4MMPA

Structure of sialic acid binding protein from pasturella multocida
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
308
structure length
308
Chain Sequence
GADYDLKFGMVAGPSSNEYKAVEFFAKEVKEKSNGKIDVAIFPSSQLGDDRVMIKQLKDGALDFTLGESARFQIYFPEAEVFALPYMIPNFETSKKALLDTKFGQGLLKKIDKELNVQVLSVAYNGTRQTTSNRAINSIEDMKGLKLRVPNAATNLAYAKYVGAAPTPMAFSEVYLALQTNSVDGQENPLPTIQAQKFYEVQKYLALTNHILNDQLYLISNDTLADLPEDLQKVVKDAAAKAAEYHTKLFVDGENSLVEFFKSQGVTVTQPDLKPFKAALTPYYDEYLKKNGEVGKMAIEEISNLAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Sialic Acid Binding Protein
publication title Bacterial periplasmic sialic acid-binding proteins exhibit a conserved binding site.
pubmed doi rcsb
source organism Pasteurella multocida subsp. gallicida p1059
total genus 121
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2013-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mmpA00
5IM2A 4NN3A 4MIJA 2ZZVA 4PAIA 2CEYA 4N17A 4PC9A 2ZZXA 5IZZA 3FXBA 4NHBA 2XWVA 4PETA 4OVTA 4MNCA 3U65A 2XWIA 5I7IA 2XA5A 4N6KA 4NG7A 4XEQA 4PBQA 4OVSA 4PAKA 4O8MA 2V4CA 4MHFA 2ZZWA 2PFYA 2WX9A 4O7MA 4OANA 4N4UA 3B50A 4DI3D 4PGNA 2XWKA 4DI4B 4PF6A 4XFEA 4P8BA 4OA4A 2HZLA 4P56A 2XXKA 2VPOA 2VPNA 2CEXA 4N15A 4PCDA 2HZKA 4MAGA 2HPGA 4NX1A 4OVPA 4NGUA 4XF5A 4P47A 5LTCA 4PBHA 4MEVA 4P3LA 4LN5A 4YICA 5CM6A 4P9KA 4N91A 4MNIA 4PFBA 4NQ8A 5I5PA 4MMPA 4PGPA 4PE3A 4X8RA 4MCOA 4X04A 4NF0A 4PFIA 4PDHA 4PFRA 2PFZA 4MX6A 4NAPA 3GYYA 4PF8A 2WYPA 4O94A 2XWOA 4N6DA 4N8YA 4OVRA 4OVQA 4PDDA 4P1LA 4PAFA 4N8GA 4P1EA 4MNPA 4YZZA 4UABA 5IGAA 2WYKA
chains in the Genus database with same CATH superfamily
3K6WA 2V93A 1DMBA 4RK2A 3TAJA 5IZZA 2DWIA 2A5SA 4OQOA 1B2HA 3FXBA 2XXWA 4NF4A 2Y84A 1US5A 4KHZE 1ZTYA 1NNTA 5FTHA 4POXA 4FORA 1QGXA 1N7XA 4R9GA 4I1DA 3MVXA 4QXDA 2BJJX 3N26A 4HCWA 1FTJA 2F7AA 1MDQA 2P0SA 1MQHA 1O63A 2IEEA 3PV0E 3M3LA 5H8HB 2Y7WA 1B3GA 1IXCA 4MAGA 4QFOA 2HPGA 3OSQA 2AIXA 4I9DA 2YLNA 1P1WA 3H4ZA 4MLQA 2H4IA 1II5A 4POWA 1NV6A 3IFCA 3H6TA 1MPBA 4NQ8A 1XC1A 2XD2A 3VVFA 4GX6A 3VDFA 4IO7A 4P0GA 3T66A 4WEDA 5I2KA 1A99A 3FGSA 3RN8A 4F1YA 4MX6A 3MW0A 4KCCA 3FJMA 4JB7A 2HEUA 4IO5A 4ZEBA 1FQCA 2QS1A 4GLIA 3EHTA 4F3BA 2XXYA 2ZYOA 5ET8A 3LV0A 2B4LA 1XVXA 1ZIUA 3Q29A 4C0RA 1K9ZA 4NN3A 1URSA 4O3BA 4YKKA 4UACA 3ILUB 1LBBA 1FRPA 1AH5A 1KZ8A 4YU0A 1P1NA 2O7IA 3R7XA 4EQBA 4U21A 3CG1A 4RXLA 5I2NA 2CZLA 4NE4A 2WX9A 3K1PA 4N4UA 1DTZA 5L9MA 3QAXA 3KJTA 5I58B 3H6WA 2VD2A 3MP8A 3T22A 1IXIA 1DBZA 4G68C 3V5AA 2Q2CA 1HSJA 4G4PA 2VPOA 4I40A 5TPAB 3EQ1A 3O29A 4BDNA 1NH7A 3R6UA 4YKJA 3OENA 3W15C 3VVEA 4ESXA 1VFDA 2DVZA 3G3IA 4PBHA 5BUUA 1MXZA 1NNFA 4G2ZA 2B65A 2Q2AA 4C1TA 4G8NA 1NNKA 3H7MA 4MJOA 1MY1A 1JNFA 3PPPA 4GWUA 1OMPA 3FASA 2DE2A 4QFKA 1MXYA 4L17A 5CBRA 2UVHA 3PU5A 4YMBA 3K6VA 4RPNA 1IZ1A 4P1LA 2YJPA 3ZKLA 1QVSA 1IQ7A 5DVIA 2Z22A 2CZIA 1BKAA 1OQGA 3TYHA 5IGAA 2WYKA 1SI0A 1IMFA 4QBAA 4OHNA 4BDRA 3B6TA 4ZS9A 3T96B 3TPAA 1LBVA 3PD8A 1WDNA 2Q88A 3OEKA 3VFJA 2PT2A 3IK6B 3KBZA 2ANJA 4MNCA 4E0WA 3NOHA 4KR5A 3RQTA 3HFUA 4PAKA 4RYAA 4HE0A 4YB6A 4AS5A 1B5HA 1FPKA 3E4RA 3LSXA 5A5XA 2H98A 1P99A 1XOCA 1LAGE 3HV1A 2DSFA 3MYUA 3PPQA 3KEIA 2HZLA 3TUSA 2V84A 4Q5TA 1YTVA 5IZ3B 2ZNSA 3T9XB 1FTLA 1FTMA 4DCYA 4NGUA 3QIMA 4F1VA 4RPOA 2QMXA 1LFHA 1S50A 2Y7IA 1BTJA 2DP8A 1YPNA 3IO4A 2XXHA 4IO6A 3K6XA 4NF6B 5ISUA 1T0KA 4PFUA 3LSFB 4PFRA 1FQDA 4OERA 4NAPA 2F3DA 2PVUA 1FBCA 4HCYA 1UTHB 3IB1A 3LSLA 4ZEFA 1XHYA 4NF5B 5L9SA 1QKAA 4DIGA 4YMAA 4QFLA 3HHFA 1QKBA 5ITOA 4UABA 1RYOA 2GRVA 2Z8DA 2CZHA 2F5XA 4ZZAA 2ONRA 3TQWA 1B4HA 4BDQA 3ECRA 5ELVA 4WKMA 5ICQA 1B32A 3M3KA 1EZPA 4H67A 3KOSA 3RT8A 1FPJA 3PPOA 2THIA 4N13A 3FV2A 4Q8RA 1B58A 4XKPA 4F22A 5I58A 2XA5A 1O7TA 1B3HA 2PFYA 2F7BA 1B7HA 1TT1A 5DVFA 4R2BA 3IOTA 1ZLQA 2W7YA 1FBFA 2H99A 1I69A 5A5LA 4H1XA 3VLWA 1M5CA 1LFIA 1SYHA 3H06B 5T3JA 3C9HA 4GXSB 3GLBA 4AS4A 5CC2A 4NF4B 3H3GA 5CM6A 2OJTA 1TWYA 3CFXA 3TCGA 5EQ9A 3LUZA 1MM7A 3S9LC 3M8UA 1SDXA 3LUYA 2WBBA 1NV5A 3JZJA 4F2QA 3GYYA 3KG2A 1NV3A 4F3PA 3E79A 3BFTA 4PQJA 2PCRA 4QFPA 4OVRA 2F35A 3IJOB 2XD3A 1Q1KA 4F1UA 4ND9A 4MH5A 4O3CA 4OMBA 4ZEDA 4O3AA 4QSCA 2CEYA 4H8IA 1K9YA 1MY2A 5I59A 3O6GA 1MXWA 1H43A 3A3UA 3IAZA 3PUXE 3UP9A 1Q35A 4X1DA 3UA8A 3MUQA 5FTIA 3TKDA 3FZVA 3FVNA 5DT6A 1P1OA 2GHBA 4FBPA 1XT8A 4NMYA 3FATA 4OANA 2DDKA 4QHQA 1D4NA 4F31B 2UVIA 4GF8A 4N6PA 4P8BA 4OA4A 4OZ9A 1LGBC 4ELRA 4IO2A 4N15A 3KSJA 1RYXA 2WBDA 1GGGA 1SPIA 1B7ZA 3SEVA 1ATGA 2NVUB 3MAMA 1FQFA 3MVWA 5I2NB 4OVJA 1IMEA 1N3XA 4PGPA 2ZYKA 3T9HB 4NF0A 2AL4A 4F3SA 3JYRA 5JEIA 3C35A 2Q8MA 3H6UA 2XWOA 4LATA 4Q0CA 3FBPA 1B9JA 4U22A 2OZZA 4QRZA 1JVXA 2QRYA 2F36A 3GXAA 3K2DA 3RT6B 4FAJA 3Q25A 4KI0E 5H8FA 4EF2A 1SQYA 1UTBA 3U94A 1YYZA 2P3NA 5HM4B 1A54A 2V3UA 1J1NA 2RC7A 4U4XA 1JETA 1MM6A 2X26A 4LZ5A 3T9UA 3ZKKA 1EZ9A 2XWIA 4HTGA 4GWOA 3MJNA 4OVSA 1ZMGA 2QS2A 2QPQA 4LZ8A 3TQLA 1EH3A 3TTKA 1FTAA 4RNSA 4GRKA 3LR1A 3OO6A 2WEFA 1I6QA 4MFIA 3IJXB 2R9JA 4I62A 4PCDA 1H3DA 3RPLB 5I84A 2NWJA 5F7VA 1QULA 4YKPA 3E3KA 4ZE9A 3ZS6A 5AA1A 3G3JA 4N91A 4E0XA 3SERA 1OLCA 2PX1A 3GBAA 5A5XB 3PMXA 2XXTA 3K02A 2UVJA 2XXUA 4PFIA 5KDTA 1JEVA 2XX9A 3IB0A 1MY4A 4ZE8A 5AA3A 1I6AA 4N6DA 4FIMA 1YAEA 2D21A 3MPLA 1SW2A 3C36A 4OVQA 2ZMBA 2LAOA 2RKMA 1YCJA 2DE4A 4ZEIA 2DS9A 1HSLA 4HS7A 2FHYA 2HCAA 1DPPA 1JW5A 1N0TA 4IY5A 2DOJA 5KCJB 5I57A 1B05A 5EQAA 4RY1A 2GQ1A 2F3BA 1ELJA 2Y5KA 1LAXA 1ZKBA 5K2XA 4LQ5A 3HPIA 4Z0IA 1Y9UA 2HHMA 3U65A 1I6BA 2O69A 2Z23A 1MXVA 1JP4A 5EHMA 2DQVA 2V4CA 4F39A 3JV9A 1Y1ZA 1JW1A 3KJ7A 2I49A 1FBDA 4ESWA 4PE5B 2O51A 3IOUA 3SESA 5ET7A 5TP9A 1D9QA 3SEYA 1BIYA 1FPIA 3MZBA 2HXWA 3KBRA 1M5FA 1PBPA 1AIVA 2HZKA 4OVPA 2B3FA 1CB6A 4G61A 3KN7A 3QYTA 4QSEA 4TQUQ 4MEVA 4OFOA 4R9FA 4N81A 4AB6A 1INPA 1D9YA 3A09A 3T93B 4BDLA 3UN6A 3ROJA 4GIZA 4R74A 1KA0A 1TXFA 2FIEA 3KOTA 4I3YA 2FIXA 3ONMA 4PF8A 3MVYA 4H65A 1Y20A 1XS5A 4Q30B 5EYFA 3OEMA 4PAFA 4XKRA 1N7WA 1XVYA 4NEDA 3KZGA 1NH8A 3LBSA 3PUZE 3TCFA 4U23A 4PAIA 4PFTA 3K6UA 4G8MA 2I4CA 2R8TA 1M5DA 1EU8A 3CSBA 3PUWE 4OXVA 1POTA 1H44A 1WVJA 3EPEA 4H46A 3PMVA 4HE1A 4XEQA 3OSRA 2MKZA 3PTYA 4WEPA 1NV1A 3PPNA 2R71A 4PGNA 3H6VA 1A40A 5F24A 3RPLA 1MXUA 4I8CA 1RKMA 2P2AA 1B0LA 3CFZA 3BIHA 5CI5A 1QJMA 3CVGA 5EYHA 5I59B 1SVXB 5DW8A 4XF5A 4HXVA 4FE8A 2GHAA 4KCDA 1NV0A 4LN5A 4P9KA 2NXOA 2YPNA 3QXMA 5AA2D 2O1MA 5LOMA 2XXPA 2XXXA 4YAHX 1NV7A 4ELOA 2I4BA 1NUYA 2XXRA 3IOWA 4P11A 2PFZA 2F34A 2I0CA 1NUXA 4DLDA 1LCTA 2V3TA 4DXBA 1URGA 2JJKA 2HQ0A 4PDDA 4QF9A 1UIVA 1B1HA 5KCJA 1OLAA 3FUZA 4ONYA 2HXRA 3FXUA 4MIJA 4H5GA 4TLLB 2KLFA 3TMGA 1DK4A 1Z7ME 4GWSA 5ICTA 3K01A 2VT5A 1JEUA 4GX3A 2DYXA 2A5TA 1QUJA 3CRBA 3R26A 4GQOA 4IO3A 4R6KA 2Q9TA 4U2RA 1EYIA 3VLVA 4OTEA 3TFLA 4IGRA 4KD5A 1FPDA 2ESNA 2NUVA 3FXRA 1ZU0A 4QFNA 3K1MA 1JW4A 1B40A 2PT1A 4LONB 2QJEA 3A3CA 5CMBA 2XXKA 2I3WA 4F29A 2XHDA 3QSLA 5H8FB 5ET6A 4GFRA 2WKYA 1NMUA 1UTBB 4MBPA 4YB5A 3TDJA 3S9NC 2OCUA 2PBWA 5AA2A 3VVDA 5M2VA 4P3LA 2CMOA 1B5JA 4THIA 1FTKA 1A7LA 1FSAA 2O1LA 5I5PA 3O6HA 4KQPA 2H5YA 5H8QA 5ITPA 2QVVA 3O28A 2M8CA 4R72A 1AOVA 3H03A 1MQDA 1R9LA 4PP0A 1AMFA 4DXCA 5CMKA 1RDZA 1LSTA 1FQEA 3T1BA 1PEBA 2GH9A 1LAHE 4HW8A 1LEVA 1N3WA 4NF8B 1R1NA 1B0HA 1WODA 4ECFA 4LZ7A 1B4ZA 1FPBA 1RDYA 2B4MA 3KN3A 4RJZA 1LBYA 5KDTB 1ZJLA 4OFLA 3C34A 4EQ7A 1PC3A 3B8BA 1Q9DA 2ZZWA 3U93A 4LVQA 1BLFA 4OEUA 2X7QA 2F6PA 3O2AA 2QL3A 1SYIA 1B7UA 5CBSA 1QUIA 3L6GA 3MP6A 2I0BA 1PB8A 4PF6A 4XFEA 2OBGA 4I3EA 3MVZA 4EF1A 5H8NA 1MXXA 3CIJA 1LBCA 3CSGA 1M5EA 1Y3NA 3VXCA 4GWZA 1FBGA 4DE8A 5I57B 4FEBA 1NUWA 2OLBA 1P1UA 2F6GA 3IL1B 1FW0A 3U1OA 1DPEA 1N04A 2HAVA 1VSOA 2REJA 1BP5A 2KQZA 1CE2A 4MF3A 3KFMA 3ILTB 4X1BA 2UVGA 3C31A 4X8RA 4LP2B 5TP9B 4G68A 4IB2A 2DE3A 5FHMA 3OMBA 2DWAA 4RK9A 3QK6A 3HHGA 4N8GA 3RNNA 3CFLA 4YB7A 4JVCA 1Z7NE 2QVUA 2ZZVA 3KC1A 3PUVE 1Y4CA 1FBEA 1R9QA 1A55A 4P0IA 3QUFA 4EDPA 5B70A 3FVOA 4NHBA 2XWVA 3K4UA 1G0IA 4PETA 4JWYA 4OVTA 4X9TA 5FBPA 4GWXA 1FJ6A 4R6HA 1MRPA 5TU0A 1VDWA 4GBWA 4LUBA 1USYE 3WAFA 2PMSA 2QSXA 1M5BA 2G29A 4U1OA 3Q28A 1B46A 4JSOA 1NI9A 1MPDA 5IAIA 4TOZA 2P1SA 1B51A 4Z7EA 2E1SA 3EHSA 2FYIA 1IMCA 2UXAA 1H45A 4GVOA 4FJPA 2HFBA 5LTCA 3G3FA 2O84X 4YICA 1N76A 3CG3A 4JWXA 1JQFA 3B6WA 4GXAA 4IGTA 1PB9A 1O64A 4MCOA 3PMWA 4X04A 5K2YA 3IB2A 2O68A 1IUDA 3PUYE 4MLVA 2ALUA 2F97A 2WYPA 1FBHA 2I3VA 4NF8A 4O7IA 3ISPA 1Y3PA 2VHAA 4P1EA 4YZZA 2XX7A 1B3LA 5H8SA 4JXIA 2PYYA 3P7IA 5CMCA 4BDOA 3L6HA 1LBZA 4BDMA 1OVBA 3MC2A 3M3FA 3GBBA 4N6KA 3EKIA 1SW1A 4TLMB 4NWCA 5ESYA 1NV2A 4IO4A 4O7MA 3IX1A 3IORA 3TTRA 4DI3D 2VD3A 3K0VA 5DEXA 2Y5LA 1UQWA 4PFWA 2R6GE 4GL8A 1NV4A 2VPNA 1SW5A 4AQ4A 4KYEA 5I56A 3MP1A 1YZ0A 1B1XA 4K3FA 2FBPA 3UORA 4P47A 4EQ9A 1FQAA 3BBRA 3KN8A 2A5TB 4U1ZA 1AWBA 2ABHA 4MNIA 3MPKA 4PFBA 3B6QA 1N84A 5BWJA 4MMPA 3F11A 1RDXA 3I6VA 4KPTA 4ZDMA 1IIWA 3HN0A 3D1RA 4H45A 4OWDA 3SZPA 4OEVA 3WAEA 4FEDA 3DP4A 1IMAA 1D3KA 4XKQA 3SETA 4GWYA 4O94A 1NKXA 3CI8A 4M4GA 4NTLA 5HPQA 3V83A 5FHOA 4AB5A 1LCFA 2P3VA 1JVYA 3EHUA 4MNPA 4KXPA 1URDA 3G3GA 5AA2B 4GWWA 2AYSA 4XIGQ 4JVIA 2XXIA 4BLAA 1TFAA 2QS4A 3MBPA 4GBVA 5H8QB 5JTYA 3T9VA 3HO7A 2F78A 1H76A 3N5LA 5I3SA 3U72A 3DLNA 4ISUA 3U8QA 2DVCA 5L9OA 2QMWA 3TODA 3PD9A 4PFYA 1KA1A 1MQGA 1MY3A 4KYDA 2RC9A 3SEXA 4ZZEA 5B7DA 3FJGA 2QVRA 3VLUA 5AA4A 4DI4B 1D9VA 3S9MC 4GX4A 1P1QA 1LB9A 2VP1A 2ZYMA 1B3EA 3BKIB 3UIFA 3RGYA 3AXFA 3G7WA 1IEJA 5EYGA 2AL5A 3K00A 2BJIA 3A29A 4FECA 1MQJA 4OFJA 4NX1A 4GL0A 2Y7RA 1MDP1 2I58A 2OK2A 1PDAA 2NOOA 4C1UA 1OIBA 2OWSA 1MG1A 3OELA 1FPLA 1MH4A 2G93A 3FVKA 1LBWA 2Q74A 3VE1B 1F9BA 4EUOA 4PDHA 3SDFA 3V89B 2I48A 1R6ZA 2B3BA 5H8NB 3BFUA 3E78A 4R2FA 4N8YA 1B52A 5DVJA 3O9PA 3T0JA 2ZNTA 5IM2A 3S2VA 1FQBA 3DELB 1FCKA 4N17A 5H8HA 2FVZA 1EYKA 2D5WA 1PB7A 5EQ8A 5ET5A 2KR0A 4HE2A 2DXRA 2XXQA 1LFGA 1B3FA 4F2OA 3OD7A 4G68B 4R75A 3SKPA 1MS7A 4NG7A 3RTWB 4PBQA 1VE4A 3TTLA 1DTGA 1CNQA 2DWJA 3B50A 4PTKA 2XWKA 4NWDA 1LB8A 2ZYNA 4OETA 1NNPA 1BK4A 3B7DA 2RCAA 5DYHA 2QS3A 4P56A 1A8FA 4G8HA 3ODBA 2CEXA 4WXJA 3O97A 1SW4A 3W9WA 1SI1A 1MH3A 3Q27A 4F18A 3OOAA 4EXLA 1NUZA 4OESA 1DOTA 3CR9A 3FD3A 3SEUA 1POY1 3C33A 1EZOA 4JVDA 2RF1A 3TELA 2Z8EA 4OENA 1USYH 4XKNA 3USDA 2FNCA 1DCUA 3V8XB 3VXBA 2IA4A 1QW0A 4PE3A 1HSEA 5EHSA 4LQ2A 3C32A 1IXGA 2GFEA 1SBPA 3G3KA 3HSTA 3DM0A 1OVTA 1GV8A 5EQ7A 3IOVA 3FJ7A 2XX8A 1FPGA 4XTCQ 2DXYA 4ELPA 3IO6A 2VGQA 3RY3A 3MSTA 3N94A 1GTKA 3W9VA 5KZTA 4JWOA 1FBPA 3S4UA 3O6IA 4DCXA 3UK4A 2O6AA 2V3QA 1Y3QA 2L5VA 5TPAA 4H6DA 1FPEA 2ZNUA 4PC9A 2ZZXA 4EXKA 1GR2A 3FVGA 3GZGA 3EN3A 3QMFA 3TTNA 3ZSFA 3Q26A 3QUJA 1TFDA 4H5FA 1SD3A 4H8JA 1GVCA 2OWZA 4F19A 3KSXA 4G77A 3MWBA 4O8MA 4MHFA 1IMBA 1Y4TA 4QSDA 4GD5A 2HAUA 3MZ1A 1LBXA 1NFTA 1A8EA 4R6YA 4IY6A 2Y7PA 3PPRA 3K1NA 4H0WA 4ZEKA 1EYJA 1DSNA 3FV1A 1LAFE 3BIGA 4OYVA 2V25A 4JDFA 3D4CA 2UYEA 2RCBA 2Q8JA 1MPCA 2O7UA 5AE4A 1B5IA 3LSWA 2Z8FA 3VV5A 3CHGA 4N07A 5CMMA 1FTOA 2CZKA 1S9TA 4UA8A 3LC8A 1FPFA 2X7PA 3TTMA 1PBQA 5DEXB 2UYFA 3RPWA 3U92A 2H25A 3E9XA 3RTFB 1FJ9A 2Y7KA 1UIUA 1AL3A 4M1VA 2RC8A 4R73A 4DXUA 3RYDA 4ZECA 5I56B 2D3IA 5I2KB 2RINA 2F8DA 3DP6A 5FHNA 3TZAA 3N6UA 4FATA 3EF7A 1L5TA 5IZ1A 4X48A 1MY0A 3IR1A 4GOTA 3FXQA 2E0SA 5DTBA 5IZ3A 5CRYA 1KWHA 4JSDA 3OO9A 2REGA 1VR5A 3HCQA 4ELQA 3OXNA 1VFEA 5JK4A 3RUMA 4IR8A 5J16A 1Y1MA 2OWTA 2ONSA 3FIRA 1QUKA 5I7IA 3KGCA 4JBZA 2ONKE 2ZXTA 1ZBMA 2Q89A 4RA1A 1S7YA 3KC0A 4NF6A 4KFQA 3TCHA 1US4A 1MQIA 5IKBA 2DWHA 2I6EA 1OQHA 3N6TA 1UTHA 3O66A 3D4GA 1LLSA 5J1DA 5F1QA 4KYSA 4NF5A 3OO8A 3MQ9A 1IMDA 5JTYB 5LDZA 1G0HA 3I5OA 1NL5A 3PGFA 3TEPA 1ANFA 3G3HA 4U4SA 4DZ1A 4LA9A 2OX3A 1XI6A 2FA7A 3MZ9A 4XXUA 5AA4B 3RLFE 5HBCA 3UGWA 5L8DA 1IXHA 3I3VA 4YKIA 1B6HA 3OO7A 2H9BA 4F3GA 3DP8A 1IITA 3S9EA 3E13X 3SEWA 3IFAA 3C4MA 2QFLA 2F7CA 2VOZA 1YXIA 4DDDA 2XXVA 3THIA
chains in the Genus database with same CATH topology
2HXRA 4MIJA 4JVIA 2CEYA 5IZZA 1DK4A 4GBVA 4GWSA 1K9YA 2VT5A 3FXBA 4GX3A 5I3SA 2Q9TA 1EYIA 1FPDA 4FBPA 1KA1A 1QGXA 4OANA 2DDKA 4QXDA 2QVRA 4HCWA 4DI4B 4GX4A 4P8BA 4OA4A 2XXKA 4N15A 5ET6A 5EYGA 2BJIA 3A29A 4MAGA 2WBDA 2HPGA 4NX1A 1SPIA 4P3LA 1NV6A 3IFCA 1FSAA 4NQ8A 1IMEA 5I5PA 4PGPA 1FPLA 4GX6A 1LBWA 2Q74A 2QVVA 4NF0A 4PDHA 4MX6A 3E78A 2Q8MA 2XWOA 1RDZA 4N8YA 3FBPA 5ET8A 3LV0A 2B4LA 3T1BA 1LEVA 3T0JA 1K9ZA 5IM2A 4NN3A 4N17A 1FPBA 2FVZA 1EYKA 1YYZA 2P3NA 5EQ8A 5ET5A 1RDYA 2B4MA 2KR0A 4HE2A 1FRPA 1LBYA 1KZ8A 2XWIA 4NG7A 4PBQA 4OVSA 3B8BA 1Q9DA 2ZZWA 1CNQA 2WX9A 2QPQA 4N4UA 3B50A 4PTKA 1FTAA 2XWKA 4PF6A 4XFEA 4I3EA 1BK4A 1DBZA 2WEFA 4P56A 2VPOA 4I40A 2CEXA 4GWZA 1FBGA 4PCDA 3W9WA 1NUWA 4F18A 3RPLB 1NUZA 2DVZA 4PBHA 4JVDA 4N91A 2KQZA 1DCUA 4MJOA 4PE3A 4X8RA 4GWUA 4PFIA 2DE2A 5EQ7A 4N6DA 2DE3A 1FPGA 4OVQA 4P1LA 4N8GA 3MSTA 2DE4A 3W9VA 2CZIA 1FBPA 5IGAA 4JVCA 2WYKA 2FHYA 2QVUA 2ZZVA 3KC1A 1IMFA 4QBAA 2V3QA 2L5VA 1FBEA 1FPEA 4PC9A 2ZZXA 5EQAA 1LBVA 4NHBA 2GQ1A 2XWVA 1G0IA 2F3BA 3QMFA 4PETA 2Y5KA 4OVTA 4X9TA 3KBZA 4MNCA 2HHMA 3U65A 5FBPA 2OWZA 1JP4A 4GWXA 4F19A 1FJ6A 3NOHA 1VDWA 3HFUA 4GBWA 4O8MA 4PAKA 2V4CA 4HE0A 4MHFA 1IMBA 4AS5A 1FPKA 1LBXA 1FBDA 3MYUA 5ET7A 1EYJA 1D9QA 1NI9A 1FPIA 2HZLA 3BIGA 5IZ3B 2HZKA 1IMCA 4OVPA 4NGUA 5LTCA 4G61A 4F1VA 4MEVA 4YICA 4N81A 3CHGA 1INPA 2CZKA 1FPFA 3ROJA 1KA0A 4MCOA 4X04A 2FIEA 4I3YA 4PFRA 2FIXA 4NAPA 1FJ9A 2F3DA 4PF8A 1FBCA 4HCYA 2WYPA 4M1VA 1FBHA 3RYDA 4O7IA 4PAFA 3ISPA 4P1EA 4YZZA 4UABA 5IZ1A 2CZHA 2F5XA 4PAIA 5IZ3A 2R8TA 1FPJA 1LBZA 5JK4A 4IR8A 5J16A 4H46A 5I7IA 2XA5A 4HE1A 4N6KA 4XEQA 3EKIA 2MKZA 5ESYA 1NV2A 3PTYA 2PFYA 3KC0A 4O7MA 1NV1A 4DI3D 4PGNA 2Y5LA 5F24A 3RPLA 1NV4A 1FBFA 2VPNA 5A5LA 3BIHA 5J1DA 5T3JA 1YZ0A 5EYHA 1IMDA 4AS4A 5LDZA 5DW8A 4XF5A 1G0HA 2FBPA 4P47A 4HXVA 1NV0A 4LN5A 5CM6A 1AWBA 4P9KA 4MNIA 4PFBA 4MMPA 1RDXA 2OX3A 1XI6A 5EQ9A 1NV7A 3LUZA 3D1RA 1NUYA 4H45A 3SZPA 1IMAA 2WBBA 1NV5A 2PFZA 3GYYA 1NV3A 3E79A 1NUXA 4GWYA 4O94A 2PCRA 2JJKA 4OVRA 4PDDA 2P3VA 3IFAA 4MNPA 4KXPA 2QFLA 4GWWA 1YXIA 4F1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IM2 A;  4NN3 A;  4MIJ A;  2ZZV A;  4PAI A;  2CEY A;  4N17 A;  4PC9 A;  2ZZX A;  5IZZ A;  3FXB A;  4NHB A;  2XWV A;  4PET A;  4OVT A;  4MNC A;  3U65 A;  2XWI A;  5I7I A;  2XA5 A;  4N6K A;  4NG7 A;  4XEQ A;  4PBQ A;  4OVS A;  4PAK A;  4O8M A;  2V4C A;  4MHF A;  2ZZW A;  2PFY A;  2WX9 A;  4O7M A;  4OAN A;  4N4U A;  3B50 A;  4DI3 D;  4PGN A;  2XWK A;  4DI4 B;  4PF6 A;  4XFE A;  4P8B A;  4OA4 A;  2HZL A;  4P56 A;  2XXK A;  2VPO A;  2VPN A;  2CEX A;  4N15 A;  4PCD A;  2HZK A;  4MAG A;  2HPG A;  4NX1 A;  4OVP A;  4NGU A;  4XF5 A;  4P47 A;  5LTC A;  4PBH A;  4MEV A;  4P3L A;  4LN5 A;  4YIC A;  5CM6 A;  4P9K A;  4N91 A;  4MNI A;  4PFB A;  4NQ8 A;  5I5P A;  4MMP A;  4PGP A;  4PE3 A;  4X8R A;  4MCO A;  4X04 A;  4NF0 A;  4PFI A;  4PDH A;  4PFR A;  2PFZ A;  4MX6 A;  4NAP A;  3GYY A;  4PF8 A;  2WYP A;  4O94 A;  2XWO A;  4N6D A;  4N8Y A;  4OVR A;  4OVQ A;  4PDD A;  4P1L A;  4PAF A;  4N8G A;  4P1E A;  4MNP A;  4YZZ A;  4UAB A;  5IGA A;  2WYK A; 
#chains in the Genus database with same CATH topology
 3K6W A;  2V93 A;  1DMB A;  4RK2 A;  3TAJ A;  5IZZ A;  2DWI A;  2A5S A;  4OQO A;  1B2H A;  3FXB A;  2XXW A;  4NF4 A;  2Y84 A;  1US5 A;  4KHZ E;  1ZTY A;  1NNT A;  5FTH A;  4POX A;  4FOR A;  1QGX A;  1N7X A;  4R9G A;  4I1D A;  3MVX A;  4QXD A;  2BJJ X;  3N26 A;  4HCW A;  1FTJ A;  2F7A A;  1MDQ A;  2P0S A;  1MQH A;  1O63 A;  2IEE A;  3PV0 E;  3M3L A;  5H8H B;  2Y7W A;  1B3G A;  1IXC A;  4MAG A;  4QFO A;  2HPG A;  3OSQ A;  2AIX A;  4I9D A;  2YLN A;  1P1W A;  3H4Z A;  4MLQ A;  2H4I A;  1II5 A;  4POW A;  1NV6 A;  3IFC A;  3H6T A;  1MPB A;  4NQ8 A;  1XC1 A;  2XD2 A;  3VVF A;  4GX6 A;  3VDF A;  4IO7 A;  4P0G A;  3T66 A;  4WED A;  5I2K A;  1A99 A;  3FGS A;  3RN8 A;  4F1Y A;  4MX6 A;  3MW0 A;  4KCC A;  3FJM A;  4JB7 A;  2HEU A;  4IO5 A;  4ZEB A;  1FQC A;  2QS1 A;  4GLI A;  3EHT A;  4F3B A;  2XXY A;  2ZYO A;  5ET8 A;  3LV0 A;  2B4L A;  1XVX A;  1ZIU A;  3Q29 A;  4C0R A;  1K9Z A;  4NN3 A;  1URS A;  4O3B A;  4YKK A;  4UAC A;  3ILU B;  1LBB A;  1FRP A;  1AH5 A;  1KZ8 A;  4YU0 A;  1P1N A;  2O7I A;  3R7X A;  4EQB A;  4U21 A;  3CG1 A;  4RXL A;  5I2N A;  2CZL A;  4NE4 A;  2WX9 A;  3K1P A;  4N4U A;  1DTZ A;  5L9M A;  3QAX A;  3KJT A;  5I58 B;  3H6W A;  2VD2 A;  3MP8 A;  3T22 A;  1IXI A;  1DBZ A;  4G68 C;  3V5A A;  2Q2C A;  1HSJ A;  4G4P A;  2VPO A;  4I40 A;  5TPA B;  3EQ1 A;  3O29 A;  4BDN A;  1NH7 A;  3R6U A;  4YKJ A;  3OEN A;  3W15 C;  3VVE A;  4ESX A;  1VFD A;  2DVZ A;  3G3I A;  4PBH A;  5BUU A;  1MXZ A;  1NNF A;  4G2Z A;  2B65 A;  2Q2A A;  4C1T A;  4G8N A;  1NNK A;  3H7M A;  4MJO A;  1MY1 A;  1JNF A;  3PPP A;  4GWU A;  1OMP A;  3FAS A;  2DE2 A;  4QFK A;  1MXY A;  4L17 A;  5CBR A;  2UVH A;  3PU5 A;  4YMB A;  3K6V A;  4RPN A;  1IZ1 A;  4P1L A;  2YJP A;  3ZKL A;  1QVS A;  1IQ7 A;  5DVI A;  2Z22 A;  2CZI A;  1BKA A;  1OQG A;  3TYH A;  5IGA A;  2WYK A;  1SI0 A;  1IMF A;  4QBA A;  4OHN A;  4BDR A;  3B6T A;  4ZS9 A;  3T96 B;  3TPA A;  1LBV A;  3PD8 A;  1WDN A;  2Q88 A;  3OEK A;  3VFJ A;  2PT2 A;  3IK6 B;  3KBZ A;  2ANJ A;  4MNC A;  4E0W A;  3NOH A;  4KR5 A;  3RQT A;  3HFU A;  4PAK A;  4RYA A;  4HE0 A;  4YB6 A;  4AS5 A;  1B5H A;  1FPK A;  3E4R A;  3LSX A;  5A5X A;  2H98 A;  1P99 A;  1XOC A;  1LAG E;  3HV1 A;  2DSF A;  3MYU A;  3PPQ A;  3KEI A;  2HZL A;  3TUS A;  2V84 A;  4Q5T A;  1YTV A;  5IZ3 B;  2ZNS A;  3T9X B;  1FTL A;  1FTM A;  4DCY A;  4NGU A;  3QIM A;  4F1V A;  4RPO A;  2QMX A;  1LFH A;  1S50 A;  2Y7I A;  1BTJ A;  2DP8 A;  1YPN A;  3IO4 A;  2XXH A;  4IO6 A;  3K6X A;  4NF6 B;  5ISU A;  1T0K A;  4PFU A;  3LSF B;  4PFR A;  1FQD A;  4OER A;  4NAP A;  2F3D A;  2PVU A;  1FBC A;  4HCY A;  1UTH B;  3IB1 A;  3LSL A;  4ZEF A;  1XHY A;  4NF5 B;  5L9S A;  1QKA A;  4DIG A;  4YMA A;  4QFL A;  3HHF A;  1QKB A;  5ITO A;  4UAB A;  1RYO A;  2GRV A;  2Z8D A;  2CZH A;  2F5X A;  4ZZA A;  2ONR A;  3TQW A;  1B4H A;  4BDQ A;  3ECR A;  5ELV A;  4WKM A;  5ICQ A;  1B32 A;  3M3K A;  1EZP A;  4H67 A;  3KOS A;  3RT8 A;  1FPJ A;  3PPO A;  2THI A;  4N13 A;  3FV2 A;  4Q8R A;  1B58 A;  4XKP A;  4F22 A;  5I58 A;  2XA5 A;  1O7T A;  1B3H A;  2PFY A;  2F7B A;  1B7H A;  1TT1 A;  5DVF A;  4R2B A;  3IOT A;  1ZLQ A;  2W7Y A;  1FBF A;  2H99 A;  1I69 A;  5A5L A;  4H1X A;  3VLW A;  1M5C A;  1LFI A;  1SYH A;  3H06 B;  5T3J A;  3C9H A;  4GXS B;  3GLB A;  4AS4 A;  5CC2 A;  4NF4 B;  3H3G A;  5CM6 A;  2OJT A;  1TWY A;  3CFX A;  3TCG A;  5EQ9 A;  3LUZ A;  1MM7 A;  3S9L C;  3M8U A;  1SDX A;  3LUY A;  2WBB A;  1NV5 A;  3JZJ A;  4F2Q A;  3GYY A;  3KG2 A;  1NV3 A;  4F3P A;  3E79 A;  3BFT A;  4PQJ A;  2PCR A;  4QFP A;  4OVR A;  2F35 A;  3IJO B;  2XD3 A;  1Q1K A;  4F1U A;  4ND9 A;  4MH5 A;  4O3C A;  4OMB A;  4ZED A;  4O3A A;  4QSC A;  2CEY A;  4H8I A;  1K9Y A;  1MY2 A;  5I59 A;  3O6G A;  1MXW A;  1H43 A;  3A3U A;  3IAZ A;  3PUX E;  3UP9 A;  1Q35 A;  4X1D A;  3UA8 A;  3MUQ A;  5FTI A;  3TKD A;  3FZV A;  3FVN A;  5DT6 A;  1P1O A;  2GHB A;  4FBP A;  1XT8 A;  4NMY A;  3FAT A;  4OAN A;  2DDK A;  4QHQ A;  1D4N A;  4F31 B;  2UVI A;  4GF8 A;  4N6P A;  4P8B A;  4OA4 A;  4OZ9 A;  1LGB C;  4ELR A;  4IO2 A;  4N15 A;  3KSJ A;  1RYX A;  2WBD A;  1GGG A;  1SPI A;  1B7Z A;  3SEV A;  1ATG A;  2NVU B;  3MAM A;  1FQF A;  3MVW A;  5I2N B;  4OVJ A;  1IME A;  1N3X A;  4PGP A;  2ZYK A;  3T9H B;  4NF0 A;  2AL4 A;  4F3S A;  3JYR A;  5JEI A;  3C35 A;  2Q8M A;  3H6U A;  2XWO A;  4LAT A;  4Q0C A;  3FBP A;  1B9J A;  4U22 A;  2OZZ A;  4QRZ A;  1JVX A;  2QRY A;  2F36 A;  3GXA A;  3K2D A;  3RT6 B;  4FAJ A;  3Q25 A;  4KI0 E;  5H8F A;  4EF2 A;  1SQY A;  1UTB A;  3U94 A;  1YYZ A;  2P3N A;  5HM4 B;  1A54 A;  2V3U A;  1J1N A;  2RC7 A;  4U4X A;  1JET A;  1MM6 A;  2X26 A;  4LZ5 A;  3T9U A;  3ZKK A;  1EZ9 A;  2XWI A;  4HTG A;  4GWO A;  3MJN A;  4OVS A;  1ZMG A;  2QS2 A;  2QPQ A;  4LZ8 A;  3TQL A;  1EH3 A;  3TTK A;  1FTA A;  4RNS A;  4GRK A;  3LR1 A;  3OO6 A;  2WEF A;  1I6Q A;  4MFI A;  3IJX B;  2R9J A;  4I62 A;  4PCD A;  1H3D A;  3RPL B;  5I84 A;  2NWJ A;  5F7V A;  1QUL A;  4YKP A;  3E3K A;  4ZE9 A;  3ZS6 A;  5AA1 A;  3G3J A;  4N91 A;  4E0X A;  3SER A;  1OLC A;  2PX1 A;  3GBA A;  5A5X B;  3PMX A;  2XXT A;  3K02 A;  2UVJ A;  2XXU A;  4PFI A;  5KDT A;  1JEV A;  2XX9 A;  3IB0 A;  1MY4 A;  4ZE8 A;  5AA3 A;  1I6A A;  4N6D A;  4FIM A;  1YAE A;  2D21 A;  3MPL A;  1SW2 A;  3C36 A;  4OVQ A;  2ZMB A;  2LAO A;  2RKM A;  1YCJ A;  2DE4 A;  4ZEI A;  2DS9 A;  1HSL A;  4HS7 A;  2FHY A;  2HCA A;  1DPP A;  1JW5 A;  1N0T A;  4IY5 A;  2DOJ A;  5KCJ B;  5I57 A;  1B05 A;  5EQA A;  4RY1 A;  2GQ1 A;  2F3B A;  1ELJ A;  2Y5K A;  1LAX A;  1ZKB A;  5K2X A;  4LQ5 A;  3HPI A;  4Z0I A;  1Y9U A;  2HHM A;  3U65 A;  1I6B A;  2O69 A;  2Z23 A;  1MXV A;  1JP4 A;  5EHM A;  2DQV A;  2V4C A;  4F39 A;  3JV9 A;  1Y1Z A;  1JW1 A;  3KJ7 A;  2I49 A;  1FBD A;  4ESW A;  4PE5 B;  2O51 A;  3IOU A;  3SES A;  5ET7 A;  5TP9 A;  1D9Q A;  3SEY A;  1BIY A;  1FPI A;  3MZB A;  2HXW A;  3KBR A;  1M5F A;  1PBP A;  1AIV A;  2HZK A;  4OVP A;  2B3F A;  1CB6 A;  4G61 A;  3KN7 A;  3QYT A;  4QSE A;  4TQU Q;  4MEV A;  4OFO A;  4R9F A;  4N81 A;  4AB6 A;  1INP A;  1D9Y A;  3A09 A;  3T93 B;  4BDL A;  3UN6 A;  3ROJ A;  4GIZ A;  4R74 A;  1KA0 A;  1TXF A;  2FIE A;  3KOT A;  4I3Y A;  2FIX A;  3ONM A;  4PF8 A;  3MVY A;  4H65 A;  1Y20 A;  1XS5 A;  4Q30 B;  5EYF A;  3OEM A;  4PAF A;  4XKR A;  1N7W A;  1XVY A;  4NED A;  3KZG A;  1NH8 A;  3LBS A;  3PUZ E;  3TCF A;  4U23 A;  4PAI A;  4PFT A;  3K6U A;  4G8M A;  2I4C A;  2R8T A;  1M5D A;  1EU8 A;  3CSB A;  3PUW E;  4OXV A;  1POT A;  1H44 A;  1WVJ A;  3EPE A;  4H46 A;  3PMV A;  4HE1 A;  4XEQ A;  3OSR A;  2MKZ A;  3PTY A;  4WEP A;  1NV1 A;  3PPN A;  2R71 A;  4PGN A;  3H6V A;  1A40 A;  5F24 A;  3RPL A;  1MXU A;  4I8C A;  1RKM A;  2P2A A;  1B0L A;  3CFZ A;  3BIH A;  5CI5 A;  1QJM A;  3CVG A;  5EYH A;  5I59 B;  1SVX B;  5DW8 A;  4XF5 A;  4HXV A;  4FE8 A;  2GHA A;  4KCD A;  1NV0 A;  4LN5 A;  4P9K A;  2NXO A;  2YPN A;  3QXM A;  5AA2 D;  2O1M A;  5LOM A;  2XXP A;  2XXX A;  4YAH X;  1NV7 A;  4ELO A;  2I4B A;  1NUY A;  2XXR A;  3IOW A;  4P11 A;  2PFZ A;  2F34 A;  2I0C A;  1NUX A;  4DLD A;  1LCT A;  2V3T A;  4DXB A;  1URG A;  2JJK A;  2HQ0 A;  4PDD A;  4QF9 A;  1UIV A;  1B1H A;  5KCJ A;  1OLA A;  3FUZ A;  4ONY A;  2HXR A;  3FXU A;  4MIJ A;  4H5G A;  4TLL B;  2KLF A;  3TMG A;  1DK4 A;  1Z7M E;  4GWS A;  5ICT A;  3K01 A;  2VT5 A;  1JEU A;  4GX3 A;  2DYX A;  2A5T A;  1QUJ A;  3CRB A;  3R26 A;  4GQO A;  4IO3 A;  4R6K A;  2Q9T A;  4U2R A;  1EYI A;  3VLV A;  4OTE A;  3TFL A;  4IGR A;  4KD5 A;  1FPD A;  2ESN A;  2NUV A;  3FXR A;  1ZU0 A;  4QFN A;  3K1M A;  1JW4 A;  1B40 A;  2PT1 A;  4LON B;  2QJE A;  3A3C A;  5CMB A;  2XXK A;  2I3W A;  4F29 A;  2XHD A;  3QSL A;  5H8F B;  5ET6 A;  4GFR A;  2WKY A;  1NMU A;  1UTB B;  4MBP A;  4YB5 A;  3TDJ A;  3S9N C;  2OCU A;  2PBW A;  5AA2 A;  3VVD A;  5M2V A;  4P3L A;  2CMO A;  1B5J A;  4THI A;  1FTK A;  1A7L A;  1FSA A;  2O1L A;  5I5P A;  3O6H A;  4KQP A;  2H5Y A;  5H8Q A;  5ITP A;  2QVV A;  3O28 A;  2M8C A;  4R72 A;  1AOV A;  3H03 A;  1MQD A;  1R9L A;  4PP0 A;  1AMF A;  4DXC A;  5CMK A;  1RDZ A;  1LST A;  1FQE A;  3T1B A;  1PEB A;  2GH9 A;  1LAH E;  4HW8 A;  1LEV A;  1N3W A;  4NF8 B;  1R1N A;  1B0H A;  1WOD A;  4ECF A;  4LZ7 A;  1B4Z A;  1FPB A;  1RDY A;  2B4M A;  3KN3 A;  4RJZ A;  1LBY A;  5KDT B;  1ZJL A;  4OFL A;  3C34 A;  4EQ7 A;  1PC3 A;  3B8B A;  1Q9D A;  2ZZW A;  3U93 A;  4LVQ A;  1BLF A;  4OEU A;  2X7Q A;  2F6P A;  3O2A A;  2QL3 A;  1SYI A;  1B7U A;  5CBS A;  1QUI A;  3L6G A;  3MP6 A;  2I0B A;  1PB8 A;  4PF6 A;  4XFE A;  2OBG A;  4I3E A;  3MVZ A;  4EF1 A;  5H8N A;  1MXX A;  3CIJ A;  1LBC A;  3CSG A;  1M5E A;  1Y3N A;  3VXC A;  4GWZ A;  1FBG A;  4DE8 A;  5I57 B;  4FEB A;  1NUW A;  2OLB A;  1P1U A;  2F6G A;  3IL1 B;  1FW0 A;  3U1O A;  1DPE A;  1N04 A;  2HAV A;  1VSO A;  2REJ A;  1BP5 A;  2KQZ A;  1CE2 A;  4MF3 A;  3KFM A;  3ILT B;  4X1B A;  2UVG A;  3C31 A;  4X8R A;  4LP2 B;  5TP9 B;  4G68 A;  4IB2 A;  2DE3 A;  5FHM A;  3OMB A;  2DWA A;  4RK9 A;  3QK6 A;  3HHG A;  4N8G A;  3RNN A;  3CFL A;  4YB7 A;  4JVC A;  1Z7N E;  2QVU A;  2ZZV A;  3KC1 A;  3PUV E;  1Y4C A;  1FBE A;  1R9Q A;  1A55 A;  4P0I A;  3QUF A;  4EDP A;  5B70 A;  3FVO A;  4NHB A;  2XWV A;  3K4U A;  1G0I A;  4PET A;  4JWY A;  4OVT A;  4X9T A;  5FBP A;  4GWX A;  1FJ6 A;  4R6H A;  1MRP A;  5TU0 A;  1VDW A;  4GBW A;  4LUB A;  1USY E;  3WAF A;  2PMS A;  2QSX A;  1M5B A;  2G29 A;  4U1O A;  3Q28 A;  1B46 A;  4JSO A;  1NI9 A;  1MPD A;  5IAI A;  4TOZ A;  2P1S A;  1B51 A;  4Z7E A;  2E1S A;  3EHS A;  2FYI A;  1IMC A;  2UXA A;  1H45 A;  4GVO A;  4FJP A;  2HFB A;  5LTC A;  3G3F A;  2O84 X;  4YIC A;  1N76 A;  3CG3 A;  4JWX A;  1JQF A;  3B6W A;  4GXA A;  4IGT A;  1PB9 A;  1O64 A;  4MCO A;  3PMW A;  4X04 A;  5K2Y A;  3IB2 A;  2O68 A;  1IUD A;  3PUY E;  4MLV A;  2ALU A;  2F97 A;  2WYP A;  1FBH A;  2I3V A;  4NF8 A;  4O7I A;  3ISP A;  1Y3P A;  2VHA A;  4P1E A;  4YZZ A;  2XX7 A;  1B3L A;  5H8S A;  4JXI A;  2PYY A;  3P7I A;  5CMC A;  4BDO A;  3L6H A;  1LBZ A;  4BDM A;  1OVB A;  3MC2 A;  3M3F A;  3GBB A;  4N6K A;  3EKI A;  1SW1 A;  4TLM B;  4NWC A;  5ESY A;  1NV2 A;  4IO4 A;  4O7M A;  3IX1 A;  3IOR A;  3TTR A;  4DI3 D;  2VD3 A;  3K0V A;  5DEX A;  2Y5L A;  1UQW A;  4PFW A;  2R6G E;  4GL8 A;  1NV4 A;  2VPN A;  1SW5 A;  4AQ4 A;  4KYE A;  5I56 A;  3MP1 A;  1YZ0 A;  1B1X A;  4K3F A;  2FBP A;  3UOR A;  4P47 A;  4EQ9 A;  1FQA A;  3BBR A;  3KN8 A;  2A5T B;  4U1Z A;  1AWB A;  2ABH A;  4MNI A;  3MPK A;  4PFB A;  3B6Q A;  1N84 A;  5BWJ A;  4MMP A;  3F11 A;  1RDX A;  3I6V A;  4KPT A;  4ZDM A;  1IIW A;  3HN0 A;  3D1R A;  4H45 A;  4OWD A;  3SZP A;  4OEV A;  3WAE A;  4FED A;  3DP4 A;  1IMA A;  1D3K A;  4XKQ A;  3SET A;  4GWY A;  4O94 A;  1NKX A;  3CI8 A;  4M4G A;  4NTL A;  5HPQ A;  3V83 A;  5FHO A;  4AB5 A;  1LCF A;  2P3V A;  1JVY A;  3EHU A;  4MNP A;  4KXP A;  1URD A;  3G3G A;  5AA2 B;  4GWW A;  2AYS A;  4XIG Q;  4JVI A;  2XXI A;  4BLA A;  1TFA A;  2QS4 A;  3MBP A;  4GBV A;  5H8Q B;  5JTY A;  3T9V A;  3HO7 A;  2F78 A;  1H76 A;  3N5L A;  5I3S A;  3U72 A;  3DLN A;  4ISU A;  3U8Q A;  2DVC A;  5L9O A;  2QMW A;  3TOD A;  3PD9 A;  4PFY A;  1KA1 A;  1MQG A;  1MY3 A;  4KYD A;  2RC9 A;  3SEX A;  4ZZE A;  5B7D A;  3FJG A;  2QVR A;  3VLU A;  5AA4 A;  4DI4 B;  1D9V A;  3S9M C;  4GX4 A;  1P1Q A;  1LB9 A;  2VP1 A;  2ZYM A;  1B3E A;  3BKI B;  3UIF A;  3RGY A;  3AXF A;  3G7W A;  1IEJ A;  5EYG A;  2AL5 A;  3K00 A;  2BJI A;  3A29 A;  4FEC A;  1MQJ A;  4OFJ A;  4NX1 A;  4GL0 A;  2Y7R A;  1MDP 1;  2I58 A;  2OK2 A;  1PDA A;  2NOO A;  4C1U A;  1OIB A;  2OWS A;  1MG1 A;  3OEL A;  1FPL A;  1MH4 A;  2G93 A;  3FVK A;  1LBW A;  2Q74 A;  3VE1 B;  1F9B A;  4EUO A;  4PDH A;  3SDF A;  3V89 B;  2I48 A;  1R6Z A;  2B3B A;  5H8N B;  3BFU A;  3E78 A;  4R2F A;  4N8Y A;  1B52 A;  5DVJ A;  3O9P A;  3T0J A;  2ZNT A;  5IM2 A;  3S2V A;  1FQB A;  3DEL B;  1FCK A;  4N17 A;  5H8H A;  2FVZ A;  1EYK A;  2D5W A;  1PB7 A;  5EQ8 A;  5ET5 A;  2KR0 A;  4HE2 A;  2DXR A;  2XXQ A;  1LFG A;  1B3F A;  4F2O A;  3OD7 A;  4G68 B;  4R75 A;  3SKP A;  1MS7 A;  4NG7 A;  3RTW B;  4PBQ A;  1VE4 A;  3TTL A;  1DTG A;  1CNQ A;  2DWJ A;  3B50 A;  4PTK A;  2XWK A;  4NWD A;  1LB8 A;  2ZYN A;  4OET A;  1NNP A;  1BK4 A;  3B7D A;  2RCA A;  5DYH A;  2QS3 A;  4P56 A;  1A8F A;  4G8H A;  3ODB A;  2CEX A;  4WXJ A;  3O97 A;  1SW4 A;  3W9W A;  1SI1 A;  1MH3 A;  3Q27 A;  4F18 A;  3OOA A;  4EXL A;  1NUZ A;  4OES A;  1DOT A;  3CR9 A;  3FD3 A;  3SEU A;  1POY 1;  3C33 A;  1EZO A;  4JVD A;  2RF1 A;  3TEL A;  2Z8E A;  4OEN A;  1USY H;  4XKN A;  3USD A;  2FNC A;  1DCU A;  3V8X B;  3VXB A;  2IA4 A;  1QW0 A;  4PE3 A;  1HSE A;  5EHS A;  4LQ2 A;  3C32 A;  1IXG A;  2GFE A;  1SBP A;  3G3K A;  3HST A;  3DM0 A;  1OVT A;  1GV8 A;  5EQ7 A;  3IOV A;  3FJ7 A;  2XX8 A;  1FPG A;  4XTC Q;  2DXY A;  4ELP A;  3IO6 A;  2VGQ A;  3RY3 A;  3MST A;  3N94 A;  1GTK A;  3W9V A;  5KZT A;  4JWO A;  1FBP A;  3S4U A;  3O6I A;  4DCX A;  3UK4 A;  2O6A A;  2V3Q A;  1Y3Q A;  2L5V A;  5TPA A;  4H6D A;  1FPE A;  2ZNU A;  4PC9 A;  2ZZX A;  4EXK A;  1GR2 A;  3FVG A;  3GZG A;  3EN3 A;  3QMF A;  3TTN A;  3ZSF A;  3Q26 A;  3QUJ A;  1TFD A;  4H5F A;  1SD3 A;  4H8J A;  1GVC A;  2OWZ A;  4F19 A;  3KSX A;  4G77 A;  3MWB A;  4O8M A;  4MHF A;  1IMB A;  1Y4T A;  4QSD A;  4GD5 A;  2HAU A;  3MZ1 A;  1LBX A;  1NFT A;  1A8E A;  4R6Y A;  4IY6 A;  2Y7P A;  3PPR A;  3K1N A;  4H0W A;  4ZEK A;  1EYJ A;  1DSN A;  3FV1 A;  1LAF E;  3BIG A;  4OYV A;  2V25 A;  4JDF A;  3D4C A;  2UYE A;  2RCB A;  2Q8J A;  1MPC A;  2O7U A;  5AE4 A;  1B5I A;  3LSW A;  2Z8F A;  3VV5 A;  3CHG A;  4N07 A;  5CMM A;  1FTO A;  2CZK A;  1S9T A;  4UA8 A;  3LC8 A;  1FPF A;  2X7P A;  3TTM A;  1PBQ A;  5DEX B;  2UYF A;  3RPW A;  3U92 A;  2H25 A;  3E9X A;  3RTF B;  1FJ9 A;  2Y7K A;  1UIU A;  1AL3 A;  4M1V A;  2RC8 A;  4R73 A;  4DXU A;  3RYD A;  4ZEC A;  5I56 B;  2D3I A;  5I2K B;  2RIN A;  2F8D A;  3DP6 A;  5FHN A;  3TZA A;  3N6U A;  4FAT A;  3EF7 A;  1L5T A;  5IZ1 A;  4X48 A;  1MY0 A;  3IR1 A;  4GOT A;  3FXQ A;  2E0S A;  5DTB A;  5IZ3 A;  5CRY A;  1KWH A;  4JSD A;  3OO9 A;  2REG A;  1VR5 A;  3HCQ A;  4ELQ A;  3OXN A;  1VFE A;  5JK4 A;  3RUM A;  4IR8 A;  5J16 A;  1Y1M A;  2OWT A;  2ONS A;  3FIR A;  1QUK A;  5I7I A;  3KGC A;  4JBZ A;  2ONK E;  2ZXT A;  1ZBM A;  2Q89 A;  4RA1 A;  1S7Y A;  3KC0 A;  4NF6 A;  4KFQ A;  3TCH A;  1US4 A;  1MQI A;  5IKB A;  2DWH A;  2I6E A;  1OQH A;  3N6T A;  1UTH A;  3O66 A;  3D4G A;  1LLS A;  5J1D A;  5F1Q A;  4KYS A;  4NF5 A;  3OO8 A;  3MQ9 A;  1IMD A;  5JTY B;  5LDZ A;  1G0H A;  3I5O A;  1NL5 A;  3PGF A;  3TEP A;  1ANF A;  3G3H A;  4U4S A;  4DZ1 A;  4LA9 A;  2OX3 A;  1XI6 A;  2FA7 A;  3MZ9 A;  4XXU A;  5AA4 B;  3RLF E;  5HBC A;  3UGW A;  5L8D A;  1IXH A;  3I3V A;  4YKI A;  1B6H A;  3OO7 A;  2H9B A;  4F3G A;  3DP8 A;  1IIT A;  3S9E A;  3E13 X;  3SEW A;  3IFA A;  3C4M A;  2QFL A;  2F7C A;  2VOZ A;  1YXI A;  4DDD A;  2XXV A;  3THI A; 
#chains in the Genus database with same CATH homology
 2HXR A;  4MIJ A;  4JVI A;  2CEY A;  5IZZ A;  1DK4 A;  4GBV A;  4GWS A;  1K9Y A;  2VT5 A;  3FXB A;  4GX3 A;  5I3S A;  2Q9T A;  1EYI A;  1FPD A;  4FBP A;  1KA1 A;  1QGX A;  4OAN A;  2DDK A;  4QXD A;  2QVR A;  4HCW A;  4DI4 B;  4GX4 A;  4P8B A;  4OA4 A;  2XXK A;  4N15 A;  5ET6 A;  5EYG A;  2BJI A;  3A29 A;  4MAG A;  2WBD A;  2HPG A;  4NX1 A;  1SPI A;  4P3L A;  1NV6 A;  3IFC A;  1FSA A;  4NQ8 A;  1IME A;  5I5P A;  4PGP A;  1FPL A;  4GX6 A;  1LBW A;  2Q74 A;  2QVV A;  4NF0 A;  4PDH A;  4MX6 A;  3E78 A;  2Q8M A;  2XWO A;  1RDZ A;  4N8Y A;  3FBP A;  5ET8 A;  3LV0 A;  2B4L A;  3T1B A;  1LEV A;  3T0J A;  1K9Z A;  5IM2 A;  4NN3 A;  4N17 A;  1FPB A;  2FVZ A;  1EYK A;  1YYZ A;  2P3N A;  5EQ8 A;  5ET5 A;  1RDY A;  2B4M A;  2KR0 A;  4HE2 A;  1FRP A;  1LBY A;  1KZ8 A;  2XWI A;  4NG7 A;  4PBQ A;  4OVS A;  3B8B A;  1Q9D A;  2ZZW A;  1CNQ A;  2WX9 A;  2QPQ A;  4N4U A;  3B50 A;  4PTK A;  1FTA A;  2XWK A;  4PF6 A;  4XFE A;  4I3E A;  1BK4 A;  1DBZ A;  2WEF A;  4P56 A;  2VPO A;  4I40 A;  2CEX A;  4GWZ A;  1FBG A;  4PCD A;  3W9W A;  1NUW A;  4F18 A;  3RPL B;  1NUZ A;  2DVZ A;  4PBH A;  4JVD A;  4N91 A;  2KQZ A;  1DCU A;  4MJO A;  4PE3 A;  4X8R A;  4GWU A;  4PFI A;  2DE2 A;  5EQ7 A;  4N6D A;  2DE3 A;  1FPG A;  4OVQ A;  4P1L A;  4N8G A;  3MST A;  2DE4 A;  3W9V A;  2CZI A;  1FBP A;  5IGA A;  4JVC A;  2WYK A;  2FHY A;  2QVU A;  2ZZV A;  3KC1 A;  1IMF A;  4QBA A;  2V3Q A;  2L5V A;  1FBE A;  1FPE A;  4PC9 A;  2ZZX A;  5EQA A;  1LBV A;  4NHB A;  2GQ1 A;  2XWV A;  1G0I A;  2F3B A;  3QMF A;  4PET A;  2Y5K A;  4OVT A;  4X9T A;  3KBZ A;  4MNC A;  2HHM A;  3U65 A;  5FBP A;  2OWZ A;  1JP4 A;  4GWX A;  4F19 A;  1FJ6 A;  3NOH A;  1VDW A;  3HFU A;  4GBW A;  4O8M A;  4PAK A;  2V4C A;  4HE0 A;  4MHF A;  1IMB A;  4AS5 A;  1FPK A;  1LBX A;  1FBD A;  3MYU A;  5ET7 A;  1EYJ A;  1D9Q A;  1NI9 A;  1FPI A;  2HZL A;  3BIG A;  5IZ3 B;  2HZK A;  1IMC A;  4OVP A;  4NGU A;  5LTC A;  4G61 A;  4F1V A;  4MEV A;  4YIC A;  4N81 A;  3CHG A;  1INP A;  2CZK A;  1FPF A;  3ROJ A;  1KA0 A;  4MCO A;  4X04 A;  2FIE A;  4I3Y A;  4PFR A;  2FIX A;  4NAP A;  1FJ9 A;  2F3D A;  4PF8 A;  1FBC A;  4HCY A;  2WYP A;  4M1V A;  1FBH A;  3RYD A;  4O7I A;  4PAF A;  3ISP A;  4P1E A;  4YZZ A;  4UAB A;  5IZ1 A;  2CZH A;  2F5X A;  4PAI A;  5IZ3 A;  2R8T A;  1FPJ A;  1LBZ A;  5JK4 A;  4IR8 A;  5J16 A;  4H46 A;  5I7I A;  2XA5 A;  4HE1 A;  4N6K A;  4XEQ A;  3EKI A;  2MKZ A;  5ESY A;  1NV2 A;  3PTY A;  2PFY A;  3KC0 A;  4O7M A;  1NV1 A;  4DI3 D;  4PGN A;  2Y5L A;  5F24 A;  3RPL A;  1NV4 A;  1FBF A;  2VPN A;  5A5L A;  3BIH A;  5J1D A;  5T3J A;  1YZ0 A;  5EYH A;  1IMD A;  4AS4 A;  5LDZ A;  5DW8 A;  4XF5 A;  1G0H A;  2FBP A;  4P47 A;  4HXV A;  1NV0 A;  4LN5 A;  5CM6 A;  1AWB A;  4P9K A;  4MNI A;  4PFB A;  4MMP A;  1RDX A;  2OX3 A;  1XI6 A;  5EQ9 A;  1NV7 A;  3LUZ A;  3D1R A;  1NUY A;  4H45 A;  3SZP A;  1IMA A;  2WBB A;  1NV5 A;  2PFZ A;  3GYY A;  1NV3 A;  3E79 A;  1NUX A;  4GWY A;  4O94 A;  2PCR A;  2JJK A;  4OVR A;  4PDD A;  2P3V A;  3IFA A;  4MNP A;  4KXP A;  2QFL A;  4GWW A;  1YXI A;  4F1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...