1AMFA

Crystal structure of moda, a molybdate transport protein, complexed with molybdate
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
231
structure length
231
Chain Sequence
GKITVFAAASLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Binding protein
molecule keywords MOLYBDATE TRANSPORT PROTEIN MODA
publication title Crystal structure of the molybdate binding protein ModA.
pubmed doi rcsb
total genus 75
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 1997-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1amfA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1amfA02
2F36A 3TQLA 1O63A 3OELA 5K2XA 5B7DA 1VR5A 4F1UA 4E0WA 4YAHX 3RY3A 3MWBA 1M5EA 1MQJA 4PE5B 2O68A 3FXQA 3KEIA 1MQHA 2ZMBA 4HTGA 3VLUA 4EF1A 4JSOA 1IITA 3FXRA 4Q30B 3PUYE 1H76A 1R9LA 4IO3A 4F18A 4GQOA 2VD3A 3N94A 1SI0A 2DWIA 4NF6A 3TKDA 1JEUA 2DWAA 2XXYA 2D21A 2QMXA 3MZ1A 3PUZE 3KN3A 3PD9A 4H1XA 1N04A 4GD5A 2WKYA 4I8CA 5I2NB 5H8FA 4YMAA 2RKMA 3TAJA 1D9VA 5DVIA 4X1DA 3K1NA 3TMGA 3IB2A 4ZE8A 1ANFA 1SW5A 4ECFA 5M2VA 1QUKA 4R9FA 1B3HA 4IO5A 1CE2A 2E1SA 2PBWA 1XS5A 1MXXA 4NTLA 2REGA 2QJEA 1GR2A 1B0LA 4BDNA 2I3WA 1NH7A 4ELPA 4NF6B 3LSFB 2Q2CA 4G8NA 2FYIA 3O66A 2Y7RA 3MVYA 3UN6A 2XX8A 3DP6A 4RK2A 4NWDA 2DQVA 4FATA 1EZPA 1CB6A 3VVFA 3G3FA 2F7AA 1BLFA 1QW0A 2O1MA 3OMBA 4RPNA 2Y7PA 5H8QB 3TCGA 2DOJA 1M5DA 4AB6A 1SW2A 2F97A 2RC8A 3MPLA 1PBPA 2QS3A 1BKAA 5CM6A 3QAXA 5HBCA 2W7YA 3SESA 1DSNA 3I5OA 2XXWA 4MH5A 4DIGA 2ALUA 4OYVA 3MZ9A 5CMKA 1MRPA 1HSLA 4OVJA 5H8HB 1ZIUA 3OEMA 1WODA 3BBRA 1OMPA 3R26A 3HPIA 3CFZA 4QFLA 2XXVA 5CRYA 5I59A 4BDLA 3P7IA 2V3TA 1B9JA 4GRKA 4UACA 1Y1MA 5ICQA 3S9LC 3SEWA 1EH3A 3B6QA 2OLBA 3PUWE 2RCAA 3HHFA 4R75A 5EHSA 3DP8A 3V8XB 1DPPA 2I58A 1MY3A 3B7DA 1B3FA 4NF8B 5DVFA 4OESA 4LATA 5KCJA 4OEVA 4DXBA 1WVJA 1NMUA 5CMCA 1XVXA 1O64A 4BDRA 4OXVA 1I69A 2XXQA 3KFMA 1YAEA 3EPEA 4RPOA 4MLQA 3KSJA 1J1NA 3TYHA 1S7YA 3S4UA 4C1TA 4EXKA 1MM6A 2D5WA 3ONMA 4KI0E 4YKJA 5I59B 4IO6A 2GHAA 2V93A 1NFTA 3RNNA 1LFIA 3V83A 1EZ9A 4KPTA 1Y4CA 3CR9A 3N6TA 3PUXE 4TQUQ 1LFGA 3RT8A 3M8UA 2Y7KA 3OEKA 1MH4A 1RKMA 1H3DA 1US4A 3MAMA 3FD3A 3A09A 3TCFA 4R72A 3FATA 2YLNA 4R73A 4OWDA 5KCJB 3SEUA 1AH5A 4FEBA 2RC7A 2R6GE 1LB8A 1NNPA 3VVDA 1SDXA 1B1XA 2F78A 3KG2A 3R7XA 1LLSA 2ZNUA 1MQIA 2HCAA 1SW4A 1A55A 3KZGA 4IB2A 1UIUA 1MDP1 3T66A 4U22A 2HAUA 1DOTA 2I0CA 2DXRA 1LB9A 4LA9A 4EF2A 4YKKA 3M3KA 2VGQA 4F3SA 2Q8JA 3VXBA 3CFXA 4F31B 1UTBA 3I3VA 2I0BA 2HEUA 1Y3PA 5L9MA 3K0VA 1FCKA 2B65A 3TTNA 3W15C 5EYFA 1MY1A 4HS7A 1PEBA 3H03A 1AL3A 2GHBA 3IO6A 1S9TA 2UVJA 3RLFE 4ZEBA 5I56A 1A8FA 4RNSA 4OHNA 3CRBA 4R74A 5CBRA 4F3BA 4JXIA 3E13X 3KN8A 1TWYA 4ELOA 2F7BA 1LCTA 5JEIA 3N5LA 4THIA 3PMWA 3IOUA 1B32A 4G2ZA 4QFOA 3O6GA 3ZKKA 4ELRA 4BLAA 5HPQA 3IK6B 1B3GA 4XIGQ 2XD2A 2FA7A 4PETA 3FUZA 5TP9A 1JNFA 3CSBA 4LP2B 4QHQA 4R2FA 2I6EA 4NE4A 3IAZA 1MPCA 4H67A 1SYIA 3EHSA 4QFKA 3H06B 1LAHE 5I56B 1Y9UA 3TZAA 1UTHA 1FQFA 4EQ7A 3BFUA 1QVSA 1Q35A 1N7WA 4Z7EA 2X26A 4PFWA 3TUSA 2H99A 4EDPA 1DMBA 4G68A 3H6WA 3EF7A 1N3WA 4OQOA 2YPNA 1SYHA 1XHYA 4N13A 3PD8A 1JW1A 2Y7IA 3GZGA 4XKRA 4YB5A 2DXYA 2QS1A 3MP8A 3MPKA 4GLIA 1FQCA 1XVYA 5ICTA 4IGTA 4OTEA 1VSOA 2VHAA 4MFIA 2DE2A 4F2QA 2OWTA 5KZTA 2IA4A 3MW0A 4GVOA 4ELQA 2NXOA 2PVUA 2UXAA 4DLDA 3MVZA 4LVQA 4U1ZA 5I2NA 5F1QA 2NUVA 3QK6A 3VVEA 3UP9A 1D3KA 4G68B 4IY6A 3EHTA 4GXAA 4YU0A 3LC8A 3EN3A 4Q0CA 2X7PA 1DPEA 2HXWA 4RK9A 4YICA 1SI1A 1PBQA 3S9MC 1DTZA 4QSCA 1OLCA 1MXWA 3DLNA 3MVWA 2P2AA 4XTCQ 4LZ5A 1H44A 5TPAA 1ZTYA 2DVZA 3MC2A 1MH3A 2P0SA 5L8DA 4F3PA 3TTLA 3F11A 3O6IA 3UORA 2RC9A 3RTWB 1MXYA 3IJOB 4XKNA 2XXXA 4LQ2A 1B51A 4FECA 1N7XA 5H8QA 3IL1B 1OIBA 1Y3QA 4GWOA 4X1BA 2REJA 3T9XB 4H0WA 2AIXA 3OO9A 3QSLA 3U1OA 3G3HA 1ZBMA 1OLAA 3RUMA 2P1SA 3O97A 3K6UA 3TDJA 4KD5A 4KHZE 4PFYA 4QFNA 3SKPA 3KOTA 2ANJA 3OO7A 4X48A 1MXZA 4ISUA 5TPAB 2G29A 5H8HA 3G3KA 4I9DA 4G68C 1IUDA 3O6HA 5A5XA 3Q25A 4QSEA 3HCQA 4PP0A 3E3KA 3M3LA 3C34A 4ZECA 3IOWA 5I58A 4LQ5A 4L17A 1JVYA 1QJMA 4YMBA 4OERA 2H25A 4G77A 4RA1A 1I6BA 4H5FA 4FIMA 3CG3A 1BTJA 2Z8DA 3RT6B 3PMVA 5DVJA 3O9PA 2F7CA 4XKQA 3S2VA 2O6AA 1B40A 1ZU0A 2Q2AA 3L6GA 4QSDA 5I2KB 2DS9A 1M5CA 4NF8A 3LSXA 2CMOA 1GV8A 3UA8A 5ELVA 2B3FA 4PFUA 5JTYB 1B7HA 2QL3A 1MXUA 4R6KA 3FVNA 3SERA 1B6HA 1URGA 5A5XB 3LSLA 4O3AA 1LSTA 1MY2A 5JK4A 3C9HA 3DELB 2UVGA 5I58B 2HZLA 4H6DA 3FGSA 1MY4A 3OENA 4M1VA 3SEXA 2VD2A 3OSQA 4WEPA 1IXHA 4GL0A 1AIVA 1XT8A 4BDMA 4F1VA 1B5JA 5ITOA 2H4IA 3FXUA 4ZEIA 3UGWA 5I84A 1LAFE 3PPNA 5AA4A 4F19A 4ESXA 3K02A 1H43A 1S50A 2O69A 3IB1A 4JSDA 5F7VA 2RF1A 1NNFA 4EUOA 4U4XA 4QRZA 1FQBA 3ECRA 4X9TA 1B3LA 1B7ZA 5CMBA 3WAEA 2H5YA 1LGBC 4U2RA 4ND9A 2V3QA 2H98A 3T9HB 3VV5A 3H6UA 4ZDMA 1USYE 2ESNA 4IO2A 1OVBA 1B4ZA 4JB7A 3V89B 3USDA 1P1QA 3FASA 4IO7A 2DP8A 2F8DA 4KCDA 5AA2D 5AA4B 1PB9A 1ZKBA 3IOVA 3ODBA 3K6VA 5HM4B 2HQ0A 3FJGA 5CBSA 1B52A 4U21A 4NEDA 3CVGA 3PPOA 1A40A 2GH9A 4RY1A 1VE4A 4NF5A 1IXIA 3OOAA 4GIZA 2Z23A 5DEXB 1JVXA 1VFEA 2O51A 4P0IA 1B3EA 4LUBA 5IAIA 3IR1A 3PPQA 3FIRA 3A3CA 1H45A 5H8SA 2O1LA 3KSXA 3Q27A 4Z0IA 2ZXTA 3UIFA 1D9YA 1M5BA 3PPRA 4DXCA 4OETA 4O3BA 3RN8A 5L9OA 2QRYA 1II5A 2Z8FA 1P1UA 4KCCA 1PB8A 3U93A 2VOZA 4KYEA 3PPPA 1NKXA 1HSEA 2ONSA 4GL8A 3TCHA 2XXRA 4UA8A 2Z22A 1I6QA 4H65A 5BWJA 2OWSA 1Y20A 1FTLA 3O29A 4PQJA 3C4MA 1GVCA 4OFJA 4NF5B 4DZ1A 4H8JA 1QKBA 2ONRA 3G7WA 1MPBA 4FAJA 3C31A 5AA2A 2XX7A 2XD3A 1Q1KA 3TTMA 3HO7A 5DT6A 1A7LA 1N0TA 3PGFA 3MP1A 3DM0A 1PC3A 1QUIA 1QUJA 3GBBA 1JW4A 4DCXA 5FHMA 2LAOA 2QS2A 3THIA 1SBPA 4GF8A 2PYYA 1EU8A 4ZZAA 2M8CA 4ZE9A 1JW5A 3WAFA 1Y4TA 3C35A 1WDNA 5J1DA 3W9VA 5KDTA 3PMXA 4XXUA 3HV1A 1POTA 2THIA 2UVIA 5CC2A 4XKPA 5AA2B 2H9BA 2B3BA 2HAVA 3DP4A 3VDFA 3PUVE 2CZLA 1N84A 3QUFA 3PV0E 3H6TA 5LOMA 4JBZA 2AL4A 2VP1A 2R9JA 3L6HA 1URSA 4EXLA 1OQHA 2QS4A 3MJNA 1SQYA 3I6VA 3JV9A 1SW1A 5L9SA 2F35A 3D4GA 2OK2A 1MDQA 3ZSFA 5ITPA 3MUQA 1NNKA 2X7QA 2FNCA 1R6ZA 4OEUA 4EQ9A 2KLFA 2O7IA 5KDTB 4KR5A 4MBPA 4C1UA 3BKIB 4U23A 1B4HA 2I4BA 4POXA 2QPQA 2F5XA 1P1NA 3SDFA 2AL5A 4YB7A 3TODA 2NWJA 1US5A 2V3UA 4QFPA 5FHOA 4I1DA 2NVUB 3E4RA 2DWHA 2ZYNA 3CIJA 3MP6A 1MG1A 2F6PA 4JDFA 3M3FA 1FTKA 3JZJA 3HN0A 3RQTA 1T0KA 4WEDA 3AXFA 2XX9A 1A99A 1YPNA 4ZZEA 3HSTA 4F3GA 4YKPA 1LCFA 1FTJA 3O28A 1RYOA 4IGRA 3U92A 2UYEA 1XC1A 3V5AA 4NF4A 1MQDA 2F34A 4JWYA 2ZYKA 2Q9TA 3MZBA 1QKAA 3T93B 3T9VA 1R1NA 4NMYA 3OD7A 4OZ9A 3FVOA 4DXUA 2GRVA 4N07A 3W9WA 1PDAA 4R9GA 3LSWA 2AYSA 1AOVA 4DCYA 5DYHA 2OBGA 5I2KA 3BFTA 1ATGA 1A8EA 3O2AA 5B70A 1NL5A 5H8NA 1QULA 4KFQA 5AA1A 1IXCA 4LZ7A 3VFJA 3OXNA 5JTYA 3K6WA 4O3CA 3G3IA 3K01A 2DVCA 4DE8A 1P1WA 3C33A 3FJ7A 1R9QA 3U72A 3ZKLA 3TQWA 1IIWA 1SVXB 1NNTA 1LFHA 4NF4B 1VFDA 4I62A 1F9BA 4K3FA 2DE4A 3Q29A 3ILUB 3KOSA 3T96B 3K1MA 4FE8A 3TFLA 2PX1A 4OFOA 4RXLA 1KWHA 1RYXA 3VLVA 1FTMA 2NOOA 3H7MA 3FV2A 1XOCA 2PT2A 2E0SA 3KN7A 3GXAA 5H8FB 1MXVA 4ZEDA 4Q8RA 1B05A 1B1HA 4ZEKA 1NH8A 4P11A 4DDDA 3B6TA 3IX1A 4MLVA 1IQ7A 5H8NB 4ZEFA 1TXFA 2Q89A 3VXCA 4F39A 4FORA 1LAXA 2ABHA 4FJPA 3C36A 1YCJA 1Y3NA 4MF3A 2Y84A 3TELA 3TPAA 3U94A 4Q5TA 5I57A 4ESWA 4R2BA 1A54A 2V84A 3JYRA 4H5GA 1LBCA 3ILTB 3KGCA 3KBRA 3IO4A 1O7TA 2A5SA 3CFLA 5CI5A 1D4NA 3SEYA 2F6GA 4GOTA 1FQDA 1L5TA 1GTKA 4G4PA 3HHGA 3OSRA 5FTIA 3GBAA 3K1PA 3C32A 4JWXA 2I3VA 3G3GA 2HZKA 2XXHA 3B6WA 4C0RA 3SEVA 1B5HA 1OQGA 3E9XA 5I57B 3MQ9A 4IY5A 3H3GA 3RPWA 4AB5A 3N6UA 1IEJA 1HSJA 5DEXA 3T22A 3U8QA 1ZJLA 1B7UA 3FVGA 1AMFA 2QSXA 3H6VA 3FVKA 5CMMA 1ELJA 1MPDA 2I48A 1OVTA 4LONB 4WKMA 4GFRA 3TEPA 1UQWA 2V25A 2GFEA 1URDA 1TT1A 4F22A 1IXGA 3TTKA 2G93A 1SD3A 3K00A 1POY1 3EHUA 4RJZA 5TU0A 3RTFB 2O84X 1B0HA 4U4SA 3T9UA 4HCWA 4G8MA 1M5FA 3MVXA 1B5IA 1IZ1A 2OZZA 4PFTA 3CSGA 4G8HA 5BUUA 3K4UA 3VE1B 2DWJA 1JEVA 3QIMA 1N76A 1P1OA 3IJXB 5DTBA 4OFLA 2RCBA 2XXPA 1TFDA 1GGGA 2QMWA 4YZZA 1LBBA 4YB6A 1FTOA 2XXUA 4ONYA 1USYH 1N3XA 4KYDA 2O7UA 3KJ7A 5AA3A 4EQBA 2PT1A 3H4ZA 4QF9A 1JETA 3OO6A 4KYSA 5FHNA 4KQPA 2ZNTA 1MY0A 1B58A 2XXTA 3UK4A 3Q26A 4GXSB 4IO4A 3CI8A 4WXJA 1MM7A 4H8IA 1MQGA 2I4CA 3VLWA 2YJPA 4N6PA 3SETA 4HW8A 4NWCA 3S9EA 3OO8A 1JQFA 4R6YA 1DTGA 1FW0A 4OENA 1MS7A 4HCYA 4AQ4A 1I6AA 2UVHA 1FQEA 5AE4A 2IEEA 3LR1A 3S9NC 4F29A 2OJTA 3R6UA 2XHDA 1UTBB 3FV1A 5K2YA 5ISUA 1B46A 3KJTA 2OCUA 2ZNSA 2A5TA 3K6XA 3LUYA 2Q88A 3LBSA 3ZS6A 4BDOA 1LAGE 4E0XA 3EQ1A 2D3IA 1B2HA 2ZYOA 1PB7A 4P0GA 1FQAA 3QXMA 1BIYA 3MBPA 4U1OA 4F2OA 3FZVA 1TFAA 3K2DA 3N26A 3RGYA 2ONKE 1Y1ZA 4FEDA 4R6HA 4RYAA 4LZ8A 4F1YA 2UYFA 2PMSA 2Y7WA 4OMBA 4TLMB 2Z8EA 4YKIA 3FJMA 4POWA 1UIVA 3TTRA 4ZS9A 2BJJX 3IORA 3IOTA 1EZOA 2I49A 1ZLQA 3QYTA 2HFBA 3G3JA 3D4CA 2A5TB 2DE3A 4BDQA 1Z7NE 5TP9B 2ZYMA 2R71A 4TOZA 1P99A 5EHMA 2DSFA 1ZMGA 3CG1A 3PU5A 2RINA 1Z7ME 4M4GA 3GLBA 5FTHA 4TLLB 1BP5A 1YTVA 3QUJA 1UTHB 3IB0A 2DYXA 3A3UA 4JWOA 2XXIA 3Q28A 5IKBA
chains in the Genus database with same CATH superfamily
2F36A 3TQLA 1LBZA 1O63A 1NUWA 3OELA 5K2XA 5B7DA 1KA1A 1VR5A 4F1UA 4E0WA 4YAHX 3RY3A 3MWBA 1M5EA 1MQJA 1NUXA 4PE5B 2O68A 2VPNA 3FXQA 3KEIA 1MQHA 2ZMBA 4HTGA 3VLUA 4EF1A 4JSOA 1IITA 1LBVA 3FXRA 1RDZA 4Q30B 3PUYE 1H76A 1Q9DA 1R9LA 4IO3A 4MNPA 4F18A 4GQOA 2VD3A 3N94A 1SI0A 2DWIA 4NF6A 3TKDA 1JEUA 3FBPA 4NG7A 2XWOA 2DWAA 2XXYA 2D21A 2QMXA 4H46A 3MZ1A 3PUZE 3KN3A 3PD9A 4H1XA 2QFLA 1N04A 4GD5A 4MAGA 2WKYA 4I8CA 5I2NB 5H8FA 4YMAA 2RKMA 3TAJA 1LBWA 1D9VA 5DVIA 4X1DA 3K1NA 3TMGA 3IB2A 4ZE8A 1ANFA 1SW5A 4ECFA 5M2VA 1QUKA 4R9FA 1B3HA 4IO5A 1XI6A 4NX1A 1CE2A 2E1SA 2PBWA 4HE0A 1XS5A 1EYJA 1MXXA 4NTLA 2REGA 4OVSA 2QJEA 1GR2A 1B0LA 4BDNA 2I3WA 1NH7A 4ELPA 4NF6B 3LSFB 2Q2CA 4G8NA 2FYIA 3O66A 1LEVA 2Y7RA 3MVYA 2VPOA 3UN6A 2XX8A 3DP6A 4RK2A 4NWDA 2DQVA 4FATA 4I40A 4GWZA 4HE2A 4N6KA 4PAFA 1EZPA 1CB6A 3VVFA 3G3FA 4MNIA 2F7AA 1BLFA 1QW0A 2O1MA 3OMBA 4RPNA 2Y7PA 4MIJA 5H8QB 3TCGA 2DOJA 1M5DA 2QVVA 4PBQA 4AB6A 1SW2A 2F97A 2WX9A 2RC8A 3MPLA 1PBPA 4H45A 3A29A 2QS3A 4GBWA 1BKAA 5CM6A 3QAXA 5HBCA 2W7YA 3SESA 4O7MA 1DSNA 3I5OA 2XXWA 4MH5A 4DIGA 2ALUA 4OYVA 3MZ9A 5CMKA 1MRPA 2WYPA 1HSLA 4OVJA 5ET8A 5H8HB 1ZIUA 1FBFA 3OEMA 1WODA 3BBRA 1OMPA 4GWSA 4X8RA 3R26A 3HPIA 3CFZA 2V4CA 2WYKA 4QFLA 2XXVA 5CRYA 5I59A 4BDLA 3P7IA 2V3TA 1B9JA 1NI9A 4GRKA 4UACA 1Y1MA 5ICQA 3S9LC 3SEWA 1EH3A 3B6QA 2OLBA 3PUWE 2RCAA 3HHFA 4R75A 5EHSA 3DP8A 3V8XB 1DPPA 5EQAA 2I58A 1MY3A 3B7DA 1IMCA 1B3FA 4NF8B 5DVFA 4OESA 4NHBA 4LATA 5KCJA 4OEVA 1WVJA 5CMCA 1NMUA 4DXBA 1XVXA 1O64A 4BDRA 4OXVA 1FRPA 1I69A 2XXQA 3KFMA 1YAEA 3EPEA 4RPOA 4OVRA 4MLQA 3KSJA 2WBBA 1J1NA 4MNCA 3TYHA 1S7YA 3S4UA 4C1TA 4EXKA 1MM6A 2D5WA 3ONMA 4OVTA 4KI0E 4YKJA 5I59B 4IO6A 2GHAA 2V93A 1NFTA 3RNNA 1LFIA 3V83A 1EZ9A 4PFIA 4KPTA 1Y4CA 3CR9A 4N8YA 3N6TA 3PUXE 4TQUQ 1LFGA 3RT8A 3M8UA 2Y7KA 3OEKA 2FIEA 1MH4A 1RKMA 1H3DA 2KR0A 1US4A 3MAMA 3FD3A 1YYZA 3A09A 3TCFA 4R72A 3FATA 2YLNA 4R73A 4OWDA 5KCJB 3SEUA 1AH5A 1KA0A 1FBHA 5IZ3B 4FEBA 2RC7A 2R6GE 1LB8A 1NNPA 3VVDA 1SDXA 1B1XA 2F78A 3KG2A 4NF0A 3R7XA 1LLSA 4GWWA 2ZNUA 1MQIA 2HCAA 1SW4A 1A55A 3KZGA 4IB2A 1G0IA 1UIUA 1MDP1 3T66A 4U22A 2HAUA 1DOTA 2I0CA 5ET7A 3PTYA 2DXRA 1LB9A 4LA9A 4EF2A 4YKKA 3M3KA 2VGQA 2XXKA 4F3SA 2Q8JA 3VXBA 3CFXA 2WEFA 4F31B 1UTBA 1FPFA 3I3VA 2I0BA 2HEUA 1Y3PA 5L9MA 3K0VA 1FCKA 4PGNA 2B65A 3TTNA 3W15C 5EYFA 1MY1A 4HS7A 1PEBA 3H03A 1AL3A 2GHBA 3IO6A 1S9TA 2UVJA 3RLFE 4ZEBA 5I56A 1A8FA 4RNSA 5IGAA 2F3BA 4OHNA 2CEXA 4AS4A 3CRBA 4R74A 4GWUA 4O94A 5CBRA 3E13X 4JXIA 4F3BA 3KN8A 1TWYA 4ELOA 2F7BA 1LCTA 5EYHA 5JEIA 3N5LA 4THIA 3PMWA 3IOUA 3RPLA 1B32A 4G2ZA 4QFOA 3O6GA 2B4LA 3E78A 3ZKKA 4N91A 4ELRA 4BLAA 1DCUA 5HPQA 4OVQA 3IK6B 1B3GA 4XIGQ 2XD2A 2FA7A 4LN5A 4PETA 3FUZA 4KXPA 5TP9A 1JNFA 3CSBA 4LP2B 2F3DA 4QHQA 4R2FA 2I6EA 4NE4A 3IAZA 1MPCA 4H67A 1SYIA 3EHSA 4QFKA 3H06B 1LAHE 5I56B 1Y9UA 3TZAA 1UTHA 1FQFA 4EQ7A 5I3SA 3BFUA 1QVSA 1Q35A 1N7WA 2QVRA 4Z7EA 4MCOA 2X26A 4PFWA 3TUSA 2H99A 4EDPA 1DMBA 4G68A 3H6WA 4QBAA 3EF7A 1N3WA 4OQOA 2YPNA 1SYHA 1XHYA 4PDDA 4N13A 3PD8A 1JW1A 2Y7IA 3GZGA 4XKRA 4YB5A 2DXYA 2QS1A 3MP8A 4N4UA 3MPKA 4GLIA 1FQCA 1XVYA 1FPGA 5ICTA 4IGTA 4OTEA 1VSOA 2VHAA 4NN3A 5LTCA 4MFIA 4GX3A 2DE2A 4F2QA 2OWTA 5KZTA 2IA4A 3MW0A 2GQ1A 4GVOA 4ELQA 2NXOA 1KZ8A 2PVUA 2P3NA 2UXAA 4DLDA 3MVZA 4LVQA 4U1ZA 5I2NA 5F1QA 2NUVA 3QK6A 1FBCA 3VVEA 3UP9A 1D3KA 4G68B 4IY6A 3EHTA 4GXAA 4YU0A 3LC8A 3MYUA 3EN3A 4Q0CA 2X7PA 1DPEA 2HXWA 1IMEA 4RK9A 4YICA 2Q74A 1SI1A 1PBQA 1FPBA 5EQ7A 3S9MC 1DTZA 4QSCA 1OLCA 1MXWA 3DLNA 5IM2A 3MVWA 2P2AA 4P9KA 4XTCQ 4LZ5A 4MEVA 4I3EA 1H44A 4HE1A 5TPAA 1ZTYA 2DVZA 3MC2A 1MH3A 3U65A 2P0SA 5L8DA 4F3PA 3TTLA 3F11A 3O6IA 3UORA 2RC9A 3RTWB 1MXYA 3IJOB 4XKNA 2XXXA 4LQ2A 1B51A 4FECA 1N7XA 5H8QA 1AWBA 3T0JA 3IL1B 1OIBA 1Y3QA 4GWOA 4X1BA 2REJA 3T9XB 4H0WA 2AIXA 3OO9A 3QSLA 3U1OA 2CEYA 3HFUA 3G3HA 1ZBMA 1OLAA 3RUMA 2P1SA 3O97A 3K6UA 3TDJA 4KD5A 3SZPA 4KHZE 4PFYA 5T3JA 4QFNA 3SKPA 3KOTA 2ANJA 3OO7A 4X48A 4N15A 1MXZA 4ISUA 5TPAB 2B4MA 2G29A 5H8HA 3G3KA 4I9DA 4G68C 1IUDA 3O6HA 5A5XA 2PFZA 2FBPA 3Q25A 4QSEA 3HCQA 4PP0A 3E3KA 1RDYA 3M3LA 4MMPA 3C34A 4ZECA 2Y5LA 2JJKA 3IOWA 5I58A 4LQ5A 4PDHA 4L17A 1CNQA 1JVYA 1QJMA 4YMBA 4OERA 2H25A 4G77A 4RA1A 1I6BA 4H5FA 4FIMA 4XF5A 3CG3A 1BTJA 2Z8DA 3RT6B 1NV1A 3PMVA 5DVJA 3O9PA 2F7CA 4XKQA 3S2VA 2O6AA 1B40A 1ZU0A 2Q2AA 4DI4B 3L6GA 4QSDA 5I2KB 2DS9A 1M5CA 4NF8A 3LSXA 2CMOA 4JVIA 1GV8A 3UA8A 5ELVA 2B3FA 4PFUA 5F24A 5JTYB 1B7HA 1QGXA 4GX6A 1NV4A 2QL3A 1MXUA 4R6KA 3FVNA 5IZZA 3SERA 4PE3A 1B6HA 4PFRA 1URGA 5A5XB 3LSLA 4O3AA 1LSTA 1MY2A 5JK4A 3C9HA 4P3LA 1D9QA 2FVZA 3DELB 2UVGA 5I58B 2HZLA 4H6DA 3FGSA 1NV6A 2L5VA 5J16A 4N8GA 3EKIA 1MY4A 3OENA 4M1VA 3SEXA 2VD2A 3OSQA 4WEPA 1IXHA 4GL0A 1AIVA 1XT8A 4BDMA 4F1VA 1B5JA 4HXVA 5IZ1A 5ITOA 2Q8MA 2H4IA 3FXUA 4ZEIA 3IFAA 3UGWA 5I84A 1LAFE 3PPNA 5AA4A 4F19A 4ESXA 4NAPA 3K02A 2HPGA 3LUZA 1H43A 1S50A 2O69A 5IZ3A 2XWIA 3IB1A 4FBPA 4JSDA 5F7VA 2RF1A 1NNFA 4EUOA 4PTKA 4U4XA 5DW8A 1FPDA 4QRZA 1EYKA 1FQBA 3ECRA 4X9TA 1B3LA 1B7ZA 5CMBA 3WAEA 1YXIA 2H5YA 1LGBC 2XWKA 4U2RA 4ND9A 2V3QA 2H98A 2R8TA 3T9HB 3VV5A 3H6UA 3CHGA 4ZDMA 1USYE 1K9ZA 2ZZWA 4JVCA 2ESNA 4IO2A 1DBZA 2HHMA 1FPJA 1OVBA 1B4ZA 4JB7A 3V89B 3USDA 4OA4A 1P1QA 3FASA 4IO7A 3BIHA 2DP8A 4PBHA 2F8DA 4KCDA 5AA2D 5AA4B 1PB9A 3MSTA 1ZKBA 3IOVA 3ODBA 4PCDA 3K6VA 5HM4B 4O7IA 2HQ0A 3FJGA 5CBSA 1B52A 4U21A 1FPIA 4NEDA 3CVGA 3PPOA 1A40A 2GH9A 4RY1A 1VE4A 4NF5A 1IXIA 3OOAA 4GIZA 3E79A 2Z23A 4MHFA 1LBXA 5DEXB 1JVXA 1VFEA 2O51A 2ZZVA 4P0IA 1B3EA 4LUBA 5IAIA 3IR1A 3PPQA 3FIRA 3A3CA 1H45A 5H8SA 2O1LA 3KSXA 3Q27A 4Z0IA 2ZXTA 3UIFA 1D9YA 1M5BA 3PPRA 4DXCA 4AS5A 4OETA 4O3BA 3RN8A 5L9OA 4GWXA 2QRYA 1II5A 2Z8FA 1P1UA 4KCCA 1PB8A 3U93A 2VOZA 4KYEA 3PPPA 4PF6A 1NKXA 1HSEA 2ONSA 4GL8A 3TCHA 3LV0A 2XXRA 4UA8A 2Z22A 1I6QA 4H65A 5BWJA 2OWSA 1Y20A 1FTLA 3O29A 4PQJA 3C4MA 4PAKA 4OFJA 1GVCA 4NF5B 4DZ1A 4H8JA 1QKBA 2ONRA 2KQZA 3G7WA 1MPBA 2WBDA 4FAJA 3QMFA 3C31A 5AA2A 2XX7A 2XD3A 1Q1KA 3TTMA 3HO7A 4GWYA 5DT6A 1A7LA 1N0TA 3PGFA 3MP1A 3DM0A 4G61A 1PC3A 1QUIA 1QUJA 3GBBA 5ESYA 1JW4A 4DCXA 5FHMA 2LAOA 2QS2A 3THIA 4PFBA 1SBPA 4GF8A 3KC0A 2PYYA 1EU8A 4ZZAA 2CZKA 2M8CA 4ZE9A 1EYIA 1JW5A 3WAFA 1Y4TA 3C35A 1WDNA 5J1DA 5EYGA 3W9VA 5KDTA 3PMXA 4XXUA 3HV1A 1POTA 2THIA 2UVIA 4P47A 5FBPA 5CC2A 4XKPA 5AA2B 2H9BA 2B3BA 2HAVA 3DP4A 3VDFA 3PUVE 2CZLA 1N84A 3QUFA 5A5LA 3PV0E 3H6TA 5LOMA 4JBZA 2AL4A 2VP1A 2R9JA 3L6HA 1URSA 4EXLA 1OQHA 2QS4A 3MJNA 1SQYA 3I6VA 3JV9A 1SW1A 5L9SA 2F35A 3D4GA 2OK2A 4XFEA 1MDQA 3ZSFA 5ITPA 2P3VA 3MUQA 1NNKA 2X7QA 2FNCA 1R6ZA 4OEUA 4EQ9A 2KLFA 2O7IA 4O8MA 5KDTB 5I5PA 4KR5A 4MBPA 4C1UA 4N6DA 4DI3D 3BKIB 1FBPA 4U23A 1B4HA 2I4BA 1YZ0A 4POXA 2QPQA 4UABA 2F5XA 1P1NA 3SDFA 2AL5A 4YB7A 3TODA 2NWJA 1US5A 2V3UA 4QFPA 5FHOA 4I1DA 2NVUB 3E4RA 3ROJA 2DWHA 2ZYNA 3CIJA 3MP6A 1MG1A 2F6PA 4JDFA 1NV7A 3M3FA 1FTKA 3JZJA 3HN0A 3RQTA 1T0KA 4WEDA 3AXFA 2XX9A 1DK4A 1A99A 1YPNA 4ZZEA 1FPKA 4NQ8A 2QVUA 3HSTA 1FBGA 4YKPA 4F3GA 1LCFA 1FTJA 3O28A 1RYOA 4IGRA 4P8BA 3U92A 2UYEA 1XC1A 3V5AA 4NF4A 1MQDA 4XEQA 2F34A 4JWYA 2ZYKA 3ISPA 3T1BA 4GBVA 2Q9TA 3MZBA 1QKAA 3T93B 3T9VA 1R1NA 4NMYA 3OD7A 4OZ9A 3FVOA 4DXUA 2GRVA 4N07A 3W9WA 1PDAA 4R9GA 3LSWA 2AYSA 1AOVA 4DCYA 5DYHA 2OBGA 5I2KA 3BFTA 1ATGA 1A8EA 4P1EA 3O2AA 5B70A 1NL5A 5H8NA 1QULA 4KFQA 5AA1A 1IXCA 4LZ7A 3VFJA 3OXNA 5JTYA 3K6WA 4O3CA 4MJOA 3G3IA 3K01A 3GYYA 3B8BA 2DVCA 4DE8A 1P1WA 4P1LA 3C33A 2HXRA 3FJ7A 1R9QA 3U72A 3ZKLA 3TQWA 1IIWA 1SVXB 1NNTA 1LFHA 4NF4B 1VFDA 4I62A 1F9BA 4K3FA 2DE4A 5ET6A 3Q29A 3ILUB 3KOSA 3KC1A 3T96B 3K1MA 4FE8A 3TFLA 2PX1A 4OFOA 4RXLA 1KWHA 4QXDA 1RYXA 3VLVA 1FTMA 2NOOA 3H7MA 3FV2A 1XOCA 2PT2A 2E0SA 3KN7A 3GXAA 1NV0A 5H8FB 1MXVA 4ZEDA 4Q8RA 1B05A 1FJ9A 1B1HA 4ZEKA 1NUZA 1NH8A 4P11A 4DDDA 3B6TA 3IX1A 4MLVA 1IQ7A 5H8NB 4ZEFA 1TXFA 2Q89A 3VXCA 2CZIA 4F39A 2PFYA 4FORA 1LAXA 2ABHA 4FJPA 3C36A 1YCJA 1Y3NA 4MF3A 4IR8A 2Y84A 3TELA 3TPAA 3D1RA 3U94A 4Q5TA 5I57A 4ESWA 4R2BA 1A54A 2V84A 3JYRA 1IMAA 4H5GA 1LBCA 3RYDA 3ILTB 3KGCA 3KBRA 3IO4A 1O7TA 2A5SA 3CFLA 5CI5A 1D4NA 5EQ9A 3SEYA 2F6GA 4GOTA 1FQDA 1L5TA 1GTKA 4G4PA 3HHGA 3OSRA 5FTIA 3GBAA 3K1PA 4P56A 3C32A 4JWXA 1FJ6A 2I3VA 2FHYA 3G3GA 2HZKA 2XXHA 1FBDA 3B6WA 4C0RA 3SEVA 1B5HA 1OQGA 3E9XA 5I57B 3MQ9A 2XWVA 3KBZA 4IY5A 4NGUA 3H3GA 3RPWA 2OWZA 4AB5A 3N6UA 1IEJA 1HSJA 5DEXA 3T22A 3U8QA 3B50A 1FSAA 1ZJLA 1B7UA 3FVGA 1JP4A 1K9YA 4I3YA 1AMFA 2QSXA 4MX6A 3H6VA 3FVKA 5CMMA 1ELJA 1MPDA 2MKZA 2I48A 1OVTA 4LONB 2PCRA 4GX4A 4WKMA 4GFRA 3TEPA 1UQWA 2V25A 2OX3A 2GFEA 1URDA 1TT1A 1BK4A 4F22A 1IXGA 3TTKA 2G93A 1SD3A 3K00A 1POY1 2FIXA 3EHUA 4RJZA 2VT5A 5TU0A 5I7IA 3RTFB 2O84X 1B0HA 1NV2A 4U4SA 1IMBA 3T9UA 4HCWA 4G8MA 5EQ8A 1M5FA 3MVXA 4PC9A 1B5IA 1IZ1A 2OZZA 4PFTA 3CSGA 4G8HA 5BUUA 3K4UA 1NUYA 3VE1B 2DWJA 1JEVA 3QIMA 1N76A 1P1OA 3IJXB 5DTBA 4OFLA 2RCBA 2XXPA 1TFDA 1GGGA 2QMWA 4YZZA 1LBBA 4YB6A 1FTOA 2XXUA 4ONYA 1USYH 1N3XA 4KYDA 2O7UA 3KJ7A 5AA3A 4EQBA 2PT1A 3H4ZA 4OVPA 4QF9A 1NV5A 1JETA 3OO6A 4PAIA 4KYSA 5FHNA 4KQPA 2ZNTA 2XA5A 1MY0A 1B58A 2XXTA 3UK4A 3Q26A 4GXSB 4IO4A 3CI8A 4WXJA 1MM7A 4H8IA 1MQGA 2I4CA 3VLWA 2YJPA 4N6PA 3SETA 4HW8A 1FTAA 4PF8A 4NWCA 1FPEA 4JVDA 1FPLA 3S9EA 3OO8A 1JQFA 4R6YA 1DTGA 3BIGA 1FW0A 4OENA 1MS7A 4HCYA 4AQ4A 1I6AA 2UVHA 1FQEA 5AE4A 2ZZXA 2IEEA 3LR1A 3S9NC 4F29A 2OJTA 3R6UA 2XHDA 1UTBB 1G0HA 4N81A 3FV1A 5K2YA 5ISUA 1B46A 3KJTA 2OCUA 2ZNSA 2A5TA 3K6XA 1NV3A 3LUYA 1IMDA 2Q88A 2BJIA 1RDXA 3LBSA 3ZS6A 4BDOA 1LAGE 2DDKA 4E0XA 3EQ1A 2D3IA 1LBYA 2CZHA 1B2HA 2ZYOA 1IMFA 1PB7A 4P0GA 1FQAA 3QXMA 1BIYA 3MBPA 4U1OA 4F2OA 3FZVA 1TFAA 3K2DA 3N26A 3RGYA 2ONKE 1VDWA 1Y1ZA 4FEDA 4R6HA 5LDZA 4RYAA 4LZ8A 4F1YA 2UYFA 2PMSA 2Y7WA 4PGPA 3FXBA 1FBEA 4OMBA 4TLMB 2Z8EA 3RPLB 4YKIA 3FJMA 4POWA 1UIVA 3TTRA 5ET5A 4OANA 4ZS9A 2BJJX 3IORA 3IOTA 1EZOA 2I49A 1ZLQA 3QYTA 2HFBA 2Y5KA 3G3JA 3D4CA 2A5TB 2DE3A 4BDQA 1Z7NE 1SPIA 5TP9B 2ZYMA 2R71A 3IFCA 4TOZA 1P99A 5EHMA 4X04A 2DSFA 1ZMGA 3CG1A 3PU5A 2RINA 1Z7ME 4M4GA 3GLBA 5FTHA 3NOHA 4TLLB 1BP5A 4N17A 1YTVA 3QUJA 1UTHB 3IB0A 2DYXA 3A3UA 4JWOA 1INPA 2XXIA 3Q28A 5IKBA
chains in the Genus database with same CATH topology
2F36A 3TQLA 1O63A 3OELA 5K2XA 5B7DA 1VR5A 4F1UA 4E0WA 4YAHX 3RY3A 3MWBA 1M5EA 1MQJA 4PE5B 2O68A 3FXQA 3KEIA 1MQHA 2ZMBA 4HTGA 3VLUA 4EF1A 4JSOA 1IITA 3FXRA 4Q30B 3PUYE 1H76A 1R9LA 4IO3A 4F18A 4GQOA 2VD3A 3N94A 1SI0A 2DWIA 4NF6A 3TKDA 1JEUA 2DWAA 2XXYA 2D21A 2QMXA 3MZ1A 3PUZE 3KN3A 3PD9A 4H1XA 1N04A 4GD5A 2WKYA 4I8CA 5I2NB 5H8FA 4YMAA 2RKMA 3TAJA 1D9VA 5DVIA 4X1DA 3K1NA 3TMGA 3IB2A 4ZE8A 1ANFA 1SW5A 4ECFA 5M2VA 1QUKA 4R9FA 1B3HA 4IO5A 1CE2A 2E1SA 2PBWA 1XS5A 1MXXA 4NTLA 2REGA 2QJEA 1GR2A 1B0LA 4BDNA 2I3WA 1NH7A 4ELPA 4NF6B 3LSFB 2Q2CA 4G8NA 2FYIA 3O66A 2Y7RA 3MVYA 3UN6A 2XX8A 3DP6A 4RK2A 4NWDA 2DQVA 4FATA 1EZPA 1CB6A 3VVFA 3G3FA 2F7AA 1BLFA 1QW0A 2O1MA 3OMBA 4RPNA 2Y7PA 5H8QB 3TCGA 2DOJA 1M5DA 4AB6A 1SW2A 2F97A 2RC8A 3MPLA 1PBPA 2QS3A 1BKAA 5CM6A 3QAXA 5HBCA 2W7YA 3SESA 1DSNA 3I5OA 2XXWA 4MH5A 4DIGA 2ALUA 4OYVA 3MZ9A 5CMKA 1MRPA 1HSLA 4OVJA 5H8HB 1ZIUA 3OEMA 1WODA 3BBRA 1OMPA 3R26A 3HPIA 3CFZA 4QFLA 2XXVA 5CRYA 5I59A 4BDLA 3P7IA 2V3TA 1B9JA 4GRKA 4UACA 1Y1MA 5ICQA 3S9LC 3SEWA 1EH3A 3B6QA 2OLBA 3PUWE 2RCAA 3HHFA 4R75A 5EHSA 3DP8A 3V8XB 1DPPA 2I58A 1MY3A 3B7DA 1B3FA 4NF8B 5DVFA 4OESA 4LATA 5KCJA 4OEVA 4DXBA 1WVJA 1NMUA 5CMCA 1XVXA 1O64A 4BDRA 4OXVA 1I69A 2XXQA 3KFMA 1YAEA 3EPEA 4RPOA 4MLQA 3KSJA 1J1NA 3TYHA 1S7YA 3S4UA 4C1TA 4EXKA 1MM6A 2D5WA 3ONMA 4KI0E 4YKJA 5I59B 4IO6A 2GHAA 2V93A 1NFTA 3RNNA 1LFIA 3V83A 1EZ9A 4KPTA 1Y4CA 3CR9A 3N6TA 3PUXE 4TQUQ 1LFGA 3RT8A 3M8UA 2Y7KA 3OEKA 1MH4A 1RKMA 1H3DA 1US4A 3MAMA 3FD3A 3A09A 3TCFA 4R72A 3FATA 2YLNA 4R73A 4OWDA 5KCJB 3SEUA 1AH5A 4FEBA 2RC7A 2R6GE 1LB8A 1NNPA 3VVDA 1SDXA 1B1XA 2F78A 3KG2A 3R7XA 1LLSA 2ZNUA 1MQIA 2HCAA 1SW4A 1A55A 3KZGA 4IB2A 1UIUA 1MDP1 3T66A 4U22A 2HAUA 1DOTA 2I0CA 2DXRA 1LB9A 4LA9A 4EF2A 4YKKA 3M3KA 2VGQA 4F3SA 2Q8JA 3VXBA 3CFXA 4F31B 1UTBA 3I3VA 2I0BA 2HEUA 1Y3PA 5L9MA 3K0VA 1FCKA 2B65A 3TTNA 3W15C 5EYFA 1MY1A 4HS7A 1PEBA 3H03A 1AL3A 2GHBA 3IO6A 1S9TA 2UVJA 3RLFE 4ZEBA 5I56A 1A8FA 4RNSA 4OHNA 3CRBA 4R74A 5CBRA 4F3BA 4JXIA 3E13X 3KN8A 1TWYA 4ELOA 2F7BA 1LCTA 5JEIA 3N5LA 4THIA 3PMWA 3IOUA 1B32A 4G2ZA 4QFOA 3O6GA 3ZKKA 4ELRA 4BLAA 5HPQA 3IK6B 1B3GA 4XIGQ 2XD2A 2FA7A 4PETA 3FUZA 5TP9A 1JNFA 3CSBA 4LP2B 4QHQA 4R2FA 2I6EA 4NE4A 3IAZA 1MPCA 4H67A 1SYIA 3EHSA 4QFKA 3H06B 1LAHE 5I56B 1Y9UA 3TZAA 1UTHA 1FQFA 4EQ7A 3BFUA 1QVSA 1Q35A 1N7WA 4Z7EA 2X26A 4PFWA 3TUSA 2H99A 4EDPA 1DMBA 4G68A 3H6WA 3EF7A 1N3WA 4OQOA 2YPNA 1SYHA 1XHYA 4N13A 3PD8A 1JW1A 2Y7IA 3GZGA 4XKRA 4YB5A 2DXYA 2QS1A 3MP8A 3MPKA 4GLIA 1FQCA 1XVYA 5ICTA 4IGTA 4OTEA 1VSOA 2VHAA 4MFIA 2DE2A 4F2QA 2OWTA 5KZTA 2IA4A 3MW0A 4GVOA 4ELQA 2NXOA 2PVUA 2UXAA 4DLDA 3MVZA 4LVQA 4U1ZA 5I2NA 5F1QA 2NUVA 3QK6A 3VVEA 3UP9A 1D3KA 4G68B 4IY6A 3EHTA 4GXAA 4YU0A 3LC8A 3EN3A 4Q0CA 2X7PA 1DPEA 2HXWA 4RK9A 4YICA 1SI1A 1PBQA 3S9MC 1DTZA 4QSCA 1OLCA 1MXWA 3DLNA 3MVWA 2P2AA 4XTCQ 4LZ5A 1H44A 5TPAA 1ZTYA 2DVZA 3MC2A 1MH3A 2P0SA 5L8DA 4F3PA 3TTLA 3F11A 3O6IA 3UORA 2RC9A 3RTWB 1MXYA 3IJOB 4XKNA 2XXXA 4LQ2A 1B51A 4FECA 1N7XA 5H8QA 3IL1B 1OIBA 1Y3QA 4GWOA 4X1BA 2REJA 3T9XB 4H0WA 2AIXA 3OO9A 3QSLA 3U1OA 3G3HA 1ZBMA 1OLAA 3RUMA 2P1SA 3O97A 3K6UA 3TDJA 4KD5A 4KHZE 4PFYA 4QFNA 3SKPA 3KOTA 2ANJA 3OO7A 4X48A 1MXZA 4ISUA 5TPAB 2G29A 5H8HA 3G3KA 4I9DA 4G68C 1IUDA 3O6HA 5A5XA 3Q25A 4QSEA 3HCQA 4PP0A 3E3KA 3M3LA 3C34A 4ZECA 3IOWA 5I58A 4LQ5A 4L17A 1JVYA 1QJMA 4YMBA 4OERA 2H25A 4G77A 4RA1A 1I6BA 4H5FA 4FIMA 3CG3A 1BTJA 2Z8DA 3RT6B 3PMVA 5DVJA 3O9PA 2F7CA 4XKQA 3S2VA 2O6AA 1B40A 1ZU0A 2Q2AA 3L6GA 4QSDA 5I2KB 2DS9A 1M5CA 4NF8A 3LSXA 2CMOA 1GV8A 3UA8A 5ELVA 2B3FA 4PFUA 5JTYB 1B7HA 2QL3A 1MXUA 4R6KA 3FVNA 3SERA 1B6HA 1URGA 5A5XB 3LSLA 4O3AA 1LSTA 1MY2A 5JK4A 3C9HA 3DELB 2UVGA 5I58B 2HZLA 4H6DA 3FGSA 1MY4A 3OENA 4M1VA 3SEXA 2VD2A 3OSQA 4WEPA 1IXHA 4GL0A 1AIVA 1XT8A 4BDMA 4F1VA 1B5JA 5ITOA 2H4IA 3FXUA 4ZEIA 3UGWA 5I84A 1LAFE 3PPNA 5AA4A 4F19A 4ESXA 3K02A 1H43A 1S50A 2O69A 3IB1A 4JSDA 5F7VA 2RF1A 1NNFA 4EUOA 4U4XA 4QRZA 1FQBA 3ECRA 4X9TA 1B3LA 1B7ZA 5CMBA 3WAEA 2H5YA 1LGBC 4U2RA 4ND9A 2V3QA 2H98A 3T9HB 3VV5A 3H6UA 4ZDMA 1USYE 2ESNA 4IO2A 1OVBA 1B4ZA 4JB7A 3V89B 3USDA 1P1QA 3FASA 4IO7A 2DP8A 2F8DA 4KCDA 5AA2D 5AA4B 1PB9A 1ZKBA 3IOVA 3ODBA 3K6VA 5HM4B 2HQ0A 3FJGA 5CBSA 1B52A 4U21A 4NEDA 3CVGA 3PPOA 1A40A 2GH9A 4RY1A 1VE4A 4NF5A 1IXIA 3OOAA 4GIZA 2Z23A 5DEXB 1JVXA 1VFEA 2O51A 4P0IA 1B3EA 4LUBA 5IAIA 3IR1A 3PPQA 3FIRA 3A3CA 1H45A 5H8SA 2O1LA 3KSXA 3Q27A 4Z0IA 2ZXTA 3UIFA 1D9YA 1M5BA 3PPRA 4DXCA 4OETA 4O3BA 3RN8A 5L9OA 2QRYA 1II5A 2Z8FA 1P1UA 4KCCA 1PB8A 3U93A 2VOZA 4KYEA 3PPPA 1NKXA 1HSEA 2ONSA 4GL8A 3TCHA 2XXRA 4UA8A 2Z22A 1I6QA 4H65A 5BWJA 2OWSA 1Y20A 1FTLA 3O29A 4PQJA 3C4MA 1GVCA 4OFJA 4NF5B 4DZ1A 4H8JA 1QKBA 2ONRA 3G7WA 1MPBA 4FAJA 3C31A 5AA2A 2XX7A 2XD3A 1Q1KA 3TTMA 3HO7A 5DT6A 1A7LA 1N0TA 3PGFA 3MP1A 3DM0A 1PC3A 1QUIA 1QUJA 3GBBA 1JW4A 4DCXA 5FHMA 2LAOA 2QS2A 3THIA 1SBPA 4GF8A 2PYYA 1EU8A 4ZZAA 2M8CA 4ZE9A 1JW5A 3WAFA 1Y4TA 3C35A 1WDNA 5J1DA 3W9VA 5KDTA 3PMXA 4XXUA 3HV1A 1POTA 2THIA 2UVIA 5CC2A 4XKPA 5AA2B 2H9BA 2B3BA 2HAVA 3DP4A 3VDFA 3PUVE 2CZLA 1N84A 3QUFA 3PV0E 3H6TA 5LOMA 4JBZA 2AL4A 2VP1A 2R9JA 3L6HA 1URSA 4EXLA 1OQHA 2QS4A 3MJNA 1SQYA 3I6VA 3JV9A 1SW1A 5L9SA 2F35A 3D4GA 2OK2A 1MDQA 3ZSFA 5ITPA 3MUQA 1NNKA 2X7QA 2FNCA 1R6ZA 4OEUA 4EQ9A 2KLFA 2O7IA 5KDTB 4KR5A 4MBPA 4C1UA 3BKIB 4U23A 1B4HA 2I4BA 4POXA 2QPQA 2F5XA 1P1NA 3SDFA 2AL5A 4YB7A 3TODA 2NWJA 1US5A 2V3UA 4QFPA 5FHOA 4I1DA 2NVUB 3E4RA 2DWHA 2ZYNA 3CIJA 3MP6A 1MG1A 2F6PA 4JDFA 3M3FA 1FTKA 3JZJA 3HN0A 3RQTA 1T0KA 4WEDA 3AXFA 2XX9A 1A99A 1YPNA 4ZZEA 3HSTA 4F3GA 4YKPA 1LCFA 1FTJA 3O28A 1RYOA 4IGRA 3U92A 2UYEA 1XC1A 3V5AA 4NF4A 1MQDA 2F34A 4JWYA 2ZYKA 2Q9TA 3MZBA 1QKAA 3T93B 3T9VA 1R1NA 4NMYA 3OD7A 4OZ9A 3FVOA 4DXUA 2GRVA 4N07A 3W9WA 1PDAA 4R9GA 3LSWA 2AYSA 1AOVA 4DCYA 5DYHA 2OBGA 5I2KA 3BFTA 1ATGA 1A8EA 3O2AA 5B70A 1NL5A 5H8NA 1QULA 4KFQA 5AA1A 1IXCA 4LZ7A 3VFJA 3OXNA 5JTYA 3K6WA 4O3CA 3G3IA 3K01A 2DVCA 4DE8A 1P1WA 3C33A 3FJ7A 1R9QA 3U72A 3ZKLA 3TQWA 1IIWA 1SVXB 1NNTA 1LFHA 4NF4B 1VFDA 4I62A 1F9BA 4K3FA 2DE4A 3Q29A 3ILUB 3KOSA 3T96B 3K1MA 4FE8A 3TFLA 2PX1A 4OFOA 4RXLA 1KWHA 1RYXA 3VLVA 1FTMA 2NOOA 3H7MA 3FV2A 1XOCA 2PT2A 2E0SA 3KN7A 3GXAA 5H8FB 1MXVA 4ZEDA 4Q8RA 1B05A 1B1HA 4ZEKA 1NH8A 4P11A 4DDDA 3B6TA 3IX1A 4MLVA 1IQ7A 5H8NB 4ZEFA 1TXFA 2Q89A 3VXCA 4F39A 4FORA 1LAXA 2ABHA 4FJPA 3C36A 1YCJA 1Y3NA 4MF3A 2Y84A 3TELA 3TPAA 3U94A 4Q5TA 5I57A 4ESWA 4R2BA 1A54A 2V84A 3JYRA 4H5GA 1LBCA 3ILTB 3KGCA 3KBRA 3IO4A 1O7TA 2A5SA 3CFLA 5CI5A 1D4NA 3SEYA 2F6GA 4GOTA 1FQDA 1L5TA 1GTKA 4G4PA 3HHGA 3OSRA 5FTIA 3GBAA 3K1PA 3C32A 4JWXA 2I3VA 3G3GA 2HZKA 2XXHA 3B6WA 4C0RA 3SEVA 1B5HA 1OQGA 3E9XA 5I57B 3MQ9A 4IY5A 3H3GA 3RPWA 4AB5A 3N6UA 1IEJA 1HSJA 5DEXA 3T22A 3U8QA 1ZJLA 1B7UA 3FVGA 1AMFA 2QSXA 3H6VA 3FVKA 5CMMA 1ELJA 1MPDA 2I48A 1OVTA 4LONB 4WKMA 4GFRA 3TEPA 1UQWA 2V25A 2GFEA 1URDA 1TT1A 4F22A 1IXGA 3TTKA 2G93A 1SD3A 3K00A 1POY1 3EHUA 4RJZA 5TU0A 3RTFB 2O84X 1B0HA 4U4SA 3T9UA 4HCWA 4G8MA 1M5FA 3MVXA 1B5IA 1IZ1A 2OZZA 4PFTA 3CSGA 4G8HA 5BUUA 3K4UA 3VE1B 2DWJA 1JEVA 3QIMA 1N76A 1P1OA 3IJXB 5DTBA 4OFLA 2RCBA 2XXPA 1TFDA 1GGGA 2QMWA 4YZZA 1LBBA 4YB6A 1FTOA 2XXUA 4ONYA 1USYH 1N3XA 4KYDA 2O7UA 3KJ7A 5AA3A 4EQBA 2PT1A 3H4ZA 4QF9A 1JETA 3OO6A 4KYSA 5FHNA 4KQPA 2ZNTA 1MY0A 1B58A 2XXTA 3UK4A 3Q26A 4GXSB 4IO4A 3CI8A 4WXJA 1MM7A 4H8IA 1MQGA 2I4CA 3VLWA 2YJPA 4N6PA 3SETA 4HW8A 4NWCA 3S9EA 3OO8A 1JQFA 4R6YA 1DTGA 1FW0A 4OENA 1MS7A 4HCYA 4AQ4A 1I6AA 2UVHA 1FQEA 5AE4A 2IEEA 3LR1A 3S9NC 4F29A 2OJTA 3R6UA 2XHDA 1UTBB 3FV1A 5K2YA 5ISUA 1B46A 3KJTA 2OCUA 2ZNSA 2A5TA 3K6XA 3LUYA 2Q88A 3LBSA 3ZS6A 4BDOA 1LAGE 4E0XA 3EQ1A 2D3IA 1B2HA 2ZYOA 1PB7A 4P0GA 1FQAA 3QXMA 1BIYA 3MBPA 4U1OA 4F2OA 3FZVA 1TFAA 3K2DA 3N26A 3RGYA 2ONKE 1Y1ZA 4FEDA 4R6HA 4RYAA 4LZ8A 4F1YA 2UYFA 2PMSA 2Y7WA 4OMBA 4TLMB 2Z8EA 4YKIA 3FJMA 4POWA 1UIVA 3TTRA 4ZS9A 2BJJX 3IORA 3IOTA 1EZOA 2I49A 1ZLQA 3QYTA 2HFBA 3G3JA 3D4CA 2A5TB 2DE3A 4BDQA 1Z7NE 5TP9B 2ZYMA 2R71A 4TOZA 1P99A 5EHMA 2DSFA 1ZMGA 3CG1A 3PU5A 2RINA 1Z7ME 4M4GA 3GLBA 5FTHA 4TLLB 1BP5A 1YTVA 3QUJA 1UTHB 3IB0A 2DYXA 3A3UA 4JWOA 2XXIA 3Q28A 5IKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F36 A;  3TQL A;  1O63 A;  3OEL A;  5K2X A;  5B7D A;  1VR5 A;  4F1U A;  4E0W A;  4YAH X;  3RY3 A;  3MWB A;  1M5E A;  1MQJ A;  4PE5 B;  2O68 A;  3FXQ A;  3KEI A;  1MQH A;  2ZMB A;  4HTG A;  3VLU A;  4EF1 A;  4JSO A;  1IIT A;  3FXR A;  4Q30 B;  3PUY E;  1H76 A;  1R9L A;  4IO3 A;  4F18 A;  4GQO A;  2VD3 A;  3N94 A;  1SI0 A;  2DWI A;  4NF6 A;  3TKD A;  1JEU A;  2DWA A;  2XXY A;  2D21 A;  2QMX A;  3MZ1 A;  3PUZ E;  3KN3 A;  3PD9 A;  4H1X A;  1N04 A;  4GD5 A;  2WKY A;  4I8C A;  5I2N B;  5H8F A;  4YMA A;  2RKM A;  3TAJ A;  1D9V A;  5DVI A;  4X1D A;  3K1N A;  3TMG A;  3IB2 A;  4ZE8 A;  1ANF A;  1SW5 A;  4ECF A;  5M2V A;  1QUK A;  4R9F A;  1B3H A;  4IO5 A;  1CE2 A;  2E1S A;  2PBW A;  1XS5 A;  1MXX A;  4NTL A;  2REG A;  2QJE A;  1GR2 A;  1B0L A;  4BDN A;  2I3W A;  1NH7 A;  4ELP A;  4NF6 B;  3LSF B;  2Q2C A;  4G8N A;  2FYI A;  3O66 A;  2Y7R A;  3MVY A;  3UN6 A;  2XX8 A;  3DP6 A;  4RK2 A;  4NWD A;  2DQV A;  4FAT A;  1EZP A;  1CB6 A;  3VVF A;  3G3F A;  2F7A A;  1BLF A;  1QW0 A;  2O1M A;  3OMB A;  4RPN A;  2Y7P A;  5H8Q B;  3TCG A;  2DOJ A;  1M5D A;  4AB6 A;  1SW2 A;  2F97 A;  2RC8 A;  3MPL A;  1PBP A;  2QS3 A;  1BKA A;  5CM6 A;  3QAX A;  5HBC A;  2W7Y A;  3SES A;  1DSN A;  3I5O A;  2XXW A;  4MH5 A;  4DIG A;  2ALU A;  4OYV A;  3MZ9 A;  5CMK A;  1MRP A;  1HSL A;  4OVJ A;  5H8H B;  1ZIU A;  3OEM A;  1WOD A;  3BBR A;  1OMP A;  3R26 A;  3HPI A;  3CFZ A;  4QFL A;  2XXV A;  5CRY A;  5I59 A;  4BDL A;  3P7I A;  2V3T A;  1B9J A;  4GRK A;  4UAC A;  1Y1M A;  5ICQ A;  3S9L C;  3SEW A;  1EH3 A;  3B6Q A;  2OLB A;  3PUW E;  2RCA A;  3HHF A;  4R75 A;  5EHS A;  3DP8 A;  3V8X B;  1DPP A;  2I58 A;  1MY3 A;  3B7D A;  1B3F A;  4NF8 B;  5DVF A;  4OES A;  4LAT A;  5KCJ A;  4OEV A;  4DXB A;  1WVJ A;  1NMU A;  5CMC A;  1XVX A;  1O64 A;  4BDR A;  4OXV A;  1I69 A;  2XXQ A;  3KFM A;  1YAE A;  3EPE A;  4RPO A;  4MLQ A;  3KSJ A;  1J1N A;  3TYH A;  1S7Y A;  3S4U A;  4C1T A;  4EXK A;  1MM6 A;  2D5W A;  3ONM A;  4KI0 E;  4YKJ A;  5I59 B;  4IO6 A;  2GHA A;  2V93 A;  1NFT A;  3RNN A;  1LFI A;  3V83 A;  1EZ9 A;  4KPT A;  1Y4C A;  3CR9 A;  3N6T A;  3PUX E;  4TQU Q;  1LFG A;  3RT8 A;  3M8U A;  2Y7K A;  3OEK A;  1MH4 A;  1RKM A;  1H3D A;  1US4 A;  3MAM A;  3FD3 A;  3A09 A;  3TCF A;  4R72 A;  3FAT A;  2YLN A;  4R73 A;  4OWD A;  5KCJ B;  3SEU A;  1AH5 A;  4FEB A;  2RC7 A;  2R6G E;  1LB8 A;  1NNP A;  3VVD A;  1SDX A;  1B1X A;  2F78 A;  3KG2 A;  3R7X A;  1LLS A;  2ZNU A;  1MQI A;  2HCA A;  1SW4 A;  1A55 A;  3KZG A;  4IB2 A;  1UIU A;  1MDP 1;  3T66 A;  4U22 A;  2HAU A;  1DOT A;  2I0C A;  2DXR A;  1LB9 A;  4LA9 A;  4EF2 A;  4YKK A;  3M3K A;  2VGQ A;  4F3S A;  2Q8J A;  3VXB A;  3CFX A;  4F31 B;  1UTB A;  3I3V A;  2I0B A;  2HEU A;  1Y3P A;  5L9M A;  3K0V A;  1FCK A;  2B65 A;  3TTN A;  3W15 C;  5EYF A;  1MY1 A;  4HS7 A;  1PEB A;  3H03 A;  1AL3 A;  2GHB A;  3IO6 A;  1S9T A;  2UVJ A;  3RLF E;  4ZEB A;  5I56 A;  1A8F A;  4RNS A;  4OHN A;  3CRB A;  4R74 A;  5CBR A;  4F3B A;  4JXI A;  3E13 X;  3KN8 A;  1TWY A;  4ELO A;  2F7B A;  1LCT A;  5JEI A;  3N5L A;  4THI A;  3PMW A;  3IOU A;  1B32 A;  4G2Z A;  4QFO A;  3O6G A;  3ZKK A;  4ELR A;  4BLA A;  5HPQ A;  3IK6 B;  1B3G A;  4XIG Q;  2XD2 A;  2FA7 A;  4PET A;  3FUZ A;  5TP9 A;  1JNF A;  3CSB A;  4LP2 B;  4QHQ A;  4R2F A;  2I6E A;  4NE4 A;  3IAZ A;  1MPC A;  4H67 A;  1SYI A;  3EHS A;  4QFK A;  3H06 B;  1LAH E;  5I56 B;  1Y9U A;  3TZA A;  1UTH A;  1FQF A;  4EQ7 A;  3BFU A;  1QVS A;  1Q35 A;  1N7W A;  4Z7E A;  2X26 A;  4PFW A;  3TUS A;  2H99 A;  4EDP A;  1DMB A;  4G68 A;  3H6W A;  3EF7 A;  1N3W A;  4OQO A;  2YPN A;  1SYH A;  1XHY A;  4N13 A;  3PD8 A;  1JW1 A;  2Y7I A;  3GZG A;  4XKR A;  4YB5 A;  2DXY A;  2QS1 A;  3MP8 A;  3MPK A;  4GLI A;  1FQC A;  1XVY A;  5ICT A;  4IGT A;  4OTE A;  1VSO A;  2VHA A;  4MFI A;  2DE2 A;  4F2Q A;  2OWT A;  5KZT A;  2IA4 A;  3MW0 A;  4GVO A;  4ELQ A;  2NXO A;  2PVU A;  2UXA A;  4DLD A;  3MVZ A;  4LVQ A;  4U1Z A;  5I2N A;  5F1Q A;  2NUV A;  3QK6 A;  3VVE A;  3UP9 A;  1D3K A;  4G68 B;  4IY6 A;  3EHT A;  4GXA A;  4YU0 A;  3LC8 A;  3EN3 A;  4Q0C A;  2X7P A;  1DPE A;  2HXW A;  4RK9 A;  4YIC A;  1SI1 A;  1PBQ A;  3S9M C;  1DTZ A;  4QSC A;  1OLC A;  1MXW A;  3DLN A;  3MVW A;  2P2A A;  4XTC Q;  4LZ5 A;  1H44 A;  5TPA A;  1ZTY A;  2DVZ A;  3MC2 A;  1MH3 A;  2P0S A;  5L8D A;  4F3P A;  3TTL A;  3F11 A;  3O6I A;  3UOR A;  2RC9 A;  3RTW B;  1MXY A;  3IJO B;  4XKN A;  2XXX A;  4LQ2 A;  1B51 A;  4FEC A;  1N7X A;  5H8Q A;  3IL1 B;  1OIB A;  1Y3Q A;  4GWO A;  4X1B A;  2REJ A;  3T9X B;  4H0W A;  2AIX A;  3OO9 A;  3QSL A;  3U1O A;  3G3H A;  1ZBM A;  1OLA A;  3RUM A;  2P1S A;  3O97 A;  3K6U A;  3TDJ A;  4KD5 A;  4KHZ E;  4PFY A;  4QFN A;  3SKP A;  3KOT A;  2ANJ A;  3OO7 A;  4X48 A;  1MXZ A;  4ISU A;  5TPA B;  2G29 A;  5H8H A;  3G3K A;  4I9D A;  4G68 C;  1IUD A;  3O6H A;  5A5X A;  3Q25 A;  4QSE A;  3HCQ A;  4PP0 A;  3E3K A;  3M3L A;  3C34 A;  4ZEC A;  3IOW A;  5I58 A;  4LQ5 A;  4L17 A;  1JVY A;  1QJM A;  4YMB A;  4OER A;  2H25 A;  4G77 A;  4RA1 A;  1I6B A;  4H5F A;  4FIM A;  3CG3 A;  1BTJ A;  2Z8D A;  3RT6 B;  3PMV A;  5DVJ A;  3O9P A;  2F7C A;  4XKQ A;  3S2V A;  2O6A A;  1B40 A;  1ZU0 A;  2Q2A A;  3L6G A;  4QSD A;  5I2K B;  2DS9 A;  1M5C A;  4NF8 A;  3LSX A;  2CMO A;  1GV8 A;  3UA8 A;  5ELV A;  2B3F A;  4PFU A;  5JTY B;  1B7H A;  2QL3 A;  1MXU A;  4R6K A;  3FVN A;  3SER A;  1B6H A;  1URG A;  5A5X B;  3LSL A;  4O3A A;  1LST A;  1MY2 A;  5JK4 A;  3C9H A;  3DEL B;  2UVG A;  5I58 B;  2HZL A;  4H6D A;  3FGS A;  1MY4 A;  3OEN A;  4M1V A;  3SEX A;  2VD2 A;  3OSQ A;  4WEP A;  1IXH A;  4GL0 A;  1AIV A;  1XT8 A;  4BDM A;  4F1V A;  1B5J A;  5ITO A;  2H4I A;  3FXU A;  4ZEI A;  3UGW A;  5I84 A;  1LAF E;  3PPN A;  5AA4 A;  4F19 A;  4ESX A;  3K02 A;  1H43 A;  1S50 A;  2O69 A;  3IB1 A;  4JSD A;  5F7V A;  2RF1 A;  1NNF A;  4EUO A;  4U4X A;  4QRZ A;  1FQB A;  3ECR A;  4X9T A;  1B3L A;  1B7Z A;  5CMB A;  3WAE A;  2H5Y A;  1LGB C;  4U2R A;  4ND9 A;  2V3Q A;  2H98 A;  3T9H B;  3VV5 A;  3H6U A;  4ZDM A;  1USY E;  2ESN A;  4IO2 A;  1OVB A;  1B4Z A;  4JB7 A;  3V89 B;  3USD A;  1P1Q A;  3FAS A;  4IO7 A;  2DP8 A;  2F8D A;  4KCD A;  5AA2 D;  5AA4 B;  1PB9 A;  1ZKB A;  3IOV A;  3ODB A;  3K6V A;  5HM4 B;  2HQ0 A;  3FJG A;  5CBS A;  1B52 A;  4U21 A;  4NED A;  3CVG A;  3PPO A;  1A40 A;  2GH9 A;  4RY1 A;  1VE4 A;  4NF5 A;  1IXI A;  3OOA A;  4GIZ A;  2Z23 A;  5DEX B;  1JVX A;  1VFE A;  2O51 A;  4P0I A;  1B3E A;  4LUB A;  5IAI A;  3IR1 A;  3PPQ A;  3FIR A;  3A3C A;  1H45 A;  5H8S A;  2O1L A;  3KSX A;  3Q27 A;  4Z0I A;  2ZXT A;  3UIF A;  1D9Y A;  1M5B A;  3PPR A;  4DXC A;  4OET A;  4O3B A;  3RN8 A;  5L9O A;  2QRY A;  1II5 A;  2Z8F A;  1P1U A;  4KCC A;  1PB8 A;  3U93 A;  2VOZ A;  4KYE A;  3PPP A;  1NKX A;  1HSE A;  2ONS A;  4GL8 A;  3TCH A;  2XXR A;  4UA8 A;  2Z22 A;  1I6Q A;  4H65 A;  5BWJ A;  2OWS A;  1Y20 A;  1FTL A;  3O29 A;  4PQJ A;  3C4M A;  1GVC A;  4OFJ A;  4NF5 B;  4DZ1 A;  4H8J A;  1QKB A;  2ONR A;  3G7W A;  1MPB A;  4FAJ A;  3C31 A;  5AA2 A;  2XX7 A;  2XD3 A;  1Q1K A;  3TTM A;  3HO7 A;  5DT6 A;  1A7L A;  1N0T A;  3PGF A;  3MP1 A;  3DM0 A;  1PC3 A;  1QUI A;  1QUJ A;  3GBB A;  1JW4 A;  4DCX A;  5FHM A;  2LAO A;  2QS2 A;  3THI A;  1SBP A;  4GF8 A;  2PYY A;  1EU8 A;  4ZZA A;  2M8C A;  4ZE9 A;  1JW5 A;  3WAF A;  1Y4T A;  3C35 A;  1WDN A;  5J1D A;  3W9V A;  5KDT A;  3PMX A;  4XXU A;  3HV1 A;  1POT A;  2THI A;  2UVI A;  5CC2 A;  4XKP A;  5AA2 B;  2H9B A;  2B3B A;  2HAV A;  3DP4 A;  3VDF A;  3PUV E;  2CZL A;  1N84 A;  3QUF A;  3PV0 E;  3H6T A;  5LOM A;  4JBZ A;  2AL4 A;  2VP1 A;  2R9J A;  3L6H A;  1URS A;  4EXL A;  1OQH A;  2QS4 A;  3MJN A;  1SQY A;  3I6V A;  3JV9 A;  1SW1 A;  5L9S A;  2F35 A;  3D4G A;  2OK2 A;  1MDQ A;  3ZSF A;  5ITP A;  3MUQ A;  1NNK A;  2X7Q A;  2FNC A;  1R6Z A;  4OEU A;  4EQ9 A;  2KLF A;  2O7I A;  5KDT B;  4KR5 A;  4MBP A;  4C1U A;  3BKI B;  4U23 A;  1B4H A;  2I4B A;  4POX A;  2QPQ A;  2F5X A;  1P1N A;  3SDF A;  2AL5 A;  4YB7 A;  3TOD A;  2NWJ A;  1US5 A;  2V3U A;  4QFP A;  5FHO A;  4I1D A;  2NVU B;  3E4R A;  2DWH A;  2ZYN A;  3CIJ A;  3MP6 A;  1MG1 A;  2F6P A;  4JDF A;  3M3F A;  1FTK A;  3JZJ A;  3HN0 A;  3RQT A;  1T0K A;  4WED A;  3AXF A;  2XX9 A;  1A99 A;  1YPN A;  4ZZE A;  3HST A;  4F3G A;  4YKP A;  1LCF A;  1FTJ A;  3O28 A;  1RYO A;  4IGR A;  3U92 A;  2UYE A;  1XC1 A;  3V5A A;  4NF4 A;  1MQD A;  2F34 A;  4JWY A;  2ZYK A;  2Q9T A;  3MZB A;  1QKA A;  3T93 B;  3T9V A;  1R1N A;  4NMY A;  3OD7 A;  4OZ9 A;  3FVO A;  4DXU A;  2GRV A;  4N07 A;  3W9W A;  1PDA A;  4R9G A;  3LSW A;  2AYS A;  1AOV A;  4DCY A;  5DYH A;  2OBG A;  5I2K A;  3BFT A;  1ATG A;  1A8E A;  3O2A A;  5B70 A;  1NL5 A;  5H8N A;  1QUL A;  4KFQ A;  5AA1 A;  1IXC A;  4LZ7 A;  3VFJ A;  3OXN A;  5JTY A;  3K6W A;  4O3C A;  3G3I A;  3K01 A;  2DVC A;  4DE8 A;  1P1W A;  3C33 A;  3FJ7 A;  1R9Q A;  3U72 A;  3ZKL A;  3TQW A;  1IIW A;  1SVX B;  1NNT A;  1LFH A;  4NF4 B;  1VFD A;  4I62 A;  1F9B A;  4K3F A;  2DE4 A;  3Q29 A;  3ILU B;  3KOS A;  3T96 B;  3K1M A;  4FE8 A;  3TFL A;  2PX1 A;  4OFO A;  4RXL A;  1KWH A;  1RYX A;  3VLV A;  1FTM A;  2NOO A;  3H7M A;  3FV2 A;  1XOC A;  2PT2 A;  2E0S A;  3KN7 A;  3GXA A;  5H8F B;  1MXV A;  4ZED A;  4Q8R A;  1B05 A;  1B1H A;  4ZEK A;  1NH8 A;  4P11 A;  4DDD A;  3B6T A;  3IX1 A;  4MLV A;  1IQ7 A;  5H8N B;  4ZEF A;  1TXF A;  2Q89 A;  3VXC A;  4F39 A;  4FOR A;  1LAX A;  2ABH A;  4FJP A;  3C36 A;  1YCJ A;  1Y3N A;  4MF3 A;  2Y84 A;  3TEL A;  3TPA A;  3U94 A;  4Q5T A;  5I57 A;  4ESW A;  4R2B A;  1A54 A;  2V84 A;  3JYR A;  4H5G A;  1LBC A;  3ILT B;  3KGC A;  3KBR A;  3IO4 A;  1O7T A;  2A5S A;  3CFL A;  5CI5 A;  1D4N A;  3SEY A;  2F6G A;  4GOT A;  1FQD A;  1L5T A;  1GTK A;  4G4P A;  3HHG A;  3OSR A;  5FTI A;  3GBA A;  3K1P A;  3C32 A;  4JWX A;  2I3V A;  3G3G A;  2HZK A;  2XXH A;  3B6W A;  4C0R A;  3SEV A;  1B5H A;  1OQG A;  3E9X A;  5I57 B;  3MQ9 A;  4IY5 A;  3H3G A;  3RPW A;  4AB5 A;  3N6U A;  1IEJ A;  1HSJ A;  5DEX A;  3T22 A;  3U8Q A;  1ZJL A;  1B7U A;  3FVG A;  1AMF A;  2QSX A;  3H6V A;  3FVK A;  5CMM A;  1ELJ A;  1MPD A;  2I48 A;  1OVT A;  4LON B;  4WKM A;  4GFR A;  3TEP A;  1UQW A;  2V25 A;  2GFE A;  1URD A;  1TT1 A;  4F22 A;  1IXG A;  3TTK A;  2G93 A;  1SD3 A;  3K00 A;  1POY 1;  3EHU A;  4RJZ A;  5TU0 A;  3RTF B;  2O84 X;  1B0H A;  4U4S A;  3T9U A;  4HCW A;  4G8M A;  1M5F A;  3MVX A;  1B5I A;  1IZ1 A;  2OZZ A;  4PFT A;  3CSG A;  4G8H A;  5BUU A;  3K4U A;  3VE1 B;  2DWJ A;  1JEV A;  3QIM A;  1N76 A;  1P1O A;  3IJX B;  5DTB A;  4OFL A;  2RCB A;  2XXP A;  1TFD A;  1GGG A;  2QMW A;  4YZZ A;  1LBB A;  4YB6 A;  1FTO A;  2XXU A;  4ONY A;  1USY H;  1N3X A;  4KYD A;  2O7U A;  3KJ7 A;  5AA3 A;  4EQB A;  2PT1 A;  3H4Z A;  4QF9 A;  1JET A;  3OO6 A;  4KYS A;  5FHN A;  4KQP A;  2ZNT A;  1MY0 A;  1B58 A;  2XXT A;  3UK4 A;  3Q26 A;  4GXS B;  4IO4 A;  3CI8 A;  4WXJ A;  1MM7 A;  4H8I A;  1MQG A;  2I4C A;  3VLW A;  2YJP A;  4N6P A;  3SET A;  4HW8 A;  4NWC A;  3S9E A;  3OO8 A;  1JQF A;  4R6Y A;  1DTG A;  1FW0 A;  4OEN A;  1MS7 A;  4HCY A;  4AQ4 A;  1I6A A;  2UVH A;  1FQE A;  5AE4 A;  2IEE A;  3LR1 A;  3S9N C;  4F29 A;  2OJT A;  3R6U A;  2XHD A;  1UTB B;  3FV1 A;  5K2Y A;  5ISU A;  1B46 A;  3KJT A;  2OCU A;  2ZNS A;  2A5T A;  3K6X A;  3LUY A;  2Q88 A;  3LBS A;  3ZS6 A;  4BDO A;  1LAG E;  4E0X A;  3EQ1 A;  2D3I A;  1B2H A;  2ZYO A;  1PB7 A;  4P0G A;  1FQA A;  3QXM A;  1BIY A;  3MBP A;  4U1O A;  4F2O A;  3FZV A;  1TFA A;  3K2D A;  3N26 A;  3RGY A;  2ONK E;  1Y1Z A;  4FED A;  4R6H A;  4RYA A;  4LZ8 A;  4F1Y A;  2UYF A;  2PMS A;  2Y7W A;  4OMB A;  4TLM B;  2Z8E A;  4YKI A;  3FJM A;  4POW A;  1UIV A;  3TTR A;  4ZS9 A;  2BJJ X;  3IOR A;  3IOT A;  1EZO A;  2I49 A;  1ZLQ A;  3QYT A;  2HFB A;  3G3J A;  3D4C A;  2A5T B;  2DE3 A;  4BDQ A;  1Z7N E;  5TP9 B;  2ZYM A;  2R71 A;  4TOZ A;  1P99 A;  5EHM A;  2DSF A;  1ZMG A;  3CG1 A;  3PU5 A;  2RIN A;  1Z7M E;  4M4G A;  3GLB A;  5FTH A;  4TLL B;  1BP5 A;  1YTV A;  3QUJ A;  1UTH B;  3IB0 A;  2DYX A;  3A3U A;  4JWO A;  2XXI A;  3Q28 A;  5IKB A; 
#chains in the Genus database with same CATH topology
 2F36 A;  3TQL A;  1LBZ A;  1O63 A;  1NUW A;  3OEL A;  5K2X A;  5B7D A;  1KA1 A;  1VR5 A;  4F1U A;  4E0W A;  4YAH X;  3RY3 A;  3MWB A;  1M5E A;  1MQJ A;  1NUX A;  4PE5 B;  2O68 A;  2VPN A;  3FXQ A;  3KEI A;  1MQH A;  2ZMB A;  4HTG A;  3VLU A;  4EF1 A;  4JSO A;  1IIT A;  1LBV A;  3FXR A;  1RDZ A;  4Q30 B;  3PUY E;  1H76 A;  1Q9D A;  1R9L A;  4IO3 A;  4MNP A;  4F18 A;  4GQO A;  2VD3 A;  3N94 A;  1SI0 A;  2DWI A;  4NF6 A;  3TKD A;  1JEU A;  3FBP A;  4NG7 A;  2XWO A;  2DWA A;  2XXY A;  2D21 A;  2QMX A;  4H46 A;  3MZ1 A;  3PUZ E;  3KN3 A;  3PD9 A;  4H1X A;  2QFL A;  1N04 A;  4GD5 A;  4MAG A;  2WKY A;  4I8C A;  5I2N B;  5H8F A;  4YMA A;  2RKM A;  3TAJ A;  1LBW A;  1D9V A;  5DVI A;  4X1D A;  3K1N A;  3TMG A;  3IB2 A;  4ZE8 A;  1ANF A;  1SW5 A;  4ECF A;  5M2V A;  1QUK A;  4R9F A;  1B3H A;  4IO5 A;  1XI6 A;  4NX1 A;  1CE2 A;  2E1S A;  2PBW A;  4HE0 A;  1XS5 A;  1EYJ A;  1MXX A;  4NTL A;  2REG A;  4OVS A;  2QJE A;  1GR2 A;  1B0L A;  4BDN A;  2I3W A;  1NH7 A;  4ELP A;  4NF6 B;  3LSF B;  2Q2C A;  4G8N A;  2FYI A;  3O66 A;  1LEV A;  2Y7R A;  3MVY A;  2VPO A;  3UN6 A;  2XX8 A;  3DP6 A;  4RK2 A;  4NWD A;  2DQV A;  4FAT A;  4I40 A;  4GWZ A;  4HE2 A;  4N6K A;  4PAF A;  1EZP A;  1CB6 A;  3VVF A;  3G3F A;  4MNI A;  2F7A A;  1BLF A;  1QW0 A;  2O1M A;  3OMB A;  4RPN A;  2Y7P A;  4MIJ A;  5H8Q B;  3TCG A;  2DOJ A;  1M5D A;  2QVV A;  4PBQ A;  4AB6 A;  1SW2 A;  2F97 A;  2WX9 A;  2RC8 A;  3MPL A;  1PBP A;  4H45 A;  3A29 A;  2QS3 A;  4GBW A;  1BKA A;  5CM6 A;  3QAX A;  5HBC A;  2W7Y A;  3SES A;  4O7M A;  1DSN A;  3I5O A;  2XXW A;  4MH5 A;  4DIG A;  2ALU A;  4OYV A;  3MZ9 A;  5CMK A;  1MRP A;  2WYP A;  1HSL A;  4OVJ A;  5ET8 A;  5H8H B;  1ZIU A;  1FBF A;  3OEM A;  1WOD A;  3BBR A;  1OMP A;  4GWS A;  4X8R A;  3R26 A;  3HPI A;  3CFZ A;  2V4C A;  2WYK A;  4QFL A;  2XXV A;  5CRY A;  5I59 A;  4BDL A;  3P7I A;  2V3T A;  1B9J A;  1NI9 A;  4GRK A;  4UAC A;  1Y1M A;  5ICQ A;  3S9L C;  3SEW A;  1EH3 A;  3B6Q A;  2OLB A;  3PUW E;  2RCA A;  3HHF A;  4R75 A;  5EHS A;  3DP8 A;  3V8X B;  1DPP A;  5EQA A;  2I58 A;  1MY3 A;  3B7D A;  1IMC A;  1B3F A;  4NF8 B;  5DVF A;  4OES A;  4NHB A;  4LAT A;  5KCJ A;  4OEV A;  1WVJ A;  5CMC A;  1NMU A;  4DXB A;  1XVX A;  1O64 A;  4BDR A;  4OXV A;  1FRP A;  1I69 A;  2XXQ A;  3KFM A;  1YAE A;  3EPE A;  4RPO A;  4OVR A;  4MLQ A;  3KSJ A;  2WBB A;  1J1N A;  4MNC A;  3TYH A;  1S7Y A;  3S4U A;  4C1T A;  4EXK A;  1MM6 A;  2D5W A;  3ONM A;  4OVT A;  4KI0 E;  4YKJ A;  5I59 B;  4IO6 A;  2GHA A;  2V93 A;  1NFT A;  3RNN A;  1LFI A;  3V83 A;  1EZ9 A;  4PFI A;  4KPT A;  1Y4C A;  3CR9 A;  4N8Y A;  3N6T A;  3PUX E;  4TQU Q;  1LFG A;  3RT8 A;  3M8U A;  2Y7K A;  3OEK A;  2FIE A;  1MH4 A;  1RKM A;  1H3D A;  2KR0 A;  1US4 A;  3MAM A;  3FD3 A;  1YYZ A;  3A09 A;  3TCF A;  4R72 A;  3FAT A;  2YLN A;  4R73 A;  4OWD A;  5KCJ B;  3SEU A;  1AH5 A;  1KA0 A;  1FBH A;  5IZ3 B;  4FEB A;  2RC7 A;  2R6G E;  1LB8 A;  1NNP A;  3VVD A;  1SDX A;  1B1X A;  2F78 A;  3KG2 A;  4NF0 A;  3R7X A;  1LLS A;  4GWW A;  2ZNU A;  1MQI A;  2HCA A;  1SW4 A;  1A55 A;  3KZG A;  4IB2 A;  1G0I A;  1UIU A;  1MDP 1;  3T66 A;  4U22 A;  2HAU A;  1DOT A;  2I0C A;  5ET7 A;  3PTY A;  2DXR A;  1LB9 A;  4LA9 A;  4EF2 A;  4YKK A;  3M3K A;  2VGQ A;  2XXK A;  4F3S A;  2Q8J A;  3VXB A;  3CFX A;  2WEF A;  4F31 B;  1UTB A;  1FPF A;  3I3V A;  2I0B A;  2HEU A;  1Y3P A;  5L9M A;  3K0V A;  1FCK A;  4PGN A;  2B65 A;  3TTN A;  3W15 C;  5EYF A;  1MY1 A;  4HS7 A;  1PEB A;  3H03 A;  1AL3 A;  2GHB A;  3IO6 A;  1S9T A;  2UVJ A;  3RLF E;  4ZEB A;  5I56 A;  1A8F A;  4RNS A;  5IGA A;  2F3B A;  4OHN A;  2CEX A;  4AS4 A;  3CRB A;  4R74 A;  4GWU A;  4O94 A;  5CBR A;  3E13 X;  4JXI A;  4F3B A;  3KN8 A;  1TWY A;  4ELO A;  2F7B A;  1LCT A;  5EYH A;  5JEI A;  3N5L A;  4THI A;  3PMW A;  3IOU A;  3RPL A;  1B32 A;  4G2Z A;  4QFO A;  3O6G A;  2B4L A;  3E78 A;  3ZKK A;  4N91 A;  4ELR A;  4BLA A;  1DCU A;  5HPQ A;  4OVQ A;  3IK6 B;  1B3G A;  4XIG Q;  2XD2 A;  2FA7 A;  4LN5 A;  4PET A;  3FUZ A;  4KXP A;  5TP9 A;  1JNF A;  3CSB A;  4LP2 B;  2F3D A;  4QHQ A;  4R2F A;  2I6E A;  4NE4 A;  3IAZ A;  1MPC A;  4H67 A;  1SYI A;  3EHS A;  4QFK A;  3H06 B;  1LAH E;  5I56 B;  1Y9U A;  3TZA A;  1UTH A;  1FQF A;  4EQ7 A;  5I3S A;  3BFU A;  1QVS A;  1Q35 A;  1N7W A;  2QVR A;  4Z7E A;  4MCO A;  2X26 A;  4PFW A;  3TUS A;  2H99 A;  4EDP A;  1DMB A;  4G68 A;  3H6W A;  4QBA A;  3EF7 A;  1N3W A;  4OQO A;  2YPN A;  1SYH A;  1XHY A;  4PDD A;  4N13 A;  3PD8 A;  1JW1 A;  2Y7I A;  3GZG A;  4XKR A;  4YB5 A;  2DXY A;  2QS1 A;  3MP8 A;  4N4U A;  3MPK A;  4GLI A;  1FQC A;  1XVY A;  1FPG A;  5ICT A;  4IGT A;  4OTE A;  1VSO A;  2VHA A;  4NN3 A;  5LTC A;  4MFI A;  4GX3 A;  2DE2 A;  4F2Q A;  2OWT A;  5KZT A;  2IA4 A;  3MW0 A;  2GQ1 A;  4GVO A;  4ELQ A;  2NXO A;  1KZ8 A;  2PVU A;  2P3N A;  2UXA A;  4DLD A;  3MVZ A;  4LVQ A;  4U1Z A;  5I2N A;  5F1Q A;  2NUV A;  3QK6 A;  1FBC A;  3VVE A;  3UP9 A;  1D3K A;  4G68 B;  4IY6 A;  3EHT A;  4GXA A;  4YU0 A;  3LC8 A;  3MYU A;  3EN3 A;  4Q0C A;  2X7P A;  1DPE A;  2HXW A;  1IME A;  4RK9 A;  4YIC A;  2Q74 A;  1SI1 A;  1PBQ A;  1FPB A;  5EQ7 A;  3S9M C;  1DTZ A;  4QSC A;  1OLC A;  1MXW A;  3DLN A;  5IM2 A;  3MVW A;  2P2A A;  4P9K A;  4XTC Q;  4LZ5 A;  4MEV A;  4I3E A;  1H44 A;  4HE1 A;  5TPA A;  1ZTY A;  2DVZ A;  3MC2 A;  1MH3 A;  3U65 A;  2P0S A;  5L8D A;  4F3P A;  3TTL A;  3F11 A;  3O6I A;  3UOR A;  2RC9 A;  3RTW B;  1MXY A;  3IJO B;  4XKN A;  2XXX A;  4LQ2 A;  1B51 A;  4FEC A;  1N7X A;  5H8Q A;  1AWB A;  3T0J A;  3IL1 B;  1OIB A;  1Y3Q A;  4GWO A;  4X1B A;  2REJ A;  3T9X B;  4H0W A;  2AIX A;  3OO9 A;  3QSL A;  3U1O A;  2CEY A;  3HFU A;  3G3H A;  1ZBM A;  1OLA A;  3RUM A;  2P1S A;  3O97 A;  3K6U A;  3TDJ A;  4KD5 A;  3SZP A;  4KHZ E;  4PFY A;  5T3J A;  4QFN A;  3SKP A;  3KOT A;  2ANJ A;  3OO7 A;  4X48 A;  4N15 A;  1MXZ A;  4ISU A;  5TPA B;  2B4M A;  2G29 A;  5H8H A;  3G3K A;  4I9D A;  4G68 C;  1IUD A;  3O6H A;  5A5X A;  2PFZ A;  2FBP A;  3Q25 A;  4QSE A;  3HCQ A;  4PP0 A;  3E3K A;  1RDY A;  3M3L A;  4MMP A;  3C34 A;  4ZEC A;  2Y5L A;  2JJK A;  3IOW A;  5I58 A;  4LQ5 A;  4PDH A;  4L17 A;  1CNQ A;  1JVY A;  1QJM A;  4YMB A;  4OER A;  2H25 A;  4G77 A;  4RA1 A;  1I6B A;  4H5F A;  4FIM A;  4XF5 A;  3CG3 A;  1BTJ A;  2Z8D A;  3RT6 B;  1NV1 A;  3PMV A;  5DVJ A;  3O9P A;  2F7C A;  4XKQ A;  3S2V A;  2O6A A;  1B40 A;  1ZU0 A;  2Q2A A;  4DI4 B;  3L6G A;  4QSD A;  5I2K B;  2DS9 A;  1M5C A;  4NF8 A;  3LSX A;  2CMO A;  4JVI A;  1GV8 A;  3UA8 A;  5ELV A;  2B3F A;  4PFU A;  5F24 A;  5JTY B;  1B7H A;  1QGX A;  4GX6 A;  1NV4 A;  2QL3 A;  1MXU A;  4R6K A;  3FVN A;  5IZZ A;  3SER A;  4PE3 A;  1B6H A;  4PFR A;  1URG A;  5A5X B;  3LSL A;  4O3A A;  1LST A;  1MY2 A;  5JK4 A;  3C9H A;  4P3L A;  1D9Q A;  2FVZ A;  3DEL B;  2UVG A;  5I58 B;  2HZL A;  4H6D A;  3FGS A;  1NV6 A;  2L5V A;  5J16 A;  4N8G A;  3EKI A;  1MY4 A;  3OEN A;  4M1V A;  3SEX A;  2VD2 A;  3OSQ A;  4WEP A;  1IXH A;  4GL0 A;  1AIV A;  1XT8 A;  4BDM A;  4F1V A;  1B5J A;  4HXV A;  5IZ1 A;  5ITO A;  2Q8M A;  2H4I A;  3FXU A;  4ZEI A;  3IFA A;  3UGW A;  5I84 A;  1LAF E;  3PPN A;  5AA4 A;  4F19 A;  4ESX A;  4NAP A;  3K02 A;  2HPG A;  3LUZ A;  1H43 A;  1S50 A;  2O69 A;  5IZ3 A;  2XWI A;  3IB1 A;  4FBP A;  4JSD A;  5F7V A;  2RF1 A;  1NNF A;  4EUO A;  4PTK A;  4U4X A;  5DW8 A;  1FPD A;  4QRZ A;  1EYK A;  1FQB A;  3ECR A;  4X9T A;  1B3L A;  1B7Z A;  5CMB A;  3WAE A;  1YXI A;  2H5Y A;  1LGB C;  2XWK A;  4U2R A;  4ND9 A;  2V3Q A;  2H98 A;  2R8T A;  3T9H B;  3VV5 A;  3H6U A;  3CHG A;  4ZDM A;  1USY E;  1K9Z A;  2ZZW A;  4JVC A;  2ESN A;  4IO2 A;  1DBZ A;  2HHM A;  1FPJ A;  1OVB A;  1B4Z A;  4JB7 A;  3V89 B;  3USD A;  4OA4 A;  1P1Q A;  3FAS A;  4IO7 A;  3BIH A;  2DP8 A;  4PBH A;  2F8D A;  4KCD A;  5AA2 D;  5AA4 B;  1PB9 A;  3MST A;  1ZKB A;  3IOV A;  3ODB A;  4PCD A;  3K6V A;  5HM4 B;  4O7I A;  2HQ0 A;  3FJG A;  5CBS A;  1B52 A;  4U21 A;  1FPI A;  4NED A;  3CVG A;  3PPO A;  1A40 A;  2GH9 A;  4RY1 A;  1VE4 A;  4NF5 A;  1IXI A;  3OOA A;  4GIZ A;  3E79 A;  2Z23 A;  4MHF A;  1LBX A;  5DEX B;  1JVX A;  1VFE A;  2O51 A;  2ZZV A;  4P0I A;  1B3E A;  4LUB A;  5IAI A;  3IR1 A;  3PPQ A;  3FIR A;  3A3C A;  1H45 A;  5H8S A;  2O1L A;  3KSX A;  3Q27 A;  4Z0I A;  2ZXT A;  3UIF A;  1D9Y A;  1M5B A;  3PPR A;  4DXC A;  4AS5 A;  4OET A;  4O3B A;  3RN8 A;  5L9O A;  4GWX A;  2QRY A;  1II5 A;  2Z8F A;  1P1U A;  4KCC A;  1PB8 A;  3U93 A;  2VOZ A;  4KYE A;  3PPP A;  4PF6 A;  1NKX A;  1HSE A;  2ONS A;  4GL8 A;  3TCH A;  3LV0 A;  2XXR A;  4UA8 A;  2Z22 A;  1I6Q A;  4H65 A;  5BWJ A;  2OWS A;  1Y20 A;  1FTL A;  3O29 A;  4PQJ A;  3C4M A;  4PAK A;  4OFJ A;  1GVC A;  4NF5 B;  4DZ1 A;  4H8J A;  1QKB A;  2ONR A;  2KQZ A;  3G7W A;  1MPB A;  2WBD A;  4FAJ A;  3QMF A;  3C31 A;  5AA2 A;  2XX7 A;  2XD3 A;  1Q1K A;  3TTM A;  3HO7 A;  4GWY A;  5DT6 A;  1A7L A;  1N0T A;  3PGF A;  3MP1 A;  3DM0 A;  4G61 A;  1PC3 A;  1QUI A;  1QUJ A;  3GBB A;  5ESY A;  1JW4 A;  4DCX A;  5FHM A;  2LAO A;  2QS2 A;  3THI A;  4PFB A;  1SBP A;  4GF8 A;  3KC0 A;  2PYY A;  1EU8 A;  4ZZA A;  2CZK A;  2M8C A;  4ZE9 A;  1EYI A;  1JW5 A;  3WAF A;  1Y4T A;  3C35 A;  1WDN A;  5J1D A;  5EYG A;  3W9V A;  5KDT A;  3PMX A;  4XXU A;  3HV1 A;  1POT A;  2THI A;  2UVI A;  4P47 A;  5FBP A;  5CC2 A;  4XKP A;  5AA2 B;  2H9B A;  2B3B A;  2HAV A;  3DP4 A;  3VDF A;  3PUV E;  2CZL A;  1N84 A;  3QUF A;  5A5L A;  3PV0 E;  3H6T A;  5LOM A;  4JBZ A;  2AL4 A;  2VP1 A;  2R9J A;  3L6H A;  1URS A;  4EXL A;  1OQH A;  2QS4 A;  3MJN A;  1SQY A;  3I6V A;  3JV9 A;  1SW1 A;  5L9S A;  2F35 A;  3D4G A;  2OK2 A;  4XFE A;  1MDQ A;  3ZSF A;  5ITP A;  2P3V A;  3MUQ A;  1NNK A;  2X7Q A;  2FNC A;  1R6Z A;  4OEU A;  4EQ9 A;  2KLF A;  2O7I A;  4O8M A;  5KDT B;  5I5P A;  4KR5 A;  4MBP A;  4C1U A;  4N6D A;  4DI3 D;  3BKI B;  1FBP A;  4U23 A;  1B4H A;  2I4B A;  1YZ0 A;  4POX A;  2QPQ A;  4UAB A;  2F5X A;  1P1N A;  3SDF A;  2AL5 A;  4YB7 A;  3TOD A;  2NWJ A;  1US5 A;  2V3U A;  4QFP A;  5FHO A;  4I1D A;  2NVU B;  3E4R A;  3ROJ A;  2DWH A;  2ZYN A;  3CIJ A;  3MP6 A;  1MG1 A;  2F6P A;  4JDF A;  1NV7 A;  3M3F A;  1FTK A;  3JZJ A;  3HN0 A;  3RQT A;  1T0K A;  4WED A;  3AXF A;  2XX9 A;  1DK4 A;  1A99 A;  1YPN A;  4ZZE A;  1FPK A;  4NQ8 A;  2QVU A;  3HST A;  1FBG A;  4YKP A;  4F3G A;  1LCF A;  1FTJ A;  3O28 A;  1RYO A;  4IGR A;  4P8B A;  3U92 A;  2UYE A;  1XC1 A;  3V5A A;  4NF4 A;  1MQD A;  4XEQ A;  2F34 A;  4JWY A;  2ZYK A;  3ISP A;  3T1B A;  4GBV A;  2Q9T A;  3MZB A;  1QKA A;  3T93 B;  3T9V A;  1R1N A;  4NMY A;  3OD7 A;  4OZ9 A;  3FVO A;  4DXU A;  2GRV A;  4N07 A;  3W9W A;  1PDA A;  4R9G A;  3LSW A;  2AYS A;  1AOV A;  4DCY A;  5DYH A;  2OBG A;  5I2K A;  3BFT A;  1ATG A;  1A8E A;  4P1E A;  3O2A A;  5B70 A;  1NL5 A;  5H8N A;  1QUL A;  4KFQ A;  5AA1 A;  1IXC A;  4LZ7 A;  3VFJ A;  3OXN A;  5JTY A;  3K6W A;  4O3C A;  4MJO A;  3G3I A;  3K01 A;  3GYY A;  3B8B A;  2DVC A;  4DE8 A;  1P1W A;  4P1L A;  3C33 A;  2HXR A;  3FJ7 A;  1R9Q A;  3U72 A;  3ZKL A;  3TQW A;  1IIW A;  1SVX B;  1NNT A;  1LFH A;  4NF4 B;  1VFD A;  4I62 A;  1F9B A;  4K3F A;  2DE4 A;  5ET6 A;  3Q29 A;  3ILU B;  3KOS A;  3KC1 A;  3T96 B;  3K1M A;  4FE8 A;  3TFL A;  2PX1 A;  4OFO A;  4RXL A;  1KWH A;  4QXD A;  1RYX A;  3VLV A;  1FTM A;  2NOO A;  3H7M A;  3FV2 A;  1XOC A;  2PT2 A;  2E0S A;  3KN7 A;  3GXA A;  1NV0 A;  5H8F B;  1MXV A;  4ZED A;  4Q8R A;  1B05 A;  1FJ9 A;  1B1H A;  4ZEK A;  1NUZ A;  1NH8 A;  4P11 A;  4DDD A;  3B6T A;  3IX1 A;  4MLV A;  1IQ7 A;  5H8N B;  4ZEF A;  1TXF A;  2Q89 A;  3VXC A;  2CZI A;  4F39 A;  2PFY A;  4FOR A;  1LAX A;  2ABH A;  4FJP A;  3C36 A;  1YCJ A;  1Y3N A;  4MF3 A;  4IR8 A;  2Y84 A;  3TEL A;  3TPA A;  3D1R A;  3U94 A;  4Q5T A;  5I57 A;  4ESW A;  4R2B A;  1A54 A;  2V84 A;  3JYR A;  1IMA A;  4H5G A;  1LBC A;  3RYD A;  3ILT B;  3KGC A;  3KBR A;  3IO4 A;  1O7T A;  2A5S A;  3CFL A;  5CI5 A;  1D4N A;  5EQ9 A;  3SEY A;  2F6G A;  4GOT A;  1FQD A;  1L5T A;  1GTK A;  4G4P A;  3HHG A;  3OSR A;  5FTI A;  3GBA A;  3K1P A;  4P56 A;  3C32 A;  4JWX A;  1FJ6 A;  2I3V A;  2FHY A;  3G3G A;  2HZK A;  2XXH A;  1FBD A;  3B6W A;  4C0R A;  3SEV A;  1B5H A;  1OQG A;  3E9X A;  5I57 B;  3MQ9 A;  2XWV A;  3KBZ A;  4IY5 A;  4NGU A;  3H3G A;  3RPW A;  2OWZ A;  4AB5 A;  3N6U A;  1IEJ A;  1HSJ A;  5DEX A;  3T22 A;  3U8Q A;  3B50 A;  1FSA A;  1ZJL A;  1B7U A;  3FVG A;  1JP4 A;  1K9Y A;  4I3Y A;  1AMF A;  2QSX A;  4MX6 A;  3H6V A;  3FVK A;  5CMM A;  1ELJ A;  1MPD A;  2MKZ A;  2I48 A;  1OVT A;  4LON B;  2PCR A;  4GX4 A;  4WKM A;  4GFR A;  3TEP A;  1UQW A;  2V25 A;  2OX3 A;  2GFE A;  1URD A;  1TT1 A;  1BK4 A;  4F22 A;  1IXG A;  3TTK A;  2G93 A;  1SD3 A;  3K00 A;  1POY 1;  2FIX A;  3EHU A;  4RJZ A;  2VT5 A;  5TU0 A;  5I7I A;  3RTF B;  2O84 X;  1B0H A;  1NV2 A;  4U4S A;  1IMB A;  3T9U A;  4HCW A;  4G8M A;  5EQ8 A;  1M5F A;  3MVX A;  4PC9 A;  1B5I A;  1IZ1 A;  2OZZ A;  4PFT A;  3CSG A;  4G8H A;  5BUU A;  3K4U A;  1NUY A;  3VE1 B;  2DWJ A;  1JEV A;  3QIM A;  1N76 A;  1P1O A;  3IJX B;  5DTB A;  4OFL A;  2RCB A;  2XXP A;  1TFD A;  1GGG A;  2QMW A;  4YZZ A;  1LBB A;  4YB6 A;  1FTO A;  2XXU A;  4ONY A;  1USY H;  1N3X A;  4KYD A;  2O7U A;  3KJ7 A;  5AA3 A;  4EQB A;  2PT1 A;  3H4Z A;  4OVP A;  4QF9 A;  1NV5 A;  1JET A;  3OO6 A;  4PAI A;  4KYS A;  5FHN A;  4KQP A;  2ZNT A;  2XA5 A;  1MY0 A;  1B58 A;  2XXT A;  3UK4 A;  3Q26 A;  4GXS B;  4IO4 A;  3CI8 A;  4WXJ A;  1MM7 A;  4H8I A;  1MQG A;  2I4C A;  3VLW A;  2YJP A;  4N6P A;  3SET A;  4HW8 A;  1FTA A;  4PF8 A;  4NWC A;  1FPE A;  4JVD A;  1FPL A;  3S9E A;  3OO8 A;  1JQF A;  4R6Y A;  1DTG A;  3BIG A;  1FW0 A;  4OEN A;  1MS7 A;  4HCY A;  4AQ4 A;  1I6A A;  2UVH A;  1FQE A;  5AE4 A;  2ZZX A;  2IEE A;  3LR1 A;  3S9N C;  4F29 A;  2OJT A;  3R6U A;  2XHD A;  1UTB B;  1G0H A;  4N81 A;  3FV1 A;  5K2Y A;  5ISU A;  1B46 A;  3KJT A;  2OCU A;  2ZNS A;  2A5T A;  3K6X A;  1NV3 A;  3LUY A;  1IMD A;  2Q88 A;  2BJI A;  1RDX A;  3LBS A;  3ZS6 A;  4BDO A;  1LAG E;  2DDK A;  4E0X A;  3EQ1 A;  2D3I A;  1LBY A;  2CZH A;  1B2H A;  2ZYO A;  1IMF A;  1PB7 A;  4P0G A;  1FQA A;  3QXM A;  1BIY A;  3MBP A;  4U1O A;  4F2O A;  3FZV A;  1TFA A;  3K2D A;  3N26 A;  3RGY A;  2ONK E;  1VDW A;  1Y1Z A;  4FED A;  4R6H A;  5LDZ A;  4RYA A;  4LZ8 A;  4F1Y A;  2UYF A;  2PMS A;  2Y7W A;  4PGP A;  3FXB A;  1FBE A;  4OMB A;  4TLM B;  2Z8E A;  3RPL B;  4YKI A;  3FJM A;  4POW A;  1UIV A;  3TTR A;  5ET5 A;  4OAN A;  4ZS9 A;  2BJJ X;  3IOR A;  3IOT A;  1EZO A;  2I49 A;  1ZLQ A;  3QYT A;  2HFB A;  2Y5K A;  3G3J A;  3D4C A;  2A5T B;  2DE3 A;  4BDQ A;  1Z7N E;  1SPI A;  5TP9 B;  2ZYM A;  2R71 A;  3IFC A;  4TOZ A;  1P99 A;  5EHM A;  4X04 A;  2DSF A;  1ZMG A;  3CG1 A;  3PU5 A;  2RIN A;  1Z7M E;  4M4G A;  3GLB A;  5FTH A;  3NOH A;  4TLL B;  1BP5 A;  4N17 A;  1YTV A;  3QUJ A;  1UTH B;  3IB0 A;  2DYX A;  3A3U A;  4JWO A;  1INP A;  2XXI A;  3Q28 A;  5IKB A; 
#chains in the Genus database with same CATH homology
 2F36 A;  3TQL A;  1O63 A;  3OEL A;  5K2X A;  5B7D A;  1VR5 A;  4F1U A;  4E0W A;  4YAH X;  3RY3 A;  3MWB A;  1M5E A;  1MQJ A;  4PE5 B;  2O68 A;  3FXQ A;  3KEI A;  1MQH A;  2ZMB A;  4HTG A;  3VLU A;  4EF1 A;  4JSO A;  1IIT A;  3FXR A;  4Q30 B;  3PUY E;  1H76 A;  1R9L A;  4IO3 A;  4F18 A;  4GQO A;  2VD3 A;  3N94 A;  1SI0 A;  2DWI A;  4NF6 A;  3TKD A;  1JEU A;  2DWA A;  2XXY A;  2D21 A;  2QMX A;  3MZ1 A;  3PUZ E;  3KN3 A;  3PD9 A;  4H1X A;  1N04 A;  4GD5 A;  2WKY A;  4I8C A;  5I2N B;  5H8F A;  4YMA A;  2RKM A;  3TAJ A;  1D9V A;  5DVI A;  4X1D A;  3K1N A;  3TMG A;  3IB2 A;  4ZE8 A;  1ANF A;  1SW5 A;  4ECF A;  5M2V A;  1QUK A;  4R9F A;  1B3H A;  4IO5 A;  1CE2 A;  2E1S A;  2PBW A;  1XS5 A;  1MXX A;  4NTL A;  2REG A;  2QJE A;  1GR2 A;  1B0L A;  4BDN A;  2I3W A;  1NH7 A;  4ELP A;  4NF6 B;  3LSF B;  2Q2C A;  4G8N A;  2FYI A;  3O66 A;  2Y7R A;  3MVY A;  3UN6 A;  2XX8 A;  3DP6 A;  4RK2 A;  4NWD A;  2DQV A;  4FAT A;  1EZP A;  1CB6 A;  3VVF A;  3G3F A;  2F7A A;  1BLF A;  1QW0 A;  2O1M A;  3OMB A;  4RPN A;  2Y7P A;  5H8Q B;  3TCG A;  2DOJ A;  1M5D A;  4AB6 A;  1SW2 A;  2F97 A;  2RC8 A;  3MPL A;  1PBP A;  2QS3 A;  1BKA A;  5CM6 A;  3QAX A;  5HBC A;  2W7Y A;  3SES A;  1DSN A;  3I5O A;  2XXW A;  4MH5 A;  4DIG A;  2ALU A;  4OYV A;  3MZ9 A;  5CMK A;  1MRP A;  1HSL A;  4OVJ A;  5H8H B;  1ZIU A;  3OEM A;  1WOD A;  3BBR A;  1OMP A;  3R26 A;  3HPI A;  3CFZ A;  4QFL A;  2XXV A;  5CRY A;  5I59 A;  4BDL A;  3P7I A;  2V3T A;  1B9J A;  4GRK A;  4UAC A;  1Y1M A;  5ICQ A;  3S9L C;  3SEW A;  1EH3 A;  3B6Q A;  2OLB A;  3PUW E;  2RCA A;  3HHF A;  4R75 A;  5EHS A;  3DP8 A;  3V8X B;  1DPP A;  2I58 A;  1MY3 A;  3B7D A;  1B3F A;  4NF8 B;  5DVF A;  4OES A;  4LAT A;  5KCJ A;  4OEV A;  4DXB A;  1WVJ A;  1NMU A;  5CMC A;  1XVX A;  1O64 A;  4BDR A;  4OXV A;  1I69 A;  2XXQ A;  3KFM A;  1YAE A;  3EPE A;  4RPO A;  4MLQ A;  3KSJ A;  1J1N A;  3TYH A;  1S7Y A;  3S4U A;  4C1T A;  4EXK A;  1MM6 A;  2D5W A;  3ONM A;  4KI0 E;  4YKJ A;  5I59 B;  4IO6 A;  2GHA A;  2V93 A;  1NFT A;  3RNN A;  1LFI A;  3V83 A;  1EZ9 A;  4KPT A;  1Y4C A;  3CR9 A;  3N6T A;  3PUX E;  4TQU Q;  1LFG A;  3RT8 A;  3M8U A;  2Y7K A;  3OEK A;  1MH4 A;  1RKM A;  1H3D A;  1US4 A;  3MAM A;  3FD3 A;  3A09 A;  3TCF A;  4R72 A;  3FAT A;  2YLN A;  4R73 A;  4OWD A;  5KCJ B;  3SEU A;  1AH5 A;  4FEB A;  2RC7 A;  2R6G E;  1LB8 A;  1NNP A;  3VVD A;  1SDX A;  1B1X A;  2F78 A;  3KG2 A;  3R7X A;  1LLS A;  2ZNU A;  1MQI A;  2HCA A;  1SW4 A;  1A55 A;  3KZG A;  4IB2 A;  1UIU A;  1MDP 1;  3T66 A;  4U22 A;  2HAU A;  1DOT A;  2I0C A;  2DXR A;  1LB9 A;  4LA9 A;  4EF2 A;  4YKK A;  3M3K A;  2VGQ A;  4F3S A;  2Q8J A;  3VXB A;  3CFX A;  4F31 B;  1UTB A;  3I3V A;  2I0B A;  2HEU A;  1Y3P A;  5L9M A;  3K0V A;  1FCK A;  2B65 A;  3TTN A;  3W15 C;  5EYF A;  1MY1 A;  4HS7 A;  1PEB A;  3H03 A;  1AL3 A;  2GHB A;  3IO6 A;  1S9T A;  2UVJ A;  3RLF E;  4ZEB A;  5I56 A;  1A8F A;  4RNS A;  4OHN A;  3CRB A;  4R74 A;  5CBR A;  4F3B A;  4JXI A;  3E13 X;  3KN8 A;  1TWY A;  4ELO A;  2F7B A;  1LCT A;  5JEI A;  3N5L A;  4THI A;  3PMW A;  3IOU A;  1B32 A;  4G2Z A;  4QFO A;  3O6G A;  3ZKK A;  4ELR A;  4BLA A;  5HPQ A;  3IK6 B;  1B3G A;  4XIG Q;  2XD2 A;  2FA7 A;  4PET A;  3FUZ A;  5TP9 A;  1JNF A;  3CSB A;  4LP2 B;  4QHQ A;  4R2F A;  2I6E A;  4NE4 A;  3IAZ A;  1MPC A;  4H67 A;  1SYI A;  3EHS A;  4QFK A;  3H06 B;  1LAH E;  5I56 B;  1Y9U A;  3TZA A;  1UTH A;  1FQF A;  4EQ7 A;  3BFU A;  1QVS A;  1Q35 A;  1N7W A;  4Z7E A;  2X26 A;  4PFW A;  3TUS A;  2H99 A;  4EDP A;  1DMB A;  4G68 A;  3H6W A;  3EF7 A;  1N3W A;  4OQO A;  2YPN A;  1SYH A;  1XHY A;  4N13 A;  3PD8 A;  1JW1 A;  2Y7I A;  3GZG A;  4XKR A;  4YB5 A;  2DXY A;  2QS1 A;  3MP8 A;  3MPK A;  4GLI A;  1FQC A;  1XVY A;  5ICT A;  4IGT A;  4OTE A;  1VSO A;  2VHA A;  4MFI A;  2DE2 A;  4F2Q A;  2OWT A;  5KZT A;  2IA4 A;  3MW0 A;  4GVO A;  4ELQ A;  2NXO A;  2PVU A;  2UXA A;  4DLD A;  3MVZ A;  4LVQ A;  4U1Z A;  5I2N A;  5F1Q A;  2NUV A;  3QK6 A;  3VVE A;  3UP9 A;  1D3K A;  4G68 B;  4IY6 A;  3EHT A;  4GXA A;  4YU0 A;  3LC8 A;  3EN3 A;  4Q0C A;  2X7P A;  1DPE A;  2HXW A;  4RK9 A;  4YIC A;  1SI1 A;  1PBQ A;  3S9M C;  1DTZ A;  4QSC A;  1OLC A;  1MXW A;  3DLN A;  3MVW A;  2P2A A;  4XTC Q;  4LZ5 A;  1H44 A;  5TPA A;  1ZTY A;  2DVZ A;  3MC2 A;  1MH3 A;  2P0S A;  5L8D A;  4F3P A;  3TTL A;  3F11 A;  3O6I A;  3UOR A;  2RC9 A;  3RTW B;  1MXY A;  3IJO B;  4XKN A;  2XXX A;  4LQ2 A;  1B51 A;  4FEC A;  1N7X A;  5H8Q A;  3IL1 B;  1OIB A;  1Y3Q A;  4GWO A;  4X1B A;  2REJ A;  3T9X B;  4H0W A;  2AIX A;  3OO9 A;  3QSL A;  3U1O A;  3G3H A;  1ZBM A;  1OLA A;  3RUM A;  2P1S A;  3O97 A;  3K6U A;  3TDJ A;  4KD5 A;  4KHZ E;  4PFY A;  4QFN A;  3SKP A;  3KOT A;  2ANJ A;  3OO7 A;  4X48 A;  1MXZ A;  4ISU A;  5TPA B;  2G29 A;  5H8H A;  3G3K A;  4I9D A;  4G68 C;  1IUD A;  3O6H A;  5A5X A;  3Q25 A;  4QSE A;  3HCQ A;  4PP0 A;  3E3K A;  3M3L A;  3C34 A;  4ZEC A;  3IOW A;  5I58 A;  4LQ5 A;  4L17 A;  1JVY A;  1QJM A;  4YMB A;  4OER A;  2H25 A;  4G77 A;  4RA1 A;  1I6B A;  4H5F A;  4FIM A;  3CG3 A;  1BTJ A;  2Z8D A;  3RT6 B;  3PMV A;  5DVJ A;  3O9P A;  2F7C A;  4XKQ A;  3S2V A;  2O6A A;  1B40 A;  1ZU0 A;  2Q2A A;  3L6G A;  4QSD A;  5I2K B;  2DS9 A;  1M5C A;  4NF8 A;  3LSX A;  2CMO A;  1GV8 A;  3UA8 A;  5ELV A;  2B3F A;  4PFU A;  5JTY B;  1B7H A;  2QL3 A;  1MXU A;  4R6K A;  3FVN A;  3SER A;  1B6H A;  1URG A;  5A5X B;  3LSL A;  4O3A A;  1LST A;  1MY2 A;  5JK4 A;  3C9H A;  3DEL B;  2UVG A;  5I58 B;  2HZL A;  4H6D A;  3FGS A;  1MY4 A;  3OEN A;  4M1V A;  3SEX A;  2VD2 A;  3OSQ A;  4WEP A;  1IXH A;  4GL0 A;  1AIV A;  1XT8 A;  4BDM A;  4F1V A;  1B5J A;  5ITO A;  2H4I A;  3FXU A;  4ZEI A;  3UGW A;  5I84 A;  1LAF E;  3PPN A;  5AA4 A;  4F19 A;  4ESX A;  3K02 A;  1H43 A;  1S50 A;  2O69 A;  3IB1 A;  4JSD A;  5F7V A;  2RF1 A;  1NNF A;  4EUO A;  4U4X A;  4QRZ A;  1FQB A;  3ECR A;  4X9T A;  1B3L A;  1B7Z A;  5CMB A;  3WAE A;  2H5Y A;  1LGB C;  4U2R A;  4ND9 A;  2V3Q A;  2H98 A;  3T9H B;  3VV5 A;  3H6U A;  4ZDM A;  1USY E;  2ESN A;  4IO2 A;  1OVB A;  1B4Z A;  4JB7 A;  3V89 B;  3USD A;  1P1Q A;  3FAS A;  4IO7 A;  2DP8 A;  2F8D A;  4KCD A;  5AA2 D;  5AA4 B;  1PB9 A;  1ZKB A;  3IOV A;  3ODB A;  3K6V A;  5HM4 B;  2HQ0 A;  3FJG A;  5CBS A;  1B52 A;  4U21 A;  4NED A;  3CVG A;  3PPO A;  1A40 A;  2GH9 A;  4RY1 A;  1VE4 A;  4NF5 A;  1IXI A;  3OOA A;  4GIZ A;  2Z23 A;  5DEX B;  1JVX A;  1VFE A;  2O51 A;  4P0I A;  1B3E A;  4LUB A;  5IAI A;  3IR1 A;  3PPQ A;  3FIR A;  3A3C A;  1H45 A;  5H8S A;  2O1L A;  3KSX A;  3Q27 A;  4Z0I A;  2ZXT A;  3UIF A;  1D9Y A;  1M5B A;  3PPR A;  4DXC A;  4OET A;  4O3B A;  3RN8 A;  5L9O A;  2QRY A;  1II5 A;  2Z8F A;  1P1U A;  4KCC A;  1PB8 A;  3U93 A;  2VOZ A;  4KYE A;  3PPP A;  1NKX A;  1HSE A;  2ONS A;  4GL8 A;  3TCH A;  2XXR A;  4UA8 A;  2Z22 A;  1I6Q A;  4H65 A;  5BWJ A;  2OWS A;  1Y20 A;  1FTL A;  3O29 A;  4PQJ A;  3C4M A;  1GVC A;  4OFJ A;  4NF5 B;  4DZ1 A;  4H8J A;  1QKB A;  2ONR A;  3G7W A;  1MPB A;  4FAJ A;  3C31 A;  5AA2 A;  2XX7 A;  2XD3 A;  1Q1K A;  3TTM A;  3HO7 A;  5DT6 A;  1A7L A;  1N0T A;  3PGF A;  3MP1 A;  3DM0 A;  1PC3 A;  1QUI A;  1QUJ A;  3GBB A;  1JW4 A;  4DCX A;  5FHM A;  2LAO A;  2QS2 A;  3THI A;  1SBP A;  4GF8 A;  2PYY A;  1EU8 A;  4ZZA A;  2M8C A;  4ZE9 A;  1JW5 A;  3WAF A;  1Y4T A;  3C35 A;  1WDN A;  5J1D A;  3W9V A;  5KDT A;  3PMX A;  4XXU A;  3HV1 A;  1POT A;  2THI A;  2UVI A;  5CC2 A;  4XKP A;  5AA2 B;  2H9B A;  2B3B A;  2HAV A;  3DP4 A;  3VDF A;  3PUV E;  2CZL A;  1N84 A;  3QUF A;  3PV0 E;  3H6T A;  5LOM A;  4JBZ A;  2AL4 A;  2VP1 A;  2R9J A;  3L6H A;  1URS A;  4EXL A;  1OQH A;  2QS4 A;  3MJN A;  1SQY A;  3I6V A;  3JV9 A;  1SW1 A;  5L9S A;  2F35 A;  3D4G A;  2OK2 A;  1MDQ A;  3ZSF A;  5ITP A;  3MUQ A;  1NNK A;  2X7Q A;  2FNC A;  1R6Z A;  4OEU A;  4EQ9 A;  2KLF A;  2O7I A;  5KDT B;  4KR5 A;  4MBP A;  4C1U A;  3BKI B;  4U23 A;  1B4H A;  2I4B A;  4POX A;  2QPQ A;  2F5X A;  1P1N A;  3SDF A;  2AL5 A;  4YB7 A;  3TOD A;  2NWJ A;  1US5 A;  2V3U A;  4QFP A;  5FHO A;  4I1D A;  2NVU B;  3E4R A;  2DWH A;  2ZYN A;  3CIJ A;  3MP6 A;  1MG1 A;  2F6P A;  4JDF A;  3M3F A;  1FTK A;  3JZJ A;  3HN0 A;  3RQT A;  1T0K A;  4WED A;  3AXF A;  2XX9 A;  1A99 A;  1YPN A;  4ZZE A;  3HST A;  4F3G A;  4YKP A;  1LCF A;  1FTJ A;  3O28 A;  1RYO A;  4IGR A;  3U92 A;  2UYE A;  1XC1 A;  3V5A A;  4NF4 A;  1MQD A;  2F34 A;  4JWY A;  2ZYK A;  2Q9T A;  3MZB A;  1QKA A;  3T93 B;  3T9V A;  1R1N A;  4NMY A;  3OD7 A;  4OZ9 A;  3FVO A;  4DXU A;  2GRV A;  4N07 A;  3W9W A;  1PDA A;  4R9G A;  3LSW A;  2AYS A;  1AOV A;  4DCY A;  5DYH A;  2OBG A;  5I2K A;  3BFT A;  1ATG A;  1A8E A;  3O2A A;  5B70 A;  1NL5 A;  5H8N A;  1QUL A;  4KFQ A;  5AA1 A;  1IXC A;  4LZ7 A;  3VFJ A;  3OXN A;  5JTY A;  3K6W A;  4O3C A;  3G3I A;  3K01 A;  2DVC A;  4DE8 A;  1P1W A;  3C33 A;  3FJ7 A;  1R9Q A;  3U72 A;  3ZKL A;  3TQW A;  1IIW A;  1SVX B;  1NNT A;  1LFH A;  4NF4 B;  1VFD A;  4I62 A;  1F9B A;  4K3F A;  2DE4 A;  3Q29 A;  3ILU B;  3KOS A;  3T96 B;  3K1M A;  4FE8 A;  3TFL A;  2PX1 A;  4OFO A;  4RXL A;  1KWH A;  1RYX A;  3VLV A;  1FTM A;  2NOO A;  3H7M A;  3FV2 A;  1XOC A;  2PT2 A;  2E0S A;  3KN7 A;  3GXA A;  5H8F B;  1MXV A;  4ZED A;  4Q8R A;  1B05 A;  1B1H A;  4ZEK A;  1NH8 A;  4P11 A;  4DDD A;  3B6T A;  3IX1 A;  4MLV A;  1IQ7 A;  5H8N B;  4ZEF A;  1TXF A;  2Q89 A;  3VXC A;  4F39 A;  4FOR A;  1LAX A;  2ABH A;  4FJP A;  3C36 A;  1YCJ A;  1Y3N A;  4MF3 A;  2Y84 A;  3TEL A;  3TPA A;  3U94 A;  4Q5T A;  5I57 A;  4ESW A;  4R2B A;  1A54 A;  2V84 A;  3JYR A;  4H5G A;  1LBC A;  3ILT B;  3KGC A;  3KBR A;  3IO4 A;  1O7T A;  2A5S A;  3CFL A;  5CI5 A;  1D4N A;  3SEY A;  2F6G A;  4GOT A;  1FQD A;  1L5T A;  1GTK A;  4G4P A;  3HHG A;  3OSR A;  5FTI A;  3GBA A;  3K1P A;  3C32 A;  4JWX A;  2I3V A;  3G3G A;  2HZK A;  2XXH A;  3B6W A;  4C0R A;  3SEV A;  1B5H A;  1OQG A;  3E9X A;  5I57 B;  3MQ9 A;  4IY5 A;  3H3G A;  3RPW A;  4AB5 A;  3N6U A;  1IEJ A;  1HSJ A;  5DEX A;  3T22 A;  3U8Q A;  1ZJL A;  1B7U A;  3FVG A;  1AMF A;  2QSX A;  3H6V A;  3FVK A;  5CMM A;  1ELJ A;  1MPD A;  2I48 A;  1OVT A;  4LON B;  4WKM A;  4GFR A;  3TEP A;  1UQW A;  2V25 A;  2GFE A;  1URD A;  1TT1 A;  4F22 A;  1IXG A;  3TTK A;  2G93 A;  1SD3 A;  3K00 A;  1POY 1;  3EHU A;  4RJZ A;  5TU0 A;  3RTF B;  2O84 X;  1B0H A;  4U4S A;  3T9U A;  4HCW A;  4G8M A;  1M5F A;  3MVX A;  1B5I A;  1IZ1 A;  2OZZ A;  4PFT A;  3CSG A;  4G8H A;  5BUU A;  3K4U A;  3VE1 B;  2DWJ A;  1JEV A;  3QIM A;  1N76 A;  1P1O A;  3IJX B;  5DTB A;  4OFL A;  2RCB A;  2XXP A;  1TFD A;  1GGG A;  2QMW A;  4YZZ A;  1LBB A;  4YB6 A;  1FTO A;  2XXU A;  4ONY A;  1USY H;  1N3X A;  4KYD A;  2O7U A;  3KJ7 A;  5AA3 A;  4EQB A;  2PT1 A;  3H4Z A;  4QF9 A;  1JET A;  3OO6 A;  4KYS A;  5FHN A;  4KQP A;  2ZNT A;  1MY0 A;  1B58 A;  2XXT A;  3UK4 A;  3Q26 A;  4GXS B;  4IO4 A;  3CI8 A;  4WXJ A;  1MM7 A;  4H8I A;  1MQG A;  2I4C A;  3VLW A;  2YJP A;  4N6P A;  3SET A;  4HW8 A;  4NWC A;  3S9E A;  3OO8 A;  1JQF A;  4R6Y A;  1DTG A;  1FW0 A;  4OEN A;  1MS7 A;  4HCY A;  4AQ4 A;  1I6A A;  2UVH A;  1FQE A;  5AE4 A;  2IEE A;  3LR1 A;  3S9N C;  4F29 A;  2OJT A;  3R6U A;  2XHD A;  1UTB B;  3FV1 A;  5K2Y A;  5ISU A;  1B46 A;  3KJT A;  2OCU A;  2ZNS A;  2A5T A;  3K6X A;  3LUY A;  2Q88 A;  3LBS A;  3ZS6 A;  4BDO A;  1LAG E;  4E0X A;  3EQ1 A;  2D3I A;  1B2H A;  2ZYO A;  1PB7 A;  4P0G A;  1FQA A;  3QXM A;  1BIY A;  3MBP A;  4U1O A;  4F2O A;  3FZV A;  1TFA A;  3K2D A;  3N26 A;  3RGY A;  2ONK E;  1Y1Z A;  4FED A;  4R6H A;  4RYA A;  4LZ8 A;  4F1Y A;  2UYF A;  2PMS A;  2Y7W A;  4OMB A;  4TLM B;  2Z8E A;  4YKI A;  3FJM A;  4POW A;  1UIV A;  3TTR A;  4ZS9 A;  2BJJ X;  3IOR A;  3IOT A;  1EZO A;  2I49 A;  1ZLQ A;  3QYT A;  2HFB A;  3G3J A;  3D4C A;  2A5T B;  2DE3 A;  4BDQ A;  1Z7N E;  5TP9 B;  2ZYM A;  2R71 A;  4TOZ A;  1P99 A;  5EHM A;  2DSF A;  1ZMG A;  3CG1 A;  3PU5 A;  2RIN A;  1Z7M E;  4M4G A;  3GLB A;  5FTH A;  4TLL B;  1BP5 A;  1YTV A;  3QUJ A;  1UTH B;  3IB0 A;  2DYX A;  3A3U A;  4JWO A;  2XXI A;  3Q28 A;  5IKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...