3KFMA

Crystal structure of the glua4 ligand-binding domain l651v mutant in complex with kainate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
257
Chain Sequence
TVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLAKQTEIAYGTVDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enhanced efficacy without further cleft closure: reevaluating twist as a source of agonist efficacy in AMPA receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords Glutamate receptor 4
total genus 80
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kfmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kfmA02
3MZ1A 2F6GA 2R6GE 3ZKKA 1ANFA 3QIMA 3SDFA 4LQ2A 5ITPA 2Q88A 4F19A 1URGA 3M3LA 3RLFE 3RY3A 5CC2A 1MPCA 1FQDA 2XX9A 1JNFA 2I3WA 4FEBA 2HZLA 5I59A 3OSRA 3W9WA 1N3XA 1OVBA 4M1VA 1QW0A 2BJJX 5H8QB 3S9LC 3PUYE 2DXRA 2XXUA 4GQOA 1AMFA 1N84A 2RF1A 3PPNA 3IR1A 4OEUA 4ONYA 1EU8A 1TWYA 3TTLA 3KG2A 3SETA 4Q30B 3K1PA 1EZOA 4FEDA 3GXAA 3K6UA 4FORA 4ZECA 1PC3A 3ECRA 3HO7A 1A8EA 3TMGA 2QPQA 3IB1A 1Y4TA 3QUFA 2QS3A 3U72A 2H4IA 1H43A 2AYSA 2XXYA 3K6VA 1XVXA 5HBCA 1M5FA 2AIXA 4QFKA 4FIMA 1B05A 4R6HA 5I59B 1Y3NA 4LA9A 1N7WA 3OENA 3K1MA 3S9EA 2XXQA 3K01A 1T0KA 3MBPA 3TCHA 1N7XA 4H8IA 3SEVA 2RC8A 1H76A 1FTMA 3RGYA 5DVJA 1A99A 4KYSA 5CRYA 1MQHA 1I6QA 3R6UA 4OWDA 3T93B 2NOOA 2DXYA 3BKIB 1PBPA 3TTMA 5IKBA 3K2DA 2UYFA 4OESA 2I58A 5FTHA 2QS4A 4H5FA 5I2KA 2ALUA 5DEXB 1LAFE 3ILUB 1MY2A 4H0WA 4QHQA 2PX1A 3TTKA 3FXUA 1P1NA 4IY5A 4NF4A 2VP1A 2DWAA 3OEMA 4E0XA 1LB9A 2RINA 3HPIA 2ZXTA 1P1WA 4TOZA 2OZZA 2F34A 2XXPA 1O63A 4Z7EA 3PMWA 4ND9A 5LOMA 3CVGA 3U93A 2VOZA 5TP9B 3O6IA 4F1UA 3C31A 4NF6A 5AA2A 3H6VA 4ZEIA 1SI0A 2IA4A 2RC7A 3KOSA 3TQWA 2OCUA 1FTKA 4OETA 3T9HB 1VFDA 4M4GA 1QUKA 2D3IA 1SW2A 3VVDA 1NH7A 3H06B 4G4PA 2O68A 3LC8A 3VFJA 1Y3PA 4RXLA 1J1NA 1NFTA 2V3TA 1N0TA 1PBQA 1Y1ZA 2QS2A 4KPTA 4R9FA 4TLMB 1B2HA 4XTCQ 3V89B 3SEYA 2E1SA 2ZYOA 2YPNA 3FXQA 4XKRA 5I58A 3I3VA 1MY0A 2F97A 1SVXB 3FVKA 4GF8A 3RQTA 2ZNSA 4KCCA 4YU0A 5AA4B 3N6TA 4AB5A 4BDMA 4R6KA 2HQ0A 3T9XB 4OXVA 2QRYA 3T66A 1B5JA 1WDNA 5FHMA 5JTYB 3CR9A 1JVXA 1SBPA 2V84A 2FA7A 3U94A 4OERA 5JK4A 2F35A 5FHNA 3B6TA 3U8QA 2ESNA 3C36A 3MVXA 4XIGQ 1JEUA 3M8UA 3WAFA 1B51A 1MQJA 2ONRA 4GIZA 3ZSFA 1DPPA 3TUSA 3S4UA 3OO7A 1DMBA 4EUOA 3MPLA 2VD3A 4ESXA 2UVIA 3GBBA 4P11A 4KR5A 4OZ9A 3LSWA 5KDTA 1R6ZA 1KWHA 2VHAA 3OO8A 3U1OA 1JETA 4JDFA 3LR1A 2PT2A 4HCYA 4PE5B 1H3DA 1D9VA 2ONSA 4F1YA 2Z8EA 1B32A 3DLNA 3IOUA 4I62A 3O29A 4OFJA 3V83A 2Z23A 3SEUA 3TZAA 2XXHA 1FQAA 1PB9A 2DP8A 2ABHA 3IJOB 2O7IA 3LSXA 4U21A 5TPAA 3R7XA 1IITA 3TTRA 2DVZA 1SI1A 4ZZAA 3OOAA 1QUIA 2Y7PA 4GL0A 2Y84A 4POWA 2DWHA 1Q1KA 3FJ7A 4NMYA 5CBRA 1S50A 4O3CA 3PPOA 3MW0A 4IO7A 3SEXA 4R6YA 3K4UA 4U23A 3TODA 5HPQA 5KZTA 4F1VA 1FTOA 1SQYA 3E9XA 4ZEKA 4R2FA 4ECFA 4GRKA 4FATA 4MFIA 3RUMA 4NF8A 2ZYMA 4FJPA 1LB8A 2OBGA 3C33A 3O6HA 2F5XA 1B7UA 3DP4A 1BKAA 3HSTA 1QKBA 4IO6A 2DE3A 3G3JA 2X7PA 4ELOA 4GXAA 3EN3A 1XC1A 1B52A 2VGQA 4UA8A 1JEVA 4LATA 1MH4A 3RNNA 4BDLA 4QFLA 2O1MA 3C34A 2Q2AA 4DXUA 2XX8A 4NE4A 3FVNA 3Q27A 5IAIA 3EHSA 5AA4A 2ZNUA 3U92A 4OHNA 2PYYA 4LUBA 2V93A 5CMMA 5CMKA 3MZBA 3HHGA 4R73A 5K2XA 1B0LA 3MWBA 4N6PA 3K1NA 1S9TA 3G3KA 2I4BA 1R9LA 4ISUA 2DYXA 4ZEFA 1II5A 3A3CA 3OELA 1YAEA 3TTNA 1NKXA 3OXNA 5I57A 3PUZE 3VE1B 1MM6A 3FJGA 3TCFA 3ZKLA 1B9JA 4BLAA 2ANJA 1B7ZA 2DVCA 2Y7RA 3GLBA 3UK4A 4RJZA 3USDA 3CRBA 2RKMA 3IOWA 5DVFA 3VVFA 3VXBA 3DP8A 4EF1A 1N3WA 4H8JA 5AE4A 1LFHA 1GTKA 2R71A 2RCBA 2OWTA 5I2NA 3C35A 3UN6A 2Y7IA 3QUJA 3N5LA 2UVHA 2AL5A 4PQJA 4QSEA 4RK2A 5DT6A 3LBSA 1P1UA 2W7YA 1LGBC 3KZGA 4PFYA 5ITOA 2FYIA 1Y3QA 1I6BA 1ZBMA 4X48A 4C1TA 3KN3A 3VDFA 2H98A 1DOTA 5HM4B 3G3GA 4G68B 4JB7A 4MH5A 1LFIA 1TT1A 1XS5A 1B3HA 1IXCA 3EHTA 1PB8A 1XHYA 2O7UA 4XKQA 1LBBA 3CG3A 5A5XA 3TFLA 3MPKA 4AQ4A 3MQ9A 1B58A 3FASA 3IX1A 2E0SA 4R72A 1AH5A 5H8SA 4DLDA 1LFGA 1LAXA 3DP6A 4MF3A 1O7TA 3KGCA 1OLCA 4KYDA 5CI5A 3MP1A 2H5YA 4F39A 2CZLA 2B3FA 3TQLA 2THIA 1O64A 3KSXA 4L17A 3G3IA 3OO6A 3JV9A 4OTEA 4U22A 3W9VA 1IIWA 5H8HA 2GFEA 4XKNA 4LZ7A 2V3QA 2XXTA 3BFUA 4N13A 4NF8B 3M3FA 4RYAA 2V25A 3B6QA 1IEJA 2PVUA 4H65A 2GHAA 1R9QA 4RPNA 3L6HA 3IOVA 1D4NA 3L6GA 4THIA 2I0CA 4H5GA 1OMPA 5L9MA 4BDOA 1B46A 2FNCA 4P0IA 5EHSA 5FHOA 1ZIUA 1N04A 2HEUA 2DE4A 3CFLA 3KEIA 4ZZEA 3IAZA 1A54A 1DTGA 4TQUQ 4R75A 1SW4A 3VLWA 3MZ9A 3K02A 3TELA 1A8FA 1URSA 3B6WA 1NH8A 1M5BA 1XOCA 3B7DA 3GBAA 1QULA 4EXLA 2I3VA 1A7LA 1BTJA 4JSDA 4IGRA 3E13X 4LZ8A 4YKKA 3RT8A 3T9VA 1TXFA 1VSOA 2HXWA 3E4RA 4R9GA 4U1OA 3UORA 1LSTA 4WXJA 3VVEA 2P0SA 3O2AA 1LCTA 3SESA 4Z0IA 3TCGA 1NL5A 3ZS6A 1LBCA 3C9HA 3EPEA 4MBPA 1TFAA 1FCKA 1ZLQA 4QF9A 3CI8A 4RY1A 4MLVA 3N94A 2DWIA 3FGSA 3KBRA 3PUWE 3S9NC 1ELJA 4OVJA 1H44A 3F11A 1D9YA 2F78A 4ZS9A 3A09A 3IK6B 4FE8A 2I4CA 4QFOA 2XXWA 1B6HA 1JW4A 1UIUA 1OQHA 3CSGA 4LP2B 3K6XA 1B1XA 2ONKE 2LAOA 4LZ5A 3G3HA 4LQ5A 2NVUB 2HZKA 4YAHX 5B70A 3IB2A 2H25A 1H45A 5L9SA 4Q5TA 4ELQA 2YLNA 5KDTB 4F2OA 1MPDA 1UTBB 4PETA 4G8MA 5AA1A 4IO3A 1M5DA 5ISUA 4TLLB 2DE2A 4EQ7A 4GVOA 1ZU0A 3IL1B 1ZMGA 2QL3A 2XD2A 3HCQA 3ONMA 1L5TA 4C1UA 2XXRA 2ZYNA 4NF4B 2REGA 4G8HA 4U2RA 4HTGA 3K0VA 1B0HA 1B3GA 3QAXA 5ELVA 3S2VA 4DCXA 1Y9UA 3A3UA 3H7MA 3FZVA 4K3FA 1NNKA 4GFRA 1EZ9A 4KD5A 2GHBA 4KYEA 2F7CA 5M2VA 3RT6B 3VLVA 2OLBA 1US5A 3PMVA 2X26A 1JW5A 4F29A 5AA2B 4NEDA 3JYRA 1MRPA 4KCDA 4ZEBA 4IGTA 4R2BA 3UA8A 1FQEA 3C4MA 3MP6A 1UTBA 1EH3A 2ZNTA 1FTJA 2PMSA 3PMXA 4U4XA 3HHFA 2HCAA 2UVJA 3TYHA 3KOTA 4KHZE 3TDJA 4F3BA 4ZEDA 2NWJA 3D4GA 3OD7A 4LVQA 1B5IA 4YZZA 3UGWA 1A55A 1MDP1 1MY3A 3CIJA 3RTWB 2V3UA 3VV5A 1OQGA 4ESWA 1B5HA 2QMXA 1QVSA 2B3BA 4MLQA 1OLAA 1B3FA 3UIFA 4PP0A 5K2YA 2OK2A 1QJMA 4WKMA 4EDPA 5B7DA 5CMCA 3CG1A 2YJPA 1RYXA 3IO6A 1OIBA 3FVGA 3MVZA 2G93A 2XXXA 4G2ZA 4OQOA 4IO2A 1POTA 4RPOA 3H4ZA 2DQVA 4NF5B 3H6TA 1MQGA 1URDA 2O84X 5CBSA 2DOJA 3OEKA 5JTYA 4POXA 1ZJLA 2Z8FA 3MUQA 3MP8A 1YTVA 1AL3A 1HSJA 1JVYA 3LUYA 2UYEA 5I2KB 1MQIA 2OJTA 2Y7WA 3SERA 3FV2A 1BP5A 1BIYA 1HSLA 1P1QA 5DTBA 5L8DA 3HV1A 3EF7A 4LONB 3D4CA 4QFNA 4UACA 2NUVA 4BDNA 4YICA 3DM0A 1VR5A 3V5AA 3FUZA 2KLFA 4YKPA 2F8DA 2Y7KA 3M3KA 5H8QA 4GL8A 3KJ7A 2O6AA 2I49A 4PFTA 3RTFB 1A40A 4BDRA 5EHMA 1NNFA 2AL4A 2F7BA 3SEWA 3JZJA 3EQ1A 5AA2D 5ICQA 4OENA 1UQWA 4YMAA 5FTIA 3VXCA 4EXKA 1B7HA 1CB6A 1I69A 1OVTA 2Z8DA 3O66A 4KFQA 1M5CA 1LLSA 1YCJA 4HW8A 2F36A 1POY1 2UVGA 1SYHA 4I9DA 4X1BA 3VLUA 3Q29A 1SD3A 2RC9A 1B3EA 4H6DA 4YKJA 4R74A 2Q9TA 1US4A 4JXIA 5I58B 2Z22A 3FV1A 5F7VA 3V8XB 4N07A 1HSEA 5F1QA 1Y1MA 4G68C 2R9JA 3PUVE 4XXUA 2B65A 4YKIA 4ELRA 3KSJA 1GGGA 1XT8A 2G29A 1AOVA 2A5TB 3R26A 3QK6A 2DSFA 4NTLA 3THIA 3Q25A 5BUUA 3QSLA 4OFLA 4OMBA 2O1LA 1UIVA 1B1HA 4XKPA 3PPPA 1SW1A 1XVYA 3AXFA 2P1SA 3RN8A 3S9MC 2REJA 3E3KA 4GOTA 1Y20A 2O51A 4OYVA 4RNSA 2QMWA 3G3FA 3IO4A 4DZ1A 5KCJA 1MPBA 1AIVA 3FVOA 3MVWA 3LSFB 1RYOA 5DEXA 4H1XA 1FQBA 1EZPA 2Q8JA 3IJXB 1DPEA 4QSCA 4QRZA 1N76A 4E0WA 3BBRA 4DXBA 4ZDMA 1UTHB 1ZTYA 4GXSB 1S7YA 3MJNA 2A5TA 1B4HA 4IO5A 5AA3A 5DVIA 4O3BA 2UXAA 4NWCA 1MXYA 4NF6B 4RK9A 5H8FA 2RCAA 5H8HB 3QYTA 1DTZA 4EQBA 1TFDA 3IB0A 2I6EA 2IEEA 3PD9A 4Q8RA 1PB7A 1MDQA 4JWXA 3OMBA 4JSOA 4ELPA 2DWJA 4O3AA 1BLFA 2Q89A 1P99A 1MXXA 1NNPA 3KFMA 5TPAB 2D21A 2PBWA 2VD2A 3MVYA 1GR2A 2HFBA 2OWSA 2QSXA 2ZYKA 4QSDA 5DYHA 3ODBA 3TPAA 4JBZA 4F31B 3I5OA 1MS7A 1PDAA 5H8NB 3H3GA 1IUDA 2X7QA 3G7WA 4H67A 4KI0E 2H9BA 2QS1A 4Q0CA 3UP9A 4F2QA 2GRVA 3PUXE 2XXIA 1IXGA 4OFOA 2M8CA 1MXWA 4G77A 3K6WA 4OEVA 3FIRA 4PFUA 4JWOA 1SDXA 5A5XB 2CMOA 1MM7A 2XX7A 2XHDA 2XD3A 3OSQA 3T22A 4C0RA 2DS9A 3DELB 1GV8A 3KN8A 1FQFA 5H8FB 4DE8A 1M5EA 4I1DA 4YB5A 4DXCA 4EF2A 4F22A 4F3GA 1IQ7A 1VE4A 2F6PA 1VFEA 3BFTA 4GD5A 1MXVA 3FD3A 4KQPA 3CFXA 3WAEA 3GZGA 5BWJA 3K00A 1MG1A 1Y4CA 2D5WA 1Z7ME 2HAVA 4QFPA 1QUJA 4X9TA 2PT1A 3OO9A 5L9OA 3C32A 1MH3A 4DCYA 1IZ1A 3TEPA 4ZE8A 3PD8A 4P0GA 4IO4A 5EYFA 5KCJB 4GWOA 1R1NA 3IOTA 4FECA 2WKYA 4DDDA 1SYIA 1B4ZA 5I57B 2I0BA 2O69A 2QJEA 1LAGE 3P7IA 4U4SA 4YB6A 3RPWA 3FATA 1Z7NE 1JQFA 1NMUA 3KN7A 5J1DA 3LSLA 1CE2A 2NXOA 1FQCA 3I6VA 1I6AA 2ZMBA 1UTHA 3PPRA 5CMBA 5TU0A 5I2NB 3PV0E 3MAMA 1MQDA 4JWYA 2GH9A 1MXZA 1MY4A 3HN0A 2F7AA 3MC2A 3O97A 4HS7A 1IXIA 1B3LA 3O9PA 1RKMA 3KJTA 3PGFA 1LAHE 3TAJA 4RA1A 4IB2A 4I8CA 1MY1A 1WVJA 1USYH 1LCFA 1YPNA 3FXRA 4G68A 4X1DA 4YB7A 3T9UA 3Q28A 4BDQA 4EQ9A 5I56B 5ICTA 1PEBA 4GLIA 3O6GA 1D3KA 1ATGA 4HCWA 1FTLA 3H6WA 4G8NA 4NWDA 1JW1A 5JEIA 2H99A 3SKPA 4F3SA 2XXVA 3CFZA 2Q2CA 3EHUA 1IXHA 3N6UA 4PFWA 3PPQA 2HAUA 3PU5A 3O28A 1GVCA 4YMBA 3Q26A 5H8NA 1ZKBA 3IORA 4WEPA 3T96B 3QXMA 2P2AA 3CSBA 3ILTB 5CM6A 4DIGA 1QKAA 1P1OA 4WEDA 4F18A 4FAJA 2I48A 1USYE 1MXUA 1SW5A 3N26A 4IY6A 3H6UA 2A5SA 3W15C 1DSNA 4AB6A 5I84A 4U1ZA 3H03A 3TKDA 1NNTA 4ZE9A 5I56A 1WODA 3FJMA 1F9BA 5TP9A 4NF5A 4F3PA 1FW0A 1B40A 1Q35A
chains in the Genus database with same CATH superfamily
3MZ1A 3QIMA 3SDFA 4LQ2A 4F19A 2Q8MA 4PFIA 3PUYE 2DXRA 2XXUA 1N84A 3IR1A 1EZOA 3KG2A 3SETA 4FORA 1IMBA 4ZECA 3TMGA 3IB1A 2QS3A 2XXYA 4R6HA 5I59B 4LA9A 2XXQA 4QBAA 2RC8A 1A99A 5CRYA 4OWDA 3K2DA 4DI4B 2I58A 5FTHA 2QS4A 2ALUA 1LAFE 3ILUB 1MY2A 4H0WA 5IM2A 2PX1A 2Q74A 3HPIA 2ZXTA 1P1WA 4TOZA 1YZ0A 1K9ZA 3U93A 2VOZA 3O6IA 4NF6A 4ZEIA 4M4GA 1NH7A 4RXLA 4XEQA 2V3TA 1N0TA 1PBQA 2QS2A 4TLMB 2YPNA 1MY0A 3RQTA 1SVXB 4GF8A 4KCCA 4YU0A 3N6TA 4X04A 4BDMA 3T66A 3LUZA 1DCUA 1BK4A 2V4CA 3U8QA 4OVPA 3M8UA 3ZSFA 1DPPA 2R8TA 1DMBA 4MIJA 4ESXA 3GBBA 4G61A 4P11A 1R6ZA 1KWHA 1JETA 1D9QA 4F1YA 4MNPA 4I62A 3DLNA 3IOUA 3V83A 2QFLA 2Z23A 2XXHA 2ABHA 5I58A 4ZZAA 3OOAA 4POWA 3PPOA 4IO7A 4ZEKA 3E79A 4MFIA 1BKAA 3G3JA 5HPQA 4GXAA 1XC1A 2VGQA 4LATA 4BDLA 3EHSA 5AA4A 3U92A 5CMMA 2PYYA 5CMKA 4R73A 1B0LA 4ISUA 1R9LA 3A3CA 3OELA 1YAEA 2FIEA 3FJGA 1B9JA 1B7ZA 2Y7RA 5A5LA 5EYGA 1QGXA 3VXBA 1LFHA 1N3WA 4H8JA 1GTKA 1FBFA 2RCBA 3IFAA 3C35A 2Y7IA 1NV2A 2UVHA 1FPFA 3KZGA 4PFYA 1I6BA 4C1TA 5HM4B 5A5XA 3TFLA 1B58A 4R72A 5H8SA 4MF3A 1LAXA 1O7TA 4KYDA 1OLCA 4X8RA 2B3FA 4PF6A 2CEXA 4RYAA 5EQ8A 2I0CA 5EHSA 3KEIA 4ZZEA 1NI9A 4TQUQ 3TELA 3B6WA 1M5BA 1QULA 4EXLA 2I3VA 4JSDA 1BTJA 4YKKA 3T9VA 1FBCA 3VVEA 4Z0IA 1NL5A 3ZS6A 2DWIA 2PFYA 4OVJA 3A09A 1FSAA 3T9HB 3K6XA 2NVUB 4YAHX 3IB2A 2H25A 4ELQA 1UTBB 4GWUA 3IL1B 3ONMA 1L5TA 2ZYNA 4G8HA 3K0VA 1B3GA 4N6DA 4MNCA 3A3UA 4K3FA 1NNKA 4KD5A 1JW5A 2PFZA 5AA2B 1UTBA 2PMSA 4U4XA 3KOTA 4KHZE 3TDJA 2NWJA 4NQ8A 3UGWA 1MDP1 1OQGA 3UIFA 2QMXA 1QVSA 1B3FA 1QJMA 4EDPA 5CMCA 3CG1A 4RPOA 4IO2A 4JVDA 2DQVA 4NF5B 3U65A 1URDA 5JTYA 4MMPA 1ZJLA 2Z8FA 3MUQA 1AL3A 4OVTA 2Y7WA 2XA5A 3FV2A 1P1QA 5DTBA 5L8DA 3HV1A 4LONB 4YICA 3DM0A 3FUZA 2F8DA 2Y7KA 5H8QA 3KJ7A 3RTFB 2O6AA 1FPLA 3RPLA 1A40A 4N8YA 5EHMA 1CB6A 2Z8DA 4KFQA 2UVGA 5EQ7A 1SD3A 4JXIA 3PUVE 2B65A 3R26A 5BUUA 3Q25A 1EYJA 2P1SA 4DZ1A 4OYVA 2O51A 4RNSA 3IO4A 3FVOA 5DEXA 4QRZA 1N76A 4GWYA 2GQ1A 3EKIA 4GXSB 1S7YA 1B4HA 4NWCA 5H8HB 4GWSA 3SZPA 3IB0A 4JWXA 4PGNA 4JSOA 4ELPA 2ZZXA 1NNPA 1FPJA 1GR2A 2HFBA 2L5VA 3ODBA 2KR0A 3H3GA 2X7QA 4NGUA 4NHBA 1MXWA 1FPBA 4OEVA 4JWOA 1MM7A 4PF8A 4DE8A 4I1DA 4YB5A 4F3GA 1VE4A 1VFEA 4GD5A 4KQPA 1Y4CA 2HAVA 5L9OA 3OO9A 4NN3A 5EYFA 5KCJB 2WKYA 1B4ZA 4YB6A 1JQFA 4PCDA 5I3SA 3PV0E 3LV0A 2P3VA 1MY4A 3KJTA 1LAHE 4HE0A 4RA1A 1YPNA 1LBYA 4G68A 2JJKA 3H6WA 4MHFA 4F3SA 1FBGA 3CFZA 3N6UA 4PFWA 3PPQA 4MAGA 3O28A 4YMBA 1ZKBA 4O94A 2P2AA 3ILTB 1USYE 3N26A 1DSNA 4O7IA 5I56A 4JB7A 1B40A 2Q88A 3M3LA 3RY3A 2XX9A 1JNFA 5I59A 1N3XA 1OVBA 1QW0A 3S9LC 2RF1A 4Q30B 3GXAA 3ECRA 2QPQA 1Y4TA 2H4IA 3GYYA 4QFKA 1DK4A 3K1MA 3S9EA 3MBPA 3TCHA 1N7XA 3SEVA 1H76A 3RGYA 1MQHA 1I6QA 3R6UA 2NOOA 2VPNA 2DXYA 1PBPA 1NUZA 2UYFA 4OESA 4H5FA 5DEXB 2Y5LA 1P1NA 4NF4A 4E0XA 3OEMA 1LB9A 2RINA 2OZZA 2XXPA 5IZZA 1NV0A 4ND9A 5TP9B 4F1UA 3C31A 5AA2A 2IA4A 2RC7A 2OCUA 1FTKA 2D3IA 3VVDA 3H06B 2O68A 3LC8A 1Y3PA 4PAFA 5CC2A 5LDZA 1Y1ZA 1B2HA 3FXQA 2F97A 4R6KA 4OXVA 5FHMA 3CR9A 2FA7A 4OERA 5JK4A 5FHNA 3B6TA 3C36A 4XIGQ 1JEUA 3S4UA 1INPA 4KR5A 3LSWA 3U1OA 4JDFA 4HCYA 4AS4A 2Z8EA 3O29A 2QVUA 4OFJA 3SEUA 3FXBA 1PB9A 2DP8A 3IJOB 3LSXA 4U21A 5TPAA 3HFUA 3R7XA 3TTRA 2Y7PA 1NUXA 1Q1KA 4NMYA 4O3CA 3SEXA 2XXKA 3K4UA 2B4LA 4F1VA 1FTOA 3E9XA 4OVSA 4ECFA 4R2FA 4FATA 1XI6A 2ZYMA 4FJPA 1NV4A 3O6HA 1B7UA 3HSTA 4F31B 1EYKA 4UA8A 1B52A 1JEVA 1EYIA 4QFLA 4DXUA 4NE4A 3FVNA 3Q27A 2ZNUA 5I7IA 4LUBA 3MZBA 5K2XA 3MWBA 3G3KA 3TTNA 3OXNA 3VE1B 1MM6A 3TCFA 3UK4A 4EQ9A 4RJZA 3DP8A 1SPIA 5I2NA 5DT6A 4RK2A 5KDTB 3LBSA 2W7YA 1LGBC 1ZBMA 3VDFA 4GX4A 2OWZA 1DOTA 1TT1A 1RDXA 1PB8A 2O7UA 3MPKA 3MQ9A 2E0SA 1AH5A 1FPKA 4F39A 2H5YA 1O64A 3JV9A 4OTEA 2GFEA 4OANA 2XXTA 4NF8B 4RPNA 5L9MA 1IMEA 4P0IA 1FBHA 1DTGA 1SW4A 3K02A 1URSA 3B7DA 1CNQA 4LZ8A 3E13X 3RT8A 2HXWA 4R9GA 1LSTA 3TCGA 3EPEA 1FPDA 3FGSA 3KBRA 1H44A 2F78A 3IK6B 2I4CA 5EQ9A 1OQHA 4LZ5A 5B70A 1H45A 4Q5TA 1LBZA 4F2OA 4PETA 1M5DA 4TLLB 4EQ7A 4GVOA 4P56A 1ZMGA 5FBPA 2XD2A 3RPWA 4NF4B 2REGA 5ELVA 4PFBA 3FZVA 1EZ9A 2GHBA 2F7CA 2OLBA 4F29A 4NEDA 4ZEBA 4IGTA 4R2BA 3UA8A 3C4MA 1FTJA 3PMXA 2UVJA 4F3BA 4ZEDA 3OD7A 4PDDA 4YZZA 1A55A 1MY3A 2V3UA 3VV5A 4MLQA 2B3BA 3V5AA 5K2YA 3IO6A 1POTA 3QMFA 4N6KA 3H6TA 4MCOA 2DOJA 2FBPA 3MP8A 5IGAA 2UYEA 1DBZA 1HSLA 3M3KA 4GL8A 2WYPA 5I5PA 5AA2D 1JP4A 1UQWA 4OENA 4EXKA 1B7HA 1OVTA 1YCJA 4OA4A 4HW8A 2F36A 4H6DA 4YKJA 2Q9TA 5I58B 3FV1A 5F7VA 3V8XB 4N07A 4N17A 4G68C 2R9JA 4ELRA 1AOVA 3KSJA 3QK6A 4NTLA 2F3BA 1UIVA 4XKPA 3PPPA 3RN8A 4OVRA 3E3KA 4GOTA 1Y20A 2QMWA 3LSFB 1RYOA 1FQBA 2Q8JA 4MX6A 3BBRA 4PGPA 3MJNA 1NV6A 2UXAA 4O7MA 1MXYA 4NF6B 4RK9A 2IEEA 1PB7A 1BLFA 4N81A 3KFMA 2D21A 2PBWA 3TPAA 5DYHA 1LBXA 3I5OA 2QS1A 3PUXE 3FBPA 4NG7A 2WEFA 2CMOA 2XHDA 2XD3A 3T22A 4C0RA 1M5EA 1IQ7A 3BFTA 4DI3D 3FD3A 2XWOA 3CFXA 4PFRA 3GZGA 3K00A 1Z7ME 4X9TA 4DCYA 1IZ1A 4GWOA 3IFCA 2I0BA 3KC1A 3P7IA 4U4SA 3FATA 1NMUA 3KN7A 2NXOA 1I6AA 3PPRA 5J16A 3ISPA 1MXZA 2F7AA 1B3LA 3O9PA 4NAPA 2QVVA 4X1DA 4H45A 5I56B 3T9UA 4PTKA 4HCWA 1FTLA 4N15A 3SKPA 2Q2CA 5F24A 1FJ9A 1GVCA 5H8NA 4HXVA 2PCRA 4DIGA 4F18A 4FAJA 2I48A 1MXUA 4U1ZA 1WODA 3FJMA 1FW0A 2FIXA 2F6GA 2R6GE 5ESYA 5ITPA 2QVRA 1MPCA 1FQDA 3OSRA 2BJJX 3PPNA 2CZKA 3TTLA 3K1PA 4FEDA 1K9YA 2FHYA 3U72A 5IZ1A 3K6VA 4N91A 1M5FA 4FIMA 1B05A 1Y3NA 3OENA 3K01A 1FPGA 5DVJA 4KYSA 1YYZA 5I2KA 4QHQA 4GX3A 1G0HA 3CVGA 1FRPA 1SI0A 4OETA 1QUKA 2BJIA 4GWXA 4KPTA 3V89B 3SEYA 4XKRA 3I3VA 3FVKA 5AA4B 5DW8A 1NV3A 2QRYA 1FTAA 1SBPA 3U94A 2ESNA 3MVXA 1MQJA 3T1BA 3TUSA 4P8BA 3OO7A 4EUOA 3RPLB 5KDTA 2VHAA 3OO8A 3LR1A 2PT2A 4PE5B 1H3DA 1D9VA 1B32A 3TZAA 1FQAA 2O7IA 2DVZA 1SI1A 4IR8A 1S50A 5EQAA 4R6YA 4I3YA 3TODA 5KZTA 4MJOA 1SQYA 5IZ3B 4GRKA 4NF8A 1LB8A 2OBGA 1RDYA 4IO6A 5IKBA 3RNNA 3C34A 2Q2AA 5IAIA 4P9KA 4N6PA 3K1NA 1S9TA 2I4BA 4ZEFA 1II5A 3PUZE 2ANJA 2DVCA 4PBQA 3USDA 2RKMA 3IOWA 4MNIA 1IMCA 3UN6A 3N5LA 4PDHA 4PQJA 2AL5A 1Y3QA 3KN3A 4GX6A 4G68B 1LFIA 5ET8A 1B3HA 1XHYA 4AQ4A 3FASA 3IX1A 4DLDA 1LFGA 5CI5A 2CZLA 3TQLA 2VPOA 3G3IA 2WYKA 4U22A 1IIWA 4XKNA 4N13A 3MSTA 4PBHA 2PVUA 4H65A 2CZIA 1D4NA 3L6GA 4THIA 4H5GA 4BDOA 1B46A 5FHOA 1N04A 3CFLA 3IAZA 1A54A 2ZZWA 3VLWA 3MZ9A 3GBAA 1NH8A 1XOCA 2DDKA 1A7LA 4IGRA 4PAIA 3UORA 1LCTA 1LBCA 4MBPA 1TFAA 4QF9A 4RY1A 4MLVA 3PUWE 1IMAA 1ELJA 4GBVA 4ZS9A 4QFOA 3A29A 4PAKA 2XXWA 1JW4A 1UIUA 4N4UA 4LP2B 1B1XA 1NUYA 2HXRA 4LQ5A 4G8MA 5EYHA 5AA1A 4IO3A 5ISUA 3BIHA 1ZU0A 2QL3A 3HCQA 4C1UA 2XXRA 4HTGA 3S2VA 5JEIA 1Y9UA 3RT6B 4KYEA 1IMDA 3VLVA 3PMVA 2XWVA 4KCDA 1FQEA 1EH3A 2ZNTA 4P3LA 3TYHA 4H46A 1IMFA 4LVQA 1B5IA 1FBPA 3RTWB 2CEYA 1OLAA 5B7DA 4PP0A 2YJPA 3MVZA 3FVGA 2XXXA 4G2ZA 3H4ZA 5CBSA 4JVIA 1YTVA 1JVYA 3LUYA 5I2KB 2OJTA 1FPEA 1BIYA 3EF7A 2HPGA 1T0KA 4PFTA 2F7BA 3SEWA 3JZJA 3EQ1A 5ICQA 1I69A 3O66A 1LLSA 3BIGA 2VT5A 1POY1 1SYHA 3Q29A 4R74A 2Z22A 4P1EA 1FBDA 4YKIA 1GGGA 1XT8A 3THIA 2DSFA 2ZZVA 4GWWA 3QSLA 4OFLA 4OMBA 1B1HA 1SW1A 3AXFA 4OVQA 3S9MC 5KCJA 3G3FA 3MVWA 4H1XA 3IJXB 1DPEA 4DXBA 4ZDMA 1ZTYA 4IO5A 5DVIA 4O3BA 4XFEA 2RCAA 3QYTA 4NX1A 3OMBA 2DWJA 4O3AA 1P99A 2VD2A 2ZYKA 2OWSA 2QSXA 1AWBA 2WX9A 4JBZA 5T3JA 2OX3A 4H67A 4KI0E 2H9BA 3UP9A 2XXIA 2M8CA 4G77A 4PFUA 3FIRA 3CHGA 1SDXA 2XX7A 1GV8A 3KN8A 5H8FB 4DXCA 4EF2A 4F22A 2P3NA 4QFPA 1QUJA 2PT1A 3B50A 1MH3A 4ZE8A 3PD8A 4IO4A 3IOTA 4DDDA 5I57B 2O69A 1LAGE 1Z7NE 2WBDA 3B8BA 5J1DA 3LSLA 1CE2A 4JVCA 3I6VA 2ZMBA 5CMBA 5TU0A 3MAMA 1MQDA 4JWYA 1YXIA 3HN0A 3O97A 2KQZA 1IXIA 1RKMA 3D1RA 1WVJA 1LCFA 4BDQA 4YB7A 3Q28A 5ICTA 4GLIA 1D3KA 4G8NA 4NWDA 2XXVA 1IXHA 3KC0A 2HAUA 4I40A 3Q26A 3T96B 3QXMA 5CM6A 1QKAA 1P1OA 3W15C 1SW5A 4AB6A 5I84A 4ZE9A 5TP9A 1F9BA 4NF5A 1VDWA 3ZKKA 1ANFA 2XWIA 1KA1A 1FBEA 1URGA 2CZHA 3RLFE 2I3WA 4FEBA 2HZLA 3W9WA 4M1VA 5H8QB 4GQOA 1AMFA 4OEUA 4ONYA 1EU8A 1TWYA 3K6UA 1PC3A 3HO7A 1A8EA 2MKZA 3QUFA 1H43A 2AYSA 5HBCA 1XVXA 2AIXA 1N7WA 4H8IA 4MEVA 1FTMA 3T93B 3BKIB 3TTMA 1Q35A 4HE2A 3TTKA 3FXUA 4IY5A 2VP1A 2DWAA 2F34A 4Z7EA 1O63A 5LOMA 3PMWA 3H6VA 3TQWA 1KZ8A 3KOSA 1VFDA 1SW2A 4G4PA 3VFJA 1J1NA 1NFTA 4R9FA 4XTCQ 2E1SA 2ZYOA 4PC9A 2ZNSA 4AB5A 2HQ0A 3T9XB 1B5JA 1WDNA 5JTYB 1JVXA 2V84A 2F35A 1LEVA 4GBWA 3WAFA 1B51A 2ONRA 4GIZA 3MPLA 2VD3A 2UVIA 4FBPA 4XF5A 4OZ9A 5LTCA 2ONSA 1IITA 3KBZA 1QUIA 4GL0A 2Y84A 2DWHA 3FJ7A 3MW0A 4U23A 3RUMA 3C33A 2F5XA 3DP4A 3T0JA 1QKBA 2DE3A 2X7PA 4ELOA 3EN3A 1MH4A 2O1MA 3PTYA 2XX8A 2F3DA 4OHNA 2V93A 3HHGA 5IZ3A 2DYXA 1NKXA 5I57A 1NV5A 3ZKLA 4BLAA 3GLBA 1LBWA 3CRBA 4EF1A 5DVFA 3VVFA 5AE4A 2R71A 2OWTA 3QUJA 4QSEA 1P1UA 5ITOA 2FYIA 2HHMA 4X48A 2H98A 3G3GA 4MH5A 1XS5A 1IXCA 3EHTA 4XKQA 1LBBA 3CG3A 1NV1A 5H8FA 3DP6A 1FJ6A 3KGCA 3MP1A 2THIA 3KSXA 4L17A 3OO6A 3W9VA 5H8HA 4LZ7A 2V3QA 3BFUA 3M3FA 4KXPA 2V25A 3B6QA 1IEJA 2GHAA 1R9QA 3L6HA 3IOVA 1OMPA 2FNCA 1ZIUA 2HEUA 2DE4A 4R75A 1A8FA 1TXFA 1VSOA 1RDZA 3E4RA 4U1OA 4WXJA 2P0SA 3O2AA 3SESA 3C9HA 1FCKA 1ZLQA 3CI8A 3N94A 3S9NC 3F11A 1D9YA 4HE1A 4FE8A 1B6HA 3CSGA 2ONKE 2LAOA 3G3HA 2HZKA 5L9SA 2YLNA 1MPDA 4N8GA 3E78A 2DE2A 4PE3A 4U2RA 5F1QA 1B0HA 3QAXA 4DCXA 3H7MA 4GFRA 5M2VA 1KA0A 1US5A 5ET6A 2X26A 3RYDA 3JYRA 1MRPA 3MP6A 3HHFA 2HCAA 3D4GA 3CIJA 4NF0A 4ESWA 2WBBA 1B5HA 2OK2A 4WKMA 1RYXA 1OIBA 5CBRA 4OQOA 2G93A 1MQGA 2O84X 3OEKA 4I3EA 4POXA 1HSJA 3SERA 1MQIA 1BP5A 4BDNA 3D4CA 4QFNA 4UACA 2NUVA 1VR5A 2KLFA 4YKPA 4BDRA 2I49A 1NNFA 2AL4A 1FPIA 4YMAA 5FTIA 3VXCA 1M5CA 4GWZA 4I9DA 3VLUA 4X1BA 2RC9A 1B3EA 1US4A 1HSEA 1Y1MA 4XXUA 2G29A 2A5TB 4P1LA 2O1LA 1XVYA 2REJA 2FVZA 2XWKA 1AIVA 1MPBA 1EZPA 3MYUA 4QSCA 4E0WA 1UTHB 2A5TA 5AA3A 1NUWA 2B4MA 1DTZA 4EQBA 1TFDA 4O8MA 2I6EA 3PD9A 4Q8RA 1MDQA 5ET5A 2Q89A 1MXXA 1Q9DA 5TPAB 3NOHA 3MVYA 4QSDA 1MS7A 1PDAA 5H8NB 1IUDA 3G7WA 4AS5A 4Q0CA 4F2QA 2GRVA 1G0IA 1IXGA 4OFOA 3K6WA 5A5XB 3OSQA 2DS9A 3DELB 1FQFA 2F6PA 3WAEA 5BWJA 1MXVA 1MG1A 2D5WA 3C32A 3TEPA 4P0GA 1R1NA 4FECA 1SYIA 2QJEA 1FQCA 4UABA 1UTHA 5I2NB 2GH9A 4HS7A 3MC2A 5ET7A 3PGFA 2Y5KA 3TAJA 4I8CA 4IB2A 1MY1A 1USYH 3FXRA 3ROJA 1PEBA 3O6GA 1ATGA 1JW1A 2H99A 3EHUA 3PU5A 3IORA 4WEPA 4QXDA 4LN5A 1LBVA 3CSBA 4WEDA 4IY6A 3H6UA 2A5SA 1NV7A 3H03A 3TKDA 1NNTA 4F3PA 4P47A
chains in the Genus database with same CATH topology
3MZ1A 2F6GA 2R6GE 3ZKKA 1ANFA 3QIMA 3SDFA 4LQ2A 5ITPA 2Q88A 4F19A 1URGA 3M3LA 3RLFE 3RY3A 5CC2A 1MPCA 1FQDA 2XX9A 1JNFA 2I3WA 4FEBA 2HZLA 5I59A 3OSRA 3W9WA 1N3XA 1OVBA 4M1VA 1QW0A 2BJJX 5H8QB 3S9LC 3PUYE 2DXRA 2XXUA 4GQOA 1AMFA 1N84A 2RF1A 3PPNA 3IR1A 4OEUA 4ONYA 1EU8A 1TWYA 3TTLA 3KG2A 3SETA 4Q30B 3K1PA 1EZOA 4FEDA 3GXAA 3K6UA 4FORA 4ZECA 1PC3A 3ECRA 3HO7A 1A8EA 3TMGA 2QPQA 3IB1A 1Y4TA 3QUFA 2QS3A 3U72A 2H4IA 1H43A 2AYSA 2XXYA 3K6VA 1XVXA 5HBCA 1M5FA 2AIXA 4QFKA 4FIMA 1B05A 4R6HA 5I59B 1Y3NA 4LA9A 1N7WA 3OENA 3K1MA 3S9EA 2XXQA 3K01A 1T0KA 3MBPA 3TCHA 1N7XA 4H8IA 3SEVA 2RC8A 1H76A 1FTMA 3RGYA 5DVJA 1A99A 4KYSA 5CRYA 1MQHA 1I6QA 3R6UA 4OWDA 3T93B 2NOOA 2DXYA 3BKIB 1PBPA 3TTMA 5IKBA 3K2DA 2UYFA 4OESA 2I58A 5FTHA 2QS4A 4H5FA 5I2KA 2ALUA 5DEXB 1LAFE 3ILUB 1MY2A 4H0WA 4QHQA 2PX1A 3TTKA 3FXUA 1P1NA 4IY5A 4NF4A 2VP1A 2DWAA 3OEMA 4E0XA 1LB9A 2RINA 3HPIA 2ZXTA 1P1WA 4TOZA 2OZZA 2F34A 2XXPA 1O63A 4Z7EA 3PMWA 4ND9A 5LOMA 3CVGA 3U93A 2VOZA 5TP9B 3O6IA 4F1UA 3C31A 4NF6A 5AA2A 3H6VA 4ZEIA 1SI0A 2IA4A 2RC7A 3KOSA 3TQWA 2OCUA 1FTKA 4OETA 3T9HB 1VFDA 4M4GA 1QUKA 2D3IA 1SW2A 3VVDA 1NH7A 3H06B 4G4PA 2O68A 3LC8A 3VFJA 1Y3PA 4RXLA 1J1NA 1NFTA 2V3TA 1N0TA 1PBQA 1Y1ZA 2QS2A 4KPTA 4R9FA 4TLMB 1B2HA 4XTCQ 3V89B 3SEYA 2E1SA 2ZYOA 2YPNA 3FXQA 4XKRA 5I58A 3I3VA 1MY0A 2F97A 1SVXB 3FVKA 4GF8A 3RQTA 2ZNSA 4KCCA 4YU0A 5AA4B 3N6TA 4AB5A 4BDMA 4R6KA 2HQ0A 3T9XB 4OXVA 2QRYA 3T66A 1B5JA 1WDNA 5FHMA 5JTYB 3CR9A 1JVXA 1SBPA 2V84A 2FA7A 3U94A 4OERA 5JK4A 2F35A 5FHNA 3B6TA 3U8QA 2ESNA 3C36A 3MVXA 4XIGQ 1JEUA 3M8UA 3WAFA 1B51A 1MQJA 2ONRA 4GIZA 3ZSFA 1DPPA 3TUSA 3S4UA 3OO7A 1DMBA 4EUOA 3MPLA 2VD3A 4ESXA 2UVIA 3GBBA 4P11A 4KR5A 4OZ9A 3LSWA 5KDTA 1R6ZA 1KWHA 2VHAA 3OO8A 3U1OA 1JETA 4JDFA 3LR1A 2PT2A 4HCYA 4PE5B 1H3DA 1D9VA 2ONSA 4F1YA 2Z8EA 1B32A 3DLNA 3IOUA 4I62A 3O29A 4OFJA 3V83A 2Z23A 3SEUA 3TZAA 2XXHA 1FQAA 1PB9A 2DP8A 2ABHA 3IJOB 2O7IA 3LSXA 4U21A 5TPAA 3R7XA 1IITA 3TTRA 2DVZA 1SI1A 4ZZAA 3OOAA 1QUIA 2Y7PA 4GL0A 2Y84A 4POWA 2DWHA 1Q1KA 3FJ7A 4NMYA 5CBRA 1S50A 4O3CA 3PPOA 3MW0A 4IO7A 3SEXA 4R6YA 3K4UA 4U23A 3TODA 5HPQA 5KZTA 4F1VA 1FTOA 1SQYA 3E9XA 4ZEKA 4R2FA 4ECFA 4GRKA 4FATA 4MFIA 3RUMA 4NF8A 2ZYMA 4FJPA 1LB8A 2OBGA 3C33A 3O6HA 2F5XA 1B7UA 3DP4A 1BKAA 3HSTA 1QKBA 4IO6A 2DE3A 3G3JA 2X7PA 4ELOA 4GXAA 3EN3A 1XC1A 1B52A 2VGQA 4UA8A 1JEVA 4LATA 1MH4A 3RNNA 4BDLA 4QFLA 2O1MA 3C34A 2Q2AA 4DXUA 2XX8A 4NE4A 3FVNA 3Q27A 5IAIA 3EHSA 5AA4A 2ZNUA 3U92A 4OHNA 2PYYA 4LUBA 2V93A 5CMMA 5CMKA 3MZBA 3HHGA 4R73A 5K2XA 1B0LA 3MWBA 4N6PA 3K1NA 1S9TA 3G3KA 2I4BA 1R9LA 4ISUA 2DYXA 4ZEFA 1II5A 3A3CA 3OELA 1YAEA 3TTNA 1NKXA 3OXNA 5I57A 3PUZE 3VE1B 1MM6A 3FJGA 3TCFA 3ZKLA 1B9JA 4BLAA 2ANJA 1B7ZA 2DVCA 2Y7RA 3GLBA 3UK4A 4RJZA 3USDA 3CRBA 2RKMA 3IOWA 5DVFA 3VVFA 3VXBA 3DP8A 4EF1A 1N3WA 4H8JA 5AE4A 1LFHA 1GTKA 2R71A 2RCBA 2OWTA 5I2NA 3C35A 3UN6A 2Y7IA 3QUJA 3N5LA 2UVHA 2AL5A 4PQJA 4QSEA 4RK2A 5DT6A 3LBSA 1P1UA 2W7YA 1LGBC 3KZGA 4PFYA 5ITOA 2FYIA 1Y3QA 1I6BA 1ZBMA 4X48A 4C1TA 3KN3A 3VDFA 2H98A 1DOTA 5HM4B 3G3GA 4G68B 4JB7A 4MH5A 1LFIA 1TT1A 1XS5A 1B3HA 1IXCA 3EHTA 1PB8A 1XHYA 2O7UA 4XKQA 1LBBA 3CG3A 5A5XA 3TFLA 3MPKA 4AQ4A 3MQ9A 1B58A 3FASA 3IX1A 2E0SA 4R72A 1AH5A 5H8SA 4DLDA 1LFGA 1LAXA 3DP6A 4MF3A 1O7TA 3KGCA 1OLCA 4KYDA 5CI5A 3MP1A 2H5YA 4F39A 2CZLA 2B3FA 3TQLA 2THIA 1O64A 3KSXA 4L17A 3G3IA 3OO6A 3JV9A 4OTEA 4U22A 3W9VA 1IIWA 5H8HA 2GFEA 4XKNA 4LZ7A 2V3QA 2XXTA 3BFUA 4N13A 4NF8B 3M3FA 4RYAA 2V25A 3B6QA 1IEJA 2PVUA 4H65A 2GHAA 1R9QA 4RPNA 3L6HA 3IOVA 1D4NA 3L6GA 4THIA 2I0CA 4H5GA 1OMPA 5L9MA 4BDOA 1B46A 2FNCA 4P0IA 5EHSA 5FHOA 1ZIUA 1N04A 2HEUA 2DE4A 3CFLA 3KEIA 4ZZEA 3IAZA 1A54A 1DTGA 4TQUQ 4R75A 1SW4A 3VLWA 3MZ9A 3K02A 3TELA 1A8FA 1URSA 3B6WA 1NH8A 1M5BA 1XOCA 3B7DA 3GBAA 1QULA 4EXLA 2I3VA 1A7LA 1BTJA 4JSDA 4IGRA 3E13X 4LZ8A 4YKKA 3RT8A 3T9VA 1TXFA 1VSOA 2HXWA 3E4RA 4R9GA 4U1OA 3UORA 1LSTA 4WXJA 3VVEA 2P0SA 3O2AA 1LCTA 3SESA 4Z0IA 3TCGA 1NL5A 3ZS6A 1LBCA 3C9HA 3EPEA 4MBPA 1TFAA 1FCKA 1ZLQA 4QF9A 3CI8A 4RY1A 4MLVA 3N94A 2DWIA 3FGSA 3KBRA 3PUWE 3S9NC 1ELJA 4OVJA 1H44A 3F11A 1D9YA 2F78A 4ZS9A 3A09A 3IK6B 4FE8A 2I4CA 4QFOA 2XXWA 1B6HA 1JW4A 1UIUA 1OQHA 3CSGA 4LP2B 3K6XA 1B1XA 2ONKE 2LAOA 4LZ5A 3G3HA 4LQ5A 2NVUB 2HZKA 4YAHX 5B70A 3IB2A 2H25A 1H45A 5L9SA 4Q5TA 4ELQA 2YLNA 5KDTB 4F2OA 1MPDA 1UTBB 4PETA 4G8MA 5AA1A 4IO3A 1M5DA 5ISUA 4TLLB 2DE2A 4EQ7A 4GVOA 1ZU0A 3IL1B 1ZMGA 2QL3A 2XD2A 3HCQA 3ONMA 1L5TA 4C1UA 2XXRA 2ZYNA 4NF4B 2REGA 4G8HA 4U2RA 4HTGA 3K0VA 1B0HA 1B3GA 3QAXA 5ELVA 3S2VA 4DCXA 1Y9UA 3A3UA 3H7MA 3FZVA 4K3FA 1NNKA 4GFRA 1EZ9A 4KD5A 2GHBA 4KYEA 2F7CA 5M2VA 3RT6B 3VLVA 2OLBA 1US5A 3PMVA 2X26A 1JW5A 4F29A 5AA2B 4NEDA 3JYRA 1MRPA 4KCDA 4ZEBA 4IGTA 4R2BA 3UA8A 1FQEA 3C4MA 3MP6A 1UTBA 1EH3A 2ZNTA 1FTJA 2PMSA 3PMXA 4U4XA 3HHFA 2HCAA 2UVJA 3TYHA 3KOTA 4KHZE 3TDJA 4F3BA 4ZEDA 2NWJA 3D4GA 3OD7A 4LVQA 1B5IA 4YZZA 3UGWA 1A55A 1MDP1 1MY3A 3CIJA 3RTWB 2V3UA 3VV5A 1OQGA 4ESWA 1B5HA 2QMXA 1QVSA 2B3BA 4MLQA 1OLAA 1B3FA 3UIFA 4PP0A 5K2YA 2OK2A 1QJMA 4WKMA 4EDPA 5B7DA 5CMCA 3CG1A 2YJPA 1RYXA 3IO6A 1OIBA 3FVGA 3MVZA 2G93A 2XXXA 4G2ZA 4OQOA 4IO2A 1POTA 4RPOA 3H4ZA 2DQVA 4NF5B 3H6TA 1MQGA 1URDA 2O84X 5CBSA 2DOJA 3OEKA 5JTYA 4POXA 1ZJLA 2Z8FA 3MUQA 3MP8A 1YTVA 1AL3A 1HSJA 1JVYA 3LUYA 2UYEA 5I2KB 1MQIA 2OJTA 2Y7WA 3SERA 3FV2A 1BP5A 1BIYA 1HSLA 1P1QA 5DTBA 5L8DA 3HV1A 3EF7A 4LONB 3D4CA 4QFNA 4UACA 2NUVA 4BDNA 4YICA 3DM0A 1VR5A 3V5AA 3FUZA 2KLFA 4YKPA 2F8DA 2Y7KA 3M3KA 5H8QA 4GL8A 3KJ7A 2O6AA 2I49A 4PFTA 3RTFB 1A40A 4BDRA 5EHMA 1NNFA 2AL4A 2F7BA 3SEWA 3JZJA 3EQ1A 5AA2D 5ICQA 4OENA 1UQWA 4YMAA 5FTIA 3VXCA 4EXKA 1B7HA 1CB6A 1I69A 1OVTA 2Z8DA 3O66A 4KFQA 1M5CA 1LLSA 1YCJA 4HW8A 2F36A 1POY1 2UVGA 1SYHA 4I9DA 4X1BA 3VLUA 3Q29A 1SD3A 2RC9A 1B3EA 4H6DA 4YKJA 4R74A 2Q9TA 1US4A 4JXIA 5I58B 2Z22A 3FV1A 5F7VA 3V8XB 4N07A 1HSEA 5F1QA 1Y1MA 4G68C 2R9JA 3PUVE 4XXUA 2B65A 4YKIA 4ELRA 3KSJA 1GGGA 1XT8A 2G29A 1AOVA 2A5TB 3R26A 3QK6A 2DSFA 4NTLA 3THIA 3Q25A 5BUUA 3QSLA 4OFLA 4OMBA 2O1LA 1UIVA 1B1HA 4XKPA 3PPPA 1SW1A 1XVYA 3AXFA 2P1SA 3RN8A 3S9MC 2REJA 3E3KA 4GOTA 1Y20A 2O51A 4OYVA 4RNSA 2QMWA 3G3FA 3IO4A 4DZ1A 5KCJA 1MPBA 1AIVA 3FVOA 3MVWA 3LSFB 1RYOA 5DEXA 4H1XA 1FQBA 1EZPA 2Q8JA 3IJXB 1DPEA 4QSCA 4QRZA 1N76A 4E0WA 3BBRA 4DXBA 4ZDMA 1UTHB 1ZTYA 4GXSB 1S7YA 3MJNA 2A5TA 1B4HA 4IO5A 5AA3A 5DVIA 4O3BA 2UXAA 4NWCA 1MXYA 4NF6B 4RK9A 5H8FA 2RCAA 5H8HB 3QYTA 1DTZA 4EQBA 1TFDA 3IB0A 2I6EA 2IEEA 3PD9A 4Q8RA 1PB7A 1MDQA 4JWXA 3OMBA 4JSOA 4ELPA 2DWJA 4O3AA 1BLFA 2Q89A 1P99A 1MXXA 1NNPA 3KFMA 5TPAB 2D21A 2PBWA 2VD2A 3MVYA 1GR2A 2HFBA 2OWSA 2QSXA 2ZYKA 4QSDA 5DYHA 3ODBA 3TPAA 4JBZA 4F31B 3I5OA 1MS7A 1PDAA 5H8NB 3H3GA 1IUDA 2X7QA 3G7WA 4H67A 4KI0E 2H9BA 2QS1A 4Q0CA 3UP9A 4F2QA 2GRVA 3PUXE 2XXIA 1IXGA 4OFOA 2M8CA 1MXWA 4G77A 3K6WA 4OEVA 3FIRA 4PFUA 4JWOA 1SDXA 5A5XB 2CMOA 1MM7A 2XX7A 2XHDA 2XD3A 3OSQA 3T22A 4C0RA 2DS9A 3DELB 1GV8A 3KN8A 1FQFA 5H8FB 4DE8A 1M5EA 4I1DA 4YB5A 4DXCA 4EF2A 4F22A 4F3GA 1IQ7A 1VE4A 2F6PA 1VFEA 3BFTA 4GD5A 1MXVA 3FD3A 4KQPA 3CFXA 3WAEA 3GZGA 5BWJA 3K00A 1MG1A 1Y4CA 2D5WA 1Z7ME 2HAVA 4QFPA 1QUJA 4X9TA 2PT1A 3OO9A 5L9OA 3C32A 1MH3A 4DCYA 1IZ1A 3TEPA 4ZE8A 3PD8A 4P0GA 4IO4A 5EYFA 5KCJB 4GWOA 1R1NA 3IOTA 4FECA 2WKYA 4DDDA 1SYIA 1B4ZA 5I57B 2I0BA 2O69A 2QJEA 1LAGE 3P7IA 4U4SA 4YB6A 3RPWA 3FATA 1Z7NE 1JQFA 1NMUA 3KN7A 5J1DA 3LSLA 1CE2A 2NXOA 1FQCA 3I6VA 1I6AA 2ZMBA 1UTHA 3PPRA 5CMBA 5TU0A 5I2NB 3PV0E 3MAMA 1MQDA 4JWYA 2GH9A 1MXZA 1MY4A 3HN0A 2F7AA 3MC2A 3O97A 4HS7A 1IXIA 1B3LA 3O9PA 1RKMA 3KJTA 3PGFA 1LAHE 3TAJA 4RA1A 4IB2A 4I8CA 1MY1A 1WVJA 1USYH 1LCFA 1YPNA 3FXRA 4G68A 4X1DA 4YB7A 3T9UA 3Q28A 4BDQA 4EQ9A 5I56B 5ICTA 1PEBA 4GLIA 3O6GA 1D3KA 1ATGA 4HCWA 1FTLA 3H6WA 4G8NA 4NWDA 1JW1A 5JEIA 2H99A 3SKPA 4F3SA 2XXVA 3CFZA 2Q2CA 3EHUA 1IXHA 3N6UA 4PFWA 3PPQA 2HAUA 3PU5A 3O28A 1GVCA 4YMBA 3Q26A 5H8NA 1ZKBA 3IORA 4WEPA 3T96B 3QXMA 2P2AA 3CSBA 3ILTB 5CM6A 4DIGA 1QKAA 1P1OA 4WEDA 4F18A 4FAJA 2I48A 1USYE 1MXUA 1SW5A 3N26A 4IY6A 3H6UA 2A5SA 3W15C 1DSNA 4AB6A 5I84A 4U1ZA 3H03A 3TKDA 1NNTA 4ZE9A 5I56A 1WODA 3FJMA 1F9BA 5TP9A 4NF5A 4F3PA 1FW0A 1B40A 1Q35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ1 A;  2F6G A;  2R6G E;  3ZKK A;  1ANF A;  3QIM A;  3SDF A;  4LQ2 A;  5ITP A;  2Q88 A;  4F19 A;  1URG A;  3M3L A;  3RLF E;  3RY3 A;  5CC2 A;  1MPC A;  1FQD A;  2XX9 A;  1JNF A;  2I3W A;  4FEB A;  2HZL A;  5I59 A;  3OSR A;  3W9W A;  1N3X A;  1OVB A;  4M1V A;  1QW0 A;  2BJJ X;  5H8Q B;  3S9L C;  3PUY E;  2DXR A;  2XXU A;  4GQO A;  1AMF A;  1N84 A;  2RF1 A;  3PPN A;  3IR1 A;  4OEU A;  4ONY A;  1EU8 A;  1TWY A;  3TTL A;  3KG2 A;  3SET A;  4Q30 B;  3K1P A;  1EZO A;  4FED A;  3GXA A;  3K6U A;  4FOR A;  4ZEC A;  1PC3 A;  3ECR A;  3HO7 A;  1A8E A;  3TMG A;  2QPQ A;  3IB1 A;  1Y4T A;  3QUF A;  2QS3 A;  3U72 A;  2H4I A;  1H43 A;  2AYS A;  2XXY A;  3K6V A;  1XVX A;  5HBC A;  1M5F A;  2AIX A;  4QFK A;  4FIM A;  1B05 A;  4R6H A;  5I59 B;  1Y3N A;  4LA9 A;  1N7W A;  3OEN A;  3K1M A;  3S9E A;  2XXQ A;  3K01 A;  1T0K A;  3MBP A;  3TCH A;  1N7X A;  4H8I A;  3SEV A;  2RC8 A;  1H76 A;  1FTM A;  3RGY A;  5DVJ A;  1A99 A;  4KYS A;  5CRY A;  1MQH A;  1I6Q A;  3R6U A;  4OWD A;  3T93 B;  2NOO A;  2DXY A;  3BKI B;  1PBP A;  3TTM A;  5IKB A;  3K2D A;  2UYF A;  4OES A;  2I58 A;  5FTH A;  2QS4 A;  4H5F A;  5I2K A;  2ALU A;  5DEX B;  1LAF E;  3ILU B;  1MY2 A;  4H0W A;  4QHQ A;  2PX1 A;  3TTK A;  3FXU A;  1P1N A;  4IY5 A;  4NF4 A;  2VP1 A;  2DWA A;  3OEM A;  4E0X A;  1LB9 A;  2RIN A;  3HPI A;  2ZXT A;  1P1W A;  4TOZ A;  2OZZ A;  2F34 A;  2XXP A;  1O63 A;  4Z7E A;  3PMW A;  4ND9 A;  5LOM A;  3CVG A;  3U93 A;  2VOZ A;  5TP9 B;  3O6I A;  4F1U A;  3C31 A;  4NF6 A;  5AA2 A;  3H6V A;  4ZEI A;  1SI0 A;  2IA4 A;  2RC7 A;  3KOS A;  3TQW A;  2OCU A;  1FTK A;  4OET A;  3T9H B;  1VFD A;  4M4G A;  1QUK A;  2D3I A;  1SW2 A;  3VVD A;  1NH7 A;  3H06 B;  4G4P A;  2O68 A;  3LC8 A;  3VFJ A;  1Y3P A;  4RXL A;  1J1N A;  1NFT A;  2V3T A;  1N0T A;  1PBQ A;  1Y1Z A;  2QS2 A;  4KPT A;  4R9F A;  4TLM B;  1B2H A;  4XTC Q;  3V89 B;  3SEY A;  2E1S A;  2ZYO A;  2YPN A;  3FXQ A;  4XKR A;  5I58 A;  3I3V A;  1MY0 A;  2F97 A;  1SVX B;  3FVK A;  4GF8 A;  3RQT A;  2ZNS A;  4KCC A;  4YU0 A;  5AA4 B;  3N6T A;  4AB5 A;  4BDM A;  4R6K A;  2HQ0 A;  3T9X B;  4OXV A;  2QRY A;  3T66 A;  1B5J A;  1WDN A;  5FHM A;  5JTY B;  3CR9 A;  1JVX A;  1SBP A;  2V84 A;  2FA7 A;  3U94 A;  4OER A;  5JK4 A;  2F35 A;  5FHN A;  3B6T A;  3U8Q A;  2ESN A;  3C36 A;  3MVX A;  4XIG Q;  1JEU A;  3M8U A;  3WAF A;  1B51 A;  1MQJ A;  2ONR A;  4GIZ A;  3ZSF A;  1DPP A;  3TUS A;  3S4U A;  3OO7 A;  1DMB A;  4EUO A;  3MPL A;  2VD3 A;  4ESX A;  2UVI A;  3GBB A;  4P11 A;  4KR5 A;  4OZ9 A;  3LSW A;  5KDT A;  1R6Z A;  1KWH A;  2VHA A;  3OO8 A;  3U1O A;  1JET A;  4JDF A;  3LR1 A;  2PT2 A;  4HCY A;  4PE5 B;  1H3D A;  1D9V A;  2ONS A;  4F1Y A;  2Z8E A;  1B32 A;  3DLN A;  3IOU A;  4I62 A;  3O29 A;  4OFJ A;  3V83 A;  2Z23 A;  3SEU A;  3TZA A;  2XXH A;  1FQA A;  1PB9 A;  2DP8 A;  2ABH A;  3IJO B;  2O7I A;  3LSX A;  4U21 A;  5TPA A;  3R7X A;  1IIT A;  3TTR A;  2DVZ A;  1SI1 A;  4ZZA A;  3OOA A;  1QUI A;  2Y7P A;  4GL0 A;  2Y84 A;  4POW A;  2DWH A;  1Q1K A;  3FJ7 A;  4NMY A;  5CBR A;  1S50 A;  4O3C A;  3PPO A;  3MW0 A;  4IO7 A;  3SEX A;  4R6Y A;  3K4U A;  4U23 A;  3TOD A;  5HPQ A;  5KZT A;  4F1V A;  1FTO A;  1SQY A;  3E9X A;  4ZEK A;  4R2F A;  4ECF A;  4GRK A;  4FAT A;  4MFI A;  3RUM A;  4NF8 A;  2ZYM A;  4FJP A;  1LB8 A;  2OBG A;  3C33 A;  3O6H A;  2F5X A;  1B7U A;  3DP4 A;  1BKA A;  3HST A;  1QKB A;  4IO6 A;  2DE3 A;  3G3J A;  2X7P A;  4ELO A;  4GXA A;  3EN3 A;  1XC1 A;  1B52 A;  2VGQ A;  4UA8 A;  1JEV A;  4LAT A;  1MH4 A;  3RNN A;  4BDL A;  4QFL A;  2O1M A;  3C34 A;  2Q2A A;  4DXU A;  2XX8 A;  4NE4 A;  3FVN A;  3Q27 A;  5IAI A;  3EHS A;  5AA4 A;  2ZNU A;  3U92 A;  4OHN A;  2PYY A;  4LUB A;  2V93 A;  5CMM A;  5CMK A;  3MZB A;  3HHG A;  4R73 A;  5K2X A;  1B0L A;  3MWB A;  4N6P A;  3K1N A;  1S9T A;  3G3K A;  2I4B A;  1R9L A;  4ISU A;  2DYX A;  4ZEF A;  1II5 A;  3A3C A;  3OEL A;  1YAE A;  3TTN A;  1NKX A;  3OXN A;  5I57 A;  3PUZ E;  3VE1 B;  1MM6 A;  3FJG A;  3TCF A;  3ZKL A;  1B9J A;  4BLA A;  2ANJ A;  1B7Z A;  2DVC A;  2Y7R A;  3GLB A;  3UK4 A;  4RJZ A;  3USD A;  3CRB A;  2RKM A;  3IOW A;  5DVF A;  3VVF A;  3VXB A;  3DP8 A;  4EF1 A;  1N3W A;  4H8J A;  5AE4 A;  1LFH A;  1GTK A;  2R71 A;  2RCB A;  2OWT A;  5I2N A;  3C35 A;  3UN6 A;  2Y7I A;  3QUJ A;  3N5L A;  2UVH A;  2AL5 A;  4PQJ A;  4QSE A;  4RK2 A;  5DT6 A;  3LBS A;  1P1U A;  2W7Y A;  1LGB C;  3KZG A;  4PFY A;  5ITO A;  2FYI A;  1Y3Q A;  1I6B A;  1ZBM A;  4X48 A;  4C1T A;  3KN3 A;  3VDF A;  2H98 A;  1DOT A;  5HM4 B;  3G3G A;  4G68 B;  4JB7 A;  4MH5 A;  1LFI A;  1TT1 A;  1XS5 A;  1B3H A;  1IXC A;  3EHT A;  1PB8 A;  1XHY A;  2O7U A;  4XKQ A;  1LBB A;  3CG3 A;  5A5X A;  3TFL A;  3MPK A;  4AQ4 A;  3MQ9 A;  1B58 A;  3FAS A;  3IX1 A;  2E0S A;  4R72 A;  1AH5 A;  5H8S A;  4DLD A;  1LFG A;  1LAX A;  3DP6 A;  4MF3 A;  1O7T A;  3KGC A;  1OLC A;  4KYD A;  5CI5 A;  3MP1 A;  2H5Y A;  4F39 A;  2CZL A;  2B3F A;  3TQL A;  2THI A;  1O64 A;  3KSX A;  4L17 A;  3G3I A;  3OO6 A;  3JV9 A;  4OTE A;  4U22 A;  3W9V A;  1IIW A;  5H8H A;  2GFE A;  4XKN A;  4LZ7 A;  2V3Q A;  2XXT A;  3BFU A;  4N13 A;  4NF8 B;  3M3F A;  4RYA A;  2V25 A;  3B6Q A;  1IEJ A;  2PVU A;  4H65 A;  2GHA A;  1R9Q A;  4RPN A;  3L6H A;  3IOV A;  1D4N A;  3L6G A;  4THI A;  2I0C A;  4H5G A;  1OMP A;  5L9M A;  4BDO A;  1B46 A;  2FNC A;  4P0I A;  5EHS A;  5FHO A;  1ZIU A;  1N04 A;  2HEU A;  2DE4 A;  3CFL A;  3KEI A;  4ZZE A;  3IAZ A;  1A54 A;  1DTG A;  4TQU Q;  4R75 A;  1SW4 A;  3VLW A;  3MZ9 A;  3K02 A;  3TEL A;  1A8F A;  1URS A;  3B6W A;  1NH8 A;  1M5B A;  1XOC A;  3B7D A;  3GBA A;  1QUL A;  4EXL A;  2I3V A;  1A7L A;  1BTJ A;  4JSD A;  4IGR A;  3E13 X;  4LZ8 A;  4YKK A;  3RT8 A;  3T9V A;  1TXF A;  1VSO A;  2HXW A;  3E4R A;  4R9G A;  4U1O A;  3UOR A;  1LST A;  4WXJ A;  3VVE A;  2P0S A;  3O2A A;  1LCT A;  3SES A;  4Z0I A;  3TCG A;  1NL5 A;  3ZS6 A;  1LBC A;  3C9H A;  3EPE A;  4MBP A;  1TFA A;  1FCK A;  1ZLQ A;  4QF9 A;  3CI8 A;  4RY1 A;  4MLV A;  3N94 A;  2DWI A;  3FGS A;  3KBR A;  3PUW E;  3S9N C;  1ELJ A;  4OVJ A;  1H44 A;  3F11 A;  1D9Y A;  2F78 A;  4ZS9 A;  3A09 A;  3IK6 B;  4FE8 A;  2I4C A;  4QFO A;  2XXW A;  1B6H A;  1JW4 A;  1UIU A;  1OQH A;  3CSG A;  4LP2 B;  3K6X A;  1B1X A;  2ONK E;  2LAO A;  4LZ5 A;  3G3H A;  4LQ5 A;  2NVU B;  2HZK A;  4YAH X;  5B70 A;  3IB2 A;  2H25 A;  1H45 A;  5L9S A;  4Q5T A;  4ELQ A;  2YLN A;  5KDT B;  4F2O A;  1MPD A;  1UTB B;  4PET A;  4G8M A;  5AA1 A;  4IO3 A;  1M5D A;  5ISU A;  4TLL B;  2DE2 A;  4EQ7 A;  4GVO A;  1ZU0 A;  3IL1 B;  1ZMG A;  2QL3 A;  2XD2 A;  3HCQ A;  3ONM A;  1L5T A;  4C1U A;  2XXR A;  2ZYN A;  4NF4 B;  2REG A;  4G8H A;  4U2R A;  4HTG A;  3K0V A;  1B0H A;  1B3G A;  3QAX A;  5ELV A;  3S2V A;  4DCX A;  1Y9U A;  3A3U A;  3H7M A;  3FZV A;  4K3F A;  1NNK A;  4GFR A;  1EZ9 A;  4KD5 A;  2GHB A;  4KYE A;  2F7C A;  5M2V A;  3RT6 B;  3VLV A;  2OLB A;  1US5 A;  3PMV A;  2X26 A;  1JW5 A;  4F29 A;  5AA2 B;  4NED A;  3JYR A;  1MRP A;  4KCD A;  4ZEB A;  4IGT A;  4R2B A;  3UA8 A;  1FQE A;  3C4M A;  3MP6 A;  1UTB A;  1EH3 A;  2ZNT A;  1FTJ A;  2PMS A;  3PMX A;  4U4X A;  3HHF A;  2HCA A;  2UVJ A;  3TYH A;  3KOT A;  4KHZ E;  3TDJ A;  4F3B A;  4ZED A;  2NWJ A;  3D4G A;  3OD7 A;  4LVQ A;  1B5I A;  4YZZ A;  3UGW A;  1A55 A;  1MDP 1;  1MY3 A;  3CIJ A;  3RTW B;  2V3U A;  3VV5 A;  1OQG A;  4ESW A;  1B5H A;  2QMX A;  1QVS A;  2B3B A;  4MLQ A;  1OLA A;  1B3F A;  3UIF A;  4PP0 A;  5K2Y A;  2OK2 A;  1QJM A;  4WKM A;  4EDP A;  5B7D A;  5CMC A;  3CG1 A;  2YJP A;  1RYX A;  3IO6 A;  1OIB A;  3FVG A;  3MVZ A;  2G93 A;  2XXX A;  4G2Z A;  4OQO A;  4IO2 A;  1POT A;  4RPO A;  3H4Z A;  2DQV A;  4NF5 B;  3H6T A;  1MQG A;  1URD A;  2O84 X;  5CBS A;  2DOJ A;  3OEK A;  5JTY A;  4POX A;  1ZJL A;  2Z8F A;  3MUQ A;  3MP8 A;  1YTV A;  1AL3 A;  1HSJ A;  1JVY A;  3LUY A;  2UYE A;  5I2K B;  1MQI A;  2OJT A;  2Y7W A;  3SER A;  3FV2 A;  1BP5 A;  1BIY A;  1HSL A;  1P1Q A;  5DTB A;  5L8D A;  3HV1 A;  3EF7 A;  4LON B;  3D4C A;  4QFN A;  4UAC A;  2NUV A;  4BDN A;  4YIC A;  3DM0 A;  1VR5 A;  3V5A A;  3FUZ A;  2KLF A;  4YKP A;  2F8D A;  2Y7K A;  3M3K A;  5H8Q A;  4GL8 A;  3KJ7 A;  2O6A A;  2I49 A;  4PFT A;  3RTF B;  1A40 A;  4BDR A;  5EHM A;  1NNF A;  2AL4 A;  2F7B A;  3SEW A;  3JZJ A;  3EQ1 A;  5AA2 D;  5ICQ A;  4OEN A;  1UQW A;  4YMA A;  5FTI A;  3VXC A;  4EXK A;  1B7H A;  1CB6 A;  1I69 A;  1OVT A;  2Z8D A;  3O66 A;  4KFQ A;  1M5C A;  1LLS A;  1YCJ A;  4HW8 A;  2F36 A;  1POY 1;  2UVG A;  1SYH A;  4I9D A;  4X1B A;  3VLU A;  3Q29 A;  1SD3 A;  2RC9 A;  1B3E A;  4H6D A;  4YKJ A;  4R74 A;  2Q9T A;  1US4 A;  4JXI A;  5I58 B;  2Z22 A;  3FV1 A;  5F7V A;  3V8X B;  4N07 A;  1HSE A;  5F1Q A;  1Y1M A;  4G68 C;  2R9J A;  3PUV E;  4XXU A;  2B65 A;  4YKI A;  4ELR A;  3KSJ A;  1GGG A;  1XT8 A;  2G29 A;  1AOV A;  2A5T B;  3R26 A;  3QK6 A;  2DSF A;  4NTL A;  3THI A;  3Q25 A;  5BUU A;  3QSL A;  4OFL A;  4OMB A;  2O1L A;  1UIV A;  1B1H A;  4XKP A;  3PPP A;  1SW1 A;  1XVY A;  3AXF A;  2P1S A;  3RN8 A;  3S9M C;  2REJ A;  3E3K A;  4GOT A;  1Y20 A;  2O51 A;  4OYV A;  4RNS A;  2QMW A;  3G3F A;  3IO4 A;  4DZ1 A;  5KCJ A;  1MPB A;  1AIV A;  3FVO A;  3MVW A;  3LSF B;  1RYO A;  5DEX A;  4H1X A;  1FQB A;  1EZP A;  2Q8J A;  3IJX B;  1DPE A;  4QSC A;  4QRZ A;  1N76 A;  4E0W A;  3BBR A;  4DXB A;  4ZDM A;  1UTH B;  1ZTY A;  4GXS B;  1S7Y A;  3MJN A;  2A5T A;  1B4H A;  4IO5 A;  5AA3 A;  5DVI A;  4O3B A;  2UXA A;  4NWC A;  1MXY A;  4NF6 B;  4RK9 A;  5H8F A;  2RCA A;  5H8H B;  3QYT A;  1DTZ A;  4EQB A;  1TFD A;  3IB0 A;  2I6E A;  2IEE A;  3PD9 A;  4Q8R A;  1PB7 A;  1MDQ A;  4JWX A;  3OMB A;  4JSO A;  4ELP A;  2DWJ A;  4O3A A;  1BLF A;  2Q89 A;  1P99 A;  1MXX A;  1NNP A;  3KFM A;  5TPA B;  2D21 A;  2PBW A;  2VD2 A;  3MVY A;  1GR2 A;  2HFB A;  2OWS A;  2QSX A;  2ZYK A;  4QSD A;  5DYH A;  3ODB A;  3TPA A;  4JBZ A;  4F31 B;  3I5O A;  1MS7 A;  1PDA A;  5H8N B;  3H3G A;  1IUD A;  2X7Q A;  3G7W A;  4H67 A;  4KI0 E;  2H9B A;  2QS1 A;  4Q0C A;  3UP9 A;  4F2Q A;  2GRV A;  3PUX E;  2XXI A;  1IXG A;  4OFO A;  2M8C A;  1MXW A;  4G77 A;  3K6W A;  4OEV A;  3FIR A;  4PFU A;  4JWO A;  1SDX A;  5A5X B;  2CMO A;  1MM7 A;  2XX7 A;  2XHD A;  2XD3 A;  3OSQ A;  3T22 A;  4C0R A;  2DS9 A;  3DEL B;  1GV8 A;  3KN8 A;  1FQF A;  5H8F B;  4DE8 A;  1M5E A;  4I1D A;  4YB5 A;  4DXC A;  4EF2 A;  4F22 A;  4F3G A;  1IQ7 A;  1VE4 A;  2F6P A;  1VFE A;  3BFT A;  4GD5 A;  1MXV A;  3FD3 A;  4KQP A;  3CFX A;  3WAE A;  3GZG A;  5BWJ A;  3K00 A;  1MG1 A;  1Y4C A;  2D5W A;  1Z7M E;  2HAV A;  4QFP A;  1QUJ A;  4X9T A;  2PT1 A;  3OO9 A;  5L9O A;  3C32 A;  1MH3 A;  4DCY A;  1IZ1 A;  3TEP A;  4ZE8 A;  3PD8 A;  4P0G A;  4IO4 A;  5EYF A;  5KCJ B;  4GWO A;  1R1N A;  3IOT A;  4FEC A;  2WKY A;  4DDD A;  1SYI A;  1B4Z A;  5I57 B;  2I0B A;  2O69 A;  2QJE A;  1LAG E;  3P7I A;  4U4S A;  4YB6 A;  3RPW A;  3FAT A;  1Z7N E;  1JQF A;  1NMU A;  3KN7 A;  5J1D A;  3LSL A;  1CE2 A;  2NXO A;  1FQC A;  3I6V A;  1I6A A;  2ZMB A;  1UTH A;  3PPR A;  5CMB A;  5TU0 A;  5I2N B;  3PV0 E;  3MAM A;  1MQD A;  4JWY A;  2GH9 A;  1MXZ A;  1MY4 A;  3HN0 A;  2F7A A;  3MC2 A;  3O97 A;  4HS7 A;  1IXI A;  1B3L A;  3O9P A;  1RKM A;  3KJT A;  3PGF A;  1LAH E;  3TAJ A;  4RA1 A;  4IB2 A;  4I8C A;  1MY1 A;  1WVJ A;  1USY H;  1LCF A;  1YPN A;  3FXR A;  4G68 A;  4X1D A;  4YB7 A;  3T9U A;  3Q28 A;  4BDQ A;  4EQ9 A;  5I56 B;  5ICT A;  1PEB A;  4GLI A;  3O6G A;  1D3K A;  1ATG A;  4HCW A;  1FTL A;  3H6W A;  4G8N A;  4NWD A;  1JW1 A;  5JEI A;  2H99 A;  3SKP A;  4F3S A;  2XXV A;  3CFZ A;  2Q2C A;  3EHU A;  1IXH A;  3N6U A;  4PFW A;  3PPQ A;  2HAU A;  3PU5 A;  3O28 A;  1GVC A;  4YMB A;  3Q26 A;  5H8N A;  1ZKB A;  3IOR A;  4WEP A;  3T96 B;  3QXM A;  2P2A A;  3CSB A;  3ILT B;  5CM6 A;  4DIG A;  1QKA A;  1P1O A;  4WED A;  4F18 A;  4FAJ A;  2I48 A;  1USY E;  1MXU A;  1SW5 A;  3N26 A;  4IY6 A;  3H6U A;  2A5S A;  3W15 C;  1DSN A;  4AB6 A;  5I84 A;  4U1Z A;  3H03 A;  3TKD A;  1NNT A;  4ZE9 A;  5I56 A;  1WOD A;  3FJM A;  1F9B A;  5TP9 A;  4NF5 A;  4F3P A;  1FW0 A;  1B40 A;  1Q35 A; 
#chains in the Genus database with same CATH topology
 3MZ1 A;  3QIM A;  3SDF A;  4LQ2 A;  4F19 A;  2Q8M A;  4PFI A;  3PUY E;  2DXR A;  2XXU A;  1N84 A;  3IR1 A;  1EZO A;  3KG2 A;  3SET A;  4FOR A;  1IMB A;  4ZEC A;  3TMG A;  3IB1 A;  2QS3 A;  2XXY A;  4R6H A;  5I59 B;  4LA9 A;  2XXQ A;  4QBA A;  2RC8 A;  1A99 A;  5CRY A;  4OWD A;  3K2D A;  4DI4 B;  2I58 A;  5FTH A;  2QS4 A;  2ALU A;  1LAF E;  3ILU B;  1MY2 A;  4H0W A;  5IM2 A;  2PX1 A;  2Q74 A;  3HPI A;  2ZXT A;  1P1W A;  4TOZ A;  1YZ0 A;  1K9Z A;  3U93 A;  2VOZ A;  3O6I A;  4NF6 A;  4ZEI A;  4M4G A;  1NH7 A;  4RXL A;  4XEQ A;  2V3T A;  1N0T A;  1PBQ A;  2QS2 A;  4TLM B;  2YPN A;  1MY0 A;  3RQT A;  1SVX B;  4GF8 A;  4KCC A;  4YU0 A;  3N6T A;  4X04 A;  4BDM A;  3T66 A;  3LUZ A;  1DCU A;  1BK4 A;  2V4C A;  3U8Q A;  4OVP A;  3M8U A;  3ZSF A;  1DPP A;  2R8T A;  1DMB A;  4MIJ A;  4ESX A;  3GBB A;  4G61 A;  4P11 A;  1R6Z A;  1KWH A;  1JET A;  1D9Q A;  4F1Y A;  4MNP A;  4I62 A;  3DLN A;  3IOU A;  3V83 A;  2QFL A;  2Z23 A;  2XXH A;  2ABH A;  5I58 A;  4ZZA A;  3OOA A;  4POW A;  3PPO A;  4IO7 A;  4ZEK A;  3E79 A;  4MFI A;  1BKA A;  3G3J A;  5HPQ A;  4GXA A;  1XC1 A;  2VGQ A;  4LAT A;  4BDL A;  3EHS A;  5AA4 A;  3U92 A;  5CMM A;  2PYY A;  5CMK A;  4R73 A;  1B0L A;  4ISU A;  1R9L A;  3A3C A;  3OEL A;  1YAE A;  2FIE A;  3FJG A;  1B9J A;  1B7Z A;  2Y7R A;  5A5L A;  5EYG A;  1QGX A;  3VXB A;  1LFH A;  1N3W A;  4H8J A;  1GTK A;  1FBF A;  2RCB A;  3IFA A;  3C35 A;  2Y7I A;  1NV2 A;  2UVH A;  1FPF A;  3KZG A;  4PFY A;  1I6B A;  4C1T A;  5HM4 B;  5A5X A;  3TFL A;  1B58 A;  4R72 A;  5H8S A;  4MF3 A;  1LAX A;  1O7T A;  4KYD A;  1OLC A;  4X8R A;  2B3F A;  4PF6 A;  2CEX A;  4RYA A;  5EQ8 A;  2I0C A;  5EHS A;  3KEI A;  4ZZE A;  1NI9 A;  4TQU Q;  3TEL A;  3B6W A;  1M5B A;  1QUL A;  4EXL A;  2I3V A;  4JSD A;  1BTJ A;  4YKK A;  3T9V A;  1FBC A;  3VVE A;  4Z0I A;  1NL5 A;  3ZS6 A;  2DWI A;  2PFY A;  4OVJ A;  3A09 A;  1FSA A;  3T9H B;  3K6X A;  2NVU B;  4YAH X;  3IB2 A;  2H25 A;  4ELQ A;  1UTB B;  4GWU A;  3IL1 B;  3ONM A;  1L5T A;  2ZYN A;  4G8H A;  3K0V A;  1B3G A;  4N6D A;  4MNC A;  3A3U A;  4K3F A;  1NNK A;  4KD5 A;  1JW5 A;  2PFZ A;  5AA2 B;  1UTB A;  2PMS A;  4U4X A;  3KOT A;  4KHZ E;  3TDJ A;  2NWJ A;  4NQ8 A;  3UGW A;  1MDP 1;  1OQG A;  3UIF A;  2QMX A;  1QVS A;  1B3F A;  1QJM A;  4EDP A;  5CMC A;  3CG1 A;  4RPO A;  4IO2 A;  4JVD A;  2DQV A;  4NF5 B;  3U65 A;  1URD A;  5JTY A;  4MMP A;  1ZJL A;  2Z8F A;  3MUQ A;  1AL3 A;  4OVT A;  2Y7W A;  2XA5 A;  3FV2 A;  1P1Q A;  5DTB A;  5L8D A;  3HV1 A;  4LON B;  4YIC A;  3DM0 A;  3FUZ A;  2F8D A;  2Y7K A;  5H8Q A;  3KJ7 A;  3RTF B;  2O6A A;  1FPL A;  3RPL A;  1A40 A;  4N8Y A;  5EHM A;  1CB6 A;  2Z8D A;  4KFQ A;  2UVG A;  5EQ7 A;  1SD3 A;  4JXI A;  3PUV E;  2B65 A;  3R26 A;  5BUU A;  3Q25 A;  1EYJ A;  2P1S A;  4DZ1 A;  4OYV A;  2O51 A;  4RNS A;  3IO4 A;  3FVO A;  5DEX A;  4QRZ A;  1N76 A;  4GWY A;  2GQ1 A;  3EKI A;  4GXS B;  1S7Y A;  1B4H A;  4NWC A;  5H8H B;  4GWS A;  3SZP A;  3IB0 A;  4JWX A;  4PGN A;  4JSO A;  4ELP A;  2ZZX A;  1NNP A;  1FPJ A;  1GR2 A;  2HFB A;  2L5V A;  3ODB A;  2KR0 A;  3H3G A;  2X7Q A;  4NGU A;  4NHB A;  1MXW A;  1FPB A;  4OEV A;  4JWO A;  1MM7 A;  4PF8 A;  4DE8 A;  4I1D A;  4YB5 A;  4F3G A;  1VE4 A;  1VFE A;  4GD5 A;  4KQP A;  1Y4C A;  2HAV A;  5L9O A;  3OO9 A;  4NN3 A;  5EYF A;  5KCJ B;  2WKY A;  1B4Z A;  4YB6 A;  1JQF A;  4PCD A;  5I3S A;  3PV0 E;  3LV0 A;  2P3V A;  1MY4 A;  3KJT A;  1LAH E;  4HE0 A;  4RA1 A;  1YPN A;  1LBY A;  4G68 A;  2JJK A;  3H6W A;  4MHF A;  4F3S A;  1FBG A;  3CFZ A;  3N6U A;  4PFW A;  3PPQ A;  4MAG A;  3O28 A;  4YMB A;  1ZKB A;  4O94 A;  2P2A A;  3ILT B;  1USY E;  3N26 A;  1DSN A;  4O7I A;  5I56 A;  4JB7 A;  1B40 A;  2Q88 A;  3M3L A;  3RY3 A;  2XX9 A;  1JNF A;  5I59 A;  1N3X A;  1OVB A;  1QW0 A;  3S9L C;  2RF1 A;  4Q30 B;  3GXA A;  3ECR A;  2QPQ A;  1Y4T A;  2H4I A;  3GYY A;  4QFK A;  1DK4 A;  3K1M A;  3S9E A;  3MBP A;  3TCH A;  1N7X A;  3SEV A;  1H76 A;  3RGY A;  1MQH A;  1I6Q A;  3R6U A;  2NOO A;  2VPN A;  2DXY A;  1PBP A;  1NUZ A;  2UYF A;  4OES A;  4H5F A;  5DEX B;  2Y5L A;  1P1N A;  4NF4 A;  4E0X A;  3OEM A;  1LB9 A;  2RIN A;  2OZZ A;  2XXP A;  5IZZ A;  1NV0 A;  4ND9 A;  5TP9 B;  4F1U A;  3C31 A;  5AA2 A;  2IA4 A;  2RC7 A;  2OCU A;  1FTK A;  2D3I A;  3VVD A;  3H06 B;  2O68 A;  3LC8 A;  1Y3P A;  4PAF A;  5CC2 A;  5LDZ A;  1Y1Z A;  1B2H A;  3FXQ A;  2F97 A;  4R6K A;  4OXV A;  5FHM A;  3CR9 A;  2FA7 A;  4OER A;  5JK4 A;  5FHN A;  3B6T A;  3C36 A;  4XIG Q;  1JEU A;  3S4U A;  1INP A;  4KR5 A;  3LSW A;  3U1O A;  4JDF A;  4HCY A;  4AS4 A;  2Z8E A;  3O29 A;  2QVU A;  4OFJ A;  3SEU A;  3FXB A;  1PB9 A;  2DP8 A;  3IJO B;  3LSX A;  4U21 A;  5TPA A;  3HFU A;  3R7X A;  3TTR A;  2Y7P A;  1NUX A;  1Q1K A;  4NMY A;  4O3C A;  3SEX A;  2XXK A;  3K4U A;  2B4L A;  4F1V A;  1FTO A;  3E9X A;  4OVS A;  4ECF A;  4R2F A;  4FAT A;  1XI6 A;  2ZYM A;  4FJP A;  1NV4 A;  3O6H A;  1B7U A;  3HST A;  4F31 B;  1EYK A;  4UA8 A;  1B52 A;  1JEV A;  1EYI A;  4QFL A;  4DXU A;  4NE4 A;  3FVN A;  3Q27 A;  2ZNU A;  5I7I A;  4LUB A;  3MZB A;  5K2X A;  3MWB A;  3G3K A;  3TTN A;  3OXN A;  3VE1 B;  1MM6 A;  3TCF A;  3UK4 A;  4EQ9 A;  4RJZ A;  3DP8 A;  1SPI A;  5I2N A;  5DT6 A;  4RK2 A;  5KDT B;  3LBS A;  2W7Y A;  1LGB C;  1ZBM A;  3VDF A;  4GX4 A;  2OWZ A;  1DOT A;  1TT1 A;  1RDX A;  1PB8 A;  2O7U A;  3MPK A;  3MQ9 A;  2E0S A;  1AH5 A;  1FPK A;  4F39 A;  2H5Y A;  1O64 A;  3JV9 A;  4OTE A;  2GFE A;  4OAN A;  2XXT A;  4NF8 B;  4RPN A;  5L9M A;  1IME A;  4P0I A;  1FBH A;  1DTG A;  1SW4 A;  3K02 A;  1URS A;  3B7D A;  1CNQ A;  4LZ8 A;  3E13 X;  3RT8 A;  2HXW A;  4R9G A;  1LST A;  3TCG A;  3EPE A;  1FPD A;  3FGS A;  3KBR A;  1H44 A;  2F78 A;  3IK6 B;  2I4C A;  5EQ9 A;  1OQH A;  4LZ5 A;  5B70 A;  1H45 A;  4Q5T A;  1LBZ A;  4F2O A;  4PET A;  1M5D A;  4TLL B;  4EQ7 A;  4GVO A;  4P56 A;  1ZMG A;  5FBP A;  2XD2 A;  3RPW A;  4NF4 B;  2REG A;  5ELV A;  4PFB A;  3FZV A;  1EZ9 A;  2GHB A;  2F7C A;  2OLB A;  4F29 A;  4NED A;  4ZEB A;  4IGT A;  4R2B A;  3UA8 A;  3C4M A;  1FTJ A;  3PMX A;  2UVJ A;  4F3B A;  4ZED A;  3OD7 A;  4PDD A;  4YZZ A;  1A55 A;  1MY3 A;  2V3U A;  3VV5 A;  4MLQ A;  2B3B A;  3V5A A;  5K2Y A;  3IO6 A;  1POT A;  3QMF A;  4N6K A;  3H6T A;  4MCO A;  2DOJ A;  2FBP A;  3MP8 A;  5IGA A;  2UYE A;  1DBZ A;  1HSL A;  3M3K A;  4GL8 A;  2WYP A;  5I5P A;  5AA2 D;  1JP4 A;  1UQW A;  4OEN A;  4EXK A;  1B7H A;  1OVT A;  1YCJ A;  4OA4 A;  4HW8 A;  2F36 A;  4H6D A;  4YKJ A;  2Q9T A;  5I58 B;  3FV1 A;  5F7V A;  3V8X B;  4N07 A;  4N17 A;  4G68 C;  2R9J A;  4ELR A;  1AOV A;  3KSJ A;  3QK6 A;  4NTL A;  2F3B A;  1UIV A;  4XKP A;  3PPP A;  3RN8 A;  4OVR A;  3E3K A;  4GOT A;  1Y20 A;  2QMW A;  3LSF B;  1RYO A;  1FQB A;  2Q8J A;  4MX6 A;  3BBR A;  4PGP A;  3MJN A;  1NV6 A;  2UXA A;  4O7M A;  1MXY A;  4NF6 B;  4RK9 A;  2IEE A;  1PB7 A;  1BLF A;  4N81 A;  3KFM A;  2D21 A;  2PBW A;  3TPA A;  5DYH A;  1LBX A;  3I5O A;  2QS1 A;  3PUX E;  3FBP A;  4NG7 A;  2WEF A;  2CMO A;  2XHD A;  2XD3 A;  3T22 A;  4C0R A;  1M5E A;  1IQ7 A;  3BFT A;  4DI3 D;  3FD3 A;  2XWO A;  3CFX A;  4PFR A;  3GZG A;  3K00 A;  1Z7M E;  4X9T A;  4DCY A;  1IZ1 A;  4GWO A;  3IFC A;  2I0B A;  3KC1 A;  3P7I A;  4U4S A;  3FAT A;  1NMU A;  3KN7 A;  2NXO A;  1I6A A;  3PPR A;  5J16 A;  3ISP A;  1MXZ A;  2F7A A;  1B3L A;  3O9P A;  4NAP A;  2QVV A;  4X1D A;  4H45 A;  5I56 B;  3T9U A;  4PTK A;  4HCW A;  1FTL A;  4N15 A;  3SKP A;  2Q2C A;  5F24 A;  1FJ9 A;  1GVC A;  5H8N A;  4HXV A;  2PCR A;  4DIG A;  4F18 A;  4FAJ A;  2I48 A;  1MXU A;  4U1Z A;  1WOD A;  3FJM A;  1FW0 A;  2FIX A;  2F6G A;  2R6G E;  5ESY A;  5ITP A;  2QVR A;  1MPC A;  1FQD A;  3OSR A;  2BJJ X;  3PPN A;  2CZK A;  3TTL A;  3K1P A;  4FED A;  1K9Y A;  2FHY A;  3U72 A;  5IZ1 A;  3K6V A;  4N91 A;  1M5F A;  4FIM A;  1B05 A;  1Y3N A;  3OEN A;  3K01 A;  1FPG A;  5DVJ A;  4KYS A;  1YYZ A;  5I2K A;  4QHQ A;  4GX3 A;  1G0H A;  3CVG A;  1FRP A;  1SI0 A;  4OET A;  1QUK A;  2BJI A;  4GWX A;  4KPT A;  3V89 B;  3SEY A;  4XKR A;  3I3V A;  3FVK A;  5AA4 B;  5DW8 A;  1NV3 A;  2QRY A;  1FTA A;  1SBP A;  3U94 A;  2ESN A;  3MVX A;  1MQJ A;  3T1B A;  3TUS A;  4P8B A;  3OO7 A;  4EUO A;  3RPL B;  5KDT A;  2VHA A;  3OO8 A;  3LR1 A;  2PT2 A;  4PE5 B;  1H3D A;  1D9V A;  1B32 A;  3TZA A;  1FQA A;  2O7I A;  2DVZ A;  1SI1 A;  4IR8 A;  1S50 A;  5EQA A;  4R6Y A;  4I3Y A;  3TOD A;  5KZT A;  4MJO A;  1SQY A;  5IZ3 B;  4GRK A;  4NF8 A;  1LB8 A;  2OBG A;  1RDY A;  4IO6 A;  5IKB A;  3RNN A;  3C34 A;  2Q2A A;  5IAI A;  4P9K A;  4N6P A;  3K1N A;  1S9T A;  2I4B A;  4ZEF A;  1II5 A;  3PUZ E;  2ANJ A;  2DVC A;  4PBQ A;  3USD A;  2RKM A;  3IOW A;  4MNI A;  1IMC A;  3UN6 A;  3N5L A;  4PDH A;  4PQJ A;  2AL5 A;  1Y3Q A;  3KN3 A;  4GX6 A;  4G68 B;  1LFI A;  5ET8 A;  1B3H A;  1XHY A;  4AQ4 A;  3FAS A;  3IX1 A;  4DLD A;  1LFG A;  5CI5 A;  2CZL A;  3TQL A;  2VPO A;  3G3I A;  2WYK A;  4U22 A;  1IIW A;  4XKN A;  4N13 A;  3MST A;  4PBH A;  2PVU A;  4H65 A;  2CZI A;  1D4N A;  3L6G A;  4THI A;  4H5G A;  4BDO A;  1B46 A;  5FHO A;  1N04 A;  3CFL A;  3IAZ A;  1A54 A;  2ZZW A;  3VLW A;  3MZ9 A;  3GBA A;  1NH8 A;  1XOC A;  2DDK A;  1A7L A;  4IGR A;  4PAI A;  3UOR A;  1LCT A;  1LBC A;  4MBP A;  1TFA A;  4QF9 A;  4RY1 A;  4MLV A;  3PUW E;  1IMA A;  1ELJ A;  4GBV A;  4ZS9 A;  4QFO A;  3A29 A;  4PAK A;  2XXW A;  1JW4 A;  1UIU A;  4N4U A;  4LP2 B;  1B1X A;  1NUY A;  2HXR A;  4LQ5 A;  4G8M A;  5EYH A;  5AA1 A;  4IO3 A;  5ISU A;  3BIH A;  1ZU0 A;  2QL3 A;  3HCQ A;  4C1U A;  2XXR A;  4HTG A;  3S2V A;  5JEI A;  1Y9U A;  3RT6 B;  4KYE A;  1IMD A;  3VLV A;  3PMV A;  2XWV A;  4KCD A;  1FQE A;  1EH3 A;  2ZNT A;  4P3L A;  3TYH A;  4H46 A;  1IMF A;  4LVQ A;  1B5I A;  1FBP A;  3RTW B;  2CEY A;  1OLA A;  5B7D A;  4PP0 A;  2YJP A;  3MVZ A;  3FVG A;  2XXX A;  4G2Z A;  3H4Z A;  5CBS A;  4JVI A;  1YTV A;  1JVY A;  3LUY A;  5I2K B;  2OJT A;  1FPE A;  1BIY A;  3EF7 A;  2HPG A;  1T0K A;  4PFT A;  2F7B A;  3SEW A;  3JZJ A;  3EQ1 A;  5ICQ A;  1I69 A;  3O66 A;  1LLS A;  3BIG A;  2VT5 A;  1POY 1;  1SYH A;  3Q29 A;  4R74 A;  2Z22 A;  4P1E A;  1FBD A;  4YKI A;  1GGG A;  1XT8 A;  3THI A;  2DSF A;  2ZZV A;  4GWW A;  3QSL A;  4OFL A;  4OMB A;  1B1H A;  1SW1 A;  3AXF A;  4OVQ A;  3S9M C;  5KCJ A;  3G3F A;  3MVW A;  4H1X A;  3IJX B;  1DPE A;  4DXB A;  4ZDM A;  1ZTY A;  4IO5 A;  5DVI A;  4O3B A;  4XFE A;  2RCA A;  3QYT A;  4NX1 A;  3OMB A;  2DWJ A;  4O3A A;  1P99 A;  2VD2 A;  2ZYK A;  2OWS A;  2QSX A;  1AWB A;  2WX9 A;  4JBZ A;  5T3J A;  2OX3 A;  4H67 A;  4KI0 E;  2H9B A;  3UP9 A;  2XXI A;  2M8C A;  4G77 A;  4PFU A;  3FIR A;  3CHG A;  1SDX A;  2XX7 A;  1GV8 A;  3KN8 A;  5H8F B;  4DXC A;  4EF2 A;  4F22 A;  2P3N A;  4QFP A;  1QUJ A;  2PT1 A;  3B50 A;  1MH3 A;  4ZE8 A;  3PD8 A;  4IO4 A;  3IOT A;  4DDD A;  5I57 B;  2O69 A;  1LAG E;  1Z7N E;  2WBD A;  3B8B A;  5J1D A;  3LSL A;  1CE2 A;  4JVC A;  3I6V A;  2ZMB A;  5CMB A;  5TU0 A;  3MAM A;  1MQD A;  4JWY A;  1YXI A;  3HN0 A;  3O97 A;  2KQZ A;  1IXI A;  1RKM A;  3D1R A;  1WVJ A;  1LCF A;  4BDQ A;  4YB7 A;  3Q28 A;  5ICT A;  4GLI A;  1D3K A;  4G8N A;  4NWD A;  2XXV A;  1IXH A;  3KC0 A;  2HAU A;  4I40 A;  3Q26 A;  3T96 B;  3QXM A;  5CM6 A;  1QKA A;  1P1O A;  3W15 C;  1SW5 A;  4AB6 A;  5I84 A;  4ZE9 A;  5TP9 A;  1F9B A;  4NF5 A;  1VDW A;  3ZKK A;  1ANF A;  2XWI A;  1KA1 A;  1FBE A;  1URG A;  2CZH A;  3RLF E;  2I3W A;  4FEB A;  2HZL A;  3W9W A;  4M1V A;  5H8Q B;  4GQO A;  1AMF A;  4OEU A;  4ONY A;  1EU8 A;  1TWY A;  3K6U A;  1PC3 A;  3HO7 A;  1A8E A;  2MKZ A;  3QUF A;  1H43 A;  2AYS A;  5HBC A;  1XVX A;  2AIX A;  1N7W A;  4H8I A;  4MEV A;  1FTM A;  3T93 B;  3BKI B;  3TTM A;  1Q35 A;  4HE2 A;  3TTK A;  3FXU A;  4IY5 A;  2VP1 A;  2DWA A;  2F34 A;  4Z7E A;  1O63 A;  5LOM A;  3PMW A;  3H6V A;  3TQW A;  1KZ8 A;  3KOS A;  1VFD A;  1SW2 A;  4G4P A;  3VFJ A;  1J1N A;  1NFT A;  4R9F A;  4XTC Q;  2E1S A;  2ZYO A;  4PC9 A;  2ZNS A;  4AB5 A;  2HQ0 A;  3T9X B;  1B5J A;  1WDN A;  5JTY B;  1JVX A;  2V84 A;  2F35 A;  1LEV A;  4GBW A;  3WAF A;  1B51 A;  2ONR A;  4GIZ A;  3MPL A;  2VD3 A;  2UVI A;  4FBP A;  4XF5 A;  4OZ9 A;  5LTC A;  2ONS A;  1IIT A;  3KBZ A;  1QUI A;  4GL0 A;  2Y84 A;  2DWH A;  3FJ7 A;  3MW0 A;  4U23 A;  3RUM A;  3C33 A;  2F5X A;  3DP4 A;  3T0J A;  1QKB A;  2DE3 A;  2X7P A;  4ELO A;  3EN3 A;  1MH4 A;  2O1M A;  3PTY A;  2XX8 A;  2F3D A;  4OHN A;  2V93 A;  3HHG A;  5IZ3 A;  2DYX A;  1NKX A;  5I57 A;  1NV5 A;  3ZKL A;  4BLA A;  3GLB A;  1LBW A;  3CRB A;  4EF1 A;  5DVF A;  3VVF A;  5AE4 A;  2R71 A;  2OWT A;  3QUJ A;  4QSE A;  1P1U A;  5ITO A;  2FYI A;  2HHM A;  4X48 A;  2H98 A;  3G3G A;  4MH5 A;  1XS5 A;  1IXC A;  3EHT A;  4XKQ A;  1LBB A;  3CG3 A;  1NV1 A;  5H8F A;  3DP6 A;  1FJ6 A;  3KGC A;  3MP1 A;  2THI A;  3KSX A;  4L17 A;  3OO6 A;  3W9V A;  5H8H A;  4LZ7 A;  2V3Q A;  3BFU A;  3M3F A;  4KXP A;  2V25 A;  3B6Q A;  1IEJ A;  2GHA A;  1R9Q A;  3L6H A;  3IOV A;  1OMP A;  2FNC A;  1ZIU A;  2HEU A;  2DE4 A;  4R75 A;  1A8F A;  1TXF A;  1VSO A;  1RDZ A;  3E4R A;  4U1O A;  4WXJ A;  2P0S A;  3O2A A;  3SES A;  3C9H A;  1FCK A;  1ZLQ A;  3CI8 A;  3N94 A;  3S9N C;  3F11 A;  1D9Y A;  4HE1 A;  4FE8 A;  1B6H A;  3CSG A;  2ONK E;  2LAO A;  3G3H A;  2HZK A;  5L9S A;  2YLN A;  1MPD A;  4N8G A;  3E78 A;  2DE2 A;  4PE3 A;  4U2R A;  5F1Q A;  1B0H A;  3QAX A;  4DCX A;  3H7M A;  4GFR A;  5M2V A;  1KA0 A;  1US5 A;  5ET6 A;  2X26 A;  3RYD A;  3JYR A;  1MRP A;  3MP6 A;  3HHF A;  2HCA A;  3D4G A;  3CIJ A;  4NF0 A;  4ESW A;  2WBB A;  1B5H A;  2OK2 A;  4WKM A;  1RYX A;  1OIB A;  5CBR A;  4OQO A;  2G93 A;  1MQG A;  2O84 X;  3OEK A;  4I3E A;  4POX A;  1HSJ A;  3SER A;  1MQI A;  1BP5 A;  4BDN A;  3D4C A;  4QFN A;  4UAC A;  2NUV A;  1VR5 A;  2KLF A;  4YKP A;  4BDR A;  2I49 A;  1NNF A;  2AL4 A;  1FPI A;  4YMA A;  5FTI A;  3VXC A;  1M5C A;  4GWZ A;  4I9D A;  3VLU A;  4X1B A;  2RC9 A;  1B3E A;  1US4 A;  1HSE A;  1Y1M A;  4XXU A;  2G29 A;  2A5T B;  4P1L A;  2O1L A;  1XVY A;  2REJ A;  2FVZ A;  2XWK A;  1AIV A;  1MPB A;  1EZP A;  3MYU A;  4QSC A;  4E0W A;  1UTH B;  2A5T A;  5AA3 A;  1NUW A;  2B4M A;  1DTZ A;  4EQB A;  1TFD A;  4O8M A;  2I6E A;  3PD9 A;  4Q8R A;  1MDQ A;  5ET5 A;  2Q89 A;  1MXX A;  1Q9D A;  5TPA B;  3NOH A;  3MVY A;  4QSD A;  1MS7 A;  1PDA A;  5H8N B;  1IUD A;  3G7W A;  4AS5 A;  4Q0C A;  4F2Q A;  2GRV A;  1G0I A;  1IXG A;  4OFO A;  3K6W A;  5A5X B;  3OSQ A;  2DS9 A;  3DEL B;  1FQF A;  2F6P A;  3WAE A;  5BWJ A;  1MXV A;  1MG1 A;  2D5W A;  3C32 A;  3TEP A;  4P0G A;  1R1N A;  4FEC A;  1SYI A;  2QJE A;  1FQC A;  4UAB A;  1UTH A;  5I2N B;  2GH9 A;  4HS7 A;  3MC2 A;  5ET7 A;  3PGF A;  2Y5K A;  3TAJ A;  4I8C A;  4IB2 A;  1MY1 A;  1USY H;  3FXR A;  3ROJ A;  1PEB A;  3O6G A;  1ATG A;  1JW1 A;  2H99 A;  3EHU A;  3PU5 A;  3IOR A;  4WEP A;  4QXD A;  4LN5 A;  1LBV A;  3CSB A;  4WED A;  4IY6 A;  3H6U A;  2A5S A;  1NV7 A;  3H03 A;  3TKD A;  1NNT A;  4F3P A;  4P47 A; 
#chains in the Genus database with same CATH homology
 3MZ1 A;  2F6G A;  2R6G E;  3ZKK A;  1ANF A;  3QIM A;  3SDF A;  4LQ2 A;  5ITP A;  2Q88 A;  4F19 A;  1URG A;  3M3L A;  3RLF E;  3RY3 A;  5CC2 A;  1MPC A;  1FQD A;  2XX9 A;  1JNF A;  2I3W A;  4FEB A;  2HZL A;  5I59 A;  3OSR A;  3W9W A;  1N3X A;  1OVB A;  4M1V A;  1QW0 A;  2BJJ X;  5H8Q B;  3S9L C;  3PUY E;  2DXR A;  2XXU A;  4GQO A;  1AMF A;  1N84 A;  2RF1 A;  3PPN A;  3IR1 A;  4OEU A;  4ONY A;  1EU8 A;  1TWY A;  3TTL A;  3KG2 A;  3SET A;  4Q30 B;  3K1P A;  1EZO A;  4FED A;  3GXA A;  3K6U A;  4FOR A;  4ZEC A;  1PC3 A;  3ECR A;  3HO7 A;  1A8E A;  3TMG A;  2QPQ A;  3IB1 A;  1Y4T A;  3QUF A;  2QS3 A;  3U72 A;  2H4I A;  1H43 A;  2AYS A;  2XXY A;  3K6V A;  1XVX A;  5HBC A;  1M5F A;  2AIX A;  4QFK A;  4FIM A;  1B05 A;  4R6H A;  5I59 B;  1Y3N A;  4LA9 A;  1N7W A;  3OEN A;  3K1M A;  3S9E A;  2XXQ A;  3K01 A;  1T0K A;  3MBP A;  3TCH A;  1N7X A;  4H8I A;  3SEV A;  2RC8 A;  1H76 A;  1FTM A;  3RGY A;  5DVJ A;  1A99 A;  4KYS A;  5CRY A;  1MQH A;  1I6Q A;  3R6U A;  4OWD A;  3T93 B;  2NOO A;  2DXY A;  3BKI B;  1PBP A;  3TTM A;  5IKB A;  3K2D A;  2UYF A;  4OES A;  2I58 A;  5FTH A;  2QS4 A;  4H5F A;  5I2K A;  2ALU A;  5DEX B;  1LAF E;  3ILU B;  1MY2 A;  4H0W A;  4QHQ A;  2PX1 A;  3TTK A;  3FXU A;  1P1N A;  4IY5 A;  4NF4 A;  2VP1 A;  2DWA A;  3OEM A;  4E0X A;  1LB9 A;  2RIN A;  3HPI A;  2ZXT A;  1P1W A;  4TOZ A;  2OZZ A;  2F34 A;  2XXP A;  1O63 A;  4Z7E A;  3PMW A;  4ND9 A;  5LOM A;  3CVG A;  3U93 A;  2VOZ A;  5TP9 B;  3O6I A;  4F1U A;  3C31 A;  4NF6 A;  5AA2 A;  3H6V A;  4ZEI A;  1SI0 A;  2IA4 A;  2RC7 A;  3KOS A;  3TQW A;  2OCU A;  1FTK A;  4OET A;  3T9H B;  1VFD A;  4M4G A;  1QUK A;  2D3I A;  1SW2 A;  3VVD A;  1NH7 A;  3H06 B;  4G4P A;  2O68 A;  3LC8 A;  3VFJ A;  1Y3P A;  4RXL A;  1J1N A;  1NFT A;  2V3T A;  1N0T A;  1PBQ A;  1Y1Z A;  2QS2 A;  4KPT A;  4R9F A;  4TLM B;  1B2H A;  4XTC Q;  3V89 B;  3SEY A;  2E1S A;  2ZYO A;  2YPN A;  3FXQ A;  4XKR A;  5I58 A;  3I3V A;  1MY0 A;  2F97 A;  1SVX B;  3FVK A;  4GF8 A;  3RQT A;  2ZNS A;  4KCC A;  4YU0 A;  5AA4 B;  3N6T A;  4AB5 A;  4BDM A;  4R6K A;  2HQ0 A;  3T9X B;  4OXV A;  2QRY A;  3T66 A;  1B5J A;  1WDN A;  5FHM A;  5JTY B;  3CR9 A;  1JVX A;  1SBP A;  2V84 A;  2FA7 A;  3U94 A;  4OER A;  5JK4 A;  2F35 A;  5FHN A;  3B6T A;  3U8Q A;  2ESN A;  3C36 A;  3MVX A;  4XIG Q;  1JEU A;  3M8U A;  3WAF A;  1B51 A;  1MQJ A;  2ONR A;  4GIZ A;  3ZSF A;  1DPP A;  3TUS A;  3S4U A;  3OO7 A;  1DMB A;  4EUO A;  3MPL A;  2VD3 A;  4ESX A;  2UVI A;  3GBB A;  4P11 A;  4KR5 A;  4OZ9 A;  3LSW A;  5KDT A;  1R6Z A;  1KWH A;  2VHA A;  3OO8 A;  3U1O A;  1JET A;  4JDF A;  3LR1 A;  2PT2 A;  4HCY A;  4PE5 B;  1H3D A;  1D9V A;  2ONS A;  4F1Y A;  2Z8E A;  1B32 A;  3DLN A;  3IOU A;  4I62 A;  3O29 A;  4OFJ A;  3V83 A;  2Z23 A;  3SEU A;  3TZA A;  2XXH A;  1FQA A;  1PB9 A;  2DP8 A;  2ABH A;  3IJO B;  2O7I A;  3LSX A;  4U21 A;  5TPA A;  3R7X A;  1IIT A;  3TTR A;  2DVZ A;  1SI1 A;  4ZZA A;  3OOA A;  1QUI A;  2Y7P A;  4GL0 A;  2Y84 A;  4POW A;  2DWH A;  1Q1K A;  3FJ7 A;  4NMY A;  5CBR A;  1S50 A;  4O3C A;  3PPO A;  3MW0 A;  4IO7 A;  3SEX A;  4R6Y A;  3K4U A;  4U23 A;  3TOD A;  5HPQ A;  5KZT A;  4F1V A;  1FTO A;  1SQY A;  3E9X A;  4ZEK A;  4R2F A;  4ECF A;  4GRK A;  4FAT A;  4MFI A;  3RUM A;  4NF8 A;  2ZYM A;  4FJP A;  1LB8 A;  2OBG A;  3C33 A;  3O6H A;  2F5X A;  1B7U A;  3DP4 A;  1BKA A;  3HST A;  1QKB A;  4IO6 A;  2DE3 A;  3G3J A;  2X7P A;  4ELO A;  4GXA A;  3EN3 A;  1XC1 A;  1B52 A;  2VGQ A;  4UA8 A;  1JEV A;  4LAT A;  1MH4 A;  3RNN A;  4BDL A;  4QFL A;  2O1M A;  3C34 A;  2Q2A A;  4DXU A;  2XX8 A;  4NE4 A;  3FVN A;  3Q27 A;  5IAI A;  3EHS A;  5AA4 A;  2ZNU A;  3U92 A;  4OHN A;  2PYY A;  4LUB A;  2V93 A;  5CMM A;  5CMK A;  3MZB A;  3HHG A;  4R73 A;  5K2X A;  1B0L A;  3MWB A;  4N6P A;  3K1N A;  1S9T A;  3G3K A;  2I4B A;  1R9L A;  4ISU A;  2DYX A;  4ZEF A;  1II5 A;  3A3C A;  3OEL A;  1YAE A;  3TTN A;  1NKX A;  3OXN A;  5I57 A;  3PUZ E;  3VE1 B;  1MM6 A;  3FJG A;  3TCF A;  3ZKL A;  1B9J A;  4BLA A;  2ANJ A;  1B7Z A;  2DVC A;  2Y7R A;  3GLB A;  3UK4 A;  4RJZ A;  3USD A;  3CRB A;  2RKM A;  3IOW A;  5DVF A;  3VVF A;  3VXB A;  3DP8 A;  4EF1 A;  1N3W A;  4H8J A;  5AE4 A;  1LFH A;  1GTK A;  2R71 A;  2RCB A;  2OWT A;  5I2N A;  3C35 A;  3UN6 A;  2Y7I A;  3QUJ A;  3N5L A;  2UVH A;  2AL5 A;  4PQJ A;  4QSE A;  4RK2 A;  5DT6 A;  3LBS A;  1P1U A;  2W7Y A;  1LGB C;  3KZG A;  4PFY A;  5ITO A;  2FYI A;  1Y3Q A;  1I6B A;  1ZBM A;  4X48 A;  4C1T A;  3KN3 A;  3VDF A;  2H98 A;  1DOT A;  5HM4 B;  3G3G A;  4G68 B;  4JB7 A;  4MH5 A;  1LFI A;  1TT1 A;  1XS5 A;  1B3H A;  1IXC A;  3EHT A;  1PB8 A;  1XHY A;  2O7U A;  4XKQ A;  1LBB A;  3CG3 A;  5A5X A;  3TFL A;  3MPK A;  4AQ4 A;  3MQ9 A;  1B58 A;  3FAS A;  3IX1 A;  2E0S A;  4R72 A;  1AH5 A;  5H8S A;  4DLD A;  1LFG A;  1LAX A;  3DP6 A;  4MF3 A;  1O7T A;  3KGC A;  1OLC A;  4KYD A;  5CI5 A;  3MP1 A;  2H5Y A;  4F39 A;  2CZL A;  2B3F A;  3TQL A;  2THI A;  1O64 A;  3KSX A;  4L17 A;  3G3I A;  3OO6 A;  3JV9 A;  4OTE A;  4U22 A;  3W9V A;  1IIW A;  5H8H A;  2GFE A;  4XKN A;  4LZ7 A;  2V3Q A;  2XXT A;  3BFU A;  4N13 A;  4NF8 B;  3M3F A;  4RYA A;  2V25 A;  3B6Q A;  1IEJ A;  2PVU A;  4H65 A;  2GHA A;  1R9Q A;  4RPN A;  3L6H A;  3IOV A;  1D4N A;  3L6G A;  4THI A;  2I0C A;  4H5G A;  1OMP A;  5L9M A;  4BDO A;  1B46 A;  2FNC A;  4P0I A;  5EHS A;  5FHO A;  1ZIU A;  1N04 A;  2HEU A;  2DE4 A;  3CFL A;  3KEI A;  4ZZE A;  3IAZ A;  1A54 A;  1DTG A;  4TQU Q;  4R75 A;  1SW4 A;  3VLW A;  3MZ9 A;  3K02 A;  3TEL A;  1A8F A;  1URS A;  3B6W A;  1NH8 A;  1M5B A;  1XOC A;  3B7D A;  3GBA A;  1QUL A;  4EXL A;  2I3V A;  1A7L A;  1BTJ A;  4JSD A;  4IGR A;  3E13 X;  4LZ8 A;  4YKK A;  3RT8 A;  3T9V A;  1TXF A;  1VSO A;  2HXW A;  3E4R A;  4R9G A;  4U1O A;  3UOR A;  1LST A;  4WXJ A;  3VVE A;  2P0S A;  3O2A A;  1LCT A;  3SES A;  4Z0I A;  3TCG A;  1NL5 A;  3ZS6 A;  1LBC A;  3C9H A;  3EPE A;  4MBP A;  1TFA A;  1FCK A;  1ZLQ A;  4QF9 A;  3CI8 A;  4RY1 A;  4MLV A;  3N94 A;  2DWI A;  3FGS A;  3KBR A;  3PUW E;  3S9N C;  1ELJ A;  4OVJ A;  1H44 A;  3F11 A;  1D9Y A;  2F78 A;  4ZS9 A;  3A09 A;  3IK6 B;  4FE8 A;  2I4C A;  4QFO A;  2XXW A;  1B6H A;  1JW4 A;  1UIU A;  1OQH A;  3CSG A;  4LP2 B;  3K6X A;  1B1X A;  2ONK E;  2LAO A;  4LZ5 A;  3G3H A;  4LQ5 A;  2NVU B;  2HZK A;  4YAH X;  5B70 A;  3IB2 A;  2H25 A;  1H45 A;  5L9S A;  4Q5T A;  4ELQ A;  2YLN A;  5KDT B;  4F2O A;  1MPD A;  1UTB B;  4PET A;  4G8M A;  5AA1 A;  4IO3 A;  1M5D A;  5ISU A;  4TLL B;  2DE2 A;  4EQ7 A;  4GVO A;  1ZU0 A;  3IL1 B;  1ZMG A;  2QL3 A;  2XD2 A;  3HCQ A;  3ONM A;  1L5T A;  4C1U A;  2XXR A;  2ZYN A;  4NF4 B;  2REG A;  4G8H A;  4U2R A;  4HTG A;  3K0V A;  1B0H A;  1B3G A;  3QAX A;  5ELV A;  3S2V A;  4DCX A;  1Y9U A;  3A3U A;  3H7M A;  3FZV A;  4K3F A;  1NNK A;  4GFR A;  1EZ9 A;  4KD5 A;  2GHB A;  4KYE A;  2F7C A;  5M2V A;  3RT6 B;  3VLV A;  2OLB A;  1US5 A;  3PMV A;  2X26 A;  1JW5 A;  4F29 A;  5AA2 B;  4NED A;  3JYR A;  1MRP A;  4KCD A;  4ZEB A;  4IGT A;  4R2B A;  3UA8 A;  1FQE A;  3C4M A;  3MP6 A;  1UTB A;  1EH3 A;  2ZNT A;  1FTJ A;  2PMS A;  3PMX A;  4U4X A;  3HHF A;  2HCA A;  2UVJ A;  3TYH A;  3KOT A;  4KHZ E;  3TDJ A;  4F3B A;  4ZED A;  2NWJ A;  3D4G A;  3OD7 A;  4LVQ A;  1B5I A;  4YZZ A;  3UGW A;  1A55 A;  1MDP 1;  1MY3 A;  3CIJ A;  3RTW B;  2V3U A;  3VV5 A;  1OQG A;  4ESW A;  1B5H A;  2QMX A;  1QVS A;  2B3B A;  4MLQ A;  1OLA A;  1B3F A;  3UIF A;  4PP0 A;  5K2Y A;  2OK2 A;  1QJM A;  4WKM A;  4EDP A;  5B7D A;  5CMC A;  3CG1 A;  2YJP A;  1RYX A;  3IO6 A;  1OIB A;  3FVG A;  3MVZ A;  2G93 A;  2XXX A;  4G2Z A;  4OQO A;  4IO2 A;  1POT A;  4RPO A;  3H4Z A;  2DQV A;  4NF5 B;  3H6T A;  1MQG A;  1URD A;  2O84 X;  5CBS A;  2DOJ A;  3OEK A;  5JTY A;  4POX A;  1ZJL A;  2Z8F A;  3MUQ A;  3MP8 A;  1YTV A;  1AL3 A;  1HSJ A;  1JVY A;  3LUY A;  2UYE A;  5I2K B;  1MQI A;  2OJT A;  2Y7W A;  3SER A;  3FV2 A;  1BP5 A;  1BIY A;  1HSL A;  1P1Q A;  5DTB A;  5L8D A;  3HV1 A;  3EF7 A;  4LON B;  3D4C A;  4QFN A;  4UAC A;  2NUV A;  4BDN A;  4YIC A;  3DM0 A;  1VR5 A;  3V5A A;  3FUZ A;  2KLF A;  4YKP A;  2F8D A;  2Y7K A;  3M3K A;  5H8Q A;  4GL8 A;  3KJ7 A;  2O6A A;  2I49 A;  4PFT A;  3RTF B;  1A40 A;  4BDR A;  5EHM A;  1NNF A;  2AL4 A;  2F7B A;  3SEW A;  3JZJ A;  3EQ1 A;  5AA2 D;  5ICQ A;  4OEN A;  1UQW A;  4YMA A;  5FTI A;  3VXC A;  4EXK A;  1B7H A;  1CB6 A;  1I69 A;  1OVT A;  2Z8D A;  3O66 A;  4KFQ A;  1M5C A;  1LLS A;  1YCJ A;  4HW8 A;  2F36 A;  1POY 1;  2UVG A;  1SYH A;  4I9D A;  4X1B A;  3VLU A;  3Q29 A;  1SD3 A;  2RC9 A;  1B3E A;  4H6D A;  4YKJ A;  4R74 A;  2Q9T A;  1US4 A;  4JXI A;  5I58 B;  2Z22 A;  3FV1 A;  5F7V A;  3V8X B;  4N07 A;  1HSE A;  5F1Q A;  1Y1M A;  4G68 C;  2R9J A;  3PUV E;  4XXU A;  2B65 A;  4YKI A;  4ELR A;  3KSJ A;  1GGG A;  1XT8 A;  2G29 A;  1AOV A;  2A5T B;  3R26 A;  3QK6 A;  2DSF A;  4NTL A;  3THI A;  3Q25 A;  5BUU A;  3QSL A;  4OFL A;  4OMB A;  2O1L A;  1UIV A;  1B1H A;  4XKP A;  3PPP A;  1SW1 A;  1XVY A;  3AXF A;  2P1S A;  3RN8 A;  3S9M C;  2REJ A;  3E3K A;  4GOT A;  1Y20 A;  2O51 A;  4OYV A;  4RNS A;  2QMW A;  3G3F A;  3IO4 A;  4DZ1 A;  5KCJ A;  1MPB A;  1AIV A;  3FVO A;  3MVW A;  3LSF B;  1RYO A;  5DEX A;  4H1X A;  1FQB A;  1EZP A;  2Q8J A;  3IJX B;  1DPE A;  4QSC A;  4QRZ A;  1N76 A;  4E0W A;  3BBR A;  4DXB A;  4ZDM A;  1UTH B;  1ZTY A;  4GXS B;  1S7Y A;  3MJN A;  2A5T A;  1B4H A;  4IO5 A;  5AA3 A;  5DVI A;  4O3B A;  2UXA A;  4NWC A;  1MXY A;  4NF6 B;  4RK9 A;  5H8F A;  2RCA A;  5H8H B;  3QYT A;  1DTZ A;  4EQB A;  1TFD A;  3IB0 A;  2I6E A;  2IEE A;  3PD9 A;  4Q8R A;  1PB7 A;  1MDQ A;  4JWX A;  3OMB A;  4JSO A;  4ELP A;  2DWJ A;  4O3A A;  1BLF A;  2Q89 A;  1P99 A;  1MXX A;  1NNP A;  3KFM A;  5TPA B;  2D21 A;  2PBW A;  2VD2 A;  3MVY A;  1GR2 A;  2HFB A;  2OWS A;  2QSX A;  2ZYK A;  4QSD A;  5DYH A;  3ODB A;  3TPA A;  4JBZ A;  4F31 B;  3I5O A;  1MS7 A;  1PDA A;  5H8N B;  3H3G A;  1IUD A;  2X7Q A;  3G7W A;  4H67 A;  4KI0 E;  2H9B A;  2QS1 A;  4Q0C A;  3UP9 A;  4F2Q A;  2GRV A;  3PUX E;  2XXI A;  1IXG A;  4OFO A;  2M8C A;  1MXW A;  4G77 A;  3K6W A;  4OEV A;  3FIR A;  4PFU A;  4JWO A;  1SDX A;  5A5X B;  2CMO A;  1MM7 A;  2XX7 A;  2XHD A;  2XD3 A;  3OSQ A;  3T22 A;  4C0R A;  2DS9 A;  3DEL B;  1GV8 A;  3KN8 A;  1FQF A;  5H8F B;  4DE8 A;  1M5E A;  4I1D A;  4YB5 A;  4DXC A;  4EF2 A;  4F22 A;  4F3G A;  1IQ7 A;  1VE4 A;  2F6P A;  1VFE A;  3BFT A;  4GD5 A;  1MXV A;  3FD3 A;  4KQP A;  3CFX A;  3WAE A;  3GZG A;  5BWJ A;  3K00 A;  1MG1 A;  1Y4C A;  2D5W A;  1Z7M E;  2HAV A;  4QFP A;  1QUJ A;  4X9T A;  2PT1 A;  3OO9 A;  5L9O A;  3C32 A;  1MH3 A;  4DCY A;  1IZ1 A;  3TEP A;  4ZE8 A;  3PD8 A;  4P0G A;  4IO4 A;  5EYF A;  5KCJ B;  4GWO A;  1R1N A;  3IOT A;  4FEC A;  2WKY A;  4DDD A;  1SYI A;  1B4Z A;  5I57 B;  2I0B A;  2O69 A;  2QJE A;  1LAG E;  3P7I A;  4U4S A;  4YB6 A;  3RPW A;  3FAT A;  1Z7N E;  1JQF A;  1NMU A;  3KN7 A;  5J1D A;  3LSL A;  1CE2 A;  2NXO A;  1FQC A;  3I6V A;  1I6A A;  2ZMB A;  1UTH A;  3PPR A;  5CMB A;  5TU0 A;  5I2N B;  3PV0 E;  3MAM A;  1MQD A;  4JWY A;  2GH9 A;  1MXZ A;  1MY4 A;  3HN0 A;  2F7A A;  3MC2 A;  3O97 A;  4HS7 A;  1IXI A;  1B3L A;  3O9P A;  1RKM A;  3KJT A;  3PGF A;  1LAH E;  3TAJ A;  4RA1 A;  4IB2 A;  4I8C A;  1MY1 A;  1WVJ A;  1USY H;  1LCF A;  1YPN A;  3FXR A;  4G68 A;  4X1D A;  4YB7 A;  3T9U A;  3Q28 A;  4BDQ A;  4EQ9 A;  5I56 B;  5ICT A;  1PEB A;  4GLI A;  3O6G A;  1D3K A;  1ATG A;  4HCW A;  1FTL A;  3H6W A;  4G8N A;  4NWD A;  1JW1 A;  5JEI A;  2H99 A;  3SKP A;  4F3S A;  2XXV A;  3CFZ A;  2Q2C A;  3EHU A;  1IXH A;  3N6U A;  4PFW A;  3PPQ A;  2HAU A;  3PU5 A;  3O28 A;  1GVC A;  4YMB A;  3Q26 A;  5H8N A;  1ZKB A;  3IOR A;  4WEP A;  3T96 B;  3QXM A;  2P2A A;  3CSB A;  3ILT B;  5CM6 A;  4DIG A;  1QKA A;  1P1O A;  4WED A;  4F18 A;  4FAJ A;  2I48 A;  1USY E;  1MXU A;  1SW5 A;  3N26 A;  4IY6 A;  3H6U A;  2A5S A;  3W15 C;  1DSN A;  4AB6 A;  5I84 A;  4U1Z A;  3H03 A;  3TKD A;  1NNT A;  4ZE9 A;  5I56 A;  1WOD A;  3FJM A;  1F9B A;  5TP9 A;  4NF5 A;  4F3P A;  1FW0 A;  1B40 A;  1Q35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...