1AMFA

Crystal structure of moda, a molybdate transport protein, complexed with molybdate
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
231
structure length
231
Chain Sequence
GKITVFAAASLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDATE TRANSPORT PROTEIN MODA
publication title Crystal structure of the molybdate binding protein ModA.
pubmed doi rcsb
molecule tags Binding protein
total genus 75
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 1997-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1amfA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1amfA02
3FJMA 5AA4B 2DVCA 2ALUA 4NF4B 2ZMBA 3RLFE 4X1DA 2I0CA 3TQWA 1IQ7A 1B7ZA 3MVWA 3HCQA 2IA4A 3O28A 2RCBA 1H43A 4LONB 4PFWA 5BWJA 1N04A 2Y7IA 4GXSB 1MY4A 4U1OA 4ISUA 2I49A 3M3KA 4KCCA 1I6QA 1FCKA 1B7UA 1POTA 4NF5B 3USDA 4KFQA 3TPAA 2XX8A 3MVYA 3IO6A 5I59B 4OERA 4ESWA 2XXXA 3RTWB 4YMBA 4R6HA 1H3DA 1D9YA 3K1PA 3G3KA 4ELRA 2QS1A 4XKNA 4R2FA 2Z23A 4X48A 1Z7ME 5DEXB 3OMBA 3SEVA 3T93B 4H67A 4HCYA 4KHZE 2V3UA 4FE8A 4OETA 5L9SA 1R6ZA 3QIMA 1LB9A 3VV5A 1B1HA 2F78A 2XXQA 3S9MC 1UTHA 2ESNA 2RF1A 4GVOA 1HSLA 3G3HA 3VLWA 4GF8A 3EQ1A 3CG1A 3MP8A 1SW4A 2CMOA 1I69A 1B40A 1IUDA 3DLNA 4FEDA 4YU0A 4R6YA 3MPLA 4KYSA 1MRPA 1S9TA 3W9VA 4IO3A 1LLSA 1NNPA 2O7UA 1GV8A 3TCGA 3GXAA 3KSJA 4TLMB 4LQ2A 3FASA 5AE4A 2OJTA 2XHDA 2V93A 1MXYA 5EYFA 3PPOA 4IO6A 1DTGA 4G2ZA 3IB1A 1MS7A 3BKIB 2H25A 4ZEIA 3I5OA 3A09A 1PDAA 3VFJA 5I58B 2XD3A 2Y7KA 3ZS6A 2E1SA 3K02A 3O6HA 3RUMA 2LAOA 3S4UA 1MG1A 1OLCA 4NF8B 5I2NB 4YKIA 3K6UA 2PX1A 1MM7A 3SEWA 4F2OA 3U94A 3OSRA 1NL5A 4P11A 4F19A 3EHTA 2UVIA 2HEUA 1TWYA 2ONRA 1IXIA 3RGYA 3T9HB 4OXVA 4KR5A 3OSQA 4DZ1A 3TTKA 1MPBA 3KBRA 1NNFA 1R9LA 3PPPA 3C31A 1YAEA 3WAEA 1NNKA 1TXFA 3ECRA 4KI0E 1B4HA 4KD5A 2Z22A 1MXZA 3SEXA 4LZ5A 1YTVA 5I56A 1A8FA 2PMSA 3MPKA 3ILTB 1H76A 2GHBA 3K6WA 1AH5A 4UA8A 4GLIA 1IIWA 4BDNA 5AA2D 1P1OA 3LC8A 5KDTB 2HCAA 3V89B 3A3UA 1ELJA 3C36A 4F3GA 4ZEBA 1ZKBA 4TLLB 2O7IA 4OEVA 5I2KA 1VFDA 3TZAA 4R6KA 1LCFA 4F18A 3R6UA 3S2VA 4NWCA 3OO8A 4JB7A 2QMXA 2XXUA 2UXAA 4Q30B 3PMVA 2X7PA 3CIJA 2H4IA 2Q8JA 3N6TA 2OCUA 4IO4A 5ELVA 3R7XA 4H0WA 3H06B 4RK9A 3FVOA 1B5JA 3O6GA 1O63A 2VD3A 4KPTA 3KG2A 3MVZA 3PU5A 5JK4A 3IOVA 4F22A 4NEDA 1SYIA 1OVTA 4C0RA 2Y84A 1Y3PA 4ZZAA 3PMWA 4PQJA 3IX1A 3SETA 4GFRA 3D4GA 4DIGA 1LBBA 3VXBA 3OEMA 2A5TB 4QFOA 1BLFA 4YKPA 3GBAA 1XVYA 4R75A 2THIA 3S9LC 1GGGA 1LGBC 5TU0A 5H8HA 5TPAB 1FTJA 1B32A 4NE4A 1M5BA 1VFEA 1QUIA 3E9XA 1UQWA 3U93A 4TOZA 4RXLA 2Z8EA 3FATA 2HQ0A 2F7AA 2XXTA 2DE3A 2BJJX 3GLBA 1H44A 1P1QA 2XXHA 4OQOA 3MWBA 2Q88A 3ZSFA 4RPOA 2ZXTA 4I9DA 5AA1A 1M5CA 2AL5A 2DQVA 3QUFA 1IXGA 4UACA 2UVJA 3LSFB 2QS4A 4WXJA 5ITOA 3H6WA 2OK2A 1EZOA 3VVDA 3KFMA 4RY1A 5AA2A 2VGQA 3IO4A 3E3KA 3DP8A 4EUOA 3H3GA 2WKYA 1OQHA 4ZDMA 5TP9B 3MJNA 1LCTA 1NKXA 2UYEA 4WEDA 5BUUA 4RPNA 1BKAA 4IB2A 2NVUB 1B3GA 3KZGA 1S7YA 1SBPA 3VE1B 4TQUQ 2DXRA 3SDFA 4F31B 1CB6A 4MF3A 1AMFA 2A5SA 4GWOA 3G3IA 3GZGA 3OO7A 4FATA 4G8NA 2DSFA 3IB0A 2AYSA 1D4NA 4YAHX 3M3LA 4YKKA 4YICA 3TQLA 4ELOA 2NOOA 3HO7A 3O9PA 3RY3A 3UA8A 2VP1A 4M4GA 3SKPA 3LSWA 1OIBA 4FJPA 1MM6A 2I0BA 5KCJB 3W15C 4MBPA 3BFUA 2VD2A 3SEYA 2ZYKA 2DOJA 1N3WA 4OESA 2HAUA 4EDPA 4RNSA 3V5AA 4ZEFA 4ECFA 4NTLA 1JVXA 1DPEA 1T0KA 3LR1A 4EXKA 3G3FA 5K2XA 5AA2B 4FAJA 2Q9TA 4FECA 4OFLA 4PE5B 3E13X 3K0VA 1LSTA 1MXXA 1NNTA 2GHAA 1JNFA 3UORA 3Q27A 2DP8A 3KEIA 2XXRA 5DVJA 1BIYA 4QFLA 4E0XA 3JV9A 3TFLA 5DT6A 1DOTA 1MXVA 1LFIA 1LAHE 3MZ9A 4G8MA 3U92A 4QRZA 1VR5A 3THIA 4U23A 3OENA 4DE8A 5ICQA 4R72A 5I57A 4U4SA 3N26A 1EZ9A 1M5DA 4RK2A 1D3KA 2I48A 1J1NA 4F3PA 3Q29A 4H6DA 3BBRA 4F2QA 1JW1A 4JBZA 4BDOA 3T96B 4BDLA 4C1TA 1EH3A 1B2HA 3H6UA 2NXOA 4NF6B 3B6QA 2I58A 1ZU0A 3K2DA 4G68A 4YB7A 2P0SA 3FJGA 1N3XA 3L6GA 4P0GA 3PPNA 4YZZA 3RT8A 4F3SA 4EF2A 3RPWA 1OVBA 2XXVA 5ITPA 4BDRA 3RTFB 2XX7A 1Y4CA 3MZ1A 4IGRA 2M8CA 4QFKA 5DTBA 3MBPA 1GR2A 5HPQA 3KSXA 2UVGA 1MXWA 4HTGA 1US4A 2RC8A 2XXWA 3IORA 3PUZE 2DWJA 3ONMA 2QSXA 1FTKA 4O3CA 3IOUA 5FHNA 3B6WA 3MZBA 3QAXA 4ELPA 1O64A 1MQGA 3JZJA 5IKBA 1LFGA 1ANFA 3UK4A 4YB6A 5HBCA 3TELA 3KN8A 1ZIUA 4NMYA 4QFPA 2QS2A 5FTIA 1PB7A 1R1NA 5F1QA 1UTHB 4O3BA 5CBRA 3SESA 3LSXA 2D5WA 3C9HA 1QULA 5CC2A 5H8NA 3H03A 2AIXA 2OLBA 2OWSA 5HM4B 1POY1 2DE2A 4G68B 4F39A 4H5GA 5A5XA 3TTNA 3Q26A 2O1MA 1PB9A 3OEKA 4F1VA 4PP0A 1SDXA 3GBBA 4QFNA 2YJPA 1VE4A 4LVQA 5H8QA 1M5EA 2GH9A 3EN3A 4GIZA 2NWJA 3TMGA 2PT2A 2GRVA 5B7DA 3CSBA 2AL4A 4QSDA 4XIGQ 1OMPA 1B6HA 4R2BA 4OENA 1QUKA 1S50A 1WVJA 2F6GA 3PUXE 3V8XB 1ZJLA 1RKMA 2F5XA 3CSGA 1MDP1 3TKDA 3HV1A 1SW1A 1SD3A 2HFBA 4IO7A 3FJ7A 1FQAA 2QMWA 4OFJA 3PGFA 4LZ7A 3KJ7A 5H8FA 3PUVE 1JW4A 4U1ZA 4U21A 4LP2B 4YMAA 3FVNA 1B51A 4PFUA 3I6VA 4IGTA 5KZTA 2I6EA 2FYIA 1IITA 5CMBA 1EZPA 1B58A 3UN6A 1Y3NA 4P0IA 2ZYNA 1L5TA 4GD5A 4BDMA 2V3QA 2E0SA 5CM6A 4QSEA 2H99A 3IOWA 3KOSA 1UIUA 3HPIA 3MP1A 1FW0A 4JWOA 1Y4TA 5JTYA 4DXUA 1URGA 3C4MA 3DP6A 4HCWA 2O6AA 3K6XA 3OOAA 1I6BA 1URSA 4ZEDA 3FD3A 3OO9A 3EHUA 4KYEA 1N0TA 2DWIA 4OFOA 3E4RA 3RN8A 2H9BA 1FTLA 2CZLA 4H8JA 1XOCA 5I56B 2REJA 4H65A 4POWA 1A54A 4U4XA 1PBQA 1A7LA 1MXUA 3HN0A 1ZBMA 1Y1ZA 2PYYA 2B3FA 3FXRA 4WEPA 2Y7WA 4OHNA 3G3GA 3CFXA 3K4UA 3EHSA 5I2KB 4AQ4A 1SVXB 1IZ1A 3AXFA 2Q2CA 5DVIA 3Q25A 1RYXA 3U1OA 2RCAA 3PPQA 4DXBA 2PT1A 1DPPA 1B3LA 3QXMA 1TFDA 4LQ5A 1UTBA 1JQFA 3UGWA 3M8UA 2YLNA 5FTHA 1Y20A 4FORA 2R6GE 2Z8DA 1SW2A 3LSLA 4EQ9A 3FUZA 4C1UA 1B7HA 3RNNA 2HXWA 2ZYMA 5FHMA 3OO6A 2D21A 2GFEA 2XXIA 3MAMA 3T9VA 3O97A 3K1MA 1ZMGA 3VVFA 5ICTA 1LAFE 3TCHA 1JW5A 1Y9UA 4GOTA 3R26A 3VDFA 5AA4A 2ZNTA 1YPNA 4NF4A 3KOTA 1GTKA 3DELB 2DWHA 1TFAA 1A40A 1B4ZA 3CFLA 2DXYA 2Z8FA 1US5A 4AB5A 2F7BA 1N84A 4PFTA 2X26A 4DCYA 4R74A 4Z0IA 4THIA 5I59A 5H8HB 2QRYA 3ZKLA 5DVFA 1BP5A 4H8IA 1JETA 2O1LA 2QPQA 4DCXA 3FGSA 1A8EA 5DEXA 1B0HA 3TUSA 1N7XA 3CR9A 2PBWA 1IXHA 2NUVA 3VXCA 3P7IA 1N76A 5CRYA 3HHFA 2RC7A 3S9NC 3IOTA 4K3FA 1FQEA 1MY1A 5L8DA 2Q89A 3FVKA 4QSCA 1A99A 1QKAA 2QJEA 4KQPA 4IO5A 4ZECA 4QF9A 2ANJA 2UVHA 2OBGA 3FXQA 1MY3A 4ESXA 1DTZA 3U8QA 3KN7A 4XTCQ 2O84X 5ISUA 2OZZA 2F36A 4EF1A 4BLAA 4OWDA 3IL1B 1F9BA 1SYHA 3IJXB 3G7WA 2H98A 2X7QA 2R9JA 5EHSA 3PD9A 3SERA 4OVJA 3TAJA 1B5IA 3LBSA 4OMBA 4X1BA 5I58A 1HSEA 2Q2AA 3LUYA 1P1UA 5CMMA 2ZNSA 1FQFA 1B52A 4JWXA 3FV1A 5CMKA 2O68A 4O3AA 4NF8A 4GXAA 5I2NA 3EPEA 2F7CA 2V3TA 4GRKA 1USYE 3V83A 3RQTA 3H4ZA 5F7VA 2I4BA 1MQDA 3ILUB 3M3FA 4YKJA 1QVSA 4MLVA 2RC9A 1DSNA 1MPDA 1OQGA 1ATGA 2PVUA 4Q5TA 3O6IA 4PETA 4Z7EA 5LOMA 3T66A 2Y7PA 1PEBA 1Y1MA 4LZ8A 3C35A 1SI1A 1QKBA 4LUBA 1Q35A 3EF7A 4GQOA 2P1SA 2IEEA 2DS9A 2F6PA 5JEIA 3CVGA 3B6TA 3K00A 4ZS9A 1AOVA 1SQYA 4H1XA 3TTRA 1TT1A 2ZYOA 3T9UA 1PC3A 1LAXA 1B3EA 2ABHA 3SEUA 3WAFA 5KDTA 3TODA 1MQHA 3PD8A 4ELQA 5L9OA 5I57B 2QL3A 1B46A 3PUYE 2FNCA 4LA9A 4RA1A 5L9MA 2F34A 4N6PA 3VVEA 1SW5A 1I6AA 3I3VA 4MLQA 2H5YA 1B05A 3FVGA 1XT8A 1Y3QA 4JSOA 1MPCA 3QYTA 4GL8A 2F97A 5K2YA 3MP6A 1XHYA 1JVYA 2P2AA 3OD7A 2R71A 2O51A 2VHAA 4G8HA 1SI0A 2B65A 4EQBA 4N07A 4L17A 3FXUA 1LBCA 1Q1KA 1GVCA 1VSOA 2QS3A 3TCFA 4Q0CA 3Q28A 1USYH 2DWAA 3KN3A 2V84A 1QJMA 1M5FA 4IO2A 4PFYA 4R9GA 3ZKKA 2FA7A 4I8CA 4DXCA 2XD2A 4JDFA 2W7YA 5CBSA 3F11A 3IR1A 5CI5A 3TDJA 1IEJA 3VLVA 4XKPA 2RINA 3O66A 4H5FA 3MW0A 4U2RA 5EHMA 1LB8A 3UP9A 1BTJA 3CRBA 1UIVA 4QHQA 3HSTA 5M2VA 2A5TA 3FZVA 2ONKE 1FTOA 3W9WA 3A3CA 1P1NA 3H6TA 3L6HA 2B3BA 3QSLA 3T22A 3O2AA 4M1VA 3TEPA 3N6UA 2V25A 5TPAA 4F1UA 1A55A 3KJTA 1ZTYA 3MVXA 3IJOB 1MH3A 2F35A 4FIMA 2ZNUA 4JXIA 2REGA 4EQ7A 1NMUA 3OXNA 2DE4A 3PUWE 4F3BA 5H8NB 1XVXA 4G4PA 4F29A 3TTMA 4RYAA 4BDQA 5A5XB 3KGCA 3MC2A 4I1DA 4IY5A 4N13A 1NFTA 4I62A 4POXA 2DVZA 2XX9A 1B9JA 3K1NA 5AA3A 1FQCA 4ND9A 1URDA 3CG3A 1B0LA 3FV2A 4OTEA 3MUQA 5H8QB 2HZKA 1O7TA 3FIRA 3RT6B 2KLFA 4IY6A 3VLUA 4ONYA 1FQBA 2F8DA 3OELA 1P1WA 4JSDA 4XKQA 5TP9A 1D9VA 1XC1A 3S9EA 1XS5A 4FEBA 3H7MA 4WKMA 1FTMA 4R73A 3H6VA 5FHOA 1QW0A 1WODA 3C34A 5H8SA 4LATA 1H45A 2DYXA 3C32A 4MFIA 4G77A 2OWTA 4ZE8A 4ZZEA 1EU8A 1MQJA 5H8FB 4HS7A 5DYHA 4X9TA 4NWDA 1IXCA 1AIVA 3K01A 5CMCA 5B70A 1RYOA 3U72A 2HAVA 4F1YA 4GL0A 4MH5A 1II5A 4EXLA 1MDQA 4XXUA 4KYDA 2UYFA 3DP4A 3TTLA 1YCJA 5KCJA 3IK6B 4OZ9A 2O69A 3DM0A 5JTYB 1B5HA 2YPNA 2XXYA 3ODBA 1ZLQA 1B3FA 1MQIA 1FQDA 4OYVA 3T9XB 4KCDA 3O29A 3JYRA 4G68C 3CFZA 3BFTA 4Q8RA 2G93A 1MY0A 3N5LA 1Z7NE 3N94A 2I3WA 1JEVA 1NH7A 2I4CA 3G3JA 3TYHA 3K6VA 2VOZA 3IAZA 3QUJA 4XKRA 1MY2A 3D4CA 1B1XA 1OLAA 4U22A 1B3HA 1JEUA 4R9FA 4RJZA 4NF5A 2ONSA 2I3VA 4JWYA 3HHGA 4ZEKA 3MQ9A 1CE2A 2D3IA 2RKMA 4HW8A 4DDDA 3IB2A 1P99A 1LAGE 1HSJA 5IAIA 3CI8A 1UTBB 3PPRA 1DMBA 1N7WA 3QK6A 1WDNA 2G29A 2XXPA 1KWHA 4AB6A 4E0WA 1AL3A 3UIFA 1NH8A 2Y7RA 4YB5A 2HZLA 4ZE9A 1LFHA 3B7DA 4OEUA 4NF6A 5J1DA 1PBPA 1R9QA 4DLDA 5I84A 3C33A 3PMXA 3PV0E 1QUJA 1PB8A 1MH4A
chains in the Genus database with same CATH superfamily
2CEYA 3FJMA 5AA4B 2DVCA 4P9KA 2ALUA 2QFLA 4NF4B 1NV6A 2ZMBA 3RLFE 4FBPA 2I0CA 4N15A 4X1DA 3TQWA 1IQ7A 1B7ZA 3MVWA 3HCQA 2IA4A 3O28A 2RCBA 1H43A 4LONB 4PFWA 5BWJA 4GWSA 1N04A 2Y7IA 4GXSB 4OVSA 1MY4A 4U1OA 4ISUA 2I49A 2ZZXA 3M3KA 5J16A 4KCCA 1I6QA 1FCKA 1B7UA 2PFZA 1POTA 4NF5B 3USDA 1NUZA 4KFQA 3TPAA 2XX8A 3MVYA 3IO6A 5I59B 2WBDA 5EQ7A 4OERA 4ESWA 2XXXA 3RTWB 4YMBA 4R6HA 1H3DA 1D9YA 3K1PA 3G3KA 4ELRA 2QS1A 4XKNA 4R2FA 2Z23A 1G0IA 4X48A 1Z7ME 5DEXB 3A29A 3OMBA 5ET7A 3SEVA 3T93B 4H67A 4HCYA 4KHZE 2V3UA 4FE8A 4OETA 5L9SA 1R6ZA 3QIMA 2XXKA 1LB9A 3VV5A 1B1HA 2F78A 2XXQA 3S9MC 1UTHA 2ESNA 2RF1A 4GVOA 1HSLA 3G3HA 2JJKA 3VLWA 4GF8A 3EQ1A 2WEFA 3CG1A 3MP8A 2GQ1A 3T1BA 1SW4A 2CMOA 1LEVA 1I69A 1B40A 4O94A 1IUDA 3DLNA 4FEDA 4YU0A 4R6YA 2Y5KA 4I3YA 3MPLA 4KYSA 4I3EA 1MRPA 1S9TA 3W9VA 4IO3A 1LLSA 1NNPA 2MKZA 2O7UA 1GV8A 3TCGA 3IFAA 3GXAA 3KSJA 4TLMB 4LQ2A 3FASA 4GX4A 3RPLA 5AE4A 2OJTA 2XHDA 5IZ3A 2V93A 1MXYA 5EYFA 3PPOA 4IO6A 1DTGA 4G2ZA 3IB1A 1MS7A 3BKIB 2H25A 4ZEIA 3I5OA 3A09A 1PDAA 3VFJA 1KZ8A 5I58B 2XD3A 2Y7KA 3ZS6A 2E1SA 3K02A 3O6HA 3RUMA 1VDWA 2LAOA 3S4UA 1MG1A 1OLCA 4NF8B 5I2NB 4YKIA 3K6UA 2PX1A 1MM7A 3SEWA 1IMCA 4F2OA 3U94A 3OSRA 1NL5A 4P11A 4F19A 3EHTA 2UVIA 2HEUA 1TWYA 2ONRA 1IXIA 3RGYA 1FPEA 3T9HB 4OXVA 4KR5A 3OSQA 4DZ1A 3TTKA 1MPBA 3KBRA 2XWOA 4XF5A 1NNFA 1R9LA 3PPPA 3C31A 1YAEA 2XWKA 3WAEA 1NNKA 1TXFA 3ECRA 4KI0E 1B4HA 4GWYA 4KD5A 1NUWA 2Z22A 1MXZA 3SEXA 4P8BA 4LZ5A 1YTVA 5I56A 1A8FA 2PMSA 3MPKA 3ILTB 2PCRA 1H76A 2GHBA 3K6WA 1AH5A 3KBZA 4UA8A 4GLIA 1IIWA 2WX9A 4BDNA 5AA2D 1P1OA 1FJ6A 3LC8A 5KDTB 2B4MA 2HCAA 3V89B 3A3UA 4PAFA 1ELJA 3C36A 4F3GA 2QVRA 4ZEBA 1ZKBA 4TLLB 2O7IA 4OEVA 5I2KA 3BIGA 1VFDA 3TZAA 4R6KA 1LCFA 4F18A 4NF0A 3R6UA 3MYUA 4MAGA 3S2VA 4NWCA 3OO8A 4JB7A 2QMXA 3B50A 2XXUA 2UXAA 1NV2A 4AS5A 4Q30B 3PMVA 2X7PA 3CIJA 2H4IA 2Q8JA 3N6TA 2OCUA 1FBDA 2CEXA 4IO4A 5ELVA 5A5LA 3R7XA 4PAKA 4H0WA 3H06B 4RK9A 3FVOA 1B5JA 3O6GA 1O63A 2VD3A 4KPTA 3KG2A 3MVZA 3PU5A 3FBPA 1NV5A 5JK4A 4DI3D 3IOVA 4HXVA 4F22A 4NEDA 1SYIA 1OVTA 4C0RA 3GYYA 4X04A 2Y84A 1Y3PA 4ZZAA 1FPKA 1K9ZA 3PMWA 4PQJA 3IX1A 3SETA 4GFRA 4N4UA 3D4GA 4DIGA 4PBQA 1LBBA 3VXBA 3OEMA 2A5TB 4QFOA 4P1EA 1BLFA 1G0HA 4YKPA 3GBAA 1XVYA 4R75A 2THIA 3S9LC 1GGGA 1LGBC 1NUXA 4UABA 5TU0A 5H8HA 4PTKA 5TPAB 1FTJA 1B32A 4NE4A 1RDZA 1M5BA 1VFEA 1QUIA 3E9XA 1UQWA 3U93A 3CHGA 4TOZA 4RXLA 2Z8EA 2XA5A 3FATA 2HQ0A 2F7AA 1LBZA 2XXTA 2DE3A 2BJJX 3GLBA 1H44A 1FPIA 1P1QA 2XXHA 4OQOA 3MWBA 2Q88A 3ZSFA 4RPOA 2Q8MA 2ZXTA 4I9DA 5AA1A 2FIEA 1DCUA 1M5CA 2KQZA 2AL5A 2DQVA 3QUFA 1IXGA 5ESYA 4UACA 2UVJA 3LSFB 2QS4A 4WXJA 5ITOA 3H6WA 2OK2A 1EZOA 2CZIA 3VVDA 3KFMA 4RY1A 2VPNA 5AA2A 4IR8A 2VGQA 3IO4A 3E3KA 3DP8A 4EUOA 3H3GA 2WKYA 1OQHA 4ZDMA 5I3SA 1LBVA 3MJNA 5TP9B 4PFIA 1LCTA 1NKXA 2UYEA 4WEDA 5BUUA 4RPNA 1BKAA 4IB2A 2NVUB 5F24A 1B3GA 3KZGA 1S7YA 1SBPA 3VE1B 4TQUQ 2DXRA 3SDFA 4F31B 4OANA 1CB6A 4MF3A 1AMFA 2A5SA 4GWOA 3G3IA 3GZGA 3OO7A 4NQ8A 4O8MA 4FATA 4G8NA 1EYJA 2DSFA 3IB0A 2AYSA 1D4NA 4YAHX 2Q74A 3M3LA 4YKKA 4YICA 3TQLA 4ELOA 4OVTA 2NOOA 3HO7A 3O9PA 3RY3A 3UA8A 4GBVA 2VP1A 4PF8A 4M4GA 3SZPA 5IGAA 3SKPA 1INPA 3LSWA 1OIBA 4FJPA 1MM6A 2I0BA 5KCJB 3W15C 2R8TA 4MBPA 3BFUA 2VD2A 3SEYA 2ZYKA 2DOJA 1N3WA 4OESA 2HAUA 4EDPA 4RNSA 3V5AA 4ZEFA 4ECFA 4NTLA 1JVXA 4PE3A 1DPEA 1T0KA 3LR1A 4EXKA 3G3FA 5K2XA 5AA2B 4FAJA 2Q9TA 4FECA 4OFLA 4PE5B 3E13X 3K0VA 1LSTA 1MXXA 1NNTA 2GHAA 1JNFA 3UORA 3Q27A 2DP8A 3KEIA 2XXRA 5DVJA 1BIYA 4QFLA 4E0XA 3JV9A 3TFLA 5DT6A 1DOTA 1FBFA 1MXVA 1LFIA 1LAHE 3MZ9A 4G8MA 3U92A 4QRZA 1VR5A 3THIA 4U23A 3OENA 4DE8A 5ICQA 4R72A 5I57A 4U4SA 3N26A 1EZ9A 1M5DA 4RK2A 1D3KA 2I48A 1J1NA 4F3PA 3Q29A 4H6DA 3BBRA 4F2QA 1JW1A 4JBZA 4BDOA 3T96B 4HE1A 2FBPA 4BDLA 4C1TA 1EH3A 1B2HA 3H6UA 2NXOA 4NF6B 5I7IA 3B6QA 2I58A 4QXDA 1ZU0A 3K2DA 1FSAA 4G68A 1RDXA 4YB7A 2P0SA 3FJGA 1N3XA 3L6GA 4P0GA 3PPNA 4YZZA 3RT8A 4F3SA 4EF2A 5LTCA 3RPWA 2KR0A 1OVBA 2XXVA 5ITPA 4BDRA 2P3NA 3RTFB 2XX7A 1Y4CA 3MZ1A 4IGRA 4JVIA 4N8GA 4NN3A 4PAIA 2M8CA 1D9QA 4QFKA 5DTBA 3MBPA 1GR2A 1IMAA 5HPQA 3KSXA 4N81A 2UVGA 1MXWA 4HTGA 1US4A 2RC8A 2XXWA 3IORA 4NAPA 3PUZE 4NG7A 2DWJA 3ONMA 2QSXA 2WYPA 2QVVA 1FTKA 4O3CA 3IOUA 5FHNA 3B6WA 1NV0A 3MZBA 3QAXA 1O64A 1MQGA 3JZJA 4ELPA 5IKBA 1LFGA 1ANFA 2ZZVA 3UK4A 4YB6A 5HBCA 3TELA 5IZ1A 3KN8A 1ZIUA 4NMYA 4QFPA 2QS2A 5FTIA 1PB7A 3U65A 1R1NA 5F1QA 1SPIA 1UTHB 4O3BA 5CBRA 3SESA 3LSXA 2D5WA 3C9HA 1QULA 5CC2A 5H8NA 3PTYA 3H03A 2AIXA 2OLBA 2OWSA 5HM4B 1POY1 2DE2A 4G68B 4F39A 4H5GA 5A5XA 3TTNA 3Q26A 2O1MA 2WBBA 1PB9A 3OEKA 4F1VA 4PP0A 1SDXA 3GBBA 4QFNA 2YJPA 1VE4A 4LVQA 1IMFA 5H8QA 1M5EA 2GH9A 1IMEA 3EN3A 4GIZA 2NWJA 3TMGA 2PT2A 2GRVA 3RPLB 5B7DA 3CSBA 2AL4A 4QSDA 4XIGQ 2XWIA 1OMPA 5IZ3B 1B6HA 4R2BA 4MNPA 3T0JA 4OENA 1QUKA 1S50A 1WVJA 1RDYA 2F6GA 1NV7A 3PUXE 3V8XB 1ZJLA 1RKMA 2F5XA 3CSGA 1MDP1 3TKDA 3ISPA 3HV1A 1SW1A 1FBEA 1SD3A 3QMFA 2HFBA 4IO7A 3MSTA 3FJ7A 1FQAA 2QMWA 4OFJA 3PGFA 4LZ7A 4PC9A 3KJ7A 5H8FA 3PUVE 1JW4A 4O7MA 4U1ZA 4U21A 4LP2B 4YMAA 3FVNA 1B51A 4PFUA 3I6VA 4IGTA 5KZTA 2I6EA 2FYIA 4H46A 4N6KA 1IITA 5CMBA 1EZPA 1YXIA 1B58A 3UN6A 1Y3NA 4P0IA 4JVDA 2ZYNA 1L5TA 1QGXA 4GD5A 4BDMA 5LDZA 2V3QA 2E0SA 5CM6A 4QSEA 2H99A 3IOWA 3KOSA 1UIUA 3HPIA 3MP1A 1FW0A 4JWOA 1Y4TA 5JTYA 4DXUA 1URGA 3C4MA 3DP6A 4HCWA 4P3LA 2O6AA 3K6XA 3OOAA 1I6BA 1URSA 4ZEDA 3FD3A 3OO9A 3EHUA 4KYEA 1N0TA 2DWIA 4OFOA 3E4RA 3RN8A 2H9BA 1FTLA 2CZLA 4H8JA 1XOCA 5I56B 2REJA 4H65A 4POWA 1A54A 4U4XA 1PBQA 4NGUA 4MJOA 1A7LA 1MXUA 3HN0A 5I5PA 1ZBMA 1Y1ZA 2PYYA 2B3FA 3FXRA 4WEPA 2Y7WA 4OHNA 3G3GA 3CFXA 4MNCA 3K4UA 3EHSA 5I2KB 4AQ4A 1SVXB 1IZ1A 3AXFA 2Q2CA 4GWZA 5DVIA 4MEVA 5EQ9A 3Q25A 4P47A 1DK4A 1FBCA 2L5VA 1RYXA 4LN5A 3U1OA 2RCAA 3PPQA 1YZ0A 4DXBA 2PT1A 1DPPA 1B3LA 3QXMA 1TFDA 4LQ5A 1UTBA 1JQFA 3UGWA 3M8UA 2YLNA 1XI6A 4P56A 4N91A 5FTHA 1Y20A 4FORA 2R6GE 2Z8DA 1SW2A 3LSLA 4EQ9A 3FUZA 4C1UA 1B7HA 3RNNA 2HXWA 2ZYMA 5FHMA 3OO6A 4MMPA 2D21A 2GFEA 2XXIA 3MAMA 3T9VA 3O97A 3K1MA 1ZMGA 3VVFA 5ICTA 1LAFE 3TCHA 1JW5A 1Y9UA 4GOTA 3R26A 4PCDA 3VDFA 5AA4A 2ZNTA 1YPNA 5EQ8A 4NF4A 2DDKA 3KOTA 1GTKA 3DELB 2DWHA 1TFAA 1A40A 1K9YA 1B4ZA 3CFLA 2OWZA 4MCOA 2DXYA 2Z8FA 1US5A 4AB5A 2F7BA 1N84A 4PFTA 1FBPA 2X26A 4DCYA 4R74A 4Z0IA 4GBWA 4THIA 3E79A 5I59A 5H8HB 2QRYA 4MIJA 3ZKLA 5DVFA 1BP5A 4H8IA 1JETA 2O1LA 2QPQA 4DCXA 3FGSA 1A8EA 5DEXA 2HHMA 2FIXA 1B0HA 4JVCA 3TUSA 1N7XA 3CR9A 2PBWA 1IXHA 2NUVA 5DW8A 3P7IA 3VXCA 1N76A 5CRYA 1KA0A 3HHFA 2RC7A 3S9NC 3IOTA 4K3FA 3IFCA 1FQEA 1MY1A 4N8YA 5L8DA 2Q89A 4N6DA 3FVKA 4QSCA 1A99A 1QKAA 1FRPA 2QJEA 2V4CA 4KQPA 4IO5A 4ZECA 1FPFA 4NX1A 4QF9A 2ANJA 2UVHA 2OBGA 3FXQA 1MY3A 4ESXA 2CZKA 1DTZA 1AWBA 3HFUA 3U8QA 4PGNA 4GWUA 1FPJA 3KN7A 4OVPA 4XTCQ 2O84X 5ISUA 2OZZA 2F36A 4EF1A 4BLAA 4OWDA 3IL1B 1F9BA 1SYHA 3IJXB 3G7WA 2H98A 2X7QA 2R9JA 3B8BA 5EHSA 1NI9A 3PD9A 3SERA 4OVJA 3TAJA 1B5IA 3LBSA 4OMBA 4X1BA 4MHFA 5I58A 1HSEA 2Q2AA 3LUYA 4GX3A 1P1UA 5CMMA 2ZNSA 4PGPA 1FQFA 1B52A 4JWXA 1NV4A 3FV1A 5CMKA 2FVZA 2O68A 4O3AA 4NF8A 4GXAA 5I2NA 3EPEA 2F7CA 2V3TA 4GRKA 1USYE 3V83A 1LBXA 3RQTA 3H4ZA 5F7VA 2I4BA 1MQDA 3ILUB 3M3FA 4YKJA 1QVSA 4MLVA 4H45A 2RC9A 1DSNA 3KC1A 1MPDA 1OQGA 1ATGA 2PVUA 4OA4A 3D1RA 4Q5TA 3O6IA 4PETA 2XWVA 4Z7EA 5LOMA 4PFBA 1FPBA 3T66A 2WYKA 2Y7PA 1PEBA 1Y1MA 4LZ8A 4PDHA 4PF6A 1NV1A 3C35A 1SI1A 1JP4A 4NHBA 1QKBA 4LUBA 1Q35A 1EYKA 4MNIA 3RYDA 3EF7A 4GQOA 2P1SA 2IEEA 2DS9A 2F6PA 5JEIA 3CVGA 4G61A 3B6TA 3K00A 4ZS9A 1AOVA 1SQYA 4H1XA 3TTRA 1TT1A 2ZYOA 3T9UA 1PC3A 1LAXA 1B3EA 2ABHA 3SEUA 3WAFA 5KDTA 3TODA 1MQHA 3PD8A 4ELQA 5L9OA 4HE0A 5I57B 2QL3A 1B46A 3PUYE 2FNCA 4LA9A 4RA1A 5L9MA 2F34A 4N6PA 2VPOA 3BIHA 3VVEA 1SW5A 1I6AA 3I3VA 4MLQA 2H5YA 1B05A 3FVGA 1XT8A 1Y3QA 1LBWA 4JSOA 1MPCA 3QYTA 4GL8A 2F97A 5K2YA 3MP6A 1Q9DA 1XHYA 1JVYA 2P2AA 3OD7A 3KC0A 2R71A 2O51A 2VHAA 4G8HA 1BK4A 1SI0A 2B65A 4EQBA 4N07A 4L17A 3FXUA 1LBCA 1Q1KA 1GVCA 2ZZWA 1YYZA 1EYIA 1VSOA 2QS3A 1FTAA 3TCFA 4Q0CA 4AS4A 3Q28A 1USYH 2DWAA 3KN3A 4X8RA 2V84A 1QJMA 1M5FA 4N17A 4IO2A 4PFYA 2HXRA 1FPGA 4PDDA 4R9GA 3ZKKA 2FA7A 4I8CA 4DXCA 2XD2A 4JDFA 2W7YA 5CBSA 4XFEA 3F11A 3IR1A 5CI5A 3TDJA 1IEJA 3VLVA 4XKPA 2QVUA 1FBGA 2RINA 3O66A 4H5FA 3MW0A 4U2RA 5EHMA 1LB8A 2F3BA 3UP9A 1BTJA 3CRBA 4DI4B 1UIVA 4QHQA 3HSTA 4GWWA 5M2VA 2A5TA 3FZVA 2HPGA 2ONKE 1FTOA 3W9WA 3A3CA 1P1NA 3H6TA 1KA1A 3L6HA 2B3BA 3QSLA 3T22A 3O2AA 4PBHA 4M1VA 3TEPA 1FJ9A 4P1LA 3N6UA 3E78A 2V25A 2OX3A 5IZZA 5TPAA 4F1UA 1A55A 3KJTA 1ZTYA 3MVXA 3IJOB 1MH3A 2F35A 4FIMA 2ZNUA 4JXIA 2REGA 4EQ7A 1NMUA 3OXNA 2DE4A 3PUWE 4F3BA 2P3VA 4QBAA 5H8NB 1XVXA 4G4PA 4F29A 3TTMA 4RYAA 4BDQA 5A5XB 3KGCA 3MC2A 4I1DA 4IY5A 4N13A 5ET8A 1NFTA 4I62A 4POXA 2DVZA 2XX9A 1IMBA 1B9JA 3K1NA 5AA3A 1FQCA 4ND9A 1URDA 3CG3A 1B0LA 3FV2A 4OTEA 3MUQA 5EYGA 5H8QB 2HZKA 1O7TA 3FIRA 3RT6B 2KLFA 4IY6A 3VLUA 4ONYA 1FQBA 2F8DA 3OELA 1P1WA 4JSDA 4XEQA 4XKQA 5TP9A 1D9VA 1XC1A 3S9EA 1XS5A 4FEBA 3H7MA 4WKMA 1FTMA 4R73A 3H6VA 5FHOA 1QW0A 1DBZA 1WODA 3C34A 5H8SA 2BJIA 4LATA 1H45A 2DYXA 3C32A 4MFIA 4G77A 2OWTA 4ZE8A 4ZZEA 1EU8A 1MQJA 5H8FB 4HS7A 5DYHA 4X9TA 4NWDA 1IXCA 2FHYA 1AIVA 3LV0A 3K01A 5CMCA 5B70A 1IMDA 1RYOA 3U72A 2HAVA 4F1YA 3ROJA 4GL0A 4MH5A 1II5A 4PFRA 4EXLA 1MDQA 3LUZA 4XXUA 1NUYA 4KYDA 2UYFA 3DP4A 3TTLA 1YCJA 5KCJA 3IK6B 1FPLA 4OZ9A 2O69A 3DM0A 5JTYB 1B5HA 2YPNA 2XXYA 3ODBA 1ZLQA 1B3FA 1MQIA 1FQDA 4OYVA 3T9XB 4KCDA 3O29A 3JYRA 4G68C 3CFZA 3BFTA 4Q8RA 2G93A 1MY0A 3N5LA 1Z7NE 1NV3A 3N94A 2I3WA 1JEVA 1NH7A 2I4CA 3G3JA 3TYHA 1FBHA 3K6VA 2VOZA 3IAZA 5IM2A 3QUJA 1FPDA 4MX6A 2F3DA 2B4LA 4XKRA 1MY2A 3D4CA 1B1XA 1OLAA 4U22A 1B3HA 1JEUA 4OVQA 4R9FA 4RJZA 4NF5A 5T3JA 5ET5A 2ONSA 2I3VA 5EYHA 4KXPA 4JWYA 3HHGA 4ZEKA 3MQ9A 1CE2A 2D3IA 5EQAA 4OVRA 2RKMA 5FBPA 1LBYA 4HW8A 4I40A 4DDDA 3IB2A 1P99A 1LAGE 1HSJA 2VT5A 4GWXA 5IAIA 3CI8A 1UTBB 3PPRA 1DMBA 1N7WA 2Y5LA 3QK6A 4HE2A 1WDNA 2G29A 2XXPA 1KWHA 4AB6A 4E0WA 3NOHA 4O7IA 1AL3A 2PFYA 3UIFA 1NH8A 2Y7RA 5ET6A 1CNQA 4YB5A 2HZLA 4ZE9A 3EKIA 1LFHA 3B7DA 3FXBA 4OEUA 4NF6A 5J1DA 1PBPA 1R9QA 4DLDA 4GX6A 2CZHA 5I84A 3C33A 3PMXA 3PV0E 1QUJA 1PB8A 1MH4A
chains in the Genus database with same CATH topology
3FJMA 5AA4B 2DVCA 2ALUA 4NF4B 2ZMBA 3RLFE 4X1DA 2I0CA 3TQWA 1IQ7A 1B7ZA 3MVWA 3HCQA 2IA4A 3O28A 2RCBA 1H43A 4LONB 4PFWA 5BWJA 1N04A 2Y7IA 4GXSB 1MY4A 4U1OA 4ISUA 2I49A 3M3KA 4KCCA 1I6QA 1FCKA 1B7UA 1POTA 4NF5B 3USDA 4KFQA 3TPAA 2XX8A 3MVYA 3IO6A 5I59B 4OERA 4ESWA 2XXXA 3RTWB 4YMBA 4R6HA 1H3DA 1D9YA 3K1PA 3G3KA 4ELRA 2QS1A 4XKNA 4R2FA 2Z23A 4X48A 1Z7ME 5DEXB 3OMBA 3SEVA 3T93B 4H67A 4HCYA 4KHZE 2V3UA 4FE8A 4OETA 5L9SA 1R6ZA 3QIMA 1LB9A 3VV5A 1B1HA 2F78A 2XXQA 3S9MC 1UTHA 2ESNA 2RF1A 4GVOA 1HSLA 3G3HA 3VLWA 4GF8A 3EQ1A 3CG1A 3MP8A 1SW4A 2CMOA 1I69A 1B40A 1IUDA 3DLNA 4FEDA 4YU0A 4R6YA 3MPLA 4KYSA 1MRPA 1S9TA 3W9VA 4IO3A 1LLSA 1NNPA 2O7UA 1GV8A 3TCGA 3GXAA 3KSJA 4TLMB 4LQ2A 3FASA 5AE4A 2OJTA 2XHDA 2V93A 1MXYA 5EYFA 3PPOA 4IO6A 1DTGA 4G2ZA 3IB1A 1MS7A 3BKIB 2H25A 4ZEIA 3I5OA 3A09A 1PDAA 3VFJA 5I58B 2XD3A 2Y7KA 3ZS6A 2E1SA 3K02A 3O6HA 3RUMA 2LAOA 3S4UA 1MG1A 1OLCA 4NF8B 5I2NB 4YKIA 3K6UA 2PX1A 1MM7A 3SEWA 4F2OA 3U94A 3OSRA 1NL5A 4P11A 4F19A 3EHTA 2UVIA 2HEUA 1TWYA 2ONRA 1IXIA 3RGYA 3T9HB 4OXVA 4KR5A 3OSQA 4DZ1A 3TTKA 1MPBA 3KBRA 1NNFA 1R9LA 3PPPA 3C31A 1YAEA 3WAEA 1NNKA 1TXFA 3ECRA 4KI0E 1B4HA 4KD5A 2Z22A 1MXZA 3SEXA 4LZ5A 1YTVA 5I56A 1A8FA 2PMSA 3MPKA 3ILTB 1H76A 2GHBA 3K6WA 1AH5A 4UA8A 4GLIA 1IIWA 4BDNA 5AA2D 1P1OA 3LC8A 5KDTB 2HCAA 3V89B 3A3UA 1ELJA 3C36A 4F3GA 4ZEBA 1ZKBA 4TLLB 2O7IA 4OEVA 5I2KA 1VFDA 3TZAA 4R6KA 1LCFA 4F18A 3R6UA 3S2VA 4NWCA 3OO8A 4JB7A 2QMXA 2XXUA 2UXAA 4Q30B 3PMVA 2X7PA 3CIJA 2H4IA 2Q8JA 3N6TA 2OCUA 4IO4A 5ELVA 3R7XA 4H0WA 3H06B 4RK9A 3FVOA 1B5JA 3O6GA 1O63A 2VD3A 4KPTA 3KG2A 3MVZA 3PU5A 5JK4A 3IOVA 4F22A 4NEDA 1SYIA 1OVTA 4C0RA 2Y84A 1Y3PA 4ZZAA 3PMWA 4PQJA 3IX1A 3SETA 4GFRA 3D4GA 4DIGA 1LBBA 3VXBA 3OEMA 2A5TB 4QFOA 1BLFA 4YKPA 3GBAA 1XVYA 4R75A 2THIA 3S9LC 1GGGA 1LGBC 5TU0A 5H8HA 5TPAB 1FTJA 1B32A 4NE4A 1M5BA 1VFEA 1QUIA 3E9XA 1UQWA 3U93A 4TOZA 4RXLA 2Z8EA 3FATA 2HQ0A 2F7AA 2XXTA 2DE3A 2BJJX 3GLBA 1H44A 1P1QA 2XXHA 4OQOA 3MWBA 2Q88A 3ZSFA 4RPOA 2ZXTA 4I9DA 5AA1A 1M5CA 2AL5A 2DQVA 3QUFA 1IXGA 4UACA 2UVJA 3LSFB 2QS4A 4WXJA 5ITOA 3H6WA 2OK2A 1EZOA 3VVDA 3KFMA 4RY1A 5AA2A 2VGQA 3IO4A 3E3KA 3DP8A 4EUOA 3H3GA 2WKYA 1OQHA 4ZDMA 5TP9B 3MJNA 1LCTA 1NKXA 2UYEA 4WEDA 5BUUA 4RPNA 1BKAA 4IB2A 2NVUB 1B3GA 3KZGA 1S7YA 1SBPA 3VE1B 4TQUQ 2DXRA 3SDFA 4F31B 1CB6A 4MF3A 1AMFA 2A5SA 4GWOA 3G3IA 3GZGA 3OO7A 4FATA 4G8NA 2DSFA 3IB0A 2AYSA 1D4NA 4YAHX 3M3LA 4YKKA 4YICA 3TQLA 4ELOA 2NOOA 3HO7A 3O9PA 3RY3A 3UA8A 2VP1A 4M4GA 3SKPA 3LSWA 1OIBA 4FJPA 1MM6A 2I0BA 5KCJB 3W15C 4MBPA 3BFUA 2VD2A 3SEYA 2ZYKA 2DOJA 1N3WA 4OESA 2HAUA 4EDPA 4RNSA 3V5AA 4ZEFA 4ECFA 4NTLA 1JVXA 1DPEA 1T0KA 3LR1A 4EXKA 3G3FA 5K2XA 5AA2B 4FAJA 2Q9TA 4FECA 4OFLA 4PE5B 3E13X 3K0VA 1LSTA 1MXXA 1NNTA 2GHAA 1JNFA 3UORA 3Q27A 2DP8A 3KEIA 2XXRA 5DVJA 1BIYA 4QFLA 4E0XA 3JV9A 3TFLA 5DT6A 1DOTA 1MXVA 1LFIA 1LAHE 3MZ9A 4G8MA 3U92A 4QRZA 1VR5A 3THIA 4U23A 3OENA 4DE8A 5ICQA 4R72A 5I57A 4U4SA 3N26A 1EZ9A 1M5DA 4RK2A 1D3KA 2I48A 1J1NA 4F3PA 3Q29A 4H6DA 3BBRA 4F2QA 1JW1A 4JBZA 4BDOA 3T96B 4BDLA 4C1TA 1EH3A 1B2HA 3H6UA 2NXOA 4NF6B 3B6QA 2I58A 1ZU0A 3K2DA 4G68A 4YB7A 2P0SA 3FJGA 1N3XA 3L6GA 4P0GA 3PPNA 4YZZA 3RT8A 4F3SA 4EF2A 3RPWA 1OVBA 2XXVA 5ITPA 4BDRA 3RTFB 2XX7A 1Y4CA 3MZ1A 4IGRA 2M8CA 4QFKA 5DTBA 3MBPA 1GR2A 5HPQA 3KSXA 2UVGA 1MXWA 4HTGA 1US4A 2RC8A 2XXWA 3IORA 3PUZE 2DWJA 3ONMA 2QSXA 1FTKA 4O3CA 3IOUA 5FHNA 3B6WA 3MZBA 3QAXA 4ELPA 1O64A 1MQGA 3JZJA 5IKBA 1LFGA 1ANFA 3UK4A 4YB6A 5HBCA 3TELA 3KN8A 1ZIUA 4NMYA 4QFPA 2QS2A 5FTIA 1PB7A 1R1NA 5F1QA 1UTHB 4O3BA 5CBRA 3SESA 3LSXA 2D5WA 3C9HA 1QULA 5CC2A 5H8NA 3H03A 2AIXA 2OLBA 2OWSA 5HM4B 1POY1 2DE2A 4G68B 4F39A 4H5GA 5A5XA 3TTNA 3Q26A 2O1MA 1PB9A 3OEKA 4F1VA 4PP0A 1SDXA 3GBBA 4QFNA 2YJPA 1VE4A 4LVQA 5H8QA 1M5EA 2GH9A 3EN3A 4GIZA 2NWJA 3TMGA 2PT2A 2GRVA 5B7DA 3CSBA 2AL4A 4QSDA 4XIGQ 1OMPA 1B6HA 4R2BA 4OENA 1QUKA 1S50A 1WVJA 2F6GA 3PUXE 3V8XB 1ZJLA 1RKMA 2F5XA 3CSGA 1MDP1 3TKDA 3HV1A 1SW1A 1SD3A 2HFBA 4IO7A 3FJ7A 1FQAA 2QMWA 4OFJA 3PGFA 4LZ7A 3KJ7A 5H8FA 3PUVE 1JW4A 4U1ZA 4U21A 4LP2B 4YMAA 3FVNA 1B51A 4PFUA 3I6VA 4IGTA 5KZTA 2I6EA 2FYIA 1IITA 5CMBA 1EZPA 1B58A 3UN6A 1Y3NA 4P0IA 2ZYNA 1L5TA 4GD5A 4BDMA 2V3QA 2E0SA 5CM6A 4QSEA 2H99A 3IOWA 3KOSA 1UIUA 3HPIA 3MP1A 1FW0A 4JWOA 1Y4TA 5JTYA 4DXUA 1URGA 3C4MA 3DP6A 4HCWA 2O6AA 3K6XA 3OOAA 1I6BA 1URSA 4ZEDA 3FD3A 3OO9A 3EHUA 4KYEA 1N0TA 2DWIA 4OFOA 3E4RA 3RN8A 2H9BA 1FTLA 2CZLA 4H8JA 1XOCA 5I56B 2REJA 4H65A 4POWA 1A54A 4U4XA 1PBQA 1A7LA 1MXUA 3HN0A 1ZBMA 1Y1ZA 2PYYA 2B3FA 3FXRA 4WEPA 2Y7WA 4OHNA 3G3GA 3CFXA 3K4UA 3EHSA 5I2KB 4AQ4A 1SVXB 1IZ1A 3AXFA 2Q2CA 5DVIA 3Q25A 1RYXA 3U1OA 2RCAA 3PPQA 4DXBA 2PT1A 1DPPA 1B3LA 3QXMA 1TFDA 4LQ5A 1UTBA 1JQFA 3UGWA 3M8UA 2YLNA 5FTHA 1Y20A 4FORA 2R6GE 2Z8DA 1SW2A 3LSLA 4EQ9A 3FUZA 4C1UA 1B7HA 3RNNA 2HXWA 2ZYMA 5FHMA 3OO6A 2D21A 2GFEA 2XXIA 3MAMA 3T9VA 3O97A 3K1MA 1ZMGA 3VVFA 5ICTA 1LAFE 3TCHA 1JW5A 1Y9UA 4GOTA 3R26A 3VDFA 5AA4A 2ZNTA 1YPNA 4NF4A 3KOTA 1GTKA 3DELB 2DWHA 1TFAA 1A40A 1B4ZA 3CFLA 2DXYA 2Z8FA 1US5A 4AB5A 2F7BA 1N84A 4PFTA 2X26A 4DCYA 4R74A 4Z0IA 4THIA 5I59A 5H8HB 2QRYA 3ZKLA 5DVFA 1BP5A 4H8IA 1JETA 2O1LA 2QPQA 4DCXA 3FGSA 1A8EA 5DEXA 1B0HA 3TUSA 1N7XA 3CR9A 2PBWA 1IXHA 2NUVA 3VXCA 3P7IA 1N76A 5CRYA 3HHFA 2RC7A 3S9NC 3IOTA 4K3FA 1FQEA 1MY1A 5L8DA 2Q89A 3FVKA 4QSCA 1A99A 1QKAA 2QJEA 4KQPA 4IO5A 4ZECA 4QF9A 2ANJA 2UVHA 2OBGA 3FXQA 1MY3A 4ESXA 1DTZA 3U8QA 3KN7A 4XTCQ 2O84X 5ISUA 2OZZA 2F36A 4EF1A 4BLAA 4OWDA 3IL1B 1F9BA 1SYHA 3IJXB 3G7WA 2H98A 2X7QA 2R9JA 5EHSA 3PD9A 3SERA 4OVJA 3TAJA 1B5IA 3LBSA 4OMBA 4X1BA 5I58A 1HSEA 2Q2AA 3LUYA 1P1UA 5CMMA 2ZNSA 1FQFA 1B52A 4JWXA 3FV1A 5CMKA 2O68A 4O3AA 4NF8A 4GXAA 5I2NA 3EPEA 2F7CA 2V3TA 4GRKA 1USYE 3V83A 3RQTA 3H4ZA 5F7VA 2I4BA 1MQDA 3ILUB 3M3FA 4YKJA 1QVSA 4MLVA 2RC9A 1DSNA 1MPDA 1OQGA 1ATGA 2PVUA 4Q5TA 3O6IA 4PETA 4Z7EA 5LOMA 3T66A 2Y7PA 1PEBA 1Y1MA 4LZ8A 3C35A 1SI1A 1QKBA 4LUBA 1Q35A 3EF7A 4GQOA 2P1SA 2IEEA 2DS9A 2F6PA 5JEIA 3CVGA 3B6TA 3K00A 4ZS9A 1AOVA 1SQYA 4H1XA 3TTRA 1TT1A 2ZYOA 3T9UA 1PC3A 1LAXA 1B3EA 2ABHA 3SEUA 3WAFA 5KDTA 3TODA 1MQHA 3PD8A 4ELQA 5L9OA 5I57B 2QL3A 1B46A 3PUYE 2FNCA 4LA9A 4RA1A 5L9MA 2F34A 4N6PA 3VVEA 1SW5A 1I6AA 3I3VA 4MLQA 2H5YA 1B05A 3FVGA 1XT8A 1Y3QA 4JSOA 1MPCA 3QYTA 4GL8A 2F97A 5K2YA 3MP6A 1XHYA 1JVYA 2P2AA 3OD7A 2R71A 2O51A 2VHAA 4G8HA 1SI0A 2B65A 4EQBA 4N07A 4L17A 3FXUA 1LBCA 1Q1KA 1GVCA 1VSOA 2QS3A 3TCFA 4Q0CA 3Q28A 1USYH 2DWAA 3KN3A 2V84A 1QJMA 1M5FA 4IO2A 4PFYA 4R9GA 3ZKKA 2FA7A 4I8CA 4DXCA 2XD2A 4JDFA 2W7YA 5CBSA 3F11A 3IR1A 5CI5A 3TDJA 1IEJA 3VLVA 4XKPA 2RINA 3O66A 4H5FA 3MW0A 4U2RA 5EHMA 1LB8A 3UP9A 1BTJA 3CRBA 1UIVA 4QHQA 3HSTA 5M2VA 2A5TA 3FZVA 2ONKE 1FTOA 3W9WA 3A3CA 1P1NA 3H6TA 3L6HA 2B3BA 3QSLA 3T22A 3O2AA 4M1VA 3TEPA 3N6UA 2V25A 5TPAA 4F1UA 1A55A 3KJTA 1ZTYA 3MVXA 3IJOB 1MH3A 2F35A 4FIMA 2ZNUA 4JXIA 2REGA 4EQ7A 1NMUA 3OXNA 2DE4A 3PUWE 4F3BA 5H8NB 1XVXA 4G4PA 4F29A 3TTMA 4RYAA 4BDQA 5A5XB 3KGCA 3MC2A 4I1DA 4IY5A 4N13A 1NFTA 4I62A 4POXA 2DVZA 2XX9A 1B9JA 3K1NA 5AA3A 1FQCA 4ND9A 1URDA 3CG3A 1B0LA 3FV2A 4OTEA 3MUQA 5H8QB 2HZKA 1O7TA 3FIRA 3RT6B 2KLFA 4IY6A 3VLUA 4ONYA 1FQBA 2F8DA 3OELA 1P1WA 4JSDA 4XKQA 5TP9A 1D9VA 1XC1A 3S9EA 1XS5A 4FEBA 3H7MA 4WKMA 1FTMA 4R73A 3H6VA 5FHOA 1QW0A 1WODA 3C34A 5H8SA 4LATA 1H45A 2DYXA 3C32A 4MFIA 4G77A 2OWTA 4ZE8A 4ZZEA 1EU8A 1MQJA 5H8FB 4HS7A 5DYHA 4X9TA 4NWDA 1IXCA 1AIVA 3K01A 5CMCA 5B70A 1RYOA 3U72A 2HAVA 4F1YA 4GL0A 4MH5A 1II5A 4EXLA 1MDQA 4XXUA 4KYDA 2UYFA 3DP4A 3TTLA 1YCJA 5KCJA 3IK6B 4OZ9A 2O69A 3DM0A 5JTYB 1B5HA 2YPNA 2XXYA 3ODBA 1ZLQA 1B3FA 1MQIA 1FQDA 4OYVA 3T9XB 4KCDA 3O29A 3JYRA 4G68C 3CFZA 3BFTA 4Q8RA 2G93A 1MY0A 3N5LA 1Z7NE 3N94A 2I3WA 1JEVA 1NH7A 2I4CA 3G3JA 3TYHA 3K6VA 2VOZA 3IAZA 3QUJA 4XKRA 1MY2A 3D4CA 1B1XA 1OLAA 4U22A 1B3HA 1JEUA 4R9FA 4RJZA 4NF5A 2ONSA 2I3VA 4JWYA 3HHGA 4ZEKA 3MQ9A 1CE2A 2D3IA 2RKMA 4HW8A 4DDDA 3IB2A 1P99A 1LAGE 1HSJA 5IAIA 3CI8A 1UTBB 3PPRA 1DMBA 1N7WA 3QK6A 1WDNA 2G29A 2XXPA 1KWHA 4AB6A 4E0WA 1AL3A 3UIFA 1NH8A 2Y7RA 4YB5A 2HZLA 4ZE9A 1LFHA 3B7DA 4OEUA 4NF6A 5J1DA 1PBPA 1R9QA 4DLDA 5I84A 3C33A 3PMXA 3PV0E 1QUJA 1PB8A 1MH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FJM A;  5AA4 B;  2DVC A;  2ALU A;  4NF4 B;  2ZMB A;  3RLF E;  4X1D A;  2I0C A;  3TQW A;  1IQ7 A;  1B7Z A;  3MVW A;  3HCQ A;  2IA4 A;  3O28 A;  2RCB A;  1H43 A;  4LON B;  4PFW A;  5BWJ A;  1N04 A;  2Y7I A;  4GXS B;  1MY4 A;  4U1O A;  4ISU A;  2I49 A;  3M3K A;  4KCC A;  1I6Q A;  1FCK A;  1B7U A;  1POT A;  4NF5 B;  3USD A;  4KFQ A;  3TPA A;  2XX8 A;  3MVY A;  3IO6 A;  5I59 B;  4OER A;  4ESW A;  2XXX A;  3RTW B;  4YMB A;  4R6H A;  1H3D A;  1D9Y A;  3K1P A;  3G3K A;  4ELR A;  2QS1 A;  4XKN A;  4R2F A;  2Z23 A;  4X48 A;  1Z7M E;  5DEX B;  3OMB A;  3SEV A;  3T93 B;  4H67 A;  4HCY A;  4KHZ E;  2V3U A;  4FE8 A;  4OET A;  5L9S A;  1R6Z A;  3QIM A;  1LB9 A;  3VV5 A;  1B1H A;  2F78 A;  2XXQ A;  3S9M C;  1UTH A;  2ESN A;  2RF1 A;  4GVO A;  1HSL A;  3G3H A;  3VLW A;  4GF8 A;  3EQ1 A;  3CG1 A;  3MP8 A;  1SW4 A;  2CMO A;  1I69 A;  1B40 A;  1IUD A;  3DLN A;  4FED A;  4YU0 A;  4R6Y A;  3MPL A;  4KYS A;  1MRP A;  1S9T A;  3W9V A;  4IO3 A;  1LLS A;  1NNP A;  2O7U A;  1GV8 A;  3TCG A;  3GXA A;  3KSJ A;  4TLM B;  4LQ2 A;  3FAS A;  5AE4 A;  2OJT A;  2XHD A;  2V93 A;  1MXY A;  5EYF A;  3PPO A;  4IO6 A;  1DTG A;  4G2Z A;  3IB1 A;  1MS7 A;  3BKI B;  2H25 A;  4ZEI A;  3I5O A;  3A09 A;  1PDA A;  3VFJ A;  5I58 B;  2XD3 A;  2Y7K A;  3ZS6 A;  2E1S A;  3K02 A;  3O6H A;  3RUM A;  2LAO A;  3S4U A;  1MG1 A;  1OLC A;  4NF8 B;  5I2N B;  4YKI A;  3K6U A;  2PX1 A;  1MM7 A;  3SEW A;  4F2O A;  3U94 A;  3OSR A;  1NL5 A;  4P11 A;  4F19 A;  3EHT A;  2UVI A;  2HEU A;  1TWY A;  2ONR A;  1IXI A;  3RGY A;  3T9H B;  4OXV A;  4KR5 A;  3OSQ A;  4DZ1 A;  3TTK A;  1MPB A;  3KBR A;  1NNF A;  1R9L A;  3PPP A;  3C31 A;  1YAE A;  3WAE A;  1NNK A;  1TXF A;  3ECR A;  4KI0 E;  1B4H A;  4KD5 A;  2Z22 A;  1MXZ A;  3SEX A;  4LZ5 A;  1YTV A;  5I56 A;  1A8F A;  2PMS A;  3MPK A;  3ILT B;  1H76 A;  2GHB A;  3K6W A;  1AH5 A;  4UA8 A;  4GLI A;  1IIW A;  4BDN A;  5AA2 D;  1P1O A;  3LC8 A;  5KDT B;  2HCA A;  3V89 B;  3A3U A;  1ELJ A;  3C36 A;  4F3G A;  4ZEB A;  1ZKB A;  4TLL B;  2O7I A;  4OEV A;  5I2K A;  1VFD A;  3TZA A;  4R6K A;  1LCF A;  4F18 A;  3R6U A;  3S2V A;  4NWC A;  3OO8 A;  4JB7 A;  2QMX A;  2XXU A;  2UXA A;  4Q30 B;  3PMV A;  2X7P A;  3CIJ A;  2H4I A;  2Q8J A;  3N6T A;  2OCU A;  4IO4 A;  5ELV A;  3R7X A;  4H0W A;  3H06 B;  4RK9 A;  3FVO A;  1B5J A;  3O6G A;  1O63 A;  2VD3 A;  4KPT A;  3KG2 A;  3MVZ A;  3PU5 A;  5JK4 A;  3IOV A;  4F22 A;  4NED A;  1SYI A;  1OVT A;  4C0R A;  2Y84 A;  1Y3P A;  4ZZA A;  3PMW A;  4PQJ A;  3IX1 A;  3SET A;  4GFR A;  3D4G A;  4DIG A;  1LBB A;  3VXB A;  3OEM A;  2A5T B;  4QFO A;  1BLF A;  4YKP A;  3GBA A;  1XVY A;  4R75 A;  2THI A;  3S9L C;  1GGG A;  1LGB C;  5TU0 A;  5H8H A;  5TPA B;  1FTJ A;  1B32 A;  4NE4 A;  1M5B A;  1VFE A;  1QUI A;  3E9X A;  1UQW A;  3U93 A;  4TOZ A;  4RXL A;  2Z8E A;  3FAT A;  2HQ0 A;  2F7A A;  2XXT A;  2DE3 A;  2BJJ X;  3GLB A;  1H44 A;  1P1Q A;  2XXH A;  4OQO A;  3MWB A;  2Q88 A;  3ZSF A;  4RPO A;  2ZXT A;  4I9D A;  5AA1 A;  1M5C A;  2AL5 A;  2DQV A;  3QUF A;  1IXG A;  4UAC A;  2UVJ A;  3LSF B;  2QS4 A;  4WXJ A;  5ITO A;  3H6W A;  2OK2 A;  1EZO A;  3VVD A;  3KFM A;  4RY1 A;  5AA2 A;  2VGQ A;  3IO4 A;  3E3K A;  3DP8 A;  4EUO A;  3H3G A;  2WKY A;  1OQH A;  4ZDM A;  5TP9 B;  3MJN A;  1LCT A;  1NKX A;  2UYE A;  4WED A;  5BUU A;  4RPN A;  1BKA A;  4IB2 A;  2NVU B;  1B3G A;  3KZG A;  1S7Y A;  1SBP A;  3VE1 B;  4TQU Q;  2DXR A;  3SDF A;  4F31 B;  1CB6 A;  4MF3 A;  1AMF A;  2A5S A;  4GWO A;  3G3I A;  3GZG A;  3OO7 A;  4FAT A;  4G8N A;  2DSF A;  3IB0 A;  2AYS A;  1D4N A;  4YAH X;  3M3L A;  4YKK A;  4YIC A;  3TQL A;  4ELO A;  2NOO A;  3HO7 A;  3O9P A;  3RY3 A;  3UA8 A;  2VP1 A;  4M4G A;  3SKP A;  3LSW A;  1OIB A;  4FJP A;  1MM6 A;  2I0B A;  5KCJ B;  3W15 C;  4MBP A;  3BFU A;  2VD2 A;  3SEY A;  2ZYK A;  2DOJ A;  1N3W A;  4OES A;  2HAU A;  4EDP A;  4RNS A;  3V5A A;  4ZEF A;  4ECF A;  4NTL A;  1JVX A;  1DPE A;  1T0K A;  3LR1 A;  4EXK A;  3G3F A;  5K2X A;  5AA2 B;  4FAJ A;  2Q9T A;  4FEC A;  4OFL A;  4PE5 B;  3E13 X;  3K0V A;  1LST A;  1MXX A;  1NNT A;  2GHA A;  1JNF A;  3UOR A;  3Q27 A;  2DP8 A;  3KEI A;  2XXR A;  5DVJ A;  1BIY A;  4QFL A;  4E0X A;  3JV9 A;  3TFL A;  5DT6 A;  1DOT A;  1MXV A;  1LFI A;  1LAH E;  3MZ9 A;  4G8M A;  3U92 A;  4QRZ A;  1VR5 A;  3THI A;  4U23 A;  3OEN A;  4DE8 A;  5ICQ A;  4R72 A;  5I57 A;  4U4S A;  3N26 A;  1EZ9 A;  1M5D A;  4RK2 A;  1D3K A;  2I48 A;  1J1N A;  4F3P A;  3Q29 A;  4H6D A;  3BBR A;  4F2Q A;  1JW1 A;  4JBZ A;  4BDO A;  3T96 B;  4BDL A;  4C1T A;  1EH3 A;  1B2H A;  3H6U A;  2NXO A;  4NF6 B;  3B6Q A;  2I58 A;  1ZU0 A;  3K2D A;  4G68 A;  4YB7 A;  2P0S A;  3FJG A;  1N3X A;  3L6G A;  4P0G A;  3PPN A;  4YZZ A;  3RT8 A;  4F3S A;  4EF2 A;  3RPW A;  1OVB A;  2XXV A;  5ITP A;  4BDR A;  3RTF B;  2XX7 A;  1Y4C A;  3MZ1 A;  4IGR A;  2M8C A;  4QFK A;  5DTB A;  3MBP A;  1GR2 A;  5HPQ A;  3KSX A;  2UVG A;  1MXW A;  4HTG A;  1US4 A;  2RC8 A;  2XXW A;  3IOR A;  3PUZ E;  2DWJ A;  3ONM A;  2QSX A;  1FTK A;  4O3C A;  3IOU A;  5FHN A;  3B6W A;  3MZB A;  3QAX A;  4ELP A;  1O64 A;  1MQG A;  3JZJ A;  5IKB A;  1LFG A;  1ANF A;  3UK4 A;  4YB6 A;  5HBC A;  3TEL A;  3KN8 A;  1ZIU A;  4NMY A;  4QFP A;  2QS2 A;  5FTI A;  1PB7 A;  1R1N A;  5F1Q A;  1UTH B;  4O3B A;  5CBR A;  3SES A;  3LSX A;  2D5W A;  3C9H A;  1QUL A;  5CC2 A;  5H8N A;  3H03 A;  2AIX A;  2OLB A;  2OWS A;  5HM4 B;  1POY 1;  2DE2 A;  4G68 B;  4F39 A;  4H5G A;  5A5X A;  3TTN A;  3Q26 A;  2O1M A;  1PB9 A;  3OEK A;  4F1V A;  4PP0 A;  1SDX A;  3GBB A;  4QFN A;  2YJP A;  1VE4 A;  4LVQ A;  5H8Q A;  1M5E A;  2GH9 A;  3EN3 A;  4GIZ A;  2NWJ A;  3TMG A;  2PT2 A;  2GRV A;  5B7D A;  3CSB A;  2AL4 A;  4QSD A;  4XIG Q;  1OMP A;  1B6H A;  4R2B A;  4OEN A;  1QUK A;  1S50 A;  1WVJ A;  2F6G A;  3PUX E;  3V8X B;  1ZJL A;  1RKM A;  2F5X A;  3CSG A;  1MDP 1;  3TKD A;  3HV1 A;  1SW1 A;  1SD3 A;  2HFB A;  4IO7 A;  3FJ7 A;  1FQA A;  2QMW A;  4OFJ A;  3PGF A;  4LZ7 A;  3KJ7 A;  5H8F A;  3PUV E;  1JW4 A;  4U1Z A;  4U21 A;  4LP2 B;  4YMA A;  3FVN A;  1B51 A;  4PFU A;  3I6V A;  4IGT A;  5KZT A;  2I6E A;  2FYI A;  1IIT A;  5CMB A;  1EZP A;  1B58 A;  3UN6 A;  1Y3N A;  4P0I A;  2ZYN A;  1L5T A;  4GD5 A;  4BDM A;  2V3Q A;  2E0S A;  5CM6 A;  4QSE A;  2H99 A;  3IOW A;  3KOS A;  1UIU A;  3HPI A;  3MP1 A;  1FW0 A;  4JWO A;  1Y4T A;  5JTY A;  4DXU A;  1URG A;  3C4M A;  3DP6 A;  4HCW A;  2O6A A;  3K6X A;  3OOA A;  1I6B A;  1URS A;  4ZED A;  3FD3 A;  3OO9 A;  3EHU A;  4KYE A;  1N0T A;  2DWI A;  4OFO A;  3E4R A;  3RN8 A;  2H9B A;  1FTL A;  2CZL A;  4H8J A;  1XOC A;  5I56 B;  2REJ A;  4H65 A;  4POW A;  1A54 A;  4U4X A;  1PBQ A;  1A7L A;  1MXU A;  3HN0 A;  1ZBM A;  1Y1Z A;  2PYY A;  2B3F A;  3FXR A;  4WEP A;  2Y7W A;  4OHN A;  3G3G A;  3CFX A;  3K4U A;  3EHS A;  5I2K B;  4AQ4 A;  1SVX B;  1IZ1 A;  3AXF A;  2Q2C A;  5DVI A;  3Q25 A;  1RYX A;  3U1O A;  2RCA A;  3PPQ A;  4DXB A;  2PT1 A;  1DPP A;  1B3L A;  3QXM A;  1TFD A;  4LQ5 A;  1UTB A;  1JQF A;  3UGW A;  3M8U A;  2YLN A;  5FTH A;  1Y20 A;  4FOR A;  2R6G E;  2Z8D A;  1SW2 A;  3LSL A;  4EQ9 A;  3FUZ A;  4C1U A;  1B7H A;  3RNN A;  2HXW A;  2ZYM A;  5FHM A;  3OO6 A;  2D21 A;  2GFE A;  2XXI A;  3MAM A;  3T9V A;  3O97 A;  3K1M A;  1ZMG A;  3VVF A;  5ICT A;  1LAF E;  3TCH A;  1JW5 A;  1Y9U A;  4GOT A;  3R26 A;  3VDF A;  5AA4 A;  2ZNT A;  1YPN A;  4NF4 A;  3KOT A;  1GTK A;  3DEL B;  2DWH A;  1TFA A;  1A40 A;  1B4Z A;  3CFL A;  2DXY A;  2Z8F A;  1US5 A;  4AB5 A;  2F7B A;  1N84 A;  4PFT A;  2X26 A;  4DCY A;  4R74 A;  4Z0I A;  4THI A;  5I59 A;  5H8H B;  2QRY A;  3ZKL A;  5DVF A;  1BP5 A;  4H8I A;  1JET A;  2O1L A;  2QPQ A;  4DCX A;  3FGS A;  1A8E A;  5DEX A;  1B0H A;  3TUS A;  1N7X A;  3CR9 A;  2PBW A;  1IXH A;  2NUV A;  3VXC A;  3P7I A;  1N76 A;  5CRY A;  3HHF A;  2RC7 A;  3S9N C;  3IOT A;  4K3F A;  1FQE A;  1MY1 A;  5L8D A;  2Q89 A;  3FVK A;  4QSC A;  1A99 A;  1QKA A;  2QJE A;  4KQP A;  4IO5 A;  4ZEC A;  4QF9 A;  2ANJ A;  2UVH A;  2OBG A;  3FXQ A;  1MY3 A;  4ESX A;  1DTZ A;  3U8Q A;  3KN7 A;  4XTC Q;  2O84 X;  5ISU A;  2OZZ A;  2F36 A;  4EF1 A;  4BLA A;  4OWD A;  3IL1 B;  1F9B A;  1SYH A;  3IJX B;  3G7W A;  2H98 A;  2X7Q A;  2R9J A;  5EHS A;  3PD9 A;  3SER A;  4OVJ A;  3TAJ A;  1B5I A;  3LBS A;  4OMB A;  4X1B A;  5I58 A;  1HSE A;  2Q2A A;  3LUY A;  1P1U A;  5CMM A;  2ZNS A;  1FQF A;  1B52 A;  4JWX A;  3FV1 A;  5CMK A;  2O68 A;  4O3A A;  4NF8 A;  4GXA A;  5I2N A;  3EPE A;  2F7C A;  2V3T A;  4GRK A;  1USY E;  3V83 A;  3RQT A;  3H4Z A;  5F7V A;  2I4B A;  1MQD A;  3ILU B;  3M3F A;  4YKJ A;  1QVS A;  4MLV A;  2RC9 A;  1DSN A;  1MPD A;  1OQG A;  1ATG A;  2PVU A;  4Q5T A;  3O6I A;  4PET A;  4Z7E A;  5LOM A;  3T66 A;  2Y7P A;  1PEB A;  1Y1M A;  4LZ8 A;  3C35 A;  1SI1 A;  1QKB A;  4LUB A;  1Q35 A;  3EF7 A;  4GQO A;  2P1S A;  2IEE A;  2DS9 A;  2F6P A;  5JEI A;  3CVG A;  3B6T A;  3K00 A;  4ZS9 A;  1AOV A;  1SQY A;  4H1X A;  3TTR A;  1TT1 A;  2ZYO A;  3T9U A;  1PC3 A;  1LAX A;  1B3E A;  2ABH A;  3SEU A;  3WAF A;  5KDT A;  3TOD A;  1MQH A;  3PD8 A;  4ELQ A;  5L9O A;  5I57 B;  2QL3 A;  1B46 A;  3PUY E;  2FNC A;  4LA9 A;  4RA1 A;  5L9M A;  2F34 A;  4N6P A;  3VVE A;  1SW5 A;  1I6A A;  3I3V A;  4MLQ A;  2H5Y A;  1B05 A;  3FVG A;  1XT8 A;  1Y3Q A;  4JSO A;  1MPC A;  3QYT A;  4GL8 A;  2F97 A;  5K2Y A;  3MP6 A;  1XHY A;  1JVY A;  2P2A A;  3OD7 A;  2R71 A;  2O51 A;  2VHA A;  4G8H A;  1SI0 A;  2B65 A;  4EQB A;  4N07 A;  4L17 A;  3FXU A;  1LBC A;  1Q1K A;  1GVC A;  1VSO A;  2QS3 A;  3TCF A;  4Q0C A;  3Q28 A;  1USY H;  2DWA A;  3KN3 A;  2V84 A;  1QJM A;  1M5F A;  4IO2 A;  4PFY A;  4R9G A;  3ZKK A;  2FA7 A;  4I8C A;  4DXC A;  2XD2 A;  4JDF A;  2W7Y A;  5CBS A;  3F11 A;  3IR1 A;  5CI5 A;  3TDJ A;  1IEJ A;  3VLV A;  4XKP A;  2RIN A;  3O66 A;  4H5F A;  3MW0 A;  4U2R A;  5EHM A;  1LB8 A;  3UP9 A;  1BTJ A;  3CRB A;  1UIV A;  4QHQ A;  3HST A;  5M2V A;  2A5T A;  3FZV A;  2ONK E;  1FTO A;  3W9W A;  3A3C A;  1P1N A;  3H6T A;  3L6H A;  2B3B A;  3QSL A;  3T22 A;  3O2A A;  4M1V A;  3TEP A;  3N6U A;  2V25 A;  5TPA A;  4F1U A;  1A55 A;  3KJT A;  1ZTY A;  3MVX A;  3IJO B;  1MH3 A;  2F35 A;  4FIM A;  2ZNU A;  4JXI A;  2REG A;  4EQ7 A;  1NMU A;  3OXN A;  2DE4 A;  3PUW E;  4F3B A;  5H8N B;  1XVX A;  4G4P A;  4F29 A;  3TTM A;  4RYA A;  4BDQ A;  5A5X B;  3KGC A;  3MC2 A;  4I1D A;  4IY5 A;  4N13 A;  1NFT A;  4I62 A;  4POX A;  2DVZ A;  2XX9 A;  1B9J A;  3K1N A;  5AA3 A;  1FQC A;  4ND9 A;  1URD A;  3CG3 A;  1B0L A;  3FV2 A;  4OTE A;  3MUQ A;  5H8Q B;  2HZK A;  1O7T A;  3FIR A;  3RT6 B;  2KLF A;  4IY6 A;  3VLU A;  4ONY A;  1FQB A;  2F8D A;  3OEL A;  1P1W A;  4JSD A;  4XKQ A;  5TP9 A;  1D9V A;  1XC1 A;  3S9E A;  1XS5 A;  4FEB A;  3H7M A;  4WKM A;  1FTM A;  4R73 A;  3H6V A;  5FHO A;  1QW0 A;  1WOD A;  3C34 A;  5H8S A;  4LAT A;  1H45 A;  2DYX A;  3C32 A;  4MFI A;  4G77 A;  2OWT A;  4ZE8 A;  4ZZE A;  1EU8 A;  1MQJ A;  5H8F B;  4HS7 A;  5DYH A;  4X9T A;  4NWD A;  1IXC A;  1AIV A;  3K01 A;  5CMC A;  5B70 A;  1RYO A;  3U72 A;  2HAV A;  4F1Y A;  4GL0 A;  4MH5 A;  1II5 A;  4EXL A;  1MDQ A;  4XXU A;  4KYD A;  2UYF A;  3DP4 A;  3TTL A;  1YCJ A;  5KCJ A;  3IK6 B;  4OZ9 A;  2O69 A;  3DM0 A;  5JTY B;  1B5H A;  2YPN A;  2XXY A;  3ODB A;  1ZLQ A;  1B3F A;  1MQI A;  1FQD A;  4OYV A;  3T9X B;  4KCD A;  3O29 A;  3JYR A;  4G68 C;  3CFZ A;  3BFT A;  4Q8R A;  2G93 A;  1MY0 A;  3N5L A;  1Z7N E;  3N94 A;  2I3W A;  1JEV A;  1NH7 A;  2I4C A;  3G3J A;  3TYH A;  3K6V A;  2VOZ A;  3IAZ A;  3QUJ A;  4XKR A;  1MY2 A;  3D4C A;  1B1X A;  1OLA A;  4U22 A;  1B3H A;  1JEU A;  4R9F A;  4RJZ A;  4NF5 A;  2ONS A;  2I3V A;  4JWY A;  3HHG A;  4ZEK A;  3MQ9 A;  1CE2 A;  2D3I A;  2RKM A;  4HW8 A;  4DDD A;  3IB2 A;  1P99 A;  1LAG E;  1HSJ A;  5IAI A;  3CI8 A;  1UTB B;  3PPR A;  1DMB A;  1N7W A;  3QK6 A;  1WDN A;  2G29 A;  2XXP A;  1KWH A;  4AB6 A;  4E0W A;  1AL3 A;  3UIF A;  1NH8 A;  2Y7R A;  4YB5 A;  2HZL A;  4ZE9 A;  1LFH A;  3B7D A;  4OEU A;  4NF6 A;  5J1D A;  1PBP A;  1R9Q A;  4DLD A;  5I84 A;  3C33 A;  3PMX A;  3PV0 E;  1QUJ A;  1PB8 A;  1MH4 A; 
#chains in the Genus database with same CATH topology
 2CEY A;  3FJM A;  5AA4 B;  2DVC A;  4P9K A;  2ALU A;  2QFL A;  4NF4 B;  1NV6 A;  2ZMB A;  3RLF E;  4FBP A;  2I0C A;  4N15 A;  4X1D A;  3TQW A;  1IQ7 A;  1B7Z A;  3MVW A;  3HCQ A;  2IA4 A;  3O28 A;  2RCB A;  1H43 A;  4LON B;  4PFW A;  5BWJ A;  4GWS A;  1N04 A;  2Y7I A;  4GXS B;  4OVS A;  1MY4 A;  4U1O A;  4ISU A;  2I49 A;  2ZZX A;  3M3K A;  5J16 A;  4KCC A;  1I6Q A;  1FCK A;  1B7U A;  2PFZ A;  1POT A;  4NF5 B;  3USD A;  1NUZ A;  4KFQ A;  3TPA A;  2XX8 A;  3MVY A;  3IO6 A;  5I59 B;  2WBD A;  5EQ7 A;  4OER A;  4ESW A;  2XXX A;  3RTW B;  4YMB A;  4R6H A;  1H3D A;  1D9Y A;  3K1P A;  3G3K A;  4ELR A;  2QS1 A;  4XKN A;  4R2F A;  2Z23 A;  1G0I A;  4X48 A;  1Z7M E;  5DEX B;  3A29 A;  3OMB A;  5ET7 A;  3SEV A;  3T93 B;  4H67 A;  4HCY A;  4KHZ E;  2V3U A;  4FE8 A;  4OET A;  5L9S A;  1R6Z A;  3QIM A;  2XXK A;  1LB9 A;  3VV5 A;  1B1H A;  2F78 A;  2XXQ A;  3S9M C;  1UTH A;  2ESN A;  2RF1 A;  4GVO A;  1HSL A;  3G3H A;  2JJK A;  3VLW A;  4GF8 A;  3EQ1 A;  2WEF A;  3CG1 A;  3MP8 A;  2GQ1 A;  3T1B A;  1SW4 A;  2CMO A;  1LEV A;  1I69 A;  1B40 A;  4O94 A;  1IUD A;  3DLN A;  4FED A;  4YU0 A;  4R6Y A;  2Y5K A;  4I3Y A;  3MPL A;  4KYS A;  4I3E A;  1MRP A;  1S9T A;  3W9V A;  4IO3 A;  1LLS A;  1NNP A;  2MKZ A;  2O7U A;  1GV8 A;  3TCG A;  3IFA A;  3GXA A;  3KSJ A;  4TLM B;  4LQ2 A;  3FAS A;  4GX4 A;  3RPL A;  5AE4 A;  2OJT A;  2XHD A;  5IZ3 A;  2V93 A;  1MXY A;  5EYF A;  3PPO A;  4IO6 A;  1DTG A;  4G2Z A;  3IB1 A;  1MS7 A;  3BKI B;  2H25 A;  4ZEI A;  3I5O A;  3A09 A;  1PDA A;  3VFJ A;  1KZ8 A;  5I58 B;  2XD3 A;  2Y7K A;  3ZS6 A;  2E1S A;  3K02 A;  3O6H A;  3RUM A;  1VDW A;  2LAO A;  3S4U A;  1MG1 A;  1OLC A;  4NF8 B;  5I2N B;  4YKI A;  3K6U A;  2PX1 A;  1MM7 A;  3SEW A;  1IMC A;  4F2O A;  3U94 A;  3OSR A;  1NL5 A;  4P11 A;  4F19 A;  3EHT A;  2UVI A;  2HEU A;  1TWY A;  2ONR A;  1IXI A;  3RGY A;  1FPE A;  3T9H B;  4OXV A;  4KR5 A;  3OSQ A;  4DZ1 A;  3TTK A;  1MPB A;  3KBR A;  2XWO A;  4XF5 A;  1NNF A;  1R9L A;  3PPP A;  3C31 A;  1YAE A;  2XWK A;  3WAE A;  1NNK A;  1TXF A;  3ECR A;  4KI0 E;  1B4H A;  4GWY A;  4KD5 A;  1NUW A;  2Z22 A;  1MXZ A;  3SEX A;  4P8B A;  4LZ5 A;  1YTV A;  5I56 A;  1A8F A;  2PMS A;  3MPK A;  3ILT B;  2PCR A;  1H76 A;  2GHB A;  3K6W A;  1AH5 A;  3KBZ A;  4UA8 A;  4GLI A;  1IIW A;  2WX9 A;  4BDN A;  5AA2 D;  1P1O A;  1FJ6 A;  3LC8 A;  5KDT B;  2B4M A;  2HCA A;  3V89 B;  3A3U A;  4PAF A;  1ELJ A;  3C36 A;  4F3G A;  2QVR A;  4ZEB A;  1ZKB A;  4TLL B;  2O7I A;  4OEV A;  5I2K A;  3BIG A;  1VFD A;  3TZA A;  4R6K A;  1LCF A;  4F18 A;  4NF0 A;  3R6U A;  3MYU A;  4MAG A;  3S2V A;  4NWC A;  3OO8 A;  4JB7 A;  2QMX A;  3B50 A;  2XXU A;  2UXA A;  1NV2 A;  4AS5 A;  4Q30 B;  3PMV A;  2X7P A;  3CIJ A;  2H4I A;  2Q8J A;  3N6T A;  2OCU A;  1FBD A;  2CEX A;  4IO4 A;  5ELV A;  5A5L A;  3R7X A;  4PAK A;  4H0W A;  3H06 B;  4RK9 A;  3FVO A;  1B5J A;  3O6G A;  1O63 A;  2VD3 A;  4KPT A;  3KG2 A;  3MVZ A;  3PU5 A;  3FBP A;  1NV5 A;  5JK4 A;  4DI3 D;  3IOV A;  4HXV A;  4F22 A;  4NED A;  1SYI A;  1OVT A;  4C0R A;  3GYY A;  4X04 A;  2Y84 A;  1Y3P A;  4ZZA A;  1FPK A;  1K9Z A;  3PMW A;  4PQJ A;  3IX1 A;  3SET A;  4GFR A;  4N4U A;  3D4G A;  4DIG A;  4PBQ A;  1LBB A;  3VXB A;  3OEM A;  2A5T B;  4QFO A;  4P1E A;  1BLF A;  1G0H A;  4YKP A;  3GBA A;  1XVY A;  4R75 A;  2THI A;  3S9L C;  1GGG A;  1LGB C;  1NUX A;  4UAB A;  5TU0 A;  5H8H A;  4PTK A;  5TPA B;  1FTJ A;  1B32 A;  4NE4 A;  1RDZ A;  1M5B A;  1VFE A;  1QUI A;  3E9X A;  1UQW A;  3U93 A;  3CHG A;  4TOZ A;  4RXL A;  2Z8E A;  2XA5 A;  3FAT A;  2HQ0 A;  2F7A A;  1LBZ A;  2XXT A;  2DE3 A;  2BJJ X;  3GLB A;  1H44 A;  1FPI A;  1P1Q A;  2XXH A;  4OQO A;  3MWB A;  2Q88 A;  3ZSF A;  4RPO A;  2Q8M A;  2ZXT A;  4I9D A;  5AA1 A;  2FIE A;  1DCU A;  1M5C A;  2KQZ A;  2AL5 A;  2DQV A;  3QUF A;  1IXG A;  5ESY A;  4UAC A;  2UVJ A;  3LSF B;  2QS4 A;  4WXJ A;  5ITO A;  3H6W A;  2OK2 A;  1EZO A;  2CZI A;  3VVD A;  3KFM A;  4RY1 A;  2VPN A;  5AA2 A;  4IR8 A;  2VGQ A;  3IO4 A;  3E3K A;  3DP8 A;  4EUO A;  3H3G A;  2WKY A;  1OQH A;  4ZDM A;  5I3S A;  1LBV A;  3MJN A;  5TP9 B;  4PFI A;  1LCT A;  1NKX A;  2UYE A;  4WED A;  5BUU A;  4RPN A;  1BKA A;  4IB2 A;  2NVU B;  5F24 A;  1B3G A;  3KZG A;  1S7Y A;  1SBP A;  3VE1 B;  4TQU Q;  2DXR A;  3SDF A;  4F31 B;  4OAN A;  1CB6 A;  4MF3 A;  1AMF A;  2A5S A;  4GWO A;  3G3I A;  3GZG A;  3OO7 A;  4NQ8 A;  4O8M A;  4FAT A;  4G8N A;  1EYJ A;  2DSF A;  3IB0 A;  2AYS A;  1D4N A;  4YAH X;  2Q74 A;  3M3L A;  4YKK A;  4YIC A;  3TQL A;  4ELO A;  4OVT A;  2NOO A;  3HO7 A;  3O9P A;  3RY3 A;  3UA8 A;  4GBV A;  2VP1 A;  4PF8 A;  4M4G A;  3SZP A;  5IGA A;  3SKP A;  1INP A;  3LSW A;  1OIB A;  4FJP A;  1MM6 A;  2I0B A;  5KCJ B;  3W15 C;  2R8T A;  4MBP A;  3BFU A;  2VD2 A;  3SEY A;  2ZYK A;  2DOJ A;  1N3W A;  4OES A;  2HAU A;  4EDP A;  4RNS A;  3V5A A;  4ZEF A;  4ECF A;  4NTL A;  1JVX A;  4PE3 A;  1DPE A;  1T0K A;  3LR1 A;  4EXK A;  3G3F A;  5K2X A;  5AA2 B;  4FAJ A;  2Q9T A;  4FEC A;  4OFL A;  4PE5 B;  3E13 X;  3K0V A;  1LST A;  1MXX A;  1NNT A;  2GHA A;  1JNF A;  3UOR A;  3Q27 A;  2DP8 A;  3KEI A;  2XXR A;  5DVJ A;  1BIY A;  4QFL A;  4E0X A;  3JV9 A;  3TFL A;  5DT6 A;  1DOT A;  1FBF A;  1MXV A;  1LFI A;  1LAH E;  3MZ9 A;  4G8M A;  3U92 A;  4QRZ A;  1VR5 A;  3THI A;  4U23 A;  3OEN A;  4DE8 A;  5ICQ A;  4R72 A;  5I57 A;  4U4S A;  3N26 A;  1EZ9 A;  1M5D A;  4RK2 A;  1D3K A;  2I48 A;  1J1N A;  4F3P A;  3Q29 A;  4H6D A;  3BBR A;  4F2Q A;  1JW1 A;  4JBZ A;  4BDO A;  3T96 B;  4HE1 A;  2FBP A;  4BDL A;  4C1T A;  1EH3 A;  1B2H A;  3H6U A;  2NXO A;  4NF6 B;  5I7I A;  3B6Q A;  2I58 A;  4QXD A;  1ZU0 A;  3K2D A;  1FSA A;  4G68 A;  1RDX A;  4YB7 A;  2P0S A;  3FJG A;  1N3X A;  3L6G A;  4P0G A;  3PPN A;  4YZZ A;  3RT8 A;  4F3S A;  4EF2 A;  5LTC A;  3RPW A;  2KR0 A;  1OVB A;  2XXV A;  5ITP A;  4BDR A;  2P3N A;  3RTF B;  2XX7 A;  1Y4C A;  3MZ1 A;  4IGR A;  4JVI A;  4N8G A;  4NN3 A;  4PAI A;  2M8C A;  1D9Q A;  4QFK A;  5DTB A;  3MBP A;  1GR2 A;  1IMA A;  5HPQ A;  3KSX A;  4N81 A;  2UVG A;  1MXW A;  4HTG A;  1US4 A;  2RC8 A;  2XXW A;  3IOR A;  4NAP A;  3PUZ E;  4NG7 A;  2DWJ A;  3ONM A;  2QSX A;  2WYP A;  2QVV A;  1FTK A;  4O3C A;  3IOU A;  5FHN A;  3B6W A;  1NV0 A;  3MZB A;  3QAX A;  1O64 A;  1MQG A;  3JZJ A;  4ELP A;  5IKB A;  1LFG A;  1ANF A;  2ZZV A;  3UK4 A;  4YB6 A;  5HBC A;  3TEL A;  5IZ1 A;  3KN8 A;  1ZIU A;  4NMY A;  4QFP A;  2QS2 A;  5FTI A;  1PB7 A;  3U65 A;  1R1N A;  5F1Q A;  1SPI A;  1UTH B;  4O3B A;  5CBR A;  3SES A;  3LSX A;  2D5W A;  3C9H A;  1QUL A;  5CC2 A;  5H8N A;  3PTY A;  3H03 A;  2AIX A;  2OLB A;  2OWS A;  5HM4 B;  1POY 1;  2DE2 A;  4G68 B;  4F39 A;  4H5G A;  5A5X A;  3TTN A;  3Q26 A;  2O1M A;  2WBB A;  1PB9 A;  3OEK A;  4F1V A;  4PP0 A;  1SDX A;  3GBB A;  4QFN A;  2YJP A;  1VE4 A;  4LVQ A;  1IMF A;  5H8Q A;  1M5E A;  2GH9 A;  1IME A;  3EN3 A;  4GIZ A;  2NWJ A;  3TMG A;  2PT2 A;  2GRV A;  3RPL B;  5B7D A;  3CSB A;  2AL4 A;  4QSD A;  4XIG Q;  2XWI A;  1OMP A;  5IZ3 B;  1B6H A;  4R2B A;  4MNP A;  3T0J A;  4OEN A;  1QUK A;  1S50 A;  1WVJ A;  1RDY A;  2F6G A;  1NV7 A;  3PUX E;  3V8X B;  1ZJL A;  1RKM A;  2F5X A;  3CSG A;  1MDP 1;  3TKD A;  3ISP A;  3HV1 A;  1SW1 A;  1FBE A;  1SD3 A;  3QMF A;  2HFB A;  4IO7 A;  3MST A;  3FJ7 A;  1FQA A;  2QMW A;  4OFJ A;  3PGF A;  4LZ7 A;  4PC9 A;  3KJ7 A;  5H8F A;  3PUV E;  1JW4 A;  4O7M A;  4U1Z A;  4U21 A;  4LP2 B;  4YMA A;  3FVN A;  1B51 A;  4PFU A;  3I6V A;  4IGT A;  5KZT A;  2I6E A;  2FYI A;  4H46 A;  4N6K A;  1IIT A;  5CMB A;  1EZP A;  1YXI A;  1B58 A;  3UN6 A;  1Y3N A;  4P0I A;  4JVD A;  2ZYN A;  1L5T A;  1QGX A;  4GD5 A;  4BDM A;  5LDZ A;  2V3Q A;  2E0S A;  5CM6 A;  4QSE A;  2H99 A;  3IOW A;  3KOS A;  1UIU A;  3HPI A;  3MP1 A;  1FW0 A;  4JWO A;  1Y4T A;  5JTY A;  4DXU A;  1URG A;  3C4M A;  3DP6 A;  4HCW A;  4P3L A;  2O6A A;  3K6X A;  3OOA A;  1I6B A;  1URS A;  4ZED A;  3FD3 A;  3OO9 A;  3EHU A;  4KYE A;  1N0T A;  2DWI A;  4OFO A;  3E4R A;  3RN8 A;  2H9B A;  1FTL A;  2CZL A;  4H8J A;  1XOC A;  5I56 B;  2REJ A;  4H65 A;  4POW A;  1A54 A;  4U4X A;  1PBQ A;  4NGU A;  4MJO A;  1A7L A;  1MXU A;  3HN0 A;  5I5P A;  1ZBM A;  1Y1Z A;  2PYY A;  2B3F A;  3FXR A;  4WEP A;  2Y7W A;  4OHN A;  3G3G A;  3CFX A;  4MNC A;  3K4U A;  3EHS A;  5I2K B;  4AQ4 A;  1SVX B;  1IZ1 A;  3AXF A;  2Q2C A;  4GWZ A;  5DVI A;  4MEV A;  5EQ9 A;  3Q25 A;  4P47 A;  1DK4 A;  1FBC A;  2L5V A;  1RYX A;  4LN5 A;  3U1O A;  2RCA A;  3PPQ A;  1YZ0 A;  4DXB A;  2PT1 A;  1DPP A;  1B3L A;  3QXM A;  1TFD A;  4LQ5 A;  1UTB A;  1JQF A;  3UGW A;  3M8U A;  2YLN A;  1XI6 A;  4P56 A;  4N91 A;  5FTH A;  1Y20 A;  4FOR A;  2R6G E;  2Z8D A;  1SW2 A;  3LSL A;  4EQ9 A;  3FUZ A;  4C1U A;  1B7H A;  3RNN A;  2HXW A;  2ZYM A;  5FHM A;  3OO6 A;  4MMP A;  2D21 A;  2GFE A;  2XXI A;  3MAM A;  3T9V A;  3O97 A;  3K1M A;  1ZMG A;  3VVF A;  5ICT A;  1LAF E;  3TCH A;  1JW5 A;  1Y9U A;  4GOT A;  3R26 A;  4PCD A;  3VDF A;  5AA4 A;  2ZNT A;  1YPN A;  5EQ8 A;  4NF4 A;  2DDK A;  3KOT A;  1GTK A;  3DEL B;  2DWH A;  1TFA A;  1A40 A;  1K9Y A;  1B4Z A;  3CFL A;  2OWZ A;  4MCO A;  2DXY A;  2Z8F A;  1US5 A;  4AB5 A;  2F7B A;  1N84 A;  4PFT A;  1FBP A;  2X26 A;  4DCY A;  4R74 A;  4Z0I A;  4GBW A;  4THI A;  3E79 A;  5I59 A;  5H8H B;  2QRY A;  4MIJ A;  3ZKL A;  5DVF A;  1BP5 A;  4H8I A;  1JET A;  2O1L A;  2QPQ A;  4DCX A;  3FGS A;  1A8E A;  5DEX A;  2HHM A;  2FIX A;  1B0H A;  4JVC A;  3TUS A;  1N7X A;  3CR9 A;  2PBW A;  1IXH A;  2NUV A;  5DW8 A;  3P7I A;  3VXC A;  1N76 A;  5CRY A;  1KA0 A;  3HHF A;  2RC7 A;  3S9N C;  3IOT A;  4K3F A;  3IFC A;  1FQE A;  1MY1 A;  4N8Y A;  5L8D A;  2Q89 A;  4N6D A;  3FVK A;  4QSC A;  1A99 A;  1QKA A;  1FRP A;  2QJE A;  2V4C A;  4KQP A;  4IO5 A;  4ZEC A;  1FPF A;  4NX1 A;  4QF9 A;  2ANJ A;  2UVH A;  2OBG A;  3FXQ A;  1MY3 A;  4ESX A;  2CZK A;  1DTZ A;  1AWB A;  3HFU A;  3U8Q A;  4PGN A;  4GWU A;  1FPJ A;  3KN7 A;  4OVP A;  4XTC Q;  2O84 X;  5ISU A;  2OZZ A;  2F36 A;  4EF1 A;  4BLA A;  4OWD A;  3IL1 B;  1F9B A;  1SYH A;  3IJX B;  3G7W A;  2H98 A;  2X7Q A;  2R9J A;  3B8B A;  5EHS A;  1NI9 A;  3PD9 A;  3SER A;  4OVJ A;  3TAJ A;  1B5I A;  3LBS A;  4OMB A;  4X1B A;  4MHF A;  5I58 A;  1HSE A;  2Q2A A;  3LUY A;  4GX3 A;  1P1U A;  5CMM A;  2ZNS A;  4PGP A;  1FQF A;  1B52 A;  4JWX A;  1NV4 A;  3FV1 A;  5CMK A;  2FVZ A;  2O68 A;  4O3A A;  4NF8 A;  4GXA A;  5I2N A;  3EPE A;  2F7C A;  2V3T A;  4GRK A;  1USY E;  3V83 A;  1LBX A;  3RQT A;  3H4Z A;  5F7V A;  2I4B A;  1MQD A;  3ILU B;  3M3F A;  4YKJ A;  1QVS A;  4MLV A;  4H45 A;  2RC9 A;  1DSN A;  3KC1 A;  1MPD A;  1OQG A;  1ATG A;  2PVU A;  4OA4 A;  3D1R A;  4Q5T A;  3O6I A;  4PET A;  2XWV A;  4Z7E A;  5LOM A;  4PFB A;  1FPB A;  3T66 A;  2WYK A;  2Y7P A;  1PEB A;  1Y1M A;  4LZ8 A;  4PDH A;  4PF6 A;  1NV1 A;  3C35 A;  1SI1 A;  1JP4 A;  4NHB A;  1QKB A;  4LUB A;  1Q35 A;  1EYK A;  4MNI A;  3RYD A;  3EF7 A;  4GQO A;  2P1S A;  2IEE A;  2DS9 A;  2F6P A;  5JEI A;  3CVG A;  4G61 A;  3B6T A;  3K00 A;  4ZS9 A;  1AOV A;  1SQY A;  4H1X A;  3TTR A;  1TT1 A;  2ZYO A;  3T9U A;  1PC3 A;  1LAX A;  1B3E A;  2ABH A;  3SEU A;  3WAF A;  5KDT A;  3TOD A;  1MQH A;  3PD8 A;  4ELQ A;  5L9O A;  4HE0 A;  5I57 B;  2QL3 A;  1B46 A;  3PUY E;  2FNC A;  4LA9 A;  4RA1 A;  5L9M A;  2F34 A;  4N6P A;  2VPO A;  3BIH A;  3VVE A;  1SW5 A;  1I6A A;  3I3V A;  4MLQ A;  2H5Y A;  1B05 A;  3FVG A;  1XT8 A;  1Y3Q A;  1LBW A;  4JSO A;  1MPC A;  3QYT A;  4GL8 A;  2F97 A;  5K2Y A;  3MP6 A;  1Q9D A;  1XHY A;  1JVY A;  2P2A A;  3OD7 A;  3KC0 A;  2R71 A;  2O51 A;  2VHA A;  4G8H A;  1BK4 A;  1SI0 A;  2B65 A;  4EQB A;  4N07 A;  4L17 A;  3FXU A;  1LBC A;  1Q1K A;  1GVC A;  2ZZW A;  1YYZ A;  1EYI A;  1VSO A;  2QS3 A;  1FTA A;  3TCF A;  4Q0C A;  4AS4 A;  3Q28 A;  1USY H;  2DWA A;  3KN3 A;  4X8R A;  2V84 A;  1QJM A;  1M5F A;  4N17 A;  4IO2 A;  4PFY A;  2HXR A;  1FPG A;  4PDD A;  4R9G A;  3ZKK A;  2FA7 A;  4I8C A;  4DXC A;  2XD2 A;  4JDF A;  2W7Y A;  5CBS A;  4XFE A;  3F11 A;  3IR1 A;  5CI5 A;  3TDJ A;  1IEJ A;  3VLV A;  4XKP A;  2QVU A;  1FBG A;  2RIN A;  3O66 A;  4H5F A;  3MW0 A;  4U2R A;  5EHM A;  1LB8 A;  2F3B A;  3UP9 A;  1BTJ A;  3CRB A;  4DI4 B;  1UIV A;  4QHQ A;  3HST A;  4GWW A;  5M2V A;  2A5T A;  3FZV A;  2HPG A;  2ONK E;  1FTO A;  3W9W A;  3A3C A;  1P1N A;  3H6T A;  1KA1 A;  3L6H A;  2B3B A;  3QSL A;  3T22 A;  3O2A A;  4PBH A;  4M1V A;  3TEP A;  1FJ9 A;  4P1L A;  3N6U A;  3E78 A;  2V25 A;  2OX3 A;  5IZZ A;  5TPA A;  4F1U A;  1A55 A;  3KJT A;  1ZTY A;  3MVX A;  3IJO B;  1MH3 A;  2F35 A;  4FIM A;  2ZNU A;  4JXI A;  2REG A;  4EQ7 A;  1NMU A;  3OXN A;  2DE4 A;  3PUW E;  4F3B A;  2P3V A;  4QBA A;  5H8N B;  1XVX A;  4G4P A;  4F29 A;  3TTM A;  4RYA A;  4BDQ A;  5A5X B;  3KGC A;  3MC2 A;  4I1D A;  4IY5 A;  4N13 A;  5ET8 A;  1NFT A;  4I62 A;  4POX A;  2DVZ A;  2XX9 A;  1IMB A;  1B9J A;  3K1N A;  5AA3 A;  1FQC A;  4ND9 A;  1URD A;  3CG3 A;  1B0L A;  3FV2 A;  4OTE A;  3MUQ A;  5EYG A;  5H8Q B;  2HZK A;  1O7T A;  3FIR A;  3RT6 B;  2KLF A;  4IY6 A;  3VLU A;  4ONY A;  1FQB A;  2F8D A;  3OEL A;  1P1W A;  4JSD A;  4XEQ A;  4XKQ A;  5TP9 A;  1D9V A;  1XC1 A;  3S9E A;  1XS5 A;  4FEB A;  3H7M A;  4WKM A;  1FTM A;  4R73 A;  3H6V A;  5FHO A;  1QW0 A;  1DBZ A;  1WOD A;  3C34 A;  5H8S A;  2BJI A;  4LAT A;  1H45 A;  2DYX A;  3C32 A;  4MFI A;  4G77 A;  2OWT A;  4ZE8 A;  4ZZE A;  1EU8 A;  1MQJ A;  5H8F B;  4HS7 A;  5DYH A;  4X9T A;  4NWD A;  1IXC A;  2FHY A;  1AIV A;  3LV0 A;  3K01 A;  5CMC A;  5B70 A;  1IMD A;  1RYO A;  3U72 A;  2HAV A;  4F1Y A;  3ROJ A;  4GL0 A;  4MH5 A;  1II5 A;  4PFR A;  4EXL A;  1MDQ A;  3LUZ A;  4XXU A;  1NUY A;  4KYD A;  2UYF A;  3DP4 A;  3TTL A;  1YCJ A;  5KCJ A;  3IK6 B;  1FPL A;  4OZ9 A;  2O69 A;  3DM0 A;  5JTY B;  1B5H A;  2YPN A;  2XXY A;  3ODB A;  1ZLQ A;  1B3F A;  1MQI A;  1FQD A;  4OYV A;  3T9X B;  4KCD A;  3O29 A;  3JYR A;  4G68 C;  3CFZ A;  3BFT A;  4Q8R A;  2G93 A;  1MY0 A;  3N5L A;  1Z7N E;  1NV3 A;  3N94 A;  2I3W A;  1JEV A;  1NH7 A;  2I4C A;  3G3J A;  3TYH A;  1FBH A;  3K6V A;  2VOZ A;  3IAZ A;  5IM2 A;  3QUJ A;  1FPD A;  4MX6 A;  2F3D A;  2B4L A;  4XKR A;  1MY2 A;  3D4C A;  1B1X A;  1OLA A;  4U22 A;  1B3H A;  1JEU A;  4OVQ A;  4R9F A;  4RJZ A;  4NF5 A;  5T3J A;  5ET5 A;  2ONS A;  2I3V A;  5EYH A;  4KXP A;  4JWY A;  3HHG A;  4ZEK A;  3MQ9 A;  1CE2 A;  2D3I A;  5EQA A;  4OVR A;  2RKM A;  5FBP A;  1LBY A;  4HW8 A;  4I40 A;  4DDD A;  3IB2 A;  1P99 A;  1LAG E;  1HSJ A;  2VT5 A;  4GWX A;  5IAI A;  3CI8 A;  1UTB B;  3PPR A;  1DMB A;  1N7W A;  2Y5L A;  3QK6 A;  4HE2 A;  1WDN A;  2G29 A;  2XXP A;  1KWH A;  4AB6 A;  4E0W A;  3NOH A;  4O7I A;  1AL3 A;  2PFY A;  3UIF A;  1NH8 A;  2Y7R A;  5ET6 A;  1CNQ A;  4YB5 A;  2HZL A;  4ZE9 A;  3EKI A;  1LFH A;  3B7D A;  3FXB A;  4OEU A;  4NF6 A;  5J1D A;  1PBP A;  1R9Q A;  4DLD A;  4GX6 A;  2CZH A;  5I84 A;  3C33 A;  3PMX A;  3PV0 E;  1QUJ A;  1PB8 A;  1MH4 A; 
#chains in the Genus database with same CATH homology
 3FJM A;  5AA4 B;  2DVC A;  2ALU A;  4NF4 B;  2ZMB A;  3RLF E;  4X1D A;  2I0C A;  3TQW A;  1IQ7 A;  1B7Z A;  3MVW A;  3HCQ A;  2IA4 A;  3O28 A;  2RCB A;  1H43 A;  4LON B;  4PFW A;  5BWJ A;  1N04 A;  2Y7I A;  4GXS B;  1MY4 A;  4U1O A;  4ISU A;  2I49 A;  3M3K A;  4KCC A;  1I6Q A;  1FCK A;  1B7U A;  1POT A;  4NF5 B;  3USD A;  4KFQ A;  3TPA A;  2XX8 A;  3MVY A;  3IO6 A;  5I59 B;  4OER A;  4ESW A;  2XXX A;  3RTW B;  4YMB A;  4R6H A;  1H3D A;  1D9Y A;  3K1P A;  3G3K A;  4ELR A;  2QS1 A;  4XKN A;  4R2F A;  2Z23 A;  4X48 A;  1Z7M E;  5DEX B;  3OMB A;  3SEV A;  3T93 B;  4H67 A;  4HCY A;  4KHZ E;  2V3U A;  4FE8 A;  4OET A;  5L9S A;  1R6Z A;  3QIM A;  1LB9 A;  3VV5 A;  1B1H A;  2F78 A;  2XXQ A;  3S9M C;  1UTH A;  2ESN A;  2RF1 A;  4GVO A;  1HSL A;  3G3H A;  3VLW A;  4GF8 A;  3EQ1 A;  3CG1 A;  3MP8 A;  1SW4 A;  2CMO A;  1I69 A;  1B40 A;  1IUD A;  3DLN A;  4FED A;  4YU0 A;  4R6Y A;  3MPL A;  4KYS A;  1MRP A;  1S9T A;  3W9V A;  4IO3 A;  1LLS A;  1NNP A;  2O7U A;  1GV8 A;  3TCG A;  3GXA A;  3KSJ A;  4TLM B;  4LQ2 A;  3FAS A;  5AE4 A;  2OJT A;  2XHD A;  2V93 A;  1MXY A;  5EYF A;  3PPO A;  4IO6 A;  1DTG A;  4G2Z A;  3IB1 A;  1MS7 A;  3BKI B;  2H25 A;  4ZEI A;  3I5O A;  3A09 A;  1PDA A;  3VFJ A;  5I58 B;  2XD3 A;  2Y7K A;  3ZS6 A;  2E1S A;  3K02 A;  3O6H A;  3RUM A;  2LAO A;  3S4U A;  1MG1 A;  1OLC A;  4NF8 B;  5I2N B;  4YKI A;  3K6U A;  2PX1 A;  1MM7 A;  3SEW A;  4F2O A;  3U94 A;  3OSR A;  1NL5 A;  4P11 A;  4F19 A;  3EHT A;  2UVI A;  2HEU A;  1TWY A;  2ONR A;  1IXI A;  3RGY A;  3T9H B;  4OXV A;  4KR5 A;  3OSQ A;  4DZ1 A;  3TTK A;  1MPB A;  3KBR A;  1NNF A;  1R9L A;  3PPP A;  3C31 A;  1YAE A;  3WAE A;  1NNK A;  1TXF A;  3ECR A;  4KI0 E;  1B4H A;  4KD5 A;  2Z22 A;  1MXZ A;  3SEX A;  4LZ5 A;  1YTV A;  5I56 A;  1A8F A;  2PMS A;  3MPK A;  3ILT B;  1H76 A;  2GHB A;  3K6W A;  1AH5 A;  4UA8 A;  4GLI A;  1IIW A;  4BDN A;  5AA2 D;  1P1O A;  3LC8 A;  5KDT B;  2HCA A;  3V89 B;  3A3U A;  1ELJ A;  3C36 A;  4F3G A;  4ZEB A;  1ZKB A;  4TLL B;  2O7I A;  4OEV A;  5I2K A;  1VFD A;  3TZA A;  4R6K A;  1LCF A;  4F18 A;  3R6U A;  3S2V A;  4NWC A;  3OO8 A;  4JB7 A;  2QMX A;  2XXU A;  2UXA A;  4Q30 B;  3PMV A;  2X7P A;  3CIJ A;  2H4I A;  2Q8J A;  3N6T A;  2OCU A;  4IO4 A;  5ELV A;  3R7X A;  4H0W A;  3H06 B;  4RK9 A;  3FVO A;  1B5J A;  3O6G A;  1O63 A;  2VD3 A;  4KPT A;  3KG2 A;  3MVZ A;  3PU5 A;  5JK4 A;  3IOV A;  4F22 A;  4NED A;  1SYI A;  1OVT A;  4C0R A;  2Y84 A;  1Y3P A;  4ZZA A;  3PMW A;  4PQJ A;  3IX1 A;  3SET A;  4GFR A;  3D4G A;  4DIG A;  1LBB A;  3VXB A;  3OEM A;  2A5T B;  4QFO A;  1BLF A;  4YKP A;  3GBA A;  1XVY A;  4R75 A;  2THI A;  3S9L C;  1GGG A;  1LGB C;  5TU0 A;  5H8H A;  5TPA B;  1FTJ A;  1B32 A;  4NE4 A;  1M5B A;  1VFE A;  1QUI A;  3E9X A;  1UQW A;  3U93 A;  4TOZ A;  4RXL A;  2Z8E A;  3FAT A;  2HQ0 A;  2F7A A;  2XXT A;  2DE3 A;  2BJJ X;  3GLB A;  1H44 A;  1P1Q A;  2XXH A;  4OQO A;  3MWB A;  2Q88 A;  3ZSF A;  4RPO A;  2ZXT A;  4I9D A;  5AA1 A;  1M5C A;  2AL5 A;  2DQV A;  3QUF A;  1IXG A;  4UAC A;  2UVJ A;  3LSF B;  2QS4 A;  4WXJ A;  5ITO A;  3H6W A;  2OK2 A;  1EZO A;  3VVD A;  3KFM A;  4RY1 A;  5AA2 A;  2VGQ A;  3IO4 A;  3E3K A;  3DP8 A;  4EUO A;  3H3G A;  2WKY A;  1OQH A;  4ZDM A;  5TP9 B;  3MJN A;  1LCT A;  1NKX A;  2UYE A;  4WED A;  5BUU A;  4RPN A;  1BKA A;  4IB2 A;  2NVU B;  1B3G A;  3KZG A;  1S7Y A;  1SBP A;  3VE1 B;  4TQU Q;  2DXR A;  3SDF A;  4F31 B;  1CB6 A;  4MF3 A;  1AMF A;  2A5S A;  4GWO A;  3G3I A;  3GZG A;  3OO7 A;  4FAT A;  4G8N A;  2DSF A;  3IB0 A;  2AYS A;  1D4N A;  4YAH X;  3M3L A;  4YKK A;  4YIC A;  3TQL A;  4ELO A;  2NOO A;  3HO7 A;  3O9P A;  3RY3 A;  3UA8 A;  2VP1 A;  4M4G A;  3SKP A;  3LSW A;  1OIB A;  4FJP A;  1MM6 A;  2I0B A;  5KCJ B;  3W15 C;  4MBP A;  3BFU A;  2VD2 A;  3SEY A;  2ZYK A;  2DOJ A;  1N3W A;  4OES A;  2HAU A;  4EDP A;  4RNS A;  3V5A A;  4ZEF A;  4ECF A;  4NTL A;  1JVX A;  1DPE A;  1T0K A;  3LR1 A;  4EXK A;  3G3F A;  5K2X A;  5AA2 B;  4FAJ A;  2Q9T A;  4FEC A;  4OFL A;  4PE5 B;  3E13 X;  3K0V A;  1LST A;  1MXX A;  1NNT A;  2GHA A;  1JNF A;  3UOR A;  3Q27 A;  2DP8 A;  3KEI A;  2XXR A;  5DVJ A;  1BIY A;  4QFL A;  4E0X A;  3JV9 A;  3TFL A;  5DT6 A;  1DOT A;  1MXV A;  1LFI A;  1LAH E;  3MZ9 A;  4G8M A;  3U92 A;  4QRZ A;  1VR5 A;  3THI A;  4U23 A;  3OEN A;  4DE8 A;  5ICQ A;  4R72 A;  5I57 A;  4U4S A;  3N26 A;  1EZ9 A;  1M5D A;  4RK2 A;  1D3K A;  2I48 A;  1J1N A;  4F3P A;  3Q29 A;  4H6D A;  3BBR A;  4F2Q A;  1JW1 A;  4JBZ A;  4BDO A;  3T96 B;  4BDL A;  4C1T A;  1EH3 A;  1B2H A;  3H6U A;  2NXO A;  4NF6 B;  3B6Q A;  2I58 A;  1ZU0 A;  3K2D A;  4G68 A;  4YB7 A;  2P0S A;  3FJG A;  1N3X A;  3L6G A;  4P0G A;  3PPN A;  4YZZ A;  3RT8 A;  4F3S A;  4EF2 A;  3RPW A;  1OVB A;  2XXV A;  5ITP A;  4BDR A;  3RTF B;  2XX7 A;  1Y4C A;  3MZ1 A;  4IGR A;  2M8C A;  4QFK A;  5DTB A;  3MBP A;  1GR2 A;  5HPQ A;  3KSX A;  2UVG A;  1MXW A;  4HTG A;  1US4 A;  2RC8 A;  2XXW A;  3IOR A;  3PUZ E;  2DWJ A;  3ONM A;  2QSX A;  1FTK A;  4O3C A;  3IOU A;  5FHN A;  3B6W A;  3MZB A;  3QAX A;  4ELP A;  1O64 A;  1MQG A;  3JZJ A;  5IKB A;  1LFG A;  1ANF A;  3UK4 A;  4YB6 A;  5HBC A;  3TEL A;  3KN8 A;  1ZIU A;  4NMY A;  4QFP A;  2QS2 A;  5FTI A;  1PB7 A;  1R1N A;  5F1Q A;  1UTH B;  4O3B A;  5CBR A;  3SES A;  3LSX A;  2D5W A;  3C9H A;  1QUL A;  5CC2 A;  5H8N A;  3H03 A;  2AIX A;  2OLB A;  2OWS A;  5HM4 B;  1POY 1;  2DE2 A;  4G68 B;  4F39 A;  4H5G A;  5A5X A;  3TTN A;  3Q26 A;  2O1M A;  1PB9 A;  3OEK A;  4F1V A;  4PP0 A;  1SDX A;  3GBB A;  4QFN A;  2YJP A;  1VE4 A;  4LVQ A;  5H8Q A;  1M5E A;  2GH9 A;  3EN3 A;  4GIZ A;  2NWJ A;  3TMG A;  2PT2 A;  2GRV A;  5B7D A;  3CSB A;  2AL4 A;  4QSD A;  4XIG Q;  1OMP A;  1B6H A;  4R2B A;  4OEN A;  1QUK A;  1S50 A;  1WVJ A;  2F6G A;  3PUX E;  3V8X B;  1ZJL A;  1RKM A;  2F5X A;  3CSG A;  1MDP 1;  3TKD A;  3HV1 A;  1SW1 A;  1SD3 A;  2HFB A;  4IO7 A;  3FJ7 A;  1FQA A;  2QMW A;  4OFJ A;  3PGF A;  4LZ7 A;  3KJ7 A;  5H8F A;  3PUV E;  1JW4 A;  4U1Z A;  4U21 A;  4LP2 B;  4YMA A;  3FVN A;  1B51 A;  4PFU A;  3I6V A;  4IGT A;  5KZT A;  2I6E A;  2FYI A;  1IIT A;  5CMB A;  1EZP A;  1B58 A;  3UN6 A;  1Y3N A;  4P0I A;  2ZYN A;  1L5T A;  4GD5 A;  4BDM A;  2V3Q A;  2E0S A;  5CM6 A;  4QSE A;  2H99 A;  3IOW A;  3KOS A;  1UIU A;  3HPI A;  3MP1 A;  1FW0 A;  4JWO A;  1Y4T A;  5JTY A;  4DXU A;  1URG A;  3C4M A;  3DP6 A;  4HCW A;  2O6A A;  3K6X A;  3OOA A;  1I6B A;  1URS A;  4ZED A;  3FD3 A;  3OO9 A;  3EHU A;  4KYE A;  1N0T A;  2DWI A;  4OFO A;  3E4R A;  3RN8 A;  2H9B A;  1FTL A;  2CZL A;  4H8J A;  1XOC A;  5I56 B;  2REJ A;  4H65 A;  4POW A;  1A54 A;  4U4X A;  1PBQ A;  1A7L A;  1MXU A;  3HN0 A;  1ZBM A;  1Y1Z A;  2PYY A;  2B3F A;  3FXR A;  4WEP A;  2Y7W A;  4OHN A;  3G3G A;  3CFX A;  3K4U A;  3EHS A;  5I2K B;  4AQ4 A;  1SVX B;  1IZ1 A;  3AXF A;  2Q2C A;  5DVI A;  3Q25 A;  1RYX A;  3U1O A;  2RCA A;  3PPQ A;  4DXB A;  2PT1 A;  1DPP A;  1B3L A;  3QXM A;  1TFD A;  4LQ5 A;  1UTB A;  1JQF A;  3UGW A;  3M8U A;  2YLN A;  5FTH A;  1Y20 A;  4FOR A;  2R6G E;  2Z8D A;  1SW2 A;  3LSL A;  4EQ9 A;  3FUZ A;  4C1U A;  1B7H A;  3RNN A;  2HXW A;  2ZYM A;  5FHM A;  3OO6 A;  2D21 A;  2GFE A;  2XXI A;  3MAM A;  3T9V A;  3O97 A;  3K1M A;  1ZMG A;  3VVF A;  5ICT A;  1LAF E;  3TCH A;  1JW5 A;  1Y9U A;  4GOT A;  3R26 A;  3VDF A;  5AA4 A;  2ZNT A;  1YPN A;  4NF4 A;  3KOT A;  1GTK A;  3DEL B;  2DWH A;  1TFA A;  1A40 A;  1B4Z A;  3CFL A;  2DXY A;  2Z8F A;  1US5 A;  4AB5 A;  2F7B A;  1N84 A;  4PFT A;  2X26 A;  4DCY A;  4R74 A;  4Z0I A;  4THI A;  5I59 A;  5H8H B;  2QRY A;  3ZKL A;  5DVF A;  1BP5 A;  4H8I A;  1JET A;  2O1L A;  2QPQ A;  4DCX A;  3FGS A;  1A8E A;  5DEX A;  1B0H A;  3TUS A;  1N7X A;  3CR9 A;  2PBW A;  1IXH A;  2NUV A;  3VXC A;  3P7I A;  1N76 A;  5CRY A;  3HHF A;  2RC7 A;  3S9N C;  3IOT A;  4K3F A;  1FQE A;  1MY1 A;  5L8D A;  2Q89 A;  3FVK A;  4QSC A;  1A99 A;  1QKA A;  2QJE A;  4KQP A;  4IO5 A;  4ZEC A;  4QF9 A;  2ANJ A;  2UVH A;  2OBG A;  3FXQ A;  1MY3 A;  4ESX A;  1DTZ A;  3U8Q A;  3KN7 A;  4XTC Q;  2O84 X;  5ISU A;  2OZZ A;  2F36 A;  4EF1 A;  4BLA A;  4OWD A;  3IL1 B;  1F9B A;  1SYH A;  3IJX B;  3G7W A;  2H98 A;  2X7Q A;  2R9J A;  5EHS A;  3PD9 A;  3SER A;  4OVJ A;  3TAJ A;  1B5I A;  3LBS A;  4OMB A;  4X1B A;  5I58 A;  1HSE A;  2Q2A A;  3LUY A;  1P1U A;  5CMM A;  2ZNS A;  1FQF A;  1B52 A;  4JWX A;  3FV1 A;  5CMK A;  2O68 A;  4O3A A;  4NF8 A;  4GXA A;  5I2N A;  3EPE A;  2F7C A;  2V3T A;  4GRK A;  1USY E;  3V83 A;  3RQT A;  3H4Z A;  5F7V A;  2I4B A;  1MQD A;  3ILU B;  3M3F A;  4YKJ A;  1QVS A;  4MLV A;  2RC9 A;  1DSN A;  1MPD A;  1OQG A;  1ATG A;  2PVU A;  4Q5T A;  3O6I A;  4PET A;  4Z7E A;  5LOM A;  3T66 A;  2Y7P A;  1PEB A;  1Y1M A;  4LZ8 A;  3C35 A;  1SI1 A;  1QKB A;  4LUB A;  1Q35 A;  3EF7 A;  4GQO A;  2P1S A;  2IEE A;  2DS9 A;  2F6P A;  5JEI A;  3CVG A;  3B6T A;  3K00 A;  4ZS9 A;  1AOV A;  1SQY A;  4H1X A;  3TTR A;  1TT1 A;  2ZYO A;  3T9U A;  1PC3 A;  1LAX A;  1B3E A;  2ABH A;  3SEU A;  3WAF A;  5KDT A;  3TOD A;  1MQH A;  3PD8 A;  4ELQ A;  5L9O A;  5I57 B;  2QL3 A;  1B46 A;  3PUY E;  2FNC A;  4LA9 A;  4RA1 A;  5L9M A;  2F34 A;  4N6P A;  3VVE A;  1SW5 A;  1I6A A;  3I3V A;  4MLQ A;  2H5Y A;  1B05 A;  3FVG A;  1XT8 A;  1Y3Q A;  4JSO A;  1MPC A;  3QYT A;  4GL8 A;  2F97 A;  5K2Y A;  3MP6 A;  1XHY A;  1JVY A;  2P2A A;  3OD7 A;  2R71 A;  2O51 A;  2VHA A;  4G8H A;  1SI0 A;  2B65 A;  4EQB A;  4N07 A;  4L17 A;  3FXU A;  1LBC A;  1Q1K A;  1GVC A;  1VSO A;  2QS3 A;  3TCF A;  4Q0C A;  3Q28 A;  1USY H;  2DWA A;  3KN3 A;  2V84 A;  1QJM A;  1M5F A;  4IO2 A;  4PFY A;  4R9G A;  3ZKK A;  2FA7 A;  4I8C A;  4DXC A;  2XD2 A;  4JDF A;  2W7Y A;  5CBS A;  3F11 A;  3IR1 A;  5CI5 A;  3TDJ A;  1IEJ A;  3VLV A;  4XKP A;  2RIN A;  3O66 A;  4H5F A;  3MW0 A;  4U2R A;  5EHM A;  1LB8 A;  3UP9 A;  1BTJ A;  3CRB A;  1UIV A;  4QHQ A;  3HST A;  5M2V A;  2A5T A;  3FZV A;  2ONK E;  1FTO A;  3W9W A;  3A3C A;  1P1N A;  3H6T A;  3L6H A;  2B3B A;  3QSL A;  3T22 A;  3O2A A;  4M1V A;  3TEP A;  3N6U A;  2V25 A;  5TPA A;  4F1U A;  1A55 A;  3KJT A;  1ZTY A;  3MVX A;  3IJO B;  1MH3 A;  2F35 A;  4FIM A;  2ZNU A;  4JXI A;  2REG A;  4EQ7 A;  1NMU A;  3OXN A;  2DE4 A;  3PUW E;  4F3B A;  5H8N B;  1XVX A;  4G4P A;  4F29 A;  3TTM A;  4RYA A;  4BDQ A;  5A5X B;  3KGC A;  3MC2 A;  4I1D A;  4IY5 A;  4N13 A;  1NFT A;  4I62 A;  4POX A;  2DVZ A;  2XX9 A;  1B9J A;  3K1N A;  5AA3 A;  1FQC A;  4ND9 A;  1URD A;  3CG3 A;  1B0L A;  3FV2 A;  4OTE A;  3MUQ A;  5H8Q B;  2HZK A;  1O7T A;  3FIR A;  3RT6 B;  2KLF A;  4IY6 A;  3VLU A;  4ONY A;  1FQB A;  2F8D A;  3OEL A;  1P1W A;  4JSD A;  4XKQ A;  5TP9 A;  1D9V A;  1XC1 A;  3S9E A;  1XS5 A;  4FEB A;  3H7M A;  4WKM A;  1FTM A;  4R73 A;  3H6V A;  5FHO A;  1QW0 A;  1WOD A;  3C34 A;  5H8S A;  4LAT A;  1H45 A;  2DYX A;  3C32 A;  4MFI A;  4G77 A;  2OWT A;  4ZE8 A;  4ZZE A;  1EU8 A;  1MQJ A;  5H8F B;  4HS7 A;  5DYH A;  4X9T A;  4NWD A;  1IXC A;  1AIV A;  3K01 A;  5CMC A;  5B70 A;  1RYO A;  3U72 A;  2HAV A;  4F1Y A;  4GL0 A;  4MH5 A;  1II5 A;  4EXL A;  1MDQ A;  4XXU A;  4KYD A;  2UYF A;  3DP4 A;  3TTL A;  1YCJ A;  5KCJ A;  3IK6 B;  4OZ9 A;  2O69 A;  3DM0 A;  5JTY B;  1B5H A;  2YPN A;  2XXY A;  3ODB A;  1ZLQ A;  1B3F A;  1MQI A;  1FQD A;  4OYV A;  3T9X B;  4KCD A;  3O29 A;  3JYR A;  4G68 C;  3CFZ A;  3BFT A;  4Q8R A;  2G93 A;  1MY0 A;  3N5L A;  1Z7N E;  3N94 A;  2I3W A;  1JEV A;  1NH7 A;  2I4C A;  3G3J A;  3TYH A;  3K6V A;  2VOZ A;  3IAZ A;  3QUJ A;  4XKR A;  1MY2 A;  3D4C A;  1B1X A;  1OLA A;  4U22 A;  1B3H A;  1JEU A;  4R9F A;  4RJZ A;  4NF5 A;  2ONS A;  2I3V A;  4JWY A;  3HHG A;  4ZEK A;  3MQ9 A;  1CE2 A;  2D3I A;  2RKM A;  4HW8 A;  4DDD A;  3IB2 A;  1P99 A;  1LAG E;  1HSJ A;  5IAI A;  3CI8 A;  1UTB B;  3PPR A;  1DMB A;  1N7W A;  3QK6 A;  1WDN A;  2G29 A;  2XXP A;  1KWH A;  4AB6 A;  4E0W A;  1AL3 A;  3UIF A;  1NH8 A;  2Y7R A;  4YB5 A;  2HZL A;  4ZE9 A;  1LFH A;  3B7D A;  4OEU A;  4NF6 A;  5J1D A;  1PBP A;  1R9Q A;  4DLD A;  5I84 A;  3C33 A;  3PMX A;  3PV0 E;  1QUJ A;  1PB8 A;  1MH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...