5K2YA

Crystal structure of m. tuberculosis uspc (monoclinic crystal form)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
400
structure length
400
Chain Sequence
IVVTVRLWDEPIAAAYRQSFAAFTRSHPDIEVRTNLVAYSTYFETLRTDVAGGSADDIFWLSNAYFAAYADSGRLMKIQTDAADWEPAVVDQFTRSGVLWGVPQLTDAGIAVFYNADLLAAAGVDPTQVDNLRWSRGDDDTLRPMLARLTVDADGRTANTPGFDARRVRQWGYNAANDPQAIYLNYIGSAGGVFQRDGKFAFDNPGAIEAFRYLVGLINDDHVAPPASDTNDNGDFSRNQFLAGKMALFQSGTYSLAPVARDALFHWGVAMLPAGPAGRVSVTNGIAAAGNSASKHPDAVRQVLAWMGSTEGNSYLGRHGAAIPAVLSAQPVYFDYWSARGVDVTPFFAVLNGPRIAAPGGAGFAAGQQALEPYFDEMFLGRGDVTTTLRQAQAAANAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable periplasmic sugar-binding lipoprotein UspC
publication title Structural and functional analysis of the solute-binding protein UspC from Mycobacterium tuberculosis that is specific for amino sugars.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transport protein
total genus 133
structure length 400
sequence length 400
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5k2yA00
2DVCA 2QMXA 4PFWA 1DTGA 4F18A 1JNFA 1Y3QA 2HEUA 3OENA 3EHTA 3G3FA 5JK4A 1NKXA 2GFEA 4JDFA 2NVUB 4EXLA 2DE3A 5JTYA 3QAXA 4XKPA 1P1OA 2ANJA 3CFLA 4QRZA 3RPWA 2PT2A 1MXVA 2W7YA 5CBSA 1B3HA 4R9FA 3THIA 3T9HB 4GFRA 1I69A 4P0GA 4QFNA 1ATGA 4ZEIA 2FYIA 5DEXA 3I3VA 4H65A 4XTCQ 1PBQA 2P0SA 4RK2A 2V3QA 2DSFA 1JEVA 3IB2A 3M3LA 3C31A 2LAOA 3PU5A 3EHSA 3K2DA 1QUIA 3FGSA 3IO4A 3FUZA 1H44A 3TTMA 3C36A 4QFOA 3EQ1A 4ZE8A 5K2XA 3G3IA 3Q27A 2HCAA 2QMWA 3S2VA 2Y7RA 3F11A 1LAXA 4F3BA 4QFKA 4GL8A 5FTHA 2R71A 2PT1A 1LBBA 3KFMA 4E0WA 3MQ9A 1LAGE 3HHFA 3QXMA 1VFDA 2AL4A 3TTRA 2F7CA 2O6AA 4LQ2A 1OLCA 4KYEA 3HV1A 4RYAA 4GXAA 2Y7KA 4TOZA 4H1XA 2HQ0A 3FVOA 3L6HA 3H4ZA 3U1OA 2X7PA 5ITPA 4NF4A 3FATA 3O97A 1M5FA 5A5XB 1TWYA 1MXWA 4GL0A 3DP8A 2A5TA 1ZU0A 3H7MA 5EHSA 4YB6A 2XXYA 2ZYNA 1KWHA 2RC8A 4QSDA 4ECFA 3UORA 1MY4A 4OMBA 1IUDA 4O3AA 5FTIA 5AA4A 3TMGA 3HHGA 1NH8A 3UIFA 4YICA 3WAEA 1UIVA 4OTEA 1P1QA 1N0TA 1ZMGA 3T66A 3MWBA 3SKPA 4AB6A 4OZ9A 1A55A 3LR1A 3IOUA 2F78A 5I2NA 3MZBA 4IO6A 3A3UA 3LSFB 1GGGA 1I6AA 4P0IA 5I57A 5I2NB 2XXIA 1NNKA 1PDAA 3TTLA 3UGWA 4KCDA 4JB7A 4NWCA 3KN3A 4OETA 5ITOA 3ECRA 3USDA 2DE2A 1B4ZA 3T93B 1DMBA 2ONRA 3MP6A 3K1MA 3BFUA 4FORA 3SEUA 1ANFA 1N7XA 3TZAA 1OIBA 3OOAA 3T9UA 3PMXA 4G8HA 4HTGA 4YKIA 5CMKA 5CMCA 2DP8A 1B51A 3OO6A 4C0RA 1JW4A 2AL5A 4NF8A 3PMVA 4AQ4A 2ABHA 2IEEA 2ZNUA 5LOMA 2XXHA 3DP6A 3W9VA 1NFTA 2OLBA 4NE4A 1EZPA 2BJJX 3AXFA 4F1YA 3O6GA 1BLFA 2B3FA 4R2BA 4LZ8A 4NF5A 4OESA 5IAIA 4K3FA 3PD8A 1D3KA 3H06B 4ESXA 1A8EA 3TCFA 1IQ7A 2DE4A 1BIYA 3KBRA 3UN6A 1BKAA 4ELOA 4QSEA 4IO3A 3K6UA 4TLMB 2QS4A 2UXAA 1ZIUA 1MPCA 1XVYA 3KOTA 5I84A 4ZEKA 4BDLA 5L9SA 1B52A 3Q26A 4U2RA 3TPAA 3JYRA 4FEBA 4DCYA 3VVEA 3LSWA 4BLAA 4X1DA 4GXSB 3VV5A 4LVQA 3CRBA 4YKPA 3MPLA 3PPOA 3S9MC 2YPNA 4R6KA 4H5FA 3C35A 5IKBA 3MJNA 1B3GA 5CM6A 4LP2B 5F7VA 2AYSA 3RTFB 2RCAA 2OJTA 1MXUA 3GXAA 3CFXA 1USYE 1DTZA 5FHOA 1TFAA 4Z7EA 1LCTA 1B1XA 2I3WA 1MM7A 1A99A 2AIXA 1H43A 1MXXA 4ONYA 4XKRA 3CG3A 1UQWA 2F7BA 3TEPA 3S9NC 3IK6B 3R6UA 4JWOA 1FQBA 4F1UA 1XOCA 5CRYA 2ONKE 1YTVA 3VLVA 3GBAA 2R9JA 1WODA 4KFQA 3O29A 4LONB 4M4GA 3ZKKA 2O51A 1B0LA 1A7LA 1P1NA 4GVOA 4N13A 4LQ5A 4OVJA 1Y1MA 2H98A 1Y4CA 1YAEA 1NNFA 3N94A 3KSJA 2RKMA 1BTJA 3EF7A 4YZZA 1GR2A 4HCWA 4KHZE 4QF9A 1IITA 4EUOA 1B3FA 2YJPA 4GQOA 1MY2A 5AA3A 5HBCA 1LSTA 1XS5A 2O1LA 2QS1A 5H8SA 3TKDA 1FQAA 3IB1A 4RPNA 1XVXA 1N7WA 1Y3PA 2X26A 1B1HA 2XD2A 3G3JA 3IR1A 4NF6B 2WKYA 4YB7A 4ZECA 5CBRA 1B7HA 1CE2A 3PPQA 1VE4A 3SEVA 3QIMA 1AL3A 3CSGA 1XT8A 5ICQA 1PB9A 4QFPA 4IB2A 4C1TA 1QULA 3MW0A 1TFDA 1DPEA 4FECA 2DVZA 3QK6A 3OO7A 1OQHA 2QRYA 5JEIA 3JZJA 3O2AA 1VFEA 1B7ZA 5BWJA 1JEUA 2B3BA 3MC2A 5DT6A 4DZ1A 1EZOA 3RGYA 5K2YA 2VD3A 5H8QB 3RLFE 5AA2A 4IO7A 1TXFA 1B3EA 2X7QA 4EF2A 3JV9A 1JVYA 4PFTA 3IOWA 1LFHA 4H6DA 5I56A 3K00A 4BDMA 1LFGA 1URDA 3RY3A 3SEXA 3HN0A 2NWJA 4OENA 1URSA 4PE5B 3TFLA 2ZYMA 1B46A 5CI5A 3V5AA 4AB5A 1B2HA 4G68A 1MY3A 1M5DA 4GIZA 3T22A 4LZ7A 3PD9A 4G68B 2FA7A 1SW1A 1UTBA 1IEJA 1H76A 1AOVA 5BUUA 4GRKA 3ILTB 5JTYB 3OD7A 1AIVA 4LZ5A 1QW0A 3LSXA 4PFUA 1L5TA 1I6BA 1LAHE 4YB5A 3C33A 3IX1A 1ZLQA 4R72A 2I48A 4G8NA 3TYHA 4IGTA 1NL5A 4QFLA 1SBPA 3K6VA 1MQJA 2I6EA 4F3PA 1NH7A 4MH5A 2I58A 4F3GA 5DEXB 2E1SA 4WEDA 3G3HA 5TPAA 2O68A 1QKBA 5I59A 4OHNA 4JWYA 2UVHA 4BDOA 2GH9A 4G8MA 3IJXB 1DPPA 1S50A 4THIA 3PUYE 3VDFA 1MM6A 4RJZA 1IZ1A 4ZDMA 1NNTA 2ZYOA 4Q0CA 1NMUA 4MF3A 2UVGA 3FXQA 3B6WA 4R6HA 3I5OA 3KN8A 2ZMBA 1ZBMA 1SW4A 3U93A 3OXNA 3E3KA 4ISUA 4XIGQ 3N6TA 4GF8A 2H5YA 3PGFA 4EDPA 1I6QA 1OLAA 5KZTA 1Y3NA 1SDXA 1SW2A 4ZEFA 5HPQA 2V25A 3H6UA 2I4CA 1CB6A 2XXVA 1MQHA 3RNNA 3B7DA 2QL3A 3V89B 5KDTA 3EPEA 1MPBA 3Q29A 1EZ9A 4NF4B 4KR5A 3RUMA 1VSOA 2UVIA 3KJTA 2Q8JA 1XHYA 2A5TB 4YAHX 1Q35A 1WDNA 3FXRA 4F29A 2CZLA 4G68C 4H67A 4YU0A 1SVXB 1Y4TA 1QUKA 3IAZA 4POWA 4UACA 2PVUA 5AA4B 3C4MA 2QPQA 1N76A 2M8CA 4TLLB 5CMBA 5AE4A 4EQ7A 1D9YA 2Q89A 3KOSA 4KI0E 2NUVA 3IL1B 1MQIA 3ODBA 1MDQA 2Z22A 2YLNA 4P11A 3H6TA 5I58A 3D4GA 2FNCA 2UYFA 5I57B 4OFLA 3SEYA 3CIJA 2Q2AA 4OYVA 4R74A 3TDJA 4MLVA 3K1PA 1SD3A 3U92A 1MH3A 3TTNA 2H25A 4IO5A 4GWOA 5ELVA 1Q1KA 4PQJA 1O64A 4RY1A 3K6WA 4NF8B 3O6IA 2H99A 4ZS9A 4KYDA 2XX8A 5DVJA 3ZSFA 3SERA 4EF1A 3PUZE 1MXZA 4DXUA 1B5JA 2DYXA 4NF5B 4F1VA 3U94A 5B70A 4NTLA 1B58A 3TODA 4IO4A 3E9XA 3IOTA 4NMYA 4DLDA 4FATA 4NWDA 4F3SA 4FAJA 3T9VA 4X1BA 5J1DA 3DLNA 3S9LC 4O3CA 3HSTA 1H3DA 4EQBA 4X9TA 4RXLA 1SW5A 5AA1A 1MY0A 5TP9A 4FE8A 4Q8RA 1J1NA 2I0CA 1QVSA 4JXIA 4F39A 1GV8A 3MZ1A 1R6ZA 2PX1A 2THIA 1DOTA 4OFJA 4GLIA 4ND9A 5H8HA 3MVWA 3TAJA 2ZNTA 1FQEA 2PMSA 1RKMA 4UA8A 4H5GA 5H8HB 5L9MA 2VOZA 3CI8A 3VLUA 4PFYA 3FVGA 3KJ7A 4XKNA 3RQTA 2VGQA 1HSEA 4XKQA 1LLSA 2OCUA 5B7DA 3UA8A 4IO2A 1LAFE 4KD5A 1Y1ZA 4BDNA 3LSLA 4ZZAA 4F19A 3H6VA 4R9GA 4I1DA 3UP9A 5DVIA 3FV2A 2Y7WA 1B5HA 3LUYA 3G3KA 3OMBA 1PEBA 2F6GA 1HSJA 1LFIA 3SETA 2OWSA 4I9DA 2Z8EA 2O69A 3VVFA 2V84A 1MQGA 2O84X 3QYTA 3VVDA 1VR5A 3EHUA 4XXUA 4H8JA 2H4IA 3K4UA 2DOJA 2VHAA 4KCCA 2OZZA 4YKJA 2F7AA 2NOOA 2Q9TA 4KPTA 5I2KA 2XX9A 3P7IA 2GHAA 3M3KA 4JWXA 5I2KB 2REGA 1R1NA 3RN8A 4G2ZA 3T9XB 4X48A 4HW8A 3A3CA 4Q30B 3DELB 4OEUA 4IY5A 4LA9A 1B05A 2Y7IA 3QUFA 1N04A 1IXHA 3V83A 2ALUA 5AA2D 1UTHA 1F9BA 5TU0A 1MH4A 1FQDA 1MY1A 3SESA 2G93A 3OELA 1UTHB 5F1QA 3PPRA 3PUWE 3RTWB 5ICTA 1O63A 1URGA 1AMFA 4RNSA 1DSNA 2HFBA 2VD2A 5EHMA 3VXCA 5AA2B 1B32A 1PB8A 3PPPA 1B0HA 3N26A 4RK9A 3CSBA 5I56B 2REJA 4ZEDA 5L9OA 1GVCA 1O7TA 2F34A 2ZXTA 4OEVA 1JVXA 4ELRA 3GLBA 1A54A 1IXIA 2HAUA 2CMOA 1S7YA 3O9PA 4QHQA 1UTBB 4DE8A 2QS3A 3O66A 5ISUA 2DXYA 3H6WA 3M8UA 1USYH 2Z8FA 4RA1A 4IY6A 4OFOA 3C9HA 4ZE9A 4R6YA 1Y20A 3PUXE 4YKKA 1QKAA 1FQCA 5TPAB 2OK2A 3OO8A 2D21A 1JETA 4L17A 2Z8DA 4JSDA 1FCKA 4LATA 2P1SA 3MVYA 5I59B 1UIUA 3IJOB 1TT1A 3BBRA 1WVJA 1A8FA 2G29A 2F5XA 1LGBC 1B4HA 4N07A 3ZKLA 3G3GA 1Y9UA 3IOVA 2F6PA 3W15C 2PBWA 3CR9A 2GHBA 4OWDA 1US4A 2HAVA 4WEPA 1MS7A 5M2VA 4U22A 3A09A 4ELQA 4U23A 5L8DA 3DM0A 3R7XA 3WAFA 3B6TA 3U8QA 1SI0A 2Y7PA 3R26A 3OSQA 1N3WA 1FTKA 2ZNSA 3EN3A 2F35A 5DTBA 5EYFA 1HSLA 4ZEBA 1OMPA 2HZKA 5FHNA 5DVFA 2Q2CA 4MFIA 2E0SA 1ELJA 2V93A 3TTKA 3FD3A 3TQLA 4DCXA 3RT6B 1T0KA 3K6XA 5KDTB 2I0BA 4N6PA 2PYYA 3FVKA 1R9LA 2XXRA 3CVGA 4KYSA 5A5XA 2RC7A 4DXBA 2D3IA 2F8DA 1JW1A 3IO6A 3V8XB 4BDRA 5FHMA 3Q25A 3HO7A 4YMAA 2RC9A 1XC1A 4U1OA 1D9VA 3MPKA 1LB8A 4F2OA 2DWIA 4G4PA 2ESNA 1II5A 1M5EA 2QS2A 1RYXA 2I3VA 1SQYA 3VFJA 3ILUB 3K02A 4R75A 1N3XA 3Q28A 1IXGA 2XD3A 1POTA 3L6GA 3S4UA 2QSXA 4M1VA 1MPDA 4OQOA 3I6VA 4BDQA 2V3UA 5I58B 4F22A 3FXUA 2KLFA 4DIGA 3E13X 4E0XA 3O28A 3S9EA 3GZGA 4KQPA 3SDFA 5HM4B 3PUVE 1FW0A 3D4CA 4FEDA 5KCJA 1FTLA 2RINA 1PC3A 2NXOA 5KCJB 1ZJLA 2XXWA 2I4BA 1EH3A 5H8NA 2UVJA 4Z0IA 4I62A 5H8NB 1Z7ME 4R2FA 2O7IA 3KZGA 3VE1B 1LCFA 1M5CA 4MLQA 1PBPA 5H8FA 3QUJA 3HCQA 1FTMA 4JSOA 5H8FB 2B65A 3BFTA 1JQFA 2Y84A 4EQ9A 3PV0E 3ONMA 4ZZEA 3KG2A 1S9TA 2IA4A 1D4NA 3DP4A 3W9WA 1NNPA 4OERA 2HZLA 3GBBA 3BKIB 1Z7NE 1IXCA 3N6UA 5DYHA 3C32A 3FJ7A 3K1NA 1FTJA 3MVZA 4MBPA 2XHDA 3H03A 3SEWA 3FZVA 1B7UA 2P2AA 1AH5A 1OQGA 4O3BA 4I8CA 3KEIA 1A40A 2DWAA 5TP9B 3FVNA 3MP1A 1N84A 2D5WA 4U4SA 3OEMA 2O7UA 4NEDA 1SI1A 4IGRA 1MG1A 3FV1A 2DQVA 2F36A 4DDDA 1FTOA 3RT8A 3M3FA 1B9JA 2XX7A 3OSRA 3TCHA 1SYIA 3MAMA 4U21A 2R6GE 4YMBA 2OBGA 2ZYKA 4WXJA 2ONSA 3IB0A 3KGCA 3FIRA 2O1MA 3MVXA 4F31B 3TUSA 1US5A 1PB7A 4H0WA 3T96B 3E4RA 3FJGA 4H8IA 1MRPA 2XXUA 1MDP1 4OXVA 1JW5A 4F2QA 3O6HA 1MQDA 1R9QA 2Z23A 3VXBA 2DWJA 3TELA 3CG1A 3QSLA 3MUQA 1OVTA 1B40A 3MZ9A 5CC2A 4GD5A 2HXWA 4GOTA 4LUBA 4FIMA 1YCJA 1QJMA 2DS9A 4C1UA 1IIWA 2XXPA 4QSCA 3LC8A 3UK4A 4JBZA 4Q5TA 1FQFA 4RPOA 1MXYA 3U72A 2F97A 4POXA 1ZTYA 4G77A 3MP8A 4PP0A 3CFZA 3B6QA 2OWTA 1B3LA 3K01A 3N5LA 2RCBA 2XXQA 3H3GA 1LBCA 4ELPA 4NF6A 2DXRA 3C34A 4HCYA 2UYEA 1P99A 1QUJA 2I49A 1EU8A 1SYHA 2QJEA 1YPNA 4WKMA 3LBSA 1GTKA 3KSXA 2DWHA 4ESWA 1LB9A 4EXKA 1ZKBA 3HPIA 4FJPA 3TCGA 4PETA 1POY1 3KN7A 3FASA 4U1ZA 3MBPA 3ZS6A 2XXTA 1B5IA 4U4XA 1P1WA 1BP5A 2Q88A 2V3TA 3VLWA 2A5SA 3G7WA 4DXCA 5CMMA 5H8QA 4R73A 1P1UA 1B6HA 2VP1A 3OEKA 2XXXA 1H45A 4HS7A 3K0VA 1RYOA 3IORA 4TQUQ 3PPNA 1M5BA 2RF1A 3FJMA 2H9BA 2GRVA 3TQWA 3PMWA 3OO9A 1OVBA
chains in the Genus database with same CATH superfamily
2DVCA 2QMXA 4PFWA 1DTGA 4F18A 1JNFA 1Y3QA 2HEUA 3OENA 3EHTA 1FPJA 3G3FA 5JK4A 1NKXA 2GFEA 4JDFA 2NVUB 4EXLA 2DE3A 5JTYA 3QAXA 4XKPA 1P1OA 2ANJA 5IZ3B 3CFLA 2ZZWA 4QRZA 3RPWA 2PT2A 1MXVA 2F3DA 2W7YA 2CZKA 5CBSA 1B3HA 4R9FA 3THIA 3T9HB 4GFRA 1I69A 4P0GA 4QFNA 1ATGA 4ZEIA 4PAIA 2FYIA 5DEXA 3I3VA 4PF6A 4PTKA 4H65A 4XTCQ 1PBQA 2P0SA 4RK2A 2V3QA 2DSFA 1FPFA 1JEVA 3IB2A 3M3LA 3C31A 2LAOA 3PU5A 2VPOA 3EHSA 3K2DA 4PBQA 1QUIA 3FGSA 3IO4A 2P3VA 3FUZA 1H44A 3TTMA 3C36A 4QFOA 4GWXA 3EQ1A 4ZE8A 4PFRA 5K2XA 3G3IA 5EQ8A 3Q27A 2HCAA 2QMWA 3S2VA 2Y7RA 3F11A 1LAXA 4F3BA 4QFKA 2HHMA 4GL8A 5F24A 1LBYA 5FTHA 2R71A 2PT1A 1LBBA 3KFMA 4E0WA 1NI9A 3MQ9A 1LAGE 3HHFA 3QXMA 4FBPA 1VFDA 2AL4A 3TTRA 2F7CA 2O6AA 4LQ2A 1OLCA 5ET8A 4KYEA 3HV1A 4RYAA 4GXAA 2Y7KA 4TOZA 4H1XA 2HQ0A 2BJIA 3FVOA 3L6HA 3H4ZA 3U1OA 2X7PA 5ITPA 5FBPA 4NF4A 3FATA 3O97A 1M5FA 5A5XB 1MXWA 1TWYA 4GL0A 3DP8A 2A5TA 1ZU0A 3H7MA 5EHSA 4YB6A 2XXYA 2ZYNA 1KWHA 1LBZA 2RC8A 4QSDA 4ECFA 3UORA 1MY4A 4OMBA 1IUDA 4O3AA 5FTIA 5AA4A 2R8TA 3TMGA 3HHGA 1NH8A 4AS5A 3UIFA 1IMAA 4YICA 3WAEA 1UIVA 4OTEA 1P1QA 1N0TA 1EYIA 1ZMGA 3T66A 2F3BA 2XWOA 3MWBA 3SKPA 4AB6A 4OZ9A 1A55A 3LR1A 3IOUA 1K9YA 2F78A 5I2NA 3MZBA 4IO6A 3A3UA 3LSFB 1GGGA 1I6AA 4P0IA 5I57A 5I2NB 3ROJA 2XXIA 1NNKA 1PDAA 3TTLA 3UGWA 4KCDA 4JB7A 3MSTA 3IFAA 3T1BA 4NWCA 3KN3A 4OETA 2Q8MA 5ITOA 3ECRA 3USDA 2DE2A 1B4ZA 3T93B 1DMBA 2ONRA 3MP6A 3K1MA 3BFUA 4FORA 4XEQA 3SEUA 1ANFA 1N7XA 3TZAA 2XWVA 1OIBA 3B8BA 3OOAA 3T9UA 3PMXA 4G8HA 4HTGA 4YKIA 3KBZA 5CMKA 2KQZA 5CMCA 2DP8A 1B51A 3OO6A 4C0RA 1JW4A 2AL5A 1NV1A 4NF8A 3PMVA 1NUYA 4AQ4A 2ABHA 2IEEA 2ZNUA 5LOMA 2XXHA 3DP6A 3W9VA 1QGXA 1NFTA 2OLBA 4NE4A 1EZPA 2BJJX 3AXFA 4GWZA 4O7IA 4F1YA 3O6GA 1BLFA 2B3FA 4R2BA 4LZ8A 4NF5A 4OESA 1EYJA 4K3FA 5IAIA 3PD8A 1D3KA 3H06B 4ESXA 1A8EA 3TCFA 1IQ7A 2DE4A 1BIYA 3KBRA 3UN6A 1K9ZA 4G61A 1BKAA 4ELOA 1LBWA 4QSEA 4IO3A 1FTAA 3K6UA 4TLMB 4MMPA 2QS4A 2UXAA 4OVRA 1ZIUA 1MPCA 3LV0A 1XVYA 3KOTA 5I84A 4ZEKA 4BDLA 5L9SA 1B52A 3Q26A 4U2RA 3TPAA 3JYRA 4FEBA 4DCYA 3VVEA 3LSWA 4BLAA 4X1DA 4GXSB 3VV5A 4LVQA 3CRBA 4YKPA 3MPLA 3PPOA 3S9MC 2YPNA 4R6KA 4H5FA 3C35A 4DI4B 5IKBA 3MJNA 2V4CA 1B3GA 1DBZA 5CM6A 4LP2B 5F7VA 2AYSA 3RTFB 2RCAA 2OJTA 1MXUA 3GXAA 3CFXA 1USYE 1DTZA 4GWYA 2Y5KA 5FHOA 1TFAA 4Z7EA 1LCTA 1B1XA 2I3WA 1MM7A 1A99A 2AIXA 1H43A 4NHBA 1MXXA 4ONYA 4XKRA 4AS4A 1VDWA 3CG3A 1UQWA 2F7BA 2CEYA 3TEPA 3S9NC 3IK6B 3R6UA 4JWOA 1FQBA 2QVVA 4F1UA 1XOCA 5CRYA 2ONKE 1YTVA 3VLVA 3GBAA 2R9JA 1WODA 4KFQA 3O29A 4LONB 4M4GA 3ZKKA 2O51A 1B0LA 1A7LA 1P1NA 4PFIA 4GVOA 4N13A 4MNCA 4LQ5A 4OVJA 2FVZA 1Y1MA 4MX6A 4OA4A 2H98A 1Y4CA 1YXIA 1YAEA 1NNFA 3N94A 1LBXA 3KSJA 2RKMA 1BTJA 3EF7A 4YZZA 1GR2A 4P8BA 4HCWA 4KHZE 4QF9A 1IITA 4O8MA 4EUOA 5T3JA 1B3FA 2YJPA 4GQOA 4OVSA 1MY2A 5AA3A 5HBCA 4UABA 2HPGA 1LSTA 3NOHA 1XS5A 2O1LA 2QS1A 5H8SA 3TKDA 1FQAA 3IB1A 4RPNA 1XVXA 1N7WA 1Y3PA 2X26A 1B1HA 2XD2A 3G3JA 3IR1A 4NF6B 2WKYA 4YB7A 4ZECA 5CBRA 1B7HA 1FSAA 1CE2A 4PF8A 3PPQA 4MAGA 1FPBA 1VE4A 4GWUA 3SEVA 3QIMA 1AL3A 3CSGA 1XT8A 5ICQA 4NAPA 1PB9A 4QFPA 4IB2A 2WX9A 4C1TA 4QXDA 1QULA 3MW0A 1TFDA 1DPEA 4FECA 2DVZA 3QK6A 3OO7A 1OQHA 2QRYA 5JEIA 3JZJA 3O2AA 1NV7A 4GWWA 1VFEA 4H45A 1B7ZA 5BWJA 1JEUA 2B3BA 3MC2A 5DT6A 4DZ1A 1EZOA 3RGYA 5K2YA 2VD3A 5H8QB 3RLFE 5AA2A 4IO7A 1TXFA 1B3EA 2X7QA 4EF2A 3JV9A 1JVYA 4PFTA 3IOWA 1LFHA 4H6DA 5I56A 3K00A 4BDMA 1LFGA 1URDA 3FXBA 3RY3A 4MIJA 3SEXA 3HN0A 4OANA 4NF0A 2NWJA 4OENA 1URSA 4PE5B 2WBDA 3TFLA 2ZYMA 1B46A 5CI5A 1CNQA 1KA0A 3V5AA 4AB5A 1B2HA 4G68A 1MY3A 4PCDA 1M5DA 4GIZA 3T22A 4LZ7A 3PD9A 4G68B 2FA7A 1SW1A 1UTBA 1IEJA 2FIXA 1H76A 4NQ8A 1AOVA 5BUUA 4GRKA 3ILTB 4I3YA 5JTYB 3OD7A 1AIVA 4LZ5A 3KC0A 1QW0A 3LSXA 4PFUA 1L5TA 1I6BA 1LAHE 1EYKA 4YB5A 4X8RA 3C33A 3IX1A 1ZLQA 4R72A 4P47A 2I48A 4G8NA 3TYHA 4IGTA 1NL5A 1FBEA 4QFLA 1SBPA 3K6VA 1MQJA 2I6EA 4F3PA 1NH7A 4MH5A 2I58A 4F3GA 1YZ0A 5DEXB 2E1SA 4WEDA 3G3HA 5TPAA 2O68A 1FPLA 4P1LA 1QKBA 5I59A 4OHNA 4JWYA 4JVCA 2UVHA 4BDOA 2GH9A 1NV0A 4G8MA 3IJXB 1DPPA 1S50A 4THIA 3PUYE 3VDFA 1MM6A 4RJZA 4PAFA 1IZ1A 4ZDMA 1NNTA 2ZYOA 4Q0CA 1NMUA 4MF3A 2UVGA 3FXQA 3B6WA 4KXPA 4R6HA 1SPIA 3I5OA 3KN8A 2ZMBA 1ZBMA 1SW4A 3U93A 3OXNA 4MCOA 3E3KA 4ISUA 4XIGQ 3N6TA 4GF8A 2H5YA 3PGFA 4EDPA 1I6QA 1OLAA 5KZTA 3E79A 1Y3NA 3LUZA 1SDXA 1SW2A 4ZEFA 4GBWA 5HPQA 2V25A 3H6UA 1FBHA 1FPDA 2I4CA 1CB6A 2XXVA 1MQHA 3RNNA 3B7DA 1FBPA 2QL3A 3V89B 5KDTA 3BIGA 3EPEA 1MPBA 5I5PA 3Q29A 1EZ9A 3KC1A 4NF4B 4KR5A 5IM2A 3RUMA 1VSOA 2UVIA 3KJTA 2Q8JA 4N81A 4LN5A 1XHYA 2A5TB 4YAHX 1Q35A 1WDNA 1DCUA 4OVQA 3FXRA 4GX4A 4F29A 2CZLA 4N6KA 4G68C 4H67A 4YU0A 5EQ7A 1SVXB 1Y4TA 1QUKA 3IAZA 4POWA 4UACA 2PVUA 5AA4B 3C4MA 2QPQA 1N76A 2M8CA 4TLLB 5CMBA 5AE4A 4EQ7A 1D9YA 2Q89A 3KOSA 4KI0E 1FBGA 1RDZA 2NUVA 3IL1B 1MQIA 1D9QA 2HXRA 3ODBA 1MDQA 2Z22A 2YLNA 2JJKA 4P11A 3H6TA 5I58A 3D4GA 2FNCA 2UYFA 5I57B 4OFLA 3SEYA 3CIJA 2Q2AA 4OYVA 4R74A 3TDJA 4MLVA 4PGPA 3K1PA 1SD3A 3U92A 1MH3A 4PDHA 2H25A 3TTNA 4MJOA 4PGNA 4IO5A 4GWOA 5ELVA 1Q1KA 4PQJA 1O64A 2OX3A 4RY1A 3K6WA 5EQ9A 4NF8B 3O6IA 2H99A 4IR8A 4ZS9A 1RDYA 3U65A 4KYDA 2XX8A 5DVJA 3ZSFA 3SERA 4EF1A 3PUZE 4JVIA 1MXZA 4DXUA 1B5JA 2DYXA 4NF5B 2FIEA 3RPLA 4F1VA 5LTCA 3U94A 1FPIA 3RPLB 5B70A 1NV3A 4NTLA 1B58A 3TODA 4IO4A 3E9XA 3IOTA 4GX6A 4XFEA 3EKIA 4NMYA 4DLDA 2XA5A 4FATA 4NWDA 4F3SA 1XI6A 4FAJA 1Q9DA 3T9VA 4X1BA 5J1DA 3DLNA 3S9LC 4O3CA 3HSTA 3QMFA 5ESYA 1H3DA 4EQBA 4X9TA 4RXLA 1SW5A 5AA1A 1MY0A 2PCRA 5TP9A 4FE8A 4Q8RA 1J1NA 2I0CA 3PTYA 1QVSA 4JXIA 4F39A 1GV8A 3MZ1A 1R6ZA 2PX1A 2THIA 1DOTA 4OFJA 4GLIA 2CZHA 4ND9A 5H8HA 3MVWA 3TAJA 2ZNTA 1LEVA 1FQEA 2PMSA 1RKMA 4UA8A 4H5GA 5H8HB 5L9MA 2VOZA 3CI8A 3VLUA 4PFYA 3FVGA 3KJ7A 4XKNA 3RQTA 2VGQA 1HSEA 4XKQA 1DK4A 1LLSA 2OCUA 1FPKA 5B7DA 3UA8A 4IO2A 1LAFE 4KD5A 1Y1ZA 4BDNA 3LSLA 2KR0A 4ZZAA 4F19A 1IMCA 3H6VA 4R9GA 4I1DA 3D1RA 3UP9A 5DVIA 3FV2A 2Y7WA 1B5HA 3LUYA 3G3KA 5LDZA 3OMBA 1PEBA 2F6GA 1HSJA 1LFIA 3SETA 2OWSA 4OVPA 4I9DA 2Z8EA 2O69A 3VVFA 2V84A 1MQGA 2O84X 3QYTA 1KA1A 4GWSA 3VVDA 2PFZA 1VR5A 3EHUA 4XXUA 4H8JA 2H4IA 3K4UA 2DOJA 2VHAA 4KCCA 2OZZA 4YKJA 2F7AA 1AWBA 2NOOA 4PC9A 2Q9TA 4KPTA 4HXVA 5I2KA 4MHFA 2XX9A 3P7IA 5EYGA 2GHAA 3M3KA 4JWXA 5I2KB 2REGA 1R1NA 3RN8A 4G2ZA 3T9XB 4X48A 4HW8A 3A3CA 4O94A 4Q30B 3DELB 4OEUA 4IY5A 4LA9A 1B05A 2Y7IA 1FJ9A 3QUFA 2B4LA 1N04A 1IXHA 3V83A 4PBHA 2ALUA 5AA2D 1UTHA 1F9BA 2XWKA 5TU0A 1MH4A 1FQDA 1MY1A 3SESA 2G93A 3OELA 1UTHB 5F1QA 4DI3D 3PPRA 1BK4A 3PUWE 3RTWB 5ICTA 1O63A 1URGA 1AMFA 4RNSA 1DSNA 4PDDA 2QFLA 2HFBA 2P3NA 2VD2A 5EHMA 3VXCA 5AA2B 1B32A 1PB8A 4MNPA 4X04A 3PPPA 1B0HA 3N26A 4RK9A 3CSBA 5I56B 2REJA 4ZEDA 5L9OA 1GVCA 1O7TA 2F34A 2ZXTA 4OEVA 1JVXA 3CHGA 4ELRA 3GLBA 1A54A 1IXIA 2HAUA 3RYDA 2CMOA 4NGUA 1S7YA 2B4MA 3O9PA 4OVTA 1LBVA 4QHQA 1UTBB 4DE8A 2QS3A 3O66A 5ISUA 2DXYA 3E78A 3H6WA 2FHYA 5IGAA 3M8UA 1USYH 2Z8FA 5IZ3A 4RA1A 4IY6A 4OFOA 3C9HA 4ZE9A 5I3SA 4R6YA 1Y20A 3PUXE 4YKKA 1YYZA 4P3LA 1QKAA 1FQCA 5TPAB 2OK2A 3OO8A 2D21A 1JETA 4L17A 2Z8DA 4JSDA 1FCKA 4LATA 5EQAA 2P1SA 3MVYA 5I59B 1UIUA 3IJOB 1TT1A 3BBRA 5ET5A 1WVJA 1A8FA 2G29A 2F5XA 1LGBC 1FJ6A 4N4UA 1B4HA 4N07A 3ZKLA 3G3GA 5IZ1A 1Y9UA 3IOVA 2F6PA 3A29A 3W15C 2PBWA 3CR9A 2GHBA 3SZPA 4OWDA 1US4A 2QVRA 2MKZA 2HAVA 4WEPA 1MS7A 5M2VA 4U22A 3A09A 4ELQA 4U23A 5J16A 5L8DA 3DM0A 3R7XA 1IMBA 3WAFA 3B6TA 3U8QA 4HE2A 1SI0A 2Y7PA 3R26A 3OSQA 1N3WA 1FTKA 2ZNSA 4XF5A 3EN3A 2F35A 5DTBA 4GBVA 4PAKA 5EYFA 1HSLA 4ZEBA 1OMPA 2HZKA 5FHNA 4N8GA 5DVFA 4P1EA 2Q2CA 4MFIA 2E0SA 1ELJA 2V93A 2L5VA 3TTKA 3FD3A 3TQLA 4DCXA 3RT6B 1T0KA 3K6XA 5KDTB 2I0BA 4N6PA 2PYYA 1NV6A 3FVKA 1R9LA 2XXRA 3CVGA 4KYSA 5A5XA 2RC7A 4DXBA 2D3IA 2F8DA 4HE0A 1JW1A 3IO6A 3V8XB 3HFUA 2ZZXA 4BDRA 4N15A 2WEFA 5FHMA 3Q25A 3HO7A 4YMAA 2RC9A 1XC1A 4U1OA 1D9VA 4P56A 3MPKA 1LB8A 4F2OA 2DWIA 1INPA 4G4PA 2ESNA 1II5A 1M5EA 2QS2A 1RYXA 2I3VA 2WYPA 1SQYA 3VFJA 3ILUB 3K02A 4R75A 1N3XA 3Q28A 1IXGA 2XD3A 4HE1A 1POTA 3L6GA 3S4UA 2QSXA 4M1VA 1MPDA 4OQOA 3I6VA 4I40A 4BDQA 2V3UA 5I58B 4F22A 5ET7A 3FXUA 2KLFA 4N91A 4DIGA 2DDKA 3E13X 4E0XA 3MYUA 3O28A 1IMEA 3S9EA 4QBAA 1NV2A 3GZGA 4KQPA 3SDFA 5HM4B 3PUVE 1FW0A 3D4CA 4FEDA 5KCJA 4PFBA 1FTLA 2RINA 2VT5A 1PC3A 2NXOA 4H46A 5KCJB 1ZJLA 2XXWA 2ZZVA 2I4BA 1EH3A 5IZZA 5H8NA 5EYHA 2UVJA 4Z0IA 2CEXA 3T0JA 4I62A 5H8NB 1Z7ME 4R2FA 2O7IA 3KZGA 1RDXA 3VE1B 1LCFA 1M5CA 4MLQA 1PBPA 5H8FA 3QUJA 3HCQA 1FPGA 1FTMA 4JSOA 2VPNA 5H8FB 2B65A 3BFTA 2QVUA 1JQFA 4MNIA 2Y84A 4EQ9A 3PV0E 3ONMA 4ZZEA 3KG2A 1S9TA 2IA4A 1D4NA 3DP4A 3W9WA 1NNPA 4OERA 4NX1A 2HZLA 3GBBA 3BKIB 1Z7NE 2WBBA 1IXCA 3N6UA 5DYHA 3C32A 3FJ7A 3K1NA 1FTJA 3MVZA 4MBPA 2WYKA 2XHDA 3H03A 3SEWA 3FZVA 1G0HA 1B7UA 4N8YA 2P2AA 1AH5A 1OQGA 4O3BA 4I8CA 3KEIA 1A40A 2DWAA 5TP9B 3FVNA 3MP1A 1KZ8A 1N84A 4P9KA 2D5WA 4U4SA 3OEMA 2O7UA 4NEDA 1SI1A 4IGRA 3B50A 1MG1A 3FV1A 2DQVA 2F36A 4DDDA 4NN3A 3BIHA 1FTOA 3RT8A 1FRPA 3M3FA 1B9JA 2XX7A 3OSRA 1IMDA 1SYIA 3TCHA 3MAMA 1FPEA 4U21A 4JVDA 2R6GE 4YMBA 2OBGA 5DW8A 2ZYKA 3IFCA 1FBFA 4WXJA 2ONSA 3IB0A 3KGCA 4I3EA 3FIRA 2O1MA 3MVXA 4F31B 1IMFA 3TUSA 1US5A 1PB7A 4H0WA 3T96B 3E4RA 3FJGA 4H8IA 1MRPA 2XXUA 1MDP1 3ISPA 4OXVA 1JW5A 4F2QA 3O6HA 4N6DA 1MQDA 1R9QA 2Z23A 1NUZA 1NUXA 3VXBA 2DWJA 3TELA 3CG1A 3QSLA 3MUQA 1OVTA 1B40A 3MZ9A 5CC2A 4GD5A 2HXWA 4GOTA 4GX3A 4LUBA 4FIMA 1YCJA 1QJMA 2DS9A 4C1UA 1IIWA 2XXPA 4QSCA 3LC8A 3UK4A 1FBCA 4JBZA 4N17A 4Q5TA 1FQFA 1NUWA 4RPOA 1MXYA 3FBPA 4O7MA 5A5LA 3U72A 2F97A 2GQ1A 4POXA 4NG7A 1ZTYA 4G77A 3MP8A 4PP0A 3CFZA 3B6QA 2OWTA 4MEVA 1B3LA 3K01A 3N5LA 2RCBA 2XXQA 3H3GA 5I7IA 1LBCA 4ELPA 4NF6A 2DXRA 3C34A 4HCYA 1JP4A 2UYEA 1P99A 1QUJA 2I49A 5ET6A 1EU8A 1SYHA 2QJEA 1YPNA 4WKMA 3LBSA 1GTKA 3KSXA 2DWHA 4ESWA 1LB9A 4EXKA 1ZKBA 3HPIA 4FJPA 3TCGA 4PETA 1FBDA 2Q74A 1POY1 3KN7A 3FASA 4U1ZA 3MBPA 3ZS6A 2XXTA 1B5IA 4U4XA 1P1WA 1BP5A 2PFYA 2Q88A 2V3TA 3VLWA 2A5SA 3G7WA 4DXCA 1G0IA 5CMMA 5H8QA 4R73A 1P1UA 1B6HA 2Y5LA 3GYYA 2VP1A 3OEKA 2XXXA 2XWIA 1H45A 1NV4A 4HS7A 3K0VA 1RYOA 3IORA 4TQUQ 3PPNA 1M5BA 1NV5A 2RF1A 2XXKA 3FJMA 2H9BA 2GRVA 3TQWA 2OWZA 2CZIA 3PMWA 3OO9A 4PE3A 1OVBA 2FBPA
chains in the Genus database with same CATH topology
2DVCA 2QMXA 4PFWA 1DTGA 4F18A 1JNFA 1Y3QA 2HEUA 3OENA 3EHTA 3G3FA 5JK4A 1NKXA 2GFEA 4JDFA 2NVUB 4EXLA 2DE3A 5JTYA 3QAXA 4XKPA 1P1OA 2ANJA 3CFLA 4QRZA 3RPWA 2PT2A 1MXVA 2W7YA 5CBSA 1B3HA 4R9FA 3THIA 3T9HB 4GFRA 1I69A 4P0GA 4QFNA 1ATGA 4ZEIA 2FYIA 5DEXA 3I3VA 4H65A 4XTCQ 1PBQA 2P0SA 4RK2A 2V3QA 2DSFA 1JEVA 3IB2A 3M3LA 3C31A 2LAOA 3PU5A 3EHSA 3K2DA 1QUIA 3FGSA 3IO4A 3FUZA 1H44A 3TTMA 3C36A 4QFOA 3EQ1A 4ZE8A 5K2XA 3G3IA 3Q27A 2HCAA 2QMWA 3S2VA 2Y7RA 3F11A 1LAXA 4F3BA 4QFKA 4GL8A 5FTHA 2R71A 2PT1A 1LBBA 3KFMA 4E0WA 3MQ9A 1LAGE 3HHFA 3QXMA 1VFDA 2AL4A 3TTRA 2F7CA 2O6AA 4LQ2A 1OLCA 4KYEA 3HV1A 4RYAA 4GXAA 2Y7KA 4TOZA 4H1XA 2HQ0A 3FVOA 3L6HA 3H4ZA 3U1OA 2X7PA 5ITPA 4NF4A 3FATA 3O97A 1M5FA 5A5XB 1TWYA 1MXWA 4GL0A 3DP8A 2A5TA 1ZU0A 3H7MA 5EHSA 4YB6A 2XXYA 2ZYNA 1KWHA 2RC8A 4QSDA 4ECFA 3UORA 1MY4A 4OMBA 1IUDA 4O3AA 5FTIA 5AA4A 3TMGA 3HHGA 1NH8A 3UIFA 4YICA 3WAEA 1UIVA 4OTEA 1P1QA 1N0TA 1ZMGA 3T66A 3MWBA 3SKPA 4AB6A 4OZ9A 1A55A 3LR1A 3IOUA 2F78A 5I2NA 3MZBA 4IO6A 3A3UA 3LSFB 1GGGA 1I6AA 4P0IA 5I57A 5I2NB 2XXIA 1NNKA 1PDAA 3TTLA 3UGWA 4KCDA 4JB7A 4NWCA 3KN3A 4OETA 5ITOA 3ECRA 3USDA 2DE2A 1B4ZA 3T93B 1DMBA 2ONRA 3MP6A 3K1MA 3BFUA 4FORA 3SEUA 1ANFA 1N7XA 3TZAA 1OIBA 3OOAA 3T9UA 3PMXA 4G8HA 4HTGA 4YKIA 5CMKA 5CMCA 2DP8A 1B51A 3OO6A 4C0RA 1JW4A 2AL5A 4NF8A 3PMVA 4AQ4A 2ABHA 2IEEA 2ZNUA 5LOMA 2XXHA 3DP6A 3W9VA 1NFTA 2OLBA 4NE4A 1EZPA 2BJJX 3AXFA 4F1YA 3O6GA 1BLFA 2B3FA 4R2BA 4LZ8A 4NF5A 4OESA 5IAIA 4K3FA 3PD8A 1D3KA 3H06B 4ESXA 1A8EA 3TCFA 1IQ7A 2DE4A 1BIYA 3KBRA 3UN6A 1BKAA 4ELOA 4QSEA 4IO3A 3K6UA 4TLMB 2QS4A 2UXAA 1ZIUA 1MPCA 1XVYA 3KOTA 5I84A 4ZEKA 4BDLA 5L9SA 1B52A 3Q26A 4U2RA 3TPAA 3JYRA 4FEBA 4DCYA 3VVEA 3LSWA 4BLAA 4X1DA 4GXSB 3VV5A 4LVQA 3CRBA 4YKPA 3MPLA 3PPOA 3S9MC 2YPNA 4R6KA 4H5FA 3C35A 5IKBA 3MJNA 1B3GA 5CM6A 4LP2B 5F7VA 2AYSA 3RTFB 2RCAA 2OJTA 1MXUA 3GXAA 3CFXA 1USYE 1DTZA 5FHOA 1TFAA 4Z7EA 1LCTA 1B1XA 2I3WA 1MM7A 1A99A 2AIXA 1H43A 1MXXA 4ONYA 4XKRA 3CG3A 1UQWA 2F7BA 3TEPA 3S9NC 3IK6B 3R6UA 4JWOA 1FQBA 4F1UA 1XOCA 5CRYA 2ONKE 1YTVA 3VLVA 3GBAA 2R9JA 1WODA 4KFQA 3O29A 4LONB 4M4GA 3ZKKA 2O51A 1B0LA 1A7LA 1P1NA 4GVOA 4N13A 4LQ5A 4OVJA 1Y1MA 2H98A 1Y4CA 1YAEA 1NNFA 3N94A 3KSJA 2RKMA 1BTJA 3EF7A 4YZZA 1GR2A 4HCWA 4KHZE 4QF9A 1IITA 4EUOA 1B3FA 2YJPA 4GQOA 1MY2A 5AA3A 5HBCA 1LSTA 1XS5A 2O1LA 2QS1A 5H8SA 3TKDA 1FQAA 3IB1A 4RPNA 1XVXA 1N7WA 1Y3PA 2X26A 1B1HA 2XD2A 3G3JA 3IR1A 4NF6B 2WKYA 4YB7A 4ZECA 5CBRA 1B7HA 1CE2A 3PPQA 1VE4A 3SEVA 3QIMA 1AL3A 3CSGA 1XT8A 5ICQA 1PB9A 4QFPA 4IB2A 4C1TA 1QULA 3MW0A 1TFDA 1DPEA 4FECA 2DVZA 3QK6A 3OO7A 1OQHA 2QRYA 5JEIA 3JZJA 3O2AA 1VFEA 1B7ZA 5BWJA 1JEUA 2B3BA 3MC2A 5DT6A 4DZ1A 1EZOA 3RGYA 5K2YA 2VD3A 5H8QB 3RLFE 5AA2A 4IO7A 1TXFA 1B3EA 2X7QA 4EF2A 3JV9A 1JVYA 4PFTA 3IOWA 1LFHA 4H6DA 5I56A 3K00A 4BDMA 1LFGA 1URDA 3RY3A 3SEXA 3HN0A 2NWJA 4OENA 1URSA 4PE5B 3TFLA 2ZYMA 1B46A 5CI5A 3V5AA 4AB5A 1B2HA 4G68A 1MY3A 1M5DA 4GIZA 3T22A 4LZ7A 3PD9A 4G68B 2FA7A 1SW1A 1UTBA 1IEJA 1H76A 1AOVA 5BUUA 4GRKA 3ILTB 5JTYB 3OD7A 1AIVA 4LZ5A 1QW0A 3LSXA 4PFUA 1L5TA 1I6BA 1LAHE 4YB5A 3C33A 3IX1A 1ZLQA 4R72A 2I48A 4G8NA 3TYHA 4IGTA 1NL5A 4QFLA 1SBPA 3K6VA 1MQJA 2I6EA 4F3PA 1NH7A 4MH5A 2I58A 4F3GA 5DEXB 2E1SA 4WEDA 3G3HA 5TPAA 2O68A 1QKBA 5I59A 4OHNA 4JWYA 2UVHA 4BDOA 2GH9A 4G8MA 3IJXB 1DPPA 1S50A 4THIA 3PUYE 3VDFA 1MM6A 4RJZA 1IZ1A 4ZDMA 1NNTA 2ZYOA 4Q0CA 1NMUA 4MF3A 2UVGA 3FXQA 3B6WA 4R6HA 3I5OA 3KN8A 2ZMBA 1ZBMA 1SW4A 3U93A 3OXNA 3E3KA 4ISUA 4XIGQ 3N6TA 4GF8A 2H5YA 3PGFA 4EDPA 1I6QA 1OLAA 5KZTA 1Y3NA 1SDXA 1SW2A 4ZEFA 5HPQA 2V25A 3H6UA 2I4CA 1CB6A 2XXVA 1MQHA 3RNNA 3B7DA 2QL3A 3V89B 5KDTA 3EPEA 1MPBA 3Q29A 1EZ9A 4NF4B 4KR5A 3RUMA 1VSOA 2UVIA 3KJTA 2Q8JA 1XHYA 2A5TB 4YAHX 1Q35A 1WDNA 3FXRA 4F29A 2CZLA 4G68C 4H67A 4YU0A 1SVXB 1Y4TA 1QUKA 3IAZA 4POWA 4UACA 2PVUA 5AA4B 3C4MA 2QPQA 1N76A 2M8CA 4TLLB 5CMBA 5AE4A 4EQ7A 1D9YA 2Q89A 3KOSA 4KI0E 2NUVA 3IL1B 1MQIA 3ODBA 1MDQA 2Z22A 2YLNA 4P11A 3H6TA 5I58A 3D4GA 2FNCA 2UYFA 5I57B 4OFLA 3SEYA 3CIJA 2Q2AA 4OYVA 4R74A 3TDJA 4MLVA 3K1PA 1SD3A 3U92A 1MH3A 3TTNA 2H25A 4IO5A 4GWOA 5ELVA 1Q1KA 4PQJA 1O64A 4RY1A 3K6WA 4NF8B 3O6IA 2H99A 4ZS9A 4KYDA 2XX8A 5DVJA 3ZSFA 3SERA 4EF1A 3PUZE 1MXZA 4DXUA 1B5JA 2DYXA 4NF5B 4F1VA 3U94A 5B70A 4NTLA 1B58A 3TODA 4IO4A 3E9XA 3IOTA 4NMYA 4DLDA 4FATA 4NWDA 4F3SA 4FAJA 3T9VA 4X1BA 5J1DA 3DLNA 3S9LC 4O3CA 3HSTA 1H3DA 4EQBA 4X9TA 4RXLA 1SW5A 5AA1A 1MY0A 5TP9A 4FE8A 4Q8RA 1J1NA 2I0CA 1QVSA 4JXIA 4F39A 1GV8A 3MZ1A 1R6ZA 2PX1A 2THIA 1DOTA 4OFJA 4GLIA 4ND9A 5H8HA 3MVWA 3TAJA 2ZNTA 1FQEA 2PMSA 1RKMA 4UA8A 4H5GA 5H8HB 5L9MA 2VOZA 3CI8A 3VLUA 4PFYA 3FVGA 3KJ7A 4XKNA 3RQTA 2VGQA 1HSEA 4XKQA 1LLSA 2OCUA 5B7DA 3UA8A 4IO2A 1LAFE 4KD5A 1Y1ZA 4BDNA 3LSLA 4ZZAA 4F19A 3H6VA 4R9GA 4I1DA 3UP9A 5DVIA 3FV2A 2Y7WA 1B5HA 3LUYA 3G3KA 3OMBA 1PEBA 2F6GA 1HSJA 1LFIA 3SETA 2OWSA 4I9DA 2Z8EA 2O69A 3VVFA 2V84A 1MQGA 2O84X 3QYTA 3VVDA 1VR5A 3EHUA 4XXUA 4H8JA 2H4IA 3K4UA 2DOJA 2VHAA 4KCCA 2OZZA 4YKJA 2F7AA 2NOOA 2Q9TA 4KPTA 5I2KA 2XX9A 3P7IA 2GHAA 3M3KA 4JWXA 5I2KB 2REGA 1R1NA 3RN8A 4G2ZA 3T9XB 4X48A 4HW8A 3A3CA 4Q30B 3DELB 4OEUA 4IY5A 4LA9A 1B05A 2Y7IA 3QUFA 1N04A 1IXHA 3V83A 2ALUA 5AA2D 1UTHA 1F9BA 5TU0A 1MH4A 1FQDA 1MY1A 3SESA 2G93A 3OELA 1UTHB 5F1QA 3PPRA 3PUWE 3RTWB 5ICTA 1O63A 1URGA 1AMFA 4RNSA 1DSNA 2HFBA 2VD2A 5EHMA 3VXCA 5AA2B 1B32A 1PB8A 3PPPA 1B0HA 3N26A 4RK9A 3CSBA 5I56B 2REJA 4ZEDA 5L9OA 1GVCA 1O7TA 2F34A 2ZXTA 4OEVA 1JVXA 4ELRA 3GLBA 1A54A 1IXIA 2HAUA 2CMOA 1S7YA 3O9PA 4QHQA 1UTBB 4DE8A 2QS3A 3O66A 5ISUA 2DXYA 3H6WA 3M8UA 1USYH 2Z8FA 4RA1A 4IY6A 4OFOA 3C9HA 4ZE9A 4R6YA 1Y20A 3PUXE 4YKKA 1QKAA 1FQCA 5TPAB 2OK2A 3OO8A 2D21A 1JETA 4L17A 2Z8DA 4JSDA 1FCKA 4LATA 2P1SA 3MVYA 5I59B 1UIUA 3IJOB 1TT1A 3BBRA 1WVJA 1A8FA 2G29A 2F5XA 1LGBC 1B4HA 4N07A 3ZKLA 3G3GA 1Y9UA 3IOVA 2F6PA 3W15C 2PBWA 3CR9A 2GHBA 4OWDA 1US4A 2HAVA 4WEPA 1MS7A 5M2VA 4U22A 3A09A 4ELQA 4U23A 5L8DA 3DM0A 3R7XA 3WAFA 3B6TA 3U8QA 1SI0A 2Y7PA 3R26A 3OSQA 1N3WA 1FTKA 2ZNSA 3EN3A 2F35A 5DTBA 5EYFA 1HSLA 4ZEBA 1OMPA 2HZKA 5FHNA 5DVFA 2Q2CA 4MFIA 2E0SA 1ELJA 2V93A 3TTKA 3FD3A 3TQLA 4DCXA 3RT6B 1T0KA 3K6XA 5KDTB 2I0BA 4N6PA 2PYYA 3FVKA 1R9LA 2XXRA 3CVGA 4KYSA 5A5XA 2RC7A 4DXBA 2D3IA 2F8DA 1JW1A 3IO6A 3V8XB 4BDRA 5FHMA 3Q25A 3HO7A 4YMAA 2RC9A 1XC1A 4U1OA 1D9VA 3MPKA 1LB8A 4F2OA 2DWIA 4G4PA 2ESNA 1II5A 1M5EA 2QS2A 1RYXA 2I3VA 1SQYA 3VFJA 3ILUB 3K02A 4R75A 1N3XA 3Q28A 1IXGA 2XD3A 1POTA 3L6GA 3S4UA 2QSXA 4M1VA 1MPDA 4OQOA 3I6VA 4BDQA 2V3UA 5I58B 4F22A 3FXUA 2KLFA 4DIGA 3E13X 4E0XA 3O28A 3S9EA 3GZGA 4KQPA 3SDFA 5HM4B 3PUVE 1FW0A 3D4CA 4FEDA 5KCJA 1FTLA 2RINA 1PC3A 2NXOA 5KCJB 1ZJLA 2XXWA 2I4BA 1EH3A 5H8NA 2UVJA 4Z0IA 4I62A 5H8NB 1Z7ME 4R2FA 2O7IA 3KZGA 3VE1B 1LCFA 1M5CA 4MLQA 1PBPA 5H8FA 3QUJA 3HCQA 1FTMA 4JSOA 5H8FB 2B65A 3BFTA 1JQFA 2Y84A 4EQ9A 3PV0E 3ONMA 4ZZEA 3KG2A 1S9TA 2IA4A 1D4NA 3DP4A 3W9WA 1NNPA 4OERA 2HZLA 3GBBA 3BKIB 1Z7NE 1IXCA 3N6UA 5DYHA 3C32A 3FJ7A 3K1NA 1FTJA 3MVZA 4MBPA 2XHDA 3H03A 3SEWA 3FZVA 1B7UA 2P2AA 1AH5A 1OQGA 4O3BA 4I8CA 3KEIA 1A40A 2DWAA 5TP9B 3FVNA 3MP1A 1N84A 2D5WA 4U4SA 3OEMA 2O7UA 4NEDA 1SI1A 4IGRA 1MG1A 3FV1A 2DQVA 2F36A 4DDDA 1FTOA 3RT8A 3M3FA 1B9JA 2XX7A 3OSRA 3TCHA 1SYIA 3MAMA 4U21A 2R6GE 4YMBA 2OBGA 2ZYKA 4WXJA 2ONSA 3IB0A 3KGCA 3FIRA 2O1MA 3MVXA 4F31B 3TUSA 1US5A 1PB7A 4H0WA 3T96B 3E4RA 3FJGA 4H8IA 1MRPA 2XXUA 1MDP1 4OXVA 1JW5A 4F2QA 3O6HA 1MQDA 1R9QA 2Z23A 3VXBA 2DWJA 3TELA 3CG1A 3QSLA 3MUQA 1OVTA 1B40A 3MZ9A 5CC2A 4GD5A 2HXWA 4GOTA 4LUBA 4FIMA 1YCJA 1QJMA 2DS9A 4C1UA 1IIWA 2XXPA 4QSCA 3LC8A 3UK4A 4JBZA 4Q5TA 1FQFA 4RPOA 1MXYA 3U72A 2F97A 4POXA 1ZTYA 4G77A 3MP8A 4PP0A 3CFZA 3B6QA 2OWTA 1B3LA 3K01A 3N5LA 2RCBA 2XXQA 3H3GA 1LBCA 4ELPA 4NF6A 2DXRA 3C34A 4HCYA 2UYEA 1P99A 1QUJA 2I49A 1EU8A 1SYHA 2QJEA 1YPNA 4WKMA 3LBSA 1GTKA 3KSXA 2DWHA 4ESWA 1LB9A 4EXKA 1ZKBA 3HPIA 4FJPA 3TCGA 4PETA 1POY1 3KN7A 3FASA 4U1ZA 3MBPA 3ZS6A 2XXTA 1B5IA 4U4XA 1P1WA 1BP5A 2Q88A 2V3TA 3VLWA 2A5SA 3G7WA 4DXCA 5CMMA 5H8QA 4R73A 1P1UA 1B6HA 2VP1A 3OEKA 2XXXA 1H45A 4HS7A 3K0VA 1RYOA 3IORA 4TQUQ 3PPNA 1M5BA 2RF1A 3FJMA 2H9BA 2GRVA 3TQWA 3PMWA 3OO9A 1OVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVC A;  2QMX A;  4PFW A;  1DTG A;  4F18 A;  1JNF A;  1Y3Q A;  2HEU A;  3OEN A;  3EHT A;  3G3F A;  5JK4 A;  1NKX A;  2GFE A;  4JDF A;  2NVU B;  4EXL A;  2DE3 A;  5JTY A;  3QAX A;  4XKP A;  1P1O A;  2ANJ A;  3CFL A;  4QRZ A;  3RPW A;  2PT2 A;  1MXV A;  2W7Y A;  5CBS A;  1B3H A;  4R9F A;  3THI A;  3T9H B;  4GFR A;  1I69 A;  4P0G A;  4QFN A;  1ATG A;  4ZEI A;  2FYI A;  5DEX A;  3I3V A;  4H65 A;  4XTC Q;  1PBQ A;  2P0S A;  4RK2 A;  2V3Q A;  2DSF A;  1JEV A;  3IB2 A;  3M3L A;  3C31 A;  2LAO A;  3PU5 A;  3EHS A;  3K2D A;  1QUI A;  3FGS A;  3IO4 A;  3FUZ A;  1H44 A;  3TTM A;  3C36 A;  4QFO A;  3EQ1 A;  4ZE8 A;  5K2X A;  3G3I A;  3Q27 A;  2HCA A;  2QMW A;  3S2V A;  2Y7R A;  3F11 A;  1LAX A;  4F3B A;  4QFK A;  4GL8 A;  5FTH A;  2R71 A;  2PT1 A;  1LBB A;  3KFM A;  4E0W A;  3MQ9 A;  1LAG E;  3HHF A;  3QXM A;  1VFD A;  2AL4 A;  3TTR A;  2F7C A;  2O6A A;  4LQ2 A;  1OLC A;  4KYE A;  3HV1 A;  4RYA A;  4GXA A;  2Y7K A;  4TOZ A;  4H1X A;  2HQ0 A;  3FVO A;  3L6H A;  3H4Z A;  3U1O A;  2X7P A;  5ITP A;  4NF4 A;  3FAT A;  3O97 A;  1M5F A;  5A5X B;  1TWY A;  1MXW A;  4GL0 A;  3DP8 A;  2A5T A;  1ZU0 A;  3H7M A;  5EHS A;  4YB6 A;  2XXY A;  2ZYN A;  1KWH A;  2RC8 A;  4QSD A;  4ECF A;  3UOR A;  1MY4 A;  4OMB A;  1IUD A;  4O3A A;  5FTI A;  5AA4 A;  3TMG A;  3HHG A;  1NH8 A;  3UIF A;  4YIC A;  3WAE A;  1UIV A;  4OTE A;  1P1Q A;  1N0T A;  1ZMG A;  3T66 A;  3MWB A;  3SKP A;  4AB6 A;  4OZ9 A;  1A55 A;  3LR1 A;  3IOU A;  2F78 A;  5I2N A;  3MZB A;  4IO6 A;  3A3U A;  3LSF B;  1GGG A;  1I6A A;  4P0I A;  5I57 A;  5I2N B;  2XXI A;  1NNK A;  1PDA A;  3TTL A;  3UGW A;  4KCD A;  4JB7 A;  4NWC A;  3KN3 A;  4OET A;  5ITO A;  3ECR A;  3USD A;  2DE2 A;  1B4Z A;  3T93 B;  1DMB A;  2ONR A;  3MP6 A;  3K1M A;  3BFU A;  4FOR A;  3SEU A;  1ANF A;  1N7X A;  3TZA A;  1OIB A;  3OOA A;  3T9U A;  3PMX A;  4G8H A;  4HTG A;  4YKI A;  5CMK A;  5CMC A;  2DP8 A;  1B51 A;  3OO6 A;  4C0R A;  1JW4 A;  2AL5 A;  4NF8 A;  3PMV A;  4AQ4 A;  2ABH A;  2IEE A;  2ZNU A;  5LOM A;  2XXH A;  3DP6 A;  3W9V A;  1NFT A;  2OLB A;  4NE4 A;  1EZP A;  2BJJ X;  3AXF A;  4F1Y A;  3O6G A;  1BLF A;  2B3F A;  4R2B A;  4LZ8 A;  4NF5 A;  4OES A;  5IAI A;  4K3F A;  3PD8 A;  1D3K A;  3H06 B;  4ESX A;  1A8E A;  3TCF A;  1IQ7 A;  2DE4 A;  1BIY A;  3KBR A;  3UN6 A;  1BKA A;  4ELO A;  4QSE A;  4IO3 A;  3K6U A;  4TLM B;  2QS4 A;  2UXA A;  1ZIU A;  1MPC A;  1XVY A;  3KOT A;  5I84 A;  4ZEK A;  4BDL A;  5L9S A;  1B52 A;  3Q26 A;  4U2R A;  3TPA A;  3JYR A;  4FEB A;  4DCY A;  3VVE A;  3LSW A;  4BLA A;  4X1D A;  4GXS B;  3VV5 A;  4LVQ A;  3CRB A;  4YKP A;  3MPL A;  3PPO A;  3S9M C;  2YPN A;  4R6K A;  4H5F A;  3C35 A;  5IKB A;  3MJN A;  1B3G A;  5CM6 A;  4LP2 B;  5F7V A;  2AYS A;  3RTF B;  2RCA A;  2OJT A;  1MXU A;  3GXA A;  3CFX A;  1USY E;  1DTZ A;  5FHO A;  1TFA A;  4Z7E A;  1LCT A;  1B1X A;  2I3W A;  1MM7 A;  1A99 A;  2AIX A;  1H43 A;  1MXX A;  4ONY A;  4XKR A;  3CG3 A;  1UQW A;  2F7B A;  3TEP A;  3S9N C;  3IK6 B;  3R6U A;  4JWO A;  1FQB A;  4F1U A;  1XOC A;  5CRY A;  2ONK E;  1YTV A;  3VLV A;  3GBA A;  2R9J A;  1WOD A;  4KFQ A;  3O29 A;  4LON B;  4M4G A;  3ZKK A;  2O51 A;  1B0L A;  1A7L A;  1P1N A;  4GVO A;  4N13 A;  4LQ5 A;  4OVJ A;  1Y1M A;  2H98 A;  1Y4C A;  1YAE A;  1NNF A;  3N94 A;  3KSJ A;  2RKM A;  1BTJ A;  3EF7 A;  4YZZ A;  1GR2 A;  4HCW A;  4KHZ E;  4QF9 A;  1IIT A;  4EUO A;  1B3F A;  2YJP A;  4GQO A;  1MY2 A;  5AA3 A;  5HBC A;  1LST A;  1XS5 A;  2O1L A;  2QS1 A;  5H8S A;  3TKD A;  1FQA A;  3IB1 A;  4RPN A;  1XVX A;  1N7W A;  1Y3P A;  2X26 A;  1B1H A;  2XD2 A;  3G3J A;  3IR1 A;  4NF6 B;  2WKY A;  4YB7 A;  4ZEC A;  5CBR A;  1B7H A;  1CE2 A;  3PPQ A;  1VE4 A;  3SEV A;  3QIM A;  1AL3 A;  3CSG A;  1XT8 A;  5ICQ A;  1PB9 A;  4QFP A;  4IB2 A;  4C1T A;  1QUL A;  3MW0 A;  1TFD A;  1DPE A;  4FEC A;  2DVZ A;  3QK6 A;  3OO7 A;  1OQH A;  2QRY A;  5JEI A;  3JZJ A;  3O2A A;  1VFE A;  1B7Z A;  5BWJ A;  1JEU A;  2B3B A;  3MC2 A;  5DT6 A;  4DZ1 A;  1EZO A;  3RGY A;  5K2Y A;  2VD3 A;  5H8Q B;  3RLF E;  5AA2 A;  4IO7 A;  1TXF A;  1B3E A;  2X7Q A;  4EF2 A;  3JV9 A;  1JVY A;  4PFT A;  3IOW A;  1LFH A;  4H6D A;  5I56 A;  3K00 A;  4BDM A;  1LFG A;  1URD A;  3RY3 A;  3SEX A;  3HN0 A;  2NWJ A;  4OEN A;  1URS A;  4PE5 B;  3TFL A;  2ZYM A;  1B46 A;  5CI5 A;  3V5A A;  4AB5 A;  1B2H A;  4G68 A;  1MY3 A;  1M5D A;  4GIZ A;  3T22 A;  4LZ7 A;  3PD9 A;  4G68 B;  2FA7 A;  1SW1 A;  1UTB A;  1IEJ A;  1H76 A;  1AOV A;  5BUU A;  4GRK A;  3ILT B;  5JTY B;  3OD7 A;  1AIV A;  4LZ5 A;  1QW0 A;  3LSX A;  4PFU A;  1L5T A;  1I6B A;  1LAH E;  4YB5 A;  3C33 A;  3IX1 A;  1ZLQ A;  4R72 A;  2I48 A;  4G8N A;  3TYH A;  4IGT A;  1NL5 A;  4QFL A;  1SBP A;  3K6V A;  1MQJ A;  2I6E A;  4F3P A;  1NH7 A;  4MH5 A;  2I58 A;  4F3G A;  5DEX B;  2E1S A;  4WED A;  3G3H A;  5TPA A;  2O68 A;  1QKB A;  5I59 A;  4OHN A;  4JWY A;  2UVH A;  4BDO A;  2GH9 A;  4G8M A;  3IJX B;  1DPP A;  1S50 A;  4THI A;  3PUY E;  3VDF A;  1MM6 A;  4RJZ A;  1IZ1 A;  4ZDM A;  1NNT A;  2ZYO A;  4Q0C A;  1NMU A;  4MF3 A;  2UVG A;  3FXQ A;  3B6W A;  4R6H A;  3I5O A;  3KN8 A;  2ZMB A;  1ZBM A;  1SW4 A;  3U93 A;  3OXN A;  3E3K A;  4ISU A;  4XIG Q;  3N6T A;  4GF8 A;  2H5Y A;  3PGF A;  4EDP A;  1I6Q A;  1OLA A;  5KZT A;  1Y3N A;  1SDX A;  1SW2 A;  4ZEF A;  5HPQ A;  2V25 A;  3H6U A;  2I4C A;  1CB6 A;  2XXV A;  1MQH A;  3RNN A;  3B7D A;  2QL3 A;  3V89 B;  5KDT A;  3EPE A;  1MPB A;  3Q29 A;  1EZ9 A;  4NF4 B;  4KR5 A;  3RUM A;  1VSO A;  2UVI A;  3KJT A;  2Q8J A;  1XHY A;  2A5T B;  4YAH X;  1Q35 A;  1WDN A;  3FXR A;  4F29 A;  2CZL A;  4G68 C;  4H67 A;  4YU0 A;  1SVX B;  1Y4T A;  1QUK A;  3IAZ A;  4POW A;  4UAC A;  2PVU A;  5AA4 B;  3C4M A;  2QPQ A;  1N76 A;  2M8C A;  4TLL B;  5CMB A;  5AE4 A;  4EQ7 A;  1D9Y A;  2Q89 A;  3KOS A;  4KI0 E;  2NUV A;  3IL1 B;  1MQI A;  3ODB A;  1MDQ A;  2Z22 A;  2YLN A;  4P11 A;  3H6T A;  5I58 A;  3D4G A;  2FNC A;  2UYF A;  5I57 B;  4OFL A;  3SEY A;  3CIJ A;  2Q2A A;  4OYV A;  4R74 A;  3TDJ A;  4MLV A;  3K1P A;  1SD3 A;  3U92 A;  1MH3 A;  3TTN A;  2H25 A;  4IO5 A;  4GWO A;  5ELV A;  1Q1K A;  4PQJ A;  1O64 A;  4RY1 A;  3K6W A;  4NF8 B;  3O6I A;  2H99 A;  4ZS9 A;  4KYD A;  2XX8 A;  5DVJ A;  3ZSF A;  3SER A;  4EF1 A;  3PUZ E;  1MXZ A;  4DXU A;  1B5J A;  2DYX A;  4NF5 B;  4F1V A;  3U94 A;  5B70 A;  4NTL A;  1B58 A;  3TOD A;  4IO4 A;  3E9X A;  3IOT A;  4NMY A;  4DLD A;  4FAT A;  4NWD A;  4F3S A;  4FAJ A;  3T9V A;  4X1B A;  5J1D A;  3DLN A;  3S9L C;  4O3C A;  3HST A;  1H3D A;  4EQB A;  4X9T A;  4RXL A;  1SW5 A;  5AA1 A;  1MY0 A;  5TP9 A;  4FE8 A;  4Q8R A;  1J1N A;  2I0C A;  1QVS A;  4JXI A;  4F39 A;  1GV8 A;  3MZ1 A;  1R6Z A;  2PX1 A;  2THI A;  1DOT A;  4OFJ A;  4GLI A;  4ND9 A;  5H8H A;  3MVW A;  3TAJ A;  2ZNT A;  1FQE A;  2PMS A;  1RKM A;  4UA8 A;  4H5G A;  5H8H B;  5L9M A;  2VOZ A;  3CI8 A;  3VLU A;  4PFY A;  3FVG A;  3KJ7 A;  4XKN A;  3RQT A;  2VGQ A;  1HSE A;  4XKQ A;  1LLS A;  2OCU A;  5B7D A;  3UA8 A;  4IO2 A;  1LAF E;  4KD5 A;  1Y1Z A;  4BDN A;  3LSL A;  4ZZA A;  4F19 A;  3H6V A;  4R9G A;  4I1D A;  3UP9 A;  5DVI A;  3FV2 A;  2Y7W A;  1B5H A;  3LUY A;  3G3K A;  3OMB A;  1PEB A;  2F6G A;  1HSJ A;  1LFI A;  3SET A;  2OWS A;  4I9D A;  2Z8E A;  2O69 A;  3VVF A;  2V84 A;  1MQG A;  2O84 X;  3QYT A;  3VVD A;  1VR5 A;  3EHU A;  4XXU A;  4H8J A;  2H4I A;  3K4U A;  2DOJ A;  2VHA A;  4KCC A;  2OZZ A;  4YKJ A;  2F7A A;  2NOO A;  2Q9T A;  4KPT A;  5I2K A;  2XX9 A;  3P7I A;  2GHA A;  3M3K A;  4JWX A;  5I2K B;  2REG A;  1R1N A;  3RN8 A;  4G2Z A;  3T9X B;  4X48 A;  4HW8 A;  3A3C A;  4Q30 B;  3DEL B;  4OEU A;  4IY5 A;  4LA9 A;  1B05 A;  2Y7I A;  3QUF A;  1N04 A;  1IXH A;  3V83 A;  2ALU A;  5AA2 D;  1UTH A;  1F9B A;  5TU0 A;  1MH4 A;  1FQD A;  1MY1 A;  3SES A;  2G93 A;  3OEL A;  1UTH B;  5F1Q A;  3PPR A;  3PUW E;  3RTW B;  5ICT A;  1O63 A;  1URG A;  1AMF A;  4RNS A;  1DSN A;  2HFB A;  2VD2 A;  5EHM A;  3VXC A;  5AA2 B;  1B32 A;  1PB8 A;  3PPP A;  1B0H A;  3N26 A;  4RK9 A;  3CSB A;  5I56 B;  2REJ A;  4ZED A;  5L9O A;  1GVC A;  1O7T A;  2F34 A;  2ZXT A;  4OEV A;  1JVX A;  4ELR A;  3GLB A;  1A54 A;  1IXI A;  2HAU A;  2CMO A;  1S7Y A;  3O9P A;  4QHQ A;  1UTB B;  4DE8 A;  2QS3 A;  3O66 A;  5ISU A;  2DXY A;  3H6W A;  3M8U A;  1USY H;  2Z8F A;  4RA1 A;  4IY6 A;  4OFO A;  3C9H A;  4ZE9 A;  4R6Y A;  1Y20 A;  3PUX E;  4YKK A;  1QKA A;  1FQC A;  5TPA B;  2OK2 A;  3OO8 A;  2D21 A;  1JET A;  4L17 A;  2Z8D A;  4JSD A;  1FCK A;  4LAT A;  2P1S A;  3MVY A;  5I59 B;  1UIU A;  3IJO B;  1TT1 A;  3BBR A;  1WVJ A;  1A8F A;  2G29 A;  2F5X A;  1LGB C;  1B4H A;  4N07 A;  3ZKL A;  3G3G A;  1Y9U A;  3IOV A;  2F6P A;  3W15 C;  2PBW A;  3CR9 A;  2GHB A;  4OWD A;  1US4 A;  2HAV A;  4WEP A;  1MS7 A;  5M2V A;  4U22 A;  3A09 A;  4ELQ A;  4U23 A;  5L8D A;  3DM0 A;  3R7X A;  3WAF A;  3B6T A;  3U8Q A;  1SI0 A;  2Y7P A;  3R26 A;  3OSQ A;  1N3W A;  1FTK A;  2ZNS A;  3EN3 A;  2F35 A;  5DTB A;  5EYF A;  1HSL A;  4ZEB A;  1OMP A;  2HZK A;  5FHN A;  5DVF A;  2Q2C A;  4MFI A;  2E0S A;  1ELJ A;  2V93 A;  3TTK A;  3FD3 A;  3TQL A;  4DCX A;  3RT6 B;  1T0K A;  3K6X A;  5KDT B;  2I0B A;  4N6P A;  2PYY A;  3FVK A;  1R9L A;  2XXR A;  3CVG A;  4KYS A;  5A5X A;  2RC7 A;  4DXB A;  2D3I A;  2F8D A;  1JW1 A;  3IO6 A;  3V8X B;  4BDR A;  5FHM A;  3Q25 A;  3HO7 A;  4YMA A;  2RC9 A;  1XC1 A;  4U1O A;  1D9V A;  3MPK A;  1LB8 A;  4F2O A;  2DWI A;  4G4P A;  2ESN A;  1II5 A;  1M5E A;  2QS2 A;  1RYX A;  2I3V A;  1SQY A;  3VFJ A;  3ILU B;  3K02 A;  4R75 A;  1N3X A;  3Q28 A;  1IXG A;  2XD3 A;  1POT A;  3L6G A;  3S4U A;  2QSX A;  4M1V A;  1MPD A;  4OQO A;  3I6V A;  4BDQ A;  2V3U A;  5I58 B;  4F22 A;  3FXU A;  2KLF A;  4DIG A;  3E13 X;  4E0X A;  3O28 A;  3S9E A;  3GZG A;  4KQP A;  3SDF A;  5HM4 B;  3PUV E;  1FW0 A;  3D4C A;  4FED A;  5KCJ A;  1FTL A;  2RIN A;  1PC3 A;  2NXO A;  5KCJ B;  1ZJL A;  2XXW A;  2I4B A;  1EH3 A;  5H8N A;  2UVJ A;  4Z0I A;  4I62 A;  5H8N B;  1Z7M E;  4R2F A;  2O7I A;  3KZG A;  3VE1 B;  1LCF A;  1M5C A;  4MLQ A;  1PBP A;  5H8F A;  3QUJ A;  3HCQ A;  1FTM A;  4JSO A;  5H8F B;  2B65 A;  3BFT A;  1JQF A;  2Y84 A;  4EQ9 A;  3PV0 E;  3ONM A;  4ZZE A;  3KG2 A;  1S9T A;  2IA4 A;  1D4N A;  3DP4 A;  3W9W A;  1NNP A;  4OER A;  2HZL A;  3GBB A;  3BKI B;  1Z7N E;  1IXC A;  3N6U A;  5DYH A;  3C32 A;  3FJ7 A;  3K1N A;  1FTJ A;  3MVZ A;  4MBP A;  2XHD A;  3H03 A;  3SEW A;  3FZV A;  1B7U A;  2P2A A;  1AH5 A;  1OQG A;  4O3B A;  4I8C A;  3KEI A;  1A40 A;  2DWA A;  5TP9 B;  3FVN A;  3MP1 A;  1N84 A;  2D5W A;  4U4S A;  3OEM A;  2O7U A;  4NED A;  1SI1 A;  4IGR A;  1MG1 A;  3FV1 A;  2DQV A;  2F36 A;  4DDD A;  1FTO A;  3RT8 A;  3M3F A;  1B9J A;  2XX7 A;  3OSR A;  3TCH A;  1SYI A;  3MAM A;  4U21 A;  2R6G E;  4YMB A;  2OBG A;  2ZYK A;  4WXJ A;  2ONS A;  3IB0 A;  3KGC A;  3FIR A;  2O1M A;  3MVX A;  4F31 B;  3TUS A;  1US5 A;  1PB7 A;  4H0W A;  3T96 B;  3E4R A;  3FJG A;  4H8I A;  1MRP A;  2XXU A;  1MDP 1;  4OXV A;  1JW5 A;  4F2Q A;  3O6H A;  1MQD A;  1R9Q A;  2Z23 A;  3VXB A;  2DWJ A;  3TEL A;  3CG1 A;  3QSL A;  3MUQ A;  1OVT A;  1B40 A;  3MZ9 A;  5CC2 A;  4GD5 A;  2HXW A;  4GOT A;  4LUB A;  4FIM A;  1YCJ A;  1QJM A;  2DS9 A;  4C1U A;  1IIW A;  2XXP A;  4QSC A;  3LC8 A;  3UK4 A;  4JBZ A;  4Q5T A;  1FQF A;  4RPO A;  1MXY A;  3U72 A;  2F97 A;  4POX A;  1ZTY A;  4G77 A;  3MP8 A;  4PP0 A;  3CFZ A;  3B6Q A;  2OWT A;  1B3L A;  3K01 A;  3N5L A;  2RCB A;  2XXQ A;  3H3G A;  1LBC A;  4ELP A;  4NF6 A;  2DXR A;  3C34 A;  4HCY A;  2UYE A;  1P99 A;  1QUJ A;  2I49 A;  1EU8 A;  1SYH A;  2QJE A;  1YPN A;  4WKM A;  3LBS A;  1GTK A;  3KSX A;  2DWH A;  4ESW A;  1LB9 A;  4EXK A;  1ZKB A;  3HPI A;  4FJP A;  3TCG A;  4PET A;  1POY 1;  3KN7 A;  3FAS A;  4U1Z A;  3MBP A;  3ZS6 A;  2XXT A;  1B5I A;  4U4X A;  1P1W A;  1BP5 A;  2Q88 A;  2V3T A;  3VLW A;  2A5S A;  3G7W A;  4DXC A;  5CMM A;  5H8Q A;  4R73 A;  1P1U A;  1B6H A;  2VP1 A;  3OEK A;  2XXX A;  1H45 A;  4HS7 A;  3K0V A;  1RYO A;  3IOR A;  4TQU Q;  3PPN A;  1M5B A;  2RF1 A;  3FJM A;  2H9B A;  2GRV A;  3TQW A;  3PMW A;  3OO9 A;  1OVB A; 
#chains in the Genus database with same CATH topology
 2DVC A;  2QMX A;  4PFW A;  1DTG A;  4F18 A;  1JNF A;  1Y3Q A;  2HEU A;  3OEN A;  3EHT A;  1FPJ A;  3G3F A;  5JK4 A;  1NKX A;  2GFE A;  4JDF A;  2NVU B;  4EXL A;  2DE3 A;  5JTY A;  3QAX A;  4XKP A;  1P1O A;  2ANJ A;  5IZ3 B;  3CFL A;  2ZZW A;  4QRZ A;  3RPW A;  2PT2 A;  1MXV A;  2F3D A;  2W7Y A;  2CZK A;  5CBS A;  1B3H A;  4R9F A;  3THI A;  3T9H B;  4GFR A;  1I69 A;  4P0G A;  4QFN A;  1ATG A;  4ZEI A;  4PAI A;  2FYI A;  5DEX A;  3I3V A;  4PF6 A;  4PTK A;  4H65 A;  4XTC Q;  1PBQ A;  2P0S A;  4RK2 A;  2V3Q A;  2DSF A;  1FPF A;  1JEV A;  3IB2 A;  3M3L A;  3C31 A;  2LAO A;  3PU5 A;  2VPO A;  3EHS A;  3K2D A;  4PBQ A;  1QUI A;  3FGS A;  3IO4 A;  2P3V A;  3FUZ A;  1H44 A;  3TTM A;  3C36 A;  4QFO A;  4GWX A;  3EQ1 A;  4ZE8 A;  4PFR A;  5K2X A;  3G3I A;  5EQ8 A;  3Q27 A;  2HCA A;  2QMW A;  3S2V A;  2Y7R A;  3F11 A;  1LAX A;  4F3B A;  4QFK A;  2HHM A;  4GL8 A;  5F24 A;  1LBY A;  5FTH A;  2R71 A;  2PT1 A;  1LBB A;  3KFM A;  4E0W A;  1NI9 A;  3MQ9 A;  1LAG E;  3HHF A;  3QXM A;  4FBP A;  1VFD A;  2AL4 A;  3TTR A;  2F7C A;  2O6A A;  4LQ2 A;  1OLC A;  5ET8 A;  4KYE A;  3HV1 A;  4RYA A;  4GXA A;  2Y7K A;  4TOZ A;  4H1X A;  2HQ0 A;  2BJI A;  3FVO A;  3L6H A;  3H4Z A;  3U1O A;  2X7P A;  5ITP A;  5FBP A;  4NF4 A;  3FAT A;  3O97 A;  1M5F A;  5A5X B;  1MXW A;  1TWY A;  4GL0 A;  3DP8 A;  2A5T A;  1ZU0 A;  3H7M A;  5EHS A;  4YB6 A;  2XXY A;  2ZYN A;  1KWH A;  1LBZ A;  2RC8 A;  4QSD A;  4ECF A;  3UOR A;  1MY4 A;  4OMB A;  1IUD A;  4O3A A;  5FTI A;  5AA4 A;  2R8T A;  3TMG A;  3HHG A;  1NH8 A;  4AS5 A;  3UIF A;  1IMA A;  4YIC A;  3WAE A;  1UIV A;  4OTE A;  1P1Q A;  1N0T A;  1EYI A;  1ZMG A;  3T66 A;  2F3B A;  2XWO A;  3MWB A;  3SKP A;  4AB6 A;  4OZ9 A;  1A55 A;  3LR1 A;  3IOU A;  1K9Y A;  2F78 A;  5I2N A;  3MZB A;  4IO6 A;  3A3U A;  3LSF B;  1GGG A;  1I6A A;  4P0I A;  5I57 A;  5I2N B;  3ROJ A;  2XXI A;  1NNK A;  1PDA A;  3TTL A;  3UGW A;  4KCD A;  4JB7 A;  3MST A;  3IFA A;  3T1B A;  4NWC A;  3KN3 A;  4OET A;  2Q8M A;  5ITO A;  3ECR A;  3USD A;  2DE2 A;  1B4Z A;  3T93 B;  1DMB A;  2ONR A;  3MP6 A;  3K1M A;  3BFU A;  4FOR A;  4XEQ A;  3SEU A;  1ANF A;  1N7X A;  3TZA A;  2XWV A;  1OIB A;  3B8B A;  3OOA A;  3T9U A;  3PMX A;  4G8H A;  4HTG A;  4YKI A;  3KBZ A;  5CMK A;  2KQZ A;  5CMC A;  2DP8 A;  1B51 A;  3OO6 A;  4C0R A;  1JW4 A;  2AL5 A;  1NV1 A;  4NF8 A;  3PMV A;  1NUY A;  4AQ4 A;  2ABH A;  2IEE A;  2ZNU A;  5LOM A;  2XXH A;  3DP6 A;  3W9V A;  1QGX A;  1NFT A;  2OLB A;  4NE4 A;  1EZP A;  2BJJ X;  3AXF A;  4GWZ A;  4O7I A;  4F1Y A;  3O6G A;  1BLF A;  2B3F A;  4R2B A;  4LZ8 A;  4NF5 A;  4OES A;  1EYJ A;  4K3F A;  5IAI A;  3PD8 A;  1D3K A;  3H06 B;  4ESX A;  1A8E A;  3TCF A;  1IQ7 A;  2DE4 A;  1BIY A;  3KBR A;  3UN6 A;  1K9Z A;  4G61 A;  1BKA A;  4ELO A;  1LBW A;  4QSE A;  4IO3 A;  1FTA A;  3K6U A;  4TLM B;  4MMP A;  2QS4 A;  2UXA A;  4OVR A;  1ZIU A;  1MPC A;  3LV0 A;  1XVY A;  3KOT A;  5I84 A;  4ZEK A;  4BDL A;  5L9S A;  1B52 A;  3Q26 A;  4U2R A;  3TPA A;  3JYR A;  4FEB A;  4DCY A;  3VVE A;  3LSW A;  4BLA A;  4X1D A;  4GXS B;  3VV5 A;  4LVQ A;  3CRB A;  4YKP A;  3MPL A;  3PPO A;  3S9M C;  2YPN A;  4R6K A;  4H5F A;  3C35 A;  4DI4 B;  5IKB A;  3MJN A;  2V4C A;  1B3G A;  1DBZ A;  5CM6 A;  4LP2 B;  5F7V A;  2AYS A;  3RTF B;  2RCA A;  2OJT A;  1MXU A;  3GXA A;  3CFX A;  1USY E;  1DTZ A;  4GWY A;  2Y5K A;  5FHO A;  1TFA A;  4Z7E A;  1LCT A;  1B1X A;  2I3W A;  1MM7 A;  1A99 A;  2AIX A;  1H43 A;  4NHB A;  1MXX A;  4ONY A;  4XKR A;  4AS4 A;  1VDW A;  3CG3 A;  1UQW A;  2F7B A;  2CEY A;  3TEP A;  3S9N C;  3IK6 B;  3R6U A;  4JWO A;  1FQB A;  2QVV A;  4F1U A;  1XOC A;  5CRY A;  2ONK E;  1YTV A;  3VLV A;  3GBA A;  2R9J A;  1WOD A;  4KFQ A;  3O29 A;  4LON B;  4M4G A;  3ZKK A;  2O51 A;  1B0L A;  1A7L A;  1P1N A;  4PFI A;  4GVO A;  4N13 A;  4MNC A;  4LQ5 A;  4OVJ A;  2FVZ A;  1Y1M A;  4MX6 A;  4OA4 A;  2H98 A;  1Y4C A;  1YXI A;  1YAE A;  1NNF A;  3N94 A;  1LBX A;  3KSJ A;  2RKM A;  1BTJ A;  3EF7 A;  4YZZ A;  1GR2 A;  4P8B A;  4HCW A;  4KHZ E;  4QF9 A;  1IIT A;  4O8M A;  4EUO A;  5T3J A;  1B3F A;  2YJP A;  4GQO A;  4OVS A;  1MY2 A;  5AA3 A;  5HBC A;  4UAB A;  2HPG A;  1LST A;  3NOH A;  1XS5 A;  2O1L A;  2QS1 A;  5H8S A;  3TKD A;  1FQA A;  3IB1 A;  4RPN A;  1XVX A;  1N7W A;  1Y3P A;  2X26 A;  1B1H A;  2XD2 A;  3G3J A;  3IR1 A;  4NF6 B;  2WKY A;  4YB7 A;  4ZEC A;  5CBR A;  1B7H A;  1FSA A;  1CE2 A;  4PF8 A;  3PPQ A;  4MAG A;  1FPB A;  1VE4 A;  4GWU A;  3SEV A;  3QIM A;  1AL3 A;  3CSG A;  1XT8 A;  5ICQ A;  4NAP A;  1PB9 A;  4QFP A;  4IB2 A;  2WX9 A;  4C1T A;  4QXD A;  1QUL A;  3MW0 A;  1TFD A;  1DPE A;  4FEC A;  2DVZ A;  3QK6 A;  3OO7 A;  1OQH A;  2QRY A;  5JEI A;  3JZJ A;  3O2A A;  1NV7 A;  4GWW A;  1VFE A;  4H45 A;  1B7Z A;  5BWJ A;  1JEU A;  2B3B A;  3MC2 A;  5DT6 A;  4DZ1 A;  1EZO A;  3RGY A;  5K2Y A;  2VD3 A;  5H8Q B;  3RLF E;  5AA2 A;  4IO7 A;  1TXF A;  1B3E A;  2X7Q A;  4EF2 A;  3JV9 A;  1JVY A;  4PFT A;  3IOW A;  1LFH A;  4H6D A;  5I56 A;  3K00 A;  4BDM A;  1LFG A;  1URD A;  3FXB A;  3RY3 A;  4MIJ A;  3SEX A;  3HN0 A;  4OAN A;  4NF0 A;  2NWJ A;  4OEN A;  1URS A;  4PE5 B;  2WBD A;  3TFL A;  2ZYM A;  1B46 A;  5CI5 A;  1CNQ A;  1KA0 A;  3V5A A;  4AB5 A;  1B2H A;  4G68 A;  1MY3 A;  4PCD A;  1M5D A;  4GIZ A;  3T22 A;  4LZ7 A;  3PD9 A;  4G68 B;  2FA7 A;  1SW1 A;  1UTB A;  1IEJ A;  2FIX A;  1H76 A;  4NQ8 A;  1AOV A;  5BUU A;  4GRK A;  3ILT B;  4I3Y A;  5JTY B;  3OD7 A;  1AIV A;  4LZ5 A;  3KC0 A;  1QW0 A;  3LSX A;  4PFU A;  1L5T A;  1I6B A;  1LAH E;  1EYK A;  4YB5 A;  4X8R A;  3C33 A;  3IX1 A;  1ZLQ A;  4R72 A;  4P47 A;  2I48 A;  4G8N A;  3TYH A;  4IGT A;  1NL5 A;  1FBE A;  4QFL A;  1SBP A;  3K6V A;  1MQJ A;  2I6E A;  4F3P A;  1NH7 A;  4MH5 A;  2I58 A;  4F3G A;  1YZ0 A;  5DEX B;  2E1S A;  4WED A;  3G3H A;  5TPA A;  2O68 A;  1FPL A;  4P1L A;  1QKB A;  5I59 A;  4OHN A;  4JWY A;  4JVC A;  2UVH A;  4BDO A;  2GH9 A;  1NV0 A;  4G8M A;  3IJX B;  1DPP A;  1S50 A;  4THI A;  3PUY E;  3VDF A;  1MM6 A;  4RJZ A;  4PAF A;  1IZ1 A;  4ZDM A;  1NNT A;  2ZYO A;  4Q0C A;  1NMU A;  4MF3 A;  2UVG A;  3FXQ A;  3B6W A;  4KXP A;  4R6H A;  1SPI A;  3I5O A;  3KN8 A;  2ZMB A;  1ZBM A;  1SW4 A;  3U93 A;  3OXN A;  4MCO A;  3E3K A;  4ISU A;  4XIG Q;  3N6T A;  4GF8 A;  2H5Y A;  3PGF A;  4EDP A;  1I6Q A;  1OLA A;  5KZT A;  3E79 A;  1Y3N A;  3LUZ A;  1SDX A;  1SW2 A;  4ZEF A;  4GBW A;  5HPQ A;  2V25 A;  3H6U A;  1FBH A;  1FPD A;  2I4C A;  1CB6 A;  2XXV A;  1MQH A;  3RNN A;  3B7D A;  1FBP A;  2QL3 A;  3V89 B;  5KDT A;  3BIG A;  3EPE A;  1MPB A;  5I5P A;  3Q29 A;  1EZ9 A;  3KC1 A;  4NF4 B;  4KR5 A;  5IM2 A;  3RUM A;  1VSO A;  2UVI A;  3KJT A;  2Q8J A;  4N81 A;  4LN5 A;  1XHY A;  2A5T B;  4YAH X;  1Q35 A;  1WDN A;  1DCU A;  4OVQ A;  3FXR A;  4GX4 A;  4F29 A;  2CZL A;  4N6K A;  4G68 C;  4H67 A;  4YU0 A;  5EQ7 A;  1SVX B;  1Y4T A;  1QUK A;  3IAZ A;  4POW A;  4UAC A;  2PVU A;  5AA4 B;  3C4M A;  2QPQ A;  1N76 A;  2M8C A;  4TLL B;  5CMB A;  5AE4 A;  4EQ7 A;  1D9Y A;  2Q89 A;  3KOS A;  4KI0 E;  1FBG A;  1RDZ A;  2NUV A;  3IL1 B;  1MQI A;  1D9Q A;  2HXR A;  3ODB A;  1MDQ A;  2Z22 A;  2YLN A;  2JJK A;  4P11 A;  3H6T A;  5I58 A;  3D4G A;  2FNC A;  2UYF A;  5I57 B;  4OFL A;  3SEY A;  3CIJ A;  2Q2A A;  4OYV A;  4R74 A;  3TDJ A;  4MLV A;  4PGP A;  3K1P A;  1SD3 A;  3U92 A;  1MH3 A;  4PDH A;  2H25 A;  3TTN A;  4MJO A;  4PGN A;  4IO5 A;  4GWO A;  5ELV A;  1Q1K A;  4PQJ A;  1O64 A;  2OX3 A;  4RY1 A;  3K6W A;  5EQ9 A;  4NF8 B;  3O6I A;  2H99 A;  4IR8 A;  4ZS9 A;  1RDY A;  3U65 A;  4KYD A;  2XX8 A;  5DVJ A;  3ZSF A;  3SER A;  4EF1 A;  3PUZ E;  4JVI A;  1MXZ A;  4DXU A;  1B5J A;  2DYX A;  4NF5 B;  2FIE A;  3RPL A;  4F1V A;  5LTC A;  3U94 A;  1FPI A;  3RPL B;  5B70 A;  1NV3 A;  4NTL A;  1B58 A;  3TOD A;  4IO4 A;  3E9X A;  3IOT A;  4GX6 A;  4XFE A;  3EKI A;  4NMY A;  4DLD A;  2XA5 A;  4FAT A;  4NWD A;  4F3S A;  1XI6 A;  4FAJ A;  1Q9D A;  3T9V A;  4X1B A;  5J1D A;  3DLN A;  3S9L C;  4O3C A;  3HST A;  3QMF A;  5ESY A;  1H3D A;  4EQB A;  4X9T A;  4RXL A;  1SW5 A;  5AA1 A;  1MY0 A;  2PCR A;  5TP9 A;  4FE8 A;  4Q8R A;  1J1N A;  2I0C A;  3PTY A;  1QVS A;  4JXI A;  4F39 A;  1GV8 A;  3MZ1 A;  1R6Z A;  2PX1 A;  2THI A;  1DOT A;  4OFJ A;  4GLI A;  2CZH A;  4ND9 A;  5H8H A;  3MVW A;  3TAJ A;  2ZNT A;  1LEV A;  1FQE A;  2PMS A;  1RKM A;  4UA8 A;  4H5G A;  5H8H B;  5L9M A;  2VOZ A;  3CI8 A;  3VLU A;  4PFY A;  3FVG A;  3KJ7 A;  4XKN A;  3RQT A;  2VGQ A;  1HSE A;  4XKQ A;  1DK4 A;  1LLS A;  2OCU A;  1FPK A;  5B7D A;  3UA8 A;  4IO2 A;  1LAF E;  4KD5 A;  1Y1Z A;  4BDN A;  3LSL A;  2KR0 A;  4ZZA A;  4F19 A;  1IMC A;  3H6V A;  4R9G A;  4I1D A;  3D1R A;  3UP9 A;  5DVI A;  3FV2 A;  2Y7W A;  1B5H A;  3LUY A;  3G3K A;  5LDZ A;  3OMB A;  1PEB A;  2F6G A;  1HSJ A;  1LFI A;  3SET A;  2OWS A;  4OVP A;  4I9D A;  2Z8E A;  2O69 A;  3VVF A;  2V84 A;  1MQG A;  2O84 X;  3QYT A;  1KA1 A;  4GWS A;  3VVD A;  2PFZ A;  1VR5 A;  3EHU A;  4XXU A;  4H8J A;  2H4I A;  3K4U A;  2DOJ A;  2VHA A;  4KCC A;  2OZZ A;  4YKJ A;  2F7A A;  1AWB A;  2NOO A;  4PC9 A;  2Q9T A;  4KPT A;  4HXV A;  5I2K A;  4MHF A;  2XX9 A;  3P7I A;  5EYG A;  2GHA A;  3M3K A;  4JWX A;  5I2K B;  2REG A;  1R1N A;  3RN8 A;  4G2Z A;  3T9X B;  4X48 A;  4HW8 A;  3A3C A;  4O94 A;  4Q30 B;  3DEL B;  4OEU A;  4IY5 A;  4LA9 A;  1B05 A;  2Y7I A;  1FJ9 A;  3QUF A;  2B4L A;  1N04 A;  1IXH A;  3V83 A;  4PBH A;  2ALU A;  5AA2 D;  1UTH A;  1F9B A;  2XWK A;  5TU0 A;  1MH4 A;  1FQD A;  1MY1 A;  3SES A;  2G93 A;  3OEL A;  1UTH B;  5F1Q A;  4DI3 D;  3PPR A;  1BK4 A;  3PUW E;  3RTW B;  5ICT A;  1O63 A;  1URG A;  1AMF A;  4RNS A;  1DSN A;  4PDD A;  2QFL A;  2HFB A;  2P3N A;  2VD2 A;  5EHM A;  3VXC A;  5AA2 B;  1B32 A;  1PB8 A;  4MNP A;  4X04 A;  3PPP A;  1B0H A;  3N26 A;  4RK9 A;  3CSB A;  5I56 B;  2REJ A;  4ZED A;  5L9O A;  1GVC A;  1O7T A;  2F34 A;  2ZXT A;  4OEV A;  1JVX A;  3CHG A;  4ELR A;  3GLB A;  1A54 A;  1IXI A;  2HAU A;  3RYD A;  2CMO A;  4NGU A;  1S7Y A;  2B4M A;  3O9P A;  4OVT A;  1LBV A;  4QHQ A;  1UTB B;  4DE8 A;  2QS3 A;  3O66 A;  5ISU A;  2DXY A;  3E78 A;  3H6W A;  2FHY A;  5IGA A;  3M8U A;  1USY H;  2Z8F A;  5IZ3 A;  4RA1 A;  4IY6 A;  4OFO A;  3C9H A;  4ZE9 A;  5I3S A;  4R6Y A;  1Y20 A;  3PUX E;  4YKK A;  1YYZ A;  4P3L A;  1QKA A;  1FQC A;  5TPA B;  2OK2 A;  3OO8 A;  2D21 A;  1JET A;  4L17 A;  2Z8D A;  4JSD A;  1FCK A;  4LAT A;  5EQA A;  2P1S A;  3MVY A;  5I59 B;  1UIU A;  3IJO B;  1TT1 A;  3BBR A;  5ET5 A;  1WVJ A;  1A8F A;  2G29 A;  2F5X A;  1LGB C;  1FJ6 A;  4N4U A;  1B4H A;  4N07 A;  3ZKL A;  3G3G A;  5IZ1 A;  1Y9U A;  3IOV A;  2F6P A;  3A29 A;  3W15 C;  2PBW A;  3CR9 A;  2GHB A;  3SZP A;  4OWD A;  1US4 A;  2QVR A;  2MKZ A;  2HAV A;  4WEP A;  1MS7 A;  5M2V A;  4U22 A;  3A09 A;  4ELQ A;  4U23 A;  5J16 A;  5L8D A;  3DM0 A;  3R7X A;  1IMB A;  3WAF A;  3B6T A;  3U8Q A;  4HE2 A;  1SI0 A;  2Y7P A;  3R26 A;  3OSQ A;  1N3W A;  1FTK A;  2ZNS A;  4XF5 A;  3EN3 A;  2F35 A;  5DTB A;  4GBV A;  4PAK A;  5EYF A;  1HSL A;  4ZEB A;  1OMP A;  2HZK A;  5FHN A;  4N8G A;  5DVF A;  4P1E A;  2Q2C A;  4MFI A;  2E0S A;  1ELJ A;  2V93 A;  2L5V A;  3TTK A;  3FD3 A;  3TQL A;  4DCX A;  3RT6 B;  1T0K A;  3K6X A;  5KDT B;  2I0B A;  4N6P A;  2PYY A;  1NV6 A;  3FVK A;  1R9L A;  2XXR A;  3CVG A;  4KYS A;  5A5X A;  2RC7 A;  4DXB A;  2D3I A;  2F8D A;  4HE0 A;  1JW1 A;  3IO6 A;  3V8X B;  3HFU A;  2ZZX A;  4BDR A;  4N15 A;  2WEF A;  5FHM A;  3Q25 A;  3HO7 A;  4YMA A;  2RC9 A;  1XC1 A;  4U1O A;  1D9V A;  4P56 A;  3MPK A;  1LB8 A;  4F2O A;  2DWI A;  1INP A;  4G4P A;  2ESN A;  1II5 A;  1M5E A;  2QS2 A;  1RYX A;  2I3V A;  2WYP A;  1SQY A;  3VFJ A;  3ILU B;  3K02 A;  4R75 A;  1N3X A;  3Q28 A;  1IXG A;  2XD3 A;  4HE1 A;  1POT A;  3L6G A;  3S4U A;  2QSX A;  4M1V A;  1MPD A;  4OQO A;  3I6V A;  4I40 A;  4BDQ A;  2V3U A;  5I58 B;  4F22 A;  5ET7 A;  3FXU A;  2KLF A;  4N91 A;  4DIG A;  2DDK A;  3E13 X;  4E0X A;  3MYU A;  3O28 A;  1IME A;  3S9E A;  4QBA A;  1NV2 A;  3GZG A;  4KQP A;  3SDF A;  5HM4 B;  3PUV E;  1FW0 A;  3D4C A;  4FED A;  5KCJ A;  4PFB A;  1FTL A;  2RIN A;  2VT5 A;  1PC3 A;  2NXO A;  4H46 A;  5KCJ B;  1ZJL A;  2XXW A;  2ZZV A;  2I4B A;  1EH3 A;  5IZZ A;  5H8N A;  5EYH A;  2UVJ A;  4Z0I A;  2CEX A;  3T0J A;  4I62 A;  5H8N B;  1Z7M E;  4R2F A;  2O7I A;  3KZG A;  1RDX A;  3VE1 B;  1LCF A;  1M5C A;  4MLQ A;  1PBP A;  5H8F A;  3QUJ A;  3HCQ A;  1FPG A;  1FTM A;  4JSO A;  2VPN A;  5H8F B;  2B65 A;  3BFT A;  2QVU A;  1JQF A;  4MNI A;  2Y84 A;  4EQ9 A;  3PV0 E;  3ONM A;  4ZZE A;  3KG2 A;  1S9T A;  2IA4 A;  1D4N A;  3DP4 A;  3W9W A;  1NNP A;  4OER A;  4NX1 A;  2HZL A;  3GBB A;  3BKI B;  1Z7N E;  2WBB A;  1IXC A;  3N6U A;  5DYH A;  3C32 A;  3FJ7 A;  3K1N A;  1FTJ A;  3MVZ A;  4MBP A;  2WYK A;  2XHD A;  3H03 A;  3SEW A;  3FZV A;  1G0H A;  1B7U A;  4N8Y A;  2P2A A;  1AH5 A;  1OQG A;  4O3B A;  4I8C A;  3KEI A;  1A40 A;  2DWA A;  5TP9 B;  3FVN A;  3MP1 A;  1KZ8 A;  1N84 A;  4P9K A;  2D5W A;  4U4S A;  3OEM A;  2O7U A;  4NED A;  1SI1 A;  4IGR A;  3B50 A;  1MG1 A;  3FV1 A;  2DQV A;  2F36 A;  4DDD A;  4NN3 A;  3BIH A;  1FTO A;  3RT8 A;  1FRP A;  3M3F A;  1B9J A;  2XX7 A;  3OSR A;  1IMD A;  1SYI A;  3TCH A;  3MAM A;  1FPE A;  4U21 A;  4JVD A;  2R6G E;  4YMB A;  2OBG A;  5DW8 A;  2ZYK A;  3IFC A;  1FBF A;  4WXJ A;  2ONS A;  3IB0 A;  3KGC A;  4I3E A;  3FIR A;  2O1M A;  3MVX A;  4F31 B;  1IMF A;  3TUS A;  1US5 A;  1PB7 A;  4H0W A;  3T96 B;  3E4R A;  3FJG A;  4H8I A;  1MRP A;  2XXU A;  1MDP 1;  3ISP A;  4OXV A;  1JW5 A;  4F2Q A;  3O6H A;  4N6D A;  1MQD A;  1R9Q A;  2Z23 A;  1NUZ A;  1NUX A;  3VXB A;  2DWJ A;  3TEL A;  3CG1 A;  3QSL A;  3MUQ A;  1OVT A;  1B40 A;  3MZ9 A;  5CC2 A;  4GD5 A;  2HXW A;  4GOT A;  4GX3 A;  4LUB A;  4FIM A;  1YCJ A;  1QJM A;  2DS9 A;  4C1U A;  1IIW A;  2XXP A;  4QSC A;  3LC8 A;  3UK4 A;  1FBC A;  4JBZ A;  4N17 A;  4Q5T A;  1FQF A;  1NUW A;  4RPO A;  1MXY A;  3FBP A;  4O7M A;  5A5L A;  3U72 A;  2F97 A;  2GQ1 A;  4POX A;  4NG7 A;  1ZTY A;  4G77 A;  3MP8 A;  4PP0 A;  3CFZ A;  3B6Q A;  2OWT A;  4MEV A;  1B3L A;  3K01 A;  3N5L A;  2RCB A;  2XXQ A;  3H3G A;  5I7I A;  1LBC A;  4ELP A;  4NF6 A;  2DXR A;  3C34 A;  4HCY A;  1JP4 A;  2UYE A;  1P99 A;  1QUJ A;  2I49 A;  5ET6 A;  1EU8 A;  1SYH A;  2QJE A;  1YPN A;  4WKM A;  3LBS A;  1GTK A;  3KSX A;  2DWH A;  4ESW A;  1LB9 A;  4EXK A;  1ZKB A;  3HPI A;  4FJP A;  3TCG A;  4PET A;  1FBD A;  2Q74 A;  1POY 1;  3KN7 A;  3FAS A;  4U1Z A;  3MBP A;  3ZS6 A;  2XXT A;  1B5I A;  4U4X A;  1P1W A;  1BP5 A;  2PFY A;  2Q88 A;  2V3T A;  3VLW A;  2A5S A;  3G7W A;  4DXC A;  1G0I A;  5CMM A;  5H8Q A;  4R73 A;  1P1U A;  1B6H A;  2Y5L A;  3GYY A;  2VP1 A;  3OEK A;  2XXX A;  2XWI A;  1H45 A;  1NV4 A;  4HS7 A;  3K0V A;  1RYO A;  3IOR A;  4TQU Q;  3PPN A;  1M5B A;  1NV5 A;  2RF1 A;  2XXK A;  3FJM A;  2H9B A;  2GRV A;  3TQW A;  2OWZ A;  2CZI A;  3PMW A;  3OO9 A;  4PE3 A;  1OVB A;  2FBP A; 
#chains in the Genus database with same CATH homology
 2DVC A;  2QMX A;  4PFW A;  1DTG A;  4F18 A;  1JNF A;  1Y3Q A;  2HEU A;  3OEN A;  3EHT A;  3G3F A;  5JK4 A;  1NKX A;  2GFE A;  4JDF A;  2NVU B;  4EXL A;  2DE3 A;  5JTY A;  3QAX A;  4XKP A;  1P1O A;  2ANJ A;  3CFL A;  4QRZ A;  3RPW A;  2PT2 A;  1MXV A;  2W7Y A;  5CBS A;  1B3H A;  4R9F A;  3THI A;  3T9H B;  4GFR A;  1I69 A;  4P0G A;  4QFN A;  1ATG A;  4ZEI A;  2FYI A;  5DEX A;  3I3V A;  4H65 A;  4XTC Q;  1PBQ A;  2P0S A;  4RK2 A;  2V3Q A;  2DSF A;  1JEV A;  3IB2 A;  3M3L A;  3C31 A;  2LAO A;  3PU5 A;  3EHS A;  3K2D A;  1QUI A;  3FGS A;  3IO4 A;  3FUZ A;  1H44 A;  3TTM A;  3C36 A;  4QFO A;  3EQ1 A;  4ZE8 A;  5K2X A;  3G3I A;  3Q27 A;  2HCA A;  2QMW A;  3S2V A;  2Y7R A;  3F11 A;  1LAX A;  4F3B A;  4QFK A;  4GL8 A;  5FTH A;  2R71 A;  2PT1 A;  1LBB A;  3KFM A;  4E0W A;  3MQ9 A;  1LAG E;  3HHF A;  3QXM A;  1VFD A;  2AL4 A;  3TTR A;  2F7C A;  2O6A A;  4LQ2 A;  1OLC A;  4KYE A;  3HV1 A;  4RYA A;  4GXA A;  2Y7K A;  4TOZ A;  4H1X A;  2HQ0 A;  3FVO A;  3L6H A;  3H4Z A;  3U1O A;  2X7P A;  5ITP A;  4NF4 A;  3FAT A;  3O97 A;  1M5F A;  5A5X B;  1TWY A;  1MXW A;  4GL0 A;  3DP8 A;  2A5T A;  1ZU0 A;  3H7M A;  5EHS A;  4YB6 A;  2XXY A;  2ZYN A;  1KWH A;  2RC8 A;  4QSD A;  4ECF A;  3UOR A;  1MY4 A;  4OMB A;  1IUD A;  4O3A A;  5FTI A;  5AA4 A;  3TMG A;  3HHG A;  1NH8 A;  3UIF A;  4YIC A;  3WAE A;  1UIV A;  4OTE A;  1P1Q A;  1N0T A;  1ZMG A;  3T66 A;  3MWB A;  3SKP A;  4AB6 A;  4OZ9 A;  1A55 A;  3LR1 A;  3IOU A;  2F78 A;  5I2N A;  3MZB A;  4IO6 A;  3A3U A;  3LSF B;  1GGG A;  1I6A A;  4P0I A;  5I57 A;  5I2N B;  2XXI A;  1NNK A;  1PDA A;  3TTL A;  3UGW A;  4KCD A;  4JB7 A;  4NWC A;  3KN3 A;  4OET A;  5ITO A;  3ECR A;  3USD A;  2DE2 A;  1B4Z A;  3T93 B;  1DMB A;  2ONR A;  3MP6 A;  3K1M A;  3BFU A;  4FOR A;  3SEU A;  1ANF A;  1N7X A;  3TZA A;  1OIB A;  3OOA A;  3T9U A;  3PMX A;  4G8H A;  4HTG A;  4YKI A;  5CMK A;  5CMC A;  2DP8 A;  1B51 A;  3OO6 A;  4C0R A;  1JW4 A;  2AL5 A;  4NF8 A;  3PMV A;  4AQ4 A;  2ABH A;  2IEE A;  2ZNU A;  5LOM A;  2XXH A;  3DP6 A;  3W9V A;  1NFT A;  2OLB A;  4NE4 A;  1EZP A;  2BJJ X;  3AXF A;  4F1Y A;  3O6G A;  1BLF A;  2B3F A;  4R2B A;  4LZ8 A;  4NF5 A;  4OES A;  5IAI A;  4K3F A;  3PD8 A;  1D3K A;  3H06 B;  4ESX A;  1A8E A;  3TCF A;  1IQ7 A;  2DE4 A;  1BIY A;  3KBR A;  3UN6 A;  1BKA A;  4ELO A;  4QSE A;  4IO3 A;  3K6U A;  4TLM B;  2QS4 A;  2UXA A;  1ZIU A;  1MPC A;  1XVY A;  3KOT A;  5I84 A;  4ZEK A;  4BDL A;  5L9S A;  1B52 A;  3Q26 A;  4U2R A;  3TPA A;  3JYR A;  4FEB A;  4DCY A;  3VVE A;  3LSW A;  4BLA A;  4X1D A;  4GXS B;  3VV5 A;  4LVQ A;  3CRB A;  4YKP A;  3MPL A;  3PPO A;  3S9M C;  2YPN A;  4R6K A;  4H5F A;  3C35 A;  5IKB A;  3MJN A;  1B3G A;  5CM6 A;  4LP2 B;  5F7V A;  2AYS A;  3RTF B;  2RCA A;  2OJT A;  1MXU A;  3GXA A;  3CFX A;  1USY E;  1DTZ A;  5FHO A;  1TFA A;  4Z7E A;  1LCT A;  1B1X A;  2I3W A;  1MM7 A;  1A99 A;  2AIX A;  1H43 A;  1MXX A;  4ONY A;  4XKR A;  3CG3 A;  1UQW A;  2F7B A;  3TEP A;  3S9N C;  3IK6 B;  3R6U A;  4JWO A;  1FQB A;  4F1U A;  1XOC A;  5CRY A;  2ONK E;  1YTV A;  3VLV A;  3GBA A;  2R9J A;  1WOD A;  4KFQ A;  3O29 A;  4LON B;  4M4G A;  3ZKK A;  2O51 A;  1B0L A;  1A7L A;  1P1N A;  4GVO A;  4N13 A;  4LQ5 A;  4OVJ A;  1Y1M A;  2H98 A;  1Y4C A;  1YAE A;  1NNF A;  3N94 A;  3KSJ A;  2RKM A;  1BTJ A;  3EF7 A;  4YZZ A;  1GR2 A;  4HCW A;  4KHZ E;  4QF9 A;  1IIT A;  4EUO A;  1B3F A;  2YJP A;  4GQO A;  1MY2 A;  5AA3 A;  5HBC A;  1LST A;  1XS5 A;  2O1L A;  2QS1 A;  5H8S A;  3TKD A;  1FQA A;  3IB1 A;  4RPN A;  1XVX A;  1N7W A;  1Y3P A;  2X26 A;  1B1H A;  2XD2 A;  3G3J A;  3IR1 A;  4NF6 B;  2WKY A;  4YB7 A;  4ZEC A;  5CBR A;  1B7H A;  1CE2 A;  3PPQ A;  1VE4 A;  3SEV A;  3QIM A;  1AL3 A;  3CSG A;  1XT8 A;  5ICQ A;  1PB9 A;  4QFP A;  4IB2 A;  4C1T A;  1QUL A;  3MW0 A;  1TFD A;  1DPE A;  4FEC A;  2DVZ A;  3QK6 A;  3OO7 A;  1OQH A;  2QRY A;  5JEI A;  3JZJ A;  3O2A A;  1VFE A;  1B7Z A;  5BWJ A;  1JEU A;  2B3B A;  3MC2 A;  5DT6 A;  4DZ1 A;  1EZO A;  3RGY A;  5K2Y A;  2VD3 A;  5H8Q B;  3RLF E;  5AA2 A;  4IO7 A;  1TXF A;  1B3E A;  2X7Q A;  4EF2 A;  3JV9 A;  1JVY A;  4PFT A;  3IOW A;  1LFH A;  4H6D A;  5I56 A;  3K00 A;  4BDM A;  1LFG A;  1URD A;  3RY3 A;  3SEX A;  3HN0 A;  2NWJ A;  4OEN A;  1URS A;  4PE5 B;  3TFL A;  2ZYM A;  1B46 A;  5CI5 A;  3V5A A;  4AB5 A;  1B2H A;  4G68 A;  1MY3 A;  1M5D A;  4GIZ A;  3T22 A;  4LZ7 A;  3PD9 A;  4G68 B;  2FA7 A;  1SW1 A;  1UTB A;  1IEJ A;  1H76 A;  1AOV A;  5BUU A;  4GRK A;  3ILT B;  5JTY B;  3OD7 A;  1AIV A;  4LZ5 A;  1QW0 A;  3LSX A;  4PFU A;  1L5T A;  1I6B A;  1LAH E;  4YB5 A;  3C33 A;  3IX1 A;  1ZLQ A;  4R72 A;  2I48 A;  4G8N A;  3TYH A;  4IGT A;  1NL5 A;  4QFL A;  1SBP A;  3K6V A;  1MQJ A;  2I6E A;  4F3P A;  1NH7 A;  4MH5 A;  2I58 A;  4F3G A;  5DEX B;  2E1S A;  4WED A;  3G3H A;  5TPA A;  2O68 A;  1QKB A;  5I59 A;  4OHN A;  4JWY A;  2UVH A;  4BDO A;  2GH9 A;  4G8M A;  3IJX B;  1DPP A;  1S50 A;  4THI A;  3PUY E;  3VDF A;  1MM6 A;  4RJZ A;  1IZ1 A;  4ZDM A;  1NNT A;  2ZYO A;  4Q0C A;  1NMU A;  4MF3 A;  2UVG A;  3FXQ A;  3B6W A;  4R6H A;  3I5O A;  3KN8 A;  2ZMB A;  1ZBM A;  1SW4 A;  3U93 A;  3OXN A;  3E3K A;  4ISU A;  4XIG Q;  3N6T A;  4GF8 A;  2H5Y A;  3PGF A;  4EDP A;  1I6Q A;  1OLA A;  5KZT A;  1Y3N A;  1SDX A;  1SW2 A;  4ZEF A;  5HPQ A;  2V25 A;  3H6U A;  2I4C A;  1CB6 A;  2XXV A;  1MQH A;  3RNN A;  3B7D A;  2QL3 A;  3V89 B;  5KDT A;  3EPE A;  1MPB A;  3Q29 A;  1EZ9 A;  4NF4 B;  4KR5 A;  3RUM A;  1VSO A;  2UVI A;  3KJT A;  2Q8J A;  1XHY A;  2A5T B;  4YAH X;  1Q35 A;  1WDN A;  3FXR A;  4F29 A;  2CZL A;  4G68 C;  4H67 A;  4YU0 A;  1SVX B;  1Y4T A;  1QUK A;  3IAZ A;  4POW A;  4UAC A;  2PVU A;  5AA4 B;  3C4M A;  2QPQ A;  1N76 A;  2M8C A;  4TLL B;  5CMB A;  5AE4 A;  4EQ7 A;  1D9Y A;  2Q89 A;  3KOS A;  4KI0 E;  2NUV A;  3IL1 B;  1MQI A;  3ODB A;  1MDQ A;  2Z22 A;  2YLN A;  4P11 A;  3H6T A;  5I58 A;  3D4G A;  2FNC A;  2UYF A;  5I57 B;  4OFL A;  3SEY A;  3CIJ A;  2Q2A A;  4OYV A;  4R74 A;  3TDJ A;  4MLV A;  3K1P A;  1SD3 A;  3U92 A;  1MH3 A;  3TTN A;  2H25 A;  4IO5 A;  4GWO A;  5ELV A;  1Q1K A;  4PQJ A;  1O64 A;  4RY1 A;  3K6W A;  4NF8 B;  3O6I A;  2H99 A;  4ZS9 A;  4KYD A;  2XX8 A;  5DVJ A;  3ZSF A;  3SER A;  4EF1 A;  3PUZ E;  1MXZ A;  4DXU A;  1B5J A;  2DYX A;  4NF5 B;  4F1V A;  3U94 A;  5B70 A;  4NTL A;  1B58 A;  3TOD A;  4IO4 A;  3E9X A;  3IOT A;  4NMY A;  4DLD A;  4FAT A;  4NWD A;  4F3S A;  4FAJ A;  3T9V A;  4X1B A;  5J1D A;  3DLN A;  3S9L C;  4O3C A;  3HST A;  1H3D A;  4EQB A;  4X9T A;  4RXL A;  1SW5 A;  5AA1 A;  1MY0 A;  5TP9 A;  4FE8 A;  4Q8R A;  1J1N A;  2I0C A;  1QVS A;  4JXI A;  4F39 A;  1GV8 A;  3MZ1 A;  1R6Z A;  2PX1 A;  2THI A;  1DOT A;  4OFJ A;  4GLI A;  4ND9 A;  5H8H A;  3MVW A;  3TAJ A;  2ZNT A;  1FQE A;  2PMS A;  1RKM A;  4UA8 A;  4H5G A;  5H8H B;  5L9M A;  2VOZ A;  3CI8 A;  3VLU A;  4PFY A;  3FVG A;  3KJ7 A;  4XKN A;  3RQT A;  2VGQ A;  1HSE A;  4XKQ A;  1LLS A;  2OCU A;  5B7D A;  3UA8 A;  4IO2 A;  1LAF E;  4KD5 A;  1Y1Z A;  4BDN A;  3LSL A;  4ZZA A;  4F19 A;  3H6V A;  4R9G A;  4I1D A;  3UP9 A;  5DVI A;  3FV2 A;  2Y7W A;  1B5H A;  3LUY A;  3G3K A;  3OMB A;  1PEB A;  2F6G A;  1HSJ A;  1LFI A;  3SET A;  2OWS A;  4I9D A;  2Z8E A;  2O69 A;  3VVF A;  2V84 A;  1MQG A;  2O84 X;  3QYT A;  3VVD A;  1VR5 A;  3EHU A;  4XXU A;  4H8J A;  2H4I A;  3K4U A;  2DOJ A;  2VHA A;  4KCC A;  2OZZ A;  4YKJ A;  2F7A A;  2NOO A;  2Q9T A;  4KPT A;  5I2K A;  2XX9 A;  3P7I A;  2GHA A;  3M3K A;  4JWX A;  5I2K B;  2REG A;  1R1N A;  3RN8 A;  4G2Z A;  3T9X B;  4X48 A;  4HW8 A;  3A3C A;  4Q30 B;  3DEL B;  4OEU A;  4IY5 A;  4LA9 A;  1B05 A;  2Y7I A;  3QUF A;  1N04 A;  1IXH A;  3V83 A;  2ALU A;  5AA2 D;  1UTH A;  1F9B A;  5TU0 A;  1MH4 A;  1FQD A;  1MY1 A;  3SES A;  2G93 A;  3OEL A;  1UTH B;  5F1Q A;  3PPR A;  3PUW E;  3RTW B;  5ICT A;  1O63 A;  1URG A;  1AMF A;  4RNS A;  1DSN A;  2HFB A;  2VD2 A;  5EHM A;  3VXC A;  5AA2 B;  1B32 A;  1PB8 A;  3PPP A;  1B0H A;  3N26 A;  4RK9 A;  3CSB A;  5I56 B;  2REJ A;  4ZED A;  5L9O A;  1GVC A;  1O7T A;  2F34 A;  2ZXT A;  4OEV A;  1JVX A;  4ELR A;  3GLB A;  1A54 A;  1IXI A;  2HAU A;  2CMO A;  1S7Y A;  3O9P A;  4QHQ A;  1UTB B;  4DE8 A;  2QS3 A;  3O66 A;  5ISU A;  2DXY A;  3H6W A;  3M8U A;  1USY H;  2Z8F A;  4RA1 A;  4IY6 A;  4OFO A;  3C9H A;  4ZE9 A;  4R6Y A;  1Y20 A;  3PUX E;  4YKK A;  1QKA A;  1FQC A;  5TPA B;  2OK2 A;  3OO8 A;  2D21 A;  1JET A;  4L17 A;  2Z8D A;  4JSD A;  1FCK A;  4LAT A;  2P1S A;  3MVY A;  5I59 B;  1UIU A;  3IJO B;  1TT1 A;  3BBR A;  1WVJ A;  1A8F A;  2G29 A;  2F5X A;  1LGB C;  1B4H A;  4N07 A;  3ZKL A;  3G3G A;  1Y9U A;  3IOV A;  2F6P A;  3W15 C;  2PBW A;  3CR9 A;  2GHB A;  4OWD A;  1US4 A;  2HAV A;  4WEP A;  1MS7 A;  5M2V A;  4U22 A;  3A09 A;  4ELQ A;  4U23 A;  5L8D A;  3DM0 A;  3R7X A;  3WAF A;  3B6T A;  3U8Q A;  1SI0 A;  2Y7P A;  3R26 A;  3OSQ A;  1N3W A;  1FTK A;  2ZNS A;  3EN3 A;  2F35 A;  5DTB A;  5EYF A;  1HSL A;  4ZEB A;  1OMP A;  2HZK A;  5FHN A;  5DVF A;  2Q2C A;  4MFI A;  2E0S A;  1ELJ A;  2V93 A;  3TTK A;  3FD3 A;  3TQL A;  4DCX A;  3RT6 B;  1T0K A;  3K6X A;  5KDT B;  2I0B A;  4N6P A;  2PYY A;  3FVK A;  1R9L A;  2XXR A;  3CVG A;  4KYS A;  5A5X A;  2RC7 A;  4DXB A;  2D3I A;  2F8D A;  1JW1 A;  3IO6 A;  3V8X B;  4BDR A;  5FHM A;  3Q25 A;  3HO7 A;  4YMA A;  2RC9 A;  1XC1 A;  4U1O A;  1D9V A;  3MPK A;  1LB8 A;  4F2O A;  2DWI A;  4G4P A;  2ESN A;  1II5 A;  1M5E A;  2QS2 A;  1RYX A;  2I3V A;  1SQY A;  3VFJ A;  3ILU B;  3K02 A;  4R75 A;  1N3X A;  3Q28 A;  1IXG A;  2XD3 A;  1POT A;  3L6G A;  3S4U A;  2QSX A;  4M1V A;  1MPD A;  4OQO A;  3I6V A;  4BDQ A;  2V3U A;  5I58 B;  4F22 A;  3FXU A;  2KLF A;  4DIG A;  3E13 X;  4E0X A;  3O28 A;  3S9E A;  3GZG A;  4KQP A;  3SDF A;  5HM4 B;  3PUV E;  1FW0 A;  3D4C A;  4FED A;  5KCJ A;  1FTL A;  2RIN A;  1PC3 A;  2NXO A;  5KCJ B;  1ZJL A;  2XXW A;  2I4B A;  1EH3 A;  5H8N A;  2UVJ A;  4Z0I A;  4I62 A;  5H8N B;  1Z7M E;  4R2F A;  2O7I A;  3KZG A;  3VE1 B;  1LCF A;  1M5C A;  4MLQ A;  1PBP A;  5H8F A;  3QUJ A;  3HCQ A;  1FTM A;  4JSO A;  5H8F B;  2B65 A;  3BFT A;  1JQF A;  2Y84 A;  4EQ9 A;  3PV0 E;  3ONM A;  4ZZE A;  3KG2 A;  1S9T A;  2IA4 A;  1D4N A;  3DP4 A;  3W9W A;  1NNP A;  4OER A;  2HZL A;  3GBB A;  3BKI B;  1Z7N E;  1IXC A;  3N6U A;  5DYH A;  3C32 A;  3FJ7 A;  3K1N A;  1FTJ A;  3MVZ A;  4MBP A;  2XHD A;  3H03 A;  3SEW A;  3FZV A;  1B7U A;  2P2A A;  1AH5 A;  1OQG A;  4O3B A;  4I8C A;  3KEI A;  1A40 A;  2DWA A;  5TP9 B;  3FVN A;  3MP1 A;  1N84 A;  2D5W A;  4U4S A;  3OEM A;  2O7U A;  4NED A;  1SI1 A;  4IGR A;  1MG1 A;  3FV1 A;  2DQV A;  2F36 A;  4DDD A;  1FTO A;  3RT8 A;  3M3F A;  1B9J A;  2XX7 A;  3OSR A;  3TCH A;  1SYI A;  3MAM A;  4U21 A;  2R6G E;  4YMB A;  2OBG A;  2ZYK A;  4WXJ A;  2ONS A;  3IB0 A;  3KGC A;  3FIR A;  2O1M A;  3MVX A;  4F31 B;  3TUS A;  1US5 A;  1PB7 A;  4H0W A;  3T96 B;  3E4R A;  3FJG A;  4H8I A;  1MRP A;  2XXU A;  1MDP 1;  4OXV A;  1JW5 A;  4F2Q A;  3O6H A;  1MQD A;  1R9Q A;  2Z23 A;  3VXB A;  2DWJ A;  3TEL A;  3CG1 A;  3QSL A;  3MUQ A;  1OVT A;  1B40 A;  3MZ9 A;  5CC2 A;  4GD5 A;  2HXW A;  4GOT A;  4LUB A;  4FIM A;  1YCJ A;  1QJM A;  2DS9 A;  4C1U A;  1IIW A;  2XXP A;  4QSC A;  3LC8 A;  3UK4 A;  4JBZ A;  4Q5T A;  1FQF A;  4RPO A;  1MXY A;  3U72 A;  2F97 A;  4POX A;  1ZTY A;  4G77 A;  3MP8 A;  4PP0 A;  3CFZ A;  3B6Q A;  2OWT A;  1B3L A;  3K01 A;  3N5L A;  2RCB A;  2XXQ A;  3H3G A;  1LBC A;  4ELP A;  4NF6 A;  2DXR A;  3C34 A;  4HCY A;  2UYE A;  1P99 A;  1QUJ A;  2I49 A;  1EU8 A;  1SYH A;  2QJE A;  1YPN A;  4WKM A;  3LBS A;  1GTK A;  3KSX A;  2DWH A;  4ESW A;  1LB9 A;  4EXK A;  1ZKB A;  3HPI A;  4FJP A;  3TCG A;  4PET A;  1POY 1;  3KN7 A;  3FAS A;  4U1Z A;  3MBP A;  3ZS6 A;  2XXT A;  1B5I A;  4U4X A;  1P1W A;  1BP5 A;  2Q88 A;  2V3T A;  3VLW A;  2A5S A;  3G7W A;  4DXC A;  5CMM A;  5H8Q A;  4R73 A;  1P1U A;  1B6H A;  2VP1 A;  3OEK A;  2XXX A;  1H45 A;  4HS7 A;  3K0V A;  1RYO A;  3IOR A;  4TQU Q;  3PPN A;  1M5B A;  2RF1 A;  3FJM A;  2H9B A;  2GRV A;  3TQW A;  3PMW A;  3OO9 A;  1OVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...