2THIA

Thiaminase i from bacillus thiaminolyticus
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
362
structure length
362
Chain Sequence
ITLKVAIYPYVPDPARFQAAVLDQWQRQEPGVKLEFTDWDSYSADPPDDLDVFVLDSIFLSHFVDAGYLLPFGSQDIDQAEDVLPFALQGAKRNGEVYGLPQILCTNLLFYRKGDLKIGQVDNIYELYKKIGTSHSEQIPPPQNKGLLINMAGGTTKASMYLEALIDVTGQYTEYDLLPPLDPLNDKVIRGLRLLINMAGEKPSQYVPEDGDAYVRASWFAQGSGRAFIGYSESMMRMGDYAEQVRFKPISSSAGQDIPLFYSDVVSVNSKTAHPELAKKLANVMASADTVEQALRPQADGQYPQYLLPARHQVYEALMQDYPIYSELAQIVNKPSNRVFRLGPEVRTWLKDAKQVLPEALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THIAMINASE I
publication title Crystal structure of thiaminase-I from Bacillus thiaminolyticus at 2.0 A resolution.
pubmed doi rcsb
source organism Paenibacillus thiaminolyticus
total genus 115
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature ec 2.5.1.2: Thiamine pyridinylase.
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2thiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2thiA02
4XIGQ 4DXUA 1AH5A 1B52A 3S9EA 3PD9A 3S9MC 2THIA 2XXPA 4XTCQ 1BP5A 3KJ7A 3IAZA 1DOTA 3E9XA 2H25A 1MPBA 4IGTA 1MY1A 5H8HA 1Y3NA 4ECFA 3UP9A 5A5XA 3QSLA 1SBPA 3MZBA 2PT2A 5M2VA 4TLLB 1JQFA 2RC8A 2XXXA 3OSRA 1SQYA 4C1UA 3EN3A 5DEXB 3C4MA 3TUSA 2REGA 4DIGA 1QUJA 1TT1A 1USYE 4BLAA 3U72A 5CMCA 4GXSB 2O7UA 1USYH 1MXXA 4OVJA 3EQ1A 3GZGA 4EQ7A 3PPNA 2XXUA 3BKIB 1A54A 5ICQA 3TELA 3K1NA 5L9SA 2ONKE 1B9JA 5K2YA 3KBRA 5K2XA 5ICTA 5L8DA 4ZE9A 1MG1A 1MM7A 1DTGA 3LBSA 5DTBA 1DPEA 1PC3A 1UTBA 4ONYA 2UYEA 3FVGA 4ZDMA 1IIWA 3BFTA 3IOTA 3M3LA 2Q89A 1B3FA 4KD5A 1LBCA 4YU0A 3G3HA 3PUXE 2YPNA 2ZYNA 1LAHE 4BDOA 2AIXA 2F7AA 4OESA 3MPLA 4PFWA 4QSCA 3SEUA 1ZLQA 4I62A 1SW5A 4RNSA 3LSXA 1QUIA 5AA4A 2I0BA 3IJXB 5AA2D 4LUBA 4GD5A 3RPWA 4PETA 1JETA 4X1BA 3PUWE 4C0RA 1II5A 4ZZEA 2NXOA 1SI1A 4U23A 1MXWA 3TCFA 3PD8A 1NH7A 4H65A 4KCCA 4BDRA 4I9DA 1TXFA 3RNNA 3EHTA 2R9JA 3TKDA 1DMBA 2E0SA 4JXIA 3EF7A 2REJA 2F6PA 2I4CA 2ESNA 3DP4A 2QMXA 4LONB 1MXYA 4UACA 4HS7A 5TPAA 1B3GA 4ESXA 2VP1A 4GOTA 4IO2A 4L17A 3K6XA 3TZAA 1B1HA 4N6PA 3CSBA 3M3KA 1ZJLA 3UORA 4GFRA 3T66A 1N04A 3Q29A 1M5BA 2DVZA 5H8FB 4ZEBA 4YB5A 3KG2A 3FXQA 2CMOA 2I0CA 5JK4A 3OO8A 2I4BA 3CFZA 4U4SA 3TDJA 3BBRA 2QS2A 1A7LA 2I49A 1N3WA 3IB0A 1OVBA 3I6VA 4YB7A 5FHOA 3H4ZA 5I57B 3C31A 3CVGA 4JDFA 4U22A 4P11A 1Z7NE 4LQ2A 2V3QA 3SEYA 3FV2A 1QW0A 1A8FA 1QULA 1MQHA 3VXBA 3PMVA 3D4GA 5JTYA 3OO6A 4YZZA 3DLNA 4RXLA 1XT8A 2H5YA 5KCJB 3H6TA 1VSOA 5CMMA 1FQCA 4EUOA 3VFJA 3IB1A 4Q8RA 5CMKA 3HPIA 3O2AA 1B4HA 3W15C 4NE4A 2RCAA 3MAMA 3PUZE 4JWYA 4ESWA 2ZYOA 4FIMA 3TTRA 3S9LC 2DXYA 1SW2A 4PE5B 1B3LA 3JZJA 1MDP1 1I6AA 1JW1A 3HHGA 1POY1 5H8QA 3SETA 5F1QA 4YKKA 3O28A 2B3FA 1LCFA 4XXUA 1US5A 1N0TA 3K2DA 4GRKA 5TP9B 2P2AA 1B32A 1MY2A 5FHNA 3L6GA 3MBPA 4F1UA 2HCAA 4IO3A 4PP0A 3MW0A 4QFPA 4G4PA 2ALUA 1BTJA 2V3TA 2H4IA 4JB7A 3LUYA 3MVZA 3N26A 4GIZA 4LATA 4PFYA 2Y84A 4H1XA 2VGQA 4NWDA 3QXMA 2OK2A 4DXBA 4YKIA 2DWHA 2E1SA 5H8SA 3I3VA 3TODA 3OOAA 1H44A 1S50A 4R2BA 1FTOA 2R6GE 2FYIA 3KOTA 4LZ5A 2F8DA 1RYXA 3CG3A 5I59B 3UA8A 3K00A 1N84A 2I3WA 1VE4A 4YMBA 4TOZA 2Q2AA 3MVXA 3IK6B 5IAIA 3K6VA 1US4A 1H76A 1MY0A 3B6QA 2V25A 1M5EA 1SW4A 3VXCA 3CG1A 3A09A 3QUFA 1OIBA 4YMAA 1JNFA 1PB8A 1Y9UA 1SYIA 4U1ZA 3K6WA 2XX8A 4OERA 2DWAA 4ZEDA 3H6UA 3KN3A 1PDAA 1FTJA 5I2NA 1UTHB 4DZ1A 2QS1A 1B46A 4DCYA 1MY4A 3TMGA 4F19A 1IUDA 1O63A 4LP2B 3SESA 3C33A 4OEVA 2PMSA 1JEUA 1ZIUA 4I8CA 1ELJA 1DTZA 5B70A 2F97A 1KWHA 2CZLA 4H5GA 1Y4TA 4P0IA 1PBQA 1S7YA 3LC8A 3OO7A 3FASA 1GGGA 4RPOA 4WKMA 4G8MA 4HCYA 3HCQA 3FD3A 4H5FA 1MH3A 5CMBA 3C34A 1M5CA 3O6IA 2ZMBA 3IB2A 2OWSA 4MF3A 4FJPA 3FVNA 3DP6A 1ATGA 5DVFA 1LGBC 2F7BA 2PT1A 2XX9A 2RINA 3RUMA 5CC2A 4NF8B 1FW0A 2PYYA 1OVTA 3SKPA 1NMUA 4F1VA 4NF5B 3KEIA 4RJZA 4EQBA 1Y1ZA 3KZGA 4P0GA 4FAJA 1QJMA 4XKQA 4G68A 2AYSA 4ZEIA 1IZ1A 5I58B 4KYDA 3T9HB 3ECRA 2ZNSA 2Q2CA 2XXHA 5B7DA 5I56B 3TAJA 2QSXA 3RQTA 2AL4A 1PEBA 1A8EA 1O7TA 4GL8A 4OXVA 3THIA 3W9VA 4QHQA 3IORA 3ZS6A 1SDXA 1ZKBA 3R26A 2Z8EA 3FJ7A 2O7IA 2VOZA 2XD2A 3FJMA 2XXIA 1LAFE 2B65A 2HAVA 2F6GA 3IOUA 3MWBA 1OLAA 2A5TB 3MZ9A 4NF4B 4H8JA 3FIRA 1HSEA 3HO7A 4KHZE 5ELVA 3PV0E 4NF6B 1MRPA 3Q27A 4WEPA 1M5FA 2B3BA 3VLVA 3K1PA 4R73A 2W7YA 5ITPA 1P1QA 4OENA 2DOJA 1B0LA 1B1XA 2UVHA 1XC1A 2HFBA 3F11A 4C1TA 1NNTA 1IQ7A 2QS3A 1P1NA 2Z23A 3IO4A 3O29A 5H8HB 2DSFA 3QIMA 1I69A 4KYEA 5A5XB 3DP8A 4R6HA 1JW5A 2KLFA 4F3SA 1ZMGA 1RYOA 3UIFA 2OWTA 4EXLA 1B7HA 2Z8DA 4R75A 2XHDA 1EU8A 5DVJA 4YKJA 4BDQA 1AIVA 3RGYA 2HZKA 4ZE8A 4HCWA 4NTLA 4OHNA 1IITA 3SDFA 3G3IA 3MP8A 4EF2A 3SEWA 4BDLA 4RK2A 3H03A 1ZTYA 2G93A 1SYHA 2GH9A 1B3EA 1FQDA 4KYSA 3DM0A 2XXTA 1UTBB 4ZEKA 1BKAA 1MQGA 4QFLA 3CFLA 3TPAA 4ELPA 2XXYA 3R7XA 3VE1B 1H45A 1XVXA 3IOVA 1N7XA 5AA1A 4IB2A 3TTNA 3IOWA 3FVOA 3TYHA 4ISUA 1Y3QA 4G68C 3E4RA 2O6AA 4F39A 3OEMA 2DS9A 2IA4A 1GTKA 1D9YA 1B6HA 4DE8A 5AA4B 2HXWA 3QYTA 3PPQA 1EZPA 1R9LA 2ZNTA 2GRVA 1MXVA 3HSTA 1LB9A 2VHAA 3FVKA 3MZ1A 3U94A 1TFAA 5IKBA 5I84A 4F3BA 5AA2B 4ELOA 3UN6A 4YB6A 3A3UA 4NEDA 1NH8A 2V93A 3T22A 3VV5A 1QVSA 1Q1KA 3T9XB 3PPPA 4M4GA 4Q5TA 1Y4CA 2DVCA 2R71A 4F18A 1TFDA 5AE4A 3U93A 5TU0A 3CFXA 4QFOA 2BJJX 3W9WA 1WVJA 1IXHA 1LSTA 1IXIA 4PFUA 3M3FA 4U1OA 3KGCA 1AMFA 1ANFA 3RLFE 3TTKA 4AB6A 1FQFA 3EHUA 2Y7KA 5H8NA 1FTKA 1PBPA 2DYXA 2DE2A 3RN8A 3KFMA 4YICA 1ZBMA 3MP1A 3RTFB 3G3JA 1LFHA 4ZECA 4NWCA 1LLSA 1QKBA 2UVGA 4KFQA 4NMYA 4HTGA 4K3FA 5JTYB 3PU5A 3KJTA 4G77A 3OELA 1IXCA 2QMWA 3N6TA 5ITOA 4DLDA 2Y7PA 2HAUA 3UGWA 1JEVA 2XXVA 3U92A 3T9UA 4DDDA 3G3KA 4YKPA 2D21A 4JWXA 1D3KA 3RT6B 3PGFA 1TWYA 5DVIA 4F2OA 4JWOA 5DYHA 3TCHA 4OFJA 1NFTA 2DP8A 4QSEA 3QUJA 4O3CA 5H8QB 3TTLA 4HW8A 4H6DA 3V83A 4LA9A 5KDTA 5JEIA 4LVQA 1WODA 3FXUA 2Q8JA 2G29A 3V8XB 1B3HA 3H6WA 4PQJA 4KCDA 1R1NA 2O84X 3C9HA 1FTLA 3MQ9A 4FATA 3CI8A 2Z8FA 3IL1B 4LQ5A 1MXUA 5CRYA 1PB7A 2DWIA 4AQ4A 5I2KB 4GL0A 4IY6A 1VFDA 3N5LA 3IO6A 2ZXTA 4RA1A 2F5XA 2UVIA 1LAGE 2Y7WA 3MVWA 4I1DA 5EHSA 1B4ZA 3LSWA 1FCKA 1MH4A 2NVUB 4XKRA 3TEPA 4EQ9A 1FQEA 3ZSFA 3T96B 3ZKKA 3PUVE 2V3UA 4FEBA 2QS4A 4AB5A 4OTEA 3P7IA 5CI5A 3LSFB 4JBZA 1B5IA 3JYRA 5L9OA 2Z22A 1M5DA 2XX7A 1P99A 4F2QA 2UVJA 3H7MA 3EPEA 4OEUA 2D5WA 1SW1A 5AA3A 5I56A 4FECA 3KOSA 2F34A 1P1OA 3CIJA 1P1UA 2QJEA 1DPPA 5I2NB 1HSJA 3TQLA 4TQUQ 1N76A 3TFLA 4ZS9A 4OETA 4H8IA 2PVUA 3R6UA 1CB6A 4FE8A 1MS7A 4R9FA 2I6EA 2FNCA 4X48A 2A5TA 4KPTA 4OWDA 2ZYMA 3QK6A 3H06B 5DEXA 1XHYA 3RT8A 5L9MA 3N6UA 4XKNA 5FTIA 2O51A 3PMXA 2RC7A 4M1VA 1IXGA 2ONRA 3Q26A 1XVYA 1SI0A 2X7QA 1YTVA 1JW4A 1B5HA 2O1MA 2QRYA 3SERA 2V84A 4OFLA 2H99A 3C32A 2XD3A 5LOMA 3OEKA 4DXCA 3IJOB 2GHBA 4E0WA 1B05A 1OMPA 2HZLA 4RYAA 2F35A 2DXRA 4IO5A 3FZVA 5FTHA 1I6QA 3ZKLA 3L6HA 3OENA 3VVEA 3MC2A 3V89B 3LSLA 4KR5A 5HBCA 4F1YA 1MY3A 4G68B 1URSA 4E0XA 2P1SA 1NKXA 4FEDA 1JVYA 3Q28A 3K1MA 4F29A 3CR9A 2X7PA 2VD3A 3VVFA 1O64A 3KN8A 3OMBA 3S4UA 2ONSA 1OQHA 1CE2A 3MPKA 2XXWA 4QFNA 3MJNA 1EH3A 1P1WA 5BWJA 2DQVA 3B7DA 1IEJA 4QFKA 3U8QA 4QRZA 3OSQA 4Q30B 1EZ9A 4Q0CA 4THIA 3C35A 2RKMA 2D3IA 4WXJA 3S2VA 3V5AA 2LAOA 4RK9A 4IY5A 3HN0A 4MLVA 3VVDA 1Y20A 3PUYE 4XKPA 3FJGA 3VLUA 4KQPA 2YLNA 3B6WA 1B7ZA 3B6TA 4IO7A 3GBBA 1J1NA 1L5TA 4OFOA 1FTMA 1MQDA 3IX1A 3OD7A 1XOCA 1B58A 5EHMA 4LZ8A 2H9BA 3T9VA 4Z0IA 1RKMA 3H3GA 2XXQA 1WDNA 5ISUA 4R72A 3Q25A 3JV9A 1UQWA 2RCBA 3TCGA 5H8FA 3LR1A 3O9PA 1YPNA 5KZTA 4G8NA 3O66A 1GR2A 2Y7RA 3QAXA 3SEXA 3A3CA 1H3DA 3G3FA 5AA2A 4OZ9A 2OCUA 1DSNA 4FORA 3G7WA 3TQWA 5I57A 1MDQA 1D9VA 2RF1A 3PPOA 2Y7IA 3MVYA 4KI0E 4U4XA 1AL3A 3MUQA 1LAXA 3I5OA 4N13A 1GVCA 4G8HA 5FHMA 1T0KA 2PBWA 1ZU0A 2ABHA 1MQIA 1Z7ME 4R6YA 5KCJA 2F7CA 1LB8A 2DE4A 3ONMA 1B40A 3C36A 1URGA 1AOVA 3T93B 1D4NA 1A99A 4MBPA 3N94A 3OO9A 1B0HA 4F3GA 3FATA 4IGRA 5J1DA 4UA8A 3VDFA 1MM6A 3KSXA 2HQ0A 3WAEA 2DE3A 3RTWB 5TPAB 1OLCA 5BUUA 4GVOA 1OQGA 4EDPA 1MXZA 1VFEA 1N7WA 4POXA 3HV1A 3ILUB 1QUKA 2ANJA 3D4CA 3MP6A 1R9QA 2F78A 4O3AA 4EXKA 3AXFA 1SVXB 3G3GA 4R6KA 4ELRA 5CM6A 5TP9A 4BDNA 4MLQA 1B5JA 4O3BA 1YCJA 3K01A 1LFIA 1PB9A 4U21A 1I6BA 3ODBA 4F31B 1BLFA 3K0VA 1B7UA 3KN7A 3K4UA 1B51A 2OBGA 1GV8A 2I48A 1LCTA 3HHFA 4QF9A 4IO4A 2QL3A 1Y1MA 3EHSA 1HSLA 2NWJA 2O69A 2ZNUA 1EZOA 4Z7EA 2UYFA 5EYFA 5I59A 3GBAA 3WAFA 4BDMA 1N3XA 1LBBA 1Y3PA 1NL5A 2I3VA 2M8CA 3SEVA 2O1LA 3RY3A 5H8NB 3IR1A 5DT6A 2XXRA 4LZ7A 5HPQA 2H98A 4GLIA 2Q88A 4ZEFA 4ELQA 4TLMB 3PPRA 2OLBA 1VR5A 4RPNA 5I2KA 2YJPA 4GQOA 1FQAA 2A5SA 1R6ZA 1UIUA 4QSDA 3S9NC 3KSJA 1NNKA 3O6GA 1NNPA 1UTHA 4H0WA 3O6HA 3FV1A 3M8UA 3K6UA 4G2ZA 3TTMA 3USDA 4N07A 2OJTA 4GXAA 4EF1A 4JSDA 1YAEA 3E13X 1POTA 3GXAA 1F9BA 5CBSA 4F3PA 2FA7A 3CSGA 4WEDA 4GF8A 3VLWA 4MH5A 1NNFA 4U2RA 1B2HA 3CRBA 1MPDA 4GWOA 3PMWA 2AL5A 4R2FA 2ZYKA 4JSOA 5KDTB 3DELB 4YAHX 4OMBA 1LFGA 4NF8A 1QKAA 5F7VA 3K02A 3ILTB 2HEUA 1UIVA 3OXNA 4F22A 1S9TA 4OYVA 4R9GA 3U1OA 1Q35A 4NF5A 3UK4A 2WKYA 2I58A 4IO6A 4PFTA 5I58A 3H6VA 3FXRA 5CBRA 4H67A 1URDA 1SD3A 2OZZA 1JVXA 2DWJA 4ND9A 5HM4B 2NUVA 2IEEA 1FQBA 2NOOA 4DCXA 2PX1A 2P0SA 1BIYA 4MFIA 4OQOA 4POWA 2Q9TA 3FGSA 2QPQA 4ZZAA 4R74A 1H43A 1MPCA 1A40A 2GFEA 2VD2A 4X9TA 2RC9A 1A55A 3E3KA 2GHAA 4RY1A 1XS5A 3GLBA 4NF4A 2O68A 4X1DA 2X26A 3BFUA 2UXAA 2F36A 3O97A 4NF6A 1MQJA 3FUZA
chains in the Genus database with same CATH superfamily
1VDWA 4XIGQ 4DXUA 1AH5A 1B52A 3S9EA 3PD9A 3S9MC 2THIA 2XXPA 4XTCQ 1BP5A 3KJ7A 3IAZA 1DOTA 4LN5A 3E9XA 2XWOA 2H25A 4DI3D 1MPBA 4IGTA 1MY1A 5H8HA 1Y3NA 4ECFA 3QMFA 3UP9A 5A5XA 3QSLA 1SBPA 3MZBA 3E78A 2PT2A 1RDXA 5M2VA 4OVQA 4TLLB 1JQFA 2RC8A 2XXXA 3OSRA 1SQYA 4C1UA 3EN3A 5DEXB 1FBGA 3C4MA 3TUSA 2REGA 4DIGA 4H46A 1QUJA 3CHGA 1TT1A 1USYE 4BLAA 3U72A 5CMCA 4GXSB 2O7UA 1USYH 1MXXA 4OVJA 3EQ1A 3GZGA 4NN3A 4EQ7A 3PPNA 2XXUA 3BKIB 1A54A 5ICQA 3E79A 4I3YA 4XF5A 3TELA 4P3LA 2R8TA 3K1NA 5L9SA 2ONKE 1B9JA 1FTAA 5K2YA 3KBRA 5K2XA 5ICTA 5L8DA 4ZE9A 1MG1A 1MM7A 1DTGA 3LBSA 5DTBA 1DPEA 1PC3A 1UTBA 4ONYA 2UYEA 3FVGA 4AS5A 4X8RA 4ZDMA 1IIWA 3BFTA 3IOTA 3M3LA 2Q89A 2XWVA 1B3FA 4KD5A 4N17A 1LBCA 4YU0A 3G3HA 3PUXE 2CEYA 2YPNA 2ZYNA 1LAHE 4BDOA 2AIXA 2F7AA 4OESA 3MPLA 4PFWA 4QSCA 3SEUA 2Y5KA 1ZLQA 4I62A 1SW5A 4RNSA 3LSXA 1QUIA 5AA4A 2I0BA 3IJXB 1KA0A 5AA2D 4LUBA 4GD5A 3RPWA 1QGXA 4PETA 1KA1A 1JETA 4X1BA 3PUWE 4C0RA 1II5A 4ZZEA 2NXOA 5ET8A 4MNCA 1SI1A 4U23A 1MXWA 3TCFA 3PD8A 1NH7A 4H65A 4KCCA 4BDRA 4OVPA 2L5VA 4I9DA 1TXFA 3RNNA 3EHTA 2R9JA 3GYYA 3TKDA 1DMBA 2E0SA 4JXIA 3EF7A 1FPKA 2REJA 2F6PA 2I4CA 2ESNA 3DP4A 5I5PA 2QMXA 4MHFA 4LONB 1MXYA 4UACA 4HS7A 1FRPA 5IGAA 4P8BA 5TPAA 5EYGA 1B3GA 4ESXA 2VP1A 3BIGA 4GOTA 4IO2A 4L17A 3K6XA 3TZAA 1B1HA 4N6PA 1IMFA 3CSBA 3M3KA 2CZHA 4OVRA 1ZJLA 3UORA 4GFRA 3T66A 1N04A 3Q29A 1M5BA 2QFLA 2DVZA 5H8FB 4ZEBA 4YB5A 3KG2A 3FXQA 2CMOA 2I0CA 5JK4A 3OO8A 1JP4A 2I4BA 3CFZA 4U4SA 3TDJA 3BBRA 2PFYA 2FHYA 2QS2A 3BIHA 1A7LA 2I49A 1N3WA 3IB0A 2FBPA 1OVBA 4P9KA 3I6VA 4YB7A 5FHOA 3H4ZA 5I57B 3C31A 3CVGA 4JDFA 4U22A 4P11A 1EYKA 1Z7NE 4LQ2A 2V3QA 3SEYA 3FV2A 2QVRA 1QW0A 3LV0A 1A8FA 1QULA 1MQHA 3VXBA 1FPLA 3PMVA 3D4GA 4PGNA 5JTYA 3OO6A 4YZZA 3LUZA 3DLNA 4P56A 1XT8A 2H5YA 4RXLA 5KCJB 3H6TA 1VSOA 5CMMA 1FQCA 4EUOA 3VFJA 3IB1A 4Q8RA 5CMKA 3HPIA 3O2AA 1B4HA 3W15C 4AS4A 4NE4A 4P47A 2KR0A 2RCAA 3MAMA 5IZ3B 3PUZE 4JWYA 4ESWA 2ZYOA 4FIMA 4PC9A 3TTRA 1D9QA 3S9LC 5IZZA 2DXYA 1LBYA 1SW2A 1XI6A 4PE5B 3RPLB 1B3LA 3JZJA 1MDP1 2PCRA 1I6AA 3NOHA 1JW1A 1IMCA 1FSAA 3HHGA 1POY1 5H8QA 3SETA 5F1QA 4YKKA 3O28A 2B3FA 1LCFA 4XXUA 1DBZA 4MNIA 1US5A 1N0TA 3K2DA 1IMDA 4GRKA 5TP9B 2P2AA 1B32A 1MY2A 5FHNA 3L6GA 4I3EA 3MBPA 4F1UA 5T3JA 2HCAA 4IO3A 4PP0A 3MW0A 4QFPA 4G4PA 2ALUA 1BTJA 2V3TA 2H4IA 4JB7A 3LUYA 3MVZA 3N26A 4GIZA 4LATA 4PFYA 2Y84A 4H1XA 2F3DA 4PDHA 3SZPA 2VGQA 4NWDA 3QXMA 2OK2A 2ZZVA 4OA4A 4DXBA 4YKIA 2DWHA 2E1SA 5H8SA 3I3VA 3TODA 3OOAA 1H44A 1S50A 4R2BA 1LBXA 1FTOA 2R6GE 2FYIA 3KC0A 3KOTA 4LZ5A 2F8DA 1RYXA 3CG3A 5I59B 1FPBA 3UA8A 3K00A 1N84A 2I3WA 1VE4A 4YMBA 4TOZA 2Q2AA 3MVXA 3IK6B 5IAIA 3K6VA 3HFUA 1US4A 2HXRA 3ROJA 1H76A 1MY0A 3B6QA 2V25A 1M5EA 1SW4A 4PE3A 4N91A 3VXCA 3CG1A 3A09A 4PGPA 3QUFA 1FBFA 1OIBA 4YMAA 1JNFA 1PB8A 1Y9UA 1SYIA 4KXPA 4U1ZA 3K6WA 2XX8A 4OERA 2DWAA 4ZEDA 3H6UA 3KN3A 1PDAA 1FTJA 5I2NA 1UTHB 4DZ1A 2QS1A 1B46A 4DCYA 1MY4A 3TMGA 4F19A 1IUDA 1O63A 4LP2B 3SESA 3C33A 4PCDA 4OEVA 2PMSA 1JEUA 1ZIUA 5ET5A 4I8CA 1ELJA 1DTZA 4PFRA 5B70A 4HE1A 2F97A 3KC1A 1KWHA 4NQ8A 2CZLA 1FPGA 4P0IA 1Y4TA 4H5GA 1PBQA 1RDYA 4O7IA 1S7YA 3LC8A 3OO7A 4O94A 3FASA 1GGGA 4RPOA 4WKMA 4G8MA 4HCYA 3HCQA 1NI9A 3FD3A 4H5FA 1MH3A 2WX9A 4P1EA 5CMBA 3C34A 1M5CA 3O6IA 2ZMBA 3IB2A 2OWSA 4MF3A 4FJPA 3FVNA 3DP6A 1ATGA 5DVFA 1LGBC 1LEVA 2F7BA 2PT1A 2XX9A 2RINA 2BJIA 3RUMA 5CC2A 4NF8B 1FW0A 2PYYA 4OVSA 1OVTA 3SKPA 1NMUA 4F1VA 4NF5B 3KEIA 4RJZA 4EQBA 1Y1ZA 3KZGA 4P0GA 4FAJA 4PTKA 1QJMA 4XKQA 4G68A 2AYSA 4ZEIA 1RDZA 1IZ1A 5I58B 4KYDA 5DW8A 3T9HB 3ECRA 1FBHA 2ZNSA 2Q2CA 2XXHA 5B7DA 5I56B 3TAJA 2QSXA 3RQTA 2AL4A 1PEBA 2FVZA 1A8EA 1NV4A 1O7TA 4GL8A 4OXVA 3IFCA 3THIA 3W9VA 2XWKA 4QHQA 5EYHA 3IORA 3ZS6A 4O8MA 1SDXA 1ZKBA 1FBDA 3R26A 2Z8EA 3FJ7A 2O7IA 2VOZA 2XD2A 3FJMA 2XXIA 1LAFE 2B65A 2HAVA 2F6GA 3IOUA 3MWBA 1OLAA 2A5TB 3MZ9A 4NF4B 3MYUA 4H8JA 3FIRA 1HSEA 3HO7A 4KHZE 2WBDA 5ELVA 5LTCA 3PV0E 4NF6B 1MRPA 4NX1A 1IMEA 3Q27A 1G0IA 4WEPA 1M5FA 2B3BA 3VLVA 3K1PA 4R73A 2W7YA 5ITPA 1P1QA 4OENA 4PFBA 2DOJA 4MAGA 1B0LA 1B1XA 2UVHA 1XC1A 2HFBA 3F11A 4C1TA 4N8GA 1NNTA 5ESYA 1IQ7A 2QS3A 2XWIA 1P1NA 2Z23A 3IO4A 3O29A 5H8HB 2DSFA 1FBEA 3QIMA 1I69A 4KYEA 5A5XB 3DP8A 4R6HA 1JW5A 2KLFA 4F3SA 1ZMGA 1RYOA 3UIFA 2OWTA 4EXLA 1B7HA 4PDDA 2Z8DA 4R75A 2XHDA 2WEFA 5EQ7A 2B4MA 1EU8A 5DVJA 4YKJA 4BDQA 1IMBA 1AIVA 3RGYA 2HZKA 4ZE8A 4HCWA 4NTLA 1YXIA 1IITA 4OHNA 3SDFA 3G3IA 3MP8A 4EF2A 3SEWA 4BDLA 4RK2A 3H03A 4PAKA 3ISPA 1ZTYA 2G93A 1SYHA 2GH9A 1B3EA 3T0JA 1FQDA 1NUWA 4KYSA 3DM0A 1FBPA 2XXTA 1UTBB 4ZEKA 1BKAA 1MQGA 4QFLA 4MIJA 3CFLA 3TPAA 2XXYA 4ELPA 3R7XA 3VE1B 1H45A 1XVXA 3IOVA 4PAIA 1N7XA 5AA1A 4IB2A 3TTNA 3IOWA 1DK4A 3FVOA 3TYHA 4ISUA 1Y3QA 4G68C 3E4RA 2O6AA 4F39A 3OEMA 2DS9A 2IA4A 2FIEA 2PFZA 1GTKA 1D9YA 1B6HA 4DE8A 5AA4B 4JVIA 2HXWA 3QYTA 3PPQA 1EZPA 1R9LA 1NV1A 2ZNTA 2GRVA 1MXVA 3HSTA 1LB9A 2VHAA 3FVKA 3MZ1A 3U94A 5EQAA 4MEVA 1TFAA 5IKBA 5I84A 4F3BA 5AA2B 4ELOA 1NV0A 3UN6A 4FBPA 4YB6A 4GWUA 4OVTA 3A3UA 4NEDA 4JVCA 1NH8A 2VPOA 2V93A 2B4LA 3T22A 3VV5A 1QVSA 1Q1KA 3T9XB 3PPPA 2KQZA 4M4GA 4Q5TA 1Y4CA 2DVCA 2R71A 2QVVA 4F18A 1TFDA 4HE2A 5AE4A 3U93A 5TU0A 4GBWA 4GWWA 3CFXA 4QFOA 2BJJX 4N81A 3W9WA 1WVJA 1IXHA 1LSTA 1YYZA 1NUYA 1IXIA 4X04A 3B8BA 4PFUA 1EYIA 1K9ZA 3M3FA 4U1OA 4N6DA 4PF6A 3KGCA 1AMFA 1ANFA 1FPFA 3RLFE 3TTKA 4AB6A 1FQFA 3EHUA 2Y7KA 5H8NA 1FTKA 1PBPA 2DYXA 2DE2A 3RN8A 3KFMA 4YICA 2VPNA 1ZBMA 4N6KA 3MP1A 3RTFB 4PAFA 3G3JA 1LFHA 4ZECA 4NWCA 1LLSA 1QKBA 2UVGA 4KFQA 4NMYA 5F24A 4HTGA 4K3FA 5JTYB 3PU5A 3KJTA 1FBCA 4XFEA 4G77A 3OELA 1IXCA 2QMWA 3N6TA 5ITOA 4DLDA 2Y7PA 2HAUA 5FBPA 3UGWA 1JEVA 2XXVA 3U92A 4UABA 3T9UA 1FPDA 4DDDA 3G3KA 4YKPA 2D21A 4JWXA 1D3KA 3RT6B 3PGFA 1TWYA 1LBWA 1NV2A 2ZZXA 4O7MA 5DVIA 4GX3A 1FJ9A 4F2OA 4JWOA 5DYHA 3TCHA 4OFJA 1NFTA 4GBVA 2DP8A 4QSEA 3QUJA 4MCOA 1K9YA 4O3CA 5H8QB 3TTLA 2GQ1A 4HW8A 4PF8A 4H6DA 3V83A 4LA9A 5KDTA 5JEIA 4LVQA 1WODA 3FXUA 2Q8JA 2G29A 4QXDA 3V8XB 1B3HA 3H6WA 4PQJA 4KCDA 1R1NA 2O84X 3C9HA 2F3BA 1FTLA 3MQ9A 4FATA 3CI8A 2Z8FA 1Q9DA 3IL1B 4LQ5A 4DI4B 1MXUA 5CRYA 5ET6A 1PB7A 2DWIA 4AQ4A 5I2KB 4GL0A 4IY6A 2CZIA 1VFDA 1IMAA 3N5LA 3IO6A 2ZXTA 4RA1A 2F5XA 1BK4A 2UVIA 1LAGE 2Y7WA 4I1DA 3MVWA 5EHSA 1B4ZA 4GWXA 3LSWA 1FJ6A 1FCKA 1MH4A 4GX6A 2NVUB 4XKRA 3T1BA 3TEPA 4EQ9A 1FQEA 3ZSFA 3T96B 3ZKKA 3PUVE 2V3UA 4FEBA 2QS4A 4AB5A 4OTEA 3P7IA 5CI5A 3LSFB 4JBZA 1B5IA 1LBVA 1FPIA 3JYRA 2MKZA 5L9OA 3IFAA 2Z22A 1M5DA 2XX7A 1P99A 4F2QA 1NV7A 2UVJA 2P3NA 3H7MA 3EPEA 4OEUA 4PFIA 2XXKA 2D5WA 1SW1A 5AA3A 5I56A 4FECA 3KOSA 2F34A 1P1OA 3CIJA 1P1UA 1YZ0A 2QJEA 1DPPA 5I2NB 1HSJA 3TQLA 4TQUQ 1N76A 3TFLA 4ZS9A 4OETA 4H8IA 2PVUA 3R6UA 1CB6A 4FE8A 1MS7A 4R9FA 2I6EA 2FNCA 4X48A 2A5TA 4KPTA 4GX4A 4OWDA 2ZYMA 3QK6A 3H06B 5DEXA 1XHYA 3RT8A 5L9MA 3N6UA 4XKNA 5FTIA 2O51A 3PMXA 2RC7A 4M1VA 4IR8A 1IXGA 2ONRA 3Q26A 1XVYA 4OANA 1SI0A 3B50A 2X7QA 1YTVA 1JW4A 1B5HA 2O1MA 2QRYA 3SERA 2QVUA 2V84A 4OFLA 2H99A 3C32A 2XD3A 5LOMA 3OEKA 4HXVA 4DXCA 3IJOB 4JVDA 1DCUA 2GHBA 1NUXA 1LBZA 5I3SA 4E0WA 1B05A 1OMPA 2HZLA 4RYAA 2F35A 2DXRA 4IO5A 3FZVA 5FTHA 1I6QA 3ZKLA 3L6HA 3OENA 3VVEA 3MC2A 3V89B 3LSLA 1NV3A 4KR5A 5HBCA 4G61A 4F1YA 1MY3A 4GWSA 4G68B 1URSA 4E0XA 2P1SA 1NKXA 4FEDA 1JVYA 3Q28A 3K1MA 4F29A 3CR9A 2X7PA 2VD3A 3VVFA 1O64A 3KN8A 3OMBA 3S4UA 2ONSA 1OQHA 1CE2A 3MPKA 2XXWA 4QFNA 3MJNA 1EH3A 1P1WA 5BWJA 2DQVA 3B7DA 1IEJA 4QFKA 3U8QA 4QRZA 3OSQA 2WYPA 4Q30B 1EZ9A 4Q0CA 4THIA 3C35A 2RKMA 2D3IA 4WXJA 3S2VA 3V5AA 2LAOA 4RK9A 4IY5A 5ET7A 3HN0A 4MLVA 4XEQA 3VVDA 1Y20A 3PUYE 4XKPA 3FJGA 3VLUA 4KQPA 2YLNA 4MMPA 3B6WA 1B7ZA 3B6TA 4IO7A 3GBBA 1J1NA 1L5TA 4OFOA 1FTMA 1MQDA 3IX1A 3OD7A 4NG7A 3EKIA 3MSTA 1NV6A 3PTYA 1NUZA 1XOCA 1B58A 2P3VA 4NAPA 5EHMA 4LZ8A 2H9BA 3T9VA 5J16A 4Z0IA 1RKMA 4MX6A 3H3GA 4P1LA 2XXQA 1WDNA 5ISUA 4R72A 2Q8MA 5IZ1A 3Q25A 4MJOA 3JV9A 1UQWA 2RCBA 3TCGA 5H8FA 3LR1A 3O9PA 1YPNA 5KZTA 4G8NA 3O66A 1GR2A 2Y7RA 3QAXA 3SEXA 3A3CA 1H3DA 3G3FA 5AA2A 4OZ9A 2OCUA 1DSNA 1EYJA 4FORA 3G7WA 4NHBA 3TQWA 5I57A 1MDQA 1D9VA 2RF1A 3FBPA 3PPOA 4PBQA 2Y7IA 3MVYA 4KI0E 4U4XA 1AL3A 3MUQA 1LAXA 4GWYA 3I5OA 4N13A 1GVCA 4G8HA 5FHMA 1T0KA 2PBWA 1ZU0A 2ABHA 4N8YA 1MQIA 3D1RA 1Z7ME 4R6YA 4QBAA 5KCJA 2F7CA 1LB8A 2DE4A 3ONMA 1B40A 3C36A 1URGA 1AOVA 3T93B 1D4NA 2V4CA 1A99A 4MBPA 3N94A 3A29A 3OO9A 1B0HA 5IZ3A 3FATA 4F3GA 4IGRA 5J1DA 4UA8A 3VDFA 1MM6A 3KSXA 2HQ0A 3WAEA 2DE3A 4NGUA 3RTWB 5TPAB 3RPLA 2Y5LA 1OLCA 1G0HA 5BUUA 4GVOA 1OQGA 3KBZA 4EDPA 1MXZA 1VFEA 1N7WA 4POXA 3HV1A 3ILUB 5LDZA 1QUKA 2ANJA 3D4CA 3MP6A 1R9QA 2F78A 4O3AA 4EXKA 3AXFA 1SVXB 5IM2A 3G3GA 4R6KA 4ELRA 5CM6A 5TP9A 4BDNA 4MLQA 1NV5A 1B5JA 4O3BA 1YCJA 3K01A 1LFIA 1PB9A 4U21A 1I6BA 3ODBA 4F31B 2CEXA 2DDKA 1BLFA 3K0VA 1B7UA 3KN7A 3K4UA 1B51A 2JJKA 2CZKA 2OX3A 2OBGA 4PBHA 1GV8A 2I48A 4I40A 1LCTA 3HHFA 4QF9A 4IO4A 2QL3A 1Y1MA 3EHSA 1HSLA 2NWJA 2O69A 4N4UA 2ZNUA 1EZOA 5A5LA 4Z7EA 2UYFA 5EYFA 5I59A 3GBAA 3WAFA 4BDMA 1N3XA 1LBBA 1Y3PA 1NL5A 2I3VA 2M8CA 3SEVA 4HE0A 2O1LA 3RY3A 5H8NB 3IR1A 5DT6A 2XXRA 4LZ7A 5HPQA 2H98A 2Q74A 1KZ8A 4GLIA 2Q88A 2WBBA 1SPIA 4ZEFA 4ELQA 4TLMB 3FXBA 3PPRA 2OLBA 1VR5A 4RPNA 5I2KA 2YJPA 4GQOA 5EQ8A 1FQAA 2A5SA 1R6ZA 1UIUA 4QSDA 3S9NC 1FPJA 3KSJA 1NNKA 3O6GA 1NNPA 1UTHA 3U65A 4H0WA 3O6HA 3FV1A 3M8UA 4MNPA 3K6UA 4G2ZA 3TTMA 3USDA 1CNQA 4N07A 2OJTA 4GXAA 4EF1A 4JSDA 1YAEA 3E13X 1POTA 3GXAA 1F9BA 5CBSA 4F3PA 2FA7A 5EQ9A 3CSGA 1FPEA 1INPA 4WEDA 4N15A 4GF8A 4MH5A 3VLWA 1NNFA 2HPGA 1B2HA 4U2RA 3CRBA 1MPDA 2VT5A 4GWOA 3PMWA 2AL5A 4R2FA 2ZYKA 2FIXA 4JSOA 5KDTB 3DELB 4YAHX 4OMBA 2ZZWA 1LFGA 4NF8A 1QKAA 5F7VA 3K02A 3ILTB 2HEUA 1UIVA 3OXNA 4F22A 1S9TA 4OYVA 4R9GA 3U1OA 1Q35A 4NF5A 3RYDA 3UK4A 2WKYA 2HHMA 2I58A 4IO6A 4PFTA 4H45A 5I58A 3H6VA 3FXRA 5CBRA 4H67A 1URDA 1SD3A 2OZZA 1JVXA 2DWJA 4ND9A 5HM4B 2NUVA 2IEEA 1FQBA 2NOOA 4DCXA 2PX1A 2P0SA 1BIYA 4MFIA 4OQOA 4POWA 2Q9TA 3FGSA 2OWZA 2QPQA 4ZZAA 5I7IA 4R74A 1H43A 1MPCA 1A40A 2GFEA 2VD2A 4X9TA 2RC9A 1A55A 3E3KA 2GHAA 4RY1A 1XS5A 2XA5A 3GLBA 4NF4A 2O68A 4X1DA 2X26A 3BFUA 4NF0A 2UXAA 2F36A 2WYKA 1AWBA 3O97A 4NF6A 4GWZA 1MQJA 3FUZA
chains in the Genus database with same CATH topology
4XIGQ 4DXUA 1AH5A 1B52A 3S9EA 3PD9A 3S9MC 2THIA 2XXPA 4XTCQ 1BP5A 3KJ7A 3IAZA 1DOTA 3E9XA 2H25A 1MPBA 4IGTA 1MY1A 5H8HA 1Y3NA 4ECFA 3UP9A 5A5XA 3QSLA 1SBPA 3MZBA 2PT2A 5M2VA 4TLLB 1JQFA 2RC8A 2XXXA 3OSRA 1SQYA 4C1UA 3EN3A 5DEXB 3C4MA 3TUSA 2REGA 4DIGA 1QUJA 1TT1A 1USYE 4BLAA 3U72A 5CMCA 4GXSB 2O7UA 1USYH 1MXXA 4OVJA 3EQ1A 3GZGA 4EQ7A 3PPNA 2XXUA 3BKIB 1A54A 5ICQA 3TELA 3K1NA 5L9SA 2ONKE 1B9JA 5K2YA 3KBRA 5K2XA 5ICTA 5L8DA 4ZE9A 1MG1A 1MM7A 1DTGA 3LBSA 5DTBA 1DPEA 1PC3A 1UTBA 4ONYA 2UYEA 3FVGA 4ZDMA 1IIWA 3BFTA 3IOTA 3M3LA 2Q89A 1B3FA 4KD5A 1LBCA 4YU0A 3G3HA 3PUXE 2YPNA 2ZYNA 1LAHE 4BDOA 2AIXA 2F7AA 4OESA 3MPLA 4PFWA 4QSCA 3SEUA 1ZLQA 4I62A 1SW5A 4RNSA 3LSXA 1QUIA 5AA4A 2I0BA 3IJXB 5AA2D 4LUBA 4GD5A 3RPWA 4PETA 1JETA 4X1BA 3PUWE 4C0RA 1II5A 4ZZEA 2NXOA 1SI1A 4U23A 1MXWA 3TCFA 3PD8A 1NH7A 4H65A 4KCCA 4BDRA 4I9DA 1TXFA 3RNNA 3EHTA 2R9JA 3TKDA 1DMBA 2E0SA 4JXIA 3EF7A 2REJA 2F6PA 2I4CA 2ESNA 3DP4A 2QMXA 4LONB 1MXYA 4UACA 4HS7A 5TPAA 1B3GA 4ESXA 2VP1A 4GOTA 4IO2A 4L17A 3K6XA 3TZAA 1B1HA 4N6PA 3CSBA 3M3KA 1ZJLA 3UORA 4GFRA 3T66A 1N04A 3Q29A 1M5BA 2DVZA 5H8FB 4ZEBA 4YB5A 3KG2A 3FXQA 2CMOA 2I0CA 5JK4A 3OO8A 2I4BA 3CFZA 4U4SA 3TDJA 3BBRA 2QS2A 1A7LA 2I49A 1N3WA 3IB0A 1OVBA 3I6VA 4YB7A 5FHOA 3H4ZA 5I57B 3C31A 3CVGA 4JDFA 4U22A 4P11A 1Z7NE 4LQ2A 2V3QA 3SEYA 3FV2A 1QW0A 1A8FA 1QULA 1MQHA 3VXBA 3PMVA 3D4GA 5JTYA 3OO6A 4YZZA 3DLNA 4RXLA 1XT8A 2H5YA 5KCJB 3H6TA 1VSOA 5CMMA 1FQCA 4EUOA 3VFJA 3IB1A 4Q8RA 5CMKA 3HPIA 3O2AA 1B4HA 3W15C 4NE4A 2RCAA 3MAMA 3PUZE 4JWYA 4ESWA 2ZYOA 4FIMA 3TTRA 3S9LC 2DXYA 1SW2A 4PE5B 1B3LA 3JZJA 1MDP1 1I6AA 1JW1A 3HHGA 1POY1 5H8QA 3SETA 5F1QA 4YKKA 3O28A 2B3FA 1LCFA 4XXUA 1US5A 1N0TA 3K2DA 4GRKA 5TP9B 2P2AA 1B32A 1MY2A 5FHNA 3L6GA 3MBPA 4F1UA 2HCAA 4IO3A 4PP0A 3MW0A 4QFPA 4G4PA 2ALUA 1BTJA 2V3TA 2H4IA 4JB7A 3LUYA 3MVZA 3N26A 4GIZA 4LATA 4PFYA 2Y84A 4H1XA 2VGQA 4NWDA 3QXMA 2OK2A 4DXBA 4YKIA 2DWHA 2E1SA 5H8SA 3I3VA 3TODA 3OOAA 1H44A 1S50A 4R2BA 1FTOA 2R6GE 2FYIA 3KOTA 4LZ5A 2F8DA 1RYXA 3CG3A 5I59B 3UA8A 3K00A 1N84A 2I3WA 1VE4A 4YMBA 4TOZA 2Q2AA 3MVXA 3IK6B 5IAIA 3K6VA 1US4A 1H76A 1MY0A 3B6QA 2V25A 1M5EA 1SW4A 3VXCA 3CG1A 3A09A 3QUFA 1OIBA 4YMAA 1JNFA 1PB8A 1Y9UA 1SYIA 4U1ZA 3K6WA 2XX8A 4OERA 2DWAA 4ZEDA 3H6UA 3KN3A 1PDAA 1FTJA 5I2NA 1UTHB 4DZ1A 2QS1A 1B46A 4DCYA 1MY4A 3TMGA 4F19A 1IUDA 1O63A 4LP2B 3SESA 3C33A 4OEVA 2PMSA 1JEUA 1ZIUA 4I8CA 1ELJA 1DTZA 5B70A 2F97A 1KWHA 2CZLA 4H5GA 1Y4TA 4P0IA 1PBQA 1S7YA 3LC8A 3OO7A 3FASA 1GGGA 4RPOA 4WKMA 4G8MA 4HCYA 3HCQA 3FD3A 4H5FA 1MH3A 5CMBA 3C34A 1M5CA 3O6IA 2ZMBA 3IB2A 2OWSA 4MF3A 4FJPA 3FVNA 3DP6A 1ATGA 5DVFA 1LGBC 2F7BA 2PT1A 2XX9A 2RINA 3RUMA 5CC2A 4NF8B 1FW0A 2PYYA 1OVTA 3SKPA 1NMUA 4F1VA 4NF5B 3KEIA 4RJZA 4EQBA 1Y1ZA 3KZGA 4P0GA 4FAJA 1QJMA 4XKQA 4G68A 2AYSA 4ZEIA 1IZ1A 5I58B 4KYDA 3T9HB 3ECRA 2ZNSA 2Q2CA 2XXHA 5B7DA 5I56B 3TAJA 2QSXA 3RQTA 2AL4A 1PEBA 1A8EA 1O7TA 4GL8A 4OXVA 3THIA 3W9VA 4QHQA 3IORA 3ZS6A 1SDXA 1ZKBA 3R26A 2Z8EA 3FJ7A 2O7IA 2VOZA 2XD2A 3FJMA 2XXIA 1LAFE 2B65A 2HAVA 2F6GA 3IOUA 3MWBA 1OLAA 2A5TB 3MZ9A 4NF4B 4H8JA 3FIRA 1HSEA 3HO7A 4KHZE 5ELVA 3PV0E 4NF6B 1MRPA 3Q27A 4WEPA 1M5FA 2B3BA 3VLVA 3K1PA 4R73A 2W7YA 5ITPA 1P1QA 4OENA 2DOJA 1B0LA 1B1XA 2UVHA 1XC1A 2HFBA 3F11A 4C1TA 1NNTA 1IQ7A 2QS3A 1P1NA 2Z23A 3IO4A 3O29A 5H8HB 2DSFA 3QIMA 1I69A 4KYEA 5A5XB 3DP8A 4R6HA 1JW5A 2KLFA 4F3SA 1ZMGA 1RYOA 3UIFA 2OWTA 4EXLA 1B7HA 2Z8DA 4R75A 2XHDA 1EU8A 5DVJA 4YKJA 4BDQA 1AIVA 3RGYA 2HZKA 4ZE8A 4HCWA 4NTLA 4OHNA 1IITA 3SDFA 3G3IA 3MP8A 4EF2A 3SEWA 4BDLA 4RK2A 3H03A 1ZTYA 2G93A 1SYHA 2GH9A 1B3EA 1FQDA 4KYSA 3DM0A 2XXTA 1UTBB 4ZEKA 1BKAA 1MQGA 4QFLA 3CFLA 3TPAA 4ELPA 2XXYA 3R7XA 3VE1B 1H45A 1XVXA 3IOVA 1N7XA 5AA1A 4IB2A 3TTNA 3IOWA 3FVOA 3TYHA 4ISUA 1Y3QA 4G68C 3E4RA 2O6AA 4F39A 3OEMA 2DS9A 2IA4A 1GTKA 1D9YA 1B6HA 4DE8A 5AA4B 2HXWA 3QYTA 3PPQA 1EZPA 1R9LA 2ZNTA 2GRVA 1MXVA 3HSTA 1LB9A 2VHAA 3FVKA 3MZ1A 3U94A 1TFAA 5IKBA 5I84A 4F3BA 5AA2B 4ELOA 3UN6A 4YB6A 3A3UA 4NEDA 1NH8A 2V93A 3T22A 3VV5A 1QVSA 1Q1KA 3T9XB 3PPPA 4M4GA 4Q5TA 1Y4CA 2DVCA 2R71A 4F18A 1TFDA 5AE4A 3U93A 5TU0A 3CFXA 4QFOA 2BJJX 3W9WA 1WVJA 1IXHA 1LSTA 1IXIA 4PFUA 3M3FA 4U1OA 3KGCA 1AMFA 1ANFA 3RLFE 3TTKA 4AB6A 1FQFA 3EHUA 2Y7KA 5H8NA 1FTKA 1PBPA 2DYXA 2DE2A 3RN8A 3KFMA 4YICA 1ZBMA 3MP1A 3RTFB 3G3JA 1LFHA 4ZECA 4NWCA 1LLSA 1QKBA 2UVGA 4KFQA 4NMYA 4HTGA 4K3FA 5JTYB 3PU5A 3KJTA 4G77A 3OELA 1IXCA 2QMWA 3N6TA 5ITOA 4DLDA 2Y7PA 2HAUA 3UGWA 1JEVA 2XXVA 3U92A 3T9UA 4DDDA 3G3KA 4YKPA 2D21A 4JWXA 1D3KA 3RT6B 3PGFA 1TWYA 5DVIA 4F2OA 4JWOA 5DYHA 3TCHA 4OFJA 1NFTA 2DP8A 4QSEA 3QUJA 4O3CA 5H8QB 3TTLA 4HW8A 4H6DA 3V83A 4LA9A 5KDTA 5JEIA 4LVQA 1WODA 3FXUA 2Q8JA 2G29A 3V8XB 1B3HA 3H6WA 4PQJA 4KCDA 1R1NA 2O84X 3C9HA 1FTLA 3MQ9A 4FATA 3CI8A 2Z8FA 3IL1B 4LQ5A 1MXUA 5CRYA 1PB7A 2DWIA 4AQ4A 5I2KB 4GL0A 4IY6A 1VFDA 3N5LA 3IO6A 2ZXTA 4RA1A 2F5XA 2UVIA 1LAGE 2Y7WA 3MVWA 4I1DA 5EHSA 1B4ZA 3LSWA 1FCKA 1MH4A 2NVUB 4XKRA 3TEPA 4EQ9A 1FQEA 3ZSFA 3T96B 3ZKKA 3PUVE 2V3UA 4FEBA 2QS4A 4AB5A 4OTEA 3P7IA 5CI5A 3LSFB 4JBZA 1B5IA 3JYRA 5L9OA 2Z22A 1M5DA 2XX7A 1P99A 4F2QA 2UVJA 3H7MA 3EPEA 4OEUA 2D5WA 1SW1A 5AA3A 5I56A 4FECA 3KOSA 2F34A 1P1OA 3CIJA 1P1UA 2QJEA 1DPPA 5I2NB 1HSJA 3TQLA 4TQUQ 1N76A 3TFLA 4ZS9A 4OETA 4H8IA 2PVUA 3R6UA 1CB6A 4FE8A 1MS7A 4R9FA 2I6EA 2FNCA 4X48A 2A5TA 4KPTA 4OWDA 2ZYMA 3QK6A 3H06B 5DEXA 1XHYA 3RT8A 5L9MA 3N6UA 4XKNA 5FTIA 2O51A 3PMXA 2RC7A 4M1VA 1IXGA 2ONRA 3Q26A 1XVYA 1SI0A 2X7QA 1YTVA 1JW4A 1B5HA 2O1MA 2QRYA 3SERA 2V84A 4OFLA 2H99A 3C32A 2XD3A 5LOMA 3OEKA 4DXCA 3IJOB 2GHBA 4E0WA 1B05A 1OMPA 2HZLA 4RYAA 2F35A 2DXRA 4IO5A 3FZVA 5FTHA 1I6QA 3ZKLA 3L6HA 3OENA 3VVEA 3MC2A 3V89B 3LSLA 4KR5A 5HBCA 4F1YA 1MY3A 4G68B 1URSA 4E0XA 2P1SA 1NKXA 4FEDA 1JVYA 3Q28A 3K1MA 4F29A 3CR9A 2X7PA 2VD3A 3VVFA 1O64A 3KN8A 3OMBA 3S4UA 2ONSA 1OQHA 1CE2A 3MPKA 2XXWA 4QFNA 3MJNA 1EH3A 1P1WA 5BWJA 2DQVA 3B7DA 1IEJA 4QFKA 3U8QA 4QRZA 3OSQA 4Q30B 1EZ9A 4Q0CA 4THIA 3C35A 2RKMA 2D3IA 4WXJA 3S2VA 3V5AA 2LAOA 4RK9A 4IY5A 3HN0A 4MLVA 3VVDA 1Y20A 3PUYE 4XKPA 3FJGA 3VLUA 4KQPA 2YLNA 3B6WA 1B7ZA 3B6TA 4IO7A 3GBBA 1J1NA 1L5TA 4OFOA 1FTMA 1MQDA 3IX1A 3OD7A 1XOCA 1B58A 5EHMA 4LZ8A 2H9BA 3T9VA 4Z0IA 1RKMA 3H3GA 2XXQA 1WDNA 5ISUA 4R72A 3Q25A 3JV9A 1UQWA 2RCBA 3TCGA 5H8FA 3LR1A 3O9PA 1YPNA 5KZTA 4G8NA 3O66A 1GR2A 2Y7RA 3QAXA 3SEXA 3A3CA 1H3DA 3G3FA 5AA2A 4OZ9A 2OCUA 1DSNA 4FORA 3G7WA 3TQWA 5I57A 1MDQA 1D9VA 2RF1A 3PPOA 2Y7IA 3MVYA 4KI0E 4U4XA 1AL3A 3MUQA 1LAXA 3I5OA 4N13A 1GVCA 4G8HA 5FHMA 1T0KA 2PBWA 1ZU0A 2ABHA 1MQIA 1Z7ME 4R6YA 5KCJA 2F7CA 1LB8A 2DE4A 3ONMA 1B40A 3C36A 1URGA 1AOVA 3T93B 1D4NA 1A99A 4MBPA 3N94A 3OO9A 1B0HA 4F3GA 3FATA 4IGRA 5J1DA 4UA8A 3VDFA 1MM6A 3KSXA 2HQ0A 3WAEA 2DE3A 3RTWB 5TPAB 1OLCA 5BUUA 4GVOA 1OQGA 4EDPA 1MXZA 1VFEA 1N7WA 4POXA 3HV1A 3ILUB 1QUKA 2ANJA 3D4CA 3MP6A 1R9QA 2F78A 4O3AA 4EXKA 3AXFA 1SVXB 3G3GA 4R6KA 4ELRA 5CM6A 5TP9A 4BDNA 4MLQA 1B5JA 4O3BA 1YCJA 3K01A 1LFIA 1PB9A 4U21A 1I6BA 3ODBA 4F31B 1BLFA 3K0VA 1B7UA 3KN7A 3K4UA 1B51A 2OBGA 1GV8A 2I48A 1LCTA 3HHFA 4QF9A 4IO4A 2QL3A 1Y1MA 3EHSA 1HSLA 2NWJA 2O69A 2ZNUA 1EZOA 4Z7EA 2UYFA 5EYFA 5I59A 3GBAA 3WAFA 4BDMA 1N3XA 1LBBA 1Y3PA 1NL5A 2I3VA 2M8CA 3SEVA 2O1LA 3RY3A 5H8NB 3IR1A 5DT6A 2XXRA 4LZ7A 5HPQA 2H98A 4GLIA 2Q88A 4ZEFA 4ELQA 4TLMB 3PPRA 2OLBA 1VR5A 4RPNA 5I2KA 2YJPA 4GQOA 1FQAA 2A5SA 1R6ZA 1UIUA 4QSDA 3S9NC 3KSJA 1NNKA 3O6GA 1NNPA 1UTHA 4H0WA 3O6HA 3FV1A 3M8UA 3K6UA 4G2ZA 3TTMA 3USDA 4N07A 2OJTA 4GXAA 4EF1A 4JSDA 1YAEA 3E13X 1POTA 3GXAA 1F9BA 5CBSA 4F3PA 2FA7A 3CSGA 4WEDA 4GF8A 3VLWA 4MH5A 1NNFA 4U2RA 1B2HA 3CRBA 1MPDA 4GWOA 3PMWA 2AL5A 4R2FA 2ZYKA 4JSOA 5KDTB 3DELB 4YAHX 4OMBA 1LFGA 4NF8A 1QKAA 5F7VA 3K02A 3ILTB 2HEUA 1UIVA 3OXNA 4F22A 1S9TA 4OYVA 4R9GA 3U1OA 1Q35A 4NF5A 3UK4A 2WKYA 2I58A 4IO6A 4PFTA 5I58A 3H6VA 3FXRA 5CBRA 4H67A 1URDA 1SD3A 2OZZA 1JVXA 2DWJA 4ND9A 5HM4B 2NUVA 2IEEA 1FQBA 2NOOA 4DCXA 2PX1A 2P0SA 1BIYA 4MFIA 4OQOA 4POWA 2Q9TA 3FGSA 2QPQA 4ZZAA 4R74A 1H43A 1MPCA 1A40A 2GFEA 2VD2A 4X9TA 2RC9A 1A55A 3E3KA 2GHAA 4RY1A 1XS5A 3GLBA 4NF4A 2O68A 4X1DA 2X26A 3BFUA 2UXAA 2F36A 3O97A 4NF6A 1MQJA 3FUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XIG Q;  4DXU A;  1AH5 A;  1B52 A;  3S9E A;  3PD9 A;  3S9M C;  2THI A;  2XXP A;  4XTC Q;  1BP5 A;  3KJ7 A;  3IAZ A;  1DOT A;  3E9X A;  2H25 A;  1MPB A;  4IGT A;  1MY1 A;  5H8H A;  1Y3N A;  4ECF A;  3UP9 A;  5A5X A;  3QSL A;  1SBP A;  3MZB A;  2PT2 A;  5M2V A;  4TLL B;  1JQF A;  2RC8 A;  2XXX A;  3OSR A;  1SQY A;  4C1U A;  3EN3 A;  5DEX B;  3C4M A;  3TUS A;  2REG A;  4DIG A;  1QUJ A;  1TT1 A;  1USY E;  4BLA A;  3U72 A;  5CMC A;  4GXS B;  2O7U A;  1USY H;  1MXX A;  4OVJ A;  3EQ1 A;  3GZG A;  4EQ7 A;  3PPN A;  2XXU A;  3BKI B;  1A54 A;  5ICQ A;  3TEL A;  3K1N A;  5L9S A;  2ONK E;  1B9J A;  5K2Y A;  3KBR A;  5K2X A;  5ICT A;  5L8D A;  4ZE9 A;  1MG1 A;  1MM7 A;  1DTG A;  3LBS A;  5DTB A;  1DPE A;  1PC3 A;  1UTB A;  4ONY A;  2UYE A;  3FVG A;  4ZDM A;  1IIW A;  3BFT A;  3IOT A;  3M3L A;  2Q89 A;  1B3F A;  4KD5 A;  1LBC A;  4YU0 A;  3G3H A;  3PUX E;  2YPN A;  2ZYN A;  1LAH E;  4BDO A;  2AIX A;  2F7A A;  4OES A;  3MPL A;  4PFW A;  4QSC A;  3SEU A;  1ZLQ A;  4I62 A;  1SW5 A;  4RNS A;  3LSX A;  1QUI A;  5AA4 A;  2I0B A;  3IJX B;  5AA2 D;  4LUB A;  4GD5 A;  3RPW A;  4PET A;  1JET A;  4X1B A;  3PUW E;  4C0R A;  1II5 A;  4ZZE A;  2NXO A;  1SI1 A;  4U23 A;  1MXW A;  3TCF A;  3PD8 A;  1NH7 A;  4H65 A;  4KCC A;  4BDR A;  4I9D A;  1TXF A;  3RNN A;  3EHT A;  2R9J A;  3TKD A;  1DMB A;  2E0S A;  4JXI A;  3EF7 A;  2REJ A;  2F6P A;  2I4C A;  2ESN A;  3DP4 A;  2QMX A;  4LON B;  1MXY A;  4UAC A;  4HS7 A;  5TPA A;  1B3G A;  4ESX A;  2VP1 A;  4GOT A;  4IO2 A;  4L17 A;  3K6X A;  3TZA A;  1B1H A;  4N6P A;  3CSB A;  3M3K A;  1ZJL A;  3UOR A;  4GFR A;  3T66 A;  1N04 A;  3Q29 A;  1M5B A;  2DVZ A;  5H8F B;  4ZEB A;  4YB5 A;  3KG2 A;  3FXQ A;  2CMO A;  2I0C A;  5JK4 A;  3OO8 A;  2I4B A;  3CFZ A;  4U4S A;  3TDJ A;  3BBR A;  2QS2 A;  1A7L A;  2I49 A;  1N3W A;  3IB0 A;  1OVB A;  3I6V A;  4YB7 A;  5FHO A;  3H4Z A;  5I57 B;  3C31 A;  3CVG A;  4JDF A;  4U22 A;  4P11 A;  1Z7N E;  4LQ2 A;  2V3Q A;  3SEY A;  3FV2 A;  1QW0 A;  1A8F A;  1QUL A;  1MQH A;  3VXB A;  3PMV A;  3D4G A;  5JTY A;  3OO6 A;  4YZZ A;  3DLN A;  4RXL A;  1XT8 A;  2H5Y A;  5KCJ B;  3H6T A;  1VSO A;  5CMM A;  1FQC A;  4EUO A;  3VFJ A;  3IB1 A;  4Q8R A;  5CMK A;  3HPI A;  3O2A A;  1B4H A;  3W15 C;  4NE4 A;  2RCA A;  3MAM A;  3PUZ E;  4JWY A;  4ESW A;  2ZYO A;  4FIM A;  3TTR A;  3S9L C;  2DXY A;  1SW2 A;  4PE5 B;  1B3L A;  3JZJ A;  1MDP 1;  1I6A A;  1JW1 A;  3HHG A;  1POY 1;  5H8Q A;  3SET A;  5F1Q A;  4YKK A;  3O28 A;  2B3F A;  1LCF A;  4XXU A;  1US5 A;  1N0T A;  3K2D A;  4GRK A;  5TP9 B;  2P2A A;  1B32 A;  1MY2 A;  5FHN A;  3L6G A;  3MBP A;  4F1U A;  2HCA A;  4IO3 A;  4PP0 A;  3MW0 A;  4QFP A;  4G4P A;  2ALU A;  1BTJ A;  2V3T A;  2H4I A;  4JB7 A;  3LUY A;  3MVZ A;  3N26 A;  4GIZ A;  4LAT A;  4PFY A;  2Y84 A;  4H1X A;  2VGQ A;  4NWD A;  3QXM A;  2OK2 A;  4DXB A;  4YKI A;  2DWH A;  2E1S A;  5H8S A;  3I3V A;  3TOD A;  3OOA A;  1H44 A;  1S50 A;  4R2B A;  1FTO A;  2R6G E;  2FYI A;  3KOT A;  4LZ5 A;  2F8D A;  1RYX A;  3CG3 A;  5I59 B;  3UA8 A;  3K00 A;  1N84 A;  2I3W A;  1VE4 A;  4YMB A;  4TOZ A;  2Q2A A;  3MVX A;  3IK6 B;  5IAI A;  3K6V A;  1US4 A;  1H76 A;  1MY0 A;  3B6Q A;  2V25 A;  1M5E A;  1SW4 A;  3VXC A;  3CG1 A;  3A09 A;  3QUF A;  1OIB A;  4YMA A;  1JNF A;  1PB8 A;  1Y9U A;  1SYI A;  4U1Z A;  3K6W A;  2XX8 A;  4OER A;  2DWA A;  4ZED A;  3H6U A;  3KN3 A;  1PDA A;  1FTJ A;  5I2N A;  1UTH B;  4DZ1 A;  2QS1 A;  1B46 A;  4DCY A;  1MY4 A;  3TMG A;  4F19 A;  1IUD A;  1O63 A;  4LP2 B;  3SES A;  3C33 A;  4OEV A;  2PMS A;  1JEU A;  1ZIU A;  4I8C A;  1ELJ A;  1DTZ A;  5B70 A;  2F97 A;  1KWH A;  2CZL A;  4H5G A;  1Y4T A;  4P0I A;  1PBQ A;  1S7Y A;  3LC8 A;  3OO7 A;  3FAS A;  1GGG A;  4RPO A;  4WKM A;  4G8M A;  4HCY A;  3HCQ A;  3FD3 A;  4H5F A;  1MH3 A;  5CMB A;  3C34 A;  1M5C A;  3O6I A;  2ZMB A;  3IB2 A;  2OWS A;  4MF3 A;  4FJP A;  3FVN A;  3DP6 A;  1ATG A;  5DVF A;  1LGB C;  2F7B A;  2PT1 A;  2XX9 A;  2RIN A;  3RUM A;  5CC2 A;  4NF8 B;  1FW0 A;  2PYY A;  1OVT A;  3SKP A;  1NMU A;  4F1V A;  4NF5 B;  3KEI A;  4RJZ A;  4EQB A;  1Y1Z A;  3KZG A;  4P0G A;  4FAJ A;  1QJM A;  4XKQ A;  4G68 A;  2AYS A;  4ZEI A;  1IZ1 A;  5I58 B;  4KYD A;  3T9H B;  3ECR A;  2ZNS A;  2Q2C A;  2XXH A;  5B7D A;  5I56 B;  3TAJ A;  2QSX A;  3RQT A;  2AL4 A;  1PEB A;  1A8E A;  1O7T A;  4GL8 A;  4OXV A;  3THI A;  3W9V A;  4QHQ A;  3IOR A;  3ZS6 A;  1SDX A;  1ZKB A;  3R26 A;  2Z8E A;  3FJ7 A;  2O7I A;  2VOZ A;  2XD2 A;  3FJM A;  2XXI A;  1LAF E;  2B65 A;  2HAV A;  2F6G A;  3IOU A;  3MWB A;  1OLA A;  2A5T B;  3MZ9 A;  4NF4 B;  4H8J A;  3FIR A;  1HSE A;  3HO7 A;  4KHZ E;  5ELV A;  3PV0 E;  4NF6 B;  1MRP A;  3Q27 A;  4WEP A;  1M5F A;  2B3B A;  3VLV A;  3K1P A;  4R73 A;  2W7Y A;  5ITP A;  1P1Q A;  4OEN A;  2DOJ A;  1B0L A;  1B1X A;  2UVH A;  1XC1 A;  2HFB A;  3F11 A;  4C1T A;  1NNT A;  1IQ7 A;  2QS3 A;  1P1N A;  2Z23 A;  3IO4 A;  3O29 A;  5H8H B;  2DSF A;  3QIM A;  1I69 A;  4KYE A;  5A5X B;  3DP8 A;  4R6H A;  1JW5 A;  2KLF A;  4F3S A;  1ZMG A;  1RYO A;  3UIF A;  2OWT A;  4EXL A;  1B7H A;  2Z8D A;  4R75 A;  2XHD A;  1EU8 A;  5DVJ A;  4YKJ A;  4BDQ A;  1AIV A;  3RGY A;  2HZK A;  4ZE8 A;  4HCW A;  4NTL A;  4OHN A;  1IIT A;  3SDF A;  3G3I A;  3MP8 A;  4EF2 A;  3SEW A;  4BDL A;  4RK2 A;  3H03 A;  1ZTY A;  2G93 A;  1SYH A;  2GH9 A;  1B3E A;  1FQD A;  4KYS A;  3DM0 A;  2XXT A;  1UTB B;  4ZEK A;  1BKA A;  1MQG A;  4QFL A;  3CFL A;  3TPA A;  4ELP A;  2XXY A;  3R7X A;  3VE1 B;  1H45 A;  1XVX A;  3IOV A;  1N7X A;  5AA1 A;  4IB2 A;  3TTN A;  3IOW A;  3FVO A;  3TYH A;  4ISU A;  1Y3Q A;  4G68 C;  3E4R A;  2O6A A;  4F39 A;  3OEM A;  2DS9 A;  2IA4 A;  1GTK A;  1D9Y A;  1B6H A;  4DE8 A;  5AA4 B;  2HXW A;  3QYT A;  3PPQ A;  1EZP A;  1R9L A;  2ZNT A;  2GRV A;  1MXV A;  3HST A;  1LB9 A;  2VHA A;  3FVK A;  3MZ1 A;  3U94 A;  1TFA A;  5IKB A;  5I84 A;  4F3B A;  5AA2 B;  4ELO A;  3UN6 A;  4YB6 A;  3A3U A;  4NED A;  1NH8 A;  2V93 A;  3T22 A;  3VV5 A;  1QVS A;  1Q1K A;  3T9X B;  3PPP A;  4M4G A;  4Q5T A;  1Y4C A;  2DVC A;  2R71 A;  4F18 A;  1TFD A;  5AE4 A;  3U93 A;  5TU0 A;  3CFX A;  4QFO A;  2BJJ X;  3W9W A;  1WVJ A;  1IXH A;  1LST A;  1IXI A;  4PFU A;  3M3F A;  4U1O A;  3KGC A;  1AMF A;  1ANF A;  3RLF E;  3TTK A;  4AB6 A;  1FQF A;  3EHU A;  2Y7K A;  5H8N A;  1FTK A;  1PBP A;  2DYX A;  2DE2 A;  3RN8 A;  3KFM A;  4YIC A;  1ZBM A;  3MP1 A;  3RTF B;  3G3J A;  1LFH A;  4ZEC A;  4NWC A;  1LLS A;  1QKB A;  2UVG A;  4KFQ A;  4NMY A;  4HTG A;  4K3F A;  5JTY B;  3PU5 A;  3KJT A;  4G77 A;  3OEL A;  1IXC A;  2QMW A;  3N6T A;  5ITO A;  4DLD A;  2Y7P A;  2HAU A;  3UGW A;  1JEV A;  2XXV A;  3U92 A;  3T9U A;  4DDD A;  3G3K A;  4YKP A;  2D21 A;  4JWX A;  1D3K A;  3RT6 B;  3PGF A;  1TWY A;  5DVI A;  4F2O A;  4JWO A;  5DYH A;  3TCH A;  4OFJ A;  1NFT A;  2DP8 A;  4QSE A;  3QUJ A;  4O3C A;  5H8Q B;  3TTL A;  4HW8 A;  4H6D A;  3V83 A;  4LA9 A;  5KDT A;  5JEI A;  4LVQ A;  1WOD A;  3FXU A;  2Q8J A;  2G29 A;  3V8X B;  1B3H A;  3H6W A;  4PQJ A;  4KCD A;  1R1N A;  2O84 X;  3C9H A;  1FTL A;  3MQ9 A;  4FAT A;  3CI8 A;  2Z8F A;  3IL1 B;  4LQ5 A;  1MXU A;  5CRY A;  1PB7 A;  2DWI A;  4AQ4 A;  5I2K B;  4GL0 A;  4IY6 A;  1VFD A;  3N5L A;  3IO6 A;  2ZXT A;  4RA1 A;  2F5X A;  2UVI A;  1LAG E;  2Y7W A;  3MVW A;  4I1D A;  5EHS A;  1B4Z A;  3LSW A;  1FCK A;  1MH4 A;  2NVU B;  4XKR A;  3TEP A;  4EQ9 A;  1FQE A;  3ZSF A;  3T96 B;  3ZKK A;  3PUV E;  2V3U A;  4FEB A;  2QS4 A;  4AB5 A;  4OTE A;  3P7I A;  5CI5 A;  3LSF B;  4JBZ A;  1B5I A;  3JYR A;  5L9O A;  2Z22 A;  1M5D A;  2XX7 A;  1P99 A;  4F2Q A;  2UVJ A;  3H7M A;  3EPE A;  4OEU A;  2D5W A;  1SW1 A;  5AA3 A;  5I56 A;  4FEC A;  3KOS A;  2F34 A;  1P1O A;  3CIJ A;  1P1U A;  2QJE A;  1DPP A;  5I2N B;  1HSJ A;  3TQL A;  4TQU Q;  1N76 A;  3TFL A;  4ZS9 A;  4OET A;  4H8I A;  2PVU A;  3R6U A;  1CB6 A;  4FE8 A;  1MS7 A;  4R9F A;  2I6E A;  2FNC A;  4X48 A;  2A5T A;  4KPT A;  4OWD A;  2ZYM A;  3QK6 A;  3H06 B;  5DEX A;  1XHY A;  3RT8 A;  5L9M A;  3N6U A;  4XKN A;  5FTI A;  2O51 A;  3PMX A;  2RC7 A;  4M1V A;  1IXG A;  2ONR A;  3Q26 A;  1XVY A;  1SI0 A;  2X7Q A;  1YTV A;  1JW4 A;  1B5H A;  2O1M A;  2QRY A;  3SER A;  2V84 A;  4OFL A;  2H99 A;  3C32 A;  2XD3 A;  5LOM A;  3OEK A;  4DXC A;  3IJO B;  2GHB A;  4E0W A;  1B05 A;  1OMP A;  2HZL A;  4RYA A;  2F35 A;  2DXR A;  4IO5 A;  3FZV A;  5FTH A;  1I6Q A;  3ZKL A;  3L6H A;  3OEN A;  3VVE A;  3MC2 A;  3V89 B;  3LSL A;  4KR5 A;  5HBC A;  4F1Y A;  1MY3 A;  4G68 B;  1URS A;  4E0X A;  2P1S A;  1NKX A;  4FED A;  1JVY A;  3Q28 A;  3K1M A;  4F29 A;  3CR9 A;  2X7P A;  2VD3 A;  3VVF A;  1O64 A;  3KN8 A;  3OMB A;  3S4U A;  2ONS A;  1OQH A;  1CE2 A;  3MPK A;  2XXW A;  4QFN A;  3MJN A;  1EH3 A;  1P1W A;  5BWJ A;  2DQV A;  3B7D A;  1IEJ A;  4QFK A;  3U8Q A;  4QRZ A;  3OSQ A;  4Q30 B;  1EZ9 A;  4Q0C A;  4THI A;  3C35 A;  2RKM A;  2D3I A;  4WXJ A;  3S2V A;  3V5A A;  2LAO A;  4RK9 A;  4IY5 A;  3HN0 A;  4MLV A;  3VVD A;  1Y20 A;  3PUY E;  4XKP A;  3FJG A;  3VLU A;  4KQP A;  2YLN A;  3B6W A;  1B7Z A;  3B6T A;  4IO7 A;  3GBB A;  1J1N A;  1L5T A;  4OFO A;  1FTM A;  1MQD A;  3IX1 A;  3OD7 A;  1XOC A;  1B58 A;  5EHM A;  4LZ8 A;  2H9B A;  3T9V A;  4Z0I A;  1RKM A;  3H3G A;  2XXQ A;  1WDN A;  5ISU A;  4R72 A;  3Q25 A;  3JV9 A;  1UQW A;  2RCB A;  3TCG A;  5H8F A;  3LR1 A;  3O9P A;  1YPN A;  5KZT A;  4G8N A;  3O66 A;  1GR2 A;  2Y7R A;  3QAX A;  3SEX A;  3A3C A;  1H3D A;  3G3F A;  5AA2 A;  4OZ9 A;  2OCU A;  1DSN A;  4FOR A;  3G7W A;  3TQW A;  5I57 A;  1MDQ A;  1D9V A;  2RF1 A;  3PPO A;  2Y7I A;  3MVY A;  4KI0 E;  4U4X A;  1AL3 A;  3MUQ A;  1LAX A;  3I5O A;  4N13 A;  1GVC A;  4G8H A;  5FHM A;  1T0K A;  2PBW A;  1ZU0 A;  2ABH A;  1MQI A;  1Z7M E;  4R6Y A;  5KCJ A;  2F7C A;  1LB8 A;  2DE4 A;  3ONM A;  1B40 A;  3C36 A;  1URG A;  1AOV A;  3T93 B;  1D4N A;  1A99 A;  4MBP A;  3N94 A;  3OO9 A;  1B0H A;  4F3G A;  3FAT A;  4IGR A;  5J1D A;  4UA8 A;  3VDF A;  1MM6 A;  3KSX A;  2HQ0 A;  3WAE A;  2DE3 A;  3RTW B;  5TPA B;  1OLC A;  5BUU A;  4GVO A;  1OQG A;  4EDP A;  1MXZ A;  1VFE A;  1N7W A;  4POX A;  3HV1 A;  3ILU B;  1QUK A;  2ANJ A;  3D4C A;  3MP6 A;  1R9Q A;  2F78 A;  4O3A A;  4EXK A;  3AXF A;  1SVX B;  3G3G A;  4R6K A;  4ELR A;  5CM6 A;  5TP9 A;  4BDN A;  4MLQ A;  1B5J A;  4O3B A;  1YCJ A;  3K01 A;  1LFI A;  1PB9 A;  4U21 A;  1I6B A;  3ODB A;  4F31 B;  1BLF A;  3K0V A;  1B7U A;  3KN7 A;  3K4U A;  1B51 A;  2OBG A;  1GV8 A;  2I48 A;  1LCT A;  3HHF A;  4QF9 A;  4IO4 A;  2QL3 A;  1Y1M A;  3EHS A;  1HSL A;  2NWJ A;  2O69 A;  2ZNU A;  1EZO A;  4Z7E A;  2UYF A;  5EYF A;  5I59 A;  3GBA A;  3WAF A;  4BDM A;  1N3X A;  1LBB A;  1Y3P A;  1NL5 A;  2I3V A;  2M8C A;  3SEV A;  2O1L A;  3RY3 A;  5H8N B;  3IR1 A;  5DT6 A;  2XXR A;  4LZ7 A;  5HPQ A;  2H98 A;  4GLI A;  2Q88 A;  4ZEF A;  4ELQ A;  4TLM B;  3PPR A;  2OLB A;  1VR5 A;  4RPN A;  5I2K A;  2YJP A;  4GQO A;  1FQA A;  2A5S A;  1R6Z A;  1UIU A;  4QSD A;  3S9N C;  3KSJ A;  1NNK A;  3O6G A;  1NNP A;  1UTH A;  4H0W A;  3O6H A;  3FV1 A;  3M8U A;  3K6U A;  4G2Z A;  3TTM A;  3USD A;  4N07 A;  2OJT A;  4GXA A;  4EF1 A;  4JSD A;  1YAE A;  3E13 X;  1POT A;  3GXA A;  1F9B A;  5CBS A;  4F3P A;  2FA7 A;  3CSG A;  4WED A;  4GF8 A;  3VLW A;  4MH5 A;  1NNF A;  4U2R A;  1B2H A;  3CRB A;  1MPD A;  4GWO A;  3PMW A;  2AL5 A;  4R2F A;  2ZYK A;  4JSO A;  5KDT B;  3DEL B;  4YAH X;  4OMB A;  1LFG A;  4NF8 A;  1QKA A;  5F7V A;  3K02 A;  3ILT B;  2HEU A;  1UIV A;  3OXN A;  4F22 A;  1S9T A;  4OYV A;  4R9G A;  3U1O A;  1Q35 A;  4NF5 A;  3UK4 A;  2WKY A;  2I58 A;  4IO6 A;  4PFT A;  5I58 A;  3H6V A;  3FXR A;  5CBR A;  4H67 A;  1URD A;  1SD3 A;  2OZZ A;  1JVX A;  2DWJ A;  4ND9 A;  5HM4 B;  2NUV A;  2IEE A;  1FQB A;  2NOO A;  4DCX A;  2PX1 A;  2P0S A;  1BIY A;  4MFI A;  4OQO A;  4POW A;  2Q9T A;  3FGS A;  2QPQ A;  4ZZA A;  4R74 A;  1H43 A;  1MPC A;  1A40 A;  2GFE A;  2VD2 A;  4X9T A;  2RC9 A;  1A55 A;  3E3K A;  2GHA A;  4RY1 A;  1XS5 A;  3GLB A;  4NF4 A;  2O68 A;  4X1D A;  2X26 A;  3BFU A;  2UXA A;  2F36 A;  3O97 A;  4NF6 A;  1MQJ A;  3FUZ A; 
#chains in the Genus database with same CATH topology
 1VDW A;  4XIG Q;  4DXU A;  1AH5 A;  1B52 A;  3S9E A;  3PD9 A;  3S9M C;  2THI A;  2XXP A;  4XTC Q;  1BP5 A;  3KJ7 A;  3IAZ A;  1DOT A;  4LN5 A;  3E9X A;  2XWO A;  2H25 A;  4DI3 D;  1MPB A;  4IGT A;  1MY1 A;  5H8H A;  1Y3N A;  4ECF A;  3QMF A;  3UP9 A;  5A5X A;  3QSL A;  1SBP A;  3MZB A;  3E78 A;  2PT2 A;  1RDX A;  5M2V A;  4OVQ A;  4TLL B;  1JQF A;  2RC8 A;  2XXX A;  3OSR A;  1SQY A;  4C1U A;  3EN3 A;  5DEX B;  1FBG A;  3C4M A;  3TUS A;  2REG A;  4DIG A;  4H46 A;  1QUJ A;  3CHG A;  1TT1 A;  1USY E;  4BLA A;  3U72 A;  5CMC A;  4GXS B;  2O7U A;  1USY H;  1MXX A;  4OVJ A;  3EQ1 A;  3GZG A;  4NN3 A;  4EQ7 A;  3PPN A;  2XXU A;  3BKI B;  1A54 A;  5ICQ A;  3E79 A;  4I3Y A;  4XF5 A;  3TEL A;  4P3L A;  2R8T A;  3K1N A;  5L9S A;  2ONK E;  1B9J A;  1FTA A;  5K2Y A;  3KBR A;  5K2X A;  5ICT A;  5L8D A;  4ZE9 A;  1MG1 A;  1MM7 A;  1DTG A;  3LBS A;  5DTB A;  1DPE A;  1PC3 A;  1UTB A;  4ONY A;  2UYE A;  3FVG A;  4AS5 A;  4X8R A;  4ZDM A;  1IIW A;  3BFT A;  3IOT A;  3M3L A;  2Q89 A;  2XWV A;  1B3F A;  4KD5 A;  4N17 A;  1LBC A;  4YU0 A;  3G3H A;  3PUX E;  2CEY A;  2YPN A;  2ZYN A;  1LAH E;  4BDO A;  2AIX A;  2F7A A;  4OES A;  3MPL A;  4PFW A;  4QSC A;  3SEU A;  2Y5K A;  1ZLQ A;  4I62 A;  1SW5 A;  4RNS A;  3LSX A;  1QUI A;  5AA4 A;  2I0B A;  3IJX B;  1KA0 A;  5AA2 D;  4LUB A;  4GD5 A;  3RPW A;  1QGX A;  4PET A;  1KA1 A;  1JET A;  4X1B A;  3PUW E;  4C0R A;  1II5 A;  4ZZE A;  2NXO A;  5ET8 A;  4MNC A;  1SI1 A;  4U23 A;  1MXW A;  3TCF A;  3PD8 A;  1NH7 A;  4H65 A;  4KCC A;  4BDR A;  4OVP A;  2L5V A;  4I9D A;  1TXF A;  3RNN A;  3EHT A;  2R9J A;  3GYY A;  3TKD A;  1DMB A;  2E0S A;  4JXI A;  3EF7 A;  1FPK A;  2REJ A;  2F6P A;  2I4C A;  2ESN A;  3DP4 A;  5I5P A;  2QMX A;  4MHF A;  4LON B;  1MXY A;  4UAC A;  4HS7 A;  1FRP A;  5IGA A;  4P8B A;  5TPA A;  5EYG A;  1B3G A;  4ESX A;  2VP1 A;  3BIG A;  4GOT A;  4IO2 A;  4L17 A;  3K6X A;  3TZA A;  1B1H A;  4N6P A;  1IMF A;  3CSB A;  3M3K A;  2CZH A;  4OVR A;  1ZJL A;  3UOR A;  4GFR A;  3T66 A;  1N04 A;  3Q29 A;  1M5B A;  2QFL A;  2DVZ A;  5H8F B;  4ZEB A;  4YB5 A;  3KG2 A;  3FXQ A;  2CMO A;  2I0C A;  5JK4 A;  3OO8 A;  1JP4 A;  2I4B A;  3CFZ A;  4U4S A;  3TDJ A;  3BBR A;  2PFY A;  2FHY A;  2QS2 A;  3BIH A;  1A7L A;  2I49 A;  1N3W A;  3IB0 A;  2FBP A;  1OVB A;  4P9K A;  3I6V A;  4YB7 A;  5FHO A;  3H4Z A;  5I57 B;  3C31 A;  3CVG A;  4JDF A;  4U22 A;  4P11 A;  1EYK A;  1Z7N E;  4LQ2 A;  2V3Q A;  3SEY A;  3FV2 A;  2QVR A;  1QW0 A;  3LV0 A;  1A8F A;  1QUL A;  1MQH A;  3VXB A;  1FPL A;  3PMV A;  3D4G A;  4PGN A;  5JTY A;  3OO6 A;  4YZZ A;  3LUZ A;  3DLN A;  4P56 A;  1XT8 A;  2H5Y A;  4RXL A;  5KCJ B;  3H6T A;  1VSO A;  5CMM A;  1FQC A;  4EUO A;  3VFJ A;  3IB1 A;  4Q8R A;  5CMK A;  3HPI A;  3O2A A;  1B4H A;  3W15 C;  4AS4 A;  4NE4 A;  4P47 A;  2KR0 A;  2RCA A;  3MAM A;  5IZ3 B;  3PUZ E;  4JWY A;  4ESW A;  2ZYO A;  4FIM A;  4PC9 A;  3TTR A;  1D9Q A;  3S9L C;  5IZZ A;  2DXY A;  1LBY A;  1SW2 A;  1XI6 A;  4PE5 B;  3RPL B;  1B3L A;  3JZJ A;  1MDP 1;  2PCR A;  1I6A A;  3NOH A;  1JW1 A;  1IMC A;  1FSA A;  3HHG A;  1POY 1;  5H8Q A;  3SET A;  5F1Q A;  4YKK A;  3O28 A;  2B3F A;  1LCF A;  4XXU A;  1DBZ A;  4MNI A;  1US5 A;  1N0T A;  3K2D A;  1IMD A;  4GRK A;  5TP9 B;  2P2A A;  1B32 A;  1MY2 A;  5FHN A;  3L6G A;  4I3E A;  3MBP A;  4F1U A;  5T3J A;  2HCA A;  4IO3 A;  4PP0 A;  3MW0 A;  4QFP A;  4G4P A;  2ALU A;  1BTJ A;  2V3T A;  2H4I A;  4JB7 A;  3LUY A;  3MVZ A;  3N26 A;  4GIZ A;  4LAT A;  4PFY A;  2Y84 A;  4H1X A;  2F3D A;  4PDH A;  3SZP A;  2VGQ A;  4NWD A;  3QXM A;  2OK2 A;  2ZZV A;  4OA4 A;  4DXB A;  4YKI A;  2DWH A;  2E1S A;  5H8S A;  3I3V A;  3TOD A;  3OOA A;  1H44 A;  1S50 A;  4R2B A;  1LBX A;  1FTO A;  2R6G E;  2FYI A;  3KC0 A;  3KOT A;  4LZ5 A;  2F8D A;  1RYX A;  3CG3 A;  5I59 B;  1FPB A;  3UA8 A;  3K00 A;  1N84 A;  2I3W A;  1VE4 A;  4YMB A;  4TOZ A;  2Q2A A;  3MVX A;  3IK6 B;  5IAI A;  3K6V A;  3HFU A;  1US4 A;  2HXR A;  3ROJ A;  1H76 A;  1MY0 A;  3B6Q A;  2V25 A;  1M5E A;  1SW4 A;  4PE3 A;  4N91 A;  3VXC A;  3CG1 A;  3A09 A;  4PGP A;  3QUF A;  1FBF A;  1OIB A;  4YMA A;  1JNF A;  1PB8 A;  1Y9U A;  1SYI A;  4KXP A;  4U1Z A;  3K6W A;  2XX8 A;  4OER A;  2DWA A;  4ZED A;  3H6U A;  3KN3 A;  1PDA A;  1FTJ A;  5I2N A;  1UTH B;  4DZ1 A;  2QS1 A;  1B46 A;  4DCY A;  1MY4 A;  3TMG A;  4F19 A;  1IUD A;  1O63 A;  4LP2 B;  3SES A;  3C33 A;  4PCD A;  4OEV A;  2PMS A;  1JEU A;  1ZIU A;  5ET5 A;  4I8C A;  1ELJ A;  1DTZ A;  4PFR A;  5B70 A;  4HE1 A;  2F97 A;  3KC1 A;  1KWH A;  4NQ8 A;  2CZL A;  1FPG A;  4P0I A;  1Y4T A;  4H5G A;  1PBQ A;  1RDY A;  4O7I A;  1S7Y A;  3LC8 A;  3OO7 A;  4O94 A;  3FAS A;  1GGG A;  4RPO A;  4WKM A;  4G8M A;  4HCY A;  3HCQ A;  1NI9 A;  3FD3 A;  4H5F A;  1MH3 A;  2WX9 A;  4P1E A;  5CMB A;  3C34 A;  1M5C A;  3O6I A;  2ZMB A;  3IB2 A;  2OWS A;  4MF3 A;  4FJP A;  3FVN A;  3DP6 A;  1ATG A;  5DVF A;  1LGB C;  1LEV A;  2F7B A;  2PT1 A;  2XX9 A;  2RIN A;  2BJI A;  3RUM A;  5CC2 A;  4NF8 B;  1FW0 A;  2PYY A;  4OVS A;  1OVT A;  3SKP A;  1NMU A;  4F1V A;  4NF5 B;  3KEI A;  4RJZ A;  4EQB A;  1Y1Z A;  3KZG A;  4P0G A;  4FAJ A;  4PTK A;  1QJM A;  4XKQ A;  4G68 A;  2AYS A;  4ZEI A;  1RDZ A;  1IZ1 A;  5I58 B;  4KYD A;  5DW8 A;  3T9H B;  3ECR A;  1FBH A;  2ZNS A;  2Q2C A;  2XXH A;  5B7D A;  5I56 B;  3TAJ A;  2QSX A;  3RQT A;  2AL4 A;  1PEB A;  2FVZ A;  1A8E A;  1NV4 A;  1O7T A;  4GL8 A;  4OXV A;  3IFC A;  3THI A;  3W9V A;  2XWK A;  4QHQ A;  5EYH A;  3IOR A;  3ZS6 A;  4O8M A;  1SDX A;  1ZKB A;  1FBD A;  3R26 A;  2Z8E A;  3FJ7 A;  2O7I A;  2VOZ A;  2XD2 A;  3FJM A;  2XXI A;  1LAF E;  2B65 A;  2HAV A;  2F6G A;  3IOU A;  3MWB A;  1OLA A;  2A5T B;  3MZ9 A;  4NF4 B;  3MYU A;  4H8J A;  3FIR A;  1HSE A;  3HO7 A;  4KHZ E;  2WBD A;  5ELV A;  5LTC A;  3PV0 E;  4NF6 B;  1MRP A;  4NX1 A;  1IME A;  3Q27 A;  1G0I A;  4WEP A;  1M5F A;  2B3B A;  3VLV A;  3K1P A;  4R73 A;  2W7Y A;  5ITP A;  1P1Q A;  4OEN A;  4PFB A;  2DOJ A;  4MAG A;  1B0L A;  1B1X A;  2UVH A;  1XC1 A;  2HFB A;  3F11 A;  4C1T A;  4N8G A;  1NNT A;  5ESY A;  1IQ7 A;  2QS3 A;  2XWI A;  1P1N A;  2Z23 A;  3IO4 A;  3O29 A;  5H8H B;  2DSF A;  1FBE A;  3QIM A;  1I69 A;  4KYE A;  5A5X B;  3DP8 A;  4R6H A;  1JW5 A;  2KLF A;  4F3S A;  1ZMG A;  1RYO A;  3UIF A;  2OWT A;  4EXL A;  1B7H A;  4PDD A;  2Z8D A;  4R75 A;  2XHD A;  2WEF A;  5EQ7 A;  2B4M A;  1EU8 A;  5DVJ A;  4YKJ A;  4BDQ A;  1IMB A;  1AIV A;  3RGY A;  2HZK A;  4ZE8 A;  4HCW A;  4NTL A;  1YXI A;  1IIT A;  4OHN A;  3SDF A;  3G3I A;  3MP8 A;  4EF2 A;  3SEW A;  4BDL A;  4RK2 A;  3H03 A;  4PAK A;  3ISP A;  1ZTY A;  2G93 A;  1SYH A;  2GH9 A;  1B3E A;  3T0J A;  1FQD A;  1NUW A;  4KYS A;  3DM0 A;  1FBP A;  2XXT A;  1UTB B;  4ZEK A;  1BKA A;  1MQG A;  4QFL A;  4MIJ A;  3CFL A;  3TPA A;  2XXY A;  4ELP A;  3R7X A;  3VE1 B;  1H45 A;  1XVX A;  3IOV A;  4PAI A;  1N7X A;  5AA1 A;  4IB2 A;  3TTN A;  3IOW A;  1DK4 A;  3FVO A;  3TYH A;  4ISU A;  1Y3Q A;  4G68 C;  3E4R A;  2O6A A;  4F39 A;  3OEM A;  2DS9 A;  2IA4 A;  2FIE A;  2PFZ A;  1GTK A;  1D9Y A;  1B6H A;  4DE8 A;  5AA4 B;  4JVI A;  2HXW A;  3QYT A;  3PPQ A;  1EZP A;  1R9L A;  1NV1 A;  2ZNT A;  2GRV A;  1MXV A;  3HST A;  1LB9 A;  2VHA A;  3FVK A;  3MZ1 A;  3U94 A;  5EQA A;  4MEV A;  1TFA A;  5IKB A;  5I84 A;  4F3B A;  5AA2 B;  4ELO A;  1NV0 A;  3UN6 A;  4FBP A;  4YB6 A;  4GWU A;  4OVT A;  3A3U A;  4NED A;  4JVC A;  1NH8 A;  2VPO A;  2V93 A;  2B4L A;  3T22 A;  3VV5 A;  1QVS A;  1Q1K A;  3T9X B;  3PPP A;  2KQZ A;  4M4G A;  4Q5T A;  1Y4C A;  2DVC A;  2R71 A;  2QVV A;  4F18 A;  1TFD A;  4HE2 A;  5AE4 A;  3U93 A;  5TU0 A;  4GBW A;  4GWW A;  3CFX A;  4QFO A;  2BJJ X;  4N81 A;  3W9W A;  1WVJ A;  1IXH A;  1LST A;  1YYZ A;  1NUY A;  1IXI A;  4X04 A;  3B8B A;  4PFU A;  1EYI A;  1K9Z A;  3M3F A;  4U1O A;  4N6D A;  4PF6 A;  3KGC A;  1AMF A;  1ANF A;  1FPF A;  3RLF E;  3TTK A;  4AB6 A;  1FQF A;  3EHU A;  2Y7K A;  5H8N A;  1FTK A;  1PBP A;  2DYX A;  2DE2 A;  3RN8 A;  3KFM A;  4YIC A;  2VPN A;  1ZBM A;  4N6K A;  3MP1 A;  3RTF B;  4PAF A;  3G3J A;  1LFH A;  4ZEC A;  4NWC A;  1LLS A;  1QKB A;  2UVG A;  4KFQ A;  4NMY A;  5F24 A;  4HTG A;  4K3F A;  5JTY B;  3PU5 A;  3KJT A;  1FBC A;  4XFE A;  4G77 A;  3OEL A;  1IXC A;  2QMW A;  3N6T A;  5ITO A;  4DLD A;  2Y7P A;  2HAU A;  5FBP A;  3UGW A;  1JEV A;  2XXV A;  3U92 A;  4UAB A;  3T9U A;  1FPD A;  4DDD A;  3G3K A;  4YKP A;  2D21 A;  4JWX A;  1D3K A;  3RT6 B;  3PGF A;  1TWY A;  1LBW A;  1NV2 A;  2ZZX A;  4O7M A;  5DVI A;  4GX3 A;  1FJ9 A;  4F2O A;  4JWO A;  5DYH A;  3TCH A;  4OFJ A;  1NFT A;  4GBV A;  2DP8 A;  4QSE A;  3QUJ A;  4MCO A;  1K9Y A;  4O3C A;  5H8Q B;  3TTL A;  2GQ1 A;  4HW8 A;  4PF8 A;  4H6D A;  3V83 A;  4LA9 A;  5KDT A;  5JEI A;  4LVQ A;  1WOD A;  3FXU A;  2Q8J A;  2G29 A;  4QXD A;  3V8X B;  1B3H A;  3H6W A;  4PQJ A;  4KCD A;  1R1N A;  2O84 X;  3C9H A;  2F3B A;  1FTL A;  3MQ9 A;  4FAT A;  3CI8 A;  2Z8F A;  1Q9D A;  3IL1 B;  4LQ5 A;  4DI4 B;  1MXU A;  5CRY A;  5ET6 A;  1PB7 A;  2DWI A;  4AQ4 A;  5I2K B;  4GL0 A;  4IY6 A;  2CZI A;  1VFD A;  1IMA A;  3N5L A;  3IO6 A;  2ZXT A;  4RA1 A;  2F5X A;  1BK4 A;  2UVI A;  1LAG E;  2Y7W A;  4I1D A;  3MVW A;  5EHS A;  1B4Z A;  4GWX A;  3LSW A;  1FJ6 A;  1FCK A;  1MH4 A;  4GX6 A;  2NVU B;  4XKR A;  3T1B A;  3TEP A;  4EQ9 A;  1FQE A;  3ZSF A;  3T96 B;  3ZKK A;  3PUV E;  2V3U A;  4FEB A;  2QS4 A;  4AB5 A;  4OTE A;  3P7I A;  5CI5 A;  3LSF B;  4JBZ A;  1B5I A;  1LBV A;  1FPI A;  3JYR A;  2MKZ A;  5L9O A;  3IFA A;  2Z22 A;  1M5D A;  2XX7 A;  1P99 A;  4F2Q A;  1NV7 A;  2UVJ A;  2P3N A;  3H7M A;  3EPE A;  4OEU A;  4PFI A;  2XXK A;  2D5W A;  1SW1 A;  5AA3 A;  5I56 A;  4FEC A;  3KOS A;  2F34 A;  1P1O A;  3CIJ A;  1P1U A;  1YZ0 A;  2QJE A;  1DPP A;  5I2N B;  1HSJ A;  3TQL A;  4TQU Q;  1N76 A;  3TFL A;  4ZS9 A;  4OET A;  4H8I A;  2PVU A;  3R6U A;  1CB6 A;  4FE8 A;  1MS7 A;  4R9F A;  2I6E A;  2FNC A;  4X48 A;  2A5T A;  4KPT A;  4GX4 A;  4OWD A;  2ZYM A;  3QK6 A;  3H06 B;  5DEX A;  1XHY A;  3RT8 A;  5L9M A;  3N6U A;  4XKN A;  5FTI A;  2O51 A;  3PMX A;  2RC7 A;  4M1V A;  4IR8 A;  1IXG A;  2ONR A;  3Q26 A;  1XVY A;  4OAN A;  1SI0 A;  3B50 A;  2X7Q A;  1YTV A;  1JW4 A;  1B5H A;  2O1M A;  2QRY A;  3SER A;  2QVU A;  2V84 A;  4OFL A;  2H99 A;  3C32 A;  2XD3 A;  5LOM A;  3OEK A;  4HXV A;  4DXC A;  3IJO B;  4JVD A;  1DCU A;  2GHB A;  1NUX A;  1LBZ A;  5I3S A;  4E0W A;  1B05 A;  1OMP A;  2HZL A;  4RYA A;  2F35 A;  2DXR A;  4IO5 A;  3FZV A;  5FTH A;  1I6Q A;  3ZKL A;  3L6H A;  3OEN A;  3VVE A;  3MC2 A;  3V89 B;  3LSL A;  1NV3 A;  4KR5 A;  5HBC A;  4G61 A;  4F1Y A;  1MY3 A;  4GWS A;  4G68 B;  1URS A;  4E0X A;  2P1S A;  1NKX A;  4FED A;  1JVY A;  3Q28 A;  3K1M A;  4F29 A;  3CR9 A;  2X7P A;  2VD3 A;  3VVF A;  1O64 A;  3KN8 A;  3OMB A;  3S4U A;  2ONS A;  1OQH A;  1CE2 A;  3MPK A;  2XXW A;  4QFN A;  3MJN A;  1EH3 A;  1P1W A;  5BWJ A;  2DQV A;  3B7D A;  1IEJ A;  4QFK A;  3U8Q A;  4QRZ A;  3OSQ A;  2WYP A;  4Q30 B;  1EZ9 A;  4Q0C A;  4THI A;  3C35 A;  2RKM A;  2D3I A;  4WXJ A;  3S2V A;  3V5A A;  2LAO A;  4RK9 A;  4IY5 A;  5ET7 A;  3HN0 A;  4MLV A;  4XEQ A;  3VVD A;  1Y20 A;  3PUY E;  4XKP A;  3FJG A;  3VLU A;  4KQP A;  2YLN A;  4MMP A;  3B6W A;  1B7Z A;  3B6T A;  4IO7 A;  3GBB A;  1J1N A;  1L5T A;  4OFO A;  1FTM A;  1MQD A;  3IX1 A;  3OD7 A;  4NG7 A;  3EKI A;  3MST A;  1NV6 A;  3PTY A;  1NUZ A;  1XOC A;  1B58 A;  2P3V A;  4NAP A;  5EHM A;  4LZ8 A;  2H9B A;  3T9V A;  5J16 A;  4Z0I A;  1RKM A;  4MX6 A;  3H3G A;  4P1L A;  2XXQ A;  1WDN A;  5ISU A;  4R72 A;  2Q8M A;  5IZ1 A;  3Q25 A;  4MJO A;  3JV9 A;  1UQW A;  2RCB A;  3TCG A;  5H8F A;  3LR1 A;  3O9P A;  1YPN A;  5KZT A;  4G8N A;  3O66 A;  1GR2 A;  2Y7R A;  3QAX A;  3SEX A;  3A3C A;  1H3D A;  3G3F A;  5AA2 A;  4OZ9 A;  2OCU A;  1DSN A;  1EYJ A;  4FOR A;  3G7W A;  4NHB A;  3TQW A;  5I57 A;  1MDQ A;  1D9V A;  2RF1 A;  3FBP A;  3PPO A;  4PBQ A;  2Y7I A;  3MVY A;  4KI0 E;  4U4X A;  1AL3 A;  3MUQ A;  1LAX A;  4GWY A;  3I5O A;  4N13 A;  1GVC A;  4G8H A;  5FHM A;  1T0K A;  2PBW A;  1ZU0 A;  2ABH A;  4N8Y A;  1MQI A;  3D1R A;  1Z7M E;  4R6Y A;  4QBA A;  5KCJ A;  2F7C A;  1LB8 A;  2DE4 A;  3ONM A;  1B40 A;  3C36 A;  1URG A;  1AOV A;  3T93 B;  1D4N A;  2V4C A;  1A99 A;  4MBP A;  3N94 A;  3A29 A;  3OO9 A;  1B0H A;  5IZ3 A;  3FAT A;  4F3G A;  4IGR A;  5J1D A;  4UA8 A;  3VDF A;  1MM6 A;  3KSX A;  2HQ0 A;  3WAE A;  2DE3 A;  4NGU A;  3RTW B;  5TPA B;  3RPL A;  2Y5L A;  1OLC A;  1G0H A;  5BUU A;  4GVO A;  1OQG A;  3KBZ A;  4EDP A;  1MXZ A;  1VFE A;  1N7W A;  4POX A;  3HV1 A;  3ILU B;  5LDZ A;  1QUK A;  2ANJ A;  3D4C A;  3MP6 A;  1R9Q A;  2F78 A;  4O3A A;  4EXK A;  3AXF A;  1SVX B;  5IM2 A;  3G3G A;  4R6K A;  4ELR A;  5CM6 A;  5TP9 A;  4BDN A;  4MLQ A;  1NV5 A;  1B5J A;  4O3B A;  1YCJ A;  3K01 A;  1LFI A;  1PB9 A;  4U21 A;  1I6B A;  3ODB A;  4F31 B;  2CEX A;  2DDK A;  1BLF A;  3K0V A;  1B7U A;  3KN7 A;  3K4U A;  1B51 A;  2JJK A;  2CZK A;  2OX3 A;  2OBG A;  4PBH A;  1GV8 A;  2I48 A;  4I40 A;  1LCT A;  3HHF A;  4QF9 A;  4IO4 A;  2QL3 A;  1Y1M A;  3EHS A;  1HSL A;  2NWJ A;  2O69 A;  4N4U A;  2ZNU A;  1EZO A;  5A5L A;  4Z7E A;  2UYF A;  5EYF A;  5I59 A;  3GBA A;  3WAF A;  4BDM A;  1N3X A;  1LBB A;  1Y3P A;  1NL5 A;  2I3V A;  2M8C A;  3SEV A;  4HE0 A;  2O1L A;  3RY3 A;  5H8N B;  3IR1 A;  5DT6 A;  2XXR A;  4LZ7 A;  5HPQ A;  2H98 A;  2Q74 A;  1KZ8 A;  4GLI A;  2Q88 A;  2WBB A;  1SPI A;  4ZEF A;  4ELQ A;  4TLM B;  3FXB A;  3PPR A;  2OLB A;  1VR5 A;  4RPN A;  5I2K A;  2YJP A;  4GQO A;  5EQ8 A;  1FQA A;  2A5S A;  1R6Z A;  1UIU A;  4QSD A;  3S9N C;  1FPJ A;  3KSJ A;  1NNK A;  3O6G A;  1NNP A;  1UTH A;  3U65 A;  4H0W A;  3O6H A;  3FV1 A;  3M8U A;  4MNP A;  3K6U A;  4G2Z A;  3TTM A;  3USD A;  1CNQ A;  4N07 A;  2OJT A;  4GXA A;  4EF1 A;  4JSD A;  1YAE A;  3E13 X;  1POT A;  3GXA A;  1F9B A;  5CBS A;  4F3P A;  2FA7 A;  5EQ9 A;  3CSG A;  1FPE A;  1INP A;  4WED A;  4N15 A;  4GF8 A;  4MH5 A;  3VLW A;  1NNF A;  2HPG A;  1B2H A;  4U2R A;  3CRB A;  1MPD A;  2VT5 A;  4GWO A;  3PMW A;  2AL5 A;  4R2F A;  2ZYK A;  2FIX A;  4JSO A;  5KDT B;  3DEL B;  4YAH X;  4OMB A;  2ZZW A;  1LFG A;  4NF8 A;  1QKA A;  5F7V A;  3K02 A;  3ILT B;  2HEU A;  1UIV A;  3OXN A;  4F22 A;  1S9T A;  4OYV A;  4R9G A;  3U1O A;  1Q35 A;  4NF5 A;  3RYD A;  3UK4 A;  2WKY A;  2HHM A;  2I58 A;  4IO6 A;  4PFT A;  4H45 A;  5I58 A;  3H6V A;  3FXR A;  5CBR A;  4H67 A;  1URD A;  1SD3 A;  2OZZ A;  1JVX A;  2DWJ A;  4ND9 A;  5HM4 B;  2NUV A;  2IEE A;  1FQB A;  2NOO A;  4DCX A;  2PX1 A;  2P0S A;  1BIY A;  4MFI A;  4OQO A;  4POW A;  2Q9T A;  3FGS A;  2OWZ A;  2QPQ A;  4ZZA A;  5I7I A;  4R74 A;  1H43 A;  1MPC A;  1A40 A;  2GFE A;  2VD2 A;  4X9T A;  2RC9 A;  1A55 A;  3E3K A;  2GHA A;  4RY1 A;  1XS5 A;  2XA5 A;  3GLB A;  4NF4 A;  2O68 A;  4X1D A;  2X26 A;  3BFU A;  4NF0 A;  2UXA A;  2F36 A;  2WYK A;  1AWB A;  3O97 A;  4NF6 A;  4GWZ A;  1MQJ A;  3FUZ A; 
#chains in the Genus database with same CATH homology
 4XIG Q;  4DXU A;  1AH5 A;  1B52 A;  3S9E A;  3PD9 A;  3S9M C;  2THI A;  2XXP A;  4XTC Q;  1BP5 A;  3KJ7 A;  3IAZ A;  1DOT A;  3E9X A;  2H25 A;  1MPB A;  4IGT A;  1MY1 A;  5H8H A;  1Y3N A;  4ECF A;  3UP9 A;  5A5X A;  3QSL A;  1SBP A;  3MZB A;  2PT2 A;  5M2V A;  4TLL B;  1JQF A;  2RC8 A;  2XXX A;  3OSR A;  1SQY A;  4C1U A;  3EN3 A;  5DEX B;  3C4M A;  3TUS A;  2REG A;  4DIG A;  1QUJ A;  1TT1 A;  1USY E;  4BLA A;  3U72 A;  5CMC A;  4GXS B;  2O7U A;  1USY H;  1MXX A;  4OVJ A;  3EQ1 A;  3GZG A;  4EQ7 A;  3PPN A;  2XXU A;  3BKI B;  1A54 A;  5ICQ A;  3TEL A;  3K1N A;  5L9S A;  2ONK E;  1B9J A;  5K2Y A;  3KBR A;  5K2X A;  5ICT A;  5L8D A;  4ZE9 A;  1MG1 A;  1MM7 A;  1DTG A;  3LBS A;  5DTB A;  1DPE A;  1PC3 A;  1UTB A;  4ONY A;  2UYE A;  3FVG A;  4ZDM A;  1IIW A;  3BFT A;  3IOT A;  3M3L A;  2Q89 A;  1B3F A;  4KD5 A;  1LBC A;  4YU0 A;  3G3H A;  3PUX E;  2YPN A;  2ZYN A;  1LAH E;  4BDO A;  2AIX A;  2F7A A;  4OES A;  3MPL A;  4PFW A;  4QSC A;  3SEU A;  1ZLQ A;  4I62 A;  1SW5 A;  4RNS A;  3LSX A;  1QUI A;  5AA4 A;  2I0B A;  3IJX B;  5AA2 D;  4LUB A;  4GD5 A;  3RPW A;  4PET A;  1JET A;  4X1B A;  3PUW E;  4C0R A;  1II5 A;  4ZZE A;  2NXO A;  1SI1 A;  4U23 A;  1MXW A;  3TCF A;  3PD8 A;  1NH7 A;  4H65 A;  4KCC A;  4BDR A;  4I9D A;  1TXF A;  3RNN A;  3EHT A;  2R9J A;  3TKD A;  1DMB A;  2E0S A;  4JXI A;  3EF7 A;  2REJ A;  2F6P A;  2I4C A;  2ESN A;  3DP4 A;  2QMX A;  4LON B;  1MXY A;  4UAC A;  4HS7 A;  5TPA A;  1B3G A;  4ESX A;  2VP1 A;  4GOT A;  4IO2 A;  4L17 A;  3K6X A;  3TZA A;  1B1H A;  4N6P A;  3CSB A;  3M3K A;  1ZJL A;  3UOR A;  4GFR A;  3T66 A;  1N04 A;  3Q29 A;  1M5B A;  2DVZ A;  5H8F B;  4ZEB A;  4YB5 A;  3KG2 A;  3FXQ A;  2CMO A;  2I0C A;  5JK4 A;  3OO8 A;  2I4B A;  3CFZ A;  4U4S A;  3TDJ A;  3BBR A;  2QS2 A;  1A7L A;  2I49 A;  1N3W A;  3IB0 A;  1OVB A;  3I6V A;  4YB7 A;  5FHO A;  3H4Z A;  5I57 B;  3C31 A;  3CVG A;  4JDF A;  4U22 A;  4P11 A;  1Z7N E;  4LQ2 A;  2V3Q A;  3SEY A;  3FV2 A;  1QW0 A;  1A8F A;  1QUL A;  1MQH A;  3VXB A;  3PMV A;  3D4G A;  5JTY A;  3OO6 A;  4YZZ A;  3DLN A;  4RXL A;  1XT8 A;  2H5Y A;  5KCJ B;  3H6T A;  1VSO A;  5CMM A;  1FQC A;  4EUO A;  3VFJ A;  3IB1 A;  4Q8R A;  5CMK A;  3HPI A;  3O2A A;  1B4H A;  3W15 C;  4NE4 A;  2RCA A;  3MAM A;  3PUZ E;  4JWY A;  4ESW A;  2ZYO A;  4FIM A;  3TTR A;  3S9L C;  2DXY A;  1SW2 A;  4PE5 B;  1B3L A;  3JZJ A;  1MDP 1;  1I6A A;  1JW1 A;  3HHG A;  1POY 1;  5H8Q A;  3SET A;  5F1Q A;  4YKK A;  3O28 A;  2B3F A;  1LCF A;  4XXU A;  1US5 A;  1N0T A;  3K2D A;  4GRK A;  5TP9 B;  2P2A A;  1B32 A;  1MY2 A;  5FHN A;  3L6G A;  3MBP A;  4F1U A;  2HCA A;  4IO3 A;  4PP0 A;  3MW0 A;  4QFP A;  4G4P A;  2ALU A;  1BTJ A;  2V3T A;  2H4I A;  4JB7 A;  3LUY A;  3MVZ A;  3N26 A;  4GIZ A;  4LAT A;  4PFY A;  2Y84 A;  4H1X A;  2VGQ A;  4NWD A;  3QXM A;  2OK2 A;  4DXB A;  4YKI A;  2DWH A;  2E1S A;  5H8S A;  3I3V A;  3TOD A;  3OOA A;  1H44 A;  1S50 A;  4R2B A;  1FTO A;  2R6G E;  2FYI A;  3KOT A;  4LZ5 A;  2F8D A;  1RYX A;  3CG3 A;  5I59 B;  3UA8 A;  3K00 A;  1N84 A;  2I3W A;  1VE4 A;  4YMB A;  4TOZ A;  2Q2A A;  3MVX A;  3IK6 B;  5IAI A;  3K6V A;  1US4 A;  1H76 A;  1MY0 A;  3B6Q A;  2V25 A;  1M5E A;  1SW4 A;  3VXC A;  3CG1 A;  3A09 A;  3QUF A;  1OIB A;  4YMA A;  1JNF A;  1PB8 A;  1Y9U A;  1SYI A;  4U1Z A;  3K6W A;  2XX8 A;  4OER A;  2DWA A;  4ZED A;  3H6U A;  3KN3 A;  1PDA A;  1FTJ A;  5I2N A;  1UTH B;  4DZ1 A;  2QS1 A;  1B46 A;  4DCY A;  1MY4 A;  3TMG A;  4F19 A;  1IUD A;  1O63 A;  4LP2 B;  3SES A;  3C33 A;  4OEV A;  2PMS A;  1JEU A;  1ZIU A;  4I8C A;  1ELJ A;  1DTZ A;  5B70 A;  2F97 A;  1KWH A;  2CZL A;  4H5G A;  1Y4T A;  4P0I A;  1PBQ A;  1S7Y A;  3LC8 A;  3OO7 A;  3FAS A;  1GGG A;  4RPO A;  4WKM A;  4G8M A;  4HCY A;  3HCQ A;  3FD3 A;  4H5F A;  1MH3 A;  5CMB A;  3C34 A;  1M5C A;  3O6I A;  2ZMB A;  3IB2 A;  2OWS A;  4MF3 A;  4FJP A;  3FVN A;  3DP6 A;  1ATG A;  5DVF A;  1LGB C;  2F7B A;  2PT1 A;  2XX9 A;  2RIN A;  3RUM A;  5CC2 A;  4NF8 B;  1FW0 A;  2PYY A;  1OVT A;  3SKP A;  1NMU A;  4F1V A;  4NF5 B;  3KEI A;  4RJZ A;  4EQB A;  1Y1Z A;  3KZG A;  4P0G A;  4FAJ A;  1QJM A;  4XKQ A;  4G68 A;  2AYS A;  4ZEI A;  1IZ1 A;  5I58 B;  4KYD A;  3T9H B;  3ECR A;  2ZNS A;  2Q2C A;  2XXH A;  5B7D A;  5I56 B;  3TAJ A;  2QSX A;  3RQT A;  2AL4 A;  1PEB A;  1A8E A;  1O7T A;  4GL8 A;  4OXV A;  3THI A;  3W9V A;  4QHQ A;  3IOR A;  3ZS6 A;  1SDX A;  1ZKB A;  3R26 A;  2Z8E A;  3FJ7 A;  2O7I A;  2VOZ A;  2XD2 A;  3FJM A;  2XXI A;  1LAF E;  2B65 A;  2HAV A;  2F6G A;  3IOU A;  3MWB A;  1OLA A;  2A5T B;  3MZ9 A;  4NF4 B;  4H8J A;  3FIR A;  1HSE A;  3HO7 A;  4KHZ E;  5ELV A;  3PV0 E;  4NF6 B;  1MRP A;  3Q27 A;  4WEP A;  1M5F A;  2B3B A;  3VLV A;  3K1P A;  4R73 A;  2W7Y A;  5ITP A;  1P1Q A;  4OEN A;  2DOJ A;  1B0L A;  1B1X A;  2UVH A;  1XC1 A;  2HFB A;  3F11 A;  4C1T A;  1NNT A;  1IQ7 A;  2QS3 A;  1P1N A;  2Z23 A;  3IO4 A;  3O29 A;  5H8H B;  2DSF A;  3QIM A;  1I69 A;  4KYE A;  5A5X B;  3DP8 A;  4R6H A;  1JW5 A;  2KLF A;  4F3S A;  1ZMG A;  1RYO A;  3UIF A;  2OWT A;  4EXL A;  1B7H A;  2Z8D A;  4R75 A;  2XHD A;  1EU8 A;  5DVJ A;  4YKJ A;  4BDQ A;  1AIV A;  3RGY A;  2HZK A;  4ZE8 A;  4HCW A;  4NTL A;  4OHN A;  1IIT A;  3SDF A;  3G3I A;  3MP8 A;  4EF2 A;  3SEW A;  4BDL A;  4RK2 A;  3H03 A;  1ZTY A;  2G93 A;  1SYH A;  2GH9 A;  1B3E A;  1FQD A;  4KYS A;  3DM0 A;  2XXT A;  1UTB B;  4ZEK A;  1BKA A;  1MQG A;  4QFL A;  3CFL A;  3TPA A;  4ELP A;  2XXY A;  3R7X A;  3VE1 B;  1H45 A;  1XVX A;  3IOV A;  1N7X A;  5AA1 A;  4IB2 A;  3TTN A;  3IOW A;  3FVO A;  3TYH A;  4ISU A;  1Y3Q A;  4G68 C;  3E4R A;  2O6A A;  4F39 A;  3OEM A;  2DS9 A;  2IA4 A;  1GTK A;  1D9Y A;  1B6H A;  4DE8 A;  5AA4 B;  2HXW A;  3QYT A;  3PPQ A;  1EZP A;  1R9L A;  2ZNT A;  2GRV A;  1MXV A;  3HST A;  1LB9 A;  2VHA A;  3FVK A;  3MZ1 A;  3U94 A;  1TFA A;  5IKB A;  5I84 A;  4F3B A;  5AA2 B;  4ELO A;  3UN6 A;  4YB6 A;  3A3U A;  4NED A;  1NH8 A;  2V93 A;  3T22 A;  3VV5 A;  1QVS A;  1Q1K A;  3T9X B;  3PPP A;  4M4G A;  4Q5T A;  1Y4C A;  2DVC A;  2R71 A;  4F18 A;  1TFD A;  5AE4 A;  3U93 A;  5TU0 A;  3CFX A;  4QFO A;  2BJJ X;  3W9W A;  1WVJ A;  1IXH A;  1LST A;  1IXI A;  4PFU A;  3M3F A;  4U1O A;  3KGC A;  1AMF A;  1ANF A;  3RLF E;  3TTK A;  4AB6 A;  1FQF A;  3EHU A;  2Y7K A;  5H8N A;  1FTK A;  1PBP A;  2DYX A;  2DE2 A;  3RN8 A;  3KFM A;  4YIC A;  1ZBM A;  3MP1 A;  3RTF B;  3G3J A;  1LFH A;  4ZEC A;  4NWC A;  1LLS A;  1QKB A;  2UVG A;  4KFQ A;  4NMY A;  4HTG A;  4K3F A;  5JTY B;  3PU5 A;  3KJT A;  4G77 A;  3OEL A;  1IXC A;  2QMW A;  3N6T A;  5ITO A;  4DLD A;  2Y7P A;  2HAU A;  3UGW A;  1JEV A;  2XXV A;  3U92 A;  3T9U A;  4DDD A;  3G3K A;  4YKP A;  2D21 A;  4JWX A;  1D3K A;  3RT6 B;  3PGF A;  1TWY A;  5DVI A;  4F2O A;  4JWO A;  5DYH A;  3TCH A;  4OFJ A;  1NFT A;  2DP8 A;  4QSE A;  3QUJ A;  4O3C A;  5H8Q B;  3TTL A;  4HW8 A;  4H6D A;  3V83 A;  4LA9 A;  5KDT A;  5JEI A;  4LVQ A;  1WOD A;  3FXU A;  2Q8J A;  2G29 A;  3V8X B;  1B3H A;  3H6W A;  4PQJ A;  4KCD A;  1R1N A;  2O84 X;  3C9H A;  1FTL A;  3MQ9 A;  4FAT A;  3CI8 A;  2Z8F A;  3IL1 B;  4LQ5 A;  1MXU A;  5CRY A;  1PB7 A;  2DWI A;  4AQ4 A;  5I2K B;  4GL0 A;  4IY6 A;  1VFD A;  3N5L A;  3IO6 A;  2ZXT A;  4RA1 A;  2F5X A;  2UVI A;  1LAG E;  2Y7W A;  3MVW A;  4I1D A;  5EHS A;  1B4Z A;  3LSW A;  1FCK A;  1MH4 A;  2NVU B;  4XKR A;  3TEP A;  4EQ9 A;  1FQE A;  3ZSF A;  3T96 B;  3ZKK A;  3PUV E;  2V3U A;  4FEB A;  2QS4 A;  4AB5 A;  4OTE A;  3P7I A;  5CI5 A;  3LSF B;  4JBZ A;  1B5I A;  3JYR A;  5L9O A;  2Z22 A;  1M5D A;  2XX7 A;  1P99 A;  4F2Q A;  2UVJ A;  3H7M A;  3EPE A;  4OEU A;  2D5W A;  1SW1 A;  5AA3 A;  5I56 A;  4FEC A;  3KOS A;  2F34 A;  1P1O A;  3CIJ A;  1P1U A;  2QJE A;  1DPP A;  5I2N B;  1HSJ A;  3TQL A;  4TQU Q;  1N76 A;  3TFL A;  4ZS9 A;  4OET A;  4H8I A;  2PVU A;  3R6U A;  1CB6 A;  4FE8 A;  1MS7 A;  4R9F A;  2I6E A;  2FNC A;  4X48 A;  2A5T A;  4KPT A;  4OWD A;  2ZYM A;  3QK6 A;  3H06 B;  5DEX A;  1XHY A;  3RT8 A;  5L9M A;  3N6U A;  4XKN A;  5FTI A;  2O51 A;  3PMX A;  2RC7 A;  4M1V A;  1IXG A;  2ONR A;  3Q26 A;  1XVY A;  1SI0 A;  2X7Q A;  1YTV A;  1JW4 A;  1B5H A;  2O1M A;  2QRY A;  3SER A;  2V84 A;  4OFL A;  2H99 A;  3C32 A;  2XD3 A;  5LOM A;  3OEK A;  4DXC A;  3IJO B;  2GHB A;  4E0W A;  1B05 A;  1OMP A;  2HZL A;  4RYA A;  2F35 A;  2DXR A;  4IO5 A;  3FZV A;  5FTH A;  1I6Q A;  3ZKL A;  3L6H A;  3OEN A;  3VVE A;  3MC2 A;  3V89 B;  3LSL A;  4KR5 A;  5HBC A;  4F1Y A;  1MY3 A;  4G68 B;  1URS A;  4E0X A;  2P1S A;  1NKX A;  4FED A;  1JVY A;  3Q28 A;  3K1M A;  4F29 A;  3CR9 A;  2X7P A;  2VD3 A;  3VVF A;  1O64 A;  3KN8 A;  3OMB A;  3S4U A;  2ONS A;  1OQH A;  1CE2 A;  3MPK A;  2XXW A;  4QFN A;  3MJN A;  1EH3 A;  1P1W A;  5BWJ A;  2DQV A;  3B7D A;  1IEJ A;  4QFK A;  3U8Q A;  4QRZ A;  3OSQ A;  4Q30 B;  1EZ9 A;  4Q0C A;  4THI A;  3C35 A;  2RKM A;  2D3I A;  4WXJ A;  3S2V A;  3V5A A;  2LAO A;  4RK9 A;  4IY5 A;  3HN0 A;  4MLV A;  3VVD A;  1Y20 A;  3PUY E;  4XKP A;  3FJG A;  3VLU A;  4KQP A;  2YLN A;  3B6W A;  1B7Z A;  3B6T A;  4IO7 A;  3GBB A;  1J1N A;  1L5T A;  4OFO A;  1FTM A;  1MQD A;  3IX1 A;  3OD7 A;  1XOC A;  1B58 A;  5EHM A;  4LZ8 A;  2H9B A;  3T9V A;  4Z0I A;  1RKM A;  3H3G A;  2XXQ A;  1WDN A;  5ISU A;  4R72 A;  3Q25 A;  3JV9 A;  1UQW A;  2RCB A;  3TCG A;  5H8F A;  3LR1 A;  3O9P A;  1YPN A;  5KZT A;  4G8N A;  3O66 A;  1GR2 A;  2Y7R A;  3QAX A;  3SEX A;  3A3C A;  1H3D A;  3G3F A;  5AA2 A;  4OZ9 A;  2OCU A;  1DSN A;  4FOR A;  3G7W A;  3TQW A;  5I57 A;  1MDQ A;  1D9V A;  2RF1 A;  3PPO A;  2Y7I A;  3MVY A;  4KI0 E;  4U4X A;  1AL3 A;  3MUQ A;  1LAX A;  3I5O A;  4N13 A;  1GVC A;  4G8H A;  5FHM A;  1T0K A;  2PBW A;  1ZU0 A;  2ABH A;  1MQI A;  1Z7M E;  4R6Y A;  5KCJ A;  2F7C A;  1LB8 A;  2DE4 A;  3ONM A;  1B40 A;  3C36 A;  1URG A;  1AOV A;  3T93 B;  1D4N A;  1A99 A;  4MBP A;  3N94 A;  3OO9 A;  1B0H A;  4F3G A;  3FAT A;  4IGR A;  5J1D A;  4UA8 A;  3VDF A;  1MM6 A;  3KSX A;  2HQ0 A;  3WAE A;  2DE3 A;  3RTW B;  5TPA B;  1OLC A;  5BUU A;  4GVO A;  1OQG A;  4EDP A;  1MXZ A;  1VFE A;  1N7W A;  4POX A;  3HV1 A;  3ILU B;  1QUK A;  2ANJ A;  3D4C A;  3MP6 A;  1R9Q A;  2F78 A;  4O3A A;  4EXK A;  3AXF A;  1SVX B;  3G3G A;  4R6K A;  4ELR A;  5CM6 A;  5TP9 A;  4BDN A;  4MLQ A;  1B5J A;  4O3B A;  1YCJ A;  3K01 A;  1LFI A;  1PB9 A;  4U21 A;  1I6B A;  3ODB A;  4F31 B;  1BLF A;  3K0V A;  1B7U A;  3KN7 A;  3K4U A;  1B51 A;  2OBG A;  1GV8 A;  2I48 A;  1LCT A;  3HHF A;  4QF9 A;  4IO4 A;  2QL3 A;  1Y1M A;  3EHS A;  1HSL A;  2NWJ A;  2O69 A;  2ZNU A;  1EZO A;  4Z7E A;  2UYF A;  5EYF A;  5I59 A;  3GBA A;  3WAF A;  4BDM A;  1N3X A;  1LBB A;  1Y3P A;  1NL5 A;  2I3V A;  2M8C A;  3SEV A;  2O1L A;  3RY3 A;  5H8N B;  3IR1 A;  5DT6 A;  2XXR A;  4LZ7 A;  5HPQ A;  2H98 A;  4GLI A;  2Q88 A;  4ZEF A;  4ELQ A;  4TLM B;  3PPR A;  2OLB A;  1VR5 A;  4RPN A;  5I2K A;  2YJP A;  4GQO A;  1FQA A;  2A5S A;  1R6Z A;  1UIU A;  4QSD A;  3S9N C;  3KSJ A;  1NNK A;  3O6G A;  1NNP A;  1UTH A;  4H0W A;  3O6H A;  3FV1 A;  3M8U A;  3K6U A;  4G2Z A;  3TTM A;  3USD A;  4N07 A;  2OJT A;  4GXA A;  4EF1 A;  4JSD A;  1YAE A;  3E13 X;  1POT A;  3GXA A;  1F9B A;  5CBS A;  4F3P A;  2FA7 A;  3CSG A;  4WED A;  4GF8 A;  3VLW A;  4MH5 A;  1NNF A;  4U2R A;  1B2H A;  3CRB A;  1MPD A;  4GWO A;  3PMW A;  2AL5 A;  4R2F A;  2ZYK A;  4JSO A;  5KDT B;  3DEL B;  4YAH X;  4OMB A;  1LFG A;  4NF8 A;  1QKA A;  5F7V A;  3K02 A;  3ILT B;  2HEU A;  1UIV A;  3OXN A;  4F22 A;  1S9T A;  4OYV A;  4R9G A;  3U1O A;  1Q35 A;  4NF5 A;  3UK4 A;  2WKY A;  2I58 A;  4IO6 A;  4PFT A;  5I58 A;  3H6V A;  3FXR A;  5CBR A;  4H67 A;  1URD A;  1SD3 A;  2OZZ A;  1JVX A;  2DWJ A;  4ND9 A;  5HM4 B;  2NUV A;  2IEE A;  1FQB A;  2NOO A;  4DCX A;  2PX1 A;  2P0S A;  1BIY A;  4MFI A;  4OQO A;  4POW A;  2Q9T A;  3FGS A;  2QPQ A;  4ZZA A;  4R74 A;  1H43 A;  1MPC A;  1A40 A;  2GFE A;  2VD2 A;  4X9T A;  2RC9 A;  1A55 A;  3E3K A;  2GHA A;  4RY1 A;  1XS5 A;  3GLB A;  4NF4 A;  2O68 A;  4X1D A;  2X26 A;  3BFU A;  2UXA A;  2F36 A;  3O97 A;  4NF6 A;  1MQJ A;  3FUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...