5K2YA

Crystal structure of m. tuberculosis uspc (monoclinic crystal form)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
400
structure length
400
Chain Sequence
IVVTVRLWDEPIAAAYRQSFAAFTRSHPDIEVRTNLVAYSTYFETLRTDVAGGSADDIFWLSNAYFAAYADSGRLMKIQTDAADWEPAVVDQFTRSGVLWGVPQLTDAGIAVFYNADLLAAAGVDPTQVDNLRWSRGDDDTLRPMLARLTVDADGRTANTPGFDARRVRQWGYNAANDPQAIYLNYIGSAGGVFQRDGKFAFDNPGAIEAFRYLVGLINDDHVAPPASDTNDNGDFSRNQFLAGKMALFQSGTYSLAPVARDALFHWGVAMLPAGPAGRVSVTNGIAAAGNSASKHPDAVRQVLAWMGSTEGNSYLGRHGAAIPAVLSAQPVYFDYWSARGVDVTPFFAVLNGPRIAAPGGAGFAAGQQALEPYFDEMFLGRGDVTTTLRQAQAAANAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Probable periplasmic sugar-binding lipoprotein UspC
publication title Structural and functional analysis of the solute-binding protein UspC from Mycobacterium tuberculosis that is specific for amino sugars.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 133
structure length 400
sequence length 400
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5k2yA00
1EZPA 4RNSA 1LFIA 3PD8A 3DP4A 1SQYA 2F78A 1WDNA 4G68B 1VE4A 1MQIA 1H45A 3Q25A 4H8IA 4DZ1A 1A55A 4GWOA 3DLNA 1LFGA 4KR5A 1FTLA 4GQOA 4FE8A 2V3UA 1O63A 3O29A 2UVGA 5L8DA 3O66A 1JNFA 2H25A 5CMBA 4TQUQ 1T0KA 3S9EA 3PPRA 3CRBA 4X1DA 3EQ1A 4YKJA 4F1YA 2XXUA 3T9VA 4RY1A 3TDJA 1LSTA 1DPEA 1MM6A 4NF4A 5CMKA 4IGRA 1BIYA 1PBQA 1URGA 3F11A 2Y7PA 1SW4A 1D9YA 2PBWA 3EPEA 1URDA 3UIFA 5BUUA 5CBRA 1MPDA 4F39A 3KN3A 2UVHA 4KFQA 4NEDA 5A5XA 3G3FA 2OK2A 2OJTA 1B05A 4HW8A 5AA2D 1BLFA 4U21A 1SDXA 5I2NB 1XHYA 3G3JA 1M5CA 4OTEA 1PBPA 4ZECA 3KEIA 3TMGA 1EZOA 1FTJA 5DT6A 3B6TA 1XT8A 3FVOA 3MQ9A 4I62A 2XXTA 1B6HA 5H8FA 1AOVA 2ZYOA 1MS7A 2Z8EA 5HBCA 1FQAA 1DTGA 1SVXB 1TFDA 3R7XA 4M1VA 1RYXA 2Y7IA 1R1NA 4F3SA 1LAGE 4F18A 4LONB 5I56B 1B40A 1B4ZA 3PPOA 1MY2A 4MBPA 3VXBA 4KYDA 1MXXA 4I9DA 3BKIB 4NF4B 1IITA 3GZGA 2UXAA 2XD3A 4U23A 3MVXA 2I3VA 4F2OA 3KZGA 2R9JA 1YPNA 5AA4A 1MPBA 2Q9TA 3K1MA 2RCBA 2M8CA 3OO6A 2A5TA 4DLDA 3CFLA 2IA4A 1Q1KA 1FCKA 2XHDA 1LBBA 1R9LA 3U92A 3PV0E 4PQJA 4QF9A 3TELA 2PVUA 3ONMA 4ESXA 3SKPA 5BWJA 3H4ZA 5FTIA 1JETA 1LGBC 3RY3A 1O7TA 3C33A 5ICTA 1PB9A 1NNPA 3MJNA 3PMVA 3MP6A 1MXVA 3ZSFA 3QK6A 4F3GA 1DSNA 3K6WA 1BKAA 4EDPA 3DELB 1US5A 1POTA 4U2RA 1NL5A 3BBRA 3U94A 2ZNUA 1VSOA 1H43A 3LUYA 3HSTA 3H06B 3Q27A 4K3FA 2QS4A 2F36A 1AL3A 2A5TB 3PPQA 5IKBA 3VVDA 4QFLA 4UA8A 4IO7A 4XTCQ 2DXRA 1DPPA 3K6UA 3QAXA 3OEKA 1Y1ZA 2ZMBA 3CVGA 3M3KA 2VD3A 3K0VA 3KGCA 3VE1B 4F29A 5AA2A 3KN7A 3MZBA 4DXUA 3HO7A 1B3GA 3K4UA 2XXQA 2QL3A 2DVZA 4FORA 1Z7NE 1JW5A 4NTLA 1NNTA 4XXUA 3W15C 3TKDA 4H5FA 4NWCA 1SI1A 1Q35A 2XX9A 1POY1 3S9LC 2DWAA 3S4UA 1IXCA 3G3GA 4JWYA 3THIA 1IQ7A 2XXXA 1KWHA 4C1UA 4POXA 4N13A 3OO7A 3UP9A 4R6HA 2OZZA 1MRPA 4QSEA 3GBAA 1HSJA 4RJZA 4KCCA 3KJ7A 2I4CA 2WKYA 1Y3NA 4FECA 2ZNTA 3CIJA 3VVFA 1SYHA 1N0TA 4EXLA 4FIMA 1GVCA 3RGYA 1IXIA 1XS5A 4M4GA 3USDA 2GHAA 2ONRA 1MY0A 2HCAA 4ZE9A 2O7UA 3K1PA 5AA2B 1N3XA 2YJPA 1MY4A 3MVWA 3VXCA 1NMUA 1B5JA 4FEBA 1B3FA 3QUJA 3TTNA 5I59A 2ZYMA 3KSJA 1FTKA 4OQOA 4C1TA 3O97A 4LVQA 3TPAA 4GXAA 1USYE 3OSRA 1B7HA 1B1XA 4Q8RA 5EHSA 1ZU0A 1FQDA 4LQ2A 4ELOA 1N7WA 5F1QA 4Q0CA 3OXNA 2DSFA 3LSFB 4YB6A 1IZ1A 1D3KA 2PT2A 3K1NA 1ANFA 5AE4A 3W9WA 3GBBA 1AH5A 3M3FA 3MBPA 3FXQA 3B6QA 3IOTA 5KCJB 1ZBMA 4JWOA 3EHTA 5HPQA 4LUBA 4R72A 4EXKA 2O1LA 1P1OA 3FVKA 2FA7A 4O3BA 3ZKLA 2FYIA 4GD5A 1B7ZA 4ISUA 1B2HA 3RTWB 4F19A 1B3HA 3MW0A 5I59B 1Y1MA 2ZNSA 3UN6A 3C4MA 2VP1A 4E0WA 3MVYA 2G93A 3U72A 2DQVA 3W9VA 1MM7A 1Y3PA 3TTMA 2HZKA 2BJJX 4KQPA 2Q2AA 5B7DA 2DP8A 4PFYA 3FASA 3FIRA 3SEUA 5ISUA 3FXUA 4H0WA 4P0GA 4PETA 1OVTA 4R2BA 4XKRA 1OLAA 4R74A 4JSDA 3CG3A 5L9MA 4Z0IA 3TTKA 3VFJA 4BDLA 2HEUA 3O6IA 1QJMA 2XXHA 1FTOA 4NF8A 4F22A 5I56A 3LSXA 1A8FA 3T9XB 2HAVA 2PT1A 2AYSA 2REGA 4YMBA 2Z23A 3PUVE 3OO9A 3RN8A 1IUDA 3AXFA 4NF5B 1A8EA 2G29A 2I6EA 3C9HA 3MP8A 3T93B 4ZEBA 2R71A 4KYEA 2UYFA 1PB7A 2YPNA 4YKIA 3TCGA 4NF6A 3IX1A 3O9PA 3RQTA 4GRKA 4DDDA 4IO2A 5FTHA 3D4CA 4TOZA 4ZZAA 1JVXA 2ABHA 1B5IA 1B3EA 3IORA 5DTBA 1B46A 4ELQA 5I2KA 4GVOA 2HXWA 2V3QA 4KPTA 4BDMA 3G7WA 4QFKA 1XC1A 1LAHE 3HHGA 2NVUB 4MFIA 1GV8A 3FV1A 3HV1A 4ZZEA 1YTVA 2XXIA 4DCYA 3ILUB 3ECRA 1USYH 4OHNA 3SERA 2P1SA 4NF8B 1QKBA 4GIZA 3RUMA 4DXBA 2RCAA 5ELVA 4LATA 3QXMA 3HN0A 5FHNA 3IO4A 5LOMA 3EF7A 4OENA 4R9GA 2X7QA 2V3TA 4ZS9A 2F8DA 2F7BA 4PE5B 3Q29A 4RK2A 4IY6A 1A7LA 4DIGA 2I0BA 4YAHX 4Q5TA 5CI5A 2NUVA 3QUFA 4F3PA 3PUXE 4ELRA 4OXVA 2DWJA 4NF6B 1QULA 4HCWA 1FQFA 4LA9A 4OVJA 3KBRA 3C34A 1UTBA 2A5SA 2VOZA 5ITPA 4YB5A 3N26A 4Q30B 1IXHA 1B0HA 2E1SA 2V93A 2H98A 5I2KB 4ZEIA 4IO5A 3G3KA 4KHZE 2VGQA 2F7CA 3LSLA 3QSLA 2QMWA 3TFLA 3H6TA 3FJGA 4BDNA 2O51A 5FHOA 4YICA 2I48A 1MY3A 1CE2A 3OMBA 3K2DA 3QIMA 2GFEA 3CSBA 2D5WA 2O69A 1B1HA 1MQHA 1M5DA 1IIWA 3H6VA 4ND9A 4OZ9A 2QMXA 1P1QA 4H1XA 4EF1A 2HFBA 1NH7A 3FGSA 3CFXA 5H8NA 1JW4A 1PB8A 2I49A 2B65A 3TEPA 4ZEKA 3V8XB 2YLNA 5CBSA 3IOWA 4YMAA 1B5HA 4R73A 1SBPA 4H67A 3H03A 1UTBB 4ZDMA 4HS7A 2DS9A 3IB1A 3JYRA 2Q2CA 4MH5A 3E13X 1AMFA 3GLBA 2GH9A 1QUKA 4NMYA 3IB0A 1XOCA 3VVEA 4YKKA 4WXJA 4G77A 1MH4A 4JB7A 4YU0A 1QW0A 5TP9A 3G3HA 1A99A 4ZEDA 4LZ5A 5I84A 2Q88A 3VLVA 2O7IA 4JXIA 4G8NA 3OO8A 3ODBA 1MY1A 4X48A 2Y7RA 4EQ9A 3O6HA 2XXRA 3U93A 3LC8A 4BDRA 2QJEA 2F6GA 4RPOA 5H8NB 5DVJA 2E0SA 1URSA 4IY5A 1OMPA 3TQWA 1P1NA 2I4BA 1MQGA 3I3VA 4X1BA 4WKMA 1UIUA 1OLCA 1EH3A 1M5FA 2DWHA 2Q89A 1MPCA 2P2AA 1J1NA 1Y4TA 3U8QA 3IK6B 3M8UA 5KCJA 1UQWA 4EQ7A 3T66A 2QSXA 2PMSA 3LSWA 2CMOA 4GF8A 1ZKBA 3T96B 3Q28A 4N07A 2H9BA 4G2ZA 3TODA 3S2VA 4LP2B 2OCUA 1LLSA 3E4RA 4POWA 2I3WA 4E0XA 1GTKA 1WVJA 4H8JA 3RNNA 5TP9B 1CB6A 1ZMGA 5EYFA 1L5TA 1II5A 1LCTA 1MDQA 4FAJA 3UORA 1OQHA 4GL0A 4U4SA 2Y84A 5CC2A 5K2XA 4GLIA 4JWXA 3T9UA 3KOTA 1B3LA 3PPNA 3TCHA 4MLVA 5TPAA 2X26A 5IAIA 1ZTYA 3HHFA 3TAJA 2NWJA 5J1DA 1OVBA 4NE4A 3CR9A 1SW5A 3SDFA 1P1UA 2DE2A 1VR5A 3LBSA 1Y20A 4IO3A 3OENA 3SEXA 3ZS6A 4OFOA 5JTYA 4AB5A 3C32A 3OD7A 2DOJA 1A54A 1YAEA 3WAFA 3OELA 1NNFA 3B6WA 5I58A 1PC3A 1JQFA 4OFJA 3FJMA 2HAUA 1I6QA 4IB2A 1MXYA 1NKXA 4DXCA 4NF5A 1S9TA 3GXAA 4OMBA 2XD2A 3SEVA 2B3BA 1JEUA 2QPQA 3FVGA 5DYHA 1D4NA 1LB9A 3PU5A 2F35A 5KZTA 2DVCA 2XX8A 1QUIA 2RF1A 3CG1A 4AB6A 3N5LA 2DWIA 4U22A 3V89B 4F3BA 4I8CA 3A3UA 2ONSA 3S9MC 1FQBA 5TPAB 4U1OA 3E9XA 2DE4A 2Z22A 3FD3A 2OWTA 5DVFA 4TLLB 3UGWA 1JVYA 5DEXB 2B3FA 1RYOA 3DP8A 4ZE8A 2F6PA 1Y3QA 3SETA 2KLFA 3CI8A 3UK4A 1LAXA 3PUZE 4XKNA 1Y4CA 3K02A 5JTYB 5FHMA 5EHMA 3KFMA 2XXYA 1MQDA 3VLUA 1LCFA 3MP1A 3L6HA 4IO6A 4O3CA 1FQCA 3IB2A 3B7DA 2O84X 3JV9A 4YZZA 4KD5A 3IAZA 2XX7A 3IJXB 4OETA 4XIGQ 5I58B 1DMBA 2AIXA 5KDTB 1B0LA 3K00A 2I58A 2RC8A 1H3DA 1LB8A 3T9HB 1MXWA 2QRYA 2R6GE 3BFTA 2GRVA 3V83A 2DYXA 4ZEFA 3K6VA 5TU0A 3IR1A 1XVYA 3L6GA 3TQLA 3IO6A 3HCQA 4PFUA 3TTLA 4LZ7A 1B9JA 3IJOB 4G8HA 3MPKA 3PMXA 1UTHA 5ITOA 3E3KA 1SW2A 2RC7A 5F7VA 2Q8JA 2PYYA 2ONKE 1B58A 1XVXA 1BP5A 2AL4A 5AA1A 1QVSA 1I6BA 2ANJA 4KCDA 2V84A 2V25A 3EHSA 1VFEA 4QSDA 4PFWA 1BTJA 1NH8A 1SYIA 2ESNA 2QS3A 3RTFB 5B70A 3I6VA 1FTMA 3QYTA 3PMWA 4RPNA 4H65A 4O3AA 3O2AA 2D21A 4X9TA 2Y7WA 4G68C 3FXRA 4G4PA 3SEWA 4IGTA 5H8HA 1SD3A 5M2VA 1FW0A 2F34A 4JBZA 4L17A 4FEDA 3I5OA 5L9OA 3DM0A 1IXGA 4H5GA 5JEIA 1N3WA 3H6WA 4R6YA 4I1DA 4R2FA 2VD2A 4XKQA 3H7MA 3IOVA 2W7YA 1LAFE 2I0CA 4G8MA 4BDOA 2RKMA 4U1ZA 3T22A 4NWDA 3KOSA 4ECFA 1H76A 1UTHB 4OFLA 2H99A 3FJ7A 3FV2A 2VHAA 5A5XB 3MWBA 3TTRA 2F5XA 1B51A 1QKAA 4ELPA 2QS2A 1SW1A 2NOOA 1SI0A 1I69A 4FJPA 2ZYKA 3MC2A 4ONYA 5K2YA 1TXFA 1MXZA 4EQBA 3V5AA 1B52A 1NFTA 5H8FB 1OIBA 1QUJA 1FQEA 1MH3A 3IOUA 3OEMA 2OWSA 3MZ1A 2LAOA 3N6TA 3VV5A 1S50A 4EF2A 4R9FA 1ZLQA 1EZ9A 1TT1A 4PP0A 5H8HB 2Y7KA 3FZVA 4YB7A 3IL1B 4GL8A 3MAMA 3TCFA 3PUYE 2GHBA 5I57A 1VFDA 1B7UA 2RC9A 3EHUA 3R6UA 2RINA 4DCXA 1ZJLA 3H3GA 3P7IA 4OWDA 4OESA 2ZYNA 3DP6A 3MPLA 3S9NC 2THIA 1N7XA 5AA4B 3A3CA 4WEPA 4R75A 4UACA 4N6PA 3RLFE 1MQJA 3O6GA 4LZ8A 1JW1A 4F1VA 2OBGA 1TFAA 5H8QA 1US4A 3KSXA 3WAEA 4PFTA 1JEVA 4QFOA 4RXLA 2XXWA 4ESWA 3KN8A 3TYHA 1N76A 4WEDA 1DTZA 5CRYA 4QHQA 2O6AA 2O68A 2HZLA 1N04A 2CZLA 2XXPA 4JDFA 4H6DA 1A40A 1F9BA 3C31A 3FATA 4F31B 1IEJA 1ZIUA 5HM4B 1LFHA 3BFUA 2HQ0A 2FNCA 1O64A 2OLBA 4OYVA 3ZKKA 5AA3A 1MXUA 4BLAA 1GGGA 3C35A 4FATA 1B4HA 5DVIA 1R6ZA 1LBCA 3RPWA 3M3LA 2D3IA 4Z7EA 3CFZA 5I57B 1PEBA 3MZ9A 3A09A 2QS1A 3PUWE 4KI0E 3PPPA 2UVJA 2IEEA 1H44A 3G3IA 3H6UA 3TZAA 2Z8FA 3FVNA 1EU8A 2H5YA 1MG1A 4KYSA 3N6UA 4JSOA 3KJTA 4DE8A 1WODA 3KG2A 5H8QB 4MLQA 3CSGA 3TUSA 4OEVA 4AQ4A 3LR1A 5H8SA 4F1UA 4F2QA 4HCYA 1TWYA 2DXYA 2F7AA 3UA8A 1HSLA 1N84A 3K01A 4RYAA 2UVIA 2X7PA 3Q26A 1UIVA 3SESA 1OQGA 4GXSB 1PDAA 4EUOA 3VDFA 5L9SA 4TLMB 1AIVA 3R26A 4RA1A 1Y9UA 4IO4A 4BDQA 1DOTA 4GOTA 5ICQA 5DEXA 4C0RA 4MF3A 1M5BA 3N94A 3PGFA 1D9VA 3OSQA 1ELJA 3O28A 4G68A 1RKMA 2AL5A 1R9QA 5CM6A 4LQ5A 2ZXTA 2F97A 1YCJA 2ALUA 2REJA 4R6KA 3K6XA 1I6AA 3MVZA 3HPIA 3D4GA 4U4XA 1HSEA 1MDP1 4THIA 5KDTA 1GR2A 3JZJA 2DE3A 1NNKA 4RK9A 3MUQA 3OOAA 3U1OA 3ILTB 1P1WA 5CMMA 3RT6B 1P99A 2Z8DA 1B32A 2H4IA 2P0SA 2UYEA 4P11A 4GFRA 4QFPA 4YKPA 4HTGA 1S7YA 4QSCA 4QFNA 2XXVA 3RT8A 4QRZA 2NXOA 1Z7ME 4OERA 4P0IA 3SEYA 3EN3A 4OEUA 1ATGA 3VLWA 3C36A 5JK4A 2O1MA 3FUZA 5CMCA 1M5EA 4XKPA 3PD9A 2PX1A 5I2NA
chains in the Genus database with same CATH superfamily
1EZPA 4RNSA 1LFIA 3PD8A 3DP4A 2XWIA 1RDZA 1SQYA 2F78A 1WDNA 4G68B 4MIJA 1VE4A 1MQIA 1H45A 3Q25A 4H8IA 4DZ1A 1A55A 4GWOA 3DLNA 1LFGA 4KR5A 1FTLA 4GQOA 4FE8A 2V3UA 1O63A 3O29A 2UVGA 5L8DA 1G0IA 4PFBA 3O66A 1JNFA 2H25A 5EYGA 5CMBA 3GYYA 4TQUQ 1T0KA 3S9EA 2FIEA 4GWSA 3PPRA 3CRBA 4XF5A 4X1DA 3EQ1A 4YKJA 1LBVA 4F1YA 2XXUA 4AS5A 3T9VA 4RY1A 1LEVA 3TDJA 1LSTA 3IFAA 1DPEA 1MM6A 4NF4A 5CMKA 4IGRA 1BIYA 1PBQA 1URGA 3F11A 3NOHA 2Y7PA 1SW4A 1D9YA 2PBWA 3EPEA 4PBHA 1URDA 1LBXA 3UIFA 5DW8A 5BUUA 4PDDA 5CBRA 1NV4A 1MPDA 4F39A 3KN3A 2UVHA 4N8GA 4PTKA 4KFQA 4NEDA 5A5XA 3G3FA 2OK2A 4X04A 5I5PA 2OJTA 1B05A 4HW8A 5AA2D 1BLFA 4U21A 2PFYA 1SDXA 5I2NB 1XHYA 2VT5A 3G3JA 1M5CA 3KC0A 4OTEA 1PBPA 4ZECA 3KEIA 3TMGA 1EZOA 4MCOA 1FTJA 5DT6A 3B6TA 1XT8A 3FVOA 3MQ9A 4I62A 2XXTA 1B6HA 5H8FA 1AOVA 5I7IA 2ZYOA 1MS7A 2Z8EA 5HBCA 1FQAA 1RDXA 1DTGA 1SVXB 1TFDA 3R7XA 4M1VA 1RYXA 2Y7IA 1R1NA 4F3SA 1LAGE 4F18A 4LONB 5I56B 1B40A 1B4ZA 3PPOA 1MY2A 4MBPA 3VXBA 4KYDA 5ET5A 1MXXA 1BK4A 1NUZA 4I9DA 3BKIB 4NF4B 5LTCA 1IITA 3GZGA 2UXAA 2XD3A 4U23A 3MVXA 2I3VA 4F2OA 3KZGA 2R9JA 1YPNA 5IM2A 5AA4A 1FPIA 4N91A 1MPBA 2Q9TA 3K1MA 2RCBA 2M8CA 3OO6A 2A5TA 4DLDA 1EYKA 3CFLA 2IA4A 1Q1KA 1FCKA 2XHDA 2ZZVA 1LBBA 5LDZA 1R9LA 4G61A 3U92A 3PV0E 4PQJA 4QF9A 4O7IA 3TELA 2PVUA 3ONMA 4ESXA 3SKPA 5BWJA 3H4ZA 5FTIA 1JETA 1LGBC 3RY3A 1O7TA 3C33A 5ICTA 4OA4A 1PB9A 4PAIA 1NNPA 3E79A 3MJNA 3PMVA 3MP6A 1MXVA 3ZSFA 3QK6A 4F3GA 1DSNA 3K6WA 1BKAA 4EDPA 3DELB 1US5A 2HXRA 1POTA 4U2RA 1CNQA 4JVDA 4GWWA 1NL5A 3BBRA 1NV7A 3U94A 2ZNUA 1VSOA 1H43A 4O94A 5J16A 3LUYA 4X8RA 3A29A 3HSTA 3H06B 3Q27A 4K3FA 1YXIA 2QS4A 2F36A 1AL3A 2HHMA 2A5TB 2QVRA 3PPQA 4DI3D 5IKBA 3VVDA 4QFLA 4UA8A 4UABA 4IO7A 4XTCQ 2DXRA 3LV0A 5FBPA 1DPPA 3K6UA 3QAXA 3OEKA 1FPBA 1Y1ZA 3M3KA 2ZMBA 3CVGA 2VD3A 3K0VA 3KGCA 1DBZA 3VE1B 2CEXA 4F29A 5AA2A 3KN7A 4P47A 3MZBA 4DXUA 3HO7A 1B3GA 3K4UA 2XXQA 1K9ZA 1FBDA 2QL3A 2DVZA 4FORA 1Z7NE 1JW5A 1QGXA 4NTLA 1KA1A 1NI9A 1NNTA 4AS4A 4XXUA 3W15C 3TKDA 4H5FA 4NWCA 1SI1A 1Q35A 2XX9A 1POY1 3S9LC 2DWAA 4HE2A 3S4UA 4P1EA 4I40A 1IXCA 3G3GA 4JWYA 3THIA 1IQ7A 4MAGA 1INPA 2XXXA 1KWHA 4C1UA 4POXA 4N13A 3OO7A 3UP9A 4R6HA 2OZZA 1MRPA 4QSEA 3GBAA 4P1LA 1HSJA 4RJZA 4KCCA 3KJ7A 4PBQA 2I4CA 2WKYA 1Y3NA 4FECA 2ZNTA 4N6DA 3CIJA 3VVFA 1SYHA 1FPGA 1N0TA 4EXLA 4FIMA 1GVCA 3RGYA 3RPLA 1IXIA 1XS5A 5ET6A 1FBPA 4M4GA 3USDA 2GHAA 2ONRA 1MY0A 5ET8A 2Q8MA 2HCAA 4ZE9A 2O7UA 3K1PA 5AA2B 1N3XA 2YJPA 2CZIA 1MY4A 3MVWA 3VXCA 2P3NA 1NMUA 1B5JA 4FEBA 1B3FA 3QUJA 3TTNA 5I59A 4NG7A 2XWOA 2ZYMA 3KSJA 1FTKA 4GWUA 4OQOA 4C1TA 3KBZA 3O97A 2Y5LA 4PGPA 4LVQA 3TPAA 4GXAA 2OX3A 1USYE 1LBYA 3OSRA 2GQ1A 1B7HA 1B1XA 4Q8RA 5EHSA 1ZU0A 1FQDA 4LQ2A 4ELOA 1FPFA 1N7WA 5F1QA 4Q0CA 3OXNA 2DSFA 3LSFB 4YB6A 1IZ1A 5EQ8A 1D3KA 2PT2A 3K1NA 1ANFA 2B4LA 5AE4A 3W9WA 3GBBA 1AH5A 4JVIA 3M3FA 3MBPA 3FXQA 3CHGA 4H46A 3B6QA 3IOTA 5KCJB 1ZBMA 4NAPA 4JWOA 3EHTA 5HPQA 4GX6A 4LUBA 4O8MA 1D9QA 4R72A 4EXKA 2O1LA 1IMCA 1P1OA 3RPLB 3FVKA 2FA7A 4O3BA 5IZ1A 3ZKLA 2FYIA 2QVUA 4GD5A 1B7ZA 4ISUA 1B2HA 1JP4A 3RTWB 4F19A 4NHBA 1B3HA 3MW0A 5I59B 1XI6A 1Y1MA 2ZNSA 3UN6A 3C4MA 2VP1A 4E0WA 3MVYA 2G93A 3U72A 1NV1A 2DQVA 3W9VA 1MM7A 1Y3PA 4GWXA 4NX1A 3TTMA 2HZKA 2BJJX 4KQPA 4MEVA 2Q2AA 5B7DA 2DP8A 4PFYA 3FASA 3LUZA 1KZ8A 4OANA 3FIRA 3SEUA 5ISUA 3FXUA 4H0WA 4P0GA 4PETA 1OVTA 4R2BA 4XKRA 3SZPA 1FPLA 1OLAA 4R74A 4JSDA 4QBAA 3CG3A 5L9MA 4Z0IA 2BJIA 3TTKA 3VFJA 4BDLA 2HEUA 3O6IA 1QJMA 2XXHA 1FTOA 4NF8A 4F22A 5I56A 3LSXA 1A8FA 5A5LA 3T9XB 2R8TA 4PGNA 2HAVA 2PT1A 2AYSA 1EYIA 4I3EA 2REGA 4YMBA 2Z23A 3PUVE 3OO9A 5EQAA 3RN8A 1IUDA 3AXFA 4NF5B 1A8EA 2G29A 2I6EA 3C9HA 3MP8A 3T93B 4ZEBA 2R71A 4KYEA 2UYFA 1PB7A 1IMBA 2YPNA 3ISPA 4YKIA 3TCGA 1NUXA 4NF6A 3IX1A 3O9PA 4GX4A 3RQTA 4GRKA 4DDDA 4IO2A 5FTHA 3D4CA 4TOZA 4ZZAA 4PAKA 1JVXA 2ABHA 2Q74A 1B5IA 1B3EA 3IORA 5DTBA 1B46A 4MNCA 4ELQA 5I2KA 1IMEA 1FBEA 4GVOA 2HXWA 2OWZA 2V3QA 4KPTA 4BDMA 3G7WA 4QFKA 1XC1A 1LAHE 3HHGA 2NVUB 4MFIA 3FV1A 1GV8A 1FBHA 3HV1A 4ZZEA 1Q9DA 1YTVA 2XXIA 4H45A 4DCYA 3ILUB 4OVSA 3ECRA 1USYH 2QVVA 4OHNA 3SERA 2P1SA 4NF8B 1QKBA 4GIZA 2CZHA 3EKIA 3RUMA 3BIHA 4DXBA 2RCAA 5ELVA 4LATA 3QXMA 3HN0A 5FHNA 1FBGA 3IO4A 5LOMA 3EF7A 4OENA 4R9GA 2X7QA 2V3TA 4ZS9A 2F8DA 2F7BA 4PE5B 3Q29A 4RK2A 4IY6A 4GX3A 1A7LA 2B4MA 4DIGA 4MX6A 2WEFA 2I0BA 4YAHX 4Q5TA 5CI5A 2NUVA 3QUFA 5EQ7A 4F3PA 3PUXE 4ELRA 3T0JA 4OXVA 2DWJA 4NF6B 1QULA 4HCWA 1FQFA 4LA9A 4OVJA 1FJ9A 3C34A 3KBRA 1UTBA 3U65A 2XWKA 2A5SA 5ESYA 2WYPA 2VOZA 5ITPA 4YB5A 3N26A 4Q30B 1IXHA 1B0HA 2XA5A 2E1SA 4PF6A 2V93A 2H98A 5I2KB 4ZEIA 4IO5A 3G3KA 4KHZE 2VGQA 2F7CA 3LSLA 2KR0A 1NV0A 4DI4B 3QSLA 2QMWA 3TFLA 1IMFA 3H6TA 3FJGA 4BDNA 2O51A 5FHOA 4YICA 2I48A 1MY3A 1CE2A 4P56A 3OMBA 3K2DA 3QIMA 2GFEA 3CSBA 2D5WA 2O69A 3BIGA 1B1HA 1MQHA 1M5DA 1IIWA 3H6VA 4ND9A 4PDHA 4OZ9A 2QMXA 1P1QA 4H1XA 4EF1A 2HFBA 1NH7A 3FGSA 3CFXA 4HE1A 5H8NA 5I3SA 1JW4A 1PB8A 2I49A 2B65A 3TEPA 4ZEKA 3V8XB 2YLNA 5CBSA 3IOWA 1NUYA 4YMAA 1B5HA 4R73A 1SBPA 4H67A 3H03A 2VPOA 1UTBB 4ZDMA 4HS7A 2DS9A 3IB1A 3JYRA 3KC1A 2Q2CA 4MH5A 3E13X 1AMFA 3GLBA 2GH9A 1QUKA 1NV2A 4QXDA 4NMYA 3IB0A 1XOCA 3VVEA 4YKKA 1NUWA 4WXJA 4G77A 1MH4A 4JB7A 4YU0A 1QW0A 5TP9A 3G3HA 1A99A 3E78A 4ZEDA 4LZ5A 5I84A 2Q88A 3VLVA 2O7IA 4JXIA 4G8NA 3OO8A 1FBCA 1KA0A 3ODBA 1MY1A 4X48A 2Y7RA 4EQ9A 3O6HA 2XXRA 1SPIA 3U93A 3LC8A 1DK4A 4BDRA 2QJEA 2F6GA 5IZZA 4RPOA 5H8NB 5DVJA 2E0SA 1URSA 2P3VA 4I3YA 4IY5A 1OMPA 1IMAA 3TQWA 1P1NA 2I4BA 3PTYA 1MQGA 3I3VA 4X1BA 4WKMA 1UIUA 4GBVA 1OLCA 1EH3A 1M5FA 2DWHA 2Q89A 1MPCA 2P2AA 1J1NA 4OVPA 1Y4TA 3U8QA 3IK6B 3M8UA 5KCJA 1UQWA 4EQ7A 3T66A 2QSXA 2PMSA 1FSAA 3LSWA 2CMOA 4GF8A 1ZKBA 4GWZA 3Q28A 3T96B 4N07A 2H9BA 5IZ3A 4G2ZA 3TODA 3S2VA 4LP2B 2OCUA 1LLSA 3E4RA 4POWA 4PC9A 2I3WA 4E0XA 1GTKA 1WVJA 4H8JA 3RNNA 5TP9B 1CB6A 1ZMGA 4N17A 5EYFA 1L5TA 1YZ0A 1II5A 1LCTA 1MDQA 1NV3A 4FAJA 3UORA 1OQHA 4GL0A 4U4SA 2Y84A 5CC2A 5K2XA 4GLIA 4JWXA 3T9UA 3KOTA 1B3LA 2KQZA 3PPNA 3TCHA 4MLVA 5TPAA 2X26A 2WYKA 5IAIA 1ZTYA 3HHFA 3TAJA 2NWJA 5J1DA 1OVBA 4NE4A 3CR9A 3ROJA 1SW5A 3SDFA 1P1UA 2DE2A 1VR5A 3LBSA 1Y20A 4IO3A 3OENA 3SEXA 3ZS6A 4OFOA 5JTYA 4AB5A 3C32A 3OD7A 2FBPA 2DOJA 1A54A 5IZ3B 1YAEA 3WAFA 3OELA 1NNFA 3B6WA 5I58A 1PC3A 1JQFA 4OFJA 3FJMA 2PCRA 2HAUA 1I6QA 4NQ8A 4IB2A 1MXYA 1NKXA 4DXCA 4NF5A 1S9TA 3GXAA 4OMBA 2XD2A 3SEVA 2B3BA 1JEUA 2QPQA 2XXKA 3FVGA 1VDWA 5DYHA 1D4NA 1LB9A 3PU5A 2F35A 5KZTA 2DVCA 2XX8A 1QUIA 2RF1A 3CG1A 4AB6A 3N5LA 2DWIA 4P3LA 3IFCA 4U22A 3V89B 4MMPA 4F3BA 4I8CA 3A3UA 2ONSA 3S9MC 1FQBA 5TPAB 4U1OA 3E9XA 2DE4A 2Z22A 3FD3A 2FVZA 2OWTA 5DVFA 4TLLB 3UGWA 1JVYA 5DEXB 2L5VA 1FJ6A 1K9YA 2B3FA 1RYOA 3DP8A 4ZE8A 2F6PA 1Y3QA 3SETA 2KLFA 3CI8A 3UK4A 1LAXA 3PUZE 4XKNA 1Y4CA 2HPGA 3K02A 5JTYB 5FHMA 5EHMA 3KFMA 2XXYA 1MQDA 1LCFA 3VLUA 3MP1A 3L6HA 4IO6A 4O3CA 1FQCA 3IB2A 3B7DA 2O84X 3JV9A 4YZZA 4KD5A 3IAZA 2XX7A 3IJXB 4OETA 4XIGQ 5I58B 4PAFA 1DMBA 2AIXA 2JJKA 5KDTB 1B0LA 3K00A 2I58A 2RC8A 1H3DA 1LB8A 3T9HB 1MXWA 2QRYA 2R6GE 3BFTA 2GRVA 3V83A 2DYXA 4ZEFA 3K6VA 5TU0A 3IR1A 1XVYA 3L6GA 3TQLA 3IO6A 3HCQA 4PFUA 3TTLA 4LZ7A 1B9JA 3IJOB 4G8HA 4NF0A 3MPKA 3PMXA 1UTHA 5ITOA 3E3KA 1SW2A 2RC7A 5F7VA 2FHYA 2Q8JA 2PYYA 3FXBA 2ONKE 1B58A 1XVXA 4O7MA 1BP5A 5T3JA 2AL4A 5AA1A 1QVSA 1I6BA 2ANJA 4KCDA 2V84A 1YYZA 2V25A 3EHSA 1VFEA 4QSDA 4PFWA 1BTJA 1NH8A 1SYIA 2ESNA 2QS3A 3RTFB 5B70A 3I6VA 1FTMA 3QYTA 4HXVA 2WX9A 3PMWA 2FIXA 4RPNA 4H65A 4O3AA 3O2AA 2D21A 4X9TA 2Y7WA 4G68C 3FXRA 4G4PA 3SEWA 1NV6A 4IGTA 5H8HA 1SD3A 5M2VA 1FW0A 2F34A 4JBZA 4L17A 4FEDA 3I5OA 5L9OA 3DM0A 1IXGA 4H5GA 5JEIA 1N3WA 4PF8A 3RYDA 3H6WA 4R6YA 4FBPA 4I1DA 4R2FA 2VD2A 4XKQA 1LBWA 3H7MA 3IOVA 2W7YA 1LAFE 2I0CA 4G8MA 4BDOA 2RKMA 4U1ZA 3HFUA 3T22A 4NWDA 3KOSA 4ECFA 1G0HA 1H76A 1FPDA 3MSTA 1UTHB 4OFLA 4HE0A 2H99A 3FJ7A 3FV2A 2VHAA 4N6KA 4OVTA 3MWBA 5A5XB 3TTRA 2F5XA 1B51A 1QKAA 4ELPA 2QS2A 1SW1A 2NOOA 1SI0A 1I69A 4MJOA 2Y5KA 4FJPA 1EYJA 2ZYKA 3MC2A 2WBDA 3D1RA 4ONYA 5K2YA 2F3BA 1TXFA 2F3DA 1MXZA 4EQBA 3V5AA 1B52A 1NFTA 5H8FB 1OIBA 1QUJA 1FQEA 1MH3A 2WBBA 2XWVA 3IOUA 3OEMA 2OWSA 3MZ1A 2LAOA 3N6TA 3VV5A 4MNPA 1S50A 4EF2A 4R9FA 1ZLQA 2V4CA 1EZ9A 1TT1A 4PP0A 5H8HB 2Y7KA 3FZVA 4PE3A 3IL1B 4GL8A 4YB7A 3MAMA 3TCFA 4GBWA 3PUYE 2GHBA 5I57A 1VFDA 1B7UA 2RC9A 3EHUA 3R6UA 2RINA 4DCXA 1ZJLA 3H3GA 3P7IA 4P9KA 3FBPA 4OWDA 3B8BA 4OESA 4XFEA 2ZYNA 3DP6A 3MPLA 3S9NC 2THIA 1N7XA 5AA4B 3A3CA 4WEPA 4R75A 4UACA 4N6PA 3RLFE 1MQJA 3O6GA 4NGUA 5EYHA 4LZ8A 1JW1A 4F1VA 2OBGA 1TFAA 5H8QA 1US4A 4XEQA 3KSXA 3WAEA 1FPEA 4N4UA 4PFTA 1JEVA 4QFOA 5ET7A 4RXLA 2XXWA 2ZZXA 4ESWA 4N15A 3KN8A 3TYHA 1N76A 4WEDA 1DTZA 2CZKA 4PCDA 5CRYA 4QHQA 2O6AA 2O68A 2HZLA 1N04A 2CZLA 2XXPA 1FPKA 4JDFA 2MKZA 4H6DA 1A40A 1F9BA 1AWBA 1LBZA 3C31A 3FATA 4F31B 1IEJA 1ZIUA 5HM4B 1LFHA 3BFUA 2HQ0A 1NV5A 2FNCA 1O64A 2OLBA 2DDKA 4OYVA 3ZKKA 5AA3A 1MXUA 4BLAA 1GGGA 3C35A 4FATA 1B4HA 1FTAA 5DVIA 1R6ZA 1LBCA 3RPWA 3M3LA 2D3IA 4Z7EA 3CFZA 5I57B 1PEBA 3MZ9A 3A09A 2QS1A 4MHFA 3PUWE 4N8YA 4KI0E 3PPPA 2UVJA 2IEEA 1H44A 3G3IA 3H6UA 3TZAA 5EQ9A 2Z8FA 3FVNA 2ZZWA 1EU8A 4NN3A 2H5YA 1MG1A 4KYSA 3N6UA 4JSOA 3KJTA 4DE8A 1WODA 3KG2A 4OVRA 5H8QB 4MLQA 3CSGA 3TUSA 4OEVA 4AQ4A 3LR1A 5H8SA 4PFRA 4F1UA 4F2QA 4HCYA 1TWYA 2DXYA 2F7AA 3UA8A 1HSLA 5IGAA 1N84A 4IR8A 3K01A 1FBFA 4RYAA 2UVIA 2X7PA 2PFZA 3Q26A 1UIVA 3SESA 1OQGA 4P8BA 4GXSB 1PDAA 4EUOA 3VDFA 3T1BA 5L9SA 4TLMB 4JVCA 1AIVA 3R26A 4RA1A 3B50A 2QFLA 1Y9UA 4IO4A 4BDQA 1DOTA 4GOTA 5ICQA 5DEXA 4C0RA 1FPJA 1M5BA 4MF3A 3N94A 3PGFA 1D9VA 3OSQA 4MNIA 4KXPA 1ELJA 1FRPA 3O28A 4G68A 1RKMA 2AL5A 1R9QA 5CM6A 4LQ5A 1RDYA 2ZXTA 3MYUA 2F97A 1YCJA 2ALUA 2REJA 4R6KA 3K6XA 1I6AA 3MVZA 3HPIA 3D4GA 4U4XA 1HSEA 1MDP1 2VPNA 4THIA 5KDTA 1GR2A 3JZJA 1DCUA 2DE3A 1NNKA 4RK9A 3MUQA 3OOAA 3U1OA 3ILTB 4GWYA 4PFIA 1P1WA 5CMMA 3RT6B 1P99A 2Z8DA 1B32A 2CEYA 2H4IA 1IMDA 2P0SA 2UYEA 4P11A 4GFRA 4LN5A 4N81A 4QFPA 4YKPA 4HTGA 1S7YA 4QSCA 4QFNA 2XXVA 3RT8A 4QRZA 2NXOA 1Z7ME 4OERA 4P0IA 3SEYA 3EN3A 4OEUA 1ATGA 4OVQA 3VLWA 3C36A 5JK4A 2O1MA 3FUZA 3QMFA 5CMCA 1M5EA 4XKPA 3PD9A 5F24A 2PX1A 5I2NA
chains in the Genus database with same CATH topology
1EZPA 4RNSA 1LFIA 3PD8A 3DP4A 1SQYA 2F78A 1WDNA 4G68B 1VE4A 1MQIA 1H45A 3Q25A 4H8IA 4DZ1A 1A55A 4GWOA 3DLNA 1LFGA 4KR5A 1FTLA 4GQOA 4FE8A 2V3UA 1O63A 3O29A 2UVGA 5L8DA 3O66A 1JNFA 2H25A 5CMBA 4TQUQ 1T0KA 3S9EA 3PPRA 3CRBA 4X1DA 3EQ1A 4YKJA 4F1YA 2XXUA 3T9VA 4RY1A 3TDJA 1LSTA 1DPEA 1MM6A 4NF4A 5CMKA 4IGRA 1BIYA 1PBQA 1URGA 3F11A 2Y7PA 1SW4A 1D9YA 2PBWA 3EPEA 1URDA 3UIFA 5BUUA 5CBRA 1MPDA 4F39A 3KN3A 2UVHA 4KFQA 4NEDA 5A5XA 3G3FA 2OK2A 2OJTA 1B05A 4HW8A 5AA2D 1BLFA 4U21A 1SDXA 5I2NB 1XHYA 3G3JA 1M5CA 4OTEA 1PBPA 4ZECA 3KEIA 3TMGA 1EZOA 1FTJA 5DT6A 3B6TA 1XT8A 3FVOA 3MQ9A 4I62A 2XXTA 1B6HA 5H8FA 1AOVA 2ZYOA 1MS7A 2Z8EA 5HBCA 1FQAA 1DTGA 1SVXB 1TFDA 3R7XA 4M1VA 1RYXA 2Y7IA 1R1NA 4F3SA 1LAGE 4F18A 4LONB 5I56B 1B40A 1B4ZA 3PPOA 1MY2A 4MBPA 3VXBA 4KYDA 1MXXA 4I9DA 3BKIB 4NF4B 1IITA 3GZGA 2UXAA 2XD3A 4U23A 3MVXA 2I3VA 4F2OA 3KZGA 2R9JA 1YPNA 5AA4A 1MPBA 2Q9TA 3K1MA 2RCBA 2M8CA 3OO6A 2A5TA 4DLDA 3CFLA 2IA4A 1Q1KA 1FCKA 2XHDA 1LBBA 1R9LA 3U92A 3PV0E 4PQJA 4QF9A 3TELA 2PVUA 3ONMA 4ESXA 3SKPA 5BWJA 3H4ZA 5FTIA 1JETA 1LGBC 3RY3A 1O7TA 3C33A 5ICTA 1PB9A 1NNPA 3MJNA 3PMVA 3MP6A 1MXVA 3ZSFA 3QK6A 4F3GA 1DSNA 3K6WA 1BKAA 4EDPA 3DELB 1US5A 1POTA 4U2RA 1NL5A 3BBRA 3U94A 2ZNUA 1VSOA 1H43A 3LUYA 3HSTA 3H06B 3Q27A 4K3FA 2QS4A 2F36A 1AL3A 2A5TB 3PPQA 5IKBA 3VVDA 4QFLA 4UA8A 4IO7A 4XTCQ 2DXRA 1DPPA 3K6UA 3QAXA 3OEKA 1Y1ZA 2ZMBA 3CVGA 3M3KA 2VD3A 3K0VA 3KGCA 3VE1B 4F29A 5AA2A 3KN7A 3MZBA 4DXUA 3HO7A 1B3GA 3K4UA 2XXQA 2QL3A 2DVZA 4FORA 1Z7NE 1JW5A 4NTLA 1NNTA 4XXUA 3W15C 3TKDA 4H5FA 4NWCA 1SI1A 1Q35A 2XX9A 1POY1 3S9LC 2DWAA 3S4UA 1IXCA 3G3GA 4JWYA 3THIA 1IQ7A 2XXXA 1KWHA 4C1UA 4POXA 4N13A 3OO7A 3UP9A 4R6HA 2OZZA 1MRPA 4QSEA 3GBAA 1HSJA 4RJZA 4KCCA 3KJ7A 2I4CA 2WKYA 1Y3NA 4FECA 2ZNTA 3CIJA 3VVFA 1SYHA 1N0TA 4EXLA 4FIMA 1GVCA 3RGYA 1IXIA 1XS5A 4M4GA 3USDA 2GHAA 2ONRA 1MY0A 2HCAA 4ZE9A 2O7UA 3K1PA 5AA2B 1N3XA 2YJPA 1MY4A 3MVWA 3VXCA 1NMUA 1B5JA 4FEBA 1B3FA 3QUJA 3TTNA 5I59A 2ZYMA 3KSJA 1FTKA 4OQOA 4C1TA 3O97A 4LVQA 3TPAA 4GXAA 1USYE 3OSRA 1B7HA 1B1XA 4Q8RA 5EHSA 1ZU0A 1FQDA 4LQ2A 4ELOA 1N7WA 5F1QA 4Q0CA 3OXNA 2DSFA 3LSFB 4YB6A 1IZ1A 1D3KA 2PT2A 3K1NA 1ANFA 5AE4A 3W9WA 3GBBA 1AH5A 3M3FA 3MBPA 3FXQA 3B6QA 3IOTA 5KCJB 1ZBMA 4JWOA 3EHTA 5HPQA 4LUBA 4R72A 4EXKA 2O1LA 1P1OA 3FVKA 2FA7A 4O3BA 3ZKLA 2FYIA 4GD5A 1B7ZA 4ISUA 1B2HA 3RTWB 4F19A 1B3HA 3MW0A 5I59B 1Y1MA 2ZNSA 3UN6A 3C4MA 2VP1A 4E0WA 3MVYA 2G93A 3U72A 2DQVA 3W9VA 1MM7A 1Y3PA 3TTMA 2HZKA 2BJJX 4KQPA 2Q2AA 5B7DA 2DP8A 4PFYA 3FASA 3FIRA 3SEUA 5ISUA 3FXUA 4H0WA 4P0GA 4PETA 1OVTA 4R2BA 4XKRA 1OLAA 4R74A 4JSDA 3CG3A 5L9MA 4Z0IA 3TTKA 3VFJA 4BDLA 2HEUA 3O6IA 1QJMA 2XXHA 1FTOA 4NF8A 4F22A 5I56A 3LSXA 1A8FA 3T9XB 2HAVA 2PT1A 2AYSA 2REGA 4YMBA 2Z23A 3PUVE 3OO9A 3RN8A 1IUDA 3AXFA 4NF5B 1A8EA 2G29A 2I6EA 3C9HA 3MP8A 3T93B 4ZEBA 2R71A 4KYEA 2UYFA 1PB7A 2YPNA 4YKIA 3TCGA 4NF6A 3IX1A 3O9PA 3RQTA 4GRKA 4DDDA 4IO2A 5FTHA 3D4CA 4TOZA 4ZZAA 1JVXA 2ABHA 1B5IA 1B3EA 3IORA 5DTBA 1B46A 4ELQA 5I2KA 4GVOA 2HXWA 2V3QA 4KPTA 4BDMA 3G7WA 4QFKA 1XC1A 1LAHE 3HHGA 2NVUB 4MFIA 1GV8A 3FV1A 3HV1A 4ZZEA 1YTVA 2XXIA 4DCYA 3ILUB 3ECRA 1USYH 4OHNA 3SERA 2P1SA 4NF8B 1QKBA 4GIZA 3RUMA 4DXBA 2RCAA 5ELVA 4LATA 3QXMA 3HN0A 5FHNA 3IO4A 5LOMA 3EF7A 4OENA 4R9GA 2X7QA 2V3TA 4ZS9A 2F8DA 2F7BA 4PE5B 3Q29A 4RK2A 4IY6A 1A7LA 4DIGA 2I0BA 4YAHX 4Q5TA 5CI5A 2NUVA 3QUFA 4F3PA 3PUXE 4ELRA 4OXVA 2DWJA 4NF6B 1QULA 4HCWA 1FQFA 4LA9A 4OVJA 3KBRA 3C34A 1UTBA 2A5SA 2VOZA 5ITPA 4YB5A 3N26A 4Q30B 1IXHA 1B0HA 2E1SA 2V93A 2H98A 5I2KB 4ZEIA 4IO5A 3G3KA 4KHZE 2VGQA 2F7CA 3LSLA 3QSLA 2QMWA 3TFLA 3H6TA 3FJGA 4BDNA 2O51A 5FHOA 4YICA 2I48A 1MY3A 1CE2A 3OMBA 3K2DA 3QIMA 2GFEA 3CSBA 2D5WA 2O69A 1B1HA 1MQHA 1M5DA 1IIWA 3H6VA 4ND9A 4OZ9A 2QMXA 1P1QA 4H1XA 4EF1A 2HFBA 1NH7A 3FGSA 3CFXA 5H8NA 1JW4A 1PB8A 2I49A 2B65A 3TEPA 4ZEKA 3V8XB 2YLNA 5CBSA 3IOWA 4YMAA 1B5HA 4R73A 1SBPA 4H67A 3H03A 1UTBB 4ZDMA 4HS7A 2DS9A 3IB1A 3JYRA 2Q2CA 4MH5A 3E13X 1AMFA 3GLBA 2GH9A 1QUKA 4NMYA 3IB0A 1XOCA 3VVEA 4YKKA 4WXJA 4G77A 1MH4A 4JB7A 4YU0A 1QW0A 5TP9A 3G3HA 1A99A 4ZEDA 4LZ5A 5I84A 2Q88A 3VLVA 2O7IA 4JXIA 4G8NA 3OO8A 3ODBA 1MY1A 4X48A 2Y7RA 4EQ9A 3O6HA 2XXRA 3U93A 3LC8A 4BDRA 2QJEA 2F6GA 4RPOA 5H8NB 5DVJA 2E0SA 1URSA 4IY5A 1OMPA 3TQWA 1P1NA 2I4BA 1MQGA 3I3VA 4X1BA 4WKMA 1UIUA 1OLCA 1EH3A 1M5FA 2DWHA 2Q89A 1MPCA 2P2AA 1J1NA 1Y4TA 3U8QA 3IK6B 3M8UA 5KCJA 1UQWA 4EQ7A 3T66A 2QSXA 2PMSA 3LSWA 2CMOA 4GF8A 1ZKBA 3T96B 3Q28A 4N07A 2H9BA 4G2ZA 3TODA 3S2VA 4LP2B 2OCUA 1LLSA 3E4RA 4POWA 2I3WA 4E0XA 1GTKA 1WVJA 4H8JA 3RNNA 5TP9B 1CB6A 1ZMGA 5EYFA 1L5TA 1II5A 1LCTA 1MDQA 4FAJA 3UORA 1OQHA 4GL0A 4U4SA 2Y84A 5CC2A 5K2XA 4GLIA 4JWXA 3T9UA 3KOTA 1B3LA 3PPNA 3TCHA 4MLVA 5TPAA 2X26A 5IAIA 1ZTYA 3HHFA 3TAJA 2NWJA 5J1DA 1OVBA 4NE4A 3CR9A 1SW5A 3SDFA 1P1UA 2DE2A 1VR5A 3LBSA 1Y20A 4IO3A 3OENA 3SEXA 3ZS6A 4OFOA 5JTYA 4AB5A 3C32A 3OD7A 2DOJA 1A54A 1YAEA 3WAFA 3OELA 1NNFA 3B6WA 5I58A 1PC3A 1JQFA 4OFJA 3FJMA 2HAUA 1I6QA 4IB2A 1MXYA 1NKXA 4DXCA 4NF5A 1S9TA 3GXAA 4OMBA 2XD2A 3SEVA 2B3BA 1JEUA 2QPQA 3FVGA 5DYHA 1D4NA 1LB9A 3PU5A 2F35A 5KZTA 2DVCA 2XX8A 1QUIA 2RF1A 3CG1A 4AB6A 3N5LA 2DWIA 4U22A 3V89B 4F3BA 4I8CA 3A3UA 2ONSA 3S9MC 1FQBA 5TPAB 4U1OA 3E9XA 2DE4A 2Z22A 3FD3A 2OWTA 5DVFA 4TLLB 3UGWA 1JVYA 5DEXB 2B3FA 1RYOA 3DP8A 4ZE8A 2F6PA 1Y3QA 3SETA 2KLFA 3CI8A 3UK4A 1LAXA 3PUZE 4XKNA 1Y4CA 3K02A 5JTYB 5FHMA 5EHMA 3KFMA 2XXYA 1MQDA 3VLUA 1LCFA 3MP1A 3L6HA 4IO6A 4O3CA 1FQCA 3IB2A 3B7DA 2O84X 3JV9A 4YZZA 4KD5A 3IAZA 2XX7A 3IJXB 4OETA 4XIGQ 5I58B 1DMBA 2AIXA 5KDTB 1B0LA 3K00A 2I58A 2RC8A 1H3DA 1LB8A 3T9HB 1MXWA 2QRYA 2R6GE 3BFTA 2GRVA 3V83A 2DYXA 4ZEFA 3K6VA 5TU0A 3IR1A 1XVYA 3L6GA 3TQLA 3IO6A 3HCQA 4PFUA 3TTLA 4LZ7A 1B9JA 3IJOB 4G8HA 3MPKA 3PMXA 1UTHA 5ITOA 3E3KA 1SW2A 2RC7A 5F7VA 2Q8JA 2PYYA 2ONKE 1B58A 1XVXA 1BP5A 2AL4A 5AA1A 1QVSA 1I6BA 2ANJA 4KCDA 2V84A 2V25A 3EHSA 1VFEA 4QSDA 4PFWA 1BTJA 1NH8A 1SYIA 2ESNA 2QS3A 3RTFB 5B70A 3I6VA 1FTMA 3QYTA 3PMWA 4RPNA 4H65A 4O3AA 3O2AA 2D21A 4X9TA 2Y7WA 4G68C 3FXRA 4G4PA 3SEWA 4IGTA 5H8HA 1SD3A 5M2VA 1FW0A 2F34A 4JBZA 4L17A 4FEDA 3I5OA 5L9OA 3DM0A 1IXGA 4H5GA 5JEIA 1N3WA 3H6WA 4R6YA 4I1DA 4R2FA 2VD2A 4XKQA 3H7MA 3IOVA 2W7YA 1LAFE 2I0CA 4G8MA 4BDOA 2RKMA 4U1ZA 3T22A 4NWDA 3KOSA 4ECFA 1H76A 1UTHB 4OFLA 2H99A 3FJ7A 3FV2A 2VHAA 5A5XB 3MWBA 3TTRA 2F5XA 1B51A 1QKAA 4ELPA 2QS2A 1SW1A 2NOOA 1SI0A 1I69A 4FJPA 2ZYKA 3MC2A 4ONYA 5K2YA 1TXFA 1MXZA 4EQBA 3V5AA 1B52A 1NFTA 5H8FB 1OIBA 1QUJA 1FQEA 1MH3A 3IOUA 3OEMA 2OWSA 3MZ1A 2LAOA 3N6TA 3VV5A 1S50A 4EF2A 4R9FA 1ZLQA 1EZ9A 1TT1A 4PP0A 5H8HB 2Y7KA 3FZVA 4YB7A 3IL1B 4GL8A 3MAMA 3TCFA 3PUYE 2GHBA 5I57A 1VFDA 1B7UA 2RC9A 3EHUA 3R6UA 2RINA 4DCXA 1ZJLA 3H3GA 3P7IA 4OWDA 4OESA 2ZYNA 3DP6A 3MPLA 3S9NC 2THIA 1N7XA 5AA4B 3A3CA 4WEPA 4R75A 4UACA 4N6PA 3RLFE 1MQJA 3O6GA 4LZ8A 1JW1A 4F1VA 2OBGA 1TFAA 5H8QA 1US4A 3KSXA 3WAEA 4PFTA 1JEVA 4QFOA 4RXLA 2XXWA 4ESWA 3KN8A 3TYHA 1N76A 4WEDA 1DTZA 5CRYA 4QHQA 2O6AA 2O68A 2HZLA 1N04A 2CZLA 2XXPA 4JDFA 4H6DA 1A40A 1F9BA 3C31A 3FATA 4F31B 1IEJA 1ZIUA 5HM4B 1LFHA 3BFUA 2HQ0A 2FNCA 1O64A 2OLBA 4OYVA 3ZKKA 5AA3A 1MXUA 4BLAA 1GGGA 3C35A 4FATA 1B4HA 5DVIA 1R6ZA 1LBCA 3RPWA 3M3LA 2D3IA 4Z7EA 3CFZA 5I57B 1PEBA 3MZ9A 3A09A 2QS1A 3PUWE 4KI0E 3PPPA 2UVJA 2IEEA 1H44A 3G3IA 3H6UA 3TZAA 2Z8FA 3FVNA 1EU8A 2H5YA 1MG1A 4KYSA 3N6UA 4JSOA 3KJTA 4DE8A 1WODA 3KG2A 5H8QB 4MLQA 3CSGA 3TUSA 4OEVA 4AQ4A 3LR1A 5H8SA 4F1UA 4F2QA 4HCYA 1TWYA 2DXYA 2F7AA 3UA8A 1HSLA 1N84A 3K01A 4RYAA 2UVIA 2X7PA 3Q26A 1UIVA 3SESA 1OQGA 4GXSB 1PDAA 4EUOA 3VDFA 5L9SA 4TLMB 1AIVA 3R26A 4RA1A 1Y9UA 4IO4A 4BDQA 1DOTA 4GOTA 5ICQA 5DEXA 4C0RA 4MF3A 1M5BA 3N94A 3PGFA 1D9VA 3OSQA 1ELJA 3O28A 4G68A 1RKMA 2AL5A 1R9QA 5CM6A 4LQ5A 2ZXTA 2F97A 1YCJA 2ALUA 2REJA 4R6KA 3K6XA 1I6AA 3MVZA 3HPIA 3D4GA 4U4XA 1HSEA 1MDP1 4THIA 5KDTA 1GR2A 3JZJA 2DE3A 1NNKA 4RK9A 3MUQA 3OOAA 3U1OA 3ILTB 1P1WA 5CMMA 3RT6B 1P99A 2Z8DA 1B32A 2H4IA 2P0SA 2UYEA 4P11A 4GFRA 4QFPA 4YKPA 4HTGA 1S7YA 4QSCA 4QFNA 2XXVA 3RT8A 4QRZA 2NXOA 1Z7ME 4OERA 4P0IA 3SEYA 3EN3A 4OEUA 1ATGA 3VLWA 3C36A 5JK4A 2O1MA 3FUZA 5CMCA 1M5EA 4XKPA 3PD9A 2PX1A 5I2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZP A;  4RNS A;  1LFI A;  3PD8 A;  3DP4 A;  1SQY A;  2F78 A;  1WDN A;  4G68 B;  1VE4 A;  1MQI A;  1H45 A;  3Q25 A;  4H8I A;  4DZ1 A;  1A55 A;  4GWO A;  3DLN A;  1LFG A;  4KR5 A;  1FTL A;  4GQO A;  4FE8 A;  2V3U A;  1O63 A;  3O29 A;  2UVG A;  5L8D A;  3O66 A;  1JNF A;  2H25 A;  5CMB A;  4TQU Q;  1T0K A;  3S9E A;  3PPR A;  3CRB A;  4X1D A;  3EQ1 A;  4YKJ A;  4F1Y A;  2XXU A;  3T9V A;  4RY1 A;  3TDJ A;  1LST A;  1DPE A;  1MM6 A;  4NF4 A;  5CMK A;  4IGR A;  1BIY A;  1PBQ A;  1URG A;  3F11 A;  2Y7P A;  1SW4 A;  1D9Y A;  2PBW A;  3EPE A;  1URD A;  3UIF A;  5BUU A;  5CBR A;  1MPD A;  4F39 A;  3KN3 A;  2UVH A;  4KFQ A;  4NED A;  5A5X A;  3G3F A;  2OK2 A;  2OJT A;  1B05 A;  4HW8 A;  5AA2 D;  1BLF A;  4U21 A;  1SDX A;  5I2N B;  1XHY A;  3G3J A;  1M5C A;  4OTE A;  1PBP A;  4ZEC A;  3KEI A;  3TMG A;  1EZO A;  1FTJ A;  5DT6 A;  3B6T A;  1XT8 A;  3FVO A;  3MQ9 A;  4I62 A;  2XXT A;  1B6H A;  5H8F A;  1AOV A;  2ZYO A;  1MS7 A;  2Z8E A;  5HBC A;  1FQA A;  1DTG A;  1SVX B;  1TFD A;  3R7X A;  4M1V A;  1RYX A;  2Y7I A;  1R1N A;  4F3S A;  1LAG E;  4F18 A;  4LON B;  5I56 B;  1B40 A;  1B4Z A;  3PPO A;  1MY2 A;  4MBP A;  3VXB A;  4KYD A;  1MXX A;  4I9D A;  3BKI B;  4NF4 B;  1IIT A;  3GZG A;  2UXA A;  2XD3 A;  4U23 A;  3MVX A;  2I3V A;  4F2O A;  3KZG A;  2R9J A;  1YPN A;  5AA4 A;  1MPB A;  2Q9T A;  3K1M A;  2RCB A;  2M8C A;  3OO6 A;  2A5T A;  4DLD A;  3CFL A;  2IA4 A;  1Q1K A;  1FCK A;  2XHD A;  1LBB A;  1R9L A;  3U92 A;  3PV0 E;  4PQJ A;  4QF9 A;  3TEL A;  2PVU A;  3ONM A;  4ESX A;  3SKP A;  5BWJ A;  3H4Z A;  5FTI A;  1JET A;  1LGB C;  3RY3 A;  1O7T A;  3C33 A;  5ICT A;  1PB9 A;  1NNP A;  3MJN A;  3PMV A;  3MP6 A;  1MXV A;  3ZSF A;  3QK6 A;  4F3G A;  1DSN A;  3K6W A;  1BKA A;  4EDP A;  3DEL B;  1US5 A;  1POT A;  4U2R A;  1NL5 A;  3BBR A;  3U94 A;  2ZNU A;  1VSO A;  1H43 A;  3LUY A;  3HST A;  3H06 B;  3Q27 A;  4K3F A;  2QS4 A;  2F36 A;  1AL3 A;  2A5T B;  3PPQ A;  5IKB A;  3VVD A;  4QFL A;  4UA8 A;  4IO7 A;  4XTC Q;  2DXR A;  1DPP A;  3K6U A;  3QAX A;  3OEK A;  1Y1Z A;  2ZMB A;  3CVG A;  3M3K A;  2VD3 A;  3K0V A;  3KGC A;  3VE1 B;  4F29 A;  5AA2 A;  3KN7 A;  3MZB A;  4DXU A;  3HO7 A;  1B3G A;  3K4U A;  2XXQ A;  2QL3 A;  2DVZ A;  4FOR A;  1Z7N E;  1JW5 A;  4NTL A;  1NNT A;  4XXU A;  3W15 C;  3TKD A;  4H5F A;  4NWC A;  1SI1 A;  1Q35 A;  2XX9 A;  1POY 1;  3S9L C;  2DWA A;  3S4U A;  1IXC A;  3G3G A;  4JWY A;  3THI A;  1IQ7 A;  2XXX A;  1KWH A;  4C1U A;  4POX A;  4N13 A;  3OO7 A;  3UP9 A;  4R6H A;  2OZZ A;  1MRP A;  4QSE A;  3GBA A;  1HSJ A;  4RJZ A;  4KCC A;  3KJ7 A;  2I4C A;  2WKY A;  1Y3N A;  4FEC A;  2ZNT A;  3CIJ A;  3VVF A;  1SYH A;  1N0T A;  4EXL A;  4FIM A;  1GVC A;  3RGY A;  1IXI A;  1XS5 A;  4M4G A;  3USD A;  2GHA A;  2ONR A;  1MY0 A;  2HCA A;  4ZE9 A;  2O7U A;  3K1P A;  5AA2 B;  1N3X A;  2YJP A;  1MY4 A;  3MVW A;  3VXC A;  1NMU A;  1B5J A;  4FEB A;  1B3F A;  3QUJ A;  3TTN A;  5I59 A;  2ZYM A;  3KSJ A;  1FTK A;  4OQO A;  4C1T A;  3O97 A;  4LVQ A;  3TPA A;  4GXA A;  1USY E;  3OSR A;  1B7H A;  1B1X A;  4Q8R A;  5EHS A;  1ZU0 A;  1FQD A;  4LQ2 A;  4ELO A;  1N7W A;  5F1Q A;  4Q0C A;  3OXN A;  2DSF A;  3LSF B;  4YB6 A;  1IZ1 A;  1D3K A;  2PT2 A;  3K1N A;  1ANF A;  5AE4 A;  3W9W A;  3GBB A;  1AH5 A;  3M3F A;  3MBP A;  3FXQ A;  3B6Q A;  3IOT A;  5KCJ B;  1ZBM A;  4JWO A;  3EHT A;  5HPQ A;  4LUB A;  4R72 A;  4EXK A;  2O1L A;  1P1O A;  3FVK A;  2FA7 A;  4O3B A;  3ZKL A;  2FYI A;  4GD5 A;  1B7Z A;  4ISU A;  1B2H A;  3RTW B;  4F19 A;  1B3H A;  3MW0 A;  5I59 B;  1Y1M A;  2ZNS A;  3UN6 A;  3C4M A;  2VP1 A;  4E0W A;  3MVY A;  2G93 A;  3U72 A;  2DQV A;  3W9V A;  1MM7 A;  1Y3P A;  3TTM A;  2HZK A;  2BJJ X;  4KQP A;  2Q2A A;  5B7D A;  2DP8 A;  4PFY A;  3FAS A;  3FIR A;  3SEU A;  5ISU A;  3FXU A;  4H0W A;  4P0G A;  4PET A;  1OVT A;  4R2B A;  4XKR A;  1OLA A;  4R74 A;  4JSD A;  3CG3 A;  5L9M A;  4Z0I A;  3TTK A;  3VFJ A;  4BDL A;  2HEU A;  3O6I A;  1QJM A;  2XXH A;  1FTO A;  4NF8 A;  4F22 A;  5I56 A;  3LSX A;  1A8F A;  3T9X B;  2HAV A;  2PT1 A;  2AYS A;  2REG A;  4YMB A;  2Z23 A;  3PUV E;  3OO9 A;  3RN8 A;  1IUD A;  3AXF A;  4NF5 B;  1A8E A;  2G29 A;  2I6E A;  3C9H A;  3MP8 A;  3T93 B;  4ZEB A;  2R71 A;  4KYE A;  2UYF A;  1PB7 A;  2YPN A;  4YKI A;  3TCG A;  4NF6 A;  3IX1 A;  3O9P A;  3RQT A;  4GRK A;  4DDD A;  4IO2 A;  5FTH A;  3D4C A;  4TOZ A;  4ZZA A;  1JVX A;  2ABH A;  1B5I A;  1B3E A;  3IOR A;  5DTB A;  1B46 A;  4ELQ A;  5I2K A;  4GVO A;  2HXW A;  2V3Q A;  4KPT A;  4BDM A;  3G7W A;  4QFK A;  1XC1 A;  1LAH E;  3HHG A;  2NVU B;  4MFI A;  1GV8 A;  3FV1 A;  3HV1 A;  4ZZE A;  1YTV A;  2XXI A;  4DCY A;  3ILU B;  3ECR A;  1USY H;  4OHN A;  3SER A;  2P1S A;  4NF8 B;  1QKB A;  4GIZ A;  3RUM A;  4DXB A;  2RCA A;  5ELV A;  4LAT A;  3QXM A;  3HN0 A;  5FHN A;  3IO4 A;  5LOM A;  3EF7 A;  4OEN A;  4R9G A;  2X7Q A;  2V3T A;  4ZS9 A;  2F8D A;  2F7B A;  4PE5 B;  3Q29 A;  4RK2 A;  4IY6 A;  1A7L A;  4DIG A;  2I0B A;  4YAH X;  4Q5T A;  5CI5 A;  2NUV A;  3QUF A;  4F3P A;  3PUX E;  4ELR A;  4OXV A;  2DWJ A;  4NF6 B;  1QUL A;  4HCW A;  1FQF A;  4LA9 A;  4OVJ A;  3KBR A;  3C34 A;  1UTB A;  2A5S A;  2VOZ A;  5ITP A;  4YB5 A;  3N26 A;  4Q30 B;  1IXH A;  1B0H A;  2E1S A;  2V93 A;  2H98 A;  5I2K B;  4ZEI A;  4IO5 A;  3G3K A;  4KHZ E;  2VGQ A;  2F7C A;  3LSL A;  3QSL A;  2QMW A;  3TFL A;  3H6T A;  3FJG A;  4BDN A;  2O51 A;  5FHO A;  4YIC A;  2I48 A;  1MY3 A;  1CE2 A;  3OMB A;  3K2D A;  3QIM A;  2GFE A;  3CSB A;  2D5W A;  2O69 A;  1B1H A;  1MQH A;  1M5D A;  1IIW A;  3H6V A;  4ND9 A;  4OZ9 A;  2QMX A;  1P1Q A;  4H1X A;  4EF1 A;  2HFB A;  1NH7 A;  3FGS A;  3CFX A;  5H8N A;  1JW4 A;  1PB8 A;  2I49 A;  2B65 A;  3TEP A;  4ZEK A;  3V8X B;  2YLN A;  5CBS A;  3IOW A;  4YMA A;  1B5H A;  4R73 A;  1SBP A;  4H67 A;  3H03 A;  1UTB B;  4ZDM A;  4HS7 A;  2DS9 A;  3IB1 A;  3JYR A;  2Q2C A;  4MH5 A;  3E13 X;  1AMF A;  3GLB A;  2GH9 A;  1QUK A;  4NMY A;  3IB0 A;  1XOC A;  3VVE A;  4YKK A;  4WXJ A;  4G77 A;  1MH4 A;  4JB7 A;  4YU0 A;  1QW0 A;  5TP9 A;  3G3H A;  1A99 A;  4ZED A;  4LZ5 A;  5I84 A;  2Q88 A;  3VLV A;  2O7I A;  4JXI A;  4G8N A;  3OO8 A;  3ODB A;  1MY1 A;  4X48 A;  2Y7R A;  4EQ9 A;  3O6H A;  2XXR A;  3U93 A;  3LC8 A;  4BDR A;  2QJE A;  2F6G A;  4RPO A;  5H8N B;  5DVJ A;  2E0S A;  1URS A;  4IY5 A;  1OMP A;  3TQW A;  1P1N A;  2I4B A;  1MQG A;  3I3V A;  4X1B A;  4WKM A;  1UIU A;  1OLC A;  1EH3 A;  1M5F A;  2DWH A;  2Q89 A;  1MPC A;  2P2A A;  1J1N A;  1Y4T A;  3U8Q A;  3IK6 B;  3M8U A;  5KCJ A;  1UQW A;  4EQ7 A;  3T66 A;  2QSX A;  2PMS A;  3LSW A;  2CMO A;  4GF8 A;  1ZKB A;  3T96 B;  3Q28 A;  4N07 A;  2H9B A;  4G2Z A;  3TOD A;  3S2V A;  4LP2 B;  2OCU A;  1LLS A;  3E4R A;  4POW A;  2I3W A;  4E0X A;  1GTK A;  1WVJ A;  4H8J A;  3RNN A;  5TP9 B;  1CB6 A;  1ZMG A;  5EYF A;  1L5T A;  1II5 A;  1LCT A;  1MDQ A;  4FAJ A;  3UOR A;  1OQH A;  4GL0 A;  4U4S A;  2Y84 A;  5CC2 A;  5K2X A;  4GLI A;  4JWX A;  3T9U A;  3KOT A;  1B3L A;  3PPN A;  3TCH A;  4MLV A;  5TPA A;  2X26 A;  5IAI A;  1ZTY A;  3HHF A;  3TAJ A;  2NWJ A;  5J1D A;  1OVB A;  4NE4 A;  3CR9 A;  1SW5 A;  3SDF A;  1P1U A;  2DE2 A;  1VR5 A;  3LBS A;  1Y20 A;  4IO3 A;  3OEN A;  3SEX A;  3ZS6 A;  4OFO A;  5JTY A;  4AB5 A;  3C32 A;  3OD7 A;  2DOJ A;  1A54 A;  1YAE A;  3WAF A;  3OEL A;  1NNF A;  3B6W A;  5I58 A;  1PC3 A;  1JQF A;  4OFJ A;  3FJM A;  2HAU A;  1I6Q A;  4IB2 A;  1MXY A;  1NKX A;  4DXC A;  4NF5 A;  1S9T A;  3GXA A;  4OMB A;  2XD2 A;  3SEV A;  2B3B A;  1JEU A;  2QPQ A;  3FVG A;  5DYH A;  1D4N A;  1LB9 A;  3PU5 A;  2F35 A;  5KZT A;  2DVC A;  2XX8 A;  1QUI A;  2RF1 A;  3CG1 A;  4AB6 A;  3N5L A;  2DWI A;  4U22 A;  3V89 B;  4F3B A;  4I8C A;  3A3U A;  2ONS A;  3S9M C;  1FQB A;  5TPA B;  4U1O A;  3E9X A;  2DE4 A;  2Z22 A;  3FD3 A;  2OWT A;  5DVF A;  4TLL B;  3UGW A;  1JVY A;  5DEX B;  2B3F A;  1RYO A;  3DP8 A;  4ZE8 A;  2F6P A;  1Y3Q A;  3SET A;  2KLF A;  3CI8 A;  3UK4 A;  1LAX A;  3PUZ E;  4XKN A;  1Y4C A;  3K02 A;  5JTY B;  5FHM A;  5EHM A;  3KFM A;  2XXY A;  1MQD A;  3VLU A;  1LCF A;  3MP1 A;  3L6H A;  4IO6 A;  4O3C A;  1FQC A;  3IB2 A;  3B7D A;  2O84 X;  3JV9 A;  4YZZ A;  4KD5 A;  3IAZ A;  2XX7 A;  3IJX B;  4OET A;  4XIG Q;  5I58 B;  1DMB A;  2AIX A;  5KDT B;  1B0L A;  3K00 A;  2I58 A;  2RC8 A;  1H3D A;  1LB8 A;  3T9H B;  1MXW A;  2QRY A;  2R6G E;  3BFT A;  2GRV A;  3V83 A;  2DYX A;  4ZEF A;  3K6V A;  5TU0 A;  3IR1 A;  1XVY A;  3L6G A;  3TQL A;  3IO6 A;  3HCQ A;  4PFU A;  3TTL A;  4LZ7 A;  1B9J A;  3IJO B;  4G8H A;  3MPK A;  3PMX A;  1UTH A;  5ITO A;  3E3K A;  1SW2 A;  2RC7 A;  5F7V A;  2Q8J A;  2PYY A;  2ONK E;  1B58 A;  1XVX A;  1BP5 A;  2AL4 A;  5AA1 A;  1QVS A;  1I6B A;  2ANJ A;  4KCD A;  2V84 A;  2V25 A;  3EHS A;  1VFE A;  4QSD A;  4PFW A;  1BTJ A;  1NH8 A;  1SYI A;  2ESN A;  2QS3 A;  3RTF B;  5B70 A;  3I6V A;  1FTM A;  3QYT A;  3PMW A;  4RPN A;  4H65 A;  4O3A A;  3O2A A;  2D21 A;  4X9T A;  2Y7W A;  4G68 C;  3FXR A;  4G4P A;  3SEW A;  4IGT A;  5H8H A;  1SD3 A;  5M2V A;  1FW0 A;  2F34 A;  4JBZ A;  4L17 A;  4FED A;  3I5O A;  5L9O A;  3DM0 A;  1IXG A;  4H5G A;  5JEI A;  1N3W A;  3H6W A;  4R6Y A;  4I1D A;  4R2F A;  2VD2 A;  4XKQ A;  3H7M A;  3IOV A;  2W7Y A;  1LAF E;  2I0C A;  4G8M A;  4BDO A;  2RKM A;  4U1Z A;  3T22 A;  4NWD A;  3KOS A;  4ECF A;  1H76 A;  1UTH B;  4OFL A;  2H99 A;  3FJ7 A;  3FV2 A;  2VHA A;  5A5X B;  3MWB A;  3TTR A;  2F5X A;  1B51 A;  1QKA A;  4ELP A;  2QS2 A;  1SW1 A;  2NOO A;  1SI0 A;  1I69 A;  4FJP A;  2ZYK A;  3MC2 A;  4ONY A;  5K2Y A;  1TXF A;  1MXZ A;  4EQB A;  3V5A A;  1B52 A;  1NFT A;  5H8F B;  1OIB A;  1QUJ A;  1FQE A;  1MH3 A;  3IOU A;  3OEM A;  2OWS A;  3MZ1 A;  2LAO A;  3N6T A;  3VV5 A;  1S50 A;  4EF2 A;  4R9F A;  1ZLQ A;  1EZ9 A;  1TT1 A;  4PP0 A;  5H8H B;  2Y7K A;  3FZV A;  4YB7 A;  3IL1 B;  4GL8 A;  3MAM A;  3TCF A;  3PUY E;  2GHB A;  5I57 A;  1VFD A;  1B7U A;  2RC9 A;  3EHU A;  3R6U A;  2RIN A;  4DCX A;  1ZJL A;  3H3G A;  3P7I A;  4OWD A;  4OES A;  2ZYN A;  3DP6 A;  3MPL A;  3S9N C;  2THI A;  1N7X A;  5AA4 B;  3A3C A;  4WEP A;  4R75 A;  4UAC A;  4N6P A;  3RLF E;  1MQJ A;  3O6G A;  4LZ8 A;  1JW1 A;  4F1V A;  2OBG A;  1TFA A;  5H8Q A;  1US4 A;  3KSX A;  3WAE A;  4PFT A;  1JEV A;  4QFO A;  4RXL A;  2XXW A;  4ESW A;  3KN8 A;  3TYH A;  1N76 A;  4WED A;  1DTZ A;  5CRY A;  4QHQ A;  2O6A A;  2O68 A;  2HZL A;  1N04 A;  2CZL A;  2XXP A;  4JDF A;  4H6D A;  1A40 A;  1F9B A;  3C31 A;  3FAT A;  4F31 B;  1IEJ A;  1ZIU A;  5HM4 B;  1LFH A;  3BFU A;  2HQ0 A;  2FNC A;  1O64 A;  2OLB A;  4OYV A;  3ZKK A;  5AA3 A;  1MXU A;  4BLA A;  1GGG A;  3C35 A;  4FAT A;  1B4H A;  5DVI A;  1R6Z A;  1LBC A;  3RPW A;  3M3L A;  2D3I A;  4Z7E A;  3CFZ A;  5I57 B;  1PEB A;  3MZ9 A;  3A09 A;  2QS1 A;  3PUW E;  4KI0 E;  3PPP A;  2UVJ A;  2IEE A;  1H44 A;  3G3I A;  3H6U A;  3TZA A;  2Z8F A;  3FVN A;  1EU8 A;  2H5Y A;  1MG1 A;  4KYS A;  3N6U A;  4JSO A;  3KJT A;  4DE8 A;  1WOD A;  3KG2 A;  5H8Q B;  4MLQ A;  3CSG A;  3TUS A;  4OEV A;  4AQ4 A;  3LR1 A;  5H8S A;  4F1U A;  4F2Q A;  4HCY A;  1TWY A;  2DXY A;  2F7A A;  3UA8 A;  1HSL A;  1N84 A;  3K01 A;  4RYA A;  2UVI A;  2X7P A;  3Q26 A;  1UIV A;  3SES A;  1OQG A;  4GXS B;  1PDA A;  4EUO A;  3VDF A;  5L9S A;  4TLM B;  1AIV A;  3R26 A;  4RA1 A;  1Y9U A;  4IO4 A;  4BDQ A;  1DOT A;  4GOT A;  5ICQ A;  5DEX A;  4C0R A;  4MF3 A;  1M5B A;  3N94 A;  3PGF A;  1D9V A;  3OSQ A;  1ELJ A;  3O28 A;  4G68 A;  1RKM A;  2AL5 A;  1R9Q A;  5CM6 A;  4LQ5 A;  2ZXT A;  2F97 A;  1YCJ A;  2ALU A;  2REJ A;  4R6K A;  3K6X A;  1I6A A;  3MVZ A;  3HPI A;  3D4G A;  4U4X A;  1HSE A;  1MDP 1;  4THI A;  5KDT A;  1GR2 A;  3JZJ A;  2DE3 A;  1NNK A;  4RK9 A;  3MUQ A;  3OOA A;  3U1O A;  3ILT B;  1P1W A;  5CMM A;  3RT6 B;  1P99 A;  2Z8D A;  1B32 A;  2H4I A;  2P0S A;  2UYE A;  4P11 A;  4GFR A;  4QFP A;  4YKP A;  4HTG A;  1S7Y A;  4QSC A;  4QFN A;  2XXV A;  3RT8 A;  4QRZ A;  2NXO A;  1Z7M E;  4OER A;  4P0I A;  3SEY A;  3EN3 A;  4OEU A;  1ATG A;  3VLW A;  3C36 A;  5JK4 A;  2O1M A;  3FUZ A;  5CMC A;  1M5E A;  4XKP A;  3PD9 A;  2PX1 A;  5I2N A; 
#chains in the Genus database with same CATH topology
 1EZP A;  4RNS A;  1LFI A;  3PD8 A;  3DP4 A;  2XWI A;  1RDZ A;  1SQY A;  2F78 A;  1WDN A;  4G68 B;  4MIJ A;  1VE4 A;  1MQI A;  1H45 A;  3Q25 A;  4H8I A;  4DZ1 A;  1A55 A;  4GWO A;  3DLN A;  1LFG A;  4KR5 A;  1FTL A;  4GQO A;  4FE8 A;  2V3U A;  1O63 A;  3O29 A;  2UVG A;  5L8D A;  1G0I A;  4PFB A;  3O66 A;  1JNF A;  2H25 A;  5EYG A;  5CMB A;  3GYY A;  4TQU Q;  1T0K A;  3S9E A;  2FIE A;  4GWS A;  3PPR A;  3CRB A;  4XF5 A;  4X1D A;  3EQ1 A;  4YKJ A;  1LBV A;  4F1Y A;  2XXU A;  4AS5 A;  3T9V A;  4RY1 A;  1LEV A;  3TDJ A;  1LST A;  3IFA A;  1DPE A;  1MM6 A;  4NF4 A;  5CMK A;  4IGR A;  1BIY A;  1PBQ A;  1URG A;  3F11 A;  3NOH A;  2Y7P A;  1SW4 A;  1D9Y A;  2PBW A;  3EPE A;  4PBH A;  1URD A;  1LBX A;  3UIF A;  5DW8 A;  5BUU A;  4PDD A;  5CBR A;  1NV4 A;  1MPD A;  4F39 A;  3KN3 A;  2UVH A;  4N8G A;  4PTK A;  4KFQ A;  4NED A;  5A5X A;  3G3F A;  2OK2 A;  4X04 A;  5I5P A;  2OJT A;  1B05 A;  4HW8 A;  5AA2 D;  1BLF A;  4U21 A;  2PFY A;  1SDX A;  5I2N B;  1XHY A;  2VT5 A;  3G3J A;  1M5C A;  3KC0 A;  4OTE A;  1PBP A;  4ZEC A;  3KEI A;  3TMG A;  1EZO A;  4MCO A;  1FTJ A;  5DT6 A;  3B6T A;  1XT8 A;  3FVO A;  3MQ9 A;  4I62 A;  2XXT A;  1B6H A;  5H8F A;  1AOV A;  5I7I A;  2ZYO A;  1MS7 A;  2Z8E A;  5HBC A;  1FQA A;  1RDX A;  1DTG A;  1SVX B;  1TFD A;  3R7X A;  4M1V A;  1RYX A;  2Y7I A;  1R1N A;  4F3S A;  1LAG E;  4F18 A;  4LON B;  5I56 B;  1B40 A;  1B4Z A;  3PPO A;  1MY2 A;  4MBP A;  3VXB A;  4KYD A;  5ET5 A;  1MXX A;  1BK4 A;  1NUZ A;  4I9D A;  3BKI B;  4NF4 B;  5LTC A;  1IIT A;  3GZG A;  2UXA A;  2XD3 A;  4U23 A;  3MVX A;  2I3V A;  4F2O A;  3KZG A;  2R9J A;  1YPN A;  5IM2 A;  5AA4 A;  1FPI A;  4N91 A;  1MPB A;  2Q9T A;  3K1M A;  2RCB A;  2M8C A;  3OO6 A;  2A5T A;  4DLD A;  1EYK A;  3CFL A;  2IA4 A;  1Q1K A;  1FCK A;  2XHD A;  2ZZV A;  1LBB A;  5LDZ A;  1R9L A;  4G61 A;  3U92 A;  3PV0 E;  4PQJ A;  4QF9 A;  4O7I A;  3TEL A;  2PVU A;  3ONM A;  4ESX A;  3SKP A;  5BWJ A;  3H4Z A;  5FTI A;  1JET A;  1LGB C;  3RY3 A;  1O7T A;  3C33 A;  5ICT A;  4OA4 A;  1PB9 A;  4PAI A;  1NNP A;  3E79 A;  3MJN A;  3PMV A;  3MP6 A;  1MXV A;  3ZSF A;  3QK6 A;  4F3G A;  1DSN A;  3K6W A;  1BKA A;  4EDP A;  3DEL B;  1US5 A;  2HXR A;  1POT A;  4U2R A;  1CNQ A;  4JVD A;  4GWW A;  1NL5 A;  3BBR A;  1NV7 A;  3U94 A;  2ZNU A;  1VSO A;  1H43 A;  4O94 A;  5J16 A;  3LUY A;  4X8R A;  3A29 A;  3HST A;  3H06 B;  3Q27 A;  4K3F A;  1YXI A;  2QS4 A;  2F36 A;  1AL3 A;  2HHM A;  2A5T B;  2QVR A;  3PPQ A;  4DI3 D;  5IKB A;  3VVD A;  4QFL A;  4UA8 A;  4UAB A;  4IO7 A;  4XTC Q;  2DXR A;  3LV0 A;  5FBP A;  1DPP A;  3K6U A;  3QAX A;  3OEK A;  1FPB A;  1Y1Z A;  3M3K A;  2ZMB A;  3CVG A;  2VD3 A;  3K0V A;  3KGC A;  1DBZ A;  3VE1 B;  2CEX A;  4F29 A;  5AA2 A;  3KN7 A;  4P47 A;  3MZB A;  4DXU A;  3HO7 A;  1B3G A;  3K4U A;  2XXQ A;  1K9Z A;  1FBD A;  2QL3 A;  2DVZ A;  4FOR A;  1Z7N E;  1JW5 A;  1QGX A;  4NTL A;  1KA1 A;  1NI9 A;  1NNT A;  4AS4 A;  4XXU A;  3W15 C;  3TKD A;  4H5F A;  4NWC A;  1SI1 A;  1Q35 A;  2XX9 A;  1POY 1;  3S9L C;  2DWA A;  4HE2 A;  3S4U A;  4P1E A;  4I40 A;  1IXC A;  3G3G A;  4JWY A;  3THI A;  1IQ7 A;  4MAG A;  1INP A;  2XXX A;  1KWH A;  4C1U A;  4POX A;  4N13 A;  3OO7 A;  3UP9 A;  4R6H A;  2OZZ A;  1MRP A;  4QSE A;  3GBA A;  4P1L A;  1HSJ A;  4RJZ A;  4KCC A;  3KJ7 A;  4PBQ A;  2I4C A;  2WKY A;  1Y3N A;  4FEC A;  2ZNT A;  4N6D A;  3CIJ A;  3VVF A;  1SYH A;  1FPG A;  1N0T A;  4EXL A;  4FIM A;  1GVC A;  3RGY A;  3RPL A;  1IXI A;  1XS5 A;  5ET6 A;  1FBP A;  4M4G A;  3USD A;  2GHA A;  2ONR A;  1MY0 A;  5ET8 A;  2Q8M A;  2HCA A;  4ZE9 A;  2O7U A;  3K1P A;  5AA2 B;  1N3X A;  2YJP A;  2CZI A;  1MY4 A;  3MVW A;  3VXC A;  2P3N A;  1NMU A;  1B5J A;  4FEB A;  1B3F A;  3QUJ A;  3TTN A;  5I59 A;  4NG7 A;  2XWO A;  2ZYM A;  3KSJ A;  1FTK A;  4GWU A;  4OQO A;  4C1T A;  3KBZ A;  3O97 A;  2Y5L A;  4PGP A;  4LVQ A;  3TPA A;  4GXA A;  2OX3 A;  1USY E;  1LBY A;  3OSR A;  2GQ1 A;  1B7H A;  1B1X A;  4Q8R A;  5EHS A;  1ZU0 A;  1FQD A;  4LQ2 A;  4ELO A;  1FPF A;  1N7W A;  5F1Q A;  4Q0C A;  3OXN A;  2DSF A;  3LSF B;  4YB6 A;  1IZ1 A;  5EQ8 A;  1D3K A;  2PT2 A;  3K1N A;  1ANF A;  2B4L A;  5AE4 A;  3W9W A;  3GBB A;  1AH5 A;  4JVI A;  3M3F A;  3MBP A;  3FXQ A;  3CHG A;  4H46 A;  3B6Q A;  3IOT A;  5KCJ B;  1ZBM A;  4NAP A;  4JWO A;  3EHT A;  5HPQ A;  4GX6 A;  4LUB A;  4O8M A;  1D9Q A;  4R72 A;  4EXK A;  2O1L A;  1IMC A;  1P1O A;  3RPL B;  3FVK A;  2FA7 A;  4O3B A;  5IZ1 A;  3ZKL A;  2FYI A;  2QVU A;  4GD5 A;  1B7Z A;  4ISU A;  1B2H A;  1JP4 A;  3RTW B;  4F19 A;  4NHB A;  1B3H A;  3MW0 A;  5I59 B;  1XI6 A;  1Y1M A;  2ZNS A;  3UN6 A;  3C4M A;  2VP1 A;  4E0W A;  3MVY A;  2G93 A;  3U72 A;  1NV1 A;  2DQV A;  3W9V A;  1MM7 A;  1Y3P A;  4GWX A;  4NX1 A;  3TTM A;  2HZK A;  2BJJ X;  4KQP A;  4MEV A;  2Q2A A;  5B7D A;  2DP8 A;  4PFY A;  3FAS A;  3LUZ A;  1KZ8 A;  4OAN A;  3FIR A;  3SEU A;  5ISU A;  3FXU A;  4H0W A;  4P0G A;  4PET A;  1OVT A;  4R2B A;  4XKR A;  3SZP A;  1FPL A;  1OLA A;  4R74 A;  4JSD A;  4QBA A;  3CG3 A;  5L9M A;  4Z0I A;  2BJI A;  3TTK A;  3VFJ A;  4BDL A;  2HEU A;  3O6I A;  1QJM A;  2XXH A;  1FTO A;  4NF8 A;  4F22 A;  5I56 A;  3LSX A;  1A8F A;  5A5L A;  3T9X B;  2R8T A;  4PGN A;  2HAV A;  2PT1 A;  2AYS A;  1EYI A;  4I3E A;  2REG A;  4YMB A;  2Z23 A;  3PUV E;  3OO9 A;  5EQA A;  3RN8 A;  1IUD A;  3AXF A;  4NF5 B;  1A8E A;  2G29 A;  2I6E A;  3C9H A;  3MP8 A;  3T93 B;  4ZEB A;  2R71 A;  4KYE A;  2UYF A;  1PB7 A;  1IMB A;  2YPN A;  3ISP A;  4YKI A;  3TCG A;  1NUX A;  4NF6 A;  3IX1 A;  3O9P A;  4GX4 A;  3RQT A;  4GRK A;  4DDD A;  4IO2 A;  5FTH A;  3D4C A;  4TOZ A;  4ZZA A;  4PAK A;  1JVX A;  2ABH A;  2Q74 A;  1B5I A;  1B3E A;  3IOR A;  5DTB A;  1B46 A;  4MNC A;  4ELQ A;  5I2K A;  1IME A;  1FBE A;  4GVO A;  2HXW A;  2OWZ A;  2V3Q A;  4KPT A;  4BDM A;  3G7W A;  4QFK A;  1XC1 A;  1LAH E;  3HHG A;  2NVU B;  4MFI A;  3FV1 A;  1GV8 A;  1FBH A;  3HV1 A;  4ZZE A;  1Q9D A;  1YTV A;  2XXI A;  4H45 A;  4DCY A;  3ILU B;  4OVS A;  3ECR A;  1USY H;  2QVV A;  4OHN A;  3SER A;  2P1S A;  4NF8 B;  1QKB A;  4GIZ A;  2CZH A;  3EKI A;  3RUM A;  3BIH A;  4DXB A;  2RCA A;  5ELV A;  4LAT A;  3QXM A;  3HN0 A;  5FHN A;  1FBG A;  3IO4 A;  5LOM A;  3EF7 A;  4OEN A;  4R9G A;  2X7Q A;  2V3T A;  4ZS9 A;  2F8D A;  2F7B A;  4PE5 B;  3Q29 A;  4RK2 A;  4IY6 A;  4GX3 A;  1A7L A;  2B4M A;  4DIG A;  4MX6 A;  2WEF A;  2I0B A;  4YAH X;  4Q5T A;  5CI5 A;  2NUV A;  3QUF A;  5EQ7 A;  4F3P A;  3PUX E;  4ELR A;  3T0J A;  4OXV A;  2DWJ A;  4NF6 B;  1QUL A;  4HCW A;  1FQF A;  4LA9 A;  4OVJ A;  1FJ9 A;  3C34 A;  3KBR A;  1UTB A;  3U65 A;  2XWK A;  2A5S A;  5ESY A;  2WYP A;  2VOZ A;  5ITP A;  4YB5 A;  3N26 A;  4Q30 B;  1IXH A;  1B0H A;  2XA5 A;  2E1S A;  4PF6 A;  2V93 A;  2H98 A;  5I2K B;  4ZEI A;  4IO5 A;  3G3K A;  4KHZ E;  2VGQ A;  2F7C A;  3LSL A;  2KR0 A;  1NV0 A;  4DI4 B;  3QSL A;  2QMW A;  3TFL A;  1IMF A;  3H6T A;  3FJG A;  4BDN A;  2O51 A;  5FHO A;  4YIC A;  2I48 A;  1MY3 A;  1CE2 A;  4P56 A;  3OMB A;  3K2D A;  3QIM A;  2GFE A;  3CSB A;  2D5W A;  2O69 A;  3BIG A;  1B1H A;  1MQH A;  1M5D A;  1IIW A;  3H6V A;  4ND9 A;  4PDH A;  4OZ9 A;  2QMX A;  1P1Q A;  4H1X A;  4EF1 A;  2HFB A;  1NH7 A;  3FGS A;  3CFX A;  4HE1 A;  5H8N A;  5I3S A;  1JW4 A;  1PB8 A;  2I49 A;  2B65 A;  3TEP A;  4ZEK A;  3V8X B;  2YLN A;  5CBS A;  3IOW A;  1NUY A;  4YMA A;  1B5H A;  4R73 A;  1SBP A;  4H67 A;  3H03 A;  2VPO A;  1UTB B;  4ZDM A;  4HS7 A;  2DS9 A;  3IB1 A;  3JYR A;  3KC1 A;  2Q2C A;  4MH5 A;  3E13 X;  1AMF A;  3GLB A;  2GH9 A;  1QUK A;  1NV2 A;  4QXD A;  4NMY A;  3IB0 A;  1XOC A;  3VVE A;  4YKK A;  1NUW A;  4WXJ A;  4G77 A;  1MH4 A;  4JB7 A;  4YU0 A;  1QW0 A;  5TP9 A;  3G3H A;  1A99 A;  3E78 A;  4ZED A;  4LZ5 A;  5I84 A;  2Q88 A;  3VLV A;  2O7I A;  4JXI A;  4G8N A;  3OO8 A;  1FBC A;  1KA0 A;  3ODB A;  1MY1 A;  4X48 A;  2Y7R A;  4EQ9 A;  3O6H A;  2XXR A;  1SPI A;  3U93 A;  3LC8 A;  1DK4 A;  4BDR A;  2QJE A;  2F6G A;  5IZZ A;  4RPO A;  5H8N B;  5DVJ A;  2E0S A;  1URS A;  2P3V A;  4I3Y A;  4IY5 A;  1OMP A;  1IMA A;  3TQW A;  1P1N A;  2I4B A;  3PTY A;  1MQG A;  3I3V A;  4X1B A;  4WKM A;  1UIU A;  4GBV A;  1OLC A;  1EH3 A;  1M5F A;  2DWH A;  2Q89 A;  1MPC A;  2P2A A;  1J1N A;  4OVP A;  1Y4T A;  3U8Q A;  3IK6 B;  3M8U A;  5KCJ A;  1UQW A;  4EQ7 A;  3T66 A;  2QSX A;  2PMS A;  1FSA A;  3LSW A;  2CMO A;  4GF8 A;  1ZKB A;  4GWZ A;  3Q28 A;  3T96 B;  4N07 A;  2H9B A;  5IZ3 A;  4G2Z A;  3TOD A;  3S2V A;  4LP2 B;  2OCU A;  1LLS A;  3E4R A;  4POW A;  4PC9 A;  2I3W A;  4E0X A;  1GTK A;  1WVJ A;  4H8J A;  3RNN A;  5TP9 B;  1CB6 A;  1ZMG A;  4N17 A;  5EYF A;  1L5T A;  1YZ0 A;  1II5 A;  1LCT A;  1MDQ A;  1NV3 A;  4FAJ A;  3UOR A;  1OQH A;  4GL0 A;  4U4S A;  2Y84 A;  5CC2 A;  5K2X A;  4GLI A;  4JWX A;  3T9U A;  3KOT A;  1B3L A;  2KQZ A;  3PPN A;  3TCH A;  4MLV A;  5TPA A;  2X26 A;  2WYK A;  5IAI A;  1ZTY A;  3HHF A;  3TAJ A;  2NWJ A;  5J1D A;  1OVB A;  4NE4 A;  3CR9 A;  3ROJ A;  1SW5 A;  3SDF A;  1P1U A;  2DE2 A;  1VR5 A;  3LBS A;  1Y20 A;  4IO3 A;  3OEN A;  3SEX A;  3ZS6 A;  4OFO A;  5JTY A;  4AB5 A;  3C32 A;  3OD7 A;  2FBP A;  2DOJ A;  1A54 A;  5IZ3 B;  1YAE A;  3WAF A;  3OEL A;  1NNF A;  3B6W A;  5I58 A;  1PC3 A;  1JQF A;  4OFJ A;  3FJM A;  2PCR A;  2HAU A;  1I6Q A;  4NQ8 A;  4IB2 A;  1MXY A;  1NKX A;  4DXC A;  4NF5 A;  1S9T A;  3GXA A;  4OMB A;  2XD2 A;  3SEV A;  2B3B A;  1JEU A;  2QPQ A;  2XXK A;  3FVG A;  1VDW A;  5DYH A;  1D4N A;  1LB9 A;  3PU5 A;  2F35 A;  5KZT A;  2DVC A;  2XX8 A;  1QUI A;  2RF1 A;  3CG1 A;  4AB6 A;  3N5L A;  2DWI A;  4P3L A;  3IFC A;  4U22 A;  3V89 B;  4MMP A;  4F3B A;  4I8C A;  3A3U A;  2ONS A;  3S9M C;  1FQB A;  5TPA B;  4U1O A;  3E9X A;  2DE4 A;  2Z22 A;  3FD3 A;  2FVZ A;  2OWT A;  5DVF A;  4TLL B;  3UGW A;  1JVY A;  5DEX B;  2L5V A;  1FJ6 A;  1K9Y A;  2B3F A;  1RYO A;  3DP8 A;  4ZE8 A;  2F6P A;  1Y3Q A;  3SET A;  2KLF A;  3CI8 A;  3UK4 A;  1LAX A;  3PUZ E;  4XKN A;  1Y4C A;  2HPG A;  3K02 A;  5JTY B;  5FHM A;  5EHM A;  3KFM A;  2XXY A;  1MQD A;  1LCF A;  3VLU A;  3MP1 A;  3L6H A;  4IO6 A;  4O3C A;  1FQC A;  3IB2 A;  3B7D A;  2O84 X;  3JV9 A;  4YZZ A;  4KD5 A;  3IAZ A;  2XX7 A;  3IJX B;  4OET A;  4XIG Q;  5I58 B;  4PAF A;  1DMB A;  2AIX A;  2JJK A;  5KDT B;  1B0L A;  3K00 A;  2I58 A;  2RC8 A;  1H3D A;  1LB8 A;  3T9H B;  1MXW A;  2QRY A;  2R6G E;  3BFT A;  2GRV A;  3V83 A;  2DYX A;  4ZEF A;  3K6V A;  5TU0 A;  3IR1 A;  1XVY A;  3L6G A;  3TQL A;  3IO6 A;  3HCQ A;  4PFU A;  3TTL A;  4LZ7 A;  1B9J A;  3IJO B;  4G8H A;  4NF0 A;  3MPK A;  3PMX A;  1UTH A;  5ITO A;  3E3K A;  1SW2 A;  2RC7 A;  5F7V A;  2FHY A;  2Q8J A;  2PYY A;  3FXB A;  2ONK E;  1B58 A;  1XVX A;  4O7M A;  1BP5 A;  5T3J A;  2AL4 A;  5AA1 A;  1QVS A;  1I6B A;  2ANJ A;  4KCD A;  2V84 A;  1YYZ A;  2V25 A;  3EHS A;  1VFE A;  4QSD A;  4PFW A;  1BTJ A;  1NH8 A;  1SYI A;  2ESN A;  2QS3 A;  3RTF B;  5B70 A;  3I6V A;  1FTM A;  3QYT A;  4HXV A;  2WX9 A;  3PMW A;  2FIX A;  4RPN A;  4H65 A;  4O3A A;  3O2A A;  2D21 A;  4X9T A;  2Y7W A;  4G68 C;  3FXR A;  4G4P A;  3SEW A;  1NV6 A;  4IGT A;  5H8H A;  1SD3 A;  5M2V A;  1FW0 A;  2F34 A;  4JBZ A;  4L17 A;  4FED A;  3I5O A;  5L9O A;  3DM0 A;  1IXG A;  4H5G A;  5JEI A;  1N3W A;  4PF8 A;  3RYD A;  3H6W A;  4R6Y A;  4FBP A;  4I1D A;  4R2F A;  2VD2 A;  4XKQ A;  1LBW A;  3H7M A;  3IOV A;  2W7Y A;  1LAF E;  2I0C A;  4G8M A;  4BDO A;  2RKM A;  4U1Z A;  3HFU A;  3T22 A;  4NWD A;  3KOS A;  4ECF A;  1G0H A;  1H76 A;  1FPD A;  3MST A;  1UTH B;  4OFL A;  4HE0 A;  2H99 A;  3FJ7 A;  3FV2 A;  2VHA A;  4N6K A;  4OVT A;  3MWB A;  5A5X B;  3TTR A;  2F5X A;  1B51 A;  1QKA A;  4ELP A;  2QS2 A;  1SW1 A;  2NOO A;  1SI0 A;  1I69 A;  4MJO A;  2Y5K A;  4FJP A;  1EYJ A;  2ZYK A;  3MC2 A;  2WBD A;  3D1R A;  4ONY A;  5K2Y A;  2F3B A;  1TXF A;  2F3D A;  1MXZ A;  4EQB A;  3V5A A;  1B52 A;  1NFT A;  5H8F B;  1OIB A;  1QUJ A;  1FQE A;  1MH3 A;  2WBB A;  2XWV A;  3IOU A;  3OEM A;  2OWS A;  3MZ1 A;  2LAO A;  3N6T A;  3VV5 A;  4MNP A;  1S50 A;  4EF2 A;  4R9F A;  1ZLQ A;  2V4C A;  1EZ9 A;  1TT1 A;  4PP0 A;  5H8H B;  2Y7K A;  3FZV A;  4PE3 A;  3IL1 B;  4GL8 A;  4YB7 A;  3MAM A;  3TCF A;  4GBW A;  3PUY E;  2GHB A;  5I57 A;  1VFD A;  1B7U A;  2RC9 A;  3EHU A;  3R6U A;  2RIN A;  4DCX A;  1ZJL A;  3H3G A;  3P7I A;  4P9K A;  3FBP A;  4OWD A;  3B8B A;  4OES A;  4XFE A;  2ZYN A;  3DP6 A;  3MPL A;  3S9N C;  2THI A;  1N7X A;  5AA4 B;  3A3C A;  4WEP A;  4R75 A;  4UAC A;  4N6P A;  3RLF E;  1MQJ A;  3O6G A;  4NGU A;  5EYH A;  4LZ8 A;  1JW1 A;  4F1V A;  2OBG A;  1TFA A;  5H8Q A;  1US4 A;  4XEQ A;  3KSX A;  3WAE A;  1FPE A;  4N4U A;  4PFT A;  1JEV A;  4QFO A;  5ET7 A;  4RXL A;  2XXW A;  2ZZX A;  4ESW A;  4N15 A;  3KN8 A;  3TYH A;  1N76 A;  4WED A;  1DTZ A;  2CZK A;  4PCD A;  5CRY A;  4QHQ A;  2O6A A;  2O68 A;  2HZL A;  1N04 A;  2CZL A;  2XXP A;  1FPK A;  4JDF A;  2MKZ A;  4H6D A;  1A40 A;  1F9B A;  1AWB A;  1LBZ A;  3C31 A;  3FAT A;  4F31 B;  1IEJ A;  1ZIU A;  5HM4 B;  1LFH A;  3BFU A;  2HQ0 A;  1NV5 A;  2FNC A;  1O64 A;  2OLB A;  2DDK A;  4OYV A;  3ZKK A;  5AA3 A;  1MXU A;  4BLA A;  1GGG A;  3C35 A;  4FAT A;  1B4H A;  1FTA A;  5DVI A;  1R6Z A;  1LBC A;  3RPW A;  3M3L A;  2D3I A;  4Z7E A;  3CFZ A;  5I57 B;  1PEB A;  3MZ9 A;  3A09 A;  2QS1 A;  4MHF A;  3PUW E;  4N8Y A;  4KI0 E;  3PPP A;  2UVJ A;  2IEE A;  1H44 A;  3G3I A;  3H6U A;  3TZA A;  5EQ9 A;  2Z8F A;  3FVN A;  2ZZW A;  1EU8 A;  4NN3 A;  2H5Y A;  1MG1 A;  4KYS A;  3N6U A;  4JSO A;  3KJT A;  4DE8 A;  1WOD A;  3KG2 A;  4OVR A;  5H8Q B;  4MLQ A;  3CSG A;  3TUS A;  4OEV A;  4AQ4 A;  3LR1 A;  5H8S A;  4PFR A;  4F1U A;  4F2Q A;  4HCY A;  1TWY A;  2DXY A;  2F7A A;  3UA8 A;  1HSL A;  5IGA A;  1N84 A;  4IR8 A;  3K01 A;  1FBF A;  4RYA A;  2UVI A;  2X7P A;  2PFZ A;  3Q26 A;  1UIV A;  3SES A;  1OQG A;  4P8B A;  4GXS B;  1PDA A;  4EUO A;  3VDF A;  3T1B A;  5L9S A;  4TLM B;  4JVC A;  1AIV A;  3R26 A;  4RA1 A;  3B50 A;  2QFL A;  1Y9U A;  4IO4 A;  4BDQ A;  1DOT A;  4GOT A;  5ICQ A;  5DEX A;  4C0R A;  1FPJ A;  1M5B A;  4MF3 A;  3N94 A;  3PGF A;  1D9V A;  3OSQ A;  4MNI A;  4KXP A;  1ELJ A;  1FRP A;  3O28 A;  4G68 A;  1RKM A;  2AL5 A;  1R9Q A;  5CM6 A;  4LQ5 A;  1RDY A;  2ZXT A;  3MYU A;  2F97 A;  1YCJ A;  2ALU A;  2REJ A;  4R6K A;  3K6X A;  1I6A A;  3MVZ A;  3HPI A;  3D4G A;  4U4X A;  1HSE A;  1MDP 1;  2VPN A;  4THI A;  5KDT A;  1GR2 A;  3JZJ A;  1DCU A;  2DE3 A;  1NNK A;  4RK9 A;  3MUQ A;  3OOA A;  3U1O A;  3ILT B;  4GWY A;  4PFI A;  1P1W A;  5CMM A;  3RT6 B;  1P99 A;  2Z8D A;  1B32 A;  2CEY A;  2H4I A;  1IMD A;  2P0S A;  2UYE A;  4P11 A;  4GFR A;  4LN5 A;  4N81 A;  4QFP A;  4YKP A;  4HTG A;  1S7Y A;  4QSC A;  4QFN A;  2XXV A;  3RT8 A;  4QRZ A;  2NXO A;  1Z7M E;  4OER A;  4P0I A;  3SEY A;  3EN3 A;  4OEU A;  1ATG A;  4OVQ A;  3VLW A;  3C36 A;  5JK4 A;  2O1M A;  3FUZ A;  3QMF A;  5CMC A;  1M5E A;  4XKP A;  3PD9 A;  5F24 A;  2PX1 A;  5I2N A; 
#chains in the Genus database with same CATH homology
 1EZP A;  4RNS A;  1LFI A;  3PD8 A;  3DP4 A;  1SQY A;  2F78 A;  1WDN A;  4G68 B;  1VE4 A;  1MQI A;  1H45 A;  3Q25 A;  4H8I A;  4DZ1 A;  1A55 A;  4GWO A;  3DLN A;  1LFG A;  4KR5 A;  1FTL A;  4GQO A;  4FE8 A;  2V3U A;  1O63 A;  3O29 A;  2UVG A;  5L8D A;  3O66 A;  1JNF A;  2H25 A;  5CMB A;  4TQU Q;  1T0K A;  3S9E A;  3PPR A;  3CRB A;  4X1D A;  3EQ1 A;  4YKJ A;  4F1Y A;  2XXU A;  3T9V A;  4RY1 A;  3TDJ A;  1LST A;  1DPE A;  1MM6 A;  4NF4 A;  5CMK A;  4IGR A;  1BIY A;  1PBQ A;  1URG A;  3F11 A;  2Y7P A;  1SW4 A;  1D9Y A;  2PBW A;  3EPE A;  1URD A;  3UIF A;  5BUU A;  5CBR A;  1MPD A;  4F39 A;  3KN3 A;  2UVH A;  4KFQ A;  4NED A;  5A5X A;  3G3F A;  2OK2 A;  2OJT A;  1B05 A;  4HW8 A;  5AA2 D;  1BLF A;  4U21 A;  1SDX A;  5I2N B;  1XHY A;  3G3J A;  1M5C A;  4OTE A;  1PBP A;  4ZEC A;  3KEI A;  3TMG A;  1EZO A;  1FTJ A;  5DT6 A;  3B6T A;  1XT8 A;  3FVO A;  3MQ9 A;  4I62 A;  2XXT A;  1B6H A;  5H8F A;  1AOV A;  2ZYO A;  1MS7 A;  2Z8E A;  5HBC A;  1FQA A;  1DTG A;  1SVX B;  1TFD A;  3R7X A;  4M1V A;  1RYX A;  2Y7I A;  1R1N A;  4F3S A;  1LAG E;  4F18 A;  4LON B;  5I56 B;  1B40 A;  1B4Z A;  3PPO A;  1MY2 A;  4MBP A;  3VXB A;  4KYD A;  1MXX A;  4I9D A;  3BKI B;  4NF4 B;  1IIT A;  3GZG A;  2UXA A;  2XD3 A;  4U23 A;  3MVX A;  2I3V A;  4F2O A;  3KZG A;  2R9J A;  1YPN A;  5AA4 A;  1MPB A;  2Q9T A;  3K1M A;  2RCB A;  2M8C A;  3OO6 A;  2A5T A;  4DLD A;  3CFL A;  2IA4 A;  1Q1K A;  1FCK A;  2XHD A;  1LBB A;  1R9L A;  3U92 A;  3PV0 E;  4PQJ A;  4QF9 A;  3TEL A;  2PVU A;  3ONM A;  4ESX A;  3SKP A;  5BWJ A;  3H4Z A;  5FTI A;  1JET A;  1LGB C;  3RY3 A;  1O7T A;  3C33 A;  5ICT A;  1PB9 A;  1NNP A;  3MJN A;  3PMV A;  3MP6 A;  1MXV A;  3ZSF A;  3QK6 A;  4F3G A;  1DSN A;  3K6W A;  1BKA A;  4EDP A;  3DEL B;  1US5 A;  1POT A;  4U2R A;  1NL5 A;  3BBR A;  3U94 A;  2ZNU A;  1VSO A;  1H43 A;  3LUY A;  3HST A;  3H06 B;  3Q27 A;  4K3F A;  2QS4 A;  2F36 A;  1AL3 A;  2A5T B;  3PPQ A;  5IKB A;  3VVD A;  4QFL A;  4UA8 A;  4IO7 A;  4XTC Q;  2DXR A;  1DPP A;  3K6U A;  3QAX A;  3OEK A;  1Y1Z A;  2ZMB A;  3CVG A;  3M3K A;  2VD3 A;  3K0V A;  3KGC A;  3VE1 B;  4F29 A;  5AA2 A;  3KN7 A;  3MZB A;  4DXU A;  3HO7 A;  1B3G A;  3K4U A;  2XXQ A;  2QL3 A;  2DVZ A;  4FOR A;  1Z7N E;  1JW5 A;  4NTL A;  1NNT A;  4XXU A;  3W15 C;  3TKD A;  4H5F A;  4NWC A;  1SI1 A;  1Q35 A;  2XX9 A;  1POY 1;  3S9L C;  2DWA A;  3S4U A;  1IXC A;  3G3G A;  4JWY A;  3THI A;  1IQ7 A;  2XXX A;  1KWH A;  4C1U A;  4POX A;  4N13 A;  3OO7 A;  3UP9 A;  4R6H A;  2OZZ A;  1MRP A;  4QSE A;  3GBA A;  1HSJ A;  4RJZ A;  4KCC A;  3KJ7 A;  2I4C A;  2WKY A;  1Y3N A;  4FEC A;  2ZNT A;  3CIJ A;  3VVF A;  1SYH A;  1N0T A;  4EXL A;  4FIM A;  1GVC A;  3RGY A;  1IXI A;  1XS5 A;  4M4G A;  3USD A;  2GHA A;  2ONR A;  1MY0 A;  2HCA A;  4ZE9 A;  2O7U A;  3K1P A;  5AA2 B;  1N3X A;  2YJP A;  1MY4 A;  3MVW A;  3VXC A;  1NMU A;  1B5J A;  4FEB A;  1B3F A;  3QUJ A;  3TTN A;  5I59 A;  2ZYM A;  3KSJ A;  1FTK A;  4OQO A;  4C1T A;  3O97 A;  4LVQ A;  3TPA A;  4GXA A;  1USY E;  3OSR A;  1B7H A;  1B1X A;  4Q8R A;  5EHS A;  1ZU0 A;  1FQD A;  4LQ2 A;  4ELO A;  1N7W A;  5F1Q A;  4Q0C A;  3OXN A;  2DSF A;  3LSF B;  4YB6 A;  1IZ1 A;  1D3K A;  2PT2 A;  3K1N A;  1ANF A;  5AE4 A;  3W9W A;  3GBB A;  1AH5 A;  3M3F A;  3MBP A;  3FXQ A;  3B6Q A;  3IOT A;  5KCJ B;  1ZBM A;  4JWO A;  3EHT A;  5HPQ A;  4LUB A;  4R72 A;  4EXK A;  2O1L A;  1P1O A;  3FVK A;  2FA7 A;  4O3B A;  3ZKL A;  2FYI A;  4GD5 A;  1B7Z A;  4ISU A;  1B2H A;  3RTW B;  4F19 A;  1B3H A;  3MW0 A;  5I59 B;  1Y1M A;  2ZNS A;  3UN6 A;  3C4M A;  2VP1 A;  4E0W A;  3MVY A;  2G93 A;  3U72 A;  2DQV A;  3W9V A;  1MM7 A;  1Y3P A;  3TTM A;  2HZK A;  2BJJ X;  4KQP A;  2Q2A A;  5B7D A;  2DP8 A;  4PFY A;  3FAS A;  3FIR A;  3SEU A;  5ISU A;  3FXU A;  4H0W A;  4P0G A;  4PET A;  1OVT A;  4R2B A;  4XKR A;  1OLA A;  4R74 A;  4JSD A;  3CG3 A;  5L9M A;  4Z0I A;  3TTK A;  3VFJ A;  4BDL A;  2HEU A;  3O6I A;  1QJM A;  2XXH A;  1FTO A;  4NF8 A;  4F22 A;  5I56 A;  3LSX A;  1A8F A;  3T9X B;  2HAV A;  2PT1 A;  2AYS A;  2REG A;  4YMB A;  2Z23 A;  3PUV E;  3OO9 A;  3RN8 A;  1IUD A;  3AXF A;  4NF5 B;  1A8E A;  2G29 A;  2I6E A;  3C9H A;  3MP8 A;  3T93 B;  4ZEB A;  2R71 A;  4KYE A;  2UYF A;  1PB7 A;  2YPN A;  4YKI A;  3TCG A;  4NF6 A;  3IX1 A;  3O9P A;  3RQT A;  4GRK A;  4DDD A;  4IO2 A;  5FTH A;  3D4C A;  4TOZ A;  4ZZA A;  1JVX A;  2ABH A;  1B5I A;  1B3E A;  3IOR A;  5DTB A;  1B46 A;  4ELQ A;  5I2K A;  4GVO A;  2HXW A;  2V3Q A;  4KPT A;  4BDM A;  3G7W A;  4QFK A;  1XC1 A;  1LAH E;  3HHG A;  2NVU B;  4MFI A;  1GV8 A;  3FV1 A;  3HV1 A;  4ZZE A;  1YTV A;  2XXI A;  4DCY A;  3ILU B;  3ECR A;  1USY H;  4OHN A;  3SER A;  2P1S A;  4NF8 B;  1QKB A;  4GIZ A;  3RUM A;  4DXB A;  2RCA A;  5ELV A;  4LAT A;  3QXM A;  3HN0 A;  5FHN A;  3IO4 A;  5LOM A;  3EF7 A;  4OEN A;  4R9G A;  2X7Q A;  2V3T A;  4ZS9 A;  2F8D A;  2F7B A;  4PE5 B;  3Q29 A;  4RK2 A;  4IY6 A;  1A7L A;  4DIG A;  2I0B A;  4YAH X;  4Q5T A;  5CI5 A;  2NUV A;  3QUF A;  4F3P A;  3PUX E;  4ELR A;  4OXV A;  2DWJ A;  4NF6 B;  1QUL A;  4HCW A;  1FQF A;  4LA9 A;  4OVJ A;  3KBR A;  3C34 A;  1UTB A;  2A5S A;  2VOZ A;  5ITP A;  4YB5 A;  3N26 A;  4Q30 B;  1IXH A;  1B0H A;  2E1S A;  2V93 A;  2H98 A;  5I2K B;  4ZEI A;  4IO5 A;  3G3K A;  4KHZ E;  2VGQ A;  2F7C A;  3LSL A;  3QSL A;  2QMW A;  3TFL A;  3H6T A;  3FJG A;  4BDN A;  2O51 A;  5FHO A;  4YIC A;  2I48 A;  1MY3 A;  1CE2 A;  3OMB A;  3K2D A;  3QIM A;  2GFE A;  3CSB A;  2D5W A;  2O69 A;  1B1H A;  1MQH A;  1M5D A;  1IIW A;  3H6V A;  4ND9 A;  4OZ9 A;  2QMX A;  1P1Q A;  4H1X A;  4EF1 A;  2HFB A;  1NH7 A;  3FGS A;  3CFX A;  5H8N A;  1JW4 A;  1PB8 A;  2I49 A;  2B65 A;  3TEP A;  4ZEK A;  3V8X B;  2YLN A;  5CBS A;  3IOW A;  4YMA A;  1B5H A;  4R73 A;  1SBP A;  4H67 A;  3H03 A;  1UTB B;  4ZDM A;  4HS7 A;  2DS9 A;  3IB1 A;  3JYR A;  2Q2C A;  4MH5 A;  3E13 X;  1AMF A;  3GLB A;  2GH9 A;  1QUK A;  4NMY A;  3IB0 A;  1XOC A;  3VVE A;  4YKK A;  4WXJ A;  4G77 A;  1MH4 A;  4JB7 A;  4YU0 A;  1QW0 A;  5TP9 A;  3G3H A;  1A99 A;  4ZED A;  4LZ5 A;  5I84 A;  2Q88 A;  3VLV A;  2O7I A;  4JXI A;  4G8N A;  3OO8 A;  3ODB A;  1MY1 A;  4X48 A;  2Y7R A;  4EQ9 A;  3O6H A;  2XXR A;  3U93 A;  3LC8 A;  4BDR A;  2QJE A;  2F6G A;  4RPO A;  5H8N B;  5DVJ A;  2E0S A;  1URS A;  4IY5 A;  1OMP A;  3TQW A;  1P1N A;  2I4B A;  1MQG A;  3I3V A;  4X1B A;  4WKM A;  1UIU A;  1OLC A;  1EH3 A;  1M5F A;  2DWH A;  2Q89 A;  1MPC A;  2P2A A;  1J1N A;  1Y4T A;  3U8Q A;  3IK6 B;  3M8U A;  5KCJ A;  1UQW A;  4EQ7 A;  3T66 A;  2QSX A;  2PMS A;  3LSW A;  2CMO A;  4GF8 A;  1ZKB A;  3T96 B;  3Q28 A;  4N07 A;  2H9B A;  4G2Z A;  3TOD A;  3S2V A;  4LP2 B;  2OCU A;  1LLS A;  3E4R A;  4POW A;  2I3W A;  4E0X A;  1GTK A;  1WVJ A;  4H8J A;  3RNN A;  5TP9 B;  1CB6 A;  1ZMG A;  5EYF A;  1L5T A;  1II5 A;  1LCT A;  1MDQ A;  4FAJ A;  3UOR A;  1OQH A;  4GL0 A;  4U4S A;  2Y84 A;  5CC2 A;  5K2X A;  4GLI A;  4JWX A;  3T9U A;  3KOT A;  1B3L A;  3PPN A;  3TCH A;  4MLV A;  5TPA A;  2X26 A;  5IAI A;  1ZTY A;  3HHF A;  3TAJ A;  2NWJ A;  5J1D A;  1OVB A;  4NE4 A;  3CR9 A;  1SW5 A;  3SDF A;  1P1U A;  2DE2 A;  1VR5 A;  3LBS A;  1Y20 A;  4IO3 A;  3OEN A;  3SEX A;  3ZS6 A;  4OFO A;  5JTY A;  4AB5 A;  3C32 A;  3OD7 A;  2DOJ A;  1A54 A;  1YAE A;  3WAF A;  3OEL A;  1NNF A;  3B6W A;  5I58 A;  1PC3 A;  1JQF A;  4OFJ A;  3FJM A;  2HAU A;  1I6Q A;  4IB2 A;  1MXY A;  1NKX A;  4DXC A;  4NF5 A;  1S9T A;  3GXA A;  4OMB A;  2XD2 A;  3SEV A;  2B3B A;  1JEU A;  2QPQ A;  3FVG A;  5DYH A;  1D4N A;  1LB9 A;  3PU5 A;  2F35 A;  5KZT A;  2DVC A;  2XX8 A;  1QUI A;  2RF1 A;  3CG1 A;  4AB6 A;  3N5L A;  2DWI A;  4U22 A;  3V89 B;  4F3B A;  4I8C A;  3A3U A;  2ONS A;  3S9M C;  1FQB A;  5TPA B;  4U1O A;  3E9X A;  2DE4 A;  2Z22 A;  3FD3 A;  2OWT A;  5DVF A;  4TLL B;  3UGW A;  1JVY A;  5DEX B;  2B3F A;  1RYO A;  3DP8 A;  4ZE8 A;  2F6P A;  1Y3Q A;  3SET A;  2KLF A;  3CI8 A;  3UK4 A;  1LAX A;  3PUZ E;  4XKN A;  1Y4C A;  3K02 A;  5JTY B;  5FHM A;  5EHM A;  3KFM A;  2XXY A;  1MQD A;  3VLU A;  1LCF A;  3MP1 A;  3L6H A;  4IO6 A;  4O3C A;  1FQC A;  3IB2 A;  3B7D A;  2O84 X;  3JV9 A;  4YZZ A;  4KD5 A;  3IAZ A;  2XX7 A;  3IJX B;  4OET A;  4XIG Q;  5I58 B;  1DMB A;  2AIX A;  5KDT B;  1B0L A;  3K00 A;  2I58 A;  2RC8 A;  1H3D A;  1LB8 A;  3T9H B;  1MXW A;  2QRY A;  2R6G E;  3BFT A;  2GRV A;  3V83 A;  2DYX A;  4ZEF A;  3K6V A;  5TU0 A;  3IR1 A;  1XVY A;  3L6G A;  3TQL A;  3IO6 A;  3HCQ A;  4PFU A;  3TTL A;  4LZ7 A;  1B9J A;  3IJO B;  4G8H A;  3MPK A;  3PMX A;  1UTH A;  5ITO A;  3E3K A;  1SW2 A;  2RC7 A;  5F7V A;  2Q8J A;  2PYY A;  2ONK E;  1B58 A;  1XVX A;  1BP5 A;  2AL4 A;  5AA1 A;  1QVS A;  1I6B A;  2ANJ A;  4KCD A;  2V84 A;  2V25 A;  3EHS A;  1VFE A;  4QSD A;  4PFW A;  1BTJ A;  1NH8 A;  1SYI A;  2ESN A;  2QS3 A;  3RTF B;  5B70 A;  3I6V A;  1FTM A;  3QYT A;  3PMW A;  4RPN A;  4H65 A;  4O3A A;  3O2A A;  2D21 A;  4X9T A;  2Y7W A;  4G68 C;  3FXR A;  4G4P A;  3SEW A;  4IGT A;  5H8H A;  1SD3 A;  5M2V A;  1FW0 A;  2F34 A;  4JBZ A;  4L17 A;  4FED A;  3I5O A;  5L9O A;  3DM0 A;  1IXG A;  4H5G A;  5JEI A;  1N3W A;  3H6W A;  4R6Y A;  4I1D A;  4R2F A;  2VD2 A;  4XKQ A;  3H7M A;  3IOV A;  2W7Y A;  1LAF E;  2I0C A;  4G8M A;  4BDO A;  2RKM A;  4U1Z A;  3T22 A;  4NWD A;  3KOS A;  4ECF A;  1H76 A;  1UTH B;  4OFL A;  2H99 A;  3FJ7 A;  3FV2 A;  2VHA A;  5A5X B;  3MWB A;  3TTR A;  2F5X A;  1B51 A;  1QKA A;  4ELP A;  2QS2 A;  1SW1 A;  2NOO A;  1SI0 A;  1I69 A;  4FJP A;  2ZYK A;  3MC2 A;  4ONY A;  5K2Y A;  1TXF A;  1MXZ A;  4EQB A;  3V5A A;  1B52 A;  1NFT A;  5H8F B;  1OIB A;  1QUJ A;  1FQE A;  1MH3 A;  3IOU A;  3OEM A;  2OWS A;  3MZ1 A;  2LAO A;  3N6T A;  3VV5 A;  1S50 A;  4EF2 A;  4R9F A;  1ZLQ A;  1EZ9 A;  1TT1 A;  4PP0 A;  5H8H B;  2Y7K A;  3FZV A;  4YB7 A;  3IL1 B;  4GL8 A;  3MAM A;  3TCF A;  3PUY E;  2GHB A;  5I57 A;  1VFD A;  1B7U A;  2RC9 A;  3EHU A;  3R6U A;  2RIN A;  4DCX A;  1ZJL A;  3H3G A;  3P7I A;  4OWD A;  4OES A;  2ZYN A;  3DP6 A;  3MPL A;  3S9N C;  2THI A;  1N7X A;  5AA4 B;  3A3C A;  4WEP A;  4R75 A;  4UAC A;  4N6P A;  3RLF E;  1MQJ A;  3O6G A;  4LZ8 A;  1JW1 A;  4F1V A;  2OBG A;  1TFA A;  5H8Q A;  1US4 A;  3KSX A;  3WAE A;  4PFT A;  1JEV A;  4QFO A;  4RXL A;  2XXW A;  4ESW A;  3KN8 A;  3TYH A;  1N76 A;  4WED A;  1DTZ A;  5CRY A;  4QHQ A;  2O6A A;  2O68 A;  2HZL A;  1N04 A;  2CZL A;  2XXP A;  4JDF A;  4H6D A;  1A40 A;  1F9B A;  3C31 A;  3FAT A;  4F31 B;  1IEJ A;  1ZIU A;  5HM4 B;  1LFH A;  3BFU A;  2HQ0 A;  2FNC A;  1O64 A;  2OLB A;  4OYV A;  3ZKK A;  5AA3 A;  1MXU A;  4BLA A;  1GGG A;  3C35 A;  4FAT A;  1B4H A;  5DVI A;  1R6Z A;  1LBC A;  3RPW A;  3M3L A;  2D3I A;  4Z7E A;  3CFZ A;  5I57 B;  1PEB A;  3MZ9 A;  3A09 A;  2QS1 A;  3PUW E;  4KI0 E;  3PPP A;  2UVJ A;  2IEE A;  1H44 A;  3G3I A;  3H6U A;  3TZA A;  2Z8F A;  3FVN A;  1EU8 A;  2H5Y A;  1MG1 A;  4KYS A;  3N6U A;  4JSO A;  3KJT A;  4DE8 A;  1WOD A;  3KG2 A;  5H8Q B;  4MLQ A;  3CSG A;  3TUS A;  4OEV A;  4AQ4 A;  3LR1 A;  5H8S A;  4F1U A;  4F2Q A;  4HCY A;  1TWY A;  2DXY A;  2F7A A;  3UA8 A;  1HSL A;  1N84 A;  3K01 A;  4RYA A;  2UVI A;  2X7P A;  3Q26 A;  1UIV A;  3SES A;  1OQG A;  4GXS B;  1PDA A;  4EUO A;  3VDF A;  5L9S A;  4TLM B;  1AIV A;  3R26 A;  4RA1 A;  1Y9U A;  4IO4 A;  4BDQ A;  1DOT A;  4GOT A;  5ICQ A;  5DEX A;  4C0R A;  4MF3 A;  1M5B A;  3N94 A;  3PGF A;  1D9V A;  3OSQ A;  1ELJ A;  3O28 A;  4G68 A;  1RKM A;  2AL5 A;  1R9Q A;  5CM6 A;  4LQ5 A;  2ZXT A;  2F97 A;  1YCJ A;  2ALU A;  2REJ A;  4R6K A;  3K6X A;  1I6A A;  3MVZ A;  3HPI A;  3D4G A;  4U4X A;  1HSE A;  1MDP 1;  4THI A;  5KDT A;  1GR2 A;  3JZJ A;  2DE3 A;  1NNK A;  4RK9 A;  3MUQ A;  3OOA A;  3U1O A;  3ILT B;  1P1W A;  5CMM A;  3RT6 B;  1P99 A;  2Z8D A;  1B32 A;  2H4I A;  2P0S A;  2UYE A;  4P11 A;  4GFR A;  4QFP A;  4YKP A;  4HTG A;  1S7Y A;  4QSC A;  4QFN A;  2XXV A;  3RT8 A;  4QRZ A;  2NXO A;  1Z7M E;  4OER A;  4P0I A;  3SEY A;  3EN3 A;  4OEU A;  1ATG A;  3VLW A;  3C36 A;  5JK4 A;  2O1M A;  3FUZ A;  5CMC A;  1M5E A;  4XKP A;  3PD9 A;  2PX1 A;  5I2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...