2QSXA

Crystal structure of putative transcriptional regulator lysr from vibrio parahaemolyticus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
197
structure length
180
Chain Sequence
ELLVVDVTPSFASLWLVPNINDFHQRHPNIRVKILTGDGAVESDLHVRCLPLSTHYEYSQLLCEETLLLIGNTNLPISHYPFIPQTTRPQLWEQFKQENITYHSVGFEHFYLACEAVRMEKGLALLPDFMAQFSILRGDIQHIGNLKLHSGYGYYVVIPNFRLTSRKVALFHDWLKDKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator, LysR family
publication title The Crystal Structure of Putative Transcriptional Regulator LysR From Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transcription
total genus 48
structure length 180
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qsxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qsxA02
2ZYMA 1B2HA 3G3GA 3P7IA 1MXXA 3IOTA 2XXRA 2RINA 3C9HA 3FIRA 4ZE9A 3LR1A 1B32A 2UXAA 5AA3A 3VDFA 1J1NA 1LB9A 1YAEA 3O28A 1A8EA 1B5IA 1SW5A 1OQGA 4XKQA 3K2DA 5BUUA 5AE4A 1JETA 4XKNA 2HXWA 3KOSA 3N6TA 4PFTA 1VFDA 3N5LA 5HPQA 1IIWA 2G29A 2F5XA 1LBCA 5EYFA 1QULA 3CVGA 3LSWA 3JYRA 3VV5A 1MM6A 4QFNA 3A3CA 4WEDA 2O69A 3S2VA 3LSXA 3ZKLA 2UYEA 3TELA 2OCUA 3PGFA 4GVOA 2REJA 2V3QA 3OXNA 2Q9TA 4RK9A 3HSTA 1URDA 3TKDA 3UN6A 2ZYNA 4GWOA 3TDJA 3B6WA 4IO5A 3I5OA 2YPNA 2B65A 3WAEA 4BDQA 3O2AA 3PUVE 4U4SA 4G8MA 2XXWA 1UTBB 1I69A 1TT1A 1BLFA 3TFLA 1UTHA 2NXOA 3BKIB 4Q0CA 4IO6A 1GGGA 2DWJA 2E0SA 4KYEA 2P1SA 3MVYA 3V89B 4X1BA 2XX9A 3O66A 2F35A 2XHDA 3R26A 4ECFA 2XXYA 4H1XA 3G3IA 4F1VA 2BJJX 3HV1A 1PDAA 1US4A 1IXGA 4PE5B 4NF8B 1MY4A 4DCYA 1MQGA 2NWJA 4EUOA 2Y84A 1VFEA 3PU5A 1R6ZA 2HCAA 5DTBA 4FJPA 3USDA 4QSCA 2ZXTA 5ELVA 2P2AA 4ZEBA 1LAFE 1A7LA 1FTLA 4KHZE 3Q26A 4LVQA 4QFPA 3ZKKA 4LZ5A 3KN7A 1AIVA 1I6AA 4U1OA 3K6VA 5I56A 4NWCA 4LATA 1MQHA 1PB9A 4LQ5A 5I2NA 1EZ9A 2GRVA 1HSEA 4OMBA 1JW5A 1SI0A 3D4CA 5H8FA 4H5FA 2QS3A 2H99A 3A09A 4YAHX 4ZEKA 2CZLA 4LZ8A 4TOZA 2I6EA 5I59B 3K1PA 2H9BA 4O3BA 4NEDA 3RN8A 4YKIA 3E13X 5K2YA 1FTOA 5DVJA 1QJMA 3PMXA 3MUQA 3V8XB 1LFIA 3S4UA 3PPPA 4NF5A 2D5WA 3MWBA 2D3IA 2OBGA 1P1WA 1NH8A 3M3FA 1NMUA 1NL5A 1FW0A 5I2KB 2HQ0A 4X48A 4RXLA 4G77A 3EN3A 3TPAA 4RPNA 1MXZA 2UVHA 3CFXA 4OEUA 1D4NA 1M5DA 3PMWA 1A99A 2VHAA 4IO3A 4KFQA 3UORA 4R6HA 4OZ9A 2ONRA 5AA2D 3VLVA 1MPDA 3RT8A 3RPWA 3TAJA 4EXKA 2A5SA 1UQWA 3KEIA 1FQCA 5CBSA 3H6VA 2GHAA 3DM0A 2NVUB 2XXQA 2O51A 1P1NA 3U8QA 4AB5A 4RPOA 3AXFA 3W9WA 4MFIA 4GIZA 4BDMA 5CM6A 3PPQA 1S7YA 2D21A 4FAJA 4ESWA 5CBRA 3TEPA 3VLUA 2ALUA 4XKRA 5AA4A 3IB2A 1B1HA 1B0LA 4PETA 2UVJA 1R1NA 1T0KA 3C33A 3SESA 1FQFA 5F1QA 4C0RA 1AMFA 3MW0A 1NNTA 3JZJA 1JNFA 4U4XA 1XVYA 3KZGA 3TUSA 4G68A 1LAGE 1ZLQA 1B5HA 4H8JA 1JW4A 3SEVA 4TLLB 1DTZA 2Q89A 1POY1 4R2BA 2XXTA 2ANJA 1SDXA 1LB8A 5JTYB 4ESXA 2ZYOA 4R6KA 5KDTB 1O63A 2DWAA 3U72A 1POTA 1H44A 3MBPA 3OO8A 1PB7A 4F22A 2V84A 2PBWA 1Q1KA 3IORA 1CB6A 1II5A 4LQ2A 1QUIA 2W7YA 2F34A 2X7QA 4EQ9A 3FVNA 2DVZA 4QFOA 1CE2A 1D3KA 4ZE8A 2F78A 4DXCA 4ZEDA 4KQPA 1ZKBA 5TPAA 1SW1A 5HM4B 4FIMA 3W9VA 3CG3A 4OENA 5J1DA 2FNCA 3KSJA 5JEIA 3MVZA 4TQUQ 3QXMA 5DEXB 2DXYA 3CRBA 5DT6A 1SW4A 3VE1B 4F1UA 3MP1A 1Y3QA 5CI5A 1DMBA 2PYYA 1ATGA 4NE4A 4X9TA 2Y7WA 2QS2A 1B9JA 3FV1A 3LSLA 3R6UA 3PPRA 4FE8A 4JDFA 3VXCA 2DP8A 1KWHA 1FTMA 1ZIUA 1QKAA 4IY5A 1RYXA 4ZECA 1RKMA 2XD3A 2DWHA 3TTRA 4AQ4A 2UVGA 2F6GA 1Y3PA 2A5TB 2XXXA 4U2RA 5ISUA 5FTHA 4NF6A 2B3FA 4R6YA 2DQVA 4I9DA 5IAIA 3M8UA 3TODA 2R6GE 3K6UA 3O6GA 1FQBA 3UA8A 3RQTA 3FZVA 4N13A 3U1OA 4F2QA 3G7WA 1M5EA 3N26A 2Z23A 4ZZAA 4R73A 2QMWA 2I49A 1R9LA 3K6WA 2REGA 2I48A 3MZBA 1YCJA 2I4CA 2RCAA 2VGQA 1SQYA 3OENA 4YU0A 5I58A 4P0GA 2WKYA 2AL5A 5ITOA 1Y4CA 1MS7A 4GXAA 5H8QA 4QSEA 3OELA 1IXIA 3T9XB 3OSRA 1L5TA 5KCJA 2HAUA 2RC7A 1YPNA 2DE3A 1H43A 1B7HA 3M3KA 2DOJA 2P0SA 4AB6A 4IGRA 2X26A 3F11A 3H6UA 4GLIA 5HBCA 4OFJA 5H8HA 4F19A 3BBRA 3MPKA 3N94A 4XKPA 3MVXA 4YKJA 4Q5TA 4ZEFA 1MXVA 1OMPA 1ZU0A 2Q8JA 4MLVA 1B4HA 1B5JA 3ODBA 4OERA 5K2XA 1B51A 5H8SA 5B7DA 4RY1A 4P0IA 3PV0E 4O3AA 3SEWA 4BDOA 1OLCA 3IL1B 4H5GA 2QL3A 2ESNA 5I84A 3IK6B 1URSA 2H98A 1B3HA 2F7AA 4E0WA 4DXBA 3CSGA 4ZEIA 1MRPA 1Y1ZA 1LBBA 3FVKA 5AA2B 5B70A 4R9FA 4K3FA 3PMVA 4ELOA 3U92A 4YB7A 4JB7A 3R7XA 1A40A 3THIA 4BLAA 3FATA 3V83A 2THIA 3CI8A 5H8NA 4H67A 3FJGA 1WDNA 1DOTA 1Y1MA 3QUJA 5L9SA 4XXUA 5I56B 1N3XA 4OFLA 4ELPA 3Q27A 1H3DA 2XXUA 2NOOA 4P11A 1JW1A 3E3KA 1LAXA 3JV9A 3D4GA 3PD9A 2F8DA 5CMCA 1LCFA 1P1QA 1Y20A 4JSOA 1A55A 3VXBA 4JWOA 4M4GA 4C1TA 4X1DA 3DP8A 1YTVA 4NF8A 1IQ7A 1GTKA 1BP5A 1MY2A 3PPNA 1MY1A 3HO7A 3K0VA 3SETA 1Q35A 3G3KA 1S50A 1GVCA 2F7BA 3LC8A 3O6IA 3OO6A 1N0TA 3IB1A 1ZBMA 3FXUA 2DXRA 2H25A 3U93A 1BKAA 4E0XA 3TTMA 3FXQA 3KSXA 3IR1A 1B4ZA 1PBPA 3TTNA 2GH9A 3EHUA 2QRYA 3RTFB 3IO4A 2YLNA 1XS5A 4DDDA 3GBAA 1MH4A 3B7DA 1QW0A 3EPEA 3H7MA 1B05A 1USYH 3FJ7A 2QS1A 5FHMA 1GV8A 5I59A 3OO9A 1ZTYA 2HFBA 1B3FA 3H6WA 3ZS6A 1PB8A 3H4ZA 3PUWE 1R9QA 2V3UA 5AA4B 2DS9A 3GBBA 4ND9A 3OMBA 1S9TA 4KD5A 2Y7IA 5F7VA 3QIMA 1WVJA 5I2KA 2VD3A 2Y7PA 3E4RA 1LLSA 1SYIA 4EQBA 4F1YA 1Y3NA 2RKMA 4KI0E 4YB6A 1IITA 1XOCA 3Q28A 3T66A 1A8FA 5JK4A 4ELRA 4C1UA 4EQ7A 3EF7A 1B3EA 4YB5A 3RNNA 5L9OA 3GXAA 3CFLA 1D9YA 2AYSA 4NF4B 1EH3A 3C35A 3C4MA 3B6TA 1MG1A 4MBPA 2GHBA 1MDP1 1SBPA 3IJOB 1B58A 3QYTA 1MQIA 4YMBA 1Y9UA 2Q88A 3RUMA 5A5XA 2AL4A 4OXVA 1LSTA 3MVWA 1Y4TA 3A3UA 4FECA 3K02A 2V3TA 4OESA 3I3VA 3RGYA 2F36A 2RF1A 5ICQA 3OOAA 4F3PA 1A54A 4YKPA 4YZZA 2AIXA 4G8NA 1IUDA 3TTKA 1SYHA 1HSLA 1VSOA 4R9GA 3Q25A 2Z8FA 1M5BA 3MZ1A 3E9XA 3V5AA 4TLMB 2PT2A 4OVJA 3QAXA 3IJXB 3TTLA 2OK2A 3HHFA 4G4PA 1EZPA 1FQDA 4KR5A 1BIYA 5TP9B 1OVTA 4IO4A 1Z7ME 1QUKA 5JTYA 4H0WA 5KDTA 3OD7A 5DVIA 4RJZA 1B6HA 1LFGA 1B3GA 5DVFA 2QJEA 4EF1A 4OWDA 4YKKA 4GFRA 5FHOA 3FXRA 5I57A 1TFDA 1N7XA 3B6QA 3S9EA 4JBZA 4NWDA 1B52A 4EDPA 4MH5A 5ICTA 4NF6B 4U1ZA 3C31A 1FQAA 5CMBA 3FV2A 3EQ1A 1XVXA 1OVBA 4OFOA 3TCFA 2R9JA 4DXUA 4PQJA 3K6XA 3LBSA 1DPPA 3S9NC 5DYHA 4FATA 2ABHA 3PUYE 3QK6A 2FA7A 1I6QA 2OWTA 3KJTA 2DVCA 4OHNA 1LCTA 4G8HA 1OLAA 4ONYA 3VLWA 3H06B 3G3HA 1ELJA 5DEXA 1NKXA 1OIBA 1EZOA 3PPOA 3O29A 3SERA 1NNFA 2IEEA 5CC2A 4G68C 4GL8A 5H8QB 1LAHE 3BFTA 5AA1A 3S9LC 3SEYA 1H45A 3TZAA 2O68A 2PX1A 4DCXA 1N3WA 2O7UA 4JWYA 4ISUA 4U22A 2XXPA 3G3FA 4N07A 1AOVA 3KFMA 4IB2A 4RYAA 3SEUA 2KLFA 1PBQA 3EHTA 3I6VA 4R75A 3N6UA 1XC1A 3OEKA 5H8HB 3K00A 1FCKA 2A5TA 2F97A 1NNKA 1TXFA 3FASA 1MQJA 3ZSFA 1EU8A 3IX1A 1O7TA 4HTGA 2HZKA 3PUZE 2QMXA 4EXLA 1TFAA 5BWJA 4KYDA 2V93A 4JSDA 2DE4A 3O9PA 3ECRA 2F7CA 4KPTA 1B40A 2O7IA 3RLFE 3KG2A 3KGCA 2XXVA 1B7UA 2Y7RA 1FTJA 1H76A 1N04A 2OJTA 4R74A 3PD8A 1FTKA 1XT8A 1UTHB 1RYOA 4IO7A 4KCCA 4OTEA 1QVSA 2Z8EA 3KN3A 2DYXA 1URGA 4DIGA 4FORA 1MPCA 3T9UA 3MAMA 1VR5A 2PMSA 4RA1A 4ELQA 4F39A 2ZYKA 4OYVA 2B3BA 3L6HA 3KOTA 5H8NB 4FEBA 2H5YA 1US5A 1IZ1A 4WKMA 4PP0A 2M8CA 3VFJA 1IXCA 4PFUA 3PUXE 2XD2A 1M5FA 2GFEA 4DZ1A 1JVYA 2HEUA 1WODA 2I58A 4I8CA 2VP1A 1OQHA 4XTCQ 3DP4A 4QFLA 3S9MC 4I62A 5EHMA 3T9VA 3ILUB 4ZS9A 1IEJA 2G93A 3C34A 5I2NB 2VD2A 1UTBA 3DLNA 1BTJA 5H8FB 3K1MA 4KYSA 2I0CA 4H6DA 2ZNTA 4F29A 1MH3A 5AA2A 4DLDA 4JXIA 1SVXB 3Q29A 5L8DA 5FTIA 2RC8A 3QSLA 2DWIA 4H65A 3IAZA 3TCGA 1B1XA 2X7PA 1MDQA 1M5CA 4LP2B 2R71A 4GD5A 3MZ9A 3RT6B 4PFYA 3DELB 4L17A 2O1LA 4IY6A 4IGTA 4NF5B 1NH7A 4EF2A 2XX8A 1MXUA 4OEVA 1Z7NE 3KN8A 4POXA 5CMKA 3L6GA 4NMYA 4F2OA 3UP9A 1FQEA 3QUFA 1P99A 4RK2A 3KJ7A 3UK4A 4ZDMA 1IXHA 3W15C 1MPBA 2ONKE 1O64A 2O1MA 5ITPA 4BDNA 1B46A 3HHGA 3TMGA 2CMOA 5CMMA 1DSNA 4O3CA 4F18A 3DP6A 4QSDA 3VVEA 4THIA 3TQWA 2F6PA 3IOVA 3C36A 1ZMGA 2I3VA 3SKPA 3RTWB 4ZZEA 2NUVA 4HW8A 3M3LA 4I1DA 4DE8A 5IKBA 4G2ZA 4MLQA 3EHSA 1P1UA 2ZNUA 1N76A 3TYHA 2Y7KA 1JQFA 3RY3A 4KCDA 1LFHA 1N7WA 1PC3A 1TWYA 4Z7EA 4QF9A 1PEBA 5L9MA 3OEMA 2RCBA 1NFTA 1ZJLA 3CFZA 1JVXA 5CRYA 4Z0IA 1MY3A 4YMAA 1F9BA 1DPEA 4U23A 2RC9A 4PFWA 4GRKA 3BFUA 4F3BA 4Q30B 4HCWA 4POWA 1MM7A 1MQDA 3CSBA 2HAVA 4WXJA 4OQOA 1B0HA 2OLBA 3K01A 1MY0A 4MF3A 4FEDA 2ZMBA 4U21A 2Q2CA 4G68B 5KZTA 4OETA 4QFKA 5A5XB 1USYE 3FD3A 2UVIA 2FYIA 4UA8A 4UACA 1P1OA 1GR2A 4F3GA 5TU0A 5M2VA 1SI1A 3T9HB 2LAOA 4LA9A 1NNPA 4F3SA 3O6HA 1SD3A 3G3JA 2ONSA 1AH5A 3IB0A 2V25A 3FJMA 4R2FA 4BDLA 1JEUA 3T22A 2HZLA 3CG1A 2DSFA 2I0BA 3FUZA 1ANFA 3VVDA 1D9VA 3T93B 1UIVA 1MXWA 4F31B 3FVGA 3SEXA 1AL3A 3OSQA 4NF4A 3FVOA 4Q8RA 5LOMA 4GF8A 4N6PA 5TPAB 4GQOA 2I4BA 3ONMA 3C32A 2E1SA 3K4UA 2UYFA 5I57B 4QHQA 4LZ7A 3IO6A 3IOUA 2H4IA 3TCHA 3O97A 3SDFA 3H3GA 2PT1A 4HS7A 4IO2A 4R72A 1UIUA 4RNSA 1I6BA 2QS4A 3VVFA 1LGBC 3MQ9A 3K1NA 4LONB 4LUBA 2QPQA 3WAFA 4NTLA 5FHNA 2PVUA 2OWSA 2DE2A 3MP8A 3MPLA 3U94A 3H03A 3H6TA 4WEPA 4GOTA 5EHSA 2O84X 4YICA 3HCQA 4XIGQ 2I3WA 1JEVA 3OO7A 1B7ZA 3HN0A 3KBRA 3GLBA 1N84A 4GXSB 3IOWA 2IA4A 5TP9A 3MJNA 4HCYA 1DTGA 4JWXA 1HSJA 1MXYA 2Z8DA 4BDRA 3MP6A 4GL0A 3CR9A 1QKBA 4M1VA 2XXHA 3LUYA 5I58B 4H8IA 2QSXA 1XHYA 3T96B 3CIJA 2VOZA 2XX7A 2YJPA 2OZZA 3UIFA 2O6AA 1QUJA 2ZNSA 1B3LA 3LSFB 2Z22A 1SW2A 5KCJB 3MC2A 2Q2AA 3UGWA 3GZGA 4QRZA 3HPIA 1VE4A 3TQLA 2XXIA 3ILTB 3FGSA
chains in the Genus database with same CATH superfamily
2ZYMA 5ESYA 1B2HA 3E78A 3G3GA 4IR8A 3P7IA 1MXXA 1IMEA 3IOTA 2XXRA 2RINA 3C9HA 3FIRA 4ZE9A 3LR1A 1B32A 2UXAA 5AA3A 3VDFA 1J1NA 1LB9A 1YAEA 3O28A 4GX4A 1B5IA 1A8EA 1SW5A 1OQGA 4XKQA 3K2DA 5BUUA 5AE4A 1JETA 4XKNA 2HXWA 3KOSA 3N6TA 4PFTA 1KZ8A 1VFDA 3N5LA 2KQZA 5HPQA 1IIWA 2ZZVA 2G29A 2F5XA 1LBCA 5EYFA 1QULA 3CVGA 3LSWA 3JYRA 4OVTA 3VV5A 1FPLA 1MM6A 3HFUA 4QFNA 3A3CA 4WEDA 2O69A 3S2VA 3LSXA 3ZKLA 2UYEA 3TELA 2OCUA 3PGFA 4GVOA 2REJA 2V3QA 3OXNA 2Q9TA 4RK9A 2WBDA 3HSTA 1URDA 3TKDA 1SPIA 3UN6A 2ZYNA 4GWOA 3TDJA 3B6WA 4IO5A 3I5OA 2YPNA 2B65A 3WAEA 4BDQA 3O2AA 2CZIA 3PUVE 4U4SA 2XWVA 4G8MA 2XXWA 4HE0A 1UTBB 1I69A 1TT1A 1BLFA 3TFLA 1UTHA 2NXOA 3BKIB 4Q0CA 4IO6A 1GGGA 2DWJA 2E0SA 4KYEA 2P1SA 2B4LA 3MVYA 3V89B 4X1BA 2XX9A 2HHMA 2DDKA 3O66A 4MNCA 4AS5A 2F35A 4MIJA 2XHDA 3R26A 4ECFA 2XXYA 4H1XA 3G3IA 3IFCA 4F1VA 2BJJX 3HV1A 5EQAA 1PDAA 1US4A 1IXGA 4PE5B 2FIEA 4NF8B 1MY4A 4DCYA 1MQGA 2NWJA 4EUOA 2Y84A 1VFEA 4PAFA 3PU5A 1R6ZA 4KXPA 2HCAA 5DTBA 4FJPA 3USDA 4QSCA 2ZXTA 5ELVA 2P2AA 4ZEBA 2OX3A 1LAFE 1A7LA 1FTLA 4KHZE 2VPNA 2L5VA 3Q26A 4LVQA 4QFPA 3ZKKA 4LZ5A 3KN7A 1AIVA 1I6AA 4U1OA 3K6VA 5I56A 4NWCA 4LATA 1MQHA 1PB9A 4LQ5A 3MSTA 5I2NA 1EZ9A 2GRVA 1HSEA 4OMBA 1JW5A 1SI0A 3D4CA 4I3YA 5H8FA 4H5FA 2QS3A 2H99A 3A09A 4YAHX 4JVCA 4ZEKA 2CZLA 4LZ8A 4TOZA 2I6EA 5I59B 3K1PA 2H9BA 4O3BA 4NEDA 3RN8A 4YKIA 3E13X 3PTYA 5K2YA 1FTOA 5DVJA 5EQ8A 4GWUA 1QJMA 3PMXA 3MUQA 3V8XB 1LFIA 3S4UA 3PPPA 4NF5A 2D5WA 2ZZWA 3MWBA 2D3IA 3RYDA 2OBGA 3FBPA 1P1WA 1NH8A 3FXBA 2CZKA 3M3FA 1NMUA 1NL5A 1FW0A 5I2KB 2HQ0A 4X48A 1D9QA 4RXLA 4G77A 3MYUA 3EN3A 3TPAA 4RPNA 5IZZA 1MXZA 2UVHA 3CFXA 4N17A 1NUZA 1FPIA 4OEUA 1D4NA 1M5DA 3PMWA 1A99A 4PGNA 2VHAA 4IO3A 4KFQA 3UORA 4R6HA 4OZ9A 2ONRA 5AA2D 3VLVA 1MPDA 3RT8A 3RPWA 4P3LA 3TAJA 4EXKA 2A5SA 1UQWA 3KEIA 2MKZA 1FQCA 5CBSA 3H6VA 2GHAA 3DM0A 2NVUB 2XXQA 1FBEA 2O51A 1RDXA 1P1NA 3U8QA 4AB5A 4RPOA 1FBFA 4P8BA 1DK4A 3AXFA 3W9WA 4MFIA 1FPKA 3BIGA 4GIZA 4BDMA 5CM6A 3PPQA 1S7YA 2D21A 4FAJA 4ESWA 5CBRA 3E79A 3TEPA 4N81A 3VLUA 2ALUA 4XKRA 5AA4A 3IB2A 1B1HA 1B0LA 4JVIA 4PETA 2UVJA 1R1NA 1NV7A 1T0KA 2P3NA 1BK4A 4MNIA 3C33A 3SESA 5FBPA 1FQFA 5F1QA 2XWIA 4C0RA 1AMFA 1AWBA 3MW0A 1NNTA 2QVRA 3JZJA 1JNFA 5ET7A 4U4XA 5IZ3A 1XVYA 3KZGA 3TUSA 4G68A 1IMBA 1LAGE 1ZLQA 1B5HA 1FSAA 4H8JA 1JW4A 3SEVA 4TLLB 1DTZA 2Q89A 1IMCA 1POY1 4R2BA 2XXTA 2ANJA 4HE1A 2HXRA 1SDXA 5J16A 4MX6A 1LB8A 4N6KA 5JTYB 4ESXA 2ZYOA 4R6KA 5DW8A 5KDTB 1O63A 2DWAA 3U72A 1POTA 1H44A 4PFBA 3MBPA 3OO8A 4NF0A 1PB7A 4F22A 2V84A 1FRPA 2PBWA 1DBZA 3D1RA 1Q1KA 1FPGA 3IORA 1CB6A 1II5A 4LQ2A 1QUIA 1RDZA 2W7YA 2F34A 3NOHA 2X7QA 4EQ9A 3FVNA 2DVZA 4QFOA 1CE2A 1D3KA 4ZE8A 2F78A 4DXCA 4PDDA 4ZEDA 4OVRA 4KQPA 1ZKBA 5TPAA 1SW1A 5HM4B 3LUZA 4FIMA 3W9VA 3CG3A 4OENA 5J1DA 2FNCA 3KSJA 4H46A 5JEIA 3MVZA 4TQUQ 3QXMA 5DEXB 2DXYA 3CRBA 5DT6A 4N8YA 1SW4A 3VE1B 4F1UA 3MP1A 1Y3QA 5CI5A 1DMBA 2PYYA 1ATGA 4NE4A 4X9TA 2Y7WA 2QS2A 1B9JA 3FV1A 4N15A 3LSLA 4HXVA 3R6UA 3PPRA 4FE8A 4JDFA 3VXCA 4UABA 2DP8A 1KWHA 1FTMA 1ZIUA 2HPGA 1QKAA 4IY5A 1RYXA 4ZECA 1RKMA 2XD3A 2DWHA 3TTRA 4AQ4A 2UVGA 2F6GA 1Y3PA 2A5TB 2XXXA 4U2RA 5ISUA 5FTHA 4NF6A 2B3FA 4R6YA 2DQVA 4I9DA 5IAIA 3M8UA 2CEXA 3TODA 2R6GE 3K6UA 3O6GA 1FQBA 3UA8A 3RQTA 4GX6A 3FZVA 4N13A 1FJ9A 4GWZA 3RPLB 3U1OA 4F2QA 3G7WA 2Q8MA 1M5EA 3N26A 2Z23A 4ZZAA 4R73A 2QMWA 2I49A 1R9LA 3K6WA 4PF6A 2REGA 2I48A 3MZBA 1YCJA 2I4CA 2RCAA 2VGQA 1SQYA 3OENA 4YU0A 3T1BA 5I58A 4P0GA 2WKYA 2AL5A 5ITOA 1Y4CA 1MS7A 4GXAA 2OWZA 2Y5KA 4P9KA 5H8QA 2ZZXA 4QSEA 3OELA 1IXIA 1NV0A 3T9XB 3OSRA 1L5TA 5KCJA 2HAUA 2RC7A 1YPNA 2DE3A 1H43A 2PFYA 1B7HA 3M3KA 2DOJA 2P0SA 4AB6A 4IGRA 2X26A 4H45A 3F11A 3H6UA 4GLIA 1LBVA 4N91A 5HBCA 4OFJA 5H8HA 4F19A 2PFZA 3BBRA 3MPKA 4OVPA 3N94A 4XKPA 3MVXA 3IFAA 4YKJA 4Q5TA 4ZEFA 1MXVA 1OMPA 2Y5LA 1ZU0A 2Q8JA 1FBHA 4MLVA 1B4HA 3ISPA 1B5JA 4I40A 4PBQA 3ODBA 4OERA 5K2XA 1B51A 5H8SA 5B7DA 4RY1A 1DCUA 4P0IA 4LN5A 3PV0E 4O3AA 3SEWA 4BDOA 1OLCA 3IL1B 4H5GA 2QL3A 5IZ1A 2ESNA 5I84A 3IK6B 3B50A 1URSA 2H98A 1B3HA 2F7AA 4E0WA 4DXBA 3CSGA 4ZEIA 1EYJA 1NV5A 1MRPA 1Y1ZA 1LBBA 1FBGA 3FVKA 5AA2B 5B70A 4R9FA 4GWXA 4MCOA 4K3FA 3PMVA 4ELOA 3U92A 4YB7A 4JB7A 3R7XA 1A40A 3THIA 4BLAA 3FATA 3V83A 2THIA 3CI8A 3CHGA 5H8NA 1KA1A 4H67A 3FJGA 1WDNA 2FIXA 1DOTA 1Y1MA 3QUJA 5L9SA 4XXUA 5I56B 1NV1A 1N3XA 5LDZA 4OFLA 4ELPA 3Q27A 1H3DA 2XXUA 2NOOA 1EYKA 4P11A 1JW1A 3E3KA 3KC0A 1LAXA 4MNPA 3JV9A 1XI6A 3D4GA 3PD9A 2F8DA 5CMCA 1LCFA 1P1QA 1Y20A 4JSOA 1A55A 2XA5A 3VXBA 4JWOA 4M4GA 4C1TA 4X1DA 1LBZA 3DP8A 1YTVA 1JP4A 4X04A 3U65A 4NF8A 1IQ7A 1GTKA 1BP5A 2WBBA 5I7IA 1MY2A 3PPNA 1MY1A 3HO7A 3K0VA 3KC1A 3SETA 1Q35A 3G3KA 4DI4B 5F24A 1S50A 4GWWA 1GVCA 2F7BA 3LC8A 3O6IA 3OO6A 1N0TA 3IB1A 5A5LA 2FVZA 1ZBMA 1KA0A 3FXUA 4PF8A 2DXRA 2H25A 3U93A 1BKAA 4E0XA 3TTMA 3FXQA 3KSXA 3IR1A 1B4ZA 1PBPA 1YZ0A 3TTNA 2GH9A 3EHUA 2QRYA 3RTFB 3IO4A 2YLNA 1XS5A 4DDDA 3GBAA 1MH4A 4GWSA 5T3JA 3B7DA 1QW0A 3EPEA 3H7MA 4NX1A 1B05A 1USYH 3FJ7A 2R8TA 2QS1A 5FHMA 1EYIA 4NG7A 1GV8A 5I59A 3OO9A 1ZTYA 2HFBA 1B3FA 4OANA 3H6WA 2V4CA 3ZS6A 1PB8A 3H4ZA 3PUWE 1G0HA 1R9QA 2V3UA 5AA4B 2DS9A 3GBBA 1LBWA 4ND9A 3OMBA 1S9TA 4KD5A 2Y7IA 5F7VA 3QIMA 1WVJA 5I2KA 2VD3A 2Y7PA 3E4RA 1LLSA 1SYIA 4NQ8A 4EQBA 4F1YA 1Y3NA 2RKMA 3EKIA 4KI0E 4YB6A 1IITA 1XOCA 3Q28A 3T66A 1IMFA 1A8FA 5IZ3B 4XEQA 4OVQA 5JK4A 4ELRA 4C1UA 3ROJA 4EQ7A 3EF7A 1B3EA 4YB5A 3RNNA 5IGAA 5L9OA 3GXAA 4G61A 1K9ZA 3CFLA 1D9YA 2AYSA 4HE2A 4NF4B 1EH3A 3C35A 4I3EA 3C4MA 3B6TA 1MG1A 4MBPA 2GHBA 1MDP1 1SBPA 3IJOB 1B58A 2WEFA 3QYTA 1MQIA 4YMBA 1Y9UA 2Q88A 3RUMA 5A5XA 2AL4A 4OXVA 1LEVA 1LSTA 3MVWA 1Y4TA 3A3UA 4FECA 3K02A 2V3TA 4OESA 3I3VA 3RGYA 1FBPA 2F36A 2RF1A 4GWYA 5ICQA 3OOAA 4F3PA 1A54A 4YKPA 4YZZA 2AIXA 4G8NA 1IUDA 3TTKA 1SYHA 1HSLA 1VSOA 2CZHA 4R9GA 3Q25A 1QGXA 2Z8FA 4MHFA 2WYPA 1M5BA 3MZ1A 3E9XA 3V5AA 4TLMB 2PT2A 4OVJA 3QAXA 3IJXB 3TTLA 2OK2A 3HHFA 4G4PA 1EZPA 1FQDA 4KR5A 4NGUA 1BIYA 5TP9B 1OVTA 4IO4A 1Z7ME 1QUKA 5JTYA 4XFEA 4PAIA 1G0IA 4H0WA 5KDTA 3OD7A 5DVIA 4RJZA 1B6HA 1LFGA 1B3GA 5DVFA 2QJEA 4EF1A 4OWDA 1FJ6A 4GFRA 4YKKA 5FHOA 3FXRA 5I57A 1TFDA 1N7XA 3B6QA 1FBCA 3S9EA 4JBZA 2P3VA 4NWDA 1B52A 4EDPA 4MH5A 5ICTA 4NF6B 4U1ZA 5EYGA 3C31A 2QFLA 1FQAA 5CMBA 3FV2A 3EQ1A 1XVXA 1OVBA 5I3SA 4PCDA 4OFOA 4PC9A 3TCFA 2R9JA 4DXUA 4GBVA 4PQJA 3K6XA 3LBSA 1DPPA 3S9NC 5DYHA 4FATA 2ABHA 3PUYE 3QK6A 4NAPA 2FA7A 1I6QA 2OWTA 3KJTA 2DVCA 4OA4A 4OHNA 1LCTA 4G8HA 1OLAA 4ONYA 3VLWA 3H06B 3G3HA 1ELJA 5DEXA 4N4UA 1NKXA 2PCRA 1OIBA 1EZOA 3PPOA 3O29A 3SERA 1FPFA 4GBWA 1NNFA 2IEEA 5CC2A 4G68C 4GL8A 5H8QB 3A29A 1LAHE 3BFTA 5AA1A 3S9LC 1VDWA 3SEYA 1H45A 1FPBA 3TZAA 2O68A 2PX1A 4DCXA 1N3WA 2O7UA 4JWYA 4ISUA 4MMPA 4N6DA 4U22A 2XXPA 3G3FA 1NI9A 4N07A 1AOVA 3KFMA 4IB2A 4RYAA 3SEUA 2KLFA 1PBQA 2XWKA 3EHTA 3I6VA 4R75A 3N6UA 1XC1A 3OEKA 5H8HB 3K00A 1FCKA 2A5TA 2F97A 1NNKA 4PDHA 1TXFA 2VT5A 3FASA 1MQJA 3ZSFA 1EU8A 3IX1A 1O7TA 4HTGA 1LBXA 2HZKA 3PUZE 2QMXA 4EXLA 5IM2A 1TFAA 5BWJA 4KYDA 3RPLA 2V93A 4JSDA 5ET6A 2DE4A 3O9PA 3ECRA 2F7CA 4KPTA 1NUXA 1B40A 2O7IA 3RLFE 5ET5A 3KG2A 3KGCA 2XXVA 1B7UA 2Y7RA 4NHBA 1FTJA 1H76A 1N04A 2OJTA 4R74A 5EYHA 3PD8A 1FTKA 4QBAA 1XT8A 1UTHB 1RYOA 4IO7A 4KCCA 5EQ7A 4OTEA 1QVSA 2Z8EA 3KN3A 2DYXA 1URGA 4DIGA 4FORA 1MPCA 3T9UA 3MAMA 1VR5A 2PMSA 4RA1A 4ELQA 4F39A 2ZYKA 5ET8A 4O8MA 4OYVA 2B3BA 3L6HA 3KOTA 4PBHA 5H8NB 4FEBA 2H5YA 1IMAA 1US5A 2KR0A 4P47A 1LBYA 1IZ1A 4WKMA 4PP0A 2M8CA 3VFJA 1IXCA 4PFUA 3PUXE 2XD2A 1M5FA 2GFEA 4DZ1A 1JVYA 2HEUA 1WODA 2I58A 4I8CA 2VP1A 1OQHA 4XTCQ 3DP4A 4QFLA 3S9MC 4I62A 5EHMA 3T9VA 3ILUB 2F3DA 2Q74A 4ZS9A 1IEJA 2G93A 1K9YA 3C34A 5I2NB 1YXIA 2VD2A 1UTBA 3DLNA 5EQ9A 1BTJA 2BJIA 1NV3A 5H8FB 3K1MA 4KYSA 2I0CA 4H6DA 3SZPA 2ZNTA 4F29A 1MH3A 5AA2A 4DLDA 4JXIA 1SVXB 3Q29A 5L8DA 5FTIA 2RC8A 3QSLA 2DWIA 4H65A 3IAZA 4JVDA 4NN3A 3TCGA 1B1XA 2X7PA 1MDQA 1M5CA 4LP2B 1FPEA 2R71A 4GD5A 4N8GA 3MZ9A 3RT6B 4PFYA 3DELB 4L17A 2O1LA 4IY6A 4IGTA 4NF5B 1NH7A 4EF2A 2XX8A 1Q9DA 1NV4A 4FBPA 1MXUA 4OEVA 1Z7NE 3KN8A 2QVUA 4POXA 5CMKA 3L6GA 4P1EA 4O7MA 4NMYA 4F2OA 3UP9A 1FQEA 2JJKA 3QUFA 1P99A 4RK2A 3KJ7A 4GX3A 3UK4A 4ZDMA 1IXHA 3W15C 1MPBA 2ONKE 1O64A 2O1MA 5ITPA 4BDNA 1FBDA 1B46A 3HHGA 3TMGA 2CMOA 5CMMA 1DSNA 4O3CA 4F18A 3KBZA 3DP6A 4QSDA 3VVEA 4THIA 2VPOA 4QXDA 3TQWA 2F6PA 2QVVA 3IOVA 3C36A 1ZMGA 2I3VA 2XXKA 3SKPA 3RTWB 4ZZEA 2NUVA 4OVSA 4HW8A 2WYKA 3M3LA 4I1DA 1YYZA 4DE8A 1RDYA 5IKBA 4G2ZA 4MLQA 3EHSA 1P1UA 2ZNUA 1N76A 3TYHA 2Y7KA 1JQFA 3RY3A 4KCDA 1LFHA 1N7WA 1PC3A 1TWYA 4Z7EA 4QF9A 1PEBA 5L9MA 3OEMA 2RCBA 1NFTA 1ZJLA 3CFZA 1JVXA 5CRYA 4Z0IA 1MY3A 4YMAA 1F9BA 1DPEA 4PFIA 4U23A 2RC9A 4PFWA 4GRKA 3BFUA 4O94A 4MJOA 4F3BA 4Q30B 4HCWA 4POWA 1MM7A 1MQDA 3CSBA 2GQ1A 2HAVA 4WXJA 4OQOA 1B0HA 2OLBA 3K01A 1MY0A 4MF3A 4FEDA 2ZMBA 4U21A 2Q2CA 4G68B 5KZTA 4OETA 4QFKA 2XWOA 5A5XB 1USYE 3FD3A 2UVIA 2FYIA 4MEVA 4UA8A 4UACA 1P1OA 4PAKA 1GR2A 4F3GA 5TU0A 5M2VA 1SI1A 3T9HB 3LV0A 2LAOA 3BIHA 4LA9A 1NNPA 4F3SA 3O6HA 1SD3A 3G3JA 2ONSA 1AH5A 3IB0A 2V25A 3FJMA 4R2FA 4BDLA 1JEUA 3T22A 4AS4A 2HZLA 3CG1A 2DSFA 1CNQA 2I0BA 3FUZA 1INPA 1ANFA 2FBPA 3VVDA 1D9VA 3T93B 1UIVA 1MXWA 1IMDA 4F31B 3FVGA 3SEXA 1AL3A 3OSQA 1FPJA 4NF4A 4O7IA 3FVOA 3QMFA 4Q8RA 5LOMA 4GF8A 4N6PA 2F3BA 4XF5A 5TPAB 3GYYA 4GQOA 2I4BA 3ONMA 3C32A 4MAGA 2E1SA 1FTAA 3K4UA 5I5PA 1NUWA 2UYFA 5I57B 4QHQA 4LZ7A 3IO6A 3IOUA 2B4MA 4DI3D 2H4IA 3TCHA 3O97A 3SDFA 3H3GA 2PT1A 4HS7A 4IO2A 4R72A 4PGPA 1UIUA 4RNSA 1I6BA 1NUYA 2QS4A 3VVFA 1LGBC 3T0JA 3MQ9A 3K1NA 4LONB 3B8BA 4LUBA 4PFRA 2QPQA 3WAFA 4NTLA 5FHNA 2PVUA 1NV6A 2OWSA 4P56A 2DE2A 3MP8A 3MPLA 3U94A 3H03A 3H6TA 4WEPA 4GOTA 5EHSA 2O84X 4YICA 1FPDA 3HCQA 4XIGQ 2I3WA 1JEVA 3OO7A 1B7ZA 3HN0A 4PTKA 3KBRA 3GLBA 1N84A 4X8RA 4GXSB 3IOWA 4P1LA 2IA4A 2CEYA 5TP9A 3MJNA 4HCYA 4PE3A 1DTGA 4JWXA 1HSJA 1MXYA 2Z8DA 4BDRA 3MP6A 4GL0A 3CR9A 1QKBA 4M1VA 2XXHA 3LUYA 5I58B 4H8IA 2QSXA 1XHYA 3T96B 3CIJA 2VOZA 2XX7A 2YJPA 2OZZA 3UIFA 2WX9A 2O6AA 1QUJA 2ZNSA 1B3LA 2FHYA 3LSFB 2Z22A 1SW2A 5KCJB 5LTCA 3MC2A 2Q2AA 3UGWA 1NV2A 3GZGA 4QRZA 3HPIA 1VE4A 3TQLA 2XXIA 3ILTB 3FGSA
chains in the Genus database with same CATH topology
2ZYMA 1B2HA 3G3GA 3P7IA 1MXXA 3IOTA 2XXRA 2RINA 3C9HA 3FIRA 4ZE9A 3LR1A 1B32A 2UXAA 5AA3A 3VDFA 1J1NA 1LB9A 1YAEA 3O28A 1A8EA 1B5IA 1SW5A 1OQGA 4XKQA 3K2DA 5BUUA 5AE4A 1JETA 4XKNA 2HXWA 3KOSA 3N6TA 4PFTA 1VFDA 3N5LA 5HPQA 1IIWA 2G29A 2F5XA 1LBCA 5EYFA 1QULA 3CVGA 3LSWA 3JYRA 3VV5A 1MM6A 4QFNA 3A3CA 4WEDA 2O69A 3S2VA 3LSXA 3ZKLA 2UYEA 3TELA 2OCUA 3PGFA 4GVOA 2REJA 2V3QA 3OXNA 2Q9TA 4RK9A 3HSTA 1URDA 3TKDA 3UN6A 2ZYNA 4GWOA 3TDJA 3B6WA 4IO5A 3I5OA 2YPNA 2B65A 3WAEA 4BDQA 3O2AA 3PUVE 4U4SA 4G8MA 2XXWA 1UTBB 1I69A 1TT1A 1BLFA 3TFLA 1UTHA 2NXOA 3BKIB 4Q0CA 4IO6A 1GGGA 2DWJA 2E0SA 4KYEA 2P1SA 3MVYA 3V89B 4X1BA 2XX9A 3O66A 2F35A 2XHDA 3R26A 4ECFA 2XXYA 4H1XA 3G3IA 4F1VA 2BJJX 3HV1A 1PDAA 1US4A 1IXGA 4PE5B 4NF8B 1MY4A 4DCYA 1MQGA 2NWJA 4EUOA 2Y84A 1VFEA 3PU5A 1R6ZA 2HCAA 5DTBA 4FJPA 3USDA 4QSCA 2ZXTA 5ELVA 2P2AA 4ZEBA 1LAFE 1A7LA 1FTLA 4KHZE 3Q26A 4LVQA 4QFPA 3ZKKA 4LZ5A 3KN7A 1AIVA 1I6AA 4U1OA 3K6VA 5I56A 4NWCA 4LATA 1MQHA 1PB9A 4LQ5A 5I2NA 1EZ9A 2GRVA 1HSEA 4OMBA 1JW5A 1SI0A 3D4CA 5H8FA 4H5FA 2QS3A 2H99A 3A09A 4YAHX 4ZEKA 2CZLA 4LZ8A 4TOZA 2I6EA 5I59B 3K1PA 2H9BA 4O3BA 4NEDA 3RN8A 4YKIA 3E13X 5K2YA 1FTOA 5DVJA 1QJMA 3PMXA 3MUQA 3V8XB 1LFIA 3S4UA 3PPPA 4NF5A 2D5WA 3MWBA 2D3IA 2OBGA 1P1WA 1NH8A 3M3FA 1NMUA 1NL5A 1FW0A 5I2KB 2HQ0A 4X48A 4RXLA 4G77A 3EN3A 3TPAA 4RPNA 1MXZA 2UVHA 3CFXA 4OEUA 1D4NA 1M5DA 3PMWA 1A99A 2VHAA 4IO3A 4KFQA 3UORA 4R6HA 4OZ9A 2ONRA 5AA2D 3VLVA 1MPDA 3RT8A 3RPWA 3TAJA 4EXKA 2A5SA 1UQWA 3KEIA 1FQCA 5CBSA 3H6VA 2GHAA 3DM0A 2NVUB 2XXQA 2O51A 1P1NA 3U8QA 4AB5A 4RPOA 3AXFA 3W9WA 4MFIA 4GIZA 4BDMA 5CM6A 3PPQA 1S7YA 2D21A 4FAJA 4ESWA 5CBRA 3TEPA 3VLUA 2ALUA 4XKRA 5AA4A 3IB2A 1B1HA 1B0LA 4PETA 2UVJA 1R1NA 1T0KA 3C33A 3SESA 1FQFA 5F1QA 4C0RA 1AMFA 3MW0A 1NNTA 3JZJA 1JNFA 4U4XA 1XVYA 3KZGA 3TUSA 4G68A 1LAGE 1ZLQA 1B5HA 4H8JA 1JW4A 3SEVA 4TLLB 1DTZA 2Q89A 1POY1 4R2BA 2XXTA 2ANJA 1SDXA 1LB8A 5JTYB 4ESXA 2ZYOA 4R6KA 5KDTB 1O63A 2DWAA 3U72A 1POTA 1H44A 3MBPA 3OO8A 1PB7A 4F22A 2V84A 2PBWA 1Q1KA 3IORA 1CB6A 1II5A 4LQ2A 1QUIA 2W7YA 2F34A 2X7QA 4EQ9A 3FVNA 2DVZA 4QFOA 1CE2A 1D3KA 4ZE8A 2F78A 4DXCA 4ZEDA 4KQPA 1ZKBA 5TPAA 1SW1A 5HM4B 4FIMA 3W9VA 3CG3A 4OENA 5J1DA 2FNCA 3KSJA 5JEIA 3MVZA 4TQUQ 3QXMA 5DEXB 2DXYA 3CRBA 5DT6A 1SW4A 3VE1B 4F1UA 3MP1A 1Y3QA 5CI5A 1DMBA 2PYYA 1ATGA 4NE4A 4X9TA 2Y7WA 2QS2A 1B9JA 3FV1A 3LSLA 3R6UA 3PPRA 4FE8A 4JDFA 3VXCA 2DP8A 1KWHA 1FTMA 1ZIUA 1QKAA 4IY5A 1RYXA 4ZECA 1RKMA 2XD3A 2DWHA 3TTRA 4AQ4A 2UVGA 2F6GA 1Y3PA 2A5TB 2XXXA 4U2RA 5ISUA 5FTHA 4NF6A 2B3FA 4R6YA 2DQVA 4I9DA 5IAIA 3M8UA 3TODA 2R6GE 3K6UA 3O6GA 1FQBA 3UA8A 3RQTA 3FZVA 4N13A 3U1OA 4F2QA 3G7WA 1M5EA 3N26A 2Z23A 4ZZAA 4R73A 2QMWA 2I49A 1R9LA 3K6WA 2REGA 2I48A 3MZBA 1YCJA 2I4CA 2RCAA 2VGQA 1SQYA 3OENA 4YU0A 5I58A 4P0GA 2WKYA 2AL5A 5ITOA 1Y4CA 1MS7A 4GXAA 5H8QA 4QSEA 3OELA 1IXIA 3T9XB 3OSRA 1L5TA 5KCJA 2HAUA 2RC7A 1YPNA 2DE3A 1H43A 1B7HA 3M3KA 2DOJA 2P0SA 4AB6A 4IGRA 2X26A 3F11A 3H6UA 4GLIA 5HBCA 4OFJA 5H8HA 4F19A 3BBRA 3MPKA 3N94A 4XKPA 3MVXA 4YKJA 4Q5TA 4ZEFA 1MXVA 1OMPA 1ZU0A 2Q8JA 4MLVA 1B4HA 1B5JA 3ODBA 4OERA 5K2XA 1B51A 5H8SA 5B7DA 4RY1A 4P0IA 3PV0E 4O3AA 3SEWA 4BDOA 1OLCA 3IL1B 4H5GA 2QL3A 2ESNA 5I84A 3IK6B 1URSA 2H98A 1B3HA 2F7AA 4E0WA 4DXBA 3CSGA 4ZEIA 1MRPA 1Y1ZA 1LBBA 3FVKA 5AA2B 5B70A 4R9FA 4K3FA 3PMVA 4ELOA 3U92A 4YB7A 4JB7A 3R7XA 1A40A 3THIA 4BLAA 3FATA 3V83A 2THIA 3CI8A 5H8NA 4H67A 3FJGA 1WDNA 1DOTA 1Y1MA 3QUJA 5L9SA 4XXUA 5I56B 1N3XA 4OFLA 4ELPA 3Q27A 1H3DA 2XXUA 2NOOA 4P11A 1JW1A 3E3KA 1LAXA 3JV9A 3D4GA 3PD9A 2F8DA 5CMCA 1LCFA 1P1QA 1Y20A 4JSOA 1A55A 3VXBA 4JWOA 4M4GA 4C1TA 4X1DA 3DP8A 1YTVA 4NF8A 1IQ7A 1GTKA 1BP5A 1MY2A 3PPNA 1MY1A 3HO7A 3K0VA 3SETA 1Q35A 3G3KA 1S50A 1GVCA 2F7BA 3LC8A 3O6IA 3OO6A 1N0TA 3IB1A 1ZBMA 3FXUA 2DXRA 2H25A 3U93A 1BKAA 4E0XA 3TTMA 3FXQA 3KSXA 3IR1A 1B4ZA 1PBPA 3TTNA 2GH9A 3EHUA 2QRYA 3RTFB 3IO4A 2YLNA 1XS5A 4DDDA 3GBAA 1MH4A 3B7DA 1QW0A 3EPEA 3H7MA 1B05A 1USYH 3FJ7A 2QS1A 5FHMA 1GV8A 5I59A 3OO9A 1ZTYA 2HFBA 1B3FA 3H6WA 3ZS6A 1PB8A 3H4ZA 3PUWE 1R9QA 2V3UA 5AA4B 2DS9A 3GBBA 4ND9A 3OMBA 1S9TA 4KD5A 2Y7IA 5F7VA 3QIMA 1WVJA 5I2KA 2VD3A 2Y7PA 3E4RA 1LLSA 1SYIA 4EQBA 4F1YA 1Y3NA 2RKMA 4KI0E 4YB6A 1IITA 1XOCA 3Q28A 3T66A 1A8FA 5JK4A 4ELRA 4C1UA 4EQ7A 3EF7A 1B3EA 4YB5A 3RNNA 5L9OA 3GXAA 3CFLA 1D9YA 2AYSA 4NF4B 1EH3A 3C35A 3C4MA 3B6TA 1MG1A 4MBPA 2GHBA 1MDP1 1SBPA 3IJOB 1B58A 3QYTA 1MQIA 4YMBA 1Y9UA 2Q88A 3RUMA 5A5XA 2AL4A 4OXVA 1LSTA 3MVWA 1Y4TA 3A3UA 4FECA 3K02A 2V3TA 4OESA 3I3VA 3RGYA 2F36A 2RF1A 5ICQA 3OOAA 4F3PA 1A54A 4YKPA 4YZZA 2AIXA 4G8NA 1IUDA 3TTKA 1SYHA 1HSLA 1VSOA 4R9GA 3Q25A 2Z8FA 1M5BA 3MZ1A 3E9XA 3V5AA 4TLMB 2PT2A 4OVJA 3QAXA 3IJXB 3TTLA 2OK2A 3HHFA 4G4PA 1EZPA 1FQDA 4KR5A 1BIYA 5TP9B 1OVTA 4IO4A 1Z7ME 1QUKA 5JTYA 4H0WA 5KDTA 3OD7A 5DVIA 4RJZA 1B6HA 1LFGA 1B3GA 5DVFA 2QJEA 4EF1A 4OWDA 4YKKA 4GFRA 5FHOA 3FXRA 5I57A 1TFDA 1N7XA 3B6QA 3S9EA 4JBZA 4NWDA 1B52A 4EDPA 4MH5A 5ICTA 4NF6B 4U1ZA 3C31A 1FQAA 5CMBA 3FV2A 3EQ1A 1XVXA 1OVBA 4OFOA 3TCFA 2R9JA 4DXUA 4PQJA 3K6XA 3LBSA 1DPPA 3S9NC 5DYHA 4FATA 2ABHA 3PUYE 3QK6A 2FA7A 1I6QA 2OWTA 3KJTA 2DVCA 4OHNA 1LCTA 4G8HA 1OLAA 4ONYA 3VLWA 3H06B 3G3HA 1ELJA 5DEXA 1NKXA 1OIBA 1EZOA 3PPOA 3O29A 3SERA 1NNFA 2IEEA 5CC2A 4G68C 4GL8A 5H8QB 1LAHE 3BFTA 5AA1A 3S9LC 3SEYA 1H45A 3TZAA 2O68A 2PX1A 4DCXA 1N3WA 2O7UA 4JWYA 4ISUA 4U22A 2XXPA 3G3FA 4N07A 1AOVA 3KFMA 4IB2A 4RYAA 3SEUA 2KLFA 1PBQA 3EHTA 3I6VA 4R75A 3N6UA 1XC1A 3OEKA 5H8HB 3K00A 1FCKA 2A5TA 2F97A 1NNKA 1TXFA 3FASA 1MQJA 3ZSFA 1EU8A 3IX1A 1O7TA 4HTGA 2HZKA 3PUZE 2QMXA 4EXLA 1TFAA 5BWJA 4KYDA 2V93A 4JSDA 2DE4A 3O9PA 3ECRA 2F7CA 4KPTA 1B40A 2O7IA 3RLFE 3KG2A 3KGCA 2XXVA 1B7UA 2Y7RA 1FTJA 1H76A 1N04A 2OJTA 4R74A 3PD8A 1FTKA 1XT8A 1UTHB 1RYOA 4IO7A 4KCCA 4OTEA 1QVSA 2Z8EA 3KN3A 2DYXA 1URGA 4DIGA 4FORA 1MPCA 3T9UA 3MAMA 1VR5A 2PMSA 4RA1A 4ELQA 4F39A 2ZYKA 4OYVA 2B3BA 3L6HA 3KOTA 5H8NB 4FEBA 2H5YA 1US5A 1IZ1A 4WKMA 4PP0A 2M8CA 3VFJA 1IXCA 4PFUA 3PUXE 2XD2A 1M5FA 2GFEA 4DZ1A 1JVYA 2HEUA 1WODA 2I58A 4I8CA 2VP1A 1OQHA 4XTCQ 3DP4A 4QFLA 3S9MC 4I62A 5EHMA 3T9VA 3ILUB 4ZS9A 1IEJA 2G93A 3C34A 5I2NB 2VD2A 1UTBA 3DLNA 1BTJA 5H8FB 3K1MA 4KYSA 2I0CA 4H6DA 2ZNTA 4F29A 1MH3A 5AA2A 4DLDA 4JXIA 1SVXB 3Q29A 5L8DA 5FTIA 2RC8A 3QSLA 2DWIA 4H65A 3IAZA 3TCGA 1B1XA 2X7PA 1MDQA 1M5CA 4LP2B 2R71A 4GD5A 3MZ9A 3RT6B 4PFYA 3DELB 4L17A 2O1LA 4IY6A 4IGTA 4NF5B 1NH7A 4EF2A 2XX8A 1MXUA 4OEVA 1Z7NE 3KN8A 4POXA 5CMKA 3L6GA 4NMYA 4F2OA 3UP9A 1FQEA 3QUFA 1P99A 4RK2A 3KJ7A 3UK4A 4ZDMA 1IXHA 3W15C 1MPBA 2ONKE 1O64A 2O1MA 5ITPA 4BDNA 1B46A 3HHGA 3TMGA 2CMOA 5CMMA 1DSNA 4O3CA 4F18A 3DP6A 4QSDA 3VVEA 4THIA 3TQWA 2F6PA 3IOVA 3C36A 1ZMGA 2I3VA 3SKPA 3RTWB 4ZZEA 2NUVA 4HW8A 3M3LA 4I1DA 4DE8A 5IKBA 4G2ZA 4MLQA 3EHSA 1P1UA 2ZNUA 1N76A 3TYHA 2Y7KA 1JQFA 3RY3A 4KCDA 1LFHA 1N7WA 1PC3A 1TWYA 4Z7EA 4QF9A 1PEBA 5L9MA 3OEMA 2RCBA 1NFTA 1ZJLA 3CFZA 1JVXA 5CRYA 4Z0IA 1MY3A 4YMAA 1F9BA 1DPEA 4U23A 2RC9A 4PFWA 4GRKA 3BFUA 4F3BA 4Q30B 4HCWA 4POWA 1MM7A 1MQDA 3CSBA 2HAVA 4WXJA 4OQOA 1B0HA 2OLBA 3K01A 1MY0A 4MF3A 4FEDA 2ZMBA 4U21A 2Q2CA 4G68B 5KZTA 4OETA 4QFKA 5A5XB 1USYE 3FD3A 2UVIA 2FYIA 4UA8A 4UACA 1P1OA 1GR2A 4F3GA 5TU0A 5M2VA 1SI1A 3T9HB 2LAOA 4LA9A 1NNPA 4F3SA 3O6HA 1SD3A 3G3JA 2ONSA 1AH5A 3IB0A 2V25A 3FJMA 4R2FA 4BDLA 1JEUA 3T22A 2HZLA 3CG1A 2DSFA 2I0BA 3FUZA 1ANFA 3VVDA 1D9VA 3T93B 1UIVA 1MXWA 4F31B 3FVGA 3SEXA 1AL3A 3OSQA 4NF4A 3FVOA 4Q8RA 5LOMA 4GF8A 4N6PA 5TPAB 4GQOA 2I4BA 3ONMA 3C32A 2E1SA 3K4UA 2UYFA 5I57B 4QHQA 4LZ7A 3IO6A 3IOUA 2H4IA 3TCHA 3O97A 3SDFA 3H3GA 2PT1A 4HS7A 4IO2A 4R72A 1UIUA 4RNSA 1I6BA 2QS4A 3VVFA 1LGBC 3MQ9A 3K1NA 4LONB 4LUBA 2QPQA 3WAFA 4NTLA 5FHNA 2PVUA 2OWSA 2DE2A 3MP8A 3MPLA 3U94A 3H03A 3H6TA 4WEPA 4GOTA 5EHSA 2O84X 4YICA 3HCQA 4XIGQ 2I3WA 1JEVA 3OO7A 1B7ZA 3HN0A 3KBRA 3GLBA 1N84A 4GXSB 3IOWA 2IA4A 5TP9A 3MJNA 4HCYA 1DTGA 4JWXA 1HSJA 1MXYA 2Z8DA 4BDRA 3MP6A 4GL0A 3CR9A 1QKBA 4M1VA 2XXHA 3LUYA 5I58B 4H8IA 2QSXA 1XHYA 3T96B 3CIJA 2VOZA 2XX7A 2YJPA 2OZZA 3UIFA 2O6AA 1QUJA 2ZNSA 1B3LA 3LSFB 2Z22A 1SW2A 5KCJB 3MC2A 2Q2AA 3UGWA 3GZGA 4QRZA 3HPIA 1VE4A 3TQLA 2XXIA 3ILTB 3FGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZYM A;  1B2H A;  3G3G A;  3P7I A;  1MXX A;  3IOT A;  2XXR A;  2RIN A;  3C9H A;  3FIR A;  4ZE9 A;  3LR1 A;  1B32 A;  2UXA A;  5AA3 A;  3VDF A;  1J1N A;  1LB9 A;  1YAE A;  3O28 A;  1A8E A;  1B5I A;  1SW5 A;  1OQG A;  4XKQ A;  3K2D A;  5BUU A;  5AE4 A;  1JET A;  4XKN A;  2HXW A;  3KOS A;  3N6T A;  4PFT A;  1VFD A;  3N5L A;  5HPQ A;  1IIW A;  2G29 A;  2F5X A;  1LBC A;  5EYF A;  1QUL A;  3CVG A;  3LSW A;  3JYR A;  3VV5 A;  1MM6 A;  4QFN A;  3A3C A;  4WED A;  2O69 A;  3S2V A;  3LSX A;  3ZKL A;  2UYE A;  3TEL A;  2OCU A;  3PGF A;  4GVO A;  2REJ A;  2V3Q A;  3OXN A;  2Q9T A;  4RK9 A;  3HST A;  1URD A;  3TKD A;  3UN6 A;  2ZYN A;  4GWO A;  3TDJ A;  3B6W A;  4IO5 A;  3I5O A;  2YPN A;  2B65 A;  3WAE A;  4BDQ A;  3O2A A;  3PUV E;  4U4S A;  4G8M A;  2XXW A;  1UTB B;  1I69 A;  1TT1 A;  1BLF A;  3TFL A;  1UTH A;  2NXO A;  3BKI B;  4Q0C A;  4IO6 A;  1GGG A;  2DWJ A;  2E0S A;  4KYE A;  2P1S A;  3MVY A;  3V89 B;  4X1B A;  2XX9 A;  3O66 A;  2F35 A;  2XHD A;  3R26 A;  4ECF A;  2XXY A;  4H1X A;  3G3I A;  4F1V A;  2BJJ X;  3HV1 A;  1PDA A;  1US4 A;  1IXG A;  4PE5 B;  4NF8 B;  1MY4 A;  4DCY A;  1MQG A;  2NWJ A;  4EUO A;  2Y84 A;  1VFE A;  3PU5 A;  1R6Z A;  2HCA A;  5DTB A;  4FJP A;  3USD A;  4QSC A;  2ZXT A;  5ELV A;  2P2A A;  4ZEB A;  1LAF E;  1A7L A;  1FTL A;  4KHZ E;  3Q26 A;  4LVQ A;  4QFP A;  3ZKK A;  4LZ5 A;  3KN7 A;  1AIV A;  1I6A A;  4U1O A;  3K6V A;  5I56 A;  4NWC A;  4LAT A;  1MQH A;  1PB9 A;  4LQ5 A;  5I2N A;  1EZ9 A;  2GRV A;  1HSE A;  4OMB A;  1JW5 A;  1SI0 A;  3D4C A;  5H8F A;  4H5F A;  2QS3 A;  2H99 A;  3A09 A;  4YAH X;  4ZEK A;  2CZL A;  4LZ8 A;  4TOZ A;  2I6E A;  5I59 B;  3K1P A;  2H9B A;  4O3B A;  4NED A;  3RN8 A;  4YKI A;  3E13 X;  5K2Y A;  1FTO A;  5DVJ A;  1QJM A;  3PMX A;  3MUQ A;  3V8X B;  1LFI A;  3S4U A;  3PPP A;  4NF5 A;  2D5W A;  3MWB A;  2D3I A;  2OBG A;  1P1W A;  1NH8 A;  3M3F A;  1NMU A;  1NL5 A;  1FW0 A;  5I2K B;  2HQ0 A;  4X48 A;  4RXL A;  4G77 A;  3EN3 A;  3TPA A;  4RPN A;  1MXZ A;  2UVH A;  3CFX A;  4OEU A;  1D4N A;  1M5D A;  3PMW A;  1A99 A;  2VHA A;  4IO3 A;  4KFQ A;  3UOR A;  4R6H A;  4OZ9 A;  2ONR A;  5AA2 D;  3VLV A;  1MPD A;  3RT8 A;  3RPW A;  3TAJ A;  4EXK A;  2A5S A;  1UQW A;  3KEI A;  1FQC A;  5CBS A;  3H6V A;  2GHA A;  3DM0 A;  2NVU B;  2XXQ A;  2O51 A;  1P1N A;  3U8Q A;  4AB5 A;  4RPO A;  3AXF A;  3W9W A;  4MFI A;  4GIZ A;  4BDM A;  5CM6 A;  3PPQ A;  1S7Y A;  2D21 A;  4FAJ A;  4ESW A;  5CBR A;  3TEP A;  3VLU A;  2ALU A;  4XKR A;  5AA4 A;  3IB2 A;  1B1H A;  1B0L A;  4PET A;  2UVJ A;  1R1N A;  1T0K A;  3C33 A;  3SES A;  1FQF A;  5F1Q A;  4C0R A;  1AMF A;  3MW0 A;  1NNT A;  3JZJ A;  1JNF A;  4U4X A;  1XVY A;  3KZG A;  3TUS A;  4G68 A;  1LAG E;  1ZLQ A;  1B5H A;  4H8J A;  1JW4 A;  3SEV A;  4TLL B;  1DTZ A;  2Q89 A;  1POY 1;  4R2B A;  2XXT A;  2ANJ A;  1SDX A;  1LB8 A;  5JTY B;  4ESX A;  2ZYO A;  4R6K A;  5KDT B;  1O63 A;  2DWA A;  3U72 A;  1POT A;  1H44 A;  3MBP A;  3OO8 A;  1PB7 A;  4F22 A;  2V84 A;  2PBW A;  1Q1K A;  3IOR A;  1CB6 A;  1II5 A;  4LQ2 A;  1QUI A;  2W7Y A;  2F34 A;  2X7Q A;  4EQ9 A;  3FVN A;  2DVZ A;  4QFO A;  1CE2 A;  1D3K A;  4ZE8 A;  2F78 A;  4DXC A;  4ZED A;  4KQP A;  1ZKB A;  5TPA A;  1SW1 A;  5HM4 B;  4FIM A;  3W9V A;  3CG3 A;  4OEN A;  5J1D A;  2FNC A;  3KSJ A;  5JEI A;  3MVZ A;  4TQU Q;  3QXM A;  5DEX B;  2DXY A;  3CRB A;  5DT6 A;  1SW4 A;  3VE1 B;  4F1U A;  3MP1 A;  1Y3Q A;  5CI5 A;  1DMB A;  2PYY A;  1ATG A;  4NE4 A;  4X9T A;  2Y7W A;  2QS2 A;  1B9J A;  3FV1 A;  3LSL A;  3R6U A;  3PPR A;  4FE8 A;  4JDF A;  3VXC A;  2DP8 A;  1KWH A;  1FTM A;  1ZIU A;  1QKA A;  4IY5 A;  1RYX A;  4ZEC A;  1RKM A;  2XD3 A;  2DWH A;  3TTR A;  4AQ4 A;  2UVG A;  2F6G A;  1Y3P A;  2A5T B;  2XXX A;  4U2R A;  5ISU A;  5FTH A;  4NF6 A;  2B3F A;  4R6Y A;  2DQV A;  4I9D A;  5IAI A;  3M8U A;  3TOD A;  2R6G E;  3K6U A;  3O6G A;  1FQB A;  3UA8 A;  3RQT A;  3FZV A;  4N13 A;  3U1O A;  4F2Q A;  3G7W A;  1M5E A;  3N26 A;  2Z23 A;  4ZZA A;  4R73 A;  2QMW A;  2I49 A;  1R9L A;  3K6W A;  2REG A;  2I48 A;  3MZB A;  1YCJ A;  2I4C A;  2RCA A;  2VGQ A;  1SQY A;  3OEN A;  4YU0 A;  5I58 A;  4P0G A;  2WKY A;  2AL5 A;  5ITO A;  1Y4C A;  1MS7 A;  4GXA A;  5H8Q A;  4QSE A;  3OEL A;  1IXI A;  3T9X B;  3OSR A;  1L5T A;  5KCJ A;  2HAU A;  2RC7 A;  1YPN A;  2DE3 A;  1H43 A;  1B7H A;  3M3K A;  2DOJ A;  2P0S A;  4AB6 A;  4IGR A;  2X26 A;  3F11 A;  3H6U A;  4GLI A;  5HBC A;  4OFJ A;  5H8H A;  4F19 A;  3BBR A;  3MPK A;  3N94 A;  4XKP A;  3MVX A;  4YKJ A;  4Q5T A;  4ZEF A;  1MXV A;  1OMP A;  1ZU0 A;  2Q8J A;  4MLV A;  1B4H A;  1B5J A;  3ODB A;  4OER A;  5K2X A;  1B51 A;  5H8S A;  5B7D A;  4RY1 A;  4P0I A;  3PV0 E;  4O3A A;  3SEW A;  4BDO A;  1OLC A;  3IL1 B;  4H5G A;  2QL3 A;  2ESN A;  5I84 A;  3IK6 B;  1URS A;  2H98 A;  1B3H A;  2F7A A;  4E0W A;  4DXB A;  3CSG A;  4ZEI A;  1MRP A;  1Y1Z A;  1LBB A;  3FVK A;  5AA2 B;  5B70 A;  4R9F A;  4K3F A;  3PMV A;  4ELO A;  3U92 A;  4YB7 A;  4JB7 A;  3R7X A;  1A40 A;  3THI A;  4BLA A;  3FAT A;  3V83 A;  2THI A;  3CI8 A;  5H8N A;  4H67 A;  3FJG A;  1WDN A;  1DOT A;  1Y1M A;  3QUJ A;  5L9S A;  4XXU A;  5I56 B;  1N3X A;  4OFL A;  4ELP A;  3Q27 A;  1H3D A;  2XXU A;  2NOO A;  4P11 A;  1JW1 A;  3E3K A;  1LAX A;  3JV9 A;  3D4G A;  3PD9 A;  2F8D A;  5CMC A;  1LCF A;  1P1Q A;  1Y20 A;  4JSO A;  1A55 A;  3VXB A;  4JWO A;  4M4G A;  4C1T A;  4X1D A;  3DP8 A;  1YTV A;  4NF8 A;  1IQ7 A;  1GTK A;  1BP5 A;  1MY2 A;  3PPN A;  1MY1 A;  3HO7 A;  3K0V A;  3SET A;  1Q35 A;  3G3K A;  1S50 A;  1GVC A;  2F7B A;  3LC8 A;  3O6I A;  3OO6 A;  1N0T A;  3IB1 A;  1ZBM A;  3FXU A;  2DXR A;  2H25 A;  3U93 A;  1BKA A;  4E0X A;  3TTM A;  3FXQ A;  3KSX A;  3IR1 A;  1B4Z A;  1PBP A;  3TTN A;  2GH9 A;  3EHU A;  2QRY A;  3RTF B;  3IO4 A;  2YLN A;  1XS5 A;  4DDD A;  3GBA A;  1MH4 A;  3B7D A;  1QW0 A;  3EPE A;  3H7M A;  1B05 A;  1USY H;  3FJ7 A;  2QS1 A;  5FHM A;  1GV8 A;  5I59 A;  3OO9 A;  1ZTY A;  2HFB A;  1B3F A;  3H6W A;  3ZS6 A;  1PB8 A;  3H4Z A;  3PUW E;  1R9Q A;  2V3U A;  5AA4 B;  2DS9 A;  3GBB A;  4ND9 A;  3OMB A;  1S9T A;  4KD5 A;  2Y7I A;  5F7V A;  3QIM A;  1WVJ A;  5I2K A;  2VD3 A;  2Y7P A;  3E4R A;  1LLS A;  1SYI A;  4EQB A;  4F1Y A;  1Y3N A;  2RKM A;  4KI0 E;  4YB6 A;  1IIT A;  1XOC A;  3Q28 A;  3T66 A;  1A8F A;  5JK4 A;  4ELR A;  4C1U A;  4EQ7 A;  3EF7 A;  1B3E A;  4YB5 A;  3RNN A;  5L9O A;  3GXA A;  3CFL A;  1D9Y A;  2AYS A;  4NF4 B;  1EH3 A;  3C35 A;  3C4M A;  3B6T A;  1MG1 A;  4MBP A;  2GHB A;  1MDP 1;  1SBP A;  3IJO B;  1B58 A;  3QYT A;  1MQI A;  4YMB A;  1Y9U A;  2Q88 A;  3RUM A;  5A5X A;  2AL4 A;  4OXV A;  1LST A;  3MVW A;  1Y4T A;  3A3U A;  4FEC A;  3K02 A;  2V3T A;  4OES A;  3I3V A;  3RGY A;  2F36 A;  2RF1 A;  5ICQ A;  3OOA A;  4F3P A;  1A54 A;  4YKP A;  4YZZ A;  2AIX A;  4G8N A;  1IUD A;  3TTK A;  1SYH A;  1HSL A;  1VSO A;  4R9G A;  3Q25 A;  2Z8F A;  1M5B A;  3MZ1 A;  3E9X A;  3V5A A;  4TLM B;  2PT2 A;  4OVJ A;  3QAX A;  3IJX B;  3TTL A;  2OK2 A;  3HHF A;  4G4P A;  1EZP A;  1FQD A;  4KR5 A;  1BIY A;  5TP9 B;  1OVT A;  4IO4 A;  1Z7M E;  1QUK A;  5JTY A;  4H0W A;  5KDT A;  3OD7 A;  5DVI A;  4RJZ A;  1B6H A;  1LFG A;  1B3G A;  5DVF A;  2QJE A;  4EF1 A;  4OWD A;  4YKK A;  4GFR A;  5FHO A;  3FXR A;  5I57 A;  1TFD A;  1N7X A;  3B6Q A;  3S9E A;  4JBZ A;  4NWD A;  1B52 A;  4EDP A;  4MH5 A;  5ICT A;  4NF6 B;  4U1Z A;  3C31 A;  1FQA A;  5CMB A;  3FV2 A;  3EQ1 A;  1XVX A;  1OVB A;  4OFO A;  3TCF A;  2R9J A;  4DXU A;  4PQJ A;  3K6X A;  3LBS A;  1DPP A;  3S9N C;  5DYH A;  4FAT A;  2ABH A;  3PUY E;  3QK6 A;  2FA7 A;  1I6Q A;  2OWT A;  3KJT A;  2DVC A;  4OHN A;  1LCT A;  4G8H A;  1OLA A;  4ONY A;  3VLW A;  3H06 B;  3G3H A;  1ELJ A;  5DEX A;  1NKX A;  1OIB A;  1EZO A;  3PPO A;  3O29 A;  3SER A;  1NNF A;  2IEE A;  5CC2 A;  4G68 C;  4GL8 A;  5H8Q B;  1LAH E;  3BFT A;  5AA1 A;  3S9L C;  3SEY A;  1H45 A;  3TZA A;  2O68 A;  2PX1 A;  4DCX A;  1N3W A;  2O7U A;  4JWY A;  4ISU A;  4U22 A;  2XXP A;  3G3F A;  4N07 A;  1AOV A;  3KFM A;  4IB2 A;  4RYA A;  3SEU A;  2KLF A;  1PBQ A;  3EHT A;  3I6V A;  4R75 A;  3N6U A;  1XC1 A;  3OEK A;  5H8H B;  3K00 A;  1FCK A;  2A5T A;  2F97 A;  1NNK A;  1TXF A;  3FAS A;  1MQJ A;  3ZSF A;  1EU8 A;  3IX1 A;  1O7T A;  4HTG A;  2HZK A;  3PUZ E;  2QMX A;  4EXL A;  1TFA A;  5BWJ A;  4KYD A;  2V93 A;  4JSD A;  2DE4 A;  3O9P A;  3ECR A;  2F7C A;  4KPT A;  1B40 A;  2O7I A;  3RLF E;  3KG2 A;  3KGC A;  2XXV A;  1B7U A;  2Y7R A;  1FTJ A;  1H76 A;  1N04 A;  2OJT A;  4R74 A;  3PD8 A;  1FTK A;  1XT8 A;  1UTH B;  1RYO A;  4IO7 A;  4KCC A;  4OTE A;  1QVS A;  2Z8E A;  3KN3 A;  2DYX A;  1URG A;  4DIG A;  4FOR A;  1MPC A;  3T9U A;  3MAM A;  1VR5 A;  2PMS A;  4RA1 A;  4ELQ A;  4F39 A;  2ZYK A;  4OYV A;  2B3B A;  3L6H A;  3KOT A;  5H8N B;  4FEB A;  2H5Y A;  1US5 A;  1IZ1 A;  4WKM A;  4PP0 A;  2M8C A;  3VFJ A;  1IXC A;  4PFU A;  3PUX E;  2XD2 A;  1M5F A;  2GFE A;  4DZ1 A;  1JVY A;  2HEU A;  1WOD A;  2I58 A;  4I8C A;  2VP1 A;  1OQH A;  4XTC Q;  3DP4 A;  4QFL A;  3S9M C;  4I62 A;  5EHM A;  3T9V A;  3ILU B;  4ZS9 A;  1IEJ A;  2G93 A;  3C34 A;  5I2N B;  2VD2 A;  1UTB A;  3DLN A;  1BTJ A;  5H8F B;  3K1M A;  4KYS A;  2I0C A;  4H6D A;  2ZNT A;  4F29 A;  1MH3 A;  5AA2 A;  4DLD A;  4JXI A;  1SVX B;  3Q29 A;  5L8D A;  5FTI A;  2RC8 A;  3QSL A;  2DWI A;  4H65 A;  3IAZ A;  3TCG A;  1B1X A;  2X7P A;  1MDQ A;  1M5C A;  4LP2 B;  2R71 A;  4GD5 A;  3MZ9 A;  3RT6 B;  4PFY A;  3DEL B;  4L17 A;  2O1L A;  4IY6 A;  4IGT A;  4NF5 B;  1NH7 A;  4EF2 A;  2XX8 A;  1MXU A;  4OEV A;  1Z7N E;  3KN8 A;  4POX A;  5CMK A;  3L6G A;  4NMY A;  4F2O A;  3UP9 A;  1FQE A;  3QUF A;  1P99 A;  4RK2 A;  3KJ7 A;  3UK4 A;  4ZDM A;  1IXH A;  3W15 C;  1MPB A;  2ONK E;  1O64 A;  2O1M A;  5ITP A;  4BDN A;  1B46 A;  3HHG A;  3TMG A;  2CMO A;  5CMM A;  1DSN A;  4O3C A;  4F18 A;  3DP6 A;  4QSD A;  3VVE A;  4THI A;  3TQW A;  2F6P A;  3IOV A;  3C36 A;  1ZMG A;  2I3V A;  3SKP A;  3RTW B;  4ZZE A;  2NUV A;  4HW8 A;  3M3L A;  4I1D A;  4DE8 A;  5IKB A;  4G2Z A;  4MLQ A;  3EHS A;  1P1U A;  2ZNU A;  1N76 A;  3TYH A;  2Y7K A;  1JQF A;  3RY3 A;  4KCD A;  1LFH A;  1N7W A;  1PC3 A;  1TWY A;  4Z7E A;  4QF9 A;  1PEB A;  5L9M A;  3OEM A;  2RCB A;  1NFT A;  1ZJL A;  3CFZ A;  1JVX A;  5CRY A;  4Z0I A;  1MY3 A;  4YMA A;  1F9B A;  1DPE A;  4U23 A;  2RC9 A;  4PFW A;  4GRK A;  3BFU A;  4F3B A;  4Q30 B;  4HCW A;  4POW A;  1MM7 A;  1MQD A;  3CSB A;  2HAV A;  4WXJ A;  4OQO A;  1B0H A;  2OLB A;  3K01 A;  1MY0 A;  4MF3 A;  4FED A;  2ZMB A;  4U21 A;  2Q2C A;  4G68 B;  5KZT A;  4OET A;  4QFK A;  5A5X B;  1USY E;  3FD3 A;  2UVI A;  2FYI A;  4UA8 A;  4UAC A;  1P1O A;  1GR2 A;  4F3G A;  5TU0 A;  5M2V A;  1SI1 A;  3T9H B;  2LAO A;  4LA9 A;  1NNP A;  4F3S A;  3O6H A;  1SD3 A;  3G3J A;  2ONS A;  1AH5 A;  3IB0 A;  2V25 A;  3FJM A;  4R2F A;  4BDL A;  1JEU A;  3T22 A;  2HZL A;  3CG1 A;  2DSF A;  2I0B A;  3FUZ A;  1ANF A;  3VVD A;  1D9V A;  3T93 B;  1UIV A;  1MXW A;  4F31 B;  3FVG A;  3SEX A;  1AL3 A;  3OSQ A;  4NF4 A;  3FVO A;  4Q8R A;  5LOM A;  4GF8 A;  4N6P A;  5TPA B;  4GQO A;  2I4B A;  3ONM A;  3C32 A;  2E1S A;  3K4U A;  2UYF A;  5I57 B;  4QHQ A;  4LZ7 A;  3IO6 A;  3IOU A;  2H4I A;  3TCH A;  3O97 A;  3SDF A;  3H3G A;  2PT1 A;  4HS7 A;  4IO2 A;  4R72 A;  1UIU A;  4RNS A;  1I6B A;  2QS4 A;  3VVF A;  1LGB C;  3MQ9 A;  3K1N A;  4LON B;  4LUB A;  2QPQ A;  3WAF A;  4NTL A;  5FHN A;  2PVU A;  2OWS A;  2DE2 A;  3MP8 A;  3MPL A;  3U94 A;  3H03 A;  3H6T A;  4WEP A;  4GOT A;  5EHS A;  2O84 X;  4YIC A;  3HCQ A;  4XIG Q;  2I3W A;  1JEV A;  3OO7 A;  1B7Z A;  3HN0 A;  3KBR A;  3GLB A;  1N84 A;  4GXS B;  3IOW A;  2IA4 A;  5TP9 A;  3MJN A;  4HCY A;  1DTG A;  4JWX A;  1HSJ A;  1MXY A;  2Z8D A;  4BDR A;  3MP6 A;  4GL0 A;  3CR9 A;  1QKB A;  4M1V A;  2XXH A;  3LUY A;  5I58 B;  4H8I A;  2QSX A;  1XHY A;  3T96 B;  3CIJ A;  2VOZ A;  2XX7 A;  2YJP A;  2OZZ A;  3UIF A;  2O6A A;  1QUJ A;  2ZNS A;  1B3L A;  3LSF B;  2Z22 A;  1SW2 A;  5KCJ B;  3MC2 A;  2Q2A A;  3UGW A;  3GZG A;  4QRZ A;  3HPI A;  1VE4 A;  3TQL A;  2XXI A;  3ILT B;  3FGS A; 
#chains in the Genus database with same CATH topology
 2ZYM A;  5ESY A;  1B2H A;  3E78 A;  3G3G A;  4IR8 A;  3P7I A;  1MXX A;  1IME A;  3IOT A;  2XXR A;  2RIN A;  3C9H A;  3FIR A;  4ZE9 A;  3LR1 A;  1B32 A;  2UXA A;  5AA3 A;  3VDF A;  1J1N A;  1LB9 A;  1YAE A;  3O28 A;  4GX4 A;  1B5I A;  1A8E A;  1SW5 A;  1OQG A;  4XKQ A;  3K2D A;  5BUU A;  5AE4 A;  1JET A;  4XKN A;  2HXW A;  3KOS A;  3N6T A;  4PFT A;  1KZ8 A;  1VFD A;  3N5L A;  2KQZ A;  5HPQ A;  1IIW A;  2ZZV A;  2G29 A;  2F5X A;  1LBC A;  5EYF A;  1QUL A;  3CVG A;  3LSW A;  3JYR A;  4OVT A;  3VV5 A;  1FPL A;  1MM6 A;  3HFU A;  4QFN A;  3A3C A;  4WED A;  2O69 A;  3S2V A;  3LSX A;  3ZKL A;  2UYE A;  3TEL A;  2OCU A;  3PGF A;  4GVO A;  2REJ A;  2V3Q A;  3OXN A;  2Q9T A;  4RK9 A;  2WBD A;  3HST A;  1URD A;  3TKD A;  1SPI A;  3UN6 A;  2ZYN A;  4GWO A;  3TDJ A;  3B6W A;  4IO5 A;  3I5O A;  2YPN A;  2B65 A;  3WAE A;  4BDQ A;  3O2A A;  2CZI A;  3PUV E;  4U4S A;  2XWV A;  4G8M A;  2XXW A;  4HE0 A;  1UTB B;  1I69 A;  1TT1 A;  1BLF A;  3TFL A;  1UTH A;  2NXO A;  3BKI B;  4Q0C A;  4IO6 A;  1GGG A;  2DWJ A;  2E0S A;  4KYE A;  2P1S A;  2B4L A;  3MVY A;  3V89 B;  4X1B A;  2XX9 A;  2HHM A;  2DDK A;  3O66 A;  4MNC A;  4AS5 A;  2F35 A;  4MIJ A;  2XHD A;  3R26 A;  4ECF A;  2XXY A;  4H1X A;  3G3I A;  3IFC A;  4F1V A;  2BJJ X;  3HV1 A;  5EQA A;  1PDA A;  1US4 A;  1IXG A;  4PE5 B;  2FIE A;  4NF8 B;  1MY4 A;  4DCY A;  1MQG A;  2NWJ A;  4EUO A;  2Y84 A;  1VFE A;  4PAF A;  3PU5 A;  1R6Z A;  4KXP A;  2HCA A;  5DTB A;  4FJP A;  3USD A;  4QSC A;  2ZXT A;  5ELV A;  2P2A A;  4ZEB A;  2OX3 A;  1LAF E;  1A7L A;  1FTL A;  4KHZ E;  2VPN A;  2L5V A;  3Q26 A;  4LVQ A;  4QFP A;  3ZKK A;  4LZ5 A;  3KN7 A;  1AIV A;  1I6A A;  4U1O A;  3K6V A;  5I56 A;  4NWC A;  4LAT A;  1MQH A;  1PB9 A;  4LQ5 A;  3MST A;  5I2N A;  1EZ9 A;  2GRV A;  1HSE A;  4OMB A;  1JW5 A;  1SI0 A;  3D4C A;  4I3Y A;  5H8F A;  4H5F A;  2QS3 A;  2H99 A;  3A09 A;  4YAH X;  4JVC A;  4ZEK A;  2CZL A;  4LZ8 A;  4TOZ A;  2I6E A;  5I59 B;  3K1P A;  2H9B A;  4O3B A;  4NED A;  3RN8 A;  4YKI A;  3E13 X;  3PTY A;  5K2Y A;  1FTO A;  5DVJ A;  5EQ8 A;  4GWU A;  1QJM A;  3PMX A;  3MUQ A;  3V8X B;  1LFI A;  3S4U A;  3PPP A;  4NF5 A;  2D5W A;  2ZZW A;  3MWB A;  2D3I A;  3RYD A;  2OBG A;  3FBP A;  1P1W A;  1NH8 A;  3FXB A;  2CZK A;  3M3F A;  1NMU A;  1NL5 A;  1FW0 A;  5I2K B;  2HQ0 A;  4X48 A;  1D9Q A;  4RXL A;  4G77 A;  3MYU A;  3EN3 A;  3TPA A;  4RPN A;  5IZZ A;  1MXZ A;  2UVH A;  3CFX A;  4N17 A;  1NUZ A;  1FPI A;  4OEU A;  1D4N A;  1M5D A;  3PMW A;  1A99 A;  4PGN A;  2VHA A;  4IO3 A;  4KFQ A;  3UOR A;  4R6H A;  4OZ9 A;  2ONR A;  5AA2 D;  3VLV A;  1MPD A;  3RT8 A;  3RPW A;  4P3L A;  3TAJ A;  4EXK A;  2A5S A;  1UQW A;  3KEI A;  2MKZ A;  1FQC A;  5CBS A;  3H6V A;  2GHA A;  3DM0 A;  2NVU B;  2XXQ A;  1FBE A;  2O51 A;  1RDX A;  1P1N A;  3U8Q A;  4AB5 A;  4RPO A;  1FBF A;  4P8B A;  1DK4 A;  3AXF A;  3W9W A;  4MFI A;  1FPK A;  3BIG A;  4GIZ A;  4BDM A;  5CM6 A;  3PPQ A;  1S7Y A;  2D21 A;  4FAJ A;  4ESW A;  5CBR A;  3E79 A;  3TEP A;  4N81 A;  3VLU A;  2ALU A;  4XKR A;  5AA4 A;  3IB2 A;  1B1H A;  1B0L A;  4JVI A;  4PET A;  2UVJ A;  1R1N A;  1NV7 A;  1T0K A;  2P3N A;  1BK4 A;  4MNI A;  3C33 A;  3SES A;  5FBP A;  1FQF A;  5F1Q A;  2XWI A;  4C0R A;  1AMF A;  1AWB A;  3MW0 A;  1NNT A;  2QVR A;  3JZJ A;  1JNF A;  5ET7 A;  4U4X A;  5IZ3 A;  1XVY A;  3KZG A;  3TUS A;  4G68 A;  1IMB A;  1LAG E;  1ZLQ A;  1B5H A;  1FSA A;  4H8J A;  1JW4 A;  3SEV A;  4TLL B;  1DTZ A;  2Q89 A;  1IMC A;  1POY 1;  4R2B A;  2XXT A;  2ANJ A;  4HE1 A;  2HXR A;  1SDX A;  5J16 A;  4MX6 A;  1LB8 A;  4N6K A;  5JTY B;  4ESX A;  2ZYO A;  4R6K A;  5DW8 A;  5KDT B;  1O63 A;  2DWA A;  3U72 A;  1POT A;  1H44 A;  4PFB A;  3MBP A;  3OO8 A;  4NF0 A;  1PB7 A;  4F22 A;  2V84 A;  1FRP A;  2PBW A;  1DBZ A;  3D1R A;  1Q1K A;  1FPG A;  3IOR A;  1CB6 A;  1II5 A;  4LQ2 A;  1QUI A;  1RDZ A;  2W7Y A;  2F34 A;  3NOH A;  2X7Q A;  4EQ9 A;  3FVN A;  2DVZ A;  4QFO A;  1CE2 A;  1D3K A;  4ZE8 A;  2F78 A;  4DXC A;  4PDD A;  4ZED A;  4OVR A;  4KQP A;  1ZKB A;  5TPA A;  1SW1 A;  5HM4 B;  3LUZ A;  4FIM A;  3W9V A;  3CG3 A;  4OEN A;  5J1D A;  2FNC A;  3KSJ A;  4H46 A;  5JEI A;  3MVZ A;  4TQU Q;  3QXM A;  5DEX B;  2DXY A;  3CRB A;  5DT6 A;  4N8Y A;  1SW4 A;  3VE1 B;  4F1U A;  3MP1 A;  1Y3Q A;  5CI5 A;  1DMB A;  2PYY A;  1ATG A;  4NE4 A;  4X9T A;  2Y7W A;  2QS2 A;  1B9J A;  3FV1 A;  4N15 A;  3LSL A;  4HXV A;  3R6U A;  3PPR A;  4FE8 A;  4JDF A;  3VXC A;  4UAB A;  2DP8 A;  1KWH A;  1FTM A;  1ZIU A;  2HPG A;  1QKA A;  4IY5 A;  1RYX A;  4ZEC A;  1RKM A;  2XD3 A;  2DWH A;  3TTR A;  4AQ4 A;  2UVG A;  2F6G A;  1Y3P A;  2A5T B;  2XXX A;  4U2R A;  5ISU A;  5FTH A;  4NF6 A;  2B3F A;  4R6Y A;  2DQV A;  4I9D A;  5IAI A;  3M8U A;  2CEX A;  3TOD A;  2R6G E;  3K6U A;  3O6G A;  1FQB A;  3UA8 A;  3RQT A;  4GX6 A;  3FZV A;  4N13 A;  1FJ9 A;  4GWZ A;  3RPL B;  3U1O A;  4F2Q A;  3G7W A;  2Q8M A;  1M5E A;  3N26 A;  2Z23 A;  4ZZA A;  4R73 A;  2QMW A;  2I49 A;  1R9L A;  3K6W A;  4PF6 A;  2REG A;  2I48 A;  3MZB A;  1YCJ A;  2I4C A;  2RCA A;  2VGQ A;  1SQY A;  3OEN A;  4YU0 A;  3T1B A;  5I58 A;  4P0G A;  2WKY A;  2AL5 A;  5ITO A;  1Y4C A;  1MS7 A;  4GXA A;  2OWZ A;  2Y5K A;  4P9K A;  5H8Q A;  2ZZX A;  4QSE A;  3OEL A;  1IXI A;  1NV0 A;  3T9X B;  3OSR A;  1L5T A;  5KCJ A;  2HAU A;  2RC7 A;  1YPN A;  2DE3 A;  1H43 A;  2PFY A;  1B7H A;  3M3K A;  2DOJ A;  2P0S A;  4AB6 A;  4IGR A;  2X26 A;  4H45 A;  3F11 A;  3H6U A;  4GLI A;  1LBV A;  4N91 A;  5HBC A;  4OFJ A;  5H8H A;  4F19 A;  2PFZ A;  3BBR A;  3MPK A;  4OVP A;  3N94 A;  4XKP A;  3MVX A;  3IFA A;  4YKJ A;  4Q5T A;  4ZEF A;  1MXV A;  1OMP A;  2Y5L A;  1ZU0 A;  2Q8J A;  1FBH A;  4MLV A;  1B4H A;  3ISP A;  1B5J A;  4I40 A;  4PBQ A;  3ODB A;  4OER A;  5K2X A;  1B51 A;  5H8S A;  5B7D A;  4RY1 A;  1DCU A;  4P0I A;  4LN5 A;  3PV0 E;  4O3A A;  3SEW A;  4BDO A;  1OLC A;  3IL1 B;  4H5G A;  2QL3 A;  5IZ1 A;  2ESN A;  5I84 A;  3IK6 B;  3B50 A;  1URS A;  2H98 A;  1B3H A;  2F7A A;  4E0W A;  4DXB A;  3CSG A;  4ZEI A;  1EYJ A;  1NV5 A;  1MRP A;  1Y1Z A;  1LBB A;  1FBG A;  3FVK A;  5AA2 B;  5B70 A;  4R9F A;  4GWX A;  4MCO A;  4K3F A;  3PMV A;  4ELO A;  3U92 A;  4YB7 A;  4JB7 A;  3R7X A;  1A40 A;  3THI A;  4BLA A;  3FAT A;  3V83 A;  2THI A;  3CI8 A;  3CHG A;  5H8N A;  1KA1 A;  4H67 A;  3FJG A;  1WDN A;  2FIX A;  1DOT A;  1Y1M A;  3QUJ A;  5L9S A;  4XXU A;  5I56 B;  1NV1 A;  1N3X A;  5LDZ A;  4OFL A;  4ELP A;  3Q27 A;  1H3D A;  2XXU A;  2NOO A;  1EYK A;  4P11 A;  1JW1 A;  3E3K A;  3KC0 A;  1LAX A;  4MNP A;  3JV9 A;  1XI6 A;  3D4G A;  3PD9 A;  2F8D A;  5CMC A;  1LCF A;  1P1Q A;  1Y20 A;  4JSO A;  1A55 A;  2XA5 A;  3VXB A;  4JWO A;  4M4G A;  4C1T A;  4X1D A;  1LBZ A;  3DP8 A;  1YTV A;  1JP4 A;  4X04 A;  3U65 A;  4NF8 A;  1IQ7 A;  1GTK A;  1BP5 A;  2WBB A;  5I7I A;  1MY2 A;  3PPN A;  1MY1 A;  3HO7 A;  3K0V A;  3KC1 A;  3SET A;  1Q35 A;  3G3K A;  4DI4 B;  5F24 A;  1S50 A;  4GWW A;  1GVC A;  2F7B A;  3LC8 A;  3O6I A;  3OO6 A;  1N0T A;  3IB1 A;  5A5L A;  2FVZ A;  1ZBM A;  1KA0 A;  3FXU A;  4PF8 A;  2DXR A;  2H25 A;  3U93 A;  1BKA A;  4E0X A;  3TTM A;  3FXQ A;  3KSX A;  3IR1 A;  1B4Z A;  1PBP A;  1YZ0 A;  3TTN A;  2GH9 A;  3EHU A;  2QRY A;  3RTF B;  3IO4 A;  2YLN A;  1XS5 A;  4DDD A;  3GBA A;  1MH4 A;  4GWS A;  5T3J A;  3B7D A;  1QW0 A;  3EPE A;  3H7M A;  4NX1 A;  1B05 A;  1USY H;  3FJ7 A;  2R8T A;  2QS1 A;  5FHM A;  1EYI A;  4NG7 A;  1GV8 A;  5I59 A;  3OO9 A;  1ZTY A;  2HFB A;  1B3F A;  4OAN A;  3H6W A;  2V4C A;  3ZS6 A;  1PB8 A;  3H4Z A;  3PUW E;  1G0H A;  1R9Q A;  2V3U A;  5AA4 B;  2DS9 A;  3GBB A;  1LBW A;  4ND9 A;  3OMB A;  1S9T A;  4KD5 A;  2Y7I A;  5F7V A;  3QIM A;  1WVJ A;  5I2K A;  2VD3 A;  2Y7P A;  3E4R A;  1LLS A;  1SYI A;  4NQ8 A;  4EQB A;  4F1Y A;  1Y3N A;  2RKM A;  3EKI A;  4KI0 E;  4YB6 A;  1IIT A;  1XOC A;  3Q28 A;  3T66 A;  1IMF A;  1A8F A;  5IZ3 B;  4XEQ A;  4OVQ A;  5JK4 A;  4ELR A;  4C1U A;  3ROJ A;  4EQ7 A;  3EF7 A;  1B3E A;  4YB5 A;  3RNN A;  5IGA A;  5L9O A;  3GXA A;  4G61 A;  1K9Z A;  3CFL A;  1D9Y A;  2AYS A;  4HE2 A;  4NF4 B;  1EH3 A;  3C35 A;  4I3E A;  3C4M A;  3B6T A;  1MG1 A;  4MBP A;  2GHB A;  1MDP 1;  1SBP A;  3IJO B;  1B58 A;  2WEF A;  3QYT A;  1MQI A;  4YMB A;  1Y9U A;  2Q88 A;  3RUM A;  5A5X A;  2AL4 A;  4OXV A;  1LEV A;  1LST A;  3MVW A;  1Y4T A;  3A3U A;  4FEC A;  3K02 A;  2V3T A;  4OES A;  3I3V A;  3RGY A;  1FBP A;  2F36 A;  2RF1 A;  4GWY A;  5ICQ A;  3OOA A;  4F3P A;  1A54 A;  4YKP A;  4YZZ A;  2AIX A;  4G8N A;  1IUD A;  3TTK A;  1SYH A;  1HSL A;  1VSO A;  2CZH A;  4R9G A;  3Q25 A;  1QGX A;  2Z8F A;  4MHF A;  2WYP A;  1M5B A;  3MZ1 A;  3E9X A;  3V5A A;  4TLM B;  2PT2 A;  4OVJ A;  3QAX A;  3IJX B;  3TTL A;  2OK2 A;  3HHF A;  4G4P A;  1EZP A;  1FQD A;  4KR5 A;  4NGU A;  1BIY A;  5TP9 B;  1OVT A;  4IO4 A;  1Z7M E;  1QUK A;  5JTY A;  4XFE A;  4PAI A;  1G0I A;  4H0W A;  5KDT A;  3OD7 A;  5DVI A;  4RJZ A;  1B6H A;  1LFG A;  1B3G A;  5DVF A;  2QJE A;  4EF1 A;  4OWD A;  1FJ6 A;  4GFR A;  4YKK A;  5FHO A;  3FXR A;  5I57 A;  1TFD A;  1N7X A;  3B6Q A;  1FBC A;  3S9E A;  4JBZ A;  2P3V A;  4NWD A;  1B52 A;  4EDP A;  4MH5 A;  5ICT A;  4NF6 B;  4U1Z A;  5EYG A;  3C31 A;  2QFL A;  1FQA A;  5CMB A;  3FV2 A;  3EQ1 A;  1XVX A;  1OVB A;  5I3S A;  4PCD A;  4OFO A;  4PC9 A;  3TCF A;  2R9J A;  4DXU A;  4GBV A;  4PQJ A;  3K6X A;  3LBS A;  1DPP A;  3S9N C;  5DYH A;  4FAT A;  2ABH A;  3PUY E;  3QK6 A;  4NAP A;  2FA7 A;  1I6Q A;  2OWT A;  3KJT A;  2DVC A;  4OA4 A;  4OHN A;  1LCT A;  4G8H A;  1OLA A;  4ONY A;  3VLW A;  3H06 B;  3G3H A;  1ELJ A;  5DEX A;  4N4U A;  1NKX A;  2PCR A;  1OIB A;  1EZO A;  3PPO A;  3O29 A;  3SER A;  1FPF A;  4GBW A;  1NNF A;  2IEE A;  5CC2 A;  4G68 C;  4GL8 A;  5H8Q B;  3A29 A;  1LAH E;  3BFT A;  5AA1 A;  3S9L C;  1VDW A;  3SEY A;  1H45 A;  1FPB A;  3TZA A;  2O68 A;  2PX1 A;  4DCX A;  1N3W A;  2O7U A;  4JWY A;  4ISU A;  4MMP A;  4N6D A;  4U22 A;  2XXP A;  3G3F A;  1NI9 A;  4N07 A;  1AOV A;  3KFM A;  4IB2 A;  4RYA A;  3SEU A;  2KLF A;  1PBQ A;  2XWK A;  3EHT A;  3I6V A;  4R75 A;  3N6U A;  1XC1 A;  3OEK A;  5H8H B;  3K00 A;  1FCK A;  2A5T A;  2F97 A;  1NNK A;  4PDH A;  1TXF A;  2VT5 A;  3FAS A;  1MQJ A;  3ZSF A;  1EU8 A;  3IX1 A;  1O7T A;  4HTG A;  1LBX A;  2HZK A;  3PUZ E;  2QMX A;  4EXL A;  5IM2 A;  1TFA A;  5BWJ A;  4KYD A;  3RPL A;  2V93 A;  4JSD A;  5ET6 A;  2DE4 A;  3O9P A;  3ECR A;  2F7C A;  4KPT A;  1NUX A;  1B40 A;  2O7I A;  3RLF E;  5ET5 A;  3KG2 A;  3KGC A;  2XXV A;  1B7U A;  2Y7R A;  4NHB A;  1FTJ A;  1H76 A;  1N04 A;  2OJT A;  4R74 A;  5EYH A;  3PD8 A;  1FTK A;  4QBA A;  1XT8 A;  1UTH B;  1RYO A;  4IO7 A;  4KCC A;  5EQ7 A;  4OTE A;  1QVS A;  2Z8E A;  3KN3 A;  2DYX A;  1URG A;  4DIG A;  4FOR A;  1MPC A;  3T9U A;  3MAM A;  1VR5 A;  2PMS A;  4RA1 A;  4ELQ A;  4F39 A;  2ZYK A;  5ET8 A;  4O8M A;  4OYV A;  2B3B A;  3L6H A;  3KOT A;  4PBH A;  5H8N B;  4FEB A;  2H5Y A;  1IMA A;  1US5 A;  2KR0 A;  4P47 A;  1LBY A;  1IZ1 A;  4WKM A;  4PP0 A;  2M8C A;  3VFJ A;  1IXC A;  4PFU A;  3PUX E;  2XD2 A;  1M5F A;  2GFE A;  4DZ1 A;  1JVY A;  2HEU A;  1WOD A;  2I58 A;  4I8C A;  2VP1 A;  1OQH A;  4XTC Q;  3DP4 A;  4QFL A;  3S9M C;  4I62 A;  5EHM A;  3T9V A;  3ILU B;  2F3D A;  2Q74 A;  4ZS9 A;  1IEJ A;  2G93 A;  1K9Y A;  3C34 A;  5I2N B;  1YXI A;  2VD2 A;  1UTB A;  3DLN A;  5EQ9 A;  1BTJ A;  2BJI A;  1NV3 A;  5H8F B;  3K1M A;  4KYS A;  2I0C A;  4H6D A;  3SZP A;  2ZNT A;  4F29 A;  1MH3 A;  5AA2 A;  4DLD A;  4JXI A;  1SVX B;  3Q29 A;  5L8D A;  5FTI A;  2RC8 A;  3QSL A;  2DWI A;  4H65 A;  3IAZ A;  4JVD A;  4NN3 A;  3TCG A;  1B1X A;  2X7P A;  1MDQ A;  1M5C A;  4LP2 B;  1FPE A;  2R71 A;  4GD5 A;  4N8G A;  3MZ9 A;  3RT6 B;  4PFY A;  3DEL B;  4L17 A;  2O1L A;  4IY6 A;  4IGT A;  4NF5 B;  1NH7 A;  4EF2 A;  2XX8 A;  1Q9D A;  1NV4 A;  4FBP A;  1MXU A;  4OEV A;  1Z7N E;  3KN8 A;  2QVU A;  4POX A;  5CMK A;  3L6G A;  4P1E A;  4O7M A;  4NMY A;  4F2O A;  3UP9 A;  1FQE A;  2JJK A;  3QUF A;  1P99 A;  4RK2 A;  3KJ7 A;  4GX3 A;  3UK4 A;  4ZDM A;  1IXH A;  3W15 C;  1MPB A;  2ONK E;  1O64 A;  2O1M A;  5ITP A;  4BDN A;  1FBD A;  1B46 A;  3HHG A;  3TMG A;  2CMO A;  5CMM A;  1DSN A;  4O3C A;  4F18 A;  3KBZ A;  3DP6 A;  4QSD A;  3VVE A;  4THI A;  2VPO A;  4QXD A;  3TQW A;  2F6P A;  2QVV A;  3IOV A;  3C36 A;  1ZMG A;  2I3V A;  2XXK A;  3SKP A;  3RTW B;  4ZZE A;  2NUV A;  4OVS A;  4HW8 A;  2WYK A;  3M3L A;  4I1D A;  1YYZ A;  4DE8 A;  1RDY A;  5IKB A;  4G2Z A;  4MLQ A;  3EHS A;  1P1U A;  2ZNU A;  1N76 A;  3TYH A;  2Y7K A;  1JQF A;  3RY3 A;  4KCD A;  1LFH A;  1N7W A;  1PC3 A;  1TWY A;  4Z7E A;  4QF9 A;  1PEB A;  5L9M A;  3OEM A;  2RCB A;  1NFT A;  1ZJL A;  3CFZ A;  1JVX A;  5CRY A;  4Z0I A;  1MY3 A;  4YMA A;  1F9B A;  1DPE A;  4PFI A;  4U23 A;  2RC9 A;  4PFW A;  4GRK A;  3BFU A;  4O94 A;  4MJO A;  4F3B A;  4Q30 B;  4HCW A;  4POW A;  1MM7 A;  1MQD A;  3CSB A;  2GQ1 A;  2HAV A;  4WXJ A;  4OQO A;  1B0H A;  2OLB A;  3K01 A;  1MY0 A;  4MF3 A;  4FED A;  2ZMB A;  4U21 A;  2Q2C A;  4G68 B;  5KZT A;  4OET A;  4QFK A;  2XWO A;  5A5X B;  1USY E;  3FD3 A;  2UVI A;  2FYI A;  4MEV A;  4UA8 A;  4UAC A;  1P1O A;  4PAK A;  1GR2 A;  4F3G A;  5TU0 A;  5M2V A;  1SI1 A;  3T9H B;  3LV0 A;  2LAO A;  3BIH A;  4LA9 A;  1NNP A;  4F3S A;  3O6H A;  1SD3 A;  3G3J A;  2ONS A;  1AH5 A;  3IB0 A;  2V25 A;  3FJM A;  4R2F A;  4BDL A;  1JEU A;  3T22 A;  4AS4 A;  2HZL A;  3CG1 A;  2DSF A;  1CNQ A;  2I0B A;  3FUZ A;  1INP A;  1ANF A;  2FBP A;  3VVD A;  1D9V A;  3T93 B;  1UIV A;  1MXW A;  1IMD A;  4F31 B;  3FVG A;  3SEX A;  1AL3 A;  3OSQ A;  1FPJ A;  4NF4 A;  4O7I A;  3FVO A;  3QMF A;  4Q8R A;  5LOM A;  4GF8 A;  4N6P A;  2F3B A;  4XF5 A;  5TPA B;  3GYY A;  4GQO A;  2I4B A;  3ONM A;  3C32 A;  4MAG A;  2E1S A;  1FTA A;  3K4U A;  5I5P A;  1NUW A;  2UYF A;  5I57 B;  4QHQ A;  4LZ7 A;  3IO6 A;  3IOU A;  2B4M A;  4DI3 D;  2H4I A;  3TCH A;  3O97 A;  3SDF A;  3H3G A;  2PT1 A;  4HS7 A;  4IO2 A;  4R72 A;  4PGP A;  1UIU A;  4RNS A;  1I6B A;  1NUY A;  2QS4 A;  3VVF A;  1LGB C;  3T0J A;  3MQ9 A;  3K1N A;  4LON B;  3B8B A;  4LUB A;  4PFR A;  2QPQ A;  3WAF A;  4NTL A;  5FHN A;  2PVU A;  1NV6 A;  2OWS A;  4P56 A;  2DE2 A;  3MP8 A;  3MPL A;  3U94 A;  3H03 A;  3H6T A;  4WEP A;  4GOT A;  5EHS A;  2O84 X;  4YIC A;  1FPD A;  3HCQ A;  4XIG Q;  2I3W A;  1JEV A;  3OO7 A;  1B7Z A;  3HN0 A;  4PTK A;  3KBR A;  3GLB A;  1N84 A;  4X8R A;  4GXS B;  3IOW A;  4P1L A;  2IA4 A;  2CEY A;  5TP9 A;  3MJN A;  4HCY A;  4PE3 A;  1DTG A;  4JWX A;  1HSJ A;  1MXY A;  2Z8D A;  4BDR A;  3MP6 A;  4GL0 A;  3CR9 A;  1QKB A;  4M1V A;  2XXH A;  3LUY A;  5I58 B;  4H8I A;  2QSX A;  1XHY A;  3T96 B;  3CIJ A;  2VOZ A;  2XX7 A;  2YJP A;  2OZZ A;  3UIF A;  2WX9 A;  2O6A A;  1QUJ A;  2ZNS A;  1B3L A;  2FHY A;  3LSF B;  2Z22 A;  1SW2 A;  5KCJ B;  5LTC A;  3MC2 A;  2Q2A A;  3UGW A;  1NV2 A;  3GZG A;  4QRZ A;  3HPI A;  1VE4 A;  3TQL A;  2XXI A;  3ILT B;  3FGS A; 
#chains in the Genus database with same CATH homology
 2ZYM A;  1B2H A;  3G3G A;  3P7I A;  1MXX A;  3IOT A;  2XXR A;  2RIN A;  3C9H A;  3FIR A;  4ZE9 A;  3LR1 A;  1B32 A;  2UXA A;  5AA3 A;  3VDF A;  1J1N A;  1LB9 A;  1YAE A;  3O28 A;  1A8E A;  1B5I A;  1SW5 A;  1OQG A;  4XKQ A;  3K2D A;  5BUU A;  5AE4 A;  1JET A;  4XKN A;  2HXW A;  3KOS A;  3N6T A;  4PFT A;  1VFD A;  3N5L A;  5HPQ A;  1IIW A;  2G29 A;  2F5X A;  1LBC A;  5EYF A;  1QUL A;  3CVG A;  3LSW A;  3JYR A;  3VV5 A;  1MM6 A;  4QFN A;  3A3C A;  4WED A;  2O69 A;  3S2V A;  3LSX A;  3ZKL A;  2UYE A;  3TEL A;  2OCU A;  3PGF A;  4GVO A;  2REJ A;  2V3Q A;  3OXN A;  2Q9T A;  4RK9 A;  3HST A;  1URD A;  3TKD A;  3UN6 A;  2ZYN A;  4GWO A;  3TDJ A;  3B6W A;  4IO5 A;  3I5O A;  2YPN A;  2B65 A;  3WAE A;  4BDQ A;  3O2A A;  3PUV E;  4U4S A;  4G8M A;  2XXW A;  1UTB B;  1I69 A;  1TT1 A;  1BLF A;  3TFL A;  1UTH A;  2NXO A;  3BKI B;  4Q0C A;  4IO6 A;  1GGG A;  2DWJ A;  2E0S A;  4KYE A;  2P1S A;  3MVY A;  3V89 B;  4X1B A;  2XX9 A;  3O66 A;  2F35 A;  2XHD A;  3R26 A;  4ECF A;  2XXY A;  4H1X A;  3G3I A;  4F1V A;  2BJJ X;  3HV1 A;  1PDA A;  1US4 A;  1IXG A;  4PE5 B;  4NF8 B;  1MY4 A;  4DCY A;  1MQG A;  2NWJ A;  4EUO A;  2Y84 A;  1VFE A;  3PU5 A;  1R6Z A;  2HCA A;  5DTB A;  4FJP A;  3USD A;  4QSC A;  2ZXT A;  5ELV A;  2P2A A;  4ZEB A;  1LAF E;  1A7L A;  1FTL A;  4KHZ E;  3Q26 A;  4LVQ A;  4QFP A;  3ZKK A;  4LZ5 A;  3KN7 A;  1AIV A;  1I6A A;  4U1O A;  3K6V A;  5I56 A;  4NWC A;  4LAT A;  1MQH A;  1PB9 A;  4LQ5 A;  5I2N A;  1EZ9 A;  2GRV A;  1HSE A;  4OMB A;  1JW5 A;  1SI0 A;  3D4C A;  5H8F A;  4H5F A;  2QS3 A;  2H99 A;  3A09 A;  4YAH X;  4ZEK A;  2CZL A;  4LZ8 A;  4TOZ A;  2I6E A;  5I59 B;  3K1P A;  2H9B A;  4O3B A;  4NED A;  3RN8 A;  4YKI A;  3E13 X;  5K2Y A;  1FTO A;  5DVJ A;  1QJM A;  3PMX A;  3MUQ A;  3V8X B;  1LFI A;  3S4U A;  3PPP A;  4NF5 A;  2D5W A;  3MWB A;  2D3I A;  2OBG A;  1P1W A;  1NH8 A;  3M3F A;  1NMU A;  1NL5 A;  1FW0 A;  5I2K B;  2HQ0 A;  4X48 A;  4RXL A;  4G77 A;  3EN3 A;  3TPA A;  4RPN A;  1MXZ A;  2UVH A;  3CFX A;  4OEU A;  1D4N A;  1M5D A;  3PMW A;  1A99 A;  2VHA A;  4IO3 A;  4KFQ A;  3UOR A;  4R6H A;  4OZ9 A;  2ONR A;  5AA2 D;  3VLV A;  1MPD A;  3RT8 A;  3RPW A;  3TAJ A;  4EXK A;  2A5S A;  1UQW A;  3KEI A;  1FQC A;  5CBS A;  3H6V A;  2GHA A;  3DM0 A;  2NVU B;  2XXQ A;  2O51 A;  1P1N A;  3U8Q A;  4AB5 A;  4RPO A;  3AXF A;  3W9W A;  4MFI A;  4GIZ A;  4BDM A;  5CM6 A;  3PPQ A;  1S7Y A;  2D21 A;  4FAJ A;  4ESW A;  5CBR A;  3TEP A;  3VLU A;  2ALU A;  4XKR A;  5AA4 A;  3IB2 A;  1B1H A;  1B0L A;  4PET A;  2UVJ A;  1R1N A;  1T0K A;  3C33 A;  3SES A;  1FQF A;  5F1Q A;  4C0R A;  1AMF A;  3MW0 A;  1NNT A;  3JZJ A;  1JNF A;  4U4X A;  1XVY A;  3KZG A;  3TUS A;  4G68 A;  1LAG E;  1ZLQ A;  1B5H A;  4H8J A;  1JW4 A;  3SEV A;  4TLL B;  1DTZ A;  2Q89 A;  1POY 1;  4R2B A;  2XXT A;  2ANJ A;  1SDX A;  1LB8 A;  5JTY B;  4ESX A;  2ZYO A;  4R6K A;  5KDT B;  1O63 A;  2DWA A;  3U72 A;  1POT A;  1H44 A;  3MBP A;  3OO8 A;  1PB7 A;  4F22 A;  2V84 A;  2PBW A;  1Q1K A;  3IOR A;  1CB6 A;  1II5 A;  4LQ2 A;  1QUI A;  2W7Y A;  2F34 A;  2X7Q A;  4EQ9 A;  3FVN A;  2DVZ A;  4QFO A;  1CE2 A;  1D3K A;  4ZE8 A;  2F78 A;  4DXC A;  4ZED A;  4KQP A;  1ZKB A;  5TPA A;  1SW1 A;  5HM4 B;  4FIM A;  3W9V A;  3CG3 A;  4OEN A;  5J1D A;  2FNC A;  3KSJ A;  5JEI A;  3MVZ A;  4TQU Q;  3QXM A;  5DEX B;  2DXY A;  3CRB A;  5DT6 A;  1SW4 A;  3VE1 B;  4F1U A;  3MP1 A;  1Y3Q A;  5CI5 A;  1DMB A;  2PYY A;  1ATG A;  4NE4 A;  4X9T A;  2Y7W A;  2QS2 A;  1B9J A;  3FV1 A;  3LSL A;  3R6U A;  3PPR A;  4FE8 A;  4JDF A;  3VXC A;  2DP8 A;  1KWH A;  1FTM A;  1ZIU A;  1QKA A;  4IY5 A;  1RYX A;  4ZEC A;  1RKM A;  2XD3 A;  2DWH A;  3TTR A;  4AQ4 A;  2UVG A;  2F6G A;  1Y3P A;  2A5T B;  2XXX A;  4U2R A;  5ISU A;  5FTH A;  4NF6 A;  2B3F A;  4R6Y A;  2DQV A;  4I9D A;  5IAI A;  3M8U A;  3TOD A;  2R6G E;  3K6U A;  3O6G A;  1FQB A;  3UA8 A;  3RQT A;  3FZV A;  4N13 A;  3U1O A;  4F2Q A;  3G7W A;  1M5E A;  3N26 A;  2Z23 A;  4ZZA A;  4R73 A;  2QMW A;  2I49 A;  1R9L A;  3K6W A;  2REG A;  2I48 A;  3MZB A;  1YCJ A;  2I4C A;  2RCA A;  2VGQ A;  1SQY A;  3OEN A;  4YU0 A;  5I58 A;  4P0G A;  2WKY A;  2AL5 A;  5ITO A;  1Y4C A;  1MS7 A;  4GXA A;  5H8Q A;  4QSE A;  3OEL A;  1IXI A;  3T9X B;  3OSR A;  1L5T A;  5KCJ A;  2HAU A;  2RC7 A;  1YPN A;  2DE3 A;  1H43 A;  1B7H A;  3M3K A;  2DOJ A;  2P0S A;  4AB6 A;  4IGR A;  2X26 A;  3F11 A;  3H6U A;  4GLI A;  5HBC A;  4OFJ A;  5H8H A;  4F19 A;  3BBR A;  3MPK A;  3N94 A;  4XKP A;  3MVX A;  4YKJ A;  4Q5T A;  4ZEF A;  1MXV A;  1OMP A;  1ZU0 A;  2Q8J A;  4MLV A;  1B4H A;  1B5J A;  3ODB A;  4OER A;  5K2X A;  1B51 A;  5H8S A;  5B7D A;  4RY1 A;  4P0I A;  3PV0 E;  4O3A A;  3SEW A;  4BDO A;  1OLC A;  3IL1 B;  4H5G A;  2QL3 A;  2ESN A;  5I84 A;  3IK6 B;  1URS A;  2H98 A;  1B3H A;  2F7A A;  4E0W A;  4DXB A;  3CSG A;  4ZEI A;  1MRP A;  1Y1Z A;  1LBB A;  3FVK A;  5AA2 B;  5B70 A;  4R9F A;  4K3F A;  3PMV A;  4ELO A;  3U92 A;  4YB7 A;  4JB7 A;  3R7X A;  1A40 A;  3THI A;  4BLA A;  3FAT A;  3V83 A;  2THI A;  3CI8 A;  5H8N A;  4H67 A;  3FJG A;  1WDN A;  1DOT A;  1Y1M A;  3QUJ A;  5L9S A;  4XXU A;  5I56 B;  1N3X A;  4OFL A;  4ELP A;  3Q27 A;  1H3D A;  2XXU A;  2NOO A;  4P11 A;  1JW1 A;  3E3K A;  1LAX A;  3JV9 A;  3D4G A;  3PD9 A;  2F8D A;  5CMC A;  1LCF A;  1P1Q A;  1Y20 A;  4JSO A;  1A55 A;  3VXB A;  4JWO A;  4M4G A;  4C1T A;  4X1D A;  3DP8 A;  1YTV A;  4NF8 A;  1IQ7 A;  1GTK A;  1BP5 A;  1MY2 A;  3PPN A;  1MY1 A;  3HO7 A;  3K0V A;  3SET A;  1Q35 A;  3G3K A;  1S50 A;  1GVC A;  2F7B A;  3LC8 A;  3O6I A;  3OO6 A;  1N0T A;  3IB1 A;  1ZBM A;  3FXU A;  2DXR A;  2H25 A;  3U93 A;  1BKA A;  4E0X A;  3TTM A;  3FXQ A;  3KSX A;  3IR1 A;  1B4Z A;  1PBP A;  3TTN A;  2GH9 A;  3EHU A;  2QRY A;  3RTF B;  3IO4 A;  2YLN A;  1XS5 A;  4DDD A;  3GBA A;  1MH4 A;  3B7D A;  1QW0 A;  3EPE A;  3H7M A;  1B05 A;  1USY H;  3FJ7 A;  2QS1 A;  5FHM A;  1GV8 A;  5I59 A;  3OO9 A;  1ZTY A;  2HFB A;  1B3F A;  3H6W A;  3ZS6 A;  1PB8 A;  3H4Z A;  3PUW E;  1R9Q A;  2V3U A;  5AA4 B;  2DS9 A;  3GBB A;  4ND9 A;  3OMB A;  1S9T A;  4KD5 A;  2Y7I A;  5F7V A;  3QIM A;  1WVJ A;  5I2K A;  2VD3 A;  2Y7P A;  3E4R A;  1LLS A;  1SYI A;  4EQB A;  4F1Y A;  1Y3N A;  2RKM A;  4KI0 E;  4YB6 A;  1IIT A;  1XOC A;  3Q28 A;  3T66 A;  1A8F A;  5JK4 A;  4ELR A;  4C1U A;  4EQ7 A;  3EF7 A;  1B3E A;  4YB5 A;  3RNN A;  5L9O A;  3GXA A;  3CFL A;  1D9Y A;  2AYS A;  4NF4 B;  1EH3 A;  3C35 A;  3C4M A;  3B6T A;  1MG1 A;  4MBP A;  2GHB A;  1MDP 1;  1SBP A;  3IJO B;  1B58 A;  3QYT A;  1MQI A;  4YMB A;  1Y9U A;  2Q88 A;  3RUM A;  5A5X A;  2AL4 A;  4OXV A;  1LST A;  3MVW A;  1Y4T A;  3A3U A;  4FEC A;  3K02 A;  2V3T A;  4OES A;  3I3V A;  3RGY A;  2F36 A;  2RF1 A;  5ICQ A;  3OOA A;  4F3P A;  1A54 A;  4YKP A;  4YZZ A;  2AIX A;  4G8N A;  1IUD A;  3TTK A;  1SYH A;  1HSL A;  1VSO A;  4R9G A;  3Q25 A;  2Z8F A;  1M5B A;  3MZ1 A;  3E9X A;  3V5A A;  4TLM B;  2PT2 A;  4OVJ A;  3QAX A;  3IJX B;  3TTL A;  2OK2 A;  3HHF A;  4G4P A;  1EZP A;  1FQD A;  4KR5 A;  1BIY A;  5TP9 B;  1OVT A;  4IO4 A;  1Z7M E;  1QUK A;  5JTY A;  4H0W A;  5KDT A;  3OD7 A;  5DVI A;  4RJZ A;  1B6H A;  1LFG A;  1B3G A;  5DVF A;  2QJE A;  4EF1 A;  4OWD A;  4YKK A;  4GFR A;  5FHO A;  3FXR A;  5I57 A;  1TFD A;  1N7X A;  3B6Q A;  3S9E A;  4JBZ A;  4NWD A;  1B52 A;  4EDP A;  4MH5 A;  5ICT A;  4NF6 B;  4U1Z A;  3C31 A;  1FQA A;  5CMB A;  3FV2 A;  3EQ1 A;  1XVX A;  1OVB A;  4OFO A;  3TCF A;  2R9J A;  4DXU A;  4PQJ A;  3K6X A;  3LBS A;  1DPP A;  3S9N C;  5DYH A;  4FAT A;  2ABH A;  3PUY E;  3QK6 A;  2FA7 A;  1I6Q A;  2OWT A;  3KJT A;  2DVC A;  4OHN A;  1LCT A;  4G8H A;  1OLA A;  4ONY A;  3VLW A;  3H06 B;  3G3H A;  1ELJ A;  5DEX A;  1NKX A;  1OIB A;  1EZO A;  3PPO A;  3O29 A;  3SER A;  1NNF A;  2IEE A;  5CC2 A;  4G68 C;  4GL8 A;  5H8Q B;  1LAH E;  3BFT A;  5AA1 A;  3S9L C;  3SEY A;  1H45 A;  3TZA A;  2O68 A;  2PX1 A;  4DCX A;  1N3W A;  2O7U A;  4JWY A;  4ISU A;  4U22 A;  2XXP A;  3G3F A;  4N07 A;  1AOV A;  3KFM A;  4IB2 A;  4RYA A;  3SEU A;  2KLF A;  1PBQ A;  3EHT A;  3I6V A;  4R75 A;  3N6U A;  1XC1 A;  3OEK A;  5H8H B;  3K00 A;  1FCK A;  2A5T A;  2F97 A;  1NNK A;  1TXF A;  3FAS A;  1MQJ A;  3ZSF A;  1EU8 A;  3IX1 A;  1O7T A;  4HTG A;  2HZK A;  3PUZ E;  2QMX A;  4EXL A;  1TFA A;  5BWJ A;  4KYD A;  2V93 A;  4JSD A;  2DE4 A;  3O9P A;  3ECR A;  2F7C A;  4KPT A;  1B40 A;  2O7I A;  3RLF E;  3KG2 A;  3KGC A;  2XXV A;  1B7U A;  2Y7R A;  1FTJ A;  1H76 A;  1N04 A;  2OJT A;  4R74 A;  3PD8 A;  1FTK A;  1XT8 A;  1UTH B;  1RYO A;  4IO7 A;  4KCC A;  4OTE A;  1QVS A;  2Z8E A;  3KN3 A;  2DYX A;  1URG A;  4DIG A;  4FOR A;  1MPC A;  3T9U A;  3MAM A;  1VR5 A;  2PMS A;  4RA1 A;  4ELQ A;  4F39 A;  2ZYK A;  4OYV A;  2B3B A;  3L6H A;  3KOT A;  5H8N B;  4FEB A;  2H5Y A;  1US5 A;  1IZ1 A;  4WKM A;  4PP0 A;  2M8C A;  3VFJ A;  1IXC A;  4PFU A;  3PUX E;  2XD2 A;  1M5F A;  2GFE A;  4DZ1 A;  1JVY A;  2HEU A;  1WOD A;  2I58 A;  4I8C A;  2VP1 A;  1OQH A;  4XTC Q;  3DP4 A;  4QFL A;  3S9M C;  4I62 A;  5EHM A;  3T9V A;  3ILU B;  4ZS9 A;  1IEJ A;  2G93 A;  3C34 A;  5I2N B;  2VD2 A;  1UTB A;  3DLN A;  1BTJ A;  5H8F B;  3K1M A;  4KYS A;  2I0C A;  4H6D A;  2ZNT A;  4F29 A;  1MH3 A;  5AA2 A;  4DLD A;  4JXI A;  1SVX B;  3Q29 A;  5L8D A;  5FTI A;  2RC8 A;  3QSL A;  2DWI A;  4H65 A;  3IAZ A;  3TCG A;  1B1X A;  2X7P A;  1MDQ A;  1M5C A;  4LP2 B;  2R71 A;  4GD5 A;  3MZ9 A;  3RT6 B;  4PFY A;  3DEL B;  4L17 A;  2O1L A;  4IY6 A;  4IGT A;  4NF5 B;  1NH7 A;  4EF2 A;  2XX8 A;  1MXU A;  4OEV A;  1Z7N E;  3KN8 A;  4POX A;  5CMK A;  3L6G A;  4NMY A;  4F2O A;  3UP9 A;  1FQE A;  3QUF A;  1P99 A;  4RK2 A;  3KJ7 A;  3UK4 A;  4ZDM A;  1IXH A;  3W15 C;  1MPB A;  2ONK E;  1O64 A;  2O1M A;  5ITP A;  4BDN A;  1B46 A;  3HHG A;  3TMG A;  2CMO A;  5CMM A;  1DSN A;  4O3C A;  4F18 A;  3DP6 A;  4QSD A;  3VVE A;  4THI A;  3TQW A;  2F6P A;  3IOV A;  3C36 A;  1ZMG A;  2I3V A;  3SKP A;  3RTW B;  4ZZE A;  2NUV A;  4HW8 A;  3M3L A;  4I1D A;  4DE8 A;  5IKB A;  4G2Z A;  4MLQ A;  3EHS A;  1P1U A;  2ZNU A;  1N76 A;  3TYH A;  2Y7K A;  1JQF A;  3RY3 A;  4KCD A;  1LFH A;  1N7W A;  1PC3 A;  1TWY A;  4Z7E A;  4QF9 A;  1PEB A;  5L9M A;  3OEM A;  2RCB A;  1NFT A;  1ZJL A;  3CFZ A;  1JVX A;  5CRY A;  4Z0I A;  1MY3 A;  4YMA A;  1F9B A;  1DPE A;  4U23 A;  2RC9 A;  4PFW A;  4GRK A;  3BFU A;  4F3B A;  4Q30 B;  4HCW A;  4POW A;  1MM7 A;  1MQD A;  3CSB A;  2HAV A;  4WXJ A;  4OQO A;  1B0H A;  2OLB A;  3K01 A;  1MY0 A;  4MF3 A;  4FED A;  2ZMB A;  4U21 A;  2Q2C A;  4G68 B;  5KZT A;  4OET A;  4QFK A;  5A5X B;  1USY E;  3FD3 A;  2UVI A;  2FYI A;  4UA8 A;  4UAC A;  1P1O A;  1GR2 A;  4F3G A;  5TU0 A;  5M2V A;  1SI1 A;  3T9H B;  2LAO A;  4LA9 A;  1NNP A;  4F3S A;  3O6H A;  1SD3 A;  3G3J A;  2ONS A;  1AH5 A;  3IB0 A;  2V25 A;  3FJM A;  4R2F A;  4BDL A;  1JEU A;  3T22 A;  2HZL A;  3CG1 A;  2DSF A;  2I0B A;  3FUZ A;  1ANF A;  3VVD A;  1D9V A;  3T93 B;  1UIV A;  1MXW A;  4F31 B;  3FVG A;  3SEX A;  1AL3 A;  3OSQ A;  4NF4 A;  3FVO A;  4Q8R A;  5LOM A;  4GF8 A;  4N6P A;  5TPA B;  4GQO A;  2I4B A;  3ONM A;  3C32 A;  2E1S A;  3K4U A;  2UYF A;  5I57 B;  4QHQ A;  4LZ7 A;  3IO6 A;  3IOU A;  2H4I A;  3TCH A;  3O97 A;  3SDF A;  3H3G A;  2PT1 A;  4HS7 A;  4IO2 A;  4R72 A;  1UIU A;  4RNS A;  1I6B A;  2QS4 A;  3VVF A;  1LGB C;  3MQ9 A;  3K1N A;  4LON B;  4LUB A;  2QPQ A;  3WAF A;  4NTL A;  5FHN A;  2PVU A;  2OWS A;  2DE2 A;  3MP8 A;  3MPL A;  3U94 A;  3H03 A;  3H6T A;  4WEP A;  4GOT A;  5EHS A;  2O84 X;  4YIC A;  3HCQ A;  4XIG Q;  2I3W A;  1JEV A;  3OO7 A;  1B7Z A;  3HN0 A;  3KBR A;  3GLB A;  1N84 A;  4GXS B;  3IOW A;  2IA4 A;  5TP9 A;  3MJN A;  4HCY A;  1DTG A;  4JWX A;  1HSJ A;  1MXY A;  2Z8D A;  4BDR A;  3MP6 A;  4GL0 A;  3CR9 A;  1QKB A;  4M1V A;  2XXH A;  3LUY A;  5I58 B;  4H8I A;  2QSX A;  1XHY A;  3T96 B;  3CIJ A;  2VOZ A;  2XX7 A;  2YJP A;  2OZZ A;  3UIF A;  2O6A A;  1QUJ A;  2ZNS A;  1B3L A;  3LSF B;  2Z22 A;  1SW2 A;  5KCJ B;  3MC2 A;  2Q2A A;  3UGW A;  3GZG A;  4QRZ A;  3HPI A;  1VE4 A;  3TQL A;  2XXI A;  3ILT B;  3FGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...