4BDMA

Crystal structure of the gluk2 k531a lbd dimer in complex with kainate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
248
structure length
246
Chain Sequence
SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSAPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
publication title Correlating Efficacy and Desensitization with Gluk2 Ligand-Binding Domain Movements.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport
total genus 81
structure length 246
sequence length 248
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdmA02
4F22A 3IOVA 4MLVA 3CVGA 1XS5A 3MVZA 4I9DA 3RGYA 3ODBA 2CMOA 1DPPA 1FQAA 3CI8A 3PMWA 1WDNA 1MXZA 3U93A 5JK4A 3PPQA 3UIFA 3UORA 3K6XA 2DXYA 1FQBA 4ECFA 1P1OA 1M5CA 1HSLA 4MBPA 3OOAA 4GF8A 1NKXA 1SW2A 2Z8FA 2ALUA 2PVUA 1ZBMA 4KI0E 4RA1A 3K2DA 4E0XA 3Q25A 4ZEFA 4DIGA 3C36A 4JWOA 4RJZA 4QF9A 4YAHX 1JETA 4G4PA 2UVJA 1Y20A 1Y1MA 3ZS6A 1H44A 1AH5A 2F97A 3MC2A 4FE8A 3MW0A 3Q28A 3RY3A 2RKMA 3T66A 1LB9A 1OIBA 3LSXA 3T9HB 4BDMA 3C4MA 4NTLA 5H8QB 1QUKA 2REJA 1MH3A 3IB1A 5L9SA 3FV1A 3FZVA 3MPLA 4I1DA 1POY1 3G3FA 3HO7A 4FEBA 2Q88A 5I57A 5DYHA 1LBCA 3OELA 3PUZE 1JVXA 1AL3A 2PX1A 3LR1A 3QYTA 5K2XA 3TTRA 2D21A 1JNFA 1USYH 4R73A 4PFYA 4RPOA 4AQ4A 4XIGQ 1R9QA 1I6QA 3PUVE 3TFLA 4OENA 4FATA 1S9TA 2YJPA 3UA8A 1SI1A 3FVGA 1N0TA 3PPRA 1ANFA 1B58A 1B52A 1P1NA 3A09A 4ZE9A 2DXRA 4IGTA 1N3WA 4C1UA 4I62A 1NNKA 3KSJA 3RPWA 5L9OA 3LBSA 2O1LA 1FW0A 2DS9A 4TLMB 5IAIA 2H4IA 3IL1B 3OO9A 3BBRA 3U92A 2BJJX 2DE3A 4GL0A 4OTEA 2NUVA 4G2ZA 2QMXA 1A7LA 3MPKA 3K6VA 1MXYA 4ZE8A 4QFOA 2F7BA 2QMWA 3IOUA 2OK2A 1ZTYA 2O1MA 5FTIA 2Z22A 5AA2D 5H8QA 1YTVA 4R74A 4N07A 1B7UA 1MM7A 1Y3NA 4F3BA 4I8CA 4DLDA 5A5XB 3PUWE 4UA8A 5KDTB 5H8HB 4IO2A 2VOZA 4IO7A 1RYOA 5TPAA 4F29A 4XXUA 2YLNA 2YPNA 3IO4A 4X1BA 2Y7RA 1QULA 4ELPA 3W9WA 3IX1A 4C1TA 1B1HA 1URGA 3RT6B 2D3IA 4P11A 3LSLA 2GHAA 3K4UA 3CG1A 3I3VA 2O69A 4WXJA 3QSLA 3DP6A 3K6UA 4QSEA 4DZ1A 1DTZA 4LVQA 4DCXA 3FUZA 1AIVA 4HS7A 3A3UA 3FXRA 4LZ7A 3DM0A 1H3DA 4LZ8A 1WODA 5DVFA 2NXOA 3FD3A 1GGGA 1NNPA 3RTFB 2I58A 3P7IA 2B3FA 1CE2A 1S7YA 1TFAA 2V3QA 4G68B 4G68C 4QFLA 4F3GA 3VXCA 5ITPA 3R26A 2XXIA 3USDA 1FTKA 4OEVA 2XXRA 4OFJA 3ECRA 5I58B 3BKIB 3C35A 4RPNA 2ZNTA 1SVXB 1VFDA 1O63A 1B05A 4ONYA 3PD9A 1B51A 4THIA 3T9UA 2XXXA 3HSTA 1NFTA 1DTGA 3O28A 3TCGA 5B70A 1MY2A 4ZS9A 4IO4A 3GZGA 3EHUA 4H8JA 3N5LA 1M5EA 1MQIA 2V93A 5A5XA 1A99A 1B3FA 2VD3A 1US4A 4IGRA 2OCUA 5KDTA 5H8HA 5JEIA 3D4GA 2DQVA 3G7WA 1IXCA 1N76A 1SBPA 1H76A 2F8DA 3MQ9A 4YMBA 4LQ5A 2PT1A 3B6QA 2O6AA 1ZIUA 3MVXA 4GQOA 1IUDA 4F3PA 2G93A 3K02A 3G3GA 1MY1A 4OETA 3FVNA 4NF5B 1EH3A 3E4RA 5DVIA 2M8CA 5FHMA 5L9MA 3THIA 3JYRA 4OQOA 5H8NA 2PYYA 3KEIA 3TTMA 3SEWA 2IA4A 3DP4A 4Q8RA 3KN3A 2XXHA 4XKPA 2DYXA 3OSQA 3S9EA 1TT1A 2HZKA 4MF3A 2DVCA 3KJ7A 3MP8A 3O2AA 3T22A 2ONKE 3TPAA 3FV2A 2QL3A 3A3CA 1O7TA 3I6VA 4G68A 1P1QA 1PEBA 2O51A 3TUSA 1MDP1 1LB8A 5ISUA 1N3XA 2X26A 4F19A 3L6HA 4OZ9A 5CI5A 5I58A 1LGBC 1QKBA 1XC1A 4RYAA 4GOTA 1MY3A 4FORA 4H65A 2Q2CA 3C33A 3GBBA 2P1SA 4KYEA 3C9HA 2P0SA 1SW5A 3SERA 3ZKKA 4QRZA 4Q30B 4PFTA 2ONRA 1H45A 5LOMA 1NNFA 4ZEDA 2Y7PA 1J1NA 3IOTA 3B6WA 4LONB 3PV0E 3IAZA 4E0WA 3IORA 2RF1A 3VLWA 5CC2A 1FCKA 3KOTA 2DVZA 2ZYOA 3SEUA 1LLSA 3K1MA 3UK4A 4IO6A 3EPEA 1Y1ZA 4NF5A 3OO7A 2QSXA 4GFRA 3I5OA 3B7DA 3D4CA 1UTBB 1BP5A 1LAXA 2XX7A 3O97A 1SI0A 3RNNA 4O3CA 2F34A 3CFXA 4BDNA 3HV1A 4X1DA 2UVHA 4DXCA 2P2AA 2VD2A 2LAOA 1B46A 4BDOA 3KGCA 3N94A 3T93B 1N04A 1MQDA 1Y3QA 4YKKA 2ANJA 2V84A 1TFDA 2HQ0A 2ZYMA 4M1VA 4GLIA 4ZEIA 4H67A 3DLNA 4OMBA 2R6GE 4EF1A 4U22A 4G8HA 2AL5A 1IEJA 1Y4TA 3V89B 4ZZAA 5J1DA 3QUJA 4IY6A 3G3HA 1QUJA 3W9VA 4NEDA 4FAJA 3KJTA 2XXYA 4TLLB 4NE4A 3IOWA 3KFMA 3MUQA 4IY5A 2F36A 3MP1A 3EHSA 3VLVA 2QPQA 2XX9A 1B7ZA 4XKQA 1B4ZA 1OMPA 3KZGA 3WAFA 1HSJA 4NF4B 2F78A 4BLAA 1UTHB 2OLBA 3M3KA 1B4HA 2GRVA 2DWHA 3KSXA 1OQHA 2AIXA 3ZSFA 1LFIA 1JW5A 1JEUA 4DXUA 5CM6A 4GXSB 2I3WA 2E0SA 4MH5A 3MBPA 2RC8A 2DWIA 2DOJA 4EDPA 1N7WA 4ZZEA 5I2KB 4LA9A 3N6UA 3TAJA 1FQCA 1MDQA 4OFOA 5CMMA 5H8SA 2I0BA 3CFZA 4Z0IA 4QFPA 3CR9A 3TQWA 2D5WA 3K01A 3MVYA 2UXAA 1YCJA 1MXVA 3OMBA 1UIUA 4XKNA 3Q29A 3MZBA 4RXLA 1XT8A 4OXVA 2F7CA 4N6PA 4NF8B 2FNCA 4ZDMA 1BLFA 1P99A 3LC8A 3IB2A 5KCJB 3RT8A 1LAHE 2QS3A 1POTA 4FECA 5F7VA 4LATA 1LFGA 2ZYKA 2UVGA 1A40A 4Z7EA 4YB7A 5M2VA 3VVEA 2KLFA 3U1OA 4OHNA 1EZPA 4PQJA 2PBWA 4NWCA 2Y7IA 1UIVA 1WVJA 1D9VA 1BTJA 3H6WA 3RUMA 4R6KA 1B5HA 2Q9TA 4WKMA 4JB7A 1B6HA 3PMVA 1MY4A 1LCFA 4X48A 4R9FA 4M4GA 5DVJA 4LP2B 4NF4A 1UTHA 1MQHA 4EQ9A 2XXWA 3G3IA 2UYFA 2OJTA 2ZXTA 1A8FA 4LZ5A 4GWOA 4GIZA 1H43A 3C31A 1IXGA 3ILUB 3QAXA 4POWA 4ISUA 5CBSA 4QSDA 3SEVA 1MG1A 3M3FA 2XX8A 2WKYA 4GL8A 4U2RA 5I2KA 3MZ1A 2B65A 1ZU0A 2QJEA 1Z7NE 2ONSA 4MLQA 5TP9B 3UGWA 4F2QA 2H5YA 2Z8DA 3PMXA 3FATA 5ELVA 1PBPA 3RN8A 3VXBA 4H1XA 3S4UA 4TQUQ 1M5DA 5HBCA 1LFHA 4BDQA 5EHMA 2XXQA 4WEDA 4NF8A 3VE1B 2VGQA 4U4XA 2OWSA 3HCQA 5KCJA 3FGSA 3V83A 3S2VA 3RTWB 4GRKA 1FTLA 2I4CA 3K1NA 3VVDA 1Z7ME 4LUBA 4G8NA 4F18A 3WAEA 1FTMA 1SDXA 5L8DA 4ELOA 4KCCA 4P0IA 1D4NA 4BDLA 4UACA 2QS4A 1LCTA 3CSGA 3GXAA 2XD3A 5I59B 3RLFE 4EXLA 1S50A 2F7AA 2RINA 4FEDA 3QK6A 3OD7A 2I48A 1HSEA 4C0RA 3EN3A 3UP9A 1D9YA 1FQFA 4R6HA 1MQJA 3PPPA 2DSFA 3U72A 3VLUA 1MRPA 4OERA 2PMSA 2VHAA 2DP8A 1BKAA 5I2NB 3H06B 3HN0A 2XD2A 2V3TA 4K3FA 4ZEKA 3TTKA 2HZLA 1JEVA 4JSDA 4OEUA 3VDFA 3MP6A 5CMBA 4R2FA 3VVFA 1FQEA 4XKRA 1B3GA 1NNTA 4U1OA 3IB0A 3H3GA 2F35A 5TP9A 3TEPA 3LSWA 2Y7KA 1MH4A 4HCWA 3MVWA 4JBZA 4ND9A 1MXXA 3CSBA 3O66A 1A8EA 3PGFA 4TOZA 4KCDA 5DEXB 1R9LA 1QJMA 5DT6A 4F1VA 5F1QA 3IK6B 4LQ2A 1OLCA 2HCAA 4IO3A 1SQYA 1QW0A 4FJPA 5B7DA 1CB6A 1USYE 3TCFA 3T96B 3IR1A 1MQGA 3H6VA 1LBBA 2H25A 2HEUA 3CG3A 3O9PA 1NH7A 2ESNA 3LUYA 4YKJA 2GHBA 1B0HA 4IO5A 2ZNUA 3HPIA 3O6IA 1XVXA 3C34A 3K1PA 1B9JA 2DE4A 1GTKA 1AMFA 1DPEA 2X7QA 3JV9A 5CRYA 4GD5A 3R7XA 3E9XA 5I2NA 4EXKA 2UYEA 5JTYB 1IIWA 4NWDA 4POXA 3FXQA 5BUUA 4ESWA 5AA4B 3EQ1A 1B3HA 3ILTB 3MZ9A 4YKPA 2ZNSA 2AL4A 4YU0A 1DMBA 5KZTA 2B3BA 1XHYA 2R71A 3FJGA 4H5FA 1VE4A 4NMYA 1SW1A 3U8QA 2NVUB 2NOOA 4PFWA 1Y3PA 4HTGA 4GVOA 3SDFA 4YMAA 1A55A 4ESXA 2A5TB 2W7YA 2XXTA 3MAMA 3M3LA 1P1WA 3T9XB 3H4ZA 3OSRA 4F3SA 5DEXA 3OENA 2X7PA 5EHSA 1TXFA 3SESA 4KYSA 4H6DA 3O29A 3H6UA 1VSOA 3TELA 3RQTA 4R6YA 2ZYNA 1OVBA 5EYFA 3K6WA 2RCBA 4P0GA 1A54A 2OZZA 3HHFA 1LSTA 1URSA 1DSNA 1IXIA 3SEXA 4HCYA 2O7IA 4F1YA 4ZECA 3C32A 4KHZE 4XTCQ 3EF7A 4JWYA 4OVJA 1YAEA 5AE4A 1II5A 4DCYA 4PP0A 5AA2B 1MPCA 3KG2A 4ZEBA 5CMCA 1SD3A 3S9NC 3PPOA 4OESA 4KYDA 1NH8A 1US5A 4NF6B 1R6ZA 3TYHA 1B5JA 5CBRA 3PD8A 3DP8A 1Q1KA 4H0WA 1B1XA 1B40A 1D3KA 2DE2A 3FXUA 5ICTA 2Q89A 2I3VA 5JTYA 1NMUA 4H8IA 5HPQA 3T9VA 3HHGA 4YICA 4ELRA 3GBAA 1M5BA 2GH9A 5AA4A 1N7XA 1TWYA 1SYHA 2RCAA 3DELB 2O68A 2XXVA 3TTNA 2THIA 3G3KA 4EQ7A 4RK2A 1UTBA 5TPAB 1PBQA 4YB6A 4DXBA 1B2HA 4DE8A 1R1NA 2A5TA 4H5GA 2Z8EA 4F39A 1B5IA 4F1UA 3K00A 3KOSA 4FIMA 2OBGA 1L5TA 3O6HA 4DDDA 3K0VA 2RC7A 3FJ7A 2NWJA 4U21A 1BIYA 4JXIA 5H8FB 2F6PA 4EUOA 3QIMA 4WEPA 3R6UA 1EZ9A 3IJOB 4QFKA 1I69A 1GV8A 4O3BA 3V5AA 3O6GA 2F5XA 1NL5A 3N6TA 4R9GA 2QS2A 1M5FA 2FA7A 2Y7WA 1I6AA 5AA2A 1FQDA 4PE5B 1F9BA 3UN6A 4NF6A 1PB9A 3OXNA 3TDJA 1URDA 1ELJA 5TU0A 1B0LA 4R75A 1ZJLA 1MY0A 5IKBA 4YKIA 3VV5A 1SW4A 1OLAA 1MXUA 4RNSA 4L17A 4YB5A 2ABHA 5DTBA 3OO6A 4EQBA 2Q2AA 1FTJA 5AA3A 3TODA 2VP1A 4O3AA 4QFNA 3FIRA 2H99A 4HW8A 3IJXB 4X9TA 2I6EA 3CRBA 3V8XB 3S9MC 4Q5TA 3MWBA 4BDRA 3TQLA 3H6TA 1ZLQA 1Q35A 3ONMA 1I6BA 5H8NB 4R2BA 1MXWA 4RY1A 4OFLA 4YZZA 5H8FA 3L6GA 2G29A 1JW4A 1AOVA 1IITA 3N26A 1UQWA 4F2OA 1N84A 3TTLA 5FHOA 2XXPA 2I49A 4KFQA 2R9JA 1LAFE 3LSFB 2F6GA 2A5SA 2Z23A 1Y4CA 3BFTA 4F31B 1B3LA 3CFLA 3TKDA 2IEEA 5I56B 1MPBA 4OWDA 2GFEA 1QUIA 1FTOA 2HAVA 1XOCA 4PETA 1EZOA 4JSOA 4AB6A 4G8MA 1PDAA 1Y9UA 1O64A 5K2YA 1LAGE 3IO6A 2XHDA 5FTHA 2I0CA 2V25A 3TZAA 1B32A 1B7HA 4OYVA 3PU5A 2CZLA 4U1ZA 3GLBA 3PPNA 3Q26A 3TMGA 1YPNA 3ZKLA 4EF2A 4G77A 2UVIA 2QS1A 1ZKBA 1JW1A 1PB8A 1PB7A 3MJNA 2H98A 4JDFA 4ELQA 4QSCA 3EHTA 3G3JA 5ITOA 3E3KA 3SETA 5AA1A 1T0KA 1KWHA 5HM4B 3FJMA 3FVOA 5CMKA 2AYSA 4KPTA 1VR5A 1GR2A 3KBRA 1GVCA 4KQPA 1JVYA 4QHQA 1OVTA 3VFJA 2REGA 5ICQA 4MFIA 2HAUA 3PUXE 4U23A 2E1SA 4N13A 1QKAA 1IXHA 4KD5A 2V3UA 2Y84A 3H7MA 3JZJA 1SYIA 3W15C 3F11A 3S9LC 1IZ1A 1MM6A 1VFEA 3QUFA 2XXUA 5I59A 3CIJA 1B3EA 5I56A 2DWJA 3H03A 4KR5A 3BFUA 3Q27A 3M8UA 3QXMA 2O7UA 4Q0CA 3FASA 1EU8A 3OEMA 3SEYA 2QRYA 2DWAA 1P1UA 1DOTA 2I4BA 5FHNA 2HXWA 3AXFA 3B6TA 4AB5A 4RK9A 3KN7A 2O84X 3FVKA 2H9BA 1MPDA 3KN8A 4JWXA 5I84A 1MS7A 1XVYA 2HFBA 1ZMGA 1RKMA 1ATGA 1OQGA 4PFUA 4GXAA 2OWTA 2PT2A 3SKPA 4R72A 2Q8JA 5I57B 3TCHA 2ZMBA 3E13X 3OO8A 2RC9A 1QVSA 3U94A 1IQ7A 4U4SA 3OEKA 1JQFA 4IB2A 3PUYE 2FYIA 5BWJA 1RYXA 1PC3A
chains in the Genus database with same CATH superfamily
4F22A 3IOVA 4MLVA 3CVGA 4N8GA 1XS5A 3MVZA 4I9DA 3RYDA 3RGYA 3ODBA 2CMOA 1DPPA 1FQAA 3CI8A 3PMWA 1WDNA 1MXZA 3U93A 5IZZA 5JK4A 1VDWA 3PPQA 1FBFA 3UIFA 3UORA 3K6XA 2DXYA 1FQBA 4ECFA 1P1OA 1M5CA 1HSLA 4MBPA 3OOAA 4GF8A 1NKXA 1SW2A 2Z8FA 2ALUA 2PVUA 1ZBMA 4KI0E 4RA1A 3KBZA 3K2DA 4GX3A 5ET6A 4NX1A 3Q25A 4E0XA 4ZEFA 4DIGA 3C36A 4JWOA 4RJZA 4QF9A 4YAHX 1JETA 4G4PA 2UVJA 1Y20A 1Y1MA 3ZS6A 1H44A 1KA0A 5IZ3B 2DDKA 1AH5A 2F97A 3MC2A 4FE8A 3MW0A 3Q28A 3RY3A 2RKMA 3T66A 1LB9A 1OIBA 1FPFA 3LSXA 3T9HB 4BDMA 4GX6A 3C4MA 2HXRA 4NTLA 2ZZVA 5H8QB 1QUKA 2REJA 1MH3A 3IB1A 5L9SA 3FV1A 3FZVA 3MPLA 4I1DA 4XF5A 1POY1 3G3FA 5FBPA 3HO7A 4FEBA 2Q88A 5I57A 5DYHA 1LBCA 5IM2A 1FPEA 3T0JA 3OELA 3PUZE 1JVXA 1AL3A 2PX1A 5IZ1A 3LR1A 3QYTA 1NV6A 5K2XA 3TTRA 2D21A 1JNFA 4OVRA 1USYH 1DK4A 4R73A 1FBPA 4PFYA 4RPOA 2CEXA 1NI9A 4AQ4A 4XIGQ 1R9QA 1I6QA 3PUVE 3TFLA 4X8RA 4OENA 4FATA 1S9TA 2YJPA 3UA8A 1SI1A 3FVGA 1N0TA 3PPRA 1ANFA 5I7IA 1B58A 1B52A 1P1NA 3A09A 4ZE9A 4X04A 2DXRA 4IGTA 1N3WA 4C1UA 4I62A 4PE3A 1NNKA 3KSJA 3RPWA 5L9OA 3LBSA 2O1LA 1FW0A 2DS9A 4TLMB 5IAIA 2H4IA 4N6DA 3IL1B 2WBDA 3OO9A 3BBRA 3U92A 2BJJX 4OVSA 2DE3A 5IZ3A 4GL0A 4OTEA 2NUVA 4G2ZA 2QMXA 1A7LA 3MPKA 3K6VA 1MXYA 4ZE8A 4QFOA 2F7BA 4O8MA 2QMWA 2CEYA 1FJ6A 3IOUA 2OK2A 1ZTYA 2O1MA 5FTIA 5LDZA 2Z22A 4PCDA 1SPIA 5AA2D 2PCRA 5H8QA 1YTVA 4R74A 4N07A 1B7UA 1MM7A 1Y3NA 2Q74A 4F3BA 4I8CA 4DLDA 5A5XB 3PUWE 3QMFA 4UA8A 5KDTB 5H8HB 1FBHA 3E78A 4IO2A 2VOZA 4IO7A 4P47A 1RYOA 5TPAA 4F29A 4XXUA 2YLNA 2YPNA 3IO4A 4X1BA 2Y7RA 4UABA 1QULA 4ELPA 3W9WA 3IX1A 4C1TA 1B1HA 2XA5A 1URGA 3RT6B 2D3IA 4P11A 5I3SA 3LSLA 2GHAA 3K4UA 3CG1A 3I3VA 2O69A 4WXJA 3QSLA 2GQ1A 3DP6A 3K6UA 4QSEA 3NOHA 4DZ1A 1DTZA 4MNIA 4LVQA 2Y5LA 1FBEA 4G61A 4MNCA 4DCXA 3FUZA 4I3EA 1RDZA 4HE0A 4HS7A 1AIVA 3B50A 4PBHA 3A3UA 3FXRA 4LZ7A 3DM0A 1H3DA 4LZ8A 1WODA 2CZKA 5DVFA 4N17A 2NXOA 3FD3A 1LBYA 1GGGA 1NNPA 3RTFB 3E79A 2I58A 3P7IA 2B3FA 4H45A 1FPBA 1FPIA 1CE2A 1S7YA 1TFAA 2V3QA 4G68B 4JVDA 4G68C 4QFLA 4F3GA 3VXCA 5ITPA 3R26A 2XXIA 3USDA 1FTKA 4OEVA 2XXRA 2XWKA 4OFJA 3FBPA 3ECRA 5I58B 3BKIB 3C35A 4RPNA 2ZNTA 1SVXB 1VFDA 1O63A 1B05A 4ONYA 3PD9A 1B51A 4THIA 4KXPA 3T9UA 2XXXA 1G0HA 3HSTA 1NFTA 1DTGA 3O28A 4FBPA 3TCGA 5B70A 1MY2A 4ZS9A 4IO4A 3GZGA 3EHUA 4H8JA 3N5LA 1M5EA 1MQIA 2V93A 5A5XA 1A99A 1B3FA 2VD3A 1US4A 4IGRA 2OCUA 5KDTA 5H8HA 5JEIA 1DCUA 3D4GA 2DQVA 3G7WA 1N76A 1IXCA 1KZ8A 1SBPA 1H76A 2F8DA 3MQ9A 4OVQA 4YMBA 4LQ5A 2PT1A 3B6QA 2O6AA 1LBVA 1ZIUA 3MVXA 4GQOA 1IUDA 4F3PA 2G93A 3K02A 3G3GA 1QGXA 1MY1A 4OETA 3FVNA 4NF5B 1EH3A 3E4RA 5DVIA 2M8CA 2F3DA 5FHMA 5L9MA 3THIA 3JYRA 4OQOA 1NUXA 5H8NA 2PYYA 3KEIA 3TTMA 1NV1A 3SEWA 2IA4A 4PF8A 3DP4A 4HXVA 4Q8RA 3KN3A 2XXHA 4XKPA 2DYXA 3OSQA 3S9EA 1TT1A 2HZKA 4MF3A 2DVCA 3KJ7A 1YYZA 3MP8A 1NUYA 3O2AA 2ONKE 3T22A 3TPAA 3FV2A 2QL3A 3EKIA 3A3CA 1O7TA 3I6VA 4G68A 1P1QA 1PEBA 2O51A 3TUSA 1MDP1 1LB8A 5ISUA 1N3XA 2X26A 4F19A 2ZZXA 3L6HA 2KQZA 4OZ9A 5CI5A 5I58A 1LGBC 1QKBA 1XC1A 4RYAA 4GOTA 1MY3A 4FORA 4H65A 1FBCA 2Q2CA 3C33A 3GBBA 2VT5A 2P1SA 1K9ZA 4KYEA 3C9HA 2P0SA 1SW5A 3SERA 3ZKKA 4QRZA 4Q30B 4PFTA 1IMAA 2ONRA 1H45A 5LOMA 4OA4A 1NNFA 3D1RA 2Y7PA 1J1NA 4ZEDA 3IOTA 4GWWA 4MMPA 3B6WA 4LONB 3PV0E 3IAZA 4E0WA 3IORA 2RF1A 3VLWA 5CC2A 4PDDA 1FCKA 3KOTA 2DVZA 2ZYOA 3SEUA 1LLSA 3K1MA 3UK4A 4IO6A 3EPEA 1Y1ZA 2WYKA 4GWSA 5ET7A 4NF5A 4MCOA 3OO7A 2QSXA 4GFRA 3I5OA 3B7DA 3D4CA 1UTBB 5A5LA 1BP5A 5I5PA 1LAXA 2XX7A 4PTKA 3O97A 1SI0A 3RNNA 2R8TA 4O3CA 2F34A 3T1BA 3CFXA 4BDNA 3HV1A 4X1DA 2UVHA 4DXCA 2P2AA 1AWBA 2VD2A 4PGPA 1LEVA 2LAOA 1B46A 4BDOA 1D9QA 3KGCA 3N94A 3T93B 1N04A 1FPLA 1MQDA 1Y3QA 4YKKA 2ANJA 2V84A 1TFDA 2HQ0A 2ZYMA 4M1VA 4GLIA 4ZEIA 2FIXA 4H67A 3DLNA 4OMBA 1LBWA 2R6GE 4EF1A 4U22A 4G8HA 2AL5A 1IMBA 1IEJA 1NV3A 1Y4TA 3V89B 4ZZAA 5J1DA 3QUJA 4IY6A 3G3HA 1QUJA 3W9VA 4NEDA 4FAJA 3KJTA 2XXYA 4TLLB 4NE4A 4PAFA 3IOWA 3KFMA 3MUQA 4IY5A 2F36A 3MP1A 1XI6A 3EHSA 3VLVA 2QPQA 2XX9A 1B7ZA 4XKQA 1B4ZA 1OMPA 3KZGA 3WAFA 1HSJA 4NF4B 2F78A 4BLAA 1UTHB 1FBDA 2OLBA 1YZ0A 3M3KA 1B4HA 2GRVA 2DWHA 3KSXA 1OQHA 2WBBA 2AIXA 3ZSFA 1LFIA 1JW5A 1JEUA 4DXUA 5CM6A 2OX3A 4GXSB 2I3WA 2E0SA 4MH5A 3MBPA 2RC8A 2DWIA 2DOJA 2OWZA 4EDPA 1N7WA 3IFCA 4ZZEA 5I2KB 1FPJA 4LA9A 3N6UA 3TAJA 1FQCA 1MDQA 4OFOA 5CMMA 5H8SA 5ESYA 2I0BA 4I3YA 3CFZA 4Z0IA 4QFPA 4P9KA 3CR9A 3TQWA 2D5WA 3K01A 3MVYA 4P56A 2UXAA 1YCJA 1MXVA 3OMBA 1UIUA 4HE2A 4XKNA 3Q29A 3MZBA 4RXLA 1XT8A 4OXVA 2F7CA 4N6PA 1G0IA 4NF8B 2FNCA 4ZDMA 1BLFA 1P99A 3LC8A 3FXBA 3IB2A 5KCJB 3RT8A 1LAHE 2QS3A 1POTA 4GWYA 4FECA 5F7VA 4LATA 1LFGA 2ZYKA 2UVGA 1A40A 4NQ8A 4Z7EA 5EQ7A 4YB7A 5M2VA 3VVEA 2KLFA 3U1OA 4OHNA 1EZPA 4PQJA 2PBWA 4NWCA 2Y7IA 1UIVA 1WVJA 1D9VA 1BTJA 5EYHA 3H6WA 3RUMA 4R6KA 1B5HA 2Q9TA 4WKMA 4JB7A 1B6HA 3PMVA 1MY4A 1LCFA 4X48A 4R9FA 4M4GA 5DVJA 4LP2B 4NF4A 1UTHA 4OVPA 1MQHA 4IR8A 4EQ9A 2XXWA 3G3IA 2UYFA 2OJTA 1NV2A 2ZXTA 4GBWA 4N8YA 1A8FA 4LZ5A 4OANA 4GWOA 4GIZA 4PGNA 1H43A 3C31A 1IXGA 3ILUB 3QAXA 4POWA 4ISUA 5CBSA 4N15A 4QSDA 3SEVA 2HPGA 1MG1A 3M3FA 2FHYA 2XX8A 2WKYA 4GL8A 2WX9A 4U2RA 5I2KA 3MZ1A 4PDHA 2B65A 1ZU0A 2QJEA 4JVCA 1Z7NE 2ONSA 4MLQA 5TP9B 1Q9DA 3UGWA 4F2QA 2H5YA 1IMCA 2Z8DA 3PMXA 3FATA 5ELVA 1PBPA 3RN8A 3VXBA 4H1XA 3S4UA 4TQUQ 1M5DA 5HBCA 1LFHA 4BDQA 1FPDA 5EHMA 2XXQA 4WEDA 4NF8A 3VE1B 2VGQA 4MEVA 4U4XA 2OWSA 3HCQA 5KCJA 3FGSA 3V83A 3S2VA 3RTWB 4GRKA 1FTLA 2I4CA 3K1NA 3VVDA 1Z7ME 4LUBA 4G8NA 4F18A 3WAEA 1FTMA 1SDXA 5L8DA 4ELOA 4KCCA 4P0IA 1D4NA 4BDLA 4UACA 2QS4A 1LCTA 3CSGA 1JP4A 3GXAA 2XD3A 5I59B 3RLFE 2Q8MA 4EXLA 1S50A 2F7AA 2RINA 4FEDA 3QK6A 3OD7A 2I48A 1HSEA 3KC1A 4C0RA 3A29A 3EN3A 3UP9A 1D9YA 1FQFA 4LN5A 4R6HA 1MQJA 2FIEA 3PPPA 2DSFA 3U72A 3VLUA 1MRPA 4OERA 2PMSA 2VHAA 4PFRA 4NGUA 2DP8A 1BKAA 5I2NB 3H06B 2WYPA 3HN0A 1FTAA 3IFAA 2XD2A 1NV4A 2V3TA 4K3FA 1LBZA 1KA1A 2FBPA 4ZEKA 3TTKA 1IMFA 2HZLA 1JEVA 2Y5KA 4JSDA 4OEUA 3VDFA 3MP6A 5CMBA 4R2FA 3VVFA 1FQEA 4XKRA 1B3GA 1NNTA 4U1OA 4NN3A 3IB0A 5EQ8A 3H3GA 2F35A 1INPA 5TP9A 3TEPA 2XWVA 3LSWA 2Y7KA 1MH4A 4HCWA 3MVWA 4JBZA 4ND9A 1MXXA 3CSBA 3O66A 1A8EA 3PGFA 5DW8A 2PFZA 4TOZA 4KCDA 5DEXB 1R9LA 1QJMA 5DT6A 4F1VA 5F1QA 3IK6B 4LQ2A 1OLCA 2HCAA 4IO3A 1SQYA 4GWUA 1EYKA 1QW0A 4FJPA 5B7DA 1CB6A 1USYE 3TCFA 5T3JA 4P1LA 3T96B 3IR1A 1MQGA 3H6VA 1LBBA 4MNPA 2H25A 1RDYA 1FPKA 2HEUA 3CG3A 3O9PA 1NH7A 1K9YA 4MAGA 2ESNA 3LUYA 4YKJA 2GHBA 4QBAA 1B0HA 4IO5A 2ZNUA 3HPIA 3O6IA 1XVXA 3C34A 3K1PA 1B9JA 2DE4A 1GTKA 1AMFA 1DPEA 2X7QA 3JV9A 5CRYA 3HFUA 4GD5A 3R7XA 3E9XA 5I2NA 4EXKA 2UYEA 5JTYB 4HE1A 1IIWA 3LUZA 4NWDA 4POXA 3FXQA 5BUUA 4ESWA 5AA4B 3EQ1A 4QXDA 1B3HA 4AS4A 3ILTB 3MZ9A 4YKPA 2ZNSA 2AL4A 4YU0A 1DMBA 5KZTA 2B3BA 1XHYA 2R71A 3FJGA 4H5FA 1VE4A 4NMYA 1SW1A 3U8QA 2NVUB 2NOOA 2KR0A 4PFWA 1Y3PA 4HTGA 4GVOA 3SDFA 1CNQA 4YMAA 1A55A 4ESXA 2A5TB 1BK4A 2W7YA 2XXTA 3MAMA 3M3LA 1P1WA 3T9XB 3H4ZA 3OSRA 4F3SA 5DEXA 4O7IA 3OENA 2X7PA 2QFLA 5EHSA 1TXFA 3SESA 4KYSA 1FSAA 4H6DA 3O29A 4O7MA 2PFYA 3H6UA 1VSOA 3TELA 1NV5A 3RQTA 4R6YA 2ZYNA 1OVBA 5EYFA 3K6WA 2RCBA 4P0GA 2V4CA 4XFEA 3BIHA 1A54A 2OZZA 3HHFA 1LSTA 1URSA 5EQ9A 1DSNA 1IXIA 3SEXA 4HCYA 2O7IA 4F1YA 4ZECA 3C32A 4KHZE 4XTCQ 3EF7A 4JWYA 4OVJA 1YAEA 5AE4A 1II5A 4DCYA 4PP0A 5AA2B 1MPCA 3KG2A 4ZEBA 5CMCA 1SD3A 3S9NC 3PPOA 4OESA 4KYDA 1NH8A 1US5A 4NF6B 1R6ZA 3TYHA 4XEQA 1B5JA 4NHBA 5LTCA 3B8BA 5CBRA 3PD8A 3DP8A 1Q1KA 4H0WA 1NUWA 1B1XA 1B40A 1D3KA 2DE2A 3FXUA 5ICTA 2Q89A 2I3VA 5JTYA 4P3LA 4AS5A 1NMUA 4H8IA 5HPQA 3T9VA 3HHGA 4PF6A 4YICA 4ELRA 4P8BA 3GBAA 1M5BA 2GH9A 2VPNA 5AA4A 1N7XA 1EYIA 1TWYA 1SYHA 2RCAA 3DELB 2O68A 2XXVA 3TTNA 2THIA 3G3KA 4EQ7A 4RK2A 1UTBA 5TPAB 4PFBA 1PBQA 4YB6A 4DXBA 1B2HA 4DE8A 2QVRA 1R1NA 2A5TA 4H5GA 2Z8EA 2L5VA 4F39A 3PTYA 1B5IA 2JJKA 4F1UA 3K00A 3KOSA 3LV0A 4FIMA 2OBGA 1L5TA 3O6HA 4DDDA 3K0VA 2RC7A 3FJ7A 3ROJA 2NWJA 4U21A 4JVIA 1BIYA 4JXIA 5H8FB 2CZHA 2F6PA 4EUOA 1IMEA 4GWZA 3QIMA 4WEPA 3R6UA 1EZ9A 3IJOB 4QFKA 1I69A 2FVZA 1GV8A 4O3BA 3V5AA 3O6GA 2F5XA 1NL5A 3N6TA 4R9GA 3SZPA 1NV0A 4N81A 2QS2A 1M5FA 2FA7A 2Y7WA 1EYJA 1I6AA 5AA2A 1FQDA 4PE5B 1F9BA 3UN6A 4NF6A 1PB9A 4NAPA 3OXNA 3TDJA 1URDA 4I40A 1ELJA 2XWOA 5TU0A 4PAIA 1B0LA 1IMDA 5IGAA 3BIGA 4R75A 1ZJLA 1MY0A 5IKBA 4YKIA 3VV5A 1SW4A 1OLAA 1MXUA 4RNSA 4L17A 4YB5A 2ABHA 5DTBA 3OO6A 4EQBA 2Q2AA 1FTJA 5AA3A 3TODA 2VP1A 4O3AA 4QFNA 2B4LA 3FIRA 2H99A 4HW8A 3IJXB 1NV7A 2HHMA 2CZIA 4X9TA 2I6EA 3CRBA 3V8XB 2P3NA 3S9MC 4Q5TA 3MWBA 4BDRA 3TQLA 4N91A 3H6TA 1ZLQA 1Q35A 3ONMA 1I6BA 5H8NB 4R2BA 1MXWA 4RY1A 4OFLA 4YZZA 1RDXA 5H8FA 3L6GA 2G29A 1JW4A 1AOVA 5EQAA 1IITA 2VPOA 3N26A 1UQWA 4F2OA 4PC9A 1N84A 3TTLA 3MYUA 5FHOA 2XXPA 2I49A 4KFQA 2R9JA 1NUZA 1LAFE 1YXIA 5ET8A 3LSFB 2F6GA 2A5SA 4PBQA 2Z23A 1Y4CA 3BFTA 3U65A 1B3LA 4F31B 3CFLA 1FPGA 3TKDA 2IEEA 5I56B 4MHFA 1MPBA 4OWDA 2GFEA 1QUIA 1FTOA 2HAVA 1XOCA 4PETA 1EZOA 4JSOA 4AB6A 4G8MA 1PDAA 4O94A 1Y9UA 1O64A 5K2YA 1LAGE 4OVTA 3IO6A 2XHDA 4GBVA 5FTHA 2I0CA 2V25A 3TZAA 1B32A 1B7HA 2BJIA 4OYVA 3PU5A 2CZLA 4U1ZA 3GLBA 3PPNA 3Q26A 3TMGA 1YPNA 2QVVA 3ISPA 3ZKLA 3RPLB 4EF2A 1DBZA 4G77A 2UVIA 2QS1A 1ZKBA 1JW1A 1FBGA 1PB8A 1PB7A 3MJNA 2H98A 3GYYA 4JDFA 4ELQA 4QSCA 3EHTA 4PFIA 3G3JA 5ITOA 3E3KA 3SETA 5AA1A 1T0KA 1KWHA 4NF0A 5HM4B 3FJMA 3FVOA 5CMKA 2AYSA 4MIJA 4KPTA 1VR5A 2ZZWA 4DI3D 1FRPA 1GR2A 3KBRA 1GVCA 2P3VA 4KQPA 1JVYA 4QHQA 3KC0A 5F24A 3CHGA 1OVTA 3MSTA 3VFJA 4H46A 2REGA 4PAKA 4N6KA 5ICQA 4MFIA 2HAUA 3PUXE 4U23A 2E1SA 4GWXA 5ET5A 4N13A 1QKAA 1FJ9A 1IXHA 4KD5A 4GX4A 2V3UA 2Y84A 3H7MA 3JZJA 1SYIA 3W15C 3F11A 3S9LC 5EYGA 1IZ1A 5J16A 1MM6A 1VFEA 3QUFA 2XXUA 5I59A 3CIJA 1B3EA 5I56A 2DWJA 3H03A 4KR5A 3BFUA 3Q27A 3M8UA 2XWIA 2MKZA 3QXMA 2O7UA 4MJOA 4P1EA 4Q0CA 3FASA 1EU8A 3OEMA 3SEYA 2QRYA 2DWAA 1P1UA 2B4MA 1DOTA 2F3BA 2I4BA 5FHNA 2HXWA 3AXFA 2XXKA 3B6TA 4AB5A 4RK9A 3KN7A 2O84X 3FVKA 2H9BA 1MPDA 4N4UA 4NG7A 3KN8A 4JWXA 4MX6A 5I84A 2WEFA 4DI4B 2QVUA 1MS7A 1XVYA 2HFBA 1ZMGA 1RKMA 1LBXA 3RPLA 1ATGA 1OQGA 4PFUA 4GXAA 2OWTA 2PT2A 3SKPA 4R72A 2Q8JA 5I57B 3TCHA 2ZMBA 3E13X 3OO8A 2RC9A 1QVSA 3U94A 1IQ7A 4U4SA 3OEKA 1JQFA 4IB2A 3PUYE 2FYIA 5BWJA 1RYXA 1PC3A
chains in the Genus database with same CATH topology
4F22A 3IOVA 4MLVA 3CVGA 1XS5A 3MVZA 4I9DA 3RGYA 3ODBA 2CMOA 1DPPA 1FQAA 3CI8A 3PMWA 1WDNA 1MXZA 3U93A 5JK4A 3PPQA 3UIFA 3UORA 3K6XA 2DXYA 1FQBA 4ECFA 1P1OA 1M5CA 1HSLA 4MBPA 3OOAA 4GF8A 1NKXA 1SW2A 2Z8FA 2ALUA 2PVUA 1ZBMA 4KI0E 4RA1A 3K2DA 4E0XA 3Q25A 4ZEFA 4DIGA 3C36A 4JWOA 4RJZA 4QF9A 4YAHX 1JETA 4G4PA 2UVJA 1Y20A 1Y1MA 3ZS6A 1H44A 1AH5A 2F97A 3MC2A 4FE8A 3MW0A 3Q28A 3RY3A 2RKMA 3T66A 1LB9A 1OIBA 3LSXA 3T9HB 4BDMA 3C4MA 4NTLA 5H8QB 1QUKA 2REJA 1MH3A 3IB1A 5L9SA 3FV1A 3FZVA 3MPLA 4I1DA 1POY1 3G3FA 3HO7A 4FEBA 2Q88A 5I57A 5DYHA 1LBCA 3OELA 3PUZE 1JVXA 1AL3A 2PX1A 3LR1A 3QYTA 5K2XA 3TTRA 2D21A 1JNFA 1USYH 4R73A 4PFYA 4RPOA 4AQ4A 4XIGQ 1R9QA 1I6QA 3PUVE 3TFLA 4OENA 4FATA 1S9TA 2YJPA 3UA8A 1SI1A 3FVGA 1N0TA 3PPRA 1ANFA 1B58A 1B52A 1P1NA 3A09A 4ZE9A 2DXRA 4IGTA 1N3WA 4C1UA 4I62A 1NNKA 3KSJA 3RPWA 5L9OA 3LBSA 2O1LA 1FW0A 2DS9A 4TLMB 5IAIA 2H4IA 3IL1B 3OO9A 3BBRA 3U92A 2BJJX 2DE3A 4GL0A 4OTEA 2NUVA 4G2ZA 2QMXA 1A7LA 3MPKA 3K6VA 1MXYA 4ZE8A 4QFOA 2F7BA 2QMWA 3IOUA 2OK2A 1ZTYA 2O1MA 5FTIA 2Z22A 5AA2D 5H8QA 1YTVA 4R74A 4N07A 1B7UA 1MM7A 1Y3NA 4F3BA 4I8CA 4DLDA 5A5XB 3PUWE 4UA8A 5KDTB 5H8HB 4IO2A 2VOZA 4IO7A 1RYOA 5TPAA 4F29A 4XXUA 2YLNA 2YPNA 3IO4A 4X1BA 2Y7RA 1QULA 4ELPA 3W9WA 3IX1A 4C1TA 1B1HA 1URGA 3RT6B 2D3IA 4P11A 3LSLA 2GHAA 3K4UA 3CG1A 3I3VA 2O69A 4WXJA 3QSLA 3DP6A 3K6UA 4QSEA 4DZ1A 1DTZA 4LVQA 4DCXA 3FUZA 1AIVA 4HS7A 3A3UA 3FXRA 4LZ7A 3DM0A 1H3DA 4LZ8A 1WODA 5DVFA 2NXOA 3FD3A 1GGGA 1NNPA 3RTFB 2I58A 3P7IA 2B3FA 1CE2A 1S7YA 1TFAA 2V3QA 4G68B 4G68C 4QFLA 4F3GA 3VXCA 5ITPA 3R26A 2XXIA 3USDA 1FTKA 4OEVA 2XXRA 4OFJA 3ECRA 5I58B 3BKIB 3C35A 4RPNA 2ZNTA 1SVXB 1VFDA 1O63A 1B05A 4ONYA 3PD9A 1B51A 4THIA 3T9UA 2XXXA 3HSTA 1NFTA 1DTGA 3O28A 3TCGA 5B70A 1MY2A 4ZS9A 4IO4A 3GZGA 3EHUA 4H8JA 3N5LA 1M5EA 1MQIA 2V93A 5A5XA 1A99A 1B3FA 2VD3A 1US4A 4IGRA 2OCUA 5KDTA 5H8HA 5JEIA 3D4GA 2DQVA 3G7WA 1IXCA 1N76A 1SBPA 1H76A 2F8DA 3MQ9A 4YMBA 4LQ5A 2PT1A 3B6QA 2O6AA 1ZIUA 3MVXA 4GQOA 1IUDA 4F3PA 2G93A 3K02A 3G3GA 1MY1A 4OETA 3FVNA 4NF5B 1EH3A 3E4RA 5DVIA 2M8CA 5FHMA 5L9MA 3THIA 3JYRA 4OQOA 5H8NA 2PYYA 3KEIA 3TTMA 3SEWA 2IA4A 3DP4A 4Q8RA 3KN3A 2XXHA 4XKPA 2DYXA 3OSQA 3S9EA 1TT1A 2HZKA 4MF3A 2DVCA 3KJ7A 3MP8A 3O2AA 3T22A 2ONKE 3TPAA 3FV2A 2QL3A 3A3CA 1O7TA 3I6VA 4G68A 1P1QA 1PEBA 2O51A 3TUSA 1MDP1 1LB8A 5ISUA 1N3XA 2X26A 4F19A 3L6HA 4OZ9A 5CI5A 5I58A 1LGBC 1QKBA 1XC1A 4RYAA 4GOTA 1MY3A 4FORA 4H65A 2Q2CA 3C33A 3GBBA 2P1SA 4KYEA 3C9HA 2P0SA 1SW5A 3SERA 3ZKKA 4QRZA 4Q30B 4PFTA 2ONRA 1H45A 5LOMA 1NNFA 4ZEDA 2Y7PA 1J1NA 3IOTA 3B6WA 4LONB 3PV0E 3IAZA 4E0WA 3IORA 2RF1A 3VLWA 5CC2A 1FCKA 3KOTA 2DVZA 2ZYOA 3SEUA 1LLSA 3K1MA 3UK4A 4IO6A 3EPEA 1Y1ZA 4NF5A 3OO7A 2QSXA 4GFRA 3I5OA 3B7DA 3D4CA 1UTBB 1BP5A 1LAXA 2XX7A 3O97A 1SI0A 3RNNA 4O3CA 2F34A 3CFXA 4BDNA 3HV1A 4X1DA 2UVHA 4DXCA 2P2AA 2VD2A 2LAOA 1B46A 4BDOA 3KGCA 3N94A 3T93B 1N04A 1MQDA 1Y3QA 4YKKA 2ANJA 2V84A 1TFDA 2HQ0A 2ZYMA 4M1VA 4GLIA 4ZEIA 4H67A 3DLNA 4OMBA 2R6GE 4EF1A 4U22A 4G8HA 2AL5A 1IEJA 1Y4TA 3V89B 4ZZAA 5J1DA 3QUJA 4IY6A 3G3HA 1QUJA 3W9VA 4NEDA 4FAJA 3KJTA 2XXYA 4TLLB 4NE4A 3IOWA 3KFMA 3MUQA 4IY5A 2F36A 3MP1A 3EHSA 3VLVA 2QPQA 2XX9A 1B7ZA 4XKQA 1B4ZA 1OMPA 3KZGA 3WAFA 1HSJA 4NF4B 2F78A 4BLAA 1UTHB 2OLBA 3M3KA 1B4HA 2GRVA 2DWHA 3KSXA 1OQHA 2AIXA 3ZSFA 1LFIA 1JW5A 1JEUA 4DXUA 5CM6A 4GXSB 2I3WA 2E0SA 4MH5A 3MBPA 2RC8A 2DWIA 2DOJA 4EDPA 1N7WA 4ZZEA 5I2KB 4LA9A 3N6UA 3TAJA 1FQCA 1MDQA 4OFOA 5CMMA 5H8SA 2I0BA 3CFZA 4Z0IA 4QFPA 3CR9A 3TQWA 2D5WA 3K01A 3MVYA 2UXAA 1YCJA 1MXVA 3OMBA 1UIUA 4XKNA 3Q29A 3MZBA 4RXLA 1XT8A 4OXVA 2F7CA 4N6PA 4NF8B 2FNCA 4ZDMA 1BLFA 1P99A 3LC8A 3IB2A 5KCJB 3RT8A 1LAHE 2QS3A 1POTA 4FECA 5F7VA 4LATA 1LFGA 2ZYKA 2UVGA 1A40A 4Z7EA 4YB7A 5M2VA 3VVEA 2KLFA 3U1OA 4OHNA 1EZPA 4PQJA 2PBWA 4NWCA 2Y7IA 1UIVA 1WVJA 1D9VA 1BTJA 3H6WA 3RUMA 4R6KA 1B5HA 2Q9TA 4WKMA 4JB7A 1B6HA 3PMVA 1MY4A 1LCFA 4X48A 4R9FA 4M4GA 5DVJA 4LP2B 4NF4A 1UTHA 1MQHA 4EQ9A 2XXWA 3G3IA 2UYFA 2OJTA 2ZXTA 1A8FA 4LZ5A 4GWOA 4GIZA 1H43A 3C31A 1IXGA 3ILUB 3QAXA 4POWA 4ISUA 5CBSA 4QSDA 3SEVA 1MG1A 3M3FA 2XX8A 2WKYA 4GL8A 4U2RA 5I2KA 3MZ1A 2B65A 1ZU0A 2QJEA 1Z7NE 2ONSA 4MLQA 5TP9B 3UGWA 4F2QA 2H5YA 2Z8DA 3PMXA 3FATA 5ELVA 1PBPA 3RN8A 3VXBA 4H1XA 3S4UA 4TQUQ 1M5DA 5HBCA 1LFHA 4BDQA 5EHMA 2XXQA 4WEDA 4NF8A 3VE1B 2VGQA 4U4XA 2OWSA 3HCQA 5KCJA 3FGSA 3V83A 3S2VA 3RTWB 4GRKA 1FTLA 2I4CA 3K1NA 3VVDA 1Z7ME 4LUBA 4G8NA 4F18A 3WAEA 1FTMA 1SDXA 5L8DA 4ELOA 4KCCA 4P0IA 1D4NA 4BDLA 4UACA 2QS4A 1LCTA 3CSGA 3GXAA 2XD3A 5I59B 3RLFE 4EXLA 1S50A 2F7AA 2RINA 4FEDA 3QK6A 3OD7A 2I48A 1HSEA 4C0RA 3EN3A 3UP9A 1D9YA 1FQFA 4R6HA 1MQJA 3PPPA 2DSFA 3U72A 3VLUA 1MRPA 4OERA 2PMSA 2VHAA 2DP8A 1BKAA 5I2NB 3H06B 3HN0A 2XD2A 2V3TA 4K3FA 4ZEKA 3TTKA 2HZLA 1JEVA 4JSDA 4OEUA 3VDFA 3MP6A 5CMBA 4R2FA 3VVFA 1FQEA 4XKRA 1B3GA 1NNTA 4U1OA 3IB0A 3H3GA 2F35A 5TP9A 3TEPA 3LSWA 2Y7KA 1MH4A 4HCWA 3MVWA 4JBZA 4ND9A 1MXXA 3CSBA 3O66A 1A8EA 3PGFA 4TOZA 4KCDA 5DEXB 1R9LA 1QJMA 5DT6A 4F1VA 5F1QA 3IK6B 4LQ2A 1OLCA 2HCAA 4IO3A 1SQYA 1QW0A 4FJPA 5B7DA 1CB6A 1USYE 3TCFA 3T96B 3IR1A 1MQGA 3H6VA 1LBBA 2H25A 2HEUA 3CG3A 3O9PA 1NH7A 2ESNA 3LUYA 4YKJA 2GHBA 1B0HA 4IO5A 2ZNUA 3HPIA 3O6IA 1XVXA 3C34A 3K1PA 1B9JA 2DE4A 1GTKA 1AMFA 1DPEA 2X7QA 3JV9A 5CRYA 4GD5A 3R7XA 3E9XA 5I2NA 4EXKA 2UYEA 5JTYB 1IIWA 4NWDA 4POXA 3FXQA 5BUUA 4ESWA 5AA4B 3EQ1A 1B3HA 3ILTB 3MZ9A 4YKPA 2ZNSA 2AL4A 4YU0A 1DMBA 5KZTA 2B3BA 1XHYA 2R71A 3FJGA 4H5FA 1VE4A 4NMYA 1SW1A 3U8QA 2NVUB 2NOOA 4PFWA 1Y3PA 4HTGA 4GVOA 3SDFA 4YMAA 1A55A 4ESXA 2A5TB 2W7YA 2XXTA 3MAMA 3M3LA 1P1WA 3T9XB 3H4ZA 3OSRA 4F3SA 5DEXA 3OENA 2X7PA 5EHSA 1TXFA 3SESA 4KYSA 4H6DA 3O29A 3H6UA 1VSOA 3TELA 3RQTA 4R6YA 2ZYNA 1OVBA 5EYFA 3K6WA 2RCBA 4P0GA 1A54A 2OZZA 3HHFA 1LSTA 1URSA 1DSNA 1IXIA 3SEXA 4HCYA 2O7IA 4F1YA 4ZECA 3C32A 4KHZE 4XTCQ 3EF7A 4JWYA 4OVJA 1YAEA 5AE4A 1II5A 4DCYA 4PP0A 5AA2B 1MPCA 3KG2A 4ZEBA 5CMCA 1SD3A 3S9NC 3PPOA 4OESA 4KYDA 1NH8A 1US5A 4NF6B 1R6ZA 3TYHA 1B5JA 5CBRA 3PD8A 3DP8A 1Q1KA 4H0WA 1B1XA 1B40A 1D3KA 2DE2A 3FXUA 5ICTA 2Q89A 2I3VA 5JTYA 1NMUA 4H8IA 5HPQA 3T9VA 3HHGA 4YICA 4ELRA 3GBAA 1M5BA 2GH9A 5AA4A 1N7XA 1TWYA 1SYHA 2RCAA 3DELB 2O68A 2XXVA 3TTNA 2THIA 3G3KA 4EQ7A 4RK2A 1UTBA 5TPAB 1PBQA 4YB6A 4DXBA 1B2HA 4DE8A 1R1NA 2A5TA 4H5GA 2Z8EA 4F39A 1B5IA 4F1UA 3K00A 3KOSA 4FIMA 2OBGA 1L5TA 3O6HA 4DDDA 3K0VA 2RC7A 3FJ7A 2NWJA 4U21A 1BIYA 4JXIA 5H8FB 2F6PA 4EUOA 3QIMA 4WEPA 3R6UA 1EZ9A 3IJOB 4QFKA 1I69A 1GV8A 4O3BA 3V5AA 3O6GA 2F5XA 1NL5A 3N6TA 4R9GA 2QS2A 1M5FA 2FA7A 2Y7WA 1I6AA 5AA2A 1FQDA 4PE5B 1F9BA 3UN6A 4NF6A 1PB9A 3OXNA 3TDJA 1URDA 1ELJA 5TU0A 1B0LA 4R75A 1ZJLA 1MY0A 5IKBA 4YKIA 3VV5A 1SW4A 1OLAA 1MXUA 4RNSA 4L17A 4YB5A 2ABHA 5DTBA 3OO6A 4EQBA 2Q2AA 1FTJA 5AA3A 3TODA 2VP1A 4O3AA 4QFNA 3FIRA 2H99A 4HW8A 3IJXB 4X9TA 2I6EA 3CRBA 3V8XB 3S9MC 4Q5TA 3MWBA 4BDRA 3TQLA 3H6TA 1ZLQA 1Q35A 3ONMA 1I6BA 5H8NB 4R2BA 1MXWA 4RY1A 4OFLA 4YZZA 5H8FA 3L6GA 2G29A 1JW4A 1AOVA 1IITA 3N26A 1UQWA 4F2OA 1N84A 3TTLA 5FHOA 2XXPA 2I49A 4KFQA 2R9JA 1LAFE 3LSFB 2F6GA 2A5SA 2Z23A 1Y4CA 3BFTA 4F31B 1B3LA 3CFLA 3TKDA 2IEEA 5I56B 1MPBA 4OWDA 2GFEA 1QUIA 1FTOA 2HAVA 1XOCA 4PETA 1EZOA 4JSOA 4AB6A 4G8MA 1PDAA 1Y9UA 1O64A 5K2YA 1LAGE 3IO6A 2XHDA 5FTHA 2I0CA 2V25A 3TZAA 1B32A 1B7HA 4OYVA 3PU5A 2CZLA 4U1ZA 3GLBA 3PPNA 3Q26A 3TMGA 1YPNA 3ZKLA 4EF2A 4G77A 2UVIA 2QS1A 1ZKBA 1JW1A 1PB8A 1PB7A 3MJNA 2H98A 4JDFA 4ELQA 4QSCA 3EHTA 3G3JA 5ITOA 3E3KA 3SETA 5AA1A 1T0KA 1KWHA 5HM4B 3FJMA 3FVOA 5CMKA 2AYSA 4KPTA 1VR5A 1GR2A 3KBRA 1GVCA 4KQPA 1JVYA 4QHQA 1OVTA 3VFJA 2REGA 5ICQA 4MFIA 2HAUA 3PUXE 4U23A 2E1SA 4N13A 1QKAA 1IXHA 4KD5A 2V3UA 2Y84A 3H7MA 3JZJA 1SYIA 3W15C 3F11A 3S9LC 1IZ1A 1MM6A 1VFEA 3QUFA 2XXUA 5I59A 3CIJA 1B3EA 5I56A 2DWJA 3H03A 4KR5A 3BFUA 3Q27A 3M8UA 3QXMA 2O7UA 4Q0CA 3FASA 1EU8A 3OEMA 3SEYA 2QRYA 2DWAA 1P1UA 1DOTA 2I4BA 5FHNA 2HXWA 3AXFA 3B6TA 4AB5A 4RK9A 3KN7A 2O84X 3FVKA 2H9BA 1MPDA 3KN8A 4JWXA 5I84A 1MS7A 1XVYA 2HFBA 1ZMGA 1RKMA 1ATGA 1OQGA 4PFUA 4GXAA 2OWTA 2PT2A 3SKPA 4R72A 2Q8JA 5I57B 3TCHA 2ZMBA 3E13X 3OO8A 2RC9A 1QVSA 3U94A 1IQ7A 4U4SA 3OEKA 1JQFA 4IB2A 3PUYE 2FYIA 5BWJA 1RYXA 1PC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F22 A;  3IOV A;  4MLV A;  3CVG A;  1XS5 A;  3MVZ A;  4I9D A;  3RGY A;  3ODB A;  2CMO A;  1DPP A;  1FQA A;  3CI8 A;  3PMW A;  1WDN A;  1MXZ A;  3U93 A;  5JK4 A;  3PPQ A;  3UIF A;  3UOR A;  3K6X A;  2DXY A;  1FQB A;  4ECF A;  1P1O A;  1M5C A;  1HSL A;  4MBP A;  3OOA A;  4GF8 A;  1NKX A;  1SW2 A;  2Z8F A;  2ALU A;  2PVU A;  1ZBM A;  4KI0 E;  4RA1 A;  3K2D A;  4E0X A;  3Q25 A;  4ZEF A;  4DIG A;  3C36 A;  4JWO A;  4RJZ A;  4QF9 A;  4YAH X;  1JET A;  4G4P A;  2UVJ A;  1Y20 A;  1Y1M A;  3ZS6 A;  1H44 A;  1AH5 A;  2F97 A;  3MC2 A;  4FE8 A;  3MW0 A;  3Q28 A;  3RY3 A;  2RKM A;  3T66 A;  1LB9 A;  1OIB A;  3LSX A;  3T9H B;  4BDM A;  3C4M A;  4NTL A;  5H8Q B;  1QUK A;  2REJ A;  1MH3 A;  3IB1 A;  5L9S A;  3FV1 A;  3FZV A;  3MPL A;  4I1D A;  1POY 1;  3G3F A;  3HO7 A;  4FEB A;  2Q88 A;  5I57 A;  5DYH A;  1LBC A;  3OEL A;  3PUZ E;  1JVX A;  1AL3 A;  2PX1 A;  3LR1 A;  3QYT A;  5K2X A;  3TTR A;  2D21 A;  1JNF A;  1USY H;  4R73 A;  4PFY A;  4RPO A;  4AQ4 A;  4XIG Q;  1R9Q A;  1I6Q A;  3PUV E;  3TFL A;  4OEN A;  4FAT A;  1S9T A;  2YJP A;  3UA8 A;  1SI1 A;  3FVG A;  1N0T A;  3PPR A;  1ANF A;  1B58 A;  1B52 A;  1P1N A;  3A09 A;  4ZE9 A;  2DXR A;  4IGT A;  1N3W A;  4C1U A;  4I62 A;  1NNK A;  3KSJ A;  3RPW A;  5L9O A;  3LBS A;  2O1L A;  1FW0 A;  2DS9 A;  4TLM B;  5IAI A;  2H4I A;  3IL1 B;  3OO9 A;  3BBR A;  3U92 A;  2BJJ X;  2DE3 A;  4GL0 A;  4OTE A;  2NUV A;  4G2Z A;  2QMX A;  1A7L A;  3MPK A;  3K6V A;  1MXY A;  4ZE8 A;  4QFO A;  2F7B A;  2QMW A;  3IOU A;  2OK2 A;  1ZTY A;  2O1M A;  5FTI A;  2Z22 A;  5AA2 D;  5H8Q A;  1YTV A;  4R74 A;  4N07 A;  1B7U A;  1MM7 A;  1Y3N A;  4F3B A;  4I8C A;  4DLD A;  5A5X B;  3PUW E;  4UA8 A;  5KDT B;  5H8H B;  4IO2 A;  2VOZ A;  4IO7 A;  1RYO A;  5TPA A;  4F29 A;  4XXU A;  2YLN A;  2YPN A;  3IO4 A;  4X1B A;  2Y7R A;  1QUL A;  4ELP A;  3W9W A;  3IX1 A;  4C1T A;  1B1H A;  1URG A;  3RT6 B;  2D3I A;  4P11 A;  3LSL A;  2GHA A;  3K4U A;  3CG1 A;  3I3V A;  2O69 A;  4WXJ A;  3QSL A;  3DP6 A;  3K6U A;  4QSE A;  4DZ1 A;  1DTZ A;  4LVQ A;  4DCX A;  3FUZ A;  1AIV A;  4HS7 A;  3A3U A;  3FXR A;  4LZ7 A;  3DM0 A;  1H3D A;  4LZ8 A;  1WOD A;  5DVF A;  2NXO A;  3FD3 A;  1GGG A;  1NNP A;  3RTF B;  2I58 A;  3P7I A;  2B3F A;  1CE2 A;  1S7Y A;  1TFA A;  2V3Q A;  4G68 B;  4G68 C;  4QFL A;  4F3G A;  3VXC A;  5ITP A;  3R26 A;  2XXI A;  3USD A;  1FTK A;  4OEV A;  2XXR A;  4OFJ A;  3ECR A;  5I58 B;  3BKI B;  3C35 A;  4RPN A;  2ZNT A;  1SVX B;  1VFD A;  1O63 A;  1B05 A;  4ONY A;  3PD9 A;  1B51 A;  4THI A;  3T9U A;  2XXX A;  3HST A;  1NFT A;  1DTG A;  3O28 A;  3TCG A;  5B70 A;  1MY2 A;  4ZS9 A;  4IO4 A;  3GZG A;  3EHU A;  4H8J A;  3N5L A;  1M5E A;  1MQI A;  2V93 A;  5A5X A;  1A99 A;  1B3F A;  2VD3 A;  1US4 A;  4IGR A;  2OCU A;  5KDT A;  5H8H A;  5JEI A;  3D4G A;  2DQV A;  3G7W A;  1IXC A;  1N76 A;  1SBP A;  1H76 A;  2F8D A;  3MQ9 A;  4YMB A;  4LQ5 A;  2PT1 A;  3B6Q A;  2O6A A;  1ZIU A;  3MVX A;  4GQO A;  1IUD A;  4F3P A;  2G93 A;  3K02 A;  3G3G A;  1MY1 A;  4OET A;  3FVN A;  4NF5 B;  1EH3 A;  3E4R A;  5DVI A;  2M8C A;  5FHM A;  5L9M A;  3THI A;  3JYR A;  4OQO A;  5H8N A;  2PYY A;  3KEI A;  3TTM A;  3SEW A;  2IA4 A;  3DP4 A;  4Q8R A;  3KN3 A;  2XXH A;  4XKP A;  2DYX A;  3OSQ A;  3S9E A;  1TT1 A;  2HZK A;  4MF3 A;  2DVC A;  3KJ7 A;  3MP8 A;  3O2A A;  3T22 A;  2ONK E;  3TPA A;  3FV2 A;  2QL3 A;  3A3C A;  1O7T A;  3I6V A;  4G68 A;  1P1Q A;  1PEB A;  2O51 A;  3TUS A;  1MDP 1;  1LB8 A;  5ISU A;  1N3X A;  2X26 A;  4F19 A;  3L6H A;  4OZ9 A;  5CI5 A;  5I58 A;  1LGB C;  1QKB A;  1XC1 A;  4RYA A;  4GOT A;  1MY3 A;  4FOR A;  4H65 A;  2Q2C A;  3C33 A;  3GBB A;  2P1S A;  4KYE A;  3C9H A;  2P0S A;  1SW5 A;  3SER A;  3ZKK A;  4QRZ A;  4Q30 B;  4PFT A;  2ONR A;  1H45 A;  5LOM A;  1NNF A;  4ZED A;  2Y7P A;  1J1N A;  3IOT A;  3B6W A;  4LON B;  3PV0 E;  3IAZ A;  4E0W A;  3IOR A;  2RF1 A;  3VLW A;  5CC2 A;  1FCK A;  3KOT A;  2DVZ A;  2ZYO A;  3SEU A;  1LLS A;  3K1M A;  3UK4 A;  4IO6 A;  3EPE A;  1Y1Z A;  4NF5 A;  3OO7 A;  2QSX A;  4GFR A;  3I5O A;  3B7D A;  3D4C A;  1UTB B;  1BP5 A;  1LAX A;  2XX7 A;  3O97 A;  1SI0 A;  3RNN A;  4O3C A;  2F34 A;  3CFX A;  4BDN A;  3HV1 A;  4X1D A;  2UVH A;  4DXC A;  2P2A A;  2VD2 A;  2LAO A;  1B46 A;  4BDO A;  3KGC A;  3N94 A;  3T93 B;  1N04 A;  1MQD A;  1Y3Q A;  4YKK A;  2ANJ A;  2V84 A;  1TFD A;  2HQ0 A;  2ZYM A;  4M1V A;  4GLI A;  4ZEI A;  4H67 A;  3DLN A;  4OMB A;  2R6G E;  4EF1 A;  4U22 A;  4G8H A;  2AL5 A;  1IEJ A;  1Y4T A;  3V89 B;  4ZZA A;  5J1D A;  3QUJ A;  4IY6 A;  3G3H A;  1QUJ A;  3W9V A;  4NED A;  4FAJ A;  3KJT A;  2XXY A;  4TLL B;  4NE4 A;  3IOW A;  3KFM A;  3MUQ A;  4IY5 A;  2F36 A;  3MP1 A;  3EHS A;  3VLV A;  2QPQ A;  2XX9 A;  1B7Z A;  4XKQ A;  1B4Z A;  1OMP A;  3KZG A;  3WAF A;  1HSJ A;  4NF4 B;  2F78 A;  4BLA A;  1UTH B;  2OLB A;  3M3K A;  1B4H A;  2GRV A;  2DWH A;  3KSX A;  1OQH A;  2AIX A;  3ZSF A;  1LFI A;  1JW5 A;  1JEU A;  4DXU A;  5CM6 A;  4GXS B;  2I3W A;  2E0S A;  4MH5 A;  3MBP A;  2RC8 A;  2DWI A;  2DOJ A;  4EDP A;  1N7W A;  4ZZE A;  5I2K B;  4LA9 A;  3N6U A;  3TAJ A;  1FQC A;  1MDQ A;  4OFO A;  5CMM A;  5H8S A;  2I0B A;  3CFZ A;  4Z0I A;  4QFP A;  3CR9 A;  3TQW A;  2D5W A;  3K01 A;  3MVY A;  2UXA A;  1YCJ A;  1MXV A;  3OMB A;  1UIU A;  4XKN A;  3Q29 A;  3MZB A;  4RXL A;  1XT8 A;  4OXV A;  2F7C A;  4N6P A;  4NF8 B;  2FNC A;  4ZDM A;  1BLF A;  1P99 A;  3LC8 A;  3IB2 A;  5KCJ B;  3RT8 A;  1LAH E;  2QS3 A;  1POT A;  4FEC A;  5F7V A;  4LAT A;  1LFG A;  2ZYK A;  2UVG A;  1A40 A;  4Z7E A;  4YB7 A;  5M2V A;  3VVE A;  2KLF A;  3U1O A;  4OHN A;  1EZP A;  4PQJ A;  2PBW A;  4NWC A;  2Y7I A;  1UIV A;  1WVJ A;  1D9V A;  1BTJ A;  3H6W A;  3RUM A;  4R6K A;  1B5H A;  2Q9T A;  4WKM A;  4JB7 A;  1B6H A;  3PMV A;  1MY4 A;  1LCF A;  4X48 A;  4R9F A;  4M4G A;  5DVJ A;  4LP2 B;  4NF4 A;  1UTH A;  1MQH A;  4EQ9 A;  2XXW A;  3G3I A;  2UYF A;  2OJT A;  2ZXT A;  1A8F A;  4LZ5 A;  4GWO A;  4GIZ A;  1H43 A;  3C31 A;  1IXG A;  3ILU B;  3QAX A;  4POW A;  4ISU A;  5CBS A;  4QSD A;  3SEV A;  1MG1 A;  3M3F A;  2XX8 A;  2WKY A;  4GL8 A;  4U2R A;  5I2K A;  3MZ1 A;  2B65 A;  1ZU0 A;  2QJE A;  1Z7N E;  2ONS A;  4MLQ A;  5TP9 B;  3UGW A;  4F2Q A;  2H5Y A;  2Z8D A;  3PMX A;  3FAT A;  5ELV A;  1PBP A;  3RN8 A;  3VXB A;  4H1X A;  3S4U A;  4TQU Q;  1M5D A;  5HBC A;  1LFH A;  4BDQ A;  5EHM A;  2XXQ A;  4WED A;  4NF8 A;  3VE1 B;  2VGQ A;  4U4X A;  2OWS A;  3HCQ A;  5KCJ A;  3FGS A;  3V83 A;  3S2V A;  3RTW B;  4GRK A;  1FTL A;  2I4C A;  3K1N A;  3VVD A;  1Z7M E;  4LUB A;  4G8N A;  4F18 A;  3WAE A;  1FTM A;  1SDX A;  5L8D A;  4ELO A;  4KCC A;  4P0I A;  1D4N A;  4BDL A;  4UAC A;  2QS4 A;  1LCT A;  3CSG A;  3GXA A;  2XD3 A;  5I59 B;  3RLF E;  4EXL A;  1S50 A;  2F7A A;  2RIN A;  4FED A;  3QK6 A;  3OD7 A;  2I48 A;  1HSE A;  4C0R A;  3EN3 A;  3UP9 A;  1D9Y A;  1FQF A;  4R6H A;  1MQJ A;  3PPP A;  2DSF A;  3U72 A;  3VLU A;  1MRP A;  4OER A;  2PMS A;  2VHA A;  2DP8 A;  1BKA A;  5I2N B;  3H06 B;  3HN0 A;  2XD2 A;  2V3T A;  4K3F A;  4ZEK A;  3TTK A;  2HZL A;  1JEV A;  4JSD A;  4OEU A;  3VDF A;  3MP6 A;  5CMB A;  4R2F A;  3VVF A;  1FQE A;  4XKR A;  1B3G A;  1NNT A;  4U1O A;  3IB0 A;  3H3G A;  2F35 A;  5TP9 A;  3TEP A;  3LSW A;  2Y7K A;  1MH4 A;  4HCW A;  3MVW A;  4JBZ A;  4ND9 A;  1MXX A;  3CSB A;  3O66 A;  1A8E A;  3PGF A;  4TOZ A;  4KCD A;  5DEX B;  1R9L A;  1QJM A;  5DT6 A;  4F1V A;  5F1Q A;  3IK6 B;  4LQ2 A;  1OLC A;  2HCA A;  4IO3 A;  1SQY A;  1QW0 A;  4FJP A;  5B7D A;  1CB6 A;  1USY E;  3TCF A;  3T96 B;  3IR1 A;  1MQG A;  3H6V A;  1LBB A;  2H25 A;  2HEU A;  3CG3 A;  3O9P A;  1NH7 A;  2ESN A;  3LUY A;  4YKJ A;  2GHB A;  1B0H A;  4IO5 A;  2ZNU A;  3HPI A;  3O6I A;  1XVX A;  3C34 A;  3K1P A;  1B9J A;  2DE4 A;  1GTK A;  1AMF A;  1DPE A;  2X7Q A;  3JV9 A;  5CRY A;  4GD5 A;  3R7X A;  3E9X A;  5I2N A;  4EXK A;  2UYE A;  5JTY B;  1IIW A;  4NWD A;  4POX A;  3FXQ A;  5BUU A;  4ESW A;  5AA4 B;  3EQ1 A;  1B3H A;  3ILT B;  3MZ9 A;  4YKP A;  2ZNS A;  2AL4 A;  4YU0 A;  1DMB A;  5KZT A;  2B3B A;  1XHY A;  2R71 A;  3FJG A;  4H5F A;  1VE4 A;  4NMY A;  1SW1 A;  3U8Q A;  2NVU B;  2NOO A;  4PFW A;  1Y3P A;  4HTG A;  4GVO A;  3SDF A;  4YMA A;  1A55 A;  4ESX A;  2A5T B;  2W7Y A;  2XXT A;  3MAM A;  3M3L A;  1P1W A;  3T9X B;  3H4Z A;  3OSR A;  4F3S A;  5DEX A;  3OEN A;  2X7P A;  5EHS A;  1TXF A;  3SES A;  4KYS A;  4H6D A;  3O29 A;  3H6U A;  1VSO A;  3TEL A;  3RQT A;  4R6Y A;  2ZYN A;  1OVB A;  5EYF A;  3K6W A;  2RCB A;  4P0G A;  1A54 A;  2OZZ A;  3HHF A;  1LST A;  1URS A;  1DSN A;  1IXI A;  3SEX A;  4HCY A;  2O7I A;  4F1Y A;  4ZEC A;  3C32 A;  4KHZ E;  4XTC Q;  3EF7 A;  4JWY A;  4OVJ A;  1YAE A;  5AE4 A;  1II5 A;  4DCY A;  4PP0 A;  5AA2 B;  1MPC A;  3KG2 A;  4ZEB A;  5CMC A;  1SD3 A;  3S9N C;  3PPO A;  4OES A;  4KYD A;  1NH8 A;  1US5 A;  4NF6 B;  1R6Z A;  3TYH A;  1B5J A;  5CBR A;  3PD8 A;  3DP8 A;  1Q1K A;  4H0W A;  1B1X A;  1B40 A;  1D3K A;  2DE2 A;  3FXU A;  5ICT A;  2Q89 A;  2I3V A;  5JTY A;  1NMU A;  4H8I A;  5HPQ A;  3T9V A;  3HHG A;  4YIC A;  4ELR A;  3GBA A;  1M5B A;  2GH9 A;  5AA4 A;  1N7X A;  1TWY A;  1SYH A;  2RCA A;  3DEL B;  2O68 A;  2XXV A;  3TTN A;  2THI A;  3G3K A;  4EQ7 A;  4RK2 A;  1UTB A;  5TPA B;  1PBQ A;  4YB6 A;  4DXB A;  1B2H A;  4DE8 A;  1R1N A;  2A5T A;  4H5G A;  2Z8E A;  4F39 A;  1B5I A;  4F1U A;  3K00 A;  3KOS A;  4FIM A;  2OBG A;  1L5T A;  3O6H A;  4DDD A;  3K0V A;  2RC7 A;  3FJ7 A;  2NWJ A;  4U21 A;  1BIY A;  4JXI A;  5H8F B;  2F6P A;  4EUO A;  3QIM A;  4WEP A;  3R6U A;  1EZ9 A;  3IJO B;  4QFK A;  1I69 A;  1GV8 A;  4O3B A;  3V5A A;  3O6G A;  2F5X A;  1NL5 A;  3N6T A;  4R9G A;  2QS2 A;  1M5F A;  2FA7 A;  2Y7W A;  1I6A A;  5AA2 A;  1FQD A;  4PE5 B;  1F9B A;  3UN6 A;  4NF6 A;  1PB9 A;  3OXN A;  3TDJ A;  1URD A;  1ELJ A;  5TU0 A;  1B0L A;  4R75 A;  1ZJL A;  1MY0 A;  5IKB A;  4YKI A;  3VV5 A;  1SW4 A;  1OLA A;  1MXU A;  4RNS A;  4L17 A;  4YB5 A;  2ABH A;  5DTB A;  3OO6 A;  4EQB A;  2Q2A A;  1FTJ A;  5AA3 A;  3TOD A;  2VP1 A;  4O3A A;  4QFN A;  3FIR A;  2H99 A;  4HW8 A;  3IJX B;  4X9T A;  2I6E A;  3CRB A;  3V8X B;  3S9M C;  4Q5T A;  3MWB A;  4BDR A;  3TQL A;  3H6T A;  1ZLQ A;  1Q35 A;  3ONM A;  1I6B A;  5H8N B;  4R2B A;  1MXW A;  4RY1 A;  4OFL A;  4YZZ A;  5H8F A;  3L6G A;  2G29 A;  1JW4 A;  1AOV A;  1IIT A;  3N26 A;  1UQW A;  4F2O A;  1N84 A;  3TTL A;  5FHO A;  2XXP A;  2I49 A;  4KFQ A;  2R9J A;  1LAF E;  3LSF B;  2F6G A;  2A5S A;  2Z23 A;  1Y4C A;  3BFT A;  4F31 B;  1B3L A;  3CFL A;  3TKD A;  2IEE A;  5I56 B;  1MPB A;  4OWD A;  2GFE A;  1QUI A;  1FTO A;  2HAV A;  1XOC A;  4PET A;  1EZO A;  4JSO A;  4AB6 A;  4G8M A;  1PDA A;  1Y9U A;  1O64 A;  5K2Y A;  1LAG E;  3IO6 A;  2XHD A;  5FTH A;  2I0C A;  2V25 A;  3TZA A;  1B32 A;  1B7H A;  4OYV A;  3PU5 A;  2CZL A;  4U1Z A;  3GLB A;  3PPN A;  3Q26 A;  3TMG A;  1YPN A;  3ZKL A;  4EF2 A;  4G77 A;  2UVI A;  2QS1 A;  1ZKB A;  1JW1 A;  1PB8 A;  1PB7 A;  3MJN A;  2H98 A;  4JDF A;  4ELQ A;  4QSC A;  3EHT A;  3G3J A;  5ITO A;  3E3K A;  3SET A;  5AA1 A;  1T0K A;  1KWH A;  5HM4 B;  3FJM A;  3FVO A;  5CMK A;  2AYS A;  4KPT A;  1VR5 A;  1GR2 A;  3KBR A;  1GVC A;  4KQP A;  1JVY A;  4QHQ A;  1OVT A;  3VFJ A;  2REG A;  5ICQ A;  4MFI A;  2HAU A;  3PUX E;  4U23 A;  2E1S A;  4N13 A;  1QKA A;  1IXH A;  4KD5 A;  2V3U A;  2Y84 A;  3H7M A;  3JZJ A;  1SYI A;  3W15 C;  3F11 A;  3S9L C;  1IZ1 A;  1MM6 A;  1VFE A;  3QUF A;  2XXU A;  5I59 A;  3CIJ A;  1B3E A;  5I56 A;  2DWJ A;  3H03 A;  4KR5 A;  3BFU A;  3Q27 A;  3M8U A;  3QXM A;  2O7U A;  4Q0C A;  3FAS A;  1EU8 A;  3OEM A;  3SEY A;  2QRY A;  2DWA A;  1P1U A;  1DOT A;  2I4B A;  5FHN A;  2HXW A;  3AXF A;  3B6T A;  4AB5 A;  4RK9 A;  3KN7 A;  2O84 X;  3FVK A;  2H9B A;  1MPD A;  3KN8 A;  4JWX A;  5I84 A;  1MS7 A;  1XVY A;  2HFB A;  1ZMG A;  1RKM A;  1ATG A;  1OQG A;  4PFU A;  4GXA A;  2OWT A;  2PT2 A;  3SKP A;  4R72 A;  2Q8J A;  5I57 B;  3TCH A;  2ZMB A;  3E13 X;  3OO8 A;  2RC9 A;  1QVS A;  3U94 A;  1IQ7 A;  4U4S A;  3OEK A;  1JQF A;  4IB2 A;  3PUY E;  2FYI A;  5BWJ A;  1RYX A;  1PC3 A; 
#chains in the Genus database with same CATH topology
 4F22 A;  3IOV A;  4MLV A;  3CVG A;  4N8G A;  1XS5 A;  3MVZ A;  4I9D A;  3RYD A;  3RGY A;  3ODB A;  2CMO A;  1DPP A;  1FQA A;  3CI8 A;  3PMW A;  1WDN A;  1MXZ A;  3U93 A;  5IZZ A;  5JK4 A;  1VDW A;  3PPQ A;  1FBF A;  3UIF A;  3UOR A;  3K6X A;  2DXY A;  1FQB A;  4ECF A;  1P1O A;  1M5C A;  1HSL A;  4MBP A;  3OOA A;  4GF8 A;  1NKX A;  1SW2 A;  2Z8F A;  2ALU A;  2PVU A;  1ZBM A;  4KI0 E;  4RA1 A;  3KBZ A;  3K2D A;  4GX3 A;  5ET6 A;  4NX1 A;  3Q25 A;  4E0X A;  4ZEF A;  4DIG A;  3C36 A;  4JWO A;  4RJZ A;  4QF9 A;  4YAH X;  1JET A;  4G4P A;  2UVJ A;  1Y20 A;  1Y1M A;  3ZS6 A;  1H44 A;  1KA0 A;  5IZ3 B;  2DDK A;  1AH5 A;  2F97 A;  3MC2 A;  4FE8 A;  3MW0 A;  3Q28 A;  3RY3 A;  2RKM A;  3T66 A;  1LB9 A;  1OIB A;  1FPF A;  3LSX A;  3T9H B;  4BDM A;  4GX6 A;  3C4M A;  2HXR A;  4NTL A;  2ZZV A;  5H8Q B;  1QUK A;  2REJ A;  1MH3 A;  3IB1 A;  5L9S A;  3FV1 A;  3FZV A;  3MPL A;  4I1D A;  4XF5 A;  1POY 1;  3G3F A;  5FBP A;  3HO7 A;  4FEB A;  2Q88 A;  5I57 A;  5DYH A;  1LBC A;  5IM2 A;  1FPE A;  3T0J A;  3OEL A;  3PUZ E;  1JVX A;  1AL3 A;  2PX1 A;  5IZ1 A;  3LR1 A;  3QYT A;  1NV6 A;  5K2X A;  3TTR A;  2D21 A;  1JNF A;  4OVR A;  1USY H;  1DK4 A;  4R73 A;  1FBP A;  4PFY A;  4RPO A;  2CEX A;  1NI9 A;  4AQ4 A;  4XIG Q;  1R9Q A;  1I6Q A;  3PUV E;  3TFL A;  4X8R A;  4OEN A;  4FAT A;  1S9T A;  2YJP A;  3UA8 A;  1SI1 A;  3FVG A;  1N0T A;  3PPR A;  1ANF A;  5I7I A;  1B58 A;  1B52 A;  1P1N A;  3A09 A;  4ZE9 A;  4X04 A;  2DXR A;  4IGT A;  1N3W A;  4C1U A;  4I62 A;  4PE3 A;  1NNK A;  3KSJ A;  3RPW A;  5L9O A;  3LBS A;  2O1L A;  1FW0 A;  2DS9 A;  4TLM B;  5IAI A;  2H4I A;  4N6D A;  3IL1 B;  2WBD A;  3OO9 A;  3BBR A;  3U92 A;  2BJJ X;  4OVS A;  2DE3 A;  5IZ3 A;  4GL0 A;  4OTE A;  2NUV A;  4G2Z A;  2QMX A;  1A7L A;  3MPK A;  3K6V A;  1MXY A;  4ZE8 A;  4QFO A;  2F7B A;  4O8M A;  2QMW A;  2CEY A;  1FJ6 A;  3IOU A;  2OK2 A;  1ZTY A;  2O1M A;  5FTI A;  5LDZ A;  2Z22 A;  4PCD A;  1SPI A;  5AA2 D;  2PCR A;  5H8Q A;  1YTV A;  4R74 A;  4N07 A;  1B7U A;  1MM7 A;  1Y3N A;  2Q74 A;  4F3B A;  4I8C A;  4DLD A;  5A5X B;  3PUW E;  3QMF A;  4UA8 A;  5KDT B;  5H8H B;  1FBH A;  3E78 A;  4IO2 A;  2VOZ A;  4IO7 A;  4P47 A;  1RYO A;  5TPA A;  4F29 A;  4XXU A;  2YLN A;  2YPN A;  3IO4 A;  4X1B A;  2Y7R A;  4UAB A;  1QUL A;  4ELP A;  3W9W A;  3IX1 A;  4C1T A;  1B1H A;  2XA5 A;  1URG A;  3RT6 B;  2D3I A;  4P11 A;  5I3S A;  3LSL A;  2GHA A;  3K4U A;  3CG1 A;  3I3V A;  2O69 A;  4WXJ A;  3QSL A;  2GQ1 A;  3DP6 A;  3K6U A;  4QSE A;  3NOH A;  4DZ1 A;  1DTZ A;  4MNI A;  4LVQ A;  2Y5L A;  1FBE A;  4G61 A;  4MNC A;  4DCX A;  3FUZ A;  4I3E A;  1RDZ A;  4HE0 A;  4HS7 A;  1AIV A;  3B50 A;  4PBH A;  3A3U A;  3FXR A;  4LZ7 A;  3DM0 A;  1H3D A;  4LZ8 A;  1WOD A;  2CZK A;  5DVF A;  4N17 A;  2NXO A;  3FD3 A;  1LBY A;  1GGG A;  1NNP A;  3RTF B;  3E79 A;  2I58 A;  3P7I A;  2B3F A;  4H45 A;  1FPB A;  1FPI A;  1CE2 A;  1S7Y A;  1TFA A;  2V3Q A;  4G68 B;  4JVD A;  4G68 C;  4QFL A;  4F3G A;  3VXC A;  5ITP A;  3R26 A;  2XXI A;  3USD A;  1FTK A;  4OEV A;  2XXR A;  2XWK A;  4OFJ A;  3FBP A;  3ECR A;  5I58 B;  3BKI B;  3C35 A;  4RPN A;  2ZNT A;  1SVX B;  1VFD A;  1O63 A;  1B05 A;  4ONY A;  3PD9 A;  1B51 A;  4THI A;  4KXP A;  3T9U A;  2XXX A;  1G0H A;  3HST A;  1NFT A;  1DTG A;  3O28 A;  4FBP A;  3TCG A;  5B70 A;  1MY2 A;  4ZS9 A;  4IO4 A;  3GZG A;  3EHU A;  4H8J A;  3N5L A;  1M5E A;  1MQI A;  2V93 A;  5A5X A;  1A99 A;  1B3F A;  2VD3 A;  1US4 A;  4IGR A;  2OCU A;  5KDT A;  5H8H A;  5JEI A;  1DCU A;  3D4G A;  2DQV A;  3G7W A;  1N76 A;  1IXC A;  1KZ8 A;  1SBP A;  1H76 A;  2F8D A;  3MQ9 A;  4OVQ A;  4YMB A;  4LQ5 A;  2PT1 A;  3B6Q A;  2O6A A;  1LBV A;  1ZIU A;  3MVX A;  4GQO A;  1IUD A;  4F3P A;  2G93 A;  3K02 A;  3G3G A;  1QGX A;  1MY1 A;  4OET A;  3FVN A;  4NF5 B;  1EH3 A;  3E4R A;  5DVI A;  2M8C A;  2F3D A;  5FHM A;  5L9M A;  3THI A;  3JYR A;  4OQO A;  1NUX A;  5H8N A;  2PYY A;  3KEI A;  3TTM A;  1NV1 A;  3SEW A;  2IA4 A;  4PF8 A;  3DP4 A;  4HXV A;  4Q8R A;  3KN3 A;  2XXH A;  4XKP A;  2DYX A;  3OSQ A;  3S9E A;  1TT1 A;  2HZK A;  4MF3 A;  2DVC A;  3KJ7 A;  1YYZ A;  3MP8 A;  1NUY A;  3O2A A;  2ONK E;  3T22 A;  3TPA A;  3FV2 A;  2QL3 A;  3EKI A;  3A3C A;  1O7T A;  3I6V A;  4G68 A;  1P1Q A;  1PEB A;  2O51 A;  3TUS A;  1MDP 1;  1LB8 A;  5ISU A;  1N3X A;  2X26 A;  4F19 A;  2ZZX A;  3L6H A;  2KQZ A;  4OZ9 A;  5CI5 A;  5I58 A;  1LGB C;  1QKB A;  1XC1 A;  4RYA A;  4GOT A;  1MY3 A;  4FOR A;  4H65 A;  1FBC A;  2Q2C A;  3C33 A;  3GBB A;  2VT5 A;  2P1S A;  1K9Z A;  4KYE A;  3C9H A;  2P0S A;  1SW5 A;  3SER A;  3ZKK A;  4QRZ A;  4Q30 B;  4PFT A;  1IMA A;  2ONR A;  1H45 A;  5LOM A;  4OA4 A;  1NNF A;  3D1R A;  2Y7P A;  1J1N A;  4ZED A;  3IOT A;  4GWW A;  4MMP A;  3B6W A;  4LON B;  3PV0 E;  3IAZ A;  4E0W A;  3IOR A;  2RF1 A;  3VLW A;  5CC2 A;  4PDD A;  1FCK A;  3KOT A;  2DVZ A;  2ZYO A;  3SEU A;  1LLS A;  3K1M A;  3UK4 A;  4IO6 A;  3EPE A;  1Y1Z A;  2WYK A;  4GWS A;  5ET7 A;  4NF5 A;  4MCO A;  3OO7 A;  2QSX A;  4GFR A;  3I5O A;  3B7D A;  3D4C A;  1UTB B;  5A5L A;  1BP5 A;  5I5P A;  1LAX A;  2XX7 A;  4PTK A;  3O97 A;  1SI0 A;  3RNN A;  2R8T A;  4O3C A;  2F34 A;  3T1B A;  3CFX A;  4BDN A;  3HV1 A;  4X1D A;  2UVH A;  4DXC A;  2P2A A;  1AWB A;  2VD2 A;  4PGP A;  1LEV A;  2LAO A;  1B46 A;  4BDO A;  1D9Q A;  3KGC A;  3N94 A;  3T93 B;  1N04 A;  1FPL A;  1MQD A;  1Y3Q A;  4YKK A;  2ANJ A;  2V84 A;  1TFD A;  2HQ0 A;  2ZYM A;  4M1V A;  4GLI A;  4ZEI A;  2FIX A;  4H67 A;  3DLN A;  4OMB A;  1LBW A;  2R6G E;  4EF1 A;  4U22 A;  4G8H A;  2AL5 A;  1IMB A;  1IEJ A;  1NV3 A;  1Y4T A;  3V89 B;  4ZZA A;  5J1D A;  3QUJ A;  4IY6 A;  3G3H A;  1QUJ A;  3W9V A;  4NED A;  4FAJ A;  3KJT A;  2XXY A;  4TLL B;  4NE4 A;  4PAF A;  3IOW A;  3KFM A;  3MUQ A;  4IY5 A;  2F36 A;  3MP1 A;  1XI6 A;  3EHS A;  3VLV A;  2QPQ A;  2XX9 A;  1B7Z A;  4XKQ A;  1B4Z A;  1OMP A;  3KZG A;  3WAF A;  1HSJ A;  4NF4 B;  2F78 A;  4BLA A;  1UTH B;  1FBD A;  2OLB A;  1YZ0 A;  3M3K A;  1B4H A;  2GRV A;  2DWH A;  3KSX A;  1OQH A;  2WBB A;  2AIX A;  3ZSF A;  1LFI A;  1JW5 A;  1JEU A;  4DXU A;  5CM6 A;  2OX3 A;  4GXS B;  2I3W A;  2E0S A;  4MH5 A;  3MBP A;  2RC8 A;  2DWI A;  2DOJ A;  2OWZ A;  4EDP A;  1N7W A;  3IFC A;  4ZZE A;  5I2K B;  1FPJ A;  4LA9 A;  3N6U A;  3TAJ A;  1FQC A;  1MDQ A;  4OFO A;  5CMM A;  5H8S A;  5ESY A;  2I0B A;  4I3Y A;  3CFZ A;  4Z0I A;  4QFP A;  4P9K A;  3CR9 A;  3TQW A;  2D5W A;  3K01 A;  3MVY A;  4P56 A;  2UXA A;  1YCJ A;  1MXV A;  3OMB A;  1UIU A;  4HE2 A;  4XKN A;  3Q29 A;  3MZB A;  4RXL A;  1XT8 A;  4OXV A;  2F7C A;  4N6P A;  1G0I A;  4NF8 B;  2FNC A;  4ZDM A;  1BLF A;  1P99 A;  3LC8 A;  3FXB A;  3IB2 A;  5KCJ B;  3RT8 A;  1LAH E;  2QS3 A;  1POT A;  4GWY A;  4FEC A;  5F7V A;  4LAT A;  1LFG A;  2ZYK A;  2UVG A;  1A40 A;  4NQ8 A;  4Z7E A;  5EQ7 A;  4YB7 A;  5M2V A;  3VVE A;  2KLF A;  3U1O A;  4OHN A;  1EZP A;  4PQJ A;  2PBW A;  4NWC A;  2Y7I A;  1UIV A;  1WVJ A;  1D9V A;  1BTJ A;  5EYH A;  3H6W A;  3RUM A;  4R6K A;  1B5H A;  2Q9T A;  4WKM A;  4JB7 A;  1B6H A;  3PMV A;  1MY4 A;  1LCF A;  4X48 A;  4R9F A;  4M4G A;  5DVJ A;  4LP2 B;  4NF4 A;  1UTH A;  4OVP A;  1MQH A;  4IR8 A;  4EQ9 A;  2XXW A;  3G3I A;  2UYF A;  2OJT A;  1NV2 A;  2ZXT A;  4GBW A;  4N8Y A;  1A8F A;  4LZ5 A;  4OAN A;  4GWO A;  4GIZ A;  4PGN A;  1H43 A;  3C31 A;  1IXG A;  3ILU B;  3QAX A;  4POW A;  4ISU A;  5CBS A;  4N15 A;  4QSD A;  3SEV A;  2HPG A;  1MG1 A;  3M3F A;  2FHY A;  2XX8 A;  2WKY A;  4GL8 A;  2WX9 A;  4U2R A;  5I2K A;  3MZ1 A;  4PDH A;  2B65 A;  1ZU0 A;  2QJE A;  4JVC A;  1Z7N E;  2ONS A;  4MLQ A;  5TP9 B;  1Q9D A;  3UGW A;  4F2Q A;  2H5Y A;  1IMC A;  2Z8D A;  3PMX A;  3FAT A;  5ELV A;  1PBP A;  3RN8 A;  3VXB A;  4H1X A;  3S4U A;  4TQU Q;  1M5D A;  5HBC A;  1LFH A;  4BDQ A;  1FPD A;  5EHM A;  2XXQ A;  4WED A;  4NF8 A;  3VE1 B;  2VGQ A;  4MEV A;  4U4X A;  2OWS A;  3HCQ A;  5KCJ A;  3FGS A;  3V83 A;  3S2V A;  3RTW B;  4GRK A;  1FTL A;  2I4C A;  3K1N A;  3VVD A;  1Z7M E;  4LUB A;  4G8N A;  4F18 A;  3WAE A;  1FTM A;  1SDX A;  5L8D A;  4ELO A;  4KCC A;  4P0I A;  1D4N A;  4BDL A;  4UAC A;  2QS4 A;  1LCT A;  3CSG A;  1JP4 A;  3GXA A;  2XD3 A;  5I59 B;  3RLF E;  2Q8M A;  4EXL A;  1S50 A;  2F7A A;  2RIN A;  4FED A;  3QK6 A;  3OD7 A;  2I48 A;  1HSE A;  3KC1 A;  4C0R A;  3A29 A;  3EN3 A;  3UP9 A;  1D9Y A;  1FQF A;  4LN5 A;  4R6H A;  1MQJ A;  2FIE A;  3PPP A;  2DSF A;  3U72 A;  3VLU A;  1MRP A;  4OER A;  2PMS A;  2VHA A;  4PFR A;  4NGU A;  2DP8 A;  1BKA A;  5I2N B;  3H06 B;  2WYP A;  3HN0 A;  1FTA A;  3IFA A;  2XD2 A;  1NV4 A;  2V3T A;  4K3F A;  1LBZ A;  1KA1 A;  2FBP A;  4ZEK A;  3TTK A;  1IMF A;  2HZL A;  1JEV A;  2Y5K A;  4JSD A;  4OEU A;  3VDF A;  3MP6 A;  5CMB A;  4R2F A;  3VVF A;  1FQE A;  4XKR A;  1B3G A;  1NNT A;  4U1O A;  4NN3 A;  3IB0 A;  5EQ8 A;  3H3G A;  2F35 A;  1INP A;  5TP9 A;  3TEP A;  2XWV A;  3LSW A;  2Y7K A;  1MH4 A;  4HCW A;  3MVW A;  4JBZ A;  4ND9 A;  1MXX A;  3CSB A;  3O66 A;  1A8E A;  3PGF A;  5DW8 A;  2PFZ A;  4TOZ A;  4KCD A;  5DEX B;  1R9L A;  1QJM A;  5DT6 A;  4F1V A;  5F1Q A;  3IK6 B;  4LQ2 A;  1OLC A;  2HCA A;  4IO3 A;  1SQY A;  4GWU A;  1EYK A;  1QW0 A;  4FJP A;  5B7D A;  1CB6 A;  1USY E;  3TCF A;  5T3J A;  4P1L A;  3T96 B;  3IR1 A;  1MQG A;  3H6V A;  1LBB A;  4MNP A;  2H25 A;  1RDY A;  1FPK A;  2HEU A;  3CG3 A;  3O9P A;  1NH7 A;  1K9Y A;  4MAG A;  2ESN A;  3LUY A;  4YKJ A;  2GHB A;  4QBA A;  1B0H A;  4IO5 A;  2ZNU A;  3HPI A;  3O6I A;  1XVX A;  3C34 A;  3K1P A;  1B9J A;  2DE4 A;  1GTK A;  1AMF A;  1DPE A;  2X7Q A;  3JV9 A;  5CRY A;  3HFU A;  4GD5 A;  3R7X A;  3E9X A;  5I2N A;  4EXK A;  2UYE A;  5JTY B;  4HE1 A;  1IIW A;  3LUZ A;  4NWD A;  4POX A;  3FXQ A;  5BUU A;  4ESW A;  5AA4 B;  3EQ1 A;  4QXD A;  1B3H A;  4AS4 A;  3ILT B;  3MZ9 A;  4YKP A;  2ZNS A;  2AL4 A;  4YU0 A;  1DMB A;  5KZT A;  2B3B A;  1XHY A;  2R71 A;  3FJG A;  4H5F A;  1VE4 A;  4NMY A;  1SW1 A;  3U8Q A;  2NVU B;  2NOO A;  2KR0 A;  4PFW A;  1Y3P A;  4HTG A;  4GVO A;  3SDF A;  1CNQ A;  4YMA A;  1A55 A;  4ESX A;  2A5T B;  1BK4 A;  2W7Y A;  2XXT A;  3MAM A;  3M3L A;  1P1W A;  3T9X B;  3H4Z A;  3OSR A;  4F3S A;  5DEX A;  4O7I A;  3OEN A;  2X7P A;  2QFL A;  5EHS A;  1TXF A;  3SES A;  4KYS A;  1FSA A;  4H6D A;  3O29 A;  4O7M A;  2PFY A;  3H6U A;  1VSO A;  3TEL A;  1NV5 A;  3RQT A;  4R6Y A;  2ZYN A;  1OVB A;  5EYF A;  3K6W A;  2RCB A;  4P0G A;  2V4C A;  4XFE A;  3BIH A;  1A54 A;  2OZZ A;  3HHF A;  1LST A;  1URS A;  5EQ9 A;  1DSN A;  1IXI A;  3SEX A;  4HCY A;  2O7I A;  4F1Y A;  4ZEC A;  3C32 A;  4KHZ E;  4XTC Q;  3EF7 A;  4JWY A;  4OVJ A;  1YAE A;  5AE4 A;  1II5 A;  4DCY A;  4PP0 A;  5AA2 B;  1MPC A;  3KG2 A;  4ZEB A;  5CMC A;  1SD3 A;  3S9N C;  3PPO A;  4OES A;  4KYD A;  1NH8 A;  1US5 A;  4NF6 B;  1R6Z A;  3TYH A;  4XEQ A;  1B5J A;  4NHB A;  5LTC A;  3B8B A;  5CBR A;  3PD8 A;  3DP8 A;  1Q1K A;  4H0W A;  1NUW A;  1B1X A;  1B40 A;  1D3K A;  2DE2 A;  3FXU A;  5ICT A;  2Q89 A;  2I3V A;  5JTY A;  4P3L A;  4AS5 A;  1NMU A;  4H8I A;  5HPQ A;  3T9V A;  3HHG A;  4PF6 A;  4YIC A;  4ELR A;  4P8B A;  3GBA A;  1M5B A;  2GH9 A;  2VPN A;  5AA4 A;  1N7X A;  1EYI A;  1TWY A;  1SYH A;  2RCA A;  3DEL B;  2O68 A;  2XXV A;  3TTN A;  2THI A;  3G3K A;  4EQ7 A;  4RK2 A;  1UTB A;  5TPA B;  4PFB A;  1PBQ A;  4YB6 A;  4DXB A;  1B2H A;  4DE8 A;  2QVR A;  1R1N A;  2A5T A;  4H5G A;  2Z8E A;  2L5V A;  4F39 A;  3PTY A;  1B5I A;  2JJK A;  4F1U A;  3K00 A;  3KOS A;  3LV0 A;  4FIM A;  2OBG A;  1L5T A;  3O6H A;  4DDD A;  3K0V A;  2RC7 A;  3FJ7 A;  3ROJ A;  2NWJ A;  4U21 A;  4JVI A;  1BIY A;  4JXI A;  5H8F B;  2CZH A;  2F6P A;  4EUO A;  1IME A;  4GWZ A;  3QIM A;  4WEP A;  3R6U A;  1EZ9 A;  3IJO B;  4QFK A;  1I69 A;  2FVZ A;  1GV8 A;  4O3B A;  3V5A A;  3O6G A;  2F5X A;  1NL5 A;  3N6T A;  4R9G A;  3SZP A;  1NV0 A;  4N81 A;  2QS2 A;  1M5F A;  2FA7 A;  2Y7W A;  1EYJ A;  1I6A A;  5AA2 A;  1FQD A;  4PE5 B;  1F9B A;  3UN6 A;  4NF6 A;  1PB9 A;  4NAP A;  3OXN A;  3TDJ A;  1URD A;  4I40 A;  1ELJ A;  2XWO A;  5TU0 A;  4PAI A;  1B0L A;  1IMD A;  5IGA A;  3BIG A;  4R75 A;  1ZJL A;  1MY0 A;  5IKB A;  4YKI A;  3VV5 A;  1SW4 A;  1OLA A;  1MXU A;  4RNS A;  4L17 A;  4YB5 A;  2ABH A;  5DTB A;  3OO6 A;  4EQB A;  2Q2A A;  1FTJ A;  5AA3 A;  3TOD A;  2VP1 A;  4O3A A;  4QFN A;  2B4L A;  3FIR A;  2H99 A;  4HW8 A;  3IJX B;  1NV7 A;  2HHM A;  2CZI A;  4X9T A;  2I6E A;  3CRB A;  3V8X B;  2P3N A;  3S9M C;  4Q5T A;  3MWB A;  4BDR A;  3TQL A;  4N91 A;  3H6T A;  1ZLQ A;  1Q35 A;  3ONM A;  1I6B A;  5H8N B;  4R2B A;  1MXW A;  4RY1 A;  4OFL A;  4YZZ A;  1RDX A;  5H8F A;  3L6G A;  2G29 A;  1JW4 A;  1AOV A;  5EQA A;  1IIT A;  2VPO A;  3N26 A;  1UQW A;  4F2O A;  4PC9 A;  1N84 A;  3TTL A;  3MYU A;  5FHO A;  2XXP A;  2I49 A;  4KFQ A;  2R9J A;  1NUZ A;  1LAF E;  1YXI A;  5ET8 A;  3LSF B;  2F6G A;  2A5S A;  4PBQ A;  2Z23 A;  1Y4C A;  3BFT A;  3U65 A;  1B3L A;  4F31 B;  3CFL A;  1FPG A;  3TKD A;  2IEE A;  5I56 B;  4MHF A;  1MPB A;  4OWD A;  2GFE A;  1QUI A;  1FTO A;  2HAV A;  1XOC A;  4PET A;  1EZO A;  4JSO A;  4AB6 A;  4G8M A;  1PDA A;  4O94 A;  1Y9U A;  1O64 A;  5K2Y A;  1LAG E;  4OVT A;  3IO6 A;  2XHD A;  4GBV A;  5FTH A;  2I0C A;  2V25 A;  3TZA A;  1B32 A;  1B7H A;  2BJI A;  4OYV A;  3PU5 A;  2CZL A;  4U1Z A;  3GLB A;  3PPN A;  3Q26 A;  3TMG A;  1YPN A;  2QVV A;  3ISP A;  3ZKL A;  3RPL B;  4EF2 A;  1DBZ A;  4G77 A;  2UVI A;  2QS1 A;  1ZKB A;  1JW1 A;  1FBG A;  1PB8 A;  1PB7 A;  3MJN A;  2H98 A;  3GYY A;  4JDF A;  4ELQ A;  4QSC A;  3EHT A;  4PFI A;  3G3J A;  5ITO A;  3E3K A;  3SET A;  5AA1 A;  1T0K A;  1KWH A;  4NF0 A;  5HM4 B;  3FJM A;  3FVO A;  5CMK A;  2AYS A;  4MIJ A;  4KPT A;  1VR5 A;  2ZZW A;  4DI3 D;  1FRP A;  1GR2 A;  3KBR A;  1GVC A;  2P3V A;  4KQP A;  1JVY A;  4QHQ A;  3KC0 A;  5F24 A;  3CHG A;  1OVT A;  3MST A;  3VFJ A;  4H46 A;  2REG A;  4PAK A;  4N6K A;  5ICQ A;  4MFI A;  2HAU A;  3PUX E;  4U23 A;  2E1S A;  4GWX A;  5ET5 A;  4N13 A;  1QKA A;  1FJ9 A;  1IXH A;  4KD5 A;  4GX4 A;  2V3U A;  2Y84 A;  3H7M A;  3JZJ A;  1SYI A;  3W15 C;  3F11 A;  3S9L C;  5EYG A;  1IZ1 A;  5J16 A;  1MM6 A;  1VFE A;  3QUF A;  2XXU A;  5I59 A;  3CIJ A;  1B3E A;  5I56 A;  2DWJ A;  3H03 A;  4KR5 A;  3BFU A;  3Q27 A;  3M8U A;  2XWI A;  2MKZ A;  3QXM A;  2O7U A;  4MJO A;  4P1E A;  4Q0C A;  3FAS A;  1EU8 A;  3OEM A;  3SEY A;  2QRY A;  2DWA A;  1P1U A;  2B4M A;  1DOT A;  2F3B A;  2I4B A;  5FHN A;  2HXW A;  3AXF A;  2XXK A;  3B6T A;  4AB5 A;  4RK9 A;  3KN7 A;  2O84 X;  3FVK A;  2H9B A;  1MPD A;  4N4U A;  4NG7 A;  3KN8 A;  4JWX A;  4MX6 A;  5I84 A;  2WEF A;  4DI4 B;  2QVU A;  1MS7 A;  1XVY A;  2HFB A;  1ZMG A;  1RKM A;  1LBX A;  3RPL A;  1ATG A;  1OQG A;  4PFU A;  4GXA A;  2OWT A;  2PT2 A;  3SKP A;  4R72 A;  2Q8J A;  5I57 B;  3TCH A;  2ZMB A;  3E13 X;  3OO8 A;  2RC9 A;  1QVS A;  3U94 A;  1IQ7 A;  4U4S A;  3OEK A;  1JQF A;  4IB2 A;  3PUY E;  2FYI A;  5BWJ A;  1RYX A;  1PC3 A; 
#chains in the Genus database with same CATH homology
 4F22 A;  3IOV A;  4MLV A;  3CVG A;  1XS5 A;  3MVZ A;  4I9D A;  3RGY A;  3ODB A;  2CMO A;  1DPP A;  1FQA A;  3CI8 A;  3PMW A;  1WDN A;  1MXZ A;  3U93 A;  5JK4 A;  3PPQ A;  3UIF A;  3UOR A;  3K6X A;  2DXY A;  1FQB A;  4ECF A;  1P1O A;  1M5C A;  1HSL A;  4MBP A;  3OOA A;  4GF8 A;  1NKX A;  1SW2 A;  2Z8F A;  2ALU A;  2PVU A;  1ZBM A;  4KI0 E;  4RA1 A;  3K2D A;  4E0X A;  3Q25 A;  4ZEF A;  4DIG A;  3C36 A;  4JWO A;  4RJZ A;  4QF9 A;  4YAH X;  1JET A;  4G4P A;  2UVJ A;  1Y20 A;  1Y1M A;  3ZS6 A;  1H44 A;  1AH5 A;  2F97 A;  3MC2 A;  4FE8 A;  3MW0 A;  3Q28 A;  3RY3 A;  2RKM A;  3T66 A;  1LB9 A;  1OIB A;  3LSX A;  3T9H B;  4BDM A;  3C4M A;  4NTL A;  5H8Q B;  1QUK A;  2REJ A;  1MH3 A;  3IB1 A;  5L9S A;  3FV1 A;  3FZV A;  3MPL A;  4I1D A;  1POY 1;  3G3F A;  3HO7 A;  4FEB A;  2Q88 A;  5I57 A;  5DYH A;  1LBC A;  3OEL A;  3PUZ E;  1JVX A;  1AL3 A;  2PX1 A;  3LR1 A;  3QYT A;  5K2X A;  3TTR A;  2D21 A;  1JNF A;  1USY H;  4R73 A;  4PFY A;  4RPO A;  4AQ4 A;  4XIG Q;  1R9Q A;  1I6Q A;  3PUV E;  3TFL A;  4OEN A;  4FAT A;  1S9T A;  2YJP A;  3UA8 A;  1SI1 A;  3FVG A;  1N0T A;  3PPR A;  1ANF A;  1B58 A;  1B52 A;  1P1N A;  3A09 A;  4ZE9 A;  2DXR A;  4IGT A;  1N3W A;  4C1U A;  4I62 A;  1NNK A;  3KSJ A;  3RPW A;  5L9O A;  3LBS A;  2O1L A;  1FW0 A;  2DS9 A;  4TLM B;  5IAI A;  2H4I A;  3IL1 B;  3OO9 A;  3BBR A;  3U92 A;  2BJJ X;  2DE3 A;  4GL0 A;  4OTE A;  2NUV A;  4G2Z A;  2QMX A;  1A7L A;  3MPK A;  3K6V A;  1MXY A;  4ZE8 A;  4QFO A;  2F7B A;  2QMW A;  3IOU A;  2OK2 A;  1ZTY A;  2O1M A;  5FTI A;  2Z22 A;  5AA2 D;  5H8Q A;  1YTV A;  4R74 A;  4N07 A;  1B7U A;  1MM7 A;  1Y3N A;  4F3B A;  4I8C A;  4DLD A;  5A5X B;  3PUW E;  4UA8 A;  5KDT B;  5H8H B;  4IO2 A;  2VOZ A;  4IO7 A;  1RYO A;  5TPA A;  4F29 A;  4XXU A;  2YLN A;  2YPN A;  3IO4 A;  4X1B A;  2Y7R A;  1QUL A;  4ELP A;  3W9W A;  3IX1 A;  4C1T A;  1B1H A;  1URG A;  3RT6 B;  2D3I A;  4P11 A;  3LSL A;  2GHA A;  3K4U A;  3CG1 A;  3I3V A;  2O69 A;  4WXJ A;  3QSL A;  3DP6 A;  3K6U A;  4QSE A;  4DZ1 A;  1DTZ A;  4LVQ A;  4DCX A;  3FUZ A;  1AIV A;  4HS7 A;  3A3U A;  3FXR A;  4LZ7 A;  3DM0 A;  1H3D A;  4LZ8 A;  1WOD A;  5DVF A;  2NXO A;  3FD3 A;  1GGG A;  1NNP A;  3RTF B;  2I58 A;  3P7I A;  2B3F A;  1CE2 A;  1S7Y A;  1TFA A;  2V3Q A;  4G68 B;  4G68 C;  4QFL A;  4F3G A;  3VXC A;  5ITP A;  3R26 A;  2XXI A;  3USD A;  1FTK A;  4OEV A;  2XXR A;  4OFJ A;  3ECR A;  5I58 B;  3BKI B;  3C35 A;  4RPN A;  2ZNT A;  1SVX B;  1VFD A;  1O63 A;  1B05 A;  4ONY A;  3PD9 A;  1B51 A;  4THI A;  3T9U A;  2XXX A;  3HST A;  1NFT A;  1DTG A;  3O28 A;  3TCG A;  5B70 A;  1MY2 A;  4ZS9 A;  4IO4 A;  3GZG A;  3EHU A;  4H8J A;  3N5L A;  1M5E A;  1MQI A;  2V93 A;  5A5X A;  1A99 A;  1B3F A;  2VD3 A;  1US4 A;  4IGR A;  2OCU A;  5KDT A;  5H8H A;  5JEI A;  3D4G A;  2DQV A;  3G7W A;  1IXC A;  1N76 A;  1SBP A;  1H76 A;  2F8D A;  3MQ9 A;  4YMB A;  4LQ5 A;  2PT1 A;  3B6Q A;  2O6A A;  1ZIU A;  3MVX A;  4GQO A;  1IUD A;  4F3P A;  2G93 A;  3K02 A;  3G3G A;  1MY1 A;  4OET A;  3FVN A;  4NF5 B;  1EH3 A;  3E4R A;  5DVI A;  2M8C A;  5FHM A;  5L9M A;  3THI A;  3JYR A;  4OQO A;  5H8N A;  2PYY A;  3KEI A;  3TTM A;  3SEW A;  2IA4 A;  3DP4 A;  4Q8R A;  3KN3 A;  2XXH A;  4XKP A;  2DYX A;  3OSQ A;  3S9E A;  1TT1 A;  2HZK A;  4MF3 A;  2DVC A;  3KJ7 A;  3MP8 A;  3O2A A;  3T22 A;  2ONK E;  3TPA A;  3FV2 A;  2QL3 A;  3A3C A;  1O7T A;  3I6V A;  4G68 A;  1P1Q A;  1PEB A;  2O51 A;  3TUS A;  1MDP 1;  1LB8 A;  5ISU A;  1N3X A;  2X26 A;  4F19 A;  3L6H A;  4OZ9 A;  5CI5 A;  5I58 A;  1LGB C;  1QKB A;  1XC1 A;  4RYA A;  4GOT A;  1MY3 A;  4FOR A;  4H65 A;  2Q2C A;  3C33 A;  3GBB A;  2P1S A;  4KYE A;  3C9H A;  2P0S A;  1SW5 A;  3SER A;  3ZKK A;  4QRZ A;  4Q30 B;  4PFT A;  2ONR A;  1H45 A;  5LOM A;  1NNF A;  4ZED A;  2Y7P A;  1J1N A;  3IOT A;  3B6W A;  4LON B;  3PV0 E;  3IAZ A;  4E0W A;  3IOR A;  2RF1 A;  3VLW A;  5CC2 A;  1FCK A;  3KOT A;  2DVZ A;  2ZYO A;  3SEU A;  1LLS A;  3K1M A;  3UK4 A;  4IO6 A;  3EPE A;  1Y1Z A;  4NF5 A;  3OO7 A;  2QSX A;  4GFR A;  3I5O A;  3B7D A;  3D4C A;  1UTB B;  1BP5 A;  1LAX A;  2XX7 A;  3O97 A;  1SI0 A;  3RNN A;  4O3C A;  2F34 A;  3CFX A;  4BDN A;  3HV1 A;  4X1D A;  2UVH A;  4DXC A;  2P2A A;  2VD2 A;  2LAO A;  1B46 A;  4BDO A;  3KGC A;  3N94 A;  3T93 B;  1N04 A;  1MQD A;  1Y3Q A;  4YKK A;  2ANJ A;  2V84 A;  1TFD A;  2HQ0 A;  2ZYM A;  4M1V A;  4GLI A;  4ZEI A;  4H67 A;  3DLN A;  4OMB A;  2R6G E;  4EF1 A;  4U22 A;  4G8H A;  2AL5 A;  1IEJ A;  1Y4T A;  3V89 B;  4ZZA A;  5J1D A;  3QUJ A;  4IY6 A;  3G3H A;  1QUJ A;  3W9V A;  4NED A;  4FAJ A;  3KJT A;  2XXY A;  4TLL B;  4NE4 A;  3IOW A;  3KFM A;  3MUQ A;  4IY5 A;  2F36 A;  3MP1 A;  3EHS A;  3VLV A;  2QPQ A;  2XX9 A;  1B7Z A;  4XKQ A;  1B4Z A;  1OMP A;  3KZG A;  3WAF A;  1HSJ A;  4NF4 B;  2F78 A;  4BLA A;  1UTH B;  2OLB A;  3M3K A;  1B4H A;  2GRV A;  2DWH A;  3KSX A;  1OQH A;  2AIX A;  3ZSF A;  1LFI A;  1JW5 A;  1JEU A;  4DXU A;  5CM6 A;  4GXS B;  2I3W A;  2E0S A;  4MH5 A;  3MBP A;  2RC8 A;  2DWI A;  2DOJ A;  4EDP A;  1N7W A;  4ZZE A;  5I2K B;  4LA9 A;  3N6U A;  3TAJ A;  1FQC A;  1MDQ A;  4OFO A;  5CMM A;  5H8S A;  2I0B A;  3CFZ A;  4Z0I A;  4QFP A;  3CR9 A;  3TQW A;  2D5W A;  3K01 A;  3MVY A;  2UXA A;  1YCJ A;  1MXV A;  3OMB A;  1UIU A;  4XKN A;  3Q29 A;  3MZB A;  4RXL A;  1XT8 A;  4OXV A;  2F7C A;  4N6P A;  4NF8 B;  2FNC A;  4ZDM A;  1BLF A;  1P99 A;  3LC8 A;  3IB2 A;  5KCJ B;  3RT8 A;  1LAH E;  2QS3 A;  1POT A;  4FEC A;  5F7V A;  4LAT A;  1LFG A;  2ZYK A;  2UVG A;  1A40 A;  4Z7E A;  4YB7 A;  5M2V A;  3VVE A;  2KLF A;  3U1O A;  4OHN A;  1EZP A;  4PQJ A;  2PBW A;  4NWC A;  2Y7I A;  1UIV A;  1WVJ A;  1D9V A;  1BTJ A;  3H6W A;  3RUM A;  4R6K A;  1B5H A;  2Q9T A;  4WKM A;  4JB7 A;  1B6H A;  3PMV A;  1MY4 A;  1LCF A;  4X48 A;  4R9F A;  4M4G A;  5DVJ A;  4LP2 B;  4NF4 A;  1UTH A;  1MQH A;  4EQ9 A;  2XXW A;  3G3I A;  2UYF A;  2OJT A;  2ZXT A;  1A8F A;  4LZ5 A;  4GWO A;  4GIZ A;  1H43 A;  3C31 A;  1IXG A;  3ILU B;  3QAX A;  4POW A;  4ISU A;  5CBS A;  4QSD A;  3SEV A;  1MG1 A;  3M3F A;  2XX8 A;  2WKY A;  4GL8 A;  4U2R A;  5I2K A;  3MZ1 A;  2B65 A;  1ZU0 A;  2QJE A;  1Z7N E;  2ONS A;  4MLQ A;  5TP9 B;  3UGW A;  4F2Q A;  2H5Y A;  2Z8D A;  3PMX A;  3FAT A;  5ELV A;  1PBP A;  3RN8 A;  3VXB A;  4H1X A;  3S4U A;  4TQU Q;  1M5D A;  5HBC A;  1LFH A;  4BDQ A;  5EHM A;  2XXQ A;  4WED A;  4NF8 A;  3VE1 B;  2VGQ A;  4U4X A;  2OWS A;  3HCQ A;  5KCJ A;  3FGS A;  3V83 A;  3S2V A;  3RTW B;  4GRK A;  1FTL A;  2I4C A;  3K1N A;  3VVD A;  1Z7M E;  4LUB A;  4G8N A;  4F18 A;  3WAE A;  1FTM A;  1SDX A;  5L8D A;  4ELO A;  4KCC A;  4P0I A;  1D4N A;  4BDL A;  4UAC A;  2QS4 A;  1LCT A;  3CSG A;  3GXA A;  2XD3 A;  5I59 B;  3RLF E;  4EXL A;  1S50 A;  2F7A A;  2RIN A;  4FED A;  3QK6 A;  3OD7 A;  2I48 A;  1HSE A;  4C0R A;  3EN3 A;  3UP9 A;  1D9Y A;  1FQF A;  4R6H A;  1MQJ A;  3PPP A;  2DSF A;  3U72 A;  3VLU A;  1MRP A;  4OER A;  2PMS A;  2VHA A;  2DP8 A;  1BKA A;  5I2N B;  3H06 B;  3HN0 A;  2XD2 A;  2V3T A;  4K3F A;  4ZEK A;  3TTK A;  2HZL A;  1JEV A;  4JSD A;  4OEU A;  3VDF A;  3MP6 A;  5CMB A;  4R2F A;  3VVF A;  1FQE A;  4XKR A;  1B3G A;  1NNT A;  4U1O A;  3IB0 A;  3H3G A;  2F35 A;  5TP9 A;  3TEP A;  3LSW A;  2Y7K A;  1MH4 A;  4HCW A;  3MVW A;  4JBZ A;  4ND9 A;  1MXX A;  3CSB A;  3O66 A;  1A8E A;  3PGF A;  4TOZ A;  4KCD A;  5DEX B;  1R9L A;  1QJM A;  5DT6 A;  4F1V A;  5F1Q A;  3IK6 B;  4LQ2 A;  1OLC A;  2HCA A;  4IO3 A;  1SQY A;  1QW0 A;  4FJP A;  5B7D A;  1CB6 A;  1USY E;  3TCF A;  3T96 B;  3IR1 A;  1MQG A;  3H6V A;  1LBB A;  2H25 A;  2HEU A;  3CG3 A;  3O9P A;  1NH7 A;  2ESN A;  3LUY A;  4YKJ A;  2GHB A;  1B0H A;  4IO5 A;  2ZNU A;  3HPI A;  3O6I A;  1XVX A;  3C34 A;  3K1P A;  1B9J A;  2DE4 A;  1GTK A;  1AMF A;  1DPE A;  2X7Q A;  3JV9 A;  5CRY A;  4GD5 A;  3R7X A;  3E9X A;  5I2N A;  4EXK A;  2UYE A;  5JTY B;  1IIW A;  4NWD A;  4POX A;  3FXQ A;  5BUU A;  4ESW A;  5AA4 B;  3EQ1 A;  1B3H A;  3ILT B;  3MZ9 A;  4YKP A;  2ZNS A;  2AL4 A;  4YU0 A;  1DMB A;  5KZT A;  2B3B A;  1XHY A;  2R71 A;  3FJG A;  4H5F A;  1VE4 A;  4NMY A;  1SW1 A;  3U8Q A;  2NVU B;  2NOO A;  4PFW A;  1Y3P A;  4HTG A;  4GVO A;  3SDF A;  4YMA A;  1A55 A;  4ESX A;  2A5T B;  2W7Y A;  2XXT A;  3MAM A;  3M3L A;  1P1W A;  3T9X B;  3H4Z A;  3OSR A;  4F3S A;  5DEX A;  3OEN A;  2X7P A;  5EHS A;  1TXF A;  3SES A;  4KYS A;  4H6D A;  3O29 A;  3H6U A;  1VSO A;  3TEL A;  3RQT A;  4R6Y A;  2ZYN A;  1OVB A;  5EYF A;  3K6W A;  2RCB A;  4P0G A;  1A54 A;  2OZZ A;  3HHF A;  1LST A;  1URS A;  1DSN A;  1IXI A;  3SEX A;  4HCY A;  2O7I A;  4F1Y A;  4ZEC A;  3C32 A;  4KHZ E;  4XTC Q;  3EF7 A;  4JWY A;  4OVJ A;  1YAE A;  5AE4 A;  1II5 A;  4DCY A;  4PP0 A;  5AA2 B;  1MPC A;  3KG2 A;  4ZEB A;  5CMC A;  1SD3 A;  3S9N C;  3PPO A;  4OES A;  4KYD A;  1NH8 A;  1US5 A;  4NF6 B;  1R6Z A;  3TYH A;  1B5J A;  5CBR A;  3PD8 A;  3DP8 A;  1Q1K A;  4H0W A;  1B1X A;  1B40 A;  1D3K A;  2DE2 A;  3FXU A;  5ICT A;  2Q89 A;  2I3V A;  5JTY A;  1NMU A;  4H8I A;  5HPQ A;  3T9V A;  3HHG A;  4YIC A;  4ELR A;  3GBA A;  1M5B A;  2GH9 A;  5AA4 A;  1N7X A;  1TWY A;  1SYH A;  2RCA A;  3DEL B;  2O68 A;  2XXV A;  3TTN A;  2THI A;  3G3K A;  4EQ7 A;  4RK2 A;  1UTB A;  5TPA B;  1PBQ A;  4YB6 A;  4DXB A;  1B2H A;  4DE8 A;  1R1N A;  2A5T A;  4H5G A;  2Z8E A;  4F39 A;  1B5I A;  4F1U A;  3K00 A;  3KOS A;  4FIM A;  2OBG A;  1L5T A;  3O6H A;  4DDD A;  3K0V A;  2RC7 A;  3FJ7 A;  2NWJ A;  4U21 A;  1BIY A;  4JXI A;  5H8F B;  2F6P A;  4EUO A;  3QIM A;  4WEP A;  3R6U A;  1EZ9 A;  3IJO B;  4QFK A;  1I69 A;  1GV8 A;  4O3B A;  3V5A A;  3O6G A;  2F5X A;  1NL5 A;  3N6T A;  4R9G A;  2QS2 A;  1M5F A;  2FA7 A;  2Y7W A;  1I6A A;  5AA2 A;  1FQD A;  4PE5 B;  1F9B A;  3UN6 A;  4NF6 A;  1PB9 A;  3OXN A;  3TDJ A;  1URD A;  1ELJ A;  5TU0 A;  1B0L A;  4R75 A;  1ZJL A;  1MY0 A;  5IKB A;  4YKI A;  3VV5 A;  1SW4 A;  1OLA A;  1MXU A;  4RNS A;  4L17 A;  4YB5 A;  2ABH A;  5DTB A;  3OO6 A;  4EQB A;  2Q2A A;  1FTJ A;  5AA3 A;  3TOD A;  2VP1 A;  4O3A A;  4QFN A;  3FIR A;  2H99 A;  4HW8 A;  3IJX B;  4X9T A;  2I6E A;  3CRB A;  3V8X B;  3S9M C;  4Q5T A;  3MWB A;  4BDR A;  3TQL A;  3H6T A;  1ZLQ A;  1Q35 A;  3ONM A;  1I6B A;  5H8N B;  4R2B A;  1MXW A;  4RY1 A;  4OFL A;  4YZZ A;  5H8F A;  3L6G A;  2G29 A;  1JW4 A;  1AOV A;  1IIT A;  3N26 A;  1UQW A;  4F2O A;  1N84 A;  3TTL A;  5FHO A;  2XXP A;  2I49 A;  4KFQ A;  2R9J A;  1LAF E;  3LSF B;  2F6G A;  2A5S A;  2Z23 A;  1Y4C A;  3BFT A;  4F31 B;  1B3L A;  3CFL A;  3TKD A;  2IEE A;  5I56 B;  1MPB A;  4OWD A;  2GFE A;  1QUI A;  1FTO A;  2HAV A;  1XOC A;  4PET A;  1EZO A;  4JSO A;  4AB6 A;  4G8M A;  1PDA A;  1Y9U A;  1O64 A;  5K2Y A;  1LAG E;  3IO6 A;  2XHD A;  5FTH A;  2I0C A;  2V25 A;  3TZA A;  1B32 A;  1B7H A;  4OYV A;  3PU5 A;  2CZL A;  4U1Z A;  3GLB A;  3PPN A;  3Q26 A;  3TMG A;  1YPN A;  3ZKL A;  4EF2 A;  4G77 A;  2UVI A;  2QS1 A;  1ZKB A;  1JW1 A;  1PB8 A;  1PB7 A;  3MJN A;  2H98 A;  4JDF A;  4ELQ A;  4QSC A;  3EHT A;  3G3J A;  5ITO A;  3E3K A;  3SET A;  5AA1 A;  1T0K A;  1KWH A;  5HM4 B;  3FJM A;  3FVO A;  5CMK A;  2AYS A;  4KPT A;  1VR5 A;  1GR2 A;  3KBR A;  1GVC A;  4KQP A;  1JVY A;  4QHQ A;  1OVT A;  3VFJ A;  2REG A;  5ICQ A;  4MFI A;  2HAU A;  3PUX E;  4U23 A;  2E1S A;  4N13 A;  1QKA A;  1IXH A;  4KD5 A;  2V3U A;  2Y84 A;  3H7M A;  3JZJ A;  1SYI A;  3W15 C;  3F11 A;  3S9L C;  1IZ1 A;  1MM6 A;  1VFE A;  3QUF A;  2XXU A;  5I59 A;  3CIJ A;  1B3E A;  5I56 A;  2DWJ A;  3H03 A;  4KR5 A;  3BFU A;  3Q27 A;  3M8U A;  3QXM A;  2O7U A;  4Q0C A;  3FAS A;  1EU8 A;  3OEM A;  3SEY A;  2QRY A;  2DWA A;  1P1U A;  1DOT A;  2I4B A;  5FHN A;  2HXW A;  3AXF A;  3B6T A;  4AB5 A;  4RK9 A;  3KN7 A;  2O84 X;  3FVK A;  2H9B A;  1MPD A;  3KN8 A;  4JWX A;  5I84 A;  1MS7 A;  1XVY A;  2HFB A;  1ZMG A;  1RKM A;  1ATG A;  1OQG A;  4PFU A;  4GXA A;  2OWT A;  2PT2 A;  3SKP A;  4R72 A;  2Q8J A;  5I57 B;  3TCH A;  2ZMB A;  3E13 X;  3OO8 A;  2RC9 A;  1QVS A;  3U94 A;  1IQ7 A;  4U4S A;  3OEK A;  1JQF A;  4IB2 A;  3PUY E;  2FYI A;  5BWJ A;  1RYX A;  1PC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...