 4R2BA 2HAUA 4N07A 1IUDA 3MUQA 4G61A 2VPOA 1SYHA 3FBPA 3RNNA 1AOVA 5F24A 4F3PA 3KC0A 2XXWA 4GL0A 3IOVA 2UVHA 4RY1A 4P9KA 1VR5A 2QL3A 2HZKA 4Z7EA 1SBPA 4R9FA 4AS5A 1XVYA 2XWIA 2ABHA 1I6BA 1NL5A 3BKIB 3OSRA 5IAIA 3FIRA 2I4BA 1LAHE 4H8JA 5DEXA 2DE2A 3OEMA 1B40A 2HZLA 3BIGA 1QUKA 1O64A 4TOZA 2ONSA 3O6GA 3P7IA 4PETA 3TYHA 1QJMA 1IXHA 1LBVA 3FXUA 1MH3A 4NX1A 3UN6A 3TTKA 3KC1A 3OENA 3OO9A 3KN7A 4ESWA 1FBHA 3IL1B 4OQOA 4MX6A 5JTYA 3TMGA 1YCJA 3TTRA 4IB2A 2VP1A 4ZZEA 3IB2A 1N04A 5JK4A 1FBFA 1FJ9A 4QFOA 1P1UA 1NUWA 2QVRA 3LV0A 2VHAA 3EHUA 3RUMA 3I6VA 3ZKLA 4H6DA 1FRPA 1NV0A 4NHBA 1XS5A 2Z23A 3ZKKA 3PTYA 1A8EA 4XTCQ 3CSGA 2IEEA 5ESYA 1B5IA 1B58A 5M2VA 1BKAA 3CHGA 4JSDA 5EHSA 2VD3A 3TDJA 4DCXA 4GX6A 1A99A 1FQBA 4QFLA 4HS7A 2NXOA 4C1UA 4RNSA 4TLLB 1NV1A 4OWDA 3TTNA 5EQAA 5LDZA 1ZTYA 1LFIA 1FPDA 1JW4A 4DI4B 5EYGA 4U4XA 5TP9A 1ZBMA 1DBZA 3RQTA 2F7CA 3RLFE 3ONMA 4X48A 1NH7A 4H46A 2QPQA 2Q8JA 2PVUA 2R8TA 4ELQA 1OLAA 3ZSFA 4NGUA 1DCUA 4JXIA 1NMUA 1B7ZA 4KYDA 3IOTA 4PF6A 3R6UA 4U22A 1US4A 3VLVA 1US5A 4NN3A 2IA4A 4PP0A 1NUXA 2Y7IA 1Q35A 4GVOA 4U4SA 1XVXA 4X9TA 4MBPA 1MQIA 1B4HA 1YAEA 1LBZA 3I5OA 2A5TB 3K0VA 1LB8A 4QSDA 1FPGA 1SI1A 4GX4A 4LQ2A 5AA4B 2LAOA 2Y5LA 2GFEA 2DDKA 4OVRA 2FNCA 3HHGA 3G3FA 1F9BA 1FBDA 5H8SA 4GQOA 1ZIUA 4EQ9A 4GLIA 2DP8A 3MPKA 2X26A 1VE4A 4JVDA 3USDA 1S7YA 2Q2CA 3K01A 1TFDA 1SW1A 4FBPA 5EQ9A 3D4GA 4QSCA 1FQDA 5H8HA 1H45A 1T0KA 3OELA 4U1ZA 5B7DA 3RT8A 3R26A 5CMMA 3PPNA 1N3WA 3KSJA 3MVXA 1Q9DA 4PFTA 2XA5A 1D3KA 4H0WA 2FBPA 1A54A 1B1XA 5FHNA 2QJEA 4H8IA 5H8NA 1MG1A 3K1MA 4XIGQ 4R6KA 2QS1A 3GBBA 5DEXB 4YB5A 2JJKA 2KQZA 2XXUA 1URSA 3FVOA 2QVVA 3RGYA 3S9MC 5DVJA 2VT5A 4P8BA 1QKAA 3W9WA 1O7TA 3IB0A 5I3SA 3KN8A 4LVQA 1IMFA 5DVIA 1B9JA 5I59A 3CRBA 4L17A 3WAEA 4I1DA 1TXFA 3VLWA 2PX1A 5JTYB 2ZYNA 5CM6A 2CZLA 4PBHA 3IORA 2W7YA 4OERA 4OVTA 1IZ1A 1FPKA 3TFLA 2UVJA 4H67A 5L8DA 1YYZA 3MC2A 1FBGA 3MAMA 4IO2A 3M3KA 5J16A 2E1SA 5ET8A 1NI9A 3G3KA 1GV8A 2QS3A 2XXKA 4QFNA 1FTLA 3DLNA 1Y20A 3CI8A 2FIXA 3EN3A 1H44A 4OENA 5A5XB 2RC8A 3LUYA 4PQJA 3SEVA 2DWAA 3DP8A 2PCRA 4FECA 2V3TA 3IAZA 3PMVA 4KFQA 2Q74A 1IMCA 5TP9B 3BBRA 4H1XA 1L5TA 2F5XA 4OXVA 4AS4A 1RDZA 1ZKBA 2P2AA 3O97A 1KA0A 1SYIA 1P1NA 3H4ZA 1LB9A 2X7PA 2D5WA 4MCOA 5DYHA 3UORA 2ZXTA 4X1BA 3KG2A 1FQFA 1POTA 1JVXA 4C1TA 1FBPA 1SPIA 1DPEA 3K1PA 3QK6A 4G2ZA 4F3SA 4DXBA 1DK4A 4PTKA 1DTZA 1LBWA 2DVCA 5HBCA 1KZ8A 4GFRA 4ELOA 2I49A 4NF4A 2H9BA 1FTOA 2D3IA 4GWSA 1B3HA 1LSTA 3O6IA 1RYXA 2F35A 1QULA 3S9LC 1Y4TA 3FXBA 4U21A 2V3QA 1JEVA 3U8QA 4KYSA 2FA7A 3HFUA 1Y3PA 3BIHA 2DXRA 1K9YA 1FPLA 3TKDA 2O51A 3IK6B 4BDMA 3O6HA 1AL3A 1Y1MA 1MQDA 3VVEA 4O7MA 3OSQA 4M4GA 1B3EA 4ZS9A 3FUZA 4FORA 1LCTA 5BUUA 4N6PA 3HSTA 3O29A 4MNPA 1URGA 1UIUA 3CFLA 5H8HB 3T9HB 5I56A 1YXIA 1FPJA 2O1MA 4IO4A 4GXSB 3GYYA 1MXYA 2UYEA 4JVCA 2G93A 2H99A 4IGRA 5I58B 3S4UA 4LUBA 2CEXA 4I3YA 1DMBA 3N5LA 2QFLA 5H8NB 4WXJA 4QF9A 3ROJA 2WBBA 4P11A 1I69A 4GRKA 5AE4A 1YZ0A 3TCGA 3HV1A 4KPTA 5ITPA 5EQ7A 2R6GE 4OHNA 5LOMA 5L9SA 4POWA 1B7HA 1FTAA 1FTKA 4HE2A 4GOTA 3PD8A 2WKYA 4OETA 1ZU0A 1B3FA 1SVXB 5I84A 1B4ZA 4XEQA 4IO6A 4RA1A 2R9JA 2GRVA 3EF7A 5I57A 5I2KB 3UGWA 4I8CA 4DI3D 3VDFA 1SW2A 4WEPA 4PDDA 1LGBC 3E3KA 2YJPA 3FVKA 3VFJA 4THIA 1MDQA 1MQJA 4ELPA 1SW5A 1GTKA 1PB9A 1MXVA 1N3XA 3VVFA 1OLCA 3EPEA 4EF2A 3TODA 4NAPA 5L9OA 4NMYA 3MZ9A 4PFBA 3MP1A 3LSXA 4UACA 2HCAA 2PT1A 3T0JA 2OBGA 2V84A 4EQ7A 1FBEA 1PEBA 4ND9A 1NNTA 4HCYA 3PUWE 2XD2A 2RCAA 3FV2A 1A8FA 4NQ8A 2OLBA 3K00A 5IM2A 4YB6A 4N8YA 1IXGA 1FSAA 2GQ1A 3G3GA 3Q26A 1MXZA 4NF4B 1ZLQA 2QSXA 1N7XA 2ZYMA 3QUJA 1FW0A 2H98A 1NUYA 4G8HA 2OCUA 3GBAA 1UTBB 2D21A 2P3NA 2B3BA 4X8RA 1M5FA 3RY3A 2XXXA 1R1NA 1NV4A 5HM4B 4XF5A 3VLUA 1RKMA 4ZECA 3VXCA 5IGAA 3GLBA 4FE8A 3IO6A 2DWIA 3E9XA 1FQCA 3LSLA 1A40A 1H43A 4U2RA 3M3FA 1EU8A 3H7MA 3ILUB 5I56B 1H76A 1NNFA 3H6VA 1VSOA 4DLDA 4YICA 4NWCA 2Y7WA 3THIA 3I3VA 2B4LA 4R9GA 2L5VA 3SEWA 4ECFA 3FASA 4QFPA 4NF8A 4DE8A 5CMKA 4P0GA 4FAJA 5AA2A 4P1EA 2DWJA 1MY3A 4OFOA 2Z8DA 4MFIA 4GIZA 1H3DA 4Q30B 4PAFA 5H8QA 3PUXE 2DXYA 4ONYA 4H5FA 3TQWA 4ZZAA 3CFXA 3KOSA 4PFWA 1FCKA 4F3BA 4I9DA 1A55A 3IOWA 1XI6A 2F3DA 4F1YA 1IIWA 1QW0A 3N26A 5I5PA 2Y7KA 3E78A 3PUZE 4MJOA 2XXVA 4TQUQ 3RPWA 3SEUA 3BFTA 1TFAA 3ZS6A 1LAFE 1TT1A 3TUSA 4YKPA 5KDTA 1FQAA 4FATA 1PBPA 3MPLA 5I57B 5IZ1A 3C9HA 1IMAA 4N6KA 3K6VA 2RC7A 1LFGA 4AB5A 2PFYA 1P1WA 2Y84A 3PMWA 3V5AA 2G29A 3IJOB 3C34A 4BDOA 1N84A 2CZKA 2REJA 1QUJA 1FPFA 1FBCA 4Q0CA 3V83A 1EYIA 5KZTA 1O63A 1B0HA 5H8FB 1LFHA 1MH4A 3AXFA 3FVGA 4DXCA 2AIXA 4P1LA 2XX9A 4OTEA 4OMBA 3SDFA 1LEVA 3OO8A 4ZE9A 5F1QA 3TEPA 3SEXA 3PD9A 2HHMA 4R2FA 4KHZE 3FGSA 4GWOA 3C33A 1I6AA 3MVWA 3K6WA 2Q2AA 1XOCA 2HXRA 1DTGA 5FTHA 1RDYA 1B5JA 1UIVA 3C35A 4PFYA 5TPAA 3ODBA 2F6GA 4Q5TA 3DM0A 4R6YA 3PUVE 1BK4A 1NV2A 4MF3A 4NF0A 3RTWB 3KGCA 2HAVA 5LTCA 3VXBA 2HXWA 3H6TA 1Q1KA 4IY5A 3CFZA 5F7VA 1LBXA 2ZZXA 2AL4A 2ALUA 2RCBA 1Z7NE 4PAKA 3E4RA 4AB6A 3C36A 4OVSA 4BDNA 4PCDA 4MIJA 4IO5A 1QKBA 2Y7RA 1AWBA 1JW1A 4ZEBA 3A3UA 2O68A 3C32A 3G3IA 2WBDA 4RJZA 2I4CA 4DDDA 4MAGA 2CEYA 3CIJA 2Q9TA 3OXNA 4LATA 4N13A 3SEYA 2O7IA 4XKPA 4GWUA 4F39A 2XWVA 4OVJA 2REGA 1B6HA 2VGQA 5BWJA 1B7UA 4YMAA 4FJPA 2I3VA 4GL8A 3FZVA 5AA2B 4OFLA 3MJNA 3QYTA 3C31A 4QXDA 1P99A 4IGTA 3PPQA 1S50A 4JVIA 4P0IA 1BP5A 4R6HA 4GWZA 5TU0A 1MXUA 2F36A 4PFUA 2I58A 1B0LA 3E79A 2X7QA 1M5DA 4NF5A 1BTJA 2B3FA 2XWOA 2FIEA 5KDTB 4F19A 3UP9A 4P56A 5EHMA 3DELB 1B46A 3QSLA 3MVYA 2XWKA 2DYXA 1NH8A 4C0RA 1MXWA 2WYKA 1WDNA 3V8XB 1K9ZA 2PT2A 4QBAA 3C4MA 1A7LA 3KJTA 3OO7A 4MNIA 2DE4A 4NF6A 4Q8RA 5IZ3A 3HPIA 2F7AA 2R71A 2RKMA 1MM6A 3K02A 3HN0A 2QVUA 3HCQA 4N17A 2BJJX 2CZIA 4PF8A 4KR5A 2Y5KA 2H5YA 1EH3A 2GHBA 2P3VA 1AMFA 1VDWA 1UTHA 4U23A 4MH5A 4JDFA 3T9UA 1SD3A 4EF1A 3R7XA 3T9VA 1NNPA 2FYIA 5ICQA 1LCFA 2YLNA 4RPNA 4YKKA 4OZ9A 2DSFA 2AL5A 4KYEA 1BIYA 1B1HA 2B65A 4F3GA 4MLQA 1SDXA 2CZHA 3FXQA 2F34A 2PYYA 4GBWA 3H6WA 3T93B 3KJ7A 4O94A 4R72A 1B05A 1AIVA 3B50A 3O28A 3SKPA 3K6XA 1QUIA 1MY0A 3FJ7A 4O3CA 4UABA 1S9TA 4BDQA 3G7WA 5AA1A 1LBCA 3CR9A 4ZEIA 1JW5A 2XXIA 5ET7A 2DE3A 1D9YA 4E0WA 1G0HA 3FJGA 2XXRA 2Z8EA 1IEJA 4WEDA 4R75A 2OK2A 3OOAA 3B7DA 2V3UA 2DVZA 5I59B 5ET5A 3TQLA 4JSOA 3MP8A 3K6UA 2XXTA 4YAHX 5CMCA 4DXUA 2I3WA 4KD5A 2I0CA 3EQ1A 3L6GA 4DCYA 4DZ1A 3LSFB 2F97A 3U92A 3TPAA 1D4NA 2WX9A 3IX1A 1Z7ME 3PMXA 3IOUA 3M3LA 4JWOA 2O84X 2AYSA 4N15A 4PAIA 3JZJA 5EYFA 4F29A 2V4CA 2XXYA 4HXVA 3TZAA
chains in the Genus database with same CATH topology
4BDLA 1NKXA 2Q88A 3KEIA 4BDRA 3K2DA 1B51A 3WAFA 1FQEA 3CG3A 4UA8A 3UA8A 4RK2A 4F18A 4O3BA 1DSNA 1CB6A 3OEKA 2OWSA 2HQ0A 2QS2A 5CRYA 5K2YA 3A3CA 4G68A 3FJMA 4LA9A 1II5A 3DP6A 5KCJA 1XHYA 4FIMA 5I2NA 3G3JA 3Q28A 2A5TA 1LBBA 1ATGA 3SETA 1YTVA 4EDPA 5AA4A 1IXCA 5ICTA 3F11A 1Y3NA 3FV1A 4KQPA 2UYFA 3S9NC 4HW8A 4KCDA 4G68C 4KI0E 1USYE 4ZDMA 1UTHB 1FTJA 1GVCA 3HO7A 5ELVA 5CMBA 1R9LA 4LONB 3H6UA 3G3HA 1OVTA 2F78A 4RYAA 1SQYA 2QMWA 2VD2A 1J1NA 3U93A 5HPQA 1UQWA 1EZPA 1B52A 1VFEA 1MM7A 2CMOA 3RN8A 2I6EA 3MBPA 3TTMA 2P0SA 4EUOA 3PPPA 4M1VA 1NNKA 5B70A 3JV9A 2NUVA 3KN3A 2XX7A 1Y9UA 2O6AA 3IO4A 1R9QA 3UK4A 4HTGA 4QSEA 3K1NA 3MVZA 1MPBA 2Z22A 4F2OA 4JB7A 3MWBA 4NWDA 3QUFA 1WODA 5CC2A 4U1OA 3KBRA 3VV5A 4BLAA 2ZNUA 1JEUA 4R74A 1HSLA 5IKBA 3T96B 3TCFA 5CBSA 4ISUA 1USYH 2DS9A 4YKIA 4YKJA 3ILTB 5AA3A 4LQ5A 1B5HA 5A5XA 2UVIA 4R73A 2ZNTA 3LSWA 5K2XA 2XXHA 2ESNA 5DVFA 3OD7A 3B6WA 4O3AA 4F2QA 2XX8A 3CSBA 1OMPA 3Q25A 4GD5A 3PGFA 1N76A 4PE5B 3O2AA 4LZ5A 3IJXB 3N94A 3VVDA 2ZYKA 1VFDA 2O69A 1GGGA 2O1LA 3MQ9A 4XXUA 1WVJA 2RINA 3E13X 4GF8A 3Q27A 1PB8A 4OYVA 4LP2B 3O9PA 4G68B 5ITOA 5FTIA 2A5SA 4DIGA 2GH9A 5KCJB 3S2VA 4F1VA 5I2NB 3A09A 1N7WA 3B6TA 2QMXA 2O7UA 2F8DA 3PUYE 4NE4A 3V89B 2PMSA 2NOOA 1R6ZA 3PPRA 1M5BA 1BLFA 1TWYA 4K3FA 4FEDA 3T66A 1JQFA 4XKNA 1IITA 2OWTA 2YPNA 2P1SA 3W9VA 4ZE8A 3MP6A 1KWHA 1Y1ZA 5FHMA 1ZJLA 4RK9A 3LR1A 2H4IA 1IQ7A 2DQVA 4LZ8A 3H3GA 1LAXA 1ANFA 2I0BA 1CE2A 4QFKA 3S9EA 5CBRA 1YPNA 5I58A 2VOZA 4G77A 4POXA 1Y4CA 2V25A 2ZMBA 1ZMGA 3FATA 3VE1B 2Z8FA 4ELRA 4FEBA 1DOTA 3PU5A 1MY1A 3OMBA 3MW0A 2KLFA 3QAXA 1LAGE 3IR1A 5L9MA 3TTLA 2ONKE 3U1OA 3K4UA 4XKRA 2F6PA 4NF8B 4AQ4A 1M5EA 3CVGA 3D4CA 5DTBA 3QXMA 5H8QB 2XXQA 3EHTA 3JYRA 1MXXA 3TELA 4YU0A 3IB1A 4H5GA 5I2KA 4RXLA 4TLMB 1XC1A 4I62A 3HHFA 5FHOA 1MDP1 2XD3A 3T22A 3GZGA 3B6QA 1MQHA 1B32A 1OQHA 2ANJA 3PPOA 1QVSA 3SERA 1AH5A 4NEDA 2PBWA 5JEIA 2XHDA 1JVYA 2H25A 4OEUA 3CG1A 3ECRA 4IO7A 4JWYA 2Q89A 1MPCA 2HFBA 1M5CA 2HEUA 2RC9A 1B2HA 3MZBA 1RYOA 3FXRA 3SESA 1OVBA 2Y7PA 1D9VA 1MY4A 5CI5A 4H65A 2RF1A 3PV0E 5ISUA 1IXIA 1ELJA 4F22A 2ZNSA 2ZYOA 2UVGA 1OIBA 1DPPA 1MPDA 3EHSA 4OFJA 4YMBA 3U72A 3QIMA 5TPAB 2V93A 1UTBA 3LBSA 3T9XB 3L6HA 4LZ7A 3DP4A 3M8UA 4X1DA 2M8CA 5J1DA 4KCCA 3LC8A 4ZEFA 3FVNA 2OZZA 4ZEKA 2XXPA 2DOJA 3N6UA 1I6QA 3OO6A 2DWHA 1MQGA 1SI0A 4NTLA 2NWJA 1MS7A 4G8MA 4E0XA 4YB7A 1FTMA 2NVUB 4IO3A 2QRYA 4Z0IA 3FD3A 3W15C 3BFUA 4EXKA 3RTFB 1LLSA 2GHAA 1P1QA 3TCHA 4QRZA 3U94A 1PBQA 1POY1 1B3LA 2F7BA 2THIA 1PC3A 3Q29A 1GR2A 4JBZA 1EZ9A 1PB7A 3KZGA 4G4PA 1N0TA 1OQGA 2OJTA 3O66A 3RT6B 3KSXA 4QHQA 1JNFA 1JETA 1XT8A 4G8NA 4XKQA 4ZEDA 2ONRA 4IY6A 4MLVA 2QS4A 4OESA 4WKMA 1PDAA 4NF5B 4EXLA 1HSJA 4F1UA 4JWXA 4OEVA 3TAJA 2I48A 2E0SA 1SW4A 1EZOA 1MY2A 3H03A 4F31B 4HCWA 1NFTA 1HSEA 5H8FA 3N6TA 3KOTA 4RPOA 3H06B 4YZZA 4GXAA 3UIFA 3GXAA 1B3GA 5AA2D 4NF6B 4ESXA 1MRPA 1Y3QA 5DT6A 3MZ1A 1P1OA 3KFMA 2UXAA 1URDA 4EQBA 4R2BA 2HAUA 4N07A 1IUDA 3MUQA 1SYHA 1AOVA 3RNNA 4F3PA 2XXWA 4GL0A 3IOVA 2UVHA 4RY1A 1VR5A 2QL3A 2HZKA 4Z7EA 1SBPA 4R9FA 1XVYA 2ABHA 1I6BA 1NL5A 3BKIB 3OSRA 5IAIA 3FIRA 2I4BA 1LAHE 4H8JA 5DEXA 2DE2A 3OEMA 1B40A 2HZLA 1QUKA 1O64A 4TOZA 2ONSA 3O6GA 3P7IA 4PETA 3TYHA 1QJMA 1IXHA 3FXUA 1MH3A 3UN6A 3TTKA 3OENA 3OO9A 3KN7A 4ESWA 3IL1B 4OQOA 5JTYA 3TMGA 1YCJA 3TTRA 4IB2A 2VP1A 4ZZEA 3IB2A 1N04A 5JK4A 1P1UA 4QFOA 2VHAA 3EHUA 3RUMA 3I6VA 3ZKLA 4H6DA 1XS5A 2Z23A 3ZKKA 1A8EA 4XTCQ 3CSGA 2IEEA 1B5IA 1B58A 5M2VA 1BKAA 4JSDA 5EHSA 2VD3A 3TDJA 4DCXA 1A99A 1FQBA 4QFLA 4HS7A 2NXOA 4C1UA 4RNSA 4TLLB 4OWDA 3TTNA 1ZTYA 1LFIA 1JW4A 4U4XA 5TP9A 1ZBMA 3RQTA 2F7CA 3RLFE 3ONMA 4X48A 1NH7A 2QPQA 2Q8JA 2PVUA 4ELQA 1OLAA 3ZSFA 4JXIA 1NMUA 1B7ZA 4KYDA 3IOTA 3R6UA 4U22A 1US4A 3VLVA 1US5A 2IA4A 4PP0A 2Y7IA 1Q35A 4GVOA 4U4SA 1XVXA 4X9TA 4MBPA 1MQIA 1B4HA 1YAEA 3I5OA 2A5TB 3K0VA 1LB8A 4QSDA 1SI1A 4LQ2A 5AA4B 2LAOA 2GFEA 2FNCA 3HHGA 3G3FA 1F9BA 5H8SA 4GQOA 1ZIUA 4EQ9A 4GLIA 2DP8A 3MPKA 2X26A 1VE4A 3USDA 1S7YA 2Q2CA 3K01A 1TFDA 1SW1A 3D4GA 4QSCA 1FQDA 5H8HA 1H45A 1T0KA 3OELA 4U1ZA 5B7DA 3RT8A 3R26A 5CMMA 3PPNA 1N3WA 3KSJA 3MVXA 4PFTA 1D3KA 4H0WA 1A54A 1B1XA 5FHNA 2QJEA 4H8IA 5H8NA 1MG1A 3K1MA 4XIGQ 4R6KA 2QS1A 3GBBA 5DEXB 4YB5A 2XXUA 1URSA 3FVOA 3RGYA 3S9MC 5DVJA 1QKAA 3W9WA 1O7TA 3IB0A 3KN8A 4LVQA 5DVIA 1B9JA 5I59A 3CRBA 4L17A 3WAEA 4I1DA 1TXFA 3VLWA 2PX1A 5JTYB 2ZYNA 5CM6A 2CZLA 3IORA 2W7YA 4OERA 1IZ1A 3TFLA 2UVJA 4H67A 5L8DA 3MC2A 3MAMA 4IO2A 3M3KA 2E1SA 3G3KA 1GV8A 2QS3A 4QFNA 1FTLA 3DLNA 1Y20A 3CI8A 3EN3A 1H44A 4OENA 5A5XB 2RC8A 3LUYA 4PQJA 3SEVA 2DWAA 3DP8A 4FECA 2V3TA 3IAZA 3PMVA 4KFQA 5TP9B 3BBRA 4H1XA 1L5TA 2F5XA 4OXVA 1ZKBA 2P2AA 3O97A 1SYIA 1P1NA 3H4ZA 1LB9A 2X7PA 2D5WA 5DYHA 3UORA 2ZXTA 4X1BA 3KG2A 1FQFA 1POTA 1JVXA 4C1TA 1DPEA 3K1PA 3QK6A 4G2ZA 4F3SA 4DXBA 1DTZA 2DVCA 5HBCA 4GFRA 4ELOA 2I49A 4NF4A 2H9BA 1FTOA 2D3IA 1B3HA 1LSTA 3O6IA 1RYXA 2F35A 1QULA 3S9LC 1Y4TA 4U21A 2V3QA 1JEVA 3U8QA 4KYSA 2FA7A 1Y3PA 2DXRA 3TKDA 2O51A 3IK6B 4BDMA 3O6HA 1AL3A 1Y1MA 1MQDA 3VVEA 3OSQA 4M4GA 1B3EA 4ZS9A 3FUZA 4FORA 1LCTA 5BUUA 4N6PA 3HSTA 3O29A 1URGA 1UIUA 3CFLA 5H8HB 3T9HB 5I56A 2O1MA 4IO4A 4GXSB 1MXYA 2UYEA 2G93A 2H99A 4IGRA 5I58B 3S4UA 4LUBA 1DMBA 3N5LA 5H8NB 4WXJA 4QF9A 4P11A 1I69A 4GRKA 5AE4A 3TCGA 3HV1A 4KPTA 5ITPA 2R6GE 4OHNA 5LOMA 5L9SA 4POWA 1B7HA 1FTKA 4GOTA 3PD8A 2WKYA 4OETA 1ZU0A 1B3FA 1SVXB 5I84A 1B4ZA 4IO6A 4RA1A 2R9JA 2GRVA 3EF7A 5I57A 5I2KB 3UGWA 4I8CA 3VDFA 1SW2A 4WEPA 1LGBC 3E3KA 2YJPA 3FVKA 3VFJA 4THIA 1MDQA 1MQJA 4ELPA 1SW5A 1GTKA 1PB9A 1MXVA 1N3XA 3VVFA 1OLCA 3EPEA 4EF2A 3TODA 5L9OA 4NMYA 3MZ9A 3MP1A 3LSXA 4UACA 2HCAA 2PT1A 2OBGA 2V84A 4EQ7A 1PEBA 4ND9A 1NNTA 4HCYA 3PUWE 2XD2A 2RCAA 3FV2A 1A8FA 2OLBA 3K00A 4YB6A 1IXGA 3G3GA 3Q26A 1MXZA 4NF4B 1ZLQA 2QSXA 1N7XA 2ZYMA 3QUJA 1FW0A 2H98A 4G8HA 2OCUA 3GBAA 1UTBB 2D21A 2B3BA 1M5FA 3RY3A 2XXXA 1R1NA 5HM4B 3VLUA 1RKMA 4ZECA 3VXCA 3GLBA 3IO6A 4FE8A 2DWIA 3E9XA 1FQCA 3LSLA 1A40A 1H43A 4U2RA 3M3FA 1EU8A 3H7MA 3ILUB 5I56B 1H76A 1NNFA 3H6VA 1VSOA 4DLDA 4YICA 2Y7WA 4NWCA 3THIA 3I3VA 4R9GA 3SEWA 4ECFA 3FASA 4QFPA 4NF8A 4DE8A 5CMKA 4P0GA 5AA2A 4FAJA 2DWJA 1MY3A 4OFOA 2Z8DA 4MFIA 4GIZA 1H3DA 4Q30B 5H8QA 3PUXE 2DXYA 4ONYA 4H5FA 3TQWA 4ZZAA 3CFXA 3KOSA 4PFWA 1FCKA 4F3BA 4I9DA 1A55A 3IOWA 4F1YA 1IIWA 1QW0A 3N26A 2Y7KA 3PUZE 2XXVA 4TQUQ 3RPWA 3SEUA 3BFTA 1TFAA 3ZS6A 1LAFE 1TT1A 3TUSA 4YKPA 5KDTA 1FQAA 4FATA 1PBPA 3MPLA 5I57B 3C9HA 3K6VA 2RC7A 1LFGA 4AB5A 1P1WA 2Y84A 3PMWA 3V5AA 2G29A 3IJOB 3C34A 4BDOA 1N84A 2REJA 1QUJA 4Q0CA 3V83A 5KZTA 1O63A 1B0HA 5H8FB 1LFHA 1MH4A 3AXFA 3FVGA 4DXCA 2AIXA 2XX9A 4OTEA 4OMBA 3SDFA 3OO8A 4ZE9A 5F1QA 3TEPA 3SEXA 3PD9A 4KHZE 4R2FA 3FGSA 4GWOA 3C33A 1I6AA 3MVWA 3K6WA 2Q2AA 1XOCA 1DTGA 5FTHA 1B5JA 1UIVA 3C35A 4PFYA 5TPAA 3ODBA 2F6GA 4Q5TA 3DM0A 4R6YA 3PUVE 4MF3A 3RTWB 3KGCA 2HAVA 3VXBA 2HXWA 3H6TA 1Q1KA 4IY5A 3CFZA 5F7VA 2AL4A 2ALUA 2RCBA 1Z7NE 3E4RA 4AB6A 3C36A 4BDNA 4IO5A 1QKBA 2Y7RA 1JW1A 4ZEBA 3A3UA 2O68A 3C32A 3G3IA 4RJZA 2I4CA 4DDDA 3CIJA 2Q9TA 3OXNA 4LATA 4N13A 3SEYA 2O7IA 4XKPA 4F39A 4OVJA 2REGA 1B6HA 2VGQA 5BWJA 1B7UA 4YMAA 4FJPA 2I3VA 4GL8A 3FZVA 5AA2B 4OFLA 3MJNA 3QYTA 3C31A 1P99A 4IGTA 3PPQA 1S50A 4P0IA 1BP5A 4R6HA 5TU0A 1MXUA 2F36A 4PFUA 2I58A 1B0LA 2X7QA 1M5DA 4NF5A 1BTJA 2B3FA 5KDTB 4F19A 3UP9A 5EHMA 3DELB 1B46A 3QSLA 3MVYA 2DYXA 1NH8A 4C0RA 1MXWA 1WDNA 3V8XB 2PT2A 3C4MA 1A7LA 3KJTA 3OO7A 2DE4A 4NF6A 4Q8RA 3HPIA 2F7AA 2R71A 2RKMA 1MM6A 3K02A 3HN0A 3HCQA 2BJJX 4KR5A 2H5YA 1EH3A 2GHBA 1AMFA 1UTHA 4U23A 4MH5A 4JDFA 3T9UA 1SD3A 4EF1A 3R7XA 3T9VA 1NNPA 2FYIA 5ICQA 1LCFA 2YLNA 4RPNA 4YKKA 4OZ9A 2DSFA 2AL5A 4KYEA 1BIYA 1B1HA 2B65A 4F3GA 4MLQA 1SDXA 3FXQA 2F34A 2PYYA 3H6WA 3T93B 3KJ7A 4R72A 1B05A 1AIVA 3O28A 3SKPA 3K6XA 1QUIA 1MY0A 3FJ7A 4O3CA 1S9TA 4BDQA 3G7WA 5AA1A 1LBCA 3CR9A 4ZEIA 1JW5A 2XXIA 2DE3A 1D9YA 4E0WA 3FJGA 2XXRA 2Z8EA 1IEJA 4WEDA 4R75A 2OK2A 3OOAA 3B7DA 2V3UA 2DVZA 5I59B 3TQLA 4JSOA 3MP8A 3K6UA 2XXTA 4YAHX 5CMCA 4DXUA 2I3WA 4KD5A 2I0CA 3EQ1A 3L6GA 4DCYA 4DZ1A 3LSFB 2F97A 3U92A 3TPAA 1D4NA 3IX1A 1Z7ME 3PMXA 3IOUA 3M3LA 4JWOA 2O84X 2AYSA 3JZJA 5EYFA 4F29A 2XXYA 3TZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BDL A;  1NKX A;  2Q88 A;  3KEI A;  4BDR A;  3K2D A;  1B51 A;  3WAF A;  1FQE A;  3CG3 A;  4UA8 A;  3UA8 A;  4RK2 A;  4F18 A;  4O3B A;  1DSN A;  1CB6 A;  3OEK A;  2OWS A;  2HQ0 A;  2QS2 A;  5CRY A;  5K2Y A;  3A3C A;  4G68 A;  3FJM A;  4LA9 A;  1II5 A;  3DP6 A;  5KCJ A;  1XHY A;  4FIM A;  5I2N A;  3G3J A;  3Q28 A;  2A5T A;  1LBB A;  1ATG A;  3SET A;  1YTV A;  4EDP A;  5AA4 A;  1IXC A;  5ICT A;  3F11 A;  1Y3N A;  3FV1 A;  4KQP A;  2UYF A;  3S9N C;  4HW8 A;  4KCD A;  4G68 C;  4KI0 E;  1USY E;  4ZDM A;  1UTH B;  1FTJ A;  1GVC A;  3HO7 A;  5ELV A;  5CMB A;  1R9L A;  4LON B;  3H6U A;  3G3H A;  1OVT A;  2F78 A;  4RYA A;  1SQY A;  2QMW A;  2VD2 A;  1J1N A;  3U93 A;  5HPQ A;  1UQW A;  1EZP A;  1B52 A;  1VFE A;  1MM7 A;  2CMO A;  3RN8 A;  2I6E A;  3MBP A;  3TTM A;  2P0S A;  4EUO A;  3PPP A;  4M1V A;  1NNK A;  5B70 A;  3JV9 A;  2NUV A;  3KN3 A;  2XX7 A;  1Y9U A;  2O6A A;  3IO4 A;  1R9Q A;  3UK4 A;  4HTG A;  4QSE A;  3K1N A;  3MVZ A;  1MPB A;  2Z22 A;  4F2O A;  4JB7 A;  3MWB A;  4NWD A;  3QUF A;  1WOD A;  5CC2 A;  4U1O A;  3KBR A;  3VV5 A;  4BLA A;  2ZNU A;  1JEU A;  4R74 A;  1HSL A;  5IKB A;  3T96 B;  3TCF A;  5CBS A;  4ISU A;  1USY H;  2DS9 A;  4YKI A;  4YKJ A;  3ILT B;  5AA3 A;  4LQ5 A;  1B5H A;  5A5X A;  2UVI A;  4R73 A;  2ZNT A;  3LSW A;  5K2X A;  2XXH A;  2ESN A;  5DVF A;  3OD7 A;  3B6W A;  4O3A A;  4F2Q A;  2XX8 A;  3CSB A;  1OMP A;  3Q25 A;  4GD5 A;  3PGF A;  1N76 A;  4PE5 B;  3O2A A;  4LZ5 A;  3IJX B;  3N94 A;  3VVD A;  2ZYK A;  1VFD A;  2O69 A;  1GGG A;  2O1L A;  3MQ9 A;  4XXU A;  1WVJ A;  2RIN A;  3E13 X;  4GF8 A;  3Q27 A;  1PB8 A;  4OYV A;  4LP2 B;  3O9P A;  4G68 B;  5ITO A;  5FTI A;  2A5S A;  4DIG A;  2GH9 A;  5KCJ B;  3S2V A;  4F1V A;  5I2N B;  3A09 A;  1N7W A;  3B6T A;  2QMX A;  2O7U A;  2F8D A;  3PUY E;  4NE4 A;  3V89 B;  2PMS A;  2NOO A;  1R6Z A;  3PPR A;  1M5B A;  1BLF A;  1TWY A;  4K3F A;  4FED A;  3T66 A;  1JQF A;  4XKN A;  1IIT A;  2OWT A;  2YPN A;  2P1S A;  3W9V A;  4ZE8 A;  3MP6 A;  1KWH A;  1Y1Z A;  5FHM A;  1ZJL A;  4RK9 A;  3LR1 A;  2H4I A;  1IQ7 A;  2DQV A;  4LZ8 A;  3H3G A;  1LAX A;  1ANF A;  2I0B A;  1CE2 A;  4QFK A;  3S9E A;  5CBR A;  1YPN A;  5I58 A;  2VOZ A;  4G77 A;  4POX A;  1Y4C A;  2V25 A;  2ZMB A;  1ZMG A;  3FAT A;  3VE1 B;  2Z8F A;  4ELR A;  4FEB A;  1DOT A;  3PU5 A;  1MY1 A;  3OMB A;  3MW0 A;  2KLF A;  3QAX A;  1LAG E;  3IR1 A;  5L9M A;  3TTL A;  2ONK E;  3U1O A;  3K4U A;  4XKR A;  2F6P A;  4NF8 B;  4AQ4 A;  1M5E A;  3CVG A;  3D4C A;  5DTB A;  3QXM A;  5H8Q B;  2XXQ A;  3EHT A;  3JYR A;  1MXX A;  3TEL A;  4YU0 A;  3IB1 A;  4H5G A;  5I2K A;  4RXL A;  4TLM B;  1XC1 A;  4I62 A;  3HHF A;  5FHO A;  1MDP 1;  2XD3 A;  3T22 A;  3GZG A;  3B6Q A;  1MQH A;  1B32 A;  1OQH A;  2ANJ A;  3PPO A;  1QVS A;  3SER A;  1AH5 A;  4NED A;  2PBW A;  5JEI A;  2XHD A;  1JVY A;  2H25 A;  4OEU A;  3CG1 A;  3ECR A;  4IO7 A;  4JWY A;  2Q89 A;  1MPC A;  2HFB A;  1M5C A;  2HEU A;  2RC9 A;  1B2H A;  3MZB A;  1RYO A;  3FXR A;  3SES A;  1OVB A;  2Y7P A;  1D9V A;  1MY4 A;  5CI5 A;  4H65 A;  2RF1 A;  3PV0 E;  5ISU A;  1IXI A;  1ELJ A;  4F22 A;  2ZNS A;  2ZYO A;  2UVG A;  1OIB A;  1DPP A;  1MPD A;  3EHS A;  4OFJ A;  4YMB A;  3U72 A;  3QIM A;  5TPA B;  2V93 A;  1UTB A;  3LBS A;  3T9X B;  3L6H A;  4LZ7 A;  3DP4 A;  3M8U A;  4X1D A;  2M8C A;  5J1D A;  4KCC A;  3LC8 A;  4ZEF A;  3FVN A;  2OZZ A;  4ZEK A;  2XXP A;  2DOJ A;  3N6U A;  1I6Q A;  3OO6 A;  2DWH A;  1MQG A;  1SI0 A;  4NTL A;  2NWJ A;  1MS7 A;  4G8M A;  4E0X A;  4YB7 A;  1FTM A;  2NVU B;  4IO3 A;  2QRY A;  4Z0I A;  3FD3 A;  3W15 C;  3BFU A;  4EXK A;  3RTF B;  1LLS A;  2GHA A;  1P1Q A;  3TCH A;  4QRZ A;  3U94 A;  1PBQ A;  1POY 1;  1B3L A;  2F7B A;  2THI A;  1PC3 A;  3Q29 A;  1GR2 A;  4JBZ A;  1EZ9 A;  1PB7 A;  3KZG A;  4G4P A;  1N0T A;  1OQG A;  2OJT A;  3O66 A;  3RT6 B;  3KSX A;  4QHQ A;  1JNF A;  1JET A;  1XT8 A;  4G8N A;  4XKQ A;  4ZED A;  2ONR A;  4IY6 A;  4MLV A;  2QS4 A;  4OES A;  4WKM A;  1PDA A;  4NF5 B;  4EXL A;  1HSJ A;  4F1U A;  4JWX A;  4OEV A;  3TAJ A;  2I48 A;  2E0S A;  1SW4 A;  1EZO A;  1MY2 A;  3H03 A;  4F31 B;  4HCW A;  1NFT A;  1HSE A;  5H8F A;  3N6T A;  3KOT A;  4RPO A;  3H06 B;  4YZZ A;  4GXA A;  3UIF A;  3GXA A;  1B3G A;  5AA2 D;  4NF6 B;  4ESX A;  1MRP A;  1Y3Q A;  5DT6 A;  3MZ1 A;  1P1O A;  3KFM A;  2UXA A;  1URD A;  4EQB A;  4R2B A;  2HAU A;  4N07 A;  1IUD A;  3MUQ A;  1SYH A;  1AOV A;  3RNN A;  4F3P A;  2XXW A;  4GL0 A;  3IOV A;  2UVH A;  4RY1 A;  1VR5 A;  2QL3 A;  2HZK A;  4Z7E A;  1SBP A;  4R9F A;  1XVY A;  2ABH A;  1I6B A;  1NL5 A;  3BKI B;  3OSR A;  5IAI A;  3FIR A;  2I4B A;  1LAH E;  4H8J A;  5DEX A;  2DE2 A;  3OEM A;  1B40 A;  2HZL A;  1QUK A;  1O64 A;  4TOZ A;  2ONS A;  3O6G A;  3P7I A;  4PET A;  3TYH A;  1QJM A;  1IXH A;  3FXU A;  1MH3 A;  3UN6 A;  3TTK A;  3OEN A;  3OO9 A;  3KN7 A;  4ESW A;  3IL1 B;  4OQO A;  5JTY A;  3TMG A;  1YCJ A;  3TTR A;  4IB2 A;  2VP1 A;  4ZZE A;  3IB2 A;  1N04 A;  5JK4 A;  1P1U A;  4QFO A;  2VHA A;  3EHU A;  3RUM A;  3I6V A;  3ZKL A;  4H6D A;  1XS5 A;  2Z23 A;  3ZKK A;  1A8E A;  4XTC Q;  3CSG A;  2IEE A;  1B5I A;  1B58 A;  5M2V A;  1BKA A;  4JSD A;  5EHS A;  2VD3 A;  3TDJ A;  4DCX A;  1A99 A;  1FQB A;  4QFL A;  4HS7 A;  2NXO A;  4C1U A;  4RNS A;  4TLL B;  4OWD A;  3TTN A;  1ZTY A;  1LFI A;  1JW4 A;  4U4X A;  5TP9 A;  1ZBM A;  3RQT A;  2F7C A;  3RLF E;  3ONM A;  4X48 A;  1NH7 A;  2QPQ A;  2Q8J A;  2PVU A;  4ELQ A;  1OLA A;  3ZSF A;  4JXI A;  1NMU A;  1B7Z A;  4KYD A;  3IOT A;  3R6U A;  4U22 A;  1US4 A;  3VLV A;  1US5 A;  2IA4 A;  4PP0 A;  2Y7I A;  1Q35 A;  4GVO A;  4U4S A;  1XVX A;  4X9T A;  4MBP A;  1MQI A;  1B4H A;  1YAE A;  3I5O A;  2A5T B;  3K0V A;  1LB8 A;  4QSD A;  1SI1 A;  4LQ2 A;  5AA4 B;  2LAO A;  2GFE A;  2FNC A;  3HHG A;  3G3F A;  1F9B A;  5H8S A;  4GQO A;  1ZIU A;  4EQ9 A;  4GLI A;  2DP8 A;  3MPK A;  2X26 A;  1VE4 A;  3USD A;  1S7Y A;  2Q2C A;  3K01 A;  1TFD A;  1SW1 A;  3D4G A;  4QSC A;  1FQD A;  5H8H A;  1H45 A;  1T0K A;  3OEL A;  4U1Z A;  5B7D A;  3RT8 A;  3R26 A;  5CMM A;  3PPN A;  1N3W A;  3KSJ A;  3MVX A;  4PFT A;  1D3K A;  4H0W A;  1A54 A;  1B1X A;  5FHN A;  2QJE A;  4H8I A;  5H8N A;  1MG1 A;  3K1M A;  4XIG Q;  4R6K A;  2QS1 A;  3GBB A;  5DEX B;  4YB5 A;  2XXU A;  1URS A;  3FVO A;  3RGY A;  3S9M C;  5DVJ A;  1QKA A;  3W9W A;  1O7T A;  3IB0 A;  3KN8 A;  4LVQ A;  5DVI A;  1B9J A;  5I59 A;  3CRB A;  4L17 A;  3WAE A;  4I1D A;  1TXF A;  3VLW A;  2PX1 A;  5JTY B;  2ZYN A;  5CM6 A;  2CZL A;  3IOR A;  2W7Y A;  4OER A;  1IZ1 A;  3TFL A;  2UVJ A;  4H67 A;  5L8D A;  3MC2 A;  3MAM A;  4IO2 A;  3M3K A;  2E1S A;  3G3K A;  1GV8 A;  2QS3 A;  4QFN A;  1FTL A;  3DLN A;  1Y20 A;  3CI8 A;  3EN3 A;  1H44 A;  4OEN A;  5A5X B;  2RC8 A;  3LUY A;  4PQJ A;  3SEV A;  2DWA A;  3DP8 A;  4FEC A;  2V3T A;  3IAZ A;  3PMV A;  4KFQ A;  5TP9 B;  3BBR A;  4H1X A;  1L5T A;  2F5X A;  4OXV A;  1ZKB A;  2P2A A;  3O97 A;  1SYI A;  1P1N A;  3H4Z A;  1LB9 A;  2X7P A;  2D5W A;  5DYH A;  3UOR A;  2ZXT A;  4X1B A;  3KG2 A;  1FQF A;  1POT A;  1JVX A;  4C1T A;  1DPE A;  3K1P A;  3QK6 A;  4G2Z A;  4F3S A;  4DXB A;  1DTZ A;  2DVC A;  5HBC A;  4GFR A;  4ELO A;  2I49 A;  4NF4 A;  2H9B A;  1FTO A;  2D3I A;  1B3H A;  1LST A;  3O6I A;  1RYX A;  2F35 A;  1QUL A;  3S9L C;  1Y4T A;  4U21 A;  2V3Q A;  1JEV A;  3U8Q A;  4KYS A;  2FA7 A;  1Y3P A;  2DXR A;  3TKD A;  2O51 A;  3IK6 B;  4BDM A;  3O6H A;  1AL3 A;  1Y1M A;  1MQD A;  3VVE A;  3OSQ A;  4M4G A;  1B3E A;  4ZS9 A;  3FUZ A;  4FOR A;  1LCT A;  5BUU A;  4N6P A;  3HST A;  3O29 A;  1URG A;  1UIU A;  3CFL A;  5H8H B;  3T9H B;  5I56 A;  2O1M A;  4IO4 A;  4GXS B;  1MXY A;  2UYE A;  2G93 A;  2H99 A;  4IGR A;  5I58 B;  3S4U A;  4LUB A;  1DMB A;  3N5L A;  5H8N B;  4WXJ A;  4QF9 A;  4P11 A;  1I69 A;  4GRK A;  5AE4 A;  3TCG A;  3HV1 A;  4KPT A;  5ITP A;  2R6G E;  4OHN A;  5LOM A;  5L9S A;  4POW A;  1B7H A;  1FTK A;  4GOT A;  3PD8 A;  2WKY A;  4OET A;  1ZU0 A;  1B3F A;  1SVX B;  5I84 A;  1B4Z A;  4IO6 A;  4RA1 A;  2R9J A;  2GRV A;  3EF7 A;  5I57 A;  5I2K B;  3UGW A;  4I8C A;  3VDF A;  1SW2 A;  4WEP A;  1LGB C;  3E3K A;  2YJP A;  3FVK A;  3VFJ A;  4THI A;  1MDQ A;  1MQJ A;  4ELP A;  1SW5 A;  1GTK A;  1PB9 A;  1MXV A;  1N3X A;  3VVF A;  1OLC A;  3EPE A;  4EF2 A;  3TOD A;  5L9O A;  4NMY A;  3MZ9 A;  3MP1 A;  3LSX A;  4UAC A;  2HCA A;  2PT1 A;  2OBG A;  2V84 A;  4EQ7 A;  1PEB A;  4ND9 A;  1NNT A;  4HCY A;  3PUW E;  2XD2 A;  2RCA A;  3FV2 A;  1A8F A;  2OLB A;  3K00 A;  4YB6 A;  1IXG A;  3G3G A;  3Q26 A;  1MXZ A;  4NF4 B;  1ZLQ A;  2QSX A;  1N7X A;  2ZYM A;  3QUJ A;  1FW0 A;  2H98 A;  4G8H A;  2OCU A;  3GBA A;  1UTB B;  2D21 A;  2B3B A;  1M5F A;  3RY3 A;  2XXX A;  1R1N A;  5HM4 B;  3VLU A;  1RKM A;  4ZEC A;  3VXC A;  3GLB A;  3IO6 A;  4FE8 A;  2DWI A;  3E9X A;  1FQC A;  3LSL A;  1A40 A;  1H43 A;  4U2R A;  3M3F A;  1EU8 A;  3H7M A;  3ILU B;  5I56 B;  1H76 A;  1NNF A;  3H6V A;  1VSO A;  4DLD A;  4YIC A;  2Y7W A;  4NWC A;  3THI A;  3I3V A;  4R9G A;  3SEW A;  4ECF A;  3FAS A;  4QFP A;  4NF8 A;  4DE8 A;  5CMK A;  4P0G A;  5AA2 A;  4FAJ A;  2DWJ A;  1MY3 A;  4OFO A;  2Z8D A;  4MFI A;  4GIZ A;  1H3D A;  4Q30 B;  5H8Q A;  3PUX E;  2DXY A;  4ONY A;  4H5F A;  3TQW A;  4ZZA A;  3CFX A;  3KOS A;  4PFW A;  1FCK A;  4F3B A;  4I9D A;  1A55 A;  3IOW A;  4F1Y A;  1IIW A;  1QW0 A;  3N26 A;  2Y7K A;  3PUZ E;  2XXV A;  4TQU Q;  3RPW A;  3SEU A;  3BFT A;  1TFA A;  3ZS6 A;  1LAF E;  1TT1 A;  3TUS A;  4YKP A;  5KDT A;  1FQA A;  4FAT A;  1PBP A;  3MPL A;  5I57 B;  3C9H A;  3K6V A;  2RC7 A;  1LFG A;  4AB5 A;  1P1W A;  2Y84 A;  3PMW A;  3V5A A;  2G29 A;  3IJO B;  3C34 A;  4BDO A;  1N84 A;  2REJ A;  1QUJ A;  4Q0C A;  3V83 A;  5KZT A;  1O63 A;  1B0H A;  5H8F B;  1LFH A;  1MH4 A;  3AXF A;  3FVG A;  4DXC A;  2AIX A;  2XX9 A;  4OTE A;  4OMB A;  3SDF A;  3OO8 A;  4ZE9 A;  5F1Q A;  3TEP A;  3SEX A;  3PD9 A;  4KHZ E;  4R2F A;  3FGS A;  4GWO A;  3C33 A;  1I6A A;  3MVW A;  3K6W A;  2Q2A A;  1XOC A;  1DTG A;  5FTH A;  1B5J A;  1UIV A;  3C35 A;  4PFY A;  5TPA A;  3ODB A;  2F6G A;  4Q5T A;  3DM0 A;  4R6Y A;  3PUV E;  4MF3 A;  3RTW B;  3KGC A;  2HAV A;  3VXB A;  2HXW A;  3H6T A;  1Q1K A;  4IY5 A;  3CFZ A;  5F7V A;  2AL4 A;  2ALU A;  2RCB A;  1Z7N E;  3E4R A;  4AB6 A;  3C36 A;  4BDN A;  4IO5 A;  1QKB A;  2Y7R A;  1JW1 A;  4ZEB A;  3A3U A;  2O68 A;  3C32 A;  3G3I A;  4RJZ A;  2I4C A;  4DDD A;  3CIJ A;  2Q9T A;  3OXN A;  4LAT A;  4N13 A;  3SEY A;  2O7I A;  4XKP A;  4F39 A;  4OVJ A;  2REG A;  1B6H A;  2VGQ A;  5BWJ A;  1B7U A;  4YMA A;  4FJP A;  2I3V A;  4GL8 A;  3FZV A;  5AA2 B;  4OFL A;  3MJN A;  3QYT A;  3C31 A;  1P99 A;  4IGT A;  3PPQ A;  1S50 A;  4P0I A;  1BP5 A;  4R6H A;  5TU0 A;  1MXU A;  2F36 A;  4PFU A;  2I58 A;  1B0L A;  2X7Q A;  1M5D A;  4NF5 A;  1BTJ A;  2B3F A;  5KDT B;  4F19 A;  3UP9 A;  5EHM A;  3DEL B;  1B46 A;  3QSL A;  3MVY A;  2DYX A;  1NH8 A;  4C0R A;  1MXW A;  1WDN A;  3V8X B;  2PT2 A;  3C4M A;  1A7L A;  3KJT A;  3OO7 A;  2DE4 A;  4NF6 A;  4Q8R A;  3HPI A;  2F7A A;  2R71 A;  2RKM A;  1MM6 A;  3K02 A;  3HN0 A;  3HCQ A;  2BJJ X;  4KR5 A;  2H5Y A;  1EH3 A;  2GHB A;  1AMF A;  1UTH A;  4U23 A;  4MH5 A;  4JDF A;  3T9U A;  1SD3 A;  4EF1 A;  3R7X A;  3T9V A;  1NNP A;  2FYI A;  5ICQ A;  1LCF A;  2YLN A;  4RPN A;  4YKK A;  4OZ9 A;  2DSF A;  2AL5 A;  4KYE A;  1BIY A;  1B1H A;  2B65 A;  4F3G A;  4MLQ A;  1SDX A;  3FXQ A;  2F34 A;  2PYY A;  3H6W A;  3T93 B;  3KJ7 A;  4R72 A;  1B05 A;  1AIV A;  3O28 A;  3SKP A;  3K6X A;  1QUI A;  1MY0 A;  3FJ7 A;  4O3C A;  1S9T A;  4BDQ A;  3G7W A;  5AA1 A;  1LBC A;  3CR9 A;  4ZEI A;  1JW5 A;  2XXI A;  2DE3 A;  1D9Y A;  4E0W A;  3FJG A;  2XXR A;  2Z8E A;  1IEJ A;  4WED A;  4R75 A;  2OK2 A;  3OOA A;  3B7D A;  2V3U A;  2DVZ A;  5I59 B;  3TQL A;  4JSO A;  3MP8 A;  3K6U A;  2XXT A;  4YAH X;  5CMC A;  4DXU A;  2I3W A;  4KD5 A;  2I0C A;  3EQ1 A;  3L6G A;  4DCY A;  4DZ1 A;  3LSF B;  2F97 A;  3U92 A;  3TPA A;  1D4N A;  3IX1 A;  1Z7M E;  3PMX A;  3IOU A;  3M3L A;  4JWO A;  2O84 X;  2AYS A;  3JZJ A;  5EYF A;  4F29 A;  2XXY A;  3TZA A; 
#chains in the Genus database with same CATH topology
 4BDL A;  1NKX A;  2Q88 A;  3KEI A;  4BDR A;  3K2D A;  1B51 A;  3B8B A;  3WAF A;  4N8G A;  1FQE A;  3CG3 A;  4UA8 A;  3UA8 A;  4RK2 A;  4F18 A;  4O3B A;  1DSN A;  1CB6 A;  3OEK A;  2OWS A;  2HQ0 A;  2QS2 A;  5CRY A;  5K2Y A;  4OAN A;  3A3C A;  5EYH A;  4G68 A;  3FJM A;  4LA9 A;  1II5 A;  5FBP A;  3DP6 A;  5KCJ A;  4PBQ A;  1XHY A;  4FIM A;  5I2N A;  3G3J A;  3Q28 A;  2A5T A;  1LBB A;  1ATG A;  3SET A;  2PFZ A;  1EYJ A;  1YTV A;  4EDP A;  5IZ3 B;  5AA4 A;  1IXC A;  1KA1 A;  5ICT A;  3F11 A;  1Y3N A;  3FV1 A;  4KQP A;  2UYF A;  3S9N C;  4HW8 A;  4KCD A;  4G68 C;  3QMF A;  4KI0 E;  1USY E;  4ZDM A;  1UTH B;  1FTJ A;  3RPL A;  4I40 A;  1GVC A;  3HO7 A;  5ELV A;  2OX3 A;  5CMB A;  3ISP A;  1R9L A;  4LON B;  3A29 A;  3H6U A;  3G3H A;  5T3J A;  1OVT A;  2F78 A;  4RYA A;  1SQY A;  1NV6 A;  2QMW A;  2VD2 A;  1J1N A;  3U93 A;  5HPQ A;  1UQW A;  1EZP A;  1B52 A;  1VFE A;  3IFC A;  1MM7 A;  2CMO A;  3RN8 A;  2I6E A;  3MBP A;  3TTM A;  2P0S A;  3MST A;  4EUO A;  3PPP A;  4M1V A;  1NNK A;  4P3L A;  5B70 A;  3JV9 A;  1INP A;  2NUV A;  4PGP A;  3KN3 A;  2XX7 A;  4I3E A;  4GX3 A;  4IR8 A;  1Y9U A;  2O6A A;  3IO4 A;  1R9Q A;  1IMD A;  3UK4 A;  4HTG A;  1IMB A;  4MMP A;  4QSE A;  3K1N A;  3MVZ A;  2B4M A;  2F3B A;  2ZZW A;  1MPB A;  4PE3 A;  2Z22 A;  4F2O A;  4JB7 A;  3MWB A;  4NWD A;  3QUF A;  1WOD A;  5CC2 A;  4U1O A;  3KBR A;  3VV5 A;  4BLA A;  2ZNU A;  1JEU A;  4R74 A;  1HSL A;  5IKB A;  1FPB A;  3T96 B;  3TCF A;  5CBS A;  4ISU A;  2FHY A;  1CNQ A;  1USY H;  2DS9 A;  4YKI A;  4PFI A;  4YKJ A;  3ILT B;  5AA3 A;  4LQ5 A;  1B5H A;  4OA4 A;  5A5X A;  2UVI A;  4R73 A;  2ZNT A;  3LSW A;  5K2X A;  2XXH A;  2ESN A;  5DVF A;  3OD7 A;  3B6W A;  4O3A A;  4F2Q A;  2XX8 A;  3CSB A;  1OMP A;  3Q25 A;  4KXP A;  4GD5 A;  3PGF A;  1N76 A;  4PE5 B;  3O2A A;  4LZ5 A;  3IJX B;  3N94 A;  3VVD A;  2ZYK A;  1VFD A;  2O69 A;  1FPE A;  2VPN A;  1GGG A;  2O1L A;  3MQ9 A;  4XXU A;  1WVJ A;  2RIN A;  3E13 X;  4GF8 A;  3Q27 A;  1PB8 A;  4OYV A;  2WEF A;  4LP2 B;  3EKI A;  3O9P A;  4G68 B;  5ITO A;  5FTI A;  2A5S A;  4DIG A;  2GH9 A;  5KCJ B;  4P47 A;  3S2V A;  4F1V A;  5I2N B;  3A09 A;  1N7W A;  3B6T A;  2QMX A;  2O7U A;  2F8D A;  3PUY E;  4NE4 A;  1NUZ A;  3V89 B;  2PMS A;  2NOO A;  1R6Z A;  3PPR A;  1M5B A;  1BLF A;  1TWY A;  4K3F A;  4FED A;  3T66 A;  1JQF A;  4XKN A;  1JP4 A;  1IIT A;  2MKZ A;  2OWT A;  2YPN A;  1NV7 A;  2P1S A;  3RPL B;  3W9V A;  4MHF A;  4ZE8 A;  1IME A;  3MP6 A;  1KWH A;  1Y1Z A;  5FHM A;  1ZJL A;  4RK9 A;  3LR1 A;  2H4I A;  4H45 A;  1IQ7 A;  1FJ6 A;  1G0I A;  2DQV A;  4LZ8 A;  3H3G A;  1LAX A;  1ANF A;  4PGN A;  2I0B A;  1CE2 A;  4QFK A;  3S9E A;  5CBR A;  1YPN A;  5I58 A;  2VOZ A;  5I7I A;  4G77 A;  4POX A;  4PC9 A;  1Y4C A;  2V25 A;  2ZMB A;  1EYK A;  1ZMG A;  3FAT A;  3VE1 B;  2Z8F A;  4ELR A;  4FEB A;  1DOT A;  3PU5 A;  2KR0 A;  1MY1 A;  3OMB A;  3MW0 A;  2KLF A;  3SZP A;  4GWY A;  3QAX A;  1LAG E;  3IR1 A;  5L9M A;  3TTL A;  2ONK E;  5A5L A;  3U1O A;  3K4U A;  4XKR A;  2F6P A;  4NF8 B;  4AQ4 A;  1M5E A;  3CVG A;  3D4C A;  5DTB A;  3QXM A;  5H8Q B;  3T1B A;  2XXQ A;  3EHT A;  3JYR A;  4O7I A;  1MXX A;  2WYP A;  3TEL A;  4YU0 A;  3IB1 A;  1QGX A;  4H5G A;  5I2K A;  4RXL A;  4TLM B;  2OWZ A;  1XC1 A;  3NOH A;  3KBZ A;  4I62 A;  3HHF A;  5FHO A;  1MDP 1;  2XD3 A;  3T22 A;  3GZG A;  3B6Q A;  5DW8 A;  4GBV A;  1MQH A;  1B32 A;  1OQH A;  2ANJ A;  3PPO A;  1QVS A;  3SER A;  1AH5 A;  4NED A;  5IZZ A;  2PBW A;  5JEI A;  2XHD A;  1JVY A;  2H25 A;  4OEU A;  3CG1 A;  3ECR A;  4IO7 A;  4JWY A;  2Q89 A;  2HPG A;  1MPC A;  1NV5 A;  2HFB A;  1M5C A;  2HEU A;  2RC9 A;  1B2H A;  3MZB A;  4N4U A;  1RYO A;  4PDH A;  3FXR A;  3SES A;  1OVB A;  2Y7P A;  1D9V A;  1MY4 A;  5CI5 A;  4H65 A;  2RF1 A;  4N91 A;  3PV0 E;  1FPI A;  3LUZ A;  5ISU A;  1IXI A;  1ELJ A;  4F22 A;  4OVP A;  2ZNS A;  2ZYO A;  2UVG A;  1OIB A;  1DPP A;  1MPD A;  3EHS A;  4OFJ A;  4YMB A;  3U72 A;  3QIM A;  5TPA B;  2V93 A;  1UTB A;  3MYU A;  3LBS A;  3T9X B;  3L6H A;  3U65 A;  4LZ7 A;  3DP4 A;  3M8U A;  4X1D A;  2M8C A;  1RDX A;  5J1D A;  4KCC A;  3LC8 A;  4ZEF A;  3FVN A;  4N6D A;  2OZZ A;  4ZEK A;  2XXP A;  2DOJ A;  3N6U A;  1I6Q A;  3OO6 A;  2Q8M A;  2DWH A;  1MQG A;  5ET6 A;  4LN5 A;  1SI0 A;  4NTL A;  2NWJ A;  2BJI A;  1MS7 A;  4G8M A;  4E0X A;  4YB7 A;  1FTM A;  2NVU B;  4IO3 A;  4X04 A;  4GWW A;  2QRY A;  4PFR A;  4Z0I A;  3FD3 A;  3W15 C;  3BFU A;  4EXK A;  3RTF B;  1LLS A;  2GHA A;  5EQ8 A;  1P1Q A;  2FVZ A;  3TCH A;  4QRZ A;  3U94 A;  1PBQ A;  3IFA A;  1POY 1;  1B3L A;  2F7B A;  2THI A;  1PC3 A;  3Q29 A;  1GR2 A;  4JBZ A;  1EZ9 A;  1PB7 A;  4HE0 A;  2ZZV A;  3KZG A;  4G4P A;  1N0T A;  1OQG A;  2OJT A;  3O66 A;  3RT6 B;  3KSX A;  1D9Q A;  4N81 A;  4QHQ A;  1JNF A;  1JET A;  1XT8 A;  1LBY A;  4G8N A;  4XKQ A;  4ZED A;  2ONR A;  4IY6 A;  4MLV A;  4O8M A;  2QS4 A;  4OES A;  4WKM A;  1PDA A;  4NF5 B;  4EXL A;  4OVQ A;  1NV3 A;  1HSJ A;  4F1U A;  4JWX A;  4OEV A;  3TAJ A;  4GWX A;  2I48 A;  2E0S A;  1SW4 A;  1EZO A;  1MY2 A;  3H03 A;  4F31 B;  4XFE A;  4HCW A;  3RYD A;  1NFT A;  4HE1 A;  1HSE A;  3D1R A;  5H8F A;  3N6T A;  3KOT A;  4RPO A;  3H06 B;  4YZZ A;  4GXA A;  4NG7 A;  3UIF A;  3GXA A;  1B3G A;  5AA2 D;  4NF6 B;  4ESX A;  1MRP A;  1Y3Q A;  5DT6 A;  3MZ1 A;  1P1O A;  3KFM A;  4MNC A;  4MEV A;  2UXA A;  1URD A;  4EQB A;  4R2B A;  2HAU A;  4N07 A;  1IUD A;  3MUQ A;  4G61 A;  2VPO A;  1SYH A;  3FBP A;  3RNN A;  1AOV A;  5F24 A;  4F3P A;  3KC0 A;  2XXW A;  4GL0 A;  3IOV A;  2UVH A;  4RY1 A;  4P9K A;  1VR5 A;  2QL3 A;  2HZK A;  4Z7E A;  1SBP A;  4R9F A;  4AS5 A;  1XVY A;  2XWI A;  2ABH A;  1I6B A;  1NL5 A;  3BKI B;  3OSR A;  5IAI A;  3FIR A;  2I4B A;  1LAH E;  4H8J A;  5DEX A;  2DE2 A;  3OEM A;  1B40 A;  2HZL A;  3BIG A;  1QUK A;  1O64 A;  4TOZ A;  2ONS A;  3O6G A;  3P7I A;  4PET A;  3TYH A;  1QJM A;  1IXH A;  1LBV A;  3FXU A;  1MH3 A;  4NX1 A;  3UN6 A;  3TTK A;  3KC1 A;  3OEN A;  3OO9 A;  3KN7 A;  4ESW A;  1FBH A;  3IL1 B;  4OQO A;  4MX6 A;  5JTY A;  3TMG A;  1YCJ A;  3TTR A;  4IB2 A;  2VP1 A;  4ZZE A;  3IB2 A;  1N04 A;  5JK4 A;  1FBF A;  1FJ9 A;  4QFO A;  1P1U A;  1NUW A;  2QVR A;  3LV0 A;  2VHA A;  3EHU A;  3RUM A;  3I6V A;  3ZKL A;  4H6D A;  1FRP A;  1NV0 A;  4NHB A;  1XS5 A;  2Z23 A;  3ZKK A;  3PTY A;  1A8E A;  4XTC Q;  3CSG A;  2IEE A;  5ESY A;  1B5I A;  1B58 A;  5M2V A;  1BKA A;  3CHG A;  4JSD A;  5EHS A;  2VD3 A;  3TDJ A;  4DCX A;  4GX6 A;  1A99 A;  1FQB A;  4QFL A;  4HS7 A;  2NXO A;  4C1U A;  4RNS A;  4TLL B;  1NV1 A;  4OWD A;  3TTN A;  5EQA A;  5LDZ A;  1ZTY A;  1LFI A;  1FPD A;  1JW4 A;  4DI4 B;  5EYG A;  4U4X A;  5TP9 A;  1ZBM A;  1DBZ A;  3RQT A;  2F7C A;  3RLF E;  3ONM A;  4X48 A;  1NH7 A;  4H46 A;  2QPQ A;  2Q8J A;  2PVU A;  2R8T A;  4ELQ A;  1OLA A;  3ZSF A;  4NGU A;  1DCU A;  4JXI A;  1NMU A;  1B7Z A;  4KYD A;  3IOT A;  4PF6 A;  3R6U A;  4U22 A;  1US4 A;  3VLV A;  1US5 A;  4NN3 A;  2IA4 A;  4PP0 A;  1NUX A;  2Y7I A;  1Q35 A;  4GVO A;  4U4S A;  1XVX A;  4X9T A;  4MBP A;  1MQI A;  1B4H A;  1YAE A;  1LBZ A;  3I5O A;  2A5T B;  3K0V A;  1LB8 A;  4QSD A;  1FPG A;  1SI1 A;  4GX4 A;  4LQ2 A;  5AA4 B;  2LAO A;  2Y5L A;  2GFE A;  2DDK A;  4OVR A;  2FNC A;  3HHG A;  3G3F A;  1F9B A;  1FBD A;  5H8S A;  4GQO A;  1ZIU A;  4EQ9 A;  4GLI A;  2DP8 A;  3MPK A;  2X26 A;  1VE4 A;  4JVD A;  3USD A;  1S7Y A;  2Q2C A;  3K01 A;  1TFD A;  1SW1 A;  4FBP A;  5EQ9 A;  3D4G A;  4QSC A;  1FQD A;  5H8H A;  1H45 A;  1T0K A;  3OEL A;  4U1Z A;  5B7D A;  3RT8 A;  3R26 A;  5CMM A;  3PPN A;  1N3W A;  3KSJ A;  3MVX A;  1Q9D A;  4PFT A;  2XA5 A;  1D3K A;  4H0W A;  2FBP A;  1A54 A;  1B1X A;  5FHN A;  2QJE A;  4H8I A;  5H8N A;  1MG1 A;  3K1M A;  4XIG Q;  4R6K A;  2QS1 A;  3GBB A;  5DEX B;  4YB5 A;  2JJK A;  2KQZ A;  2XXU A;  1URS A;  3FVO A;  2QVV A;  3RGY A;  3S9M C;  5DVJ A;  2VT5 A;  4P8B A;  1QKA A;  3W9W A;  1O7T A;  3IB0 A;  5I3S A;  3KN8 A;  4LVQ A;  1IMF A;  5DVI A;  1B9J A;  5I59 A;  3CRB A;  4L17 A;  3WAE A;  4I1D A;  1TXF A;  3VLW A;  2PX1 A;  5JTY B;  2ZYN A;  5CM6 A;  2CZL A;  4PBH A;  3IOR A;  2W7Y A;  4OER A;  4OVT A;  1IZ1 A;  1FPK A;  3TFL A;  2UVJ A;  4H67 A;  5L8D A;  1YYZ A;  3MC2 A;  1FBG A;  3MAM A;  4IO2 A;  3M3K A;  5J16 A;  2E1S A;  5ET8 A;  1NI9 A;  3G3K A;  1GV8 A;  2QS3 A;  2XXK A;  4QFN A;  1FTL A;  3DLN A;  1Y20 A;  3CI8 A;  2FIX A;  3EN3 A;  1H44 A;  4OEN A;  5A5X B;  2RC8 A;  3LUY A;  4PQJ A;  3SEV A;  2DWA A;  3DP8 A;  2PCR A;  4FEC A;  2V3T A;  3IAZ A;  3PMV A;  4KFQ A;  2Q74 A;  1IMC A;  5TP9 B;  3BBR A;  4H1X A;  1L5T A;  2F5X A;  4OXV A;  4AS4 A;  1RDZ A;  1ZKB A;  2P2A A;  3O97 A;  1KA0 A;  1SYI A;  1P1N A;  3H4Z A;  1LB9 A;  2X7P A;  2D5W A;  4MCO A;  5DYH A;  3UOR A;  2ZXT A;  4X1B A;  3KG2 A;  1FQF A;  1POT A;  1JVX A;  4C1T A;  1FBP A;  1SPI A;  1DPE A;  3K1P A;  3QK6 A;  4G2Z A;  4F3S A;  4DXB A;  1DK4 A;  4PTK A;  1DTZ A;  1LBW A;  2DVC A;  5HBC A;  1KZ8 A;  4GFR A;  4ELO A;  2I49 A;  4NF4 A;  2H9B A;  1FTO A;  2D3I A;  4GWS A;  1B3H A;  1LST A;  3O6I A;  1RYX A;  2F35 A;  1QUL A;  3S9L C;  1Y4T A;  3FXB A;  4U21 A;  2V3Q A;  1JEV A;  3U8Q A;  4KYS A;  2FA7 A;  3HFU A;  1Y3P A;  3BIH A;  2DXR A;  1K9Y A;  1FPL A;  3TKD A;  2O51 A;  3IK6 B;  4BDM A;  3O6H A;  1AL3 A;  1Y1M A;  1MQD A;  3VVE A;  4O7M A;  3OSQ A;  4M4G A;  1B3E A;  4ZS9 A;  3FUZ A;  4FOR A;  1LCT A;  5BUU A;  4N6P A;  3HST A;  3O29 A;  4MNP A;  1URG A;  1UIU A;  3CFL A;  5H8H B;  3T9H B;  5I56 A;  1YXI A;  1FPJ A;  2O1M A;  4IO4 A;  4GXS B;  3GYY A;  1MXY A;  2UYE A;  4JVC A;  2G93 A;  2H99 A;  4IGR A;  5I58 B;  3S4U A;  4LUB A;  2CEX A;  4I3Y A;  1DMB A;  3N5L A;  2QFL A;  5H8N B;  4WXJ A;  4QF9 A;  3ROJ A;  2WBB A;  4P11 A;  1I69 A;  4GRK A;  5AE4 A;  1YZ0 A;  3TCG A;  3HV1 A;  4KPT A;  5ITP A;  5EQ7 A;  2R6G E;  4OHN A;  5LOM A;  5L9S A;  4POW A;  1B7H A;  1FTA A;  1FTK A;  4HE2 A;  4GOT A;  3PD8 A;  2WKY A;  4OET A;  1ZU0 A;  1B3F A;  1SVX B;  5I84 A;  1B4Z A;  4XEQ A;  4IO6 A;  4RA1 A;  2R9J A;  2GRV A;  3EF7 A;  5I57 A;  5I2K B;  3UGW A;  4I8C A;  4DI3 D;  3VDF A;  1SW2 A;  4WEP A;  4PDD A;  1LGB C;  3E3K A;  2YJP A;  3FVK A;  3VFJ A;  4THI A;  1MDQ A;  1MQJ A;  4ELP A;  1SW5 A;  1GTK A;  1PB9 A;  1MXV A;  1N3X A;  3VVF A;  1OLC A;  3EPE A;  4EF2 A;  3TOD A;  4NAP A;  5L9O A;  4NMY A;  3MZ9 A;  4PFB A;  3MP1 A;  3LSX A;  4UAC A;  2HCA A;  2PT1 A;  3T0J A;  2OBG A;  2V84 A;  4EQ7 A;  1FBE A;  1PEB A;  4ND9 A;  1NNT A;  4HCY A;  3PUW E;  2XD2 A;  2RCA A;  3FV2 A;  1A8F A;  4NQ8 A;  2OLB A;  3K00 A;  5IM2 A;  4YB6 A;  4N8Y A;  1IXG A;  1FSA A;  2GQ1 A;  3G3G A;  3Q26 A;  1MXZ A;  4NF4 B;  1ZLQ A;  2QSX A;  1N7X A;  2ZYM A;  3QUJ A;  1FW0 A;  2H98 A;  1NUY A;  4G8H A;  2OCU A;  3GBA A;  1UTB B;  2D21 A;  2P3N A;  2B3B A;  4X8R A;  1M5F A;  3RY3 A;  2XXX A;  1R1N A;  1NV4 A;  5HM4 B;  4XF5 A;  3VLU A;  1RKM A;  4ZEC A;  3VXC A;  5IGA A;  3GLB A;  4FE8 A;  3IO6 A;  2DWI A;  3E9X A;  1FQC A;  3LSL A;  1A40 A;  1H43 A;  4U2R A;  3M3F A;  1EU8 A;  3H7M A;  3ILU B;  5I56 B;  1H76 A;  1NNF A;  3H6V A;  1VSO A;  4DLD A;  4YIC A;  4NWC A;  2Y7W A;  3THI A;  3I3V A;  2B4L A;  4R9G A;  2L5V A;  3SEW A;  4ECF A;  3FAS A;  4QFP A;  4NF8 A;  4DE8 A;  5CMK A;  4P0G A;  4FAJ A;  5AA2 A;  4P1E A;  2DWJ A;  1MY3 A;  4OFO A;  2Z8D A;  4MFI A;  4GIZ A;  1H3D A;  4Q30 B;  4PAF A;  5H8Q A;  3PUX E;  2DXY A;  4ONY A;  4H5F A;  3TQW A;  4ZZA A;  3CFX A;  3KOS A;  4PFW A;  1FCK A;  4F3B A;  4I9D A;  1A55 A;  3IOW A;  1XI6 A;  2F3D A;  4F1Y A;  1IIW A;  1QW0 A;  3N26 A;  5I5P A;  2Y7K A;  3E78 A;  3PUZ E;  4MJO A;  2XXV A;  4TQU Q;  3RPW A;  3SEU A;  3BFT A;  1TFA A;  3ZS6 A;  1LAF E;  1TT1 A;  3TUS A;  4YKP A;  5KDT A;  1FQA A;  4FAT A;  1PBP A;  3MPL A;  5I57 B;  5IZ1 A;  3C9H A;  1IMA A;  4N6K A;  3K6V A;  2RC7 A;  1LFG A;  4AB5 A;  2PFY A;  1P1W A;  2Y84 A;  3PMW A;  3V5A A;  2G29 A;  3IJO B;  3C34 A;  4BDO A;  1N84 A;  2CZK A;  2REJ A;  1QUJ A;  1FPF A;  1FBC A;  4Q0C A;  3V83 A;  1EYI A;  5KZT A;  1O63 A;  1B0H A;  5H8F B;  1LFH A;  1MH4 A;  3AXF A;  3FVG A;  4DXC A;  2AIX A;  4P1L A;  2XX9 A;  4OTE A;  4OMB A;  3SDF A;  1LEV A;  3OO8 A;  4ZE9 A;  5F1Q A;  3TEP A;  3SEX A;  3PD9 A;  2HHM A;  4R2F A;  4KHZ E;  3FGS A;  4GWO A;  3C33 A;  1I6A A;  3MVW A;  3K6W A;  2Q2A A;  1XOC A;  2HXR A;  1DTG A;  5FTH A;  1RDY A;  1B5J A;  1UIV A;  3C35 A;  4PFY A;  5TPA A;  3ODB A;  2F6G A;  4Q5T A;  3DM0 A;  4R6Y A;  3PUV E;  1BK4 A;  1NV2 A;  4MF3 A;  4NF0 A;  3RTW B;  3KGC A;  2HAV A;  5LTC A;  3VXB A;  2HXW A;  3H6T A;  1Q1K A;  4IY5 A;  3CFZ A;  5F7V A;  1LBX A;  2ZZX A;  2AL4 A;  2ALU A;  2RCB A;  1Z7N E;  4PAK A;  3E4R A;  4AB6 A;  3C36 A;  4OVS A;  4BDN A;  4PCD A;  4MIJ A;  4IO5 A;  1QKB A;  2Y7R A;  1AWB A;  1JW1 A;  4ZEB A;  3A3U A;  2O68 A;  3C32 A;  3G3I A;  2WBD A;  4RJZ A;  2I4C A;  4DDD A;  4MAG A;  2CEY A;  3CIJ A;  2Q9T A;  3OXN A;  4LAT A;  4N13 A;  3SEY A;  2O7I A;  4XKP A;  4GWU A;  4F39 A;  2XWV A;  4OVJ A;  2REG A;  1B6H A;  2VGQ A;  5BWJ A;  1B7U A;  4YMA A;  4FJP A;  2I3V A;  4GL8 A;  3FZV A;  5AA2 B;  4OFL A;  3MJN A;  3QYT A;  3C31 A;  4QXD A;  1P99 A;  4IGT A;  3PPQ A;  1S50 A;  4JVI A;  4P0I A;  1BP5 A;  4R6H A;  4GWZ A;  5TU0 A;  1MXU A;  2F36 A;  4PFU A;  2I58 A;  1B0L A;  3E79 A;  2X7Q A;  1M5D A;  4NF5 A;  1BTJ A;  2B3F A;  2XWO A;  2FIE A;  5KDT B;  4F19 A;  3UP9 A;  4P56 A;  5EHM A;  3DEL B;  1B46 A;  3QSL A;  3MVY A;  2XWK A;  2DYX A;  1NH8 A;  4C0R A;  1MXW A;  2WYK A;  1WDN A;  3V8X B;  1K9Z A;  2PT2 A;  4QBA A;  3C4M A;  1A7L A;  3KJT A;  3OO7 A;  4MNI A;  2DE4 A;  4NF6 A;  4Q8R A;  5IZ3 A;  3HPI A;  2F7A A;  2R71 A;  2RKM A;  1MM6 A;  3K02 A;  3HN0 A;  2QVU A;  3HCQ A;  4N17 A;  2BJJ X;  2CZI A;  4PF8 A;  4KR5 A;  2Y5K A;  2H5Y A;  1EH3 A;  2GHB A;  2P3V A;  1AMF A;  1VDW A;  1UTH A;  4U23 A;  4MH5 A;  4JDF A;  3T9U A;  1SD3 A;  4EF1 A;  3R7X A;  3T9V A;  1NNP A;  2FYI A;  5ICQ A;  1LCF A;  2YLN A;  4RPN A;  4YKK A;  4OZ9 A;  2DSF A;  2AL5 A;  4KYE A;  1BIY A;  1B1H A;  2B65 A;  4F3G A;  4MLQ A;  1SDX A;  2CZH A;  3FXQ A;  2F34 A;  2PYY A;  4GBW A;  3H6W A;  3T93 B;  3KJ7 A;  4O94 A;  4R72 A;  1B05 A;  1AIV A;  3B50 A;  3O28 A;  3SKP A;  3K6X A;  1QUI A;  1MY0 A;  3FJ7 A;  4O3C A;  4UAB A;  1S9T A;  4BDQ A;  3G7W A;  5AA1 A;  1LBC A;  3CR9 A;  4ZEI A;  1JW5 A;  2XXI A;  5ET7 A;  2DE3 A;  1D9Y A;  4E0W A;  1G0H A;  3FJG A;  2XXR A;  2Z8E A;  1IEJ A;  4WED A;  4R75 A;  2OK2 A;  3OOA A;  3B7D A;  2V3U A;  2DVZ A;  5I59 B;  5ET5 A;  3TQL A;  4JSO A;  3MP8 A;  3K6U A;  2XXT A;  4YAH X;  5CMC A;  4DXU A;  2I3W A;  4KD5 A;  2I0C A;  3EQ1 A;  3L6G A;  4DCY A;  4DZ1 A;  3LSF B;  2F97 A;  3U92 A;  3TPA A;  1D4N A;  2WX9 A;  3IX1 A;  1Z7M E;  3PMX A;  3IOU A;  3M3L A;  4JWO A;  2O84 X;  2AYS A;  4N15 A;  4PAI A;  3JZJ A;  5EYF A;  4F29 A;  2V4C A;  2XXY A;  4HXV A;  3TZA A; 
#chains in the Genus database with same CATH homology
 4BDL A;  1NKX A;  2Q88 A;  3KEI A;  4BDR A;  3K2D A;  1B51 A;  3WAF A;  1FQE A;  3CG3 A;  4UA8 A;  3UA8 A;  4RK2 A;  4F18 A;  4O3B A;  1DSN A;  1CB6 A;  3OEK A;  2OWS A;  2HQ0 A;  2QS2 A;  5CRY A;  5K2Y A;  3A3C A;  4G68 A;  3FJM A;  4LA9 A;  1II5 A;  3DP6 A;  5KCJ A;  1XHY A;  4FIM A;  5I2N A;  3G3J A;  3Q28 A;  2A5T A;  1LBB A;  1ATG A;  3SET A;  1YTV A;  4EDP A;  5AA4 A;  1IXC A;  5ICT A;  3F11 A;  1Y3N A;  3FV1 A;  4KQP A;  2UYF A;  3S9N C;  4HW8 A;  4KCD A;  4G68 C;  4KI0 E;  1USY E;  4ZDM A;  1UTH B;  1FTJ A;  1GVC A;  3HO7 A;  5ELV A;  5CMB A;  1R9L A;  4LON B;  3H6U A;  3G3H A;  1OVT A;  2F78 A;  4RYA A;  1SQY A;  2QMW A;  2VD2 A;  1J1N A;  3U93 A;  5HPQ A;  1UQW A;  1EZP A;  1B52 A;  1VFE A;  1MM7 A;  2CMO A;  3RN8 A;  2I6E A;  3MBP A;  3TTM A;  2P0S A;  4EUO A;  3PPP A;  4M1V A;  1NNK A;  5B70 A;  3JV9 A;  2NUV A;  3KN3 A;  2XX7 A;  1Y9U A;  2O6A A;  3IO4 A;  1R9Q A;  3UK4 A;  4HTG A;  4QSE A;  3K1N A;  3MVZ A;  1MPB A;  2Z22 A;  4F2O A;  4JB7 A;  3MWB A;  4NWD A;  3QUF A;  1WOD A;  5CC2 A;  4U1O A;  3KBR A;  3VV5 A;  4BLA A;  2ZNU A;  1JEU A;  4R74 A;  1HSL A;  5IKB A;  3T96 B;  3TCF A;  5CBS A;  4ISU A;  1USY H;  2DS9 A;  4YKI A;  4YKJ A;  3ILT B;  5AA3 A;  4LQ5 A;  1B5H A;  5A5X A;  2UVI A;  4R73 A;  2ZNT A;  3LSW A;  5K2X A;  2XXH A;  2ESN A;  5DVF A;  3OD7 A;  3B6W A;  4O3A A;  4F2Q A;  2XX8 A;  3CSB A;  1OMP A;  3Q25 A;  4GD5 A;  3PGF A;  1N76 A;  4PE5 B;  3O2A A;  4LZ5 A;  3IJX B;  3N94 A;  3VVD A;  2ZYK A;  1VFD A;  2O69 A;  1GGG A;  2O1L A;  3MQ9 A;  4XXU A;  1WVJ A;  2RIN A;  3E13 X;  4GF8 A;  3Q27 A;  1PB8 A;  4OYV A;  4LP2 B;  3O9P A;  4G68 B;  5ITO A;  5FTI A;  2A5S A;  4DIG A;  2GH9 A;  5KCJ B;  3S2V A;  4F1V A;  5I2N B;  3A09 A;  1N7W A;  3B6T A;  2QMX A;  2O7U A;  2F8D A;  3PUY E;  4NE4 A;  3V89 B;  2PMS A;  2NOO A;  1R6Z A;  3PPR A;  1M5B A;  1BLF A;  1TWY A;  4K3F A;  4FED A;  3T66 A;  1JQF A;  4XKN A;  1IIT A;  2OWT A;  2YPN A;  2P1S A;  3W9V A;  4ZE8 A;  3MP6 A;  1KWH A;  1Y1Z A;  5FHM A;  1ZJL A;  4RK9 A;  3LR1 A;  2H4I A;  1IQ7 A;  2DQV A;  4LZ8 A;  3H3G A;  1LAX A;  1ANF A;  2I0B A;  1CE2 A;  4QFK A;  3S9E A;  5CBR A;  1YPN A;  5I58 A;  2VOZ A;  4G77 A;  4POX A;  1Y4C A;  2V25 A;  2ZMB A;  1ZMG A;  3FAT A;  3VE1 B;  2Z8F A;  4ELR A;  4FEB A;  1DOT A;  3PU5 A;  1MY1 A;  3OMB A;  3MW0 A;  2KLF A;  3QAX A;  1LAG E;  3IR1 A;  5L9M A;  3TTL A;  2ONK E;  3U1O A;  3K4U A;  4XKR A;  2F6P A;  4NF8 B;  4AQ4 A;  1M5E A;  3CVG A;  3D4C A;  5DTB A;  3QXM A;  5H8Q B;  2XXQ A;  3EHT A;  3JYR A;  1MXX A;  3TEL A;  4YU0 A;  3IB1 A;  4H5G A;  5I2K A;  4RXL A;  4TLM B;  1XC1 A;  4I62 A;  3HHF A;  5FHO A;  1MDP 1;  2XD3 A;  3T22 A;  3GZG A;  3B6Q A;  1MQH A;  1B32 A;  1OQH A;  2ANJ A;  3PPO A;  1QVS A;  3SER A;  1AH5 A;  4NED A;  2PBW A;  5JEI A;  2XHD A;  1JVY A;  2H25 A;  4OEU A;  3CG1 A;  3ECR A;  4IO7 A;  4JWY A;  2Q89 A;  1MPC A;  2HFB A;  1M5C A;  2HEU A;  2RC9 A;  1B2H A;  3MZB A;  1RYO A;  3FXR A;  3SES A;  1OVB A;  2Y7P A;  1D9V A;  1MY4 A;  5CI5 A;  4H65 A;  2RF1 A;  3PV0 E;  5ISU A;  1IXI A;  1ELJ A;  4F22 A;  2ZNS A;  2ZYO A;  2UVG A;  1OIB A;  1DPP A;  1MPD A;  3EHS A;  4OFJ A;  4YMB A;  3U72 A;  3QIM A;  5TPA B;  2V93 A;  1UTB A;  3LBS A;  3T9X B;  3L6H A;  4LZ7 A;  3DP4 A;  3M8U A;  4X1D A;  2M8C A;  5J1D A;  4KCC A;  3LC8 A;  4ZEF A;  3FVN A;  2OZZ A;  4ZEK A;  2XXP A;  2DOJ A;  3N6U A;  1I6Q A;  3OO6 A;  2DWH A;  1MQG A;  1SI0 A;  4NTL A;  2NWJ A;  1MS7 A;  4G8M A;  4E0X A;  4YB7 A;  1FTM A;  2NVU B;  4IO3 A;  2QRY A;  4Z0I A;  3FD3 A;  3W15 C;  3BFU A;  4EXK A;  3RTF B;  1LLS A;  2GHA A;  1P1Q A;  3TCH A;  4QRZ A;  3U94 A;  1PBQ A;  1POY 1;  1B3L A;  2F7B A;  2THI A;  1PC3 A;  3Q29 A;  1GR2 A;  4JBZ A;  1EZ9 A;  1PB7 A;  3KZG A;  4G4P A;  1N0T A;  1OQG A;  2OJT A;  3O66 A;  3RT6 B;  3KSX A;  4QHQ A;  1JNF A;  1JET A;  1XT8 A;  4G8N A;  4XKQ A;  4ZED A;  2ONR A;  4IY6 A;  4MLV A;  2QS4 A;  4OES A;  4WKM A;  1PDA A;  4NF5 B;  4EXL A;  1HSJ A;  4F1U A;  4JWX A;  4OEV A;  3TAJ A;  2I48 A;  2E0S A;  1SW4 A;  1EZO A;  1MY2 A;  3H03 A;  4F31 B;  4HCW A;  1NFT A;  1HSE A;  5H8F A;  3N6T A;  3KOT A;  4RPO A;  3H06 B;  4YZZ A;  4GXA A;  3UIF A;  3GXA A;  1B3G A;  5AA2 D;  4NF6 B;  4ESX A;  1MRP A;  1Y3Q A;  5DT6 A;  3MZ1 A;  1P1O A;  3KFM A;  2UXA A;  1URD A;  4EQB A;  4R2B A;  2HAU A;  4N07 A;  1IUD A;  3MUQ A;  1SYH A;  1AOV A;  3RNN A;  4F3P A;  2XXW A;  4GL0 A;  3IOV A;  2UVH A;  4RY1 A;  1VR5 A;  2QL3 A;  2HZK A;  4Z7E A;  1SBP A;  4R9F A;  1XVY A;  2ABH A;  1I6B A;  1NL5 A;  3BKI B;  3OSR A;  5IAI A;  3FIR A;  2I4B A;  1LAH E;  4H8J A;  5DEX A;  2DE2 A;  3OEM A;  1B40 A;  2HZL A;  1QUK A;  1O64 A;  4TOZ A;  2ONS A;  3O6G A;  3P7I A;  4PET A;  3TYH A;  1QJM A;  1IXH A;  3FXU A;  1MH3 A;  3UN6 A;  3TTK A;  3OEN A;  3OO9 A;  3KN7 A;  4ESW A;  3IL1 B;  4OQO A;  5JTY A;  3TMG A;  1YCJ A;  3TTR A;  4IB2 A;  2VP1 A;  4ZZE A;  3IB2 A;  1N04 A;  5JK4 A;  1P1U A;  4QFO A;  2VHA A;  3EHU A;  3RUM A;  3I6V A;  3ZKL A;  4H6D A;  1XS5 A;  2Z23 A;  3ZKK A;  1A8E A;  4XTC Q;  3CSG A;  2IEE A;  1B5I A;  1B58 A;  5M2V A;  1BKA A;  4JSD A;  5EHS A;  2VD3 A;  3TDJ A;  4DCX A;  1A99 A;  1FQB A;  4QFL A;  4HS7 A;  2NXO A;  4C1U A;  4RNS A;  4TLL B;  4OWD A;  3TTN A;  1ZTY A;  1LFI A;  1JW4 A;  4U4X A;  5TP9 A;  1ZBM A;  3RQT A;  2F7C A;  3RLF E;  3ONM A;  4X48 A;  1NH7 A;  2QPQ A;  2Q8J A;  2PVU A;  4ELQ A;  1OLA A;  3ZSF A;  4JXI A;  1NMU A;  1B7Z A;  4KYD A;  3IOT A;  3R6U A;  4U22 A;  1US4 A;  3VLV A;  1US5 A;  2IA4 A;  4PP0 A;  2Y7I A;  1Q35 A;  4GVO A;  4U4S A;  1XVX A;  4X9T A;  4MBP A;  1MQI A;  1B4H A;  1YAE A;  3I5O A;  2A5T B;  3K0V A;  1LB8 A;  4QSD A;  1SI1 A;  4LQ2 A;  5AA4 B;  2LAO A;  2GFE A;  2FNC A;  3HHG A;  3G3F A;  1F9B A;  5H8S A;  4GQO A;  1ZIU A;  4EQ9 A;  4GLI A;  2DP8 A;  3MPK A;  2X26 A;  1VE4 A;  3USD A;  1S7Y A;  2Q2C A;  3K01 A;  1TFD A;  1SW1 A;  3D4G A;  4QSC A;  1FQD A;  5H8H A;  1H45 A;  1T0K A;  3OEL A;  4U1Z A;  5B7D A;  3RT8 A;  3R26 A;  5CMM A;  3PPN A;  1N3W A;  3KSJ A;  3MVX A;  4PFT A;  1D3K A;  4H0W A;  1A54 A;  1B1X A;  5FHN A;  2QJE A;  4H8I A;  5H8N A;  1MG1 A;  3K1M A;  4XIG Q;  4R6K A;  2QS1 A;  3GBB A;  5DEX B;  4YB5 A;  2XXU A;  1URS A;  3FVO A;  3RGY A;  3S9M C;  5DVJ A;  1QKA A;  3W9W A;  1O7T A;  3IB0 A;  3KN8 A;  4LVQ A;  5DVI A;  1B9J A;  5I59 A;  3CRB A;  4L17 A;  3WAE A;  4I1D A;  1TXF A;  3VLW A;  2PX1 A;  5JTY B;  2ZYN A;  5CM6 A;  2CZL A;  3IOR A;  2W7Y A;  4OER A;  1IZ1 A;  3TFL A;  2UVJ A;  4H67 A;  5L8D A;  3MC2 A;  3MAM A;  4IO2 A;  3M3K A;  2E1S A;  3G3K A;  1GV8 A;  2QS3 A;  4QFN A;  1FTL A;  3DLN A;  1Y20 A;  3CI8 A;  3EN3 A;  1H44 A;  4OEN A;  5A5X B;  2RC8 A;  3LUY A;  4PQJ A;  3SEV A;  2DWA A;  3DP8 A;  4FEC A;  2V3T A;  3IAZ A;  3PMV A;  4KFQ A;  5TP9 B;  3BBR A;  4H1X A;  1L5T A;  2F5X A;  4OXV A;  1ZKB A;  2P2A A;  3O97 A;  1SYI A;  1P1N A;  3H4Z A;  1LB9 A;  2X7P A;  2D5W A;  5DYH A;  3UOR A;  2ZXT A;  4X1B A;  3KG2 A;  1FQF A;  1POT A;  1JVX A;  4C1T A;  1DPE A;  3K1P A;  3QK6 A;  4G2Z A;  4F3S A;  4DXB A;  1DTZ A;  2DVC A;  5HBC A;  4GFR A;  4ELO A;  2I49 A;  4NF4 A;  2H9B A;  1FTO A;  2D3I A;  1B3H A;  1LST A;  3O6I A;  1RYX A;  2F35 A;  1QUL A;  3S9L C;  1Y4T A;  4U21 A;  2V3Q A;  1JEV A;  3U8Q A;  4KYS A;  2FA7 A;  1Y3P A;  2DXR A;  3TKD A;  2O51 A;  3IK6 B;  4BDM A;  3O6H A;  1AL3 A;  1Y1M A;  1MQD A;  3VVE A;  3OSQ A;  4M4G A;  1B3E A;  4ZS9 A;  3FUZ A;  4FOR A;  1LCT A;  5BUU A;  4N6P A;  3HST A;  3O29 A;  1URG A;  1UIU A;  3CFL A;  5H8H B;  3T9H B;  5I56 A;  2O1M A;  4IO4 A;  4GXS B;  1MXY A;  2UYE A;  2G93 A;  2H99 A;  4IGR A;  5I58 B;  3S4U A;  4LUB A;  1DMB A;  3N5L A;  5H8N B;  4WXJ A;  4QF9 A;  4P11 A;  1I69 A;  4GRK A;  5AE4 A;  3TCG A;  3HV1 A;  4KPT A;  5ITP A;  2R6G E;  4OHN A;  5LOM A;  5L9S A;  4POW A;  1B7H A;  1FTK A;  4GOT A;  3PD8 A;  2WKY A;  4OET A;  1ZU0 A;  1B3F A;  1SVX B;  5I84 A;  1B4Z A;  4IO6 A;  4RA1 A;  2R9J A;  2GRV A;  3EF7 A;  5I57 A;  5I2K B;  3UGW A;  4I8C A;  3VDF A;  1SW2 A;  4WEP A;  1LGB C;  3E3K A;  2YJP A;  3FVK A;  3VFJ A;  4THI A;  1MDQ A;  1MQJ A;  4ELP A;  1SW5 A;  1GTK A;  1PB9 A;  1MXV A;  1N3X A;  3VVF A;  1OLC A;  3EPE A;  4EF2 A;  3TOD A;  5L9O A;  4NMY A;  3MZ9 A;  3MP1 A;  3LSX A;  4UAC A;  2HCA A;  2PT1 A;  2OBG A;  2V84 A;  4EQ7 A;  1PEB A;  4ND9 A;  1NNT A;  4HCY A;  3PUW E;  2XD2 A;  2RCA A;  3FV2 A;  1A8F A;  2OLB A;  3K00 A;  4YB6 A;  1IXG A;  3G3G A;  3Q26 A;  1MXZ A;  4NF4 B;  1ZLQ A;  2QSX A;  1N7X A;  2ZYM A;  3QUJ A;  1FW0 A;  2H98 A;  4G8H A;  2OCU A;  3GBA A;  1UTB B;  2D21 A;  2B3B A;  1M5F A;  3RY3 A;  2XXX A;  1R1N A;  5HM4 B;  3VLU A;  1RKM A;  4ZEC A;  3VXC A;  3GLB A;  3IO6 A;  4FE8 A;  2DWI A;  3E9X A;  1FQC A;  3LSL A;  1A40 A;  1H43 A;  4U2R A;  3M3F A;  1EU8 A;  3H7M A;  3ILU B;  5I56 B;  1H76 A;  1NNF A;  3H6V A;  1VSO A;  4DLD A;  4YIC A;  2Y7W A;  4NWC A;  3THI A;  3I3V A;  4R9G A;  3SEW A;  4ECF A;  3FAS A;  4QFP A;  4NF8 A;  4DE8 A;  5CMK A;  4P0G A;  5AA2 A;  4FAJ A;  2DWJ A;  1MY3 A;  4OFO A;  2Z8D A;  4MFI A;  4GIZ A;  1H3D A;  4Q30 B;  5H8Q A;  3PUX E;  2DXY A;  4ONY A;  4H5F A;  3TQW A;  4ZZA A;  3CFX A;  3KOS A;  4PFW A;  1FCK A;  4F3B A;  4I9D A;  1A55 A;  3IOW A;  4F1Y A;  1IIW A;  1QW0 A;  3N26 A;  2Y7K A;  3PUZ E;  2XXV A;  4TQU Q;  3RPW A;  3SEU A;  3BFT A;  1TFA A;  3ZS6 A;  1LAF E;  1TT1 A;  3TUS A;  4YKP A;  5KDT A;  1FQA A;  4FAT A;  1PBP A;  3MPL A;  5I57 B;  3C9H A;  3K6V A;  2RC7 A;  1LFG A;  4AB5 A;  1P1W A;  2Y84 A;  3PMW A;  3V5A A;  2G29 A;  3IJO B;  3C34 A;  4BDO A;  1N84 A;  2REJ A;  1QUJ A;  4Q0C A;  3V83 A;  5KZT A;  1O63 A;  1B0H A;  5H8F B;  1LFH A;  1MH4 A;  3AXF A;  3FVG A;  4DXC A;  2AIX A;  2XX9 A;  4OTE A;  4OMB A;  3SDF A;  3OO8 A;  4ZE9 A;  5F1Q A;  3TEP A;  3SEX A;  3PD9 A;  4KHZ E;  4R2F A;  3FGS A;  4GWO A;  3C33 A;  1I6A A;  3MVW A;  3K6W A;  2Q2A A;  1XOC A;  1DTG A;  5FTH A;  1B5J A;  1UIV A;  3C35 A;  4PFY A;  5TPA A;  3ODB A;  2F6G A;  4Q5T A;  3DM0 A;  4R6Y A;  3PUV E;  4MF3 A;  3RTW B;  3KGC A;  2HAV A;  3VXB A;  2HXW A;  3H6T A;  1Q1K A;  4IY5 A;  3CFZ A;  5F7V A;  2AL4 A;  2ALU A;  2RCB A;  1Z7N E;  3E4R A;  4AB6 A;  3C36 A;  4BDN A;  4IO5 A;  1QKB A;  2Y7R A;  1JW1 A;  4ZEB A;  3A3U A;  2O68 A;  3C32 A;  3G3I A;  4RJZ A;  2I4C A;  4DDD A;  3CIJ A;  2Q9T A;  3OXN A;  4LAT A;  4N13 A;  3SEY A;  2O7I A;  4XKP A;  4F39 A;  4OVJ A;  2REG A;  1B6H A;  2VGQ A;  5BWJ A;  1B7U A;  4YMA A;  4FJP A;  2I3V A;  4GL8 A;  3FZV A;  5AA2 B;  4OFL A;  3MJN A;  3QYT A;  3C31 A;  1P99 A;  4IGT A;  3PPQ A;  1S50 A;  4P0I A;  1BP5 A;  4R6H A;  5TU0 A;  1MXU A;  2F36 A;  4PFU A;  2I58 A;  1B0L A;  2X7Q A;  1M5D A;  4NF5 A;  1BTJ A;  2B3F A;  5KDT B;  4F19 A;  3UP9 A;  5EHM A;  3DEL B;  1B46 A;  3QSL A;  3MVY A;  2DYX A;  1NH8 A;  4C0R A;  1MXW A;  1WDN A;  3V8X B;  2PT2 A;  3C4M A;  1A7L A;  3KJT A;  3OO7 A;  2DE4 A;  4NF6 A;  4Q8R A;  3HPI A;  2F7A A;  2R71 A;  2RKM A;  1MM6 A;  3K02 A;  3HN0 A;  3HCQ A;  2BJJ X;  4KR5 A;  2H5Y A;  1EH3 A;  2GHB A;  1AMF A;  1UTH A;  4U23 A;  4MH5 A;  4JDF A;  3T9U A;  1SD3 A;  4EF1 A;  3R7X A;  3T9V A;  1NNP A;  2FYI A;  5ICQ A;  1LCF A;  2YLN A;  4RPN A;  4YKK A;  4OZ9 A;  2DSF A;  2AL5 A;  4KYE A;  1BIY A;  1B1H A;  2B65 A;  4F3G A;  4MLQ A;  1SDX A;  3FXQ A;  2F34 A;  2PYY A;  3H6W A;  3T93 B;  3KJ7 A;  4R72 A;  1B05 A;  1AIV A;  3O28 A;  3SKP A;  3K6X A;  1QUI A;  1MY0 A;  3FJ7 A;  4O3C A;  1S9T A;  4BDQ A;  3G7W A;  5AA1 A;  1LBC A;  3CR9 A;  4ZEI A;  1JW5 A;  2XXI A;  2DE3 A;  1D9Y A;  4E0W A;  3FJG A;  2XXR A;  2Z8E A;  1IEJ A;  4WED A;  4R75 A;  2OK2 A;  3OOA A;  3B7D A;  2V3U A;  2DVZ A;  5I59 B;  3TQL A;  4JSO A;  3MP8 A;  3K6U A;  2XXT A;  4YAH X;  5CMC A;  4DXU A;  2I3W A;  4KD5 A;  2I0C A;  3EQ1 A;  3L6G A;  4DCY A;  4DZ1 A;  3LSF B;  2F97 A;  3U92 A;  3TPA A;  1D4N A;  3IX1 A;  1Z7M E;  3PMX A;  3IOU A;  3M3L A;  4JWO A;  2O84 X;  2AYS A;  3JZJ A;  5EYF A;  4F29 A;  2XXY A;  3TZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...