3KFMA

Crystal structure of the glua4 ligand-binding domain l651v mutant in complex with kainate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
257
Chain Sequence
TVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLAKQTEIAYGTVDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 4
publication title Enhanced efficacy without further cleft closure: reevaluating twist as a source of agonist efficacy in AMPA receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 80
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kfmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kfmA02
2I3VA 4ZEBA 1ANFA 1Y1MA 1Y20A 3LBSA 4PETA 3BFTA 1IXGA 1NH7A 3VXCA 3D4CA 3TKDA 1B6HA 1QKAA 1TFDA 5H8FB 4H67A 3JV9A 3HHGA 4YB6A 4H1XA 4HCWA 1N3XA 3K0VA 1B3FA 1MDQA 1I69A 4F3PA 3TPAA 3KOSA 2V25A 1Z7NE 3AXFA 2GHBA 3MZBA 4NE4A 1B5JA 1QUKA 4JWYA 1S7YA 1B58A 3O97A 2GRVA 3C9HA 5ICTA 3MP8A 2OWTA 5H8SA 3LC8A 4U1OA 3KG2A 2ZXTA 3LSWA 4OVJA 3MP6A 4JWOA 3IORA 1B0LA 3C34A 5CMCA 1QJMA 1YCJA 2HEUA 1WDNA 3UP9A 3S9LC 4EXKA 3G3JA 1H3DA 5DVJA 4WEDA 4QFLA 1POTA 3TELA 4XKRA 2HXWA 2E0SA 1OLCA 1QUIA 3K1PA 4I62A 3L6HA 3CSGA 3S9EA 5EHMA 1A99A 2F97A 5JK4A 4ESWA 1SW1A 3IOUA 5JTYA 1EZ9A 1UIVA 2P0SA 1UTBA 2XXYA 5H8FA 2W7YA 2ESNA 2XXIA 2R6GE 4O3BA 3O2AA 4RXLA 2YPNA 3H06B 1II5A 4ONYA 3V83A 3C32A 1SVXB 4DZ1A 5AA4B 2DXRA 3G7WA 1B2HA 1NL5A 3S2VA 2HAUA 4DLDA 4F1YA 4GD5A 3RLFE 1LBBA 4NTLA 1N84A 1UQWA 2D5WA 3RGYA 2F7CA 1AOVA 1AL3A 4R2FA 2UVJA 1MY4A 3RUMA 5CBSA 1D9YA 1OLAA 1LB8A 3DLNA 1ATGA 5CMBA 1JW1A 3QSLA 3TTRA 4YICA 5ITPA 5ICQA 1URDA 4FORA 2DQVA 2DWIA 1SYIA 4GIZA 3JYRA 1FTMA 1USYH 1Y4TA 4OYVA 2DS9A 4R72A 4FE8A 1MQIA 1HSEA 1NH8A 4KYDA 3GXAA 2X26A 3O6HA 1AMFA 2QPQA 5L9OA 2O1LA 4OHNA 3S9NC 3KN3A 1LAGE 3Q27A 1B3GA 3O28A 4ESXA 4BLAA 1Y3QA 4IO4A 3HHFA 4F22A 3E13X 1N3WA 2M8CA 3OO6A 1H76A 1URGA 3CG1A 3F11A 3IL1B 1NNFA 3GLBA 1MDP1 3I6VA 3OEMA 3LSXA 1HSJA 1LCTA 2UVIA 3SESA 5EHSA 1IXHA 2UVHA 2AYSA 3MVXA 1MXWA 4FJPA 4LA9A 5I2NB 3IO4A 4OETA 1MXYA 2QRYA 1B7HA 1LBCA 4POWA 3FD3A 3K2DA 4KYSA 3O6GA 4HW8A 5I84A 3HSTA 2Q89A 5TPAB 2VD3A 1O7TA 4ZECA 3CFXA 4LVQA 2ONKE 4BDNA 4F1VA 3EHTA 4YKIA 2DXYA 4U23A 4G8NA 1H44A 1N7WA 3GBAA 2DOJA 3QK6A 4RPOA 4RA1A 2ONRA 1FQCA 5BUUA 1MXVA 2ZYOA 4G2ZA 4PFWA 1DTZA 1JW4A 3OSQA 2XXUA 1A55A 3TTLA 5LOMA 2Q9TA 4XTCQ 1LAHE 5IKBA 1LFIA 1IXCA 4E0WA 3SERA 5KZTA 4OFOA 3MVWA 4DCXA 1DOTA 1XHYA 5I2NA 4MBPA 3H4ZA 4JXIA 3OOAA 1QW0A 3VLWA 3VXBA 1FTOA 2ZYNA 2VD2A 4OFJA 4KFQA 4EUOA 3MJNA 1MXUA 1BIYA 3GBBA 2DVCA 3BFUA 3H7MA 3G3KA 5DEXA 4U4XA 2QJEA 3QXMA 4XKPA 3OO7A 2HZKA 4KPTA 4KQPA 5I56B 4LUBA 2O7IA 2V3QA 1Y1ZA 2X7QA 3PD8A 1MQGA 4ZZAA 2HFBA 2GFEA 1A54A 5HPQA 3H6WA 3FV1A 4IO2A 4PE5B 4LZ5A 4JDFA 1JQFA 3ILTB 2LAOA 1SI1A 3MVYA 3HCQA 5H8HB 4PQJA 1S50A 3MBPA 3DM0A 5AA1A 1URSA 3BKIB 4EDPA 3R26A 5CI5A 2Y7WA 2NUVA 1UTHA 1US5A 4X1BA 4LATA 1SW2A 2F36A 4R74A 1USYE 3U93A 4ZE8A 3JZJA 1O63A 1P1WA 1GR2A 3FVNA 5FTHA 2XX8A 3N6UA 1ZBMA 3B6QA 4QFOA 5I57B 1MY2A 2ZNSA 4BDLA 3KBRA 3KFMA 1MRPA 4P0IA 3S4UA 1B4HA 5L8DA 4F1UA 3CR9A 2HCAA 5CBRA 1NNKA 3UGWA 4O3CA 1LCFA 3W15C 5I56A 2REJA 4F2OA 4MFIA 1F9BA 2IEEA 5KDTA 1SD3A 3UORA 4GXAA 3VE1B 2F78A 1EZPA 1P1NA 3TAJA 3FVKA 3MVZA 2RC7A 1P99A 3TDJA 1NNPA 5H8HA 4ZE9A 3H03A 3CRBA 4GWOA 2E1SA 4QFPA 2ZNTA 5K2YA 4JBZA 5M2VA 3PGFA 5CM6A 3VVEA 1A8EA 2QL3A 2PX1A 4ND9A 1YTVA 1B0HA 1Y4CA 1PB9A 4NWCA 2Y7PA 5DTBA 3LSFB 1GVCA 2XXRA 1MPBA 2XD2A 1CE2A 3N5LA 3CIJA 1LB9A 2QS1A 3Q29A 5B7DA 1MY3A 2Y7IA 4IY5A 4H5GA 2RC9A 4BDRA 4ZS9A 4OZ9A 4ISUA 4GXSB 2B65A 2QS3A 3T9VA 4F39A 4RJZA 4YMAA 4JSOA 2QMWA 2XXVA 3HO7A 2F35A 2AL5A 3IR1A 5IAIA 3QUFA 5CC2A 5DT6A 1N7XA 3DP6A 3UK4A 3K1NA 3G3FA 2Q2CA 4FEBA 2UYEA 3PPQA 1UIUA 3M3LA 3RQTA 4QSEA 3TFLA 2P2AA 5FTIA 2RINA 2I49A 3K6VA 4OEVA 4XXUA 3K01A 4NF5B 4YAHX 3QAXA 3OD7A 4R73A 1LFHA 4LONB 3N6TA 1L5TA 3HV1A 3MQ9A 4EQBA 2RF1A 2XXQA 4O3AA 2RKMA 4ELPA 4YKKA 1B51A 4F3SA 3WAEA 2OLBA 4AQ4A 3Q26A 3MZ9A 2P1SA 4FECA 1FQFA 2OBGA 4WKMA 5H8NB 2I48A 3ILUB 3PUZE 2WKYA 1DPPA 1IZ1A 2DWAA 1B5HA 4X1DA 2OZZA 2HQ0A 4R75A 3VVDA 1MQJA 4C1TA 3PPPA 4AB6A 4F29A 4HCYA 1QULA 2XXXA 2V3UA 1ZTYA 3FV2A 1H43A 1PB8A 2DVZA 4Q30B 3TZAA 3FUZA 2Z23A 4ELRA 2NXOA 3TEPA 2ABHA 4IO6A 4ZZEA 3TTMA 1AIVA 3N26A 1LFGA 3FXUA 3MPLA 3K6WA 1B46A 2IA4A 2REGA 2F6GA 2DE3A 1MH4A 4KYEA 5HBCA 4JSDA 5H8QB 4PP0A 1EH3A 3FJMA 4N07A 4YMBA 4LQ2A 3TYHA 3O9PA 3ECRA 3T66A 2XX7A 2XXHA 1POY1 1PBQA 4U2RA 2PVUA 1ZU0A 2ALUA 3WAFA 5AA4A 2VP1A 1DPEA 1DMBA 1RYOA 1FTJA 1S9TA 1LSTA 1SW5A 4E0XA 2DE4A 3GZGA 1N76A 5ITOA 3IB0A 1O64A 5AE4A 3I3VA 2A5SA 4QSDA 4G4PA 4R9GA 1ZLQA 3E9XA 2Q8JA 2D21A 1MY0A 1NNTA 2GH9A 4N13A 2DWJA 3BBRA 3T9UA 1MM7A 4L17A 4ECFA 4NF6B 4IGRA 3KEIA 2D3IA 3ZKLA 1PDAA 5CMMA 2XXTA 3ODBA 4IO3A 4Z7EA 4DDDA 1I6BA 2DSFA 2I58A 2QS2A 3RT6B 4GVOA 2H9BA 3K1MA 4IY6A 3RNNA 4KHZE 2FYIA 2OCUA 1TFAA 1MXZA 3TUSA 4GL8A 1JNFA 1R6ZA 4DXBA 2KLFA 3FJ7A 1R9QA 2AL4A 1N0TA 2H5YA 4OTEA 3DP4A 4ELQA 2H4IA 3PMWA 1JETA 4I8CA 1A7LA 3QIMA 2H99A 4PFTA 3VLVA 1Z7ME 4R6YA 3P7IA 3USDA 4LZ8A 2Q88A 4FAJA 2PT1A 3OEKA 3EQ1A 1FQDA 1GTKA 1TXFA 1SYHA 4FIMA 5JEIA 1MH3A 4GQOA 1PB7A 4P11A 2FA7A 3THIA 1LGBC 3TCGA 2V84A 1ZIUA 3TCHA 4H5FA 1R1NA 3M8UA 3IO6A 4X9TA 3R7XA 2OJTA 5TPAA 3O66A 1FQAA 3G3GA 3PUYE 2F7AA 1RYXA 1MY1A 5B70A 3MAMA 4R9FA 4RPNA 1LAFE 3RN8A 3PD9A 2FNCA 3C36A 3MP1A 5KCJB 4OWDA 5TU0A 4LP2B 1ZJLA 4YKJA 3EHUA 4G68B 4TLMB 4IO7A 4WXJA 2B3BA 2Z8DA 1OVBA 4YZZA 3W9VA 4OERA 4KR5A 4LQ5A 5AA2B 3CI8A 4ZEIA 3MPKA 3OENA 1Y3NA 1KWHA 4EQ7A 5DYHA 4R6KA 2RC8A 1MG1A 3PPNA 4UACA 3SKPA 1VSOA 4NMYA 3PPRA 3K02A 4LZ7A 2ZYKA 5FHMA 4QRZA 3FGSA 2CZLA 2ANJA 2PT2A 4U22A 1VFDA 3W9WA 3G3IA 4XKQA 1VR5A 2I4BA 4H8JA 1XVYA 4BDQA 1JEUA 3B6TA 1B1HA 1FQEA 1XOCA 3D4GA 4F18A 2OWSA 5L9SA 1XT8A 5F7VA 4NWDA 1BTJA 1M5FA 1J1NA 3MWBA 3TQLA 4GLIA 3IJOB 2F7BA 1DSNA 2YJPA 3RY3A 2Q2AA 2V93A 3K6UA 2O84X 2CMOA 3U92A 1D4NA 2Z8EA 1BKAA 3FATA 5AA2A 3C35A 3IB1A 4BDMA 1JVXA 4H65A 3H3GA 4GL0A 4M1VA 3V89B 2Z8FA 1SDXA 1B7ZA 1SBPA 1M5DA 3V5AA 3C31A 1XC1A 4WEPA 1TT1A 2R71A 4DE8A 3Q25A 5JTYB 5EYFA 3KGCA 3OMBA 1UTBB 4ZEFA 2Y7KA 2Y7RA 3IOTA 1MS7A 3TQWA 2ZNUA 3LSLA 4FEDA 1WODA 5I57A 5CMKA 1I6QA 1OMPA 3RPWA 3EN3A 1NFTA 3KJTA 3A09A 1B3LA 3H6UA 4QFNA 3K6XA 2DE2A 4DCYA 1MM6A 3CVGA 3IK6B 4POXA 3FIRA 4Q8RA 1EZOA 2RCBA 3PMXA 2AIXA 3U94A 3HN0A 4NF8B 1SW4A 3UA8A 1IITA 5DVIA 2O51A 1EU8A 3OXNA 4M4GA 1Y9UA 3EPEA 4GF8A 5AA3A 2VGQA 1IIWA 4F2QA 3M3KA 3QYTA 4PFYA 3MW0A 4C1UA 2I0CA 4RY1A 1CB6A 5ELVA 1B3HA 4MLVA 1Q35A 5K2XA 5F1QA 3O6IA 2XXWA 4TLLB 3KZGA 1Y3PA 1SI0A 2DWHA 4PFUA 4HTGA 4NEDA 1DTGA 3PU5A 4U1ZA 2G29A 1NMUA 5FHNA 3VLUA 2ZYMA 4RNSA 1IQ7A 3PPOA 1LAXA 5ISUA 2DP8A 2NVUB 3A3CA 3G3HA 1RKMA 4ELOA 3T96B 3TTKA 4ZEDA 4IO5A 4JWXA 4EF1A 3H6TA 2B3FA 1D9VA 4TOZA 2UYFA 1A8FA 3R6UA 2I0BA 4ZDMA 1IUDA 4Z0IA 5I59B 4OENA 2OK2A 4KCCA 3OO9A 4NF8A 3KOTA 4QHQA 1IXIA 4THIA 5I58B 1JVYA 2HAVA 3OELA 1ZKBA 4H8IA 2I3WA 3DP8A 4AB5A 3FXRA 4DXCA 4YB7A 4G77A 4P0GA 4KI0E 1P1OA 1N04A 3E4RA 1PEBA 3KN7A 4QF9A 5CRYA 3U72A 3VV5A 4OEUA 4YB5A 3CG3A 4NF5A 1JW5A 3KSXA 4EQ9A 2I4CA 4OQOA 2VOZA 5DVFA 4F31B 2XX9A 2O68A 1MQDA 4YKPA 4H6DA 3TCFA 3PUXE 1MPCA 1M5BA 1FW0A 1B40A 3A3UA 3MZ1A 1B05A 3EF7A 1B5IA 3FVOA 2QMXA 4I9DA 4KCDA 2HZLA 1BP5A 1XVXA 3TODA 3UIFA 5H8NA 1VFEA 1HSLA 1OIBA 2G93A 2V3TA 1YPNA 2QSXA 5I59A 4HS7A 1T0KA 1OVTA 1QKBA 2R9JA 5BWJA 3PV0E 3IOWA 2O6AA 3T9XB 3C4MA 3IOVA 4OESA 4F3BA 3MC2A 4U21A 3UN6A 4H0WA 2PBWA 1VE4A 5I58A 3O29A 2F6PA 4JB7A 3TTNA 1P1QA 1OQHA 2VHAA 3ZKKA 1M5EA 1FQBA 3V8XB 3FVGA 5DEXB 4YU0A 5L9MA 3M3FA 4Q5TA 1B32A 4N6PA 3PMVA 3TMGA 3OO8A 1FTLA 5H8QA 2Z22A 3SETA 3T93B 4OXVA 3ONMA 1MXXA 4NF4B 3ZS6A 1ELJA 3T22A 2O7UA 4F3GA 1NKXA 1PBPA 3N94A 4U4SA 1D3KA 3RTFB 2PMSA 4RK2A 2ONSA 1MPDA 2UXAA 3U8QA 1R9LA 3FASA 2UVGA 3H6VA 1UTHB 4BDOA 4DXUA 4QFKA 1QVSA 2PYYA 2YLNA 3B6WA 5J1DA 2RCAA 2I6EA 5TP9B 4MF3A 4X48A 4TQUQ 3EHSA 4EF2A 1OQGA 3HPIA 3ZSFA 4OFLA 5A5XB 3KN8A 2X7PA 3VFJA 4Q0CA 1QUJA 2F5XA 3IX1A 4GOTA 4IB2A 3SDFA 1ZMGA 4IGTA 1B9JA 4RYAA 3S9MC 4MH5A 2ZMBA 3KSJA 3OSRA 2BJJX 4NF6A 3VVFA 1MQHA 2A5TB 1YAEA 4G68C 2XD3A 4R6HA 3K00A 5AA2D 1A40A 3FJGA 2DYXA 5I2KB 3PUVE 3K4UA 1PC3A 4C0RA 5KDTB 3SEYA 3MUQA 2H25A 3PUWE 3QUJA 1B7UA 1M5CA 3FZVA 3RT8A 4I1DA 4NF4A 4ZEKA 1GGGA 3CFLA 4RK9A 1AH5A 3FXQA 2H98A 3SEWA 1TWYA 4OMBA 4KD5A 3IB2A 1B52A 1B1XA 4F19A 3B7DA 3I5OA 2F8DA 2XHDA 4MLQA 2NWJA 5TP9A 1B3EA 4K3FA 3IAZA 3SEVA 3CFZA 1IEJA 1FCKA 5FHOA 5A5XA 1LLSA 4EXLA 3T9HB 2QS4A 3Q28A 3LR1A 4XKNA 4DIGA 2F34A 1H45A 3RTWB 1FTKA 1I6AA 4R2BA 1XS5A 4XIGQ 2GHAA 4G8HA 4G8MA 1Q1KA 2O69A 3CSBA 2A5TA 1BLFA 3IJXB 1SQYA 4GFRA 3LUYA 4FATA 5KCJA 1P1UA 3VDFA 2XXPA 3SEUA 4QSCA 1GV8A 5I2KA 4G68A 1JEVA 3C33A 5HM4B 3KJ7A 3U1OA 4GRKA 1B4ZA 1WVJA 4UA8A 3L6GA 2O1MA 3DELB 3SEXA 1US4A 2NOOA 2Y84A 3E3KA 2THIA
chains in the Genus database with same CATH superfamily
2I3VA 4ZEBA 1ANFA 1Y1MA 1Y20A 3LBSA 4PETA 1EYJA 3BFTA 1IXGA 1NH7A 3VXCA 1DBZA 3D4CA 3TKDA 1B6HA 2WYKA 1QKAA 1TFDA 5H8FB 4H67A 3JV9A 3HHGA 4YB6A 4H1XA 4HCWA 1N3XA 3K0VA 1B3FA 1MDQA 4DI3D 1I69A 4F3PA 3TPAA 3KOSA 4PBHA 2V25A 1Z7NE 3AXFA 2GHBA 4N91A 3MZBA 4NE4A 1B5JA 1QUKA 2WEFA 4JWYA 1S7YA 1B58A 1YZ0A 3O97A 2GRVA 2PFZA 3C9HA 5ICTA 3MP8A 2OWTA 5H8SA 1NV2A 3LC8A 2FVZA 4U1OA 3KG2A 2ZXTA 3LSWA 4OVJA 3MP6A 4JWOA 3IORA 1B0LA 3C34A 4PAIA 5CMCA 1QJMA 1YCJA 2HEUA 3B8BA 1WDNA 3UP9A 3S9LC 4EXKA 3G3JA 5IGAA 1H3DA 5DVJA 4WEDA 2Q74A 1POTA 4QFLA 3TELA 4XKRA 2HXWA 4N8YA 2E0SA 2QVUA 1OLCA 1QUIA 3K1PA 4X04A 4I62A 3L6HA 3CSGA 3S9EA 5I5PA 5EHMA 1A99A 2F97A 5JK4A 4ESWA 1SW1A 4XFEA 3IOUA 5JTYA 1EZ9A 1UIVA 2P0SA 1UTBA 2XXYA 5H8FA 2W7YA 3IFCA 2ESNA 2XXIA 1FPBA 2R6GE 4MJOA 4O3BA 3O2AA 4RXLA 5ET7A 2FBPA 2YPNA 3H06B 4LN5A 1II5A 4ONYA 3V83A 3C32A 1SVXB 1FPJA 4PF8A 4DZ1A 5AA4B 2DXRA 3B50A 2CZKA 3G7WA 1B2HA 1FTAA 1NL5A 3S2VA 2HAUA 4DLDA 4F1YA 1DK4A 4GD5A 3RLFE 1LBBA 4NTLA 1N84A 1UQWA 3CHGA 2D5WA 3RGYA 2F7CA 1AOVA 1AL3A 4R2FA 2UVJA 1MY4A 4GWUA 3RUMA 4GBVA 5CBSA 1D9YA 1OLAA 1LB8A 3DLNA 1ATGA 4XEQA 2GQ1A 5CMBA 1FBGA 1JW1A 3QSLA 3TTRA 4YICA 5ITPA 5EYGA 1FBFA 5ICQA 1URDA 4FORA 2DQVA 2DWIA 5EQAA 4PGPA 1SYIA 3RYDA 4GIZA 3JYRA 1FTMA 1USYH 1Y4TA 4OYVA 2DS9A 4R72A 4FE8A 4PF6A 1MQIA 1HSEA 1NH8A 4KYDA 3GXAA 2X26A 4P9KA 3O6HA 1AMFA 2QPQA 5L9OA 1K9YA 1NV3A 2O1LA 4OHNA 3S9NC 3KN3A 1LAGE 1IMCA 1VDWA 3Q27A 1B3GA 3O28A 4UABA 4ESXA 4BLAA 1Y3QA 4IO4A 3HHFA 4F22A 3E13X 1N3WA 2M8CA 3OO6A 1H76A 1URGA 3CG1A 3F11A 3IL1B 1NNFA 3GLBA 1MDP1 3I6VA 3OEMA 3LSXA 1HSJA 1LCTA 2UVIA 3SESA 5LTCA 5EHSA 1IXHA 2UVHA 2AYSA 4O7IA 1FPGA 3MVXA 1MXWA 4FJPA 2ZZVA 4LA9A 5I2NB 1IMEA 3IO4A 4OETA 2B4LA 1MXYA 2QRYA 2QVRA 1B7HA 1LBCA 4POWA 3FD3A 3K2DA 4KYSA 3O6GA 4HW8A 5I84A 3HSTA 2Q89A 5TPAB 2VD3A 1O7TA 4LVQA 3CFXA 4ZECA 2ONKE 4BDNA 4F1VA 3EHTA 4YKIA 2DXYA 4U23A 4G8NA 1H44A 3E79A 1N7WA 3GBAA 4GX3A 2DOJA 3QK6A 4RPOA 5IZZA 4RA1A 2ONRA 1FQCA 4P8BA 5BUUA 1MXVA 5IZ1A 2ZYOA 4G2ZA 4PFWA 1DTZA 1JW4A 3OSQA 2XXUA 2FHYA 1LEVA 1A55A 4N8GA 3TTLA 5LOMA 5ESYA 2Q9TA 4XTCQ 1LAHE 1NV5A 5IKBA 4N17A 1LFIA 1IXCA 4E0WA 2F3BA 3SERA 5KZTA 4OFOA 1NV1A 3MVWA 4DCXA 1DOTA 4GWZA 1XHYA 1KA0A 5I2NA 4MBPA 3H4ZA 2P3NA 1NUWA 4JXIA 3OOAA 1QW0A 3VLWA 3VXBA 1FTOA 2ZYNA 2VD2A 4OFJA 4KFQA 4EUOA 3MJNA 1MXUA 1BIYA 3GBBA 2DVCA 3BFUA 3H7MA 3G3KA 5DEXA 1NV6A 4U4XA 2WX9A 2QJEA 3QXMA 4XKPA 3OO7A 2HZKA 4KPTA 4KQPA 5I56B 4LUBA 2O7IA 2V3QA 1Y1ZA 2X7QA 3PD8A 1MQGA 4ZZAA 2HFBA 2GFEA 1A54A 2HHMA 5HPQA 3H6WA 3FV1A 4IO2A 4PE5B 4LZ5A 4JDFA 1JQFA 4MNIA 3ILTB 2LAOA 1SI1A 3MVYA 3HCQA 2F3DA 5H8HB 5F24A 4PQJA 1S50A 3MBPA 3DM0A 5AA1A 1URSA 4JVDA 3BKIB 1XI6A 4EDPA 3R26A 2FIXA 5CI5A 1FPKA 2Y7WA 2NUVA 1UTHA 1US5A 4X1BA 4LATA 1SW2A 2F36A 4R74A 1USYE 3U93A 4ZE8A 3JZJA 1O63A 1P1WA 4NF0A 1GR2A 3FVNA 1FJ9A 5FTHA 1K9ZA 4PFBA 1NI9A 2XX8A 3N6UA 1KZ8A 2XWIA 1ZBMA 4NG7A 4X8RA 1NUYA 3B6QA 4QFOA 5I57B 1MY2A 2ZNSA 4BDLA 3KBRA 3KFMA 4GWXA 3T1BA 1MRPA 4P0IA 3S4UA 1B4HA 5L8DA 4F1UA 3CR9A 2HCAA 4OVRA 5CBRA 1NNKA 3UGWA 4O3CA 1LCFA 3W15C 1NV4A 5I56A 2REJA 4F2OA 4MFIA 1F9BA 2IEEA 5KDTA 1SD3A 3UORA 4GXAA 3VE1B 2F78A 1EZPA 1P1NA 3TAJA 4P1EA 4JVCA 3FVKA 3MVZA 2RC7A 1P99A 3TDJA 1NNPA 2WBBA 5H8HA 4ZE9A 3H03A 3CRBA 4GWOA 2E1SA 4GX6A 4QFPA 2ZNTA 5K2YA 4JBZA 5M2VA 3PGFA 5CM6A 3VVEA 1FRPA 1A8EA 2QL3A 2PX1A 3E78A 4ND9A 1YTVA 1B0HA 1Y4CA 1IMBA 1PB9A 4NWCA 2Y7PA 4P3LA 1RDXA 5DTBA 3LSFB 1GVCA 2XXRA 1MPBA 2XD2A 1CE2A 3N5LA 3CIJA 1LB9A 2QS1A 3Q29A 5B7DA 1FPDA 4PTKA 1MY3A 2Y7IA 4IY5A 4H5GA 2RC9A 4BDRA 4ZS9A 2R8TA 4P47A 4OZ9A 4N4UA 4ISUA 4GXSB 2B65A 1YYZA 2QS3A 3T9VA 4F39A 4RJZA 4HE1A 5FBPA 4YMAA 4JSOA 2QMWA 2XXVA 4OVPA 3HO7A 2F35A 2AL5A 3IR1A 5IAIA 3QUFA 5CC2A 5DT6A 1N7XA 3DP6A 3UK4A 3K1NA 3G3FA 2Q2CA 4FEBA 2UYEA 1IMFA 3PPQA 1UIUA 3M3LA 3RQTA 4QSEA 1FBCA 5EYHA 3TFLA 1CNQA 2P2AA 5FTIA 2RINA 2I49A 3K6VA 4OEVA 4XXUA 3K01A 4NF5B 4YAHX 5LDZA 3QAXA 3OD7A 2Y5LA 4R73A 1LFHA 4LONB 3N6TA 1L5TA 3HV1A 3MQ9A 2VPNA 2XWKA 4O7MA 4MCOA 4EQBA 2RF1A 2XXQA 4O3AA 2RKMA 2OX3A 4ELPA 4YKKA 1B51A 1FJ6A 4F3SA 3WAEA 2OLBA 4AQ4A 3Q26A 3MZ9A 2P1SA 4FECA 1FQFA 2OBGA 4WKMA 5H8NB 2I48A 3ILUB 3PUZE 2WKYA 1DPPA 1IZ1A 4AS5A 2DWAA 1B5HA 2PCRA 4X1DA 2OZZA 2HQ0A 1YXIA 4R75A 3VVDA 4PDHA 1MQJA 4C1TA 3PPPA 4NQ8A 1BK4A 2JJKA 4AB6A 4F29A 4HCYA 1QULA 2XXXA 2V3UA 1ZTYA 3FV2A 1H43A 1PB8A 2DVZA 4Q30B 4MMPA 3TZAA 3FUZA 2Z23A 4ELRA 2NXOA 3TEPA 2ABHA 4IO6A 4ZZEA 4GWSA 3TTMA 1AIVA 4OVSA 3N26A 1LFGA 3MPLA 2QVVA 3FXUA 3K6WA 1B46A 2IA4A 2REGA 2F6GA 2DE3A 1MH4A 4KYEA 5HBCA 4JSDA 5H8QB 3LV0A 4PP0A 1EH3A 3FJMA 4N07A 4YMBA 4LQ2A 3TYHA 3O9PA 3ECRA 3T66A 4N81A 2XX7A 2XXHA 1POY1 1PBQA 4U2RA 2PVUA 1EYIA 1ZU0A 3KC1A 4MHFA 2ALUA 3WAFA 5AA4A 2VP1A 1DPEA 2Y5KA 1DMBA 2CZHA 1RYOA 1FTJA 1S9TA 1LSTA 1SW5A 4E0XA 2DE4A 3GZGA 1N76A 5ITOA 2KR0A 3IB0A 1O64A 5AE4A 3I3VA 1FPEA 2A5SA 4QSDA 4G4PA 4R9GA 1ZLQA 3E9XA 2Q8JA 2D21A 1MY0A 4XF5A 1NNTA 2GH9A 4N13A 2DWJA 3BBRA 3T9UA 1MM7A 4L17A 4ECFA 2CZIA 4NF6B 4IGRA 3KEIA 2D3IA 3ZKLA 1PDAA 5CMMA 2XXTA 3ODBA 4IO3A 1JP4A 4Z7EA 4DDDA 1I6BA 2DSFA 2B4MA 2I58A 2QS2A 3RT6B 1FBHA 4GVOA 2H9BA 4GX4A 3K1MA 4IY6A 2V4CA 4OA4A 3IFAA 3RNNA 4KHZE 2FYIA 2OCUA 2DDKA 1TFAA 1MXZA 3TUSA 4GL8A 1JNFA 5I7IA 1R6ZA 4DXBA 2KLFA 3FJ7A 4JVIA 1R9QA 2AL4A 1N0TA 4MIJA 2H5YA 4OTEA 3DP4A 4ELQA 2H4IA 3PMWA 4NHBA 4NN3A 1JETA 4G61A 4I8CA 1A7LA 3QIMA 2H99A 4PFTA 3VLVA 1Z7ME 4R6YA 3P7IA 3USDA 4LZ8A 4P1LA 2Q88A 4FAJA 2PT1A 3OEKA 1INPA 3EQ1A 1FQDA 1GTKA 1TXFA 1SYHA 4FIMA 5JEIA 1MH3A 3RPLB 4N6DA 4GQOA 1PB7A 4P11A 2FA7A 3THIA 1LGBC 3TCGA 2V84A 1ZIUA 4PCDA 3TCHA 4H5FA 1R1NA 3M8UA 3IO6A 4X9TA 3MYUA 3R7XA 2OJTA 5TPAA 3O66A 1FQAA 3G3GA 1LBYA 3PUYE 2F7AA 1RYXA 5EQ7A 1MY1A 1RDZA 5B70A 3MAMA 4R9FA 4RPNA 1LAFE 3RN8A 3PD9A 2FNCA 3C36A 2WYPA 3U65A 3MP1A 5KCJB 4HE0A 4OWDA 5TU0A 4LP2B 1ZJLA 4YKJA 3EHUA 3A29A 3ROJA 4G68B 4TLMB 3KC0A 4IO7A 4WXJA 4N15A 2B3BA 2Z8DA 1OVBA 4YZZA 3W9VA 4QXDA 4OERA 4KR5A 4LQ5A 5AA2B 5A5LA 3CI8A 4ZEIA 3MPKA 3OENA 5J16A 1Y3NA 1KWHA 4PE3A 4EQ7A 5DYHA 4R6KA 2VPOA 4PFRA 1IMAA 2RC8A 4H46A 1MG1A 1FPIA 1KA1A 3PPNA 1LBWA 2CEYA 4UACA 3SKPA 4OVTA 1VSOA 4NMYA 3PPRA 3K02A 4LZ7A 3RPLA 2ZYKA 5FHMA 1NV7A 4QRZA 3EKIA 3FGSA 2CZLA 5DW8A 2ANJA 2PT2A 4U22A 1VFDA 3W9WA 3G3IA 4I3YA 4XKQA 1VR5A 2I4BA 4H8JA 4OANA 1XVYA 4BDQA 3LUZA 3GYYA 4PAKA 1JEUA 3B6TA 3HFUA 1B1HA 1FQEA 1XOCA 3D4GA 4F18A 3SZPA 2OWSA 4OVQA 1XT8A 5L9SA 5F7VA 4NWDA 1BTJA 1M5FA 1J1NA 3MWBA 3TQLA 4PGNA 4GLIA 3IJOB 2F7BA 1DSNA 2PFYA 2YJPA 3RY3A 2Q2AA 2V93A 3K6UA 2O84X 2CMOA 3U92A 1D4NA 2Z8EA 1BKAA 3FATA 5AA2A 3C35A 3IB1A 4BDMA 1JVXA 4H65A 3H3GA 4GL0A 4M1VA 3V89B 4MAGA 2Z8FA 1SDXA 2HPGA 1B7ZA 1SBPA 1M5DA 1D9QA 3V5AA 3C31A 1XC1A 4WEPA 1TT1A 4GBWA 2R71A 4DE8A 3Q25A 5JTYB 5EYFA 3KGCA 3OMBA 1UTBB 4ZEFA 2Y7KA 1FBPA 2Y7RA 2P3VA 3IOTA 1MS7A 3TQWA 2ZNUA 3LSLA 4FEDA 1WODA 5I57A 5CMKA 1I6QA 1OMPA 3RPWA 3EN3A 1NFTA 1NUXA 3KJTA 3A09A 2QFLA 1B3LA 4IR8A 3H6UA 5EQ8A 1Q9DA 2Q8MA 5ET6A 4QFNA 3K6XA 2DE2A 4DCYA 1MM6A 3CVGA 3IK6B 4POXA 3FIRA 4Q8RA 4PAFA 1EZOA 2RCBA 3PMXA 2AIXA 3U94A 3HN0A 4NF8B 1SW4A 3UA8A 1LBXA 1IITA 4MNPA 5DVIA 2O51A 1EU8A 4NGUA 3OXNA 4M4GA 4MEVA 1Y9UA 3EPEA 1DCUA 4FBPA 4GF8A 5AA3A 2VGQA 1IIWA 5T3JA 4F2QA 3M3KA 3QYTA 4PFYA 3MW0A 4O94A 4C1UA 2I0CA 4RY1A 1CB6A 5ELVA 1B3HA 2VT5A 4MLVA 1Q35A 5K2XA 5F1QA 3O6IA 2XXWA 4TLLB 3KZGA 1Y3PA 1SI0A 2DWHA 4PFUA 4HTGA 4NEDA 1DTGA 3PU5A 1LBZA 4U1ZA 2G29A 1NMUA 5FHNA 5IZ3B 3VLUA 2ZYMA 4RNSA 1IQ7A 3PPOA 1LAXA 5ISUA 2DP8A 2NVUB 2WBDA 3A3CA 3G3HA 1RKMA 4ELOA 3T96B 3TTKA 4ZEDA 4IO5A 2XXKA 4JWXA 2KQZA 4EF1A 3H6TA 2B3FA 4I3EA 1D9VA 4TOZA 2UYFA 1A8FA 3R6UA 2I0BA 4ZDMA 1IUDA 4Z0IA 3BIHA 2MKZA 5I59B 2OWZA 4OENA 2OK2A 4KCCA 3OO9A 4NF8A 3KOTA 4QHQA 1IXIA 3FBPA 4THIA 5I58B 1JVYA 1AWBA 2HAVA 3OELA 3FXBA 1ZKBA 5ET8A 4H8IA 2I3WA 3DP8A 4AB5A 3FXRA 4DXCA 4YB7A 4G77A 4P0GA 4KI0E 1P1OA 2XWOA 1N04A 2BJIA 4AS4A 3E4RA 1PEBA 3KN7A 4QF9A 4PDDA 5CRYA 3U72A 3VV5A 4OEUA 4YB5A 3CG3A 4NF5A 1JW5A 3BIGA 3KSXA 4EQ9A 5ET5A 2I4CA 4OQOA 2VOZA 5DVFA 4F31B 2XX9A 2O68A 1MQDA 4YKPA 4H6DA 3MSTA 3D1RA 3PUXE 3TCFA 5IZ3A 2ZZWA 1MPCA 1M5BA 1FW0A 1B40A 3A3UA 3MZ1A 1B05A 3EF7A 1B5IA 2ZZXA 3FVOA 2QMXA 4I9DA 4KCDA 2HZLA 1BP5A 1XVXA 3TODA 3UIFA 5H8NA 4H45A 1VFEA 1HSLA 1OIBA 2G93A 3KBZA 2V3TA 1YPNA 2QSXA 5I59A 4HS7A 1T0KA 1OVTA 1QKBA 2R9JA 5BWJA 4I40A 3PV0E 3IOWA 2O6AA 3T9XB 3C4MA 3IOVA 4OESA 4F3BA 3MC2A 4U21A 4QBAA 3UN6A 4H0WA 2PBWA 4KXPA 1VE4A 5I58A 3O29A 2F6PA 2XA5A 4JB7A 3TTNA 1P1QA 1OQHA 2VHAA 4NX1A 3ZKKA 1M5EA 1FQBA 3V8XB 3FVGA 5DEXB 4YU0A 5L9MA 3M3FA 4Q5TA 1B32A 4N6PA 1FPFA 3PMVA 3TMGA 3OO8A 1FTLA 5H8QA 2Z22A 3SETA 3T93B 4OXVA 3ONMA 4GWYA 1MXXA 4NF4B 4P56A 3ZS6A 1ELJA 3T22A 2O7UA 4F3GA 3ISPA 1NKXA 1PBPA 3N94A 4U4SA 1D3KA 3RTFB 2PMSA 4RK2A 2ONSA 1MPDA 2UXAA 3U8QA 1R9LA 3FASA 2UVGA 3H6VA 1UTHB 4BDOA 4DXUA 4QFKA 1QVSA 2PYYA 2YLNA 4HXVA 3B6WA 5J1DA 2RCAA 2I6EA 4MF3A 5TP9B 4X48A 4TQUQ 3EHSA 4EF2A 1OQGA 3HPIA 3ZSFA 4OFLA 5A5XB 3KN8A 2X7PA 3VFJA 4Q0CA 4DI4B 1QUJA 2L5VA 2F5XA 3IX1A 4GOTA 4PFIA 4IB2A 3SDFA 1ZMGA 4IGTA 5EQ9A 1B9JA 5I3SA 1G0IA 4RYAA 3S9MC 2XWVA 4MH5A 2ZMBA 3KSJA 3OSRA 2BJJX 4NF6A 3VVFA 1MQHA 4NAPA 2A5TB 1FBEA 1YAEA 4G68C 4HE2A 2XD3A 4R6HA 3K00A 5AA2D 1A40A 1FSAA 3FJGA 2DYXA 5I2KB 3PUVE 3K4UA 1PC3A 4C0RA 5KDTB 3SEYA 3MUQA 2H25A 3PUWE 3QUJA 1B7UA 1M5CA 3FZVA 3RT8A 4I1DA 4NF4A 3T0JA 4ZEKA 1EYKA 4GWWA 1GGGA 2FIEA 3CFLA 4RK9A 1AH5A 3FXQA 2H98A 3SEWA 1TWYA 4PBQA 4OMBA 4KD5A 3IB2A 1B52A 1B1XA 4F19A 3B7DA 3I5OA 2F8DA 1LBVA 2XHDA 4MLQA 2NWJA 5TP9A 1B3EA 4K3FA 3IAZA 3SEVA 3CFZA 1IEJA 1FCKA 5FHOA 5A5XA 1LLSA 4EXLA 3T9HB 3QMFA 4MNCA 2QS4A 3Q28A 3LR1A 1FPLA 4XKNA 4DIGA 2F34A 1RDYA 1G0HA 4PC9A 1H45A 3RTWB 1FTKA 1I6AA 4R2BA 1XS5A 4XIGQ 2GHAA 4G8HA 4G8MA 1Q1KA 2O69A 3CSBA 2A5TA 1BLFA 2CEXA 3IJXB 1SQYA 4GFRA 2HXRA 3PTYA 4O8MA 3LUYA 1NUZA 4FATA 5KCJA 1P1UA 3VDFA 2XXPA 3SEUA 4MX6A 4QSCA 1GV8A 5I2KA 4G68A 1SPIA 1NV0A 1IMDA 3NOHA 1JEVA 4N6KA 5IM2A 3C33A 5HM4B 3KJ7A 3U1OA 4GRKA 1FBDA 1B4ZA 1WVJA 4UA8A 3L6GA 2O1MA 3DELB 1QGXA 3SEXA 1US4A 2NOOA 2Y84A 3E3KA 2THIA
chains in the Genus database with same CATH topology
2I3VA 4ZEBA 1ANFA 1Y1MA 1Y20A 3LBSA 4PETA 3BFTA 1IXGA 1NH7A 3VXCA 3D4CA 3TKDA 1B6HA 1QKAA 1TFDA 5H8FB 4H67A 3JV9A 3HHGA 4YB6A 4H1XA 4HCWA 1N3XA 3K0VA 1B3FA 1MDQA 1I69A 4F3PA 3TPAA 3KOSA 2V25A 1Z7NE 3AXFA 2GHBA 3MZBA 4NE4A 1B5JA 1QUKA 4JWYA 1S7YA 1B58A 3O97A 2GRVA 3C9HA 5ICTA 3MP8A 2OWTA 5H8SA 3LC8A 4U1OA 3KG2A 2ZXTA 3LSWA 4OVJA 3MP6A 4JWOA 3IORA 1B0LA 3C34A 5CMCA 1QJMA 1YCJA 2HEUA 1WDNA 3UP9A 3S9LC 4EXKA 3G3JA 1H3DA 5DVJA 4WEDA 4QFLA 1POTA 3TELA 4XKRA 2HXWA 2E0SA 1OLCA 1QUIA 3K1PA 4I62A 3L6HA 3CSGA 3S9EA 5EHMA 1A99A 2F97A 5JK4A 4ESWA 1SW1A 3IOUA 5JTYA 1EZ9A 1UIVA 2P0SA 1UTBA 2XXYA 5H8FA 2W7YA 2ESNA 2XXIA 2R6GE 4O3BA 3O2AA 4RXLA 2YPNA 3H06B 1II5A 4ONYA 3V83A 3C32A 1SVXB 4DZ1A 5AA4B 2DXRA 3G7WA 1B2HA 1NL5A 3S2VA 2HAUA 4DLDA 4F1YA 4GD5A 3RLFE 1LBBA 4NTLA 1N84A 1UQWA 2D5WA 3RGYA 2F7CA 1AOVA 1AL3A 4R2FA 2UVJA 1MY4A 3RUMA 5CBSA 1D9YA 1OLAA 1LB8A 3DLNA 1ATGA 5CMBA 1JW1A 3QSLA 3TTRA 4YICA 5ITPA 5ICQA 1URDA 4FORA 2DQVA 2DWIA 1SYIA 4GIZA 3JYRA 1FTMA 1USYH 1Y4TA 4OYVA 2DS9A 4R72A 4FE8A 1MQIA 1HSEA 1NH8A 4KYDA 3GXAA 2X26A 3O6HA 1AMFA 2QPQA 5L9OA 2O1LA 4OHNA 3S9NC 3KN3A 1LAGE 3Q27A 1B3GA 3O28A 4ESXA 4BLAA 1Y3QA 4IO4A 3HHFA 4F22A 3E13X 1N3WA 2M8CA 3OO6A 1H76A 1URGA 3CG1A 3F11A 3IL1B 1NNFA 3GLBA 1MDP1 3I6VA 3OEMA 3LSXA 1HSJA 1LCTA 2UVIA 3SESA 5EHSA 1IXHA 2UVHA 2AYSA 3MVXA 1MXWA 4FJPA 4LA9A 5I2NB 3IO4A 4OETA 1MXYA 2QRYA 1B7HA 1LBCA 4POWA 3FD3A 3K2DA 4KYSA 3O6GA 4HW8A 5I84A 3HSTA 2Q89A 5TPAB 2VD3A 1O7TA 4ZECA 3CFXA 4LVQA 2ONKE 4BDNA 4F1VA 3EHTA 4YKIA 2DXYA 4U23A 4G8NA 1H44A 1N7WA 3GBAA 2DOJA 3QK6A 4RPOA 4RA1A 2ONRA 1FQCA 5BUUA 1MXVA 2ZYOA 4G2ZA 4PFWA 1DTZA 1JW4A 3OSQA 2XXUA 1A55A 3TTLA 5LOMA 2Q9TA 4XTCQ 1LAHE 5IKBA 1LFIA 1IXCA 4E0WA 3SERA 5KZTA 4OFOA 3MVWA 4DCXA 1DOTA 1XHYA 5I2NA 4MBPA 3H4ZA 4JXIA 3OOAA 1QW0A 3VLWA 3VXBA 1FTOA 2ZYNA 2VD2A 4OFJA 4KFQA 4EUOA 3MJNA 1MXUA 1BIYA 3GBBA 2DVCA 3BFUA 3H7MA 3G3KA 5DEXA 4U4XA 2QJEA 3QXMA 4XKPA 3OO7A 2HZKA 4KPTA 4KQPA 5I56B 4LUBA 2O7IA 2V3QA 1Y1ZA 2X7QA 3PD8A 1MQGA 4ZZAA 2HFBA 2GFEA 1A54A 5HPQA 3H6WA 3FV1A 4IO2A 4PE5B 4LZ5A 4JDFA 1JQFA 3ILTB 2LAOA 1SI1A 3MVYA 3HCQA 5H8HB 4PQJA 1S50A 3MBPA 3DM0A 5AA1A 1URSA 3BKIB 4EDPA 3R26A 5CI5A 2Y7WA 2NUVA 1UTHA 1US5A 4X1BA 4LATA 1SW2A 2F36A 4R74A 1USYE 3U93A 4ZE8A 3JZJA 1O63A 1P1WA 1GR2A 3FVNA 5FTHA 2XX8A 3N6UA 1ZBMA 3B6QA 4QFOA 5I57B 1MY2A 2ZNSA 4BDLA 3KBRA 3KFMA 1MRPA 4P0IA 3S4UA 1B4HA 5L8DA 4F1UA 3CR9A 2HCAA 5CBRA 1NNKA 3UGWA 4O3CA 1LCFA 3W15C 5I56A 2REJA 4F2OA 4MFIA 1F9BA 2IEEA 5KDTA 1SD3A 3UORA 4GXAA 3VE1B 2F78A 1EZPA 1P1NA 3TAJA 3FVKA 3MVZA 2RC7A 1P99A 3TDJA 1NNPA 5H8HA 4ZE9A 3H03A 3CRBA 4GWOA 2E1SA 4QFPA 2ZNTA 5K2YA 4JBZA 5M2VA 3PGFA 5CM6A 3VVEA 1A8EA 2QL3A 2PX1A 4ND9A 1YTVA 1B0HA 1Y4CA 1PB9A 4NWCA 2Y7PA 5DTBA 3LSFB 1GVCA 2XXRA 1MPBA 2XD2A 1CE2A 3N5LA 3CIJA 1LB9A 2QS1A 3Q29A 5B7DA 1MY3A 2Y7IA 4IY5A 4H5GA 2RC9A 4BDRA 4ZS9A 4OZ9A 4ISUA 4GXSB 2B65A 2QS3A 3T9VA 4F39A 4RJZA 4YMAA 4JSOA 2QMWA 2XXVA 3HO7A 2F35A 2AL5A 3IR1A 5IAIA 3QUFA 5CC2A 5DT6A 1N7XA 3DP6A 3UK4A 3K1NA 3G3FA 2Q2CA 4FEBA 2UYEA 3PPQA 1UIUA 3M3LA 3RQTA 4QSEA 3TFLA 2P2AA 5FTIA 2RINA 2I49A 3K6VA 4OEVA 4XXUA 3K01A 4NF5B 4YAHX 3QAXA 3OD7A 4R73A 1LFHA 4LONB 3N6TA 1L5TA 3HV1A 3MQ9A 4EQBA 2RF1A 2XXQA 4O3AA 2RKMA 4ELPA 4YKKA 1B51A 4F3SA 3WAEA 2OLBA 4AQ4A 3Q26A 3MZ9A 2P1SA 4FECA 1FQFA 2OBGA 4WKMA 5H8NB 2I48A 3ILUB 3PUZE 2WKYA 1DPPA 1IZ1A 2DWAA 1B5HA 4X1DA 2OZZA 2HQ0A 4R75A 3VVDA 1MQJA 4C1TA 3PPPA 4AB6A 4F29A 4HCYA 1QULA 2XXXA 2V3UA 1ZTYA 3FV2A 1H43A 1PB8A 2DVZA 4Q30B 3TZAA 3FUZA 2Z23A 4ELRA 2NXOA 3TEPA 2ABHA 4IO6A 4ZZEA 3TTMA 1AIVA 3N26A 1LFGA 3FXUA 3MPLA 3K6WA 1B46A 2IA4A 2REGA 2F6GA 2DE3A 1MH4A 4KYEA 5HBCA 4JSDA 5H8QB 4PP0A 1EH3A 3FJMA 4N07A 4YMBA 4LQ2A 3TYHA 3O9PA 3ECRA 3T66A 2XX7A 2XXHA 1POY1 1PBQA 4U2RA 2PVUA 1ZU0A 2ALUA 3WAFA 5AA4A 2VP1A 1DPEA 1DMBA 1RYOA 1FTJA 1S9TA 1LSTA 1SW5A 4E0XA 2DE4A 3GZGA 1N76A 5ITOA 3IB0A 1O64A 5AE4A 3I3VA 2A5SA 4QSDA 4G4PA 4R9GA 1ZLQA 3E9XA 2Q8JA 2D21A 1MY0A 1NNTA 2GH9A 4N13A 2DWJA 3BBRA 3T9UA 1MM7A 4L17A 4ECFA 4NF6B 4IGRA 3KEIA 2D3IA 3ZKLA 1PDAA 5CMMA 2XXTA 3ODBA 4IO3A 4Z7EA 4DDDA 1I6BA 2DSFA 2I58A 2QS2A 3RT6B 4GVOA 2H9BA 3K1MA 4IY6A 3RNNA 4KHZE 2FYIA 2OCUA 1TFAA 1MXZA 3TUSA 4GL8A 1JNFA 1R6ZA 4DXBA 2KLFA 3FJ7A 1R9QA 2AL4A 1N0TA 2H5YA 4OTEA 3DP4A 4ELQA 2H4IA 3PMWA 1JETA 4I8CA 1A7LA 3QIMA 2H99A 4PFTA 3VLVA 1Z7ME 4R6YA 3P7IA 3USDA 4LZ8A 2Q88A 4FAJA 2PT1A 3OEKA 3EQ1A 1FQDA 1GTKA 1TXFA 1SYHA 4FIMA 5JEIA 1MH3A 4GQOA 1PB7A 4P11A 2FA7A 3THIA 1LGBC 3TCGA 2V84A 1ZIUA 3TCHA 4H5FA 1R1NA 3M8UA 3IO6A 4X9TA 3R7XA 2OJTA 5TPAA 3O66A 1FQAA 3G3GA 3PUYE 2F7AA 1RYXA 1MY1A 5B70A 3MAMA 4R9FA 4RPNA 1LAFE 3RN8A 3PD9A 2FNCA 3C36A 3MP1A 5KCJB 4OWDA 5TU0A 4LP2B 1ZJLA 4YKJA 3EHUA 4G68B 4TLMB 4IO7A 4WXJA 2B3BA 2Z8DA 1OVBA 4YZZA 3W9VA 4OERA 4KR5A 4LQ5A 5AA2B 3CI8A 4ZEIA 3MPKA 3OENA 1Y3NA 1KWHA 4EQ7A 5DYHA 4R6KA 2RC8A 1MG1A 3PPNA 4UACA 3SKPA 1VSOA 4NMYA 3PPRA 3K02A 4LZ7A 2ZYKA 5FHMA 4QRZA 3FGSA 2CZLA 2ANJA 2PT2A 4U22A 1VFDA 3W9WA 3G3IA 4XKQA 1VR5A 2I4BA 4H8JA 1XVYA 4BDQA 1JEUA 3B6TA 1B1HA 1FQEA 1XOCA 3D4GA 4F18A 2OWSA 5L9SA 1XT8A 5F7VA 4NWDA 1BTJA 1M5FA 1J1NA 3MWBA 3TQLA 4GLIA 3IJOB 2F7BA 1DSNA 2YJPA 3RY3A 2Q2AA 2V93A 3K6UA 2O84X 2CMOA 3U92A 1D4NA 2Z8EA 1BKAA 3FATA 5AA2A 3C35A 3IB1A 4BDMA 1JVXA 4H65A 3H3GA 4GL0A 4M1VA 3V89B 2Z8FA 1SDXA 1B7ZA 1SBPA 1M5DA 3V5AA 3C31A 1XC1A 4WEPA 1TT1A 2R71A 4DE8A 3Q25A 5JTYB 5EYFA 3KGCA 3OMBA 1UTBB 4ZEFA 2Y7KA 2Y7RA 3IOTA 1MS7A 3TQWA 2ZNUA 3LSLA 4FEDA 1WODA 5I57A 5CMKA 1I6QA 1OMPA 3RPWA 3EN3A 1NFTA 3KJTA 3A09A 1B3LA 3H6UA 4QFNA 3K6XA 2DE2A 4DCYA 1MM6A 3CVGA 3IK6B 4POXA 3FIRA 4Q8RA 1EZOA 2RCBA 3PMXA 2AIXA 3U94A 3HN0A 4NF8B 1SW4A 3UA8A 1IITA 5DVIA 2O51A 1EU8A 3OXNA 4M4GA 1Y9UA 3EPEA 4GF8A 5AA3A 2VGQA 1IIWA 4F2QA 3M3KA 3QYTA 4PFYA 3MW0A 4C1UA 2I0CA 4RY1A 1CB6A 5ELVA 1B3HA 4MLVA 1Q35A 5K2XA 5F1QA 3O6IA 2XXWA 4TLLB 3KZGA 1Y3PA 1SI0A 2DWHA 4PFUA 4HTGA 4NEDA 1DTGA 3PU5A 4U1ZA 2G29A 1NMUA 5FHNA 3VLUA 2ZYMA 4RNSA 1IQ7A 3PPOA 1LAXA 5ISUA 2DP8A 2NVUB 3A3CA 3G3HA 1RKMA 4ELOA 3T96B 3TTKA 4ZEDA 4IO5A 4JWXA 4EF1A 3H6TA 2B3FA 1D9VA 4TOZA 2UYFA 1A8FA 3R6UA 2I0BA 4ZDMA 1IUDA 4Z0IA 5I59B 4OENA 2OK2A 4KCCA 3OO9A 4NF8A 3KOTA 4QHQA 1IXIA 4THIA 5I58B 1JVYA 2HAVA 3OELA 1ZKBA 4H8IA 2I3WA 3DP8A 4AB5A 3FXRA 4DXCA 4YB7A 4G77A 4P0GA 4KI0E 1P1OA 1N04A 3E4RA 1PEBA 3KN7A 4QF9A 5CRYA 3U72A 3VV5A 4OEUA 4YB5A 3CG3A 4NF5A 1JW5A 3KSXA 4EQ9A 2I4CA 4OQOA 2VOZA 5DVFA 4F31B 2XX9A 2O68A 1MQDA 4YKPA 4H6DA 3TCFA 3PUXE 1MPCA 1M5BA 1FW0A 1B40A 3A3UA 3MZ1A 1B05A 3EF7A 1B5IA 3FVOA 2QMXA 4I9DA 4KCDA 2HZLA 1BP5A 1XVXA 3TODA 3UIFA 5H8NA 1VFEA 1HSLA 1OIBA 2G93A 2V3TA 1YPNA 2QSXA 5I59A 4HS7A 1T0KA 1OVTA 1QKBA 2R9JA 5BWJA 3PV0E 3IOWA 2O6AA 3T9XB 3C4MA 3IOVA 4OESA 4F3BA 3MC2A 4U21A 3UN6A 4H0WA 2PBWA 1VE4A 5I58A 3O29A 2F6PA 4JB7A 3TTNA 1P1QA 1OQHA 2VHAA 3ZKKA 1M5EA 1FQBA 3V8XB 3FVGA 5DEXB 4YU0A 5L9MA 3M3FA 4Q5TA 1B32A 4N6PA 3PMVA 3TMGA 3OO8A 1FTLA 5H8QA 2Z22A 3SETA 3T93B 4OXVA 3ONMA 1MXXA 4NF4B 3ZS6A 1ELJA 3T22A 2O7UA 4F3GA 1NKXA 1PBPA 3N94A 4U4SA 1D3KA 3RTFB 2PMSA 4RK2A 2ONSA 1MPDA 2UXAA 3U8QA 1R9LA 3FASA 2UVGA 3H6VA 1UTHB 4BDOA 4DXUA 4QFKA 1QVSA 2PYYA 2YLNA 3B6WA 5J1DA 2RCAA 2I6EA 5TP9B 4MF3A 4X48A 4TQUQ 3EHSA 4EF2A 1OQGA 3HPIA 3ZSFA 4OFLA 5A5XB 3KN8A 2X7PA 3VFJA 4Q0CA 1QUJA 2F5XA 3IX1A 4GOTA 4IB2A 3SDFA 1ZMGA 4IGTA 1B9JA 4RYAA 3S9MC 4MH5A 2ZMBA 3KSJA 3OSRA 2BJJX 4NF6A 3VVFA 1MQHA 2A5TB 1YAEA 4G68C 2XD3A 4R6HA 3K00A 5AA2D 1A40A 3FJGA 2DYXA 5I2KB 3PUVE 3K4UA 1PC3A 4C0RA 5KDTB 3SEYA 3MUQA 2H25A 3PUWE 3QUJA 1B7UA 1M5CA 3FZVA 3RT8A 4I1DA 4NF4A 4ZEKA 1GGGA 3CFLA 4RK9A 1AH5A 3FXQA 2H98A 3SEWA 1TWYA 4OMBA 4KD5A 3IB2A 1B52A 1B1XA 4F19A 3B7DA 3I5OA 2F8DA 2XHDA 4MLQA 2NWJA 5TP9A 1B3EA 4K3FA 3IAZA 3SEVA 3CFZA 1IEJA 1FCKA 5FHOA 5A5XA 1LLSA 4EXLA 3T9HB 2QS4A 3Q28A 3LR1A 4XKNA 4DIGA 2F34A 1H45A 3RTWB 1FTKA 1I6AA 4R2BA 1XS5A 4XIGQ 2GHAA 4G8HA 4G8MA 1Q1KA 2O69A 3CSBA 2A5TA 1BLFA 3IJXB 1SQYA 4GFRA 3LUYA 4FATA 5KCJA 1P1UA 3VDFA 2XXPA 3SEUA 4QSCA 1GV8A 5I2KA 4G68A 1JEVA 3C33A 5HM4B 3KJ7A 3U1OA 4GRKA 1B4ZA 1WVJA 4UA8A 3L6GA 2O1MA 3DELB 3SEXA 1US4A 2NOOA 2Y84A 3E3KA 2THIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I3V A;  4ZEB A;  1ANF A;  1Y1M A;  1Y20 A;  3LBS A;  4PET A;  3BFT A;  1IXG A;  1NH7 A;  3VXC A;  3D4C A;  3TKD A;  1B6H A;  1QKA A;  1TFD A;  5H8F B;  4H67 A;  3JV9 A;  3HHG A;  4YB6 A;  4H1X A;  4HCW A;  1N3X A;  3K0V A;  1B3F A;  1MDQ A;  1I69 A;  4F3P A;  3TPA A;  3KOS A;  2V25 A;  1Z7N E;  3AXF A;  2GHB A;  3MZB A;  4NE4 A;  1B5J A;  1QUK A;  4JWY A;  1S7Y A;  1B58 A;  3O97 A;  2GRV A;  3C9H A;  5ICT A;  3MP8 A;  2OWT A;  5H8S A;  3LC8 A;  4U1O A;  3KG2 A;  2ZXT A;  3LSW A;  4OVJ A;  3MP6 A;  4JWO A;  3IOR A;  1B0L A;  3C34 A;  5CMC A;  1QJM A;  1YCJ A;  2HEU A;  1WDN A;  3UP9 A;  3S9L C;  4EXK A;  3G3J A;  1H3D A;  5DVJ A;  4WED A;  4QFL A;  1POT A;  3TEL A;  4XKR A;  2HXW A;  2E0S A;  1OLC A;  1QUI A;  3K1P A;  4I62 A;  3L6H A;  3CSG A;  3S9E A;  5EHM A;  1A99 A;  2F97 A;  5JK4 A;  4ESW A;  1SW1 A;  3IOU A;  5JTY A;  1EZ9 A;  1UIV A;  2P0S A;  1UTB A;  2XXY A;  5H8F A;  2W7Y A;  2ESN A;  2XXI A;  2R6G E;  4O3B A;  3O2A A;  4RXL A;  2YPN A;  3H06 B;  1II5 A;  4ONY A;  3V83 A;  3C32 A;  1SVX B;  4DZ1 A;  5AA4 B;  2DXR A;  3G7W A;  1B2H A;  1NL5 A;  3S2V A;  2HAU A;  4DLD A;  4F1Y A;  4GD5 A;  3RLF E;  1LBB A;  4NTL A;  1N84 A;  1UQW A;  2D5W A;  3RGY A;  2F7C A;  1AOV A;  1AL3 A;  4R2F A;  2UVJ A;  1MY4 A;  3RUM A;  5CBS A;  1D9Y A;  1OLA A;  1LB8 A;  3DLN A;  1ATG A;  5CMB A;  1JW1 A;  3QSL A;  3TTR A;  4YIC A;  5ITP A;  5ICQ A;  1URD A;  4FOR A;  2DQV A;  2DWI A;  1SYI A;  4GIZ A;  3JYR A;  1FTM A;  1USY H;  1Y4T A;  4OYV A;  2DS9 A;  4R72 A;  4FE8 A;  1MQI A;  1HSE A;  1NH8 A;  4KYD A;  3GXA A;  2X26 A;  3O6H A;  1AMF A;  2QPQ A;  5L9O A;  2O1L A;  4OHN A;  3S9N C;  3KN3 A;  1LAG E;  3Q27 A;  1B3G A;  3O28 A;  4ESX A;  4BLA A;  1Y3Q A;  4IO4 A;  3HHF A;  4F22 A;  3E13 X;  1N3W A;  2M8C A;  3OO6 A;  1H76 A;  1URG A;  3CG1 A;  3F11 A;  3IL1 B;  1NNF A;  3GLB A;  1MDP 1;  3I6V A;  3OEM A;  3LSX A;  1HSJ A;  1LCT A;  2UVI A;  3SES A;  5EHS A;  1IXH A;  2UVH A;  2AYS A;  3MVX A;  1MXW A;  4FJP A;  4LA9 A;  5I2N B;  3IO4 A;  4OET A;  1MXY A;  2QRY A;  1B7H A;  1LBC A;  4POW A;  3FD3 A;  3K2D A;  4KYS A;  3O6G A;  4HW8 A;  5I84 A;  3HST A;  2Q89 A;  5TPA B;  2VD3 A;  1O7T A;  4ZEC A;  3CFX A;  4LVQ A;  2ONK E;  4BDN A;  4F1V A;  3EHT A;  4YKI A;  2DXY A;  4U23 A;  4G8N A;  1H44 A;  1N7W A;  3GBA A;  2DOJ A;  3QK6 A;  4RPO A;  4RA1 A;  2ONR A;  1FQC A;  5BUU A;  1MXV A;  2ZYO A;  4G2Z A;  4PFW A;  1DTZ A;  1JW4 A;  3OSQ A;  2XXU A;  1A55 A;  3TTL A;  5LOM A;  2Q9T A;  4XTC Q;  1LAH E;  5IKB A;  1LFI A;  1IXC A;  4E0W A;  3SER A;  5KZT A;  4OFO A;  3MVW A;  4DCX A;  1DOT A;  1XHY A;  5I2N A;  4MBP A;  3H4Z A;  4JXI A;  3OOA A;  1QW0 A;  3VLW A;  3VXB A;  1FTO A;  2ZYN A;  2VD2 A;  4OFJ A;  4KFQ A;  4EUO A;  3MJN A;  1MXU A;  1BIY A;  3GBB A;  2DVC A;  3BFU A;  3H7M A;  3G3K A;  5DEX A;  4U4X A;  2QJE A;  3QXM A;  4XKP A;  3OO7 A;  2HZK A;  4KPT A;  4KQP A;  5I56 B;  4LUB A;  2O7I A;  2V3Q A;  1Y1Z A;  2X7Q A;  3PD8 A;  1MQG A;  4ZZA A;  2HFB A;  2GFE A;  1A54 A;  5HPQ A;  3H6W A;  3FV1 A;  4IO2 A;  4PE5 B;  4LZ5 A;  4JDF A;  1JQF A;  3ILT B;  2LAO A;  1SI1 A;  3MVY A;  3HCQ A;  5H8H B;  4PQJ A;  1S50 A;  3MBP A;  3DM0 A;  5AA1 A;  1URS A;  3BKI B;  4EDP A;  3R26 A;  5CI5 A;  2Y7W A;  2NUV A;  1UTH A;  1US5 A;  4X1B A;  4LAT A;  1SW2 A;  2F36 A;  4R74 A;  1USY E;  3U93 A;  4ZE8 A;  3JZJ A;  1O63 A;  1P1W A;  1GR2 A;  3FVN A;  5FTH A;  2XX8 A;  3N6U A;  1ZBM A;  3B6Q A;  4QFO A;  5I57 B;  1MY2 A;  2ZNS A;  4BDL A;  3KBR A;  3KFM A;  1MRP A;  4P0I A;  3S4U A;  1B4H A;  5L8D A;  4F1U A;  3CR9 A;  2HCA A;  5CBR A;  1NNK A;  3UGW A;  4O3C A;  1LCF A;  3W15 C;  5I56 A;  2REJ A;  4F2O A;  4MFI A;  1F9B A;  2IEE A;  5KDT A;  1SD3 A;  3UOR A;  4GXA A;  3VE1 B;  2F78 A;  1EZP A;  1P1N A;  3TAJ A;  3FVK A;  3MVZ A;  2RC7 A;  1P99 A;  3TDJ A;  1NNP A;  5H8H A;  4ZE9 A;  3H03 A;  3CRB A;  4GWO A;  2E1S A;  4QFP A;  2ZNT A;  5K2Y A;  4JBZ A;  5M2V A;  3PGF A;  5CM6 A;  3VVE A;  1A8E A;  2QL3 A;  2PX1 A;  4ND9 A;  1YTV A;  1B0H A;  1Y4C A;  1PB9 A;  4NWC A;  2Y7P A;  5DTB A;  3LSF B;  1GVC A;  2XXR A;  1MPB A;  2XD2 A;  1CE2 A;  3N5L A;  3CIJ A;  1LB9 A;  2QS1 A;  3Q29 A;  5B7D A;  1MY3 A;  2Y7I A;  4IY5 A;  4H5G A;  2RC9 A;  4BDR A;  4ZS9 A;  4OZ9 A;  4ISU A;  4GXS B;  2B65 A;  2QS3 A;  3T9V A;  4F39 A;  4RJZ A;  4YMA A;  4JSO A;  2QMW A;  2XXV A;  3HO7 A;  2F35 A;  2AL5 A;  3IR1 A;  5IAI A;  3QUF A;  5CC2 A;  5DT6 A;  1N7X A;  3DP6 A;  3UK4 A;  3K1N A;  3G3F A;  2Q2C A;  4FEB A;  2UYE A;  3PPQ A;  1UIU A;  3M3L A;  3RQT A;  4QSE A;  3TFL A;  2P2A A;  5FTI A;  2RIN A;  2I49 A;  3K6V A;  4OEV A;  4XXU A;  3K01 A;  4NF5 B;  4YAH X;  3QAX A;  3OD7 A;  4R73 A;  1LFH A;  4LON B;  3N6T A;  1L5T A;  3HV1 A;  3MQ9 A;  4EQB A;  2RF1 A;  2XXQ A;  4O3A A;  2RKM A;  4ELP A;  4YKK A;  1B51 A;  4F3S A;  3WAE A;  2OLB A;  4AQ4 A;  3Q26 A;  3MZ9 A;  2P1S A;  4FEC A;  1FQF A;  2OBG A;  4WKM A;  5H8N B;  2I48 A;  3ILU B;  3PUZ E;  2WKY A;  1DPP A;  1IZ1 A;  2DWA A;  1B5H A;  4X1D A;  2OZZ A;  2HQ0 A;  4R75 A;  3VVD A;  1MQJ A;  4C1T A;  3PPP A;  4AB6 A;  4F29 A;  4HCY A;  1QUL A;  2XXX A;  2V3U A;  1ZTY A;  3FV2 A;  1H43 A;  1PB8 A;  2DVZ A;  4Q30 B;  3TZA A;  3FUZ A;  2Z23 A;  4ELR A;  2NXO A;  3TEP A;  2ABH A;  4IO6 A;  4ZZE A;  3TTM A;  1AIV A;  3N26 A;  1LFG A;  3FXU A;  3MPL A;  3K6W A;  1B46 A;  2IA4 A;  2REG A;  2F6G A;  2DE3 A;  1MH4 A;  4KYE A;  5HBC A;  4JSD A;  5H8Q B;  4PP0 A;  1EH3 A;  3FJM A;  4N07 A;  4YMB A;  4LQ2 A;  3TYH A;  3O9P A;  3ECR A;  3T66 A;  2XX7 A;  2XXH A;  1POY 1;  1PBQ A;  4U2R A;  2PVU A;  1ZU0 A;  2ALU A;  3WAF A;  5AA4 A;  2VP1 A;  1DPE A;  1DMB A;  1RYO A;  1FTJ A;  1S9T A;  1LST A;  1SW5 A;  4E0X A;  2DE4 A;  3GZG A;  1N76 A;  5ITO A;  3IB0 A;  1O64 A;  5AE4 A;  3I3V A;  2A5S A;  4QSD A;  4G4P A;  4R9G A;  1ZLQ A;  3E9X A;  2Q8J A;  2D21 A;  1MY0 A;  1NNT A;  2GH9 A;  4N13 A;  2DWJ A;  3BBR A;  3T9U A;  1MM7 A;  4L17 A;  4ECF A;  4NF6 B;  4IGR A;  3KEI A;  2D3I A;  3ZKL A;  1PDA A;  5CMM A;  2XXT A;  3ODB A;  4IO3 A;  4Z7E A;  4DDD A;  1I6B A;  2DSF A;  2I58 A;  2QS2 A;  3RT6 B;  4GVO A;  2H9B A;  3K1M A;  4IY6 A;  3RNN A;  4KHZ E;  2FYI A;  2OCU A;  1TFA A;  1MXZ A;  3TUS A;  4GL8 A;  1JNF A;  1R6Z A;  4DXB A;  2KLF A;  3FJ7 A;  1R9Q A;  2AL4 A;  1N0T A;  2H5Y A;  4OTE A;  3DP4 A;  4ELQ A;  2H4I A;  3PMW A;  1JET A;  4I8C A;  1A7L A;  3QIM A;  2H99 A;  4PFT A;  3VLV A;  1Z7M E;  4R6Y A;  3P7I A;  3USD A;  4LZ8 A;  2Q88 A;  4FAJ A;  2PT1 A;  3OEK A;  3EQ1 A;  1FQD A;  1GTK A;  1TXF A;  1SYH A;  4FIM A;  5JEI A;  1MH3 A;  4GQO A;  1PB7 A;  4P11 A;  2FA7 A;  3THI A;  1LGB C;  3TCG A;  2V84 A;  1ZIU A;  3TCH A;  4H5F A;  1R1N A;  3M8U A;  3IO6 A;  4X9T A;  3R7X A;  2OJT A;  5TPA A;  3O66 A;  1FQA A;  3G3G A;  3PUY E;  2F7A A;  1RYX A;  1MY1 A;  5B70 A;  3MAM A;  4R9F A;  4RPN A;  1LAF E;  3RN8 A;  3PD9 A;  2FNC A;  3C36 A;  3MP1 A;  5KCJ B;  4OWD A;  5TU0 A;  4LP2 B;  1ZJL A;  4YKJ A;  3EHU A;  4G68 B;  4TLM B;  4IO7 A;  4WXJ A;  2B3B A;  2Z8D A;  1OVB A;  4YZZ A;  3W9V A;  4OER A;  4KR5 A;  4LQ5 A;  5AA2 B;  3CI8 A;  4ZEI A;  3MPK A;  3OEN A;  1Y3N A;  1KWH A;  4EQ7 A;  5DYH A;  4R6K A;  2RC8 A;  1MG1 A;  3PPN A;  4UAC A;  3SKP A;  1VSO A;  4NMY A;  3PPR A;  3K02 A;  4LZ7 A;  2ZYK A;  5FHM A;  4QRZ A;  3FGS A;  2CZL A;  2ANJ A;  2PT2 A;  4U22 A;  1VFD A;  3W9W A;  3G3I A;  4XKQ A;  1VR5 A;  2I4B A;  4H8J A;  1XVY A;  4BDQ A;  1JEU A;  3B6T A;  1B1H A;  1FQE A;  1XOC A;  3D4G A;  4F18 A;  2OWS A;  5L9S A;  1XT8 A;  5F7V A;  4NWD A;  1BTJ A;  1M5F A;  1J1N A;  3MWB A;  3TQL A;  4GLI A;  3IJO B;  2F7B A;  1DSN A;  2YJP A;  3RY3 A;  2Q2A A;  2V93 A;  3K6U A;  2O84 X;  2CMO A;  3U92 A;  1D4N A;  2Z8E A;  1BKA A;  3FAT A;  5AA2 A;  3C35 A;  3IB1 A;  4BDM A;  1JVX A;  4H65 A;  3H3G A;  4GL0 A;  4M1V A;  3V89 B;  2Z8F A;  1SDX A;  1B7Z A;  1SBP A;  1M5D A;  3V5A A;  3C31 A;  1XC1 A;  4WEP A;  1TT1 A;  2R71 A;  4DE8 A;  3Q25 A;  5JTY B;  5EYF A;  3KGC A;  3OMB A;  1UTB B;  4ZEF A;  2Y7K A;  2Y7R A;  3IOT A;  1MS7 A;  3TQW A;  2ZNU A;  3LSL A;  4FED A;  1WOD A;  5I57 A;  5CMK A;  1I6Q A;  1OMP A;  3RPW A;  3EN3 A;  1NFT A;  3KJT A;  3A09 A;  1B3L A;  3H6U A;  4QFN A;  3K6X A;  2DE2 A;  4DCY A;  1MM6 A;  3CVG A;  3IK6 B;  4POX A;  3FIR A;  4Q8R A;  1EZO A;  2RCB A;  3PMX A;  2AIX A;  3U94 A;  3HN0 A;  4NF8 B;  1SW4 A;  3UA8 A;  1IIT A;  5DVI A;  2O51 A;  1EU8 A;  3OXN A;  4M4G A;  1Y9U A;  3EPE A;  4GF8 A;  5AA3 A;  2VGQ A;  1IIW A;  4F2Q A;  3M3K A;  3QYT A;  4PFY A;  3MW0 A;  4C1U A;  2I0C A;  4RY1 A;  1CB6 A;  5ELV A;  1B3H A;  4MLV A;  1Q35 A;  5K2X A;  5F1Q A;  3O6I A;  2XXW A;  4TLL B;  3KZG A;  1Y3P A;  1SI0 A;  2DWH A;  4PFU A;  4HTG A;  4NED A;  1DTG A;  3PU5 A;  4U1Z A;  2G29 A;  1NMU A;  5FHN A;  3VLU A;  2ZYM A;  4RNS A;  1IQ7 A;  3PPO A;  1LAX A;  5ISU A;  2DP8 A;  2NVU B;  3A3C A;  3G3H A;  1RKM A;  4ELO A;  3T96 B;  3TTK A;  4ZED A;  4IO5 A;  4JWX A;  4EF1 A;  3H6T A;  2B3F A;  1D9V A;  4TOZ A;  2UYF A;  1A8F A;  3R6U A;  2I0B A;  4ZDM A;  1IUD A;  4Z0I A;  5I59 B;  4OEN A;  2OK2 A;  4KCC A;  3OO9 A;  4NF8 A;  3KOT A;  4QHQ A;  1IXI A;  4THI A;  5I58 B;  1JVY A;  2HAV A;  3OEL A;  1ZKB A;  4H8I A;  2I3W A;  3DP8 A;  4AB5 A;  3FXR A;  4DXC A;  4YB7 A;  4G77 A;  4P0G A;  4KI0 E;  1P1O A;  1N04 A;  3E4R A;  1PEB A;  3KN7 A;  4QF9 A;  5CRY A;  3U72 A;  3VV5 A;  4OEU A;  4YB5 A;  3CG3 A;  4NF5 A;  1JW5 A;  3KSX A;  4EQ9 A;  2I4C A;  4OQO A;  2VOZ A;  5DVF A;  4F31 B;  2XX9 A;  2O68 A;  1MQD A;  4YKP A;  4H6D A;  3TCF A;  3PUX E;  1MPC A;  1M5B A;  1FW0 A;  1B40 A;  3A3U A;  3MZ1 A;  1B05 A;  3EF7 A;  1B5I A;  3FVO A;  2QMX A;  4I9D A;  4KCD A;  2HZL A;  1BP5 A;  1XVX A;  3TOD A;  3UIF A;  5H8N A;  1VFE A;  1HSL A;  1OIB A;  2G93 A;  2V3T A;  1YPN A;  2QSX A;  5I59 A;  4HS7 A;  1T0K A;  1OVT A;  1QKB A;  2R9J A;  5BWJ A;  3PV0 E;  3IOW A;  2O6A A;  3T9X B;  3C4M A;  3IOV A;  4OES A;  4F3B A;  3MC2 A;  4U21 A;  3UN6 A;  4H0W A;  2PBW A;  1VE4 A;  5I58 A;  3O29 A;  2F6P A;  4JB7 A;  3TTN A;  1P1Q A;  1OQH A;  2VHA A;  3ZKK A;  1M5E A;  1FQB A;  3V8X B;  3FVG A;  5DEX B;  4YU0 A;  5L9M A;  3M3F A;  4Q5T A;  1B32 A;  4N6P A;  3PMV A;  3TMG A;  3OO8 A;  1FTL A;  5H8Q A;  2Z22 A;  3SET A;  3T93 B;  4OXV A;  3ONM A;  1MXX A;  4NF4 B;  3ZS6 A;  1ELJ A;  3T22 A;  2O7U A;  4F3G A;  1NKX A;  1PBP A;  3N94 A;  4U4S A;  1D3K A;  3RTF B;  2PMS A;  4RK2 A;  2ONS A;  1MPD A;  2UXA A;  3U8Q A;  1R9L A;  3FAS A;  2UVG A;  3H6V A;  1UTH B;  4BDO A;  4DXU A;  4QFK A;  1QVS A;  2PYY A;  2YLN A;  3B6W A;  5J1D A;  2RCA A;  2I6E A;  5TP9 B;  4MF3 A;  4X48 A;  4TQU Q;  3EHS A;  4EF2 A;  1OQG A;  3HPI A;  3ZSF A;  4OFL A;  5A5X B;  3KN8 A;  2X7P A;  3VFJ A;  4Q0C A;  1QUJ A;  2F5X A;  3IX1 A;  4GOT A;  4IB2 A;  3SDF A;  1ZMG A;  4IGT A;  1B9J A;  4RYA A;  3S9M C;  4MH5 A;  2ZMB A;  3KSJ A;  3OSR A;  2BJJ X;  4NF6 A;  3VVF A;  1MQH A;  2A5T B;  1YAE A;  4G68 C;  2XD3 A;  4R6H A;  3K00 A;  5AA2 D;  1A40 A;  3FJG A;  2DYX A;  5I2K B;  3PUV E;  3K4U A;  1PC3 A;  4C0R A;  5KDT B;  3SEY A;  3MUQ A;  2H25 A;  3PUW E;  3QUJ A;  1B7U A;  1M5C A;  3FZV A;  3RT8 A;  4I1D A;  4NF4 A;  4ZEK A;  1GGG A;  3CFL A;  4RK9 A;  1AH5 A;  3FXQ A;  2H98 A;  3SEW A;  1TWY A;  4OMB A;  4KD5 A;  3IB2 A;  1B52 A;  1B1X A;  4F19 A;  3B7D A;  3I5O A;  2F8D A;  2XHD A;  4MLQ A;  2NWJ A;  5TP9 A;  1B3E A;  4K3F A;  3IAZ A;  3SEV A;  3CFZ A;  1IEJ A;  1FCK A;  5FHO A;  5A5X A;  1LLS A;  4EXL A;  3T9H B;  2QS4 A;  3Q28 A;  3LR1 A;  4XKN A;  4DIG A;  2F34 A;  1H45 A;  3RTW B;  1FTK A;  1I6A A;  4R2B A;  1XS5 A;  4XIG Q;  2GHA A;  4G8H A;  4G8M A;  1Q1K A;  2O69 A;  3CSB A;  2A5T A;  1BLF A;  3IJX B;  1SQY A;  4GFR A;  3LUY A;  4FAT A;  5KCJ A;  1P1U A;  3VDF A;  2XXP A;  3SEU A;  4QSC A;  1GV8 A;  5I2K A;  4G68 A;  1JEV A;  3C33 A;  5HM4 B;  3KJ7 A;  3U1O A;  4GRK A;  1B4Z A;  1WVJ A;  4UA8 A;  3L6G A;  2O1M A;  3DEL B;  3SEX A;  1US4 A;  2NOO A;  2Y84 A;  3E3K A;  2THI A; 
#chains in the Genus database with same CATH topology
 2I3V A;  4ZEB A;  1ANF A;  1Y1M A;  1Y20 A;  3LBS A;  4PET A;  1EYJ A;  3BFT A;  1IXG A;  1NH7 A;  3VXC A;  1DBZ A;  3D4C A;  3TKD A;  1B6H A;  2WYK A;  1QKA A;  1TFD A;  5H8F B;  4H67 A;  3JV9 A;  3HHG A;  4YB6 A;  4H1X A;  4HCW A;  1N3X A;  3K0V A;  1B3F A;  1MDQ A;  4DI3 D;  1I69 A;  4F3P A;  3TPA A;  3KOS A;  4PBH A;  2V25 A;  1Z7N E;  3AXF A;  2GHB A;  4N91 A;  3MZB A;  4NE4 A;  1B5J A;  1QUK A;  2WEF A;  4JWY A;  1S7Y A;  1B58 A;  1YZ0 A;  3O97 A;  2GRV A;  2PFZ A;  3C9H A;  5ICT A;  3MP8 A;  2OWT A;  5H8S A;  1NV2 A;  3LC8 A;  2FVZ A;  4U1O A;  3KG2 A;  2ZXT A;  3LSW A;  4OVJ A;  3MP6 A;  4JWO A;  3IOR A;  1B0L A;  3C34 A;  4PAI A;  5CMC A;  1QJM A;  1YCJ A;  2HEU A;  3B8B A;  1WDN A;  3UP9 A;  3S9L C;  4EXK A;  3G3J A;  5IGA A;  1H3D A;  5DVJ A;  4WED A;  2Q74 A;  1POT A;  4QFL A;  3TEL A;  4XKR A;  2HXW A;  4N8Y A;  2E0S A;  2QVU A;  1OLC A;  1QUI A;  3K1P A;  4X04 A;  4I62 A;  3L6H A;  3CSG A;  3S9E A;  5I5P A;  5EHM A;  1A99 A;  2F97 A;  5JK4 A;  4ESW A;  1SW1 A;  4XFE A;  3IOU A;  5JTY A;  1EZ9 A;  1UIV A;  2P0S A;  1UTB A;  2XXY A;  5H8F A;  2W7Y A;  3IFC A;  2ESN A;  2XXI A;  1FPB A;  2R6G E;  4MJO A;  4O3B A;  3O2A A;  4RXL A;  5ET7 A;  2FBP A;  2YPN A;  3H06 B;  4LN5 A;  1II5 A;  4ONY A;  3V83 A;  3C32 A;  1SVX B;  1FPJ A;  4PF8 A;  4DZ1 A;  5AA4 B;  2DXR A;  3B50 A;  2CZK A;  3G7W A;  1B2H A;  1FTA A;  1NL5 A;  3S2V A;  2HAU A;  4DLD A;  4F1Y A;  1DK4 A;  4GD5 A;  3RLF E;  1LBB A;  4NTL A;  1N84 A;  1UQW A;  3CHG A;  2D5W A;  3RGY A;  2F7C A;  1AOV A;  1AL3 A;  4R2F A;  2UVJ A;  1MY4 A;  4GWU A;  3RUM A;  4GBV A;  5CBS A;  1D9Y A;  1OLA A;  1LB8 A;  3DLN A;  1ATG A;  4XEQ A;  2GQ1 A;  5CMB A;  1FBG A;  1JW1 A;  3QSL A;  3TTR A;  4YIC A;  5ITP A;  5EYG A;  1FBF A;  5ICQ A;  1URD A;  4FOR A;  2DQV A;  2DWI A;  5EQA A;  4PGP A;  1SYI A;  3RYD A;  4GIZ A;  3JYR A;  1FTM A;  1USY H;  1Y4T A;  4OYV A;  2DS9 A;  4R72 A;  4FE8 A;  4PF6 A;  1MQI A;  1HSE A;  1NH8 A;  4KYD A;  3GXA A;  2X26 A;  4P9K A;  3O6H A;  1AMF A;  2QPQ A;  5L9O A;  1K9Y A;  1NV3 A;  2O1L A;  4OHN A;  3S9N C;  3KN3 A;  1LAG E;  1IMC A;  1VDW A;  3Q27 A;  1B3G A;  3O28 A;  4UAB A;  4ESX A;  4BLA A;  1Y3Q A;  4IO4 A;  3HHF A;  4F22 A;  3E13 X;  1N3W A;  2M8C A;  3OO6 A;  1H76 A;  1URG A;  3CG1 A;  3F11 A;  3IL1 B;  1NNF A;  3GLB A;  1MDP 1;  3I6V A;  3OEM A;  3LSX A;  1HSJ A;  1LCT A;  2UVI A;  3SES A;  5LTC A;  5EHS A;  1IXH A;  2UVH A;  2AYS A;  4O7I A;  1FPG A;  3MVX A;  1MXW A;  4FJP A;  2ZZV A;  4LA9 A;  5I2N B;  1IME A;  3IO4 A;  4OET A;  2B4L A;  1MXY A;  2QRY A;  2QVR A;  1B7H A;  1LBC A;  4POW A;  3FD3 A;  3K2D A;  4KYS A;  3O6G A;  4HW8 A;  5I84 A;  3HST A;  2Q89 A;  5TPA B;  2VD3 A;  1O7T A;  4LVQ A;  3CFX A;  4ZEC A;  2ONK E;  4BDN A;  4F1V A;  3EHT A;  4YKI A;  2DXY A;  4U23 A;  4G8N A;  1H44 A;  3E79 A;  1N7W A;  3GBA A;  4GX3 A;  2DOJ A;  3QK6 A;  4RPO A;  5IZZ A;  4RA1 A;  2ONR A;  1FQC A;  4P8B A;  5BUU A;  1MXV A;  5IZ1 A;  2ZYO A;  4G2Z A;  4PFW A;  1DTZ A;  1JW4 A;  3OSQ A;  2XXU A;  2FHY A;  1LEV A;  1A55 A;  4N8G A;  3TTL A;  5LOM A;  5ESY A;  2Q9T A;  4XTC Q;  1LAH E;  1NV5 A;  5IKB A;  4N17 A;  1LFI A;  1IXC A;  4E0W A;  2F3B A;  3SER A;  5KZT A;  4OFO A;  1NV1 A;  3MVW A;  4DCX A;  1DOT A;  4GWZ A;  1XHY A;  1KA0 A;  5I2N A;  4MBP A;  3H4Z A;  2P3N A;  1NUW A;  4JXI A;  3OOA A;  1QW0 A;  3VLW A;  3VXB A;  1FTO A;  2ZYN A;  2VD2 A;  4OFJ A;  4KFQ A;  4EUO A;  3MJN A;  1MXU A;  1BIY A;  3GBB A;  2DVC A;  3BFU A;  3H7M A;  3G3K A;  5DEX A;  1NV6 A;  4U4X A;  2WX9 A;  2QJE A;  3QXM A;  4XKP A;  3OO7 A;  2HZK A;  4KPT A;  4KQP A;  5I56 B;  4LUB A;  2O7I A;  2V3Q A;  1Y1Z A;  2X7Q A;  3PD8 A;  1MQG A;  4ZZA A;  2HFB A;  2GFE A;  1A54 A;  2HHM A;  5HPQ A;  3H6W A;  3FV1 A;  4IO2 A;  4PE5 B;  4LZ5 A;  4JDF A;  1JQF A;  4MNI A;  3ILT B;  2LAO A;  1SI1 A;  3MVY A;  3HCQ A;  2F3D A;  5H8H B;  5F24 A;  4PQJ A;  1S50 A;  3MBP A;  3DM0 A;  5AA1 A;  1URS A;  4JVD A;  3BKI B;  1XI6 A;  4EDP A;  3R26 A;  2FIX A;  5CI5 A;  1FPK A;  2Y7W A;  2NUV A;  1UTH A;  1US5 A;  4X1B A;  4LAT A;  1SW2 A;  2F36 A;  4R74 A;  1USY E;  3U93 A;  4ZE8 A;  3JZJ A;  1O63 A;  1P1W A;  4NF0 A;  1GR2 A;  3FVN A;  1FJ9 A;  5FTH A;  1K9Z A;  4PFB A;  1NI9 A;  2XX8 A;  3N6U A;  1KZ8 A;  2XWI A;  1ZBM A;  4NG7 A;  4X8R A;  1NUY A;  3B6Q A;  4QFO A;  5I57 B;  1MY2 A;  2ZNS A;  4BDL A;  3KBR A;  3KFM A;  4GWX A;  3T1B A;  1MRP A;  4P0I A;  3S4U A;  1B4H A;  5L8D A;  4F1U A;  3CR9 A;  2HCA A;  4OVR A;  5CBR A;  1NNK A;  3UGW A;  4O3C A;  1LCF A;  3W15 C;  1NV4 A;  5I56 A;  2REJ A;  4F2O A;  4MFI A;  1F9B A;  2IEE A;  5KDT A;  1SD3 A;  3UOR A;  4GXA A;  3VE1 B;  2F78 A;  1EZP A;  1P1N A;  3TAJ A;  4P1E A;  4JVC A;  3FVK A;  3MVZ A;  2RC7 A;  1P99 A;  3TDJ A;  1NNP A;  2WBB A;  5H8H A;  4ZE9 A;  3H03 A;  3CRB A;  4GWO A;  2E1S A;  4GX6 A;  4QFP A;  2ZNT A;  5K2Y A;  4JBZ A;  5M2V A;  3PGF A;  5CM6 A;  3VVE A;  1FRP A;  1A8E A;  2QL3 A;  2PX1 A;  3E78 A;  4ND9 A;  1YTV A;  1B0H A;  1Y4C A;  1IMB A;  1PB9 A;  4NWC A;  2Y7P A;  4P3L A;  1RDX A;  5DTB A;  3LSF B;  1GVC A;  2XXR A;  1MPB A;  2XD2 A;  1CE2 A;  3N5L A;  3CIJ A;  1LB9 A;  2QS1 A;  3Q29 A;  5B7D A;  1FPD A;  4PTK A;  1MY3 A;  2Y7I A;  4IY5 A;  4H5G A;  2RC9 A;  4BDR A;  4ZS9 A;  2R8T A;  4P47 A;  4OZ9 A;  4N4U A;  4ISU A;  4GXS B;  2B65 A;  1YYZ A;  2QS3 A;  3T9V A;  4F39 A;  4RJZ A;  4HE1 A;  5FBP A;  4YMA A;  4JSO A;  2QMW A;  2XXV A;  4OVP A;  3HO7 A;  2F35 A;  2AL5 A;  3IR1 A;  5IAI A;  3QUF A;  5CC2 A;  5DT6 A;  1N7X A;  3DP6 A;  3UK4 A;  3K1N A;  3G3F A;  2Q2C A;  4FEB A;  2UYE A;  1IMF A;  3PPQ A;  1UIU A;  3M3L A;  3RQT A;  4QSE A;  1FBC A;  5EYH A;  3TFL A;  1CNQ A;  2P2A A;  5FTI A;  2RIN A;  2I49 A;  3K6V A;  4OEV A;  4XXU A;  3K01 A;  4NF5 B;  4YAH X;  5LDZ A;  3QAX A;  3OD7 A;  2Y5L A;  4R73 A;  1LFH A;  4LON B;  3N6T A;  1L5T A;  3HV1 A;  3MQ9 A;  2VPN A;  2XWK A;  4O7M A;  4MCO A;  4EQB A;  2RF1 A;  2XXQ A;  4O3A A;  2RKM A;  2OX3 A;  4ELP A;  4YKK A;  1B51 A;  1FJ6 A;  4F3S A;  3WAE A;  2OLB A;  4AQ4 A;  3Q26 A;  3MZ9 A;  2P1S A;  4FEC A;  1FQF A;  2OBG A;  4WKM A;  5H8N B;  2I48 A;  3ILU B;  3PUZ E;  2WKY A;  1DPP A;  1IZ1 A;  4AS5 A;  2DWA A;  1B5H A;  2PCR A;  4X1D A;  2OZZ A;  2HQ0 A;  1YXI A;  4R75 A;  3VVD A;  4PDH A;  1MQJ A;  4C1T A;  3PPP A;  4NQ8 A;  1BK4 A;  2JJK A;  4AB6 A;  4F29 A;  4HCY A;  1QUL A;  2XXX A;  2V3U A;  1ZTY A;  3FV2 A;  1H43 A;  1PB8 A;  2DVZ A;  4Q30 B;  4MMP A;  3TZA A;  3FUZ A;  2Z23 A;  4ELR A;  2NXO A;  3TEP A;  2ABH A;  4IO6 A;  4ZZE A;  4GWS A;  3TTM A;  1AIV A;  4OVS A;  3N26 A;  1LFG A;  3MPL A;  2QVV A;  3FXU A;  3K6W A;  1B46 A;  2IA4 A;  2REG A;  2F6G A;  2DE3 A;  1MH4 A;  4KYE A;  5HBC A;  4JSD A;  5H8Q B;  3LV0 A;  4PP0 A;  1EH3 A;  3FJM A;  4N07 A;  4YMB A;  4LQ2 A;  3TYH A;  3O9P A;  3ECR A;  3T66 A;  4N81 A;  2XX7 A;  2XXH A;  1POY 1;  1PBQ A;  4U2R A;  2PVU A;  1EYI A;  1ZU0 A;  3KC1 A;  4MHF A;  2ALU A;  3WAF A;  5AA4 A;  2VP1 A;  1DPE A;  2Y5K A;  1DMB A;  2CZH A;  1RYO A;  1FTJ A;  1S9T A;  1LST A;  1SW5 A;  4E0X A;  2DE4 A;  3GZG A;  1N76 A;  5ITO A;  2KR0 A;  3IB0 A;  1O64 A;  5AE4 A;  3I3V A;  1FPE A;  2A5S A;  4QSD A;  4G4P A;  4R9G A;  1ZLQ A;  3E9X A;  2Q8J A;  2D21 A;  1MY0 A;  4XF5 A;  1NNT A;  2GH9 A;  4N13 A;  2DWJ A;  3BBR A;  3T9U A;  1MM7 A;  4L17 A;  4ECF A;  2CZI A;  4NF6 B;  4IGR A;  3KEI A;  2D3I A;  3ZKL A;  1PDA A;  5CMM A;  2XXT A;  3ODB A;  4IO3 A;  1JP4 A;  4Z7E A;  4DDD A;  1I6B A;  2DSF A;  2B4M A;  2I58 A;  2QS2 A;  3RT6 B;  1FBH A;  4GVO A;  2H9B A;  4GX4 A;  3K1M A;  4IY6 A;  2V4C A;  4OA4 A;  3IFA A;  3RNN A;  4KHZ E;  2FYI A;  2OCU A;  2DDK A;  1TFA A;  1MXZ A;  3TUS A;  4GL8 A;  1JNF A;  5I7I A;  1R6Z A;  4DXB A;  2KLF A;  3FJ7 A;  4JVI A;  1R9Q A;  2AL4 A;  1N0T A;  4MIJ A;  2H5Y A;  4OTE A;  3DP4 A;  4ELQ A;  2H4I A;  3PMW A;  4NHB A;  4NN3 A;  1JET A;  4G61 A;  4I8C A;  1A7L A;  3QIM A;  2H99 A;  4PFT A;  3VLV A;  1Z7M E;  4R6Y A;  3P7I A;  3USD A;  4LZ8 A;  4P1L A;  2Q88 A;  4FAJ A;  2PT1 A;  3OEK A;  1INP A;  3EQ1 A;  1FQD A;  1GTK A;  1TXF A;  1SYH A;  4FIM A;  5JEI A;  1MH3 A;  3RPL B;  4N6D A;  4GQO A;  1PB7 A;  4P11 A;  2FA7 A;  3THI A;  1LGB C;  3TCG A;  2V84 A;  1ZIU A;  4PCD A;  3TCH A;  4H5F A;  1R1N A;  3M8U A;  3IO6 A;  4X9T A;  3MYU A;  3R7X A;  2OJT A;  5TPA A;  3O66 A;  1FQA A;  3G3G A;  1LBY A;  3PUY E;  2F7A A;  1RYX A;  5EQ7 A;  1MY1 A;  1RDZ A;  5B70 A;  3MAM A;  4R9F A;  4RPN A;  1LAF E;  3RN8 A;  3PD9 A;  2FNC A;  3C36 A;  2WYP A;  3U65 A;  3MP1 A;  5KCJ B;  4HE0 A;  4OWD A;  5TU0 A;  4LP2 B;  1ZJL A;  4YKJ A;  3EHU A;  3A29 A;  3ROJ A;  4G68 B;  4TLM B;  3KC0 A;  4IO7 A;  4WXJ A;  4N15 A;  2B3B A;  2Z8D A;  1OVB A;  4YZZ A;  3W9V A;  4QXD A;  4OER A;  4KR5 A;  4LQ5 A;  5AA2 B;  5A5L A;  3CI8 A;  4ZEI A;  3MPK A;  3OEN A;  5J16 A;  1Y3N A;  1KWH A;  4PE3 A;  4EQ7 A;  5DYH A;  4R6K A;  2VPO A;  4PFR A;  1IMA A;  2RC8 A;  4H46 A;  1MG1 A;  1FPI A;  1KA1 A;  3PPN A;  1LBW A;  2CEY A;  4UAC A;  3SKP A;  4OVT A;  1VSO A;  4NMY A;  3PPR A;  3K02 A;  4LZ7 A;  3RPL A;  2ZYK A;  5FHM A;  1NV7 A;  4QRZ A;  3EKI A;  3FGS A;  2CZL A;  5DW8 A;  2ANJ A;  2PT2 A;  4U22 A;  1VFD A;  3W9W A;  3G3I A;  4I3Y A;  4XKQ A;  1VR5 A;  2I4B A;  4H8J A;  4OAN A;  1XVY A;  4BDQ A;  3LUZ A;  3GYY A;  4PAK A;  1JEU A;  3B6T A;  3HFU A;  1B1H A;  1FQE A;  1XOC A;  3D4G A;  4F18 A;  3SZP A;  2OWS A;  4OVQ A;  1XT8 A;  5L9S A;  5F7V A;  4NWD A;  1BTJ A;  1M5F A;  1J1N A;  3MWB A;  3TQL A;  4PGN A;  4GLI A;  3IJO B;  2F7B A;  1DSN A;  2PFY A;  2YJP A;  3RY3 A;  2Q2A A;  2V93 A;  3K6U A;  2O84 X;  2CMO A;  3U92 A;  1D4N A;  2Z8E A;  1BKA A;  3FAT A;  5AA2 A;  3C35 A;  3IB1 A;  4BDM A;  1JVX A;  4H65 A;  3H3G A;  4GL0 A;  4M1V A;  3V89 B;  4MAG A;  2Z8F A;  1SDX A;  2HPG A;  1B7Z A;  1SBP A;  1M5D A;  1D9Q A;  3V5A A;  3C31 A;  1XC1 A;  4WEP A;  1TT1 A;  4GBW A;  2R71 A;  4DE8 A;  3Q25 A;  5JTY B;  5EYF A;  3KGC A;  3OMB A;  1UTB B;  4ZEF A;  2Y7K A;  1FBP A;  2Y7R A;  2P3V A;  3IOT A;  1MS7 A;  3TQW A;  2ZNU A;  3LSL A;  4FED A;  1WOD A;  5I57 A;  5CMK A;  1I6Q A;  1OMP A;  3RPW A;  3EN3 A;  1NFT A;  1NUX A;  3KJT A;  3A09 A;  2QFL A;  1B3L A;  4IR8 A;  3H6U A;  5EQ8 A;  1Q9D A;  2Q8M A;  5ET6 A;  4QFN A;  3K6X A;  2DE2 A;  4DCY A;  1MM6 A;  3CVG A;  3IK6 B;  4POX A;  3FIR A;  4Q8R A;  4PAF A;  1EZO A;  2RCB A;  3PMX A;  2AIX A;  3U94 A;  3HN0 A;  4NF8 B;  1SW4 A;  3UA8 A;  1LBX A;  1IIT A;  4MNP A;  5DVI A;  2O51 A;  1EU8 A;  4NGU A;  3OXN A;  4M4G A;  4MEV A;  1Y9U A;  3EPE A;  1DCU A;  4FBP A;  4GF8 A;  5AA3 A;  2VGQ A;  1IIW A;  5T3J A;  4F2Q A;  3M3K A;  3QYT A;  4PFY A;  3MW0 A;  4O94 A;  4C1U A;  2I0C A;  4RY1 A;  1CB6 A;  5ELV A;  1B3H A;  2VT5 A;  4MLV A;  1Q35 A;  5K2X A;  5F1Q A;  3O6I A;  2XXW A;  4TLL B;  3KZG A;  1Y3P A;  1SI0 A;  2DWH A;  4PFU A;  4HTG A;  4NED A;  1DTG A;  3PU5 A;  1LBZ A;  4U1Z A;  2G29 A;  1NMU A;  5FHN A;  5IZ3 B;  3VLU A;  2ZYM A;  4RNS A;  1IQ7 A;  3PPO A;  1LAX A;  5ISU A;  2DP8 A;  2NVU B;  2WBD A;  3A3C A;  3G3H A;  1RKM A;  4ELO A;  3T96 B;  3TTK A;  4ZED A;  4IO5 A;  2XXK A;  4JWX A;  2KQZ A;  4EF1 A;  3H6T A;  2B3F A;  4I3E A;  1D9V A;  4TOZ A;  2UYF A;  1A8F A;  3R6U A;  2I0B A;  4ZDM A;  1IUD A;  4Z0I A;  3BIH A;  2MKZ A;  5I59 B;  2OWZ A;  4OEN A;  2OK2 A;  4KCC A;  3OO9 A;  4NF8 A;  3KOT A;  4QHQ A;  1IXI A;  3FBP A;  4THI A;  5I58 B;  1JVY A;  1AWB A;  2HAV A;  3OEL A;  3FXB A;  1ZKB A;  5ET8 A;  4H8I A;  2I3W A;  3DP8 A;  4AB5 A;  3FXR A;  4DXC A;  4YB7 A;  4G77 A;  4P0G A;  4KI0 E;  1P1O A;  2XWO A;  1N04 A;  2BJI A;  4AS4 A;  3E4R A;  1PEB A;  3KN7 A;  4QF9 A;  4PDD A;  5CRY A;  3U72 A;  3VV5 A;  4OEU A;  4YB5 A;  3CG3 A;  4NF5 A;  1JW5 A;  3BIG A;  3KSX A;  4EQ9 A;  5ET5 A;  2I4C A;  4OQO A;  2VOZ A;  5DVF A;  4F31 B;  2XX9 A;  2O68 A;  1MQD A;  4YKP A;  4H6D A;  3MST A;  3D1R A;  3PUX E;  3TCF A;  5IZ3 A;  2ZZW A;  1MPC A;  1M5B A;  1FW0 A;  1B40 A;  3A3U A;  3MZ1 A;  1B05 A;  3EF7 A;  1B5I A;  2ZZX A;  3FVO A;  2QMX A;  4I9D A;  4KCD A;  2HZL A;  1BP5 A;  1XVX A;  3TOD A;  3UIF A;  5H8N A;  4H45 A;  1VFE A;  1HSL A;  1OIB A;  2G93 A;  3KBZ A;  2V3T A;  1YPN A;  2QSX A;  5I59 A;  4HS7 A;  1T0K A;  1OVT A;  1QKB A;  2R9J A;  5BWJ A;  4I40 A;  3PV0 E;  3IOW A;  2O6A A;  3T9X B;  3C4M A;  3IOV A;  4OES A;  4F3B A;  3MC2 A;  4U21 A;  4QBA A;  3UN6 A;  4H0W A;  2PBW A;  4KXP A;  1VE4 A;  5I58 A;  3O29 A;  2F6P A;  2XA5 A;  4JB7 A;  3TTN A;  1P1Q A;  1OQH A;  2VHA A;  4NX1 A;  3ZKK A;  1M5E A;  1FQB A;  3V8X B;  3FVG A;  5DEX B;  4YU0 A;  5L9M A;  3M3F A;  4Q5T A;  1B32 A;  4N6P A;  1FPF A;  3PMV A;  3TMG A;  3OO8 A;  1FTL A;  5H8Q A;  2Z22 A;  3SET A;  3T93 B;  4OXV A;  3ONM A;  4GWY A;  1MXX A;  4NF4 B;  4P56 A;  3ZS6 A;  1ELJ A;  3T22 A;  2O7U A;  4F3G A;  3ISP A;  1NKX A;  1PBP A;  3N94 A;  4U4S A;  1D3K A;  3RTF B;  2PMS A;  4RK2 A;  2ONS A;  1MPD A;  2UXA A;  3U8Q A;  1R9L A;  3FAS A;  2UVG A;  3H6V A;  1UTH B;  4BDO A;  4DXU A;  4QFK A;  1QVS A;  2PYY A;  2YLN A;  4HXV A;  3B6W A;  5J1D A;  2RCA A;  2I6E A;  4MF3 A;  5TP9 B;  4X48 A;  4TQU Q;  3EHS A;  4EF2 A;  1OQG A;  3HPI A;  3ZSF A;  4OFL A;  5A5X B;  3KN8 A;  2X7P A;  3VFJ A;  4Q0C A;  4DI4 B;  1QUJ A;  2L5V A;  2F5X A;  3IX1 A;  4GOT A;  4PFI A;  4IB2 A;  3SDF A;  1ZMG A;  4IGT A;  5EQ9 A;  1B9J A;  5I3S A;  1G0I A;  4RYA A;  3S9M C;  2XWV A;  4MH5 A;  2ZMB A;  3KSJ A;  3OSR A;  2BJJ X;  4NF6 A;  3VVF A;  1MQH A;  4NAP A;  2A5T B;  1FBE A;  1YAE A;  4G68 C;  4HE2 A;  2XD3 A;  4R6H A;  3K00 A;  5AA2 D;  1A40 A;  1FSA A;  3FJG A;  2DYX A;  5I2K B;  3PUV E;  3K4U A;  1PC3 A;  4C0R A;  5KDT B;  3SEY A;  3MUQ A;  2H25 A;  3PUW E;  3QUJ A;  1B7U A;  1M5C A;  3FZV A;  3RT8 A;  4I1D A;  4NF4 A;  3T0J A;  4ZEK A;  1EYK A;  4GWW A;  1GGG A;  2FIE A;  3CFL A;  4RK9 A;  1AH5 A;  3FXQ A;  2H98 A;  3SEW A;  1TWY A;  4PBQ A;  4OMB A;  4KD5 A;  3IB2 A;  1B52 A;  1B1X A;  4F19 A;  3B7D A;  3I5O A;  2F8D A;  1LBV A;  2XHD A;  4MLQ A;  2NWJ A;  5TP9 A;  1B3E A;  4K3F A;  3IAZ A;  3SEV A;  3CFZ A;  1IEJ A;  1FCK A;  5FHO A;  5A5X A;  1LLS A;  4EXL A;  3T9H B;  3QMF A;  4MNC A;  2QS4 A;  3Q28 A;  3LR1 A;  1FPL A;  4XKN A;  4DIG A;  2F34 A;  1RDY A;  1G0H A;  4PC9 A;  1H45 A;  3RTW B;  1FTK A;  1I6A A;  4R2B A;  1XS5 A;  4XIG Q;  2GHA A;  4G8H A;  4G8M A;  1Q1K A;  2O69 A;  3CSB A;  2A5T A;  1BLF A;  2CEX A;  3IJX B;  1SQY A;  4GFR A;  2HXR A;  3PTY A;  4O8M A;  3LUY A;  1NUZ A;  4FAT A;  5KCJ A;  1P1U A;  3VDF A;  2XXP A;  3SEU A;  4MX6 A;  4QSC A;  1GV8 A;  5I2K A;  4G68 A;  1SPI A;  1NV0 A;  1IMD A;  3NOH A;  1JEV A;  4N6K A;  5IM2 A;  3C33 A;  5HM4 B;  3KJ7 A;  3U1O A;  4GRK A;  1FBD A;  1B4Z A;  1WVJ A;  4UA8 A;  3L6G A;  2O1M A;  3DEL B;  1QGX A;  3SEX A;  1US4 A;  2NOO A;  2Y84 A;  3E3K A;  2THI A; 
#chains in the Genus database with same CATH homology
 2I3V A;  4ZEB A;  1ANF A;  1Y1M A;  1Y20 A;  3LBS A;  4PET A;  3BFT A;  1IXG A;  1NH7 A;  3VXC A;  3D4C A;  3TKD A;  1B6H A;  1QKA A;  1TFD A;  5H8F B;  4H67 A;  3JV9 A;  3HHG A;  4YB6 A;  4H1X A;  4HCW A;  1N3X A;  3K0V A;  1B3F A;  1MDQ A;  1I69 A;  4F3P A;  3TPA A;  3KOS A;  2V25 A;  1Z7N E;  3AXF A;  2GHB A;  3MZB A;  4NE4 A;  1B5J A;  1QUK A;  4JWY A;  1S7Y A;  1B58 A;  3O97 A;  2GRV A;  3C9H A;  5ICT A;  3MP8 A;  2OWT A;  5H8S A;  3LC8 A;  4U1O A;  3KG2 A;  2ZXT A;  3LSW A;  4OVJ A;  3MP6 A;  4JWO A;  3IOR A;  1B0L A;  3C34 A;  5CMC A;  1QJM A;  1YCJ A;  2HEU A;  1WDN A;  3UP9 A;  3S9L C;  4EXK A;  3G3J A;  1H3D A;  5DVJ A;  4WED A;  4QFL A;  1POT A;  3TEL A;  4XKR A;  2HXW A;  2E0S A;  1OLC A;  1QUI A;  3K1P A;  4I62 A;  3L6H A;  3CSG A;  3S9E A;  5EHM A;  1A99 A;  2F97 A;  5JK4 A;  4ESW A;  1SW1 A;  3IOU A;  5JTY A;  1EZ9 A;  1UIV A;  2P0S A;  1UTB A;  2XXY A;  5H8F A;  2W7Y A;  2ESN A;  2XXI A;  2R6G E;  4O3B A;  3O2A A;  4RXL A;  2YPN A;  3H06 B;  1II5 A;  4ONY A;  3V83 A;  3C32 A;  1SVX B;  4DZ1 A;  5AA4 B;  2DXR A;  3G7W A;  1B2H A;  1NL5 A;  3S2V A;  2HAU A;  4DLD A;  4F1Y A;  4GD5 A;  3RLF E;  1LBB A;  4NTL A;  1N84 A;  1UQW A;  2D5W A;  3RGY A;  2F7C A;  1AOV A;  1AL3 A;  4R2F A;  2UVJ A;  1MY4 A;  3RUM A;  5CBS A;  1D9Y A;  1OLA A;  1LB8 A;  3DLN A;  1ATG A;  5CMB A;  1JW1 A;  3QSL A;  3TTR A;  4YIC A;  5ITP A;  5ICQ A;  1URD A;  4FOR A;  2DQV A;  2DWI A;  1SYI A;  4GIZ A;  3JYR A;  1FTM A;  1USY H;  1Y4T A;  4OYV A;  2DS9 A;  4R72 A;  4FE8 A;  1MQI A;  1HSE A;  1NH8 A;  4KYD A;  3GXA A;  2X26 A;  3O6H A;  1AMF A;  2QPQ A;  5L9O A;  2O1L A;  4OHN A;  3S9N C;  3KN3 A;  1LAG E;  3Q27 A;  1B3G A;  3O28 A;  4ESX A;  4BLA A;  1Y3Q A;  4IO4 A;  3HHF A;  4F22 A;  3E13 X;  1N3W A;  2M8C A;  3OO6 A;  1H76 A;  1URG A;  3CG1 A;  3F11 A;  3IL1 B;  1NNF A;  3GLB A;  1MDP 1;  3I6V A;  3OEM A;  3LSX A;  1HSJ A;  1LCT A;  2UVI A;  3SES A;  5EHS A;  1IXH A;  2UVH A;  2AYS A;  3MVX A;  1MXW A;  4FJP A;  4LA9 A;  5I2N B;  3IO4 A;  4OET A;  1MXY A;  2QRY A;  1B7H A;  1LBC A;  4POW A;  3FD3 A;  3K2D A;  4KYS A;  3O6G A;  4HW8 A;  5I84 A;  3HST A;  2Q89 A;  5TPA B;  2VD3 A;  1O7T A;  4ZEC A;  3CFX A;  4LVQ A;  2ONK E;  4BDN A;  4F1V A;  3EHT A;  4YKI A;  2DXY A;  4U23 A;  4G8N A;  1H44 A;  1N7W A;  3GBA A;  2DOJ A;  3QK6 A;  4RPO A;  4RA1 A;  2ONR A;  1FQC A;  5BUU A;  1MXV A;  2ZYO A;  4G2Z A;  4PFW A;  1DTZ A;  1JW4 A;  3OSQ A;  2XXU A;  1A55 A;  3TTL A;  5LOM A;  2Q9T A;  4XTC Q;  1LAH E;  5IKB A;  1LFI A;  1IXC A;  4E0W A;  3SER A;  5KZT A;  4OFO A;  3MVW A;  4DCX A;  1DOT A;  1XHY A;  5I2N A;  4MBP A;  3H4Z A;  4JXI A;  3OOA A;  1QW0 A;  3VLW A;  3VXB A;  1FTO A;  2ZYN A;  2VD2 A;  4OFJ A;  4KFQ A;  4EUO A;  3MJN A;  1MXU A;  1BIY A;  3GBB A;  2DVC A;  3BFU A;  3H7M A;  3G3K A;  5DEX A;  4U4X A;  2QJE A;  3QXM A;  4XKP A;  3OO7 A;  2HZK A;  4KPT A;  4KQP A;  5I56 B;  4LUB A;  2O7I A;  2V3Q A;  1Y1Z A;  2X7Q A;  3PD8 A;  1MQG A;  4ZZA A;  2HFB A;  2GFE A;  1A54 A;  5HPQ A;  3H6W A;  3FV1 A;  4IO2 A;  4PE5 B;  4LZ5 A;  4JDF A;  1JQF A;  3ILT B;  2LAO A;  1SI1 A;  3MVY A;  3HCQ A;  5H8H B;  4PQJ A;  1S50 A;  3MBP A;  3DM0 A;  5AA1 A;  1URS A;  3BKI B;  4EDP A;  3R26 A;  5CI5 A;  2Y7W A;  2NUV A;  1UTH A;  1US5 A;  4X1B A;  4LAT A;  1SW2 A;  2F36 A;  4R74 A;  1USY E;  3U93 A;  4ZE8 A;  3JZJ A;  1O63 A;  1P1W A;  1GR2 A;  3FVN A;  5FTH A;  2XX8 A;  3N6U A;  1ZBM A;  3B6Q A;  4QFO A;  5I57 B;  1MY2 A;  2ZNS A;  4BDL A;  3KBR A;  3KFM A;  1MRP A;  4P0I A;  3S4U A;  1B4H A;  5L8D A;  4F1U A;  3CR9 A;  2HCA A;  5CBR A;  1NNK A;  3UGW A;  4O3C A;  1LCF A;  3W15 C;  5I56 A;  2REJ A;  4F2O A;  4MFI A;  1F9B A;  2IEE A;  5KDT A;  1SD3 A;  3UOR A;  4GXA A;  3VE1 B;  2F78 A;  1EZP A;  1P1N A;  3TAJ A;  3FVK A;  3MVZ A;  2RC7 A;  1P99 A;  3TDJ A;  1NNP A;  5H8H A;  4ZE9 A;  3H03 A;  3CRB A;  4GWO A;  2E1S A;  4QFP A;  2ZNT A;  5K2Y A;  4JBZ A;  5M2V A;  3PGF A;  5CM6 A;  3VVE A;  1A8E A;  2QL3 A;  2PX1 A;  4ND9 A;  1YTV A;  1B0H A;  1Y4C A;  1PB9 A;  4NWC A;  2Y7P A;  5DTB A;  3LSF B;  1GVC A;  2XXR A;  1MPB A;  2XD2 A;  1CE2 A;  3N5L A;  3CIJ A;  1LB9 A;  2QS1 A;  3Q29 A;  5B7D A;  1MY3 A;  2Y7I A;  4IY5 A;  4H5G A;  2RC9 A;  4BDR A;  4ZS9 A;  4OZ9 A;  4ISU A;  4GXS B;  2B65 A;  2QS3 A;  3T9V A;  4F39 A;  4RJZ A;  4YMA A;  4JSO A;  2QMW A;  2XXV A;  3HO7 A;  2F35 A;  2AL5 A;  3IR1 A;  5IAI A;  3QUF A;  5CC2 A;  5DT6 A;  1N7X A;  3DP6 A;  3UK4 A;  3K1N A;  3G3F A;  2Q2C A;  4FEB A;  2UYE A;  3PPQ A;  1UIU A;  3M3L A;  3RQT A;  4QSE A;  3TFL A;  2P2A A;  5FTI A;  2RIN A;  2I49 A;  3K6V A;  4OEV A;  4XXU A;  3K01 A;  4NF5 B;  4YAH X;  3QAX A;  3OD7 A;  4R73 A;  1LFH A;  4LON B;  3N6T A;  1L5T A;  3HV1 A;  3MQ9 A;  4EQB A;  2RF1 A;  2XXQ A;  4O3A A;  2RKM A;  4ELP A;  4YKK A;  1B51 A;  4F3S A;  3WAE A;  2OLB A;  4AQ4 A;  3Q26 A;  3MZ9 A;  2P1S A;  4FEC A;  1FQF A;  2OBG A;  4WKM A;  5H8N B;  2I48 A;  3ILU B;  3PUZ E;  2WKY A;  1DPP A;  1IZ1 A;  2DWA A;  1B5H A;  4X1D A;  2OZZ A;  2HQ0 A;  4R75 A;  3VVD A;  1MQJ A;  4C1T A;  3PPP A;  4AB6 A;  4F29 A;  4HCY A;  1QUL A;  2XXX A;  2V3U A;  1ZTY A;  3FV2 A;  1H43 A;  1PB8 A;  2DVZ A;  4Q30 B;  3TZA A;  3FUZ A;  2Z23 A;  4ELR A;  2NXO A;  3TEP A;  2ABH A;  4IO6 A;  4ZZE A;  3TTM A;  1AIV A;  3N26 A;  1LFG A;  3FXU A;  3MPL A;  3K6W A;  1B46 A;  2IA4 A;  2REG A;  2F6G A;  2DE3 A;  1MH4 A;  4KYE A;  5HBC A;  4JSD A;  5H8Q B;  4PP0 A;  1EH3 A;  3FJM A;  4N07 A;  4YMB A;  4LQ2 A;  3TYH A;  3O9P A;  3ECR A;  3T66 A;  2XX7 A;  2XXH A;  1POY 1;  1PBQ A;  4U2R A;  2PVU A;  1ZU0 A;  2ALU A;  3WAF A;  5AA4 A;  2VP1 A;  1DPE A;  1DMB A;  1RYO A;  1FTJ A;  1S9T A;  1LST A;  1SW5 A;  4E0X A;  2DE4 A;  3GZG A;  1N76 A;  5ITO A;  3IB0 A;  1O64 A;  5AE4 A;  3I3V A;  2A5S A;  4QSD A;  4G4P A;  4R9G A;  1ZLQ A;  3E9X A;  2Q8J A;  2D21 A;  1MY0 A;  1NNT A;  2GH9 A;  4N13 A;  2DWJ A;  3BBR A;  3T9U A;  1MM7 A;  4L17 A;  4ECF A;  4NF6 B;  4IGR A;  3KEI A;  2D3I A;  3ZKL A;  1PDA A;  5CMM A;  2XXT A;  3ODB A;  4IO3 A;  4Z7E A;  4DDD A;  1I6B A;  2DSF A;  2I58 A;  2QS2 A;  3RT6 B;  4GVO A;  2H9B A;  3K1M A;  4IY6 A;  3RNN A;  4KHZ E;  2FYI A;  2OCU A;  1TFA A;  1MXZ A;  3TUS A;  4GL8 A;  1JNF A;  1R6Z A;  4DXB A;  2KLF A;  3FJ7 A;  1R9Q A;  2AL4 A;  1N0T A;  2H5Y A;  4OTE A;  3DP4 A;  4ELQ A;  2H4I A;  3PMW A;  1JET A;  4I8C A;  1A7L A;  3QIM A;  2H99 A;  4PFT A;  3VLV A;  1Z7M E;  4R6Y A;  3P7I A;  3USD A;  4LZ8 A;  2Q88 A;  4FAJ A;  2PT1 A;  3OEK A;  3EQ1 A;  1FQD A;  1GTK A;  1TXF A;  1SYH A;  4FIM A;  5JEI A;  1MH3 A;  4GQO A;  1PB7 A;  4P11 A;  2FA7 A;  3THI A;  1LGB C;  3TCG A;  2V84 A;  1ZIU A;  3TCH A;  4H5F A;  1R1N A;  3M8U A;  3IO6 A;  4X9T A;  3R7X A;  2OJT A;  5TPA A;  3O66 A;  1FQA A;  3G3G A;  3PUY E;  2F7A A;  1RYX A;  1MY1 A;  5B70 A;  3MAM A;  4R9F A;  4RPN A;  1LAF E;  3RN8 A;  3PD9 A;  2FNC A;  3C36 A;  3MP1 A;  5KCJ B;  4OWD A;  5TU0 A;  4LP2 B;  1ZJL A;  4YKJ A;  3EHU A;  4G68 B;  4TLM B;  4IO7 A;  4WXJ A;  2B3B A;  2Z8D A;  1OVB A;  4YZZ A;  3W9V A;  4OER A;  4KR5 A;  4LQ5 A;  5AA2 B;  3CI8 A;  4ZEI A;  3MPK A;  3OEN A;  1Y3N A;  1KWH A;  4EQ7 A;  5DYH A;  4R6K A;  2RC8 A;  1MG1 A;  3PPN A;  4UAC A;  3SKP A;  1VSO A;  4NMY A;  3PPR A;  3K02 A;  4LZ7 A;  2ZYK A;  5FHM A;  4QRZ A;  3FGS A;  2CZL A;  2ANJ A;  2PT2 A;  4U22 A;  1VFD A;  3W9W A;  3G3I A;  4XKQ A;  1VR5 A;  2I4B A;  4H8J A;  1XVY A;  4BDQ A;  1JEU A;  3B6T A;  1B1H A;  1FQE A;  1XOC A;  3D4G A;  4F18 A;  2OWS A;  5L9S A;  1XT8 A;  5F7V A;  4NWD A;  1BTJ A;  1M5F A;  1J1N A;  3MWB A;  3TQL A;  4GLI A;  3IJO B;  2F7B A;  1DSN A;  2YJP A;  3RY3 A;  2Q2A A;  2V93 A;  3K6U A;  2O84 X;  2CMO A;  3U92 A;  1D4N A;  2Z8E A;  1BKA A;  3FAT A;  5AA2 A;  3C35 A;  3IB1 A;  4BDM A;  1JVX A;  4H65 A;  3H3G A;  4GL0 A;  4M1V A;  3V89 B;  2Z8F A;  1SDX A;  1B7Z A;  1SBP A;  1M5D A;  3V5A A;  3C31 A;  1XC1 A;  4WEP A;  1TT1 A;  2R71 A;  4DE8 A;  3Q25 A;  5JTY B;  5EYF A;  3KGC A;  3OMB A;  1UTB B;  4ZEF A;  2Y7K A;  2Y7R A;  3IOT A;  1MS7 A;  3TQW A;  2ZNU A;  3LSL A;  4FED A;  1WOD A;  5I57 A;  5CMK A;  1I6Q A;  1OMP A;  3RPW A;  3EN3 A;  1NFT A;  3KJT A;  3A09 A;  1B3L A;  3H6U A;  4QFN A;  3K6X A;  2DE2 A;  4DCY A;  1MM6 A;  3CVG A;  3IK6 B;  4POX A;  3FIR A;  4Q8R A;  1EZO A;  2RCB A;  3PMX A;  2AIX A;  3U94 A;  3HN0 A;  4NF8 B;  1SW4 A;  3UA8 A;  1IIT A;  5DVI A;  2O51 A;  1EU8 A;  3OXN A;  4M4G A;  1Y9U A;  3EPE A;  4GF8 A;  5AA3 A;  2VGQ A;  1IIW A;  4F2Q A;  3M3K A;  3QYT A;  4PFY A;  3MW0 A;  4C1U A;  2I0C A;  4RY1 A;  1CB6 A;  5ELV A;  1B3H A;  4MLV A;  1Q35 A;  5K2X A;  5F1Q A;  3O6I A;  2XXW A;  4TLL B;  3KZG A;  1Y3P A;  1SI0 A;  2DWH A;  4PFU A;  4HTG A;  4NED A;  1DTG A;  3PU5 A;  4U1Z A;  2G29 A;  1NMU A;  5FHN A;  3VLU A;  2ZYM A;  4RNS A;  1IQ7 A;  3PPO A;  1LAX A;  5ISU A;  2DP8 A;  2NVU B;  3A3C A;  3G3H A;  1RKM A;  4ELO A;  3T96 B;  3TTK A;  4ZED A;  4IO5 A;  4JWX A;  4EF1 A;  3H6T A;  2B3F A;  1D9V A;  4TOZ A;  2UYF A;  1A8F A;  3R6U A;  2I0B A;  4ZDM A;  1IUD A;  4Z0I A;  5I59 B;  4OEN A;  2OK2 A;  4KCC A;  3OO9 A;  4NF8 A;  3KOT A;  4QHQ A;  1IXI A;  4THI A;  5I58 B;  1JVY A;  2HAV A;  3OEL A;  1ZKB A;  4H8I A;  2I3W A;  3DP8 A;  4AB5 A;  3FXR A;  4DXC A;  4YB7 A;  4G77 A;  4P0G A;  4KI0 E;  1P1O A;  1N04 A;  3E4R A;  1PEB A;  3KN7 A;  4QF9 A;  5CRY A;  3U72 A;  3VV5 A;  4OEU A;  4YB5 A;  3CG3 A;  4NF5 A;  1JW5 A;  3KSX A;  4EQ9 A;  2I4C A;  4OQO A;  2VOZ A;  5DVF A;  4F31 B;  2XX9 A;  2O68 A;  1MQD A;  4YKP A;  4H6D A;  3TCF A;  3PUX E;  1MPC A;  1M5B A;  1FW0 A;  1B40 A;  3A3U A;  3MZ1 A;  1B05 A;  3EF7 A;  1B5I A;  3FVO A;  2QMX A;  4I9D A;  4KCD A;  2HZL A;  1BP5 A;  1XVX A;  3TOD A;  3UIF A;  5H8N A;  1VFE A;  1HSL A;  1OIB A;  2G93 A;  2V3T A;  1YPN A;  2QSX A;  5I59 A;  4HS7 A;  1T0K A;  1OVT A;  1QKB A;  2R9J A;  5BWJ A;  3PV0 E;  3IOW A;  2O6A A;  3T9X B;  3C4M A;  3IOV A;  4OES A;  4F3B A;  3MC2 A;  4U21 A;  3UN6 A;  4H0W A;  2PBW A;  1VE4 A;  5I58 A;  3O29 A;  2F6P A;  4JB7 A;  3TTN A;  1P1Q A;  1OQH A;  2VHA A;  3ZKK A;  1M5E A;  1FQB A;  3V8X B;  3FVG A;  5DEX B;  4YU0 A;  5L9M A;  3M3F A;  4Q5T A;  1B32 A;  4N6P A;  3PMV A;  3TMG A;  3OO8 A;  1FTL A;  5H8Q A;  2Z22 A;  3SET A;  3T93 B;  4OXV A;  3ONM A;  1MXX A;  4NF4 B;  3ZS6 A;  1ELJ A;  3T22 A;  2O7U A;  4F3G A;  1NKX A;  1PBP A;  3N94 A;  4U4S A;  1D3K A;  3RTF B;  2PMS A;  4RK2 A;  2ONS A;  1MPD A;  2UXA A;  3U8Q A;  1R9L A;  3FAS A;  2UVG A;  3H6V A;  1UTH B;  4BDO A;  4DXU A;  4QFK A;  1QVS A;  2PYY A;  2YLN A;  3B6W A;  5J1D A;  2RCA A;  2I6E A;  5TP9 B;  4MF3 A;  4X48 A;  4TQU Q;  3EHS A;  4EF2 A;  1OQG A;  3HPI A;  3ZSF A;  4OFL A;  5A5X B;  3KN8 A;  2X7P A;  3VFJ A;  4Q0C A;  1QUJ A;  2F5X A;  3IX1 A;  4GOT A;  4IB2 A;  3SDF A;  1ZMG A;  4IGT A;  1B9J A;  4RYA A;  3S9M C;  4MH5 A;  2ZMB A;  3KSJ A;  3OSR A;  2BJJ X;  4NF6 A;  3VVF A;  1MQH A;  2A5T B;  1YAE A;  4G68 C;  2XD3 A;  4R6H A;  3K00 A;  5AA2 D;  1A40 A;  3FJG A;  2DYX A;  5I2K B;  3PUV E;  3K4U A;  1PC3 A;  4C0R A;  5KDT B;  3SEY A;  3MUQ A;  2H25 A;  3PUW E;  3QUJ A;  1B7U A;  1M5C A;  3FZV A;  3RT8 A;  4I1D A;  4NF4 A;  4ZEK A;  1GGG A;  3CFL A;  4RK9 A;  1AH5 A;  3FXQ A;  2H98 A;  3SEW A;  1TWY A;  4OMB A;  4KD5 A;  3IB2 A;  1B52 A;  1B1X A;  4F19 A;  3B7D A;  3I5O A;  2F8D A;  2XHD A;  4MLQ A;  2NWJ A;  5TP9 A;  1B3E A;  4K3F A;  3IAZ A;  3SEV A;  3CFZ A;  1IEJ A;  1FCK A;  5FHO A;  5A5X A;  1LLS A;  4EXL A;  3T9H B;  2QS4 A;  3Q28 A;  3LR1 A;  4XKN A;  4DIG A;  2F34 A;  1H45 A;  3RTW B;  1FTK A;  1I6A A;  4R2B A;  1XS5 A;  4XIG Q;  2GHA A;  4G8H A;  4G8M A;  1Q1K A;  2O69 A;  3CSB A;  2A5T A;  1BLF A;  3IJX B;  1SQY A;  4GFR A;  3LUY A;  4FAT A;  5KCJ A;  1P1U A;  3VDF A;  2XXP A;  3SEU A;  4QSC A;  1GV8 A;  5I2K A;  4G68 A;  1JEV A;  3C33 A;  5HM4 B;  3KJ7 A;  3U1O A;  4GRK A;  1B4Z A;  1WVJ A;  4UA8 A;  3L6G A;  2O1M A;  3DEL B;  3SEX A;  1US4 A;  2NOO A;  2Y84 A;  3E3K A;  2THI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...