3KFMA

Crystal structure of the glua4 ligand-binding domain l651v mutant in complex with kainate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
257
Chain Sequence
TVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLAKQTEIAYGTVDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Glutamate receptor 4
publication title Enhanced efficacy without further cleft closure: reevaluating twist as a source of agonist efficacy in AMPA receptors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 80
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kfmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kfmA02
5I2NB 1SQYA 2QL3A 4X48A 3T9XB 4Q8RA 3MQ9A 4H8JA 3ZKKA 5F7VA 4LQ5A 2A5SA 2W7YA 3KN3A 3DELB 3H06B 4KQPA 2UVGA 3MVYA 1ZTYA 3ZSFA 1UQWA 2PYYA 4IY5A 2XXQA 2OJTA 3M3LA 2H98A 5H8HB 1QULA 5I59A 3V83A 3FZVA 3IOUA 1UIUA 2XXUA 4U1ZA 3SESA 1JW1A 1PBPA 4GD5A 2DXYA 4R75A 1EZ9A 3U93A 4EXKA 1OIBA 2B3FA 1GV8A 1L5TA 4H65A 3KJ7A 4OENA 5FHMA 4R6KA 3IORA 3JV9A 1LAFE 4HCYA 3K2DA 4TLMB 1P1QA 1OQHA 3LR1A 5H8NA 5JTYA 2ZYMA 2DXRA 4XTCQ 2Y84A 1BLFA 2XHDA 1B0HA 4YMAA 2R9JA 2NWJA 5EHMA 1RYXA 3C33A 3L6GA 1SW4A 1N76A 5FTHA 3MP1A 2O84X 4PP0A 4YKKA 1ZKBA 4G68C 5FHOA 4GWOA 3O28A 4XKRA 2X7QA 4EF2A 2UXAA 3B6WA 2F8DA 4KR5A 1ZJLA 4MLQA 2QMWA 2F6GA 3G3FA 1OMPA 3MVWA 5TPAA 3CVGA 3TPAA 3CR9A 4IB2A 2RC9A 1B1XA 2V3UA 3VFJA 2QSXA 3K6XA 2CZLA 1O63A 1SYIA 4H8IA 3H03A 1MY4A 4OWDA 2THIA 5ICTA 3KG2A 2ONKE 5CMMA 3PPNA 2O6AA 5CI5A 1GVCA 3PUZE 4NF6A 2Z8DA 1XC1A 1ZLQA 3OXNA 3FVOA 4OESA 2V84A 2FNCA 1UIVA 4ZEBA 3K6WA 2G29A 1B7UA 4QSDA 3Q27A 4OZ9A 4ZEDA 4LZ7A 3EQ1A 1N3XA 5H8SA 1I6QA 1IXGA 3HPIA 3T9VA 3KOSA 5AE4A 3S9MC 3PUVE 4X9TA 4LONB 2I6EA 4QRZA 2LAOA 4JBZA 4F3GA 4GOTA 1CE2A 4YMBA 1HSEA 1US4A 2WKYA 2Y7IA 4M4GA 3FGSA 2RC8A 1B3LA 5ITOA 4OFOA 2GHAA 5IKBA 5I2KA 4MLVA 4BDMA 4RPOA 2V3TA 3IB1A 1NH8A 5I57A 3TDJA 1USYH 5TU0A 3R26A 5CMCA 2F78A 5CM6A 1TXFA 4PFWA 5TP9A 1N0TA 2DS9A 4YB6A 3OEMA 5DVIA 3E4RA 4R9FA 4NTLA 3RGYA 1US5A 1IIWA 1PBQA 1MXXA 4JSOA 3MC2A 1MS7A 2DQVA 4AQ4A 1B7ZA 3RNNA 4R74A 1BKAA 4U4XA 1MXWA 1SW2A 4PFTA 2Z8EA 3U72A 1MY2A 2KLFA 2CMOA 4F19A 1MM7A 2Q2AA 2D5WA 4Z7EA 3S2VA 1TFDA 1B2HA 3TCGA 2QS2A 3I6VA 1FQBA 5DEXA 4F2QA 2E0SA 4OEUA 3ODBA 1A8FA 1MXVA 4ISUA 4EF1A 1JVXA 3CFLA 3B6TA 1YAEA 3O6GA 4G8NA 2PT2A 4EQ7A 3SDFA 2O69A 4R6YA 3H4ZA 1M5DA 4GXAA 1B4ZA 3M8UA 1LB8A 3OENA 3SEXA 3FUZA 5AA4A 3KFMA 1AL3A 4KFQA 4YZZA 3V5AA 3N5LA 2O68A 4WEPA 1MQHA 1RKMA 4BDOA 1AOVA 5KDTA 5BWJA 1LCFA 1GTKA 4R72A 3TTKA 3SEVA 1VFEA 3M3KA 2XX9A 4OYVA 1NNPA 1B32A 3IB2A 2BJJX 4DIGA 1Q1KA 2P0SA 3VVEA 2DE4A 4FJPA 3O2AA 4R2BA 5H8QB 4DCYA 4PETA 3KN8A 3CIJA 3BKIB 3PPPA 1Y3NA 3TYHA 4YKJA 2I4CA 5ITPA 1B3HA 2F5XA 3C36A 1POTA 3W9VA 4P0IA 1DTGA 1SBPA 3O66A 4NF4A 5HPQA 5IAIA 1LAGE 3VLWA 5I59B 4R9GA 4H0WA 4LA9A 1FTOA 4JWYA 3K6VA 3GBBA 1XOCA 4BDRA 3RPWA 3ZKLA 4F29A 4EDPA 1FCKA 4NMYA 1A40A 3M3FA 4ELRA 3C35A 1MXYA 2XXVA 2HEUA 2YPNA 3OEKA 2NOOA 1B58A 4R2FA 1EZPA 1SI1A 4UA8A 1DTZA 3EHTA 4QFLA 5DYHA 4IGTA 3UK4A 1VR5A 5H8NB 4RYAA 5JTYB 1Y4TA 2F34A 2ESNA 2ZYOA 4GL0A 1QVSA 2ZMBA 2ONSA 2DE3A 3A09A 1B5HA 4EUOA 4ZE8A 3GLBA 2XXIA 2F6PA 5ICQA 2RC7A 3HCQA 1JEVA 3QXMA 1QKBA 1P1WA 4U23A 3FV1A 2R6GE 1FTKA 3VVDA 4LZ8A 4Q30B 1DMBA 4KYDA 4NWDA 5L8DA 1JVYA 4X1DA 2D21A 3O6IA 1M5BA 1QW0A 3KOTA 1WODA 3I5OA 3H3GA 1MY3A 5TPAB 3MPKA 5I58A 3FVGA 2IA4A 4OVJA 1Y3QA 3FJGA 1NFTA 3IR1A 4FEBA 3H6VA 1LBBA 2O51A 4X1BA 1NNFA 5DVJA 4RXLA 2PX1A 2QS4A 1B46A 2XXXA 1OVTA 4G68A 1A7LA 4ECFA 4GXSB 1JW4A 1IXCA 2F7AA 1EZOA 3H6WA 1SI0A 3TEPA 1ZBMA 4IO3A 3USDA 3MZ9A 3QUFA 4YKIA 2G93A 3PD9A 1ZIUA 3SEUA 4P11A 3TKDA 2HZLA 1B7HA 4N13A 1LCTA 3T93B 5AA3A 5A5XB 3R7XA 1B6HA 1TT1A 2V25A 2O1MA 4ZEFA 1B5IA 4H5GA 2P2AA 2XX7A 3CRBA 3IAZA 3G7WA 1B4HA 1HSLA 1WVJA 3PUYE 2I48A 4L17A 3MZBA 4XKPA 3U92A 3UA8A 1URSA 1OQGA 3FVKA 1SD3A 2XD2A 4KI0E 4RA1A 4ZZEA 2Q8JA 1QUKA 2ANJA 2OCUA 5AA1A 1UTBB 2XXHA 1BIYA 3SEYA 5B7DA 5I56B 2RCAA 1ANFA 3C31A 1NNKA 2I4BA 5I57B 1URDA 3O9PA 3FVNA 4G2ZA 1LBCA 1MY1A 2DVZA 5DTBA 2DWAA 3PUXE 2YJPA 2HCAA 1FTMA 3ILUB 3FD3A 4ZS9A 5CBSA 5M2VA 3RQTA 5KCJB 4ESWA 4F1UA 4P0GA 1DPPA 4DXBA 5LOMA 3T9UA 4OETA 3B7DA 3BFTA 4E0XA 1B0LA 3T9HB 3MW0A 1R1NA 3U1OA 1AMFA 1MQJA 3QYTA 3MVXA 3LBSA 1PEBA 1SW1A 3HHGA 2NVUB 3D4CA 3MZ1A 3A3UA 4K3FA 1SW5A 1F9BA 3HO7A 2Y7KA 1MH4A 2UVIA 2DWJA 2XXWA 3S4UA 3IOTA 4U1OA 2OK2A 1H76A 2I0BA 3TTLA 4RPNA 3TODA 5ELVA 4JXIA 4NF8B 1LAHE 2OBGA 1XT8A 3TMGA 1ZMGA 4QFOA 4I8CA 5CMKA 3ILTB 4OHNA 4NF5B 3TAJA 4N6PA 4G4PA 3UGWA 2DWHA 3C4MA 1A8EA 3PD8A 1XHYA 4XIGQ 4ELQA 3VE1B 3O97A 5F1QA 3PPRA 1H43A 4ONYA 4OMBA 4FORA 2RINA 1B3GA 4JWXA 2AL4A 3TCFA 1B1HA 3TZAA 2Y7PA 4I9DA 3G3HA 4KCDA 3EHUA 1IEJA 2A5TB 1MQDA 4GRKA 3LUYA 2Q2CA 2RKMA 3DP8A 1H3DA 1M5CA 4G77A 4IY6A 4ZE9A 3FASA 3OMBA 4IO6A 2D3IA 2HQ0A 2Z8FA 1OVBA 5AA2B 4WXJA 4KHZE 2VHAA 4O3BA 4G8MA 4ZZAA 3F11A 2O1LA 4YU0A 3IO6A 1H45A 4ZDMA 4JWOA 2DWIA 1PB7A 2ZNTA 4GL8A 2O7UA 5L9OA 3N6UA 1TFAA 2GFEA 3K1PA 1DOTA 1P1NA 4XKNA 2DSFA 4F1VA 2HFBA 3EPEA 4U4SA 4H6DA 1A99A 4PFYA 2Y7WA 4N07A 4FEDA 1N84A 3QSLA 4ND9A 4XKQA 3QAXA 2QPQA 1KWHA 3MBPA 4F3PA 5BUUA 1MQIA 4PQJA 3LSXA 1BP5A 2FYIA 3IJXB 3VLUA 3K1MA 1OLCA 2I58A 1D9YA 1SVXB 3K0VA 2X7PA 1MY0A 1B40A 4H1XA 3E9XA 1Q35A 3K02A 2H9BA 3BFUA 4HS7A 4MH5A 3QK6A 4KCCA 4GVOA 3G3GA 1LAXA 2HZKA 5J1DA 5I58B 3TTNA 4TLLB 3LC8A 3E13X 4FECA 3TTMA 2XXPA 3OO8A 2UVJA 1FQEA 4F3SA 1IQ7A 3WAFA 3MAMA 1B52A 3T96B 4G68B 2O7IA 4U2RA 3CFXA 1IZ1A 4RK9A 1R9QA 3IOWA 3FXQA 4EQ9A 2DP8A 3DP6A 1QKAA 1MXZA 1Z7NE 2DE2A 1D3KA 5L9SA 4GFRA 1FQFA 4IO4A 3ONMA 4F31B 5JK4A 2DVCA 2UYFA 4DCXA 1VFDA 1B3FA 2GHBA 4ESXA 2H25A 3PPOA 1JNFA 1Y20A 3KZGA 1P1OA 3VV5A 2Q88A 2H5YA 3S9NC 3HV1A 2DYXA 3UP9A 3IK6B 2Q9TA 4BLAA 1QJMA 3L6HA 2OWTA 3RTFB 1JETA 4DLDA 2H99A 2V3QA 3CSBA 1PC3A 4KYSA 1S7YA 2Z23A 3PPQA 5ISUA 2XXYA 2OLBA 4MF3A 4ZECA 2QS3A 1PB9A 1NKXA 3OOAA 4JB7A 3OELA 4JDFA 3BBRA 4PFUA 2ALUA 1JQFA 3K00A 3PGFA 4LATA 1B51A 1MRPA 5H8FA 4Q0CA 4QSEA 1MQGA 1Y4CA 4R6HA 3LSFB 2VOZA 3K1NA 3AXFA 2Z22A 1ATGA 3LSLA 3P7IA 4RK2A 4TOZA 4KD5A 1I6AA 3CSGA 1UTHA 4R73A 4RNSA 2PBWA 4BDLA 1R9LA 1S50A 4M1VA 1LFHA 2ZYNA 2PMSA 1NMUA 1MDP1 2I3WA 3O6HA 4ZEKA 1N7WA 3RN8A 3T22A 5H8QA 1GGGA 4U21A 3O29A 4TQUQ 4IO5A 4RJZA 2HAUA 3KGCA 3TCHA 4NF6B 2RF1A 1MG1A 3E3KA 4YB7A 1POY1 1R6ZA 4ZEIA 3EF7A 1MXUA 1YTVA 2V93A 4O3AA 1VSOA 1D9VA 3GBAA 4F18A 3SKPA 3GZGA 4IGRA 1EH3A 4C0RA 4DDDA 1MPDA 5B70A 2VD2A 3V8XB 3KSXA 1B05A 3FATA 2R71A 2RCBA 2AYSA 4NE4A 3VXCA 3N26A 3OO6A 3KJTA 4LUBA 4C1UA 4ELOA 5AA2D 1Y3PA 2PVUA 3U94A 2OWSA 3IX1A 1Y1MA 3VLVA 5I2KB 3THIA 3K01A 3LSWA 1SYHA 3RUMA 3DM0A 1Y9UA 2XXTA 2H4IA 4Z0IA 1URGA 1IXIA 1M5FA 4DZ1A 5L9MA 1RYOA 3KSJA 3MWBA 3DP4A 5TP9B 1WDNA 4FATA 2YLNA 1P99A 3MP8A 1D4NA 4WEDA 4LVQA 3G3JA 2VGQA 3PMVA 1QUJA 1J1NA 4OEVA 5EYFA 3CI8A 4RY1A 4EQBA 4GQOA 4OERA 5I2NA 2I0CA 3K6UA 3C34A 3QIMA 4IO7A 2QRYA 1ZU0A 1H44A 4WKMA 2F97A 1TWYA 1II5A 1PB8A 5FHNA 1HSJA 1LB9A 1AH5A 2VD3A 3K4UA 2ABHA 4F22A 5K2YA 4DE8A 3MP6A 5DEXB 1ELJA 1FQAA 1Z7ME 1AIVA 5H8HA 4HCWA 2QS1A 1FTJA 1M5EA 3JYRA 3S9EA 3U8QA 1S9TA 4POXA 4UACA 3IJOB 4F39A 3KN7A 3FXRA 4GLIA 3Q29A 5DT6A 1FQCA 2E1SA 4OTEA 2ZNUA 3MUQA 5A5XA 3KBRA 5HBCA 2X26A 5AA4B 2F35A 3B6QA 4H67A 5K2XA 3FJ7A 2UYEA 2QMXA 3UN6A 3EHSA 3Q26A 3TQWA 4HW8A 3JZJA 4MFIA 1IUDA 5KDTB 1I69A 1A55A 3UIFA 3SEWA 4C1TA 3GXAA 1GR2A 1UTBA 1LSTA 1N7XA 1NH7A 4DXCA 5DVFA 3PMXA 5I56A 3Q28A 4BDQA 3I3VA 3VVFA 4KYEA 4QFPA 3HHFA 3KEIA 3TFLA 4YB5A 3ECRA 2F36A 4PE5B 3FIRA 3CG3A 1MDQA 2AIXA 3CG1A 1XVXA 4POWA 5HM4B 4IO2A 3W15C 4KPTA 4NF4B 1N04A 1JW5A 3WAEA 1B5JA 4F3BA 3OSRA 2ONRA 5CMBA 2OZZA 4YAHX 5KCJA 3T66A 2GH9A 5EHSA 1YPNA 1P1UA 2F7CA 4QFKA 2F7BA 3H6TA 4F1YA 2M8CA 1PDAA 4MBPA 5I84A 1LFIA 3V89B 4LP2B 3A3CA 3IOVA 3FXUA 3TTRA 4LZ5A 3FJMA 4OXVA 1XS5A 2HAVA 1LGBC 4ELPA 1YCJA 3PU5A 1DPEA 4FE8A 3N94A 1B9JA 2NUVA 2I49A 2XD3A 3OO9A 4OQOA 3MVZA 1IITA 3FV2A 3R6UA 3RY3A 4AB6A 1CB6A 1B3EA 5KZTA 1O7TA 2ZXTA 4FAJA 3PUWE 3S9LC 2ZYKA 1JEUA 4NF8A 4OFJA 5FTIA 3VDFA 1O64A 4JSDA 3IO4A 4NWCA 5H8FB 3C9HA 4NF5A 4F2OA 2FA7A 1Y1ZA 1SDXA 3SETA 3TUSA 4I1DA 4U22A 5CRYA 2XX8A 2P1SA 1UTHB 3SERA 3OD7A 3HN0A 2Q89A 3G3IA 2REJA 5CBRA 4QHQA 3OO7A 3H7MA 3PMWA 2Y7RA 2HXWA 4O3CA 1I6BA 4BDNA 4LQ2A 1NNTA 4G8HA 4QFNA 1FQDA 1IXHA 2A5TA 3OSQA 4GIZA 1QUIA 4E0WA 2PT1A 2DOJA 2I3VA 1USYE 1MM6A 3CFZA 2XXRA 2REGA 4QSCA 5AA2A 4AB5A 3G3KA 4OFLA 2NXOA 3ZS6A 3RLFE 4EXLA 1FW0A 3IB0A 2IEEA 4HTGA 3H6UA 1DSNA 3QUJA 4THIA 3TELA 3D4GA 3RT8A 3RT6B 3Q25A 3EN3A 2B3BA 1LFGA 1T0KA 4H5FA 1N3WA 1XVYA 3IL1B 4NEDA 4GF8A 4FIMA 4XXUA 1VE4A 1NL5A 1A54A 5CC2A 2ZNSA 3VXBA 5JEIA 2GRVA 3PV0E 3W9WA 1EU8A 1LLSA 3MJNA 4QF9A 3HSTA 1FTLA 3MPLA 3N6TA 3RTWB 3TQLA 4DXUA 4YICA 3C32A 4YKPA 3UORA 1OLAA 1MPBA 1BTJA 2B65A 2VP1A 4I62A 4Q5TA 2QJEA 1MPCA 2UVHA 3DLNA 1MH3A 2AL5A
chains in the Genus database with same CATH superfamily
5I2NB 1SQYA 3SZPA 2QL3A 2V4CA 1FPKA 2P3NA 4X48A 3T9XB 4Q8RA 5EYHA 3MQ9A 4H8JA 3ZKKA 5F7VA 4LQ5A 2A5SA 1IMEA 2W7YA 3KN3A 3DELB 3H06B 4KQPA 2UVGA 3MVYA 5IZ3B 3BIGA 3A29A 1FBDA 1ZTYA 5ET8A 4OA4A 3ZSFA 1UQWA 2PYYA 3LV0A 1NV6A 4IY5A 2XXQA 2OJTA 3M3LA 2H98A 5H8HB 1QULA 5I59A 3V83A 4PBQA 3FZVA 3IOUA 1UIUA 2XXUA 4U1ZA 1D9QA 3SESA 1JW1A 1PBPA 4GD5A 2DXYA 4R75A 5EQ7A 1EZ9A 3U93A 4EXKA 1OIBA 2B3FA 1GV8A 1FPJA 1L5TA 4H65A 3KJ7A 2HXRA 4OENA 5FHMA 4R6KA 2QVVA 3IORA 3JV9A 1LAFE 4HCYA 3K2DA 4TLMB 1P1QA 1OQHA 3LR1A 5H8NA 5JTYA 2ZYMA 2DXRA 5F24A 2WBBA 4XTCQ 2Y84A 1BLFA 2XHDA 1B0HA 4YMAA 2R9JA 2NWJA 5EHMA 1RYXA 3C33A 3L6GA 1SW4A 1N76A 5FTHA 3MP1A 5EQ8A 2O84X 4PP0A 4YKKA 1ZKBA 4G68C 5FHOA 4GWOA 5LTCA 3O28A 4XKRA 2X7QA 2XXKA 4EF2A 2UXAA 3B6WA 2F8DA 4KR5A 1ZJLA 1AWBA 4MLQA 2QMWA 2F6GA 4PFIA 3G3FA 1OMPA 3MVWA 5TPAA 3CVGA 3TPAA 3CR9A 4IB2A 2RC9A 1B1XA 2V3UA 2CZKA 1IMFA 3VFJA 2WEFA 1FSAA 2QSXA 3K6XA 1LBXA 2CZLA 1O63A 1SYIA 4H8IA 3H03A 1MY4A 4OWDA 2THIA 4PC9A 5ICTA 3KG2A 2ONKE 2CEXA 5CMMA 3PPNA 2O6AA 5CI5A 1GVCA 1FBHA 3PUZE 4NF6A 2Z8DA 1XC1A 1ZLQA 3OXNA 1NV4A 3FVOA 4OESA 2V84A 2FNCA 3CHGA 1UIVA 3EKIA 4ZEBA 3K6WA 4DI4B 2G29A 1B7UA 1YZ0A 4QSDA 3Q27A 4OZ9A 3NOHA 1FPDA 4ZEDA 4LZ7A 2XWIA 3EQ1A 1N3XA 5H8SA 1I6QA 1Q9DA 1IXGA 3HPIA 3T9VA 3KOSA 5AE4A 3S9MC 3PUVE 4X9TA 4LONB 2I6EA 4QRZA 2LAOA 4JBZA 1RDZA 4F3GA 4PGNA 4GOTA 1CE2A 4YMBA 1HSEA 1US4A 2WKYA 2Y7IA 4M4GA 3FGSA 2RC8A 1B3LA 5ITOA 4OFOA 2GHAA 5IKBA 5I2KA 4MLVA 4BDMA 4RPOA 2V3TA 2F3DA 3IB1A 4MX6A 1NH8A 2Q74A 5I57A 3TDJA 1USYH 5I3SA 4XEQA 5TU0A 1LBWA 2CZIA 3R26A 5CMCA 2F78A 5CM6A 1TXFA 4PFWA 5TP9A 1N0TA 2DS9A 4PE3A 4YB6A 3OEMA 5DVIA 3E4RA 2CZHA 1IMDA 4R9FA 4NTLA 3RGYA 1DCUA 1US5A 1IIWA 4OVQA 1PBQA 1MXXA 4JSOA 1FPLA 3MC2A 4HE2A 1MS7A 2DQVA 1NUZA 4NG7A 4AQ4A 1B7ZA 1NUXA 3RNNA 4R74A 4OVSA 1BKAA 4U4XA 1MXWA 1SW2A 4PFTA 2Z8EA 3U72A 1MY2A 2KLFA 2CMOA 4FBPA 4F19A 1FTAA 1MM7A 2Q2AA 2PFZA 2D5WA 4Z7EA 4N8YA 3S2VA 1TFDA 1B2HA 3TCGA 2QS2A 2VPNA 3I6VA 1FQBA 4X04A 5DEXA 4F2QA 2E0SA 4OEUA 3ODBA 1A8FA 1MXVA 1K9ZA 5ET6A 4ISUA 4EF1A 4P9KA 1JVXA 3CFLA 3B6TA 2DDKA 1YAEA 3O6GA 4G8NA 2PT2A 4O7MA 4EQ7A 3SDFA 2O69A 4R6YA 3H4ZA 1M5DA 4GXAA 1B4ZA 3M8UA 4MIJA 1LB8A 3OENA 3SEXA 3FUZA 5AA4A 4JVDA 3KFMA 1AL3A 4KFQA 4PDDA 4YZZA 3BIHA 3ROJA 3V5AA 3N5LA 3KC1A 2O68A 4WEPA 1MQHA 1RKMA 4BDOA 1AOVA 5KDTA 5BWJA 1NI9A 1LCFA 1GTKA 2KR0A 4R72A 3TTKA 3SEVA 1VFEA 1FBCA 3M3KA 2XX9A 4OYVA 1NNPA 1FBGA 1B32A 3IB2A 4MJOA 2BJJX 4DIGA 1Q1KA 2P0SA 3VVEA 2DE4A 4FJPA 2VT5A 1LBVA 3O2AA 4I3EA 4R2BA 5H8QB 4DCYA 3QMFA 4PETA 3KN8A 3CIJA 3RPLB 3BKIB 4O94A 3PPPA 1Y3NA 3TYHA 4YKJA 1NV2A 1LEVA 2I4CA 5ITPA 1B3HA 2F5XA 2BJIA 4N91A 1XI6A 1POTA 3C36A 3W9VA 4P0IA 1DTGA 1SBPA 3O66A 4NF4A 5HPQA 5IAIA 1LAGE 3VLWA 5I59B 4R9GA 4H0WA 4LA9A 2FVZA 1FTOA 4JWYA 3K6VA 4N4UA 3GBBA 1XOCA 4BDRA 3RPWA 3ZKLA 4F29A 4EDPA 1FCKA 4NMYA 1A40A 4X8RA 4N15A 1FJ6A 5EQAA 3M3FA 4ELRA 1BK4A 3C35A 1MXYA 2XXVA 2HEUA 2YPNA 3OEKA 2NOOA 1IMCA 1B58A 4R2FA 1EZPA 1SI1A 4UA8A 1DTZA 3EHTA 5ET5A 4QFLA 4NAPA 5DYHA 4IGTA 3UK4A 1VR5A 5H8NB 4RYAA 5JTYB 1Y4TA 4O7IA 2F34A 2ESNA 4GWWA 2ZYOA 4GL0A 4NHBA 1QVSA 2ZMBA 2ONSA 2DE3A 2QVRA 3A09A 1B5HA 1EYJA 4EUOA 4ZE8A 3GLBA 2XXIA 5IM2A 2F6PA 5ICQA 2ZZVA 2RC7A 5EQ9A 2ZZWA 3HCQA 4GWSA 1JEVA 3QXMA 1QKBA 1P1WA 4U23A 3FV1A 2R6GE 1FTKA 4PFRA 3VVDA 4LZ8A 4Q30B 1DMBA 4KYDA 4NWDA 5L8DA 1JVYA 4X1DA 2D21A 3O6IA 1M5BA 1QW0A 3KOTA 1WODA 5EYGA 3I5OA 3H3GA 1MY3A 5TPAB 3MPKA 5I58A 3FVGA 4NQ8A 2IA4A 4OVJA 1Y3QA 3FJGA 1NFTA 3IR1A 4FEBA 3H6VA 1LBBA 2O51A 1FPFA 4X1BA 1NNFA 5DVJA 2HPGA 4RXLA 2PX1A 2QS4A 1B46A 2XXXA 1CNQA 1OVTA 4G68A 4PDHA 1A7LA 4ECFA 5FBPA 4GXSB 1JW4A 1IXCA 3U65A 2F7AA 1EZOA 3H6WA 1SI0A 3TEPA 1ZBMA 2WYKA 4PF6A 4IO3A 3USDA 3MZ9A 1FPGA 3QUFA 4YKIA 2G93A 3PD9A 1ZIUA 3SEUA 4P11A 4P56A 3TKDA 2HZLA 1B7HA 4N13A 1LCTA 3T93B 5AA3A 5A5XB 3R7XA 1B6HA 1LBZA 1TT1A 2V25A 2O1MA 4ZEFA 4HXVA 1B5IA 4H5GA 2P2AA 2XX7A 3CRBA 3IAZA 3G7WA 1B4HA 1HSLA 1WVJA 3PUYE 2I48A 4I3YA 2XWVA 4HE0A 4L17A 3MZBA 4XKPA 3U92A 3UA8A 1URSA 1OQGA 3FVKA 2KQZA 1SD3A 1KA0A 1FBFA 2XD2A 4KI0E 4RA1A 4ZZEA 2Q8JA 2GQ1A 1QUKA 2ANJA 4N17A 2OCUA 5AA1A 1UTBB 2XXHA 1BIYA 3SEYA 5LDZA 5B7DA 5I56B 2R8TA 2RCAA 3RYDA 1ANFA 3C31A 3B50A 3FXBA 1NNKA 2I4BA 5I57B 1URDA 3O9PA 4N8GA 3FVNA 4G2ZA 1LBCA 1MY1A 2DVZA 5DTBA 2DWAA 3PUXE 2YJPA 2HCAA 1FTMA 3ILUB 4I40A 3FD3A 4P3LA 4ZS9A 5CBSA 5M2VA 3FBPA 3RQTA 5KCJB 1NV0A 2WX9A 4ESWA 5ESYA 4F1UA 4N6KA 4P0GA 1DPPA 4PCDA 2XA5A 4DI3D 4DXBA 5LOMA 3T9UA 4OETA 3B7DA 3BFTA 4E0XA 1B0LA 3T9HB 3MW0A 1R1NA 3U1OA 1AMFA 4QBAA 5IZ3A 1MQJA 3QYTA 3MVXA 3LBSA 1PEBA 1SW1A 1KZ8A 3HHGA 2NVUB 3D4CA 3MZ1A 3A3UA 4K3FA 1SW5A 1F9BA 3HO7A 2Y7KA 1MH4A 2UVIA 2DWJA 2XXWA 3S4UA 3IOTA 4U1OA 2OK2A 1H76A 2I0BA 3TTLA 4RPNA 4O8MA 3TODA 5ELVA 4JXIA 4NF8B 4H46A 1LAHE 2OBGA 1XT8A 3IFCA 1ZMGA 3TMGA 4QFOA 2VPOA 4I8CA 5CMKA 3ILTB 4OHNA 4NF5B 3TAJA 2F3BA 4N6PA 4G4PA 3UGWA 5DW8A 2DWHA 1FPBA 3C4MA 4NGUA 1A8EA 3PD8A 1XHYA 4XIGQ 4AS5A 4ELQA 3VE1B 2MKZA 2Y5LA 3O97A 5F1QA 1RDYA 3PPRA 1H43A 4NF0A 4P1EA 4MAGA 4ONYA 4OMBA 4FORA 1DK4A 2RINA 1B3GA 3HFUA 4JWXA 2AL4A 3TCFA 1B1HA 4P1LA 3TZAA 2Y7PA 4I9DA 3G3HA 4KCDA 4G61A 3EHUA 1IEJA 1NV1A 2A5TB 1MQDA 4GRKA 4GWUA 3LUYA 2Q2CA 2RKMA 3MSTA 3DP8A 1H3DA 1FPEA 1M5CA 4G77A 4IY6A 4ZE9A 3FASA 3OMBA 2XWKA 4IO6A 2D3IA 3T1BA 2HQ0A 2Z8FA 1OVBA 5AA2B 4WXJA 4KHZE 2VHAA 2WBDA 4O3BA 4G8MA 4ZZAA 4N6DA 3F11A 2O1LA 4YU0A 4XFEA 3IO6A 4OANA 1H45A 4ZDMA 4PAFA 4JWOA 2DWIA 1PB7A 2ZNTA 2XWOA 4GL8A 2O7UA 5L9OA 3N6UA 1TFAA 2GFEA 3K1PA 1DOTA 1P1NA 4XKNA 2DSFA 4F1VA 2HFBA 3EPEA 4U4SA 4GX6A 4H6DA 1A99A 4HE1A 4PFYA 2Y7WA 4JVCA 4N07A 4FEDA 1N84A 3QSLA 3KBZA 4ND9A 4XKQA 4PBHA 3QAXA 2QPQA 1KWHA 3MBPA 4F3PA 5BUUA 4IR8A 1MQIA 4PQJA 3LSXA 1BP5A 2FYIA 3IJXB 3VLUA 3K1MA 1OLCA 2I58A 1D9YA 1SVXB 3K0VA 2X7PA 1MY0A 1B40A 5ET7A 4H1XA 3E9XA 1Q35A 3K02A 4OVRA 2H9BA 3BFUA 4HS7A 4MH5A 3QK6A 1YXIA 4KCCA 4GVOA 4OVTA 2QFLA 3G3GA 1LAXA 2HZKA 1NV7A 5J1DA 5I58B 3TTNA 4TLLB 3LC8A 3E13X 4FECA 3TTMA 2XXPA 3OO8A 2UVJA 1FQEA 4F3SA 1IQ7A 3WAFA 3MAMA 1B52A 3T96B 4G68B 2O7IA 4U2RA 3CFXA 1IZ1A 4RK9A 1R9QA 1INPA 3IOWA 5I5PA 3FXQA 4EQ9A 1LBYA 2DP8A 3DP6A 1QKAA 1MXZA 1Z7NE 2DE2A 1D3KA 5L9SA 4GFRA 1FQFA 4IO4A 3ONMA 4F31B 5JK4A 2DVCA 2UYFA 4DCXA 1VFDA 1B3FA 3KC0A 2GHBA 4ESXA 2H25A 3PPOA 1JNFA 1Y20A 4PAIA 3KZGA 1P1OA 3VV5A 2Q88A 4GWYA 2H5YA 4GX4A 3S9NC 3HV1A 2DYXA 3UP9A 3IK6B 2Q9TA 4BLAA 1QJMA 3L6HA 2OWTA 3RTFB 1JETA 4DLDA 2H99A 2V3QA 3CSBA 1PC3A 4KYSA 4P47A 1S7YA 2Z23A 3PPQA 5ISUA 2XXYA 2OLBA 4MF3A 4ZECA 2QS3A 1IMBA 1PB9A 1NKXA 3OOAA 4JB7A 3OELA 4JDFA 5IZ1A 3BBRA 3GYYA 4PFUA 2ALUA 1JQFA 3K00A 1NV5A 1VDWA 3PGFA 4LATA 1B51A 1MRPA 5H8FA 4Q0CA 4QSEA 1MQGA 1Y4CA 4R6HA 3LSFB 2VOZA 3K1NA 3AXFA 2Z22A 1ATGA 3LSLA 3P7IA 4RK2A 4OVPA 4TOZA 1G0IA 4KD5A 1I6AA 4GBVA 3CSGA 1UTHA 4R73A 4RNSA 2PBWA 4BDLA 1R9LA 2JJKA 1S50A 4M1VA 2ZZXA 1LFHA 2ZYNA 2PMSA 1NMUA 1MDP1 2I3WA 3O6HA 4ZEKA 4QXDA 1N7WA 3RN8A 3T22A 5H8QA 1GGGA 4U21A 5IGAA 3O29A 4TQUQ 4IO5A 4RJZA 3RPLA 2HAUA 3KGCA 3TCHA 4NF6B 2RF1A 1EYIA 1MG1A 3E3KA 2Y5KA 4YB7A 1POY1 2OWZA 1R6ZA 4ZEIA 1SPIA 3EF7A 1MXUA 1YTVA 2V93A 2FIXA 4O3AA 1VSOA 1D9VA 4MHFA 3GBAA 4F18A 3SKPA 3GZGA 3ISPA 4IGRA 1EH3A 4C0RA 4DDDA 1MPDA 5B70A 2VD2A 3V8XB 3KSXA 1K9YA 1B05A 3FATA 4XF5A 2R71A 2RCBA 2AYSA 4NE4A 3VXCA 3N26A 3OO6A 3KJTA 4LUBA 4C1UA 4MNCA 4ELOA 5AA2D 1Y3PA 2PVUA 3U94A 2OWSA 3IX1A 1Y1MA 3VLVA 5I2KB 3THIA 4MEVA 3K01A 3LSWA 1SYHA 4PTKA 2Q8MA 3RUMA 3DM0A 1Y9UA 2XXTA 2H4IA 4Z0IA 1URGA 1IXIA 1M5FA 3PTYA 2B4LA 4DZ1A 5L9MA 1FJ9A 4P8BA 1RYOA 3KSJA 3MWBA 3DP4A 5TP9B 4N81A 1WDNA 4FATA 1FPIA 2B4MA 2YLNA 1P99A 3MP8A 3B8BA 3MYUA 1D4NA 4WEDA 4LVQA 3G3JA 2VGQA 3PMVA 1QUJA 1J1NA 4OEVA 5EYFA 3CI8A 4RY1A 4EQBA 4GQOA 4OERA 5I2NA 2I0CA 3T0JA 3K6UA 3C34A 3QIMA 4IO7A 2QRYA 1ZU0A 1H44A 4WKMA 2F97A 1TWYA 1II5A 1PB8A 5FHNA 1HSJA 4UABA 1LB9A 1AH5A 2VD3A 3K4UA 2ABHA 4F22A 5K2YA 4DE8A 3MP6A 4GX3A 5DEXB 1ELJA 1G0HA 1FQAA 1Z7ME 5A5LA 5I7IA 4NN3A 1AIVA 5H8HA 4HCWA 2QS1A 1FTJA 1M5EA 3E79A 3JYRA 4PF8A 3S9EA 3U8QA 1S9TA 4POXA 4UACA 3IJOB 4F39A 3KN7A 5IZZA 3FXRA 4GLIA 3Q29A 5DT6A 1FQCA 2E1SA 4OTEA 2ZNUA 3MUQA 5A5XA 3KBRA 5HBCA 2X26A 5AA4B 2F35A 3B6QA 4H67A 5K2XA 3FJ7A 4PAKA 2UYEA 2QMXA 3UN6A 3EHSA 3Q26A 3TQWA 4HW8A 3JZJA 4MFIA 1IUDA 5KDTB 1I69A 1A55A 1DBZA 1EYKA 3UIFA 3SEWA 4C1TA 3GXAA 1GR2A 1UTBA 2PCRA 1LSTA 1N7XA 1NH7A 4DXCA 5DVFA 3PMXA 5I56A 3Q28A 4BDQA 3I3VA 3VVFA 4KYEA 4QFPA 3HHFA 3KEIA 3TFLA 4YB5A 3ECRA 2F36A 5J16A 4PE5B 3FIRA 4AS4A 3CG3A 1MDQA 2AIXA 3CG1A 1XVXA 4POWA 1FBPA 5HM4B 2QVUA 4IO2A 3W15C 4KPTA 4NF4B 1N04A 1JW5A 3WAEA 1B5JA 4F3BA 3OSRA 4GWXA 2ONRA 4LN5A 5CMBA 2OZZA 4YAHX 5KCJA 3T66A 2GH9A 5EHSA 1YPNA 1P1UA 2F7CA 4QFKA 2F7BA 3H6TA 4F1YA 2M8CA 1PDAA 4MBPA 5I84A 1LFIA 3V89B 4LP2B 3A3CA 3IOVA 3D1RA 3FXUA 3TTRA 4LZ5A 3FJMA 4OXVA 1XS5A 2HAVA 1LGBC 4ELPA 1FBEA 1YCJA 3PU5A 4JVIA 1DPEA 1RDXA 1YYZA 4FE8A 3N94A 1B9JA 2NUVA 2I49A 2PFYA 2XD3A 2FIEA 3OO9A 1NV3A 4OQOA 3MVZA 1IITA 3FV2A 3R6UA 3RY3A 4AB6A 1CB6A 1B3EA 4PGPA 5KZTA 1O7TA 2ZXTA 4FAJA 3PUWE 3S9LC 2ZYKA 1JEUA 4NF8A 4OFJA 5FTIA 3VDFA 1O64A 4JSDA 3IO4A 4NWCA 5H8FB 3C9HA 2FBPA 4NF5A 4F2OA 2FA7A 1Y1ZA 2P3VA 1SDXA 4NX1A 3SETA 3TUSA 1FRPA 1QGXA 4I1DA 4U22A 5T3JA 5CRYA 2XX8A 2P1SA 1UTHB 3SERA 3OD7A 3HN0A 2Q89A 3G3IA 2REJA 5CBRA 4QHQA 1NUWA 3OO7A 3H7MA 4MMPA 3PMWA 2Y7RA 2HXWA 4O3CA 1I6BA 4BDNA 4LQ2A 1NNTA 2OX3A 4G8HA 4QFNA 1FQDA 1IXHA 2A5TA 3OSQA 4GIZA 1QUIA 4E0WA 2PT1A 2DOJA 1JP4A 2I3VA 1USYE 1MM6A 3CFZA 3LUZA 2XXRA 2REGA 4GWZA 4QSCA 5AA2A 4AB5A 2FHYA 3G3KA 4MNIA 4MNPA 4OFLA 2NXOA 3ZS6A 3RLFE 4EXLA 3IB0A 1FW0A 2IEEA 4HTGA 3H6UA 1DSNA 3QUJA 4THIA 3TELA 1IMAA 3D4GA 4KXPA 3RT8A 3RT6B 3Q25A 3EN3A 1NUYA 2B3BA 1LFGA 1T0KA 4H5FA 1N3WA 1XVYA 3IL1B 4NEDA 4GF8A 1KA1A 4FIMA 4XXUA 2HHMA 4H45A 1VE4A 1NL5A 1A54A 4PFBA 5CC2A 2ZNSA 3VXBA 5JEIA 2GRVA 2WYPA 3PV0E 3E78A 3W9WA 1EU8A 1LLSA 3MJNA 4QF9A 3HSTA 1FTLA 3MPLA 3N6TA 3IFAA 3RTWB 3TQLA 2L5VA 4GBWA 4DXUA 4YICA 2CEYA 3C32A 4YKPA 3UORA 4MCOA 1OLAA 1MPBA 1BTJA 2B65A 2VP1A 4I62A 4Q5TA 2QJEA 1MPCA 2UVHA 3DLNA 1MH3A 2AL5A
chains in the Genus database with same CATH topology
5I2NB 1SQYA 2QL3A 4X48A 3T9XB 4Q8RA 3MQ9A 4H8JA 3ZKKA 5F7VA 4LQ5A 2A5SA 2W7YA 3KN3A 3DELB 3H06B 4KQPA 2UVGA 3MVYA 1ZTYA 3ZSFA 1UQWA 2PYYA 4IY5A 2XXQA 2OJTA 3M3LA 2H98A 5H8HB 1QULA 5I59A 3V83A 3FZVA 3IOUA 1UIUA 2XXUA 4U1ZA 3SESA 1JW1A 1PBPA 4GD5A 2DXYA 4R75A 1EZ9A 3U93A 4EXKA 1OIBA 2B3FA 1GV8A 1L5TA 4H65A 3KJ7A 4OENA 5FHMA 4R6KA 3IORA 3JV9A 1LAFE 4HCYA 3K2DA 4TLMB 1P1QA 1OQHA 3LR1A 5H8NA 5JTYA 2ZYMA 2DXRA 4XTCQ 2Y84A 1BLFA 2XHDA 1B0HA 4YMAA 2R9JA 2NWJA 5EHMA 1RYXA 3C33A 3L6GA 1SW4A 1N76A 5FTHA 3MP1A 2O84X 4PP0A 4YKKA 1ZKBA 4G68C 5FHOA 4GWOA 3O28A 4XKRA 2X7QA 4EF2A 2UXAA 3B6WA 2F8DA 4KR5A 1ZJLA 4MLQA 2QMWA 2F6GA 3G3FA 1OMPA 3MVWA 5TPAA 3CVGA 3TPAA 3CR9A 4IB2A 2RC9A 1B1XA 2V3UA 3VFJA 2QSXA 3K6XA 2CZLA 1O63A 1SYIA 4H8IA 3H03A 1MY4A 4OWDA 2THIA 5ICTA 3KG2A 2ONKE 5CMMA 3PPNA 2O6AA 5CI5A 1GVCA 3PUZE 4NF6A 2Z8DA 1XC1A 1ZLQA 3OXNA 3FVOA 4OESA 2V84A 2FNCA 1UIVA 4ZEBA 3K6WA 2G29A 1B7UA 4QSDA 3Q27A 4OZ9A 4ZEDA 4LZ7A 3EQ1A 1N3XA 5H8SA 1I6QA 1IXGA 3HPIA 3T9VA 3KOSA 5AE4A 3S9MC 3PUVE 4X9TA 4LONB 2I6EA 4QRZA 2LAOA 4JBZA 4F3GA 4GOTA 1CE2A 4YMBA 1HSEA 1US4A 2WKYA 2Y7IA 4M4GA 3FGSA 2RC8A 1B3LA 5ITOA 4OFOA 2GHAA 5IKBA 5I2KA 4MLVA 4BDMA 4RPOA 2V3TA 3IB1A 1NH8A 5I57A 3TDJA 1USYH 5TU0A 3R26A 5CMCA 2F78A 5CM6A 1TXFA 4PFWA 5TP9A 1N0TA 2DS9A 4YB6A 3OEMA 5DVIA 3E4RA 4R9FA 4NTLA 3RGYA 1US5A 1IIWA 1PBQA 1MXXA 4JSOA 3MC2A 1MS7A 2DQVA 4AQ4A 1B7ZA 3RNNA 4R74A 1BKAA 4U4XA 1MXWA 1SW2A 4PFTA 2Z8EA 3U72A 1MY2A 2KLFA 2CMOA 4F19A 1MM7A 2Q2AA 2D5WA 4Z7EA 3S2VA 1TFDA 1B2HA 3TCGA 2QS2A 3I6VA 1FQBA 5DEXA 4F2QA 2E0SA 4OEUA 3ODBA 1A8FA 1MXVA 4ISUA 4EF1A 1JVXA 3CFLA 3B6TA 1YAEA 3O6GA 4G8NA 2PT2A 4EQ7A 3SDFA 2O69A 4R6YA 3H4ZA 1M5DA 4GXAA 1B4ZA 3M8UA 1LB8A 3OENA 3SEXA 3FUZA 5AA4A 3KFMA 1AL3A 4KFQA 4YZZA 3V5AA 3N5LA 2O68A 4WEPA 1MQHA 1RKMA 4BDOA 1AOVA 5KDTA 5BWJA 1LCFA 1GTKA 4R72A 3TTKA 3SEVA 1VFEA 3M3KA 2XX9A 4OYVA 1NNPA 1B32A 3IB2A 2BJJX 4DIGA 1Q1KA 2P0SA 3VVEA 2DE4A 4FJPA 3O2AA 4R2BA 5H8QB 4DCYA 4PETA 3KN8A 3CIJA 3BKIB 3PPPA 1Y3NA 3TYHA 4YKJA 2I4CA 5ITPA 1B3HA 2F5XA 3C36A 1POTA 3W9VA 4P0IA 1DTGA 1SBPA 3O66A 4NF4A 5HPQA 5IAIA 1LAGE 3VLWA 5I59B 4R9GA 4H0WA 4LA9A 1FTOA 4JWYA 3K6VA 3GBBA 1XOCA 4BDRA 3RPWA 3ZKLA 4F29A 4EDPA 1FCKA 4NMYA 1A40A 3M3FA 4ELRA 3C35A 1MXYA 2XXVA 2HEUA 2YPNA 3OEKA 2NOOA 1B58A 4R2FA 1EZPA 1SI1A 4UA8A 1DTZA 3EHTA 4QFLA 5DYHA 4IGTA 3UK4A 1VR5A 5H8NB 4RYAA 5JTYB 1Y4TA 2F34A 2ESNA 2ZYOA 4GL0A 1QVSA 2ZMBA 2ONSA 2DE3A 3A09A 1B5HA 4EUOA 4ZE8A 3GLBA 2XXIA 2F6PA 5ICQA 2RC7A 3HCQA 1JEVA 3QXMA 1QKBA 1P1WA 4U23A 3FV1A 2R6GE 1FTKA 3VVDA 4LZ8A 4Q30B 1DMBA 4KYDA 4NWDA 5L8DA 1JVYA 4X1DA 2D21A 3O6IA 1M5BA 1QW0A 3KOTA 1WODA 3I5OA 3H3GA 1MY3A 5TPAB 3MPKA 5I58A 3FVGA 2IA4A 4OVJA 1Y3QA 3FJGA 1NFTA 3IR1A 4FEBA 3H6VA 1LBBA 2O51A 4X1BA 1NNFA 5DVJA 4RXLA 2PX1A 2QS4A 1B46A 2XXXA 1OVTA 4G68A 1A7LA 4ECFA 4GXSB 1JW4A 1IXCA 2F7AA 1EZOA 3H6WA 1SI0A 3TEPA 1ZBMA 4IO3A 3USDA 3MZ9A 3QUFA 4YKIA 2G93A 3PD9A 1ZIUA 3SEUA 4P11A 3TKDA 2HZLA 1B7HA 4N13A 1LCTA 3T93B 5AA3A 5A5XB 3R7XA 1B6HA 1TT1A 2V25A 2O1MA 4ZEFA 1B5IA 4H5GA 2P2AA 2XX7A 3CRBA 3IAZA 3G7WA 1B4HA 1HSLA 1WVJA 3PUYE 2I48A 4L17A 3MZBA 4XKPA 3U92A 3UA8A 1URSA 1OQGA 3FVKA 1SD3A 2XD2A 4KI0E 4RA1A 4ZZEA 2Q8JA 1QUKA 2ANJA 2OCUA 5AA1A 1UTBB 2XXHA 1BIYA 3SEYA 5B7DA 5I56B 2RCAA 1ANFA 3C31A 1NNKA 2I4BA 5I57B 1URDA 3O9PA 3FVNA 4G2ZA 1LBCA 1MY1A 2DVZA 5DTBA 2DWAA 3PUXE 2YJPA 2HCAA 1FTMA 3ILUB 3FD3A 4ZS9A 5CBSA 5M2VA 3RQTA 5KCJB 4ESWA 4F1UA 4P0GA 1DPPA 4DXBA 5LOMA 3T9UA 4OETA 3B7DA 3BFTA 4E0XA 1B0LA 3T9HB 3MW0A 1R1NA 3U1OA 1AMFA 1MQJA 3QYTA 3MVXA 3LBSA 1PEBA 1SW1A 3HHGA 2NVUB 3D4CA 3MZ1A 3A3UA 4K3FA 1SW5A 1F9BA 3HO7A 2Y7KA 1MH4A 2UVIA 2DWJA 2XXWA 3S4UA 3IOTA 4U1OA 2OK2A 1H76A 2I0BA 3TTLA 4RPNA 3TODA 5ELVA 4JXIA 4NF8B 1LAHE 2OBGA 1XT8A 3TMGA 1ZMGA 4QFOA 4I8CA 5CMKA 3ILTB 4OHNA 4NF5B 3TAJA 4N6PA 4G4PA 3UGWA 2DWHA 3C4MA 1A8EA 3PD8A 1XHYA 4XIGQ 4ELQA 3VE1B 3O97A 5F1QA 3PPRA 1H43A 4ONYA 4OMBA 4FORA 2RINA 1B3GA 4JWXA 2AL4A 3TCFA 1B1HA 3TZAA 2Y7PA 4I9DA 3G3HA 4KCDA 3EHUA 1IEJA 2A5TB 1MQDA 4GRKA 3LUYA 2Q2CA 2RKMA 3DP8A 1H3DA 1M5CA 4G77A 4IY6A 4ZE9A 3FASA 3OMBA 4IO6A 2D3IA 2HQ0A 2Z8FA 1OVBA 5AA2B 4WXJA 4KHZE 2VHAA 4O3BA 4G8MA 4ZZAA 3F11A 2O1LA 4YU0A 3IO6A 1H45A 4ZDMA 4JWOA 2DWIA 1PB7A 2ZNTA 4GL8A 2O7UA 5L9OA 3N6UA 1TFAA 2GFEA 3K1PA 1DOTA 1P1NA 4XKNA 2DSFA 4F1VA 2HFBA 3EPEA 4U4SA 4H6DA 1A99A 4PFYA 2Y7WA 4N07A 4FEDA 1N84A 3QSLA 4ND9A 4XKQA 3QAXA 2QPQA 1KWHA 3MBPA 4F3PA 5BUUA 1MQIA 4PQJA 3LSXA 1BP5A 2FYIA 3IJXB 3VLUA 3K1MA 1OLCA 2I58A 1D9YA 1SVXB 3K0VA 2X7PA 1MY0A 1B40A 4H1XA 3E9XA 1Q35A 3K02A 2H9BA 3BFUA 4HS7A 4MH5A 3QK6A 4KCCA 4GVOA 3G3GA 1LAXA 2HZKA 5J1DA 5I58B 3TTNA 4TLLB 3LC8A 3E13X 4FECA 3TTMA 2XXPA 3OO8A 2UVJA 1FQEA 4F3SA 1IQ7A 3WAFA 3MAMA 1B52A 3T96B 4G68B 2O7IA 4U2RA 3CFXA 1IZ1A 4RK9A 1R9QA 3IOWA 3FXQA 4EQ9A 2DP8A 3DP6A 1QKAA 1MXZA 1Z7NE 2DE2A 1D3KA 5L9SA 4GFRA 1FQFA 4IO4A 3ONMA 4F31B 5JK4A 2DVCA 2UYFA 4DCXA 1VFDA 1B3FA 2GHBA 4ESXA 2H25A 3PPOA 1JNFA 1Y20A 3KZGA 1P1OA 3VV5A 2Q88A 2H5YA 3S9NC 3HV1A 2DYXA 3UP9A 3IK6B 2Q9TA 4BLAA 1QJMA 3L6HA 2OWTA 3RTFB 1JETA 4DLDA 2H99A 2V3QA 3CSBA 1PC3A 4KYSA 1S7YA 2Z23A 3PPQA 5ISUA 2XXYA 2OLBA 4MF3A 4ZECA 2QS3A 1PB9A 1NKXA 3OOAA 4JB7A 3OELA 4JDFA 3BBRA 4PFUA 2ALUA 1JQFA 3K00A 3PGFA 4LATA 1B51A 1MRPA 5H8FA 4Q0CA 4QSEA 1MQGA 1Y4CA 4R6HA 3LSFB 2VOZA 3K1NA 3AXFA 2Z22A 1ATGA 3LSLA 3P7IA 4RK2A 4TOZA 4KD5A 1I6AA 3CSGA 1UTHA 4R73A 4RNSA 2PBWA 4BDLA 1R9LA 1S50A 4M1VA 1LFHA 2ZYNA 2PMSA 1NMUA 1MDP1 2I3WA 3O6HA 4ZEKA 1N7WA 3RN8A 3T22A 5H8QA 1GGGA 4U21A 3O29A 4TQUQ 4IO5A 4RJZA 2HAUA 3KGCA 3TCHA 4NF6B 2RF1A 1MG1A 3E3KA 4YB7A 1POY1 1R6ZA 4ZEIA 3EF7A 1MXUA 1YTVA 2V93A 4O3AA 1VSOA 1D9VA 3GBAA 4F18A 3SKPA 3GZGA 4IGRA 1EH3A 4C0RA 4DDDA 1MPDA 5B70A 2VD2A 3V8XB 3KSXA 1B05A 3FATA 2R71A 2RCBA 2AYSA 4NE4A 3VXCA 3N26A 3OO6A 3KJTA 4LUBA 4C1UA 4ELOA 5AA2D 1Y3PA 2PVUA 3U94A 2OWSA 3IX1A 1Y1MA 3VLVA 5I2KB 3THIA 3K01A 3LSWA 1SYHA 3RUMA 3DM0A 1Y9UA 2XXTA 2H4IA 4Z0IA 1URGA 1IXIA 1M5FA 4DZ1A 5L9MA 1RYOA 3KSJA 3MWBA 3DP4A 5TP9B 1WDNA 4FATA 2YLNA 1P99A 3MP8A 1D4NA 4WEDA 4LVQA 3G3JA 2VGQA 3PMVA 1QUJA 1J1NA 4OEVA 5EYFA 3CI8A 4RY1A 4EQBA 4GQOA 4OERA 5I2NA 2I0CA 3K6UA 3C34A 3QIMA 4IO7A 2QRYA 1ZU0A 1H44A 4WKMA 2F97A 1TWYA 1II5A 1PB8A 5FHNA 1HSJA 1LB9A 1AH5A 2VD3A 3K4UA 2ABHA 4F22A 5K2YA 4DE8A 3MP6A 5DEXB 1ELJA 1FQAA 1Z7ME 1AIVA 5H8HA 4HCWA 2QS1A 1FTJA 1M5EA 3JYRA 3S9EA 3U8QA 1S9TA 4POXA 4UACA 3IJOB 4F39A 3KN7A 3FXRA 4GLIA 3Q29A 5DT6A 1FQCA 2E1SA 4OTEA 2ZNUA 3MUQA 5A5XA 3KBRA 5HBCA 2X26A 5AA4B 2F35A 3B6QA 4H67A 5K2XA 3FJ7A 2UYEA 2QMXA 3UN6A 3EHSA 3Q26A 3TQWA 4HW8A 3JZJA 4MFIA 1IUDA 5KDTB 1I69A 1A55A 3UIFA 3SEWA 4C1TA 3GXAA 1GR2A 1UTBA 1LSTA 1N7XA 1NH7A 4DXCA 5DVFA 3PMXA 5I56A 3Q28A 4BDQA 3I3VA 3VVFA 4KYEA 4QFPA 3HHFA 3KEIA 3TFLA 4YB5A 3ECRA 2F36A 4PE5B 3FIRA 3CG3A 1MDQA 2AIXA 3CG1A 1XVXA 4POWA 5HM4B 4IO2A 3W15C 4KPTA 4NF4B 1N04A 1JW5A 3WAEA 1B5JA 4F3BA 3OSRA 2ONRA 5CMBA 2OZZA 4YAHX 5KCJA 3T66A 2GH9A 5EHSA 1YPNA 1P1UA 2F7CA 4QFKA 2F7BA 3H6TA 4F1YA 2M8CA 1PDAA 4MBPA 5I84A 1LFIA 3V89B 4LP2B 3A3CA 3IOVA 3FXUA 3TTRA 4LZ5A 3FJMA 4OXVA 1XS5A 2HAVA 1LGBC 4ELPA 1YCJA 3PU5A 1DPEA 4FE8A 3N94A 1B9JA 2NUVA 2I49A 2XD3A 3OO9A 4OQOA 3MVZA 1IITA 3FV2A 3R6UA 3RY3A 4AB6A 1CB6A 1B3EA 5KZTA 1O7TA 2ZXTA 4FAJA 3PUWE 3S9LC 2ZYKA 1JEUA 4NF8A 4OFJA 5FTIA 3VDFA 1O64A 4JSDA 3IO4A 4NWCA 5H8FB 3C9HA 4NF5A 4F2OA 2FA7A 1Y1ZA 1SDXA 3SETA 3TUSA 4I1DA 4U22A 5CRYA 2XX8A 2P1SA 1UTHB 3SERA 3OD7A 3HN0A 2Q89A 3G3IA 2REJA 5CBRA 4QHQA 3OO7A 3H7MA 3PMWA 2Y7RA 2HXWA 4O3CA 1I6BA 4BDNA 4LQ2A 1NNTA 4G8HA 4QFNA 1FQDA 1IXHA 2A5TA 3OSQA 4GIZA 1QUIA 4E0WA 2PT1A 2DOJA 2I3VA 1USYE 1MM6A 3CFZA 2XXRA 2REGA 4QSCA 5AA2A 4AB5A 3G3KA 4OFLA 2NXOA 3ZS6A 3RLFE 4EXLA 1FW0A 3IB0A 2IEEA 4HTGA 3H6UA 1DSNA 3QUJA 4THIA 3TELA 3D4GA 3RT8A 3RT6B 3Q25A 3EN3A 2B3BA 1LFGA 1T0KA 4H5FA 1N3WA 1XVYA 3IL1B 4NEDA 4GF8A 4FIMA 4XXUA 1VE4A 1NL5A 1A54A 5CC2A 2ZNSA 3VXBA 5JEIA 2GRVA 3PV0E 3W9WA 1EU8A 1LLSA 3MJNA 4QF9A 3HSTA 1FTLA 3MPLA 3N6TA 3RTWB 3TQLA 4DXUA 4YICA 3C32A 4YKPA 3UORA 1OLAA 1MPBA 1BTJA 2B65A 2VP1A 4I62A 4Q5TA 2QJEA 1MPCA 2UVHA 3DLNA 1MH3A 2AL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I2N B;  1SQY A;  2QL3 A;  4X48 A;  3T9X B;  4Q8R A;  3MQ9 A;  4H8J A;  3ZKK A;  5F7V A;  4LQ5 A;  2A5S A;  2W7Y A;  3KN3 A;  3DEL B;  3H06 B;  4KQP A;  2UVG A;  3MVY A;  1ZTY A;  3ZSF A;  1UQW A;  2PYY A;  4IY5 A;  2XXQ A;  2OJT A;  3M3L A;  2H98 A;  5H8H B;  1QUL A;  5I59 A;  3V83 A;  3FZV A;  3IOU A;  1UIU A;  2XXU A;  4U1Z A;  3SES A;  1JW1 A;  1PBP A;  4GD5 A;  2DXY A;  4R75 A;  1EZ9 A;  3U93 A;  4EXK A;  1OIB A;  2B3F A;  1GV8 A;  1L5T A;  4H65 A;  3KJ7 A;  4OEN A;  5FHM A;  4R6K A;  3IOR A;  3JV9 A;  1LAF E;  4HCY A;  3K2D A;  4TLM B;  1P1Q A;  1OQH A;  3LR1 A;  5H8N A;  5JTY A;  2ZYM A;  2DXR A;  4XTC Q;  2Y84 A;  1BLF A;  2XHD A;  1B0H A;  4YMA A;  2R9J A;  2NWJ A;  5EHM A;  1RYX A;  3C33 A;  3L6G A;  1SW4 A;  1N76 A;  5FTH A;  3MP1 A;  2O84 X;  4PP0 A;  4YKK A;  1ZKB A;  4G68 C;  5FHO A;  4GWO A;  3O28 A;  4XKR A;  2X7Q A;  4EF2 A;  2UXA A;  3B6W A;  2F8D A;  4KR5 A;  1ZJL A;  4MLQ A;  2QMW A;  2F6G A;  3G3F A;  1OMP A;  3MVW A;  5TPA A;  3CVG A;  3TPA A;  3CR9 A;  4IB2 A;  2RC9 A;  1B1X A;  2V3U A;  3VFJ A;  2QSX A;  3K6X A;  2CZL A;  1O63 A;  1SYI A;  4H8I A;  3H03 A;  1MY4 A;  4OWD A;  2THI A;  5ICT A;  3KG2 A;  2ONK E;  5CMM A;  3PPN A;  2O6A A;  5CI5 A;  1GVC A;  3PUZ E;  4NF6 A;  2Z8D A;  1XC1 A;  1ZLQ A;  3OXN A;  3FVO A;  4OES A;  2V84 A;  2FNC A;  1UIV A;  4ZEB A;  3K6W A;  2G29 A;  1B7U A;  4QSD A;  3Q27 A;  4OZ9 A;  4ZED A;  4LZ7 A;  3EQ1 A;  1N3X A;  5H8S A;  1I6Q A;  1IXG A;  3HPI A;  3T9V A;  3KOS A;  5AE4 A;  3S9M C;  3PUV E;  4X9T A;  4LON B;  2I6E A;  4QRZ A;  2LAO A;  4JBZ A;  4F3G A;  4GOT A;  1CE2 A;  4YMB A;  1HSE A;  1US4 A;  2WKY A;  2Y7I A;  4M4G A;  3FGS A;  2RC8 A;  1B3L A;  5ITO A;  4OFO A;  2GHA A;  5IKB A;  5I2K A;  4MLV A;  4BDM A;  4RPO A;  2V3T A;  3IB1 A;  1NH8 A;  5I57 A;  3TDJ A;  1USY H;  5TU0 A;  3R26 A;  5CMC A;  2F78 A;  5CM6 A;  1TXF A;  4PFW A;  5TP9 A;  1N0T A;  2DS9 A;  4YB6 A;  3OEM A;  5DVI A;  3E4R A;  4R9F A;  4NTL A;  3RGY A;  1US5 A;  1IIW A;  1PBQ A;  1MXX A;  4JSO A;  3MC2 A;  1MS7 A;  2DQV A;  4AQ4 A;  1B7Z A;  3RNN A;  4R74 A;  1BKA A;  4U4X A;  1MXW A;  1SW2 A;  4PFT A;  2Z8E A;  3U72 A;  1MY2 A;  2KLF A;  2CMO A;  4F19 A;  1MM7 A;  2Q2A A;  2D5W A;  4Z7E A;  3S2V A;  1TFD A;  1B2H A;  3TCG A;  2QS2 A;  3I6V A;  1FQB A;  5DEX A;  4F2Q A;  2E0S A;  4OEU A;  3ODB A;  1A8F A;  1MXV A;  4ISU A;  4EF1 A;  1JVX A;  3CFL A;  3B6T A;  1YAE A;  3O6G A;  4G8N A;  2PT2 A;  4EQ7 A;  3SDF A;  2O69 A;  4R6Y A;  3H4Z A;  1M5D A;  4GXA A;  1B4Z A;  3M8U A;  1LB8 A;  3OEN A;  3SEX A;  3FUZ A;  5AA4 A;  3KFM A;  1AL3 A;  4KFQ A;  4YZZ A;  3V5A A;  3N5L A;  2O68 A;  4WEP A;  1MQH A;  1RKM A;  4BDO A;  1AOV A;  5KDT A;  5BWJ A;  1LCF A;  1GTK A;  4R72 A;  3TTK A;  3SEV A;  1VFE A;  3M3K A;  2XX9 A;  4OYV A;  1NNP A;  1B32 A;  3IB2 A;  2BJJ X;  4DIG A;  1Q1K A;  2P0S A;  3VVE A;  2DE4 A;  4FJP A;  3O2A A;  4R2B A;  5H8Q B;  4DCY A;  4PET A;  3KN8 A;  3CIJ A;  3BKI B;  3PPP A;  1Y3N A;  3TYH A;  4YKJ A;  2I4C A;  5ITP A;  1B3H A;  2F5X A;  3C36 A;  1POT A;  3W9V A;  4P0I A;  1DTG A;  1SBP A;  3O66 A;  4NF4 A;  5HPQ A;  5IAI A;  1LAG E;  3VLW A;  5I59 B;  4R9G A;  4H0W A;  4LA9 A;  1FTO A;  4JWY A;  3K6V A;  3GBB A;  1XOC A;  4BDR A;  3RPW A;  3ZKL A;  4F29 A;  4EDP A;  1FCK A;  4NMY A;  1A40 A;  3M3F A;  4ELR A;  3C35 A;  1MXY A;  2XXV A;  2HEU A;  2YPN A;  3OEK A;  2NOO A;  1B58 A;  4R2F A;  1EZP A;  1SI1 A;  4UA8 A;  1DTZ A;  3EHT A;  4QFL A;  5DYH A;  4IGT A;  3UK4 A;  1VR5 A;  5H8N B;  4RYA A;  5JTY B;  1Y4T A;  2F34 A;  2ESN A;  2ZYO A;  4GL0 A;  1QVS A;  2ZMB A;  2ONS A;  2DE3 A;  3A09 A;  1B5H A;  4EUO A;  4ZE8 A;  3GLB A;  2XXI A;  2F6P A;  5ICQ A;  2RC7 A;  3HCQ A;  1JEV A;  3QXM A;  1QKB A;  1P1W A;  4U23 A;  3FV1 A;  2R6G E;  1FTK A;  3VVD A;  4LZ8 A;  4Q30 B;  1DMB A;  4KYD A;  4NWD A;  5L8D A;  1JVY A;  4X1D A;  2D21 A;  3O6I A;  1M5B A;  1QW0 A;  3KOT A;  1WOD A;  3I5O A;  3H3G A;  1MY3 A;  5TPA B;  3MPK A;  5I58 A;  3FVG A;  2IA4 A;  4OVJ A;  1Y3Q A;  3FJG A;  1NFT A;  3IR1 A;  4FEB A;  3H6V A;  1LBB A;  2O51 A;  4X1B A;  1NNF A;  5DVJ A;  4RXL A;  2PX1 A;  2QS4 A;  1B46 A;  2XXX A;  1OVT A;  4G68 A;  1A7L A;  4ECF A;  4GXS B;  1JW4 A;  1IXC A;  2F7A A;  1EZO A;  3H6W A;  1SI0 A;  3TEP A;  1ZBM A;  4IO3 A;  3USD A;  3MZ9 A;  3QUF A;  4YKI A;  2G93 A;  3PD9 A;  1ZIU A;  3SEU A;  4P11 A;  3TKD A;  2HZL A;  1B7H A;  4N13 A;  1LCT A;  3T93 B;  5AA3 A;  5A5X B;  3R7X A;  1B6H A;  1TT1 A;  2V25 A;  2O1M A;  4ZEF A;  1B5I A;  4H5G A;  2P2A A;  2XX7 A;  3CRB A;  3IAZ A;  3G7W A;  1B4H A;  1HSL A;  1WVJ A;  3PUY E;  2I48 A;  4L17 A;  3MZB A;  4XKP A;  3U92 A;  3UA8 A;  1URS A;  1OQG A;  3FVK A;  1SD3 A;  2XD2 A;  4KI0 E;  4RA1 A;  4ZZE A;  2Q8J A;  1QUK A;  2ANJ A;  2OCU A;  5AA1 A;  1UTB B;  2XXH A;  1BIY A;  3SEY A;  5B7D A;  5I56 B;  2RCA A;  1ANF A;  3C31 A;  1NNK A;  2I4B A;  5I57 B;  1URD A;  3O9P A;  3FVN A;  4G2Z A;  1LBC A;  1MY1 A;  2DVZ A;  5DTB A;  2DWA A;  3PUX E;  2YJP A;  2HCA A;  1FTM A;  3ILU B;  3FD3 A;  4ZS9 A;  5CBS A;  5M2V A;  3RQT A;  5KCJ B;  4ESW A;  4F1U A;  4P0G A;  1DPP A;  4DXB A;  5LOM A;  3T9U A;  4OET A;  3B7D A;  3BFT A;  4E0X A;  1B0L A;  3T9H B;  3MW0 A;  1R1N A;  3U1O A;  1AMF A;  1MQJ A;  3QYT A;  3MVX A;  3LBS A;  1PEB A;  1SW1 A;  3HHG A;  2NVU B;  3D4C A;  3MZ1 A;  3A3U A;  4K3F A;  1SW5 A;  1F9B A;  3HO7 A;  2Y7K A;  1MH4 A;  2UVI A;  2DWJ A;  2XXW A;  3S4U A;  3IOT A;  4U1O A;  2OK2 A;  1H76 A;  2I0B A;  3TTL A;  4RPN A;  3TOD A;  5ELV A;  4JXI A;  4NF8 B;  1LAH E;  2OBG A;  1XT8 A;  3TMG A;  1ZMG A;  4QFO A;  4I8C A;  5CMK A;  3ILT B;  4OHN A;  4NF5 B;  3TAJ A;  4N6P A;  4G4P A;  3UGW A;  2DWH A;  3C4M A;  1A8E A;  3PD8 A;  1XHY A;  4XIG Q;  4ELQ A;  3VE1 B;  3O97 A;  5F1Q A;  3PPR A;  1H43 A;  4ONY A;  4OMB A;  4FOR A;  2RIN A;  1B3G A;  4JWX A;  2AL4 A;  3TCF A;  1B1H A;  3TZA A;  2Y7P A;  4I9D A;  3G3H A;  4KCD A;  3EHU A;  1IEJ A;  2A5T B;  1MQD A;  4GRK A;  3LUY A;  2Q2C A;  2RKM A;  3DP8 A;  1H3D A;  1M5C A;  4G77 A;  4IY6 A;  4ZE9 A;  3FAS A;  3OMB A;  4IO6 A;  2D3I A;  2HQ0 A;  2Z8F A;  1OVB A;  5AA2 B;  4WXJ A;  4KHZ E;  2VHA A;  4O3B A;  4G8M A;  4ZZA A;  3F11 A;  2O1L A;  4YU0 A;  3IO6 A;  1H45 A;  4ZDM A;  4JWO A;  2DWI A;  1PB7 A;  2ZNT A;  4GL8 A;  2O7U A;  5L9O A;  3N6U A;  1TFA A;  2GFE A;  3K1P A;  1DOT A;  1P1N A;  4XKN A;  2DSF A;  4F1V A;  2HFB A;  3EPE A;  4U4S A;  4H6D A;  1A99 A;  4PFY A;  2Y7W A;  4N07 A;  4FED A;  1N84 A;  3QSL A;  4ND9 A;  4XKQ A;  3QAX A;  2QPQ A;  1KWH A;  3MBP A;  4F3P A;  5BUU A;  1MQI A;  4PQJ A;  3LSX A;  1BP5 A;  2FYI A;  3IJX B;  3VLU A;  3K1M A;  1OLC A;  2I58 A;  1D9Y A;  1SVX B;  3K0V A;  2X7P A;  1MY0 A;  1B40 A;  4H1X A;  3E9X A;  1Q35 A;  3K02 A;  2H9B A;  3BFU A;  4HS7 A;  4MH5 A;  3QK6 A;  4KCC A;  4GVO A;  3G3G A;  1LAX A;  2HZK A;  5J1D A;  5I58 B;  3TTN A;  4TLL B;  3LC8 A;  3E13 X;  4FEC A;  3TTM A;  2XXP A;  3OO8 A;  2UVJ A;  1FQE A;  4F3S A;  1IQ7 A;  3WAF A;  3MAM A;  1B52 A;  3T96 B;  4G68 B;  2O7I A;  4U2R A;  3CFX A;  1IZ1 A;  4RK9 A;  1R9Q A;  3IOW A;  3FXQ A;  4EQ9 A;  2DP8 A;  3DP6 A;  1QKA A;  1MXZ A;  1Z7N E;  2DE2 A;  1D3K A;  5L9S A;  4GFR A;  1FQF A;  4IO4 A;  3ONM A;  4F31 B;  5JK4 A;  2DVC A;  2UYF A;  4DCX A;  1VFD A;  1B3F A;  2GHB A;  4ESX A;  2H25 A;  3PPO A;  1JNF A;  1Y20 A;  3KZG A;  1P1O A;  3VV5 A;  2Q88 A;  2H5Y A;  3S9N C;  3HV1 A;  2DYX A;  3UP9 A;  3IK6 B;  2Q9T A;  4BLA A;  1QJM A;  3L6H A;  2OWT A;  3RTF B;  1JET A;  4DLD A;  2H99 A;  2V3Q A;  3CSB A;  1PC3 A;  4KYS A;  1S7Y A;  2Z23 A;  3PPQ A;  5ISU A;  2XXY A;  2OLB A;  4MF3 A;  4ZEC A;  2QS3 A;  1PB9 A;  1NKX A;  3OOA A;  4JB7 A;  3OEL A;  4JDF A;  3BBR A;  4PFU A;  2ALU A;  1JQF A;  3K00 A;  3PGF A;  4LAT A;  1B51 A;  1MRP A;  5H8F A;  4Q0C A;  4QSE A;  1MQG A;  1Y4C A;  4R6H A;  3LSF B;  2VOZ A;  3K1N A;  3AXF A;  2Z22 A;  1ATG A;  3LSL A;  3P7I A;  4RK2 A;  4TOZ A;  4KD5 A;  1I6A A;  3CSG A;  1UTH A;  4R73 A;  4RNS A;  2PBW A;  4BDL A;  1R9L A;  1S50 A;  4M1V A;  1LFH A;  2ZYN A;  2PMS A;  1NMU A;  1MDP 1;  2I3W A;  3O6H A;  4ZEK A;  1N7W A;  3RN8 A;  3T22 A;  5H8Q A;  1GGG A;  4U21 A;  3O29 A;  4TQU Q;  4IO5 A;  4RJZ A;  2HAU A;  3KGC A;  3TCH A;  4NF6 B;  2RF1 A;  1MG1 A;  3E3K A;  4YB7 A;  1POY 1;  1R6Z A;  4ZEI A;  3EF7 A;  1MXU A;  1YTV A;  2V93 A;  4O3A A;  1VSO A;  1D9V A;  3GBA A;  4F18 A;  3SKP A;  3GZG A;  4IGR A;  1EH3 A;  4C0R A;  4DDD A;  1MPD A;  5B70 A;  2VD2 A;  3V8X B;  3KSX A;  1B05 A;  3FAT A;  2R71 A;  2RCB A;  2AYS A;  4NE4 A;  3VXC A;  3N26 A;  3OO6 A;  3KJT A;  4LUB A;  4C1U A;  4ELO A;  5AA2 D;  1Y3P A;  2PVU A;  3U94 A;  2OWS A;  3IX1 A;  1Y1M A;  3VLV A;  5I2K B;  3THI A;  3K01 A;  3LSW A;  1SYH A;  3RUM A;  3DM0 A;  1Y9U A;  2XXT A;  2H4I A;  4Z0I A;  1URG A;  1IXI A;  1M5F A;  4DZ1 A;  5L9M A;  1RYO A;  3KSJ A;  3MWB A;  3DP4 A;  5TP9 B;  1WDN A;  4FAT A;  2YLN A;  1P99 A;  3MP8 A;  1D4N A;  4WED A;  4LVQ A;  3G3J A;  2VGQ A;  3PMV A;  1QUJ A;  1J1N A;  4OEV A;  5EYF A;  3CI8 A;  4RY1 A;  4EQB A;  4GQO A;  4OER A;  5I2N A;  2I0C A;  3K6U A;  3C34 A;  3QIM A;  4IO7 A;  2QRY A;  1ZU0 A;  1H44 A;  4WKM A;  2F97 A;  1TWY A;  1II5 A;  1PB8 A;  5FHN A;  1HSJ A;  1LB9 A;  1AH5 A;  2VD3 A;  3K4U A;  2ABH A;  4F22 A;  5K2Y A;  4DE8 A;  3MP6 A;  5DEX B;  1ELJ A;  1FQA A;  1Z7M E;  1AIV A;  5H8H A;  4HCW A;  2QS1 A;  1FTJ A;  1M5E A;  3JYR A;  3S9E A;  3U8Q A;  1S9T A;  4POX A;  4UAC A;  3IJO B;  4F39 A;  3KN7 A;  3FXR A;  4GLI A;  3Q29 A;  5DT6 A;  1FQC A;  2E1S A;  4OTE A;  2ZNU A;  3MUQ A;  5A5X A;  3KBR A;  5HBC A;  2X26 A;  5AA4 B;  2F35 A;  3B6Q A;  4H67 A;  5K2X A;  3FJ7 A;  2UYE A;  2QMX A;  3UN6 A;  3EHS A;  3Q26 A;  3TQW A;  4HW8 A;  3JZJ A;  4MFI A;  1IUD A;  5KDT B;  1I69 A;  1A55 A;  3UIF A;  3SEW A;  4C1T A;  3GXA A;  1GR2 A;  1UTB A;  1LST A;  1N7X A;  1NH7 A;  4DXC A;  5DVF A;  3PMX A;  5I56 A;  3Q28 A;  4BDQ A;  3I3V A;  3VVF A;  4KYE A;  4QFP A;  3HHF A;  3KEI A;  3TFL A;  4YB5 A;  3ECR A;  2F36 A;  4PE5 B;  3FIR A;  3CG3 A;  1MDQ A;  2AIX A;  3CG1 A;  1XVX A;  4POW A;  5HM4 B;  4IO2 A;  3W15 C;  4KPT A;  4NF4 B;  1N04 A;  1JW5 A;  3WAE A;  1B5J A;  4F3B A;  3OSR A;  2ONR A;  5CMB A;  2OZZ A;  4YAH X;  5KCJ A;  3T66 A;  2GH9 A;  5EHS A;  1YPN A;  1P1U A;  2F7C A;  4QFK A;  2F7B A;  3H6T A;  4F1Y A;  2M8C A;  1PDA A;  4MBP A;  5I84 A;  1LFI A;  3V89 B;  4LP2 B;  3A3C A;  3IOV A;  3FXU A;  3TTR A;  4LZ5 A;  3FJM A;  4OXV A;  1XS5 A;  2HAV A;  1LGB C;  4ELP A;  1YCJ A;  3PU5 A;  1DPE A;  4FE8 A;  3N94 A;  1B9J A;  2NUV A;  2I49 A;  2XD3 A;  3OO9 A;  4OQO A;  3MVZ A;  1IIT A;  3FV2 A;  3R6U A;  3RY3 A;  4AB6 A;  1CB6 A;  1B3E A;  5KZT A;  1O7T A;  2ZXT A;  4FAJ A;  3PUW E;  3S9L C;  2ZYK A;  1JEU A;  4NF8 A;  4OFJ A;  5FTI A;  3VDF A;  1O64 A;  4JSD A;  3IO4 A;  4NWC A;  5H8F B;  3C9H A;  4NF5 A;  4F2O A;  2FA7 A;  1Y1Z A;  1SDX A;  3SET A;  3TUS A;  4I1D A;  4U22 A;  5CRY A;  2XX8 A;  2P1S A;  1UTH B;  3SER A;  3OD7 A;  3HN0 A;  2Q89 A;  3G3I A;  2REJ A;  5CBR A;  4QHQ A;  3OO7 A;  3H7M A;  3PMW A;  2Y7R A;  2HXW A;  4O3C A;  1I6B A;  4BDN A;  4LQ2 A;  1NNT A;  4G8H A;  4QFN A;  1FQD A;  1IXH A;  2A5T A;  3OSQ A;  4GIZ A;  1QUI A;  4E0W A;  2PT1 A;  2DOJ A;  2I3V A;  1USY E;  1MM6 A;  3CFZ A;  2XXR A;  2REG A;  4QSC A;  5AA2 A;  4AB5 A;  3G3K A;  4OFL A;  2NXO A;  3ZS6 A;  3RLF E;  4EXL A;  1FW0 A;  3IB0 A;  2IEE A;  4HTG A;  3H6U A;  1DSN A;  3QUJ A;  4THI A;  3TEL A;  3D4G A;  3RT8 A;  3RT6 B;  3Q25 A;  3EN3 A;  2B3B A;  1LFG A;  1T0K A;  4H5F A;  1N3W A;  1XVY A;  3IL1 B;  4NED A;  4GF8 A;  4FIM A;  4XXU A;  1VE4 A;  1NL5 A;  1A54 A;  5CC2 A;  2ZNS A;  3VXB A;  5JEI A;  2GRV A;  3PV0 E;  3W9W A;  1EU8 A;  1LLS A;  3MJN A;  4QF9 A;  3HST A;  1FTL A;  3MPL A;  3N6T A;  3RTW B;  3TQL A;  4DXU A;  4YIC A;  3C32 A;  4YKP A;  3UOR A;  1OLA A;  1MPB A;  1BTJ A;  2B65 A;  2VP1 A;  4I62 A;  4Q5T A;  2QJE A;  1MPC A;  2UVH A;  3DLN A;  1MH3 A;  2AL5 A; 
#chains in the Genus database with same CATH topology
 5I2N B;  1SQY A;  3SZP A;  2QL3 A;  2V4C A;  1FPK A;  2P3N A;  4X48 A;  3T9X B;  4Q8R A;  5EYH A;  3MQ9 A;  4H8J A;  3ZKK A;  5F7V A;  4LQ5 A;  2A5S A;  1IME A;  2W7Y A;  3KN3 A;  3DEL B;  3H06 B;  4KQP A;  2UVG A;  3MVY A;  5IZ3 B;  3BIG A;  3A29 A;  1FBD A;  1ZTY A;  5ET8 A;  4OA4 A;  3ZSF A;  1UQW A;  2PYY A;  3LV0 A;  1NV6 A;  4IY5 A;  2XXQ A;  2OJT A;  3M3L A;  2H98 A;  5H8H B;  1QUL A;  5I59 A;  3V83 A;  4PBQ A;  3FZV A;  3IOU A;  1UIU A;  2XXU A;  4U1Z A;  1D9Q A;  3SES A;  1JW1 A;  1PBP A;  4GD5 A;  2DXY A;  4R75 A;  5EQ7 A;  1EZ9 A;  3U93 A;  4EXK A;  1OIB A;  2B3F A;  1GV8 A;  1FPJ A;  1L5T A;  4H65 A;  3KJ7 A;  2HXR A;  4OEN A;  5FHM A;  4R6K A;  2QVV A;  3IOR A;  3JV9 A;  1LAF E;  4HCY A;  3K2D A;  4TLM B;  1P1Q A;  1OQH A;  3LR1 A;  5H8N A;  5JTY A;  2ZYM A;  2DXR A;  5F24 A;  2WBB A;  4XTC Q;  2Y84 A;  1BLF A;  2XHD A;  1B0H A;  4YMA A;  2R9J A;  2NWJ A;  5EHM A;  1RYX A;  3C33 A;  3L6G A;  1SW4 A;  1N76 A;  5FTH A;  3MP1 A;  5EQ8 A;  2O84 X;  4PP0 A;  4YKK A;  1ZKB A;  4G68 C;  5FHO A;  4GWO A;  5LTC A;  3O28 A;  4XKR A;  2X7Q A;  2XXK A;  4EF2 A;  2UXA A;  3B6W A;  2F8D A;  4KR5 A;  1ZJL A;  1AWB A;  4MLQ A;  2QMW A;  2F6G A;  4PFI A;  3G3F A;  1OMP A;  3MVW A;  5TPA A;  3CVG A;  3TPA A;  3CR9 A;  4IB2 A;  2RC9 A;  1B1X A;  2V3U A;  2CZK A;  1IMF A;  3VFJ A;  2WEF A;  1FSA A;  2QSX A;  3K6X A;  1LBX A;  2CZL A;  1O63 A;  1SYI A;  4H8I A;  3H03 A;  1MY4 A;  4OWD A;  2THI A;  4PC9 A;  5ICT A;  3KG2 A;  2ONK E;  2CEX A;  5CMM A;  3PPN A;  2O6A A;  5CI5 A;  1GVC A;  1FBH A;  3PUZ E;  4NF6 A;  2Z8D A;  1XC1 A;  1ZLQ A;  3OXN A;  1NV4 A;  3FVO A;  4OES A;  2V84 A;  2FNC A;  3CHG A;  1UIV A;  3EKI A;  4ZEB A;  3K6W A;  4DI4 B;  2G29 A;  1B7U A;  1YZ0 A;  4QSD A;  3Q27 A;  4OZ9 A;  3NOH A;  1FPD A;  4ZED A;  4LZ7 A;  2XWI A;  3EQ1 A;  1N3X A;  5H8S A;  1I6Q A;  1Q9D A;  1IXG A;  3HPI A;  3T9V A;  3KOS A;  5AE4 A;  3S9M C;  3PUV E;  4X9T A;  4LON B;  2I6E A;  4QRZ A;  2LAO A;  4JBZ A;  1RDZ A;  4F3G A;  4PGN A;  4GOT A;  1CE2 A;  4YMB A;  1HSE A;  1US4 A;  2WKY A;  2Y7I A;  4M4G A;  3FGS A;  2RC8 A;  1B3L A;  5ITO A;  4OFO A;  2GHA A;  5IKB A;  5I2K A;  4MLV A;  4BDM A;  4RPO A;  2V3T A;  2F3D A;  3IB1 A;  4MX6 A;  1NH8 A;  2Q74 A;  5I57 A;  3TDJ A;  1USY H;  5I3S A;  4XEQ A;  5TU0 A;  1LBW A;  2CZI A;  3R26 A;  5CMC A;  2F78 A;  5CM6 A;  1TXF A;  4PFW A;  5TP9 A;  1N0T A;  2DS9 A;  4PE3 A;  4YB6 A;  3OEM A;  5DVI A;  3E4R A;  2CZH A;  1IMD A;  4R9F A;  4NTL A;  3RGY A;  1DCU A;  1US5 A;  1IIW A;  4OVQ A;  1PBQ A;  1MXX A;  4JSO A;  1FPL A;  3MC2 A;  4HE2 A;  1MS7 A;  2DQV A;  1NUZ A;  4NG7 A;  4AQ4 A;  1B7Z A;  1NUX A;  3RNN A;  4R74 A;  4OVS A;  1BKA A;  4U4X A;  1MXW A;  1SW2 A;  4PFT A;  2Z8E A;  3U72 A;  1MY2 A;  2KLF A;  2CMO A;  4FBP A;  4F19 A;  1FTA A;  1MM7 A;  2Q2A A;  2PFZ A;  2D5W A;  4Z7E A;  4N8Y A;  3S2V A;  1TFD A;  1B2H A;  3TCG A;  2QS2 A;  2VPN A;  3I6V A;  1FQB A;  4X04 A;  5DEX A;  4F2Q A;  2E0S A;  4OEU A;  3ODB A;  1A8F A;  1MXV A;  1K9Z A;  5ET6 A;  4ISU A;  4EF1 A;  4P9K A;  1JVX A;  3CFL A;  3B6T A;  2DDK A;  1YAE A;  3O6G A;  4G8N A;  2PT2 A;  4O7M A;  4EQ7 A;  3SDF A;  2O69 A;  4R6Y A;  3H4Z A;  1M5D A;  4GXA A;  1B4Z A;  3M8U A;  4MIJ A;  1LB8 A;  3OEN A;  3SEX A;  3FUZ A;  5AA4 A;  4JVD A;  3KFM A;  1AL3 A;  4KFQ A;  4PDD A;  4YZZ A;  3BIH A;  3ROJ A;  3V5A A;  3N5L A;  3KC1 A;  2O68 A;  4WEP A;  1MQH A;  1RKM A;  4BDO A;  1AOV A;  5KDT A;  5BWJ A;  1NI9 A;  1LCF A;  1GTK A;  2KR0 A;  4R72 A;  3TTK A;  3SEV A;  1VFE A;  1FBC A;  3M3K A;  2XX9 A;  4OYV A;  1NNP A;  1FBG A;  1B32 A;  3IB2 A;  4MJO A;  2BJJ X;  4DIG A;  1Q1K A;  2P0S A;  3VVE A;  2DE4 A;  4FJP A;  2VT5 A;  1LBV A;  3O2A A;  4I3E A;  4R2B A;  5H8Q B;  4DCY A;  3QMF A;  4PET A;  3KN8 A;  3CIJ A;  3RPL B;  3BKI B;  4O94 A;  3PPP A;  1Y3N A;  3TYH A;  4YKJ A;  1NV2 A;  1LEV A;  2I4C A;  5ITP A;  1B3H A;  2F5X A;  2BJI A;  4N91 A;  1XI6 A;  1POT A;  3C36 A;  3W9V A;  4P0I A;  1DTG A;  1SBP A;  3O66 A;  4NF4 A;  5HPQ A;  5IAI A;  1LAG E;  3VLW A;  5I59 B;  4R9G A;  4H0W A;  4LA9 A;  2FVZ A;  1FTO A;  4JWY A;  3K6V A;  4N4U A;  3GBB A;  1XOC A;  4BDR A;  3RPW A;  3ZKL A;  4F29 A;  4EDP A;  1FCK A;  4NMY A;  1A40 A;  4X8R A;  4N15 A;  1FJ6 A;  5EQA A;  3M3F A;  4ELR A;  1BK4 A;  3C35 A;  1MXY A;  2XXV A;  2HEU A;  2YPN A;  3OEK A;  2NOO A;  1IMC A;  1B58 A;  4R2F A;  1EZP A;  1SI1 A;  4UA8 A;  1DTZ A;  3EHT A;  5ET5 A;  4QFL A;  4NAP A;  5DYH A;  4IGT A;  3UK4 A;  1VR5 A;  5H8N B;  4RYA A;  5JTY B;  1Y4T A;  4O7I A;  2F34 A;  2ESN A;  4GWW A;  2ZYO A;  4GL0 A;  4NHB A;  1QVS A;  2ZMB A;  2ONS A;  2DE3 A;  2QVR A;  3A09 A;  1B5H A;  1EYJ A;  4EUO A;  4ZE8 A;  3GLB A;  2XXI A;  5IM2 A;  2F6P A;  5ICQ A;  2ZZV A;  2RC7 A;  5EQ9 A;  2ZZW A;  3HCQ A;  4GWS A;  1JEV A;  3QXM A;  1QKB A;  1P1W A;  4U23 A;  3FV1 A;  2R6G E;  1FTK A;  4PFR A;  3VVD A;  4LZ8 A;  4Q30 B;  1DMB A;  4KYD A;  4NWD A;  5L8D A;  1JVY A;  4X1D A;  2D21 A;  3O6I A;  1M5B A;  1QW0 A;  3KOT A;  1WOD A;  5EYG A;  3I5O A;  3H3G A;  1MY3 A;  5TPA B;  3MPK A;  5I58 A;  3FVG A;  4NQ8 A;  2IA4 A;  4OVJ A;  1Y3Q A;  3FJG A;  1NFT A;  3IR1 A;  4FEB A;  3H6V A;  1LBB A;  2O51 A;  1FPF A;  4X1B A;  1NNF A;  5DVJ A;  2HPG A;  4RXL A;  2PX1 A;  2QS4 A;  1B46 A;  2XXX A;  1CNQ A;  1OVT A;  4G68 A;  4PDH A;  1A7L A;  4ECF A;  5FBP A;  4GXS B;  1JW4 A;  1IXC A;  3U65 A;  2F7A A;  1EZO A;  3H6W A;  1SI0 A;  3TEP A;  1ZBM A;  2WYK A;  4PF6 A;  4IO3 A;  3USD A;  3MZ9 A;  1FPG A;  3QUF A;  4YKI A;  2G93 A;  3PD9 A;  1ZIU A;  3SEU A;  4P11 A;  4P56 A;  3TKD A;  2HZL A;  1B7H A;  4N13 A;  1LCT A;  3T93 B;  5AA3 A;  5A5X B;  3R7X A;  1B6H A;  1LBZ A;  1TT1 A;  2V25 A;  2O1M A;  4ZEF A;  4HXV A;  1B5I A;  4H5G A;  2P2A A;  2XX7 A;  3CRB A;  3IAZ A;  3G7W A;  1B4H A;  1HSL A;  1WVJ A;  3PUY E;  2I48 A;  4I3Y A;  2XWV A;  4HE0 A;  4L17 A;  3MZB A;  4XKP A;  3U92 A;  3UA8 A;  1URS A;  1OQG A;  3FVK A;  2KQZ A;  1SD3 A;  1KA0 A;  1FBF A;  2XD2 A;  4KI0 E;  4RA1 A;  4ZZE A;  2Q8J A;  2GQ1 A;  1QUK A;  2ANJ A;  4N17 A;  2OCU A;  5AA1 A;  1UTB B;  2XXH A;  1BIY A;  3SEY A;  5LDZ A;  5B7D A;  5I56 B;  2R8T A;  2RCA A;  3RYD A;  1ANF A;  3C31 A;  3B50 A;  3FXB A;  1NNK A;  2I4B A;  5I57 B;  1URD A;  3O9P A;  4N8G A;  3FVN A;  4G2Z A;  1LBC A;  1MY1 A;  2DVZ A;  5DTB A;  2DWA A;  3PUX E;  2YJP A;  2HCA A;  1FTM A;  3ILU B;  4I40 A;  3FD3 A;  4P3L A;  4ZS9 A;  5CBS A;  5M2V A;  3FBP A;  3RQT A;  5KCJ B;  1NV0 A;  2WX9 A;  4ESW A;  5ESY A;  4F1U A;  4N6K A;  4P0G A;  1DPP A;  4PCD A;  2XA5 A;  4DI3 D;  4DXB A;  5LOM A;  3T9U A;  4OET A;  3B7D A;  3BFT A;  4E0X A;  1B0L A;  3T9H B;  3MW0 A;  1R1N A;  3U1O A;  1AMF A;  4QBA A;  5IZ3 A;  1MQJ A;  3QYT A;  3MVX A;  3LBS A;  1PEB A;  1SW1 A;  1KZ8 A;  3HHG A;  2NVU B;  3D4C A;  3MZ1 A;  3A3U A;  4K3F A;  1SW5 A;  1F9B A;  3HO7 A;  2Y7K A;  1MH4 A;  2UVI A;  2DWJ A;  2XXW A;  3S4U A;  3IOT A;  4U1O A;  2OK2 A;  1H76 A;  2I0B A;  3TTL A;  4RPN A;  4O8M A;  3TOD A;  5ELV A;  4JXI A;  4NF8 B;  4H46 A;  1LAH E;  2OBG A;  1XT8 A;  3IFC A;  1ZMG A;  3TMG A;  4QFO A;  2VPO A;  4I8C A;  5CMK A;  3ILT B;  4OHN A;  4NF5 B;  3TAJ A;  2F3B A;  4N6P A;  4G4P A;  3UGW A;  5DW8 A;  2DWH A;  1FPB A;  3C4M A;  4NGU A;  1A8E A;  3PD8 A;  1XHY A;  4XIG Q;  4AS5 A;  4ELQ A;  3VE1 B;  2MKZ A;  2Y5L A;  3O97 A;  5F1Q A;  1RDY A;  3PPR A;  1H43 A;  4NF0 A;  4P1E A;  4MAG A;  4ONY A;  4OMB A;  4FOR A;  1DK4 A;  2RIN A;  1B3G A;  3HFU A;  4JWX A;  2AL4 A;  3TCF A;  1B1H A;  4P1L A;  3TZA A;  2Y7P A;  4I9D A;  3G3H A;  4KCD A;  4G61 A;  3EHU A;  1IEJ A;  1NV1 A;  2A5T B;  1MQD A;  4GRK A;  4GWU A;  3LUY A;  2Q2C A;  2RKM A;  3MST A;  3DP8 A;  1H3D A;  1FPE A;  1M5C A;  4G77 A;  4IY6 A;  4ZE9 A;  3FAS A;  3OMB A;  2XWK A;  4IO6 A;  2D3I A;  3T1B A;  2HQ0 A;  2Z8F A;  1OVB A;  5AA2 B;  4WXJ A;  4KHZ E;  2VHA A;  2WBD A;  4O3B A;  4G8M A;  4ZZA A;  4N6D A;  3F11 A;  2O1L A;  4YU0 A;  4XFE A;  3IO6 A;  4OAN A;  1H45 A;  4ZDM A;  4PAF A;  4JWO A;  2DWI A;  1PB7 A;  2ZNT A;  2XWO A;  4GL8 A;  2O7U A;  5L9O A;  3N6U A;  1TFA A;  2GFE A;  3K1P A;  1DOT A;  1P1N A;  4XKN A;  2DSF A;  4F1V A;  2HFB A;  3EPE A;  4U4S A;  4GX6 A;  4H6D A;  1A99 A;  4HE1 A;  4PFY A;  2Y7W A;  4JVC A;  4N07 A;  4FED A;  1N84 A;  3QSL A;  3KBZ A;  4ND9 A;  4XKQ A;  4PBH A;  3QAX A;  2QPQ A;  1KWH A;  3MBP A;  4F3P A;  5BUU A;  4IR8 A;  1MQI A;  4PQJ A;  3LSX A;  1BP5 A;  2FYI A;  3IJX B;  3VLU A;  3K1M A;  1OLC A;  2I58 A;  1D9Y A;  1SVX B;  3K0V A;  2X7P A;  1MY0 A;  1B40 A;  5ET7 A;  4H1X A;  3E9X A;  1Q35 A;  3K02 A;  4OVR A;  2H9B A;  3BFU A;  4HS7 A;  4MH5 A;  3QK6 A;  1YXI A;  4KCC A;  4GVO A;  4OVT A;  2QFL A;  3G3G A;  1LAX A;  2HZK A;  1NV7 A;  5J1D A;  5I58 B;  3TTN A;  4TLL B;  3LC8 A;  3E13 X;  4FEC A;  3TTM A;  2XXP A;  3OO8 A;  2UVJ A;  1FQE A;  4F3S A;  1IQ7 A;  3WAF A;  3MAM A;  1B52 A;  3T96 B;  4G68 B;  2O7I A;  4U2R A;  3CFX A;  1IZ1 A;  4RK9 A;  1R9Q A;  1INP A;  3IOW A;  5I5P A;  3FXQ A;  4EQ9 A;  1LBY A;  2DP8 A;  3DP6 A;  1QKA A;  1MXZ A;  1Z7N E;  2DE2 A;  1D3K A;  5L9S A;  4GFR A;  1FQF A;  4IO4 A;  3ONM A;  4F31 B;  5JK4 A;  2DVC A;  2UYF A;  4DCX A;  1VFD A;  1B3F A;  3KC0 A;  2GHB A;  4ESX A;  2H25 A;  3PPO A;  1JNF A;  1Y20 A;  4PAI A;  3KZG A;  1P1O A;  3VV5 A;  2Q88 A;  4GWY A;  2H5Y A;  4GX4 A;  3S9N C;  3HV1 A;  2DYX A;  3UP9 A;  3IK6 B;  2Q9T A;  4BLA A;  1QJM A;  3L6H A;  2OWT A;  3RTF B;  1JET A;  4DLD A;  2H99 A;  2V3Q A;  3CSB A;  1PC3 A;  4KYS A;  4P47 A;  1S7Y A;  2Z23 A;  3PPQ A;  5ISU A;  2XXY A;  2OLB A;  4MF3 A;  4ZEC A;  2QS3 A;  1IMB A;  1PB9 A;  1NKX A;  3OOA A;  4JB7 A;  3OEL A;  4JDF A;  5IZ1 A;  3BBR A;  3GYY A;  4PFU A;  2ALU A;  1JQF A;  3K00 A;  1NV5 A;  1VDW A;  3PGF A;  4LAT A;  1B51 A;  1MRP A;  5H8F A;  4Q0C A;  4QSE A;  1MQG A;  1Y4C A;  4R6H A;  3LSF B;  2VOZ A;  3K1N A;  3AXF A;  2Z22 A;  1ATG A;  3LSL A;  3P7I A;  4RK2 A;  4OVP A;  4TOZ A;  1G0I A;  4KD5 A;  1I6A A;  4GBV A;  3CSG A;  1UTH A;  4R73 A;  4RNS A;  2PBW A;  4BDL A;  1R9L A;  2JJK A;  1S50 A;  4M1V A;  2ZZX A;  1LFH A;  2ZYN A;  2PMS A;  1NMU A;  1MDP 1;  2I3W A;  3O6H A;  4ZEK A;  4QXD A;  1N7W A;  3RN8 A;  3T22 A;  5H8Q A;  1GGG A;  4U21 A;  5IGA A;  3O29 A;  4TQU Q;  4IO5 A;  4RJZ A;  3RPL A;  2HAU A;  3KGC A;  3TCH A;  4NF6 B;  2RF1 A;  1EYI A;  1MG1 A;  3E3K A;  2Y5K A;  4YB7 A;  1POY 1;  2OWZ A;  1R6Z A;  4ZEI A;  1SPI A;  3EF7 A;  1MXU A;  1YTV A;  2V93 A;  2FIX A;  4O3A A;  1VSO A;  1D9V A;  4MHF A;  3GBA A;  4F18 A;  3SKP A;  3GZG A;  3ISP A;  4IGR A;  1EH3 A;  4C0R A;  4DDD A;  1MPD A;  5B70 A;  2VD2 A;  3V8X B;  3KSX A;  1K9Y A;  1B05 A;  3FAT A;  4XF5 A;  2R71 A;  2RCB A;  2AYS A;  4NE4 A;  3VXC A;  3N26 A;  3OO6 A;  3KJT A;  4LUB A;  4C1U A;  4MNC A;  4ELO A;  5AA2 D;  1Y3P A;  2PVU A;  3U94 A;  2OWS A;  3IX1 A;  1Y1M A;  3VLV A;  5I2K B;  3THI A;  4MEV A;  3K01 A;  3LSW A;  1SYH A;  4PTK A;  2Q8M A;  3RUM A;  3DM0 A;  1Y9U A;  2XXT A;  2H4I A;  4Z0I A;  1URG A;  1IXI A;  1M5F A;  3PTY A;  2B4L A;  4DZ1 A;  5L9M A;  1FJ9 A;  4P8B A;  1RYO A;  3KSJ A;  3MWB A;  3DP4 A;  5TP9 B;  4N81 A;  1WDN A;  4FAT A;  1FPI A;  2B4M A;  2YLN A;  1P99 A;  3MP8 A;  3B8B A;  3MYU A;  1D4N A;  4WED A;  4LVQ A;  3G3J A;  2VGQ A;  3PMV A;  1QUJ A;  1J1N A;  4OEV A;  5EYF A;  3CI8 A;  4RY1 A;  4EQB A;  4GQO A;  4OER A;  5I2N A;  2I0C A;  3T0J A;  3K6U A;  3C34 A;  3QIM A;  4IO7 A;  2QRY A;  1ZU0 A;  1H44 A;  4WKM A;  2F97 A;  1TWY A;  1II5 A;  1PB8 A;  5FHN A;  1HSJ A;  4UAB A;  1LB9 A;  1AH5 A;  2VD3 A;  3K4U A;  2ABH A;  4F22 A;  5K2Y A;  4DE8 A;  3MP6 A;  4GX3 A;  5DEX B;  1ELJ A;  1G0H A;  1FQA A;  1Z7M E;  5A5L A;  5I7I A;  4NN3 A;  1AIV A;  5H8H A;  4HCW A;  2QS1 A;  1FTJ A;  1M5E A;  3E79 A;  3JYR A;  4PF8 A;  3S9E A;  3U8Q A;  1S9T A;  4POX A;  4UAC A;  3IJO B;  4F39 A;  3KN7 A;  5IZZ A;  3FXR A;  4GLI A;  3Q29 A;  5DT6 A;  1FQC A;  2E1S A;  4OTE A;  2ZNU A;  3MUQ A;  5A5X A;  3KBR A;  5HBC A;  2X26 A;  5AA4 B;  2F35 A;  3B6Q A;  4H67 A;  5K2X A;  3FJ7 A;  4PAK A;  2UYE A;  2QMX A;  3UN6 A;  3EHS A;  3Q26 A;  3TQW A;  4HW8 A;  3JZJ A;  4MFI A;  1IUD A;  5KDT B;  1I69 A;  1A55 A;  1DBZ A;  1EYK A;  3UIF A;  3SEW A;  4C1T A;  3GXA A;  1GR2 A;  1UTB A;  2PCR A;  1LST A;  1N7X A;  1NH7 A;  4DXC A;  5DVF A;  3PMX A;  5I56 A;  3Q28 A;  4BDQ A;  3I3V A;  3VVF A;  4KYE A;  4QFP A;  3HHF A;  3KEI A;  3TFL A;  4YB5 A;  3ECR A;  2F36 A;  5J16 A;  4PE5 B;  3FIR A;  4AS4 A;  3CG3 A;  1MDQ A;  2AIX A;  3CG1 A;  1XVX A;  4POW A;  1FBP A;  5HM4 B;  2QVU A;  4IO2 A;  3W15 C;  4KPT A;  4NF4 B;  1N04 A;  1JW5 A;  3WAE A;  1B5J A;  4F3B A;  3OSR A;  4GWX A;  2ONR A;  4LN5 A;  5CMB A;  2OZZ A;  4YAH X;  5KCJ A;  3T66 A;  2GH9 A;  5EHS A;  1YPN A;  1P1U A;  2F7C A;  4QFK A;  2F7B A;  3H6T A;  4F1Y A;  2M8C A;  1PDA A;  4MBP A;  5I84 A;  1LFI A;  3V89 B;  4LP2 B;  3A3C A;  3IOV A;  3D1R A;  3FXU A;  3TTR A;  4LZ5 A;  3FJM A;  4OXV A;  1XS5 A;  2HAV A;  1LGB C;  4ELP A;  1FBE A;  1YCJ A;  3PU5 A;  4JVI A;  1DPE A;  1RDX A;  1YYZ A;  4FE8 A;  3N94 A;  1B9J A;  2NUV A;  2I49 A;  2PFY A;  2XD3 A;  2FIE A;  3OO9 A;  1NV3 A;  4OQO A;  3MVZ A;  1IIT A;  3FV2 A;  3R6U A;  3RY3 A;  4AB6 A;  1CB6 A;  1B3E A;  4PGP A;  5KZT A;  1O7T A;  2ZXT A;  4FAJ A;  3PUW E;  3S9L C;  2ZYK A;  1JEU A;  4NF8 A;  4OFJ A;  5FTI A;  3VDF A;  1O64 A;  4JSD A;  3IO4 A;  4NWC A;  5H8F B;  3C9H A;  2FBP A;  4NF5 A;  4F2O A;  2FA7 A;  1Y1Z A;  2P3V A;  1SDX A;  4NX1 A;  3SET A;  3TUS A;  1FRP A;  1QGX A;  4I1D A;  4U22 A;  5T3J A;  5CRY A;  2XX8 A;  2P1S A;  1UTH B;  3SER A;  3OD7 A;  3HN0 A;  2Q89 A;  3G3I A;  2REJ A;  5CBR A;  4QHQ A;  1NUW A;  3OO7 A;  3H7M A;  4MMP A;  3PMW A;  2Y7R A;  2HXW A;  4O3C A;  1I6B A;  4BDN A;  4LQ2 A;  1NNT A;  2OX3 A;  4G8H A;  4QFN A;  1FQD A;  1IXH A;  2A5T A;  3OSQ A;  4GIZ A;  1QUI A;  4E0W A;  2PT1 A;  2DOJ A;  1JP4 A;  2I3V A;  1USY E;  1MM6 A;  3CFZ A;  3LUZ A;  2XXR A;  2REG A;  4GWZ A;  4QSC A;  5AA2 A;  4AB5 A;  2FHY A;  3G3K A;  4MNI A;  4MNP A;  4OFL A;  2NXO A;  3ZS6 A;  3RLF E;  4EXL A;  3IB0 A;  1FW0 A;  2IEE A;  4HTG A;  3H6U A;  1DSN A;  3QUJ A;  4THI A;  3TEL A;  1IMA A;  3D4G A;  4KXP A;  3RT8 A;  3RT6 B;  3Q25 A;  3EN3 A;  1NUY A;  2B3B A;  1LFG A;  1T0K A;  4H5F A;  1N3W A;  1XVY A;  3IL1 B;  4NED A;  4GF8 A;  1KA1 A;  4FIM A;  4XXU A;  2HHM A;  4H45 A;  1VE4 A;  1NL5 A;  1A54 A;  4PFB A;  5CC2 A;  2ZNS A;  3VXB A;  5JEI A;  2GRV A;  2WYP A;  3PV0 E;  3E78 A;  3W9W A;  1EU8 A;  1LLS A;  3MJN A;  4QF9 A;  3HST A;  1FTL A;  3MPL A;  3N6T A;  3IFA A;  3RTW B;  3TQL A;  2L5V A;  4GBW A;  4DXU A;  4YIC A;  2CEY A;  3C32 A;  4YKP A;  3UOR A;  4MCO A;  1OLA A;  1MPB A;  1BTJ A;  2B65 A;  2VP1 A;  4I62 A;  4Q5T A;  2QJE A;  1MPC A;  2UVH A;  3DLN A;  1MH3 A;  2AL5 A; 
#chains in the Genus database with same CATH homology
 5I2N B;  1SQY A;  2QL3 A;  4X48 A;  3T9X B;  4Q8R A;  3MQ9 A;  4H8J A;  3ZKK A;  5F7V A;  4LQ5 A;  2A5S A;  2W7Y A;  3KN3 A;  3DEL B;  3H06 B;  4KQP A;  2UVG A;  3MVY A;  1ZTY A;  3ZSF A;  1UQW A;  2PYY A;  4IY5 A;  2XXQ A;  2OJT A;  3M3L A;  2H98 A;  5H8H B;  1QUL A;  5I59 A;  3V83 A;  3FZV A;  3IOU A;  1UIU A;  2XXU A;  4U1Z A;  3SES A;  1JW1 A;  1PBP A;  4GD5 A;  2DXY A;  4R75 A;  1EZ9 A;  3U93 A;  4EXK A;  1OIB A;  2B3F A;  1GV8 A;  1L5T A;  4H65 A;  3KJ7 A;  4OEN A;  5FHM A;  4R6K A;  3IOR A;  3JV9 A;  1LAF E;  4HCY A;  3K2D A;  4TLM B;  1P1Q A;  1OQH A;  3LR1 A;  5H8N A;  5JTY A;  2ZYM A;  2DXR A;  4XTC Q;  2Y84 A;  1BLF A;  2XHD A;  1B0H A;  4YMA A;  2R9J A;  2NWJ A;  5EHM A;  1RYX A;  3C33 A;  3L6G A;  1SW4 A;  1N76 A;  5FTH A;  3MP1 A;  2O84 X;  4PP0 A;  4YKK A;  1ZKB A;  4G68 C;  5FHO A;  4GWO A;  3O28 A;  4XKR A;  2X7Q A;  4EF2 A;  2UXA A;  3B6W A;  2F8D A;  4KR5 A;  1ZJL A;  4MLQ A;  2QMW A;  2F6G A;  3G3F A;  1OMP A;  3MVW A;  5TPA A;  3CVG A;  3TPA A;  3CR9 A;  4IB2 A;  2RC9 A;  1B1X A;  2V3U A;  3VFJ A;  2QSX A;  3K6X A;  2CZL A;  1O63 A;  1SYI A;  4H8I A;  3H03 A;  1MY4 A;  4OWD A;  2THI A;  5ICT A;  3KG2 A;  2ONK E;  5CMM A;  3PPN A;  2O6A A;  5CI5 A;  1GVC A;  3PUZ E;  4NF6 A;  2Z8D A;  1XC1 A;  1ZLQ A;  3OXN A;  3FVO A;  4OES A;  2V84 A;  2FNC A;  1UIV A;  4ZEB A;  3K6W A;  2G29 A;  1B7U A;  4QSD A;  3Q27 A;  4OZ9 A;  4ZED A;  4LZ7 A;  3EQ1 A;  1N3X A;  5H8S A;  1I6Q A;  1IXG A;  3HPI A;  3T9V A;  3KOS A;  5AE4 A;  3S9M C;  3PUV E;  4X9T A;  4LON B;  2I6E A;  4QRZ A;  2LAO A;  4JBZ A;  4F3G A;  4GOT A;  1CE2 A;  4YMB A;  1HSE A;  1US4 A;  2WKY A;  2Y7I A;  4M4G A;  3FGS A;  2RC8 A;  1B3L A;  5ITO A;  4OFO A;  2GHA A;  5IKB A;  5I2K A;  4MLV A;  4BDM A;  4RPO A;  2V3T A;  3IB1 A;  1NH8 A;  5I57 A;  3TDJ A;  1USY H;  5TU0 A;  3R26 A;  5CMC A;  2F78 A;  5CM6 A;  1TXF A;  4PFW A;  5TP9 A;  1N0T A;  2DS9 A;  4YB6 A;  3OEM A;  5DVI A;  3E4R A;  4R9F A;  4NTL A;  3RGY A;  1US5 A;  1IIW A;  1PBQ A;  1MXX A;  4JSO A;  3MC2 A;  1MS7 A;  2DQV A;  4AQ4 A;  1B7Z A;  3RNN A;  4R74 A;  1BKA A;  4U4X A;  1MXW A;  1SW2 A;  4PFT A;  2Z8E A;  3U72 A;  1MY2 A;  2KLF A;  2CMO A;  4F19 A;  1MM7 A;  2Q2A A;  2D5W A;  4Z7E A;  3S2V A;  1TFD A;  1B2H A;  3TCG A;  2QS2 A;  3I6V A;  1FQB A;  5DEX A;  4F2Q A;  2E0S A;  4OEU A;  3ODB A;  1A8F A;  1MXV A;  4ISU A;  4EF1 A;  1JVX A;  3CFL A;  3B6T A;  1YAE A;  3O6G A;  4G8N A;  2PT2 A;  4EQ7 A;  3SDF A;  2O69 A;  4R6Y A;  3H4Z A;  1M5D A;  4GXA A;  1B4Z A;  3M8U A;  1LB8 A;  3OEN A;  3SEX A;  3FUZ A;  5AA4 A;  3KFM A;  1AL3 A;  4KFQ A;  4YZZ A;  3V5A A;  3N5L A;  2O68 A;  4WEP A;  1MQH A;  1RKM A;  4BDO A;  1AOV A;  5KDT A;  5BWJ A;  1LCF A;  1GTK A;  4R72 A;  3TTK A;  3SEV A;  1VFE A;  3M3K A;  2XX9 A;  4OYV A;  1NNP A;  1B32 A;  3IB2 A;  2BJJ X;  4DIG A;  1Q1K A;  2P0S A;  3VVE A;  2DE4 A;  4FJP A;  3O2A A;  4R2B A;  5H8Q B;  4DCY A;  4PET A;  3KN8 A;  3CIJ A;  3BKI B;  3PPP A;  1Y3N A;  3TYH A;  4YKJ A;  2I4C A;  5ITP A;  1B3H A;  2F5X A;  3C36 A;  1POT A;  3W9V A;  4P0I A;  1DTG A;  1SBP A;  3O66 A;  4NF4 A;  5HPQ A;  5IAI A;  1LAG E;  3VLW A;  5I59 B;  4R9G A;  4H0W A;  4LA9 A;  1FTO A;  4JWY A;  3K6V A;  3GBB A;  1XOC A;  4BDR A;  3RPW A;  3ZKL A;  4F29 A;  4EDP A;  1FCK A;  4NMY A;  1A40 A;  3M3F A;  4ELR A;  3C35 A;  1MXY A;  2XXV A;  2HEU A;  2YPN A;  3OEK A;  2NOO A;  1B58 A;  4R2F A;  1EZP A;  1SI1 A;  4UA8 A;  1DTZ A;  3EHT A;  4QFL A;  5DYH A;  4IGT A;  3UK4 A;  1VR5 A;  5H8N B;  4RYA A;  5JTY B;  1Y4T A;  2F34 A;  2ESN A;  2ZYO A;  4GL0 A;  1QVS A;  2ZMB A;  2ONS A;  2DE3 A;  3A09 A;  1B5H A;  4EUO A;  4ZE8 A;  3GLB A;  2XXI A;  2F6P A;  5ICQ A;  2RC7 A;  3HCQ A;  1JEV A;  3QXM A;  1QKB A;  1P1W A;  4U23 A;  3FV1 A;  2R6G E;  1FTK A;  3VVD A;  4LZ8 A;  4Q30 B;  1DMB A;  4KYD A;  4NWD A;  5L8D A;  1JVY A;  4X1D A;  2D21 A;  3O6I A;  1M5B A;  1QW0 A;  3KOT A;  1WOD A;  3I5O A;  3H3G A;  1MY3 A;  5TPA B;  3MPK A;  5I58 A;  3FVG A;  2IA4 A;  4OVJ A;  1Y3Q A;  3FJG A;  1NFT A;  3IR1 A;  4FEB A;  3H6V A;  1LBB A;  2O51 A;  4X1B A;  1NNF A;  5DVJ A;  4RXL A;  2PX1 A;  2QS4 A;  1B46 A;  2XXX A;  1OVT A;  4G68 A;  1A7L A;  4ECF A;  4GXS B;  1JW4 A;  1IXC A;  2F7A A;  1EZO A;  3H6W A;  1SI0 A;  3TEP A;  1ZBM A;  4IO3 A;  3USD A;  3MZ9 A;  3QUF A;  4YKI A;  2G93 A;  3PD9 A;  1ZIU A;  3SEU A;  4P11 A;  3TKD A;  2HZL A;  1B7H A;  4N13 A;  1LCT A;  3T93 B;  5AA3 A;  5A5X B;  3R7X A;  1B6H A;  1TT1 A;  2V25 A;  2O1M A;  4ZEF A;  1B5I A;  4H5G A;  2P2A A;  2XX7 A;  3CRB A;  3IAZ A;  3G7W A;  1B4H A;  1HSL A;  1WVJ A;  3PUY E;  2I48 A;  4L17 A;  3MZB A;  4XKP A;  3U92 A;  3UA8 A;  1URS A;  1OQG A;  3FVK A;  1SD3 A;  2XD2 A;  4KI0 E;  4RA1 A;  4ZZE A;  2Q8J A;  1QUK A;  2ANJ A;  2OCU A;  5AA1 A;  1UTB B;  2XXH A;  1BIY A;  3SEY A;  5B7D A;  5I56 B;  2RCA A;  1ANF A;  3C31 A;  1NNK A;  2I4B A;  5I57 B;  1URD A;  3O9P A;  3FVN A;  4G2Z A;  1LBC A;  1MY1 A;  2DVZ A;  5DTB A;  2DWA A;  3PUX E;  2YJP A;  2HCA A;  1FTM A;  3ILU B;  3FD3 A;  4ZS9 A;  5CBS A;  5M2V A;  3RQT A;  5KCJ B;  4ESW A;  4F1U A;  4P0G A;  1DPP A;  4DXB A;  5LOM A;  3T9U A;  4OET A;  3B7D A;  3BFT A;  4E0X A;  1B0L A;  3T9H B;  3MW0 A;  1R1N A;  3U1O A;  1AMF A;  1MQJ A;  3QYT A;  3MVX A;  3LBS A;  1PEB A;  1SW1 A;  3HHG A;  2NVU B;  3D4C A;  3MZ1 A;  3A3U A;  4K3F A;  1SW5 A;  1F9B A;  3HO7 A;  2Y7K A;  1MH4 A;  2UVI A;  2DWJ A;  2XXW A;  3S4U A;  3IOT A;  4U1O A;  2OK2 A;  1H76 A;  2I0B A;  3TTL A;  4RPN A;  3TOD A;  5ELV A;  4JXI A;  4NF8 B;  1LAH E;  2OBG A;  1XT8 A;  3TMG A;  1ZMG A;  4QFO A;  4I8C A;  5CMK A;  3ILT B;  4OHN A;  4NF5 B;  3TAJ A;  4N6P A;  4G4P A;  3UGW A;  2DWH A;  3C4M A;  1A8E A;  3PD8 A;  1XHY A;  4XIG Q;  4ELQ A;  3VE1 B;  3O97 A;  5F1Q A;  3PPR A;  1H43 A;  4ONY A;  4OMB A;  4FOR A;  2RIN A;  1B3G A;  4JWX A;  2AL4 A;  3TCF A;  1B1H A;  3TZA A;  2Y7P A;  4I9D A;  3G3H A;  4KCD A;  3EHU A;  1IEJ A;  2A5T B;  1MQD A;  4GRK A;  3LUY A;  2Q2C A;  2RKM A;  3DP8 A;  1H3D A;  1M5C A;  4G77 A;  4IY6 A;  4ZE9 A;  3FAS A;  3OMB A;  4IO6 A;  2D3I A;  2HQ0 A;  2Z8F A;  1OVB A;  5AA2 B;  4WXJ A;  4KHZ E;  2VHA A;  4O3B A;  4G8M A;  4ZZA A;  3F11 A;  2O1L A;  4YU0 A;  3IO6 A;  1H45 A;  4ZDM A;  4JWO A;  2DWI A;  1PB7 A;  2ZNT A;  4GL8 A;  2O7U A;  5L9O A;  3N6U A;  1TFA A;  2GFE A;  3K1P A;  1DOT A;  1P1N A;  4XKN A;  2DSF A;  4F1V A;  2HFB A;  3EPE A;  4U4S A;  4H6D A;  1A99 A;  4PFY A;  2Y7W A;  4N07 A;  4FED A;  1N84 A;  3QSL A;  4ND9 A;  4XKQ A;  3QAX A;  2QPQ A;  1KWH A;  3MBP A;  4F3P A;  5BUU A;  1MQI A;  4PQJ A;  3LSX A;  1BP5 A;  2FYI A;  3IJX B;  3VLU A;  3K1M A;  1OLC A;  2I58 A;  1D9Y A;  1SVX B;  3K0V A;  2X7P A;  1MY0 A;  1B40 A;  4H1X A;  3E9X A;  1Q35 A;  3K02 A;  2H9B A;  3BFU A;  4HS7 A;  4MH5 A;  3QK6 A;  4KCC A;  4GVO A;  3G3G A;  1LAX A;  2HZK A;  5J1D A;  5I58 B;  3TTN A;  4TLL B;  3LC8 A;  3E13 X;  4FEC A;  3TTM A;  2XXP A;  3OO8 A;  2UVJ A;  1FQE A;  4F3S A;  1IQ7 A;  3WAF A;  3MAM A;  1B52 A;  3T96 B;  4G68 B;  2O7I A;  4U2R A;  3CFX A;  1IZ1 A;  4RK9 A;  1R9Q A;  3IOW A;  3FXQ A;  4EQ9 A;  2DP8 A;  3DP6 A;  1QKA A;  1MXZ A;  1Z7N E;  2DE2 A;  1D3K A;  5L9S A;  4GFR A;  1FQF A;  4IO4 A;  3ONM A;  4F31 B;  5JK4 A;  2DVC A;  2UYF A;  4DCX A;  1VFD A;  1B3F A;  2GHB A;  4ESX A;  2H25 A;  3PPO A;  1JNF A;  1Y20 A;  3KZG A;  1P1O A;  3VV5 A;  2Q88 A;  2H5Y A;  3S9N C;  3HV1 A;  2DYX A;  3UP9 A;  3IK6 B;  2Q9T A;  4BLA A;  1QJM A;  3L6H A;  2OWT A;  3RTF B;  1JET A;  4DLD A;  2H99 A;  2V3Q A;  3CSB A;  1PC3 A;  4KYS A;  1S7Y A;  2Z23 A;  3PPQ A;  5ISU A;  2XXY A;  2OLB A;  4MF3 A;  4ZEC A;  2QS3 A;  1PB9 A;  1NKX A;  3OOA A;  4JB7 A;  3OEL A;  4JDF A;  3BBR A;  4PFU A;  2ALU A;  1JQF A;  3K00 A;  3PGF A;  4LAT A;  1B51 A;  1MRP A;  5H8F A;  4Q0C A;  4QSE A;  1MQG A;  1Y4C A;  4R6H A;  3LSF B;  2VOZ A;  3K1N A;  3AXF A;  2Z22 A;  1ATG A;  3LSL A;  3P7I A;  4RK2 A;  4TOZ A;  4KD5 A;  1I6A A;  3CSG A;  1UTH A;  4R73 A;  4RNS A;  2PBW A;  4BDL A;  1R9L A;  1S50 A;  4M1V A;  1LFH A;  2ZYN A;  2PMS A;  1NMU A;  1MDP 1;  2I3W A;  3O6H A;  4ZEK A;  1N7W A;  3RN8 A;  3T22 A;  5H8Q A;  1GGG A;  4U21 A;  3O29 A;  4TQU Q;  4IO5 A;  4RJZ A;  2HAU A;  3KGC A;  3TCH A;  4NF6 B;  2RF1 A;  1MG1 A;  3E3K A;  4YB7 A;  1POY 1;  1R6Z A;  4ZEI A;  3EF7 A;  1MXU A;  1YTV A;  2V93 A;  4O3A A;  1VSO A;  1D9V A;  3GBA A;  4F18 A;  3SKP A;  3GZG A;  4IGR A;  1EH3 A;  4C0R A;  4DDD A;  1MPD A;  5B70 A;  2VD2 A;  3V8X B;  3KSX A;  1B05 A;  3FAT A;  2R71 A;  2RCB A;  2AYS A;  4NE4 A;  3VXC A;  3N26 A;  3OO6 A;  3KJT A;  4LUB A;  4C1U A;  4ELO A;  5AA2 D;  1Y3P A;  2PVU A;  3U94 A;  2OWS A;  3IX1 A;  1Y1M A;  3VLV A;  5I2K B;  3THI A;  3K01 A;  3LSW A;  1SYH A;  3RUM A;  3DM0 A;  1Y9U A;  2XXT A;  2H4I A;  4Z0I A;  1URG A;  1IXI A;  1M5F A;  4DZ1 A;  5L9M A;  1RYO A;  3KSJ A;  3MWB A;  3DP4 A;  5TP9 B;  1WDN A;  4FAT A;  2YLN A;  1P99 A;  3MP8 A;  1D4N A;  4WED A;  4LVQ A;  3G3J A;  2VGQ A;  3PMV A;  1QUJ A;  1J1N A;  4OEV A;  5EYF A;  3CI8 A;  4RY1 A;  4EQB A;  4GQO A;  4OER A;  5I2N A;  2I0C A;  3K6U A;  3C34 A;  3QIM A;  4IO7 A;  2QRY A;  1ZU0 A;  1H44 A;  4WKM A;  2F97 A;  1TWY A;  1II5 A;  1PB8 A;  5FHN A;  1HSJ A;  1LB9 A;  1AH5 A;  2VD3 A;  3K4U A;  2ABH A;  4F22 A;  5K2Y A;  4DE8 A;  3MP6 A;  5DEX B;  1ELJ A;  1FQA A;  1Z7M E;  1AIV A;  5H8H A;  4HCW A;  2QS1 A;  1FTJ A;  1M5E A;  3JYR A;  3S9E A;  3U8Q A;  1S9T A;  4POX A;  4UAC A;  3IJO B;  4F39 A;  3KN7 A;  3FXR A;  4GLI A;  3Q29 A;  5DT6 A;  1FQC A;  2E1S A;  4OTE A;  2ZNU A;  3MUQ A;  5A5X A;  3KBR A;  5HBC A;  2X26 A;  5AA4 B;  2F35 A;  3B6Q A;  4H67 A;  5K2X A;  3FJ7 A;  2UYE A;  2QMX A;  3UN6 A;  3EHS A;  3Q26 A;  3TQW A;  4HW8 A;  3JZJ A;  4MFI A;  1IUD A;  5KDT B;  1I69 A;  1A55 A;  3UIF A;  3SEW A;  4C1T A;  3GXA A;  1GR2 A;  1UTB A;  1LST A;  1N7X A;  1NH7 A;  4DXC A;  5DVF A;  3PMX A;  5I56 A;  3Q28 A;  4BDQ A;  3I3V A;  3VVF A;  4KYE A;  4QFP A;  3HHF A;  3KEI A;  3TFL A;  4YB5 A;  3ECR A;  2F36 A;  4PE5 B;  3FIR A;  3CG3 A;  1MDQ A;  2AIX A;  3CG1 A;  1XVX A;  4POW A;  5HM4 B;  4IO2 A;  3W15 C;  4KPT A;  4NF4 B;  1N04 A;  1JW5 A;  3WAE A;  1B5J A;  4F3B A;  3OSR A;  2ONR A;  5CMB A;  2OZZ A;  4YAH X;  5KCJ A;  3T66 A;  2GH9 A;  5EHS A;  1YPN A;  1P1U A;  2F7C A;  4QFK A;  2F7B A;  3H6T A;  4F1Y A;  2M8C A;  1PDA A;  4MBP A;  5I84 A;  1LFI A;  3V89 B;  4LP2 B;  3A3C A;  3IOV A;  3FXU A;  3TTR A;  4LZ5 A;  3FJM A;  4OXV A;  1XS5 A;  2HAV A;  1LGB C;  4ELP A;  1YCJ A;  3PU5 A;  1DPE A;  4FE8 A;  3N94 A;  1B9J A;  2NUV A;  2I49 A;  2XD3 A;  3OO9 A;  4OQO A;  3MVZ A;  1IIT A;  3FV2 A;  3R6U A;  3RY3 A;  4AB6 A;  1CB6 A;  1B3E A;  5KZT A;  1O7T A;  2ZXT A;  4FAJ A;  3PUW E;  3S9L C;  2ZYK A;  1JEU A;  4NF8 A;  4OFJ A;  5FTI A;  3VDF A;  1O64 A;  4JSD A;  3IO4 A;  4NWC A;  5H8F B;  3C9H A;  4NF5 A;  4F2O A;  2FA7 A;  1Y1Z A;  1SDX A;  3SET A;  3TUS A;  4I1D A;  4U22 A;  5CRY A;  2XX8 A;  2P1S A;  1UTH B;  3SER A;  3OD7 A;  3HN0 A;  2Q89 A;  3G3I A;  2REJ A;  5CBR A;  4QHQ A;  3OO7 A;  3H7M A;  3PMW A;  2Y7R A;  2HXW A;  4O3C A;  1I6B A;  4BDN A;  4LQ2 A;  1NNT A;  4G8H A;  4QFN A;  1FQD A;  1IXH A;  2A5T A;  3OSQ A;  4GIZ A;  1QUI A;  4E0W A;  2PT1 A;  2DOJ A;  2I3V A;  1USY E;  1MM6 A;  3CFZ A;  2XXR A;  2REG A;  4QSC A;  5AA2 A;  4AB5 A;  3G3K A;  4OFL A;  2NXO A;  3ZS6 A;  3RLF E;  4EXL A;  1FW0 A;  3IB0 A;  2IEE A;  4HTG A;  3H6U A;  1DSN A;  3QUJ A;  4THI A;  3TEL A;  3D4G A;  3RT8 A;  3RT6 B;  3Q25 A;  3EN3 A;  2B3B A;  1LFG A;  1T0K A;  4H5F A;  1N3W A;  1XVY A;  3IL1 B;  4NED A;  4GF8 A;  4FIM A;  4XXU A;  1VE4 A;  1NL5 A;  1A54 A;  5CC2 A;  2ZNS A;  3VXB A;  5JEI A;  2GRV A;  3PV0 E;  3W9W A;  1EU8 A;  1LLS A;  3MJN A;  4QF9 A;  3HST A;  1FTL A;  3MPL A;  3N6T A;  3RTW B;  3TQL A;  4DXU A;  4YIC A;  3C32 A;  4YKP A;  3UOR A;  1OLA A;  1MPB A;  1BTJ A;  2B65 A;  2VP1 A;  4I62 A;  4Q5T A;  2QJE A;  1MPC A;  2UVH A;  3DLN A;  1MH3 A;  2AL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...