5K2YA

Crystal structure of m. tuberculosis uspc (monoclinic crystal form)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
400
structure length
400
Chain Sequence
IVVTVRLWDEPIAAAYRQSFAAFTRSHPDIEVRTNLVAYSTYFETLRTDVAGGSADDIFWLSNAYFAAYADSGRLMKIQTDAADWEPAVVDQFTRSGVLWGVPQLTDAGIAVFYNADLLAAAGVDPTQVDNLRWSRGDDDTLRPMLARLTVDADGRTANTPGFDARRVRQWGYNAANDPQAIYLNYIGSAGGVFQRDGKFAFDNPGAIEAFRYLVGLINDDHVAPPASDTNDNGDFSRNQFLAGKMALFQSGTYSLAPVARDALFHWGVAMLPAGPAGRVSVTNGIAAAGNSASKHPDAVRQVLAWMGSTEGNSYLGRHGAAIPAVLSAQPVYFDYWSARGVDVTPFFAVLNGPRIAAPGGAGFAAGQQALEPYFDEMFLGRGDVTTTLRQAQAAANAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the solute-binding protein UspC from Mycobacterium tuberculosis that is specific for amino sugars.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transport protein
molecule keywords Probable periplasmic sugar-binding lipoprotein UspC
total genus 133
structure length 400
sequence length 400
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5k2yA00
4G68C 2XD2A 1M5FA 1IXCA 1Y4TA 3LUYA 3N6UA 4YB5A 3DP8A 1MPBA 3PGFA 4IY6A 2Y7RA 3VLWA 4C0RA 1YAEA 5I84A 2Z8EA 4Z0IA 4GQOA 4F3BA 4DZ1A 4DDDA 5CBSA 4KFQA 1TXFA 2ZYOA 3W15C 4NF5A 2F97A 4IO7A 1TFDA 2O1MA 1M5EA 2Y7PA 4I62A 1US5A 4OETA 4O3CA 3PD8A 1MM7A 3USDA 4RK2A 4FATA 1FTKA 2O1LA 3P7IA 1H3DA 2GHBA 3OO9A 4YAHX 1LAGE 4ZECA 1PDAA 1LB8A 3KJTA 4P0IA 3VXCA 5EHSA 2RCAA 3IORA 1MS7A 3IR1A 3O6IA 2O7UA 2UVHA 3KOTA 4JB7A 4Z7EA 5IKBA 2RF1A 5HM4B 5L9OA 2V3QA 3I5OA 4H1XA 3ZKKA 5CM6A 2XXWA 3IOWA 2Q89A 5L9SA 5J1DA 1BTJA 3TZAA 1D9YA 1SW4A 1HSJA 4BDOA 4BDLA 4H65A 1PB8A 5EHMA 5H8FB 5TP9A 1LGBC 3MBPA 3GZGA 4LQ5A 3QXMA 4P0GA 2RC8A 2H25A 3QIMA 4ZEBA 3T22A 3U8QA 3LSFB 1DPEA 3K2DA 2Q9TA 4XIGQ 3WAEA 5I2NB 3B6QA 3BFUA 1B0LA 2REJA 3LSWA 3OMBA 4LZ8A 4GLIA 4TLMB 3OSQA 4OERA 5AA2D 1P1UA 2Z22A 1SI1A 3MZ9A 1YTVA 4Q5TA 4DXBA 2CMOA 3T9VA 4ZZEA 1KWHA 1B3LA 1LAFE 1WVJA 4EQ7A 2QPQA 3FUZA 2Z8DA 1ZKBA 2ZNSA 2DXYA 1JEVA 2LAOA 2PT2A 1Z7ME 2ONSA 2ZNUA 1PBQA 3FXUA 5ITOA 2OWSA 4OXVA 3Q25A 3BBRA 1SBPA 1MXYA 4G2ZA 4IO6A 5K2YA 4FE8A 1TT1A 2AL5A 4NF4A 4ECFA 2OCUA 5CMKA 4ND9A 2F36A 3EHTA 3KEIA 1FQFA 1N76A 3I6VA 3ONMA 3SDFA 4OFJA 1B2HA 1MY0A 4GOTA 2H4IA 3LSLA 2ZMBA 5H8HB 4ELPA 2PVUA 1NH7A 1URDA 4QSEA 3DELB 5CMBA 3T66A 3W9VA 4F31B 3KSXA 4R9GA 4G4PA 3PMWA 2O51A 1OVTA 2H9BA 4RPNA 1FTLA 1LAXA 4ELRA 1A40A 4I9DA 3W9WA 4MLQA 3OELA 3FVKA 3MPKA 4YMBA 2F6PA 2Y7WA 2O7IA 2XXTA 4H8JA 2H98A 2XX8A 3MVXA 2B65A 4RA1A 5DT6A 2IA4A 4ZDMA 4GL8A 3SEYA 3TFLA 1RKMA 5FTIA 1MXWA 4OMBA 3TKDA 3OENA 5EYFA 4KYDA 1B40A 3UA8A 1B6HA 1WODA 1QW0A 1DSNA 1BKAA 4P11A 4OTEA 4F29A 4XKNA 1UTHA 1PB9A 1SYIA 3CRBA 3FZVA 3H4ZA 1MXVA 1ZU0A 4POWA 1IUDA 1IXHA 4LQ2A 1NH8A 4YKKA 1B46A 1DTGA 4X1DA 3VV5A 3MAMA 3QK6A 3H7MA 3OD7A 1GGGA 3H6VA 2QJEA 3TELA 5I58A 3G7WA 5AA4A 4DE8A 1I69A 2PX1A 5JTYB 1SW1A 4RYAA 1VR5A 4MFIA 4U4XA 4F3GA 3EQ1A 3OO6A 2O6AA 2XXIA 4MF3A 1HSEA 4F1UA 2HFBA 2Q2AA 1SQYA 4OWDA 5JEIA 4JWYA 1MY2A 3QAXA 4HTGA 4QFOA 1JNFA 5TU0A 3FJGA 1H44A 2DS9A 4G8HA 4YZZA 3VDFA 4GL0A 2FNCA 4OEVA 1ZBMA 3BKIB 1B3EA 3FASA 1M5DA 1LSTA 4NTLA 1HSLA 2D21A 2I6EA 4DLDA 4ONYA 1F9BA 5JTYA 3C4MA 1NKXA 1P99A 5A5XA 4GD5A 5KDTA 2OK2A 4NF8B 1USYE 4GRKA 2ZYMA 3PPPA 3RTWB 1N3WA 3GLBA 1IIWA 2X7QA 1MDP1 1B5JA 2XXQA 3PUXE 1N3XA 4H0WA 3RT8A 1OLAA 2VD3A 2Y7IA 1I6BA 3DM0A 4QHQA 3FD3A 2F35A 5M2VA 1MQJA 4FECA 1B3FA 3TTRA 3ILTB 3MQ9A 4QSDA 1FQDA 3C31A 3K1MA 4LVQA 4GIZA 1A99A 2XXVA 3MP8A 1ZLQA 3JYRA 1PB7A 1LBCA 2XXUA 4O3AA 2AIXA 4YKIA 4DXUA 2A5TA 4IO4A 3G3JA 2HAUA 1XS5A 3HHFA 2XHDA 3OO7A 1IXIA 4ESWA 1SI0A 4AB5A 2HEUA 1MY3A 4LZ5A 4ZEIA 4QRZA 2RKMA 5IAIA 1II5A 1B7UA 3CG1A 1OQGA 3FV2A 4I8CA 1N84A 2F7AA 3KFMA 2VHAA 3H6WA 2GRVA 4RXLA 3Q27A 5H8HA 2NUVA 1URGA 2NOOA 1GV8A 4ZZAA 1GVCA 2DVCA 1R9QA 3FJMA 1XOCA 1P1OA 1NNTA 2IEEA 1T0KA 2UYEA 4NE4A 3K01A 5ICTA 4N6PA 5I56B 4BLAA 2HZLA 1N04A 1RYXA 1B51A 3B7DA 3AXFA 3M3LA 2ZYKA 3RUMA 3FVGA 1OMPA 4KPTA 4LATA 1AIVA 3V89B 5AA2B 3JZJA 3OO8A 3MW0A 5DEXA 3LBSA 3A3UA 2NVUB 4OVJA 2QL3A 2Y7KA 3HSTA 4KCCA 4MLVA 1OQHA 1A7LA 3TQLA 4EF1A 5AA3A 3CVGA 2E1SA 4KYSA 2XXRA 1JVXA 4UACA 4JWXA 3A3CA 3VXBA 2ONRA 3M8UA 5ITPA 2Q88A 1P1NA 1CB6A 1TWYA 3GXAA 1ELJA 3TAJA 2DVZA 3TCGA 3T9HB 3UP9A 4LUBA 4PFTA 3S4UA 4R6YA 1QUIA 5KCJB 2DP8A 2UYFA 3EHUA 2A5TB 5H8SA 1LFIA 1QULA 4X1BA 2O68A 5L8DA 3CG3A 4H5GA 3QUFA 3R26A 5DVFA 3VFJA 3G3KA 4EDPA 2RCBA 3KOSA 1B58A 1QUJA 1OVBA 3O97A 3PPNA 4U4SA 3RGYA 4NF6B 3IAZA 1GTKA 4PP0A 1A8EA 4I1DA 5DVIA 5I2KB 4FAJA 4Q0CA 2P1SA 3Q26A 1UIUA 1ANFA 3L6GA 3KN8A 3KGCA 4YICA 1Y4CA 2QMXA 2QSXA 3N26A 4ZEDA 3K0VA 3MZ1A 1IXGA 1MDQA 2F8DA 3N5LA 4NMYA 4R6KA 5DTBA 1H43A 2AL4A 2XD3A 1MY4A 2A5SA 2WKYA 3FJ7A 3K6UA 3TUSA 1XVYA 2UVIA 3E13X 1DPPA 1FQAA 1SD3A 2H99A 1FQBA 4QF9A 3SEWA 1ZMGA 3VE1B 1FCKA 4KD5A 3SKPA 4GXAA 5L9MA 1Q35A 2X26A 3PPQA 1BIYA 4IO2A 5I58B 1QKBA 4YB7A 3A09A 4NF8A 5F7VA 4XKRA 4OYVA 3IK6B 3MVZA 1S9TA 1OLCA 1FTOA 5H8QB 1Y1MA 3TDJA 2Q2CA 4F18A 2F6GA 1EZPA 5I57A 1VSOA 4WEDA 2QS1A 4LONB 1UTHB 3C36A 4WXJA 1LAHE 1B32A 2FYIA 2R6GE 2ZYNA 2P2AA 4DIGA 4KR5A 4QFKA 1NFTA 4R73A 3U1OA 5HPQA 4F19A 1ZTYA 3H3GA 3S9MC 3V83A 5FHMA 3H6UA 5KZTA 3RN8A 3EPEA 3O6GA 5FHOA 3MP6A 2DE2A 4JDFA 3SEUA 4QFNA 3SESA 1POY1 2VP1A 3LR1A 5F1QA 4AB6A 2ANJA 1NMUA 1B7ZA 1O64A 1B4HA 2F34A 1BP5A 2THIA 1MQDA 3QYTA 4H6DA 3K4UA 3H06B 4FORA 2OLBA 1FW0A 1MQIA 1ZJLA 2D3IA 2O84X 3RTFB 1ZIUA 3VLVA 3K1PA 4F1VA 3M3FA 2YPNA 3VVFA 3K6WA 4OESA 3UORA 1JEUA 4R2FA 1JETA 5KCJA 3S2VA 3CFLA 3MC2A 4U21A 2UVJA 2DE3A 3TYHA 2O69A 4OENA 4F2QA 1MXUA 3SEXA 2DOJA 2FA7A 3CSGA 3B6TA 3IB2A 3DLNA 4ISUA 5HBCA 1EZOA 4N07A 1NNFA 3I3VA 3IO6A 3MUQA 4IO3A 1MXXA 2YJPA 3FATA 3FXRA 4KYEA 4R75A 3O9PA 1FQCA 3ZSFA 4GF8A 3PPRA 3O28A 4GXSB 3E4RA 1PC3A 4HCYA 4IGTA 4GWOA 1M5BA 4N13A 3IX1A 2ONKE 3OEKA 4YKJA 2R71A 4KQPA 1MH3A 1QJMA 3KBRA 1D9VA 1LCFA 4Q8RA 3MZBA 3N6TA 4R6HA 4DXCA 2GH9A 3CFZA 3IOUA 1UTBB 5AE4A 1LBBA 3UIFA 3HCQA 3HN0A 1UTBA 5LOMA 3IL1B 5BUUA 3S9NC 3WAFA 3PPOA 1Y9UA 1MQHA 1EZ9A 2YLNA 1Z7NE 3BFTA 1OIBA 3PUVE 1L5TA 1POTA 1Y3QA 2I4CA 1ATGA 2XXXA 3QSLA 1MRPA 3R6UA 2ABHA 3RPWA 4EQ9A 3CI8A 3FVNA 2I0BA 2DWJA 3U94A 1D4NA 4L17A 2I58A 4XKQA 1QVSA 2I3WA 4R9FA 4ZS9A 2M8CA 4F22A 1IQ7A 4RK9A 2P0SA 4UA8A 2F5XA 3C9HA 1B3GA 3DP4A 4H8IA 4WKMA 5B70A 2RC7A 4M1VA 1B5IA 1IEJA 4RJZA 4HW8A 3S9EA 4QSCA 3UN6A 3GBBA 3ODBA 5K2XA 1Y20A 1B5HA 3SETA 2E0SA 1P1WA 3OOAA 3T96B 3KZGA 1B52A 1B4ZA 4JSOA 2V3UA 1P1QA 3RNNA 4H5FA 3V5AA 2Q8JA 1MPCA 4LA9A 4RY1A 4TQUQ 5CMCA 3T93B 2PYYA 1A55A 5DVJA 3N94A 5ICQA 1IZ1A 1AL3A 1B9JA 1SVXB 2VGQA 3MP1A 4OFOA 3RT6B 1LB9A 3ZS6A 2DWHA 4PQJA 3OEMA 4OHNA 3K1NA 4GFRA 3RQTA 4JWOA 4OEUA 2DWIA 3DP6A 4EF2A 2QRYA 1Y1ZA 4YMAA 2OBGA 5H8QA 2PT1A 4NWDA 5JK4A 3C35A 4YU0A 3O6HA 4NF5B 3CR9A 3VLUA 2B3FA 2QS3A 3PUZE 2PBWA 1URSA 4KCDA 4PFWA 3K6XA 1MQGA 3RLFE 2NWJA 1Q1KA 2XXPA 4GVOA 4MBPA 5TPAA 2RC9A 3IJOB 4U1OA 2X7PA 2D5WA 3TTMA 2F7CA 3KN3A 1B1HA 1EH3A 2ZXTA 5KDTB 2KLFA 3GBAA 3C34A 3G3IA 1NL5A 1J1NA 1AH5A 4TOZA 5CMMA 4JBZA 5I57B 4G77A 3O2AA 3PD9A 4KI0E 1H45A 2DYXA 1SDXA 1B05A 2DSFA 4XXUA 1SW2A 2I0CA 4G8MA 3Q28A 1PBPA 4RNSA 3ILUB 4ELQA 2REGA 4EUOA 2OJTA 4EXKA 1Y3PA 1XT8A 4G8NA 4F39A 4QFLA 5AA4B 2V25A 3E9XA 3QUJA 5AA1A 4NWCA 4BDQA 1NNKA 1LFGA 3O66A 3IOTA 2RINA 1JW5A 1M5CA 1R6ZA 3FXQA 3MJNA 4KHZE 4POXA 4QFPA 1VFDA 5BWJA 2VOZA 3RY3A 5I59A 1MH4A 2QMWA 3U72A 4AQ4A 3S9LC 2W7YA 3E3KA 4FJPA 3G3HA 4OQOA 5DEXB 2Z8FA 3O29A 4ZEKA 3TTKA 3CSBA 2DXRA 3TCHA 3LSXA 1MXZA 3VVEA 2UVGA 3JV9A 2ALUA 3TCFA 3FVOA 1RYOA 2OZZA 4U1ZA 1VFEA 4IY5A 4X9TA 5H8NA 1JW4A 4E0XA 3IB1A 4PFYA 3U93A 5I56A 3FIRA 2G93A 1VE4A 5I2NA 4IB2A 3SEVA 1SW5A 2I3VA 3UK4A 4C1TA 4ZEFA 2HCAA 1B7HA 3IJXB 1AMFA 1B0HA 1N0TA 1WDNA 3PUWE 1MY1A 4LZ7A 1I6AA 1QKAA 1JW1A 2I4BA 4HCWA 3TQWA 1EU8A 3HHGA 4ESXA 2ZNTA 4NF4B 1S50A 2XX7A 1JVYA 2HZKA 3MVWA 4FIMA 4X48A 1XHYA 2BJJX 5DYHA 1XC1A 2F7BA 3D4GA 5TP9B 4MH5A 4BDNA 1IITA 3FV1A 1H76A 2XXYA 3IO4A 4FEBA 4R74A 2AYSA 4ELOA 4LP2B 1R1NA 2PMSA 2QS2A 2GHAA 3T9UA 3MWBA 2I48A 3TEPA 4YKPA 4BDRA 3TTNA 4DCYA 5AA2A 1LCTA 1LLSA 1N7XA 3IB0A 3EN3A 4JSDA 5H8NB 1MG1A 3MPLA 2I49A 4DCXA 1FTMA 2V3TA 2HXWA 4OZ9A 1S7YA 2XXHA 3HO7A 1YCJA 3D4CA 1DOTA 2OWTA 1FQEA 2HAVA 4M4GA 3M3KA 5CC2A 5H8FA 4XTCQ 5CI5A 2GFEA 2XX9A 1XVXA 2DWAA 3K02A 1BLFA 1DTZA 3H03A 3MVYA 4C1UA 4NEDA 1JQFA 3KJ7A 2NXOA 4HS7A 4BDMA 3PV0E 2CZLA 3FGSA 4U22A 4RPOA 4H67A 5I59B 1USYH 4FEDA 1SYHA 3CIJA 5A5XB 3OSRA 2F78A 3C32A 1I6QA 4JXIA 1PEBA 2H5YA 2G29A 3THIA 1B3HA 4IGRA 3G3GA 2Z23A 3F11A 3K6VA 4TLLB 4EXLA 3H6TA 4K3FA 3KN7A 2UXAA 4YB6A 2R9JA 3UGWA 4R2BA 4THIA 4F2OA 4PFUA 1QUKA 3IOVA 3LC8A 3KG2A 1DMBA 3HPIA 3PMVA 4Q30B 4WEPA 5TPAB 1B1XA 3TPAA 4EQBA 3U92A 5B7DA 1A54A 4G68A 1N7WA 1TFAA 3K00A 1LFHA 4U23A 2ESNA 2VD2A 4G68B 3T9XB 1UIVA 4E0WA 4IO5A 3CFXA 3PU5A 1GR2A 3SERA 3HV1A 3ECRA 2V84A 2QS4A 3KSJA 1UQWA 1Y3NA 3TTLA 5ISUA 1US4A 1A8FA 2B3BA 3PMXA 3C33A 2HQ0A 4ZE8A 5FTHA 1YPNA 1D3KA 4ZE9A 4O3BA 3V8XB 4XKPA 1O63A 3PUYE 3ZKLA 4F3PA 1R9LA 1FTJA 2Y84A 5ELVA 3VVDA 4F3SA 1MM6A 3B6WA 1CE2A 1NNPA 3EF7A 1MPDA 4NF6A 4R72A 4OFLA 3TMGA 2DE4A 3EHSA 5CBRA 3TODA 1AOVA 5CRYA 1O7TA 3G3FA 5FHNA 3R7XA 3L6HA 2V93A 3Q29A 4PETA 4U2RA 2DQVA 5I2KA 3OXNA 4PE5B 4F1YA
chains in the Genus database with same CATH superfamily
1M5FA 4C0RA 3FXBA 5I84A 4DDDA 5CBSA 1FPFA 3FBPA 4IO7A 4DI4B 1M5EA 4O3CA 2WBDA 2PFYA 4ZECA 3KJTA 4P0IA 2O7UA 1FPDA 5IKBA 5HM4B 3IOWA 5J1DA 1BTJA 3TZAA 1HSJA 4H65A 3MBPA 4LQ5A 3T22A 2H25A 3QIMA 3LSFB 1DPEA 3K2DA 3B6QA 1B0LA 2REJA 4LZ8A 4GLIA 3OSQA 1P1UA 3MZ9A 4DXBA 4ZZEA 4GX6A 3NOHA 4GWZA 2LAOA 2ONSA 2ZNUA 2XWIA 2OWSA 1SBPA 5IZ3A 4NF4A 2F36A 3EHTA 1FQFA 3ONMA 2H4IA 3T66A 4OVTA 3KSXA 4P56A 4R9GA 3PMWA 3RPLB 4P8BA 3FVKA 2Y7WA 4ZEFA 2XXTA 2XX8A 4RA1A 4ZDMA 3TFLA 1MXWA 5EYFA 3UA8A 1QW0A 4OTEA 4N15A 3T1BA 1SYIA 1ZU0A 4XEQA 2FIXA 4AS5A 3VV5A 4PGPA 4DE8A 5ESYA 2F3DA 4RYAA 4MFIA 4U4XA 4F3GA 3EQ1A 2O6AA 2XXIA 4F1UA 5JEIA 3QAXA 4G8HA 2I6EA 4ONYA 1F9BA 1P99A 4GWYA 2ZYMA 1N3WA 2X7QA 3PUXE 1YYZA 2Y7IA 4MIJA 4MNIA 3ILTB 3MQ9A 1FQDA 3K1MA 1A99A 2PFZA 1PB7A 4AB5A 2FBPA 3CG1A 4I8CA 1OQGA 2FVZA 3Q27A 2NOOA 1R9QA 1XOCA 1NNTA 4NE4A 4N6PA 4BLAA 3M3LA 2ZYKA 1KA1A 1OMPA 3LBSA 3A3UA 5AA3A 3CVGA 1CB6A 1FBFA 4PBHA 5KCJB 1QUIA 2DP8A 5H8SA 2O68A 3CG3A 3QUFA 5DVFA 3VFJA 2GQ1A 4PGNA 1GTKA 3KN8A 1Y4CA 1NV5A 1H43A 3K6UA 1MY4A 2WKYA 3SEWA 1DPPA 2X26A 2V4CA 1NV1A 1FTAA 4YB7A 3A09A 4OYVA 3IK6B 1S9TA 2B4LA 2Q2CA 4PTKA 5A5LA 1UTHB 3C36A 5A5XA 4N91A 4QFKA 5HPQA 3H3GA 3V83A 5KZTA 4JDFA 3SEUA 2VP1A 3LR1A 1NMUA 1B4HA 1MQDA 4H6DA 3H06B 1MQIA 2D3IA 1VDWA 1ZIUA 2YPNA 1JEUA 5KCJA 3CFLA 3TYHA 1MXUA 1IMCA 2DOJA 2FA7A 3DLNA 1EZOA 3V8XB 3IO6A 1MXXA 2L5VA 4GF8A 3RPLA 2Y5KA 4GWOA 4N13A 2ONKE 5AE4A 1UTBB 1LBBA 5BUUA 3PPOA 1BK4A 1Y3QA 1ATGA 2XXXA 3R6UA 3FVNA 1QVSA 4N8GA 2I3WA 4R9FA 1NUZA 3DP4A 5B70A 1B5IA 4RJZA 3D1RA 3GBBA 1P1WA 3T96B 1B52A 1B4ZA 3RNNA 4TQUQ 2PYYA 5ET8A 4QXDA 3TUSA 3MSTA 3K1NA 1NV7A 4JWOA 2DWIA 3DP6A 2QRYA 2PT1A 3O6HA 2PBWA 1URSA 2NWJA 1Q1KA 4MBPA 2RC9A 4U1OA 3KN3A 2ZXTA 2KLFA 1K9ZA 1B05A 1NI9A 4G8MA 3ILUB 3KC1A 1Y3PA 4QFLA 4N4UA 3O66A 4KHZE 1JW5A 1R6ZA 5I59A 4AQ4A 3S9LC 3E3KA 4FJPA 3G3HA 4ZEKA 2DXRA 3TCHA 3LSXA 3TCFA 4X9TA 4E0XA 4PFYA 3U93A 3FIRA 5I2NA 2I3VA 3IJXB 1B7HA 4NAPA 1MY1A 1QKAA 1JW1A 2I4BA 1EU8A 4H45A 3HHGA 5DW8A 4NF4B 5DYHA 4FIMA 4MH5A 1IITA 3FV1A 2AYSA 4GBWA 5AA2A 1LLSA 4DCXA 2I49A 1FBDA 4M4GA 3M3KA 3KJ7A 4BDMA 3PV0E 4U22A 4FEDA 1SYHA 5A5XB 2G29A 1LBZA 2UXAA 3UGWA 2R9JA 3E78A 4NHBA 3IOVA 4PFBA 1DMBA 3HPIA 1FPEA 5B7DA 1A54A 1N7WA 1LFHA 4U23A 2VT5A 3CFXA 3PU5A 4IO5A 3ECRA 2V84A 1UQWA 3A29A 2B3BA 1A8FA 1D3KA 4ZE9A 1O63A 3ZKLA 1FTJA 1CE2A 1MPDA 3E79A 1DCUA 3EHSA 5CRYA 1O7TA 5FHNA 4OVQA 3L6HA 4G68C 1Y4TA 4MNCA 3DP8A 1NV2A 2Y7RA 4Z0IA 3W15C 2O1MA 1US5A 3PD8A 1MM7A 4RK2A 2O1LA 1H3DA 2GHBA 1LB8A 1MS7A 3O6IA 1D9QA 2Q89A 4MNPA 4BDLA 1SW4A 5TP9A 1LGBC 4F19A 3QXMA 4ZEBA 2RC8A 4OERA 2Z22A 4Q5TA 1B3LA 3FUZA 2Z8DA 2PT2A 1Z7ME 3FXUA 5K2YA 5CMKA 4ECFA 2OCUA 4ND9A 4PE3A 1B2HA 4N17A 1OVTA 3SZPA 4RPNA 1LAXA 4ELRA 1A40A 4I9DA 4YMBA 3MPKA 3ROJA 1NUYA 2F6PA 4H8JA 2O7IA 2IA4A 4OMBA 1EYJA 1B6HA 4F29A 4PF6A 1PB9A 3CRBA 3FZVA 1MXVA 1NH8A 4YKKA 3H7MA 1GGGA 4NX1A 3G7WA 4P9KA 1VR5A 4MF3A 2HFBA 4OWDA 1K9YA 1MY2A 4HTGA 1JNFA 3VDFA 4PFIA 4GD5A 5KDTA 2OK2A 4GRKA 4NG7A 4PAFA 2VD3A 3DM0A 4FECA 4QSDA 4GWWA 1KA0A 2XXVA 3MP8A 2XXUA 4DXUA 2AIXA 2A5TA 5F24A 3G3JA 2HAUA 1XS5A 2XHDA 1IXIA 4ZEIA 4LZ5A 4QRZA 5IAIA 1II5A 1EZPA 3FV2A 2F7AA 3KFMA 3H6WA 2GRVA 4MX6A 2CEXA 3EKIA 3FJMA 2UYEA 1N04A 3AXFA 2FIEA 4I3YA 3OO8A 2NVUB 3HSTA 1OQHA 1A7LA 4QBAA 2XXKA 2E1SA 2XXRA 1JVXA 3A3CA 3VXBA 3GXAA 2DVZA 3TCGA 3T9HB 3UP9A 4LUBA 4R6YA 2A5TB 4NN3A 4GBVA 3KOSA 1B58A 4U4SA 4NF6B 4PP0A 1A8EA 5DVIA 5I2KB 5FBPA 1ANFA 3KGCA 2ZZVA 3K0VA 4PBQA 4NMYA 3N5LA 5DTBA 2A5SA 3E13X 1SD3A 1FQBA 3VE1B 4GXAA 1Q35A 5AA4A 1Y1MA 2XWKA 4F18A 4P1EA 4WXJA 2ZYNA 1FBGA 2JJKA 2Q8MA 1NFTA 3U1OA 5EQ7A 3IFAA 3MP6A 1B7ZA 5EQ8A 2O84X 3VLVA 3K1PA 3VVFA 3IFCA 4OESA 3UORA 4R2FA 1JETA 2R8TA 2VPOA 1INPA 4O7IA 2O69A 4OENA 3CSGA 3IB2A 5HBCA 3I3VA 4IO3A 3FATA 4KYEA 1FQCA 3PPRA 4GX4A 4IGTA 4MMPA 3IX1A 3OEKA 1AWBA 1MH3A 4Q8RA 3MZBA 4DXCA 2GH9A 3CFZA 4JVIA 3UIFA 3HN0A 3S9NC 1Z7NE 3PUVE 4EQ9A 1FBHA 2DWJA 5EQAA 3U94A 2CEYA 4H46A 4ZS9A 4F22A 4RK9A 2P0SA 4UA8A 2F5XA 1B3GA 1FJ6A 3ODBA 5K2XA 1NV3A 1B5HA 3OOAA 3KZGA 4H5FA 1AL3A 2VGQA 3MP1A 3ZS6A 3RT6B 3RQTA 4EF2A 4YMAA 2OBGA 5H8QA 4NWDA 4YU0A 3CR9A 3LUZA 3PUZE 1YXIA 4KCDA 3K6XA 1MQGA 4GVOA 2D5WA 2F7CA 4JBZA 3PD9A 4KI0E 1FBPA 2DSFA 2I0CA 1PBPA 1G0IA 4EXKA 4G8NA 4F39A 3B50A 3E9XA 4NWCA 1NNKA 4QFPA 3IOTA 1M5CA 4POXA 3FXQA 1KZ8A 1VFDA 2VOZA 3RY3A 3U72A 3O29A 4P3LA 2UVGA 3FVOA 2OZZA 1JW4A 1VE4A 4IB2A 1YZ0A 1SW5A 3UK4A 2HCAA 1AMFA 1WDNA 2ZZXA 1S50A 3MVWA 2XXYA 4FEBA 4R74A 1R1NA 3T9UA 2GHAA 3KC0A 3TEPA 4YKPA 4BDRA 1N7XA 4JSDA 1MG1A 3MPLA 2HXWA 2OWTA 2HAVA 2HPGA 1XVXA 4C1UA 3H03A 3RYDA 4NEDA 4HS7A 3C32A 3THIA 4TLLB 4K3FA 3KN7A 4N8YA 5IM2A 4F2OA 1QUKA 4Q30B 5TPAB 3U92A 4E0WA 3HV1A 2QS4A 5ISUA 3PMXA 3C33A 2HQ0A 2QVVA 4F3PA 3VVDA 3B6WA 1NNPA 4P1LA 5CBRA 4O94A 3Q29A 2V93A 5I2KA 4JVCA 1FPBA 4F1YA 2XD2A 1IXCA 3N6UA 2P3NA 3PGFA 1IMDA 1YAEA 4O7MA 4GQOA 4F3BA 4DZ1A 4KFQA 2ZYOA 1EYKA 4NF5A 1TFDA 2Y7PA 4FATA 1FTKA 3P7IA 3OO9A 4YAHX 1PDAA 2RCAA 3IORA 3KOTA 2UVHA 5L9OA 4HE0A 2V3QA 5L9SA 1D9YA 1PB8A 5H8FB 3GZGA 4P0GA 3U8QA 3WAEA 4XIGQ 1Q9DA 3BFUA 4TLMB 3LSWA 5AA2D 3HFUA 4NGUA 1JP4A 1KWHA 2B4MA 2ZNSA 2DXYA 3R7XA 1PBQA 1G0HA 4OXVA 3Q25A 1MXYA 2AL5A 3KEIA 4PAKA 1N76A 3I6VA 4OFJA 4GOTA 4ELPA 4QSEA 3MYUA 4G4PA 2O51A 5EYHA 2H9BA 1FTLA 3W9WA 3OELA 3U65A 5DT6A 3OENA 1NUWA 1DSNA 4P11A 1UTHA 4POWA 1IUDA 1B46A 1DTGA 3OD7A 3H6VA 2QJEA 5I58A 2PX1A 3T0JA 1SW1A 1IMEA 1HSEA 2Q2AA 4JWYA 2CZIA 4YZZA 4GL0A 2FNCA 4OEVA 1ZBMA 1B3EA 1M5DA 1LSTA 1HSLA 3C4MA 4NF8B 1USYE 5ET6A 3PPPA 3RTWB 3GLBA 1IIWA 3BIGA 1MDP1 1B5JA 5I3SA 4H0WA 3RT8A 4QHQA 3FD3A 2F35A 1MQJA 3C31A 3JYRA 4YKIA 4GWSA 4IO4A 1DBZA 1SI0A 4GWUA 2RKMA 1N84A 5H8HA 2NUVA 1GV8A 1GVCA 1T0KA 1NV4A 5ICTA 5I56B 3RUMA 1B51A 3B7DA 3FVGA 4KPTA 4LATA 1AIVA 3V89B 5AA2B 3JZJA 5DEXA 5J16A 4MLVA 3TQLA 2BJIA 4UACA 1FPGA 4JWXA 2ONRA 3M8UA 4GX3A 5ITPA 2Q88A 3TAJA 4PFTA 2UYFA 5L8DA 4H5GA 3G3KA 4EDPA 2RCBA 4FBPA 3RGYA 3IAZA 4X8RA 4I1DA 1UIUA 3L6GA 4N6KA 4YICA 2QSXA 2QMXA 4ZEDA 1IXGA 1MDQA 2F8DA 2XD3A 1EYIA 1FQAA 2H99A 1ZMGA 1FCKA 5L9MA 4IO2A 3PPQA 4MAGA 4NF8A 5F7VA 4XKRA 3TDJA 1OLCA 1FTOA 2F3BA 2QS1A 1B32A 4OANA 4DIGA 4R73A 3H6UA 3RN8A 3O6GA 2DE2A 3SESA 4QFNA 1POY1 2ANJA 3QYTA 1LEVA 4FORA 1FW0A 1FRPA 4KXPA 3RTFB 4F1VA 3M3FA 3S2VA 4U21A 1NV6A 2DE3A 4F2QA 4ISUA 4N07A 3MUQA 2YJPA 3FXRA 3ZSFA 3O28A 3E4RA 4HCYA 2CZHA 5EYGA 2Y5LA 1FPIA 3KBRA 1D9VA 3N6TA 1LBWA 5LOMA 3IL1B 1Y9UA 2WX9A 1MQHA 1EZ9A 2YLNA 1L5TA 1POTA 2I4CA 3CHGA 3RPWA 1MRPA 2ABHA 2WYKA 2I0BA 1D4NA 2I58A 4XKQA 1IMBA 2M8CA 1IQ7A 4WKMA 1IEJA 4QSCA 3UN6A 4LN5A 1Y20A 3SETA 2E0SA 4JSOA 2V3UA 1P1QA 3V5AA 4LA9A 5CMCA 1A55A 5DVJA 3N94A 1SVXB 4OFOA 4PQJA 3GYYA 3OEMA 4MEVA 4GFRA 5IZ1A 2P3VA 3VLUA 2B3FA 1FPKA 4PFWA 3RLFE 5TPAA 2X7PA 3TTMA 1B1HA 3C34A 3G3IA 1NL5A 1AH5A 5I57B 2QVUA 3O2AA 2DYXA 2QVRA 4ELQA 2REGA 4EUOA 2OJTA 2OX3A 5AA4B 2V25A 3QUJA 4BDQA 4PC9A 4XF5A 1FBEA 1LFGA 5BWJA 4P47A 4OQOA 1MXZA 4XFEA 2ALUA 1VFEA 4IY5A 3IB1A 5I56A 2G93A 3SEVA 5IZ3B 5I7IA 4LZ7A 1I6AA 5LDZA 4UABA 2HZKA 1XHYA 2BJJX 4BDNA 3IO4A 4ELOA 2QS2A 5ET7A 4DI3D 3IB0A 5H8NB 2V3TA 2XXHA 1RDXA 3HO7A 1YCJA 3D4CA 1DOTA 1FQEA 2Q74A 5CC2A 5H8FA 4XTCQ 5CI5A 2XA5A 1JQFA 2NXOA 3FGSA 2FHYA 4RPOA 4H67A 5I59B 3QMFA 3CIJA 3OSRA 1I6QA 4JXIA 2H5YA 1B3HA 4IGRA 3K6VA 3LC8A 3KG2A 4WEPA 1B1XA 4EQBA 4G68A 3K00A 1TFAA 3T9XB 1GR2A 1RDYA 3SERA 4HXVA 4PF8A 1Y3NA 3TTLA 1US4A 1YPNA 4XKPA 3PUYE 5ELVA 4AS4A 4F3SA 3EF7A 4R72A 5EQ9A 4GWXA 4OFLA 2KQZA 4U2RA 4PETA 2DQVA 4PCDA 3LUYA 2HXRA 4YB5A 1MPBA 4IY6A 3VLWA 2Z8EA 1TXFA 2F97A 2XWVA 2WYPA 4I62A 4OETA 3USDA 4HE2A 1LAGE 3VXCA 1LBYA 5EHSA 3IR1A 4JB7A 4Z7EA 2RF1A 3I5OA 4H1XA 3ZKKA 5CM6A 2XXWA 1FBCA 4BDOA 5EHMA 2VPNA 4MHFA 2Q9TA 5I2NB 3OMBA 1SI1A 1YTVA 1LBVA 2CMOA 3T9VA 1LAFE 1WVJA 4EQ7A 2QPQA 1ZKBA 1JEVA 4NQ8A 5ITOA 3BBRA 4G2ZA 4IO6A 4FE8A 1TT1A 3SDFA 1MY0A 3LSLA 5H8HB 2ZMBA 2PVUA 1NH7A 1URDA 3DELB 5CMBA 3W9VA 4F31B 4MLQA 2H98A 3MVXA 2B65A 4GL8A 4N81A 3SEYA 1RKMA 5FTIA 3TKDA 4KYDA 1B40A 1WODA 1BKAA 4XKNA 3H4ZA 5I5PA 1IXHA 4LQ2A 4X1DA 3MAMA 3QK6A 3TELA 5IGAA 1I69A 5JTYB 3OO6A 1SQYA 2DDKA 4QFOA 5TU0A 3FJGA 1H44A 2DS9A 3BKIB 4MJOA 3FASA 4NTLA 2D21A 4DLDA 5JTYA 1FJ9A 1NKXA 4I40A 2XXQA 1N3XA 1IMAA 1OLAA 1I6BA 4OVSA 3LV0A 5M2VA 1B3FA 3TTRA 4I3EA 4LVQA 4GIZA 2ZZWA 1ZLQA 1LBCA 4O3AA 3HHFA 3OO7A 4ESWA 1FPJA 1MY3A 2HEUA 1B7UA 2KR0A 2VHAA 4RXLA 3ISPA 1URGA 4ZZAA 2DVCA 1P1OA 2IEEA 3K01A 2HZLA 1RYXA 2QFLA 3MW0A 4HE1A 4OVJA 2QL3A 2Y7KA 4KCCA 4EF1A 4KYSA 3BIHA 5IZZA 1P1NA 1TWYA 1ELJA 4JVDA 3S4UA 3EHUA 2WBBA 1LFIA 1QULA 4X1BA 2OWZA 3R26A 3O97A 1QUJA 1OVBA 3PPNA 4IR8A 4FAJA 4Q0CA 2P1SA 3Q26A 3N26A 3MZ1A 4R6KA 1DK4A 4PFRA 2AL4A 3FJ7A 1XVYA 2UVIA 4QF9A 4KD5A 4O8MA 3SKPA 5I58B 1BIYA 3B8BA 1QKBA 5H8QB 3MVZA 2F6GA 4PDHA 5I57A 1VSOA 4WEDA 4LONB 1LAHE 2FYIA 2R6GE 2P2AA 4KR5A 1XI6A 1ZTYA 3S9MC 4X04A 5FHMA 3EPEA 5FHOA 5F1QA 2HHMA 4AB6A 1O64A 2F34A 1BP5A 1FPLA 2THIA 3K4UA 2OLBA 1ZJLA 2XWOA 3K6WA 3MC2A 2UVJA 3SEXA 3B6TA 1NNFA 4R75A 3O9PA 4GXSB 1PC3A 1M5BA 4YKJA 2R71A 4KQPA 1QJMA 1LCFA 4R6HA 3IOUA 4G61A 3HCQA 1UTBA 3WAFA 4OVPA 3BFTA 1OIBA 3QSLA 3CI8A 4NF0A 4L17A 1FSAA 3C9HA 4H8IA 2RC7A 4M1VA 4HW8A 3S9EA 2Q8JA 1MPCA 4RY1A 3T93B 5ICQA 1IZ1A 1B9JA 4N6DA 1LB9A 2DWHA 4OHNA 4OEUA 3KBZA 1Y1ZA 4MCOA 1IMFA 5JK4A 3C35A 4NF5B 1NV0A 2QS3A 2XXPA 2PCRA 3IJOB 5KDTB 1EH3A 3GBAA 4TOZA 1J1NA 5CMMA 4G77A 1H45A 1SDXA 4XXUA 1SW2A 3Q28A 4RNSA 1XT8A 5AA1A 2RINA 3MJNA 1MH4A 2QMWA 2W7YA 5DEXB 2Z8FA 3TTKA 3CSBA 3VVEA 3JV9A 1RYOA 4U1ZA 5H8NA 4PDDA 4C1TA 1B0HA 1N0TA 3PUWE 3TQWA 4HCWA 4ESXA 2ZNTA 5T3JA 2XX7A 1JVYA 4X48A 1XC1A 2F7BA 3D4GA 4PAIA 5TP9B 1H76A 2WEFA 1QGXA 2PMSA 4LP2B 3MWBA 2I48A 3TTNA 1NUXA 4DCYA 1LCTA 3EN3A 1FTMA 4OZ9A 1S7YA 2MKZA 1RDZA 2GFEA 2XX9A 2DWAA 3K02A 1BLFA 1DTZA 3MVYA 5ET5A 5LTCA 4OA4A 2CZLA 2CZKA 1USYH 2F78A 1PEBA 3G3GA 2Z23A 3F11A 4EXLA 3H6TA 4YB6A 4R2BA 4THIA 4PFUA 3PMVA 3TPAA 2ESNA 2VD2A 4G68B 1UIVA 1LBXA 3KSJA 4OVRA 4ZE8A 5FTHA 4O3BA 1R9LA 3PTYA 2Y84A 1MM6A 4NF6A 1CNQA 1SPIA 3TMGA 2DE4A 3TODA 1AOVA 3G3FA 3OXNA 4PE5B
chains in the Genus database with same CATH topology
4G68C 2XD2A 1M5FA 1IXCA 1Y4TA 3LUYA 3N6UA 4YB5A 3DP8A 1MPBA 3PGFA 4IY6A 2Y7RA 3VLWA 4C0RA 1YAEA 5I84A 2Z8EA 4Z0IA 4GQOA 4F3BA 4DZ1A 4DDDA 5CBSA 4KFQA 1TXFA 2ZYOA 3W15C 4NF5A 2F97A 4IO7A 1TFDA 2O1MA 1M5EA 2Y7PA 4I62A 1US5A 4OETA 4O3CA 3PD8A 1MM7A 3USDA 4RK2A 4FATA 1FTKA 2O1LA 3P7IA 1H3DA 2GHBA 3OO9A 4YAHX 1LAGE 4ZECA 1PDAA 1LB8A 3KJTA 4P0IA 3VXCA 5EHSA 2RCAA 3IORA 1MS7A 3IR1A 3O6IA 2O7UA 2UVHA 3KOTA 4JB7A 4Z7EA 5IKBA 2RF1A 5HM4B 5L9OA 2V3QA 3I5OA 4H1XA 3ZKKA 5CM6A 2XXWA 3IOWA 2Q89A 5L9SA 5J1DA 1BTJA 3TZAA 1D9YA 1SW4A 1HSJA 4BDOA 4BDLA 4H65A 1PB8A 5EHMA 5H8FB 5TP9A 1LGBC 3MBPA 3GZGA 4LQ5A 3QXMA 4P0GA 2RC8A 2H25A 3QIMA 4ZEBA 3T22A 3U8QA 3LSFB 1DPEA 3K2DA 2Q9TA 4XIGQ 3WAEA 5I2NB 3B6QA 3BFUA 1B0LA 2REJA 3LSWA 3OMBA 4LZ8A 4GLIA 4TLMB 3OSQA 4OERA 5AA2D 1P1UA 2Z22A 1SI1A 3MZ9A 1YTVA 4Q5TA 4DXBA 2CMOA 3T9VA 4ZZEA 1KWHA 1B3LA 1LAFE 1WVJA 4EQ7A 2QPQA 3FUZA 2Z8DA 1ZKBA 2ZNSA 2DXYA 1JEVA 2LAOA 2PT2A 1Z7ME 2ONSA 2ZNUA 1PBQA 3FXUA 5ITOA 2OWSA 4OXVA 3Q25A 3BBRA 1SBPA 1MXYA 4G2ZA 4IO6A 5K2YA 4FE8A 1TT1A 2AL5A 4NF4A 4ECFA 2OCUA 5CMKA 4ND9A 2F36A 3EHTA 3KEIA 1FQFA 1N76A 3I6VA 3ONMA 3SDFA 4OFJA 1B2HA 1MY0A 4GOTA 2H4IA 3LSLA 2ZMBA 5H8HB 4ELPA 2PVUA 1NH7A 1URDA 4QSEA 3DELB 5CMBA 3T66A 3W9VA 4F31B 3KSXA 4R9GA 4G4PA 3PMWA 2O51A 1OVTA 2H9BA 4RPNA 1FTLA 1LAXA 4ELRA 1A40A 4I9DA 3W9WA 4MLQA 3OELA 3FVKA 3MPKA 4YMBA 2F6PA 2Y7WA 2O7IA 2XXTA 4H8JA 2H98A 2XX8A 3MVXA 2B65A 4RA1A 5DT6A 2IA4A 4ZDMA 4GL8A 3SEYA 3TFLA 1RKMA 5FTIA 1MXWA 4OMBA 3TKDA 3OENA 5EYFA 4KYDA 1B40A 3UA8A 1B6HA 1WODA 1QW0A 1DSNA 1BKAA 4P11A 4OTEA 4F29A 4XKNA 1UTHA 1PB9A 1SYIA 3CRBA 3FZVA 3H4ZA 1MXVA 1ZU0A 4POWA 1IUDA 1IXHA 4LQ2A 1NH8A 4YKKA 1B46A 1DTGA 4X1DA 3VV5A 3MAMA 3QK6A 3H7MA 3OD7A 1GGGA 3H6VA 2QJEA 3TELA 5I58A 3G7WA 5AA4A 4DE8A 1I69A 2PX1A 5JTYB 1SW1A 4RYAA 1VR5A 4MFIA 4U4XA 4F3GA 3EQ1A 3OO6A 2O6AA 2XXIA 4MF3A 1HSEA 4F1UA 2HFBA 2Q2AA 1SQYA 4OWDA 5JEIA 4JWYA 1MY2A 3QAXA 4HTGA 4QFOA 1JNFA 5TU0A 3FJGA 1H44A 2DS9A 4G8HA 4YZZA 3VDFA 4GL0A 2FNCA 4OEVA 1ZBMA 3BKIB 1B3EA 3FASA 1M5DA 1LSTA 4NTLA 1HSLA 2D21A 2I6EA 4DLDA 4ONYA 1F9BA 5JTYA 3C4MA 1NKXA 1P99A 5A5XA 4GD5A 5KDTA 2OK2A 4NF8B 1USYE 4GRKA 2ZYMA 3PPPA 3RTWB 1N3WA 3GLBA 1IIWA 2X7QA 1MDP1 1B5JA 2XXQA 3PUXE 1N3XA 4H0WA 3RT8A 1OLAA 2VD3A 2Y7IA 1I6BA 3DM0A 4QHQA 3FD3A 2F35A 5M2VA 1MQJA 4FECA 1B3FA 3TTRA 3ILTB 3MQ9A 4QSDA 1FQDA 3C31A 3K1MA 4LVQA 4GIZA 1A99A 2XXVA 3MP8A 1ZLQA 3JYRA 1PB7A 1LBCA 2XXUA 4O3AA 2AIXA 4YKIA 4DXUA 2A5TA 4IO4A 3G3JA 2HAUA 1XS5A 3HHFA 2XHDA 3OO7A 1IXIA 4ESWA 1SI0A 4AB5A 2HEUA 1MY3A 4LZ5A 4ZEIA 4QRZA 2RKMA 5IAIA 1II5A 1B7UA 3CG1A 1OQGA 3FV2A 4I8CA 1N84A 2F7AA 3KFMA 2VHAA 3H6WA 2GRVA 4RXLA 3Q27A 5H8HA 2NUVA 1URGA 2NOOA 1GV8A 4ZZAA 1GVCA 2DVCA 1R9QA 3FJMA 1XOCA 1P1OA 1NNTA 2IEEA 1T0KA 2UYEA 4NE4A 3K01A 5ICTA 4N6PA 5I56B 4BLAA 2HZLA 1N04A 1RYXA 1B51A 3B7DA 3AXFA 3M3LA 2ZYKA 3RUMA 3FVGA 1OMPA 4KPTA 4LATA 1AIVA 3V89B 5AA2B 3JZJA 3OO8A 3MW0A 5DEXA 3LBSA 3A3UA 2NVUB 4OVJA 2QL3A 2Y7KA 3HSTA 4KCCA 4MLVA 1OQHA 1A7LA 3TQLA 4EF1A 5AA3A 3CVGA 2E1SA 4KYSA 2XXRA 1JVXA 4UACA 4JWXA 3A3CA 3VXBA 2ONRA 3M8UA 5ITPA 2Q88A 1P1NA 1CB6A 1TWYA 3GXAA 1ELJA 3TAJA 2DVZA 3TCGA 3T9HB 3UP9A 4LUBA 4PFTA 3S4UA 4R6YA 1QUIA 5KCJB 2DP8A 2UYFA 3EHUA 2A5TB 5H8SA 1LFIA 1QULA 4X1BA 2O68A 5L8DA 3CG3A 4H5GA 3QUFA 3R26A 5DVFA 3VFJA 3G3KA 4EDPA 2RCBA 3KOSA 1B58A 1QUJA 1OVBA 3O97A 3PPNA 4U4SA 3RGYA 4NF6B 3IAZA 1GTKA 4PP0A 1A8EA 4I1DA 5DVIA 5I2KB 4FAJA 4Q0CA 2P1SA 3Q26A 1UIUA 1ANFA 3L6GA 3KN8A 3KGCA 4YICA 1Y4CA 2QMXA 2QSXA 3N26A 4ZEDA 3K0VA 3MZ1A 1IXGA 1MDQA 2F8DA 3N5LA 4NMYA 4R6KA 5DTBA 1H43A 2AL4A 2XD3A 1MY4A 2A5SA 2WKYA 3FJ7A 3K6UA 3TUSA 1XVYA 2UVIA 3E13X 1DPPA 1FQAA 1SD3A 2H99A 1FQBA 4QF9A 3SEWA 1ZMGA 3VE1B 1FCKA 4KD5A 3SKPA 4GXAA 5L9MA 1Q35A 2X26A 3PPQA 1BIYA 4IO2A 5I58B 1QKBA 4YB7A 3A09A 4NF8A 5F7VA 4XKRA 4OYVA 3IK6B 3MVZA 1S9TA 1OLCA 1FTOA 5H8QB 1Y1MA 3TDJA 2Q2CA 4F18A 2F6GA 1EZPA 5I57A 1VSOA 4WEDA 2QS1A 4LONB 1UTHB 3C36A 4WXJA 1LAHE 1B32A 2FYIA 2R6GE 2ZYNA 2P2AA 4DIGA 4KR5A 4QFKA 1NFTA 4R73A 3U1OA 5HPQA 4F19A 1ZTYA 3H3GA 3S9MC 3V83A 5FHMA 3H6UA 5KZTA 3RN8A 3EPEA 3O6GA 5FHOA 3MP6A 2DE2A 4JDFA 3SEUA 4QFNA 3SESA 1POY1 2VP1A 3LR1A 5F1QA 4AB6A 2ANJA 1NMUA 1B7ZA 1O64A 1B4HA 2F34A 1BP5A 2THIA 1MQDA 3QYTA 4H6DA 3K4UA 3H06B 4FORA 2OLBA 1FW0A 1MQIA 1ZJLA 2D3IA 2O84X 3RTFB 1ZIUA 3VLVA 3K1PA 4F1VA 3M3FA 2YPNA 3VVFA 3K6WA 4OESA 3UORA 1JEUA 4R2FA 1JETA 5KCJA 3S2VA 3CFLA 3MC2A 4U21A 2UVJA 2DE3A 3TYHA 2O69A 4OENA 4F2QA 1MXUA 3SEXA 2DOJA 2FA7A 3CSGA 3B6TA 3IB2A 3DLNA 4ISUA 5HBCA 1EZOA 4N07A 1NNFA 3I3VA 3IO6A 3MUQA 4IO3A 1MXXA 2YJPA 3FATA 3FXRA 4KYEA 4R75A 3O9PA 1FQCA 3ZSFA 4GF8A 3PPRA 3O28A 4GXSB 3E4RA 1PC3A 4HCYA 4IGTA 4GWOA 1M5BA 4N13A 3IX1A 2ONKE 3OEKA 4YKJA 2R71A 4KQPA 1MH3A 1QJMA 3KBRA 1D9VA 1LCFA 4Q8RA 3MZBA 3N6TA 4R6HA 4DXCA 2GH9A 3CFZA 3IOUA 1UTBB 5AE4A 1LBBA 3UIFA 3HCQA 3HN0A 1UTBA 5LOMA 3IL1B 5BUUA 3S9NC 3WAFA 3PPOA 1Y9UA 1MQHA 1EZ9A 2YLNA 1Z7NE 3BFTA 1OIBA 3PUVE 1L5TA 1POTA 1Y3QA 2I4CA 1ATGA 2XXXA 3QSLA 1MRPA 3R6UA 2ABHA 3RPWA 4EQ9A 3CI8A 3FVNA 2I0BA 2DWJA 3U94A 1D4NA 4L17A 2I58A 4XKQA 1QVSA 2I3WA 4R9FA 4ZS9A 2M8CA 4F22A 1IQ7A 4RK9A 2P0SA 4UA8A 2F5XA 3C9HA 1B3GA 3DP4A 4H8IA 4WKMA 5B70A 2RC7A 4M1VA 1B5IA 1IEJA 4RJZA 4HW8A 3S9EA 4QSCA 3UN6A 3GBBA 3ODBA 5K2XA 1Y20A 1B5HA 3SETA 2E0SA 1P1WA 3OOAA 3T96B 3KZGA 1B52A 1B4ZA 4JSOA 2V3UA 1P1QA 3RNNA 4H5FA 3V5AA 2Q8JA 1MPCA 4LA9A 4RY1A 4TQUQ 5CMCA 3T93B 2PYYA 1A55A 5DVJA 3N94A 5ICQA 1IZ1A 1AL3A 1B9JA 1SVXB 2VGQA 3MP1A 4OFOA 3RT6B 1LB9A 3ZS6A 2DWHA 4PQJA 3OEMA 4OHNA 3K1NA 4GFRA 3RQTA 4JWOA 4OEUA 2DWIA 3DP6A 4EF2A 2QRYA 1Y1ZA 4YMAA 2OBGA 5H8QA 2PT1A 4NWDA 5JK4A 3C35A 4YU0A 3O6HA 4NF5B 3CR9A 3VLUA 2B3FA 2QS3A 3PUZE 2PBWA 1URSA 4KCDA 4PFWA 3K6XA 1MQGA 3RLFE 2NWJA 1Q1KA 2XXPA 4GVOA 4MBPA 5TPAA 2RC9A 3IJOB 4U1OA 2X7PA 2D5WA 3TTMA 2F7CA 3KN3A 1B1HA 1EH3A 2ZXTA 5KDTB 2KLFA 3GBAA 3C34A 3G3IA 1NL5A 1J1NA 1AH5A 4TOZA 5CMMA 4JBZA 5I57B 4G77A 3O2AA 3PD9A 4KI0E 1H45A 2DYXA 1SDXA 1B05A 2DSFA 4XXUA 1SW2A 2I0CA 4G8MA 3Q28A 1PBPA 4RNSA 3ILUB 4ELQA 2REGA 4EUOA 2OJTA 4EXKA 1Y3PA 1XT8A 4G8NA 4F39A 4QFLA 5AA4B 2V25A 3E9XA 3QUJA 5AA1A 4NWCA 4BDQA 1NNKA 1LFGA 3O66A 3IOTA 2RINA 1JW5A 1M5CA 1R6ZA 3FXQA 3MJNA 4KHZE 4POXA 4QFPA 1VFDA 5BWJA 2VOZA 3RY3A 5I59A 1MH4A 2QMWA 3U72A 4AQ4A 3S9LC 2W7YA 3E3KA 4FJPA 3G3HA 4OQOA 5DEXB 2Z8FA 3O29A 4ZEKA 3TTKA 3CSBA 2DXRA 3TCHA 3LSXA 1MXZA 3VVEA 2UVGA 3JV9A 2ALUA 3TCFA 3FVOA 1RYOA 2OZZA 4U1ZA 1VFEA 4IY5A 4X9TA 5H8NA 1JW4A 4E0XA 3IB1A 4PFYA 3U93A 5I56A 3FIRA 2G93A 1VE4A 5I2NA 4IB2A 3SEVA 1SW5A 2I3VA 3UK4A 4C1TA 4ZEFA 2HCAA 1B7HA 3IJXB 1AMFA 1B0HA 1N0TA 1WDNA 3PUWE 1MY1A 4LZ7A 1I6AA 1QKAA 1JW1A 2I4BA 4HCWA 3TQWA 1EU8A 3HHGA 4ESXA 2ZNTA 4NF4B 1S50A 2XX7A 1JVYA 2HZKA 3MVWA 4FIMA 4X48A 1XHYA 2BJJX 5DYHA 1XC1A 2F7BA 3D4GA 5TP9B 4MH5A 4BDNA 1IITA 3FV1A 1H76A 2XXYA 3IO4A 4FEBA 4R74A 2AYSA 4ELOA 4LP2B 1R1NA 2PMSA 2QS2A 2GHAA 3T9UA 3MWBA 2I48A 3TEPA 4YKPA 4BDRA 3TTNA 4DCYA 5AA2A 1LCTA 1LLSA 1N7XA 3IB0A 3EN3A 4JSDA 5H8NB 1MG1A 3MPLA 2I49A 4DCXA 1FTMA 2V3TA 2HXWA 4OZ9A 1S7YA 2XXHA 3HO7A 1YCJA 3D4CA 1DOTA 2OWTA 1FQEA 2HAVA 4M4GA 3M3KA 5CC2A 5H8FA 4XTCQ 5CI5A 2GFEA 2XX9A 1XVXA 2DWAA 3K02A 1BLFA 1DTZA 3H03A 3MVYA 4C1UA 4NEDA 1JQFA 3KJ7A 2NXOA 4HS7A 4BDMA 3PV0E 2CZLA 3FGSA 4U22A 4RPOA 4H67A 5I59B 1USYH 4FEDA 1SYHA 3CIJA 5A5XB 3OSRA 2F78A 3C32A 1I6QA 4JXIA 1PEBA 2H5YA 2G29A 3THIA 1B3HA 4IGRA 3G3GA 2Z23A 3F11A 3K6VA 4TLLB 4EXLA 3H6TA 4K3FA 3KN7A 2UXAA 4YB6A 2R9JA 3UGWA 4R2BA 4THIA 4F2OA 4PFUA 1QUKA 3IOVA 3LC8A 3KG2A 1DMBA 3HPIA 3PMVA 4Q30B 4WEPA 5TPAB 1B1XA 3TPAA 4EQBA 3U92A 5B7DA 1A54A 4G68A 1N7WA 1TFAA 3K00A 1LFHA 4U23A 2ESNA 2VD2A 4G68B 3T9XB 1UIVA 4E0WA 4IO5A 3CFXA 3PU5A 1GR2A 3SERA 3HV1A 3ECRA 2V84A 2QS4A 3KSJA 1UQWA 1Y3NA 3TTLA 5ISUA 1US4A 1A8FA 2B3BA 3PMXA 3C33A 2HQ0A 4ZE8A 5FTHA 1YPNA 1D3KA 4ZE9A 4O3BA 3V8XB 4XKPA 1O63A 3PUYE 3ZKLA 4F3PA 1R9LA 1FTJA 2Y84A 5ELVA 3VVDA 4F3SA 1MM6A 3B6WA 1CE2A 1NNPA 3EF7A 1MPDA 4NF6A 4R72A 4OFLA 3TMGA 2DE4A 3EHSA 5CBRA 3TODA 1AOVA 5CRYA 1O7TA 3G3FA 5FHNA 3R7XA 3L6HA 2V93A 3Q29A 4PETA 4U2RA 2DQVA 5I2KA 3OXNA 4PE5B 4F1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G68 C;  2XD2 A;  1M5F A;  1IXC A;  1Y4T A;  3LUY A;  3N6U A;  4YB5 A;  3DP8 A;  1MPB A;  3PGF A;  4IY6 A;  2Y7R A;  3VLW A;  4C0R A;  1YAE A;  5I84 A;  2Z8E A;  4Z0I A;  4GQO A;  4F3B A;  4DZ1 A;  4DDD A;  5CBS A;  4KFQ A;  1TXF A;  2ZYO A;  3W15 C;  4NF5 A;  2F97 A;  4IO7 A;  1TFD A;  2O1M A;  1M5E A;  2Y7P A;  4I62 A;  1US5 A;  4OET A;  4O3C A;  3PD8 A;  1MM7 A;  3USD A;  4RK2 A;  4FAT A;  1FTK A;  2O1L A;  3P7I A;  1H3D A;  2GHB A;  3OO9 A;  4YAH X;  1LAG E;  4ZEC A;  1PDA A;  1LB8 A;  3KJT A;  4P0I A;  3VXC A;  5EHS A;  2RCA A;  3IOR A;  1MS7 A;  3IR1 A;  3O6I A;  2O7U A;  2UVH A;  3KOT A;  4JB7 A;  4Z7E A;  5IKB A;  2RF1 A;  5HM4 B;  5L9O A;  2V3Q A;  3I5O A;  4H1X A;  3ZKK A;  5CM6 A;  2XXW A;  3IOW A;  2Q89 A;  5L9S A;  5J1D A;  1BTJ A;  3TZA A;  1D9Y A;  1SW4 A;  1HSJ A;  4BDO A;  4BDL A;  4H65 A;  1PB8 A;  5EHM A;  5H8F B;  5TP9 A;  1LGB C;  3MBP A;  3GZG A;  4LQ5 A;  3QXM A;  4P0G A;  2RC8 A;  2H25 A;  3QIM A;  4ZEB A;  3T22 A;  3U8Q A;  3LSF B;  1DPE A;  3K2D A;  2Q9T A;  4XIG Q;  3WAE A;  5I2N B;  3B6Q A;  3BFU A;  1B0L A;  2REJ A;  3LSW A;  3OMB A;  4LZ8 A;  4GLI A;  4TLM B;  3OSQ A;  4OER A;  5AA2 D;  1P1U A;  2Z22 A;  1SI1 A;  3MZ9 A;  1YTV A;  4Q5T A;  4DXB A;  2CMO A;  3T9V A;  4ZZE A;  1KWH A;  1B3L A;  1LAF E;  1WVJ A;  4EQ7 A;  2QPQ A;  3FUZ A;  2Z8D A;  1ZKB A;  2ZNS A;  2DXY A;  1JEV A;  2LAO A;  2PT2 A;  1Z7M E;  2ONS A;  2ZNU A;  1PBQ A;  3FXU A;  5ITO A;  2OWS A;  4OXV A;  3Q25 A;  3BBR A;  1SBP A;  1MXY A;  4G2Z A;  4IO6 A;  5K2Y A;  4FE8 A;  1TT1 A;  2AL5 A;  4NF4 A;  4ECF A;  2OCU A;  5CMK A;  4ND9 A;  2F36 A;  3EHT A;  3KEI A;  1FQF A;  1N76 A;  3I6V A;  3ONM A;  3SDF A;  4OFJ A;  1B2H A;  1MY0 A;  4GOT A;  2H4I A;  3LSL A;  2ZMB A;  5H8H B;  4ELP A;  2PVU A;  1NH7 A;  1URD A;  4QSE A;  3DEL B;  5CMB A;  3T66 A;  3W9V A;  4F31 B;  3KSX A;  4R9G A;  4G4P A;  3PMW A;  2O51 A;  1OVT A;  2H9B A;  4RPN A;  1FTL A;  1LAX A;  4ELR A;  1A40 A;  4I9D A;  3W9W A;  4MLQ A;  3OEL A;  3FVK A;  3MPK A;  4YMB A;  2F6P A;  2Y7W A;  2O7I A;  2XXT A;  4H8J A;  2H98 A;  2XX8 A;  3MVX A;  2B65 A;  4RA1 A;  5DT6 A;  2IA4 A;  4ZDM A;  4GL8 A;  3SEY A;  3TFL A;  1RKM A;  5FTI A;  1MXW A;  4OMB A;  3TKD A;  3OEN A;  5EYF A;  4KYD A;  1B40 A;  3UA8 A;  1B6H A;  1WOD A;  1QW0 A;  1DSN A;  1BKA A;  4P11 A;  4OTE A;  4F29 A;  4XKN A;  1UTH A;  1PB9 A;  1SYI A;  3CRB A;  3FZV A;  3H4Z A;  1MXV A;  1ZU0 A;  4POW A;  1IUD A;  1IXH A;  4LQ2 A;  1NH8 A;  4YKK A;  1B46 A;  1DTG A;  4X1D A;  3VV5 A;  3MAM A;  3QK6 A;  3H7M A;  3OD7 A;  1GGG A;  3H6V A;  2QJE A;  3TEL A;  5I58 A;  3G7W A;  5AA4 A;  4DE8 A;  1I69 A;  2PX1 A;  5JTY B;  1SW1 A;  4RYA A;  1VR5 A;  4MFI A;  4U4X A;  4F3G A;  3EQ1 A;  3OO6 A;  2O6A A;  2XXI A;  4MF3 A;  1HSE A;  4F1U A;  2HFB A;  2Q2A A;  1SQY A;  4OWD A;  5JEI A;  4JWY A;  1MY2 A;  3QAX A;  4HTG A;  4QFO A;  1JNF A;  5TU0 A;  3FJG A;  1H44 A;  2DS9 A;  4G8H A;  4YZZ A;  3VDF A;  4GL0 A;  2FNC A;  4OEV A;  1ZBM A;  3BKI B;  1B3E A;  3FAS A;  1M5D A;  1LST A;  4NTL A;  1HSL A;  2D21 A;  2I6E A;  4DLD A;  4ONY A;  1F9B A;  5JTY A;  3C4M A;  1NKX A;  1P99 A;  5A5X A;  4GD5 A;  5KDT A;  2OK2 A;  4NF8 B;  1USY E;  4GRK A;  2ZYM A;  3PPP A;  3RTW B;  1N3W A;  3GLB A;  1IIW A;  2X7Q A;  1MDP 1;  1B5J A;  2XXQ A;  3PUX E;  1N3X A;  4H0W A;  3RT8 A;  1OLA A;  2VD3 A;  2Y7I A;  1I6B A;  3DM0 A;  4QHQ A;  3FD3 A;  2F35 A;  5M2V A;  1MQJ A;  4FEC A;  1B3F A;  3TTR A;  3ILT B;  3MQ9 A;  4QSD A;  1FQD A;  3C31 A;  3K1M A;  4LVQ A;  4GIZ A;  1A99 A;  2XXV A;  3MP8 A;  1ZLQ A;  3JYR A;  1PB7 A;  1LBC A;  2XXU A;  4O3A A;  2AIX A;  4YKI A;  4DXU A;  2A5T A;  4IO4 A;  3G3J A;  2HAU A;  1XS5 A;  3HHF A;  2XHD A;  3OO7 A;  1IXI A;  4ESW A;  1SI0 A;  4AB5 A;  2HEU A;  1MY3 A;  4LZ5 A;  4ZEI A;  4QRZ A;  2RKM A;  5IAI A;  1II5 A;  1B7U A;  3CG1 A;  1OQG A;  3FV2 A;  4I8C A;  1N84 A;  2F7A A;  3KFM A;  2VHA A;  3H6W A;  2GRV A;  4RXL A;  3Q27 A;  5H8H A;  2NUV A;  1URG A;  2NOO A;  1GV8 A;  4ZZA A;  1GVC A;  2DVC A;  1R9Q A;  3FJM A;  1XOC A;  1P1O A;  1NNT A;  2IEE A;  1T0K A;  2UYE A;  4NE4 A;  3K01 A;  5ICT A;  4N6P A;  5I56 B;  4BLA A;  2HZL A;  1N04 A;  1RYX A;  1B51 A;  3B7D A;  3AXF A;  3M3L A;  2ZYK A;  3RUM A;  3FVG A;  1OMP A;  4KPT A;  4LAT A;  1AIV A;  3V89 B;  5AA2 B;  3JZJ A;  3OO8 A;  3MW0 A;  5DEX A;  3LBS A;  3A3U A;  2NVU B;  4OVJ A;  2QL3 A;  2Y7K A;  3HST A;  4KCC A;  4MLV A;  1OQH A;  1A7L A;  3TQL A;  4EF1 A;  5AA3 A;  3CVG A;  2E1S A;  4KYS A;  2XXR A;  1JVX A;  4UAC A;  4JWX A;  3A3C A;  3VXB A;  2ONR A;  3M8U A;  5ITP A;  2Q88 A;  1P1N A;  1CB6 A;  1TWY A;  3GXA A;  1ELJ A;  3TAJ A;  2DVZ A;  3TCG A;  3T9H B;  3UP9 A;  4LUB A;  4PFT A;  3S4U A;  4R6Y A;  1QUI A;  5KCJ B;  2DP8 A;  2UYF A;  3EHU A;  2A5T B;  5H8S A;  1LFI A;  1QUL A;  4X1B A;  2O68 A;  5L8D A;  3CG3 A;  4H5G A;  3QUF A;  3R26 A;  5DVF A;  3VFJ A;  3G3K A;  4EDP A;  2RCB A;  3KOS A;  1B58 A;  1QUJ A;  1OVB A;  3O97 A;  3PPN A;  4U4S A;  3RGY A;  4NF6 B;  3IAZ A;  1GTK A;  4PP0 A;  1A8E A;  4I1D A;  5DVI A;  5I2K B;  4FAJ A;  4Q0C A;  2P1S A;  3Q26 A;  1UIU A;  1ANF A;  3L6G A;  3KN8 A;  3KGC A;  4YIC A;  1Y4C A;  2QMX A;  2QSX A;  3N26 A;  4ZED A;  3K0V A;  3MZ1 A;  1IXG A;  1MDQ A;  2F8D A;  3N5L A;  4NMY A;  4R6K A;  5DTB A;  1H43 A;  2AL4 A;  2XD3 A;  1MY4 A;  2A5S A;  2WKY A;  3FJ7 A;  3K6U A;  3TUS A;  1XVY A;  2UVI A;  3E13 X;  1DPP A;  1FQA A;  1SD3 A;  2H99 A;  1FQB A;  4QF9 A;  3SEW A;  1ZMG A;  3VE1 B;  1FCK A;  4KD5 A;  3SKP A;  4GXA A;  5L9M A;  1Q35 A;  2X26 A;  3PPQ A;  1BIY A;  4IO2 A;  5I58 B;  1QKB A;  4YB7 A;  3A09 A;  4NF8 A;  5F7V A;  4XKR A;  4OYV A;  3IK6 B;  3MVZ A;  1S9T A;  1OLC A;  1FTO A;  5H8Q B;  1Y1M A;  3TDJ A;  2Q2C A;  4F18 A;  2F6G A;  1EZP A;  5I57 A;  1VSO A;  4WED A;  2QS1 A;  4LON B;  1UTH B;  3C36 A;  4WXJ A;  1LAH E;  1B32 A;  2FYI A;  2R6G E;  2ZYN A;  2P2A A;  4DIG A;  4KR5 A;  4QFK A;  1NFT A;  4R73 A;  3U1O A;  5HPQ A;  4F19 A;  1ZTY A;  3H3G A;  3S9M C;  3V83 A;  5FHM A;  3H6U A;  5KZT A;  3RN8 A;  3EPE A;  3O6G A;  5FHO A;  3MP6 A;  2DE2 A;  4JDF A;  3SEU A;  4QFN A;  3SES A;  1POY 1;  2VP1 A;  3LR1 A;  5F1Q A;  4AB6 A;  2ANJ A;  1NMU A;  1B7Z A;  1O64 A;  1B4H A;  2F34 A;  1BP5 A;  2THI A;  1MQD A;  3QYT A;  4H6D A;  3K4U A;  3H06 B;  4FOR A;  2OLB A;  1FW0 A;  1MQI A;  1ZJL A;  2D3I A;  2O84 X;  3RTF B;  1ZIU A;  3VLV A;  3K1P A;  4F1V A;  3M3F A;  2YPN A;  3VVF A;  3K6W A;  4OES A;  3UOR A;  1JEU A;  4R2F A;  1JET A;  5KCJ A;  3S2V A;  3CFL A;  3MC2 A;  4U21 A;  2UVJ A;  2DE3 A;  3TYH A;  2O69 A;  4OEN A;  4F2Q A;  1MXU A;  3SEX A;  2DOJ A;  2FA7 A;  3CSG A;  3B6T A;  3IB2 A;  3DLN A;  4ISU A;  5HBC A;  1EZO A;  4N07 A;  1NNF A;  3I3V A;  3IO6 A;  3MUQ A;  4IO3 A;  1MXX A;  2YJP A;  3FAT A;  3FXR A;  4KYE A;  4R75 A;  3O9P A;  1FQC A;  3ZSF A;  4GF8 A;  3PPR A;  3O28 A;  4GXS B;  3E4R A;  1PC3 A;  4HCY A;  4IGT A;  4GWO A;  1M5B A;  4N13 A;  3IX1 A;  2ONK E;  3OEK A;  4YKJ A;  2R71 A;  4KQP A;  1MH3 A;  1QJM A;  3KBR A;  1D9V A;  1LCF A;  4Q8R A;  3MZB A;  3N6T A;  4R6H A;  4DXC A;  2GH9 A;  3CFZ A;  3IOU A;  1UTB B;  5AE4 A;  1LBB A;  3UIF A;  3HCQ A;  3HN0 A;  1UTB A;  5LOM A;  3IL1 B;  5BUU A;  3S9N C;  3WAF A;  3PPO A;  1Y9U A;  1MQH A;  1EZ9 A;  2YLN A;  1Z7N E;  3BFT A;  1OIB A;  3PUV E;  1L5T A;  1POT A;  1Y3Q A;  2I4C A;  1ATG A;  2XXX A;  3QSL A;  1MRP A;  3R6U A;  2ABH A;  3RPW A;  4EQ9 A;  3CI8 A;  3FVN A;  2I0B A;  2DWJ A;  3U94 A;  1D4N A;  4L17 A;  2I58 A;  4XKQ A;  1QVS A;  2I3W A;  4R9F A;  4ZS9 A;  2M8C A;  4F22 A;  1IQ7 A;  4RK9 A;  2P0S A;  4UA8 A;  2F5X A;  3C9H A;  1B3G A;  3DP4 A;  4H8I A;  4WKM A;  5B70 A;  2RC7 A;  4M1V A;  1B5I A;  1IEJ A;  4RJZ A;  4HW8 A;  3S9E A;  4QSC A;  3UN6 A;  3GBB A;  3ODB A;  5K2X A;  1Y20 A;  1B5H A;  3SET A;  2E0S A;  1P1W A;  3OOA A;  3T96 B;  3KZG A;  1B52 A;  1B4Z A;  4JSO A;  2V3U A;  1P1Q A;  3RNN A;  4H5F A;  3V5A A;  2Q8J A;  1MPC A;  4LA9 A;  4RY1 A;  4TQU Q;  5CMC A;  3T93 B;  2PYY A;  1A55 A;  5DVJ A;  3N94 A;  5ICQ A;  1IZ1 A;  1AL3 A;  1B9J A;  1SVX B;  2VGQ A;  3MP1 A;  4OFO A;  3RT6 B;  1LB9 A;  3ZS6 A;  2DWH A;  4PQJ A;  3OEM A;  4OHN A;  3K1N A;  4GFR A;  3RQT A;  4JWO A;  4OEU A;  2DWI A;  3DP6 A;  4EF2 A;  2QRY A;  1Y1Z A;  4YMA A;  2OBG A;  5H8Q A;  2PT1 A;  4NWD A;  5JK4 A;  3C35 A;  4YU0 A;  3O6H A;  4NF5 B;  3CR9 A;  3VLU A;  2B3F A;  2QS3 A;  3PUZ E;  2PBW A;  1URS A;  4KCD A;  4PFW A;  3K6X A;  1MQG A;  3RLF E;  2NWJ A;  1Q1K A;  2XXP A;  4GVO A;  4MBP A;  5TPA A;  2RC9 A;  3IJO B;  4U1O A;  2X7P A;  2D5W A;  3TTM A;  2F7C A;  3KN3 A;  1B1H A;  1EH3 A;  2ZXT A;  5KDT B;  2KLF A;  3GBA A;  3C34 A;  3G3I A;  1NL5 A;  1J1N A;  1AH5 A;  4TOZ A;  5CMM A;  4JBZ A;  5I57 B;  4G77 A;  3O2A A;  3PD9 A;  4KI0 E;  1H45 A;  2DYX A;  1SDX A;  1B05 A;  2DSF A;  4XXU A;  1SW2 A;  2I0C A;  4G8M A;  3Q28 A;  1PBP A;  4RNS A;  3ILU B;  4ELQ A;  2REG A;  4EUO A;  2OJT A;  4EXK A;  1Y3P A;  1XT8 A;  4G8N A;  4F39 A;  4QFL A;  5AA4 B;  2V25 A;  3E9X A;  3QUJ A;  5AA1 A;  4NWC A;  4BDQ A;  1NNK A;  1LFG A;  3O66 A;  3IOT A;  2RIN A;  1JW5 A;  1M5C A;  1R6Z A;  3FXQ A;  3MJN A;  4KHZ E;  4POX A;  4QFP A;  1VFD A;  5BWJ A;  2VOZ A;  3RY3 A;  5I59 A;  1MH4 A;  2QMW A;  3U72 A;  4AQ4 A;  3S9L C;  2W7Y A;  3E3K A;  4FJP A;  3G3H A;  4OQO A;  5DEX B;  2Z8F A;  3O29 A;  4ZEK A;  3TTK A;  3CSB A;  2DXR A;  3TCH A;  3LSX A;  1MXZ A;  3VVE A;  2UVG A;  3JV9 A;  2ALU A;  3TCF A;  3FVO A;  1RYO A;  2OZZ A;  4U1Z A;  1VFE A;  4IY5 A;  4X9T A;  5H8N A;  1JW4 A;  4E0X A;  3IB1 A;  4PFY A;  3U93 A;  5I56 A;  3FIR A;  2G93 A;  1VE4 A;  5I2N A;  4IB2 A;  3SEV A;  1SW5 A;  2I3V A;  3UK4 A;  4C1T A;  4ZEF A;  2HCA A;  1B7H A;  3IJX B;  1AMF A;  1B0H A;  1N0T A;  1WDN A;  3PUW E;  1MY1 A;  4LZ7 A;  1I6A A;  1QKA A;  1JW1 A;  2I4B A;  4HCW A;  3TQW A;  1EU8 A;  3HHG A;  4ESX A;  2ZNT A;  4NF4 B;  1S50 A;  2XX7 A;  1JVY A;  2HZK A;  3MVW A;  4FIM A;  4X48 A;  1XHY A;  2BJJ X;  5DYH A;  1XC1 A;  2F7B A;  3D4G A;  5TP9 B;  4MH5 A;  4BDN A;  1IIT A;  3FV1 A;  1H76 A;  2XXY A;  3IO4 A;  4FEB A;  4R74 A;  2AYS A;  4ELO A;  4LP2 B;  1R1N A;  2PMS A;  2QS2 A;  2GHA A;  3T9U A;  3MWB A;  2I48 A;  3TEP A;  4YKP A;  4BDR A;  3TTN A;  4DCY A;  5AA2 A;  1LCT A;  1LLS A;  1N7X A;  3IB0 A;  3EN3 A;  4JSD A;  5H8N B;  1MG1 A;  3MPL A;  2I49 A;  4DCX A;  1FTM A;  2V3T A;  2HXW A;  4OZ9 A;  1S7Y A;  2XXH A;  3HO7 A;  1YCJ A;  3D4C A;  1DOT A;  2OWT A;  1FQE A;  2HAV A;  4M4G A;  3M3K A;  5CC2 A;  5H8F A;  4XTC Q;  5CI5 A;  2GFE A;  2XX9 A;  1XVX A;  2DWA A;  3K02 A;  1BLF A;  1DTZ A;  3H03 A;  3MVY A;  4C1U A;  4NED A;  1JQF A;  3KJ7 A;  2NXO A;  4HS7 A;  4BDM A;  3PV0 E;  2CZL A;  3FGS A;  4U22 A;  4RPO A;  4H67 A;  5I59 B;  1USY H;  4FED A;  1SYH A;  3CIJ A;  5A5X B;  3OSR A;  2F78 A;  3C32 A;  1I6Q A;  4JXI A;  1PEB A;  2H5Y A;  2G29 A;  3THI A;  1B3H A;  4IGR A;  3G3G A;  2Z23 A;  3F11 A;  3K6V A;  4TLL B;  4EXL A;  3H6T A;  4K3F A;  3KN7 A;  2UXA A;  4YB6 A;  2R9J A;  3UGW A;  4R2B A;  4THI A;  4F2O A;  4PFU A;  1QUK A;  3IOV A;  3LC8 A;  3KG2 A;  1DMB A;  3HPI A;  3PMV A;  4Q30 B;  4WEP A;  5TPA B;  1B1X A;  3TPA A;  4EQB A;  3U92 A;  5B7D A;  1A54 A;  4G68 A;  1N7W A;  1TFA A;  3K00 A;  1LFH A;  4U23 A;  2ESN A;  2VD2 A;  4G68 B;  3T9X B;  1UIV A;  4E0W A;  4IO5 A;  3CFX A;  3PU5 A;  1GR2 A;  3SER A;  3HV1 A;  3ECR A;  2V84 A;  2QS4 A;  3KSJ A;  1UQW A;  1Y3N A;  3TTL A;  5ISU A;  1US4 A;  1A8F A;  2B3B A;  3PMX A;  3C33 A;  2HQ0 A;  4ZE8 A;  5FTH A;  1YPN A;  1D3K A;  4ZE9 A;  4O3B A;  3V8X B;  4XKP A;  1O63 A;  3PUY E;  3ZKL A;  4F3P A;  1R9L A;  1FTJ A;  2Y84 A;  5ELV A;  3VVD A;  4F3S A;  1MM6 A;  3B6W A;  1CE2 A;  1NNP A;  3EF7 A;  1MPD A;  4NF6 A;  4R72 A;  4OFL A;  3TMG A;  2DE4 A;  3EHS A;  5CBR A;  3TOD A;  1AOV A;  5CRY A;  1O7T A;  3G3F A;  5FHN A;  3R7X A;  3L6H A;  2V93 A;  3Q29 A;  4PET A;  4U2R A;  2DQV A;  5I2K A;  3OXN A;  4PE5 B;  4F1Y A; 
#chains in the Genus database with same CATH topology
 1M5F A;  4C0R A;  3FXB A;  5I84 A;  4DDD A;  5CBS A;  1FPF A;  3FBP A;  4IO7 A;  4DI4 B;  1M5E A;  4O3C A;  2WBD A;  2PFY A;  4ZEC A;  3KJT A;  4P0I A;  2O7U A;  1FPD A;  5IKB A;  5HM4 B;  3IOW A;  5J1D A;  1BTJ A;  3TZA A;  1HSJ A;  4H65 A;  3MBP A;  4LQ5 A;  3T22 A;  2H25 A;  3QIM A;  3LSF B;  1DPE A;  3K2D A;  3B6Q A;  1B0L A;  2REJ A;  4LZ8 A;  4GLI A;  3OSQ A;  1P1U A;  3MZ9 A;  4DXB A;  4ZZE A;  4GX6 A;  3NOH A;  4GWZ A;  2LAO A;  2ONS A;  2ZNU A;  2XWI A;  2OWS A;  1SBP A;  5IZ3 A;  4NF4 A;  2F36 A;  3EHT A;  1FQF A;  3ONM A;  2H4I A;  3T66 A;  4OVT A;  3KSX A;  4P56 A;  4R9G A;  3PMW A;  3RPL B;  4P8B A;  3FVK A;  2Y7W A;  4ZEF A;  2XXT A;  2XX8 A;  4RA1 A;  4ZDM A;  3TFL A;  1MXW A;  5EYF A;  3UA8 A;  1QW0 A;  4OTE A;  4N15 A;  3T1B A;  1SYI A;  1ZU0 A;  4XEQ A;  2FIX A;  4AS5 A;  3VV5 A;  4PGP A;  4DE8 A;  5ESY A;  2F3D A;  4RYA A;  4MFI A;  4U4X A;  4F3G A;  3EQ1 A;  2O6A A;  2XXI A;  4F1U A;  5JEI A;  3QAX A;  4G8H A;  2I6E A;  4ONY A;  1F9B A;  1P99 A;  4GWY A;  2ZYM A;  1N3W A;  2X7Q A;  3PUX E;  1YYZ A;  2Y7I A;  4MIJ A;  4MNI A;  3ILT B;  3MQ9 A;  1FQD A;  3K1M A;  1A99 A;  2PFZ A;  1PB7 A;  4AB5 A;  2FBP A;  3CG1 A;  4I8C A;  1OQG A;  2FVZ A;  3Q27 A;  2NOO A;  1R9Q A;  1XOC A;  1NNT A;  4NE4 A;  4N6P A;  4BLA A;  3M3L A;  2ZYK A;  1KA1 A;  1OMP A;  3LBS A;  3A3U A;  5AA3 A;  3CVG A;  1CB6 A;  1FBF A;  4PBH A;  5KCJ B;  1QUI A;  2DP8 A;  5H8S A;  2O68 A;  3CG3 A;  3QUF A;  5DVF A;  3VFJ A;  2GQ1 A;  4PGN A;  1GTK A;  3KN8 A;  1Y4C A;  1NV5 A;  1H43 A;  3K6U A;  1MY4 A;  2WKY A;  3SEW A;  1DPP A;  2X26 A;  2V4C A;  1NV1 A;  1FTA A;  4YB7 A;  3A09 A;  4OYV A;  3IK6 B;  1S9T A;  2B4L A;  2Q2C A;  4PTK A;  5A5L A;  1UTH B;  3C36 A;  5A5X A;  4N91 A;  4QFK A;  5HPQ A;  3H3G A;  3V83 A;  5KZT A;  4JDF A;  3SEU A;  2VP1 A;  3LR1 A;  1NMU A;  1B4H A;  1MQD A;  4H6D A;  3H06 B;  1MQI A;  2D3I A;  1VDW A;  1ZIU A;  2YPN A;  1JEU A;  5KCJ A;  3CFL A;  3TYH A;  1MXU A;  1IMC A;  2DOJ A;  2FA7 A;  3DLN A;  1EZO A;  3V8X B;  3IO6 A;  1MXX A;  2L5V A;  4GF8 A;  3RPL A;  2Y5K A;  4GWO A;  4N13 A;  2ONK E;  5AE4 A;  1UTB B;  1LBB A;  5BUU A;  3PPO A;  1BK4 A;  1Y3Q A;  1ATG A;  2XXX A;  3R6U A;  3FVN A;  1QVS A;  4N8G A;  2I3W A;  4R9F A;  1NUZ A;  3DP4 A;  5B70 A;  1B5I A;  4RJZ A;  3D1R A;  3GBB A;  1P1W A;  3T96 B;  1B52 A;  1B4Z A;  3RNN A;  4TQU Q;  2PYY A;  5ET8 A;  4QXD A;  3TUS A;  3MST A;  3K1N A;  1NV7 A;  4JWO A;  2DWI A;  3DP6 A;  2QRY A;  2PT1 A;  3O6H A;  2PBW A;  1URS A;  2NWJ A;  1Q1K A;  4MBP A;  2RC9 A;  4U1O A;  3KN3 A;  2ZXT A;  2KLF A;  1K9Z A;  1B05 A;  1NI9 A;  4G8M A;  3ILU B;  3KC1 A;  1Y3P A;  4QFL A;  4N4U A;  3O66 A;  4KHZ E;  1JW5 A;  1R6Z A;  5I59 A;  4AQ4 A;  3S9L C;  3E3K A;  4FJP A;  3G3H A;  4ZEK A;  2DXR A;  3TCH A;  3LSX A;  3TCF A;  4X9T A;  4E0X A;  4PFY A;  3U93 A;  3FIR A;  5I2N A;  2I3V A;  3IJX B;  1B7H A;  4NAP A;  1MY1 A;  1QKA A;  1JW1 A;  2I4B A;  1EU8 A;  4H45 A;  3HHG A;  5DW8 A;  4NF4 B;  5DYH A;  4FIM A;  4MH5 A;  1IIT A;  3FV1 A;  2AYS A;  4GBW A;  5AA2 A;  1LLS A;  4DCX A;  2I49 A;  1FBD A;  4M4G A;  3M3K A;  3KJ7 A;  4BDM A;  3PV0 E;  4U22 A;  4FED A;  1SYH A;  5A5X B;  2G29 A;  1LBZ A;  2UXA A;  3UGW A;  2R9J A;  3E78 A;  4NHB A;  3IOV A;  4PFB A;  1DMB A;  3HPI A;  1FPE A;  5B7D A;  1A54 A;  1N7W A;  1LFH A;  4U23 A;  2VT5 A;  3CFX A;  3PU5 A;  4IO5 A;  3ECR A;  2V84 A;  1UQW A;  3A29 A;  2B3B A;  1A8F A;  1D3K A;  4ZE9 A;  1O63 A;  3ZKL A;  1FTJ A;  1CE2 A;  1MPD A;  3E79 A;  1DCU A;  3EHS A;  5CRY A;  1O7T A;  5FHN A;  4OVQ A;  3L6H A;  4G68 C;  1Y4T A;  4MNC A;  3DP8 A;  1NV2 A;  2Y7R A;  4Z0I A;  3W15 C;  2O1M A;  1US5 A;  3PD8 A;  1MM7 A;  4RK2 A;  2O1L A;  1H3D A;  2GHB A;  1LB8 A;  1MS7 A;  3O6I A;  1D9Q A;  2Q89 A;  4MNP A;  4BDL A;  1SW4 A;  5TP9 A;  1LGB C;  4F19 A;  3QXM A;  4ZEB A;  2RC8 A;  4OER A;  2Z22 A;  4Q5T A;  1B3L A;  3FUZ A;  2Z8D A;  2PT2 A;  1Z7M E;  3FXU A;  5K2Y A;  5CMK A;  4ECF A;  2OCU A;  4ND9 A;  4PE3 A;  1B2H A;  4N17 A;  1OVT A;  3SZP A;  4RPN A;  1LAX A;  4ELR A;  1A40 A;  4I9D A;  4YMB A;  3MPK A;  3ROJ A;  1NUY A;  2F6P A;  4H8J A;  2O7I A;  2IA4 A;  4OMB A;  1EYJ A;  1B6H A;  4F29 A;  4PF6 A;  1PB9 A;  3CRB A;  3FZV A;  1MXV A;  1NH8 A;  4YKK A;  3H7M A;  1GGG A;  4NX1 A;  3G7W A;  4P9K A;  1VR5 A;  4MF3 A;  2HFB A;  4OWD A;  1K9Y A;  1MY2 A;  4HTG A;  1JNF A;  3VDF A;  4PFI A;  4GD5 A;  5KDT A;  2OK2 A;  4GRK A;  4NG7 A;  4PAF A;  2VD3 A;  3DM0 A;  4FEC A;  4QSD A;  4GWW A;  1KA0 A;  2XXV A;  3MP8 A;  2XXU A;  4DXU A;  2AIX A;  2A5T A;  5F24 A;  3G3J A;  2HAU A;  1XS5 A;  2XHD A;  1IXI A;  4ZEI A;  4LZ5 A;  4QRZ A;  5IAI A;  1II5 A;  1EZP A;  3FV2 A;  2F7A A;  3KFM A;  3H6W A;  2GRV A;  4MX6 A;  2CEX A;  3EKI A;  3FJM A;  2UYE A;  1N04 A;  3AXF A;  2FIE A;  4I3Y A;  3OO8 A;  2NVU B;  3HST A;  1OQH A;  1A7L A;  4QBA A;  2XXK A;  2E1S A;  2XXR A;  1JVX A;  3A3C A;  3VXB A;  3GXA A;  2DVZ A;  3TCG A;  3T9H B;  3UP9 A;  4LUB A;  4R6Y A;  2A5T B;  4NN3 A;  4GBV A;  3KOS A;  1B58 A;  4U4S A;  4NF6 B;  4PP0 A;  1A8E A;  5DVI A;  5I2K B;  5FBP A;  1ANF A;  3KGC A;  2ZZV A;  3K0V A;  4PBQ A;  4NMY A;  3N5L A;  5DTB A;  2A5S A;  3E13 X;  1SD3 A;  1FQB A;  3VE1 B;  4GXA A;  1Q35 A;  5AA4 A;  1Y1M A;  2XWK A;  4F18 A;  4P1E A;  4WXJ A;  2ZYN A;  1FBG A;  2JJK A;  2Q8M A;  1NFT A;  3U1O A;  5EQ7 A;  3IFA A;  3MP6 A;  1B7Z A;  5EQ8 A;  2O84 X;  3VLV A;  3K1P A;  3VVF A;  3IFC A;  4OES A;  3UOR A;  4R2F A;  1JET A;  2R8T A;  2VPO A;  1INP A;  4O7I A;  2O69 A;  4OEN A;  3CSG A;  3IB2 A;  5HBC A;  3I3V A;  4IO3 A;  3FAT A;  4KYE A;  1FQC A;  3PPR A;  4GX4 A;  4IGT A;  4MMP A;  3IX1 A;  3OEK A;  1AWB A;  1MH3 A;  4Q8R A;  3MZB A;  4DXC A;  2GH9 A;  3CFZ A;  4JVI A;  3UIF A;  3HN0 A;  3S9N C;  1Z7N E;  3PUV E;  4EQ9 A;  1FBH A;  2DWJ A;  5EQA A;  3U94 A;  2CEY A;  4H46 A;  4ZS9 A;  4F22 A;  4RK9 A;  2P0S A;  4UA8 A;  2F5X A;  1B3G A;  1FJ6 A;  3ODB A;  5K2X A;  1NV3 A;  1B5H A;  3OOA A;  3KZG A;  4H5F A;  1AL3 A;  2VGQ A;  3MP1 A;  3ZS6 A;  3RT6 B;  3RQT A;  4EF2 A;  4YMA A;  2OBG A;  5H8Q A;  4NWD A;  4YU0 A;  3CR9 A;  3LUZ A;  3PUZ E;  1YXI A;  4KCD A;  3K6X A;  1MQG A;  4GVO A;  2D5W A;  2F7C A;  4JBZ A;  3PD9 A;  4KI0 E;  1FBP A;  2DSF A;  2I0C A;  1PBP A;  1G0I A;  4EXK A;  4G8N A;  4F39 A;  3B50 A;  3E9X A;  4NWC A;  1NNK A;  4QFP A;  3IOT A;  1M5C A;  4POX A;  3FXQ A;  1KZ8 A;  1VFD A;  2VOZ A;  3RY3 A;  3U72 A;  3O29 A;  4P3L A;  2UVG A;  3FVO A;  2OZZ A;  1JW4 A;  1VE4 A;  4IB2 A;  1YZ0 A;  1SW5 A;  3UK4 A;  2HCA A;  1AMF A;  1WDN A;  2ZZX A;  1S50 A;  3MVW A;  2XXY A;  4FEB A;  4R74 A;  1R1N A;  3T9U A;  2GHA A;  3KC0 A;  3TEP A;  4YKP A;  4BDR A;  1N7X A;  4JSD A;  1MG1 A;  3MPL A;  2HXW A;  2OWT A;  2HAV A;  2HPG A;  1XVX A;  4C1U A;  3H03 A;  3RYD A;  4NED A;  4HS7 A;  3C32 A;  3THI A;  4TLL B;  4K3F A;  3KN7 A;  4N8Y A;  5IM2 A;  4F2O A;  1QUK A;  4Q30 B;  5TPA B;  3U92 A;  4E0W A;  3HV1 A;  2QS4 A;  5ISU A;  3PMX A;  3C33 A;  2HQ0 A;  2QVV A;  4F3P A;  3VVD A;  3B6W A;  1NNP A;  4P1L A;  5CBR A;  4O94 A;  3Q29 A;  2V93 A;  5I2K A;  4JVC A;  1FPB A;  4F1Y A;  2XD2 A;  1IXC A;  3N6U A;  2P3N A;  3PGF A;  1IMD A;  1YAE A;  4O7M A;  4GQO A;  4F3B A;  4DZ1 A;  4KFQ A;  2ZYO A;  1EYK A;  4NF5 A;  1TFD A;  2Y7P A;  4FAT A;  1FTK A;  3P7I A;  3OO9 A;  4YAH X;  1PDA A;  2RCA A;  3IOR A;  3KOT A;  2UVH A;  5L9O A;  4HE0 A;  2V3Q A;  5L9S A;  1D9Y A;  1PB8 A;  5H8F B;  3GZG A;  4P0G A;  3U8Q A;  3WAE A;  4XIG Q;  1Q9D A;  3BFU A;  4TLM B;  3LSW A;  5AA2 D;  3HFU A;  4NGU A;  1JP4 A;  1KWH A;  2B4M A;  2ZNS A;  2DXY A;  3R7X A;  1PBQ A;  1G0H A;  4OXV A;  3Q25 A;  1MXY A;  2AL5 A;  3KEI A;  4PAK A;  1N76 A;  3I6V A;  4OFJ A;  4GOT A;  4ELP A;  4QSE A;  3MYU A;  4G4P A;  2O51 A;  5EYH A;  2H9B A;  1FTL A;  3W9W A;  3OEL A;  3U65 A;  5DT6 A;  3OEN A;  1NUW A;  1DSN A;  4P11 A;  1UTH A;  4POW A;  1IUD A;  1B46 A;  1DTG A;  3OD7 A;  3H6V A;  2QJE A;  5I58 A;  2PX1 A;  3T0J A;  1SW1 A;  1IME A;  1HSE A;  2Q2A A;  4JWY A;  2CZI A;  4YZZ A;  4GL0 A;  2FNC A;  4OEV A;  1ZBM A;  1B3E A;  1M5D A;  1LST A;  1HSL A;  3C4M A;  4NF8 B;  1USY E;  5ET6 A;  3PPP A;  3RTW B;  3GLB A;  1IIW A;  3BIG A;  1MDP 1;  1B5J A;  5I3S A;  4H0W A;  3RT8 A;  4QHQ A;  3FD3 A;  2F35 A;  1MQJ A;  3C31 A;  3JYR A;  4YKI A;  4GWS A;  4IO4 A;  1DBZ A;  1SI0 A;  4GWU A;  2RKM A;  1N84 A;  5H8H A;  2NUV A;  1GV8 A;  1GVC A;  1T0K A;  1NV4 A;  5ICT A;  5I56 B;  3RUM A;  1B51 A;  3B7D A;  3FVG A;  4KPT A;  4LAT A;  1AIV A;  3V89 B;  5AA2 B;  3JZJ A;  5DEX A;  5J16 A;  4MLV A;  3TQL A;  2BJI A;  4UAC A;  1FPG A;  4JWX A;  2ONR A;  3M8U A;  4GX3 A;  5ITP A;  2Q88 A;  3TAJ A;  4PFT A;  2UYF A;  5L8D A;  4H5G A;  3G3K A;  4EDP A;  2RCB A;  4FBP A;  3RGY A;  3IAZ A;  4X8R A;  4I1D A;  1UIU A;  3L6G A;  4N6K A;  4YIC A;  2QSX A;  2QMX A;  4ZED A;  1IXG A;  1MDQ A;  2F8D A;  2XD3 A;  1EYI A;  1FQA A;  2H99 A;  1ZMG A;  1FCK A;  5L9M A;  4IO2 A;  3PPQ A;  4MAG A;  4NF8 A;  5F7V A;  4XKR A;  3TDJ A;  1OLC A;  1FTO A;  2F3B A;  2QS1 A;  1B32 A;  4OAN A;  4DIG A;  4R73 A;  3H6U A;  3RN8 A;  3O6G A;  2DE2 A;  3SES A;  4QFN A;  1POY 1;  2ANJ A;  3QYT A;  1LEV A;  4FOR A;  1FW0 A;  1FRP A;  4KXP A;  3RTF B;  4F1V A;  3M3F A;  3S2V A;  4U21 A;  1NV6 A;  2DE3 A;  4F2Q A;  4ISU A;  4N07 A;  3MUQ A;  2YJP A;  3FXR A;  3ZSF A;  3O28 A;  3E4R A;  4HCY A;  2CZH A;  5EYG A;  2Y5L A;  1FPI A;  3KBR A;  1D9V A;  3N6T A;  1LBW A;  5LOM A;  3IL1 B;  1Y9U A;  2WX9 A;  1MQH A;  1EZ9 A;  2YLN A;  1L5T A;  1POT A;  2I4C A;  3CHG A;  3RPW A;  1MRP A;  2ABH A;  2WYK A;  2I0B A;  1D4N A;  2I58 A;  4XKQ A;  1IMB A;  2M8C A;  1IQ7 A;  4WKM A;  1IEJ A;  4QSC A;  3UN6 A;  4LN5 A;  1Y20 A;  3SET A;  2E0S A;  4JSO A;  2V3U A;  1P1Q A;  3V5A A;  4LA9 A;  5CMC A;  1A55 A;  5DVJ A;  3N94 A;  1SVX B;  4OFO A;  4PQJ A;  3GYY A;  3OEM A;  4MEV A;  4GFR A;  5IZ1 A;  2P3V A;  3VLU A;  2B3F A;  1FPK A;  4PFW A;  3RLF E;  5TPA A;  2X7P A;  3TTM A;  1B1H A;  3C34 A;  3G3I A;  1NL5 A;  1AH5 A;  5I57 B;  2QVU A;  3O2A A;  2DYX A;  2QVR A;  4ELQ A;  2REG A;  4EUO A;  2OJT A;  2OX3 A;  5AA4 B;  2V25 A;  3QUJ A;  4BDQ A;  4PC9 A;  4XF5 A;  1FBE A;  1LFG A;  5BWJ A;  4P47 A;  4OQO A;  1MXZ A;  4XFE A;  2ALU A;  1VFE A;  4IY5 A;  3IB1 A;  5I56 A;  2G93 A;  3SEV A;  5IZ3 B;  5I7I A;  4LZ7 A;  1I6A A;  5LDZ A;  4UAB A;  2HZK A;  1XHY A;  2BJJ X;  4BDN A;  3IO4 A;  4ELO A;  2QS2 A;  5ET7 A;  4DI3 D;  3IB0 A;  5H8N B;  2V3T A;  2XXH A;  1RDX A;  3HO7 A;  1YCJ A;  3D4C A;  1DOT A;  1FQE A;  2Q74 A;  5CC2 A;  5H8F A;  4XTC Q;  5CI5 A;  2XA5 A;  1JQF A;  2NXO A;  3FGS A;  2FHY A;  4RPO A;  4H67 A;  5I59 B;  3QMF A;  3CIJ A;  3OSR A;  1I6Q A;  4JXI A;  2H5Y A;  1B3H A;  4IGR A;  3K6V A;  3LC8 A;  3KG2 A;  4WEP A;  1B1X A;  4EQB A;  4G68 A;  3K00 A;  1TFA A;  3T9X B;  1GR2 A;  1RDY A;  3SER A;  4HXV A;  4PF8 A;  1Y3N A;  3TTL A;  1US4 A;  1YPN A;  4XKP A;  3PUY E;  5ELV A;  4AS4 A;  4F3S A;  3EF7 A;  4R72 A;  5EQ9 A;  4GWX A;  4OFL A;  2KQZ A;  4U2R A;  4PET A;  2DQV A;  4PCD A;  3LUY A;  2HXR A;  4YB5 A;  1MPB A;  4IY6 A;  3VLW A;  2Z8E A;  1TXF A;  2F97 A;  2XWV A;  2WYP A;  4I62 A;  4OET A;  3USD A;  4HE2 A;  1LAG E;  3VXC A;  1LBY A;  5EHS A;  3IR1 A;  4JB7 A;  4Z7E A;  2RF1 A;  3I5O A;  4H1X A;  3ZKK A;  5CM6 A;  2XXW A;  1FBC A;  4BDO A;  5EHM A;  2VPN A;  4MHF A;  2Q9T A;  5I2N B;  3OMB A;  1SI1 A;  1YTV A;  1LBV A;  2CMO A;  3T9V A;  1LAF E;  1WVJ A;  4EQ7 A;  2QPQ A;  1ZKB A;  1JEV A;  4NQ8 A;  5ITO A;  3BBR A;  4G2Z A;  4IO6 A;  4FE8 A;  1TT1 A;  3SDF A;  1MY0 A;  3LSL A;  5H8H B;  2ZMB A;  2PVU A;  1NH7 A;  1URD A;  3DEL B;  5CMB A;  3W9V A;  4F31 B;  4MLQ A;  2H98 A;  3MVX A;  2B65 A;  4GL8 A;  4N81 A;  3SEY A;  1RKM A;  5FTI A;  3TKD A;  4KYD A;  1B40 A;  1WOD A;  1BKA A;  4XKN A;  3H4Z A;  5I5P A;  1IXH A;  4LQ2 A;  4X1D A;  3MAM A;  3QK6 A;  3TEL A;  5IGA A;  1I69 A;  5JTY B;  3OO6 A;  1SQY A;  2DDK A;  4QFO A;  5TU0 A;  3FJG A;  1H44 A;  2DS9 A;  3BKI B;  4MJO A;  3FAS A;  4NTL A;  2D21 A;  4DLD A;  5JTY A;  1FJ9 A;  1NKX A;  4I40 A;  2XXQ A;  1N3X A;  1IMA A;  1OLA A;  1I6B A;  4OVS A;  3LV0 A;  5M2V A;  1B3F A;  3TTR A;  4I3E A;  4LVQ A;  4GIZ A;  2ZZW A;  1ZLQ A;  1LBC A;  4O3A A;  3HHF A;  3OO7 A;  4ESW A;  1FPJ A;  1MY3 A;  2HEU A;  1B7U A;  2KR0 A;  2VHA A;  4RXL A;  3ISP A;  1URG A;  4ZZA A;  2DVC A;  1P1O A;  2IEE A;  3K01 A;  2HZL A;  1RYX A;  2QFL A;  3MW0 A;  4HE1 A;  4OVJ A;  2QL3 A;  2Y7K A;  4KCC A;  4EF1 A;  4KYS A;  3BIH A;  5IZZ A;  1P1N A;  1TWY A;  1ELJ A;  4JVD A;  3S4U A;  3EHU A;  2WBB A;  1LFI A;  1QUL A;  4X1B A;  2OWZ A;  3R26 A;  3O97 A;  1QUJ A;  1OVB A;  3PPN A;  4IR8 A;  4FAJ A;  4Q0C A;  2P1S A;  3Q26 A;  3N26 A;  3MZ1 A;  4R6K A;  1DK4 A;  4PFR A;  2AL4 A;  3FJ7 A;  1XVY A;  2UVI A;  4QF9 A;  4KD5 A;  4O8M A;  3SKP A;  5I58 B;  1BIY A;  3B8B A;  1QKB A;  5H8Q B;  3MVZ A;  2F6G A;  4PDH A;  5I57 A;  1VSO A;  4WED A;  4LON B;  1LAH E;  2FYI A;  2R6G E;  2P2A A;  4KR5 A;  1XI6 A;  1ZTY A;  3S9M C;  4X04 A;  5FHM A;  3EPE A;  5FHO A;  5F1Q A;  2HHM A;  4AB6 A;  1O64 A;  2F34 A;  1BP5 A;  1FPL A;  2THI A;  3K4U A;  2OLB A;  1ZJL A;  2XWO A;  3K6W A;  3MC2 A;  2UVJ A;  3SEX A;  3B6T A;  1NNF A;  4R75 A;  3O9P A;  4GXS B;  1PC3 A;  1M5B A;  4YKJ A;  2R71 A;  4KQP A;  1QJM A;  1LCF A;  4R6H A;  3IOU A;  4G61 A;  3HCQ A;  1UTB A;  3WAF A;  4OVP A;  3BFT A;  1OIB A;  3QSL A;  3CI8 A;  4NF0 A;  4L17 A;  1FSA A;  3C9H A;  4H8I A;  2RC7 A;  4M1V A;  4HW8 A;  3S9E A;  2Q8J A;  1MPC A;  4RY1 A;  3T93 B;  5ICQ A;  1IZ1 A;  1B9J A;  4N6D A;  1LB9 A;  2DWH A;  4OHN A;  4OEU A;  3KBZ A;  1Y1Z A;  4MCO A;  1IMF A;  5JK4 A;  3C35 A;  4NF5 B;  1NV0 A;  2QS3 A;  2XXP A;  2PCR A;  3IJO B;  5KDT B;  1EH3 A;  3GBA A;  4TOZ A;  1J1N A;  5CMM A;  4G77 A;  1H45 A;  1SDX A;  4XXU A;  1SW2 A;  3Q28 A;  4RNS A;  1XT8 A;  5AA1 A;  2RIN A;  3MJN A;  1MH4 A;  2QMW A;  2W7Y A;  5DEX B;  2Z8F A;  3TTK A;  3CSB A;  3VVE A;  3JV9 A;  1RYO A;  4U1Z A;  5H8N A;  4PDD A;  4C1T A;  1B0H A;  1N0T A;  3PUW E;  3TQW A;  4HCW A;  4ESX A;  2ZNT A;  5T3J A;  2XX7 A;  1JVY A;  4X48 A;  1XC1 A;  2F7B A;  3D4G A;  4PAI A;  5TP9 B;  1H76 A;  2WEF A;  1QGX A;  2PMS A;  4LP2 B;  3MWB A;  2I48 A;  3TTN A;  1NUX A;  4DCY A;  1LCT A;  3EN3 A;  1FTM A;  4OZ9 A;  1S7Y A;  2MKZ A;  1RDZ A;  2GFE A;  2XX9 A;  2DWA A;  3K02 A;  1BLF A;  1DTZ A;  3MVY A;  5ET5 A;  5LTC A;  4OA4 A;  2CZL A;  2CZK A;  1USY H;  2F78 A;  1PEB A;  3G3G A;  2Z23 A;  3F11 A;  4EXL A;  3H6T A;  4YB6 A;  4R2B A;  4THI A;  4PFU A;  3PMV A;  3TPA A;  2ESN A;  2VD2 A;  4G68 B;  1UIV A;  1LBX A;  3KSJ A;  4OVR A;  4ZE8 A;  5FTH A;  4O3B A;  1R9L A;  3PTY A;  2Y84 A;  1MM6 A;  4NF6 A;  1CNQ A;  1SPI A;  3TMG A;  2DE4 A;  3TOD A;  1AOV A;  3G3F A;  3OXN A;  4PE5 B; 
#chains in the Genus database with same CATH homology
 4G68 C;  2XD2 A;  1M5F A;  1IXC A;  1Y4T A;  3LUY A;  3N6U A;  4YB5 A;  3DP8 A;  1MPB A;  3PGF A;  4IY6 A;  2Y7R A;  3VLW A;  4C0R A;  1YAE A;  5I84 A;  2Z8E A;  4Z0I A;  4GQO A;  4F3B A;  4DZ1 A;  4DDD A;  5CBS A;  4KFQ A;  1TXF A;  2ZYO A;  3W15 C;  4NF5 A;  2F97 A;  4IO7 A;  1TFD A;  2O1M A;  1M5E A;  2Y7P A;  4I62 A;  1US5 A;  4OET A;  4O3C A;  3PD8 A;  1MM7 A;  3USD A;  4RK2 A;  4FAT A;  1FTK A;  2O1L A;  3P7I A;  1H3D A;  2GHB A;  3OO9 A;  4YAH X;  1LAG E;  4ZEC A;  1PDA A;  1LB8 A;  3KJT A;  4P0I A;  3VXC A;  5EHS A;  2RCA A;  3IOR A;  1MS7 A;  3IR1 A;  3O6I A;  2O7U A;  2UVH A;  3KOT A;  4JB7 A;  4Z7E A;  5IKB A;  2RF1 A;  5HM4 B;  5L9O A;  2V3Q A;  3I5O A;  4H1X A;  3ZKK A;  5CM6 A;  2XXW A;  3IOW A;  2Q89 A;  5L9S A;  5J1D A;  1BTJ A;  3TZA A;  1D9Y A;  1SW4 A;  1HSJ A;  4BDO A;  4BDL A;  4H65 A;  1PB8 A;  5EHM A;  5H8F B;  5TP9 A;  1LGB C;  3MBP A;  3GZG A;  4LQ5 A;  3QXM A;  4P0G A;  2RC8 A;  2H25 A;  3QIM A;  4ZEB A;  3T22 A;  3U8Q A;  3LSF B;  1DPE A;  3K2D A;  2Q9T A;  4XIG Q;  3WAE A;  5I2N B;  3B6Q A;  3BFU A;  1B0L A;  2REJ A;  3LSW A;  3OMB A;  4LZ8 A;  4GLI A;  4TLM B;  3OSQ A;  4OER A;  5AA2 D;  1P1U A;  2Z22 A;  1SI1 A;  3MZ9 A;  1YTV A;  4Q5T A;  4DXB A;  2CMO A;  3T9V A;  4ZZE A;  1KWH A;  1B3L A;  1LAF E;  1WVJ A;  4EQ7 A;  2QPQ A;  3FUZ A;  2Z8D A;  1ZKB A;  2ZNS A;  2DXY A;  1JEV A;  2LAO A;  2PT2 A;  1Z7M E;  2ONS A;  2ZNU A;  1PBQ A;  3FXU A;  5ITO A;  2OWS A;  4OXV A;  3Q25 A;  3BBR A;  1SBP A;  1MXY A;  4G2Z A;  4IO6 A;  5K2Y A;  4FE8 A;  1TT1 A;  2AL5 A;  4NF4 A;  4ECF A;  2OCU A;  5CMK A;  4ND9 A;  2F36 A;  3EHT A;  3KEI A;  1FQF A;  1N76 A;  3I6V A;  3ONM A;  3SDF A;  4OFJ A;  1B2H A;  1MY0 A;  4GOT A;  2H4I A;  3LSL A;  2ZMB A;  5H8H B;  4ELP A;  2PVU A;  1NH7 A;  1URD A;  4QSE A;  3DEL B;  5CMB A;  3T66 A;  3W9V A;  4F31 B;  3KSX A;  4R9G A;  4G4P A;  3PMW A;  2O51 A;  1OVT A;  2H9B A;  4RPN A;  1FTL A;  1LAX A;  4ELR A;  1A40 A;  4I9D A;  3W9W A;  4MLQ A;  3OEL A;  3FVK A;  3MPK A;  4YMB A;  2F6P A;  2Y7W A;  2O7I A;  2XXT A;  4H8J A;  2H98 A;  2XX8 A;  3MVX A;  2B65 A;  4RA1 A;  5DT6 A;  2IA4 A;  4ZDM A;  4GL8 A;  3SEY A;  3TFL A;  1RKM A;  5FTI A;  1MXW A;  4OMB A;  3TKD A;  3OEN A;  5EYF A;  4KYD A;  1B40 A;  3UA8 A;  1B6H A;  1WOD A;  1QW0 A;  1DSN A;  1BKA A;  4P11 A;  4OTE A;  4F29 A;  4XKN A;  1UTH A;  1PB9 A;  1SYI A;  3CRB A;  3FZV A;  3H4Z A;  1MXV A;  1ZU0 A;  4POW A;  1IUD A;  1IXH A;  4LQ2 A;  1NH8 A;  4YKK A;  1B46 A;  1DTG A;  4X1D A;  3VV5 A;  3MAM A;  3QK6 A;  3H7M A;  3OD7 A;  1GGG A;  3H6V A;  2QJE A;  3TEL A;  5I58 A;  3G7W A;  5AA4 A;  4DE8 A;  1I69 A;  2PX1 A;  5JTY B;  1SW1 A;  4RYA A;  1VR5 A;  4MFI A;  4U4X A;  4F3G A;  3EQ1 A;  3OO6 A;  2O6A A;  2XXI A;  4MF3 A;  1HSE A;  4F1U A;  2HFB A;  2Q2A A;  1SQY A;  4OWD A;  5JEI A;  4JWY A;  1MY2 A;  3QAX A;  4HTG A;  4QFO A;  1JNF A;  5TU0 A;  3FJG A;  1H44 A;  2DS9 A;  4G8H A;  4YZZ A;  3VDF A;  4GL0 A;  2FNC A;  4OEV A;  1ZBM A;  3BKI B;  1B3E A;  3FAS A;  1M5D A;  1LST A;  4NTL A;  1HSL A;  2D21 A;  2I6E A;  4DLD A;  4ONY A;  1F9B A;  5JTY A;  3C4M A;  1NKX A;  1P99 A;  5A5X A;  4GD5 A;  5KDT A;  2OK2 A;  4NF8 B;  1USY E;  4GRK A;  2ZYM A;  3PPP A;  3RTW B;  1N3W A;  3GLB A;  1IIW A;  2X7Q A;  1MDP 1;  1B5J A;  2XXQ A;  3PUX E;  1N3X A;  4H0W A;  3RT8 A;  1OLA A;  2VD3 A;  2Y7I A;  1I6B A;  3DM0 A;  4QHQ A;  3FD3 A;  2F35 A;  5M2V A;  1MQJ A;  4FEC A;  1B3F A;  3TTR A;  3ILT B;  3MQ9 A;  4QSD A;  1FQD A;  3C31 A;  3K1M A;  4LVQ A;  4GIZ A;  1A99 A;  2XXV A;  3MP8 A;  1ZLQ A;  3JYR A;  1PB7 A;  1LBC A;  2XXU A;  4O3A A;  2AIX A;  4YKI A;  4DXU A;  2A5T A;  4IO4 A;  3G3J A;  2HAU A;  1XS5 A;  3HHF A;  2XHD A;  3OO7 A;  1IXI A;  4ESW A;  1SI0 A;  4AB5 A;  2HEU A;  1MY3 A;  4LZ5 A;  4ZEI A;  4QRZ A;  2RKM A;  5IAI A;  1II5 A;  1B7U A;  3CG1 A;  1OQG A;  3FV2 A;  4I8C A;  1N84 A;  2F7A A;  3KFM A;  2VHA A;  3H6W A;  2GRV A;  4RXL A;  3Q27 A;  5H8H A;  2NUV A;  1URG A;  2NOO A;  1GV8 A;  4ZZA A;  1GVC A;  2DVC A;  1R9Q A;  3FJM A;  1XOC A;  1P1O A;  1NNT A;  2IEE A;  1T0K A;  2UYE A;  4NE4 A;  3K01 A;  5ICT A;  4N6P A;  5I56 B;  4BLA A;  2HZL A;  1N04 A;  1RYX A;  1B51 A;  3B7D A;  3AXF A;  3M3L A;  2ZYK A;  3RUM A;  3FVG A;  1OMP A;  4KPT A;  4LAT A;  1AIV A;  3V89 B;  5AA2 B;  3JZJ A;  3OO8 A;  3MW0 A;  5DEX A;  3LBS A;  3A3U A;  2NVU B;  4OVJ A;  2QL3 A;  2Y7K A;  3HST A;  4KCC A;  4MLV A;  1OQH A;  1A7L A;  3TQL A;  4EF1 A;  5AA3 A;  3CVG A;  2E1S A;  4KYS A;  2XXR A;  1JVX A;  4UAC A;  4JWX A;  3A3C A;  3VXB A;  2ONR A;  3M8U A;  5ITP A;  2Q88 A;  1P1N A;  1CB6 A;  1TWY A;  3GXA A;  1ELJ A;  3TAJ A;  2DVZ A;  3TCG A;  3T9H B;  3UP9 A;  4LUB A;  4PFT A;  3S4U A;  4R6Y A;  1QUI A;  5KCJ B;  2DP8 A;  2UYF A;  3EHU A;  2A5T B;  5H8S A;  1LFI A;  1QUL A;  4X1B A;  2O68 A;  5L8D A;  3CG3 A;  4H5G A;  3QUF A;  3R26 A;  5DVF A;  3VFJ A;  3G3K A;  4EDP A;  2RCB A;  3KOS A;  1B58 A;  1QUJ A;  1OVB A;  3O97 A;  3PPN A;  4U4S A;  3RGY A;  4NF6 B;  3IAZ A;  1GTK A;  4PP0 A;  1A8E A;  4I1D A;  5DVI A;  5I2K B;  4FAJ A;  4Q0C A;  2P1S A;  3Q26 A;  1UIU A;  1ANF A;  3L6G A;  3KN8 A;  3KGC A;  4YIC A;  1Y4C A;  2QMX A;  2QSX A;  3N26 A;  4ZED A;  3K0V A;  3MZ1 A;  1IXG A;  1MDQ A;  2F8D A;  3N5L A;  4NMY A;  4R6K A;  5DTB A;  1H43 A;  2AL4 A;  2XD3 A;  1MY4 A;  2A5S A;  2WKY A;  3FJ7 A;  3K6U A;  3TUS A;  1XVY A;  2UVI A;  3E13 X;  1DPP A;  1FQA A;  1SD3 A;  2H99 A;  1FQB A;  4QF9 A;  3SEW A;  1ZMG A;  3VE1 B;  1FCK A;  4KD5 A;  3SKP A;  4GXA A;  5L9M A;  1Q35 A;  2X26 A;  3PPQ A;  1BIY A;  4IO2 A;  5I58 B;  1QKB A;  4YB7 A;  3A09 A;  4NF8 A;  5F7V A;  4XKR A;  4OYV A;  3IK6 B;  3MVZ A;  1S9T A;  1OLC A;  1FTO A;  5H8Q B;  1Y1M A;  3TDJ A;  2Q2C A;  4F18 A;  2F6G A;  1EZP A;  5I57 A;  1VSO A;  4WED A;  2QS1 A;  4LON B;  1UTH B;  3C36 A;  4WXJ A;  1LAH E;  1B32 A;  2FYI A;  2R6G E;  2ZYN A;  2P2A A;  4DIG A;  4KR5 A;  4QFK A;  1NFT A;  4R73 A;  3U1O A;  5HPQ A;  4F19 A;  1ZTY A;  3H3G A;  3S9M C;  3V83 A;  5FHM A;  3H6U A;  5KZT A;  3RN8 A;  3EPE A;  3O6G A;  5FHO A;  3MP6 A;  2DE2 A;  4JDF A;  3SEU A;  4QFN A;  3SES A;  1POY 1;  2VP1 A;  3LR1 A;  5F1Q A;  4AB6 A;  2ANJ A;  1NMU A;  1B7Z A;  1O64 A;  1B4H A;  2F34 A;  1BP5 A;  2THI A;  1MQD A;  3QYT A;  4H6D A;  3K4U A;  3H06 B;  4FOR A;  2OLB A;  1FW0 A;  1MQI A;  1ZJL A;  2D3I A;  2O84 X;  3RTF B;  1ZIU A;  3VLV A;  3K1P A;  4F1V A;  3M3F A;  2YPN A;  3VVF A;  3K6W A;  4OES A;  3UOR A;  1JEU A;  4R2F A;  1JET A;  5KCJ A;  3S2V A;  3CFL A;  3MC2 A;  4U21 A;  2UVJ A;  2DE3 A;  3TYH A;  2O69 A;  4OEN A;  4F2Q A;  1MXU A;  3SEX A;  2DOJ A;  2FA7 A;  3CSG A;  3B6T A;  3IB2 A;  3DLN A;  4ISU A;  5HBC A;  1EZO A;  4N07 A;  1NNF A;  3I3V A;  3IO6 A;  3MUQ A;  4IO3 A;  1MXX A;  2YJP A;  3FAT A;  3FXR A;  4KYE A;  4R75 A;  3O9P A;  1FQC A;  3ZSF A;  4GF8 A;  3PPR A;  3O28 A;  4GXS B;  3E4R A;  1PC3 A;  4HCY A;  4IGT A;  4GWO A;  1M5B A;  4N13 A;  3IX1 A;  2ONK E;  3OEK A;  4YKJ A;  2R71 A;  4KQP A;  1MH3 A;  1QJM A;  3KBR A;  1D9V A;  1LCF A;  4Q8R A;  3MZB A;  3N6T A;  4R6H A;  4DXC A;  2GH9 A;  3CFZ A;  3IOU A;  1UTB B;  5AE4 A;  1LBB A;  3UIF A;  3HCQ A;  3HN0 A;  1UTB A;  5LOM A;  3IL1 B;  5BUU A;  3S9N C;  3WAF A;  3PPO A;  1Y9U A;  1MQH A;  1EZ9 A;  2YLN A;  1Z7N E;  3BFT A;  1OIB A;  3PUV E;  1L5T A;  1POT A;  1Y3Q A;  2I4C A;  1ATG A;  2XXX A;  3QSL A;  1MRP A;  3R6U A;  2ABH A;  3RPW A;  4EQ9 A;  3CI8 A;  3FVN A;  2I0B A;  2DWJ A;  3U94 A;  1D4N A;  4L17 A;  2I58 A;  4XKQ A;  1QVS A;  2I3W A;  4R9F A;  4ZS9 A;  2M8C A;  4F22 A;  1IQ7 A;  4RK9 A;  2P0S A;  4UA8 A;  2F5X A;  3C9H A;  1B3G A;  3DP4 A;  4H8I A;  4WKM A;  5B70 A;  2RC7 A;  4M1V A;  1B5I A;  1IEJ A;  4RJZ A;  4HW8 A;  3S9E A;  4QSC A;  3UN6 A;  3GBB A;  3ODB A;  5K2X A;  1Y20 A;  1B5H A;  3SET A;  2E0S A;  1P1W A;  3OOA A;  3T96 B;  3KZG A;  1B52 A;  1B4Z A;  4JSO A;  2V3U A;  1P1Q A;  3RNN A;  4H5F A;  3V5A A;  2Q8J A;  1MPC A;  4LA9 A;  4RY1 A;  4TQU Q;  5CMC A;  3T93 B;  2PYY A;  1A55 A;  5DVJ A;  3N94 A;  5ICQ A;  1IZ1 A;  1AL3 A;  1B9J A;  1SVX B;  2VGQ A;  3MP1 A;  4OFO A;  3RT6 B;  1LB9 A;  3ZS6 A;  2DWH A;  4PQJ A;  3OEM A;  4OHN A;  3K1N A;  4GFR A;  3RQT A;  4JWO A;  4OEU A;  2DWI A;  3DP6 A;  4EF2 A;  2QRY A;  1Y1Z A;  4YMA A;  2OBG A;  5H8Q A;  2PT1 A;  4NWD A;  5JK4 A;  3C35 A;  4YU0 A;  3O6H A;  4NF5 B;  3CR9 A;  3VLU A;  2B3F A;  2QS3 A;  3PUZ E;  2PBW A;  1URS A;  4KCD A;  4PFW A;  3K6X A;  1MQG A;  3RLF E;  2NWJ A;  1Q1K A;  2XXP A;  4GVO A;  4MBP A;  5TPA A;  2RC9 A;  3IJO B;  4U1O A;  2X7P A;  2D5W A;  3TTM A;  2F7C A;  3KN3 A;  1B1H A;  1EH3 A;  2ZXT A;  5KDT B;  2KLF A;  3GBA A;  3C34 A;  3G3I A;  1NL5 A;  1J1N A;  1AH5 A;  4TOZ A;  5CMM A;  4JBZ A;  5I57 B;  4G77 A;  3O2A A;  3PD9 A;  4KI0 E;  1H45 A;  2DYX A;  1SDX A;  1B05 A;  2DSF A;  4XXU A;  1SW2 A;  2I0C A;  4G8M A;  3Q28 A;  1PBP A;  4RNS A;  3ILU B;  4ELQ A;  2REG A;  4EUO A;  2OJT A;  4EXK A;  1Y3P A;  1XT8 A;  4G8N A;  4F39 A;  4QFL A;  5AA4 B;  2V25 A;  3E9X A;  3QUJ A;  5AA1 A;  4NWC A;  4BDQ A;  1NNK A;  1LFG A;  3O66 A;  3IOT A;  2RIN A;  1JW5 A;  1M5C A;  1R6Z A;  3FXQ A;  3MJN A;  4KHZ E;  4POX A;  4QFP A;  1VFD A;  5BWJ A;  2VOZ A;  3RY3 A;  5I59 A;  1MH4 A;  2QMW A;  3U72 A;  4AQ4 A;  3S9L C;  2W7Y A;  3E3K A;  4FJP A;  3G3H A;  4OQO A;  5DEX B;  2Z8F A;  3O29 A;  4ZEK A;  3TTK A;  3CSB A;  2DXR A;  3TCH A;  3LSX A;  1MXZ A;  3VVE A;  2UVG A;  3JV9 A;  2ALU A;  3TCF A;  3FVO A;  1RYO A;  2OZZ A;  4U1Z A;  1VFE A;  4IY5 A;  4X9T A;  5H8N A;  1JW4 A;  4E0X A;  3IB1 A;  4PFY A;  3U93 A;  5I56 A;  3FIR A;  2G93 A;  1VE4 A;  5I2N A;  4IB2 A;  3SEV A;  1SW5 A;  2I3V A;  3UK4 A;  4C1T A;  4ZEF A;  2HCA A;  1B7H A;  3IJX B;  1AMF A;  1B0H A;  1N0T A;  1WDN A;  3PUW E;  1MY1 A;  4LZ7 A;  1I6A A;  1QKA A;  1JW1 A;  2I4B A;  4HCW A;  3TQW A;  1EU8 A;  3HHG A;  4ESX A;  2ZNT A;  4NF4 B;  1S50 A;  2XX7 A;  1JVY A;  2HZK A;  3MVW A;  4FIM A;  4X48 A;  1XHY A;  2BJJ X;  5DYH A;  1XC1 A;  2F7B A;  3D4G A;  5TP9 B;  4MH5 A;  4BDN A;  1IIT A;  3FV1 A;  1H76 A;  2XXY A;  3IO4 A;  4FEB A;  4R74 A;  2AYS A;  4ELO A;  4LP2 B;  1R1N A;  2PMS A;  2QS2 A;  2GHA A;  3T9U A;  3MWB A;  2I48 A;  3TEP A;  4YKP A;  4BDR A;  3TTN A;  4DCY A;  5AA2 A;  1LCT A;  1LLS A;  1N7X A;  3IB0 A;  3EN3 A;  4JSD A;  5H8N B;  1MG1 A;  3MPL A;  2I49 A;  4DCX A;  1FTM A;  2V3T A;  2HXW A;  4OZ9 A;  1S7Y A;  2XXH A;  3HO7 A;  1YCJ A;  3D4C A;  1DOT A;  2OWT A;  1FQE A;  2HAV A;  4M4G A;  3M3K A;  5CC2 A;  5H8F A;  4XTC Q;  5CI5 A;  2GFE A;  2XX9 A;  1XVX A;  2DWA A;  3K02 A;  1BLF A;  1DTZ A;  3H03 A;  3MVY A;  4C1U A;  4NED A;  1JQF A;  3KJ7 A;  2NXO A;  4HS7 A;  4BDM A;  3PV0 E;  2CZL A;  3FGS A;  4U22 A;  4RPO A;  4H67 A;  5I59 B;  1USY H;  4FED A;  1SYH A;  3CIJ A;  5A5X B;  3OSR A;  2F78 A;  3C32 A;  1I6Q A;  4JXI A;  1PEB A;  2H5Y A;  2G29 A;  3THI A;  1B3H A;  4IGR A;  3G3G A;  2Z23 A;  3F11 A;  3K6V A;  4TLL B;  4EXL A;  3H6T A;  4K3F A;  3KN7 A;  2UXA A;  4YB6 A;  2R9J A;  3UGW A;  4R2B A;  4THI A;  4F2O A;  4PFU A;  1QUK A;  3IOV A;  3LC8 A;  3KG2 A;  1DMB A;  3HPI A;  3PMV A;  4Q30 B;  4WEP A;  5TPA B;  1B1X A;  3TPA A;  4EQB A;  3U92 A;  5B7D A;  1A54 A;  4G68 A;  1N7W A;  1TFA A;  3K00 A;  1LFH A;  4U23 A;  2ESN A;  2VD2 A;  4G68 B;  3T9X B;  1UIV A;  4E0W A;  4IO5 A;  3CFX A;  3PU5 A;  1GR2 A;  3SER A;  3HV1 A;  3ECR A;  2V84 A;  2QS4 A;  3KSJ A;  1UQW A;  1Y3N A;  3TTL A;  5ISU A;  1US4 A;  1A8F A;  2B3B A;  3PMX A;  3C33 A;  2HQ0 A;  4ZE8 A;  5FTH A;  1YPN A;  1D3K A;  4ZE9 A;  4O3B A;  3V8X B;  4XKP A;  1O63 A;  3PUY E;  3ZKL A;  4F3P A;  1R9L A;  1FTJ A;  2Y84 A;  5ELV A;  3VVD A;  4F3S A;  1MM6 A;  3B6W A;  1CE2 A;  1NNP A;  3EF7 A;  1MPD A;  4NF6 A;  4R72 A;  4OFL A;  3TMG A;  2DE4 A;  3EHS A;  5CBR A;  3TOD A;  1AOV A;  5CRY A;  1O7T A;  3G3F A;  5FHN A;  3R7X A;  3L6H A;  2V93 A;  3Q29 A;  4PET A;  4U2R A;  2DQV A;  5I2K A;  3OXN A;  4PE5 B;  4F1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...