2QSXA

Crystal structure of putative transcriptional regulator lysr from vibrio parahaemolyticus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
197
structure length
180
Chain Sequence
ELLVVDVTPSFASLWLVPNINDFHQRHPNIRVKILTGDGAVESDLHVRCLPLSTHYEYSQLLCEETLLLIGNTNLPISHYPFIPQTTRPQLWEQFKQENITYHSVGFEHFYLACEAVRMEKGLALLPDFMAQFSILRGDIQHIGNLKLHSGYGYYVVIPNFRLTSRKVALFHDWLKDKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative transcriptional regulator, LysR family
publication title The Crystal Structure of Putative Transcriptional Regulator LysR From Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus
total genus 48
structure length 180
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qsxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qsxA02
1R1NA 1XOCA 1LB9A 2RCBA 4QSEA 2LAOA 4LP2B 2REGA 1MQHA 2PBWA 3KOTA 1PDAA 3K1NA 1PB7A 5TPAA 3Q29A 4R6HA 3ONMA 4F3BA 4MBPA 4Q5TA 4JSDA 1BLFA 2F35A 1I6QA 5L9MA 3CSGA 3KN3A 1B5JA 4YB7A 1IQ7A 2UVGA 2XD2A 2O7UA 5BUUA 1TFDA 3T9VA 1FQBA 3FV1A 3EQ1A 1URSA 1D4NA 2A5SA 4NTLA 4IB2A 2H25A 4RPOA 4YICA 2UYEA 2XD3A 4F1UA 4O3CA 2RINA 4KFQA 1SD3A 4EF2A 1FQCA 3PPQA 2OLBA 3HV1A 3QYTA 4NF5B 4G68B 5DT6A 3O6IA 3H6TA 2IA4A 3U72A 1B51A 1B58A 1H44A 1JEVA 3W15C 3IL1B 4P0IA 3H3GA 2HZKA 1SW4A 5ISUA 4BDMA 1SW5A 2DE4A 5AA4B 2V25A 1GR2A 3WAFA 4QRZA 1FQDA 1POTA 1B4ZA 4XKRA 1MS7A 3IOVA 1LSTA 4I8CA 5H8NA 4G8NA 3KZGA 2REJA 2X26A 3K6VA 1USYE 2NWJA 1O64A 4RA1A 3I6VA 2DOJA 3LSFB 1MQJA 2ZXTA 1QW0A 3K6WA 5EYFA 4F18A 4OWDA 3K6XA 2GFEA 4WEPA 3I3VA 3O28A 1Q1KA 4K3FA 1LFIA 1ZBMA 4P0GA 4FECA 3SEYA 5AA2D 4QSDA 5CBRA 4R6KA 4BLAA 2I3VA 4QFKA 1EZOA 3TODA 1MDP1 1JW1A 2ZNTA 3IB1A 3C34A 2V3UA 1SI0A 2Y84A 3RTWB 1MXUA 1OVTA 1N3XA 4R73A 2UXAA 3B6TA 5KCJB 3OO9A 4RK9A 3HHFA 3HCQA 3PMWA 3IJOB 3KN7A 3TCHA 3CIJA 3N94A 3MJNA 5A5XB 2ESNA 2Z8FA 4H8IA 4PFTA 4EDPA 1B0LA 3ZKLA 2PVUA 5FTIA 2DXYA 2XXYA 3MZBA 5I57A 2F8DA 4OZ9A 2P1SA 5DVJA 3IJXB 4NF8B 4IY5A 2F7BA 1Y4CA 1LGBC 3VFJA 1AH5A 3QXMA 4H8JA 2VGQA 4EQ9A 1XHYA 3C4MA 4Q0CA 3HHGA 4NF6B 2W7YA 1FTMA 2V84A 5AE4A 1FQEA 3HPIA 3M8UA 4OHNA 1NKXA 4C0RA 2O69A 3WAEA 3FGSA 2DP8A 2DYXA 3TTMA 2HZLA 2GHBA 4PETA 4I1DA 3EPEA 2O84X 4OESA 3CSBA 2H4IA 1EZ9A 5AA2A 4TOZA 3VLVA 4G4PA 3ODBA 1D9YA 2Y7PA 3V89B 4F3SA 5TU0A 4FEDA 3JYRA 2VHAA 4U22A 2ALUA 2Y7IA 2XXHA 4BDQA 3JZJA 3MP1A 5ELVA 1L5TA 2YPNA 3TTNA 4HS7A 4KR5A 3KN8A 1B5IA 1RYXA 1Y1MA 5I56B 4XKQA 3DLNA 1P1QA 5H8HA 2R9JA 4P11A 3EF7A 3PPOA 3BFTA 4GF8A 4QFPA 4DXCA 1UTBA 3C35A 4ELRA 1MQGA 3W9WA 3K0VA 1VE4A 3V8XB 3UORA 3MVZA 4MFIA 5I59A 3CFZA 3SKPA 2QL3A 5JTYB 2RF1A 5CMBA 1PBPA 4YAHX 1D3KA 3IORA 5TP9A 3KOSA 1QUIA 4H0WA 4PP0A 5KDTA 5JK4A 3A3UA 2Z8DA 1D9VA 2BJJX 4KCCA 1LCTA 1B3EA 3TZAA 3SEWA 5IAIA 3H6UA 3VE1B 4U1OA 5L9SA 4JBZA 4FEBA 1H43A 2XXVA 1GV8A 1VFDA 3A09A 3F11A 4PFYA 3MZ9A 3RGYA 5H8NB 1A54A 1MY3A 4LA9A 5I2NA 3B6WA 4KD5A 3TTLA 2I3WA 3TTKA 2XXRA 3LSWA 5CMKA 3PD9A 3KGCA 4F3GA 3OD7A 4FE8A 4ECFA 4U23A 3UP9A 4OQOA 2NOOA 3UN6A 1N04A 4ZEFA 3THIA 3S9EA 3FXUA 2O68A 2OBGA 1JW5A 1B3GA 4RXLA 3IOUA 4DZ1A 5AA3A 4POXA 4OFOA 3LR1A 3CVGA 4DXBA 4R74A 1S7YA 1WVJA 1JW4A 2RC8A 1JETA 1B32A 1S50A 4YMAA 4JWOA 3ILUB 4F3PA 3RTFB 4ZEBA 3OSQA 4TLMB 3G3KA 4IGRA 2XX8A 5L8DA 3EHSA 1XT8A 1M5CA 4R72A 4KYSA 3GZGA 3MQ9A 5DEXA 4I62A 2P0SA 3P7IA 5ITOA 4UA8A 1OMPA 3H6VA 3KEIA 2OWTA 2O1MA 4IO6A 4QF9A 2B65A 4IY6A 3R7XA 5DTBA 2ABHA 4H1XA 3TKDA 2OK2A 2M8CA 3H03A 1I6BA 2OCUA 2VD2A 3CFLA 4JDFA 1LFHA 2QSXA 1P1OA 5LOMA 4R6YA 1Y4TA 3V5AA 4GLIA 4O3BA 1PB8A 4PQJA 4YMBA 4OFLA 5AA2B 3O6GA 2I6EA 1PB9A 2D3IA 3K2DA 3D4GA 5J1DA 4BDLA 4ZEKA 3PUZE 3G3HA 4BDRA 4Q30B 5CC2A 3DP4A 4E0XA 4FJPA 1I69A 3SEUA 4DDDA 3H4ZA 2ZYMA 4NF4A 2I0BA 3SETA 3TUSA 1B2HA 3UIFA 4LONB 3SEXA 4GVOA 3PD8A 1MXYA 5DYHA 1ZIUA 4QFOA 2UVJA 4AQ4A 2DWHA 1OIBA 3W9VA 2Z23A 3K4UA 1JQFA 1URDA 1JNFA 2H99A 4M1VA 1MY1A 2DXRA 3G3FA 1GVCA 1HSEA 2OWSA 3TFLA 1A8EA 5I59B 1POY1 3OO7A 2Y7WA 3C9HA 3IOWA 4GL8A 3FZVA 1LAHE 1SI1A 5TP9B 3TELA 5KDTB 2CMOA 1JEUA 1B7UA 1B5HA 5CMCA 4Z0IA 3G3GA 4GWOA 4Z7EA 5K2XA 3IO6A 4DIGA 3H6WA 2Q88A 2QJEA 5I2NB 1ANFA 1HSJA 4JWYA 1ZU0A 3RN8A 4KHZE 1UQWA 3ECRA 3MZ1A 4OEVA 4EXKA 1JVYA 3GXAA 3T9HB 3BFUA 4FAJA 4XKNA 3IX1A 5I2KA 2F6GA 3DP8A 3IAZA 2ONKE 5HM4B 1EZPA 3O9PA 1NH8A 3B7DA 3T9XB 1Y1ZA 3KFMA 4GOTA 2QPQA 4MF3A 1XC1A 1Z7ME 4ZE9A 3KG2A 1YAEA 4IGTA 3O66A 4ZZEA 1IXIA 3RT6B 2H9BA 4O3AA 4ZEIA 1P99A 2DWIA 1SYHA 3JV9A 2HFBA 3CG1A 2HEUA 4THIA 1YCJA 1H76A 2YLNA 3G3IA 4RY1A 1KWHA 4GQOA 4OENA 1B52A 4JWXA 4KYDA 4MLQA 1AMFA 1TXFA 2RCAA 1DSNA 1M5DA 2Z8EA 3TTRA 4H6DA 4H67A 2QS1A 3TDJA 3EHTA 1B4HA 1Q35A 3TMGA 4EXLA 3D4CA 2P2AA 2WKYA 2QMWA 2DE2A 3TYHA 3CR9A 2UVHA 5H8FA 2F7AA 1B3HA 1XVYA 1IZ1A 1B7HA 3B6QA 3S9MC 1LBBA 1VSOA 4R2FA 1B3LA 4ONYA 1N76A 4Q8RA 3K1PA 2PMSA 1T0KA 4EF1A 4WXJA 3L6GA 3ZSFA 5FHMA 2QS2A 3M3FA 3S4UA 3FVKA 4ZS9A 1MY2A 2H5YA 1FTJA 1OVBA 1FW0A 4ESWA 4NWCA 3VXCA 2V3QA 2RKMA 1O7TA 4U1ZA 2ANJA 1SW1A 2ZNSA 3OSRA 4ZDMA 4OVJA 4F2OA 3SDFA 5TPAB 2XXIA 1LLSA 4KI0E 4YZZA 4LZ8A 3T96B 3OEKA 4X9TA 5B7DA 2F5XA 2F34A 1DTGA 1R6ZA 1ZKBA 2XX7A 3KJTA 1QKAA 4QHQA 2AIXA 4RNSA 3RUMA 5EHSA 4I9DA 1BTJA 1BIYA 3QUJA 3RY3A 1MXZA 1UTHA 3C36A 2Y7RA 2DWJA 4IO2A 1R9QA 1N7WA 4YB5A 3BBRA 4PE5B 1B05A 4F2QA 3RNNA 4AB5A 4OERA 4ESXA 3GBAA 3E3KA 4WEDA 1MXXA 1IXHA 4AB6A 2AL5A 4JXIA 5K2YA 1Y3NA 3V83A 2VOZA 2F78A 1XS5A 4ZECA 3FUZA 4G68A 3MAMA 4PFWA 1ATGA 1IXCA 3QSLA 1SW2A 5F1QA 2DVZA 5EHMA 1OQHA 4EQBA 1F9BA 3UK4A 1YPNA 2Q8JA 1M5FA 1GGGA 5HPQA 3FVNA 5I58A 2OJTA 4G8MA 1Y3PA 5AA4A 2UYFA 2I0CA 4IO7A 1ZLQA 4ND9A 3OOAA 1ELJA 4GD5A 1RKMA 1NH7A 3OENA 1USYH 3MP6A 2Y7KA 5H8SA 1MPDA 4DLDA 3U94A 3FIRA 4FORA 4GRKA 2RC7A 1QVSA 2FA7A 1VR5A 4YB6A 3K01A 2XX9A 4R9GA 3MPLA 3R6UA 5CBSA 3TQWA 3PU5A 2DVCA 1B7ZA 2QMXA 4F39A 3TEPA 1OQGA 3MVYA 3DELB 2NVUB 4N13A 3K00A 2I4BA 5I57B 3S9LC 4ELQA 4F22A 5HBCA 1UIUA 5H8QA 4ZZAA 3VXBA 4F31B 1MM7A 4QSCA 3FASA 1US4A 5A5XA 2B3BA 3H7MA 2XXQA 2I49A 3Q28A 1WODA 5B70A 2F6PA 4U2RA 3T9UA 3E9XA 2O51A 3FXQA 1FCKA 1NNPA 3MBPA 1HSLA 2ZNUA 1H3DA 2DE3A 1O63A 4NEDA 1Z7NE 4NF8A 4H5FA 4IO3A 2R71A 2I4CA 2FYIA 1MM6A 1ZTYA 2XXWA 4R9FA 4NF6A 3VLUA 5FHOA 1IEJA 2X7QA 1B3FA 3O97A 1Y3QA 4KPTA 2QRYA 3QIMA 3OO8A 1A99A 3C33A 3T93B 3MVWA 1NL5A 4DCYA 1I6AA 3MUQA 1MY4A 2PX1A 3G7WA 4MH5A 4IO4A 3L6HA 5H8HB 1IUDA 1SYIA 3TPAA 4HTGA 4WKMA 4GL0A 3E13X 2I48A 1UTBB 2CZLA 1QKBA 2ONSA 1EU8A 2ZYNA 3GBBA 5BWJA 1EH3A 4EQ7A 3PUWE 4DCXA 3PMVA 1UTHB 2YJPA 1Y20A 2I58A 4YKKA 1TT1A 1DPPA 3VVEA 1LAFE 3VV5A 1OLAA 3HO7A 3PUVE 5I56A 3IB0A 3T66A 1B9JA 3EN3A 3HN0A 1UIVA 1LB8A 3TCGA 3PPRA 1N84A 4DXUA 4QFNA 1NNTA 2HAVA 4BDOA 1II5A 1VFEA 3M3LA 1TFAA 4G77A 1B1XA 3QUFA 3LSXA 1LAGE 5JTYA 2D21A 4POWA 4GIZA 3PUXE 4OEUA 1LAXA 1RYOA 4YKPA 4OTEA 4FATA 4GFRA 3CG3A 3N5LA 3OO6A 1SDXA 1M5BA 4OXVA 3FJGA 5I58B 5CRYA 3OMBA 2NXOA 1MH4A 3MP8A 3UGWA 2AL4A 1QJMA 3S2VA 3MPKA 2PT2A 3IOTA 4N07A 3FXRA 1US5A 3ZKKA 1N0TA 5FTHA 4LVQA 2F7CA 3CRBA 4GXAA 1FQAA 2O1LA 4R2BA 4DE8A 2XXUA 3MVXA 1P1WA 2THIA 3OELA 5IKBA 4NE4A 1TWYA 3FJ7A 3IO4A 3EHUA 1AIVA 2H98A 4NMYA 4OFJA 1P1UA 1DTZA 1NFTA 3E4RA 4NWDA 2V93A 2PYYA 2GHAA 1J1NA 1LFGA 4BDNA 2R6GE 5DEXB 1Y9UA 5H8QB 4KCDA 2HXWA 3DM0A 4X48A 2E1SA 3MC2A 3MW0A 3U93A 1MPBA 4JSOA 4X1DA 2B3FA 2F97A 4C1TA 1MRPA 5CI5A 3TCFA 4G8HA 2AYSA 1PBQA 2A5TA 3RLFE 3OXNA 2Q2AA 1BKAA 4KQPA 4LQ2A 5M2VA 4TQUQ 4F29A 4XKPA 3PPPA 4LQ5A 3TAJA 2Q2CA 4ELPA 3T22A 1B46A 1DMBA 5DVFA 2DWAA 1M5EA 3IB2A 1SQYA 1MY0A 3K1MA 3UA8A 1DOTA 1LCFA 3N6UA 1SBPA 1A40A 3CFXA 1MPCA 4ELOA 3RT8A 5ICTA 2HQ0A 3IR1A 2V3TA 2X7PA 3N6TA 1A8FA 4NF4B 3LSLA 1IIWA 3SEVA 2Q89A 5JEIA 4ISUA 1FTKA 1N7XA 3VVDA 4HCWA 3O2AA 3RQTA 4YU0A 1N3WA 2XXTA 3OEMA 2KLFA 3SERA 2QS3A 3FVOA 1B0HA 3K6UA 1IITA 4E0WA 4F19A 1MXVA 4XIGQ 1B6HA 4M4GA 1NNFA 5ICQA 3U8QA 4OYVA 5KZTA 4LZ5A 1B1HA 1MQDA 3ZS6A 4F1VA 2XXPA 1AOVA 3LUYA 1JVXA 2QS4A 2XXXA 3K02A 3PGFA 1CB6A 3DP6A 4PFUA 3U1OA 3ILTB 3PUYE 5AA1A 3USDA 2VP1A 3MWBA 3H06B 2Z22A 3I5OA 4N6PA 1MQIA 3C32A 2UVIA 1A55A 4ZEDA 4OETA 4LUBA 1QULA 3O6HA 4U21A 4NF5A 2E0SA 2O6AA 3N26A 4RPNA 1R9LA 3FATA 3PV0E 5CM6A 5I2KB 4H5GA 3Q25A 4FIMA 4R75A 1QUKA 4TLLB 2G29A 1P1NA 3FD3A 4UACA 1XVXA 1PEBA 2OZZA 1B40A 4X1BA 1MH3A 2IEEA 5F7VA 1MDQA 1QUJA 4G2ZA 5I84A 3IK6B 2F36A 2ZMBA 2DQVA 2DSFA 4JB7A 3A3CA 1DPEA 3QAXA 4H65A 3FJMA 3KSXA 3M3KA 3RPWA 1FTLA 4XXUA 1NMUA 1WDNA 1FQFA 1ZMGA 1AL3A 4IO5A 2GH9A 3R26A 1OLCA 2D5WA 3FV2A 4G68C 4LATA 4L17A 3C31A 1FTOA 2ZYKA 4HW8A 4YKJA 1YTVA 2ONRA 2PT1A 3AXFA 3SESA 1PC3A 1MXWA 2ZYOA 2DS9A 3G3JA 4GXSB 3Q26A 3CI8A 4RYAA 5H8FB 4RK2A 1URGA 5KCJA 4F1YA 2A5TB 3VVFA 4QFLA 3TQLA 3Q27A 1SVXB 2FNCA 3GLBA 2NUVA 5DVIA 2XHDA 4C1UA 3HSTA 3PMXA 4ZE8A 3KBRA 4KYEA 4YKIA 3KJ7A 3U92A 1S9TA 3KSJA 4LZ7A 3QK6A 1ZJLA 3LBSA 1MG1A 5L9OA 3FVGA 4MLVA 5FHNA 3S9NC 2HCAA 5ITPA 2VD3A 3PPNA 1A7LA 4EUOA 1BP5A 1IXGA 2RC9A 5CMMA 3LC8A 1H45A 2GRVA 2O7IA 1LBCA 1GTKA 4U4XA 1NNKA 4XTCQ 4OMBA 4HCYA 3BKIB 4U4SA 1CE2A 3O29A 3VDFA 2HAUA 4RJZA 2Q9TA 3VLWA 2G93A
chains in the Genus database with same CATH superfamily
1LEVA 1R1NA 2OX3A 1K9YA 1XOCA 1LB9A 1NV3A 2RCBA 4QSEA 2LAOA 4LP2B 2REGA 1MQHA 2PBWA 3KOTA 1PDAA 3K1NA 1PB7A 5TPAA 3Q29A 4R6HA 5IZZA 3ONMA 4F3BA 4MBPA 4Q5TA 4JSDA 1BLFA 2F35A 1I6QA 5L9MA 3CSGA 3KN3A 1B5JA 4YB7A 1G0IA 1IQ7A 2UVGA 2XD2A 2O7UA 5BUUA 1TFDA 3T9VA 1FQBA 3FV1A 3EQ1A 1URSA 1D4NA 2A5SA 4NTLA 4IB2A 2H25A 5I3SA 4RPOA 4YICA 2UYEA 2V4CA 2XD3A 4F1UA 4O3CA 4NHBA 2RINA 4KFQA 1SD3A 2FIEA 4EF2A 4P47A 1FQCA 3PPQA 2OLBA 3HV1A 3QYTA 4NF5B 1FPBA 1FJ6A 4G68B 4GWYA 3PTYA 5DT6A 3O6IA 3H6TA 2IA4A 3U72A 1B51A 1B58A 1H44A 1JEVA 3W15C 3IL1B 2F3DA 4P0IA 5T3JA 3H3GA 2HZKA 1SW4A 5ISUA 4NX1A 4QBAA 4BDMA 1SW5A 2DE4A 5AA4B 2WYPA 2V25A 1GR2A 1K9ZA 3WAFA 4QRZA 1FQDA 1POTA 1B4ZA 4XKRA 1MS7A 3IOVA 1LSTA 4I8CA 5H8NA 4G8NA 3KZGA 2REJA 2X26A 3K6VA 1USYE 2NWJA 1O64A 4RA1A 3A29A 3I6VA 2DOJA 3LSFB 5ET7A 1MQJA 2ZXTA 1QW0A 3K6WA 5EYFA 4F18A 4OWDA 3K6XA 2GFEA 4WEPA 3I3VA 3O28A 4LN5A 1Q1KA 4K3FA 1LFIA 1ZBMA 4P0GA 4FECA 3SEYA 4GX3A 5AA2D 4QSDA 5CBRA 4R6KA 4BLAA 2I3VA 4QFKA 1EZOA 3TODA 1MDP1 1JW1A 2ZNTA 3RPLA 3IB1A 3C34A 2V3UA 4PAIA 1SI0A 2Y84A 4PFBA 3RTWB 3D1RA 1MXUA 1OVTA 1N3XA 4R73A 2UXAA 2WX9A 3B6TA 5KCJB 3OO9A 4RK9A 4PBQA 3HHFA 1RDZA 3HCQA 3PMWA 3IJOB 3KN7A 3TCHA 3CIJA 3N94A 3MJNA 5A5XB 2ESNA 2Z8FA 4H8IA 4OVRA 5EYGA 4PTKA 1INPA 4PFTA 4EDPA 1B0LA 3ZKLA 2PVUA 5FTIA 2DXYA 2XXYA 3MZBA 4GWZA 4MNPA 5I57A 2DDKA 2F8DA 4OZ9A 2P1SA 5DVJA 3QMFA 1FPLA 3IJXB 4NF8B 4IY5A 2F7BA 1Y4CA 4MHFA 5I5PA 5DW8A 1LGBC 4H8JA 1AH5A 3QXMA 3VFJA 2VGQA 1IMFA 4EQ9A 1XHYA 3C4MA 4Q0CA 3HHGA 4NF6B 2W7YA 1FTMA 2V84A 5AE4A 1FQEA 3HPIA 3M8UA 4OHNA 1NKXA 4C0RA 2O69A 4JVDA 4QXDA 3WAEA 2FVZA 3FGSA 2DP8A 2DYXA 3TTMA 2HZLA 2GHBA 4PETA 4I1DA 3EPEA 2O84X 4OESA 3CSBA 2H4IA 2B4MA 1EZ9A 5AA2A 4HXVA 4TOZA 3VLVA 4G4PA 3ODBA 1FBGA 1D9YA 1NV4A 2Y7PA 3V89B 4F3SA 5TU0A 4FEDA 3JYRA 2VHAA 4U22A 2ALUA 2Y7IA 2XXHA 4BDQA 3JZJA 3MP1A 5ELVA 1L5TA 2YPNA 3TTNA 2HPGA 4HS7A 4KR5A 3KN8A 5IM2A 1B5IA 1RYXA 1Y1MA 5I56B 4XKQA 3DLNA 1P1QA 5H8HA 2R9JA 4P11A 3EF7A 3PPOA 2OWZA 3BFTA 4GF8A 4QFPA 4DXCA 1UTBA 3U65A 1DBZA 3C35A 4ELRA 1MQGA 4MIJA 3W9WA 3K0VA 1VE4A 3V8XB 3UORA 3MVZA 4MFIA 5I59A 3CFZA 3SKPA 2QL3A 5JTYB 2ZZXA 2RF1A 5CMBA 1PBPA 4YAHX 2Q74A 1D3KA 3IORA 5TP9A 3KOSA 1QUIA 4H0WA 4PP0A 5KDTA 5JK4A 3A3UA 2Z8DA 1D9VA 2BJJX 4KCCA 1LCTA 1B3EA 4I3EA 3TZAA 3SEWA 2GQ1A 5IAIA 3H6UA 3VE1B 4U1OA 5L9SA 4JBZA 4FEBA 1H43A 2XXVA 1GV8A 1VFDA 4PFYA 3A09A 3EKIA 3F11A 3MZ9A 3RGYA 2FBPA 2CEYA 1A54A 5H8NB 1MY3A 4LA9A 5I2NA 3B6WA 4KD5A 3TTLA 2I3WA 3TTKA 2XXRA 3LSWA 1IMAA 5CMKA 3PD9A 2QVVA 3KGCA 4F3GA 3OD7A 4FE8A 4ECFA 4U23A 3UP9A 4OQOA 2NOOA 4HE0A 3UN6A 1N04A 4ZEFA 4GBVA 1IMBA 3THIA 4O7MA 3S9EA 4HE1A 3FXUA 1YYZA 2O68A 1BK4A 2OBGA 1JW5A 1B3GA 4RXLA 3IOUA 4DZ1A 5AA3A 4POXA 4OFOA 3LR1A 3CVGA 4DXBA 4R74A 4N8GA 1S7YA 1WVJA 1JW4A 2RC8A 1JETA 1B32A 1S50A 3NOHA 2KQZA 4JWOA 4YMAA 4NG7A 3ILUB 4F3PA 3RTFB 4ZEBA 3OSQA 4TLMB 3G3KA 3LV0A 4IGRA 2XX8A 5L8DA 3KC1A 3EHSA 1XT8A 1M5CA 4R72A 4PDHA 4KYSA 3GZGA 3MQ9A 5DEXA 4I62A 2P0SA 3P7IA 5ITOA 3IFCA 4UA8A 1OMPA 3H6VA 3KEIA 2R8TA 2OWTA 4N17A 5LTCA 2O1MA 3FBPA 1LBXA 4IO6A 4DI4B 4QF9A 2B65A 4IY6A 1JP4A 3R7XA 4X04A 5DTBA 2ABHA 4H1XA 3TKDA 2OK2A 2M8CA 3H03A 1I6BA 2OCUA 2VD2A 1FBEA 3CFLA 4XEQA 4JDFA 1LFHA 2VPOA 4PAFA 2QVUA 2QSXA 1P1OA 5LOMA 4R6YA 1Y4TA 3V5AA 4GLIA 4O3BA 1PB8A 4PQJA 4YMBA 4OFLA 5AA2B 1KZ8A 3O6GA 2I6EA 1PB9A 2D3IA 3K2DA 3D4GA 5J1DA 4OVTA 2QVRA 4ZEKA 4BDLA 3PUZE 3G3HA 4BDRA 4H45A 4Q30B 5CC2A 3DP4A 4JVIA 4PFIA 4E0XA 4N91A 4FJPA 1I69A 3SEUA 4DDDA 3H4ZA 2ZYMA 4NF4A 5EQ9A 2I0BA 3SETA 3TUSA 1B2HA 3UIFA 3MSTA 4G61A 4LONB 4O7IA 3SEXA 4GVOA 3PD8A 1MXYA 5DYHA 3T0JA 1ZIUA 4QFOA 2UVJA 4N81A 4AQ4A 2DWHA 1OIBA 3W9VA 2Z23A 3K4UA 1JQFA 1URDA 1JNFA 2H99A 4M1VA 3HFUA 1MY1A 2DXRA 3G3FA 1GVCA 1HSEA 5F24A 2OWSA 3TFLA 1A8EA 5I59B 1POY1 3OO7A 2Y7WA 3C9HA 3IOWA 4XF5A 4GL8A 3FZVA 1LAHE 1SI1A 5TP9B 3TELA 5KDTB 2CMOA 3B8BA 3FXBA 1JEUA 1B7UA 1B5HA 4JVCA 5CMCA 4Z0IA 3G3GA 4GWOA 4Z7EA 5K2XA 3IO6A 4DIGA 3H6WA 2Q88A 2QJEA 5I2NB 1LBYA 1ANFA 1HSJA 4JWYA 1ZU0A 3RN8A 4KHZE 1UQWA 2CZIA 2XWKA 3ECRA 3MZ1A 4OEVA 4EXKA 1JVYA 4AS5A 3GXAA 3T9HB 3BFUA 4FAJA 4XKNA 2PFYA 3IX1A 5I2KA 2F6GA 3DP8A 1EYJA 3IAZA 2ONKE 4PC9A 4GX6A 5HM4B 1EZPA 3O9PA 1NH8A 1NUXA 3B7DA 3T9XB 1Y1ZA 3KFMA 4GOTA 2QPQA 4MF3A 2P3NA 1XC1A 1Z7ME 4ZE9A 3KG2A 1YAEA 4IGTA 3O66A 4ZZEA 1IXIA 3RT6B 2H9BA 4O3AA 4ZEIA 1P99A 2DWIA 1SYHA 3JV9A 2HFBA 3CG1A 2HEUA 4THIA 1YCJA 1H76A 2YLNA 3G3IA 4RY1A 1KWHA 4GQOA 4OENA 1B52A 4JWXA 4KYDA 4MLQA 1XI6A 1AMFA 1NUWA 1TXFA 2RCAA 1DSNA 1M5DA 2Z8EA 3TTRA 4H6DA 4H67A 2QS1A 3TDJA 3EHTA 1FTAA 1B4HA 1Q35A 3TMGA 4XFEA 4EXLA 3D4CA 2P2AA 4GWUA 2WKYA 2QMWA 2DE2A 3TYHA 3CR9A 2UVHA 5H8FA 1NI9A 2F7AA 1FBPA 4NAPA 1B3HA 2Q8MA 4P9KA 1XVYA 1IZ1A 1B7HA 3B6QA 4DI3D 3S9MC 1LBBA 4OA4A 3LUZA 1VSOA 4R2FA 1B3LA 4ONYA 1N76A 2WBDA 4Q8RA 3K1PA 2PMSA 1T0KA 4EF1A 4WXJA 3L6GA 3ZSFA 5FHMA 2QS2A 3M3FA 3S4UA 3FVKA 4ZS9A 1MY2A 5LDZA 2XA5A 2H5YA 1FTJA 1OVBA 1FW0A 4ESWA 4PE3A 1FPIA 4NWCA 3VXCA 2V3QA 2RKMA 1O7TA 4U1ZA 2ANJA 3CHGA 1SW1A 2ZNSA 3OSRA 4ZDMA 4OVJA 4F2OA 3SDFA 5TPAB 2XXIA 1LLSA 4KI0E 4YZZA 4LZ8A 3T96B 3OEKA 4X9TA 5B7DA 2F5XA 2F34A 4O8MA 2CZHA 1DTGA 4P1EA 1R6ZA 3SZPA 1ZKBA 4PAKA 2XX7A 3KJTA 1QKAA 4QHQA 2AIXA 4RNSA 1EYKA 2QFLA 1FRPA 3RUMA 5EHSA 4I9DA 1BTJA 1BIYA 4PFRA 3QUJA 3RY3A 1MXZA 4P8BA 4N15A 1UTHA 3C36A 2Y7RA 2DWJA 4IO2A 1R9QA 1N7WA 4PF6A 4YB5A 3BBRA 4PE5B 1B05A 4F2QA 3RNNA 4AB5A 4OERA 4ESXA 3GBAA 1IMDA 3E3KA 4WEDA 1MXXA 1IXHA 2WYKA 4AB6A 2WBBA 2AL5A 2B4LA 4JXIA 5K2YA 1Y3NA 3V83A 4KXPA 2VOZA 1FPGA 2F78A 1XS5A 4ZECA 3FUZA 4G68A 3MAMA 1KA1A 4PFWA 1ATGA 1IXCA 3QSLA 1SW2A 5F1QA 1SPIA 2DVZA 5EHMA 1OQHA 4EQBA 1F9BA 3UK4A 1YPNA 1NV1A 2Q8JA 1M5FA 1GGGA 5HPQA 2CEXA 3FVNA 5I58A 2OJTA 4G8MA 1Y3PA 5AA4A 2UYFA 2I0CA 4IO7A 1ZLQA 4ND9A 5EQAA 3OOAA 1ELJA 4GD5A 1RKMA 1NH7A 3OENA 1USYH 3MP6A 1FPFA 2Y7KA 5H8SA 1MPDA 1YZ0A 3RPLB 4DLDA 3ROJA 3U94A 5EYHA 3FIRA 4FORA 4GRKA 5IZ3A 2RC7A 1QVSA 2FA7A 1VR5A 4YB6A 3K01A 2XX9A 4R9GA 3MPLA 3KBZA 3R6UA 5CBSA 3TQWA 3PU5A 2DVCA 4MMPA 1LBZA 1B7ZA 2QMXA 4F39A 3TEPA 1OQGA 1G0HA 3MVYA 3DELB 2NVUB 4N13A 4MEVA 5J16A 5ET5A 3K00A 2I4BA 2XXKA 5I57B 4GWSA 3S9LC 4ELQA 4F22A 5HBCA 1UIUA 5H8QA 4ZZAA 1FPDA 3VXBA 4F31B 1MM7A 4QSCA 2F3BA 3FASA 1US4A 1IMEA 5A5XA 2B3BA 3H7MA 2XXQA 2I49A 3Q28A 1WODA 4MAGA 5B70A 2WEFA 2F6PA 4P3LA 4U2RA 1FBCA 3T9UA 3E9XA 2O51A 3FXQA 1FCKA 1NNPA 3MBPA 1HSLA 4AS4A 2ZNUA 1H3DA 2DE3A 1O63A 4NEDA 1Z7NE 4NF8A 4H5FA 4IO3A 2R71A 2I4CA 2FYIA 1MM6A 1ZTYA 2XXWA 4R9FA 4IR8A 4NF6A 3E79A 2XWIA 1FBHA 3VLUA 5FHOA 1IEJA 2X7QA 1B3FA 3BIGA 3O97A 1Y3QA 4KPTA 2QRYA 3QIMA 3OO8A 1A99A 3C33A 3T93B 2HXRA 4I40A 3MVWA 1NL5A 4PGPA 4DCYA 1I6AA 3MUQA 1MY4A 2PX1A 3G7WA 4MH5A 4IO4A 3L6HA 5H8HB 1IUDA 1SYIA 3TPAA 4HTGA 5EQ8A 4WKMA 4GL0A 4NN3A 3E13X 2I48A 1UTBB 2CZLA 1QKBA 2ONSA 1EU8A 2ZYNA 3GBBA 1FSAA 5BWJA 1EH3A 4EQ7A 3PUWE 4DCXA 4H46A 3PMVA 1CNQA 1UTHB 2YJPA 1Y20A 2I58A 4YKKA 1TT1A 1DPPA 3VVEA 1LAFE 2VT5A 3VV5A 1OLAA 3HO7A 4X8RA 1LBWA 3PUVE 5I56A 3IB0A 4N6DA 3T66A 1B9JA 3EN3A 3HN0A 1UIVA 1LB8A 3TCGA 3PPRA 1N84A 4DXUA 4QFNA 4PBHA 1NNTA 2HAVA 2HHMA 4N4UA 4BDOA 1II5A 1VFEA 3M3LA 1TFAA 4G77A 1B1XA 3QUFA 3LSXA 1LAGE 5JTYA 2XWOA 2D21A 5I7IA 4POWA 4GIZA 2P3VA 4MNCA 3PUXE 4MCOA 4OEUA 1LAXA 2PCRA 1RYOA 1FBDA 4YKPA 4OTEA 2JJKA 1NV6A 4OVSA 4FATA 4GFRA 3CG3A 3N5LA 3OO6A 1SDXA 1M5BA 4OXVA 3FJGA 5I58B 5CRYA 3OMBA 2NXOA 1MH4A 3MP8A 3UGWA 4P1LA 2AL4A 1QJMA 3S2VA 3MPKA 1FPEA 2PT2A 3IOTA 4N07A 3FXRA 1US5A 3ZKKA 1N0TA 5FTHA 4LVQA 5ET6A 2F7CA 3CRBA 1DCUA 4GXAA 1FQAA 2O1LA 4NGUA 4R2BA 4DE8A 5IZ3B 5IGAA 2XXUA 4HE2A 4GWXA 3MVXA 1P1WA 2THIA 4NF0A 1DK4A 3OELA 5IKBA 4NE4A 1TWYA 3FJ7A 3IO4A 3EHUA 1AIVA 2H98A 4NMYA 4MX6A 4OFJA 1P1UA 1DTZA 1NFTA 3E4RA 4NWDA 2V93A 1FPKA 2PYYA 2GHAA 1J1NA 1LFGA 4NQ8A 4BDNA 1NUYA 2R6GE 5DEXB 1Y9UA 5H8QB 4KCDA 2HXWA 3DM0A 1EYIA 4X48A 2E1SA 3MC2A 4I3YA 3MW0A 3U93A 1MPBA 4JSOA 4X1DA 2B3FA 2F97A 2CZKA 4C1TA 1MRPA 5CI5A 3TCFA 4PDDA 4G8HA 2AYSA 1PBQA 5FBPA 4MNIA 2A5TA 3RLFE 3OXNA 2Q2AA 1BKAA 4KQPA 4LQ2A 5M2VA 4TQUQ 4F29A 4XKPA 3PPPA 4LQ5A 3TAJA 1YXIA 2Q2CA 4ELPA 1FPJA 2XWVA 3T22A 3IFAA 1B46A 1DMBA 5DVFA 2DWAA 1M5EA 3IB2A 1SQYA 1MY0A 3K1MA 3UA8A 1DOTA 1LCFA 3N6UA 1SBPA 1A40A 4N8YA 4GWWA 4OVPA 3CFXA 4PF8A 4O94A 1MPCA 4ELOA 3RT8A 5ICTA 4PCDA 2HQ0A 3IR1A 4N6KA 2V3TA 2X7PA 3N6TA 4FBPA 2Y5LA 1RDXA 1A8FA 1QGXA 4NF4B 3LSLA 1IMCA 1IIWA 3SEVA 2Q89A 5JEIA 4ISUA 1FTKA 1N7XA 3VVDA 4HCWA 3O2AA 3T1BA 3RQTA 4YU0A 1N3WA 2XXTA 3OEMA 2KLFA 3SERA 2QS3A 3FVOA 1B0HA 3K6UA 5EQ7A 1IITA 1VDWA 4E0WA 4F19A 1MXVA 4XIGQ 1B6HA 4M4GA 1NNFA 5ICQA 1NV2A 3U8QA 4OYVA 4UABA 5KZTA 2MKZA 4LZ5A 1Q9DA 1B1HA 1MQDA 3ZS6A 4F1VA 2XXPA 1AOVA 3LUYA 1JVXA 1KA0A 2QS4A 2XXXA 2PFZA 3K02A 2ZZVA 3PGFA 1CB6A 3DP6A 4PFUA 3U1OA 3ILTB 3PUYE 5AA1A 3USDA 2VP1A 3MWBA 3H06B 2Z22A 3E78A 3I5OA 2L5VA 4N6PA 1MQIA 3C32A 4GBWA 2UVIA 1A55A 4ZEDA 4OETA 4LUBA 1QULA 3O6HA 4U21A 4NF5A 1FJ9A 1NV7A 2E0SA 2O6AA 3N26A 4RPNA 3ISPA 1R9LA 3FATA 3PV0E 4OVQA 5CM6A 5I2KB 4H5GA 3Q25A 4FIMA 4R75A 1QUKA 4TLLB 2G29A 1P1NA 3GYYA 2BJIA 2Y5KA 3FD3A 4UACA 1XVXA 1PEBA 2OZZA 1B40A 4X1BA 1MH3A 2ZZWA 2IEEA 5F7VA 1MDQA 1QUJA 4G2ZA 4PGNA 5I84A 3IK6B 2F36A 2FIXA 2ZMBA 2DQVA 1NV5A 4OANA 5ET8A 1AWBA 2DSFA 4JB7A 3BIHA 3A3CA 1DPEA 3QAXA 4H65A 3FJMA 3KSXA 3M3KA 3RPWA 1FTLA 1LBVA 4XXUA 1NMUA 1NUZA 5IZ1A 1WDNA 1FQFA 1ZMGA 1AL3A 4IO5A 1D9QA 2GH9A 3R26A 1OLCA 2D5WA 3FV2A 4G68C 4LATA 4L17A 3C31A 1FTOA 3KC0A 2ZYKA 4HW8A 3B50A 4YKJA 1YTVA 2ONRA 2PT1A 3AXFA 3SESA 1PC3A 1MXWA 2ZYOA 2DS9A 3G3JA 4GXSB 3Q26A 3CI8A 4RYAA 5H8FB 4RK2A 4MJOA 2KR0A 1URGA 2FHYA 5KCJA 4F1YA 2A5TB 3VVFA 4QFLA 3TQLA 3Q27A 1SVXB 2FNCA 3GLBA 2NUVA 5DVIA 2XHDA 4C1UA 1RDYA 3HSTA 3PMXA 4ZE8A 3KBRA 4KYEA 4YKIA 3KJ7A 3U92A 1S9TA 3KSJA 4LZ7A 5ESYA 3QK6A 4P56A 1ZJLA 3LBSA 1MG1A 5L9OA 3FVGA 4MLVA 5FHNA 3S9NC 2HCAA 5ITPA 2VPNA 2VD3A 3PPNA 1A7LA 4EUOA 1BP5A 1IXGA 3RYDA 2RC9A 1NV0A 5CMMA 3LC8A 1H45A 3MYUA 4GX4A 2GRVA 2O7IA 1LBCA 1GTKA 4U4XA 1FBFA 1NNKA 4XTCQ 4OMBA 4HCYA 3BKIB 4U4SA 1CE2A 3O29A 3VDFA 2HAUA 4RJZA 5A5LA 2Q9TA 3VLWA 2G93A
chains in the Genus database with same CATH topology
1R1NA 1XOCA 1LB9A 2RCBA 4QSEA 2LAOA 4LP2B 2REGA 1MQHA 2PBWA 3KOTA 1PDAA 3K1NA 1PB7A 5TPAA 3Q29A 4R6HA 3ONMA 4F3BA 4MBPA 4Q5TA 4JSDA 1BLFA 2F35A 1I6QA 5L9MA 3CSGA 3KN3A 1B5JA 4YB7A 1IQ7A 2UVGA 2XD2A 2O7UA 5BUUA 1TFDA 3T9VA 1FQBA 3FV1A 3EQ1A 1URSA 1D4NA 2A5SA 4NTLA 4IB2A 2H25A 4RPOA 4YICA 2UYEA 2XD3A 4F1UA 4O3CA 2RINA 4KFQA 1SD3A 4EF2A 1FQCA 3PPQA 2OLBA 3HV1A 3QYTA 4NF5B 4G68B 5DT6A 3O6IA 3H6TA 2IA4A 3U72A 1B51A 1B58A 1H44A 1JEVA 3W15C 3IL1B 4P0IA 3H3GA 2HZKA 1SW4A 5ISUA 4BDMA 1SW5A 2DE4A 5AA4B 2V25A 1GR2A 3WAFA 4QRZA 1FQDA 1POTA 1B4ZA 4XKRA 1MS7A 3IOVA 1LSTA 4I8CA 5H8NA 4G8NA 3KZGA 2REJA 2X26A 3K6VA 1USYE 2NWJA 1O64A 4RA1A 3I6VA 2DOJA 3LSFB 1MQJA 2ZXTA 1QW0A 3K6WA 5EYFA 4F18A 4OWDA 3K6XA 2GFEA 4WEPA 3I3VA 3O28A 1Q1KA 4K3FA 1LFIA 1ZBMA 4P0GA 4FECA 3SEYA 5AA2D 4QSDA 5CBRA 4R6KA 4BLAA 2I3VA 4QFKA 1EZOA 3TODA 1MDP1 1JW1A 2ZNTA 3IB1A 3C34A 2V3UA 1SI0A 2Y84A 3RTWB 1MXUA 1OVTA 1N3XA 4R73A 2UXAA 3B6TA 5KCJB 3OO9A 4RK9A 3HHFA 3HCQA 3PMWA 3IJOB 3KN7A 3TCHA 3CIJA 3N94A 3MJNA 5A5XB 2ESNA 2Z8FA 4H8IA 4PFTA 4EDPA 1B0LA 3ZKLA 2PVUA 5FTIA 2DXYA 2XXYA 3MZBA 5I57A 2F8DA 4OZ9A 2P1SA 5DVJA 3IJXB 4NF8B 4IY5A 2F7BA 1Y4CA 1LGBC 3VFJA 1AH5A 3QXMA 4H8JA 2VGQA 4EQ9A 1XHYA 3C4MA 4Q0CA 3HHGA 4NF6B 2W7YA 1FTMA 2V84A 5AE4A 1FQEA 3HPIA 3M8UA 4OHNA 1NKXA 4C0RA 2O69A 3WAEA 3FGSA 2DP8A 2DYXA 3TTMA 2HZLA 2GHBA 4PETA 4I1DA 3EPEA 2O84X 4OESA 3CSBA 2H4IA 1EZ9A 5AA2A 4TOZA 3VLVA 4G4PA 3ODBA 1D9YA 2Y7PA 3V89B 4F3SA 5TU0A 4FEDA 3JYRA 2VHAA 4U22A 2ALUA 2Y7IA 2XXHA 4BDQA 3JZJA 3MP1A 5ELVA 1L5TA 2YPNA 3TTNA 4HS7A 4KR5A 3KN8A 1B5IA 1RYXA 1Y1MA 5I56B 4XKQA 3DLNA 1P1QA 5H8HA 2R9JA 4P11A 3EF7A 3PPOA 3BFTA 4GF8A 4QFPA 4DXCA 1UTBA 3C35A 4ELRA 1MQGA 3W9WA 3K0VA 1VE4A 3V8XB 3UORA 3MVZA 4MFIA 5I59A 3CFZA 3SKPA 2QL3A 5JTYB 2RF1A 5CMBA 1PBPA 4YAHX 1D3KA 3IORA 5TP9A 3KOSA 1QUIA 4H0WA 4PP0A 5KDTA 5JK4A 3A3UA 2Z8DA 1D9VA 2BJJX 4KCCA 1LCTA 1B3EA 3TZAA 3SEWA 5IAIA 3H6UA 3VE1B 4U1OA 5L9SA 4JBZA 4FEBA 1H43A 2XXVA 1GV8A 1VFDA 3A09A 3F11A 4PFYA 3MZ9A 3RGYA 5H8NB 1A54A 1MY3A 4LA9A 5I2NA 3B6WA 4KD5A 3TTLA 2I3WA 3TTKA 2XXRA 3LSWA 5CMKA 3PD9A 3KGCA 4F3GA 3OD7A 4FE8A 4ECFA 4U23A 3UP9A 4OQOA 2NOOA 3UN6A 1N04A 4ZEFA 3THIA 3S9EA 3FXUA 2O68A 2OBGA 1JW5A 1B3GA 4RXLA 3IOUA 4DZ1A 5AA3A 4POXA 4OFOA 3LR1A 3CVGA 4DXBA 4R74A 1S7YA 1WVJA 1JW4A 2RC8A 1JETA 1B32A 1S50A 4YMAA 4JWOA 3ILUB 4F3PA 3RTFB 4ZEBA 3OSQA 4TLMB 3G3KA 4IGRA 2XX8A 5L8DA 3EHSA 1XT8A 1M5CA 4R72A 4KYSA 3GZGA 3MQ9A 5DEXA 4I62A 2P0SA 3P7IA 5ITOA 4UA8A 1OMPA 3H6VA 3KEIA 2OWTA 2O1MA 4IO6A 4QF9A 2B65A 4IY6A 3R7XA 5DTBA 2ABHA 4H1XA 3TKDA 2OK2A 2M8CA 3H03A 1I6BA 2OCUA 2VD2A 3CFLA 4JDFA 1LFHA 2QSXA 1P1OA 5LOMA 4R6YA 1Y4TA 3V5AA 4GLIA 4O3BA 1PB8A 4PQJA 4YMBA 4OFLA 5AA2B 3O6GA 2I6EA 1PB9A 2D3IA 3K2DA 3D4GA 5J1DA 4BDLA 4ZEKA 3PUZE 3G3HA 4BDRA 4Q30B 5CC2A 3DP4A 4E0XA 4FJPA 1I69A 3SEUA 4DDDA 3H4ZA 2ZYMA 4NF4A 2I0BA 3SETA 3TUSA 1B2HA 3UIFA 4LONB 3SEXA 4GVOA 3PD8A 1MXYA 5DYHA 1ZIUA 4QFOA 2UVJA 4AQ4A 2DWHA 1OIBA 3W9VA 2Z23A 3K4UA 1JQFA 1URDA 1JNFA 2H99A 4M1VA 1MY1A 2DXRA 3G3FA 1GVCA 1HSEA 2OWSA 3TFLA 1A8EA 5I59B 1POY1 3OO7A 2Y7WA 3C9HA 3IOWA 4GL8A 3FZVA 1LAHE 1SI1A 5TP9B 3TELA 5KDTB 2CMOA 1JEUA 1B7UA 1B5HA 5CMCA 4Z0IA 3G3GA 4GWOA 4Z7EA 5K2XA 3IO6A 4DIGA 3H6WA 2Q88A 2QJEA 5I2NB 1ANFA 1HSJA 4JWYA 1ZU0A 3RN8A 4KHZE 1UQWA 3ECRA 3MZ1A 4OEVA 4EXKA 1JVYA 3GXAA 3T9HB 3BFUA 4FAJA 4XKNA 3IX1A 5I2KA 2F6GA 3DP8A 3IAZA 2ONKE 5HM4B 1EZPA 3O9PA 1NH8A 3B7DA 3T9XB 1Y1ZA 3KFMA 4GOTA 2QPQA 4MF3A 1XC1A 1Z7ME 4ZE9A 3KG2A 1YAEA 4IGTA 3O66A 4ZZEA 1IXIA 3RT6B 2H9BA 4O3AA 4ZEIA 1P99A 2DWIA 1SYHA 3JV9A 2HFBA 3CG1A 2HEUA 4THIA 1YCJA 1H76A 2YLNA 3G3IA 4RY1A 1KWHA 4GQOA 4OENA 1B52A 4JWXA 4KYDA 4MLQA 1AMFA 1TXFA 2RCAA 1DSNA 1M5DA 2Z8EA 3TTRA 4H6DA 4H67A 2QS1A 3TDJA 3EHTA 1B4HA 1Q35A 3TMGA 4EXLA 3D4CA 2P2AA 2WKYA 2QMWA 2DE2A 3TYHA 3CR9A 2UVHA 5H8FA 2F7AA 1B3HA 1XVYA 1IZ1A 1B7HA 3B6QA 3S9MC 1LBBA 1VSOA 4R2FA 1B3LA 4ONYA 1N76A 4Q8RA 3K1PA 2PMSA 1T0KA 4EF1A 4WXJA 3L6GA 3ZSFA 5FHMA 2QS2A 3M3FA 3S4UA 3FVKA 4ZS9A 1MY2A 2H5YA 1FTJA 1OVBA 1FW0A 4ESWA 4NWCA 3VXCA 2V3QA 2RKMA 1O7TA 4U1ZA 2ANJA 1SW1A 2ZNSA 3OSRA 4ZDMA 4OVJA 4F2OA 3SDFA 5TPAB 2XXIA 1LLSA 4KI0E 4YZZA 4LZ8A 3T96B 3OEKA 4X9TA 5B7DA 2F5XA 2F34A 1DTGA 1R6ZA 1ZKBA 2XX7A 3KJTA 1QKAA 4QHQA 2AIXA 4RNSA 3RUMA 5EHSA 4I9DA 1BTJA 1BIYA 3QUJA 3RY3A 1MXZA 1UTHA 3C36A 2Y7RA 2DWJA 4IO2A 1R9QA 1N7WA 4YB5A 3BBRA 4PE5B 1B05A 4F2QA 3RNNA 4AB5A 4OERA 4ESXA 3GBAA 3E3KA 4WEDA 1MXXA 1IXHA 4AB6A 2AL5A 4JXIA 5K2YA 1Y3NA 3V83A 2VOZA 2F78A 1XS5A 4ZECA 3FUZA 4G68A 3MAMA 4PFWA 1ATGA 1IXCA 3QSLA 1SW2A 5F1QA 2DVZA 5EHMA 1OQHA 4EQBA 1F9BA 3UK4A 1YPNA 2Q8JA 1M5FA 1GGGA 5HPQA 3FVNA 5I58A 2OJTA 4G8MA 1Y3PA 5AA4A 2UYFA 2I0CA 4IO7A 1ZLQA 4ND9A 3OOAA 1ELJA 4GD5A 1RKMA 1NH7A 3OENA 1USYH 3MP6A 2Y7KA 5H8SA 1MPDA 4DLDA 3U94A 3FIRA 4FORA 4GRKA 2RC7A 1QVSA 2FA7A 1VR5A 4YB6A 3K01A 2XX9A 4R9GA 3MPLA 3R6UA 5CBSA 3TQWA 3PU5A 2DVCA 1B7ZA 2QMXA 4F39A 3TEPA 1OQGA 3MVYA 3DELB 2NVUB 4N13A 3K00A 2I4BA 5I57B 3S9LC 4ELQA 4F22A 5HBCA 1UIUA 5H8QA 4ZZAA 3VXBA 4F31B 1MM7A 4QSCA 3FASA 1US4A 5A5XA 2B3BA 3H7MA 2XXQA 2I49A 3Q28A 1WODA 5B70A 2F6PA 4U2RA 3T9UA 3E9XA 2O51A 3FXQA 1FCKA 1NNPA 3MBPA 1HSLA 2ZNUA 1H3DA 2DE3A 1O63A 4NEDA 1Z7NE 4NF8A 4H5FA 4IO3A 2R71A 2I4CA 2FYIA 1MM6A 1ZTYA 2XXWA 4R9FA 4NF6A 3VLUA 5FHOA 1IEJA 2X7QA 1B3FA 3O97A 1Y3QA 4KPTA 2QRYA 3QIMA 3OO8A 1A99A 3C33A 3T93B 3MVWA 1NL5A 4DCYA 1I6AA 3MUQA 1MY4A 2PX1A 3G7WA 4MH5A 4IO4A 3L6HA 5H8HB 1IUDA 1SYIA 3TPAA 4HTGA 4WKMA 4GL0A 3E13X 2I48A 1UTBB 2CZLA 1QKBA 2ONSA 1EU8A 2ZYNA 3GBBA 5BWJA 1EH3A 4EQ7A 3PUWE 4DCXA 3PMVA 1UTHB 2YJPA 1Y20A 2I58A 4YKKA 1TT1A 1DPPA 3VVEA 1LAFE 3VV5A 1OLAA 3HO7A 3PUVE 5I56A 3IB0A 3T66A 1B9JA 3EN3A 3HN0A 1UIVA 1LB8A 3TCGA 3PPRA 1N84A 4DXUA 4QFNA 1NNTA 2HAVA 4BDOA 1II5A 1VFEA 3M3LA 1TFAA 4G77A 1B1XA 3QUFA 3LSXA 1LAGE 5JTYA 2D21A 4POWA 4GIZA 3PUXE 4OEUA 1LAXA 1RYOA 4YKPA 4OTEA 4FATA 4GFRA 3CG3A 3N5LA 3OO6A 1SDXA 1M5BA 4OXVA 3FJGA 5I58B 5CRYA 3OMBA 2NXOA 1MH4A 3MP8A 3UGWA 2AL4A 1QJMA 3S2VA 3MPKA 2PT2A 3IOTA 4N07A 3FXRA 1US5A 3ZKKA 1N0TA 5FTHA 4LVQA 2F7CA 3CRBA 4GXAA 1FQAA 2O1LA 4R2BA 4DE8A 2XXUA 3MVXA 1P1WA 2THIA 3OELA 5IKBA 4NE4A 1TWYA 3FJ7A 3IO4A 3EHUA 1AIVA 2H98A 4NMYA 4OFJA 1P1UA 1DTZA 1NFTA 3E4RA 4NWDA 2V93A 2PYYA 2GHAA 1J1NA 1LFGA 4BDNA 2R6GE 5DEXB 1Y9UA 5H8QB 4KCDA 2HXWA 3DM0A 4X48A 2E1SA 3MC2A 3MW0A 3U93A 1MPBA 4JSOA 4X1DA 2B3FA 2F97A 4C1TA 1MRPA 5CI5A 3TCFA 4G8HA 2AYSA 1PBQA 2A5TA 3RLFE 3OXNA 2Q2AA 1BKAA 4KQPA 4LQ2A 5M2VA 4TQUQ 4F29A 4XKPA 3PPPA 4LQ5A 3TAJA 2Q2CA 4ELPA 3T22A 1B46A 1DMBA 5DVFA 2DWAA 1M5EA 3IB2A 1SQYA 1MY0A 3K1MA 3UA8A 1DOTA 1LCFA 3N6UA 1SBPA 1A40A 3CFXA 1MPCA 4ELOA 3RT8A 5ICTA 2HQ0A 3IR1A 2V3TA 2X7PA 3N6TA 1A8FA 4NF4B 3LSLA 1IIWA 3SEVA 2Q89A 5JEIA 4ISUA 1FTKA 1N7XA 3VVDA 4HCWA 3O2AA 3RQTA 4YU0A 1N3WA 2XXTA 3OEMA 2KLFA 3SERA 2QS3A 3FVOA 1B0HA 3K6UA 1IITA 4E0WA 4F19A 1MXVA 4XIGQ 1B6HA 4M4GA 1NNFA 5ICQA 3U8QA 4OYVA 5KZTA 4LZ5A 1B1HA 1MQDA 3ZS6A 4F1VA 2XXPA 1AOVA 3LUYA 1JVXA 2QS4A 2XXXA 3K02A 3PGFA 1CB6A 3DP6A 4PFUA 3U1OA 3ILTB 3PUYE 5AA1A 3USDA 2VP1A 3MWBA 3H06B 2Z22A 3I5OA 4N6PA 1MQIA 3C32A 2UVIA 1A55A 4ZEDA 4OETA 4LUBA 1QULA 3O6HA 4U21A 4NF5A 2E0SA 2O6AA 3N26A 4RPNA 1R9LA 3FATA 3PV0E 5CM6A 5I2KB 4H5GA 3Q25A 4FIMA 4R75A 1QUKA 4TLLB 2G29A 1P1NA 3FD3A 4UACA 1XVXA 1PEBA 2OZZA 1B40A 4X1BA 1MH3A 2IEEA 5F7VA 1MDQA 1QUJA 4G2ZA 5I84A 3IK6B 2F36A 2ZMBA 2DQVA 2DSFA 4JB7A 3A3CA 1DPEA 3QAXA 4H65A 3FJMA 3KSXA 3M3KA 3RPWA 1FTLA 4XXUA 1NMUA 1WDNA 1FQFA 1ZMGA 1AL3A 4IO5A 2GH9A 3R26A 1OLCA 2D5WA 3FV2A 4G68C 4LATA 4L17A 3C31A 1FTOA 2ZYKA 4HW8A 4YKJA 1YTVA 2ONRA 2PT1A 3AXFA 3SESA 1PC3A 1MXWA 2ZYOA 2DS9A 3G3JA 4GXSB 3Q26A 3CI8A 4RYAA 5H8FB 4RK2A 1URGA 5KCJA 4F1YA 2A5TB 3VVFA 4QFLA 3TQLA 3Q27A 1SVXB 2FNCA 3GLBA 2NUVA 5DVIA 2XHDA 4C1UA 3HSTA 3PMXA 4ZE8A 3KBRA 4KYEA 4YKIA 3KJ7A 3U92A 1S9TA 3KSJA 4LZ7A 3QK6A 1ZJLA 3LBSA 1MG1A 5L9OA 3FVGA 4MLVA 5FHNA 3S9NC 2HCAA 5ITPA 2VD3A 3PPNA 1A7LA 4EUOA 1BP5A 1IXGA 2RC9A 5CMMA 3LC8A 1H45A 2GRVA 2O7IA 1LBCA 1GTKA 4U4XA 1NNKA 4XTCQ 4OMBA 4HCYA 3BKIB 4U4SA 1CE2A 3O29A 3VDFA 2HAUA 4RJZA 2Q9TA 3VLWA 2G93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1N A;  1XOC A;  1LB9 A;  2RCB A;  4QSE A;  2LAO A;  4LP2 B;  2REG A;  1MQH A;  2PBW A;  3KOT A;  1PDA A;  3K1N A;  1PB7 A;  5TPA A;  3Q29 A;  4R6H A;  3ONM A;  4F3B A;  4MBP A;  4Q5T A;  4JSD A;  1BLF A;  2F35 A;  1I6Q A;  5L9M A;  3CSG A;  3KN3 A;  1B5J A;  4YB7 A;  1IQ7 A;  2UVG A;  2XD2 A;  2O7U A;  5BUU A;  1TFD A;  3T9V A;  1FQB A;  3FV1 A;  3EQ1 A;  1URS A;  1D4N A;  2A5S A;  4NTL A;  4IB2 A;  2H25 A;  4RPO A;  4YIC A;  2UYE A;  2XD3 A;  4F1U A;  4O3C A;  2RIN A;  4KFQ A;  1SD3 A;  4EF2 A;  1FQC A;  3PPQ A;  2OLB A;  3HV1 A;  3QYT A;  4NF5 B;  4G68 B;  5DT6 A;  3O6I A;  3H6T A;  2IA4 A;  3U72 A;  1B51 A;  1B58 A;  1H44 A;  1JEV A;  3W15 C;  3IL1 B;  4P0I A;  3H3G A;  2HZK A;  1SW4 A;  5ISU A;  4BDM A;  1SW5 A;  2DE4 A;  5AA4 B;  2V25 A;  1GR2 A;  3WAF A;  4QRZ A;  1FQD A;  1POT A;  1B4Z A;  4XKR A;  1MS7 A;  3IOV A;  1LST A;  4I8C A;  5H8N A;  4G8N A;  3KZG A;  2REJ A;  2X26 A;  3K6V A;  1USY E;  2NWJ A;  1O64 A;  4RA1 A;  3I6V A;  2DOJ A;  3LSF B;  1MQJ A;  2ZXT A;  1QW0 A;  3K6W A;  5EYF A;  4F18 A;  4OWD A;  3K6X A;  2GFE A;  4WEP A;  3I3V A;  3O28 A;  1Q1K A;  4K3F A;  1LFI A;  1ZBM A;  4P0G A;  4FEC A;  3SEY A;  5AA2 D;  4QSD A;  5CBR A;  4R6K A;  4BLA A;  2I3V A;  4QFK A;  1EZO A;  3TOD A;  1MDP 1;  1JW1 A;  2ZNT A;  3IB1 A;  3C34 A;  2V3U A;  1SI0 A;  2Y84 A;  3RTW B;  1MXU A;  1OVT A;  1N3X A;  4R73 A;  2UXA A;  3B6T A;  5KCJ B;  3OO9 A;  4RK9 A;  3HHF A;  3HCQ A;  3PMW A;  3IJO B;  3KN7 A;  3TCH A;  3CIJ A;  3N94 A;  3MJN A;  5A5X B;  2ESN A;  2Z8F A;  4H8I A;  4PFT A;  4EDP A;  1B0L A;  3ZKL A;  2PVU A;  5FTI A;  2DXY A;  2XXY A;  3MZB A;  5I57 A;  2F8D A;  4OZ9 A;  2P1S A;  5DVJ A;  3IJX B;  4NF8 B;  4IY5 A;  2F7B A;  1Y4C A;  1LGB C;  3VFJ A;  1AH5 A;  3QXM A;  4H8J A;  2VGQ A;  4EQ9 A;  1XHY A;  3C4M A;  4Q0C A;  3HHG A;  4NF6 B;  2W7Y A;  1FTM A;  2V84 A;  5AE4 A;  1FQE A;  3HPI A;  3M8U A;  4OHN A;  1NKX A;  4C0R A;  2O69 A;  3WAE A;  3FGS A;  2DP8 A;  2DYX A;  3TTM A;  2HZL A;  2GHB A;  4PET A;  4I1D A;  3EPE A;  2O84 X;  4OES A;  3CSB A;  2H4I A;  1EZ9 A;  5AA2 A;  4TOZ A;  3VLV A;  4G4P A;  3ODB A;  1D9Y A;  2Y7P A;  3V89 B;  4F3S A;  5TU0 A;  4FED A;  3JYR A;  2VHA A;  4U22 A;  2ALU A;  2Y7I A;  2XXH A;  4BDQ A;  3JZJ A;  3MP1 A;  5ELV A;  1L5T A;  2YPN A;  3TTN A;  4HS7 A;  4KR5 A;  3KN8 A;  1B5I A;  1RYX A;  1Y1M A;  5I56 B;  4XKQ A;  3DLN A;  1P1Q A;  5H8H A;  2R9J A;  4P11 A;  3EF7 A;  3PPO A;  3BFT A;  4GF8 A;  4QFP A;  4DXC A;  1UTB A;  3C35 A;  4ELR A;  1MQG A;  3W9W A;  3K0V A;  1VE4 A;  3V8X B;  3UOR A;  3MVZ A;  4MFI A;  5I59 A;  3CFZ A;  3SKP A;  2QL3 A;  5JTY B;  2RF1 A;  5CMB A;  1PBP A;  4YAH X;  1D3K A;  3IOR A;  5TP9 A;  3KOS A;  1QUI A;  4H0W A;  4PP0 A;  5KDT A;  5JK4 A;  3A3U A;  2Z8D A;  1D9V A;  2BJJ X;  4KCC A;  1LCT A;  1B3E A;  3TZA A;  3SEW A;  5IAI A;  3H6U A;  3VE1 B;  4U1O A;  5L9S A;  4JBZ A;  4FEB A;  1H43 A;  2XXV A;  1GV8 A;  1VFD A;  3A09 A;  3F11 A;  4PFY A;  3MZ9 A;  3RGY A;  5H8N B;  1A54 A;  1MY3 A;  4LA9 A;  5I2N A;  3B6W A;  4KD5 A;  3TTL A;  2I3W A;  3TTK A;  2XXR A;  3LSW A;  5CMK A;  3PD9 A;  3KGC A;  4F3G A;  3OD7 A;  4FE8 A;  4ECF A;  4U23 A;  3UP9 A;  4OQO A;  2NOO A;  3UN6 A;  1N04 A;  4ZEF A;  3THI A;  3S9E A;  3FXU A;  2O68 A;  2OBG A;  1JW5 A;  1B3G A;  4RXL A;  3IOU A;  4DZ1 A;  5AA3 A;  4POX A;  4OFO A;  3LR1 A;  3CVG A;  4DXB A;  4R74 A;  1S7Y A;  1WVJ A;  1JW4 A;  2RC8 A;  1JET A;  1B32 A;  1S50 A;  4YMA A;  4JWO A;  3ILU B;  4F3P A;  3RTF B;  4ZEB A;  3OSQ A;  4TLM B;  3G3K A;  4IGR A;  2XX8 A;  5L8D A;  3EHS A;  1XT8 A;  1M5C A;  4R72 A;  4KYS A;  3GZG A;  3MQ9 A;  5DEX A;  4I62 A;  2P0S A;  3P7I A;  5ITO A;  4UA8 A;  1OMP A;  3H6V A;  3KEI A;  2OWT A;  2O1M A;  4IO6 A;  4QF9 A;  2B65 A;  4IY6 A;  3R7X A;  5DTB A;  2ABH A;  4H1X A;  3TKD A;  2OK2 A;  2M8C A;  3H03 A;  1I6B A;  2OCU A;  2VD2 A;  3CFL A;  4JDF A;  1LFH A;  2QSX A;  1P1O A;  5LOM A;  4R6Y A;  1Y4T A;  3V5A A;  4GLI A;  4O3B A;  1PB8 A;  4PQJ A;  4YMB A;  4OFL A;  5AA2 B;  3O6G A;  2I6E A;  1PB9 A;  2D3I A;  3K2D A;  3D4G A;  5J1D A;  4BDL A;  4ZEK A;  3PUZ E;  3G3H A;  4BDR A;  4Q30 B;  5CC2 A;  3DP4 A;  4E0X A;  4FJP A;  1I69 A;  3SEU A;  4DDD A;  3H4Z A;  2ZYM A;  4NF4 A;  2I0B A;  3SET A;  3TUS A;  1B2H A;  3UIF A;  4LON B;  3SEX A;  4GVO A;  3PD8 A;  1MXY A;  5DYH A;  1ZIU A;  4QFO A;  2UVJ A;  4AQ4 A;  2DWH A;  1OIB A;  3W9V A;  2Z23 A;  3K4U A;  1JQF A;  1URD A;  1JNF A;  2H99 A;  4M1V A;  1MY1 A;  2DXR A;  3G3F A;  1GVC A;  1HSE A;  2OWS A;  3TFL A;  1A8E A;  5I59 B;  1POY 1;  3OO7 A;  2Y7W A;  3C9H A;  3IOW A;  4GL8 A;  3FZV A;  1LAH E;  1SI1 A;  5TP9 B;  3TEL A;  5KDT B;  2CMO A;  1JEU A;  1B7U A;  1B5H A;  5CMC A;  4Z0I A;  3G3G A;  4GWO A;  4Z7E A;  5K2X A;  3IO6 A;  4DIG A;  3H6W A;  2Q88 A;  2QJE A;  5I2N B;  1ANF A;  1HSJ A;  4JWY A;  1ZU0 A;  3RN8 A;  4KHZ E;  1UQW A;  3ECR A;  3MZ1 A;  4OEV A;  4EXK A;  1JVY A;  3GXA A;  3T9H B;  3BFU A;  4FAJ A;  4XKN A;  3IX1 A;  5I2K A;  2F6G A;  3DP8 A;  3IAZ A;  2ONK E;  5HM4 B;  1EZP A;  3O9P A;  1NH8 A;  3B7D A;  3T9X B;  1Y1Z A;  3KFM A;  4GOT A;  2QPQ A;  4MF3 A;  1XC1 A;  1Z7M E;  4ZE9 A;  3KG2 A;  1YAE A;  4IGT A;  3O66 A;  4ZZE A;  1IXI A;  3RT6 B;  2H9B A;  4O3A A;  4ZEI A;  1P99 A;  2DWI A;  1SYH A;  3JV9 A;  2HFB A;  3CG1 A;  2HEU A;  4THI A;  1YCJ A;  1H76 A;  2YLN A;  3G3I A;  4RY1 A;  1KWH A;  4GQO A;  4OEN A;  1B52 A;  4JWX A;  4KYD A;  4MLQ A;  1AMF A;  1TXF A;  2RCA A;  1DSN A;  1M5D A;  2Z8E A;  3TTR A;  4H6D A;  4H67 A;  2QS1 A;  3TDJ A;  3EHT A;  1B4H A;  1Q35 A;  3TMG A;  4EXL A;  3D4C A;  2P2A A;  2WKY A;  2QMW A;  2DE2 A;  3TYH A;  3CR9 A;  2UVH A;  5H8F A;  2F7A A;  1B3H A;  1XVY A;  1IZ1 A;  1B7H A;  3B6Q A;  3S9M C;  1LBB A;  1VSO A;  4R2F A;  1B3L A;  4ONY A;  1N76 A;  4Q8R A;  3K1P A;  2PMS A;  1T0K A;  4EF1 A;  4WXJ A;  3L6G A;  3ZSF A;  5FHM A;  2QS2 A;  3M3F A;  3S4U A;  3FVK A;  4ZS9 A;  1MY2 A;  2H5Y A;  1FTJ A;  1OVB A;  1FW0 A;  4ESW A;  4NWC A;  3VXC A;  2V3Q A;  2RKM A;  1O7T A;  4U1Z A;  2ANJ A;  1SW1 A;  2ZNS A;  3OSR A;  4ZDM A;  4OVJ A;  4F2O A;  3SDF A;  5TPA B;  2XXI A;  1LLS A;  4KI0 E;  4YZZ A;  4LZ8 A;  3T96 B;  3OEK A;  4X9T A;  5B7D A;  2F5X A;  2F34 A;  1DTG A;  1R6Z A;  1ZKB A;  2XX7 A;  3KJT A;  1QKA A;  4QHQ A;  2AIX A;  4RNS A;  3RUM A;  5EHS A;  4I9D A;  1BTJ A;  1BIY A;  3QUJ A;  3RY3 A;  1MXZ A;  1UTH A;  3C36 A;  2Y7R A;  2DWJ A;  4IO2 A;  1R9Q A;  1N7W A;  4YB5 A;  3BBR A;  4PE5 B;  1B05 A;  4F2Q A;  3RNN A;  4AB5 A;  4OER A;  4ESX A;  3GBA A;  3E3K A;  4WED A;  1MXX A;  1IXH A;  4AB6 A;  2AL5 A;  4JXI A;  5K2Y A;  1Y3N A;  3V83 A;  2VOZ A;  2F78 A;  1XS5 A;  4ZEC A;  3FUZ A;  4G68 A;  3MAM A;  4PFW A;  1ATG A;  1IXC A;  3QSL A;  1SW2 A;  5F1Q A;  2DVZ A;  5EHM A;  1OQH A;  4EQB A;  1F9B A;  3UK4 A;  1YPN A;  2Q8J A;  1M5F A;  1GGG A;  5HPQ A;  3FVN A;  5I58 A;  2OJT A;  4G8M A;  1Y3P A;  5AA4 A;  2UYF A;  2I0C A;  4IO7 A;  1ZLQ A;  4ND9 A;  3OOA A;  1ELJ A;  4GD5 A;  1RKM A;  1NH7 A;  3OEN A;  1USY H;  3MP6 A;  2Y7K A;  5H8S A;  1MPD A;  4DLD A;  3U94 A;  3FIR A;  4FOR A;  4GRK A;  2RC7 A;  1QVS A;  2FA7 A;  1VR5 A;  4YB6 A;  3K01 A;  2XX9 A;  4R9G A;  3MPL A;  3R6U A;  5CBS A;  3TQW A;  3PU5 A;  2DVC A;  1B7Z A;  2QMX A;  4F39 A;  3TEP A;  1OQG A;  3MVY A;  3DEL B;  2NVU B;  4N13 A;  3K00 A;  2I4B A;  5I57 B;  3S9L C;  4ELQ A;  4F22 A;  5HBC A;  1UIU A;  5H8Q A;  4ZZA A;  3VXB A;  4F31 B;  1MM7 A;  4QSC A;  3FAS A;  1US4 A;  5A5X A;  2B3B A;  3H7M A;  2XXQ A;  2I49 A;  3Q28 A;  1WOD A;  5B70 A;  2F6P A;  4U2R A;  3T9U A;  3E9X A;  2O51 A;  3FXQ A;  1FCK A;  1NNP A;  3MBP A;  1HSL A;  2ZNU A;  1H3D A;  2DE3 A;  1O63 A;  4NED A;  1Z7N E;  4NF8 A;  4H5F A;  4IO3 A;  2R71 A;  2I4C A;  2FYI A;  1MM6 A;  1ZTY A;  2XXW A;  4R9F A;  4NF6 A;  3VLU A;  5FHO A;  1IEJ A;  2X7Q A;  1B3F A;  3O97 A;  1Y3Q A;  4KPT A;  2QRY A;  3QIM A;  3OO8 A;  1A99 A;  3C33 A;  3T93 B;  3MVW A;  1NL5 A;  4DCY A;  1I6A A;  3MUQ A;  1MY4 A;  2PX1 A;  3G7W A;  4MH5 A;  4IO4 A;  3L6H A;  5H8H B;  1IUD A;  1SYI A;  3TPA A;  4HTG A;  4WKM A;  4GL0 A;  3E13 X;  2I48 A;  1UTB B;  2CZL A;  1QKB A;  2ONS A;  1EU8 A;  2ZYN A;  3GBB A;  5BWJ A;  1EH3 A;  4EQ7 A;  3PUW E;  4DCX A;  3PMV A;  1UTH B;  2YJP A;  1Y20 A;  2I58 A;  4YKK A;  1TT1 A;  1DPP A;  3VVE A;  1LAF E;  3VV5 A;  1OLA A;  3HO7 A;  3PUV E;  5I56 A;  3IB0 A;  3T66 A;  1B9J A;  3EN3 A;  3HN0 A;  1UIV A;  1LB8 A;  3TCG A;  3PPR A;  1N84 A;  4DXU A;  4QFN A;  1NNT A;  2HAV A;  4BDO A;  1II5 A;  1VFE A;  3M3L A;  1TFA A;  4G77 A;  1B1X A;  3QUF A;  3LSX A;  1LAG E;  5JTY A;  2D21 A;  4POW A;  4GIZ A;  3PUX E;  4OEU A;  1LAX A;  1RYO A;  4YKP A;  4OTE A;  4FAT A;  4GFR A;  3CG3 A;  3N5L A;  3OO6 A;  1SDX A;  1M5B A;  4OXV A;  3FJG A;  5I58 B;  5CRY A;  3OMB A;  2NXO A;  1MH4 A;  3MP8 A;  3UGW A;  2AL4 A;  1QJM A;  3S2V A;  3MPK A;  2PT2 A;  3IOT A;  4N07 A;  3FXR A;  1US5 A;  3ZKK A;  1N0T A;  5FTH A;  4LVQ A;  2F7C A;  3CRB A;  4GXA A;  1FQA A;  2O1L A;  4R2B A;  4DE8 A;  2XXU A;  3MVX A;  1P1W A;  2THI A;  3OEL A;  5IKB A;  4NE4 A;  1TWY A;  3FJ7 A;  3IO4 A;  3EHU A;  1AIV A;  2H98 A;  4NMY A;  4OFJ A;  1P1U A;  1DTZ A;  1NFT A;  3E4R A;  4NWD A;  2V93 A;  2PYY A;  2GHA A;  1J1N A;  1LFG A;  4BDN A;  2R6G E;  5DEX B;  1Y9U A;  5H8Q B;  4KCD A;  2HXW A;  3DM0 A;  4X48 A;  2E1S A;  3MC2 A;  3MW0 A;  3U93 A;  1MPB A;  4JSO A;  4X1D A;  2B3F A;  2F97 A;  4C1T A;  1MRP A;  5CI5 A;  3TCF A;  4G8H A;  2AYS A;  1PBQ A;  2A5T A;  3RLF E;  3OXN A;  2Q2A A;  1BKA A;  4KQP A;  4LQ2 A;  5M2V A;  4TQU Q;  4F29 A;  4XKP A;  3PPP A;  4LQ5 A;  3TAJ A;  2Q2C A;  4ELP A;  3T22 A;  1B46 A;  1DMB A;  5DVF A;  2DWA A;  1M5E A;  3IB2 A;  1SQY A;  1MY0 A;  3K1M A;  3UA8 A;  1DOT A;  1LCF A;  3N6U A;  1SBP A;  1A40 A;  3CFX A;  1MPC A;  4ELO A;  3RT8 A;  5ICT A;  2HQ0 A;  3IR1 A;  2V3T A;  2X7P A;  3N6T A;  1A8F A;  4NF4 B;  3LSL A;  1IIW A;  3SEV A;  2Q89 A;  5JEI A;  4ISU A;  1FTK A;  1N7X A;  3VVD A;  4HCW A;  3O2A A;  3RQT A;  4YU0 A;  1N3W A;  2XXT A;  3OEM A;  2KLF A;  3SER A;  2QS3 A;  3FVO A;  1B0H A;  3K6U A;  1IIT A;  4E0W A;  4F19 A;  1MXV A;  4XIG Q;  1B6H A;  4M4G A;  1NNF A;  5ICQ A;  3U8Q A;  4OYV A;  5KZT A;  4LZ5 A;  1B1H A;  1MQD A;  3ZS6 A;  4F1V A;  2XXP A;  1AOV A;  3LUY A;  1JVX A;  2QS4 A;  2XXX A;  3K02 A;  3PGF A;  1CB6 A;  3DP6 A;  4PFU A;  3U1O A;  3ILT B;  3PUY E;  5AA1 A;  3USD A;  2VP1 A;  3MWB A;  3H06 B;  2Z22 A;  3I5O A;  4N6P A;  1MQI A;  3C32 A;  2UVI A;  1A55 A;  4ZED A;  4OET A;  4LUB A;  1QUL A;  3O6H A;  4U21 A;  4NF5 A;  2E0S A;  2O6A A;  3N26 A;  4RPN A;  1R9L A;  3FAT A;  3PV0 E;  5CM6 A;  5I2K B;  4H5G A;  3Q25 A;  4FIM A;  4R75 A;  1QUK A;  4TLL B;  2G29 A;  1P1N A;  3FD3 A;  4UAC A;  1XVX A;  1PEB A;  2OZZ A;  1B40 A;  4X1B A;  1MH3 A;  2IEE A;  5F7V A;  1MDQ A;  1QUJ A;  4G2Z A;  5I84 A;  3IK6 B;  2F36 A;  2ZMB A;  2DQV A;  2DSF A;  4JB7 A;  3A3C A;  1DPE A;  3QAX A;  4H65 A;  3FJM A;  3KSX A;  3M3K A;  3RPW A;  1FTL A;  4XXU A;  1NMU A;  1WDN A;  1FQF A;  1ZMG A;  1AL3 A;  4IO5 A;  2GH9 A;  3R26 A;  1OLC A;  2D5W A;  3FV2 A;  4G68 C;  4LAT A;  4L17 A;  3C31 A;  1FTO A;  2ZYK A;  4HW8 A;  4YKJ A;  1YTV A;  2ONR A;  2PT1 A;  3AXF A;  3SES A;  1PC3 A;  1MXW A;  2ZYO A;  2DS9 A;  3G3J A;  4GXS B;  3Q26 A;  3CI8 A;  4RYA A;  5H8F B;  4RK2 A;  1URG A;  5KCJ A;  4F1Y A;  2A5T B;  3VVF A;  4QFL A;  3TQL A;  3Q27 A;  1SVX B;  2FNC A;  3GLB A;  2NUV A;  5DVI A;  2XHD A;  4C1U A;  3HST A;  3PMX A;  4ZE8 A;  3KBR A;  4KYE A;  4YKI A;  3KJ7 A;  3U92 A;  1S9T A;  3KSJ A;  4LZ7 A;  3QK6 A;  1ZJL A;  3LBS A;  1MG1 A;  5L9O A;  3FVG A;  4MLV A;  5FHN A;  3S9N C;  2HCA A;  5ITP A;  2VD3 A;  3PPN A;  1A7L A;  4EUO A;  1BP5 A;  1IXG A;  2RC9 A;  5CMM A;  3LC8 A;  1H45 A;  2GRV A;  2O7I A;  1LBC A;  1GTK A;  4U4X A;  1NNK A;  4XTC Q;  4OMB A;  4HCY A;  3BKI B;  4U4S A;  1CE2 A;  3O29 A;  3VDF A;  2HAU A;  4RJZ A;  2Q9T A;  3VLW A;  2G93 A; 
#chains in the Genus database with same CATH topology
 1LEV A;  1R1N A;  2OX3 A;  1K9Y A;  1XOC A;  1LB9 A;  1NV3 A;  2RCB A;  4QSE A;  2LAO A;  4LP2 B;  2REG A;  1MQH A;  2PBW A;  3KOT A;  1PDA A;  3K1N A;  1PB7 A;  5TPA A;  3Q29 A;  4R6H A;  5IZZ A;  3ONM A;  4F3B A;  4MBP A;  4Q5T A;  4JSD A;  1BLF A;  2F35 A;  1I6Q A;  5L9M A;  3CSG A;  3KN3 A;  1B5J A;  4YB7 A;  1G0I A;  1IQ7 A;  2UVG A;  2XD2 A;  2O7U A;  5BUU A;  1TFD A;  3T9V A;  1FQB A;  3FV1 A;  3EQ1 A;  1URS A;  1D4N A;  2A5S A;  4NTL A;  4IB2 A;  2H25 A;  5I3S A;  4RPO A;  4YIC A;  2UYE A;  2V4C A;  2XD3 A;  4F1U A;  4O3C A;  4NHB A;  2RIN A;  4KFQ A;  1SD3 A;  2FIE A;  4EF2 A;  4P47 A;  1FQC A;  3PPQ A;  2OLB A;  3HV1 A;  3QYT A;  4NF5 B;  1FPB A;  1FJ6 A;  4G68 B;  4GWY A;  3PTY A;  5DT6 A;  3O6I A;  3H6T A;  2IA4 A;  3U72 A;  1B51 A;  1B58 A;  1H44 A;  1JEV A;  3W15 C;  3IL1 B;  2F3D A;  4P0I A;  5T3J A;  3H3G A;  2HZK A;  1SW4 A;  5ISU A;  4NX1 A;  4QBA A;  4BDM A;  1SW5 A;  2DE4 A;  5AA4 B;  2WYP A;  2V25 A;  1GR2 A;  1K9Z A;  3WAF A;  4QRZ A;  1FQD A;  1POT A;  1B4Z A;  4XKR A;  1MS7 A;  3IOV A;  1LST A;  4I8C A;  5H8N A;  4G8N A;  3KZG A;  2REJ A;  2X26 A;  3K6V A;  1USY E;  2NWJ A;  1O64 A;  4RA1 A;  3A29 A;  3I6V A;  2DOJ A;  3LSF B;  5ET7 A;  1MQJ A;  2ZXT A;  1QW0 A;  3K6W A;  5EYF A;  4F18 A;  4OWD A;  3K6X A;  2GFE A;  4WEP A;  3I3V A;  3O28 A;  4LN5 A;  1Q1K A;  4K3F A;  1LFI A;  1ZBM A;  4P0G A;  4FEC A;  3SEY A;  4GX3 A;  5AA2 D;  4QSD A;  5CBR A;  4R6K A;  4BLA A;  2I3V A;  4QFK A;  1EZO A;  3TOD A;  1MDP 1;  1JW1 A;  2ZNT A;  3RPL A;  3IB1 A;  3C34 A;  2V3U A;  4PAI A;  1SI0 A;  2Y84 A;  4PFB A;  3RTW B;  3D1R A;  1MXU A;  1OVT A;  1N3X A;  4R73 A;  2UXA A;  2WX9 A;  3B6T A;  5KCJ B;  3OO9 A;  4RK9 A;  4PBQ A;  3HHF A;  1RDZ A;  3HCQ A;  3PMW A;  3IJO B;  3KN7 A;  3TCH A;  3CIJ A;  3N94 A;  3MJN A;  5A5X B;  2ESN A;  2Z8F A;  4H8I A;  4OVR A;  5EYG A;  4PTK A;  1INP A;  4PFT A;  4EDP A;  1B0L A;  3ZKL A;  2PVU A;  5FTI A;  2DXY A;  2XXY A;  3MZB A;  4GWZ A;  4MNP A;  5I57 A;  2DDK A;  2F8D A;  4OZ9 A;  2P1S A;  5DVJ A;  3QMF A;  1FPL A;  3IJX B;  4NF8 B;  4IY5 A;  2F7B A;  1Y4C A;  4MHF A;  5I5P A;  5DW8 A;  1LGB C;  4H8J A;  1AH5 A;  3QXM A;  3VFJ A;  2VGQ A;  1IMF A;  4EQ9 A;  1XHY A;  3C4M A;  4Q0C A;  3HHG A;  4NF6 B;  2W7Y A;  1FTM A;  2V84 A;  5AE4 A;  1FQE A;  3HPI A;  3M8U A;  4OHN A;  1NKX A;  4C0R A;  2O69 A;  4JVD A;  4QXD A;  3WAE A;  2FVZ A;  3FGS A;  2DP8 A;  2DYX A;  3TTM A;  2HZL A;  2GHB A;  4PET A;  4I1D A;  3EPE A;  2O84 X;  4OES A;  3CSB A;  2H4I A;  2B4M A;  1EZ9 A;  5AA2 A;  4HXV A;  4TOZ A;  3VLV A;  4G4P A;  3ODB A;  1FBG A;  1D9Y A;  1NV4 A;  2Y7P A;  3V89 B;  4F3S A;  5TU0 A;  4FED A;  3JYR A;  2VHA A;  4U22 A;  2ALU A;  2Y7I A;  2XXH A;  4BDQ A;  3JZJ A;  3MP1 A;  5ELV A;  1L5T A;  2YPN A;  3TTN A;  2HPG A;  4HS7 A;  4KR5 A;  3KN8 A;  5IM2 A;  1B5I A;  1RYX A;  1Y1M A;  5I56 B;  4XKQ A;  3DLN A;  1P1Q A;  5H8H A;  2R9J A;  4P11 A;  3EF7 A;  3PPO A;  2OWZ A;  3BFT A;  4GF8 A;  4QFP A;  4DXC A;  1UTB A;  3U65 A;  1DBZ A;  3C35 A;  4ELR A;  1MQG A;  4MIJ A;  3W9W A;  3K0V A;  1VE4 A;  3V8X B;  3UOR A;  3MVZ A;  4MFI A;  5I59 A;  3CFZ A;  3SKP A;  2QL3 A;  5JTY B;  2ZZX A;  2RF1 A;  5CMB A;  1PBP A;  4YAH X;  2Q74 A;  1D3K A;  3IOR A;  5TP9 A;  3KOS A;  1QUI A;  4H0W A;  4PP0 A;  5KDT A;  5JK4 A;  3A3U A;  2Z8D A;  1D9V A;  2BJJ X;  4KCC A;  1LCT A;  1B3E A;  4I3E A;  3TZA A;  3SEW A;  2GQ1 A;  5IAI A;  3H6U A;  3VE1 B;  4U1O A;  5L9S A;  4JBZ A;  4FEB A;  1H43 A;  2XXV A;  1GV8 A;  1VFD A;  4PFY A;  3A09 A;  3EKI A;  3F11 A;  3MZ9 A;  3RGY A;  2FBP A;  2CEY A;  1A54 A;  5H8N B;  1MY3 A;  4LA9 A;  5I2N A;  3B6W A;  4KD5 A;  3TTL A;  2I3W A;  3TTK A;  2XXR A;  3LSW A;  1IMA A;  5CMK A;  3PD9 A;  2QVV A;  3KGC A;  4F3G A;  3OD7 A;  4FE8 A;  4ECF A;  4U23 A;  3UP9 A;  4OQO A;  2NOO A;  4HE0 A;  3UN6 A;  1N04 A;  4ZEF A;  4GBV A;  1IMB A;  3THI A;  4O7M A;  3S9E A;  4HE1 A;  3FXU A;  1YYZ A;  2O68 A;  1BK4 A;  2OBG A;  1JW5 A;  1B3G A;  4RXL A;  3IOU A;  4DZ1 A;  5AA3 A;  4POX A;  4OFO A;  3LR1 A;  3CVG A;  4DXB A;  4R74 A;  4N8G A;  1S7Y A;  1WVJ A;  1JW4 A;  2RC8 A;  1JET A;  1B32 A;  1S50 A;  3NOH A;  2KQZ A;  4JWO A;  4YMA A;  4NG7 A;  3ILU B;  4F3P A;  3RTF B;  4ZEB A;  3OSQ A;  4TLM B;  3G3K A;  3LV0 A;  4IGR A;  2XX8 A;  5L8D A;  3KC1 A;  3EHS A;  1XT8 A;  1M5C A;  4R72 A;  4PDH A;  4KYS A;  3GZG A;  3MQ9 A;  5DEX A;  4I62 A;  2P0S A;  3P7I A;  5ITO A;  3IFC A;  4UA8 A;  1OMP A;  3H6V A;  3KEI A;  2R8T A;  2OWT A;  4N17 A;  5LTC A;  2O1M A;  3FBP A;  1LBX A;  4IO6 A;  4DI4 B;  4QF9 A;  2B65 A;  4IY6 A;  1JP4 A;  3R7X A;  4X04 A;  5DTB A;  2ABH A;  4H1X A;  3TKD A;  2OK2 A;  2M8C A;  3H03 A;  1I6B A;  2OCU A;  2VD2 A;  1FBE A;  3CFL A;  4XEQ A;  4JDF A;  1LFH A;  2VPO A;  4PAF A;  2QVU A;  2QSX A;  1P1O A;  5LOM A;  4R6Y A;  1Y4T A;  3V5A A;  4GLI A;  4O3B A;  1PB8 A;  4PQJ A;  4YMB A;  4OFL A;  5AA2 B;  1KZ8 A;  3O6G A;  2I6E A;  1PB9 A;  2D3I A;  3K2D A;  3D4G A;  5J1D A;  4OVT A;  2QVR A;  4ZEK A;  4BDL A;  3PUZ E;  3G3H A;  4BDR A;  4H45 A;  4Q30 B;  5CC2 A;  3DP4 A;  4JVI A;  4PFI A;  4E0X A;  4N91 A;  4FJP A;  1I69 A;  3SEU A;  4DDD A;  3H4Z A;  2ZYM A;  4NF4 A;  5EQ9 A;  2I0B A;  3SET A;  3TUS A;  1B2H A;  3UIF A;  3MST A;  4G61 A;  4LON B;  4O7I A;  3SEX A;  4GVO A;  3PD8 A;  1MXY A;  5DYH A;  3T0J A;  1ZIU A;  4QFO A;  2UVJ A;  4N81 A;  4AQ4 A;  2DWH A;  1OIB A;  3W9V A;  2Z23 A;  3K4U A;  1JQF A;  1URD A;  1JNF A;  2H99 A;  4M1V A;  3HFU A;  1MY1 A;  2DXR A;  3G3F A;  1GVC A;  1HSE A;  5F24 A;  2OWS A;  3TFL A;  1A8E A;  5I59 B;  1POY 1;  3OO7 A;  2Y7W A;  3C9H A;  3IOW A;  4XF5 A;  4GL8 A;  3FZV A;  1LAH E;  1SI1 A;  5TP9 B;  3TEL A;  5KDT B;  2CMO A;  3B8B A;  3FXB A;  1JEU A;  1B7U A;  1B5H A;  4JVC A;  5CMC A;  4Z0I A;  3G3G A;  4GWO A;  4Z7E A;  5K2X A;  3IO6 A;  4DIG A;  3H6W A;  2Q88 A;  2QJE A;  5I2N B;  1LBY A;  1ANF A;  1HSJ A;  4JWY A;  1ZU0 A;  3RN8 A;  4KHZ E;  1UQW A;  2CZI A;  2XWK A;  3ECR A;  3MZ1 A;  4OEV A;  4EXK A;  1JVY A;  4AS5 A;  3GXA A;  3T9H B;  3BFU A;  4FAJ A;  4XKN A;  2PFY A;  3IX1 A;  5I2K A;  2F6G A;  3DP8 A;  1EYJ A;  3IAZ A;  2ONK E;  4PC9 A;  4GX6 A;  5HM4 B;  1EZP A;  3O9P A;  1NH8 A;  1NUX A;  3B7D A;  3T9X B;  1Y1Z A;  3KFM A;  4GOT A;  2QPQ A;  4MF3 A;  2P3N A;  1XC1 A;  1Z7M E;  4ZE9 A;  3KG2 A;  1YAE A;  4IGT A;  3O66 A;  4ZZE A;  1IXI A;  3RT6 B;  2H9B A;  4O3A A;  4ZEI A;  1P99 A;  2DWI A;  1SYH A;  3JV9 A;  2HFB A;  3CG1 A;  2HEU A;  4THI A;  1YCJ A;  1H76 A;  2YLN A;  3G3I A;  4RY1 A;  1KWH A;  4GQO A;  4OEN A;  1B52 A;  4JWX A;  4KYD A;  4MLQ A;  1XI6 A;  1AMF A;  1NUW A;  1TXF A;  2RCA A;  1DSN A;  1M5D A;  2Z8E A;  3TTR A;  4H6D A;  4H67 A;  2QS1 A;  3TDJ A;  3EHT A;  1FTA A;  1B4H A;  1Q35 A;  3TMG A;  4XFE A;  4EXL A;  3D4C A;  2P2A A;  4GWU A;  2WKY A;  2QMW A;  2DE2 A;  3TYH A;  3CR9 A;  2UVH A;  5H8F A;  1NI9 A;  2F7A A;  1FBP A;  4NAP A;  1B3H A;  2Q8M A;  4P9K A;  1XVY A;  1IZ1 A;  1B7H A;  3B6Q A;  4DI3 D;  3S9M C;  1LBB A;  4OA4 A;  3LUZ A;  1VSO A;  4R2F A;  1B3L A;  4ONY A;  1N76 A;  2WBD A;  4Q8R A;  3K1P A;  2PMS A;  1T0K A;  4EF1 A;  4WXJ A;  3L6G A;  3ZSF A;  5FHM A;  2QS2 A;  3M3F A;  3S4U A;  3FVK A;  4ZS9 A;  1MY2 A;  5LDZ A;  2XA5 A;  2H5Y A;  1FTJ A;  1OVB A;  1FW0 A;  4ESW A;  4PE3 A;  1FPI A;  4NWC A;  3VXC A;  2V3Q A;  2RKM A;  1O7T A;  4U1Z A;  2ANJ A;  3CHG A;  1SW1 A;  2ZNS A;  3OSR A;  4ZDM A;  4OVJ A;  4F2O A;  3SDF A;  5TPA B;  2XXI A;  1LLS A;  4KI0 E;  4YZZ A;  4LZ8 A;  3T96 B;  3OEK A;  4X9T A;  5B7D A;  2F5X A;  2F34 A;  4O8M A;  2CZH A;  1DTG A;  4P1E A;  1R6Z A;  3SZP A;  1ZKB A;  4PAK A;  2XX7 A;  3KJT A;  1QKA A;  4QHQ A;  2AIX A;  4RNS A;  1EYK A;  2QFL A;  1FRP A;  3RUM A;  5EHS A;  4I9D A;  1BTJ A;  1BIY A;  4PFR A;  3QUJ A;  3RY3 A;  1MXZ A;  4P8B A;  4N15 A;  1UTH A;  3C36 A;  2Y7R A;  2DWJ A;  4IO2 A;  1R9Q A;  1N7W A;  4PF6 A;  4YB5 A;  3BBR A;  4PE5 B;  1B05 A;  4F2Q A;  3RNN A;  4AB5 A;  4OER A;  4ESX A;  3GBA A;  1IMD A;  3E3K A;  4WED A;  1MXX A;  1IXH A;  2WYK A;  4AB6 A;  2WBB A;  2AL5 A;  2B4L A;  4JXI A;  5K2Y A;  1Y3N A;  3V83 A;  4KXP A;  2VOZ A;  1FPG A;  2F78 A;  1XS5 A;  4ZEC A;  3FUZ A;  4G68 A;  3MAM A;  1KA1 A;  4PFW A;  1ATG A;  1IXC A;  3QSL A;  1SW2 A;  5F1Q A;  1SPI A;  2DVZ A;  5EHM A;  1OQH A;  4EQB A;  1F9B A;  3UK4 A;  1YPN A;  1NV1 A;  2Q8J A;  1M5F A;  1GGG A;  5HPQ A;  2CEX A;  3FVN A;  5I58 A;  2OJT A;  4G8M A;  1Y3P A;  5AA4 A;  2UYF A;  2I0C A;  4IO7 A;  1ZLQ A;  4ND9 A;  5EQA A;  3OOA A;  1ELJ A;  4GD5 A;  1RKM A;  1NH7 A;  3OEN A;  1USY H;  3MP6 A;  1FPF A;  2Y7K A;  5H8S A;  1MPD A;  1YZ0 A;  3RPL B;  4DLD A;  3ROJ A;  3U94 A;  5EYH A;  3FIR A;  4FOR A;  4GRK A;  5IZ3 A;  2RC7 A;  1QVS A;  2FA7 A;  1VR5 A;  4YB6 A;  3K01 A;  2XX9 A;  4R9G A;  3MPL A;  3KBZ A;  3R6U A;  5CBS A;  3TQW A;  3PU5 A;  2DVC A;  4MMP A;  1LBZ A;  1B7Z A;  2QMX A;  4F39 A;  3TEP A;  1OQG A;  1G0H A;  3MVY A;  3DEL B;  2NVU B;  4N13 A;  4MEV A;  5J16 A;  5ET5 A;  3K00 A;  2I4B A;  2XXK A;  5I57 B;  4GWS A;  3S9L C;  4ELQ A;  4F22 A;  5HBC A;  1UIU A;  5H8Q A;  4ZZA A;  1FPD A;  3VXB A;  4F31 B;  1MM7 A;  4QSC A;  2F3B A;  3FAS A;  1US4 A;  1IME A;  5A5X A;  2B3B A;  3H7M A;  2XXQ A;  2I49 A;  3Q28 A;  1WOD A;  4MAG A;  5B70 A;  2WEF A;  2F6P A;  4P3L A;  4U2R A;  1FBC A;  3T9U A;  3E9X A;  2O51 A;  3FXQ A;  1FCK A;  1NNP A;  3MBP A;  1HSL A;  4AS4 A;  2ZNU A;  1H3D A;  2DE3 A;  1O63 A;  4NED A;  1Z7N E;  4NF8 A;  4H5F A;  4IO3 A;  2R71 A;  2I4C A;  2FYI A;  1MM6 A;  1ZTY A;  2XXW A;  4R9F A;  4IR8 A;  4NF6 A;  3E79 A;  2XWI A;  1FBH A;  3VLU A;  5FHO A;  1IEJ A;  2X7Q A;  1B3F A;  3BIG A;  3O97 A;  1Y3Q A;  4KPT A;  2QRY A;  3QIM A;  3OO8 A;  1A99 A;  3C33 A;  3T93 B;  2HXR A;  4I40 A;  3MVW A;  1NL5 A;  4PGP A;  4DCY A;  1I6A A;  3MUQ A;  1MY4 A;  2PX1 A;  3G7W A;  4MH5 A;  4IO4 A;  3L6H A;  5H8H B;  1IUD A;  1SYI A;  3TPA A;  4HTG A;  5EQ8 A;  4WKM A;  4GL0 A;  4NN3 A;  3E13 X;  2I48 A;  1UTB B;  2CZL A;  1QKB A;  2ONS A;  1EU8 A;  2ZYN A;  3GBB A;  1FSA A;  5BWJ A;  1EH3 A;  4EQ7 A;  3PUW E;  4DCX A;  4H46 A;  3PMV A;  1CNQ A;  1UTH B;  2YJP A;  1Y20 A;  2I58 A;  4YKK A;  1TT1 A;  1DPP A;  3VVE A;  1LAF E;  2VT5 A;  3VV5 A;  1OLA A;  3HO7 A;  4X8R A;  1LBW A;  3PUV E;  5I56 A;  3IB0 A;  4N6D A;  3T66 A;  1B9J A;  3EN3 A;  3HN0 A;  1UIV A;  1LB8 A;  3TCG A;  3PPR A;  1N84 A;  4DXU A;  4QFN A;  4PBH A;  1NNT A;  2HAV A;  2HHM A;  4N4U A;  4BDO A;  1II5 A;  1VFE A;  3M3L A;  1TFA A;  4G77 A;  1B1X A;  3QUF A;  3LSX A;  1LAG E;  5JTY A;  2XWO A;  2D21 A;  5I7I A;  4POW A;  4GIZ A;  2P3V A;  4MNC A;  3PUX E;  4MCO A;  4OEU A;  1LAX A;  2PCR A;  1RYO A;  1FBD A;  4YKP A;  4OTE A;  2JJK A;  1NV6 A;  4OVS A;  4FAT A;  4GFR A;  3CG3 A;  3N5L A;  3OO6 A;  1SDX A;  1M5B A;  4OXV A;  3FJG A;  5I58 B;  5CRY A;  3OMB A;  2NXO A;  1MH4 A;  3MP8 A;  3UGW A;  4P1L A;  2AL4 A;  1QJM A;  3S2V A;  3MPK A;  1FPE A;  2PT2 A;  3IOT A;  4N07 A;  3FXR A;  1US5 A;  3ZKK A;  1N0T A;  5FTH A;  4LVQ A;  5ET6 A;  2F7C A;  3CRB A;  1DCU A;  4GXA A;  1FQA A;  2O1L A;  4NGU A;  4R2B A;  4DE8 A;  5IZ3 B;  5IGA A;  2XXU A;  4HE2 A;  4GWX A;  3MVX A;  1P1W A;  2THI A;  4NF0 A;  1DK4 A;  3OEL A;  5IKB A;  4NE4 A;  1TWY A;  3FJ7 A;  3IO4 A;  3EHU A;  1AIV A;  2H98 A;  4NMY A;  4MX6 A;  4OFJ A;  1P1U A;  1DTZ A;  1NFT A;  3E4R A;  4NWD A;  2V93 A;  1FPK A;  2PYY A;  2GHA A;  1J1N A;  1LFG A;  4NQ8 A;  4BDN A;  1NUY A;  2R6G E;  5DEX B;  1Y9U A;  5H8Q B;  4KCD A;  2HXW A;  3DM0 A;  1EYI A;  4X48 A;  2E1S A;  3MC2 A;  4I3Y A;  3MW0 A;  3U93 A;  1MPB A;  4JSO A;  4X1D A;  2B3F A;  2F97 A;  2CZK A;  4C1T A;  1MRP A;  5CI5 A;  3TCF A;  4PDD A;  4G8H A;  2AYS A;  1PBQ A;  5FBP A;  4MNI A;  2A5T A;  3RLF E;  3OXN A;  2Q2A A;  1BKA A;  4KQP A;  4LQ2 A;  5M2V A;  4TQU Q;  4F29 A;  4XKP A;  3PPP A;  4LQ5 A;  3TAJ A;  1YXI A;  2Q2C A;  4ELP A;  1FPJ A;  2XWV A;  3T22 A;  3IFA A;  1B46 A;  1DMB A;  5DVF A;  2DWA A;  1M5E A;  3IB2 A;  1SQY A;  1MY0 A;  3K1M A;  3UA8 A;  1DOT A;  1LCF A;  3N6U A;  1SBP A;  1A40 A;  4N8Y A;  4GWW A;  4OVP A;  3CFX A;  4PF8 A;  4O94 A;  1MPC A;  4ELO A;  3RT8 A;  5ICT A;  4PCD A;  2HQ0 A;  3IR1 A;  4N6K A;  2V3T A;  2X7P A;  3N6T A;  4FBP A;  2Y5L A;  1RDX A;  1A8F A;  1QGX A;  4NF4 B;  3LSL A;  1IMC A;  1IIW A;  3SEV A;  2Q89 A;  5JEI A;  4ISU A;  1FTK A;  1N7X A;  3VVD A;  4HCW A;  3O2A A;  3T1B A;  3RQT A;  4YU0 A;  1N3W A;  2XXT A;  3OEM A;  2KLF A;  3SER A;  2QS3 A;  3FVO A;  1B0H A;  3K6U A;  5EQ7 A;  1IIT A;  1VDW A;  4E0W A;  4F19 A;  1MXV A;  4XIG Q;  1B6H A;  4M4G A;  1NNF A;  5ICQ A;  1NV2 A;  3U8Q A;  4OYV A;  4UAB A;  5KZT A;  2MKZ A;  4LZ5 A;  1Q9D A;  1B1H A;  1MQD A;  3ZS6 A;  4F1V A;  2XXP A;  1AOV A;  3LUY A;  1JVX A;  1KA0 A;  2QS4 A;  2XXX A;  2PFZ A;  3K02 A;  2ZZV A;  3PGF A;  1CB6 A;  3DP6 A;  4PFU A;  3U1O A;  3ILT B;  3PUY E;  5AA1 A;  3USD A;  2VP1 A;  3MWB A;  3H06 B;  2Z22 A;  3E78 A;  3I5O A;  2L5V A;  4N6P A;  1MQI A;  3C32 A;  4GBW A;  2UVI A;  1A55 A;  4ZED A;  4OET A;  4LUB A;  1QUL A;  3O6H A;  4U21 A;  4NF5 A;  1FJ9 A;  1NV7 A;  2E0S A;  2O6A A;  3N26 A;  4RPN A;  3ISP A;  1R9L A;  3FAT A;  3PV0 E;  4OVQ A;  5CM6 A;  5I2K B;  4H5G A;  3Q25 A;  4FIM A;  4R75 A;  1QUK A;  4TLL B;  2G29 A;  1P1N A;  3GYY A;  2BJI A;  2Y5K A;  3FD3 A;  4UAC A;  1XVX A;  1PEB A;  2OZZ A;  1B40 A;  4X1B A;  1MH3 A;  2ZZW A;  2IEE A;  5F7V A;  1MDQ A;  1QUJ A;  4G2Z A;  4PGN A;  5I84 A;  3IK6 B;  2F36 A;  2FIX A;  2ZMB A;  2DQV A;  1NV5 A;  4OAN A;  5ET8 A;  1AWB A;  2DSF A;  4JB7 A;  3BIH A;  3A3C A;  1DPE A;  3QAX A;  4H65 A;  3FJM A;  3KSX A;  3M3K A;  3RPW A;  1FTL A;  1LBV A;  4XXU A;  1NMU A;  1NUZ A;  5IZ1 A;  1WDN A;  1FQF A;  1ZMG A;  1AL3 A;  4IO5 A;  1D9Q A;  2GH9 A;  3R26 A;  1OLC A;  2D5W A;  3FV2 A;  4G68 C;  4LAT A;  4L17 A;  3C31 A;  1FTO A;  3KC0 A;  2ZYK A;  4HW8 A;  3B50 A;  4YKJ A;  1YTV A;  2ONR A;  2PT1 A;  3AXF A;  3SES A;  1PC3 A;  1MXW A;  2ZYO A;  2DS9 A;  3G3J A;  4GXS B;  3Q26 A;  3CI8 A;  4RYA A;  5H8F B;  4RK2 A;  4MJO A;  2KR0 A;  1URG A;  2FHY A;  5KCJ A;  4F1Y A;  2A5T B;  3VVF A;  4QFL A;  3TQL A;  3Q27 A;  1SVX B;  2FNC A;  3GLB A;  2NUV A;  5DVI A;  2XHD A;  4C1U A;  1RDY A;  3HST A;  3PMX A;  4ZE8 A;  3KBR A;  4KYE A;  4YKI A;  3KJ7 A;  3U92 A;  1S9T A;  3KSJ A;  4LZ7 A;  5ESY A;  3QK6 A;  4P56 A;  1ZJL A;  3LBS A;  1MG1 A;  5L9O A;  3FVG A;  4MLV A;  5FHN A;  3S9N C;  2HCA A;  5ITP A;  2VPN A;  2VD3 A;  3PPN A;  1A7L A;  4EUO A;  1BP5 A;  1IXG A;  3RYD A;  2RC9 A;  1NV0 A;  5CMM A;  3LC8 A;  1H45 A;  3MYU A;  4GX4 A;  2GRV A;  2O7I A;  1LBC A;  1GTK A;  4U4X A;  1FBF A;  1NNK A;  4XTC Q;  4OMB A;  4HCY A;  3BKI B;  4U4S A;  1CE2 A;  3O29 A;  3VDF A;  2HAU A;  4RJZ A;  5A5L A;  2Q9T A;  3VLW A;  2G93 A; 
#chains in the Genus database with same CATH homology
 1R1N A;  1XOC A;  1LB9 A;  2RCB A;  4QSE A;  2LAO A;  4LP2 B;  2REG A;  1MQH A;  2PBW A;  3KOT A;  1PDA A;  3K1N A;  1PB7 A;  5TPA A;  3Q29 A;  4R6H A;  3ONM A;  4F3B A;  4MBP A;  4Q5T A;  4JSD A;  1BLF A;  2F35 A;  1I6Q A;  5L9M A;  3CSG A;  3KN3 A;  1B5J A;  4YB7 A;  1IQ7 A;  2UVG A;  2XD2 A;  2O7U A;  5BUU A;  1TFD A;  3T9V A;  1FQB A;  3FV1 A;  3EQ1 A;  1URS A;  1D4N A;  2A5S A;  4NTL A;  4IB2 A;  2H25 A;  4RPO A;  4YIC A;  2UYE A;  2XD3 A;  4F1U A;  4O3C A;  2RIN A;  4KFQ A;  1SD3 A;  4EF2 A;  1FQC A;  3PPQ A;  2OLB A;  3HV1 A;  3QYT A;  4NF5 B;  4G68 B;  5DT6 A;  3O6I A;  3H6T A;  2IA4 A;  3U72 A;  1B51 A;  1B58 A;  1H44 A;  1JEV A;  3W15 C;  3IL1 B;  4P0I A;  3H3G A;  2HZK A;  1SW4 A;  5ISU A;  4BDM A;  1SW5 A;  2DE4 A;  5AA4 B;  2V25 A;  1GR2 A;  3WAF A;  4QRZ A;  1FQD A;  1POT A;  1B4Z A;  4XKR A;  1MS7 A;  3IOV A;  1LST A;  4I8C A;  5H8N A;  4G8N A;  3KZG A;  2REJ A;  2X26 A;  3K6V A;  1USY E;  2NWJ A;  1O64 A;  4RA1 A;  3I6V A;  2DOJ A;  3LSF B;  1MQJ A;  2ZXT A;  1QW0 A;  3K6W A;  5EYF A;  4F18 A;  4OWD A;  3K6X A;  2GFE A;  4WEP A;  3I3V A;  3O28 A;  1Q1K A;  4K3F A;  1LFI A;  1ZBM A;  4P0G A;  4FEC A;  3SEY A;  5AA2 D;  4QSD A;  5CBR A;  4R6K A;  4BLA A;  2I3V A;  4QFK A;  1EZO A;  3TOD A;  1MDP 1;  1JW1 A;  2ZNT A;  3IB1 A;  3C34 A;  2V3U A;  1SI0 A;  2Y84 A;  3RTW B;  1MXU A;  1OVT A;  1N3X A;  4R73 A;  2UXA A;  3B6T A;  5KCJ B;  3OO9 A;  4RK9 A;  3HHF A;  3HCQ A;  3PMW A;  3IJO B;  3KN7 A;  3TCH A;  3CIJ A;  3N94 A;  3MJN A;  5A5X B;  2ESN A;  2Z8F A;  4H8I A;  4PFT A;  4EDP A;  1B0L A;  3ZKL A;  2PVU A;  5FTI A;  2DXY A;  2XXY A;  3MZB A;  5I57 A;  2F8D A;  4OZ9 A;  2P1S A;  5DVJ A;  3IJX B;  4NF8 B;  4IY5 A;  2F7B A;  1Y4C A;  1LGB C;  3VFJ A;  1AH5 A;  3QXM A;  4H8J A;  2VGQ A;  4EQ9 A;  1XHY A;  3C4M A;  4Q0C A;  3HHG A;  4NF6 B;  2W7Y A;  1FTM A;  2V84 A;  5AE4 A;  1FQE A;  3HPI A;  3M8U A;  4OHN A;  1NKX A;  4C0R A;  2O69 A;  3WAE A;  3FGS A;  2DP8 A;  2DYX A;  3TTM A;  2HZL A;  2GHB A;  4PET A;  4I1D A;  3EPE A;  2O84 X;  4OES A;  3CSB A;  2H4I A;  1EZ9 A;  5AA2 A;  4TOZ A;  3VLV A;  4G4P A;  3ODB A;  1D9Y A;  2Y7P A;  3V89 B;  4F3S A;  5TU0 A;  4FED A;  3JYR A;  2VHA A;  4U22 A;  2ALU A;  2Y7I A;  2XXH A;  4BDQ A;  3JZJ A;  3MP1 A;  5ELV A;  1L5T A;  2YPN A;  3TTN A;  4HS7 A;  4KR5 A;  3KN8 A;  1B5I A;  1RYX A;  1Y1M A;  5I56 B;  4XKQ A;  3DLN A;  1P1Q A;  5H8H A;  2R9J A;  4P11 A;  3EF7 A;  3PPO A;  3BFT A;  4GF8 A;  4QFP A;  4DXC A;  1UTB A;  3C35 A;  4ELR A;  1MQG A;  3W9W A;  3K0V A;  1VE4 A;  3V8X B;  3UOR A;  3MVZ A;  4MFI A;  5I59 A;  3CFZ A;  3SKP A;  2QL3 A;  5JTY B;  2RF1 A;  5CMB A;  1PBP A;  4YAH X;  1D3K A;  3IOR A;  5TP9 A;  3KOS A;  1QUI A;  4H0W A;  4PP0 A;  5KDT A;  5JK4 A;  3A3U A;  2Z8D A;  1D9V A;  2BJJ X;  4KCC A;  1LCT A;  1B3E A;  3TZA A;  3SEW A;  5IAI A;  3H6U A;  3VE1 B;  4U1O A;  5L9S A;  4JBZ A;  4FEB A;  1H43 A;  2XXV A;  1GV8 A;  1VFD A;  3A09 A;  3F11 A;  4PFY A;  3MZ9 A;  3RGY A;  5H8N B;  1A54 A;  1MY3 A;  4LA9 A;  5I2N A;  3B6W A;  4KD5 A;  3TTL A;  2I3W A;  3TTK A;  2XXR A;  3LSW A;  5CMK A;  3PD9 A;  3KGC A;  4F3G A;  3OD7 A;  4FE8 A;  4ECF A;  4U23 A;  3UP9 A;  4OQO A;  2NOO A;  3UN6 A;  1N04 A;  4ZEF A;  3THI A;  3S9E A;  3FXU A;  2O68 A;  2OBG A;  1JW5 A;  1B3G A;  4RXL A;  3IOU A;  4DZ1 A;  5AA3 A;  4POX A;  4OFO A;  3LR1 A;  3CVG A;  4DXB A;  4R74 A;  1S7Y A;  1WVJ A;  1JW4 A;  2RC8 A;  1JET A;  1B32 A;  1S50 A;  4YMA A;  4JWO A;  3ILU B;  4F3P A;  3RTF B;  4ZEB A;  3OSQ A;  4TLM B;  3G3K A;  4IGR A;  2XX8 A;  5L8D A;  3EHS A;  1XT8 A;  1M5C A;  4R72 A;  4KYS A;  3GZG A;  3MQ9 A;  5DEX A;  4I62 A;  2P0S A;  3P7I A;  5ITO A;  4UA8 A;  1OMP A;  3H6V A;  3KEI A;  2OWT A;  2O1M A;  4IO6 A;  4QF9 A;  2B65 A;  4IY6 A;  3R7X A;  5DTB A;  2ABH A;  4H1X A;  3TKD A;  2OK2 A;  2M8C A;  3H03 A;  1I6B A;  2OCU A;  2VD2 A;  3CFL A;  4JDF A;  1LFH A;  2QSX A;  1P1O A;  5LOM A;  4R6Y A;  1Y4T A;  3V5A A;  4GLI A;  4O3B A;  1PB8 A;  4PQJ A;  4YMB A;  4OFL A;  5AA2 B;  3O6G A;  2I6E A;  1PB9 A;  2D3I A;  3K2D A;  3D4G A;  5J1D A;  4BDL A;  4ZEK A;  3PUZ E;  3G3H A;  4BDR A;  4Q30 B;  5CC2 A;  3DP4 A;  4E0X A;  4FJP A;  1I69 A;  3SEU A;  4DDD A;  3H4Z A;  2ZYM A;  4NF4 A;  2I0B A;  3SET A;  3TUS A;  1B2H A;  3UIF A;  4LON B;  3SEX A;  4GVO A;  3PD8 A;  1MXY A;  5DYH A;  1ZIU A;  4QFO A;  2UVJ A;  4AQ4 A;  2DWH A;  1OIB A;  3W9V A;  2Z23 A;  3K4U A;  1JQF A;  1URD A;  1JNF A;  2H99 A;  4M1V A;  1MY1 A;  2DXR A;  3G3F A;  1GVC A;  1HSE A;  2OWS A;  3TFL A;  1A8E A;  5I59 B;  1POY 1;  3OO7 A;  2Y7W A;  3C9H A;  3IOW A;  4GL8 A;  3FZV A;  1LAH E;  1SI1 A;  5TP9 B;  3TEL A;  5KDT B;  2CMO A;  1JEU A;  1B7U A;  1B5H A;  5CMC A;  4Z0I A;  3G3G A;  4GWO A;  4Z7E A;  5K2X A;  3IO6 A;  4DIG A;  3H6W A;  2Q88 A;  2QJE A;  5I2N B;  1ANF A;  1HSJ A;  4JWY A;  1ZU0 A;  3RN8 A;  4KHZ E;  1UQW A;  3ECR A;  3MZ1 A;  4OEV A;  4EXK A;  1JVY A;  3GXA A;  3T9H B;  3BFU A;  4FAJ A;  4XKN A;  3IX1 A;  5I2K A;  2F6G A;  3DP8 A;  3IAZ A;  2ONK E;  5HM4 B;  1EZP A;  3O9P A;  1NH8 A;  3B7D A;  3T9X B;  1Y1Z A;  3KFM A;  4GOT A;  2QPQ A;  4MF3 A;  1XC1 A;  1Z7M E;  4ZE9 A;  3KG2 A;  1YAE A;  4IGT A;  3O66 A;  4ZZE A;  1IXI A;  3RT6 B;  2H9B A;  4O3A A;  4ZEI A;  1P99 A;  2DWI A;  1SYH A;  3JV9 A;  2HFB A;  3CG1 A;  2HEU A;  4THI A;  1YCJ A;  1H76 A;  2YLN A;  3G3I A;  4RY1 A;  1KWH A;  4GQO A;  4OEN A;  1B52 A;  4JWX A;  4KYD A;  4MLQ A;  1AMF A;  1TXF A;  2RCA A;  1DSN A;  1M5D A;  2Z8E A;  3TTR A;  4H6D A;  4H67 A;  2QS1 A;  3TDJ A;  3EHT A;  1B4H A;  1Q35 A;  3TMG A;  4EXL A;  3D4C A;  2P2A A;  2WKY A;  2QMW A;  2DE2 A;  3TYH A;  3CR9 A;  2UVH A;  5H8F A;  2F7A A;  1B3H A;  1XVY A;  1IZ1 A;  1B7H A;  3B6Q A;  3S9M C;  1LBB A;  1VSO A;  4R2F A;  1B3L A;  4ONY A;  1N76 A;  4Q8R A;  3K1P A;  2PMS A;  1T0K A;  4EF1 A;  4WXJ A;  3L6G A;  3ZSF A;  5FHM A;  2QS2 A;  3M3F A;  3S4U A;  3FVK A;  4ZS9 A;  1MY2 A;  2H5Y A;  1FTJ A;  1OVB A;  1FW0 A;  4ESW A;  4NWC A;  3VXC A;  2V3Q A;  2RKM A;  1O7T A;  4U1Z A;  2ANJ A;  1SW1 A;  2ZNS A;  3OSR A;  4ZDM A;  4OVJ A;  4F2O A;  3SDF A;  5TPA B;  2XXI A;  1LLS A;  4KI0 E;  4YZZ A;  4LZ8 A;  3T96 B;  3OEK A;  4X9T A;  5B7D A;  2F5X A;  2F34 A;  1DTG A;  1R6Z A;  1ZKB A;  2XX7 A;  3KJT A;  1QKA A;  4QHQ A;  2AIX A;  4RNS A;  3RUM A;  5EHS A;  4I9D A;  1BTJ A;  1BIY A;  3QUJ A;  3RY3 A;  1MXZ A;  1UTH A;  3C36 A;  2Y7R A;  2DWJ A;  4IO2 A;  1R9Q A;  1N7W A;  4YB5 A;  3BBR A;  4PE5 B;  1B05 A;  4F2Q A;  3RNN A;  4AB5 A;  4OER A;  4ESX A;  3GBA A;  3E3K A;  4WED A;  1MXX A;  1IXH A;  4AB6 A;  2AL5 A;  4JXI A;  5K2Y A;  1Y3N A;  3V83 A;  2VOZ A;  2F78 A;  1XS5 A;  4ZEC A;  3FUZ A;  4G68 A;  3MAM A;  4PFW A;  1ATG A;  1IXC A;  3QSL A;  1SW2 A;  5F1Q A;  2DVZ A;  5EHM A;  1OQH A;  4EQB A;  1F9B A;  3UK4 A;  1YPN A;  2Q8J A;  1M5F A;  1GGG A;  5HPQ A;  3FVN A;  5I58 A;  2OJT A;  4G8M A;  1Y3P A;  5AA4 A;  2UYF A;  2I0C A;  4IO7 A;  1ZLQ A;  4ND9 A;  3OOA A;  1ELJ A;  4GD5 A;  1RKM A;  1NH7 A;  3OEN A;  1USY H;  3MP6 A;  2Y7K A;  5H8S A;  1MPD A;  4DLD A;  3U94 A;  3FIR A;  4FOR A;  4GRK A;  2RC7 A;  1QVS A;  2FA7 A;  1VR5 A;  4YB6 A;  3K01 A;  2XX9 A;  4R9G A;  3MPL A;  3R6U A;  5CBS A;  3TQW A;  3PU5 A;  2DVC A;  1B7Z A;  2QMX A;  4F39 A;  3TEP A;  1OQG A;  3MVY A;  3DEL B;  2NVU B;  4N13 A;  3K00 A;  2I4B A;  5I57 B;  3S9L C;  4ELQ A;  4F22 A;  5HBC A;  1UIU A;  5H8Q A;  4ZZA A;  3VXB A;  4F31 B;  1MM7 A;  4QSC A;  3FAS A;  1US4 A;  5A5X A;  2B3B A;  3H7M A;  2XXQ A;  2I49 A;  3Q28 A;  1WOD A;  5B70 A;  2F6P A;  4U2R A;  3T9U A;  3E9X A;  2O51 A;  3FXQ A;  1FCK A;  1NNP A;  3MBP A;  1HSL A;  2ZNU A;  1H3D A;  2DE3 A;  1O63 A;  4NED A;  1Z7N E;  4NF8 A;  4H5F A;  4IO3 A;  2R71 A;  2I4C A;  2FYI A;  1MM6 A;  1ZTY A;  2XXW A;  4R9F A;  4NF6 A;  3VLU A;  5FHO A;  1IEJ A;  2X7Q A;  1B3F A;  3O97 A;  1Y3Q A;  4KPT A;  2QRY A;  3QIM A;  3OO8 A;  1A99 A;  3C33 A;  3T93 B;  3MVW A;  1NL5 A;  4DCY A;  1I6A A;  3MUQ A;  1MY4 A;  2PX1 A;  3G7W A;  4MH5 A;  4IO4 A;  3L6H A;  5H8H B;  1IUD A;  1SYI A;  3TPA A;  4HTG A;  4WKM A;  4GL0 A;  3E13 X;  2I48 A;  1UTB B;  2CZL A;  1QKB A;  2ONS A;  1EU8 A;  2ZYN A;  3GBB A;  5BWJ A;  1EH3 A;  4EQ7 A;  3PUW E;  4DCX A;  3PMV A;  1UTH B;  2YJP A;  1Y20 A;  2I58 A;  4YKK A;  1TT1 A;  1DPP A;  3VVE A;  1LAF E;  3VV5 A;  1OLA A;  3HO7 A;  3PUV E;  5I56 A;  3IB0 A;  3T66 A;  1B9J A;  3EN3 A;  3HN0 A;  1UIV A;  1LB8 A;  3TCG A;  3PPR A;  1N84 A;  4DXU A;  4QFN A;  1NNT A;  2HAV A;  4BDO A;  1II5 A;  1VFE A;  3M3L A;  1TFA A;  4G77 A;  1B1X A;  3QUF A;  3LSX A;  1LAG E;  5JTY A;  2D21 A;  4POW A;  4GIZ A;  3PUX E;  4OEU A;  1LAX A;  1RYO A;  4YKP A;  4OTE A;  4FAT A;  4GFR A;  3CG3 A;  3N5L A;  3OO6 A;  1SDX A;  1M5B A;  4OXV A;  3FJG A;  5I58 B;  5CRY A;  3OMB A;  2NXO A;  1MH4 A;  3MP8 A;  3UGW A;  2AL4 A;  1QJM A;  3S2V A;  3MPK A;  2PT2 A;  3IOT A;  4N07 A;  3FXR A;  1US5 A;  3ZKK A;  1N0T A;  5FTH A;  4LVQ A;  2F7C A;  3CRB A;  4GXA A;  1FQA A;  2O1L A;  4R2B A;  4DE8 A;  2XXU A;  3MVX A;  1P1W A;  2THI A;  3OEL A;  5IKB A;  4NE4 A;  1TWY A;  3FJ7 A;  3IO4 A;  3EHU A;  1AIV A;  2H98 A;  4NMY A;  4OFJ A;  1P1U A;  1DTZ A;  1NFT A;  3E4R A;  4NWD A;  2V93 A;  2PYY A;  2GHA A;  1J1N A;  1LFG A;  4BDN A;  2R6G E;  5DEX B;  1Y9U A;  5H8Q B;  4KCD A;  2HXW A;  3DM0 A;  4X48 A;  2E1S A;  3MC2 A;  3MW0 A;  3U93 A;  1MPB A;  4JSO A;  4X1D A;  2B3F A;  2F97 A;  4C1T A;  1MRP A;  5CI5 A;  3TCF A;  4G8H A;  2AYS A;  1PBQ A;  2A5T A;  3RLF E;  3OXN A;  2Q2A A;  1BKA A;  4KQP A;  4LQ2 A;  5M2V A;  4TQU Q;  4F29 A;  4XKP A;  3PPP A;  4LQ5 A;  3TAJ A;  2Q2C A;  4ELP A;  3T22 A;  1B46 A;  1DMB A;  5DVF A;  2DWA A;  1M5E A;  3IB2 A;  1SQY A;  1MY0 A;  3K1M A;  3UA8 A;  1DOT A;  1LCF A;  3N6U A;  1SBP A;  1A40 A;  3CFX A;  1MPC A;  4ELO A;  3RT8 A;  5ICT A;  2HQ0 A;  3IR1 A;  2V3T A;  2X7P A;  3N6T A;  1A8F A;  4NF4 B;  3LSL A;  1IIW A;  3SEV A;  2Q89 A;  5JEI A;  4ISU A;  1FTK A;  1N7X A;  3VVD A;  4HCW A;  3O2A A;  3RQT A;  4YU0 A;  1N3W A;  2XXT A;  3OEM A;  2KLF A;  3SER A;  2QS3 A;  3FVO A;  1B0H A;  3K6U A;  1IIT A;  4E0W A;  4F19 A;  1MXV A;  4XIG Q;  1B6H A;  4M4G A;  1NNF A;  5ICQ A;  3U8Q A;  4OYV A;  5KZT A;  4LZ5 A;  1B1H A;  1MQD A;  3ZS6 A;  4F1V A;  2XXP A;  1AOV A;  3LUY A;  1JVX A;  2QS4 A;  2XXX A;  3K02 A;  3PGF A;  1CB6 A;  3DP6 A;  4PFU A;  3U1O A;  3ILT B;  3PUY E;  5AA1 A;  3USD A;  2VP1 A;  3MWB A;  3H06 B;  2Z22 A;  3I5O A;  4N6P A;  1MQI A;  3C32 A;  2UVI A;  1A55 A;  4ZED A;  4OET A;  4LUB A;  1QUL A;  3O6H A;  4U21 A;  4NF5 A;  2E0S A;  2O6A A;  3N26 A;  4RPN A;  1R9L A;  3FAT A;  3PV0 E;  5CM6 A;  5I2K B;  4H5G A;  3Q25 A;  4FIM A;  4R75 A;  1QUK A;  4TLL B;  2G29 A;  1P1N A;  3FD3 A;  4UAC A;  1XVX A;  1PEB A;  2OZZ A;  1B40 A;  4X1B A;  1MH3 A;  2IEE A;  5F7V A;  1MDQ A;  1QUJ A;  4G2Z A;  5I84 A;  3IK6 B;  2F36 A;  2ZMB A;  2DQV A;  2DSF A;  4JB7 A;  3A3C A;  1DPE A;  3QAX A;  4H65 A;  3FJM A;  3KSX A;  3M3K A;  3RPW A;  1FTL A;  4XXU A;  1NMU A;  1WDN A;  1FQF A;  1ZMG A;  1AL3 A;  4IO5 A;  2GH9 A;  3R26 A;  1OLC A;  2D5W A;  3FV2 A;  4G68 C;  4LAT A;  4L17 A;  3C31 A;  1FTO A;  2ZYK A;  4HW8 A;  4YKJ A;  1YTV A;  2ONR A;  2PT1 A;  3AXF A;  3SES A;  1PC3 A;  1MXW A;  2ZYO A;  2DS9 A;  3G3J A;  4GXS B;  3Q26 A;  3CI8 A;  4RYA A;  5H8F B;  4RK2 A;  1URG A;  5KCJ A;  4F1Y A;  2A5T B;  3VVF A;  4QFL A;  3TQL A;  3Q27 A;  1SVX B;  2FNC A;  3GLB A;  2NUV A;  5DVI A;  2XHD A;  4C1U A;  3HST A;  3PMX A;  4ZE8 A;  3KBR A;  4KYE A;  4YKI A;  3KJ7 A;  3U92 A;  1S9T A;  3KSJ A;  4LZ7 A;  3QK6 A;  1ZJL A;  3LBS A;  1MG1 A;  5L9O A;  3FVG A;  4MLV A;  5FHN A;  3S9N C;  2HCA A;  5ITP A;  2VD3 A;  3PPN A;  1A7L A;  4EUO A;  1BP5 A;  1IXG A;  2RC9 A;  5CMM A;  3LC8 A;  1H45 A;  2GRV A;  2O7I A;  1LBC A;  1GTK A;  4U4X A;  1NNK A;  4XTC Q;  4OMB A;  4HCY A;  3BKI B;  4U4S A;  1CE2 A;  3O29 A;  3VDF A;  2HAU A;  4RJZ A;  2Q9T A;  3VLW A;  2G93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...