2I58A

Crystal structure of rafe from streptococcus pneumoniae complexed with raffinose
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
385
structure length
385
Chain Sequence
STVTIEYFNQKKEMTKTLEEITRDFEKENPKIKVKVVNVPNAGEVLKTRVLAGDVPDVVNIYPQSIELQEWAKAGVFEDLSNKDYLKRVKNGYAEKYAVNEKVYNVPFTANAYGIYYNKDKFEELGLKVPETWDEFEQLVKDIVAKGQTPFGIAGADAWTLNGYNQLAFATATGGGKEANQYLRYSQPNAIKLSDPIMKDDIKVMDILRINGSKQKNWEGAGYTDVIGAFARGDVLMTPNGSWAITAINEQKPNFKIGTFMIPGKEKGQSLTVGAGDLAWSISATTKHPKEANAFVEYMTRPEVMQKYYDVDGSPTAIEGVKQAGEDSPLAGMTEYAFTDRHLVWLQQYWTSEADFHTLTMNYVLTGDKQGMVNDLNAFFNPMKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Sugar ABC transporter, sugar-binding protein
publication title Crystal structure of apo and bound forms of RafE from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
total genus 130
structure length 385
sequence length 385
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2i58A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2i58A02
3CFZA 3TTMA 3OO9A 1B4ZA 3M3KA 1XVXA 1OQHA 2PYYA 1MQDA 5I2NB 1OIBA 1OLAA 1B51A 3K6WA 4ZEBA 3CFLA 4R6HA 3MAMA 5FHNA 5ITPA 4ZECA 3FXQA 4F3BA 4QFKA 3IOVA 2VHAA 4EF1A 2RC7A 3IOUA 3K0VA 3K6VA 1SI0A 4EQBA 2X26A 1H76A 3GBAA 2R71A 1I69A 3MBPA 1DTGA 2UVGA 4U4XA 4ELRA 5J1DA 1PBPA 5DYHA 2XX9A 1MY4A 3TELA 4O3BA 1LAXA 3T96B 4R9FA 4U2RA 4RA1A 2HXWA 4KQPA 1VE4A 4IO7A 4ND9A 4PFWA 3ZKLA 1JW4A 2Y7KA 1S7YA 1ANFA 3FVOA 4C0RA 2V3TA 3FUZA 1GTKA 3CFXA 3PD9A 2D3IA 2H99A 1MM7A 2I48A 2F35A 4KYEA 1SVXB 1EU8A 2DWIA 1B05A 4FEBA 2KLFA 3AXFA 3S2VA 1PB8A 1YAEA 3K6UA 1JETA 3KGCA 2Y7IA 3IB2A 1BTJA 2DP8A 3C36A 2FA7A 1MXUA 5EYFA 1H44A 1ZJLA 4LZ8A 3PPQA 2REGA 3T66A 4EXKA 3GLBA 4EQ9A 4Z7EA 1JW1A 3U94A 4RK2A 2XD3A 3UORA 4OFOA 1FQAA 4PFUA 1FW0A 1MM6A 3HN0A 3SEXA 4FIMA 2Z8FA 4R6YA 3FJMA 5AA4B 4R6KA 4MF3A 4QHQA 3T9XB 1VR5A 2VGQA 3PUWE 3CG3A 2HEUA 4EDPA 2ZNUA 3A09A 4WKMA 3IR1A 1LCFA 3WAFA 5AA4A 3MVXA 1MH3A 2GHAA 2THIA 1UQWA 1LFIA 2OK2A 1Z7ME 4QFOA 3JYRA 3VLVA 1TT1A 3U93A 3S9LC 4TOZA 1LFGA 1LGBC 1JQFA 3G3FA 4BDOA 1JVXA 5H8QB 4F39A 5H8FB 2DE4A 1MQHA 3G3HA 4RXLA 1NKXA 4BDNA 1A7LA 3SEVA 4XKRA 3D4GA 1P1NA 4G8HA 4NTLA 5DVIA 2F36A 1B3EA 2I0CA 1R9QA 3O6GA 4C1TA 2D5WA 2OJTA 4JWOA 3O6IA 1GV8A 3VXCA 2O51A 3CI8A 2XX7A 4DIGA 1ELJA 2DE2A 2ONRA 2ZXTA 3C32A 2XXVA 3N5LA 5CMBA 1QKBA 2UVIA 4U22A 5KCJB 3FV1A 2QS1A 3IO4A 3IOWA 4OEVA 5JEIA 1S9TA 5ICTA 1JEVA 1OQGA 2Z22A 1MPDA 2QJEA 3G3JA 4LQ2A 1B32A 4O3AA 1QJMA 1EZ9A 1IIWA 5AA2A 4NWDA 4HW8A 5DVJA 1SBPA 1LLSA 2ABHA 2HCAA 4R73A 2F78A 2DYXA 3OD7A 1US4A 3RPWA 3PMWA 3K6XA 2B65A 5I59A 3T9HB 3MJNA 4F22A 1XC1A 5ICQA 4UACA 1A55A 1B3FA 3PD8A 1EZOA 4H67A 2XX8A 5CBSA 2VD2A 3OO8A 4FE8A 5TP9A 3G3IA 2PMSA 4OWDA 2B3FA 3Q29A 2PT2A 1D9VA 4RPNA 3MP1A 4F3SA 3S4UA 4DXBA 2LAOA 1WODA 4DXUA 4ZZAA 5ISUA 1SQYA 1TXFA 1MXZA 4U4SA 4WEPA 1NL5A 2A5TB 2NOOA 4M4GA 5DTBA 4BLAA 1ZIUA 1N76A 2RF1A 2QPQA 3CIJA 5EHSA 3MVZA 3MC2A 1AMFA 3PV0E 2VD3A 1DPPA 1I6QA 3HHGA 2ZMBA 3TTKA 1LCTA 3KJ7A 3MZ1A 1QULA 2PVUA 2ALUA 1ZBMA 3IAZA 3SEWA 4EF2A 4PFYA 5KDTB 1URGA 5H8HB 1USYE 5H8NA 3ILUB 4DXCA 2Q89A 4NWCA 1NNPA 4KI0E 2QSXA 5CMKA 2O84X 2WKYA 5KDTA 5H8HA 4H5GA 1AL3A 3PPNA 1OMPA 3FXRA 4GXSB 4X1BA 2GRVA 2O1MA 2Q2CA 4KFQA 2H5YA 2RC9A 4F1VA 5I57B 1Y4TA 2DVZA 1P1UA 1SW4A 2I58A 3VLWA 2X7QA 2ZNSA 4F1YA 4OXVA 1Y3QA 2BJJX 1BP5A 4NF6B 1A54A 1WDNA 4UA8A 3H6WA 2FNCA 2XXPA 4RNSA 3C4MA 1B2HA 5HM4B 5I58A 5IAIA 3K02A 3H06B 4U1OA 1N0TA 1AH5A 4GIZA 1MQJA 3PMXA 4U23A 1B3GA 1MQIA 3ODBA 2GFEA 2HQ0A 1UTHB 4AB6A 3VV5A 5DEXB 4YAHX 4F29A 4IY6A 1MY3A 1O63A 3HCQA 3TTRA 2I0BA 3OEMA 3FVGA 5I2KB 3N6TA 4KCDA 2Q8JA 4Z0IA 3K1MA 1OLCA 1A40A 1JVYA 4QRZA 4BDLA 3VVDA 3IX1A 5DEXA 3G3KA 4FAJA 3S9MC 3FJGA 2RCBA 4Q30B 4ELOA 1UIUA 1FQFA 3MUQA 2G93A 4X9TA 4OETA 3T9UA 4YMBA 3RUMA 4JDFA 3QYTA 3CSGA 3IB0A 1Y3NA 4Q0CA 3BKIB 2RINA 3BFUA 3TQWA 3BFTA 4NE4A 5I56B 1LBCA 1TWYA 1LB8A 2I4BA 1FTLA 2Z23A 1EZPA 1YPNA 2Y7WA 1R9LA 3ZSFA 5DVFA 2PT1A 4O3CA 3T93B 4P11A 5I84A 1VFDA 2DWAA 3E9XA 1UTBA 1J1NA 4N13A 5I56A 1R6ZA 4YU0A 1MY0A 2DS9A 1GR2A 1B7HA 3CR9A 3O6HA 3TAJA 4NF4B 1SW2A 1BIYA 4ZS9A 3T9VA 4GWOA 2V25A 2VOZA 4OMBA 1MPCA 2QS2A 1A99A 3F11A 3G3GA 1XS5A 5B7DA 2Y7PA 1DTZA 3N6UA 3SKPA 4KPTA 4NF4A 4QSDA 5L9SA 5CM6A 2OZZA 1B1XA 1LB9A 1JW5A 2R9JA 4GQOA 3I5OA 5B70A 3TTNA 2OBGA 4E0WA 4YKKA 3H4ZA 4PP0A 1B6HA 1M5DA 4JXIA 1IEJA 5HBCA 4IO6A 3LUYA 3TKDA 1Y9UA 2XXHA 4JBZA 5FTIA 2I6EA 1MXXA 5KZTA 3W9VA 1II5A 4ELPA 2B3BA 3M8UA 2QMWA 2DVCA 3EHTA 3K01A 2AYSA 3TQLA 4AB5A 1O7TA 4WEDA 1XOCA 3SESA 4E0XA 3I6VA 3VXBA 3M3LA 4GD5A 1Q35A 1PB7A 3IORA 3H6UA 4XKNA 1XT8A 3SETA 1VFEA 2O69A 2E1SA 1CE2A 1MY1A 1PDAA 5DT6A 3A3CA 1ZTYA 4JWYA 3V8XB 1IQ7A 4OHNA 1N7WA 1BKAA 5CI5A 4G68A 1URDA 4G2ZA 1D4NA 5ELVA 3OENA 4YB7A 4RY1A 3USDA 1N04A 2XXIA 1B7ZA 3TTLA 3FGSA 2H4IA 1IXHA 4F2OA 2HZKA 4TQUQ 3N94A 2GH9A 4LQ5A 2IA4A 4HCWA 2F7BA 1ZLQA 1XHYA 5AA2D 3DP4A 3IO6A 2OLBA 4YKPA 4GOTA 3E4RA 3H03A 3P7IA 2Q88A 1S50A 3UIFA 1H3DA 2A5SA 3D4CA 2X7PA 4QF9A 3RNNA 3MZBA 3VDFA 1M5EA 2XXUA 1Z7NE 1LAGE 4G68C 4XXUA 4ZEDA 1KWHA 5EHMA 1B3LA 3FXUA 5IKBA 4GL0A 1MG1A 5AA2B 3PUVE 4YKJA 2QL3A 2V3UA 2V3QA 1M5BA 3OMBA 3Q27A 1AIVA 4PE5B 4ELQA 3R6UA 4OESA 4H0WA 2D21A 2W7YA 4HS7A 5I59B 3IK6B 3Q25A 1DMBA 3DELB 4GXAA 2P1SA 3KN7A 3KSJA 2QRYA 3QIMA 1POTA 3QK6A 2XXRA 3L6GA 3O28A 4H8IA 4I9DA 2O6AA 3OO7A 5TP9B 1JNFA 1FTJA 4DCYA 1YCJA 4FEDA 2HAUA 1DOTA 2Z8DA 3LSFB 3OELA 3PUXE 2HZLA 2RC8A 2UVHA 3OOAA 4OENA 1NMUA 1LFHA 3TCHA 4LONB 3QUJA 3PPRA 4L17A 2AL5A 2DOJA 4KYSA 4ZEKA 1ZKBA 1QUJA 1IXCA 1B58A 1MRPA 3LR1A 2OWTA 3RTFB 4POXA 2UYEA 4F31B 4ISUA 1B5IA 4ZEIA 3ONMA 3O2AA 4R74A 4OVJA 3R26A 4YB5A 2PX1A 1B0LA 2DXYA 2F6GA 1HSJA 1BLFA 4LATA 3TDJA 2F5XA 2O68A 3IJXB 3TCGA 2NUVA 3TUSA 4Q5TA 2YLNA 3LSLA 3B6WA 4H1XA 4XIGQ 2XHDA 5H8NB 1URSA 1B5HA 3OSRA 4XKQA 1N3XA 2XXQA 1H43A 2GHBA 4OEUA 3RT6B 3HO7A 4FECA 3C33A 4GF8A 2UYFA 3MP6A 4AQ4A 4LZ7A 1EH3A 4BDMA 1POY1 5A5XA 4H8JA 3FZVA 4ZE9A 1XVYA 3RT8A 4KHZE 2Y84A 4NF5A 4ESXA 1SD3A 4JSDA 1MPBA 2H9BA 3QSLA 1PBQA 2Q9TA 5I58B 1FQBA 4U1ZA 1I6BA 4MBPA 3IL1B 1D9YA 3TYHA 4EUOA 3VLUA 4H5FA 4R2FA 3UA8A 1TFDA 5TU0A 1AOVA 3PUZE 1LAHE 2ZYOA 3MPKA 1NNTA 1IZ1A 3QUFA 1SYHA 2PBWA 4GFRA 2R6GE 3UK4A 3ZKKA 1FTMA 2QMXA 4HTGA 3TMGA 3LSXA 2HAVA 2DWJA 4PETA 5AA3A 1Y1MA 4DLDA 1FQDA 2F7CA 1Q1KA 1US5A 3M3FA 1JEUA 1Y20A 3KOTA 5JK4A 3OO6A 3G7WA 2AIXA 2ONSA 1MXYA 3KSXA 4P0GA 2NVUB 2E0SA 3B6TA 4OTEA 3MQ9A 1NNKA 3IB1A 3OEKA 2OCUA 1USYH 1LAFE 4JSOA 3LC8A 3V83A 3PU5A 3FVKA 5CMMA 1UTBB 4F19A 1QUKA 4IO5A 4JB7A 5AA1A 1IXGA 4BDRA 4GL8A 5LOMA 4JWXA 1P1QA 1MY2A 3C31A 4G8NA 1R1NA 3BBRA 4I62A 3U8QA 1D3KA 4LVQA 4R75A 4MFIA 3TZAA 5L8DA 1TFAA 5M2VA 4K3FA 1HSEA 4YZZA 2G29A 1B46A 2F6PA 4KYDA 5I2NA 3EN3A 3KFMA 2F34A 3K4UA 3H7MA 3JZJA 4G77A 4QFPA 3PGFA 4MH5A 3SEUA 3Q28A 4XKPA 2REJA 2Y7RA 2YJPA 1MDQA 4N07A 3ILTB 2HFBA 3I3VA 5K2YA 4QSCA 3U1OA 2RCAA 3SEYA 2H25A 4KR5A 4R2BA 2O7IA 4YKIA 1IITA 4LZ5A 4RPOA 2I4CA 2XXWA 4ESWA 4N6PA 5CRYA 2XXYA 4IO4A 1NH7A 4QFNA 1ZU0A 3B6QA 3ZS6A 1NH8A 2ONKE 3DP6A 3VVEA 1N84A 1P99A 3KZGA 3EHUA 3KJTA 3FVNA 2V84A 3H6TA 4H65A 5L9OA 2P2AA 3KN8A 2M8CA 3VVFA 2DE3A 4M1VA 3MZ9A 1H45A 5BWJA 2Q2AA 1L5TA 1MH4A 1N3WA 3FATA 4F1UA 3UN6A 1PEBA 4QFLA 4G68B 5TPAB 4F3PA 4IO3A 3V5AA 4RYAA 5HPQA 1F9BA 1DPEA 3VFJA 1SDXA 1MXVA 5FHOA 5CBRA 1M5CA 4YB6A 3KN3A 4THIA 3GXAA 3W15C 5L9MA 3O29A 2IEEA 5TPAA 4POWA 3LBSA 3MVWA 5JTYB 4ZZEA 1DSNA 1MS7A 1Y3PA 1FTOA 1B0HA 1HSLA 2DQVA 3LSWA 3O97A 1B9JA 1WVJA 1B5JA 3OXNA 4F3GA 3MWBA 4NF8B 5JTYA 2ZYKA 1MDP1 2ZYNA 3K00A 3K1NA 2NWJA 1FCKA 3HPIA 4X1DA 4YICA 4ONYA 4DE8A 3L6HA 4GLIA 4KD5A 1B4HA 4NF8A 1B3HA 5F7VA 3MVYA 3RN8A 5H8QA 4IY5A 3SERA 3W9WA 5H8FA 2ANJA 3GBBA 3K1PA 1QUIA 3S9NC 4ZEFA 4HCYA 3DLNA 4LP2B 3FV2A 3E13X 1CB6A 1B7UA 2QS3A 1FTKA 3C9HA 1Y1ZA 4DCXA 3TFLA 1B52A 1A8FA 4NMYA 1SW5A 3DP8A 3FASA 1LSTA 1MQGA 1PC3A 3CSBA 1QW0A 4BDQA 4XTCQ 1ZMGA 5ITOA 5KCJA 1I6AA 3PPOA 2XXTA 1RKMA 1SI1A 3PUYE 4LUBA 1M5FA 1SYIA 5FHMA 3UGWA 4OFLA 3KEIA 3RGYA 3EHSA 3RLFE 1GVCA 3EPEA 1Y4CA 1P1WA 1B1HA 4U21A 2CMOA 1NNFA 1IXIA 3C34A 4TLMB 4G4PA 2YPNA 2CZLA 1FQEA 4QSEA 2I3VA 3T22A 2ZYMA 4P0IA 2DSFA 3HSTA 3RY3A 3DM0A 3E3KA 2UXAA 3EQ1A 3IJOB 3CRBA 4RJZA 4DDDA 4FATA 3KG2A 4DZ1A 1A8EA 4OERA 5H8SA 4ECFA 1T0KA 5FTHA 3KBRA 4NEDA 3V89B 2DWHA 2ESNA 4EXLA 1SW1A 3RQTA 3MPLA 1QKAA 4MLVA 5F1QA 2QS4A 2I49A 1QVSA 4F2QA 4GVOA 5A5XB 4H6DA 5K2XA 3H6VA 5CMCA 3KOSA 3TCFA 2XXXA 2VP1A 3CVGA 2O1LA 4NF5B 2A5TA 4PFTA 1NFTA 1RYOA 1IUDA 1N7XA 1B40A 2F97A 3O9PA 4LA9A 3MP8A 4C1UA 4IO2A 4FORA 3PMVA 1FQCA 3S9EA 3CG1A 3THIA 4IGTA 2FYIA 4G8MA 4OZ9A 3FD3A 3PPPA 3R7XA 2H98A 1VSOA 4R9GA 2F7AA 4TLLB 4R72A 1O64A 4X48A 4IGRA 5BUUA 4RK9A 2V93A 2AL4A 2I3WA 2OWSA 4IB2A 3H3GA 3JV9A 4MLQA 4KCCA 3ECRA 3FIRA 1PB9A 3UP9A 3RTWB 3WAEA 3SDFA 3U92A 1RYXA 2ZNTA 3OSQA 3HHFA 1OVBA 3MW0A 2UVJA 5I57A 2DXRA 2RKMA 4ZDMA 5AE4A 1P1OA 3FJ7A 1ATGA 1YTVA 3TPAA 4NF6A 2XD2A 2P0SA 3B7DA 3O66A 1OVTA 3N26A 1MXWA 2Z8EA 3A3UA 3U72A 3HV1A 4YMAA 1LBBA 4ZE8A 4F18A 3K2DA 4PQJA 4GRKA 3C35A 3IOTA 3GZGA 2O7UA 2F8DA 3QXMA 4I8CA 3QAXA 3Q26A 4Q8RA 1UTHA 4EQ7A 5CC2A 4OYVA 4I1DA 2NXOA 3TEPA 3VE1B 1GGGA 4FJPA 1UIVA 3EF7A 4OQOA 4WXJA 4OFJA 5I2KA 3TODA
chains in the Genus database with same CATH superfamily
3CFZA 3TTMA 3OO9A 1B4ZA 3M3KA 1XVXA 1OQHA 2PYYA 1MQDA 5I2NB 1OIBA 1OLAA 1B51A 3K6WA 4ZEBA 3CFLA 4R6HA 3MAMA 5FHNA 4MHFA 5ITPA 4ZECA 3FXQA 4F3BA 4QFKA 1FPEA 3IOVA 2VHAA 4EF1A 2RC7A 3IOUA 1YZ0A 3K0VA 3K6VA 1SI0A 4EQBA 2X26A 1H76A 3GBAA 2R71A 1I69A 3MBPA 1EYKA 1DTGA 2UVGA 4U4XA 4ELRA 5J1DA 1PBPA 1YXIA 5DYHA 3ISPA 2XX9A 1MY4A 3TELA 4O3BA 1LAXA 4MNCA 3T96B 2ZZVA 4R9FA 4U2RA 4RA1A 2HXWA 4KQPA 4MEVA 4OANA 1VE4A 4IO7A 4ND9A 4PFWA 3ZKLA 1JW4A 2Y7KA 1S7YA 1ANFA 3FVOA 4C0RA 1RDZA 2V3TA 3FUZA 1GTKA 3CFXA 2R8TA 4NG7A 3PD9A 2D3IA 1YYZA 2H99A 1MM7A 4XF5A 2I48A 2F35A 4GX3A 4KYEA 2V4CA 1SVXB 1EU8A 1LBYA 2DWIA 1B05A 4FEBA 2KLFA 4OVRA 3AXFA 3E78A 3S2VA 1PB8A 1YAEA 1IMCA 3K6UA 1JETA 4H46A 3KGCA 2Y7IA 3IB2A 1BTJA 2DP8A 3C36A 2FA7A 1MXUA 5EYFA 1H44A 1ZJLA 1FPGA 5IZZA 4GWWA 4LZ8A 3PPQA 1FPIA 2REGA 2XXKA 3T66A 1BK4A 4EXKA 5DW8A 1FJ6A 3GLBA 4EQ9A 4Z7EA 1JW1A 3U94A 4RK2A 2XD3A 3UORA 4OFOA 1FQAA 2QFLA 4PFUA 3KC1A 2F3BA 1FW0A 1MM6A 3HN0A 5I7IA 3SEXA 4FIMA 2Z8FA 4R6YA 3FJMA 5AA4B 4R6KA 4MF3A 4QHQA 3T9XB 1VR5A 2VGQA 3PUWE 3CG3A 2HEUA 4EDPA 1FRPA 2ZNUA 1FJ9A 3A09A 2WYPA 1LEVA 4WKMA 3IR1A 1LCFA 3WAFA 5AA4A 3MVXA 1MH3A 5IZ1A 2GHAA 2THIA 1UQWA 1LFIA 2OK2A 1Z7ME 4QFOA 3JYRA 3VLVA 1TT1A 3U93A 3S9LC 4TOZA 1LFGA 1LGBC 1JQFA 1KA1A 3G3FA 4BDOA 1JVXA 1NUWA 5H8QB 4F39A 2Q74A 5H8FB 2XWIA 1DCUA 2DE4A 1MQHA 3G3HA 4RXLA 1NKXA 4BDNA 1A7LA 3SEVA 4XKRA 3D4GA 1P1NA 4G8HA 4NTLA 4G61A 5DVIA 2F36A 1B3EA 2I0CA 1R9QA 3O6GA 4C1TA 2D5WA 3LUZA 2OJTA 4N6KA 4JWOA 3O6IA 1GV8A 3VXCA 1NUYA 2O51A 3CI8A 2XX7A 4DIGA 1RDXA 1ELJA 2DE2A 2ONRA 2ZXTA 3C32A 5FBPA 4OVPA 2XXVA 3N5LA 5CMBA 1QKBA 2KQZA 2UVIA 4U22A 5KCJB 3FV1A 2VPNA 2QS1A 3IO4A 2WBBA 3IOWA 4HXVA 4H45A 4OEVA 5JEIA 1S9TA 5ICTA 1JEVA 1OQGA 4P1EA 2Z22A 1MPDA 2QJEA 3G3JA 4LQ2A 1B32A 4O3AA 2VT5A 1QJMA 1EZ9A 1IIWA 2WEFA 5AA2A 3IFAA 4NWDA 4HW8A 5DVJA 5IZ3B 1SBPA 1LLSA 2ABHA 2HCAA 4R73A 4I40A 2F78A 2DYXA 3OD7A 1US4A 1XI6A 3RPWA 3PMWA 3K6XA 2B65A 1NV7A 5I59A 3T9HB 3MJNA 4F22A 1XC1A 2HPGA 5ICQA 4UACA 1A55A 1B3FA 3PD8A 1EZOA 2CEYA 4H67A 2XX8A 5CBSA 1G0IA 2VD2A 3OO8A 4FE8A 5TP9A 4PFIA 3G3IA 2PMSA 1FTAA 4OWDA 1NV0A 2B3FA 3Q29A 2PT2A 1D9VA 4RPNA 3MP1A 4F3SA 2WBDA 3S4UA 4DXBA 2LAOA 1WODA 2VPOA 2XWOA 4LN5A 4DXUA 4ZZAA 5ISUA 1SQYA 1TXFA 1FPJA 1MXZA 4U4SA 4WEPA 1NL5A 2XWKA 2A5TB 2NOOA 4QXDA 4M4GA 5DTBA 4BLAA 1ZIUA 4NAPA 2XA5A 1N76A 2RF1A 2QPQA 3CIJA 5EHSA 3MVZA 4O8MA 3MC2A 1AMFA 3PV0E 2CEXA 2VD3A 1DPPA 1I6QA 4P56A 3HHGA 2ZMBA 3TTKA 1LCTA 3KJ7A 3MZ1A 3RPLB 1QULA 1LBWA 2PVUA 2ALUA 1ZBMA 3IAZA 3SEWA 4EF2A 4O94A 4PFYA 5KDTB 1URGA 5H8HB 1USYE 3FXBA 4UABA 5H8NA 3ILUB 4DXCA 2Q89A 4NWCA 1NNPA 4KI0E 5A5LA 2QSXA 5CMKA 2O84X 3LV0A 2WKYA 5KDTA 5H8HA 4H5GA 1AL3A 3PPNA 4MIJA 1OMPA 3FXRA 4GXSB 4X1BA 2GRVA 2O1MA 2Q2CA 4KFQA 2H5YA 2RC9A 4F1VA 4N81A 5I57B 1Y4TA 2DVZA 1P1UA 1SW4A 2I58A 3VLWA 2X7QA 2ZNSA 4F1YA 4OXVA 1Y3QA 1NUZA 2BJJX 1BP5A 4NF6B 2QVUA 1A54A 1WDNA 4UA8A 3H6WA 2FNCA 2XXPA 4RNSA 3C4MA 1B2HA 5HM4B 5I58A 5IAIA 3K02A 3H06B 4U1OA 1N0TA 4PAFA 1AH5A 4GIZA 1MQJA 3PMXA 4U23A 1B3GA 4MX6A 1KZ8A 2QVVA 4GX6A 1MQIA 4MAGA 3ODBA 2GFEA 1QGXA 2HQ0A 1UTHB 4AB6A 3VV5A 5DEXB 4YAHX 4F29A 4IY6A 1MY3A 1O63A 3HCQA 3TTRA 1FBDA 2I0BA 3OEMA 3FVGA 1K9YA 5I2KB 3N6TA 4KCDA 2Q8JA 4Z0IA 3K1MA 1OLCA 1A40A 1JVYA 4QRZA 4AS4A 4BDLA 3VVDA 3IX1A 5DEXA 3G3KA 4FAJA 3S9MC 3FJGA 2RCBA 4Q30B 4ELOA 1UIUA 1FQFA 3MUQA 2G93A 4X9TA 4OETA 3T9UA 4YMBA 3RUMA 4JDFA 3QYTA 3CSGA 3IB0A 1Y3NA 4Q0CA 3BKIB 2RINA 3BFUA 3TQWA 3BFTA 4NE4A 5I56B 1LBCA 1TWYA 1LB8A 1FPLA 2I4BA 1FTLA 2Z23A 1EZPA 1YPNA 2Y7WA 1R9LA 3ZSFA 4NN3A 5DVFA 2PT1A 4O3CA 4P8BA 3T93B 4P11A 5I84A 2CZKA 4PAIA 4HE0A 1VFDA 2DWAA 3E9XA 1UTBA 1J1NA 4N13A 5I56A 1R6ZA 1D9QA 4YU0A 2Y5KA 1MY0A 2DS9A 1GR2A 1B7HA 3CR9A 3O6HA 3TAJA 4NF4B 1SW2A 1BIYA 4ZS9A 3T9VA 4GWOA 2Y5LA 2V25A 2VOZA 4OMBA 1MPCA 4N8YA 2QS2A 1A99A 3F11A 3G3GA 1XS5A 5B7DA 2Y7PA 1FPBA 1DTZA 3N6UA 3SKPA 4KPTA 4NF4A 4QSDA 5L9SA 5CM6A 2OZZA 1B1XA 1LB9A 1JW5A 2R9JA 1FPDA 4GQOA 1CNQA 1DK4A 3I5OA 3NOHA 5B70A 4GX4A 3TTNA 2OBGA 4E0WA 4YKKA 3H4ZA 4PP0A 3B50A 1B6HA 1M5DA 4JVIA 4JXIA 1IEJA 5HBCA 4IO6A 3LUYA 3TKDA 1Y9UA 3IFCA 2XXHA 4JBZA 5FTIA 2I6EA 1MXXA 5KZTA 3W9VA 1II5A 4ELPA 2B3BA 3M8UA 2QMWA 2DVCA 3EHTA 3SZPA 3K01A 2AYSA 3MSTA 3TQLA 4AB5A 4I3EA 1O7TA 4WEDA 1XOCA 3SESA 4E0XA 3I6VA 4P47A 3VXBA 2FHYA 3M3LA 4GD5A 1Q35A 1PB7A 3IORA 3H6UA 5J16A 4XKNA 4MJOA 1XT8A 4I3YA 3SETA 2FIEA 1VFEA 2BJIA 2O69A 2E1SA 1CE2A 1MY1A 1PDAA 5DT6A 1INPA 3A3CA 1ZTYA 4JWYA 3V8XB 1IQ7A 4OHNA 1N7WA 4PAKA 1BKAA 2CZIA 5CI5A 4G68A 1URDA 4G2ZA 1D4NA 4KXPA 5ELVA 3OENA 2B4MA 4YB7A 4RY1A 3USDA 1N04A 3ROJA 2XXIA 1B7ZA 3TTLA 3FGSA 2H4IA 1IXHA 4F2OA 2PCRA 2HZKA 1FPFA 4TQUQ 3N94A 2GH9A 4LQ5A 2IA4A 4HCWA 2B4LA 2XWVA 2F7BA 1ZLQA 1XHYA 5AA2D 1FBCA 3DP4A 1NV5A 3IO6A 2OLBA 4MNPA 4YKPA 4GOTA 3E4RA 3H03A 3P7IA 2Q88A 1S50A 3UIFA 1H3DA 3CHGA 2ZZXA 4DI3D 2A5SA 2FIXA 3D4CA 5LDZA 2X7PA 4QF9A 4XFEA 3RNNA 3MZBA 3VDFA 1NI9A 1M5EA 2XXUA 4N6DA 4JVDA 1Z7NE 1LAGE 4G68C 4XXUA 4ZEDA 1KWHA 1B3LA 3FXUA 5EHMA 5IKBA 3BIGA 4GL0A 3E79A 1MG1A 5AA2B 3PUVE 4YKJA 2QL3A 2V3UA 2V3QA 1M5BA 3OMBA 3Q27A 1AIVA 4HE2A 4PE5B 4PDHA 4ELQA 3R6UA 4OESA 4H0WA 2D21A 2W7YA 4HS7A 4X8RA 5I59B 3IK6B 3Q25A 1DMBA 3DELB 5EYGA 5ET5A 4GXAA 2P1SA 3KN7A 3KSJA 2QRYA 3QIMA 1POTA 3QK6A 2XXRA 1LBXA 3L6GA 3O28A 4NHBA 4H8IA 4I9DA 2O6AA 4PFRA 5EQAA 3OO7A 5TP9B 1FBPA 1JNFA 1FTJA 4DCYA 1YCJA 4FEDA 4PF8A 2HAUA 1DOTA 2Z8DA 3LSFB 3OELA 5ET7A 3PUXE 2HZLA 2RC8A 2UVHA 3OOAA 4OENA 1NMUA 1LFHA 3TCHA 4GBVA 4LONB 3QUJA 3PPRA 4L17A 4O7MA 5IM2A 2AL5A 2DOJA 4KYSA 4ZEKA 1NV2A 1ZKBA 1QUJA 1IXCA 1NUXA 1B58A 1MRPA 3LR1A 5EQ7A 2OWTA 3RTFB 4POXA 2UYEA 4F31B 4ISUA 1B5IA 4ZEIA 3ONMA 3O2AA 4R74A 4OVJA 3R26A 4YB5A 2WYKA 2PX1A 1B0LA 2FBPA 2DXYA 2F6GA 1EYIA 1HSJA 5EQ9A 2P3VA 4PTKA 1BLFA 4N15A 4LATA 3TDJA 2F3DA 4PGNA 2F5XA 2O68A 3IJXB 3TCGA 2NUVA 3TUSA 2OX3A 4Q5TA 2YLNA 3LSLA 3B6WA 4H1XA 1G0HA 4XIGQ 3T0JA 2XHDA 5H8NB 1URSA 1B5HA 3OSRA 4XKQA 1N3XA 2XXQA 1H43A 2GHBA 3PTYA 4OEUA 3RT6B 3HO7A 4MNIA 4FECA 3C33A 4GF8A 2UYFA 3MP6A 4NF0A 4AQ4A 4LZ7A 1EH3A 4PGPA 4BDMA 1POY1 5A5XA 4H8JA 3FZVA 4ZE9A 1RDYA 1XVYA 3RT8A 4KHZE 2Y84A 4NF5A 4ESXA 1SD3A 2KR0A 4GWYA 4JSDA 1MPBA 2H9BA 3QSLA 1PBQA 2Q9TA 4XEQA 5I58B 5I3SA 1FQBA 4U1ZA 2WX9A 2L5VA 1I6BA 4MBPA 4PF6A 3IL1B 1D9YA 3TYHA 4EUOA 3VLUA 4H5FA 4R2FA 3UA8A 1TFDA 5TU0A 1AOVA 3PUZE 1LAHE 2ZYOA 3MPKA 4OA4A 1NNTA 1IZ1A 3QUFA 1SYHA 2PBWA 4GFRA 2R6GE 3UK4A 3ZKKA 1FTMA 2QMXA 4HTGA 2P3NA 3TMGA 4PE3A 3LSXA 2HAVA 2DWJA 4PETA 5AA3A 1Y1MA 4DLDA 1FQDA 4GWUA 2F7CA 1Q1KA 1US5A 3M3FA 1JEUA 2CZHA 1Y20A 3KOTA 5JK4A 3OO6A 3HFUA 3G7WA 2AIXA 1FBGA 2ONSA 1MXYA 2HHMA 3KSXA 4P0GA 2NVUB 2E0SA 3B6TA 4OTEA 3MQ9A 1NNKA 3IB1A 3OEKA 2FVZA 3U65A 2OCUA 1JP4A 1USYH 1LAFE 1NV1A 3BIHA 4JSOA 3LC8A 1FPKA 3V83A 1NV3A 3PU5A 3FVKA 4MCOA 5CMMA 1UTBB 4F19A 1QUKA 4IO5A 4JB7A 5AA1A 4GWZA 1IXGA 4BDRA 4GL8A 5LOMA 4JWXA 1P1QA 1MY2A 3C31A 4G8NA 1R1NA 3BBRA 1SPIA 1IMDA 4I62A 3U8QA 1D3KA 4LVQA 4R75A 1NV6A 4MFIA 3TZAA 5L8DA 1IMAA 1TFAA 5M2VA 4K3FA 1HSEA 1VDWA 4YZZA 2G29A 1B46A 2F6PA 4KYDA 5I2NA 3EN3A 3KFMA 2F34A 3K4UA 3H7MA 3JZJA 4G77A 4QFPA 4N91A 3PGFA 4MH5A 3SEUA 3Q28A 4XKPA 2REJA 2Y7RA 2YJPA 3D1RA 1MDQA 3GYYA 4N07A 4PCDA 3ILTB 2HFBA 3I3VA 5K2YA 4QSCA 3U1OA 2RCAA 3SEYA 2H25A 4KR5A 4R2BA 2O7IA 4YKIA 1IITA 4LZ5A 4RPOA 2I4CA 2XXWA 4ESWA 4O7IA 4N6PA 5ESYA 5CRYA 2XXYA 4IO4A 1NH7A 4QFNA 1ZU0A 3B6QA 3ZS6A 1IMBA 1NH8A 2ONKE 3DP6A 3VVEA 4GWXA 4N4UA 1N84A 1P99A 3KZGA 3EHUA 3KJTA 3FVNA 2V84A 5I5PA 4OVTA 2PFZA 3H6TA 4H65A 1KA0A 5L9OA 4PBQA 2MKZA 2P2AA 3KN8A 2M8CA 3VVFA 2DE3A 4M1VA 4OVSA 3MZ9A 1H45A 5BWJA 2Q2AA 1L5TA 1MH4A 1N3WA 3FATA 4F1UA 3UN6A 1PEBA 4QFLA 4G68B 5TPAB 4F3PA 4IO3A 1FSAA 3V5AA 4RYAA 5HPQA 1F9BA 1DPEA 3VFJA 1SDXA 2JJKA 1MXVA 5FHOA 5CBRA 2QVRA 1M5CA 4YB6A 3KN3A 1Q9DA 4THIA 3GXAA 3W15C 5L9MA 3O29A 4PFBA 2IEEA 5F24A 4POWA 5TPAA 3LBSA 3MVWA 5JTYB 4ZZEA 4FBPA 2DDKA 3KBZA 1K9ZA 1DSNA 2OWZA 1MS7A 3QMFA 1FBHA 1Y3PA 1FTOA 3EKIA 1B0HA 1HSLA 2DQVA 3LSWA 3O97A 1B9JA 1WVJA 1B5JA 3OXNA 4P3LA 4F3GA 3MWBA 4NF8B 5JTYA 2ZYKA 1MDP1 2ZYNA 3K00A 3K1NA 4JVCA 2NWJA 1FCKA 3HPIA 4X1DA 5EYHA 1FBFA 4YICA 4ONYA 4DE8A 3L6HA 4GLIA 4KD5A 1B4HA 4NF8A 1B3HA 5F7VA 3MVYA 3A29A 2GQ1A 3RN8A 5H8QA 5ET6A 4IY5A 3SERA 3W9WA 5H8FA 2ANJA 3GBBA 3K1PA 1QUIA 3S9NC 4ZEFA 4HCYA 3DLNA 4N17A 4LP2B 3FV2A 3E13X 1CB6A 1B7UA 3FBPA 4PC9A 2QS3A 1FTKA 3C9HA 1Y1ZA 4DCXA 3TFLA 1B52A 1A8FA 4NMYA 1SW5A 3DP8A 3FASA 1LSTA 1MQGA 1PC3A 3CSBA 1QW0A 4BDQA 4P1LA 1ZMGA 4XTCQ 5ITOA 4X04A 5KCJA 1I6AA 3PPOA 2XXTA 3B8BA 4P9KA 1RKMA 1SI1A 3PUYE 4LUBA 1M5FA 1SYIA 5FHMA 3UGWA 4OFLA 4PBHA 2PFYA 3KEIA 3RGYA 3EHSA 3RLFE 1GVCA 3EPEA 1Y4CA 1P1WA 1B1HA 4U21A 5IZ3A 2CMOA 1NNFA 1IXIA 3C34A 4TLMB 4G4PA 2YPNA 2CZLA 1FQEA 2Q8MA 4QSEA 2I3VA 3T22A 2ZYMA 4P0IA 2DSFA 3HSTA 3RY3A 3DM0A 3E3KA 2UXAA 3EQ1A 3IJOB 3CRBA 4RJZA 5IGAA 4DDDA 4MMPA 4FATA 3KG2A 4NQ8A 4DZ1A 1A8EA 4OERA 5H8SA 4ECFA 1T0KA 5FTHA 3KBRA 4NEDA 3V89B 2DWHA 2ESNA 4EXLA 1SW1A 3RYDA 5EQ8A 3RQTA 3MPLA 1QKAA 4MLVA 3MYUA 5F1QA 2QS4A 4GWSA 2I49A 1QVSA 4F2QA 4GVOA 5A5XB 4H6DA 5K2XA 3H6VA 5CMCA 2HXRA 3KOSA 3TCFA 2XXXA 1IMEA 2VP1A 3CVGA 2O1LA 4NF5B 2A5TA 4PFTA 1NFTA 1RYOA 5ET8A 1IUDA 5LTCA 1N7XA 4IR8A 1B40A 2F97A 3O9PA 4LA9A 3MP8A 4C1UA 5T3JA 4IO2A 1IMFA 4FORA 3PMVA 1FQCA 3S9EA 3CG1A 4GBWA 4IGTA 3THIA 2FYIA 4G8MA 4OZ9A 3FD3A 3RPLA 3PPPA 4QBAA 3R7XA 2H98A 1VSOA 1EYJA 4R9GA 2F7AA 4DI4B 4TLLB 4R72A 1O64A 4X48A 4IGRA 5BUUA 4RK9A 2V93A 2AL4A 2I3WA 2OWSA 4PDDA 4IB2A 3H3GA 3JV9A 4MLQA 4KCCA 3ECRA 3FIRA 1PB9A 3UP9A 3RTWB 3WAEA 1NV4A 3SDFA 3T1BA 3U92A 1RYXA 2ZNTA 2ZZWA 3OSQA 3HHFA 1OVBA 3MW0A 4AS5A 2UVJA 5I57A 2DXRA 1LBVA 2RKMA 4ZDMA 5AE4A 1P1OA 3FJ7A 4NGUA 1ATGA 1YTVA 3TPAA 4NF6A 2XD2A 3KC0A 1LBZA 2P0SA 3B7DA 3O66A 1OVTA 1DBZA 3N26A 1MXWA 2Z8EA 4HE1A 3A3UA 3U72A 3HV1A 4YMAA 1LBBA 4ZE8A 4F18A 3K2DA 4PQJA 4GRKA 3C35A 3IOTA 3GZGA 2O7UA 2F8DA 1FBEA 3QXMA 4I8CA 3QAXA 3Q26A 4Q8RA 1AWBA 1UTHA 4EQ7A 4N8GA 5CC2A 4OYVA 4I1DA 2NXOA 3TEPA 3VE1B 1GGGA 4FJPA 1UIVA 3EF7A 4NX1A 4OQOA 4WXJA 4OFJA 5I2KA 4OVQA 3TODA
chains in the Genus database with same CATH topology
3CFZA 3TTMA 3OO9A 1B4ZA 3M3KA 1XVXA 1OQHA 2PYYA 1MQDA 5I2NB 1OIBA 1OLAA 1B51A 3K6WA 4ZEBA 3CFLA 4R6HA 3MAMA 5FHNA 5ITPA 4ZECA 3FXQA 4F3BA 4QFKA 3IOVA 2VHAA 4EF1A 2RC7A 3IOUA 3K0VA 3K6VA 1SI0A 4EQBA 2X26A 1H76A 3GBAA 2R71A 1I69A 3MBPA 1DTGA 2UVGA 4U4XA 4ELRA 5J1DA 1PBPA 5DYHA 2XX9A 1MY4A 3TELA 4O3BA 1LAXA 3T96B 4R9FA 4U2RA 4RA1A 2HXWA 4KQPA 1VE4A 4IO7A 4ND9A 4PFWA 3ZKLA 1JW4A 2Y7KA 1S7YA 1ANFA 3FVOA 4C0RA 2V3TA 3FUZA 1GTKA 3CFXA 3PD9A 2D3IA 2H99A 1MM7A 2I48A 2F35A 4KYEA 1SVXB 1EU8A 2DWIA 1B05A 4FEBA 2KLFA 3AXFA 3S2VA 1PB8A 1YAEA 3K6UA 1JETA 3KGCA 2Y7IA 3IB2A 1BTJA 2DP8A 3C36A 2FA7A 1MXUA 5EYFA 1H44A 1ZJLA 4LZ8A 3PPQA 2REGA 3T66A 4EXKA 3GLBA 4EQ9A 4Z7EA 1JW1A 3U94A 4RK2A 2XD3A 3UORA 4OFOA 1FQAA 4PFUA 1FW0A 1MM6A 3HN0A 3SEXA 4FIMA 2Z8FA 4R6YA 3FJMA 5AA4B 4R6KA 4MF3A 4QHQA 3T9XB 1VR5A 2VGQA 3PUWE 3CG3A 2HEUA 4EDPA 2ZNUA 3A09A 4WKMA 3IR1A 1LCFA 3WAFA 5AA4A 3MVXA 1MH3A 2GHAA 2THIA 1UQWA 1LFIA 2OK2A 1Z7ME 4QFOA 3JYRA 3VLVA 1TT1A 3U93A 3S9LC 4TOZA 1LFGA 1LGBC 1JQFA 3G3FA 4BDOA 1JVXA 5H8QB 4F39A 5H8FB 2DE4A 1MQHA 3G3HA 4RXLA 1NKXA 4BDNA 1A7LA 3SEVA 4XKRA 3D4GA 1P1NA 4G8HA 4NTLA 5DVIA 2F36A 1B3EA 2I0CA 1R9QA 3O6GA 4C1TA 2D5WA 2OJTA 4JWOA 3O6IA 1GV8A 3VXCA 2O51A 3CI8A 2XX7A 4DIGA 1ELJA 2DE2A 2ONRA 2ZXTA 3C32A 2XXVA 3N5LA 5CMBA 1QKBA 2UVIA 4U22A 5KCJB 3FV1A 2QS1A 3IO4A 3IOWA 4OEVA 5JEIA 1S9TA 5ICTA 1JEVA 1OQGA 2Z22A 1MPDA 2QJEA 3G3JA 4LQ2A 1B32A 4O3AA 1QJMA 1EZ9A 1IIWA 5AA2A 4NWDA 4HW8A 5DVJA 1SBPA 1LLSA 2ABHA 2HCAA 4R73A 2F78A 2DYXA 3OD7A 1US4A 3RPWA 3PMWA 3K6XA 2B65A 5I59A 3T9HB 3MJNA 4F22A 1XC1A 5ICQA 4UACA 1A55A 1B3FA 3PD8A 1EZOA 4H67A 2XX8A 5CBSA 2VD2A 3OO8A 4FE8A 5TP9A 3G3IA 2PMSA 4OWDA 2B3FA 3Q29A 2PT2A 1D9VA 4RPNA 3MP1A 4F3SA 3S4UA 4DXBA 2LAOA 1WODA 4DXUA 4ZZAA 5ISUA 1SQYA 1TXFA 1MXZA 4U4SA 4WEPA 1NL5A 2A5TB 2NOOA 4M4GA 5DTBA 4BLAA 1ZIUA 1N76A 2RF1A 2QPQA 3CIJA 5EHSA 3MVZA 3MC2A 1AMFA 3PV0E 2VD3A 1DPPA 1I6QA 3HHGA 2ZMBA 3TTKA 1LCTA 3KJ7A 3MZ1A 1QULA 2PVUA 2ALUA 1ZBMA 3IAZA 3SEWA 4EF2A 4PFYA 5KDTB 1URGA 5H8HB 1USYE 5H8NA 3ILUB 4DXCA 2Q89A 4NWCA 1NNPA 4KI0E 2QSXA 5CMKA 2O84X 2WKYA 5KDTA 5H8HA 4H5GA 1AL3A 3PPNA 1OMPA 3FXRA 4GXSB 4X1BA 2GRVA 2O1MA 2Q2CA 4KFQA 2H5YA 2RC9A 4F1VA 5I57B 1Y4TA 2DVZA 1P1UA 1SW4A 2I58A 3VLWA 2X7QA 2ZNSA 4F1YA 4OXVA 1Y3QA 2BJJX 1BP5A 4NF6B 1A54A 1WDNA 4UA8A 3H6WA 2FNCA 2XXPA 4RNSA 3C4MA 1B2HA 5HM4B 5I58A 5IAIA 3K02A 3H06B 4U1OA 1N0TA 1AH5A 4GIZA 1MQJA 3PMXA 4U23A 1B3GA 1MQIA 3ODBA 2GFEA 2HQ0A 1UTHB 4AB6A 3VV5A 5DEXB 4YAHX 4F29A 4IY6A 1MY3A 1O63A 3HCQA 3TTRA 2I0BA 3OEMA 3FVGA 5I2KB 3N6TA 4KCDA 2Q8JA 4Z0IA 3K1MA 1OLCA 1A40A 1JVYA 4QRZA 4BDLA 3VVDA 3IX1A 5DEXA 3G3KA 4FAJA 3S9MC 3FJGA 2RCBA 4Q30B 4ELOA 1UIUA 1FQFA 3MUQA 2G93A 4X9TA 4OETA 3T9UA 4YMBA 3RUMA 4JDFA 3QYTA 3CSGA 3IB0A 1Y3NA 4Q0CA 3BKIB 2RINA 3BFUA 3TQWA 3BFTA 4NE4A 5I56B 1LBCA 1TWYA 1LB8A 2I4BA 1FTLA 2Z23A 1EZPA 1YPNA 2Y7WA 1R9LA 3ZSFA 5DVFA 2PT1A 4O3CA 3T93B 4P11A 5I84A 1VFDA 2DWAA 3E9XA 1UTBA 1J1NA 4N13A 5I56A 1R6ZA 4YU0A 1MY0A 2DS9A 1GR2A 1B7HA 3CR9A 3O6HA 3TAJA 4NF4B 1SW2A 1BIYA 4ZS9A 3T9VA 4GWOA 2V25A 2VOZA 4OMBA 1MPCA 2QS2A 1A99A 3F11A 3G3GA 1XS5A 5B7DA 2Y7PA 1DTZA 3N6UA 3SKPA 4KPTA 4NF4A 4QSDA 5L9SA 5CM6A 2OZZA 1B1XA 1LB9A 1JW5A 2R9JA 4GQOA 3I5OA 5B70A 3TTNA 2OBGA 4E0WA 4YKKA 3H4ZA 4PP0A 1B6HA 1M5DA 4JXIA 1IEJA 5HBCA 4IO6A 3LUYA 3TKDA 1Y9UA 2XXHA 4JBZA 5FTIA 2I6EA 1MXXA 5KZTA 3W9VA 1II5A 4ELPA 2B3BA 3M8UA 2QMWA 2DVCA 3EHTA 3K01A 2AYSA 3TQLA 4AB5A 1O7TA 4WEDA 1XOCA 3SESA 4E0XA 3I6VA 3VXBA 3M3LA 4GD5A 1Q35A 1PB7A 3IORA 3H6UA 4XKNA 1XT8A 3SETA 1VFEA 2O69A 2E1SA 1CE2A 1MY1A 1PDAA 5DT6A 3A3CA 1ZTYA 4JWYA 3V8XB 1IQ7A 4OHNA 1N7WA 1BKAA 5CI5A 4G68A 1URDA 4G2ZA 1D4NA 5ELVA 3OENA 4YB7A 4RY1A 3USDA 1N04A 2XXIA 1B7ZA 3TTLA 3FGSA 2H4IA 1IXHA 4F2OA 2HZKA 4TQUQ 3N94A 2GH9A 4LQ5A 2IA4A 4HCWA 2F7BA 1ZLQA 1XHYA 5AA2D 3DP4A 3IO6A 2OLBA 4YKPA 4GOTA 3E4RA 3H03A 3P7IA 2Q88A 1S50A 3UIFA 1H3DA 2A5SA 3D4CA 2X7PA 4QF9A 3RNNA 3MZBA 3VDFA 1M5EA 2XXUA 1Z7NE 1LAGE 4G68C 4XXUA 4ZEDA 1KWHA 5EHMA 1B3LA 3FXUA 5IKBA 4GL0A 1MG1A 5AA2B 3PUVE 4YKJA 2QL3A 2V3UA 2V3QA 1M5BA 3OMBA 3Q27A 1AIVA 4PE5B 4ELQA 3R6UA 4OESA 4H0WA 2D21A 2W7YA 4HS7A 5I59B 3IK6B 3Q25A 1DMBA 3DELB 4GXAA 2P1SA 3KN7A 3KSJA 2QRYA 3QIMA 1POTA 3QK6A 2XXRA 3L6GA 3O28A 4H8IA 4I9DA 2O6AA 3OO7A 5TP9B 1JNFA 1FTJA 4DCYA 1YCJA 4FEDA 2HAUA 1DOTA 2Z8DA 3LSFB 3OELA 3PUXE 2HZLA 2RC8A 2UVHA 3OOAA 4OENA 1NMUA 1LFHA 3TCHA 4LONB 3QUJA 3PPRA 4L17A 2AL5A 2DOJA 4KYSA 4ZEKA 1ZKBA 1QUJA 1IXCA 1B58A 1MRPA 3LR1A 2OWTA 3RTFB 4POXA 2UYEA 4F31B 4ISUA 1B5IA 4ZEIA 3ONMA 3O2AA 4R74A 4OVJA 3R26A 4YB5A 2PX1A 1B0LA 2DXYA 2F6GA 1HSJA 1BLFA 4LATA 3TDJA 2F5XA 2O68A 3IJXB 3TCGA 2NUVA 3TUSA 4Q5TA 2YLNA 3LSLA 3B6WA 4H1XA 4XIGQ 2XHDA 5H8NB 1URSA 1B5HA 3OSRA 4XKQA 1N3XA 2XXQA 1H43A 2GHBA 4OEUA 3RT6B 3HO7A 4FECA 3C33A 4GF8A 2UYFA 3MP6A 4AQ4A 4LZ7A 1EH3A 4BDMA 1POY1 5A5XA 4H8JA 3FZVA 4ZE9A 1XVYA 3RT8A 4KHZE 2Y84A 4NF5A 4ESXA 1SD3A 4JSDA 1MPBA 2H9BA 3QSLA 1PBQA 2Q9TA 5I58B 1FQBA 4U1ZA 1I6BA 4MBPA 3IL1B 1D9YA 3TYHA 4EUOA 3VLUA 4H5FA 4R2FA 3UA8A 1TFDA 5TU0A 1AOVA 3PUZE 1LAHE 2ZYOA 3MPKA 1NNTA 1IZ1A 3QUFA 1SYHA 2PBWA 4GFRA 2R6GE 3UK4A 3ZKKA 1FTMA 2QMXA 4HTGA 3TMGA 3LSXA 2HAVA 2DWJA 4PETA 5AA3A 1Y1MA 4DLDA 1FQDA 2F7CA 1Q1KA 1US5A 3M3FA 1JEUA 1Y20A 3KOTA 5JK4A 3OO6A 3G7WA 2AIXA 2ONSA 1MXYA 3KSXA 4P0GA 2NVUB 2E0SA 3B6TA 4OTEA 3MQ9A 1NNKA 3IB1A 3OEKA 2OCUA 1USYH 1LAFE 4JSOA 3LC8A 3V83A 3PU5A 3FVKA 5CMMA 1UTBB 4F19A 1QUKA 4IO5A 4JB7A 5AA1A 1IXGA 4BDRA 4GL8A 5LOMA 4JWXA 1P1QA 1MY2A 3C31A 4G8NA 1R1NA 3BBRA 4I62A 3U8QA 1D3KA 4LVQA 4R75A 4MFIA 3TZAA 5L8DA 1TFAA 5M2VA 4K3FA 1HSEA 4YZZA 2G29A 1B46A 2F6PA 4KYDA 5I2NA 3EN3A 3KFMA 2F34A 3K4UA 3H7MA 3JZJA 4G77A 4QFPA 3PGFA 4MH5A 3SEUA 3Q28A 4XKPA 2REJA 2Y7RA 2YJPA 1MDQA 4N07A 3ILTB 2HFBA 3I3VA 5K2YA 4QSCA 3U1OA 2RCAA 3SEYA 2H25A 4KR5A 4R2BA 2O7IA 4YKIA 1IITA 4LZ5A 4RPOA 2I4CA 2XXWA 4ESWA 4N6PA 5CRYA 2XXYA 4IO4A 1NH7A 4QFNA 1ZU0A 3B6QA 3ZS6A 1NH8A 2ONKE 3DP6A 3VVEA 1N84A 1P99A 3KZGA 3EHUA 3KJTA 3FVNA 2V84A 3H6TA 4H65A 5L9OA 2P2AA 3KN8A 2M8CA 3VVFA 2DE3A 4M1VA 3MZ9A 1H45A 5BWJA 2Q2AA 1L5TA 1MH4A 1N3WA 3FATA 4F1UA 3UN6A 1PEBA 4QFLA 4G68B 5TPAB 4F3PA 4IO3A 3V5AA 4RYAA 5HPQA 1F9BA 1DPEA 3VFJA 1SDXA 1MXVA 5FHOA 5CBRA 1M5CA 4YB6A 3KN3A 4THIA 3GXAA 3W15C 5L9MA 3O29A 2IEEA 5TPAA 4POWA 3LBSA 3MVWA 5JTYB 4ZZEA 1DSNA 1MS7A 1Y3PA 1FTOA 1B0HA 1HSLA 2DQVA 3LSWA 3O97A 1B9JA 1WVJA 1B5JA 3OXNA 4F3GA 3MWBA 4NF8B 5JTYA 2ZYKA 1MDP1 2ZYNA 3K00A 3K1NA 2NWJA 1FCKA 3HPIA 4X1DA 4YICA 4ONYA 4DE8A 3L6HA 4GLIA 4KD5A 1B4HA 4NF8A 1B3HA 5F7VA 3MVYA 3RN8A 5H8QA 4IY5A 3SERA 3W9WA 5H8FA 2ANJA 3GBBA 3K1PA 1QUIA 3S9NC 4ZEFA 4HCYA 3DLNA 4LP2B 3FV2A 3E13X 1CB6A 1B7UA 2QS3A 1FTKA 3C9HA 1Y1ZA 4DCXA 3TFLA 1B52A 1A8FA 4NMYA 1SW5A 3DP8A 3FASA 1LSTA 1MQGA 1PC3A 3CSBA 1QW0A 4BDQA 4XTCQ 1ZMGA 5ITOA 5KCJA 1I6AA 3PPOA 2XXTA 1RKMA 1SI1A 3PUYE 4LUBA 1M5FA 1SYIA 5FHMA 3UGWA 4OFLA 3KEIA 3RGYA 3EHSA 3RLFE 1GVCA 3EPEA 1Y4CA 1P1WA 1B1HA 4U21A 2CMOA 1NNFA 1IXIA 3C34A 4TLMB 4G4PA 2YPNA 2CZLA 1FQEA 4QSEA 2I3VA 3T22A 2ZYMA 4P0IA 2DSFA 3HSTA 3RY3A 3DM0A 3E3KA 2UXAA 3EQ1A 3IJOB 3CRBA 4RJZA 4DDDA 4FATA 3KG2A 4DZ1A 1A8EA 4OERA 5H8SA 4ECFA 1T0KA 5FTHA 3KBRA 4NEDA 3V89B 2DWHA 2ESNA 4EXLA 1SW1A 3RQTA 3MPLA 1QKAA 4MLVA 5F1QA 2QS4A 2I49A 1QVSA 4F2QA 4GVOA 5A5XB 4H6DA 5K2XA 3H6VA 5CMCA 3KOSA 3TCFA 2XXXA 2VP1A 3CVGA 2O1LA 4NF5B 2A5TA 4PFTA 1NFTA 1RYOA 1IUDA 1N7XA 1B40A 2F97A 3O9PA 4LA9A 3MP8A 4C1UA 4IO2A 4FORA 3PMVA 1FQCA 3S9EA 3CG1A 3THIA 4IGTA 2FYIA 4G8MA 4OZ9A 3FD3A 3PPPA 3R7XA 2H98A 1VSOA 4R9GA 2F7AA 4TLLB 4R72A 1O64A 4X48A 4IGRA 5BUUA 4RK9A 2V93A 2AL4A 2I3WA 2OWSA 4IB2A 3H3GA 3JV9A 4MLQA 4KCCA 3ECRA 3FIRA 1PB9A 3UP9A 3RTWB 3WAEA 3SDFA 3U92A 1RYXA 2ZNTA 3OSQA 3HHFA 1OVBA 3MW0A 2UVJA 5I57A 2DXRA 2RKMA 4ZDMA 5AE4A 1P1OA 3FJ7A 1ATGA 1YTVA 3TPAA 4NF6A 2XD2A 2P0SA 3B7DA 3O66A 1OVTA 3N26A 1MXWA 2Z8EA 3A3UA 3U72A 3HV1A 4YMAA 1LBBA 4ZE8A 4F18A 3K2DA 4PQJA 4GRKA 3C35A 3IOTA 3GZGA 2O7UA 2F8DA 3QXMA 4I8CA 3QAXA 3Q26A 4Q8RA 1UTHA 4EQ7A 5CC2A 4OYVA 4I1DA 2NXOA 3TEPA 3VE1B 1GGGA 4FJPA 1UIVA 3EF7A 4OQOA 4WXJA 4OFJA 5I2KA 3TODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CFZ A;  3TTM A;  3OO9 A;  1B4Z A;  3M3K A;  1XVX A;  1OQH A;  2PYY A;  1MQD A;  5I2N B;  1OIB A;  1OLA A;  1B51 A;  3K6W A;  4ZEB A;  3CFL A;  4R6H A;  3MAM A;  5FHN A;  5ITP A;  4ZEC A;  3FXQ A;  4F3B A;  4QFK A;  3IOV A;  2VHA A;  4EF1 A;  2RC7 A;  3IOU A;  3K0V A;  3K6V A;  1SI0 A;  4EQB A;  2X26 A;  1H76 A;  3GBA A;  2R71 A;  1I69 A;  3MBP A;  1DTG A;  2UVG A;  4U4X A;  4ELR A;  5J1D A;  1PBP A;  5DYH A;  2XX9 A;  1MY4 A;  3TEL A;  4O3B A;  1LAX A;  3T96 B;  4R9F A;  4U2R A;  4RA1 A;  2HXW A;  4KQP A;  1VE4 A;  4IO7 A;  4ND9 A;  4PFW A;  3ZKL A;  1JW4 A;  2Y7K A;  1S7Y A;  1ANF A;  3FVO A;  4C0R A;  2V3T A;  3FUZ A;  1GTK A;  3CFX A;  3PD9 A;  2D3I A;  2H99 A;  1MM7 A;  2I48 A;  2F35 A;  4KYE A;  1SVX B;  1EU8 A;  2DWI A;  1B05 A;  4FEB A;  2KLF A;  3AXF A;  3S2V A;  1PB8 A;  1YAE A;  3K6U A;  1JET A;  3KGC A;  2Y7I A;  3IB2 A;  1BTJ A;  2DP8 A;  3C36 A;  2FA7 A;  1MXU A;  5EYF A;  1H44 A;  1ZJL A;  4LZ8 A;  3PPQ A;  2REG A;  3T66 A;  4EXK A;  3GLB A;  4EQ9 A;  4Z7E A;  1JW1 A;  3U94 A;  4RK2 A;  2XD3 A;  3UOR A;  4OFO A;  1FQA A;  4PFU A;  1FW0 A;  1MM6 A;  3HN0 A;  3SEX A;  4FIM A;  2Z8F A;  4R6Y A;  3FJM A;  5AA4 B;  4R6K A;  4MF3 A;  4QHQ A;  3T9X B;  1VR5 A;  2VGQ A;  3PUW E;  3CG3 A;  2HEU A;  4EDP A;  2ZNU A;  3A09 A;  4WKM A;  3IR1 A;  1LCF A;  3WAF A;  5AA4 A;  3MVX A;  1MH3 A;  2GHA A;  2THI A;  1UQW A;  1LFI A;  2OK2 A;  1Z7M E;  4QFO A;  3JYR A;  3VLV A;  1TT1 A;  3U93 A;  3S9L C;  4TOZ A;  1LFG A;  1LGB C;  1JQF A;  3G3F A;  4BDO A;  1JVX A;  5H8Q B;  4F39 A;  5H8F B;  2DE4 A;  1MQH A;  3G3H A;  4RXL A;  1NKX A;  4BDN A;  1A7L A;  3SEV A;  4XKR A;  3D4G A;  1P1N A;  4G8H A;  4NTL A;  5DVI A;  2F36 A;  1B3E A;  2I0C A;  1R9Q A;  3O6G A;  4C1T A;  2D5W A;  2OJT A;  4JWO A;  3O6I A;  1GV8 A;  3VXC A;  2O51 A;  3CI8 A;  2XX7 A;  4DIG A;  1ELJ A;  2DE2 A;  2ONR A;  2ZXT A;  3C32 A;  2XXV A;  3N5L A;  5CMB A;  1QKB A;  2UVI A;  4U22 A;  5KCJ B;  3FV1 A;  2QS1 A;  3IO4 A;  3IOW A;  4OEV A;  5JEI A;  1S9T A;  5ICT A;  1JEV A;  1OQG A;  2Z22 A;  1MPD A;  2QJE A;  3G3J A;  4LQ2 A;  1B32 A;  4O3A A;  1QJM A;  1EZ9 A;  1IIW A;  5AA2 A;  4NWD A;  4HW8 A;  5DVJ A;  1SBP A;  1LLS A;  2ABH A;  2HCA A;  4R73 A;  2F78 A;  2DYX A;  3OD7 A;  1US4 A;  3RPW A;  3PMW A;  3K6X A;  2B65 A;  5I59 A;  3T9H B;  3MJN A;  4F22 A;  1XC1 A;  5ICQ A;  4UAC A;  1A55 A;  1B3F A;  3PD8 A;  1EZO A;  4H67 A;  2XX8 A;  5CBS A;  2VD2 A;  3OO8 A;  4FE8 A;  5TP9 A;  3G3I A;  2PMS A;  4OWD A;  2B3F A;  3Q29 A;  2PT2 A;  1D9V A;  4RPN A;  3MP1 A;  4F3S A;  3S4U A;  4DXB A;  2LAO A;  1WOD A;  4DXU A;  4ZZA A;  5ISU A;  1SQY A;  1TXF A;  1MXZ A;  4U4S A;  4WEP A;  1NL5 A;  2A5T B;  2NOO A;  4M4G A;  5DTB A;  4BLA A;  1ZIU A;  1N76 A;  2RF1 A;  2QPQ A;  3CIJ A;  5EHS A;  3MVZ A;  3MC2 A;  1AMF A;  3PV0 E;  2VD3 A;  1DPP A;  1I6Q A;  3HHG A;  2ZMB A;  3TTK A;  1LCT A;  3KJ7 A;  3MZ1 A;  1QUL A;  2PVU A;  2ALU A;  1ZBM A;  3IAZ A;  3SEW A;  4EF2 A;  4PFY A;  5KDT B;  1URG A;  5H8H B;  1USY E;  5H8N A;  3ILU B;  4DXC A;  2Q89 A;  4NWC A;  1NNP A;  4KI0 E;  2QSX A;  5CMK A;  2O84 X;  2WKY A;  5KDT A;  5H8H A;  4H5G A;  1AL3 A;  3PPN A;  1OMP A;  3FXR A;  4GXS B;  4X1B A;  2GRV A;  2O1M A;  2Q2C A;  4KFQ A;  2H5Y A;  2RC9 A;  4F1V A;  5I57 B;  1Y4T A;  2DVZ A;  1P1U A;  1SW4 A;  2I58 A;  3VLW A;  2X7Q A;  2ZNS A;  4F1Y A;  4OXV A;  1Y3Q A;  2BJJ X;  1BP5 A;  4NF6 B;  1A54 A;  1WDN A;  4UA8 A;  3H6W A;  2FNC A;  2XXP A;  4RNS A;  3C4M A;  1B2H A;  5HM4 B;  5I58 A;  5IAI A;  3K02 A;  3H06 B;  4U1O A;  1N0T A;  1AH5 A;  4GIZ A;  1MQJ A;  3PMX A;  4U23 A;  1B3G A;  1MQI A;  3ODB A;  2GFE A;  2HQ0 A;  1UTH B;  4AB6 A;  3VV5 A;  5DEX B;  4YAH X;  4F29 A;  4IY6 A;  1MY3 A;  1O63 A;  3HCQ A;  3TTR A;  2I0B A;  3OEM A;  3FVG A;  5I2K B;  3N6T A;  4KCD A;  2Q8J A;  4Z0I A;  3K1M A;  1OLC A;  1A40 A;  1JVY A;  4QRZ A;  4BDL A;  3VVD A;  3IX1 A;  5DEX A;  3G3K A;  4FAJ A;  3S9M C;  3FJG A;  2RCB A;  4Q30 B;  4ELO A;  1UIU A;  1FQF A;  3MUQ A;  2G93 A;  4X9T A;  4OET A;  3T9U A;  4YMB A;  3RUM A;  4JDF A;  3QYT A;  3CSG A;  3IB0 A;  1Y3N A;  4Q0C A;  3BKI B;  2RIN A;  3BFU A;  3TQW A;  3BFT A;  4NE4 A;  5I56 B;  1LBC A;  1TWY A;  1LB8 A;  2I4B A;  1FTL A;  2Z23 A;  1EZP A;  1YPN A;  2Y7W A;  1R9L A;  3ZSF A;  5DVF A;  2PT1 A;  4O3C A;  3T93 B;  4P11 A;  5I84 A;  1VFD A;  2DWA A;  3E9X A;  1UTB A;  1J1N A;  4N13 A;  5I56 A;  1R6Z A;  4YU0 A;  1MY0 A;  2DS9 A;  1GR2 A;  1B7H A;  3CR9 A;  3O6H A;  3TAJ A;  4NF4 B;  1SW2 A;  1BIY A;  4ZS9 A;  3T9V A;  4GWO A;  2V25 A;  2VOZ A;  4OMB A;  1MPC A;  2QS2 A;  1A99 A;  3F11 A;  3G3G A;  1XS5 A;  5B7D A;  2Y7P A;  1DTZ A;  3N6U A;  3SKP A;  4KPT A;  4NF4 A;  4QSD A;  5L9S A;  5CM6 A;  2OZZ A;  1B1X A;  1LB9 A;  1JW5 A;  2R9J A;  4GQO A;  3I5O A;  5B70 A;  3TTN A;  2OBG A;  4E0W A;  4YKK A;  3H4Z A;  4PP0 A;  1B6H A;  1M5D A;  4JXI A;  1IEJ A;  5HBC A;  4IO6 A;  3LUY A;  3TKD A;  1Y9U A;  2XXH A;  4JBZ A;  5FTI A;  2I6E A;  1MXX A;  5KZT A;  3W9V A;  1II5 A;  4ELP A;  2B3B A;  3M8U A;  2QMW A;  2DVC A;  3EHT A;  3K01 A;  2AYS A;  3TQL A;  4AB5 A;  1O7T A;  4WED A;  1XOC A;  3SES A;  4E0X A;  3I6V A;  3VXB A;  3M3L A;  4GD5 A;  1Q35 A;  1PB7 A;  3IOR A;  3H6U A;  4XKN A;  1XT8 A;  3SET A;  1VFE A;  2O69 A;  2E1S A;  1CE2 A;  1MY1 A;  1PDA A;  5DT6 A;  3A3C A;  1ZTY A;  4JWY A;  3V8X B;  1IQ7 A;  4OHN A;  1N7W A;  1BKA A;  5CI5 A;  4G68 A;  1URD A;  4G2Z A;  1D4N A;  5ELV A;  3OEN A;  4YB7 A;  4RY1 A;  3USD A;  1N04 A;  2XXI A;  1B7Z A;  3TTL A;  3FGS A;  2H4I A;  1IXH A;  4F2O A;  2HZK A;  4TQU Q;  3N94 A;  2GH9 A;  4LQ5 A;  2IA4 A;  4HCW A;  2F7B A;  1ZLQ A;  1XHY A;  5AA2 D;  3DP4 A;  3IO6 A;  2OLB A;  4YKP A;  4GOT A;  3E4R A;  3H03 A;  3P7I A;  2Q88 A;  1S50 A;  3UIF A;  1H3D A;  2A5S A;  3D4C A;  2X7P A;  4QF9 A;  3RNN A;  3MZB A;  3VDF A;  1M5E A;  2XXU A;  1Z7N E;  1LAG E;  4G68 C;  4XXU A;  4ZED A;  1KWH A;  5EHM A;  1B3L A;  3FXU A;  5IKB A;  4GL0 A;  1MG1 A;  5AA2 B;  3PUV E;  4YKJ A;  2QL3 A;  2V3U A;  2V3Q A;  1M5B A;  3OMB A;  3Q27 A;  1AIV A;  4PE5 B;  4ELQ A;  3R6U A;  4OES A;  4H0W A;  2D21 A;  2W7Y A;  4HS7 A;  5I59 B;  3IK6 B;  3Q25 A;  1DMB A;  3DEL B;  4GXA A;  2P1S A;  3KN7 A;  3KSJ A;  2QRY A;  3QIM A;  1POT A;  3QK6 A;  2XXR A;  3L6G A;  3O28 A;  4H8I A;  4I9D A;  2O6A A;  3OO7 A;  5TP9 B;  1JNF A;  1FTJ A;  4DCY A;  1YCJ A;  4FED A;  2HAU A;  1DOT A;  2Z8D A;  3LSF B;  3OEL A;  3PUX E;  2HZL A;  2RC8 A;  2UVH A;  3OOA A;  4OEN A;  1NMU A;  1LFH A;  3TCH A;  4LON B;  3QUJ A;  3PPR A;  4L17 A;  2AL5 A;  2DOJ A;  4KYS A;  4ZEK A;  1ZKB A;  1QUJ A;  1IXC A;  1B58 A;  1MRP A;  3LR1 A;  2OWT A;  3RTF B;  4POX A;  2UYE A;  4F31 B;  4ISU A;  1B5I A;  4ZEI A;  3ONM A;  3O2A A;  4R74 A;  4OVJ A;  3R26 A;  4YB5 A;  2PX1 A;  1B0L A;  2DXY A;  2F6G A;  1HSJ A;  1BLF A;  4LAT A;  3TDJ A;  2F5X A;  2O68 A;  3IJX B;  3TCG A;  2NUV A;  3TUS A;  4Q5T A;  2YLN A;  3LSL A;  3B6W A;  4H1X A;  4XIG Q;  2XHD A;  5H8N B;  1URS A;  1B5H A;  3OSR A;  4XKQ A;  1N3X A;  2XXQ A;  1H43 A;  2GHB A;  4OEU A;  3RT6 B;  3HO7 A;  4FEC A;  3C33 A;  4GF8 A;  2UYF A;  3MP6 A;  4AQ4 A;  4LZ7 A;  1EH3 A;  4BDM A;  1POY 1;  5A5X A;  4H8J A;  3FZV A;  4ZE9 A;  1XVY A;  3RT8 A;  4KHZ E;  2Y84 A;  4NF5 A;  4ESX A;  1SD3 A;  4JSD A;  1MPB A;  2H9B A;  3QSL A;  1PBQ A;  2Q9T A;  5I58 B;  1FQB A;  4U1Z A;  1I6B A;  4MBP A;  3IL1 B;  1D9Y A;  3TYH A;  4EUO A;  3VLU A;  4H5F A;  4R2F A;  3UA8 A;  1TFD A;  5TU0 A;  1AOV A;  3PUZ E;  1LAH E;  2ZYO A;  3MPK A;  1NNT A;  1IZ1 A;  3QUF A;  1SYH A;  2PBW A;  4GFR A;  2R6G E;  3UK4 A;  3ZKK A;  1FTM A;  2QMX A;  4HTG A;  3TMG A;  3LSX A;  2HAV A;  2DWJ A;  4PET A;  5AA3 A;  1Y1M A;  4DLD A;  1FQD A;  2F7C A;  1Q1K A;  1US5 A;  3M3F A;  1JEU A;  1Y20 A;  3KOT A;  5JK4 A;  3OO6 A;  3G7W A;  2AIX A;  2ONS A;  1MXY A;  3KSX A;  4P0G A;  2NVU B;  2E0S A;  3B6T A;  4OTE A;  3MQ9 A;  1NNK A;  3IB1 A;  3OEK A;  2OCU A;  1USY H;  1LAF E;  4JSO A;  3LC8 A;  3V83 A;  3PU5 A;  3FVK A;  5CMM A;  1UTB B;  4F19 A;  1QUK A;  4IO5 A;  4JB7 A;  5AA1 A;  1IXG A;  4BDR A;  4GL8 A;  5LOM A;  4JWX A;  1P1Q A;  1MY2 A;  3C31 A;  4G8N A;  1R1N A;  3BBR A;  4I62 A;  3U8Q A;  1D3K A;  4LVQ A;  4R75 A;  4MFI A;  3TZA A;  5L8D A;  1TFA A;  5M2V A;  4K3F A;  1HSE A;  4YZZ A;  2G29 A;  1B46 A;  2F6P A;  4KYD A;  5I2N A;  3EN3 A;  3KFM A;  2F34 A;  3K4U A;  3H7M A;  3JZJ A;  4G77 A;  4QFP A;  3PGF A;  4MH5 A;  3SEU A;  3Q28 A;  4XKP A;  2REJ A;  2Y7R A;  2YJP A;  1MDQ A;  4N07 A;  3ILT B;  2HFB A;  3I3V A;  5K2Y A;  4QSC A;  3U1O A;  2RCA A;  3SEY A;  2H25 A;  4KR5 A;  4R2B A;  2O7I A;  4YKI A;  1IIT A;  4LZ5 A;  4RPO A;  2I4C A;  2XXW A;  4ESW A;  4N6P A;  5CRY A;  2XXY A;  4IO4 A;  1NH7 A;  4QFN A;  1ZU0 A;  3B6Q A;  3ZS6 A;  1NH8 A;  2ONK E;  3DP6 A;  3VVE A;  1N84 A;  1P99 A;  3KZG A;  3EHU A;  3KJT A;  3FVN A;  2V84 A;  3H6T A;  4H65 A;  5L9O A;  2P2A A;  3KN8 A;  2M8C A;  3VVF A;  2DE3 A;  4M1V A;  3MZ9 A;  1H45 A;  5BWJ A;  2Q2A A;  1L5T A;  1MH4 A;  1N3W A;  3FAT A;  4F1U A;  3UN6 A;  1PEB A;  4QFL A;  4G68 B;  5TPA B;  4F3P A;  4IO3 A;  3V5A A;  4RYA A;  5HPQ A;  1F9B A;  1DPE A;  3VFJ A;  1SDX A;  1MXV A;  5FHO A;  5CBR A;  1M5C A;  4YB6 A;  3KN3 A;  4THI A;  3GXA A;  3W15 C;  5L9M A;  3O29 A;  2IEE A;  5TPA A;  4POW A;  3LBS A;  3MVW A;  5JTY B;  4ZZE A;  1DSN A;  1MS7 A;  1Y3P A;  1FTO A;  1B0H A;  1HSL A;  2DQV A;  3LSW A;  3O97 A;  1B9J A;  1WVJ A;  1B5J A;  3OXN A;  4F3G A;  3MWB A;  4NF8 B;  5JTY A;  2ZYK A;  1MDP 1;  2ZYN A;  3K00 A;  3K1N A;  2NWJ A;  1FCK A;  3HPI A;  4X1D A;  4YIC A;  4ONY A;  4DE8 A;  3L6H A;  4GLI A;  4KD5 A;  1B4H A;  4NF8 A;  1B3H A;  5F7V A;  3MVY A;  3RN8 A;  5H8Q A;  4IY5 A;  3SER A;  3W9W A;  5H8F A;  2ANJ A;  3GBB A;  3K1P A;  1QUI A;  3S9N C;  4ZEF A;  4HCY A;  3DLN A;  4LP2 B;  3FV2 A;  3E13 X;  1CB6 A;  1B7U A;  2QS3 A;  1FTK A;  3C9H A;  1Y1Z A;  4DCX A;  3TFL A;  1B52 A;  1A8F A;  4NMY A;  1SW5 A;  3DP8 A;  3FAS A;  1LST A;  1MQG A;  1PC3 A;  3CSB A;  1QW0 A;  4BDQ A;  4XTC Q;  1ZMG A;  5ITO A;  5KCJ A;  1I6A A;  3PPO A;  2XXT A;  1RKM A;  1SI1 A;  3PUY E;  4LUB A;  1M5F A;  1SYI A;  5FHM A;  3UGW A;  4OFL A;  3KEI A;  3RGY A;  3EHS A;  3RLF E;  1GVC A;  3EPE A;  1Y4C A;  1P1W A;  1B1H A;  4U21 A;  2CMO A;  1NNF A;  1IXI A;  3C34 A;  4TLM B;  4G4P A;  2YPN A;  2CZL A;  1FQE A;  4QSE A;  2I3V A;  3T22 A;  2ZYM A;  4P0I A;  2DSF A;  3HST A;  3RY3 A;  3DM0 A;  3E3K A;  2UXA A;  3EQ1 A;  3IJO B;  3CRB A;  4RJZ A;  4DDD A;  4FAT A;  3KG2 A;  4DZ1 A;  1A8E A;  4OER A;  5H8S A;  4ECF A;  1T0K A;  5FTH A;  3KBR A;  4NED A;  3V89 B;  2DWH A;  2ESN A;  4EXL A;  1SW1 A;  3RQT A;  3MPL A;  1QKA A;  4MLV A;  5F1Q A;  2QS4 A;  2I49 A;  1QVS A;  4F2Q A;  4GVO A;  5A5X B;  4H6D A;  5K2X A;  3H6V A;  5CMC A;  3KOS A;  3TCF A;  2XXX A;  2VP1 A;  3CVG A;  2O1L A;  4NF5 B;  2A5T A;  4PFT A;  1NFT A;  1RYO A;  1IUD A;  1N7X A;  1B40 A;  2F97 A;  3O9P A;  4LA9 A;  3MP8 A;  4C1U A;  4IO2 A;  4FOR A;  3PMV A;  1FQC A;  3S9E A;  3CG1 A;  3THI A;  4IGT A;  2FYI A;  4G8M A;  4OZ9 A;  3FD3 A;  3PPP A;  3R7X A;  2H98 A;  1VSO A;  4R9G A;  2F7A A;  4TLL B;  4R72 A;  1O64 A;  4X48 A;  4IGR A;  5BUU A;  4RK9 A;  2V93 A;  2AL4 A;  2I3W A;  2OWS A;  4IB2 A;  3H3G A;  3JV9 A;  4MLQ A;  4KCC A;  3ECR A;  3FIR A;  1PB9 A;  3UP9 A;  3RTW B;  3WAE A;  3SDF A;  3U92 A;  1RYX A;  2ZNT A;  3OSQ A;  3HHF A;  1OVB A;  3MW0 A;  2UVJ A;  5I57 A;  2DXR A;  2RKM A;  4ZDM A;  5AE4 A;  1P1O A;  3FJ7 A;  1ATG A;  1YTV A;  3TPA A;  4NF6 A;  2XD2 A;  2P0S A;  3B7D A;  3O66 A;  1OVT A;  3N26 A;  1MXW A;  2Z8E A;  3A3U A;  3U72 A;  3HV1 A;  4YMA A;  1LBB A;  4ZE8 A;  4F18 A;  3K2D A;  4PQJ A;  4GRK A;  3C35 A;  3IOT A;  3GZG A;  2O7U A;  2F8D A;  3QXM A;  4I8C A;  3QAX A;  3Q26 A;  4Q8R A;  1UTH A;  4EQ7 A;  5CC2 A;  4OYV A;  4I1D A;  2NXO A;  3TEP A;  3VE1 B;  1GGG A;  4FJP A;  1UIV A;  3EF7 A;  4OQO A;  4WXJ A;  4OFJ A;  5I2K A;  3TOD A; 
#chains in the Genus database with same CATH topology
 3CFZ A;  3TTM A;  3OO9 A;  1B4Z A;  3M3K A;  1XVX A;  1OQH A;  2PYY A;  1MQD A;  5I2N B;  1OIB A;  1OLA A;  1B51 A;  3K6W A;  4ZEB A;  3CFL A;  4R6H A;  3MAM A;  5FHN A;  4MHF A;  5ITP A;  4ZEC A;  3FXQ A;  4F3B A;  4QFK A;  1FPE A;  3IOV A;  2VHA A;  4EF1 A;  2RC7 A;  3IOU A;  1YZ0 A;  3K0V A;  3K6V A;  1SI0 A;  4EQB A;  2X26 A;  1H76 A;  3GBA A;  2R71 A;  1I69 A;  3MBP A;  1EYK A;  1DTG A;  2UVG A;  4U4X A;  4ELR A;  5J1D A;  1PBP A;  1YXI A;  5DYH A;  3ISP A;  2XX9 A;  1MY4 A;  3TEL A;  4O3B A;  1LAX A;  4MNC A;  3T96 B;  2ZZV A;  4R9F A;  4U2R A;  4RA1 A;  2HXW A;  4KQP A;  4MEV A;  4OAN A;  1VE4 A;  4IO7 A;  4ND9 A;  4PFW A;  3ZKL A;  1JW4 A;  2Y7K A;  1S7Y A;  1ANF A;  3FVO A;  4C0R A;  1RDZ A;  2V3T A;  3FUZ A;  1GTK A;  3CFX A;  2R8T A;  4NG7 A;  3PD9 A;  2D3I A;  1YYZ A;  2H99 A;  1MM7 A;  4XF5 A;  2I48 A;  2F35 A;  4GX3 A;  4KYE A;  2V4C A;  1SVX B;  1EU8 A;  1LBY A;  2DWI A;  1B05 A;  4FEB A;  2KLF A;  4OVR A;  3AXF A;  3E78 A;  3S2V A;  1PB8 A;  1YAE A;  1IMC A;  3K6U A;  1JET A;  4H46 A;  3KGC A;  2Y7I A;  3IB2 A;  1BTJ A;  2DP8 A;  3C36 A;  2FA7 A;  1MXU A;  5EYF A;  1H44 A;  1ZJL A;  1FPG A;  5IZZ A;  4GWW A;  4LZ8 A;  3PPQ A;  1FPI A;  2REG A;  2XXK A;  3T66 A;  1BK4 A;  4EXK A;  5DW8 A;  1FJ6 A;  3GLB A;  4EQ9 A;  4Z7E A;  1JW1 A;  3U94 A;  4RK2 A;  2XD3 A;  3UOR A;  4OFO A;  1FQA A;  2QFL A;  4PFU A;  3KC1 A;  2F3B A;  1FW0 A;  1MM6 A;  3HN0 A;  5I7I A;  3SEX A;  4FIM A;  2Z8F A;  4R6Y A;  3FJM A;  5AA4 B;  4R6K A;  4MF3 A;  4QHQ A;  3T9X B;  1VR5 A;  2VGQ A;  3PUW E;  3CG3 A;  2HEU A;  4EDP A;  1FRP A;  2ZNU A;  1FJ9 A;  3A09 A;  2WYP A;  1LEV A;  4WKM A;  3IR1 A;  1LCF A;  3WAF A;  5AA4 A;  3MVX A;  1MH3 A;  5IZ1 A;  2GHA A;  2THI A;  1UQW A;  1LFI A;  2OK2 A;  1Z7M E;  4QFO A;  3JYR A;  3VLV A;  1TT1 A;  3U93 A;  3S9L C;  4TOZ A;  1LFG A;  1LGB C;  1JQF A;  1KA1 A;  3G3F A;  4BDO A;  1JVX A;  1NUW A;  5H8Q B;  4F39 A;  2Q74 A;  5H8F B;  2XWI A;  1DCU A;  2DE4 A;  1MQH A;  3G3H A;  4RXL A;  1NKX A;  4BDN A;  1A7L A;  3SEV A;  4XKR A;  3D4G A;  1P1N A;  4G8H A;  4NTL A;  4G61 A;  5DVI A;  2F36 A;  1B3E A;  2I0C A;  1R9Q A;  3O6G A;  4C1T A;  2D5W A;  3LUZ A;  2OJT A;  4N6K A;  4JWO A;  3O6I A;  1GV8 A;  3VXC A;  1NUY A;  2O51 A;  3CI8 A;  2XX7 A;  4DIG A;  1RDX A;  1ELJ A;  2DE2 A;  2ONR A;  2ZXT A;  3C32 A;  5FBP A;  4OVP A;  2XXV A;  3N5L A;  5CMB A;  1QKB A;  2KQZ A;  2UVI A;  4U22 A;  5KCJ B;  3FV1 A;  2VPN A;  2QS1 A;  3IO4 A;  2WBB A;  3IOW A;  4HXV A;  4H45 A;  4OEV A;  5JEI A;  1S9T A;  5ICT A;  1JEV A;  1OQG A;  4P1E A;  2Z22 A;  1MPD A;  2QJE A;  3G3J A;  4LQ2 A;  1B32 A;  4O3A A;  2VT5 A;  1QJM A;  1EZ9 A;  1IIW A;  2WEF A;  5AA2 A;  3IFA A;  4NWD A;  4HW8 A;  5DVJ A;  5IZ3 B;  1SBP A;  1LLS A;  2ABH A;  2HCA A;  4R73 A;  4I40 A;  2F78 A;  2DYX A;  3OD7 A;  1US4 A;  1XI6 A;  3RPW A;  3PMW A;  3K6X A;  2B65 A;  1NV7 A;  5I59 A;  3T9H B;  3MJN A;  4F22 A;  1XC1 A;  2HPG A;  5ICQ A;  4UAC A;  1A55 A;  1B3F A;  3PD8 A;  1EZO A;  2CEY A;  4H67 A;  2XX8 A;  5CBS A;  1G0I A;  2VD2 A;  3OO8 A;  4FE8 A;  5TP9 A;  4PFI A;  3G3I A;  2PMS A;  1FTA A;  4OWD A;  1NV0 A;  2B3F A;  3Q29 A;  2PT2 A;  1D9V A;  4RPN A;  3MP1 A;  4F3S A;  2WBD A;  3S4U A;  4DXB A;  2LAO A;  1WOD A;  2VPO A;  2XWO A;  4LN5 A;  4DXU A;  4ZZA A;  5ISU A;  1SQY A;  1TXF A;  1FPJ A;  1MXZ A;  4U4S A;  4WEP A;  1NL5 A;  2XWK A;  2A5T B;  2NOO A;  4QXD A;  4M4G A;  5DTB A;  4BLA A;  1ZIU A;  4NAP A;  2XA5 A;  1N76 A;  2RF1 A;  2QPQ A;  3CIJ A;  5EHS A;  3MVZ A;  4O8M A;  3MC2 A;  1AMF A;  3PV0 E;  2CEX A;  2VD3 A;  1DPP A;  1I6Q A;  4P56 A;  3HHG A;  2ZMB A;  3TTK A;  1LCT A;  3KJ7 A;  3MZ1 A;  3RPL B;  1QUL A;  1LBW A;  2PVU A;  2ALU A;  1ZBM A;  3IAZ A;  3SEW A;  4EF2 A;  4O94 A;  4PFY A;  5KDT B;  1URG A;  5H8H B;  1USY E;  3FXB A;  4UAB A;  5H8N A;  3ILU B;  4DXC A;  2Q89 A;  4NWC A;  1NNP A;  4KI0 E;  5A5L A;  2QSX A;  5CMK A;  2O84 X;  3LV0 A;  2WKY A;  5KDT A;  5H8H A;  4H5G A;  1AL3 A;  3PPN A;  4MIJ A;  1OMP A;  3FXR A;  4GXS B;  4X1B A;  2GRV A;  2O1M A;  2Q2C A;  4KFQ A;  2H5Y A;  2RC9 A;  4F1V A;  4N81 A;  5I57 B;  1Y4T A;  2DVZ A;  1P1U A;  1SW4 A;  2I58 A;  3VLW A;  2X7Q A;  2ZNS A;  4F1Y A;  4OXV A;  1Y3Q A;  1NUZ A;  2BJJ X;  1BP5 A;  4NF6 B;  2QVU A;  1A54 A;  1WDN A;  4UA8 A;  3H6W A;  2FNC A;  2XXP A;  4RNS A;  3C4M A;  1B2H A;  5HM4 B;  5I58 A;  5IAI A;  3K02 A;  3H06 B;  4U1O A;  1N0T A;  4PAF A;  1AH5 A;  4GIZ A;  1MQJ A;  3PMX A;  4U23 A;  1B3G A;  4MX6 A;  1KZ8 A;  2QVV A;  4GX6 A;  1MQI A;  4MAG A;  3ODB A;  2GFE A;  1QGX A;  2HQ0 A;  1UTH B;  4AB6 A;  3VV5 A;  5DEX B;  4YAH X;  4F29 A;  4IY6 A;  1MY3 A;  1O63 A;  3HCQ A;  3TTR A;  1FBD A;  2I0B A;  3OEM A;  3FVG A;  1K9Y A;  5I2K B;  3N6T A;  4KCD A;  2Q8J A;  4Z0I A;  3K1M A;  1OLC A;  1A40 A;  1JVY A;  4QRZ A;  4AS4 A;  4BDL A;  3VVD A;  3IX1 A;  5DEX A;  3G3K A;  4FAJ A;  3S9M C;  3FJG A;  2RCB A;  4Q30 B;  4ELO A;  1UIU A;  1FQF A;  3MUQ A;  2G93 A;  4X9T A;  4OET A;  3T9U A;  4YMB A;  3RUM A;  4JDF A;  3QYT A;  3CSG A;  3IB0 A;  1Y3N A;  4Q0C A;  3BKI B;  2RIN A;  3BFU A;  3TQW A;  3BFT A;  4NE4 A;  5I56 B;  1LBC A;  1TWY A;  1LB8 A;  1FPL A;  2I4B A;  1FTL A;  2Z23 A;  1EZP A;  1YPN A;  2Y7W A;  1R9L A;  3ZSF A;  4NN3 A;  5DVF A;  2PT1 A;  4O3C A;  4P8B A;  3T93 B;  4P11 A;  5I84 A;  2CZK A;  4PAI A;  4HE0 A;  1VFD A;  2DWA A;  3E9X A;  1UTB A;  1J1N A;  4N13 A;  5I56 A;  1R6Z A;  1D9Q A;  4YU0 A;  2Y5K A;  1MY0 A;  2DS9 A;  1GR2 A;  1B7H A;  3CR9 A;  3O6H A;  3TAJ A;  4NF4 B;  1SW2 A;  1BIY A;  4ZS9 A;  3T9V A;  4GWO A;  2Y5L A;  2V25 A;  2VOZ A;  4OMB A;  1MPC A;  4N8Y A;  2QS2 A;  1A99 A;  3F11 A;  3G3G A;  1XS5 A;  5B7D A;  2Y7P A;  1FPB A;  1DTZ A;  3N6U A;  3SKP A;  4KPT A;  4NF4 A;  4QSD A;  5L9S A;  5CM6 A;  2OZZ A;  1B1X A;  1LB9 A;  1JW5 A;  2R9J A;  1FPD A;  4GQO A;  1CNQ A;  1DK4 A;  3I5O A;  3NOH A;  5B70 A;  4GX4 A;  3TTN A;  2OBG A;  4E0W A;  4YKK A;  3H4Z A;  4PP0 A;  3B50 A;  1B6H A;  1M5D A;  4JVI A;  4JXI A;  1IEJ A;  5HBC A;  4IO6 A;  3LUY A;  3TKD A;  1Y9U A;  3IFC A;  2XXH A;  4JBZ A;  5FTI A;  2I6E A;  1MXX A;  5KZT A;  3W9V A;  1II5 A;  4ELP A;  2B3B A;  3M8U A;  2QMW A;  2DVC A;  3EHT A;  3SZP A;  3K01 A;  2AYS A;  3MST A;  3TQL A;  4AB5 A;  4I3E A;  1O7T A;  4WED A;  1XOC A;  3SES A;  4E0X A;  3I6V A;  4P47 A;  3VXB A;  2FHY A;  3M3L A;  4GD5 A;  1Q35 A;  1PB7 A;  3IOR A;  3H6U A;  5J16 A;  4XKN A;  4MJO A;  1XT8 A;  4I3Y A;  3SET A;  2FIE A;  1VFE A;  2BJI A;  2O69 A;  2E1S A;  1CE2 A;  1MY1 A;  1PDA A;  5DT6 A;  1INP A;  3A3C A;  1ZTY A;  4JWY A;  3V8X B;  1IQ7 A;  4OHN A;  1N7W A;  4PAK A;  1BKA A;  2CZI A;  5CI5 A;  4G68 A;  1URD A;  4G2Z A;  1D4N A;  4KXP A;  5ELV A;  3OEN A;  2B4M A;  4YB7 A;  4RY1 A;  3USD A;  1N04 A;  3ROJ A;  2XXI A;  1B7Z A;  3TTL A;  3FGS A;  2H4I A;  1IXH A;  4F2O A;  2PCR A;  2HZK A;  1FPF A;  4TQU Q;  3N94 A;  2GH9 A;  4LQ5 A;  2IA4 A;  4HCW A;  2B4L A;  2XWV A;  2F7B A;  1ZLQ A;  1XHY A;  5AA2 D;  1FBC A;  3DP4 A;  1NV5 A;  3IO6 A;  2OLB A;  4MNP A;  4YKP A;  4GOT A;  3E4R A;  3H03 A;  3P7I A;  2Q88 A;  1S50 A;  3UIF A;  1H3D A;  3CHG A;  2ZZX A;  4DI3 D;  2A5S A;  2FIX A;  3D4C A;  5LDZ A;  2X7P A;  4QF9 A;  4XFE A;  3RNN A;  3MZB A;  3VDF A;  1NI9 A;  1M5E A;  2XXU A;  4N6D A;  4JVD A;  1Z7N E;  1LAG E;  4G68 C;  4XXU A;  4ZED A;  1KWH A;  1B3L A;  3FXU A;  5EHM A;  5IKB A;  3BIG A;  4GL0 A;  3E79 A;  1MG1 A;  5AA2 B;  3PUV E;  4YKJ A;  2QL3 A;  2V3U A;  2V3Q A;  1M5B A;  3OMB A;  3Q27 A;  1AIV A;  4HE2 A;  4PE5 B;  4PDH A;  4ELQ A;  3R6U A;  4OES A;  4H0W A;  2D21 A;  2W7Y A;  4HS7 A;  4X8R A;  5I59 B;  3IK6 B;  3Q25 A;  1DMB A;  3DEL B;  5EYG A;  5ET5 A;  4GXA A;  2P1S A;  3KN7 A;  3KSJ A;  2QRY A;  3QIM A;  1POT A;  3QK6 A;  2XXR A;  1LBX A;  3L6G A;  3O28 A;  4NHB A;  4H8I A;  4I9D A;  2O6A A;  4PFR A;  5EQA A;  3OO7 A;  5TP9 B;  1FBP A;  1JNF A;  1FTJ A;  4DCY A;  1YCJ A;  4FED A;  4PF8 A;  2HAU A;  1DOT A;  2Z8D A;  3LSF B;  3OEL A;  5ET7 A;  3PUX E;  2HZL A;  2RC8 A;  2UVH A;  3OOA A;  4OEN A;  1NMU A;  1LFH A;  3TCH A;  4GBV A;  4LON B;  3QUJ A;  3PPR A;  4L17 A;  4O7M A;  5IM2 A;  2AL5 A;  2DOJ A;  4KYS A;  4ZEK A;  1NV2 A;  1ZKB A;  1QUJ A;  1IXC A;  1NUX A;  1B58 A;  1MRP A;  3LR1 A;  5EQ7 A;  2OWT A;  3RTF B;  4POX A;  2UYE A;  4F31 B;  4ISU A;  1B5I A;  4ZEI A;  3ONM A;  3O2A A;  4R74 A;  4OVJ A;  3R26 A;  4YB5 A;  2WYK A;  2PX1 A;  1B0L A;  2FBP A;  2DXY A;  2F6G A;  1EYI A;  1HSJ A;  5EQ9 A;  2P3V A;  4PTK A;  1BLF A;  4N15 A;  4LAT A;  3TDJ A;  2F3D A;  4PGN A;  2F5X A;  2O68 A;  3IJX B;  3TCG A;  2NUV A;  3TUS A;  2OX3 A;  4Q5T A;  2YLN A;  3LSL A;  3B6W A;  4H1X A;  1G0H A;  4XIG Q;  3T0J A;  2XHD A;  5H8N B;  1URS A;  1B5H A;  3OSR A;  4XKQ A;  1N3X A;  2XXQ A;  1H43 A;  2GHB A;  3PTY A;  4OEU A;  3RT6 B;  3HO7 A;  4MNI A;  4FEC A;  3C33 A;  4GF8 A;  2UYF A;  3MP6 A;  4NF0 A;  4AQ4 A;  4LZ7 A;  1EH3 A;  4PGP A;  4BDM A;  1POY 1;  5A5X A;  4H8J A;  3FZV A;  4ZE9 A;  1RDY A;  1XVY A;  3RT8 A;  4KHZ E;  2Y84 A;  4NF5 A;  4ESX A;  1SD3 A;  2KR0 A;  4GWY A;  4JSD A;  1MPB A;  2H9B A;  3QSL A;  1PBQ A;  2Q9T A;  4XEQ A;  5I58 B;  5I3S A;  1FQB A;  4U1Z A;  2WX9 A;  2L5V A;  1I6B A;  4MBP A;  4PF6 A;  3IL1 B;  1D9Y A;  3TYH A;  4EUO A;  3VLU A;  4H5F A;  4R2F A;  3UA8 A;  1TFD A;  5TU0 A;  1AOV A;  3PUZ E;  1LAH E;  2ZYO A;  3MPK A;  4OA4 A;  1NNT A;  1IZ1 A;  3QUF A;  1SYH A;  2PBW A;  4GFR A;  2R6G E;  3UK4 A;  3ZKK A;  1FTM A;  2QMX A;  4HTG A;  2P3N A;  3TMG A;  4PE3 A;  3LSX A;  2HAV A;  2DWJ A;  4PET A;  5AA3 A;  1Y1M A;  4DLD A;  1FQD A;  4GWU A;  2F7C A;  1Q1K A;  1US5 A;  3M3F A;  1JEU A;  2CZH A;  1Y20 A;  3KOT A;  5JK4 A;  3OO6 A;  3HFU A;  3G7W A;  2AIX A;  1FBG A;  2ONS A;  1MXY A;  2HHM A;  3KSX A;  4P0G A;  2NVU B;  2E0S A;  3B6T A;  4OTE A;  3MQ9 A;  1NNK A;  3IB1 A;  3OEK A;  2FVZ A;  3U65 A;  2OCU A;  1JP4 A;  1USY H;  1LAF E;  1NV1 A;  3BIH A;  4JSO A;  3LC8 A;  1FPK A;  3V83 A;  1NV3 A;  3PU5 A;  3FVK A;  4MCO A;  5CMM A;  1UTB B;  4F19 A;  1QUK A;  4IO5 A;  4JB7 A;  5AA1 A;  4GWZ A;  1IXG A;  4BDR A;  4GL8 A;  5LOM A;  4JWX A;  1P1Q A;  1MY2 A;  3C31 A;  4G8N A;  1R1N A;  3BBR A;  1SPI A;  1IMD A;  4I62 A;  3U8Q A;  1D3K A;  4LVQ A;  4R75 A;  1NV6 A;  4MFI A;  3TZA A;  5L8D A;  1IMA A;  1TFA A;  5M2V A;  4K3F A;  1HSE A;  1VDW A;  4YZZ A;  2G29 A;  1B46 A;  2F6P A;  4KYD A;  5I2N A;  3EN3 A;  3KFM A;  2F34 A;  3K4U A;  3H7M A;  3JZJ A;  4G77 A;  4QFP A;  4N91 A;  3PGF A;  4MH5 A;  3SEU A;  3Q28 A;  4XKP A;  2REJ A;  2Y7R A;  2YJP A;  3D1R A;  1MDQ A;  3GYY A;  4N07 A;  4PCD A;  3ILT B;  2HFB A;  3I3V A;  5K2Y A;  4QSC A;  3U1O A;  2RCA A;  3SEY A;  2H25 A;  4KR5 A;  4R2B A;  2O7I A;  4YKI A;  1IIT A;  4LZ5 A;  4RPO A;  2I4C A;  2XXW A;  4ESW A;  4O7I A;  4N6P A;  5ESY A;  5CRY A;  2XXY A;  4IO4 A;  1NH7 A;  4QFN A;  1ZU0 A;  3B6Q A;  3ZS6 A;  1IMB A;  1NH8 A;  2ONK E;  3DP6 A;  3VVE A;  4GWX A;  4N4U A;  1N84 A;  1P99 A;  3KZG A;  3EHU A;  3KJT A;  3FVN A;  2V84 A;  5I5P A;  4OVT A;  2PFZ A;  3H6T A;  4H65 A;  1KA0 A;  5L9O A;  4PBQ A;  2MKZ A;  2P2A A;  3KN8 A;  2M8C A;  3VVF A;  2DE3 A;  4M1V A;  4OVS A;  3MZ9 A;  1H45 A;  5BWJ A;  2Q2A A;  1L5T A;  1MH4 A;  1N3W A;  3FAT A;  4F1U A;  3UN6 A;  1PEB A;  4QFL A;  4G68 B;  5TPA B;  4F3P A;  4IO3 A;  1FSA A;  3V5A A;  4RYA A;  5HPQ A;  1F9B A;  1DPE A;  3VFJ A;  1SDX A;  2JJK A;  1MXV A;  5FHO A;  5CBR A;  2QVR A;  1M5C A;  4YB6 A;  3KN3 A;  1Q9D A;  4THI A;  3GXA A;  3W15 C;  5L9M A;  3O29 A;  4PFB A;  2IEE A;  5F24 A;  4POW A;  5TPA A;  3LBS A;  3MVW A;  5JTY B;  4ZZE A;  4FBP A;  2DDK A;  3KBZ A;  1K9Z A;  1DSN A;  2OWZ A;  1MS7 A;  3QMF A;  1FBH A;  1Y3P A;  1FTO A;  3EKI A;  1B0H A;  1HSL A;  2DQV A;  3LSW A;  3O97 A;  1B9J A;  1WVJ A;  1B5J A;  3OXN A;  4P3L A;  4F3G A;  3MWB A;  4NF8 B;  5JTY A;  2ZYK A;  1MDP 1;  2ZYN A;  3K00 A;  3K1N A;  4JVC A;  2NWJ A;  1FCK A;  3HPI A;  4X1D A;  5EYH A;  1FBF A;  4YIC A;  4ONY A;  4DE8 A;  3L6H A;  4GLI A;  4KD5 A;  1B4H A;  4NF8 A;  1B3H A;  5F7V A;  3MVY A;  3A29 A;  2GQ1 A;  3RN8 A;  5H8Q A;  5ET6 A;  4IY5 A;  3SER A;  3W9W A;  5H8F A;  2ANJ A;  3GBB A;  3K1P A;  1QUI A;  3S9N C;  4ZEF A;  4HCY A;  3DLN A;  4N17 A;  4LP2 B;  3FV2 A;  3E13 X;  1CB6 A;  1B7U A;  3FBP A;  4PC9 A;  2QS3 A;  1FTK A;  3C9H A;  1Y1Z A;  4DCX A;  3TFL A;  1B52 A;  1A8F A;  4NMY A;  1SW5 A;  3DP8 A;  3FAS A;  1LST A;  1MQG A;  1PC3 A;  3CSB A;  1QW0 A;  4BDQ A;  4P1L A;  1ZMG A;  4XTC Q;  5ITO A;  4X04 A;  5KCJ A;  1I6A A;  3PPO A;  2XXT A;  3B8B A;  4P9K A;  1RKM A;  1SI1 A;  3PUY E;  4LUB A;  1M5F A;  1SYI A;  5FHM A;  3UGW A;  4OFL A;  4PBH A;  2PFY A;  3KEI A;  3RGY A;  3EHS A;  3RLF E;  1GVC A;  3EPE A;  1Y4C A;  1P1W A;  1B1H A;  4U21 A;  5IZ3 A;  2CMO A;  1NNF A;  1IXI A;  3C34 A;  4TLM B;  4G4P A;  2YPN A;  2CZL A;  1FQE A;  2Q8M A;  4QSE A;  2I3V A;  3T22 A;  2ZYM A;  4P0I A;  2DSF A;  3HST A;  3RY3 A;  3DM0 A;  3E3K A;  2UXA A;  3EQ1 A;  3IJO B;  3CRB A;  4RJZ A;  5IGA A;  4DDD A;  4MMP A;  4FAT A;  3KG2 A;  4NQ8 A;  4DZ1 A;  1A8E A;  4OER A;  5H8S A;  4ECF A;  1T0K A;  5FTH A;  3KBR A;  4NED A;  3V89 B;  2DWH A;  2ESN A;  4EXL A;  1SW1 A;  3RYD A;  5EQ8 A;  3RQT A;  3MPL A;  1QKA A;  4MLV A;  3MYU A;  5F1Q A;  2QS4 A;  4GWS A;  2I49 A;  1QVS A;  4F2Q A;  4GVO A;  5A5X B;  4H6D A;  5K2X A;  3H6V A;  5CMC A;  2HXR A;  3KOS A;  3TCF A;  2XXX A;  1IME A;  2VP1 A;  3CVG A;  2O1L A;  4NF5 B;  2A5T A;  4PFT A;  1NFT A;  1RYO A;  5ET8 A;  1IUD A;  5LTC A;  1N7X A;  4IR8 A;  1B40 A;  2F97 A;  3O9P A;  4LA9 A;  3MP8 A;  4C1U A;  5T3J A;  4IO2 A;  1IMF A;  4FOR A;  3PMV A;  1FQC A;  3S9E A;  3CG1 A;  4GBW A;  4IGT A;  3THI A;  2FYI A;  4G8M A;  4OZ9 A;  3FD3 A;  3RPL A;  3PPP A;  4QBA A;  3R7X A;  2H98 A;  1VSO A;  1EYJ A;  4R9G A;  2F7A A;  4DI4 B;  4TLL B;  4R72 A;  1O64 A;  4X48 A;  4IGR A;  5BUU A;  4RK9 A;  2V93 A;  2AL4 A;  2I3W A;  2OWS A;  4PDD A;  4IB2 A;  3H3G A;  3JV9 A;  4MLQ A;  4KCC A;  3ECR A;  3FIR A;  1PB9 A;  3UP9 A;  3RTW B;  3WAE A;  1NV4 A;  3SDF A;  3T1B A;  3U92 A;  1RYX A;  2ZNT A;  2ZZW A;  3OSQ A;  3HHF A;  1OVB A;  3MW0 A;  4AS5 A;  2UVJ A;  5I57 A;  2DXR A;  1LBV A;  2RKM A;  4ZDM A;  5AE4 A;  1P1O A;  3FJ7 A;  4NGU A;  1ATG A;  1YTV A;  3TPA A;  4NF6 A;  2XD2 A;  3KC0 A;  1LBZ A;  2P0S A;  3B7D A;  3O66 A;  1OVT A;  1DBZ A;  3N26 A;  1MXW A;  2Z8E A;  4HE1 A;  3A3U A;  3U72 A;  3HV1 A;  4YMA A;  1LBB A;  4ZE8 A;  4F18 A;  3K2D A;  4PQJ A;  4GRK A;  3C35 A;  3IOT A;  3GZG A;  2O7U A;  2F8D A;  1FBE A;  3QXM A;  4I8C A;  3QAX A;  3Q26 A;  4Q8R A;  1AWB A;  1UTH A;  4EQ7 A;  4N8G A;  5CC2 A;  4OYV A;  4I1D A;  2NXO A;  3TEP A;  3VE1 B;  1GGG A;  4FJP A;  1UIV A;  3EF7 A;  4NX1 A;  4OQO A;  4WXJ A;  4OFJ A;  5I2K A;  4OVQ A;  3TOD A; 
#chains in the Genus database with same CATH homology
 3CFZ A;  3TTM A;  3OO9 A;  1B4Z A;  3M3K A;  1XVX A;  1OQH A;  2PYY A;  1MQD A;  5I2N B;  1OIB A;  1OLA A;  1B51 A;  3K6W A;  4ZEB A;  3CFL A;  4R6H A;  3MAM A;  5FHN A;  5ITP A;  4ZEC A;  3FXQ A;  4F3B A;  4QFK A;  3IOV A;  2VHA A;  4EF1 A;  2RC7 A;  3IOU A;  3K0V A;  3K6V A;  1SI0 A;  4EQB A;  2X26 A;  1H76 A;  3GBA A;  2R71 A;  1I69 A;  3MBP A;  1DTG A;  2UVG A;  4U4X A;  4ELR A;  5J1D A;  1PBP A;  5DYH A;  2XX9 A;  1MY4 A;  3TEL A;  4O3B A;  1LAX A;  3T96 B;  4R9F A;  4U2R A;  4RA1 A;  2HXW A;  4KQP A;  1VE4 A;  4IO7 A;  4ND9 A;  4PFW A;  3ZKL A;  1JW4 A;  2Y7K A;  1S7Y A;  1ANF A;  3FVO A;  4C0R A;  2V3T A;  3FUZ A;  1GTK A;  3CFX A;  3PD9 A;  2D3I A;  2H99 A;  1MM7 A;  2I48 A;  2F35 A;  4KYE A;  1SVX B;  1EU8 A;  2DWI A;  1B05 A;  4FEB A;  2KLF A;  3AXF A;  3S2V A;  1PB8 A;  1YAE A;  3K6U A;  1JET A;  3KGC A;  2Y7I A;  3IB2 A;  1BTJ A;  2DP8 A;  3C36 A;  2FA7 A;  1MXU A;  5EYF A;  1H44 A;  1ZJL A;  4LZ8 A;  3PPQ A;  2REG A;  3T66 A;  4EXK A;  3GLB A;  4EQ9 A;  4Z7E A;  1JW1 A;  3U94 A;  4RK2 A;  2XD3 A;  3UOR A;  4OFO A;  1FQA A;  4PFU A;  1FW0 A;  1MM6 A;  3HN0 A;  3SEX A;  4FIM A;  2Z8F A;  4R6Y A;  3FJM A;  5AA4 B;  4R6K A;  4MF3 A;  4QHQ A;  3T9X B;  1VR5 A;  2VGQ A;  3PUW E;  3CG3 A;  2HEU A;  4EDP A;  2ZNU A;  3A09 A;  4WKM A;  3IR1 A;  1LCF A;  3WAF A;  5AA4 A;  3MVX A;  1MH3 A;  2GHA A;  2THI A;  1UQW A;  1LFI A;  2OK2 A;  1Z7M E;  4QFO A;  3JYR A;  3VLV A;  1TT1 A;  3U93 A;  3S9L C;  4TOZ A;  1LFG A;  1LGB C;  1JQF A;  3G3F A;  4BDO A;  1JVX A;  5H8Q B;  4F39 A;  5H8F B;  2DE4 A;  1MQH A;  3G3H A;  4RXL A;  1NKX A;  4BDN A;  1A7L A;  3SEV A;  4XKR A;  3D4G A;  1P1N A;  4G8H A;  4NTL A;  5DVI A;  2F36 A;  1B3E A;  2I0C A;  1R9Q A;  3O6G A;  4C1T A;  2D5W A;  2OJT A;  4JWO A;  3O6I A;  1GV8 A;  3VXC A;  2O51 A;  3CI8 A;  2XX7 A;  4DIG A;  1ELJ A;  2DE2 A;  2ONR A;  2ZXT A;  3C32 A;  2XXV A;  3N5L A;  5CMB A;  1QKB A;  2UVI A;  4U22 A;  5KCJ B;  3FV1 A;  2QS1 A;  3IO4 A;  3IOW A;  4OEV A;  5JEI A;  1S9T A;  5ICT A;  1JEV A;  1OQG A;  2Z22 A;  1MPD A;  2QJE A;  3G3J A;  4LQ2 A;  1B32 A;  4O3A A;  1QJM A;  1EZ9 A;  1IIW A;  5AA2 A;  4NWD A;  4HW8 A;  5DVJ A;  1SBP A;  1LLS A;  2ABH A;  2HCA A;  4R73 A;  2F78 A;  2DYX A;  3OD7 A;  1US4 A;  3RPW A;  3PMW A;  3K6X A;  2B65 A;  5I59 A;  3T9H B;  3MJN A;  4F22 A;  1XC1 A;  5ICQ A;  4UAC A;  1A55 A;  1B3F A;  3PD8 A;  1EZO A;  4H67 A;  2XX8 A;  5CBS A;  2VD2 A;  3OO8 A;  4FE8 A;  5TP9 A;  3G3I A;  2PMS A;  4OWD A;  2B3F A;  3Q29 A;  2PT2 A;  1D9V A;  4RPN A;  3MP1 A;  4F3S A;  3S4U A;  4DXB A;  2LAO A;  1WOD A;  4DXU A;  4ZZA A;  5ISU A;  1SQY A;  1TXF A;  1MXZ A;  4U4S A;  4WEP A;  1NL5 A;  2A5T B;  2NOO A;  4M4G A;  5DTB A;  4BLA A;  1ZIU A;  1N76 A;  2RF1 A;  2QPQ A;  3CIJ A;  5EHS A;  3MVZ A;  3MC2 A;  1AMF A;  3PV0 E;  2VD3 A;  1DPP A;  1I6Q A;  3HHG A;  2ZMB A;  3TTK A;  1LCT A;  3KJ7 A;  3MZ1 A;  1QUL A;  2PVU A;  2ALU A;  1ZBM A;  3IAZ A;  3SEW A;  4EF2 A;  4PFY A;  5KDT B;  1URG A;  5H8H B;  1USY E;  5H8N A;  3ILU B;  4DXC A;  2Q89 A;  4NWC A;  1NNP A;  4KI0 E;  2QSX A;  5CMK A;  2O84 X;  2WKY A;  5KDT A;  5H8H A;  4H5G A;  1AL3 A;  3PPN A;  1OMP A;  3FXR A;  4GXS B;  4X1B A;  2GRV A;  2O1M A;  2Q2C A;  4KFQ A;  2H5Y A;  2RC9 A;  4F1V A;  5I57 B;  1Y4T A;  2DVZ A;  1P1U A;  1SW4 A;  2I58 A;  3VLW A;  2X7Q A;  2ZNS A;  4F1Y A;  4OXV A;  1Y3Q A;  2BJJ X;  1BP5 A;  4NF6 B;  1A54 A;  1WDN A;  4UA8 A;  3H6W A;  2FNC A;  2XXP A;  4RNS A;  3C4M A;  1B2H A;  5HM4 B;  5I58 A;  5IAI A;  3K02 A;  3H06 B;  4U1O A;  1N0T A;  1AH5 A;  4GIZ A;  1MQJ A;  3PMX A;  4U23 A;  1B3G A;  1MQI A;  3ODB A;  2GFE A;  2HQ0 A;  1UTH B;  4AB6 A;  3VV5 A;  5DEX B;  4YAH X;  4F29 A;  4IY6 A;  1MY3 A;  1O63 A;  3HCQ A;  3TTR A;  2I0B A;  3OEM A;  3FVG A;  5I2K B;  3N6T A;  4KCD A;  2Q8J A;  4Z0I A;  3K1M A;  1OLC A;  1A40 A;  1JVY A;  4QRZ A;  4BDL A;  3VVD A;  3IX1 A;  5DEX A;  3G3K A;  4FAJ A;  3S9M C;  3FJG A;  2RCB A;  4Q30 B;  4ELO A;  1UIU A;  1FQF A;  3MUQ A;  2G93 A;  4X9T A;  4OET A;  3T9U A;  4YMB A;  3RUM A;  4JDF A;  3QYT A;  3CSG A;  3IB0 A;  1Y3N A;  4Q0C A;  3BKI B;  2RIN A;  3BFU A;  3TQW A;  3BFT A;  4NE4 A;  5I56 B;  1LBC A;  1TWY A;  1LB8 A;  2I4B A;  1FTL A;  2Z23 A;  1EZP A;  1YPN A;  2Y7W A;  1R9L A;  3ZSF A;  5DVF A;  2PT1 A;  4O3C A;  3T93 B;  4P11 A;  5I84 A;  1VFD A;  2DWA A;  3E9X A;  1UTB A;  1J1N A;  4N13 A;  5I56 A;  1R6Z A;  4YU0 A;  1MY0 A;  2DS9 A;  1GR2 A;  1B7H A;  3CR9 A;  3O6H A;  3TAJ A;  4NF4 B;  1SW2 A;  1BIY A;  4ZS9 A;  3T9V A;  4GWO A;  2V25 A;  2VOZ A;  4OMB A;  1MPC A;  2QS2 A;  1A99 A;  3F11 A;  3G3G A;  1XS5 A;  5B7D A;  2Y7P A;  1DTZ A;  3N6U A;  3SKP A;  4KPT A;  4NF4 A;  4QSD A;  5L9S A;  5CM6 A;  2OZZ A;  1B1X A;  1LB9 A;  1JW5 A;  2R9J A;  4GQO A;  3I5O A;  5B70 A;  3TTN A;  2OBG A;  4E0W A;  4YKK A;  3H4Z A;  4PP0 A;  1B6H A;  1M5D A;  4JXI A;  1IEJ A;  5HBC A;  4IO6 A;  3LUY A;  3TKD A;  1Y9U A;  2XXH A;  4JBZ A;  5FTI A;  2I6E A;  1MXX A;  5KZT A;  3W9V A;  1II5 A;  4ELP A;  2B3B A;  3M8U A;  2QMW A;  2DVC A;  3EHT A;  3K01 A;  2AYS A;  3TQL A;  4AB5 A;  1O7T A;  4WED A;  1XOC A;  3SES A;  4E0X A;  3I6V A;  3VXB A;  3M3L A;  4GD5 A;  1Q35 A;  1PB7 A;  3IOR A;  3H6U A;  4XKN A;  1XT8 A;  3SET A;  1VFE A;  2O69 A;  2E1S A;  1CE2 A;  1MY1 A;  1PDA A;  5DT6 A;  3A3C A;  1ZTY A;  4JWY A;  3V8X B;  1IQ7 A;  4OHN A;  1N7W A;  1BKA A;  5CI5 A;  4G68 A;  1URD A;  4G2Z A;  1D4N A;  5ELV A;  3OEN A;  4YB7 A;  4RY1 A;  3USD A;  1N04 A;  2XXI A;  1B7Z A;  3TTL A;  3FGS A;  2H4I A;  1IXH A;  4F2O A;  2HZK A;  4TQU Q;  3N94 A;  2GH9 A;  4LQ5 A;  2IA4 A;  4HCW A;  2F7B A;  1ZLQ A;  1XHY A;  5AA2 D;  3DP4 A;  3IO6 A;  2OLB A;  4YKP A;  4GOT A;  3E4R A;  3H03 A;  3P7I A;  2Q88 A;  1S50 A;  3UIF A;  1H3D A;  2A5S A;  3D4C A;  2X7P A;  4QF9 A;  3RNN A;  3MZB A;  3VDF A;  1M5E A;  2XXU A;  1Z7N E;  1LAG E;  4G68 C;  4XXU A;  4ZED A;  1KWH A;  5EHM A;  1B3L A;  3FXU A;  5IKB A;  4GL0 A;  1MG1 A;  5AA2 B;  3PUV E;  4YKJ A;  2QL3 A;  2V3U A;  2V3Q A;  1M5B A;  3OMB A;  3Q27 A;  1AIV A;  4PE5 B;  4ELQ A;  3R6U A;  4OES A;  4H0W A;  2D21 A;  2W7Y A;  4HS7 A;  5I59 B;  3IK6 B;  3Q25 A;  1DMB A;  3DEL B;  4GXA A;  2P1S A;  3KN7 A;  3KSJ A;  2QRY A;  3QIM A;  1POT A;  3QK6 A;  2XXR A;  3L6G A;  3O28 A;  4H8I A;  4I9D A;  2O6A A;  3OO7 A;  5TP9 B;  1JNF A;  1FTJ A;  4DCY A;  1YCJ A;  4FED A;  2HAU A;  1DOT A;  2Z8D A;  3LSF B;  3OEL A;  3PUX E;  2HZL A;  2RC8 A;  2UVH A;  3OOA A;  4OEN A;  1NMU A;  1LFH A;  3TCH A;  4LON B;  3QUJ A;  3PPR A;  4L17 A;  2AL5 A;  2DOJ A;  4KYS A;  4ZEK A;  1ZKB A;  1QUJ A;  1IXC A;  1B58 A;  1MRP A;  3LR1 A;  2OWT A;  3RTF B;  4POX A;  2UYE A;  4F31 B;  4ISU A;  1B5I A;  4ZEI A;  3ONM A;  3O2A A;  4R74 A;  4OVJ A;  3R26 A;  4YB5 A;  2PX1 A;  1B0L A;  2DXY A;  2F6G A;  1HSJ A;  1BLF A;  4LAT A;  3TDJ A;  2F5X A;  2O68 A;  3IJX B;  3TCG A;  2NUV A;  3TUS A;  4Q5T A;  2YLN A;  3LSL A;  3B6W A;  4H1X A;  4XIG Q;  2XHD A;  5H8N B;  1URS A;  1B5H A;  3OSR A;  4XKQ A;  1N3X A;  2XXQ A;  1H43 A;  2GHB A;  4OEU A;  3RT6 B;  3HO7 A;  4FEC A;  3C33 A;  4GF8 A;  2UYF A;  3MP6 A;  4AQ4 A;  4LZ7 A;  1EH3 A;  4BDM A;  1POY 1;  5A5X A;  4H8J A;  3FZV A;  4ZE9 A;  1XVY A;  3RT8 A;  4KHZ E;  2Y84 A;  4NF5 A;  4ESX A;  1SD3 A;  4JSD A;  1MPB A;  2H9B A;  3QSL A;  1PBQ A;  2Q9T A;  5I58 B;  1FQB A;  4U1Z A;  1I6B A;  4MBP A;  3IL1 B;  1D9Y A;  3TYH A;  4EUO A;  3VLU A;  4H5F A;  4R2F A;  3UA8 A;  1TFD A;  5TU0 A;  1AOV A;  3PUZ E;  1LAH E;  2ZYO A;  3MPK A;  1NNT A;  1IZ1 A;  3QUF A;  1SYH A;  2PBW A;  4GFR A;  2R6G E;  3UK4 A;  3ZKK A;  1FTM A;  2QMX A;  4HTG A;  3TMG A;  3LSX A;  2HAV A;  2DWJ A;  4PET A;  5AA3 A;  1Y1M A;  4DLD A;  1FQD A;  2F7C A;  1Q1K A;  1US5 A;  3M3F A;  1JEU A;  1Y20 A;  3KOT A;  5JK4 A;  3OO6 A;  3G7W A;  2AIX A;  2ONS A;  1MXY A;  3KSX A;  4P0G A;  2NVU B;  2E0S A;  3B6T A;  4OTE A;  3MQ9 A;  1NNK A;  3IB1 A;  3OEK A;  2OCU A;  1USY H;  1LAF E;  4JSO A;  3LC8 A;  3V83 A;  3PU5 A;  3FVK A;  5CMM A;  1UTB B;  4F19 A;  1QUK A;  4IO5 A;  4JB7 A;  5AA1 A;  1IXG A;  4BDR A;  4GL8 A;  5LOM A;  4JWX A;  1P1Q A;  1MY2 A;  3C31 A;  4G8N A;  1R1N A;  3BBR A;  4I62 A;  3U8Q A;  1D3K A;  4LVQ A;  4R75 A;  4MFI A;  3TZA A;  5L8D A;  1TFA A;  5M2V A;  4K3F A;  1HSE A;  4YZZ A;  2G29 A;  1B46 A;  2F6P A;  4KYD A;  5I2N A;  3EN3 A;  3KFM A;  2F34 A;  3K4U A;  3H7M A;  3JZJ A;  4G77 A;  4QFP A;  3PGF A;  4MH5 A;  3SEU A;  3Q28 A;  4XKP A;  2REJ A;  2Y7R A;  2YJP A;  1MDQ A;  4N07 A;  3ILT B;  2HFB A;  3I3V A;  5K2Y A;  4QSC A;  3U1O A;  2RCA A;  3SEY A;  2H25 A;  4KR5 A;  4R2B A;  2O7I A;  4YKI A;  1IIT A;  4LZ5 A;  4RPO A;  2I4C A;  2XXW A;  4ESW A;  4N6P A;  5CRY A;  2XXY A;  4IO4 A;  1NH7 A;  4QFN A;  1ZU0 A;  3B6Q A;  3ZS6 A;  1NH8 A;  2ONK E;  3DP6 A;  3VVE A;  1N84 A;  1P99 A;  3KZG A;  3EHU A;  3KJT A;  3FVN A;  2V84 A;  3H6T A;  4H65 A;  5L9O A;  2P2A A;  3KN8 A;  2M8C A;  3VVF A;  2DE3 A;  4M1V A;  3MZ9 A;  1H45 A;  5BWJ A;  2Q2A A;  1L5T A;  1MH4 A;  1N3W A;  3FAT A;  4F1U A;  3UN6 A;  1PEB A;  4QFL A;  4G68 B;  5TPA B;  4F3P A;  4IO3 A;  3V5A A;  4RYA A;  5HPQ A;  1F9B A;  1DPE A;  3VFJ A;  1SDX A;  1MXV A;  5FHO A;  5CBR A;  1M5C A;  4YB6 A;  3KN3 A;  4THI A;  3GXA A;  3W15 C;  5L9M A;  3O29 A;  2IEE A;  5TPA A;  4POW A;  3LBS A;  3MVW A;  5JTY B;  4ZZE A;  1DSN A;  1MS7 A;  1Y3P A;  1FTO A;  1B0H A;  1HSL A;  2DQV A;  3LSW A;  3O97 A;  1B9J A;  1WVJ A;  1B5J A;  3OXN A;  4F3G A;  3MWB A;  4NF8 B;  5JTY A;  2ZYK A;  1MDP 1;  2ZYN A;  3K00 A;  3K1N A;  2NWJ A;  1FCK A;  3HPI A;  4X1D A;  4YIC A;  4ONY A;  4DE8 A;  3L6H A;  4GLI A;  4KD5 A;  1B4H A;  4NF8 A;  1B3H A;  5F7V A;  3MVY A;  3RN8 A;  5H8Q A;  4IY5 A;  3SER A;  3W9W A;  5H8F A;  2ANJ A;  3GBB A;  3K1P A;  1QUI A;  3S9N C;  4ZEF A;  4HCY A;  3DLN A;  4LP2 B;  3FV2 A;  3E13 X;  1CB6 A;  1B7U A;  2QS3 A;  1FTK A;  3C9H A;  1Y1Z A;  4DCX A;  3TFL A;  1B52 A;  1A8F A;  4NMY A;  1SW5 A;  3DP8 A;  3FAS A;  1LST A;  1MQG A;  1PC3 A;  3CSB A;  1QW0 A;  4BDQ A;  4XTC Q;  1ZMG A;  5ITO A;  5KCJ A;  1I6A A;  3PPO A;  2XXT A;  1RKM A;  1SI1 A;  3PUY E;  4LUB A;  1M5F A;  1SYI A;  5FHM A;  3UGW A;  4OFL A;  3KEI A;  3RGY A;  3EHS A;  3RLF E;  1GVC A;  3EPE A;  1Y4C A;  1P1W A;  1B1H A;  4U21 A;  2CMO A;  1NNF A;  1IXI A;  3C34 A;  4TLM B;  4G4P A;  2YPN A;  2CZL A;  1FQE A;  4QSE A;  2I3V A;  3T22 A;  2ZYM A;  4P0I A;  2DSF A;  3HST A;  3RY3 A;  3DM0 A;  3E3K A;  2UXA A;  3EQ1 A;  3IJO B;  3CRB A;  4RJZ A;  4DDD A;  4FAT A;  3KG2 A;  4DZ1 A;  1A8E A;  4OER A;  5H8S A;  4ECF A;  1T0K A;  5FTH A;  3KBR A;  4NED A;  3V89 B;  2DWH A;  2ESN A;  4EXL A;  1SW1 A;  3RQT A;  3MPL A;  1QKA A;  4MLV A;  5F1Q A;  2QS4 A;  2I49 A;  1QVS A;  4F2Q A;  4GVO A;  5A5X B;  4H6D A;  5K2X A;  3H6V A;  5CMC A;  3KOS A;  3TCF A;  2XXX A;  2VP1 A;  3CVG A;  2O1L A;  4NF5 B;  2A5T A;  4PFT A;  1NFT A;  1RYO A;  1IUD A;  1N7X A;  1B40 A;  2F97 A;  3O9P A;  4LA9 A;  3MP8 A;  4C1U A;  4IO2 A;  4FOR A;  3PMV A;  1FQC A;  3S9E A;  3CG1 A;  3THI A;  4IGT A;  2FYI A;  4G8M A;  4OZ9 A;  3FD3 A;  3PPP A;  3R7X A;  2H98 A;  1VSO A;  4R9G A;  2F7A A;  4TLL B;  4R72 A;  1O64 A;  4X48 A;  4IGR A;  5BUU A;  4RK9 A;  2V93 A;  2AL4 A;  2I3W A;  2OWS A;  4IB2 A;  3H3G A;  3JV9 A;  4MLQ A;  4KCC A;  3ECR A;  3FIR A;  1PB9 A;  3UP9 A;  3RTW B;  3WAE A;  3SDF A;  3U92 A;  1RYX A;  2ZNT A;  3OSQ A;  3HHF A;  1OVB A;  3MW0 A;  2UVJ A;  5I57 A;  2DXR A;  2RKM A;  4ZDM A;  5AE4 A;  1P1O A;  3FJ7 A;  1ATG A;  1YTV A;  3TPA A;  4NF6 A;  2XD2 A;  2P0S A;  3B7D A;  3O66 A;  1OVT A;  3N26 A;  1MXW A;  2Z8E A;  3A3U A;  3U72 A;  3HV1 A;  4YMA A;  1LBB A;  4ZE8 A;  4F18 A;  3K2D A;  4PQJ A;  4GRK A;  3C35 A;  3IOT A;  3GZG A;  2O7U A;  2F8D A;  3QXM A;  4I8C A;  3QAX A;  3Q26 A;  4Q8R A;  1UTH A;  4EQ7 A;  5CC2 A;  4OYV A;  4I1D A;  2NXO A;  3TEP A;  3VE1 B;  1GGG A;  4FJP A;  1UIV A;  3EF7 A;  4OQO A;  4WXJ A;  4OFJ A;  5I2K A;  3TOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...