4MMPA

Structure of sialic acid binding protein from pasturella multocida
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
308
structure length
308
Chain Sequence
b'GADYDLKFGMVAGPSSNEYKAVEFFAKEVKEKSNGKIDVAIFPSSQLGDDRVMIKQLKDGALDFTLGESARFQIYFPEAEVFALPYMIPNFETSKKALLDTKFGQGLLKKIDKELNVQVLSVAYNGTRQTTSNRAINSIEDMKGLKLRVPNAATNLAYAKYVGAAPTPMAFSEVYLALQTNSVDGQENPLPTIQAQKFYEVQKYLALTNHILNDQLYLISNDTLADLPEDLQKVVKDAAAKAAEYHTKLFVDGENSLVEFFKSQGVTVTQPDLKPFKAALTPYYDEYLKKNGEVGKMAIEEISNLAKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sialic Acid Binding Protein
publication title Bacterial periplasmic sialic acid-binding proteins exhibit a conserved binding site.
pubmed doi rcsb
source organism Pasteurella multocida subsp. gallicida p1059
molecule tags Sugar binding protein
total genus 121
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2013-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mmpA00
4P8BA 4P3LA 4MX6A 5I5PA 4N8GA 2VPOA 2V4CA 4DI3D 4PAIA 2CEYA 2WX9A 4MAGA 4X04A 4OVRA 2XXKA 3GYYA 5IGAA 4MMPA 4PF6A 2ZZWA 4NN3A 4N6DA 4PAFA 2CEXA 2HZLA 4PBQA 4PFBA 2XWOA 4N4UA 4OVPA 4PFRA 4N6KA 4NHBA 4UABA 4NGUA 4OVTA 4NF0A 4MNPA 4XEQA 4LN5A 4OVSA 4YICA 2XWKA 4PGNA 4MCOA 5CM6A 4XFEA 4P9KA 4PGPA 4NQ8A 4X8RA 4MHFA 4PF8A 4PE3A 4PDHA 4P1LA 4YZZA 3U65A 2PFYA 4MEVA 4PCDA 5IZZA 4O94A 4DI4B 3FXBA 4O8MA 4O7MA 4N91A 4NX1A 4PETA 4OANA 4NAPA 2HPGA 4OVQA 4PBHA 4MIJA 4P1EA 4MNIA 4PAKA 2ZZXA 4PDDA 4N17A 4OA4A 4P56A 2XWVA 2WYPA 2ZZVA 4PC9A 2HZKA 2XA5A 4XF5A 4P47A 2PFZA 4N15A 2XWIA 4NG7A 2VPNA 4N8YA 4MNCA 5IM2A 3B50A 5LTCA 5I7IA 2WYKA 4PFIA
chains in the Genus database with same CATH superfamily
2D5WA 4IR8A 2D3IA 4R6HA 3N6TA 3U1OA 1P1OA 3UA8A 1IXIA 1A7LA 2QPQA 3G3GA 3FVKA 3MZBA 5B70A 2PX1A 2RC9A 4KI0E 2GRVA 3OO8A 4LA9A 4MMPA 5L9SA 4FJPA 4PAFA 4OERA 2Q8MA 2I0CA 3C36A 4X9TA 1NUZA 5H8HA 2QRYA 4G8MA 3QMFA 4GF8A 2O1LA 3I5OA 4MNPA 1RKMA 4NF6B 4IO2A 1LAHE 3DP8A 2WKYA 1FTJA 1FTAA 1SQYA 3HCQA 2A5TB 2G29A 4GVOA 2QSXA 4OWDA 4KR5A 5KDTB 2F7BA 5DTBA 4OANA 4GX4A 3PGFA 1UTHB 4I3EA 2Y7KA 3PUVE 3N5LA 2DWHA 2DVCA 3HFUA 1IITA 1DMBA 2WYPA 3OO7A 1IIWA 4H8JA 4ZS9A 2OX3A 4XF5A 2ZYMA 1ELJA 1XHYA 1B5JA 2WBBA 3MVWA 4WEPA 4GD5A 1R9QA 1LFHA 4H65A 2Q8JA 1EZPA 2UVJA 4ND9A 2YLNA 2B4LA 1NUXA 3CG3A 1BIYA 4HTGA 1YPNA 2ZZWA 2RC8A 3CR9A 4IO6A 4ZEDA 2CZLA 3TFLA 1FBFA 4QBAA 4ZE8A 4F1VA 4GRKA 3H6UA 3FXQA 1EYIA 1VE4A 4OFJA 4UABA 3MVXA 3O6IA 5JK4A 4BDLA 1NNFA 3N26A 3VLUA 1P99A 4PFYA 2H99A 4P0GA 2OCUA 1A40A 4DZ1A 3RPWA 4PGNA 5DEXA 2V84A 4GBWA 4P9KA 4NQ8A 2DXRA 5TPAB 1D4NA 1MY1A 5F7VA 2RKMA 3MW0A 5DT6A 3IJXB 3USDA 4AS5A 5IZZA 3H6VA 3KSXA 1FPBA 4QHQA 1NMUA 3CI8A 2A5SA 3CSBA 4OTEA 4K3FA 4F3PA 1TWYA 1S7YA 4R9FA 4H5GA 1AH5A 4WXJA 4ZEFA 4I3YA 3HV1A 4KFQA 3KG2A 1WVJA 4WEDA 3KZGA 4G4PA 1VFDA 1MXYA 3DM0A 1D9QA 1AIVA 3VXBA 3QAXA 2H4IA 4P8BA 1EYKA 4GXAA 3TPAA 4QSDA 1URSA 5F1QA 1SI0A 4PQJA 1MQGA 3R6UA 2Z8FA 3C34A 2RC7A 4YB7A 5KCJA 4LZ8A 4GL0A 3MBPA 2DE4A 4GOTA 5CMBA 1GV8A 3WAEA 4JXIA 1JVYA 3TTKA 3PUZE 1FPLA 2RINA 1QULA 2FBPA 3ZS6A 3W9WA 4GL8A 1MM6A 3BBRA 5EQ8A 2MKZA 4NHBA 1RDXA 1NNKA 4DLDA 2DDKA 2H98A 2OZZA 1FBPA 1N3WA 2F3BA 4G61A 3MJNA 1QUJA 1HSEA 2ABHA 2OBGA 3UGWA 3H6TA 1YTVA 1B05A 3K6WA 3ZKLA 4OZ9A 1LLSA 3RLFE 4EUOA 2M8CA 2W7YA 3FIRA 4O7MA 1LB8A 3VVDA 4HE2A 4NF4B 1M5FA 1NV0A 1XI6A 1A55A 1SDXA 3LUYA 5TU0A 1JETA 2I0BA 5ELVA 1M5BA 1LFGA 4OA4A 1FTLA 1NL5A 1GTKA 3A3CA 5L9OA 2P3VA 4AB6A 4MBPA 2ZXTA 1LBWA 5CMMA 5JEIA 1MXXA 3JV9A 4NF5B 3BIHA 1S9TA 2QVVA 5I7IA 3UIFA 1FTKA 3JYRA 1N04A 5DVJA 5CI5A 3GBAA 4G2ZA 5FHMA 1K9ZA 4PAIA 1A54A 5AA4A 3K1PA 4YKIA 2Q89A 1FQFA 3PUXE 2V25A 4ESWA 2XX9A 1RYXA 5HM4B 2FA7A 1LAGE 2QS1A 5LOMA 5DEXB 5H8QA 1N7WA 4Q30B 4HS7A 2PT2A 2I6EA 3IB0A 4R6KA 2DSFA 4F3BA 1DTZA 4YU0A 4NGUA 1TFDA 1NNTA 4U4SA 4JWOA 4GWXA 4F31B 4DCYA 4RY1A 4XXUA 4YB6A 1AOVA 3IFCA 2LAOA 3IK6B 3K00A 3FD3A 2Z8DA 3KEIA 1CE2A 4PDHA 3SEXA 5ET8A 4X1DA 4P1LA 1JEVA 4F22A 3U65A 2GHAA 2V3QA 1MXVA 2PFYA 3TKDA 4N81A 2O68A 4IO5A 3KOTA 2WBDA 1B5IA 4ISUA 5A5LA 3GXAA 4MNIA 1RYOA 2ZZXA 2X26A 4H5FA 2X7QA 3OO9A 2G93A 1FPEA 2XXYA 2B3BA 4XTCQ 1UIVA 4QSEA 3BIGA 4GFRA 4BDOA 2DP8A 4LZ7A 3IAZA 4NF6A 4N15A 3ISPA 2PVUA 2QFLA 4YKPA 3T0JA 1H45A 4GWOA 1DSNA 4PFIA 1D9VA 2KLFA 1USYE 3G3IA 4IO4A 4N8GA 3U94A 4MLQA 3OSQA 4XKPA 1SPIA 4HXVA 5I56B 5ICTA 1JNFA 1SYHA 3IX1A 1L5TA 3SETA 5IGAA 1ZKBA 1AWBA 1QUKA 2HZLA 4I62A 3FVOA 2YJPA 3G3JA 2FHYA 1NUYA 1IZ1A 1YXIA 4HE0A 1ATGA 4N6KA 1WODA 1DPPA 4F18A 2ZYNA 4H0WA 3BKIB 4EF1A 3IORA 5HPQA 1GVCA 3TTNA 4R6YA 1FBGA 4GXSB 4LONB 3FBPA 2HCAA 2DE2A 2UVHA 2YPNA 5H8FA 3O6GA 1Y20A 4IO7A 5K2YA 2F6PA 1MDP1 1G0IA 1MPCA 3AXFA 4OESA 4F3GA 1NFTA 4MIJA 4P1EA 1PB7A 3RTWB 2O51A 1MQJA 1BLFA 1VSOA 1SYIA 3E3KA 2ZZVA 3QUFA 1SD3A 1PEBA 3FZVA 3PUWE 3RNNA 4JBZA 3S2VA 4NG7A 5LTCA 4GQOA 3MC2A 4I8CA 3E9XA 2B3FA 3PD8A 3LSWA 4OENA 2NVUB 3S9EA 3D4GA 5BWJA 3UK4A 3S4UA 3N94A 1FW0A 1RDYA 4JSOA 4FBPA 4N07A 3HO7A 5KZTA 2F8DA 1JW5A 1A99A 5ESYA 5I59A 2Q74A 5AA2D 5DYHA 3ECRA 4ZDMA 3W9VA 4DIGA 2OJTA 1MQDA 2VGQA 1BKAA 3IOUA 1EYJA 2KR0A 3SZPA 4YKJA 3MZ9A 3K1MA 3K6UA 4XFEA 1LBYA 3PD9A 4M1VA 4I9DA 1FQAA 2F3DA 5HBCA 3K6VA 4H67A 4IY6A 2PYYA 1H76A 2GQ1A 4FEBA 3ROJA 1AMFA 2UVGA 1A8EA 1YAEA 2F78A 3BFTA 3Q28A 4O8MA 3U72A 3I6VA 4PETA 5F24A 2HPGA 2DQVA 1FTMA 3MPKA 1O7TA 1PB9A 4NWCA 2X7PA 1FTOA 1NH8A 4NF8B 4ONYA 2Q9TA 4R2BA 4OVJA 4LQ5A 1B3EA 3DP6A 2I49A 1FPGA 2OK2A 3M3KA 1B32A 2P0SA 2ZNTA 1B46A 1QUIA 1B7HA 2IEEA 1PC3A 2UXAA 5H8SA 1Y3NA 3OO6A 4NF4A 1SW2A 2E1SA 3TCGA 3TTMA 4X1BA 2GH9A 3U93A 1URDA 4EXKA 1IUDA 2CEXA 1IEJA 4O7IA 4KYDA 5T3JA 3TCFA 5H8FB 2PT1A 4QRZA 4R2FA 3T22A 3M3FA 2UYFA 3M8UA 4L17A 4NF5A 1FCKA 2XD2A 1US4A 1ZTYA 3FJGA 4O3BA 1INPA 2XXWA 3FJ7A 3T9XB 3IO6A 3TODA 3BFUA 4QXDA 3MP8A 2VT5A 1OLCA 2Y5LA 1MY2A 1MS7A 1PBPA 1FBCA 1I6AA 3LBSA 1MPDA 1H43A 3NOHA 1Y1MA 3A29A 4NX1A 4OETA 2DXYA 4AB5A 1MH3A 1Y3PA 3FASA 3C32A 4KD5A 2QS4A 4ECFA 1VR5A 2AYSA 1MRPA 3CRBA 3RN8A 4N17A 1II5A 2R6GE 4TOZA 3QYTA 5DVIA 5FHNA 3D1RA 1FBHA 1I69A 3D4CA 4NMYA 4ZZEA 4E0XA 3IJOB 4LATA 2HFBA 4KPTA 4P3LA 4QFOA 4MF3A 1NV2A 1MQHA 3GZGA 3LC8A 5I59B 1XOCA 1B52A 4EQ7A 3S9MC 4PTKA 4RA1A 1H44A 4R72A 3PMVA 3TTLA 1IXHA 2H9BA 5EYGA 3SESA 3KN8A 3QIMA 5FTIA 1M5EA 4OEVA 3H7MA 4F2OA 4DXBA 5CBRA 1M5CA 1EZ9A 3O2AA 4OVTA 3VFJA 4WKMA 1J1NA 3EQ1A 4ZZAA 2Q88A 4BDNA 1UQWA 1B3GA 3QSLA 4XEQA 1N7XA 3DELB 2HEUA 1MM7A 1MY4A 4MCOA 5CMKA 4JVDA 2ONRA 1IMAA 1TT1A 3RT8A 5CC2A 3PMWA 1Y4TA 5I56A 1VFEA 1B4HA 5I2KB 3FXBA 4N91A 2REJA 2F7CA 4FIMA 4DXUA 3K6XA 3CFZA 1R1NA 1NKXA 1N3XA 4G77A 1M5DA 3V5AA 2ALUA 4FATA 5JTYA 1B3LA 4IGTA 4P56A 1YCJA 1LAXA 3LUZA 2QS2A 2UYEA 4JWXA 5ET7A 4HCYA 3LSXA 1POTA 4DXCA 3LSLA 1LAFE 3KSJA 2ANJA 3O28A 1LBZA 2V4CA 1S50A 1QKAA 1SI1A 1Z7NE 2HXWA 5AA3A 3Q29A 3CFLA 1LEVA 1RDZA 2NWJA 1D3KA 2XXRA 1FQBA 3KC0A 4X04A 1T0KA 1JEUA 3LV0A 4UACA 3RT6B 1R6ZA 2XXKA 4KYEA 1YZ0A 2Y7IA 2ZMBA 2F35A 2AL4A 1KZ8A 2Y7RA 1IQ7A 2I58A 4PBQA 1Y9UA 3TUSA 3FUZA 1IMDA 4JSDA 1OIBA 4OVPA 4LZ5A 3I3VA 1JP4A 1B58A 4UA8A 4U4XA 3O6HA 4O3AA 3Q26A 3K2DA 1N84A 4OVSA 3IFAA 4YICA 4ELOA 2NOOA 3C4MA 3TEPA 4ZEKA 1LB9A 3K1NA 3VV5A 3L6GA 3W15C 1LSTA 1JVXA 4MJOA 2REGA 4Q8RA 5J16A 3OXNA 4GWYA 2GFEA 2Q2CA 1OVTA 3C33A 3PU5A 4PP0A 3UORA 1A8FA 4RYAA 3R7XA 3N6UA 2P2AA 3SEWA 1FPFA 2XA5A 1ZBMA 4P47A 4ZEBA 4QFPA 3TMGA 4BDMA 3WAFA 5AA1A 3B8BA 1LGBC 2XXQA 3TQLA 2GHBA 1NNPA 5I84A 5L8DA 4AQ4A 4PFUA 1FBDA 4OHNA 4RXLA 4MX6A 3HHFA 1NUWA 2WEFA 1SW4A 3IOTA 2KQZA 4KXPA 3ZSFA 3KBZA 4NWDA 1FQDA 3O9PA 3PTYA 2I4BA 4H1XA 4N4UA 1SW5A 4PE5B 2V3TA 3FATA 1B2HA 4G68A 1MY3A 3C9HA 4NF8A 1FPKA 3EHTA 2DS9A 2XXVA 1IMEA 1BTJA 4OQOA 2OWZA 2HQ0A 3H3GA 3RQTA 4X48A 4KHZE 4H46A 3MUQA 4GBVA 5ET5A 3MYUA 4TLLB 5JTYB 4QFNA 2VD3A 3CHGA 4PCDA 5IZ3B 2L5VA 5I3SA 4YKKA 1US5A 1NI9A 1UIUA 1JW4A 1ZU0A 4EQBA 1IMFA 1PDAA 3MVYA 2BJIA 1B7UA 3B6WA 3H6WA 4P11A 5BUUA 2XXPA 3H06B 4QF9A 3RYDA 2HAUA 1EZOA 3ILUB 3DP4A 3PUYE 5EHSA 4LUBA 4R73A 2VHAA 2VD2A 4FE8A 3V89B 1PBQA 5CBSA 4Z0IA 4U1OA 1MH4A 4EF2A 5FBPA 4GX3A 4Q0CA 1FSAA 2DE3A 2QJEA 4QSCA 1LFIA 4NN3A 5AA2B 2FYIA 1Q1KA 2XWOA 3T96B 4NEDA 4TQUQ 2PBWA 2CZIA 2XXIA 2PCRA 1B5HA 2QVUA 3L6HA 1LBXA 4GLIA 4GIZA 1XVYA 4JVIA 3PV0E 1KWHA 4R75A 1IMBA 4I1DA 3CG1A 2CZHA 1MPBA 2DVZA 3E78A 4C1UA 5EYHA 1Q35A 5I57B 3TQWA 1HSJA 3M3LA 2H25A 4BDQA 1B0HA 3FXUA 1Y1ZA 1BK4A 3S9LC 1JQFA 1ZJLA 5I2NB 2O6AA 4OMBA 3K0VA 4HE1A 2ZYOA 3PPPA 4PDDA 3G3HA 4YB5A 3C31A 1MXWA 3F11A 2B4MA 2DWAA 3K4UA 3MZ1A 4E0WA 5I58A 3RTFB 2VPNA 4N8YA 3RPLB 2QMXA 1P1QA 3IB2A 3T9HB 5L9MA 3OMBA 1B4ZA 2P3NA 4RJZA 5IAIA 2I48A 4IGRA 1K9YA 3E4RA 4F19A 1EU8A 4G68B 3KBRA 5I2KA 2ZYKA 1XT8A 1NV7A 1FPIA 1JW1A 3GBBA 4POWA 3GYYA 1NH7A 3EF7A 3R26A 3FJMA 4RK9A 3B6QA 5FTHA 5EQAA 1AL3A 4THIA 2XHDA 1Y4CA 3ONMA 3ILTB 1KA1A 5A5XB 2F36A 4YMBA 4PGPA 3EPEA 4ELPA 3CFXA 4PE3A 1FPJA 3FV2A 1TXFA 1QJMA 4FECA 4OYVA 4O94A 4DI4B 1DK4A 4F2QA 3A09A 4RK2A 2HHMA 4G68C 5ITPA 2XX8A 1CNQA 3PPOA 4U23A 3SDFA 3V83A 4PFWA 1F9BA 2XWVA 1PB8A 3TYHA 1UTBB 3T66A 5IM2A 1B3FA 2UVIA 2F97A 1QKBA 3TELA 2NUVA 2NXOA 1NV6A 3OELA 4FAJA 4R9GA 3O29A 4U21A 2CEYA 5TP9B 3KJTA 4F39A 1O64A 3Q25A 4MAGA 4DCXA 1SVXB 5EQ7A 3MSTA 3G3FA 1NV1A 1OQHA 3FVGA 2ZNUA 4RPNA 4KQPA 4GWWA 3QUJA 4F1UA 4N6DA 5CMCA 2QMWA 2FIEA 2Z8EA 4OFLA 4YMAA 1H3DA 4KCCA 1GGGA 1QVSA 2RCAA 4O3CA 3KN7A 4N13A 3VE1B 3O97A 2H5YA 2F6GA 1NV4A 3MVZA 3KFMA 4ELRA 2XX7A 4I40A 3E13X 4KCDA 5H8NB 1B6HA 4NE4A 1MXUA 5CM6A 3GLBA 3VXCA 1MXZA 2AL5A 3CSGA 2B65A 4MFIA 2I3WA 5LDZA 3T1BA 1EH3A 3EKIA 2THIA 3TZAA 1DTGA 3EN3A 3KOSA 5EYFA 4N6PA 2V93A 3SEYA 4C1TA 1YYZA 3KGCA 3THIA 3RGYA 5I58B 3FVNA 1FBEA 4U2RA 2I3VA 1QW0A 1MY0A 2HZKA 4GWUA 1DCUA 5H8HB 3K01A 1MQIA 4H8IA 5B7DA 3OENA 1Y3QA 2RCBA 1B51A 4U22A 4HCWA 3A3UA 3TAJA 3MP6A 1I6QA 1LCFA 1WDNA 4AS4A 3OSRA 1FQCA 4P0IA 1Z7ME 2AIXA 5IZ3A 1FPDA 2CMOA 1B9JA 2Y84A 5ITOA 1IMCA 5ICQA 2HXRA 5EHMA 2F5XA 1TFAA 1B0LA 1ZLQA 3IO4A 4ESXA 1B7ZA 4PFRA 3KC1A 1SW1A 2Y7WA 3OEKA 4HW8A 4NF0A 5ET6A 4JVCA 4LN5A 2F34A 3ODBA 2XWKA 1DOTA 4IB2A 4RPOA 4IO3A 4X8RA 2R9JA 3MP1A 4MHFA 4H6DA 2HAVA 4PF8A 2FIXA 4YZZA 1O63A 4QFLA 4MEVA 2XXTA 3ZKKA 1FJ6A 3KN3A 3IR1A 1ANFA 4Q5TA 4NAPA 3VLWA 2XXHA 4JWYA 2ESNA 1DPEA 4EDPA 1BP5A 5DW8A 5AA2A 1NV3A 3HSTA 1FRPA 3PPRA 4C0RA 4YAHX 1D9YA 2CZKA 2V3UA 4EXLA 3B6TA 2PMSA 3CVGA 4R74A 3IOWA 2Q2AA 3SEUA 1B1XA 2I4CA 2WYKA 3HPIA 1OMPA 1IXCA 4KYSA 3TTRA 3PPQA 3HHGA 5EQ9A 4DI3D 5ISUA 3LSFB 3V8XB 3VVFA 2BJJX 3G7WA 5I57A 1CB6A 1P1UA 3E79A 3KJ7A 4ZEIA 4EQ9A 2VP1A 4OVRA 5I2NA 1LBVA 3DLNA 2Z23A 1NV5A 4G8HA 3T93B 4PFBA 3H03A 1B1HA 1OVBA 3T9UA 2OLBA 4IY5A 4DE8A 2DOJA 3IOVA 3S9NC 2IA4A 1N76A 2JJKA 1MDQA 2RF1A 3UN6A 3OEMA 4F29A 5J1DA 3RPLA 4POXA 2XXXA 4G8NA 5IZ1A 3EHSA 4M4GA 3IL1B 3QXMA 1FJ9A 3OOAA 3U8QA 2OWTA 4MH5A 4GWSA 5KCJB 1USYH 2O1MA 3O66A 4OVQA 3LR1A 4PBHA 2DYXA 2A5TA 4PAKA 4GWZA 1VDWA 1LBBA 5M2VA 4TLMB 2Z22A 1Q9DA 3FGSA 5AE4A 1ZIUA 4PC9A 5KDTA 4PFTA 2OWSA 3MQ9A 1DBZA 3VLVA 3QK6A 1P1WA 2PFZA 4LVQA 2VOZA 4MLVA 1N0TA 2XWIA 4OXVA 5A5XA 3RUMA 1UTHA 4MNCA 3PPNA 1XC1A 3OD7A 4JDFA 3HN0A 2O7UA 3G3KA 3UP9A 1B40A 5I5PA 2VPOA 1URGA 2D21A 4BDRA 2XXUA 2F7AA 2WX9A 5IKBA 3RY3A 4DDDA 2E0SA 1HSLA 2O84X 4PF6A 1P1NA 3K02A 2QVRA 1R9LA 1OQGA 4ELQA 5K2XA 2FVZA 3VVEA 4ZECA 2Y5KA 4F3SA 1UTBA 3SEVA 2Y7PA 1IXGA 3B7DA 2QS3A 4XIGQ 3H4ZA 4ZE9A 2R8TA 3EHUA 4XKQA 3IB1A 1GR2A 1SBPA 3SKPA 4RNSA 4OEUA 4LQ2A 4BLAA 4Z7EA 1LCTA 1XVXA 2ZNSA 2DWIA 1XS5A 5TP9A 2P1SA 3SERA 3JZJA 3C35A 5AA4B 3MWBA 3P7IA 4FEDA 1G0HA 1QGXA 1KA0A 3CIJA 1LBCA 5FHOA 4XKRA 5CRYA 3T9VA 4GX6A 1I6BA 4F1YA 5TPAA 3TDJA 4H45A 4OFOA 4JB7A 5H8QB 1POY1 4XKNA 1OLAA 1MG1A 1ZMGA 3FV1A 4QFKA 4U1ZA 2O7IA 3VDFA 3PMXA 2XD3A 3Q27A 3FXRA 3TCHA 2ONSA 2R71A 5H8NA 1FQEA 3MAMA 4NTLA 5DVFA 4LP2B 3B50A 4FORA 3U92A 2ONKE 2DWJA 3MPLA 2QL3A 2O69A 2FNCA 1B3HA
chains in the Genus database with same CATH topology
4IR8A 1NV6A 4N8GA 1LBZA 2V4CA 2CEYA 1LEVA 2QPQA 1RDZA 1SPIA 4HXVA 4MAGA 3KC0A 5EQ7A 3MSTA 4X04A 3LV0A 1NV1A 2XXKA 5IGAA 1YZ0A 4MMPA 1AWBA 1KZ8A 4GWWA 4F1UA 4N6DA 4PAFA 2HZLA 4PBQA 2Q8MA 2FIEA 1IMDA 2FHYA 1NUYA 1YXIA 4HE0A 4OVPA 4X9TA 1NUZA 1JP4A 1NV4A 3QMFA 4N6KA 4F18A 4MNPA 4I40A 4OVSA 3IFAA 4YICA 5CM6A 1FTAA 1FBGA 5LDZA 3T1BA 3FBPA 3EKIA 2DE2A 1YYZA 4MJOA 1G0IA 5J16A 4GWYA 4OANA 4GX4A 4I3EA 4MIJA 4P1EA 1FBEA 3HFUA 2ZZVA 2WYPA 1FPFA 2HZKA 1DCUA 4GWUA 2OX3A 2XA5A 4XF5A 4P47A 3B8BA 4NG7A 5LTCA 2WBBA 4HCWA 1FBDA 4MX6A 4AS4A 1NUWA 2WEFA 5IZ3A 1FPDA 2KQZA 4KXPA 1RDYA 4FBPA 2B4LA 3KBZA 1IMCA 1NUXA 2HXRA 2ZZWA 2F5XA 3PTYA 5ESYA 4N4UA 1FBFA 2Q74A 4QBAA 4F1VA 1EYIA 4PFRA 3W9VA 3KC1A 4UABA 1FPKA 4NF0A 5ET6A 5JK4A 1EYJA 2KR0A 4JVCA 4LN5A 3SZPA 1IMEA 2XWKA 4PGNA 2OWZA 4GBWA 4XFEA 4P9KA 4X8RA 4NQ8A 4MHFA 1LBYA 4M1VA 4H46A 4PF8A 2FIXA 2F3DA 4GBVA 4YZZA 3MYUA 5ET5A 4MEVA 2GQ1A 3CHGA 4PCDA 4AS5A 5IZZA 5IZ3B 2L5VA 3ROJA 5I3SA 1FJ6A 1FPBA 4O8MA 1NI9A 4PETA 4NAPA 5F24A 1IMFA 2BJIA 2HPGA 5DW8A 1NV3A 1FRPA 3RYDA 4I3YA 2CZKA 2Q9TA 1D9QA 2WYKA 4P8BA 1EYKA 5EQ9A 4DI3D 1FPGA 5FBPA 4GX3A 3E79A 1FSAA 2DE3A 2DE4A 4OVRA 1LBVA 1FPLA 1NV5A 4NN3A 2CEXA 2FBPA 4PFBA 2XWOA 3W9WA 4O7IA 5T3JA 5EQ8A 2MKZA 2CZIA 4NHBA 2JJKA 2PCRA 1RDXA 2QVUA 1LBXA 5J1DA 3RPLA 2DDKA 4JVIA 1INPA 1FBPA 2F3BA 5IZ1A 4G61A 1IMBA 4QXDA 2VT5A 2Y5LA 2CZHA 2DVZA 3E78A 1FBCA 5EYHA 1FJ9A 4GWSA 3NOHA 4O7MA 3A29A 4NX1A 4HE2A 1BK4A 1NV0A 1XI6A 4OVQA 4PBHA 4PAKA 4GWZA 4HE1A 1VDWA 4PDDA 1Q9DA 4N17A 4OA4A 4PC9A 2P3VA 2B4MA 3D1RA 1DBZA 1LBWA 2PFZA 1FBHA 2XWIA 2VPNA 4N8YA 4MNCA 3RPLB 3BIHA 2QVVA 5I7IA 4P3LA 1NV2A 5I5PA 2P3NA 2VPOA 1K9ZA 4PAIA 1K9YA 4F19A 2WX9A 4PTKA 5EYGA 1NV7A 1FPIA 3GYYA 4PF6A 2QVRA 2FVZA 5EQAA 4NGUA 4OVTA 2Y5KA 4XEQA 1KA1A 4GWXA 2R8TA 4MCOA 3IFCA 4JVDA 4PGPA 1IMAA 4PE3A 4PDHA 5ET8A 4P1LA 3U65A 1FPJA 2V3QA 2PFYA 4N81A 1G0HA 1QGXA 1KA0A 4O94A 4DI4B 2WBDA 3FXBA 4N91A 4GX6A 5A5LA 1DK4A 2HHMA 4MNIA 2ZZXA 4H45A 1CNQA 1FPEA 4P56A 2XWVA 3BIGA 3LUZA 5ET7A 4N15A 3ISPA 4HCYA 5IM2A 2QFLA 3B50A 3T0JA 4PFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P8B A;  4P3L A;  4MX6 A;  5I5P A;  4N8G A;  2VPO A;  2V4C A;  4DI3 D;  4PAI A;  2CEY A;  2WX9 A;  4MAG A;  4X04 A;  4OVR A;  2XXK A;  3GYY A;  5IGA A;  4MMP A;  4PF6 A;  2ZZW A;  4NN3 A;  4N6D A;  4PAF A;  2CEX A;  2HZL A;  4PBQ A;  4PFB A;  2XWO A;  4N4U A;  4OVP A;  4PFR A;  4N6K A;  4NHB A;  4UAB A;  4NGU A;  4OVT A;  4NF0 A;  4MNP A;  4XEQ A;  4LN5 A;  4OVS A;  4YIC A;  2XWK A;  4PGN A;  4MCO A;  5CM6 A;  4XFE A;  4P9K A;  4PGP A;  4NQ8 A;  4X8R A;  4MHF A;  4PF8 A;  4PE3 A;  4PDH A;  4P1L A;  4YZZ A;  3U65 A;  2PFY A;  4MEV A;  4PCD A;  5IZZ A;  4O94 A;  4DI4 B;  3FXB A;  4O8M A;  4O7M A;  4N91 A;  4NX1 A;  4PET A;  4OAN A;  4NAP A;  2HPG A;  4OVQ A;  4PBH A;  4MIJ A;  4P1E A;  4MNI A;  4PAK A;  2ZZX A;  4PDD A;  4N17 A;  4OA4 A;  4P56 A;  2XWV A;  2WYP A;  2ZZV A;  4PC9 A;  2HZK A;  2XA5 A;  4XF5 A;  4P47 A;  2PFZ A;  4N15 A;  2XWI A;  4NG7 A;  2VPN A;  4N8Y A;  4MNC A;  5IM2 A;  3B50 A;  5LTC A;  5I7I A;  2WYK A;  4PFI A; 
#chains in the Genus database with same CATH topology
 2D5W A;  4IR8 A;  2D3I A;  4R6H A;  3N6T A;  3U1O A;  1P1O A;  3UA8 A;  1IXI A;  1A7L A;  2QPQ A;  3G3G A;  3FVK A;  3MZB A;  5B70 A;  2PX1 A;  2RC9 A;  4KI0 E;  2GRV A;  3OO8 A;  4LA9 A;  4MMP A;  5L9S A;  4FJP A;  4PAF A;  4OER A;  2Q8M A;  2I0C A;  3C36 A;  4X9T A;  1NUZ A;  5H8H A;  2QRY A;  4G8M A;  3QMF A;  4GF8 A;  2O1L A;  3I5O A;  4MNP A;  1RKM A;  4NF6 B;  4IO2 A;  1LAH E;  3DP8 A;  2WKY A;  1FTJ A;  1FTA A;  1SQY A;  3HCQ A;  2A5T B;  2G29 A;  4GVO A;  2QSX A;  4OWD A;  4KR5 A;  5KDT B;  2F7B A;  5DTB A;  4OAN A;  4GX4 A;  3PGF A;  1UTH B;  4I3E A;  2Y7K A;  3PUV E;  3N5L A;  2DWH A;  2DVC A;  3HFU A;  1IIT A;  1DMB A;  2WYP A;  3OO7 A;  1IIW A;  4H8J A;  4ZS9 A;  2OX3 A;  4XF5 A;  2ZYM A;  1ELJ A;  1XHY A;  1B5J A;  2WBB A;  3MVW A;  4WEP A;  4GD5 A;  1R9Q A;  1LFH A;  4H65 A;  2Q8J A;  1EZP A;  2UVJ A;  4ND9 A;  2YLN A;  2B4L A;  1NUX A;  3CG3 A;  1BIY A;  4HTG A;  1YPN A;  2ZZW A;  2RC8 A;  3CR9 A;  4IO6 A;  4ZED A;  2CZL A;  3TFL A;  1FBF A;  4QBA A;  4ZE8 A;  4F1V A;  4GRK A;  3H6U A;  3FXQ A;  1EYI A;  1VE4 A;  4OFJ A;  4UAB A;  3MVX A;  3O6I A;  5JK4 A;  4BDL A;  1NNF A;  3N26 A;  3VLU A;  1P99 A;  4PFY A;  2H99 A;  4P0G A;  2OCU A;  1A40 A;  4DZ1 A;  3RPW A;  4PGN A;  5DEX A;  2V84 A;  4GBW A;  4P9K A;  4NQ8 A;  2DXR A;  5TPA B;  1D4N A;  1MY1 A;  5F7V A;  2RKM A;  3MW0 A;  5DT6 A;  3IJX B;  3USD A;  4AS5 A;  5IZZ A;  3H6V A;  3KSX A;  1FPB A;  4QHQ A;  1NMU A;  3CI8 A;  2A5S A;  3CSB A;  4OTE A;  4K3F A;  4F3P A;  1TWY A;  1S7Y A;  4R9F A;  4H5G A;  1AH5 A;  4WXJ A;  4ZEF A;  4I3Y A;  3HV1 A;  4KFQ A;  3KG2 A;  1WVJ A;  4WED A;  3KZG A;  4G4P A;  1VFD A;  1MXY A;  3DM0 A;  1D9Q A;  1AIV A;  3VXB A;  3QAX A;  2H4I A;  4P8B A;  1EYK A;  4GXA A;  3TPA A;  4QSD A;  1URS A;  5F1Q A;  1SI0 A;  4PQJ A;  1MQG A;  3R6U A;  2Z8F A;  3C34 A;  2RC7 A;  4YB7 A;  5KCJ A;  4LZ8 A;  4GL0 A;  3MBP A;  2DE4 A;  4GOT A;  5CMB A;  1GV8 A;  3WAE A;  4JXI A;  1JVY A;  3TTK A;  3PUZ E;  1FPL A;  2RIN A;  1QUL A;  2FBP A;  3ZS6 A;  3W9W A;  4GL8 A;  1MM6 A;  3BBR A;  5EQ8 A;  2MKZ A;  4NHB A;  1RDX A;  1NNK A;  4DLD A;  2DDK A;  2H98 A;  2OZZ A;  1FBP A;  1N3W A;  2F3B A;  4G61 A;  3MJN A;  1QUJ A;  1HSE A;  2ABH A;  2OBG A;  3UGW A;  3H6T A;  1YTV A;  1B05 A;  3K6W A;  3ZKL A;  4OZ9 A;  1LLS A;  3RLF E;  4EUO A;  2M8C A;  2W7Y A;  3FIR A;  4O7M A;  1LB8 A;  3VVD A;  4HE2 A;  4NF4 B;  1M5F A;  1NV0 A;  1XI6 A;  1A55 A;  1SDX A;  3LUY A;  5TU0 A;  1JET A;  2I0B A;  5ELV A;  1M5B A;  1LFG A;  4OA4 A;  1FTL A;  1NL5 A;  1GTK A;  3A3C A;  5L9O A;  2P3V A;  4AB6 A;  4MBP A;  2ZXT A;  1LBW A;  5CMM A;  5JEI A;  1MXX A;  3JV9 A;  4NF5 B;  3BIH A;  1S9T A;  2QVV A;  5I7I A;  3UIF A;  1FTK A;  3JYR A;  1N04 A;  5DVJ A;  5CI5 A;  3GBA A;  4G2Z A;  5FHM A;  1K9Z A;  4PAI A;  1A54 A;  5AA4 A;  3K1P A;  4YKI A;  2Q89 A;  1FQF A;  3PUX E;  2V25 A;  4ESW A;  2XX9 A;  1RYX A;  5HM4 B;  2FA7 A;  1LAG E;  2QS1 A;  5LOM A;  5DEX B;  5H8Q A;  1N7W A;  4Q30 B;  4HS7 A;  2PT2 A;  2I6E A;  3IB0 A;  4R6K A;  2DSF A;  4F3B A;  1DTZ A;  4YU0 A;  4NGU A;  1TFD A;  1NNT A;  4U4S A;  4JWO A;  4GWX A;  4F31 B;  4DCY A;  4RY1 A;  4XXU A;  4YB6 A;  1AOV A;  3IFC A;  2LAO A;  3IK6 B;  3K00 A;  3FD3 A;  2Z8D A;  3KEI A;  1CE2 A;  4PDH A;  3SEX A;  5ET8 A;  4X1D A;  4P1L A;  1JEV A;  4F22 A;  3U65 A;  2GHA A;  2V3Q A;  1MXV A;  2PFY A;  3TKD A;  4N81 A;  2O68 A;  4IO5 A;  3KOT A;  2WBD A;  1B5I A;  4ISU A;  5A5L A;  3GXA A;  4MNI A;  1RYO A;  2ZZX A;  2X26 A;  4H5F A;  2X7Q A;  3OO9 A;  2G93 A;  1FPE A;  2XXY A;  2B3B A;  4XTC Q;  1UIV A;  4QSE A;  3BIG A;  4GFR A;  4BDO A;  2DP8 A;  4LZ7 A;  3IAZ A;  4NF6 A;  4N15 A;  3ISP A;  2PVU A;  2QFL A;  4YKP A;  3T0J A;  1H45 A;  4GWO A;  1DSN A;  4PFI A;  1D9V A;  2KLF A;  1USY E;  3G3I A;  4IO4 A;  4N8G A;  3U94 A;  4MLQ A;  3OSQ A;  4XKP A;  1SPI A;  4HXV A;  5I56 B;  5ICT A;  1JNF A;  1SYH A;  3IX1 A;  1L5T A;  3SET A;  5IGA A;  1ZKB A;  1AWB A;  1QUK A;  2HZL A;  4I62 A;  3FVO A;  2YJP A;  3G3J A;  2FHY A;  1NUY A;  1IZ1 A;  1YXI A;  4HE0 A;  1ATG A;  4N6K A;  1WOD A;  1DPP A;  4F18 A;  2ZYN A;  4H0W A;  3BKI B;  4EF1 A;  3IOR A;  5HPQ A;  1GVC A;  3TTN A;  4R6Y A;  1FBG A;  4GXS B;  4LON B;  3FBP A;  2HCA A;  2DE2 A;  2UVH A;  2YPN A;  5H8F A;  3O6G A;  1Y20 A;  4IO7 A;  5K2Y A;  2F6P A;  1MDP 1;  1G0I A;  1MPC A;  3AXF A;  4OES A;  4F3G A;  1NFT A;  4MIJ A;  4P1E A;  1PB7 A;  3RTW B;  2O51 A;  1MQJ A;  1BLF A;  1VSO A;  1SYI A;  3E3K A;  2ZZV A;  3QUF A;  1SD3 A;  1PEB A;  3FZV A;  3PUW E;  3RNN A;  4JBZ A;  3S2V A;  4NG7 A;  5LTC A;  4GQO A;  3MC2 A;  4I8C A;  3E9X A;  2B3F A;  3PD8 A;  3LSW A;  4OEN A;  2NVU B;  3S9E A;  3D4G A;  5BWJ A;  3UK4 A;  3S4U A;  3N94 A;  1FW0 A;  1RDY A;  4JSO A;  4FBP A;  4N07 A;  3HO7 A;  5KZT A;  2F8D A;  1JW5 A;  1A99 A;  5ESY A;  5I59 A;  2Q74 A;  5AA2 D;  5DYH A;  3ECR A;  4ZDM A;  3W9V A;  4DIG A;  2OJT A;  1MQD A;  2VGQ A;  1BKA A;  3IOU A;  1EYJ A;  2KR0 A;  3SZP A;  4YKJ A;  3MZ9 A;  3K1M A;  3K6U A;  4XFE A;  1LBY A;  3PD9 A;  4M1V A;  4I9D A;  1FQA A;  2F3D A;  5HBC A;  3K6V A;  4H67 A;  4IY6 A;  2PYY A;  1H76 A;  2GQ1 A;  4FEB A;  3ROJ A;  1AMF A;  2UVG A;  1A8E A;  1YAE A;  2F78 A;  3BFT A;  3Q28 A;  4O8M A;  3U72 A;  3I6V A;  4PET A;  5F24 A;  2HPG A;  2DQV A;  1FTM A;  3MPK A;  1O7T A;  1PB9 A;  4NWC A;  2X7P A;  1FTO A;  1NH8 A;  4NF8 B;  4ONY A;  2Q9T A;  4R2B A;  4OVJ A;  4LQ5 A;  1B3E A;  3DP6 A;  2I49 A;  1FPG A;  2OK2 A;  3M3K A;  1B32 A;  2P0S A;  2ZNT A;  1B46 A;  1QUI A;  1B7H A;  2IEE A;  1PC3 A;  2UXA A;  5H8S A;  1Y3N A;  3OO6 A;  4NF4 A;  1SW2 A;  2E1S A;  3TCG A;  3TTM A;  4X1B A;  2GH9 A;  3U93 A;  1URD A;  4EXK A;  1IUD A;  2CEX A;  1IEJ A;  4O7I A;  4KYD A;  5T3J A;  3TCF A;  5H8F B;  2PT1 A;  4QRZ A;  4R2F A;  3T22 A;  3M3F A;  2UYF A;  3M8U A;  4L17 A;  4NF5 A;  1FCK A;  2XD2 A;  1US4 A;  1ZTY A;  3FJG A;  4O3B A;  1INP A;  2XXW A;  3FJ7 A;  3T9X B;  3IO6 A;  3TOD A;  3BFU A;  4QXD A;  3MP8 A;  2VT5 A;  1OLC A;  2Y5L A;  1MY2 A;  1MS7 A;  1PBP A;  1FBC A;  1I6A A;  3LBS A;  1MPD A;  1H43 A;  3NOH A;  1Y1M A;  3A29 A;  4NX1 A;  4OET A;  2DXY A;  4AB5 A;  1MH3 A;  1Y3P A;  3FAS A;  3C32 A;  4KD5 A;  2QS4 A;  4ECF A;  1VR5 A;  2AYS A;  1MRP A;  3CRB A;  3RN8 A;  4N17 A;  1II5 A;  2R6G E;  4TOZ A;  3QYT A;  5DVI A;  5FHN A;  3D1R A;  1FBH A;  1I69 A;  3D4C A;  4NMY A;  4ZZE A;  4E0X A;  3IJO B;  4LAT A;  2HFB A;  4KPT A;  4P3L A;  4QFO A;  4MF3 A;  1NV2 A;  1MQH A;  3GZG A;  3LC8 A;  5I59 B;  1XOC A;  1B52 A;  4EQ7 A;  3S9M C;  4PTK A;  4RA1 A;  1H44 A;  4R72 A;  3PMV A;  3TTL A;  1IXH A;  2H9B A;  5EYG A;  3SES A;  3KN8 A;  3QIM A;  5FTI A;  1M5E A;  4OEV A;  3H7M A;  4F2O A;  4DXB A;  5CBR A;  1M5C A;  1EZ9 A;  3O2A A;  4OVT A;  3VFJ A;  4WKM A;  1J1N A;  3EQ1 A;  4ZZA A;  2Q88 A;  4BDN A;  1UQW A;  1B3G A;  3QSL A;  4XEQ A;  1N7X A;  3DEL B;  2HEU A;  1MM7 A;  1MY4 A;  4MCO A;  5CMK A;  4JVD A;  2ONR A;  1IMA A;  1TT1 A;  3RT8 A;  5CC2 A;  3PMW A;  1Y4T A;  5I56 A;  1VFE A;  1B4H A;  5I2K B;  3FXB A;  4N91 A;  2REJ A;  2F7C A;  4FIM A;  4DXU A;  3K6X A;  3CFZ A;  1R1N A;  1NKX A;  1N3X A;  4G77 A;  1M5D A;  3V5A A;  2ALU A;  4FAT A;  5JTY A;  1B3L A;  4IGT A;  4P56 A;  1YCJ A;  1LAX A;  3LUZ A;  2QS2 A;  2UYE A;  4JWX A;  5ET7 A;  4HCY A;  3LSX A;  1POT A;  4DXC A;  3LSL A;  1LAF E;  3KSJ A;  2ANJ A;  3O28 A;  1LBZ A;  2V4C A;  1S50 A;  1QKA A;  1SI1 A;  1Z7N E;  2HXW A;  5AA3 A;  3Q29 A;  3CFL A;  1LEV A;  1RDZ A;  2NWJ A;  1D3K A;  2XXR A;  1FQB A;  3KC0 A;  4X04 A;  1T0K A;  1JEU A;  3LV0 A;  4UAC A;  3RT6 B;  1R6Z A;  2XXK A;  4KYE A;  1YZ0 A;  2Y7I A;  2ZMB A;  2F35 A;  2AL4 A;  1KZ8 A;  2Y7R A;  1IQ7 A;  2I58 A;  4PBQ A;  1Y9U A;  3TUS A;  3FUZ A;  1IMD A;  4JSD A;  1OIB A;  4OVP A;  4LZ5 A;  3I3V A;  1JP4 A;  1B58 A;  4UA8 A;  4U4X A;  3O6H A;  4O3A A;  3Q26 A;  3K2D A;  1N84 A;  4OVS A;  3IFA A;  4YIC A;  4ELO A;  2NOO A;  3C4M A;  3TEP A;  4ZEK A;  1LB9 A;  3K1N A;  3VV5 A;  3L6G A;  3W15 C;  1LST A;  1JVX A;  4MJO A;  2REG A;  4Q8R A;  5J16 A;  3OXN A;  4GWY A;  2GFE A;  2Q2C A;  1OVT A;  3C33 A;  3PU5 A;  4PP0 A;  3UOR A;  1A8F A;  4RYA A;  3R7X A;  3N6U A;  2P2A A;  3SEW A;  1FPF A;  2XA5 A;  1ZBM A;  4P47 A;  4ZEB A;  4QFP A;  3TMG A;  4BDM A;  3WAF A;  5AA1 A;  3B8B A;  1LGB C;  2XXQ A;  3TQL A;  2GHB A;  1NNP A;  5I84 A;  5L8D A;  4AQ4 A;  4PFU A;  1FBD A;  4OHN A;  4RXL A;  4MX6 A;  3HHF A;  1NUW A;  2WEF A;  1SW4 A;  3IOT A;  2KQZ A;  4KXP A;  3ZSF A;  3KBZ A;  4NWD A;  1FQD A;  3O9P A;  3PTY A;  2I4B A;  4H1X A;  4N4U A;  1SW5 A;  4PE5 B;  2V3T A;  3FAT A;  1B2H A;  4G68 A;  1MY3 A;  3C9H A;  4NF8 A;  1FPK A;  3EHT A;  2DS9 A;  2XXV A;  1IME A;  1BTJ A;  4OQO A;  2OWZ A;  2HQ0 A;  3H3G A;  3RQT A;  4X48 A;  4KHZ E;  4H46 A;  3MUQ A;  4GBV A;  5ET5 A;  3MYU A;  4TLL B;  5JTY B;  4QFN A;  2VD3 A;  3CHG A;  4PCD A;  5IZ3 B;  2L5V A;  5I3S A;  4YKK A;  1US5 A;  1NI9 A;  1UIU A;  1JW4 A;  1ZU0 A;  4EQB A;  1IMF A;  1PDA A;  3MVY A;  2BJI A;  1B7U A;  3B6W A;  3H6W A;  4P11 A;  5BUU A;  2XXP A;  3H06 B;  4QF9 A;  3RYD A;  2HAU A;  1EZO A;  3ILU B;  3DP4 A;  3PUY E;  5EHS A;  4LUB A;  4R73 A;  2VHA A;  2VD2 A;  4FE8 A;  3V89 B;  1PBQ A;  5CBS A;  4Z0I A;  4U1O A;  1MH4 A;  4EF2 A;  5FBP A;  4GX3 A;  4Q0C A;  1FSA A;  2DE3 A;  2QJE A;  4QSC A;  1LFI A;  4NN3 A;  5AA2 B;  2FYI A;  1Q1K A;  2XWO A;  3T96 B;  4NED A;  4TQU Q;  2PBW A;  2CZI A;  2XXI A;  2PCR A;  1B5H A;  2QVU A;  3L6H A;  1LBX A;  4GLI A;  4GIZ A;  1XVY A;  4JVI A;  3PV0 E;  1KWH A;  4R75 A;  1IMB A;  4I1D A;  3CG1 A;  2CZH A;  1MPB A;  2DVZ A;  3E78 A;  4C1U A;  5EYH A;  1Q35 A;  5I57 B;  3TQW A;  1HSJ A;  3M3L A;  2H25 A;  4BDQ A;  1B0H A;  3FXU A;  1Y1Z A;  1BK4 A;  3S9L C;  1JQF A;  1ZJL A;  5I2N B;  2O6A A;  4OMB A;  3K0V A;  4HE1 A;  2ZYO A;  3PPP A;  4PDD A;  3G3H A;  4YB5 A;  3C31 A;  1MXW A;  3F11 A;  2B4M A;  2DWA A;  3K4U A;  3MZ1 A;  4E0W A;  5I58 A;  3RTF B;  2VPN A;  4N8Y A;  3RPL B;  2QMX A;  1P1Q A;  3IB2 A;  3T9H B;  5L9M A;  3OMB A;  1B4Z A;  2P3N A;  4RJZ A;  5IAI A;  2I48 A;  4IGR A;  1K9Y A;  3E4R A;  4F19 A;  1EU8 A;  4G68 B;  3KBR A;  5I2K A;  2ZYK A;  1XT8 A;  1NV7 A;  1FPI A;  1JW1 A;  3GBB A;  4POW A;  3GYY A;  1NH7 A;  3EF7 A;  3R26 A;  3FJM A;  4RK9 A;  3B6Q A;  5FTH A;  5EQA A;  1AL3 A;  4THI A;  2XHD A;  1Y4C A;  3ONM A;  3ILT B;  1KA1 A;  5A5X B;  2F36 A;  4YMB A;  4PGP A;  3EPE A;  4ELP A;  3CFX A;  4PE3 A;  1FPJ A;  3FV2 A;  1TXF A;  1QJM A;  4FEC A;  4OYV A;  4O94 A;  4DI4 B;  1DK4 A;  4F2Q A;  3A09 A;  4RK2 A;  2HHM A;  4G68 C;  5ITP A;  2XX8 A;  1CNQ A;  3PPO A;  4U23 A;  3SDF A;  3V83 A;  4PFW A;  1F9B A;  2XWV A;  1PB8 A;  3TYH A;  1UTB B;  3T66 A;  5IM2 A;  1B3F A;  2UVI A;  2F97 A;  1QKB A;  3TEL A;  2NUV A;  2NXO A;  1NV6 A;  3OEL A;  4FAJ A;  4R9G A;  3O29 A;  4U21 A;  2CEY A;  5TP9 B;  3KJT A;  4F39 A;  1O64 A;  3Q25 A;  4MAG A;  4DCX A;  1SVX B;  5EQ7 A;  3MST A;  3G3F A;  1NV1 A;  1OQH A;  3FVG A;  2ZNU A;  4RPN A;  4KQP A;  4GWW A;  3QUJ A;  4F1U A;  4N6D A;  5CMC A;  2QMW A;  2FIE A;  2Z8E A;  4OFL A;  4YMA A;  1H3D A;  4KCC A;  1GGG A;  1QVS A;  2RCA A;  4O3C A;  3KN7 A;  4N13 A;  3VE1 B;  3O97 A;  2H5Y A;  2F6G A;  1NV4 A;  3MVZ A;  3KFM A;  4ELR A;  2XX7 A;  4I40 A;  3E13 X;  4KCD A;  5H8N B;  1B6H A;  4NE4 A;  1MXU A;  5CM6 A;  3GLB A;  3VXC A;  1MXZ A;  2AL5 A;  3CSG A;  2B65 A;  4MFI A;  2I3W A;  5LDZ A;  3T1B A;  1EH3 A;  3EKI A;  2THI A;  3TZA A;  1DTG A;  3EN3 A;  3KOS A;  5EYF A;  4N6P A;  2V93 A;  3SEY A;  4C1T A;  1YYZ A;  3KGC A;  3THI A;  3RGY A;  5I58 B;  3FVN A;  1FBE A;  4U2R A;  2I3V A;  1QW0 A;  1MY0 A;  2HZK A;  4GWU A;  1DCU A;  5H8H B;  3K01 A;  1MQI A;  4H8I A;  5B7D A;  3OEN A;  1Y3Q A;  2RCB A;  1B51 A;  4U22 A;  4HCW A;  3A3U A;  3TAJ A;  3MP6 A;  1I6Q A;  1LCF A;  1WDN A;  4AS4 A;  3OSR A;  1FQC A;  4P0I A;  1Z7M E;  2AIX A;  5IZ3 A;  1FPD A;  2CMO A;  1B9J A;  2Y84 A;  5ITO A;  1IMC A;  5ICQ A;  2HXR A;  5EHM A;  2F5X A;  1TFA A;  1B0L A;  1ZLQ A;  3IO4 A;  4ESX A;  1B7Z A;  4PFR A;  3KC1 A;  1SW1 A;  2Y7W A;  3OEK A;  4HW8 A;  4NF0 A;  5ET6 A;  4JVC A;  4LN5 A;  2F34 A;  3ODB A;  2XWK A;  1DOT A;  4IB2 A;  4RPO A;  4IO3 A;  4X8R A;  2R9J A;  3MP1 A;  4MHF A;  4H6D A;  2HAV A;  4PF8 A;  2FIX A;  4YZZ A;  1O63 A;  4QFL A;  4MEV A;  2XXT A;  3ZKK A;  1FJ6 A;  3KN3 A;  3IR1 A;  1ANF A;  4Q5T A;  4NAP A;  3VLW A;  2XXH A;  4JWY A;  2ESN A;  1DPE A;  4EDP A;  1BP5 A;  5DW8 A;  5AA2 A;  1NV3 A;  3HST A;  1FRP A;  3PPR A;  4C0R A;  4YAH X;  1D9Y A;  2CZK A;  2V3U A;  4EXL A;  3B6T A;  2PMS A;  3CVG A;  4R74 A;  3IOW A;  2Q2A A;  3SEU A;  1B1X A;  2I4C A;  2WYK A;  3HPI A;  1OMP A;  1IXC A;  4KYS A;  3TTR A;  3PPQ A;  3HHG A;  5EQ9 A;  4DI3 D;  5ISU A;  3LSF B;  3V8X B;  3VVF A;  2BJJ X;  3G7W A;  5I57 A;  1CB6 A;  1P1U A;  3E79 A;  3KJ7 A;  4ZEI A;  4EQ9 A;  2VP1 A;  4OVR A;  5I2N A;  1LBV A;  3DLN A;  2Z23 A;  1NV5 A;  4G8H A;  3T93 B;  4PFB A;  3H03 A;  1B1H A;  1OVB A;  3T9U A;  2OLB A;  4IY5 A;  4DE8 A;  2DOJ A;  3IOV A;  3S9N C;  2IA4 A;  1N76 A;  2JJK A;  1MDQ A;  2RF1 A;  3UN6 A;  3OEM A;  4F29 A;  5J1D A;  3RPL A;  4POX A;  2XXX A;  4G8N A;  5IZ1 A;  3EHS A;  4M4G A;  3IL1 B;  3QXM A;  1FJ9 A;  3OOA A;  3U8Q A;  2OWT A;  4MH5 A;  4GWS A;  5KCJ B;  1USY H;  2O1M A;  3O66 A;  4OVQ A;  3LR1 A;  4PBH A;  2DYX A;  2A5T A;  4PAK A;  4GWZ A;  1VDW A;  1LBB A;  5M2V A;  4TLM B;  2Z22 A;  1Q9D A;  3FGS A;  5AE4 A;  1ZIU A;  4PC9 A;  5KDT A;  4PFT A;  2OWS A;  3MQ9 A;  1DBZ A;  3VLV A;  3QK6 A;  1P1W A;  2PFZ A;  4LVQ A;  2VOZ A;  4MLV A;  1N0T A;  2XWI A;  4OXV A;  5A5X A;  3RUM A;  1UTH A;  4MNC A;  3PPN A;  1XC1 A;  3OD7 A;  4JDF A;  3HN0 A;  2O7U A;  3G3K A;  3UP9 A;  1B40 A;  5I5P A;  2VPO A;  1URG A;  2D21 A;  4BDR A;  2XXU A;  2F7A A;  2WX9 A;  5IKB A;  3RY3 A;  4DDD A;  2E0S A;  1HSL A;  2O84 X;  4PF6 A;  1P1N A;  3K02 A;  2QVR A;  1R9L A;  1OQG A;  4ELQ A;  5K2X A;  2FVZ A;  3VVE A;  4ZEC A;  2Y5K A;  4F3S A;  1UTB A;  3SEV A;  2Y7P A;  1IXG A;  3B7D A;  2QS3 A;  4XIG Q;  3H4Z A;  4ZE9 A;  2R8T A;  3EHU A;  4XKQ A;  3IB1 A;  1GR2 A;  1SBP A;  3SKP A;  4RNS A;  4OEU A;  4LQ2 A;  4BLA A;  4Z7E A;  1LCT A;  1XVX A;  2ZNS A;  2DWI A;  1XS5 A;  5TP9 A;  2P1S A;  3SER A;  3JZJ A;  3C35 A;  5AA4 B;  3MWB A;  3P7I A;  4FED A;  1G0H A;  1QGX A;  1KA0 A;  3CIJ A;  1LBC A;  5FHO A;  4XKR A;  5CRY A;  3T9V A;  4GX6 A;  1I6B A;  4F1Y A;  5TPA A;  3TDJ A;  4H45 A;  4OFO A;  4JB7 A;  5H8Q B;  1POY 1;  4XKN A;  1OLA A;  1MG1 A;  1ZMG A;  3FV1 A;  4QFK A;  4U1Z A;  2O7I A;  3VDF A;  3PMX A;  2XD3 A;  3Q27 A;  3FXR A;  3TCH A;  2ONS A;  2R71 A;  5H8N A;  1FQE A;  3MAM A;  4NTL A;  5DVF A;  4LP2 B;  3B50 A;  4FOR A;  3U92 A;  2ONK E;  2DWJ A;  3MPL A;  2QL3 A;  2O69 A;  2FNC A;  1B3H A; 
#chains in the Genus database with same CATH homology
 4IR8 A;  1NV6 A;  4N8G A;  1LBZ A;  2V4C A;  2CEY A;  1LEV A;  2QPQ A;  1RDZ A;  1SPI A;  4HXV A;  4MAG A;  3KC0 A;  5EQ7 A;  3MST A;  4X04 A;  3LV0 A;  1NV1 A;  2XXK A;  5IGA A;  1YZ0 A;  4MMP A;  1AWB A;  1KZ8 A;  4GWW A;  4F1U A;  4N6D A;  4PAF A;  2HZL A;  4PBQ A;  2Q8M A;  2FIE A;  1IMD A;  2FHY A;  1NUY A;  1YXI A;  4HE0 A;  4OVP A;  4X9T A;  1NUZ A;  1JP4 A;  1NV4 A;  3QMF A;  4N6K A;  4F18 A;  4MNP A;  4I40 A;  4OVS A;  3IFA A;  4YIC A;  5CM6 A;  1FTA A;  1FBG A;  5LDZ A;  3T1B A;  3FBP A;  3EKI A;  2DE2 A;  1YYZ A;  4MJO A;  1G0I A;  5J16 A;  4GWY A;  4OAN A;  4GX4 A;  4I3E A;  4MIJ A;  4P1E A;  1FBE A;  3HFU A;  2ZZV A;  2WYP A;  1FPF A;  2HZK A;  1DCU A;  4GWU A;  2OX3 A;  2XA5 A;  4XF5 A;  4P47 A;  3B8B A;  4NG7 A;  5LTC A;  2WBB A;  4HCW A;  1FBD A;  4MX6 A;  4AS4 A;  1NUW A;  2WEF A;  5IZ3 A;  1FPD A;  2KQZ A;  4KXP A;  1RDY A;  4FBP A;  2B4L A;  3KBZ A;  1IMC A;  1NUX A;  2HXR A;  2ZZW A;  2F5X A;  3PTY A;  5ESY A;  4N4U A;  1FBF A;  2Q74 A;  4QBA A;  4F1V A;  1EYI A;  4PFR A;  3W9V A;  3KC1 A;  4UAB A;  1FPK A;  4NF0 A;  5ET6 A;  5JK4 A;  1EYJ A;  2KR0 A;  4JVC A;  4LN5 A;  3SZP A;  1IME A;  2XWK A;  4PGN A;  2OWZ A;  4GBW A;  4XFE A;  4P9K A;  4X8R A;  4NQ8 A;  4MHF A;  1LBY A;  4M1V A;  4H46 A;  4PF8 A;  2FIX A;  2F3D A;  4GBV A;  4YZZ A;  3MYU A;  5ET5 A;  4MEV A;  2GQ1 A;  3CHG A;  4PCD A;  4AS5 A;  5IZZ A;  5IZ3 B;  2L5V A;  3ROJ A;  5I3S A;  1FJ6 A;  1FPB A;  4O8M A;  1NI9 A;  4PET A;  4NAP A;  5F24 A;  1IMF A;  2BJI A;  2HPG A;  5DW8 A;  1NV3 A;  1FRP A;  3RYD A;  4I3Y A;  2CZK A;  2Q9T A;  1D9Q A;  2WYK A;  4P8B A;  1EYK A;  5EQ9 A;  4DI3 D;  1FPG A;  5FBP A;  4GX3 A;  3E79 A;  1FSA A;  2DE3 A;  2DE4 A;  4OVR A;  1LBV A;  1FPL A;  1NV5 A;  4NN3 A;  2CEX A;  2FBP A;  4PFB A;  2XWO A;  3W9W A;  4O7I A;  5T3J A;  5EQ8 A;  2MKZ A;  2CZI A;  4NHB A;  2JJK A;  2PCR A;  1RDX A;  2QVU A;  1LBX A;  5J1D A;  3RPL A;  2DDK A;  4JVI A;  1INP A;  1FBP A;  2F3B A;  5IZ1 A;  4G61 A;  1IMB A;  4QXD A;  2VT5 A;  2Y5L A;  2CZH A;  2DVZ A;  3E78 A;  1FBC A;  5EYH A;  1FJ9 A;  4GWS A;  3NOH A;  4O7M A;  3A29 A;  4NX1 A;  4HE2 A;  1BK4 A;  1NV0 A;  1XI6 A;  4OVQ A;  4PBH A;  4PAK A;  4GWZ A;  4HE1 A;  1VDW A;  4PDD A;  1Q9D A;  4N17 A;  4OA4 A;  4PC9 A;  2P3V A;  2B4M A;  3D1R A;  1DBZ A;  1LBW A;  2PFZ A;  1FBH A;  2XWI A;  2VPN A;  4N8Y A;  4MNC A;  3RPL B;  3BIH A;  2QVV A;  5I7I A;  4P3L A;  1NV2 A;  5I5P A;  2P3N A;  2VPO A;  1K9Z A;  4PAI A;  1K9Y A;  4F19 A;  2WX9 A;  4PTK A;  5EYG A;  1NV7 A;  1FPI A;  3GYY A;  4PF6 A;  2QVR A;  2FVZ A;  5EQA A;  4NGU A;  4OVT A;  2Y5K A;  4XEQ A;  1KA1 A;  4GWX A;  2R8T A;  4MCO A;  3IFC A;  4JVD A;  4PGP A;  1IMA A;  4PE3 A;  4PDH A;  5ET8 A;  4P1L A;  3U65 A;  1FPJ A;  2V3Q A;  2PFY A;  4N81 A;  1G0H A;  1QGX A;  1KA0 A;  4O94 A;  4DI4 B;  2WBD A;  3FXB A;  4N91 A;  4GX6 A;  5A5L A;  1DK4 A;  2HHM A;  4MNI A;  2ZZX A;  4H45 A;  1CNQ A;  1FPE A;  4P56 A;  2XWV A;  3BIG A;  3LUZ A;  5ET7 A;  4N15 A;  3ISP A;  4HCY A;  5IM2 A;  2QFL A;  3B50 A;  3T0J A;  4PFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...