3G7WA

Islet amyloid polypeptide (iapp or amylin) residues 1 to 22 fused to maltose binding protein
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
393
structure length
393
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAKCNTATCATQRLANFLVHSSNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein, Islet amyloid polypepti
publication title Atomic structures of IAPP (amylin) fusions suggest a mechanism for fibrillation and the role of insulin in the process
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein, hormone
total genus 123
structure length 393
sequence length 393
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g7wA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g7wA01
2QSXA 2HXWA 4DE8A 4GVOA 1FCKA 4G68B 4QSEA 3HHFA 3I6VA 2AIXA 1FQCA 4IGTA 1N3XA 4JBZA 1JEUA 4XKPA 4MLVA 4RK2A 5BWJA 3O66A 3P7IA 1PEBA 1A55A 3PMVA 4F2QA 3G3IA 3N5LA 3QAXA 4YKJA 1SW2A 1AH5A 4F3SA 1JETA 1Y20A 4FE8A 3BKIB 3RY3A 1A99A 3CI8A 1ATGA 4M4GA 3SESA 1JW5A 1DPPA 1BTJA 4OTEA 2FA7A 3MBPA 3OELA 3HV1A 3IOVA 2UVHA 2HFBA 3L6HA 3CSBA 1I6BA 3TTNA 3FXRA 1LBCA 3MZ9A 4TOZA 1MY1A 2ONSA 3CVGA 4MLQA 5HBCA 2AYSA 2IEEA 1SI1A 1N7XA 3HCQA 3FIRA 1XVXA 2ESNA 3SKPA 1NNPA 4RY1A 1B2HA 2AL5A 3HHGA 3ZKKA 1S7YA 3CG1A 1MXVA 4WEDA 5AA2A 2Y7RA 3G7WA 1EH3A 4ZDMA 4U1OA 1DSNA 4KD5A 4ZE9A 1MPCA 4UACA 4GF8A 2XXWA 2RCAA 4LP2B 3FATA 4FAJA 2P0SA 1MH3A 5KCJA 3ILUB 4QFKA 4JWXA 4IO5A 2HZLA 4RPNA 1WODA 3LUYA 1B1XA 4F3BA 3JYRA 3GBBA 4POWA 4R75A 4KQPA 1BP5A 3OO8A 4KCDA 3RNNA 5H8QB 3EHSA 1XVYA 4H5GA 3H06B 4TLLB 3LR1A 3KN8A 4XKRA 2XXVA 3ECRA 4RPOA 3KJTA 3IR1A 2O69A 3FASA 1B5IA 1TXFA 5AA3A 3H6WA 3TQWA 1SVXB 1VE4A 3OO9A 3DELB 2F5XA 5I2KA 3KSJA 2OBGA 3OOAA 3K1NA 4LZ5A 3JZJA 1LGBC 1A54A 4MH5A 1J1NA 3H7MA 2I6EA 3MZ1A 4XTCQ 5DT6A 5B7DA 1R1NA 3QSLA 1Y1ZA 3K1MA 3U8QA 4PETA 2RINA 1N04A 4U4SA 3KBRA 1T0KA 5EYFA 4NF6B 4KYSA 4YICA 3TKDA 3USDA 2RKMA 2VD3A 3KGCA 3O9PA 1M5DA 5H8SA 5DTBA 4ZEKA 4OVJA 2XD3A 3FZVA 5KZTA 1GGGA 3MPKA 2F35A 1B40A 1PBQA 1OIBA 4JSDA 5L9SA 5AA2D 3K4UA 4JSOA 1N7WA 5DEXB 4OEVA 3OEKA 2QRYA 1Z7NE 3DM0A 1OVBA 1BIYA 5ITOA 5AA4A 3GBAA 3IL1B 2Z23A 5AE4A 4EQ7A 2H25A 2OLBA 2P1SA 3MPLA 1UTBB 3D4GA 3KJ7A 1NMUA 3M3FA 2OCUA 4PE5B 4R6YA 1B7ZA 5CMKA 3B6QA 1UTHA 3V5AA 4YKKA 3FGSA 3FV1A 1N0TA 2Q2AA 4PFTA 2QMXA 4PQJA 2E1SA 4KPTA 5CBRA 4GD5A 1MPBA 3ODBA 3MVYA 4OERA 2GH9A 4OYVA 3BBRA 2REJA 4Q8RA 1NNKA 4E0WA 1MQDA 3CFXA 4R73A 1FTJA 3CFZA 1S50A 1MM6A 4FECA 3UORA 1QUIA 1O64A 5A5XA 5CRYA 1GV8A 1MM7A 1UIVA 1SDXA 4DIGA 2GRVA 4WKMA 1ZBMA 1P1QA 2QS4A 1MXXA 2A5TA 3SEVA 3PPPA 4H5FA 5CMBA 5JTYA 3KSXA 3QXMA 3PD9A 1KWHA 4R74A 5EHSA 3ONMA 3TZAA 3PUYE 1SQYA 3S9NC 2FNCA 1B7HA 3VLWA 2YPNA 2PMSA 2R71A 3M3LA 1URDA 2DOJA 3KN3A 3BFUA 1SBPA 4BDOA 3Q29A 1H43A 3RTFB 2X7QA 4AQ4A 5JK4A 3O6HA 3LSLA 4YKPA 3C4MA 1FQDA 4P0IA 3TPAA 1N3WA 4NF4B 4I62A 3TODA 2XHDA 1Q35A 3MP1A 4GL0A 4GFRA 3H3GA 2ZNUA 4ESWA 3A09A 1A8FA 2XX9A 3VDFA 4NF8B 3PPNA 2REGA 2O6AA 4ZZEA 1B05A 3FJGA 1PB9A 2ANJA 4M1VA 3K02A 4PFWA 1Y4TA 4F1YA 4U4XA 3K6WA 3N94A 1MH4A 3TFLA 1SW5A 4UA8A 2UVJA 4HCYA 2O84X 1MQIA 4RJZA 1M5FA 3MUQA 2F36A 3QK6A 5I2NA 4OFJA 1LFIA 4C1UA 4EDPA 2O7UA 1M5CA 5AA1A 3ZSFA 3JV9A 1XHYA 4G68C 5FTIA 4F31B 1OQGA 4GXSB 2UVIA 4X48A 1Y3PA 4ZEFA 1IIWA 5TPAB 1H76A 3CIJA 2IA4A 2XXRA 3VFJA 2B3FA 3MQ9A 2VOZA 3KOTA 5KCJB 3ILTB 2F78A 5ICTA 1MXYA 3OXNA 4EXKA 1H44A 3UGWA 1URGA 4HW8A 1LFHA 5LOMA 3BFTA 3R7XA 5ITPA 2I58A 3KEIA 4OFLA 3LSFB 3PU5A 1HSLA 4F3PA 3H6VA 3OSRA 3MVXA 4BDLA 1BLFA 2VP1A 2ZNSA 1MDQA 2Q9TA 5ICQA 3N26A 3T93B 4LATA 2I0CA 3FUZA 4TQUQ 1HSEA 2I48A 3PPRA 4EF2A 3T9HB 1B51A 4XKNA 5DVJA 1M5BA 2Q89A 2PX1A 1XT8A 4EUOA 3S2VA 2HAVA 4OQOA 2UVGA 1LCFA 1N84A 4ZECA 4JDFA 2I4CA 2ZYMA 3C9HA 2F97A 4P11A 2RF1A 2V3UA 3U92A 1ZU0A 1JVXA 3RTWB 3MWBA 1MXZA 4I8CA 1Y9UA 5EHMA 2NWJA 2H98A 1MG1A 4F18A 5KDTB 2XXUA 3UIFA 4LVQA 2Z8FA 4ZZAA 1P1WA 1B0LA 2P2AA 4C1TA 1LBBA 4OFOA 3EPEA 1I6QA 1LCTA 4N07A 4Z7EA 3IB0A 3QUFA 4JWOA 4FORA 2QJEA 3Q28A 3K2DA 5I58A 4OESA 1VSOA 1FQEA 4NWDA 2NVUB 2UYEA 3RUMA 3S4UA 4HCWA 4OEUA 1D4NA 1OMPA 2CZLA 1PB8A 3IO6A 4KYDA 4IO7A 2ZNTA 1OQHA 2D3IA 4IO6A 3DP4A 1LB9A 1B3EA 3WAFA 3A3CA 1QULA 4OENA 2V3TA 3FD3A 1LAHE 1DTGA 4LA9A 4DXUA 2DWHA 2ONKE 4ELQA 2F7BA 1XC1A 3TEPA 2Y7IA 5H8FB 1R9LA 2XXPA 3SEUA 3HN0A 4JB7A 3MVWA 2PT1A 1FTLA 1B3HA 1CE2A 5I56B 1O63A 3PPOA 5FHNA 5A5XB 1GVCA 1SW1A 2WKYA 1SI0A 3C36A 4DXCA 4PFYA 5TP9A 4ONYA 3B6TA 1D3KA 2A5TB 2O7IA 4R72A 2ZYKA 4MFIA 4L17A 3G3FA 4Q0CA 5I84A 2W7YA 4DZ1A 4R6HA 3HO7A 4H1XA 4F2OA 1US4A 3SEWA 1FQFA 4KHZE 5L9OA 4ZEBA 3DLNA 2QS3A 1JVYA 3SERA 3TCGA 1OLAA 1P1OA 3SEYA 4NWCA 2HAUA 4QF9A 1FW0A 2HEUA 5HPQA 3IOTA 4F39A 3LBSA 3HPIA 2R9JA 4U21A 3MJNA 1LAFE 3SETA 3TMGA 1A8EA 4THIA 4RK9A 3EHUA 4F29A 4U23A 2G93A 3TTLA 4X1DA 2H99A 4QFOA 4YB5A 4FEDA 1B3LA 2QL3A 3IOUA 3VVFA 4AB5A 2DYXA 3B6WA 5CC2A 3VVEA 2DE2A 4BDRA 3T9UA 4ELRA 3QIMA 2Q2CA 1TT1A 1ANFA 4U22A 4GIZA 4ZS9A 3PMXA 3TTRA 4XIGQ 4G4PA 1DPEA 2XXYA 4G8MA 1NNFA 1FTOA 1MDP1 4QFLA 1NNTA 4IO2A 2M8CA 1DTZA 1YAEA 2NXOA 1DOTA 2DWIA 1B52A 3IJXB 1OLCA 4NF5A 2UXAA 4RXLA 2B3BA 2X26A 5CBSA 2G29A 2PVUA 1Z7ME 4LZ8A 4KYEA 1B0HA 3O28A 4KCCA 2PBWA 5DVFA 3OEMA 4LUBA 2UYFA 2Y7KA 4H65A 3CR9A 3TCFA 2DE4A 2V93A 4ND9A 5M2VA 2XXXA 1LFGA 1B58A 3D4CA 2E0SA 5I59B 2V25A 5I57A 3E4RA 1B7UA 4GOTA 4N6PA 2F7CA 1A7LA 4R2FA 4BDQA 3IAZA 2XD2A 1M5EA 3T9XB 1AMFA 5JEIA 1VR5A 1SYHA 2DXRA 4QRZA 2VD2A 3O2AA 3LSXA 1B3FA 4RNSA 1YPNA 1POY1 1SW4A 1UIUA 2XXIA 4NF6A 3FJMA 2RC7A 1FTKA 2QS1A 1ZLQA 4ESXA 3T96B 2V84A 3IB2A 2OWSA 1QUJA 3I5OA 4HTGA 5CM6A 1Y4CA 3OMBA 3I3VA 2XXHA 1LB8A 5IKBA 4G8HA 3QYTA 3T9VA 2OK2A 4R2BA 3G3KA 3EQ1A 3KFMA 1NL5A 3CG3A 3TCHA 4QSCA 3EHTA 1B4HA 3MAMA 2Y7PA 4JXIA 4QFNA 4NMYA 3K0VA 1ZMGA 4YKIA 4QHQA 2DWJA 1MXUA 3ZS6A 1JQFA 1IZ1A 4KR5A 1F9BA 2ZYNA 3C35A 2R6GE 3TDJA 4ZE8A 3R6UA 4KI0E 3MP8A 2VGQA 4DDDA 1USYH 1BKAA 3H6UA 2Q88A 4Z0IA 2V3QA 3B7DA 2ZYOA 1PDAA 4KFQA 3QUJA 3TELA 4P0GA 1HSJA 3LC8A 1FQBA 3IK6B 3L6GA 3T22A 3GZGA 1Q1KA 3RN8A 1O7TA 4WEPA 5CMCA 5AA2B 3K6VA 2DE3A 4U2RA 5ELVA 2DVCA 4U1ZA 4F1UA 1B1HA 2DS9A 2YLNA 3RQTA 1QW0A 3GLBA 3IORA 4MBPA 3M8UA 3SEXA 1R9QA 1SD3A 2ALUA 1B5HA 1H45A 4TLMB 2Y84A 4F22A 5K2XA 1R6ZA 1MY3A 1FTMA 4R6KA 3C34A 1LAGE 4LQ5A 3H03A 2AL4A 2ZMBA 1MXWA 2RC8A 3F11A 4XKQA 1IXGA 2LAOA 3TUSA 1JNFA 4DCXA 3S9LC 1RYOA 1N76A 3C32A 4LQ2A 5I2KB 3EN3A 3AXFA 5TP9B 1L5TA 4GRKA 4WXJA 4IO3A 2F34A 2HQ0A 3RT8A 1PB7A 3OD7A 4H0WA 4XXUA 4RA1A 2I49A 4NF4A 5H8HA 1NH7A 3VVDA 4NF8A 2GFEA 3KZGA 1QUKA 2CMOA 4ZEIA 3H4ZA 2O1MA 3KG2A 1TFAA 1IXHA 3THIA 3C33A 5H8NA 3N6UA 4Q5TA 3U72A 1RYXA 4QSDA 4R9FA 3TQLA 4OXVA 1GTKA 1Y3NA 1AIVA 4EXLA 4YB6A 3TYHA 3U94A 1ZKBA 4H6DA 4Q30B 3TTKA 2BJJX 2Z8EA 4GWOA 3S9EA 2PT2A 3FVNA 4IY6A 1YTVA 3LSWA 2H4IA 4YU0A 3ZKLA 3V83A 5AA4B 4R9GA 4BDNA 4DLDA 2F6PA 3MZBA 3VLVA 2O51A 2THIA 1ELJA 3C31A 1UTHB 3PMWA 1YCJA 3GXAA 4MF3A 4GLIA 1QVSA 2D21A 4F3GA 3FVOA 1B46A 5TPAA 3RPWA 4POXA 1USYE 4NF5B 2I3WA 3SDFA 4X9TA 4G77A 1IXCA 2GHAA 1MQGA 4FJPA 4H67A 3U93A 2DP8A 3M3KA 3DP6A 1OVTA 4EQ9A 3H6TA 1NH8A 1H3DA 1EZ9A 3PUVE 5DYHA 3G3GA 3HSTA 3UA8A 5CI5A 1LAXA 4G68A 1MPDA 2GHBA 3R26A 1II5A 3KN7A 1MY4A 4NE4A 5I57B 2DXYA 4IO4A 2I4BA 1P1UA 5JTYB 3CSGA 3Q25A 4C0RA 3PGFA 2HCAA 2Z8DA 2B65A 2O1LA 5J1DA 4O3AA 5B70A 2Y7WA 3MP6A 1B9JA 1QKAA 1SYIA 3VXBA 1B32A 1POTA 1A40A 3FXQA 5DVIA 3TTMA 2ONRA 4ELOA 3IJOB 1ZIUA 2HZKA 1IEJA 1QKBA 4DXBA 3RT6B 2QS2A 2H9BA 2XX8A 3UP9A 3PPQA 1MY2A 2X7PA 3N6TA 3O6IA 4I1DA 4LONB 3CFLA 3VE1B 2DQVA 4F19A 1LSTA 1DMBA 4F1VA 4K3FA 2OWTA 4YAHX 5KDTA 1IQ7A 4OMBA 4OZ9A 4H8JA 1WDNA 3E3KA 1MRPA 1WVJA 3O97A 3OO6A 3TAJA 1JW4A 4O3CA 3PUZE 3DP8A 4LZ7A 4O3BA 5F1QA 1NKXA 3U1OA 1MY0A 1AOVA 2QPQA 2NOOA 3K01A 5I2NB 1RKMA 5IAIA 3K6UA 3PUXE 3O6GA 4ECFA 3MVZA 2XXQA 1I6AA 1IXIA 2DSFA 5H8FA 4IY5A 3WAEA 1D9VA 1JW1A 1S9TA 5HM4B 3VXCA 2DVZA 2I0BA 5H8QA 2NUVA 1IUDA 3OO7A 5I56A 5FHMA 4YZZA 2XXTA 4FEBA 4IGRA 3IOWA 1Y1MA 1GR2A 4OWDA 1IITA 1B5JA 2ZXTA 3UN6A 3A3UA 2O68A 4ZEDA 3G3JA 4N13A 2DWAA 4IB2A 1EZOA 5FTHA 1NFTA 3O29A 4E0XA 4EF1A 5FHOA 2VHAA 4OETA 3FVKA 3W9WA 3RLFE 1ZJLA 2Q8JA 3MW0A 1ZTYA 2I3VA 4G2ZA 3S9MC 1TFDA 3K6XA 1MQJA 3V89B 2D5WA 4ELPA 3K1PA 3FVGA 4BDMA 5DEXA 4QFPA 1B4ZA 4PFUA 5H8HB 3KOSA 4PP0A 2Z22A 1UQWA 5ISUA 4OHNA 2QMWA 2XX7A 1JEVA 3G3HA 3RGYA 1B6HA 2YJPA 4NEDA 1PC3A 4JWYA 1P1NA 3VV5A 5H8NB 4GQOA 1UTBA 3OSQA 4YMBA 4ISUA 3UK4A 4HS7A 1I69A 3EF7A 3FXUA 3PV0E 4FIMA 1AL3A 5BUUA 3Q27A 5TU0A 1FQAA 3IO4A 5F7VA 1EZPA 1VFDA 1VFEA 3K00A 4DCYA 5I58B 1XS5A 2RC9A 3IB1A 2OZZA 3FV2A 1US5A 2F8DA 4FATA 5L8DA 2KLFA 4RYAA 1TWYA 3VLUA 1XOCA 3V8XB 3IX1A 2FYIA 3T66A 1CB6A 2A5SA 1LLSA 1QJMA 2OJTA 2ABHA 2PYYA 4X1BA 5L9MA 1MQHA 1B3GA 4G8NA 3PUWE 4YMAA 3E9XA 3OENA 5I59A 2H5YA 2F7AA 5CMMA 4GXAA 3PD8A 1URSA 4AB6A 3W15C 3Q26A 1Y3QA 2F6GA 5K2YA 3E13X 1PBPA 1P99A 1MS7A 3FJ7A 4EQBA 4I9DA 4BLAA 3CRBA 4H8IA 4GL8A 2RCBA 4NTLA 4YB7A 1EU8A 3MC2A 3W9VA 1D9YA
chains in the Genus database with same CATH superfamily
2QSXA 2HXWA 4DE8A 4GVOA 4UABA 1FCKA 4G68B 4QSEA 3HHFA 3I6VA 2AIXA 1FQCA 4IGTA 4OVTA 1N3XA 3FBPA 1NUXA 3KC0A 1NV7A 4JBZA 1JEUA 4LN5A 4XKPA 4MLVA 4RK2A 5BWJA 3O66A 3P7IA 1PEBA 4P3LA 1A55A 3PMVA 4F2QA 3G3IA 3N5LA 5EQAA 3QAXA 4YKJA 1SW2A 1AH5A 3BIHA 4F3SA 1JETA 1Y20A 4N17A 4FE8A 2QVUA 4HXVA 3BKIB 3RY3A 1A99A 3CI8A 1ATGA 4M4GA 3SESA 1JW5A 1DPPA 1BTJA 4OTEA 2FA7A 3MBPA 3OELA 3HV1A 2F3DA 3IOVA 2UVHA 2HFBA 3L6HA 3CSBA 1I6BA 3TTNA 3FXRA 1LBCA 3MZ9A 4TOZA 1MY1A 2ONSA 3CVGA 4MLQA 1FPDA 5HBCA 2AYSA 2IEEA 1SI1A 1N7XA 3HCQA 3FIRA 1XVXA 2ESNA 3SKPA 1NNPA 4RY1A 1B2HA 2AL5A 3HHGA 3ZKKA 1S7YA 3CG1A 1MXVA 4WEDA 5AA2A 2Y7RA 3G7WA 1EH3A 4ZDMA 4U1OA 4X8RA 1DSNA 2VPOA 4KD5A 4ZE9A 1MPCA 4UACA 4GF8A 2XXWA 2RCAA 4LP2B 3FATA 4FAJA 2P0SA 1MH3A 1VDWA 5KCJA 3ILUB 4QFKA 4JWXA 4IO5A 2HZLA 4RPNA 1WODA 3LUYA 1B1XA 4PBHA 4F3BA 1DBZA 2P3VA 3JYRA 3GBBA 4POWA 4R75A 4KQPA 1BP5A 3OO8A 2B4LA 4KCDA 3RNNA 5H8QB 3EHSA 1XVYA 2XWVA 4H5GA 3H06B 4TLLB 3LR1A 3KN8A 4XKRA 3MSTA 2XXVA 4MMPA 3ECRA 4RPOA 1FBFA 3KJTA 3RYDA 3IR1A 2O69A 3FASA 1B5IA 1TXFA 5AA3A 3BIGA 3H6WA 3TQWA 1SVXB 1VE4A 3OO9A 3DELB 2F5XA 5I2KA 2Q8MA 3KSJA 2OBGA 3OOAA 3K1NA 4LZ5A 3JZJA 1LGBC 1A54A 4MH5A 1J1NA 3H7MA 2I6EA 3MZ1A 4XTCQ 5DT6A 5B7DA 1R1NA 3QSLA 1K9ZA 1Y1ZA 3K1MA 3E79A 3U8QA 4PETA 2QVRA 2RINA 1N04A 4U4SA 3KBRA 3T0JA 4XF5A 5EYFA 1T0KA 4NF6B 4KYSA 4YICA 3TKDA 3USDA 2RKMA 2VD3A 3KGCA 3O9PA 1M5DA 5H8SA 5DTBA 4ZEKA 4OVJA 2XD3A 5ET5A 3FZVA 5KZTA 1GGGA 1RDYA 3MPKA 2F35A 1B40A 1PBQA 2CEYA 1OIBA 4JSDA 5L9SA 5AA2D 3K4UA 4JSOA 1DCUA 1N7WA 5DEXB 4N8YA 2VT5A 4OEVA 3OEKA 2QRYA 1Z7NE 3DM0A 1OVBA 1BIYA 5ITOA 2MKZA 5AA4A 3GBAA 3IL1B 2Z23A 5T3JA 5AE4A 4EQ7A 2H25A 2OLBA 2P1SA 3MPLA 1UTBB 3D4GA 3KJ7A 1NMUA 3M3FA 3CHGA 2OCUA 4PE5B 4R6YA 1B7ZA 5CMKA 3B6QA 1UTHA 3V5AA 5ET8A 4YKKA 3FGSA 4NF0A 3FV1A 1KA0A 1N0TA 2Y5KA 4PFTA 2Q2AA 2QMXA 4G61A 2WBBA 4PQJA 2E1SA 4KPTA 5CBRA 4GD5A 1MPBA 3ODBA 3MVYA 4OERA 2GH9A 4OYVA 3BBRA 2REJA 1NNKA 4Q8RA 4E0WA 1MQDA 3CFXA 4GWXA 4R73A 1FTJA 3CFZA 1S50A 1MM6A 4FECA 3UORA 1QUIA 1O64A 5A5XA 5CRYA 1GV8A 1MM7A 1FPIA 1UIVA 1SDXA 4XFEA 4DIGA 2GRVA 2CZKA 4WKMA 1ZBMA 1P1QA 4PC9A 4PAKA 2QS4A 1MXXA 5IM2A 1Q9DA 4PE3A 2A5TA 4GWWA 3SEVA 4PGNA 3PPPA 4H5FA 5CMBA 5JTYA 3KSXA 3QXMA 3PD9A 4P1LA 4N8GA 1KWHA 2HHMA 4R74A 5EHSA 3ONMA 3TZAA 3PUYE 1SQYA 3S9NC 2FNCA 1B7HA 3VLWA 2ZZWA 1FBEA 2YPNA 2PMSA 2R71A 3M3LA 1URDA 2DOJA 3KC1A 3KN3A 3BFUA 1SBPA 4BDOA 4MJOA 3B50A 3Q29A 1H43A 3RTFB 2X7QA 4AQ4A 5JK4A 3O6HA 3LSLA 4YKPA 3C4MA 1FQDA 4P0IA 3TPAA 1N3WA 4NF4B 5FBPA 4I62A 4I3EA 3TODA 2XHDA 1Q35A 3MP1A 4GL0A 4GFRA 3H3GA 2ZNUA 4ESWA 3A09A 1A8FA 2XX9A 3VDFA 4NF8B 5EQ8A 2QVVA 4NGUA 3PPNA 2REGA 2O6AA 4OA4A 1KA1A 4ZZEA 1FPKA 4N4UA 1B05A 4O8MA 4I40A 3FJGA 1PB9A 2F3BA 5IZ1A 2ANJA 4M1VA 3K02A 4PFWA 1Y4TA 4F1YA 4U4XA 3K6WA 4N6KA 3N94A 1MH4A 3TFLA 1SW5A 4UA8A 2UVJA 4HCYA 2O84X 4PF6A 1NV6A 1MQIA 4RJZA 1M5FA 3MUQA 2F36A 4O7MA 3QK6A 5I2NA 4OFJA 2ZZXA 1LFIA 4C1UA 4EDPA 2O7UA 1M5CA 5AA1A 2KR0A 3ZSFA 3B8BA 3JV9A 1XHYA 4G68C 5FTIA 1FBGA 3KBZA 4F31B 1OQGA 4GXSB 3ISPA 4PFIA 2UVIA 4X48A 1Y3PA 4ZEFA 1IIWA 5TPAB 4NG7A 1H76A 3CIJA 2IA4A 2XXRA 3VFJA 2B3FA 3MQ9A 2VOZA 3KOTA 5KCJB 3ILTB 2F78A 5ICTA 1MXYA 3OXNA 4EXKA 1H44A 2ZZVA 3UGWA 2FIEA 1URGA 4HW8A 1LFHA 5LOMA 1FBDA 2PFZA 3BFTA 3R7XA 4GWZA 5ITPA 2I58A 3KEIA 4OFLA 1IMCA 4OVSA 5DW8A 3LSFB 3PU5A 1HSLA 4F3PA 3H6VA 2V4CA 3OSRA 3MVXA 4BDLA 1BLFA 2VP1A 2ZNSA 1MDQA 2Q9TA 5ICQA 3N26A 3T93B 4LATA 2I0CA 3FUZA 3RPLA 4TQUQ 1HSEA 2I48A 3PPRA 4EF2A 3T9HB 1B51A 4XKNA 5DVJA 5I5PA 1M5BA 2Q89A 2PX1A 1XT8A 4GX4A 4EUOA 4PDHA 3S2VA 2HAVA 4OQOA 4MEVA 2UVGA 1LCFA 1N84A 4ZECA 4JDFA 2I4CA 1FJ6A 2ZYMA 3C9HA 2F97A 4P11A 2RF1A 2V3UA 3U92A 1ZU0A 1JVXA 3RTWB 3MWBA 1MXZA 3U65A 4I8CA 1Y9UA 5EHMA 2NWJA 2H98A 1MG1A 4F18A 5KDTB 2XXUA 3UIFA 4OANA 4LVQA 2Z8FA 4ZZAA 1P1WA 1B0LA 2P2AA 4I3YA 1LBBA 4OFOA 4C1TA 3EPEA 1I6QA 1LCTA 4N07A 4Z7EA 3IB0A 3QUFA 2WYPA 2OX3A 4JWOA 4FORA 2QJEA 3Q28A 3K2DA 5I58A 4OESA 1VSOA 1FQEA 4NWDA 2NVUB 4P56A 2UYEA 2XWIA 3RUMA 3S4UA 4HCWA 4OEUA 1D4NA 1OMPA 2CZLA 1PB8A 2OWZA 3A29A 3IO6A 4KYDA 4IO7A 2ZNTA 1OQHA 3PTYA 2D3IA 4IO6A 3DP4A 1LB9A 1B3EA 3WAFA 3A3CA 3ROJA 1QULA 4OENA 4N15A 2V3TA 3FD3A 2BJIA 1LAHE 1DTGA 4LA9A 4DXUA 2DWHA 2ONKE 4ELQA 2XWKA 1FPFA 2F7BA 5IZ3A 1XC1A 3TEPA 1NUWA 2Y7IA 5H8FB 1R9LA 2XXPA 3SEUA 4NX1A 1LBVA 3HN0A 4JB7A 3MVWA 2PT1A 1FTLA 1B3HA 1CE2A 5I56B 3IFCA 1O63A 3PPOA 5FHNA 1LBYA 5A5XB 1GVCA 1SW1A 2WKYA 1SI0A 3C36A 4DXCA 4PFYA 4DI3D 5TP9A 4ONYA 3B6TA 1D3KA 4AS4A 2A5TB 2O7IA 4R72A 2ZYKA 4MFIA 4QXDA 4L17A 3G3FA 4Q0CA 5I84A 2W7YA 4DZ1A 4R6HA 4GBVA 3HO7A 4H1XA 4F2OA 1US4A 4PFBA 1FQFA 3SEWA 1FJ9A 4KHZE 5L9OA 4PAFA 4ZEBA 3DLNA 2QS3A 1JVYA 3SERA 3TCGA 1OLAA 1P1OA 3SEYA 1BK4A 4NWCA 2HAUA 4QF9A 2HEUA 5HPQA 2PFYA 3IOTA 4F39A 3LBSA 3HPIA 2R9JA 4U21A 4DI4B 4MNCA 3MJNA 1LAFE 5F24A 3SETA 3TMGA 1A8EA 4THIA 4RK9A 3EHUA 1INPA 4F29A 4U23A 2G93A 3TTLA 4X1DA 2H99A 4QFOA 4YB5A 4FEDA 1B3LA 2QL3A 4OVQA 3IOUA 3VVFA 4AB5A 2DYXA 3B6WA 2P3NA 5CC2A 3VVEA 1NV1A 2DE2A 4BDRA 3T9UA 4ELRA 3QIMA 2Q2CA 1TT1A 4PAIA 3W9VA 1ANFA 4U22A 4GIZA 4ZS9A 3PMXA 3TTRA 4XIGQ 4G4PA 1DPEA 2XXYA 4G8MA 1NNFA 1FTOA 1XI6A 1MDP1 1NUYA 3LUZA 4QFLA 1NNTA 4IO2A 2M8CA 1DTZA 1YAEA 2NXOA 1DOTA 2DWIA 1B52A 3IJXB 1OLCA 1FBPA 4NF5A 2VPNA 2UXAA 4RXLA 2B3BA 2X26A 2FVZA 5CBSA 2G29A 2PVUA 4PBQA 1Z7ME 4LZ8A 4IR8A 4KYEA 1B0HA 3O28A 4KCCA 2PBWA 5DVFA 3OEMA 4LUBA 1D9QA 4H45A 2UYFA 2Y7KA 4H65A 3CR9A 3TCFA 2DE4A 2V93A 4OVRA 4ND9A 5M2VA 2XXXA 1LFGA 1B58A 3D4CA 2E0SA 5I59B 2V25A 5I57A 3E4RA 1B7UA 4FBPA 4GOTA 4N6PA 1FPEA 1EYKA 2F7CA 1A7LA 4R2FA 4BDQA 3IAZA 2XD2A 1M5EA 3T9XB 1AMFA 5JEIA 1VR5A 2PCRA 1SYHA 4X04A 4NHBA 2DXRA 4QRZA 2VD2A 3O2AA 3LSXA 1B3FA 4RNSA 1YPNA 1POY1 1SW4A 1UIUA 2XXIA 4NF6A 3FJMA 2RC7A 4MX6A 1FTKA 2QS1A 2WX9A 1AWBA 1ZLQA 2FHYA 1NV5A 4ESXA 3T96B 1FRPA 2V84A 3IB2A 2OWSA 1QUJA 3I5OA 4HTGA 5CM6A 2CZHA 1Y4CA 3OMBA 3I3VA 2XXHA 1YZ0A 1LB8A 5IKBA 4G8HA 1K9YA 3QYTA 3T9VA 2OK2A 4R2BA 3G3KA 3EQ1A 3KFMA 1NL5A 3CG3A 3TCHA 1IMEA 4O94A 1KZ8A 4QSCA 3EHTA 1B4HA 3MAMA 2Y7PA 4JXIA 1FPBA 4QFNA 4NMYA 3K0VA 3T1BA 1ZMGA 4YKIA 4QHQA 2DWJA 1MXUA 3ZS6A 1G0IA 1JQFA 1IZ1A 4KR5A 1F9BA 2ZYNA 3C35A 2R6GE 3TDJA 4ZE8A 4HE0A 3R6UA 4KI0E 3MP8A 2VGQA 5IGAA 4DDDA 1USYH 1BKAA 4PF8A 3H6UA 4P1EA 2Q88A 5IZZA 4Z0IA 2V3QA 3B7DA 1NV4A 5EYGA 2ZYOA 1PDAA 4MCOA 4KFQA 3QUJA 4PFRA 3TELA 1DK4A 4P0GA 1HSJA 3NOHA 3LC8A 1FQBA 1SPIA 3IK6B 3L6GA 3T22A 3GZGA 1Q1KA 3RN8A 1O7TA 4WEPA 5CMCA 5AA2B 2XWOA 2DE3A 3K6VA 4N81A 4NQ8A 4U2RA 5ELVA 2DVCA 4U1ZA 4F1UA 1B1HA 2DS9A 2YLNA 3RQTA 1QW0A 3GLBA 3IORA 4GX6A 4MBPA 3M8UA 3SEXA 1R9QA 1SD3A 2ALUA 1B5HA 1H45A 4TLMB 2Y84A 1EYJA 4F22A 1LBXA 1R6ZA 5K2XA 1MY3A 1FTMA 4R6KA 3C34A 1LAGE 1FPJA 4PCDA 4LQ5A 3H03A 2AL4A 2R8TA 2ZMBA 1MXWA 2RC8A 3F11A 4XKQA 1IXGA 1G0HA 2LAOA 3TUSA 1LBZA 2FBPA 1JNFA 4DCXA 2XXKA 3S9LC 1RYOA 1N76A 3C32A 4LQ2A 5I2KB 2CEXA 3EN3A 3AXFA 5TP9B 1L5TA 1LBWA 4GRKA 1FPLA 4IO3A 4WXJA 2F34A 2HQ0A 3RT8A 1PB7A 3OD7A 4H0WA 4XXUA 4RA1A 2I49A 5LTCA 4NF4A 3SZPA 4NAPA 5H8HA 1NH7A 3VVDA 4NF8A 2GFEA 3KZGA 1QUKA 2CMOA 4ZEIA 3H4ZA 2O1MA 3KG2A 1TFAA 1IXHA 3THIA 3C33A 5H8NA 3N6UA 4Q5TA 3U72A 1RYXA 4QSDA 4PTKA 4R9FA 3TQLA 4OXVA 1GTKA 1Y3NA 1AIVA 1FBHA 4EXLA 4YB6A 3TYHA 3U94A 1ZKBA 4H6DA 4Q30B 3TTKA 2BJJX 2Z8EA 4GWOA 3S9EA 2PT2A 4P8BA 3FVNA 4IY6A 4MNIA 1YTVA 4JVCA 3LSWA 2H4IA 4YU0A 3ZKLA 3V83A 5AA4B 4R9GA 4BDNA 1NV3A 2DDKA 4DLDA 2F6PA 3MZBA 5ET7A 3VLVA 2O51A 2THIA 1ELJA 3C31A 1UTHB 3PMWA 1YCJA 3GXAA 4MF3A 4GLIA 1QVSA 4N91A 2D21A 4F3GA 3FVOA 1B46A 2KQZA 4GWSA 2HPGA 5TPAA 4PDDA 4P9KA 1USYE 4POXA 3RPWA 4NF5B 2WBDA 4P47A 2I3WA 3SDFA 4X9TA 4G77A 1IXCA 2GHAA 1MQGA 4FJPA 1FBCA 4H67A 3D1RA 3U93A 5I7IA 2DP8A 3M3KA 3DP6A 1OVTA 4EQ9A 3H6TA 1NH8A 1H3DA 1EZ9A 3PUVE 5DYHA 3FXBA 3G3GA 3HSTA 3UA8A 5CI5A 1LAXA 4G68A 5J16A 1MPDA 2GHBA 1IMDA 4MAGA 3R26A 1II5A 3KN7A 1MY4A 4NE4A 5I57B 2DXYA 4IO4A 2I4BA 1P1UA 5JTYB 3CSGA 3Q25A 4C0RA 3PGFA 2HCAA 2Z8DA 2B65A 2O1LA 1RDZA 5J1DA 4O3AA 5EQ7A 4HE2A 5B70A 4H46A 2Y7WA 3MP6A 1B9JA 1QKAA 1SYIA 3VXBA 4AS5A 1B32A 1POTA 1A40A 3FXQA 5DVIA 3TTMA 2ONRA 4ELOA 4NN3A 3IJOB 1ZIUA 2HZKA 1IEJA 1QKBA 4DXBA 3RT6B 2QS2A 2H9BA 2XX8A 3UP9A 3PPQA 4O7IA 1MY2A 2X7PA 3N6TA 3O6IA 4I1DA 4LONB 3CFLA 4XEQA 3VE1B 2DQVA 4F19A 1LSTA 1DMBA 2Y5LA 4F1VA 4K3FA 2OWTA 4YAHX 1IMAA 3EKIA 5KDTA 1IQ7A 4OMBA 3GYYA 2HXRA 4OZ9A 2Q74A 4H8JA 1WDNA 5ET6A 1IMBA 3E3KA 1MRPA 1WVJA 3O97A 2GQ1A 3OO6A 4PGPA 3TAJA 1NUZA 2L5VA 1JW4A 2XA5A 4QBAA 4O3CA 3PUZE 3DP8A 4LZ7A 4O3BA 5F1QA 1NKXA 3U1OA 1MY0A 1AOVA 2QPQA 2NOOA 1QGXA 3K01A 5A5LA 5I2NB 1RKMA 5IAIA 3K6UA 3PUXE 3O6GA 4ECFA 3MVZA 2XXQA 1I6AA 1IXIA 2DSFA 5H8FA 1RDXA 4IY5A 3WAEA 1D9VA 1JW1A 1S9TA 5HM4B 3VXCA 2DVZA 2I0BA 4MIJA 5H8QA 2NUVA 1IUDA 3OO7A 1FTAA 4N6DA 5I56A 5FHMA 4YZZA 1FSAA 2XXTA 4FEBA 4IGRA 2CZIA 3IOWA 1Y1MA 1GR2A 4GX3A 4OWDA 4JVIA 1IITA 1B5JA 1EYIA 2ZXTA 3UN6A 3A3UA 4KXPA 4MNPA 4GWYA 2O68A 4OVPA 4ZEDA 3G3JA 4N13A 4GWUA 2DWAA 4IB2A 1EZOA 5FTHA 1NFTA 3O29A 4E0XA 4EF1A 5FHOA 2VHAA 4OETA 3FVKA 1NV0A 3W9WA 3RLFE 1ZJLA 2JJKA 2Q8JA 3MW0A 1ZTYA 2I3VA 1IMFA 2WEFA 4G2ZA 3S9MC 3RPLB 1TFDA 3K6XA 1MQJA 3V89B 2D5WA 4ELPA 3K1PA 3FVGA 4BDMA 5DEXA 4QFPA 1LEVA 1B4ZA 4PFUA 5H8HB 3KOSA 4PP0A 2Z22A 1UQWA 2FIXA 5ISUA 4OHNA 5EYHA 2QMWA 1NV2A 1NI9A 3E78A 2XX7A 1JEVA 3G3HA 3RGYA 1B6HA 1JP4A 2YJPA 4NEDA 1PC3A 4JWYA 1P1NA 3VV5A 5H8NB 4GQOA 1UTBA 1YYZA 1FPGA 3OSQA 4YMBA 4ISUA 3UK4A 4HS7A 1I69A 3EF7A 4MHFA 3FXUA 3PV0E 4FIMA 1AL3A 5BUUA 5LDZA 1YXIA 4JVDA 3Q27A 3QMFA 5TU0A 1FQAA 3IO4A 5F7VA 1EZPA 1VFDA 1VFEA 2QFLA 3K00A 4DCYA 5I58B 3HFUA 1XS5A 2RC9A 3IB1A 2OZZA 3IFAA 3FV2A 1US5A 2F8DA 4FATA 5L8DA 4RYAA 2KLFA 1TWYA 3VLUA 3LV0A 1XOCA 3V8XB 3IX1A 2FYIA 3T66A 1CB6A 2A5SA 5I3SA 1LLSA 1QJMA 2OJTA 2ABHA 2PYYA 4X1BA 5L9MA 1MQHA 1B3GA 2B4MA 4G8NA 3PUWE 4YMAA 3E9XA 3OENA 5I59A 2H5YA 5IZ3B 2F7AA 5CMMA 4GXAA 3PD8A 1URSA 4AB6A 3W15C 3Q26A 2WYKA 5EQ9A 1Y3QA 2F6GA 4HE1A 5K2YA 3E13X 1PBPA 1P99A 1MS7A 3FJ7A 4EQBA 4I9DA 4BLAA 3CRBA 4H8IA 4GL8A 2RCBA 1CNQA 4NTLA 5ESYA 4GBWA 4YB7A 1EU8A 3MYUA 3MC2A 1FW0A 1D9YA
chains in the Genus database with same CATH topology
2QSXA 2HXWA 4DE8A 4GVOA 1FCKA 4G68B 4QSEA 3HHFA 3I6VA 2AIXA 1FQCA 4IGTA 1N3XA 4JBZA 1JEUA 4XKPA 4MLVA 4RK2A 5BWJA 3O66A 3P7IA 1PEBA 1A55A 3PMVA 4F2QA 3G3IA 3N5LA 3QAXA 4YKJA 1SW2A 1AH5A 4F3SA 1JETA 1Y20A 4FE8A 3BKIB 3RY3A 1A99A 3CI8A 1ATGA 4M4GA 3SESA 1JW5A 1DPPA 1BTJA 4OTEA 2FA7A 3MBPA 3OELA 3HV1A 3IOVA 2UVHA 2HFBA 3L6HA 3CSBA 1I6BA 3TTNA 3FXRA 1LBCA 3MZ9A 4TOZA 1MY1A 2ONSA 3CVGA 4MLQA 5HBCA 2AYSA 2IEEA 1SI1A 1N7XA 3HCQA 3FIRA 1XVXA 2ESNA 3SKPA 1NNPA 4RY1A 1B2HA 2AL5A 3HHGA 3ZKKA 1S7YA 3CG1A 1MXVA 4WEDA 5AA2A 2Y7RA 3G7WA 1EH3A 4ZDMA 4U1OA 1DSNA 4KD5A 4ZE9A 1MPCA 4UACA 4GF8A 2XXWA 2RCAA 4LP2B 3FATA 4FAJA 2P0SA 1MH3A 5KCJA 3ILUB 4QFKA 4JWXA 4IO5A 2HZLA 4RPNA 1WODA 3LUYA 1B1XA 4F3BA 3JYRA 3GBBA 4POWA 4R75A 4KQPA 1BP5A 3OO8A 4KCDA 3RNNA 5H8QB 3EHSA 1XVYA 4H5GA 3H06B 4TLLB 3LR1A 3KN8A 4XKRA 2XXVA 3ECRA 4RPOA 3KJTA 3IR1A 2O69A 3FASA 1B5IA 1TXFA 5AA3A 3H6WA 3TQWA 1SVXB 1VE4A 3OO9A 3DELB 2F5XA 5I2KA 3KSJA 2OBGA 3OOAA 3K1NA 4LZ5A 3JZJA 1LGBC 1A54A 4MH5A 1J1NA 3H7MA 2I6EA 3MZ1A 4XTCQ 5DT6A 5B7DA 1R1NA 3QSLA 1Y1ZA 3K1MA 3U8QA 4PETA 2RINA 1N04A 4U4SA 3KBRA 1T0KA 5EYFA 4NF6B 4KYSA 4YICA 3TKDA 3USDA 2RKMA 2VD3A 3KGCA 3O9PA 1M5DA 5H8SA 5DTBA 4ZEKA 4OVJA 2XD3A 3FZVA 5KZTA 1GGGA 3MPKA 2F35A 1B40A 1PBQA 1OIBA 4JSDA 5L9SA 5AA2D 3K4UA 4JSOA 1N7WA 5DEXB 4OEVA 3OEKA 2QRYA 1Z7NE 3DM0A 1OVBA 1BIYA 5ITOA 5AA4A 3GBAA 3IL1B 2Z23A 5AE4A 4EQ7A 2H25A 2OLBA 2P1SA 3MPLA 1UTBB 3D4GA 3KJ7A 1NMUA 3M3FA 2OCUA 4PE5B 4R6YA 1B7ZA 5CMKA 3B6QA 1UTHA 3V5AA 4YKKA 3FGSA 3FV1A 1N0TA 2Q2AA 4PFTA 2QMXA 4PQJA 2E1SA 4KPTA 5CBRA 4GD5A 1MPBA 3ODBA 3MVYA 4OERA 2GH9A 4OYVA 3BBRA 2REJA 4Q8RA 1NNKA 4E0WA 1MQDA 3CFXA 4R73A 1FTJA 3CFZA 1S50A 1MM6A 4FECA 3UORA 1QUIA 1O64A 5A5XA 5CRYA 1GV8A 1MM7A 1UIVA 1SDXA 4DIGA 2GRVA 4WKMA 1ZBMA 1P1QA 2QS4A 1MXXA 2A5TA 3SEVA 3PPPA 4H5FA 5CMBA 5JTYA 3KSXA 3QXMA 3PD9A 1KWHA 4R74A 5EHSA 3ONMA 3TZAA 3PUYE 1SQYA 3S9NC 2FNCA 1B7HA 3VLWA 2YPNA 2PMSA 2R71A 3M3LA 1URDA 2DOJA 3KN3A 3BFUA 1SBPA 4BDOA 3Q29A 1H43A 3RTFB 2X7QA 4AQ4A 5JK4A 3O6HA 3LSLA 4YKPA 3C4MA 1FQDA 4P0IA 3TPAA 1N3WA 4NF4B 4I62A 3TODA 2XHDA 1Q35A 3MP1A 4GL0A 4GFRA 3H3GA 2ZNUA 4ESWA 3A09A 1A8FA 2XX9A 3VDFA 4NF8B 3PPNA 2REGA 2O6AA 4ZZEA 1B05A 3FJGA 1PB9A 2ANJA 4M1VA 3K02A 4PFWA 1Y4TA 4F1YA 4U4XA 3K6WA 3N94A 1MH4A 3TFLA 1SW5A 4UA8A 2UVJA 4HCYA 2O84X 1MQIA 4RJZA 1M5FA 3MUQA 2F36A 3QK6A 5I2NA 4OFJA 1LFIA 4C1UA 4EDPA 2O7UA 1M5CA 5AA1A 3ZSFA 3JV9A 1XHYA 4G68C 5FTIA 4F31B 1OQGA 4GXSB 2UVIA 4X48A 1Y3PA 4ZEFA 1IIWA 5TPAB 1H76A 3CIJA 2IA4A 2XXRA 3VFJA 2B3FA 3MQ9A 2VOZA 3KOTA 5KCJB 3ILTB 2F78A 5ICTA 1MXYA 3OXNA 4EXKA 1H44A 3UGWA 1URGA 4HW8A 1LFHA 5LOMA 3BFTA 3R7XA 5ITPA 2I58A 3KEIA 4OFLA 3LSFB 3PU5A 1HSLA 4F3PA 3H6VA 3OSRA 3MVXA 4BDLA 1BLFA 2VP1A 2ZNSA 1MDQA 2Q9TA 5ICQA 3N26A 3T93B 4LATA 2I0CA 3FUZA 4TQUQ 1HSEA 2I48A 3PPRA 4EF2A 3T9HB 1B51A 4XKNA 5DVJA 1M5BA 2Q89A 2PX1A 1XT8A 4EUOA 3S2VA 2HAVA 4OQOA 2UVGA 1LCFA 1N84A 4ZECA 4JDFA 2I4CA 2ZYMA 3C9HA 2F97A 4P11A 2RF1A 2V3UA 3U92A 1ZU0A 1JVXA 3RTWB 3MWBA 1MXZA 4I8CA 1Y9UA 5EHMA 2NWJA 2H98A 1MG1A 4F18A 5KDTB 2XXUA 3UIFA 4LVQA 2Z8FA 4ZZAA 1P1WA 1B0LA 2P2AA 4C1TA 1LBBA 4OFOA 3EPEA 1I6QA 1LCTA 4N07A 4Z7EA 3IB0A 3QUFA 4JWOA 4FORA 2QJEA 3Q28A 3K2DA 5I58A 4OESA 1VSOA 1FQEA 4NWDA 2NVUB 2UYEA 3RUMA 3S4UA 4HCWA 4OEUA 1D4NA 1OMPA 2CZLA 1PB8A 3IO6A 4KYDA 4IO7A 2ZNTA 1OQHA 2D3IA 4IO6A 3DP4A 1LB9A 1B3EA 3WAFA 3A3CA 1QULA 4OENA 2V3TA 3FD3A 1LAHE 1DTGA 4LA9A 4DXUA 2DWHA 2ONKE 4ELQA 2F7BA 1XC1A 3TEPA 2Y7IA 5H8FB 1R9LA 2XXPA 3SEUA 3HN0A 4JB7A 3MVWA 2PT1A 1FTLA 1B3HA 1CE2A 5I56B 1O63A 3PPOA 5FHNA 5A5XB 1GVCA 1SW1A 2WKYA 1SI0A 3C36A 4DXCA 4PFYA 5TP9A 4ONYA 3B6TA 1D3KA 2A5TB 2O7IA 4R72A 2ZYKA 4MFIA 4L17A 3G3FA 4Q0CA 5I84A 2W7YA 4DZ1A 4R6HA 3HO7A 4H1XA 4F2OA 1US4A 3SEWA 1FQFA 4KHZE 5L9OA 4ZEBA 3DLNA 2QS3A 1JVYA 3SERA 3TCGA 1OLAA 1P1OA 3SEYA 4NWCA 2HAUA 4QF9A 1FW0A 2HEUA 5HPQA 3IOTA 4F39A 3LBSA 3HPIA 2R9JA 4U21A 3MJNA 1LAFE 3SETA 3TMGA 1A8EA 4THIA 4RK9A 3EHUA 4F29A 4U23A 2G93A 3TTLA 4X1DA 2H99A 4QFOA 4YB5A 4FEDA 1B3LA 2QL3A 3IOUA 3VVFA 4AB5A 2DYXA 3B6WA 5CC2A 3VVEA 2DE2A 4BDRA 3T9UA 4ELRA 3QIMA 2Q2CA 1TT1A 1ANFA 4U22A 4GIZA 4ZS9A 3PMXA 3TTRA 4XIGQ 4G4PA 1DPEA 2XXYA 4G8MA 1NNFA 1FTOA 1MDP1 4QFLA 1NNTA 4IO2A 2M8CA 1DTZA 1YAEA 2NXOA 1DOTA 2DWIA 1B52A 3IJXB 1OLCA 4NF5A 2UXAA 4RXLA 2B3BA 2X26A 5CBSA 2G29A 2PVUA 1Z7ME 4LZ8A 4KYEA 1B0HA 3O28A 4KCCA 2PBWA 5DVFA 3OEMA 4LUBA 2UYFA 2Y7KA 4H65A 3CR9A 3TCFA 2DE4A 2V93A 4ND9A 5M2VA 2XXXA 1LFGA 1B58A 3D4CA 2E0SA 5I59B 2V25A 5I57A 3E4RA 1B7UA 4GOTA 4N6PA 2F7CA 1A7LA 4R2FA 4BDQA 3IAZA 2XD2A 1M5EA 3T9XB 1AMFA 5JEIA 1VR5A 1SYHA 2DXRA 4QRZA 2VD2A 3O2AA 3LSXA 1B3FA 4RNSA 1YPNA 1POY1 1SW4A 1UIUA 2XXIA 4NF6A 3FJMA 2RC7A 1FTKA 2QS1A 1ZLQA 4ESXA 3T96B 2V84A 3IB2A 2OWSA 1QUJA 3I5OA 4HTGA 5CM6A 1Y4CA 3OMBA 3I3VA 2XXHA 1LB8A 5IKBA 4G8HA 3QYTA 3T9VA 2OK2A 4R2BA 3G3KA 3EQ1A 3KFMA 1NL5A 3CG3A 3TCHA 4QSCA 3EHTA 1B4HA 3MAMA 2Y7PA 4JXIA 4QFNA 4NMYA 3K0VA 1ZMGA 4YKIA 4QHQA 2DWJA 1MXUA 3ZS6A 1JQFA 1IZ1A 4KR5A 1F9BA 2ZYNA 3C35A 2R6GE 3TDJA 4ZE8A 3R6UA 4KI0E 3MP8A 2VGQA 4DDDA 1USYH 1BKAA 3H6UA 2Q88A 4Z0IA 2V3QA 3B7DA 2ZYOA 1PDAA 4KFQA 3QUJA 3TELA 4P0GA 1HSJA 3LC8A 1FQBA 3IK6B 3L6GA 3T22A 3GZGA 1Q1KA 3RN8A 1O7TA 4WEPA 5CMCA 5AA2B 3K6VA 2DE3A 4U2RA 5ELVA 2DVCA 4U1ZA 4F1UA 1B1HA 2DS9A 2YLNA 3RQTA 1QW0A 3GLBA 3IORA 4MBPA 3M8UA 3SEXA 1R9QA 1SD3A 2ALUA 1B5HA 1H45A 4TLMB 2Y84A 4F22A 5K2XA 1R6ZA 1MY3A 1FTMA 4R6KA 3C34A 1LAGE 4LQ5A 3H03A 2AL4A 2ZMBA 1MXWA 2RC8A 3F11A 4XKQA 1IXGA 2LAOA 3TUSA 1JNFA 4DCXA 3S9LC 1RYOA 1N76A 3C32A 4LQ2A 5I2KB 3EN3A 3AXFA 5TP9B 1L5TA 4GRKA 4WXJA 4IO3A 2F34A 2HQ0A 3RT8A 1PB7A 3OD7A 4H0WA 4XXUA 4RA1A 2I49A 4NF4A 5H8HA 1NH7A 3VVDA 4NF8A 2GFEA 3KZGA 1QUKA 2CMOA 4ZEIA 3H4ZA 2O1MA 3KG2A 1TFAA 1IXHA 3THIA 3C33A 5H8NA 3N6UA 4Q5TA 3U72A 1RYXA 4QSDA 4R9FA 3TQLA 4OXVA 1GTKA 1Y3NA 1AIVA 4EXLA 4YB6A 3TYHA 3U94A 1ZKBA 4H6DA 4Q30B 3TTKA 2BJJX 2Z8EA 4GWOA 3S9EA 2PT2A 3FVNA 4IY6A 1YTVA 3LSWA 2H4IA 4YU0A 3ZKLA 3V83A 5AA4B 4R9GA 4BDNA 4DLDA 2F6PA 3MZBA 3VLVA 2O51A 2THIA 1ELJA 3C31A 1UTHB 3PMWA 1YCJA 3GXAA 4MF3A 4GLIA 1QVSA 2D21A 4F3GA 3FVOA 1B46A 5TPAA 3RPWA 4POXA 1USYE 4NF5B 2I3WA 3SDFA 4X9TA 4G77A 1IXCA 2GHAA 1MQGA 4FJPA 4H67A 3U93A 2DP8A 3M3KA 3DP6A 1OVTA 4EQ9A 3H6TA 1NH8A 1H3DA 1EZ9A 3PUVE 5DYHA 3G3GA 3HSTA 3UA8A 5CI5A 1LAXA 4G68A 1MPDA 2GHBA 3R26A 1II5A 3KN7A 1MY4A 4NE4A 5I57B 2DXYA 4IO4A 2I4BA 1P1UA 5JTYB 3CSGA 3Q25A 4C0RA 3PGFA 2HCAA 2Z8DA 2B65A 2O1LA 5J1DA 4O3AA 5B70A 2Y7WA 3MP6A 1B9JA 1QKAA 1SYIA 3VXBA 1B32A 1POTA 1A40A 3FXQA 5DVIA 3TTMA 2ONRA 4ELOA 3IJOB 1ZIUA 2HZKA 1IEJA 1QKBA 4DXBA 3RT6B 2QS2A 2H9BA 2XX8A 3UP9A 3PPQA 1MY2A 2X7PA 3N6TA 3O6IA 4I1DA 4LONB 3CFLA 3VE1B 2DQVA 4F19A 1LSTA 1DMBA 4F1VA 4K3FA 2OWTA 4YAHX 5KDTA 1IQ7A 4OMBA 4OZ9A 4H8JA 1WDNA 3E3KA 1MRPA 1WVJA 3O97A 3OO6A 3TAJA 1JW4A 4O3CA 3PUZE 3DP8A 4LZ7A 4O3BA 5F1QA 1NKXA 3U1OA 1MY0A 1AOVA 2QPQA 2NOOA 3K01A 5I2NB 1RKMA 5IAIA 3K6UA 3PUXE 3O6GA 4ECFA 3MVZA 2XXQA 1I6AA 1IXIA 2DSFA 5H8FA 4IY5A 3WAEA 1D9VA 1JW1A 1S9TA 5HM4B 3VXCA 2DVZA 2I0BA 5H8QA 2NUVA 1IUDA 3OO7A 5I56A 5FHMA 4YZZA 2XXTA 4FEBA 4IGRA 3IOWA 1Y1MA 1GR2A 4OWDA 1IITA 1B5JA 2ZXTA 3UN6A 3A3UA 2O68A 4ZEDA 3G3JA 4N13A 2DWAA 4IB2A 1EZOA 5FTHA 1NFTA 3O29A 4E0XA 4EF1A 5FHOA 2VHAA 4OETA 3FVKA 3W9WA 3RLFE 1ZJLA 2Q8JA 3MW0A 1ZTYA 2I3VA 4G2ZA 3S9MC 1TFDA 3K6XA 1MQJA 3V89B 2D5WA 4ELPA 3K1PA 3FVGA 4BDMA 5DEXA 4QFPA 1B4ZA 4PFUA 5H8HB 3KOSA 4PP0A 2Z22A 1UQWA 5ISUA 4OHNA 2QMWA 2XX7A 1JEVA 3G3HA 3RGYA 1B6HA 2YJPA 4NEDA 1PC3A 4JWYA 1P1NA 3VV5A 5H8NB 4GQOA 1UTBA 3OSQA 4YMBA 4ISUA 3UK4A 4HS7A 1I69A 3EF7A 3FXUA 3PV0E 4FIMA 1AL3A 5BUUA 3Q27A 5TU0A 1FQAA 3IO4A 5F7VA 1EZPA 1VFDA 1VFEA 3K00A 4DCYA 5I58B 1XS5A 2RC9A 3IB1A 2OZZA 3FV2A 1US5A 2F8DA 4FATA 5L8DA 2KLFA 4RYAA 1TWYA 3VLUA 1XOCA 3V8XB 3IX1A 2FYIA 3T66A 1CB6A 2A5SA 1LLSA 1QJMA 2OJTA 2ABHA 2PYYA 4X1BA 5L9MA 1MQHA 1B3GA 4G8NA 3PUWE 4YMAA 3E9XA 3OENA 5I59A 2H5YA 2F7AA 5CMMA 4GXAA 3PD8A 1URSA 4AB6A 3W15C 3Q26A 1Y3QA 2F6GA 5K2YA 3E13X 1PBPA 1P99A 1MS7A 3FJ7A 4EQBA 4I9DA 4BLAA 3CRBA 4H8IA 4GL8A 2RCBA 4NTLA 4YB7A 1EU8A 3MC2A 3W9VA 1D9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSX A;  2HXW A;  4DE8 A;  4GVO A;  1FCK A;  4G68 B;  4QSE A;  3HHF A;  3I6V A;  2AIX A;  1FQC A;  4IGT A;  1N3X A;  4JBZ A;  1JEU A;  4XKP A;  4MLV A;  4RK2 A;  5BWJ A;  3O66 A;  3P7I A;  1PEB A;  1A55 A;  3PMV A;  4F2Q A;  3G3I A;  3N5L A;  3QAX A;  4YKJ A;  1SW2 A;  1AH5 A;  4F3S A;  1JET A;  1Y20 A;  4FE8 A;  3BKI B;  3RY3 A;  1A99 A;  3CI8 A;  1ATG A;  4M4G A;  3SES A;  1JW5 A;  1DPP A;  1BTJ A;  4OTE A;  2FA7 A;  3MBP A;  3OEL A;  3HV1 A;  3IOV A;  2UVH A;  2HFB A;  3L6H A;  3CSB A;  1I6B A;  3TTN A;  3FXR A;  1LBC A;  3MZ9 A;  4TOZ A;  1MY1 A;  2ONS A;  3CVG A;  4MLQ A;  5HBC A;  2AYS A;  2IEE A;  1SI1 A;  1N7X A;  3HCQ A;  3FIR A;  1XVX A;  2ESN A;  3SKP A;  1NNP A;  4RY1 A;  1B2H A;  2AL5 A;  3HHG A;  3ZKK A;  1S7Y A;  3CG1 A;  1MXV A;  4WED A;  5AA2 A;  2Y7R A;  3G7W A;  1EH3 A;  4ZDM A;  4U1O A;  1DSN A;  4KD5 A;  4ZE9 A;  1MPC A;  4UAC A;  4GF8 A;  2XXW A;  2RCA A;  4LP2 B;  3FAT A;  4FAJ A;  2P0S A;  1MH3 A;  5KCJ A;  3ILU B;  4QFK A;  4JWX A;  4IO5 A;  2HZL A;  4RPN A;  1WOD A;  3LUY A;  1B1X A;  4F3B A;  3JYR A;  3GBB A;  4POW A;  4R75 A;  4KQP A;  1BP5 A;  3OO8 A;  4KCD A;  3RNN A;  5H8Q B;  3EHS A;  1XVY A;  4H5G A;  3H06 B;  4TLL B;  3LR1 A;  3KN8 A;  4XKR A;  2XXV A;  3ECR A;  4RPO A;  3KJT A;  3IR1 A;  2O69 A;  3FAS A;  1B5I A;  1TXF A;  5AA3 A;  3H6W A;  3TQW A;  1SVX B;  1VE4 A;  3OO9 A;  3DEL B;  2F5X A;  5I2K A;  3KSJ A;  2OBG A;  3OOA A;  3K1N A;  4LZ5 A;  3JZJ A;  1LGB C;  1A54 A;  4MH5 A;  1J1N A;  3H7M A;  2I6E A;  3MZ1 A;  4XTC Q;  5DT6 A;  5B7D A;  1R1N A;  3QSL A;  1Y1Z A;  3K1M A;  3U8Q A;  4PET A;  2RIN A;  1N04 A;  4U4S A;  3KBR A;  1T0K A;  5EYF A;  4NF6 B;  4KYS A;  4YIC A;  3TKD A;  3USD A;  2RKM A;  2VD3 A;  3KGC A;  3O9P A;  1M5D A;  5H8S A;  5DTB A;  4ZEK A;  4OVJ A;  2XD3 A;  3FZV A;  5KZT A;  1GGG A;  3MPK A;  2F35 A;  1B40 A;  1PBQ A;  1OIB A;  4JSD A;  5L9S A;  5AA2 D;  3K4U A;  4JSO A;  1N7W A;  5DEX B;  4OEV A;  3OEK A;  2QRY A;  1Z7N E;  3DM0 A;  1OVB A;  1BIY A;  5ITO A;  5AA4 A;  3GBA A;  3IL1 B;  2Z23 A;  5AE4 A;  4EQ7 A;  2H25 A;  2OLB A;  2P1S A;  3MPL A;  1UTB B;  3D4G A;  3KJ7 A;  1NMU A;  3M3F A;  2OCU A;  4PE5 B;  4R6Y A;  1B7Z A;  5CMK A;  3B6Q A;  1UTH A;  3V5A A;  4YKK A;  3FGS A;  3FV1 A;  1N0T A;  2Q2A A;  4PFT A;  2QMX A;  4PQJ A;  2E1S A;  4KPT A;  5CBR A;  4GD5 A;  1MPB A;  3ODB A;  3MVY A;  4OER A;  2GH9 A;  4OYV A;  3BBR A;  2REJ A;  4Q8R A;  1NNK A;  4E0W A;  1MQD A;  3CFX A;  4R73 A;  1FTJ A;  3CFZ A;  1S50 A;  1MM6 A;  4FEC A;  3UOR A;  1QUI A;  1O64 A;  5A5X A;  5CRY A;  1GV8 A;  1MM7 A;  1UIV A;  1SDX A;  4DIG A;  2GRV A;  4WKM A;  1ZBM A;  1P1Q A;  2QS4 A;  1MXX A;  2A5T A;  3SEV A;  3PPP A;  4H5F A;  5CMB A;  5JTY A;  3KSX A;  3QXM A;  3PD9 A;  1KWH A;  4R74 A;  5EHS A;  3ONM A;  3TZA A;  3PUY E;  1SQY A;  3S9N C;  2FNC A;  1B7H A;  3VLW A;  2YPN A;  2PMS A;  2R71 A;  3M3L A;  1URD A;  2DOJ A;  3KN3 A;  3BFU A;  1SBP A;  4BDO A;  3Q29 A;  1H43 A;  3RTF B;  2X7Q A;  4AQ4 A;  5JK4 A;  3O6H A;  3LSL A;  4YKP A;  3C4M A;  1FQD A;  4P0I A;  3TPA A;  1N3W A;  4NF4 B;  4I62 A;  3TOD A;  2XHD A;  1Q35 A;  3MP1 A;  4GL0 A;  4GFR A;  3H3G A;  2ZNU A;  4ESW A;  3A09 A;  1A8F A;  2XX9 A;  3VDF A;  4NF8 B;  3PPN A;  2REG A;  2O6A A;  4ZZE A;  1B05 A;  3FJG A;  1PB9 A;  2ANJ A;  4M1V A;  3K02 A;  4PFW A;  1Y4T A;  4F1Y A;  4U4X A;  3K6W A;  3N94 A;  1MH4 A;  3TFL A;  1SW5 A;  4UA8 A;  2UVJ A;  4HCY A;  2O84 X;  1MQI A;  4RJZ A;  1M5F A;  3MUQ A;  2F36 A;  3QK6 A;  5I2N A;  4OFJ A;  1LFI A;  4C1U A;  4EDP A;  2O7U A;  1M5C A;  5AA1 A;  3ZSF A;  3JV9 A;  1XHY A;  4G68 C;  5FTI A;  4F31 B;  1OQG A;  4GXS B;  2UVI A;  4X48 A;  1Y3P A;  4ZEF A;  1IIW A;  5TPA B;  1H76 A;  3CIJ A;  2IA4 A;  2XXR A;  3VFJ A;  2B3F A;  3MQ9 A;  2VOZ A;  3KOT A;  5KCJ B;  3ILT B;  2F78 A;  5ICT A;  1MXY A;  3OXN A;  4EXK A;  1H44 A;  3UGW A;  1URG A;  4HW8 A;  1LFH A;  5LOM A;  3BFT A;  3R7X A;  5ITP A;  2I58 A;  3KEI A;  4OFL A;  3LSF B;  3PU5 A;  1HSL A;  4F3P A;  3H6V A;  3OSR A;  3MVX A;  4BDL A;  1BLF A;  2VP1 A;  2ZNS A;  1MDQ A;  2Q9T A;  5ICQ A;  3N26 A;  3T93 B;  4LAT A;  2I0C A;  3FUZ A;  4TQU Q;  1HSE A;  2I48 A;  3PPR A;  4EF2 A;  3T9H B;  1B51 A;  4XKN A;  5DVJ A;  1M5B A;  2Q89 A;  2PX1 A;  1XT8 A;  4EUO A;  3S2V A;  2HAV A;  4OQO A;  2UVG A;  1LCF A;  1N84 A;  4ZEC A;  4JDF A;  2I4C A;  2ZYM A;  3C9H A;  2F97 A;  4P11 A;  2RF1 A;  2V3U A;  3U92 A;  1ZU0 A;  1JVX A;  3RTW B;  3MWB A;  1MXZ A;  4I8C A;  1Y9U A;  5EHM A;  2NWJ A;  2H98 A;  1MG1 A;  4F18 A;  5KDT B;  2XXU A;  3UIF A;  4LVQ A;  2Z8F A;  4ZZA A;  1P1W A;  1B0L A;  2P2A A;  4C1T A;  1LBB A;  4OFO A;  3EPE A;  1I6Q A;  1LCT A;  4N07 A;  4Z7E A;  3IB0 A;  3QUF A;  4JWO A;  4FOR A;  2QJE A;  3Q28 A;  3K2D A;  5I58 A;  4OES A;  1VSO A;  1FQE A;  4NWD A;  2NVU B;  2UYE A;  3RUM A;  3S4U A;  4HCW A;  4OEU A;  1D4N A;  1OMP A;  2CZL A;  1PB8 A;  3IO6 A;  4KYD A;  4IO7 A;  2ZNT A;  1OQH A;  2D3I A;  4IO6 A;  3DP4 A;  1LB9 A;  1B3E A;  3WAF A;  3A3C A;  1QUL A;  4OEN A;  2V3T A;  3FD3 A;  1LAH E;  1DTG A;  4LA9 A;  4DXU A;  2DWH A;  2ONK E;  4ELQ A;  2F7B A;  1XC1 A;  3TEP A;  2Y7I A;  5H8F B;  1R9L A;  2XXP A;  3SEU A;  3HN0 A;  4JB7 A;  3MVW A;  2PT1 A;  1FTL A;  1B3H A;  1CE2 A;  5I56 B;  1O63 A;  3PPO A;  5FHN A;  5A5X B;  1GVC A;  1SW1 A;  2WKY A;  1SI0 A;  3C36 A;  4DXC A;  4PFY A;  5TP9 A;  4ONY A;  3B6T A;  1D3K A;  2A5T B;  2O7I A;  4R72 A;  2ZYK A;  4MFI A;  4L17 A;  3G3F A;  4Q0C A;  5I84 A;  2W7Y A;  4DZ1 A;  4R6H A;  3HO7 A;  4H1X A;  4F2O A;  1US4 A;  3SEW A;  1FQF A;  4KHZ E;  5L9O A;  4ZEB A;  3DLN A;  2QS3 A;  1JVY A;  3SER A;  3TCG A;  1OLA A;  1P1O A;  3SEY A;  4NWC A;  2HAU A;  4QF9 A;  1FW0 A;  2HEU A;  5HPQ A;  3IOT A;  4F39 A;  3LBS A;  3HPI A;  2R9J A;  4U21 A;  3MJN A;  1LAF E;  3SET A;  3TMG A;  1A8E A;  4THI A;  4RK9 A;  3EHU A;  4F29 A;  4U23 A;  2G93 A;  3TTL A;  4X1D A;  2H99 A;  4QFO A;  4YB5 A;  4FED A;  1B3L A;  2QL3 A;  3IOU A;  3VVF A;  4AB5 A;  2DYX A;  3B6W A;  5CC2 A;  3VVE A;  2DE2 A;  4BDR A;  3T9U A;  4ELR A;  3QIM A;  2Q2C A;  1TT1 A;  1ANF A;  4U22 A;  4GIZ A;  4ZS9 A;  3PMX A;  3TTR A;  4XIG Q;  4G4P A;  1DPE A;  2XXY A;  4G8M A;  1NNF A;  1FTO A;  1MDP 1;  4QFL A;  1NNT A;  4IO2 A;  2M8C A;  1DTZ A;  1YAE A;  2NXO A;  1DOT A;  2DWI A;  1B52 A;  3IJX B;  1OLC A;  4NF5 A;  2UXA A;  4RXL A;  2B3B A;  2X26 A;  5CBS A;  2G29 A;  2PVU A;  1Z7M E;  4LZ8 A;  4KYE A;  1B0H A;  3O28 A;  4KCC A;  2PBW A;  5DVF A;  3OEM A;  4LUB A;  2UYF A;  2Y7K A;  4H65 A;  3CR9 A;  3TCF A;  2DE4 A;  2V93 A;  4ND9 A;  5M2V A;  2XXX A;  1LFG A;  1B58 A;  3D4C A;  2E0S A;  5I59 B;  2V25 A;  5I57 A;  3E4R A;  1B7U A;  4GOT A;  4N6P A;  2F7C A;  1A7L A;  4R2F A;  4BDQ A;  3IAZ A;  2XD2 A;  1M5E A;  3T9X B;  1AMF A;  5JEI A;  1VR5 A;  1SYH A;  2DXR A;  4QRZ A;  2VD2 A;  3O2A A;  3LSX A;  1B3F A;  4RNS A;  1YPN A;  1POY 1;  1SW4 A;  1UIU A;  2XXI A;  4NF6 A;  3FJM A;  2RC7 A;  1FTK A;  2QS1 A;  1ZLQ A;  4ESX A;  3T96 B;  2V84 A;  3IB2 A;  2OWS A;  1QUJ A;  3I5O A;  4HTG A;  5CM6 A;  1Y4C A;  3OMB A;  3I3V A;  2XXH A;  1LB8 A;  5IKB A;  4G8H A;  3QYT A;  3T9V A;  2OK2 A;  4R2B A;  3G3K A;  3EQ1 A;  3KFM A;  1NL5 A;  3CG3 A;  3TCH A;  4QSC A;  3EHT A;  1B4H A;  3MAM A;  2Y7P A;  4JXI A;  4QFN A;  4NMY A;  3K0V A;  1ZMG A;  4YKI A;  4QHQ A;  2DWJ A;  1MXU A;  3ZS6 A;  1JQF A;  1IZ1 A;  4KR5 A;  1F9B A;  2ZYN A;  3C35 A;  2R6G E;  3TDJ A;  4ZE8 A;  3R6U A;  4KI0 E;  3MP8 A;  2VGQ A;  4DDD A;  1USY H;  1BKA A;  3H6U A;  2Q88 A;  4Z0I A;  2V3Q A;  3B7D A;  2ZYO A;  1PDA A;  4KFQ A;  3QUJ A;  3TEL A;  4P0G A;  1HSJ A;  3LC8 A;  1FQB A;  3IK6 B;  3L6G A;  3T22 A;  3GZG A;  1Q1K A;  3RN8 A;  1O7T A;  4WEP A;  5CMC A;  5AA2 B;  3K6V A;  2DE3 A;  4U2R A;  5ELV A;  2DVC A;  4U1Z A;  4F1U A;  1B1H A;  2DS9 A;  2YLN A;  3RQT A;  1QW0 A;  3GLB A;  3IOR A;  4MBP A;  3M8U A;  3SEX A;  1R9Q A;  1SD3 A;  2ALU A;  1B5H A;  1H45 A;  4TLM B;  2Y84 A;  4F22 A;  5K2X A;  1R6Z A;  1MY3 A;  1FTM A;  4R6K A;  3C34 A;  1LAG E;  4LQ5 A;  3H03 A;  2AL4 A;  2ZMB A;  1MXW A;  2RC8 A;  3F11 A;  4XKQ A;  1IXG A;  2LAO A;  3TUS A;  1JNF A;  4DCX A;  3S9L C;  1RYO A;  1N76 A;  3C32 A;  4LQ2 A;  5I2K B;  3EN3 A;  3AXF A;  5TP9 B;  1L5T A;  4GRK A;  4WXJ A;  4IO3 A;  2F34 A;  2HQ0 A;  3RT8 A;  1PB7 A;  3OD7 A;  4H0W A;  4XXU A;  4RA1 A;  2I49 A;  4NF4 A;  5H8H A;  1NH7 A;  3VVD A;  4NF8 A;  2GFE A;  3KZG A;  1QUK A;  2CMO A;  4ZEI A;  3H4Z A;  2O1M A;  3KG2 A;  1TFA A;  1IXH A;  3THI A;  3C33 A;  5H8N A;  3N6U A;  4Q5T A;  3U72 A;  1RYX A;  4QSD A;  4R9F A;  3TQL A;  4OXV A;  1GTK A;  1Y3N A;  1AIV A;  4EXL A;  4YB6 A;  3TYH A;  3U94 A;  1ZKB A;  4H6D A;  4Q30 B;  3TTK A;  2BJJ X;  2Z8E A;  4GWO A;  3S9E A;  2PT2 A;  3FVN A;  4IY6 A;  1YTV A;  3LSW A;  2H4I A;  4YU0 A;  3ZKL A;  3V83 A;  5AA4 B;  4R9G A;  4BDN A;  4DLD A;  2F6P A;  3MZB A;  3VLV A;  2O51 A;  2THI A;  1ELJ A;  3C31 A;  1UTH B;  3PMW A;  1YCJ A;  3GXA A;  4MF3 A;  4GLI A;  1QVS A;  2D21 A;  4F3G A;  3FVO A;  1B46 A;  5TPA A;  3RPW A;  4POX A;  1USY E;  4NF5 B;  2I3W A;  3SDF A;  4X9T A;  4G77 A;  1IXC A;  2GHA A;  1MQG A;  4FJP A;  4H67 A;  3U93 A;  2DP8 A;  3M3K A;  3DP6 A;  1OVT A;  4EQ9 A;  3H6T A;  1NH8 A;  1H3D A;  1EZ9 A;  3PUV E;  5DYH A;  3G3G A;  3HST A;  3UA8 A;  5CI5 A;  1LAX A;  4G68 A;  1MPD A;  2GHB A;  3R26 A;  1II5 A;  3KN7 A;  1MY4 A;  4NE4 A;  5I57 B;  2DXY A;  4IO4 A;  2I4B A;  1P1U A;  5JTY B;  3CSG A;  3Q25 A;  4C0R A;  3PGF A;  2HCA A;  2Z8D A;  2B65 A;  2O1L A;  5J1D A;  4O3A A;  5B70 A;  2Y7W A;  3MP6 A;  1B9J A;  1QKA A;  1SYI A;  3VXB A;  1B32 A;  1POT A;  1A40 A;  3FXQ A;  5DVI A;  3TTM A;  2ONR A;  4ELO A;  3IJO B;  1ZIU A;  2HZK A;  1IEJ A;  1QKB A;  4DXB A;  3RT6 B;  2QS2 A;  2H9B A;  2XX8 A;  3UP9 A;  3PPQ A;  1MY2 A;  2X7P A;  3N6T A;  3O6I A;  4I1D A;  4LON B;  3CFL A;  3VE1 B;  2DQV A;  4F19 A;  1LST A;  1DMB A;  4F1V A;  4K3F A;  2OWT A;  4YAH X;  5KDT A;  1IQ7 A;  4OMB A;  4OZ9 A;  4H8J A;  1WDN A;  3E3K A;  1MRP A;  1WVJ A;  3O97 A;  3OO6 A;  3TAJ A;  1JW4 A;  4O3C A;  3PUZ E;  3DP8 A;  4LZ7 A;  4O3B A;  5F1Q A;  1NKX A;  3U1O A;  1MY0 A;  1AOV A;  2QPQ A;  2NOO A;  3K01 A;  5I2N B;  1RKM A;  5IAI A;  3K6U A;  3PUX E;  3O6G A;  4ECF A;  3MVZ A;  2XXQ A;  1I6A A;  1IXI A;  2DSF A;  5H8F A;  4IY5 A;  3WAE A;  1D9V A;  1JW1 A;  1S9T A;  5HM4 B;  3VXC A;  2DVZ A;  2I0B A;  5H8Q A;  2NUV A;  1IUD A;  3OO7 A;  5I56 A;  5FHM A;  4YZZ A;  2XXT A;  4FEB A;  4IGR A;  3IOW A;  1Y1M A;  1GR2 A;  4OWD A;  1IIT A;  1B5J A;  2ZXT A;  3UN6 A;  3A3U A;  2O68 A;  4ZED A;  3G3J A;  4N13 A;  2DWA A;  4IB2 A;  1EZO A;  5FTH A;  1NFT A;  3O29 A;  4E0X A;  4EF1 A;  5FHO A;  2VHA A;  4OET A;  3FVK A;  3W9W A;  3RLF E;  1ZJL A;  2Q8J A;  3MW0 A;  1ZTY A;  2I3V A;  4G2Z A;  3S9M C;  1TFD A;  3K6X A;  1MQJ A;  3V89 B;  2D5W A;  4ELP A;  3K1P A;  3FVG A;  4BDM A;  5DEX A;  4QFP A;  1B4Z A;  4PFU A;  5H8H B;  3KOS A;  4PP0 A;  2Z22 A;  1UQW A;  5ISU A;  4OHN A;  2QMW A;  2XX7 A;  1JEV A;  3G3H A;  3RGY A;  1B6H A;  2YJP A;  4NED A;  1PC3 A;  4JWY A;  1P1N A;  3VV5 A;  5H8N B;  4GQO A;  1UTB A;  3OSQ A;  4YMB A;  4ISU A;  3UK4 A;  4HS7 A;  1I69 A;  3EF7 A;  3FXU A;  3PV0 E;  4FIM A;  1AL3 A;  5BUU A;  3Q27 A;  5TU0 A;  1FQA A;  3IO4 A;  5F7V A;  1EZP A;  1VFD A;  1VFE A;  3K00 A;  4DCY A;  5I58 B;  1XS5 A;  2RC9 A;  3IB1 A;  2OZZ A;  3FV2 A;  1US5 A;  2F8D A;  4FAT A;  5L8D A;  2KLF A;  4RYA A;  1TWY A;  3VLU A;  1XOC A;  3V8X B;  3IX1 A;  2FYI A;  3T66 A;  1CB6 A;  2A5S A;  1LLS A;  1QJM A;  2OJT A;  2ABH A;  2PYY A;  4X1B A;  5L9M A;  1MQH A;  1B3G A;  4G8N A;  3PUW E;  4YMA A;  3E9X A;  3OEN A;  5I59 A;  2H5Y A;  2F7A A;  5CMM A;  4GXA A;  3PD8 A;  1URS A;  4AB6 A;  3W15 C;  3Q26 A;  1Y3Q A;  2F6G A;  5K2Y A;  3E13 X;  1PBP A;  1P99 A;  1MS7 A;  3FJ7 A;  4EQB A;  4I9D A;  4BLA A;  3CRB A;  4H8I A;  4GL8 A;  2RCB A;  4NTL A;  4YB7 A;  1EU8 A;  3MC2 A;  3W9V A;  1D9Y A; 
#chains in the Genus database with same CATH topology
 2QSX A;  2HXW A;  4DE8 A;  4GVO A;  4UAB A;  1FCK A;  4G68 B;  4QSE A;  3HHF A;  3I6V A;  2AIX A;  1FQC A;  4IGT A;  4OVT A;  1N3X A;  3FBP A;  1NUX A;  3KC0 A;  1NV7 A;  4JBZ A;  1JEU A;  4LN5 A;  4XKP A;  4MLV A;  4RK2 A;  5BWJ A;  3O66 A;  3P7I A;  1PEB A;  4P3L A;  1A55 A;  3PMV A;  4F2Q A;  3G3I A;  3N5L A;  5EQA A;  3QAX A;  4YKJ A;  1SW2 A;  1AH5 A;  3BIH A;  4F3S A;  1JET A;  1Y20 A;  4N17 A;  4FE8 A;  2QVU A;  4HXV A;  3BKI B;  3RY3 A;  1A99 A;  3CI8 A;  1ATG A;  4M4G A;  3SES A;  1JW5 A;  1DPP A;  1BTJ A;  4OTE A;  2FA7 A;  3MBP A;  3OEL A;  3HV1 A;  2F3D A;  3IOV A;  2UVH A;  2HFB A;  3L6H A;  3CSB A;  1I6B A;  3TTN A;  3FXR A;  1LBC A;  3MZ9 A;  4TOZ A;  1MY1 A;  2ONS A;  3CVG A;  4MLQ A;  1FPD A;  5HBC A;  2AYS A;  2IEE A;  1SI1 A;  1N7X A;  3HCQ A;  3FIR A;  1XVX A;  2ESN A;  3SKP A;  1NNP A;  4RY1 A;  1B2H A;  2AL5 A;  3HHG A;  3ZKK A;  1S7Y A;  3CG1 A;  1MXV A;  4WED A;  5AA2 A;  2Y7R A;  3G7W A;  1EH3 A;  4ZDM A;  4U1O A;  4X8R A;  1DSN A;  2VPO A;  4KD5 A;  4ZE9 A;  1MPC A;  4UAC A;  4GF8 A;  2XXW A;  2RCA A;  4LP2 B;  3FAT A;  4FAJ A;  2P0S A;  1MH3 A;  1VDW A;  5KCJ A;  3ILU B;  4QFK A;  4JWX A;  4IO5 A;  2HZL A;  4RPN A;  1WOD A;  3LUY A;  1B1X A;  4PBH A;  4F3B A;  1DBZ A;  2P3V A;  3JYR A;  3GBB A;  4POW A;  4R75 A;  4KQP A;  1BP5 A;  3OO8 A;  2B4L A;  4KCD A;  3RNN A;  5H8Q B;  3EHS A;  1XVY A;  2XWV A;  4H5G A;  3H06 B;  4TLL B;  3LR1 A;  3KN8 A;  4XKR A;  3MST A;  2XXV A;  4MMP A;  3ECR A;  4RPO A;  1FBF A;  3KJT A;  3RYD A;  3IR1 A;  2O69 A;  3FAS A;  1B5I A;  1TXF A;  5AA3 A;  3BIG A;  3H6W A;  3TQW A;  1SVX B;  1VE4 A;  3OO9 A;  3DEL B;  2F5X A;  5I2K A;  2Q8M A;  3KSJ A;  2OBG A;  3OOA A;  3K1N A;  4LZ5 A;  3JZJ A;  1LGB C;  1A54 A;  4MH5 A;  1J1N A;  3H7M A;  2I6E A;  3MZ1 A;  4XTC Q;  5DT6 A;  5B7D A;  1R1N A;  3QSL A;  1K9Z A;  1Y1Z A;  3K1M A;  3E79 A;  3U8Q A;  4PET A;  2QVR A;  2RIN A;  1N04 A;  4U4S A;  3KBR A;  3T0J A;  4XF5 A;  5EYF A;  1T0K A;  4NF6 B;  4KYS A;  4YIC A;  3TKD A;  3USD A;  2RKM A;  2VD3 A;  3KGC A;  3O9P A;  1M5D A;  5H8S A;  5DTB A;  4ZEK A;  4OVJ A;  2XD3 A;  5ET5 A;  3FZV A;  5KZT A;  1GGG A;  1RDY A;  3MPK A;  2F35 A;  1B40 A;  1PBQ A;  2CEY A;  1OIB A;  4JSD A;  5L9S A;  5AA2 D;  3K4U A;  4JSO A;  1DCU A;  1N7W A;  5DEX B;  4N8Y A;  2VT5 A;  4OEV A;  3OEK A;  2QRY A;  1Z7N E;  3DM0 A;  1OVB A;  1BIY A;  5ITO A;  2MKZ A;  5AA4 A;  3GBA A;  3IL1 B;  2Z23 A;  5T3J A;  5AE4 A;  4EQ7 A;  2H25 A;  2OLB A;  2P1S A;  3MPL A;  1UTB B;  3D4G A;  3KJ7 A;  1NMU A;  3M3F A;  3CHG A;  2OCU A;  4PE5 B;  4R6Y A;  1B7Z A;  5CMK A;  3B6Q A;  1UTH A;  3V5A A;  5ET8 A;  4YKK A;  3FGS A;  4NF0 A;  3FV1 A;  1KA0 A;  1N0T A;  2Y5K A;  4PFT A;  2Q2A A;  2QMX A;  4G61 A;  2WBB A;  4PQJ A;  2E1S A;  4KPT A;  5CBR A;  4GD5 A;  1MPB A;  3ODB A;  3MVY A;  4OER A;  2GH9 A;  4OYV A;  3BBR A;  2REJ A;  1NNK A;  4Q8R A;  4E0W A;  1MQD A;  3CFX A;  4GWX A;  4R73 A;  1FTJ A;  3CFZ A;  1S50 A;  1MM6 A;  4FEC A;  3UOR A;  1QUI A;  1O64 A;  5A5X A;  5CRY A;  1GV8 A;  1MM7 A;  1FPI A;  1UIV A;  1SDX A;  4XFE A;  4DIG A;  2GRV A;  2CZK A;  4WKM A;  1ZBM A;  1P1Q A;  4PC9 A;  4PAK A;  2QS4 A;  1MXX A;  5IM2 A;  1Q9D A;  4PE3 A;  2A5T A;  4GWW A;  3SEV A;  4PGN A;  3PPP A;  4H5F A;  5CMB A;  5JTY A;  3KSX A;  3QXM A;  3PD9 A;  4P1L A;  4N8G A;  1KWH A;  2HHM A;  4R74 A;  5EHS A;  3ONM A;  3TZA A;  3PUY E;  1SQY A;  3S9N C;  2FNC A;  1B7H A;  3VLW A;  2ZZW A;  1FBE A;  2YPN A;  2PMS A;  2R71 A;  3M3L A;  1URD A;  2DOJ A;  3KC1 A;  3KN3 A;  3BFU A;  1SBP A;  4BDO A;  4MJO A;  3B50 A;  3Q29 A;  1H43 A;  3RTF B;  2X7Q A;  4AQ4 A;  5JK4 A;  3O6H A;  3LSL A;  4YKP A;  3C4M A;  1FQD A;  4P0I A;  3TPA A;  1N3W A;  4NF4 B;  5FBP A;  4I62 A;  4I3E A;  3TOD A;  2XHD A;  1Q35 A;  3MP1 A;  4GL0 A;  4GFR A;  3H3G A;  2ZNU A;  4ESW A;  3A09 A;  1A8F A;  2XX9 A;  3VDF A;  4NF8 B;  5EQ8 A;  2QVV A;  4NGU A;  3PPN A;  2REG A;  2O6A A;  4OA4 A;  1KA1 A;  4ZZE A;  1FPK A;  4N4U A;  1B05 A;  4O8M A;  4I40 A;  3FJG A;  1PB9 A;  2F3B A;  5IZ1 A;  2ANJ A;  4M1V A;  3K02 A;  4PFW A;  1Y4T A;  4F1Y A;  4U4X A;  3K6W A;  4N6K A;  3N94 A;  1MH4 A;  3TFL A;  1SW5 A;  4UA8 A;  2UVJ A;  4HCY A;  2O84 X;  4PF6 A;  1NV6 A;  1MQI A;  4RJZ A;  1M5F A;  3MUQ A;  2F36 A;  4O7M A;  3QK6 A;  5I2N A;  4OFJ A;  2ZZX A;  1LFI A;  4C1U A;  4EDP A;  2O7U A;  1M5C A;  5AA1 A;  2KR0 A;  3ZSF A;  3B8B A;  3JV9 A;  1XHY A;  4G68 C;  5FTI A;  1FBG A;  3KBZ A;  4F31 B;  1OQG A;  4GXS B;  3ISP A;  4PFI A;  2UVI A;  4X48 A;  1Y3P A;  4ZEF A;  1IIW A;  5TPA B;  4NG7 A;  1H76 A;  3CIJ A;  2IA4 A;  2XXR A;  3VFJ A;  2B3F A;  3MQ9 A;  2VOZ A;  3KOT A;  5KCJ B;  3ILT B;  2F78 A;  5ICT A;  1MXY A;  3OXN A;  4EXK A;  1H44 A;  2ZZV A;  3UGW A;  2FIE A;  1URG A;  4HW8 A;  1LFH A;  5LOM A;  1FBD A;  2PFZ A;  3BFT A;  3R7X A;  4GWZ A;  5ITP A;  2I58 A;  3KEI A;  4OFL A;  1IMC A;  4OVS A;  5DW8 A;  3LSF B;  3PU5 A;  1HSL A;  4F3P A;  3H6V A;  2V4C A;  3OSR A;  3MVX A;  4BDL A;  1BLF A;  2VP1 A;  2ZNS A;  1MDQ A;  2Q9T A;  5ICQ A;  3N26 A;  3T93 B;  4LAT A;  2I0C A;  3FUZ A;  3RPL A;  4TQU Q;  1HSE A;  2I48 A;  3PPR A;  4EF2 A;  3T9H B;  1B51 A;  4XKN A;  5DVJ A;  5I5P A;  1M5B A;  2Q89 A;  2PX1 A;  1XT8 A;  4GX4 A;  4EUO A;  4PDH A;  3S2V A;  2HAV A;  4OQO A;  4MEV A;  2UVG A;  1LCF A;  1N84 A;  4ZEC A;  4JDF A;  2I4C A;  1FJ6 A;  2ZYM A;  3C9H A;  2F97 A;  4P11 A;  2RF1 A;  2V3U A;  3U92 A;  1ZU0 A;  1JVX A;  3RTW B;  3MWB A;  1MXZ A;  3U65 A;  4I8C A;  1Y9U A;  5EHM A;  2NWJ A;  2H98 A;  1MG1 A;  4F18 A;  5KDT B;  2XXU A;  3UIF A;  4OAN A;  4LVQ A;  2Z8F A;  4ZZA A;  1P1W A;  1B0L A;  2P2A A;  4I3Y A;  1LBB A;  4OFO A;  4C1T A;  3EPE A;  1I6Q A;  1LCT A;  4N07 A;  4Z7E A;  3IB0 A;  3QUF A;  2WYP A;  2OX3 A;  4JWO A;  4FOR A;  2QJE A;  3Q28 A;  3K2D A;  5I58 A;  4OES A;  1VSO A;  1FQE A;  4NWD A;  2NVU B;  4P56 A;  2UYE A;  2XWI A;  3RUM A;  3S4U A;  4HCW A;  4OEU A;  1D4N A;  1OMP A;  2CZL A;  1PB8 A;  2OWZ A;  3A29 A;  3IO6 A;  4KYD A;  4IO7 A;  2ZNT A;  1OQH A;  3PTY A;  2D3I A;  4IO6 A;  3DP4 A;  1LB9 A;  1B3E A;  3WAF A;  3A3C A;  3ROJ A;  1QUL A;  4OEN A;  4N15 A;  2V3T A;  3FD3 A;  2BJI A;  1LAH E;  1DTG A;  4LA9 A;  4DXU A;  2DWH A;  2ONK E;  4ELQ A;  2XWK A;  1FPF A;  2F7B A;  5IZ3 A;  1XC1 A;  3TEP A;  1NUW A;  2Y7I A;  5H8F B;  1R9L A;  2XXP A;  3SEU A;  4NX1 A;  1LBV A;  3HN0 A;  4JB7 A;  3MVW A;  2PT1 A;  1FTL A;  1B3H A;  1CE2 A;  5I56 B;  3IFC A;  1O63 A;  3PPO A;  5FHN A;  1LBY A;  5A5X B;  1GVC A;  1SW1 A;  2WKY A;  1SI0 A;  3C36 A;  4DXC A;  4PFY A;  4DI3 D;  5TP9 A;  4ONY A;  3B6T A;  1D3K A;  4AS4 A;  2A5T B;  2O7I A;  4R72 A;  2ZYK A;  4MFI A;  4QXD A;  4L17 A;  3G3F A;  4Q0C A;  5I84 A;  2W7Y A;  4DZ1 A;  4R6H A;  4GBV A;  3HO7 A;  4H1X A;  4F2O A;  1US4 A;  4PFB A;  1FQF A;  3SEW A;  1FJ9 A;  4KHZ E;  5L9O A;  4PAF A;  4ZEB A;  3DLN A;  2QS3 A;  1JVY A;  3SER A;  3TCG A;  1OLA A;  1P1O A;  3SEY A;  1BK4 A;  4NWC A;  2HAU A;  4QF9 A;  2HEU A;  5HPQ A;  2PFY A;  3IOT A;  4F39 A;  3LBS A;  3HPI A;  2R9J A;  4U21 A;  4DI4 B;  4MNC A;  3MJN A;  1LAF E;  5F24 A;  3SET A;  3TMG A;  1A8E A;  4THI A;  4RK9 A;  3EHU A;  1INP A;  4F29 A;  4U23 A;  2G93 A;  3TTL A;  4X1D A;  2H99 A;  4QFO A;  4YB5 A;  4FED A;  1B3L A;  2QL3 A;  4OVQ A;  3IOU A;  3VVF A;  4AB5 A;  2DYX A;  3B6W A;  2P3N A;  5CC2 A;  3VVE A;  1NV1 A;  2DE2 A;  4BDR A;  3T9U A;  4ELR A;  3QIM A;  2Q2C A;  1TT1 A;  4PAI A;  3W9V A;  1ANF A;  4U22 A;  4GIZ A;  4ZS9 A;  3PMX A;  3TTR A;  4XIG Q;  4G4P A;  1DPE A;  2XXY A;  4G8M A;  1NNF A;  1FTO A;  1XI6 A;  1MDP 1;  1NUY A;  3LUZ A;  4QFL A;  1NNT A;  4IO2 A;  2M8C A;  1DTZ A;  1YAE A;  2NXO A;  1DOT A;  2DWI A;  1B52 A;  3IJX B;  1OLC A;  1FBP A;  4NF5 A;  2VPN A;  2UXA A;  4RXL A;  2B3B A;  2X26 A;  2FVZ A;  5CBS A;  2G29 A;  2PVU A;  4PBQ A;  1Z7M E;  4LZ8 A;  4IR8 A;  4KYE A;  1B0H A;  3O28 A;  4KCC A;  2PBW A;  5DVF A;  3OEM A;  4LUB A;  1D9Q A;  4H45 A;  2UYF A;  2Y7K A;  4H65 A;  3CR9 A;  3TCF A;  2DE4 A;  2V93 A;  4OVR A;  4ND9 A;  5M2V A;  2XXX A;  1LFG A;  1B58 A;  3D4C A;  2E0S A;  5I59 B;  2V25 A;  5I57 A;  3E4R A;  1B7U A;  4FBP A;  4GOT A;  4N6P A;  1FPE A;  1EYK A;  2F7C A;  1A7L A;  4R2F A;  4BDQ A;  3IAZ A;  2XD2 A;  1M5E A;  3T9X B;  1AMF A;  5JEI A;  1VR5 A;  2PCR A;  1SYH A;  4X04 A;  4NHB A;  2DXR A;  4QRZ A;  2VD2 A;  3O2A A;  3LSX A;  1B3F A;  4RNS A;  1YPN A;  1POY 1;  1SW4 A;  1UIU A;  2XXI A;  4NF6 A;  3FJM A;  2RC7 A;  4MX6 A;  1FTK A;  2QS1 A;  2WX9 A;  1AWB A;  1ZLQ A;  2FHY A;  1NV5 A;  4ESX A;  3T96 B;  1FRP A;  2V84 A;  3IB2 A;  2OWS A;  1QUJ A;  3I5O A;  4HTG A;  5CM6 A;  2CZH A;  1Y4C A;  3OMB A;  3I3V A;  2XXH A;  1YZ0 A;  1LB8 A;  5IKB A;  4G8H A;  1K9Y A;  3QYT A;  3T9V A;  2OK2 A;  4R2B A;  3G3K A;  3EQ1 A;  3KFM A;  1NL5 A;  3CG3 A;  3TCH A;  1IME A;  4O94 A;  1KZ8 A;  4QSC A;  3EHT A;  1B4H A;  3MAM A;  2Y7P A;  4JXI A;  1FPB A;  4QFN A;  4NMY A;  3K0V A;  3T1B A;  1ZMG A;  4YKI A;  4QHQ A;  2DWJ A;  1MXU A;  3ZS6 A;  1G0I A;  1JQF A;  1IZ1 A;  4KR5 A;  1F9B A;  2ZYN A;  3C35 A;  2R6G E;  3TDJ A;  4ZE8 A;  4HE0 A;  3R6U A;  4KI0 E;  3MP8 A;  2VGQ A;  5IGA A;  4DDD A;  1USY H;  1BKA A;  4PF8 A;  3H6U A;  4P1E A;  2Q88 A;  5IZZ A;  4Z0I A;  2V3Q A;  3B7D A;  1NV4 A;  5EYG A;  2ZYO A;  1PDA A;  4MCO A;  4KFQ A;  3QUJ A;  4PFR A;  3TEL A;  1DK4 A;  4P0G A;  1HSJ A;  3NOH A;  3LC8 A;  1FQB A;  1SPI A;  3IK6 B;  3L6G A;  3T22 A;  3GZG A;  1Q1K A;  3RN8 A;  1O7T A;  4WEP A;  5CMC A;  5AA2 B;  2XWO A;  2DE3 A;  3K6V A;  4N81 A;  4NQ8 A;  4U2R A;  5ELV A;  2DVC A;  4U1Z A;  4F1U A;  1B1H A;  2DS9 A;  2YLN A;  3RQT A;  1QW0 A;  3GLB A;  3IOR A;  4GX6 A;  4MBP A;  3M8U A;  3SEX A;  1R9Q A;  1SD3 A;  2ALU A;  1B5H A;  1H45 A;  4TLM B;  2Y84 A;  1EYJ A;  4F22 A;  1LBX A;  1R6Z A;  5K2X A;  1MY3 A;  1FTM A;  4R6K A;  3C34 A;  1LAG E;  1FPJ A;  4PCD A;  4LQ5 A;  3H03 A;  2AL4 A;  2R8T A;  2ZMB A;  1MXW A;  2RC8 A;  3F11 A;  4XKQ A;  1IXG A;  1G0H A;  2LAO A;  3TUS A;  1LBZ A;  2FBP A;  1JNF A;  4DCX A;  2XXK A;  3S9L C;  1RYO A;  1N76 A;  3C32 A;  4LQ2 A;  5I2K B;  2CEX A;  3EN3 A;  3AXF A;  5TP9 B;  1L5T A;  1LBW A;  4GRK A;  1FPL A;  4IO3 A;  4WXJ A;  2F34 A;  2HQ0 A;  3RT8 A;  1PB7 A;  3OD7 A;  4H0W A;  4XXU A;  4RA1 A;  2I49 A;  5LTC A;  4NF4 A;  3SZP A;  4NAP A;  5H8H A;  1NH7 A;  3VVD A;  4NF8 A;  2GFE A;  3KZG A;  1QUK A;  2CMO A;  4ZEI A;  3H4Z A;  2O1M A;  3KG2 A;  1TFA A;  1IXH A;  3THI A;  3C33 A;  5H8N A;  3N6U A;  4Q5T A;  3U72 A;  1RYX A;  4QSD A;  4PTK A;  4R9F A;  3TQL A;  4OXV A;  1GTK A;  1Y3N A;  1AIV A;  1FBH A;  4EXL A;  4YB6 A;  3TYH A;  3U94 A;  1ZKB A;  4H6D A;  4Q30 B;  3TTK A;  2BJJ X;  2Z8E A;  4GWO A;  3S9E A;  2PT2 A;  4P8B A;  3FVN A;  4IY6 A;  4MNI A;  1YTV A;  4JVC A;  3LSW A;  2H4I A;  4YU0 A;  3ZKL A;  3V83 A;  5AA4 B;  4R9G A;  4BDN A;  1NV3 A;  2DDK A;  4DLD A;  2F6P A;  3MZB A;  5ET7 A;  3VLV A;  2O51 A;  2THI A;  1ELJ A;  3C31 A;  1UTH B;  3PMW A;  1YCJ A;  3GXA A;  4MF3 A;  4GLI A;  1QVS A;  4N91 A;  2D21 A;  4F3G A;  3FVO A;  1B46 A;  2KQZ A;  4GWS A;  2HPG A;  5TPA A;  4PDD A;  4P9K A;  1USY E;  4POX A;  3RPW A;  4NF5 B;  2WBD A;  4P47 A;  2I3W A;  3SDF A;  4X9T A;  4G77 A;  1IXC A;  2GHA A;  1MQG A;  4FJP A;  1FBC A;  4H67 A;  3D1R A;  3U93 A;  5I7I A;  2DP8 A;  3M3K A;  3DP6 A;  1OVT A;  4EQ9 A;  3H6T A;  1NH8 A;  1H3D A;  1EZ9 A;  3PUV E;  5DYH A;  3FXB A;  3G3G A;  3HST A;  3UA8 A;  5CI5 A;  1LAX A;  4G68 A;  5J16 A;  1MPD A;  2GHB A;  1IMD A;  4MAG A;  3R26 A;  1II5 A;  3KN7 A;  1MY4 A;  4NE4 A;  5I57 B;  2DXY A;  4IO4 A;  2I4B A;  1P1U A;  5JTY B;  3CSG A;  3Q25 A;  4C0R A;  3PGF A;  2HCA A;  2Z8D A;  2B65 A;  2O1L A;  1RDZ A;  5J1D A;  4O3A A;  5EQ7 A;  4HE2 A;  5B70 A;  4H46 A;  2Y7W A;  3MP6 A;  1B9J A;  1QKA A;  1SYI A;  3VXB A;  4AS5 A;  1B32 A;  1POT A;  1A40 A;  3FXQ A;  5DVI A;  3TTM A;  2ONR A;  4ELO A;  4NN3 A;  3IJO B;  1ZIU A;  2HZK A;  1IEJ A;  1QKB A;  4DXB A;  3RT6 B;  2QS2 A;  2H9B A;  2XX8 A;  3UP9 A;  3PPQ A;  4O7I A;  1MY2 A;  2X7P A;  3N6T A;  3O6I A;  4I1D A;  4LON B;  3CFL A;  4XEQ A;  3VE1 B;  2DQV A;  4F19 A;  1LST A;  1DMB A;  2Y5L A;  4F1V A;  4K3F A;  2OWT A;  4YAH X;  1IMA A;  3EKI A;  5KDT A;  1IQ7 A;  4OMB A;  3GYY A;  2HXR A;  4OZ9 A;  2Q74 A;  4H8J A;  1WDN A;  5ET6 A;  1IMB A;  3E3K A;  1MRP A;  1WVJ A;  3O97 A;  2GQ1 A;  3OO6 A;  4PGP A;  3TAJ A;  1NUZ A;  2L5V A;  1JW4 A;  2XA5 A;  4QBA A;  4O3C A;  3PUZ E;  3DP8 A;  4LZ7 A;  4O3B A;  5F1Q A;  1NKX A;  3U1O A;  1MY0 A;  1AOV A;  2QPQ A;  2NOO A;  1QGX A;  3K01 A;  5A5L A;  5I2N B;  1RKM A;  5IAI A;  3K6U A;  3PUX E;  3O6G A;  4ECF A;  3MVZ A;  2XXQ A;  1I6A A;  1IXI A;  2DSF A;  5H8F A;  1RDX A;  4IY5 A;  3WAE A;  1D9V A;  1JW1 A;  1S9T A;  5HM4 B;  3VXC A;  2DVZ A;  2I0B A;  4MIJ A;  5H8Q A;  2NUV A;  1IUD A;  3OO7 A;  1FTA A;  4N6D A;  5I56 A;  5FHM A;  4YZZ A;  1FSA A;  2XXT A;  4FEB A;  4IGR A;  2CZI A;  3IOW A;  1Y1M A;  1GR2 A;  4GX3 A;  4OWD A;  4JVI A;  1IIT A;  1B5J A;  1EYI A;  2ZXT A;  3UN6 A;  3A3U A;  4KXP A;  4MNP A;  4GWY A;  2O68 A;  4OVP A;  4ZED A;  3G3J A;  4N13 A;  4GWU A;  2DWA A;  4IB2 A;  1EZO A;  5FTH A;  1NFT A;  3O29 A;  4E0X A;  4EF1 A;  5FHO A;  2VHA A;  4OET A;  3FVK A;  1NV0 A;  3W9W A;  3RLF E;  1ZJL A;  2JJK A;  2Q8J A;  3MW0 A;  1ZTY A;  2I3V A;  1IMF A;  2WEF A;  4G2Z A;  3S9M C;  3RPL B;  1TFD A;  3K6X A;  1MQJ A;  3V89 B;  2D5W A;  4ELP A;  3K1P A;  3FVG A;  4BDM A;  5DEX A;  4QFP A;  1LEV A;  1B4Z A;  4PFU A;  5H8H B;  3KOS A;  4PP0 A;  2Z22 A;  1UQW A;  2FIX A;  5ISU A;  4OHN A;  5EYH A;  2QMW A;  1NV2 A;  1NI9 A;  3E78 A;  2XX7 A;  1JEV A;  3G3H A;  3RGY A;  1B6H A;  1JP4 A;  2YJP A;  4NED A;  1PC3 A;  4JWY A;  1P1N A;  3VV5 A;  5H8N B;  4GQO A;  1UTB A;  1YYZ A;  1FPG A;  3OSQ A;  4YMB A;  4ISU A;  3UK4 A;  4HS7 A;  1I69 A;  3EF7 A;  4MHF A;  3FXU A;  3PV0 E;  4FIM A;  1AL3 A;  5BUU A;  5LDZ A;  1YXI A;  4JVD A;  3Q27 A;  3QMF A;  5TU0 A;  1FQA A;  3IO4 A;  5F7V A;  1EZP A;  1VFD A;  1VFE A;  2QFL A;  3K00 A;  4DCY A;  5I58 B;  3HFU A;  1XS5 A;  2RC9 A;  3IB1 A;  2OZZ A;  3IFA A;  3FV2 A;  1US5 A;  2F8D A;  4FAT A;  5L8D A;  4RYA A;  2KLF A;  1TWY A;  3VLU A;  3LV0 A;  1XOC A;  3V8X B;  3IX1 A;  2FYI A;  3T66 A;  1CB6 A;  2A5S A;  5I3S A;  1LLS A;  1QJM A;  2OJT A;  2ABH A;  2PYY A;  4X1B A;  5L9M A;  1MQH A;  1B3G A;  2B4M A;  4G8N A;  3PUW E;  4YMA A;  3E9X A;  3OEN A;  5I59 A;  2H5Y A;  5IZ3 B;  2F7A A;  5CMM A;  4GXA A;  3PD8 A;  1URS A;  4AB6 A;  3W15 C;  3Q26 A;  2WYK A;  5EQ9 A;  1Y3Q A;  2F6G A;  4HE1 A;  5K2Y A;  3E13 X;  1PBP A;  1P99 A;  1MS7 A;  3FJ7 A;  4EQB A;  4I9D A;  4BLA A;  3CRB A;  4H8I A;  4GL8 A;  2RCB A;  1CNQ A;  4NTL A;  5ESY A;  4GBW A;  4YB7 A;  1EU8 A;  3MYU A;  3MC2 A;  1FW0 A;  1D9Y A; 
#chains in the Genus database with same CATH homology
 2QSX A;  2HXW A;  4DE8 A;  4GVO A;  1FCK A;  4G68 B;  4QSE A;  3HHF A;  3I6V A;  2AIX A;  1FQC A;  4IGT A;  1N3X A;  4JBZ A;  1JEU A;  4XKP A;  4MLV A;  4RK2 A;  5BWJ A;  3O66 A;  3P7I A;  1PEB A;  1A55 A;  3PMV A;  4F2Q A;  3G3I A;  3N5L A;  3QAX A;  4YKJ A;  1SW2 A;  1AH5 A;  4F3S A;  1JET A;  1Y20 A;  4FE8 A;  3BKI B;  3RY3 A;  1A99 A;  3CI8 A;  1ATG A;  4M4G A;  3SES A;  1JW5 A;  1DPP A;  1BTJ A;  4OTE A;  2FA7 A;  3MBP A;  3OEL A;  3HV1 A;  3IOV A;  2UVH A;  2HFB A;  3L6H A;  3CSB A;  1I6B A;  3TTN A;  3FXR A;  1LBC A;  3MZ9 A;  4TOZ A;  1MY1 A;  2ONS A;  3CVG A;  4MLQ A;  5HBC A;  2AYS A;  2IEE A;  1SI1 A;  1N7X A;  3HCQ A;  3FIR A;  1XVX A;  2ESN A;  3SKP A;  1NNP A;  4RY1 A;  1B2H A;  2AL5 A;  3HHG A;  3ZKK A;  1S7Y A;  3CG1 A;  1MXV A;  4WED A;  5AA2 A;  2Y7R A;  3G7W A;  1EH3 A;  4ZDM A;  4U1O A;  1DSN A;  4KD5 A;  4ZE9 A;  1MPC A;  4UAC A;  4GF8 A;  2XXW A;  2RCA A;  4LP2 B;  3FAT A;  4FAJ A;  2P0S A;  1MH3 A;  5KCJ A;  3ILU B;  4QFK A;  4JWX A;  4IO5 A;  2HZL A;  4RPN A;  1WOD A;  3LUY A;  1B1X A;  4F3B A;  3JYR A;  3GBB A;  4POW A;  4R75 A;  4KQP A;  1BP5 A;  3OO8 A;  4KCD A;  3RNN A;  5H8Q B;  3EHS A;  1XVY A;  4H5G A;  3H06 B;  4TLL B;  3LR1 A;  3KN8 A;  4XKR A;  2XXV A;  3ECR A;  4RPO A;  3KJT A;  3IR1 A;  2O69 A;  3FAS A;  1B5I A;  1TXF A;  5AA3 A;  3H6W A;  3TQW A;  1SVX B;  1VE4 A;  3OO9 A;  3DEL B;  2F5X A;  5I2K A;  3KSJ A;  2OBG A;  3OOA A;  3K1N A;  4LZ5 A;  3JZJ A;  1LGB C;  1A54 A;  4MH5 A;  1J1N A;  3H7M A;  2I6E A;  3MZ1 A;  4XTC Q;  5DT6 A;  5B7D A;  1R1N A;  3QSL A;  1Y1Z A;  3K1M A;  3U8Q A;  4PET A;  2RIN A;  1N04 A;  4U4S A;  3KBR A;  1T0K A;  5EYF A;  4NF6 B;  4KYS A;  4YIC A;  3TKD A;  3USD A;  2RKM A;  2VD3 A;  3KGC A;  3O9P A;  1M5D A;  5H8S A;  5DTB A;  4ZEK A;  4OVJ A;  2XD3 A;  3FZV A;  5KZT A;  1GGG A;  3MPK A;  2F35 A;  1B40 A;  1PBQ A;  1OIB A;  4JSD A;  5L9S A;  5AA2 D;  3K4U A;  4JSO A;  1N7W A;  5DEX B;  4OEV A;  3OEK A;  2QRY A;  1Z7N E;  3DM0 A;  1OVB A;  1BIY A;  5ITO A;  5AA4 A;  3GBA A;  3IL1 B;  2Z23 A;  5AE4 A;  4EQ7 A;  2H25 A;  2OLB A;  2P1S A;  3MPL A;  1UTB B;  3D4G A;  3KJ7 A;  1NMU A;  3M3F A;  2OCU A;  4PE5 B;  4R6Y A;  1B7Z A;  5CMK A;  3B6Q A;  1UTH A;  3V5A A;  4YKK A;  3FGS A;  3FV1 A;  1N0T A;  2Q2A A;  4PFT A;  2QMX A;  4PQJ A;  2E1S A;  4KPT A;  5CBR A;  4GD5 A;  1MPB A;  3ODB A;  3MVY A;  4OER A;  2GH9 A;  4OYV A;  3BBR A;  2REJ A;  4Q8R A;  1NNK A;  4E0W A;  1MQD A;  3CFX A;  4R73 A;  1FTJ A;  3CFZ A;  1S50 A;  1MM6 A;  4FEC A;  3UOR A;  1QUI A;  1O64 A;  5A5X A;  5CRY A;  1GV8 A;  1MM7 A;  1UIV A;  1SDX A;  4DIG A;  2GRV A;  4WKM A;  1ZBM A;  1P1Q A;  2QS4 A;  1MXX A;  2A5T A;  3SEV A;  3PPP A;  4H5F A;  5CMB A;  5JTY A;  3KSX A;  3QXM A;  3PD9 A;  1KWH A;  4R74 A;  5EHS A;  3ONM A;  3TZA A;  3PUY E;  1SQY A;  3S9N C;  2FNC A;  1B7H A;  3VLW A;  2YPN A;  2PMS A;  2R71 A;  3M3L A;  1URD A;  2DOJ A;  3KN3 A;  3BFU A;  1SBP A;  4BDO A;  3Q29 A;  1H43 A;  3RTF B;  2X7Q A;  4AQ4 A;  5JK4 A;  3O6H A;  3LSL A;  4YKP A;  3C4M A;  1FQD A;  4P0I A;  3TPA A;  1N3W A;  4NF4 B;  4I62 A;  3TOD A;  2XHD A;  1Q35 A;  3MP1 A;  4GL0 A;  4GFR A;  3H3G A;  2ZNU A;  4ESW A;  3A09 A;  1A8F A;  2XX9 A;  3VDF A;  4NF8 B;  3PPN A;  2REG A;  2O6A A;  4ZZE A;  1B05 A;  3FJG A;  1PB9 A;  2ANJ A;  4M1V A;  3K02 A;  4PFW A;  1Y4T A;  4F1Y A;  4U4X A;  3K6W A;  3N94 A;  1MH4 A;  3TFL A;  1SW5 A;  4UA8 A;  2UVJ A;  4HCY A;  2O84 X;  1MQI A;  4RJZ A;  1M5F A;  3MUQ A;  2F36 A;  3QK6 A;  5I2N A;  4OFJ A;  1LFI A;  4C1U A;  4EDP A;  2O7U A;  1M5C A;  5AA1 A;  3ZSF A;  3JV9 A;  1XHY A;  4G68 C;  5FTI A;  4F31 B;  1OQG A;  4GXS B;  2UVI A;  4X48 A;  1Y3P A;  4ZEF A;  1IIW A;  5TPA B;  1H76 A;  3CIJ A;  2IA4 A;  2XXR A;  3VFJ A;  2B3F A;  3MQ9 A;  2VOZ A;  3KOT A;  5KCJ B;  3ILT B;  2F78 A;  5ICT A;  1MXY A;  3OXN A;  4EXK A;  1H44 A;  3UGW A;  1URG A;  4HW8 A;  1LFH A;  5LOM A;  3BFT A;  3R7X A;  5ITP A;  2I58 A;  3KEI A;  4OFL A;  3LSF B;  3PU5 A;  1HSL A;  4F3P A;  3H6V A;  3OSR A;  3MVX A;  4BDL A;  1BLF A;  2VP1 A;  2ZNS A;  1MDQ A;  2Q9T A;  5ICQ A;  3N26 A;  3T93 B;  4LAT A;  2I0C A;  3FUZ A;  4TQU Q;  1HSE A;  2I48 A;  3PPR A;  4EF2 A;  3T9H B;  1B51 A;  4XKN A;  5DVJ A;  1M5B A;  2Q89 A;  2PX1 A;  1XT8 A;  4EUO A;  3S2V A;  2HAV A;  4OQO A;  2UVG A;  1LCF A;  1N84 A;  4ZEC A;  4JDF A;  2I4C A;  2ZYM A;  3C9H A;  2F97 A;  4P11 A;  2RF1 A;  2V3U A;  3U92 A;  1ZU0 A;  1JVX A;  3RTW B;  3MWB A;  1MXZ A;  4I8C A;  1Y9U A;  5EHM A;  2NWJ A;  2H98 A;  1MG1 A;  4F18 A;  5KDT B;  2XXU A;  3UIF A;  4LVQ A;  2Z8F A;  4ZZA A;  1P1W A;  1B0L A;  2P2A A;  4C1T A;  1LBB A;  4OFO A;  3EPE A;  1I6Q A;  1LCT A;  4N07 A;  4Z7E A;  3IB0 A;  3QUF A;  4JWO A;  4FOR A;  2QJE A;  3Q28 A;  3K2D A;  5I58 A;  4OES A;  1VSO A;  1FQE A;  4NWD A;  2NVU B;  2UYE A;  3RUM A;  3S4U A;  4HCW A;  4OEU A;  1D4N A;  1OMP A;  2CZL A;  1PB8 A;  3IO6 A;  4KYD A;  4IO7 A;  2ZNT A;  1OQH A;  2D3I A;  4IO6 A;  3DP4 A;  1LB9 A;  1B3E A;  3WAF A;  3A3C A;  1QUL A;  4OEN A;  2V3T A;  3FD3 A;  1LAH E;  1DTG A;  4LA9 A;  4DXU A;  2DWH A;  2ONK E;  4ELQ A;  2F7B A;  1XC1 A;  3TEP A;  2Y7I A;  5H8F B;  1R9L A;  2XXP A;  3SEU A;  3HN0 A;  4JB7 A;  3MVW A;  2PT1 A;  1FTL A;  1B3H A;  1CE2 A;  5I56 B;  1O63 A;  3PPO A;  5FHN A;  5A5X B;  1GVC A;  1SW1 A;  2WKY A;  1SI0 A;  3C36 A;  4DXC A;  4PFY A;  5TP9 A;  4ONY A;  3B6T A;  1D3K A;  2A5T B;  2O7I A;  4R72 A;  2ZYK A;  4MFI A;  4L17 A;  3G3F A;  4Q0C A;  5I84 A;  2W7Y A;  4DZ1 A;  4R6H A;  3HO7 A;  4H1X A;  4F2O A;  1US4 A;  3SEW A;  1FQF A;  4KHZ E;  5L9O A;  4ZEB A;  3DLN A;  2QS3 A;  1JVY A;  3SER A;  3TCG A;  1OLA A;  1P1O A;  3SEY A;  4NWC A;  2HAU A;  4QF9 A;  1FW0 A;  2HEU A;  5HPQ A;  3IOT A;  4F39 A;  3LBS A;  3HPI A;  2R9J A;  4U21 A;  3MJN A;  1LAF E;  3SET A;  3TMG A;  1A8E A;  4THI A;  4RK9 A;  3EHU A;  4F29 A;  4U23 A;  2G93 A;  3TTL A;  4X1D A;  2H99 A;  4QFO A;  4YB5 A;  4FED A;  1B3L A;  2QL3 A;  3IOU A;  3VVF A;  4AB5 A;  2DYX A;  3B6W A;  5CC2 A;  3VVE A;  2DE2 A;  4BDR A;  3T9U A;  4ELR A;  3QIM A;  2Q2C A;  1TT1 A;  1ANF A;  4U22 A;  4GIZ A;  4ZS9 A;  3PMX A;  3TTR A;  4XIG Q;  4G4P A;  1DPE A;  2XXY A;  4G8M A;  1NNF A;  1FTO A;  1MDP 1;  4QFL A;  1NNT A;  4IO2 A;  2M8C A;  1DTZ A;  1YAE A;  2NXO A;  1DOT A;  2DWI A;  1B52 A;  3IJX B;  1OLC A;  4NF5 A;  2UXA A;  4RXL A;  2B3B A;  2X26 A;  5CBS A;  2G29 A;  2PVU A;  1Z7M E;  4LZ8 A;  4KYE A;  1B0H A;  3O28 A;  4KCC A;  2PBW A;  5DVF A;  3OEM A;  4LUB A;  2UYF A;  2Y7K A;  4H65 A;  3CR9 A;  3TCF A;  2DE4 A;  2V93 A;  4ND9 A;  5M2V A;  2XXX A;  1LFG A;  1B58 A;  3D4C A;  2E0S A;  5I59 B;  2V25 A;  5I57 A;  3E4R A;  1B7U A;  4GOT A;  4N6P A;  2F7C A;  1A7L A;  4R2F A;  4BDQ A;  3IAZ A;  2XD2 A;  1M5E A;  3T9X B;  1AMF A;  5JEI A;  1VR5 A;  1SYH A;  2DXR A;  4QRZ A;  2VD2 A;  3O2A A;  3LSX A;  1B3F A;  4RNS A;  1YPN A;  1POY 1;  1SW4 A;  1UIU A;  2XXI A;  4NF6 A;  3FJM A;  2RC7 A;  1FTK A;  2QS1 A;  1ZLQ A;  4ESX A;  3T96 B;  2V84 A;  3IB2 A;  2OWS A;  1QUJ A;  3I5O A;  4HTG A;  5CM6 A;  1Y4C A;  3OMB A;  3I3V A;  2XXH A;  1LB8 A;  5IKB A;  4G8H A;  3QYT A;  3T9V A;  2OK2 A;  4R2B A;  3G3K A;  3EQ1 A;  3KFM A;  1NL5 A;  3CG3 A;  3TCH A;  4QSC A;  3EHT A;  1B4H A;  3MAM A;  2Y7P A;  4JXI A;  4QFN A;  4NMY A;  3K0V A;  1ZMG A;  4YKI A;  4QHQ A;  2DWJ A;  1MXU A;  3ZS6 A;  1JQF A;  1IZ1 A;  4KR5 A;  1F9B A;  2ZYN A;  3C35 A;  2R6G E;  3TDJ A;  4ZE8 A;  3R6U A;  4KI0 E;  3MP8 A;  2VGQ A;  4DDD A;  1USY H;  1BKA A;  3H6U A;  2Q88 A;  4Z0I A;  2V3Q A;  3B7D A;  2ZYO A;  1PDA A;  4KFQ A;  3QUJ A;  3TEL A;  4P0G A;  1HSJ A;  3LC8 A;  1FQB A;  3IK6 B;  3L6G A;  3T22 A;  3GZG A;  1Q1K A;  3RN8 A;  1O7T A;  4WEP A;  5CMC A;  5AA2 B;  3K6V A;  2DE3 A;  4U2R A;  5ELV A;  2DVC A;  4U1Z A;  4F1U A;  1B1H A;  2DS9 A;  2YLN A;  3RQT A;  1QW0 A;  3GLB A;  3IOR A;  4MBP A;  3M8U A;  3SEX A;  1R9Q A;  1SD3 A;  2ALU A;  1B5H A;  1H45 A;  4TLM B;  2Y84 A;  4F22 A;  5K2X A;  1R6Z A;  1MY3 A;  1FTM A;  4R6K A;  3C34 A;  1LAG E;  4LQ5 A;  3H03 A;  2AL4 A;  2ZMB A;  1MXW A;  2RC8 A;  3F11 A;  4XKQ A;  1IXG A;  2LAO A;  3TUS A;  1JNF A;  4DCX A;  3S9L C;  1RYO A;  1N76 A;  3C32 A;  4LQ2 A;  5I2K B;  3EN3 A;  3AXF A;  5TP9 B;  1L5T A;  4GRK A;  4WXJ A;  4IO3 A;  2F34 A;  2HQ0 A;  3RT8 A;  1PB7 A;  3OD7 A;  4H0W A;  4XXU A;  4RA1 A;  2I49 A;  4NF4 A;  5H8H A;  1NH7 A;  3VVD A;  4NF8 A;  2GFE A;  3KZG A;  1QUK A;  2CMO A;  4ZEI A;  3H4Z A;  2O1M A;  3KG2 A;  1TFA A;  1IXH A;  3THI A;  3C33 A;  5H8N A;  3N6U A;  4Q5T A;  3U72 A;  1RYX A;  4QSD A;  4R9F A;  3TQL A;  4OXV A;  1GTK A;  1Y3N A;  1AIV A;  4EXL A;  4YB6 A;  3TYH A;  3U94 A;  1ZKB A;  4H6D A;  4Q30 B;  3TTK A;  2BJJ X;  2Z8E A;  4GWO A;  3S9E A;  2PT2 A;  3FVN A;  4IY6 A;  1YTV A;  3LSW A;  2H4I A;  4YU0 A;  3ZKL A;  3V83 A;  5AA4 B;  4R9G A;  4BDN A;  4DLD A;  2F6P A;  3MZB A;  3VLV A;  2O51 A;  2THI A;  1ELJ A;  3C31 A;  1UTH B;  3PMW A;  1YCJ A;  3GXA A;  4MF3 A;  4GLI A;  1QVS A;  2D21 A;  4F3G A;  3FVO A;  1B46 A;  5TPA A;  3RPW A;  4POX A;  1USY E;  4NF5 B;  2I3W A;  3SDF A;  4X9T A;  4G77 A;  1IXC A;  2GHA A;  1MQG A;  4FJP A;  4H67 A;  3U93 A;  2DP8 A;  3M3K A;  3DP6 A;  1OVT A;  4EQ9 A;  3H6T A;  1NH8 A;  1H3D A;  1EZ9 A;  3PUV E;  5DYH A;  3G3G A;  3HST A;  3UA8 A;  5CI5 A;  1LAX A;  4G68 A;  1MPD A;  2GHB A;  3R26 A;  1II5 A;  3KN7 A;  1MY4 A;  4NE4 A;  5I57 B;  2DXY A;  4IO4 A;  2I4B A;  1P1U A;  5JTY B;  3CSG A;  3Q25 A;  4C0R A;  3PGF A;  2HCA A;  2Z8D A;  2B65 A;  2O1L A;  5J1D A;  4O3A A;  5B70 A;  2Y7W A;  3MP6 A;  1B9J A;  1QKA A;  1SYI A;  3VXB A;  1B32 A;  1POT A;  1A40 A;  3FXQ A;  5DVI A;  3TTM A;  2ONR A;  4ELO A;  3IJO B;  1ZIU A;  2HZK A;  1IEJ A;  1QKB A;  4DXB A;  3RT6 B;  2QS2 A;  2H9B A;  2XX8 A;  3UP9 A;  3PPQ A;  1MY2 A;  2X7P A;  3N6T A;  3O6I A;  4I1D A;  4LON B;  3CFL A;  3VE1 B;  2DQV A;  4F19 A;  1LST A;  1DMB A;  4F1V A;  4K3F A;  2OWT A;  4YAH X;  5KDT A;  1IQ7 A;  4OMB A;  4OZ9 A;  4H8J A;  1WDN A;  3E3K A;  1MRP A;  1WVJ A;  3O97 A;  3OO6 A;  3TAJ A;  1JW4 A;  4O3C A;  3PUZ E;  3DP8 A;  4LZ7 A;  4O3B A;  5F1Q A;  1NKX A;  3U1O A;  1MY0 A;  1AOV A;  2QPQ A;  2NOO A;  3K01 A;  5I2N B;  1RKM A;  5IAI A;  3K6U A;  3PUX E;  3O6G A;  4ECF A;  3MVZ A;  2XXQ A;  1I6A A;  1IXI A;  2DSF A;  5H8F A;  4IY5 A;  3WAE A;  1D9V A;  1JW1 A;  1S9T A;  5HM4 B;  3VXC A;  2DVZ A;  2I0B A;  5H8Q A;  2NUV A;  1IUD A;  3OO7 A;  5I56 A;  5FHM A;  4YZZ A;  2XXT A;  4FEB A;  4IGR A;  3IOW A;  1Y1M A;  1GR2 A;  4OWD A;  1IIT A;  1B5J A;  2ZXT A;  3UN6 A;  3A3U A;  2O68 A;  4ZED A;  3G3J A;  4N13 A;  2DWA A;  4IB2 A;  1EZO A;  5FTH A;  1NFT A;  3O29 A;  4E0X A;  4EF1 A;  5FHO A;  2VHA A;  4OET A;  3FVK A;  3W9W A;  3RLF E;  1ZJL A;  2Q8J A;  3MW0 A;  1ZTY A;  2I3V A;  4G2Z A;  3S9M C;  1TFD A;  3K6X A;  1MQJ A;  3V89 B;  2D5W A;  4ELP A;  3K1P A;  3FVG A;  4BDM A;  5DEX A;  4QFP A;  1B4Z A;  4PFU A;  5H8H B;  3KOS A;  4PP0 A;  2Z22 A;  1UQW A;  5ISU A;  4OHN A;  2QMW A;  2XX7 A;  1JEV A;  3G3H A;  3RGY A;  1B6H A;  2YJP A;  4NED A;  1PC3 A;  4JWY A;  1P1N A;  3VV5 A;  5H8N B;  4GQO A;  1UTB A;  3OSQ A;  4YMB A;  4ISU A;  3UK4 A;  4HS7 A;  1I69 A;  3EF7 A;  3FXU A;  3PV0 E;  4FIM A;  1AL3 A;  5BUU A;  3Q27 A;  5TU0 A;  1FQA A;  3IO4 A;  5F7V A;  1EZP A;  1VFD A;  1VFE A;  3K00 A;  4DCY A;  5I58 B;  1XS5 A;  2RC9 A;  3IB1 A;  2OZZ A;  3FV2 A;  1US5 A;  2F8D A;  4FAT A;  5L8D A;  2KLF A;  4RYA A;  1TWY A;  3VLU A;  1XOC A;  3V8X B;  3IX1 A;  2FYI A;  3T66 A;  1CB6 A;  2A5S A;  1LLS A;  1QJM A;  2OJT A;  2ABH A;  2PYY A;  4X1B A;  5L9M A;  1MQH A;  1B3G A;  4G8N A;  3PUW E;  4YMA A;  3E9X A;  3OEN A;  5I59 A;  2H5Y A;  2F7A A;  5CMM A;  4GXA A;  3PD8 A;  1URS A;  4AB6 A;  3W15 C;  3Q26 A;  1Y3Q A;  2F6G A;  5K2Y A;  3E13 X;  1PBP A;  1P99 A;  1MS7 A;  3FJ7 A;  4EQB A;  4I9D A;  4BLA A;  3CRB A;  4H8I A;  4GL8 A;  2RCB A;  4NTL A;  4YB7 A;  1EU8 A;  3MC2 A;  3W9V A;  1D9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...