3G7WA

Islet amyloid polypeptide (iapp or amylin) residues 1 to 22 fused to maltose binding protein
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
393
structure length
393
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAKCNTATCATQRLANFLVHSSNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein, hormone
molecule keywords Maltose-binding periplasmic protein, Islet amyloid polypepti
publication title Atomic structures of IAPP (amylin) fusions suggest a mechanism for fibrillation and the role of insulin in the process
pubmed doi rcsb
source organism Escherichia coli
total genus 123
structure length 393
sequence length 393
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g7wA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g7wA01
3O6IA 1LSTA 2I58A 4QFPA 1MDP1 4H0WA 1POTA 5FTIA 4TLMB 3VXCA 2UVGA 1T0KA 1SW4A 4RYAA 2ONSA 3N6UA 3K6UA 5KDTA 3PMWA 2O1LA 5L9SA 4FECA 3IOWA 4PP0A 1D9YA 2Y7RA 4XTCQ 1B3EA 3PPOA 3UGWA 5AA2D 2PBWA 1MPCA 2UXAA 3TQLA 3H03A 2HZKA 2OBGA 3TKDA 1B40A 1VFDA 2ONKE 1FTKA 4KYSA 1ANFA 3MZ1A 1MQIA 1MY4A 4RPNA 4IO2A 3IJXB 1POY1 4C1TA 1AL3A 5ISUA 1ZTYA 5FHNA 4OFOA 3JYRA 3PU5A 1GR2A 3UK4A 1JW5A 3IB0A 4OYVA 2F7CA 3I3VA 1O64A 3TTMA 3LBSA 2Y84A 5B70A 2ZMBA 1NNTA 4KQPA 3JZJA 1SYIA 1ELJA 4QFOA 3R26A 1URDA 3K6XA 1H76A 1USYH 1Y1ZA 3ZS6A 4G2ZA 1MDQA 2Y7PA 1TWYA 5B7DA 2UVJA 1XS5A 3KOSA 5CM6A 1Y3PA 3KZGA 4EXLA 2VHAA 2XXQA 1MQJA 1B5HA 1B4HA 1N0TA 3IL1B 2PYYA 3UIFA 3LSLA 4GWOA 4EXKA 4FAJA 4BDLA 4OESA 3MPLA 4N6PA 3H06B 3MWBA 2R6GE 3HPIA 4PFTA 4GFRA 4M1VA 3I6VA 2DXYA 2ZYMA 4ZDMA 4ZEIA 1XVYA 4G8MA 4HW8A 1USYE 4NF6B 3GZGA 3SKPA 2OJTA 1RYOA 2E1SA 3FVKA 5DVJA 4EQ7A 3ZSFA 1LFGA 1EZPA 3CG1A 1LCFA 1I6AA 2D21A 1B3HA 5H8NB 3PMXA 2NVUB 1DOTA 4NF6A 1Y3QA 2O1MA 3IB2A 2ESNA 3FUZA 4DXCA 4G4PA 2Z23A 4U23A 2DYXA 4OHNA 3PPRA 2RC8A 2XXYA 1DPEA 2RKMA 3PPQA 1XVXA 4TQUQ 1D9VA 4MFIA 3I5OA 4O3AA 3U92A 1B1HA 4OQOA 3VFJA 1MXVA 3U94A 1DMBA 4H6DA 2XXIA 1OVTA 3PPNA 2H98A 4KYEA 4IY6A 3RT8A 1NMUA 4ZEBA 1P1QA 3Q28A 4TLLB 4NE4A 3H3GA 1B58A 2X7PA 2F7BA 3CR9A 2UYEA 3KBRA 3LSWA 4NF5A 4BLAA 3E3KA 4G77A 4DLDA 4C1UA 4OENA 1KWHA 2PT1A 4ELQA 1UQWA 5ELVA 1A7LA 1H44A 1Y9UA 4F3BA 4ZECA 3D4GA 4OFLA 2ONRA 2XXTA 4R72A 4POXA 4PE5B 3CSGA 2Y7WA 4DDDA 1JEVA 3B6QA 2LAOA 5JK4A 2X7QA 4H8IA 3RT6B 3O6GA 3OEKA 3V89B 5FHMA 3EF7A 1MRPA 5DEXB 3EHUA 1MH3A 2HEUA 3ZKLA 2AL5A 4NEDA 4BDNA 1JVYA 5ICTA 1M5FA 2E0SA 3A3CA 4LONB 3C32A 5TU0A 3TDJA 4BDRA 4DZ1A 1JVXA 2FNCA 3KSXA 3PD8A 2GH9A 5H8QA 4R74A 3TYHA 1URGA 4F3SA 1H43A 2F5XA 4POWA 4IO4A 1B1XA 5I58B 2F6PA 4WKMA 1XT8A 2DWJA 2ZNUA 5IKBA 2RF1A 4JXIA 4TOZA 2GFEA 5F7VA 3DP8A 3PGFA 2H9BA 1OVBA 1LB9A 2F35A 4GQOA 4FIMA 1PB8A 1N76A 4GL0A 2Z8DA 3LC8A 3PUXE 1QKBA 1Y3NA 1BLFA 3MVZA 1DSNA 1UTHA 1A8FA 5FHOA 4LQ5A 1YPNA 3TTNA 2HFBA 3LSXA 3FASA 3O28A 1FW0A 3FVOA 3K00A 1MY1A 2Q88A 3U8QA 2QL3A 5L9OA 3TCFA 4R9FA 3TQWA 2A5TB 1IXGA 3TCHA 2H25A 5ITPA 2F97A 1IITA 1MXWA 3RTFB 1Y4CA 3IAZA 4LZ5A 3IO4A 5K2YA 3IORA 1DTZA 3Q26A 5FTHA 3T9VA 3K2DA 1N7WA 4G8NA 1DPPA 2THIA 2QS1A 4R73A 3TTLA 4YMBA 4NWCA 3IB1A 5H8HB 1NL5A 5AA3A 2BJJX 3BKIB 3FJ7A 3VXBA 1QUKA 1II5A 4KYDA 1I6BA 2QMXA 2Q89A 3IK6B 3OENA 1FQEA 3PD9A 3FJGA 1AIVA 3BBRA 3QK6A 4U22A 3CI8A 4WEPA 4U1ZA 2NXOA 1FTLA 4XKRA 4DCXA 1EH3A 2V25A 1F9BA 4I62A 5I59B 1BTJA 1ZJLA 3OO6A 2YPNA 2H4IA 3PUWE 3MZBA 5I56A 4F22A 2DOJA 2DS9A 5DVFA 5I59A 4XKPA 3KFMA 1S9TA 3FXQA 4ZEKA 2I6EA 1MY3A 4YKKA 1LFHA 1GGGA 2O68A 1JW1A 3SESA 1D4NA 5DYHA 4WXJA 3T93B 4AB5A 1CB6A 5TP9B 3RN8A 1N3WA 3OMBA 1B3LA 4QSEA 4ZZAA 4F29A 5H8FA 1MM7A 3RLFE 1MPBA 5DVIA 3H7MA 4LATA 2O6AA 5TP9A 3C34A 3W15C 3MUQA 4OERA 2YJPA 3SEVA 4ECFA 5CMKA 2GHAA 1LB8A 3MBPA 2ALUA 4OXVA 3TPAA 4DE8A 3C36A 2VD3A 3B6TA 3C35A 4ZE8A 3GLBA 5CBSA 1Y4TA 4P0GA 1FCKA 5TPAB 5M2VA 1VE4A 1FQFA 4MLQA 1B0HA 4YKIA 2QS2A 3OD7A 1S7YA 2KLFA 3TAJA 3SEXA 4NF4B 1BKAA 5ITOA 5IAIA 2Q8JA 5TPAA 4ELPA 3PV0E 2DSFA 3OO8A 3K0VA 3RY3A 4X9TA 3WAEA 2YLNA 2F78A 3KJ7A 2XX7A 3DLNA 3LUYA 4U21A 3VLVA 1B9JA 3C9HA 4Q8RA 4XKQA 3S2VA 4Z7EA 3H6WA 4G8HA 4DIGA 4GLIA 4IGRA 4DXUA 4G68C 4GRKA 1FQDA 3HV1A 4F18A 4L17A 2Y7KA 4N07A 5L9MA 1Z7ME 4P11A 1NNKA 4FEDA 4YICA 4ZS9A 1ZIUA 4EF1A 3IO6A 1UIVA 3S9EA 4JSOA 3OO7A 4I8CA 4MBPA 3KEIA 1IIWA 3QXMA 1FQAA 3CRBA 3TZAA 2O84X 4EQ9A 3EQ1A 1GVCA 2I3VA 1DTGA 2Z8FA 4QF9A 3R6UA 3WAFA 4NMYA 1R1NA 1B3FA 3HHFA 3USDA 5JTYB 3O97A 3A09A 1D3KA 4OWDA 3L6HA 3MQ9A 3N26A 3G3HA 4IO6A 1MQHA 3EPEA 4IO5A 4JDFA 4G68B 2GHBA 3MP6A 5JTYA 4YU0A 4RNSA 4GIZA 1N7XA 3PPPA 3CVGA 3H6UA 4H5GA 2P0SA 1M5BA 1I69A 1OLAA 3FXUA 5H8NA 2ZNTA 3G3FA 3MAMA 4PETA 1IXHA 2B3BA 4G68A 5AA1A 5BUUA 2ANJA 4BDQA 3U93A 1MG1A 3M3LA 3S4UA 1OQHA 4LVQA 3OOAA 1PDAA 1NNPA 2D3IA 3B6WA 4YB7A 4XXUA 1B7ZA 3EHTA 2REJA 4GXSB 5J1DA 5EHMA 4OFJA 1M5CA 4FEBA 3BFTA 1LAHE 1TFAA 4OVJA 3B7DA 4IB2A 4RK9A 1WVJA 2DWHA 1HSJA 2FA7A 1ZBMA 4OETA 4U1OA 1N84A 3O6HA 2I0BA 1J1NA 3T96B 1AH5A 1IZ1A 4DXBA 1NH8A 1QJMA 4QSCA 1MPDA 2NOOA 1BIYA 4LA9A 4YZZA 1EZOA 2IA4A 4R6HA 1LAXA 3FXRA 1SYHA 3IOUA 4Z0IA 4IO3A 4U4XA 4GD5A 4EF2A 1BP5A 4MH5A 2AIXA 1O7TA 3TCGA 4R75A 2W7YA 3EHSA 2G93A 3ONMA 1A54A 1IUDA 1OMPA 2REGA 1B5JA 1FQCA 3LR1A 2XD3A 4JSDA 3CFLA 4AQ4A 2NWJA 3F11A 5ICQA 4X1BA 5DEXA 1YTVA 2H5YA 1MY0A 3PUYE 4R9GA 1Y20A 4YKJA 2O7IA 1PC3A 4MF3A 2CZLA 1AOVA 1MS7A 1N04A 2DVZA 2AL4A 3SEUA 5I2NB 4NF8B 3CFZA 2DWAA 4H8JA 1LCTA 5AE4A 3RGYA 1B7HA 5I58A 2ZXTA 4IGTA 4PFUA 4KFQA 5I2NA 1LLSA 2CMOA 5HM4B 2VGQA 4EUOA 1PB9A 5CI5A 3K1PA 1UIUA 4KI0E 3IR1A 4OMBA 4JWXA 1B46A 3U72A 1N3XA 4PQJA 1OIBA 3DP6A 4H1XA 1SBPA 3QSLA 2XHDA 1QKAA 1GTKA 4F3GA 1GV8A 3MW0A 5HPQA 2V84A 2F36A 3QUFA 2DE4A 3MP1A 4YB6A 4R2BA 3S9LC 1XC1A 1PB7A 3OSQA 3VE1B 2UVHA 4UACA 2A5TA 3RPWA 3FVNA 1A40A 1IXIA 3PUVE 3D4CA 3Q27A 2DP8A 1B5IA 1MQGA 2M8CA 4X48A 4LQ2A 4PFWA 1I6QA 3M8UA 3C33A 1LBCA 1PEBA 1UTBB 4RK2A 3IJOB 4HCWA 2D5WA 1Z7NE 2PVUA 3JV9A 5H8HA 3M3FA 3SEYA 3SETA 4KD5A 2F34A 2HXWA 3RNNA 1TT1A 1EZ9A 1PBPA 2G29A 2VOZA 1UTBA 3ZKKA 4M4GA 5BWJA 4NWDA 2A5SA 3E13X 2I4BA 4R6YA 2RINA 1LAGE 3OSRA 3S9NC 4QHQA 5AA4B 3IOTA 3IOVA 2P1SA 1A55A 1NH7A 2DQVA 3ODBA 3V83A 2AYSA 3MVXA 1XHYA 3L6GA 1ZLQA 2XXPA 3UORA 2O7UA 5F1QA 5AA4A 2F8DA 1ZU0A 3R7XA 2X26A 2I3WA 3E4RA 3E9XA 3K6VA 4YMAA 1B7UA 3G3IA 2R71A 3K6WA 2QJEA 4IY5A 3OELA 1PBQA 5CMMA 1P99A 3MVYA 4N13A 1H45A 3G3KA 3G3JA 1LGBC 2XXHA 4Q30B 2HCAA 4GXAA 2FYIA 3SDFA 3Q29A 4XIGQ 1M5EA 4EQBA 3MPKA 2UYFA 3T9UA 4NTLA 3HCQA 3TTRA 3CSBA 3IX1A 2R9JA 3W9VA 4YKPA 4KHZE 1US4A 3OXNA 1IXCA 4GF8A 3K02A 1H3DA 5LOMA 1QUIA 4F19A 3O2AA 1XOCA 2XX9A 4E0XA 4ESXA 2QPQA 1ZKBA 4C0RA 4ONYA 1RKMA 1SW2A 5CRYA 4QSDA 1WDNA 3O66A 1VR5A 1O63A 3FVGA 3TODA 3ECRA 2DE3A 3SEWA 3DP4A 2XD2A 4NF4A 4E0WA 2O69A 4FE8A 3H6TA 3KJTA 1Q1KA 4ND9A 3ILUB 3N5LA 4I1DA 2OZZA 2NUVA 2Q2CA 2DE2A 1L5TA 1SW1A 1QVSA 1B05A 2OLBA 2OWTA 1QUJA 1JQFA 2PMSA 2F6GA 3VV5A 4FORA 3FGSA 3VVDA 3MVWA 3RUMA 3T9HB 3V8XB 3SERA 2Q2AA 4U2RA 2OWSA 4JBZA 1MM6A 2Z22A 1B4ZA 3KG2A 3W9WA 4K3FA 1JW4A 3TUSA 2RCAA 1URSA 3EN3A 2PT2A 3TFLA 1QULA 4H5FA 4OEUA 4OTEA 3KN7A 4ZE9A 4KCCA 1LFIA 4F2QA 4KCDA 4EDPA 5JEIA 2VD2A 3CG3A 3HHGA 1IQ7A 3O9PA 4HCYA 4QRZA 3TELA 1B2HA 5A5XB 2XXVA 4RPOA 3UA8A 4F1VA 4MLVA 3C4MA 3OEMA 3PUZE 1WODA 2XX8A 4RY1A 4WEDA 4RXLA 1LAFE 3Q25A 4IO7A 3TMGA 2WKYA 5A5XA 3K4UA 3M3KA 3N94A 4JB7A 1B32A 3CIJA 1TFDA 5DTBA 1SW5A 1P1NA 1NFTA 2Y7IA 5DT6A 4NF5B 5KCJB 1TXFA 4R2FA 4ISUA 4ELRA 2ZYKA 3U1OA 1IEJA 3MP8A 3THIA 3UP9A 1NKXA 4UA8A 3MC2A 2H99A 2V3QA 1S50A 5I84A 2ZYNA 2Q9TA 1MH4A 3VDFA 2QRYA 4FJPA 4QFNA 5KCJA 2DVCA 4KR5A 4GL8A 1FTMA 2I4CA 4THIA 3HN0A 3KGCA 1P1UA 4ELOA 3T66A 1VFEA 1CE2A 1HSEA 2F7AA 1JNFA 3FJMA 3HO7A 4F1YA 3P7IA 4P0IA 5EHSA 3FV1A 4YAHX 1R9QA 1A8EA 3UN6A 3MZ9A 2OCUA 2QSXA 1MXUA 2XXRA 4F2OA 2VP1A 1Q35A 4ZEDA 3K01A 1FQBA 5H8QB 3FZVA 2IEEA 4QFLA 3BFUA 1AMFA 2HQ0A 4O3BA 1US5A 3FIRA 4I9DA 2OK2A 3ILTB 1SD3A 4ESWA 3QYTA 5H8SA 4F1UA 2HAVA 2DXRA 3T22A 1B52A 2DWIA 1NNFA 4ZZEA 4OEVA 3CFXA 3TEPA 2O51A 5I2KB 4JWYA 3GBBA 4QFKA 1Y1MA 2V3UA 1FTOA 1UTHB 4DCYA 4NF8A 2RC7A 2I0CA 1B0LA 1EU8A 3VLWA 4F31B 5I2KA 3AXFA 4O3CA 3RQTA 2I49A 5CMBA 2RC9A 3VVFA 2PX1A 3N6TA 3T9XB 3FD3A 4GVOA 1SDXA 1MQDA 2ABHA 1YCJA 2B3FA 5CBRA 1OLCA 1RYXA 2QS4A 1VSOA 4LUBA 4GOTA 4RJZA 1SVXB 4RA1A 4LZ8A 3V5AA 3KSJA 3RTWB 1P1OA 1B3GA 1LBBA 5AA2B 5EYFA 1JETA 3FATA 3OO9A 3H6VA 4X1DA 3FV2A 2UVIA 3QIMA 1MXXA 4XKNA 5I57B 4LZ7A 4YB5A 3QAXA 5AA2A 3VLUA 2XXUA 5KZTA 4PFYA 3PMVA 3DELB 1OQGA 4LP2B 1A99A 2I48A 4JWOA 5I57A 4FATA 1ZMGA 3QUJA 5K2XA 3K1NA 4OZ9A 1R6ZA 4BDOA 3VVEA 3TTKA 4HTGA 1MXZA 1ATGA 2GRVA 4H65A 3HSTA 1HSLA 4F3PA 2Z8EA 1MXYA 1MY2A 2XXWA 2QS3A 4BDMA 2V93A 1FTJA 4AB6A 1SI0A 1YAEA 2XXXA 5I56B 3O29A 3H4ZA 1QW0A 4H67A 3A3UA 1SQYA 4Q5TA 5L8DA 3MJNA 1B6HA 4HS7A 2HAUA 2ZYOA 4R6KA 3G3GA 2P2AA 3S9MC 3GBAA 3K1MA 1SI1A 1JEUA 3DM0A 5CMCA 4KPTA 5CC2A 3G7WA 4U4SA 3KN3A 1P1WA 5H8FB 4Q0CA 3C31A 4F39A 2B65A 2ZNSA 2HZLA 3KOTA 2RCBA 3KN8A 3GXAA 1R9LA 4ZEFA 5KDTB 1B51A 5HBCA 2V3TA 1M5DA 2QMWA 3LSFB
chains in the Genus database with same CATH superfamily
3O6IA 2GQ1A 1LSTA 2I58A 1EYIA 1MDP1 4H0WA 1POTA 4QFPA 5FTIA 4TLMB 3VXCA 2UVGA 1T0KA 1SW4A 4RYAA 2ONSA 3N6UA 3K6UA 5KDTA 4PBHA 3PMWA 5ET6A 2O1LA 5L9SA 4FECA 3IOWA 4PP0A 1D9YA 2FBPA 1IMDA 2Y7RA 4XTCQ 1B3EA 2L5VA 3PPOA 3UGWA 5AA2D 2PBWA 1MPCA 2UXAA 3TQLA 3H03A 2HZKA 2OBGA 3TKDA 5I5PA 1B40A 1VFDA 2ONKE 1FTKA 2OX3A 4KYSA 1ANFA 3MZ1A 1MQIA 1MY4A 1KZ8A 5IZ1A 4HE1A 4RPNA 3KC0A 4IO2A 5EQ8A 3IJXB 1POY1 4C1TA 4O7MA 1AL3A 5ISUA 1ZTYA 5FHNA 4OFOA 3JYRA 4X8RA 3PU5A 1GR2A 3UK4A 3D1RA 1JW5A 3IB0A 1FPJA 4OYVA 2F7CA 3I3VA 1O64A 3TTMA 3LBSA 2Y84A 5B70A 2ZMBA 1NNTA 3T1BA 4KQPA 3JZJA 1SYIA 1ELJA 3GYYA 4QFOA 3R26A 1URDA 3K6XA 4X04A 1H76A 2WX9A 1USYH 1Y1ZA 3ZS6A 4P1LA 4PGNA 4G2ZA 1MDQA 2Y7PA 1TWYA 1XI6A 5B7DA 2UVJA 1XS5A 3KOSA 5CM6A 1Y3PA 3KZGA 4EXLA 2VHAA 2XXQA 1MQJA 1B5HA 1B4HA 4NN3A 1N0TA 3IL1B 2PYYA 3UIFA 1LBWA 3LSLA 4GWOA 4EXKA 4FAJA 2PFYA 4BDLA 4N4UA 4OESA 3B8BA 3MPLA 4N6PA 3H06B 1IMFA 3MWBA 2R6GE 3HPIA 4PFTA 4GFRA 4M1VA 3I6VA 2DXYA 4GWWA 2ZYMA 4ZDMA 4O7IA 4ZEIA 1XVYA 4G8MA 4HW8A 1USYE 4NF6B 3GZGA 3SKPA 2OJTA 1RYOA 2E1SA 3FVKA 5DVJA 4EQ7A 3ZSFA 1LFGA 1EZPA 3CG1A 1LCFA 5I7IA 1I6AA 2D21A 1B3HA 1RDYA 4PGPA 5H8NB 3PMXA 2NVUB 1DOTA 4NF6A 4NGUA 1Y3QA 2O1MA 3IB2A 2ESNA 3FUZA 4DXCA 4G4PA 2Z23A 4U23A 1NUWA 2DYXA 4OHNA 3PPRA 2RC8A 2XXYA 1DPEA 2VPNA 2RKMA 3PPQA 1XVXA 2KQZA 4TQUQ 1D9VA 4MFIA 2WYPA 4O3AA 1FBEA 3I5OA 3U92A 1B1HA 4OQOA 3VFJA 4DI3D 1MXVA 3U94A 1DMBA 4H6DA 2XXIA 4QXDA 1OVTA 3PPNA 2H98A 4KYEA 4IY6A 4O8MA 3RT8A 1NMUA 2FIEA 4ZEBA 2Y5LA 1P1QA 3Q28A 4TLLB 4NE4A 3H3GA 1B58A 2X7PA 5IM2A 4PBQA 2F7BA 3CR9A 2UYEA 3KBRA 3LSWA 4NF5A 4BLAA 3E3KA 2F3DA 4G77A 4DLDA 4C1UA 4OENA 2WBBA 1KWHA 1G0IA 2B4MA 2PT1A 4ELQA 3IFAA 1UQWA 3LUZA 5ELVA 4DI4B 4PAFA 1A7LA 1FPKA 1H44A 1Y9UA 4F3BA 4ZECA 3D4GA 4OFLA 2ONRA 2XXTA 4R72A 5IZ3B 4POXA 4PE5B 3LV0A 3CSGA 2Y7WA 4DDDA 1JEVA 3B6QA 2LAOA 5JK4A 2X7QA 4H8IA 4GWYA 3RT6B 3O6GA 4GWZA 3KBZA 3OEKA 5ESYA 3V89B 5FHMA 3EF7A 1MRPA 5DEXB 1NUYA 5IZ3A 3EHUA 1MH3A 2HEUA 3ZKLA 2AL5A 4NEDA 4BDNA 1JVYA 5ICTA 4JVDA 1M5FA 3FXBA 2E0SA 3A3CA 4LONB 3C32A 5TU0A 3TDJA 4BDRA 4UABA 4DZ1A 1JVXA 2FNCA 3KSXA 3PD8A 2GH9A 5H8QA 4R74A 3TYHA 3ISPA 1URGA 1DK4A 4F3SA 1H43A 4MMPA 4GWSA 2F5XA 4POWA 4IO4A 1B1XA 5I58B 2F6PA 1KA0A 1K9YA 4WKMA 1XT8A 3PTYA 2DWJA 2ZNUA 4OVTA 5IKBA 2RF1A 2WBDA 4JXIA 1FTAA 4TOZA 2GFEA 1DCUA 5F7VA 4JVIA 3DP8A 3PGFA 2H9BA 1OVBA 1LB9A 2F35A 4GQOA 4FIMA 1PB8A 1N76A 4GL0A 2Z8DA 3LC8A 3PUXE 1QKBA 4P56A 1Y3NA 1BLFA 3MVZA 1DSNA 1UTHA 1A8FA 5FHOA 4LQ5A 1YPNA 1JP4A 3TTNA 2HFBA 3LSXA 3FASA 3BIGA 3O28A 1FW0A 3FVOA 5I3SA 3K00A 1MY1A 2Q88A 3U8QA 2QL3A 5L9OA 3TCFA 4R9FA 3TQWA 2A5TB 1IXGA 3TCHA 3B50A 2H25A 5ITPA 2F97A 1IITA 1MXWA 3RTFB 1Y4CA 4P8BA 3IAZA 4LZ5A 2XXKA 3IO4A 5K2YA 3IORA 1DTZA 4LN5A 3Q26A 5FTHA 3T9VA 3K2DA 1N7WA 4G8NA 1DPPA 4MNIA 2THIA 2QS1A 4R73A 3TTLA 4YMBA 4NWCA 3IB1A 5H8HB 1NL5A 5AA3A 1CNQA 2BJJX 3BKIB 3FJ7A 3VXBA 1QUKA 1II5A 4KYDA 4NF0A 1I6BA 2QMXA 1NV3A 2Q89A 1NUXA 3IK6B 3OENA 2HXRA 4N8YA 2R8TA 3NOHA 1FQEA 3PD9A 3FJGA 1FSAA 1AIVA 1NUZA 3BBRA 3QK6A 4U22A 1DBZA 3CI8A 4WEPA 1FPFA 4U1ZA 2NXOA 1FTLA 4XKRA 4DCXA 2V4CA 1EH3A 4N8GA 2V25A 1F9BA 4I62A 5I59B 4GX6A 1BTJA 4PF8A 1ZJLA 3OO6A 1EYJA 2YPNA 2H4IA 3PUWE 3MZBA 5I56A 4F22A 2DOJA 2DS9A 5DVFA 1SPIA 5I59A 4XKPA 3QMFA 4GX3A 3KFMA 1S9TA 3FXQA 4OVQA 4ZEKA 2I6EA 1MY3A 4YKKA 1LFHA 1GGGA 2O68A 1JW1A 3SESA 1D4NA 5DYHA 4WXJA 3T93B 4MIJA 4AB5A 2FVZA 1CB6A 1FPIA 5TP9B 3RN8A 1N3WA 1LBXA 3OMBA 5EQAA 1B3LA 4MEVA 4QSEA 4ZZAA 4F29A 5H8FA 1MM7A 3RLFE 1MPBA 5DVIA 3H7MA 4LATA 2O6AA 2WEFA 5TP9A 3C34A 3W15C 3MUQA 4OERA 2YJPA 3SEVA 4ECFA 5CMKA 2GHAA 1LB8A 3MBPA 2Y5KA 2ALUA 4OXVA 3TPAA 4DE8A 3C36A 2VD3A 3B6TA 3C35A 5ET5A 4ZE8A 3GLBA 5CBSA 1Y4TA 4P0GA 1FCKA 5TPAB 4PC9A 1FPDA 5M2VA 1VE4A 1FQFA 4NQ8A 4MLQA 1B0HA 4YKIA 2QS2A 3OD7A 1S7YA 2KLFA 3TAJA 3SEXA 4NF4B 1BKAA 5ITOA 2XWOA 5IAIA 2Q8JA 1LEVA 5TPAA 4ELPA 3PV0E 1RDXA 2DSFA 3OO8A 3K0VA 3RY3A 4X9TA 3WAEA 1FJ6A 1NV1A 2YLNA 3ROJA 1KA1A 2F78A 3KJ7A 2XX7A 3DLNA 3LUYA 4U21A 3VLVA 2P3NA 1B9JA 2QVVA 3C9HA 4H45A 1YZ0A 4Q8RA 4XKQA 3S2VA 4OA4A 2HHMA 4Z7EA 3H6WA 4G8HA 4DIGA 4GLIA 4IGRA 4DXUA 4G68C 4GRKA 1FQDA 3HV1A 4F18A 4L17A 2XWVA 2Y7KA 4N07A 5L9MA 1Z7ME 4P11A 1NNKA 4FEDA 4YICA 4ZS9A 1ZIUA 4EF1A 3IO6A 2WYKA 1UIVA 2VT5A 3S9EA 4JSOA 3OO7A 4I8CA 4MBPA 3EKIA 3KEIA 1IIWA 3QXMA 1FQAA 3CRBA 3TZAA 2O84X 2PFZA 4EQ9A 3EQ1A 1GVCA 2I3VA 1DTGA 2Z8FA 1NV2A 4QF9A 3R6UA 4P47A 5FBPA 1LBZA 3WAFA 4NMYA 1R1NA 1B3FA 3HHFA 4MHFA 3USDA 5JTYB 3O97A 3A09A 1D3KA 2Q74A 4OWDA 3L6HA 3MQ9A 3SZPA 3N26A 3G3HA 4IO6A 1MQHA 3EPEA 4IO5A 4JDFA 4G68B 2GHBA 3MP6A 5JTYA 4YU0A 4RNSA 4GIZA 1N7XA 3PPPA 3CVGA 3H6UA 2FIXA 4H5GA 2P0SA 1M5BA 1I69A 1OLAA 3FXUA 5H8NA 2ZNTA 3G3FA 3MAMA 4PETA 1IXHA 2B3BA 4G68A 5AA1A 2JJKA 5BUUA 4FBPA 2ANJA 4BDQA 3U93A 1NV7A 1MG1A 3M3LA 3S4UA 4LVQA 1OQHA 3OOAA 1PDAA 1NNPA 2D3IA 3B6WA 4YB7A 4XXUA 1B7ZA 3EHTA 2REJA 4GXSB 5J1DA 5EHMA 4OFJA 1M5CA 4FEBA 3BFTA 1LAHE 1TFAA 4OVJA 3B7DA 4IB2A 4RK9A 1WVJA 1NV4A 2DWHA 1HSJA 2FA7A 1ZBMA 4OETA 4U1OA 4GWXA 1N84A 3O6HA 2I0BA 2CZKA 1J1NA 2PCRA 3T96B 1AH5A 1IZ1A 4DXBA 1NH8A 1AWBA 1QJMA 2CEXA 1FPLA 4QSCA 1MPDA 2NOOA 1BIYA 4LA9A 4YZZA 5LDZA 4OVPA 1EZOA 2IA4A 4R6HA 4PAKA 1LAXA 3FXRA 1SYHA 3IOUA 4Z0IA 4IO3A 4U4XA 4GD5A 1BP5A 4EF2A 4MH5A 2AIXA 1O7TA 3TCGA 4R75A 2W7YA 3EHSA 4NG7A 2G93A 3ONMA 2F3BA 1A54A 1IUDA 1OMPA 2REGA 1B5JA 1FQCA 3LR1A 2XD3A 1NV6A 4JSDA 3CFLA 1IMAA 4AQ4A 2NWJA 4N6DA 4N91A 3F11A 2QVUA 5ICQA 4X1BA 5DEXA 5J16A 1YTVA 2H5YA 1MY0A 3PUYE 4R9GA 1Y20A 4YKJA 2O7IA 1PC3A 4MF3A 2CZLA 1AOVA 1MS7A 1N04A 2DVZA 2AL4A 3SEUA 5I2NB 4I3YA 4NF8B 3CFZA 2DWAA 4H8JA 1LCTA 5AE4A 3RGYA 1B7HA 5I58A 2ZXTA 5A5LA 4IGTA 4PFUA 4I40A 4KFQA 5I2NA 2VPOA 1LLSA 2CMOA 5HM4B 2VGQA 4EUOA 1PB9A 5CI5A 3K1PA 1UIUA 4KI0E 4P3LA 3IR1A 4JVCA 4OMBA 4JWXA 1B46A 3T0JA 4N6KA 3U72A 1N3XA 4PQJA 1OIBA 3DP6A 4H1XA 1SBPA 3QSLA 2XHDA 1QKAA 1GTKA 2XWIA 4F3GA 4MCOA 1GV8A 3MW0A 4AS4A 5HPQA 2V84A 2F36A 4HE2A 3QUFA 2DE4A 1FBGA 3MP1A 4YB6A 4R2BA 3S9LC 1XC1A 1PB7A 3OSQA 3VE1B 2UVHA 4UACA 5ET8A 2A5TA 3RPWA 3FVNA 1A40A 1IXIA 3PUVE 4NHBA 3D4CA 3Q27A 2DP8A 1B5IA 1MQGA 2M8CA 1FBPA 4X48A 4LQ2A 4PFWA 1I6QA 3M8UA 3C33A 1LBCA 3E78A 1PEBA 1UTBB 1FRPA 4RK2A 3IJOB 4HCWA 2D5WA 1FBHA 1Z7NE 2PVUA 3JV9A 5H8HA 3M3FA 3SEYA 3SETA 4KD5A 2Q8MA 2F34A 2HXWA 2P3VA 2ZZWA 3RNNA 1TT1A 1IMBA 1EZ9A 1PBPA 2G29A 2VOZA 1UTBA 3ZKKA 2B4LA 4M4GA 5BWJA 2ZZVA 4NWDA 2A5SA 3E13X 2I4BA 4R6YA 2RINA 1IMCA 1LAGE 3OSRA 3S9NC 4QHQA 5AA4B 3IOTA 3IOVA 2P1SA 1A55A 1NH7A 2DQVA 3ODBA 3V83A 2AYSA 3MVXA 3RPLB 1XHYA 3L6GA 1ZLQA 2XXPA 3UORA 2O7UA 4N17A 1FBFA 5F1QA 5AA4A 2F8DA 2HPGA 1LBYA 1ZU0A 3R7XA 2X26A 4PE3A 2I3WA 4NAPA 1NV5A 3E4RA 3E9XA 3K6VA 4YMAA 1B7UA 3G3IA 2R71A 3K6WA 2QJEA 4IY5A 3OELA 4OVSA 1PBQA 3RPLA 5CMMA 1P99A 3MVYA 4N13A 1H45A 3G3KA 3G3JA 2DDKA 1LGBC 2XXHA 4Q30B 2HCAA 4GXAA 2FYIA 3SDFA 3Q29A 1YXIA 4XIGQ 1M5EA 1D9QA 4EQBA 3MPKA 2UYFA 3T9UA 4NTLA 3HCQA 3TTRA 3CSBA 3IX1A 2R9JA 3W9VA 4YKPA 4KHZE 1US4A 1Q9DA 3OXNA 1IXCA 4GF8A 3K02A 4PF6A 1H3DA 5LOMA 4MNCA 1QUIA 4F19A 3O2AA 3MSTA 1XOCA 2XX9A 4E0XA 4ESXA 1LBVA 2QPQA 1ZKBA 5T3JA 4C0RA 4ONYA 4PCDA 1RKMA 1SW2A 5CRYA 4QSDA 1WDNA 3O66A 1VR5A 1O63A 3FVGA 3TODA 3ECRA 2DE3A 3SEWA 3DP4A 2XD2A 4NF4A 4E0WA 2QFLA 2O69A 2CEYA 4IR8A 4FE8A 4P1EA 3H6TA 3KJTA 4N15A 1Q1KA 4ND9A 3ILUB 3N5LA 4PDHA 4KXPA 4I1DA 2OZZA 2NUVA 2Q2CA 2DE2A 1L5TA 1SW1A 1QVSA 1B05A 2OLBA 2OWTA 1QUJA 1JQFA 2PMSA 2F6GA 3VV5A 4FORA 2FHYA 3FGSA 3VVDA 3MVWA 3RUMA 3T9HB 3V8XB 3SERA 2Q2AA 4PTKA 4U2RA 2OWSA 4JBZA 1MM6A 2Z22A 1B4ZA 3KG2A 3W9WA 4K3FA 2XWKA 1JW4A 3TUSA 2RCAA 1URSA 3EN3A 2PT2A 5DW8A 3TFLA 1QULA 4H5FA 4OEUA 4OTEA 3KN7A 4ZE9A 4KCCA 1LFIA 4F2QA 4KCDA 4EDPA 5JEIA 2VD2A 3CG3A 3HHGA 1IQ7A 3O9PA 4HCYA 4QRZA 3TELA 1B2HA 5F24A 5A5XB 2XXVA 4RPOA 3UA8A 4HXVA 1FBCA 4F1VA 4MLVA 3C4MA 3OEMA 3PUZE 1WODA 4AS5A 2XX8A 4RY1A 4WEDA 4G61A 1INPA 4RXLA 1LAFE 4XF5A 3Q25A 4IO7A 3TMGA 2WKYA 1YYZA 4PFIA 5A5XA 1G0HA 3K4UA 3M3KA 4XFEA 3N94A 3U65A 3FBPA 4JB7A 1B32A 3CIJA 1TFDA 5DTBA 1SW5A 1P1NA 1NFTA 2Y7IA 5DT6A 4NF5B 5KCJB 1TXFA 4R2FA 4ISUA 5EYHA 4ELRA 2ZYKA 3U1OA 1IEJA 3MP8A 3THIA 3UP9A 1NKXA 4UA8A 3MC2A 2H99A 2V3QA 1S50A 3RYDA 5I84A 2ZYNA 2Q9TA 1MH4A 5ET7A 3VDFA 2QRYA 1FBDA 4FJPA 4QFNA 5KCJA 2DVCA 4KR5A 4GL8A 1FTMA 2I4CA 4THIA 3HN0A 3KGCA 1P1UA 4ELOA 5IZZA 3T66A 4OVRA 1VFEA 1CE2A 1HSEA 4PFBA 2F7AA 4I3EA 1JNFA 3HFUA 3FJMA 3HO7A 4F1YA 3P7IA 4P0IA 5EHSA 4MNPA 3FV1A 4YAHX 1R9QA 1A8EA 3UN6A 3MZ9A 2OCUA 2QSXA 1MXUA 2XXRA 4F2OA 2VP1A 1Q35A 4ZEDA 3K01A 1FQBA 2MKZA 5LTCA 4OANA 5H8QB 3FZVA 1NI9A 2IEEA 1FJ9A 4QFLA 4PDDA 3BFUA 1AMFA 2HQ0A 4O3BA 1US5A 5EQ7A 3FIRA 4I9DA 2OK2A 3ILTB 1SD3A 4ESWA 5EQ9A 4PFRA 3QYTA 4HE0A 5H8SA 4F1UA 2HAVA 2DXRA 3T22A 4MAGA 1B52A 2DWIA 1NNFA 4ZZEA 4OEVA 3CFXA 3TEPA 2O51A 5I2KB 4JWYA 1RDZA 3GBBA 4QFKA 1Y1MA 2V3UA 2XA5A 1FTOA 1UTHB 4DCYA 4NF8A 2RC7A 2I0CA 1B0LA 1EU8A 3VLWA 1QGXA 4F31B 5I2KA 3AXFA 4O3CA 3RQTA 2I49A 5CMBA 2RC9A 3VVFA 2PX1A 3N6TA 3T9XB 3FD3A 4GVOA 1SDXA 1MQDA 4XEQA 2ABHA 1YCJA 2B3FA 5CBRA 4MX6A 1OLCA 1RYXA 2QS4A 4PAIA 1VSOA 4LUBA 4GOTA 4RJZA 1SVXB 2ZZXA 4RA1A 4LZ8A 3V5AA 3KSJA 4O94A 3RTWB 1P1OA 1B3GA 1LBBA 5AA2B 1IMEA 5EYFA 4GX4A 1JETA 4QBAA 2BJIA 3FATA 4GBWA 3OO9A 3H6VA 4X1DA 3FV2A 2UVIA 3QIMA 1MXXA 4XKNA 1FPEA 5I57B 4LZ7A 4YB5A 3QAXA 5AA2A 3KC1A 5IGAA 3VLUA 3BIHA 2QVRA 4GBVA 2CZHA 2XXUA 5KZTA 4PFYA 3PMVA 3DELB 1OQGA 4LP2B 1A99A 2I48A 4JWOA 5I57A 5EYGA 4FATA 1ZMGA 3QUJA 3K1NA 4OZ9A 5K2XA 1R6ZA 3MYUA 4BDOA 3VVEA 3TTKA 4HTGA 4NX1A 1NV0A 4H65A 1MXZA 1ATGA 2GRVA 3CHGA 3HSTA 1HSLA 4F3PA 2Z8EA 1MXYA 1MY2A 2XXWA 2QS3A 4BDMA 2V93A 1FTJA 4AB6A 1SI0A 1YAEA 2XXXA 5I56B 3O29A 2KR0A 2CZIA 3H4ZA 1QW0A 4H67A 1EYKA 3A3UA 1SQYA 4Q5TA 5L8DA 3MJNA 1B6HA 4HS7A 2HAUA 2OWZA 2ZYOA 3IFCA 4N81A 4R6KA 1FPGA 3E79A 3G3GA 2P2AA 3S9MC 3GBAA 1BK4A 4H46A 3K1MA 1SI1A 1JEUA 3DM0A 5CMCA 4KPTA 4P9KA 5CC2A 3G7WA 4U4SA 3KN3A 1P1WA 4MJOA 5H8FB 4Q0CA 3C31A 4F39A 2B65A 2ZNSA 2HZLA 3KOTA 2RCBA 3KN8A 1VDWA 3A29A 3GXAA 1FPBA 1R9LA 4GWUA 4ZEFA 5KDTB 1B51A 5HBCA 2V3TA 1M5DA 1K9ZA 2QMWA 3LSFB
chains in the Genus database with same CATH topology
3O6IA 1LSTA 2I58A 4QFPA 1MDP1 4H0WA 1POTA 5FTIA 4TLMB 3VXCA 2UVGA 1T0KA 1SW4A 4RYAA 2ONSA 3N6UA 3K6UA 5KDTA 3PMWA 2O1LA 5L9SA 4FECA 3IOWA 4PP0A 1D9YA 2Y7RA 4XTCQ 1B3EA 3PPOA 3UGWA 5AA2D 2PBWA 1MPCA 2UXAA 3TQLA 3H03A 2HZKA 2OBGA 3TKDA 1B40A 1VFDA 2ONKE 1FTKA 4KYSA 1ANFA 3MZ1A 1MQIA 1MY4A 4RPNA 4IO2A 3IJXB 1POY1 4C1TA 1AL3A 5ISUA 1ZTYA 5FHNA 4OFOA 3JYRA 3PU5A 1GR2A 3UK4A 1JW5A 3IB0A 4OYVA 2F7CA 3I3VA 1O64A 3TTMA 3LBSA 2Y84A 5B70A 2ZMBA 1NNTA 4KQPA 3JZJA 1SYIA 1ELJA 4QFOA 3R26A 1URDA 3K6XA 1H76A 1USYH 1Y1ZA 3ZS6A 4G2ZA 1MDQA 2Y7PA 1TWYA 5B7DA 2UVJA 1XS5A 3KOSA 5CM6A 1Y3PA 3KZGA 4EXLA 2VHAA 2XXQA 1MQJA 1B5HA 1B4HA 1N0TA 3IL1B 2PYYA 3UIFA 3LSLA 4GWOA 4EXKA 4FAJA 4BDLA 4OESA 3MPLA 4N6PA 3H06B 3MWBA 2R6GE 3HPIA 4PFTA 4GFRA 4M1VA 3I6VA 2DXYA 2ZYMA 4ZDMA 4ZEIA 1XVYA 4G8MA 4HW8A 1USYE 4NF6B 3GZGA 3SKPA 2OJTA 1RYOA 2E1SA 3FVKA 5DVJA 4EQ7A 3ZSFA 1LFGA 1EZPA 3CG1A 1LCFA 1I6AA 2D21A 1B3HA 5H8NB 3PMXA 2NVUB 1DOTA 4NF6A 1Y3QA 2O1MA 3IB2A 2ESNA 3FUZA 4DXCA 4G4PA 2Z23A 4U23A 2DYXA 4OHNA 3PPRA 2RC8A 2XXYA 1DPEA 2RKMA 3PPQA 1XVXA 4TQUQ 1D9VA 4MFIA 3I5OA 4O3AA 3U92A 1B1HA 4OQOA 3VFJA 1MXVA 3U94A 1DMBA 4H6DA 2XXIA 1OVTA 3PPNA 2H98A 4KYEA 4IY6A 3RT8A 1NMUA 4ZEBA 1P1QA 3Q28A 4TLLB 4NE4A 3H3GA 1B58A 2X7PA 2F7BA 3CR9A 2UYEA 3KBRA 3LSWA 4NF5A 4BLAA 3E3KA 4G77A 4DLDA 4C1UA 4OENA 1KWHA 2PT1A 4ELQA 1UQWA 5ELVA 1A7LA 1H44A 1Y9UA 4F3BA 4ZECA 3D4GA 4OFLA 2ONRA 2XXTA 4R72A 4POXA 4PE5B 3CSGA 2Y7WA 4DDDA 1JEVA 3B6QA 2LAOA 5JK4A 2X7QA 4H8IA 3RT6B 3O6GA 3OEKA 3V89B 5FHMA 3EF7A 1MRPA 5DEXB 3EHUA 1MH3A 2HEUA 3ZKLA 2AL5A 4NEDA 4BDNA 1JVYA 5ICTA 1M5FA 2E0SA 3A3CA 4LONB 3C32A 5TU0A 3TDJA 4BDRA 4DZ1A 1JVXA 2FNCA 3KSXA 3PD8A 2GH9A 5H8QA 4R74A 3TYHA 1URGA 4F3SA 1H43A 2F5XA 4POWA 4IO4A 1B1XA 5I58B 2F6PA 4WKMA 1XT8A 2DWJA 2ZNUA 5IKBA 2RF1A 4JXIA 4TOZA 2GFEA 5F7VA 3DP8A 3PGFA 2H9BA 1OVBA 1LB9A 2F35A 4GQOA 4FIMA 1PB8A 1N76A 4GL0A 2Z8DA 3LC8A 3PUXE 1QKBA 1Y3NA 1BLFA 3MVZA 1DSNA 1UTHA 1A8FA 5FHOA 4LQ5A 1YPNA 3TTNA 2HFBA 3LSXA 3FASA 3O28A 1FW0A 3FVOA 3K00A 1MY1A 2Q88A 3U8QA 2QL3A 5L9OA 3TCFA 4R9FA 3TQWA 2A5TB 1IXGA 3TCHA 2H25A 5ITPA 2F97A 1IITA 1MXWA 3RTFB 1Y4CA 3IAZA 4LZ5A 3IO4A 5K2YA 3IORA 1DTZA 3Q26A 5FTHA 3T9VA 3K2DA 1N7WA 4G8NA 1DPPA 2THIA 2QS1A 4R73A 3TTLA 4YMBA 4NWCA 3IB1A 5H8HB 1NL5A 5AA3A 2BJJX 3BKIB 3FJ7A 3VXBA 1QUKA 1II5A 4KYDA 1I6BA 2QMXA 2Q89A 3IK6B 3OENA 1FQEA 3PD9A 3FJGA 1AIVA 3BBRA 3QK6A 4U22A 3CI8A 4WEPA 4U1ZA 2NXOA 1FTLA 4XKRA 4DCXA 1EH3A 2V25A 1F9BA 4I62A 5I59B 1BTJA 1ZJLA 3OO6A 2YPNA 2H4IA 3PUWE 3MZBA 5I56A 4F22A 2DOJA 2DS9A 5DVFA 5I59A 4XKPA 3KFMA 1S9TA 3FXQA 4ZEKA 2I6EA 1MY3A 4YKKA 1LFHA 1GGGA 2O68A 1JW1A 3SESA 1D4NA 5DYHA 4WXJA 3T93B 4AB5A 1CB6A 5TP9B 3RN8A 1N3WA 3OMBA 1B3LA 4QSEA 4ZZAA 4F29A 5H8FA 1MM7A 3RLFE 1MPBA 5DVIA 3H7MA 4LATA 2O6AA 5TP9A 3C34A 3W15C 3MUQA 4OERA 2YJPA 3SEVA 4ECFA 5CMKA 2GHAA 1LB8A 3MBPA 2ALUA 4OXVA 3TPAA 4DE8A 3C36A 2VD3A 3B6TA 3C35A 4ZE8A 3GLBA 5CBSA 1Y4TA 4P0GA 1FCKA 5TPAB 5M2VA 1VE4A 1FQFA 4MLQA 1B0HA 4YKIA 2QS2A 3OD7A 1S7YA 2KLFA 3TAJA 3SEXA 4NF4B 1BKAA 5ITOA 5IAIA 2Q8JA 5TPAA 4ELPA 3PV0E 2DSFA 3OO8A 3K0VA 3RY3A 4X9TA 3WAEA 2YLNA 2F78A 3KJ7A 2XX7A 3DLNA 3LUYA 4U21A 3VLVA 1B9JA 3C9HA 4Q8RA 4XKQA 3S2VA 4Z7EA 3H6WA 4G8HA 4DIGA 4GLIA 4IGRA 4DXUA 4G68C 4GRKA 1FQDA 3HV1A 4F18A 4L17A 2Y7KA 4N07A 5L9MA 1Z7ME 4P11A 1NNKA 4FEDA 4YICA 4ZS9A 1ZIUA 4EF1A 3IO6A 1UIVA 3S9EA 4JSOA 3OO7A 4I8CA 4MBPA 3KEIA 1IIWA 3QXMA 1FQAA 3CRBA 3TZAA 2O84X 4EQ9A 3EQ1A 1GVCA 2I3VA 1DTGA 2Z8FA 4QF9A 3R6UA 3WAFA 4NMYA 1R1NA 1B3FA 3HHFA 3USDA 5JTYB 3O97A 3A09A 1D3KA 4OWDA 3L6HA 3MQ9A 3N26A 3G3HA 4IO6A 1MQHA 3EPEA 4IO5A 4JDFA 4G68B 2GHBA 3MP6A 5JTYA 4YU0A 4RNSA 4GIZA 1N7XA 3PPPA 3CVGA 3H6UA 4H5GA 2P0SA 1M5BA 1I69A 1OLAA 3FXUA 5H8NA 2ZNTA 3G3FA 3MAMA 4PETA 1IXHA 2B3BA 4G68A 5AA1A 5BUUA 2ANJA 4BDQA 3U93A 1MG1A 3M3LA 3S4UA 1OQHA 4LVQA 3OOAA 1PDAA 1NNPA 2D3IA 3B6WA 4YB7A 4XXUA 1B7ZA 3EHTA 2REJA 4GXSB 5J1DA 5EHMA 4OFJA 1M5CA 4FEBA 3BFTA 1LAHE 1TFAA 4OVJA 3B7DA 4IB2A 4RK9A 1WVJA 2DWHA 1HSJA 2FA7A 1ZBMA 4OETA 4U1OA 1N84A 3O6HA 2I0BA 1J1NA 3T96B 1AH5A 1IZ1A 4DXBA 1NH8A 1QJMA 4QSCA 1MPDA 2NOOA 1BIYA 4LA9A 4YZZA 1EZOA 2IA4A 4R6HA 1LAXA 3FXRA 1SYHA 3IOUA 4Z0IA 4IO3A 4U4XA 4GD5A 4EF2A 1BP5A 4MH5A 2AIXA 1O7TA 3TCGA 4R75A 2W7YA 3EHSA 2G93A 3ONMA 1A54A 1IUDA 1OMPA 2REGA 1B5JA 1FQCA 3LR1A 2XD3A 4JSDA 3CFLA 4AQ4A 2NWJA 3F11A 5ICQA 4X1BA 5DEXA 1YTVA 2H5YA 1MY0A 3PUYE 4R9GA 1Y20A 4YKJA 2O7IA 1PC3A 4MF3A 2CZLA 1AOVA 1MS7A 1N04A 2DVZA 2AL4A 3SEUA 5I2NB 4NF8B 3CFZA 2DWAA 4H8JA 1LCTA 5AE4A 3RGYA 1B7HA 5I58A 2ZXTA 4IGTA 4PFUA 4KFQA 5I2NA 1LLSA 2CMOA 5HM4B 2VGQA 4EUOA 1PB9A 5CI5A 3K1PA 1UIUA 4KI0E 3IR1A 4OMBA 4JWXA 1B46A 3U72A 1N3XA 4PQJA 1OIBA 3DP6A 4H1XA 1SBPA 3QSLA 2XHDA 1QKAA 1GTKA 4F3GA 1GV8A 3MW0A 5HPQA 2V84A 2F36A 3QUFA 2DE4A 3MP1A 4YB6A 4R2BA 3S9LC 1XC1A 1PB7A 3OSQA 3VE1B 2UVHA 4UACA 2A5TA 3RPWA 3FVNA 1A40A 1IXIA 3PUVE 3D4CA 3Q27A 2DP8A 1B5IA 1MQGA 2M8CA 4X48A 4LQ2A 4PFWA 1I6QA 3M8UA 3C33A 1LBCA 1PEBA 1UTBB 4RK2A 3IJOB 4HCWA 2D5WA 1Z7NE 2PVUA 3JV9A 5H8HA 3M3FA 3SEYA 3SETA 4KD5A 2F34A 2HXWA 3RNNA 1TT1A 1EZ9A 1PBPA 2G29A 2VOZA 1UTBA 3ZKKA 4M4GA 5BWJA 4NWDA 2A5SA 3E13X 2I4BA 4R6YA 2RINA 1LAGE 3OSRA 3S9NC 4QHQA 5AA4B 3IOTA 3IOVA 2P1SA 1A55A 1NH7A 2DQVA 3ODBA 3V83A 2AYSA 3MVXA 1XHYA 3L6GA 1ZLQA 2XXPA 3UORA 2O7UA 5F1QA 5AA4A 2F8DA 1ZU0A 3R7XA 2X26A 2I3WA 3E4RA 3E9XA 3K6VA 4YMAA 1B7UA 3G3IA 2R71A 3K6WA 2QJEA 4IY5A 3OELA 1PBQA 5CMMA 1P99A 3MVYA 4N13A 1H45A 3G3KA 3G3JA 1LGBC 2XXHA 4Q30B 2HCAA 4GXAA 2FYIA 3SDFA 3Q29A 4XIGQ 1M5EA 4EQBA 3MPKA 2UYFA 3T9UA 4NTLA 3HCQA 3TTRA 3CSBA 3IX1A 2R9JA 3W9VA 4YKPA 4KHZE 1US4A 3OXNA 1IXCA 4GF8A 3K02A 1H3DA 5LOMA 1QUIA 4F19A 3O2AA 1XOCA 2XX9A 4E0XA 4ESXA 2QPQA 1ZKBA 4C0RA 4ONYA 1RKMA 1SW2A 5CRYA 4QSDA 1WDNA 3O66A 1VR5A 1O63A 3FVGA 3TODA 3ECRA 2DE3A 3SEWA 3DP4A 2XD2A 4NF4A 4E0WA 2O69A 4FE8A 3H6TA 3KJTA 1Q1KA 4ND9A 3ILUB 3N5LA 4I1DA 2OZZA 2NUVA 2Q2CA 2DE2A 1L5TA 1SW1A 1QVSA 1B05A 2OLBA 2OWTA 1QUJA 1JQFA 2PMSA 2F6GA 3VV5A 4FORA 3FGSA 3VVDA 3MVWA 3RUMA 3T9HB 3V8XB 3SERA 2Q2AA 4U2RA 2OWSA 4JBZA 1MM6A 2Z22A 1B4ZA 3KG2A 3W9WA 4K3FA 1JW4A 3TUSA 2RCAA 1URSA 3EN3A 2PT2A 3TFLA 1QULA 4H5FA 4OEUA 4OTEA 3KN7A 4ZE9A 4KCCA 1LFIA 4F2QA 4KCDA 4EDPA 5JEIA 2VD2A 3CG3A 3HHGA 1IQ7A 3O9PA 4HCYA 4QRZA 3TELA 1B2HA 5A5XB 2XXVA 4RPOA 3UA8A 4F1VA 4MLVA 3C4MA 3OEMA 3PUZE 1WODA 2XX8A 4RY1A 4WEDA 4RXLA 1LAFE 3Q25A 4IO7A 3TMGA 2WKYA 5A5XA 3K4UA 3M3KA 3N94A 4JB7A 1B32A 3CIJA 1TFDA 5DTBA 1SW5A 1P1NA 1NFTA 2Y7IA 5DT6A 4NF5B 5KCJB 1TXFA 4R2FA 4ISUA 4ELRA 2ZYKA 3U1OA 1IEJA 3MP8A 3THIA 3UP9A 1NKXA 4UA8A 3MC2A 2H99A 2V3QA 1S50A 5I84A 2ZYNA 2Q9TA 1MH4A 3VDFA 2QRYA 4FJPA 4QFNA 5KCJA 2DVCA 4KR5A 4GL8A 1FTMA 2I4CA 4THIA 3HN0A 3KGCA 1P1UA 4ELOA 3T66A 1VFEA 1CE2A 1HSEA 2F7AA 1JNFA 3FJMA 3HO7A 4F1YA 3P7IA 4P0IA 5EHSA 3FV1A 4YAHX 1R9QA 1A8EA 3UN6A 3MZ9A 2OCUA 2QSXA 1MXUA 2XXRA 4F2OA 2VP1A 1Q35A 4ZEDA 3K01A 1FQBA 5H8QB 3FZVA 2IEEA 4QFLA 3BFUA 1AMFA 2HQ0A 4O3BA 1US5A 3FIRA 4I9DA 2OK2A 3ILTB 1SD3A 4ESWA 3QYTA 5H8SA 4F1UA 2HAVA 2DXRA 3T22A 1B52A 2DWIA 1NNFA 4ZZEA 4OEVA 3CFXA 3TEPA 2O51A 5I2KB 4JWYA 3GBBA 4QFKA 1Y1MA 2V3UA 1FTOA 1UTHB 4DCYA 4NF8A 2RC7A 2I0CA 1B0LA 1EU8A 3VLWA 4F31B 5I2KA 3AXFA 4O3CA 3RQTA 2I49A 5CMBA 2RC9A 3VVFA 2PX1A 3N6TA 3T9XB 3FD3A 4GVOA 1SDXA 1MQDA 2ABHA 1YCJA 2B3FA 5CBRA 1OLCA 1RYXA 2QS4A 1VSOA 4LUBA 4GOTA 4RJZA 1SVXB 4RA1A 4LZ8A 3V5AA 3KSJA 3RTWB 1P1OA 1B3GA 1LBBA 5AA2B 5EYFA 1JETA 3FATA 3OO9A 3H6VA 4X1DA 3FV2A 2UVIA 3QIMA 1MXXA 4XKNA 5I57B 4LZ7A 4YB5A 3QAXA 5AA2A 3VLUA 2XXUA 5KZTA 4PFYA 3PMVA 3DELB 1OQGA 4LP2B 1A99A 2I48A 4JWOA 5I57A 4FATA 1ZMGA 3QUJA 5K2XA 3K1NA 4OZ9A 1R6ZA 4BDOA 3VVEA 3TTKA 4HTGA 1MXZA 1ATGA 2GRVA 4H65A 3HSTA 1HSLA 4F3PA 2Z8EA 1MXYA 1MY2A 2XXWA 2QS3A 4BDMA 2V93A 1FTJA 4AB6A 1SI0A 1YAEA 2XXXA 5I56B 3O29A 3H4ZA 1QW0A 4H67A 3A3UA 1SQYA 4Q5TA 5L8DA 3MJNA 1B6HA 4HS7A 2HAUA 2ZYOA 4R6KA 3G3GA 2P2AA 3S9MC 3GBAA 3K1MA 1SI1A 1JEUA 3DM0A 5CMCA 4KPTA 5CC2A 3G7WA 4U4SA 3KN3A 1P1WA 5H8FB 4Q0CA 3C31A 4F39A 2B65A 2ZNSA 2HZLA 3KOTA 2RCBA 3KN8A 3GXAA 1R9LA 4ZEFA 5KDTB 1B51A 5HBCA 2V3TA 1M5DA 2QMWA 3LSFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O6I A;  1LST A;  2I58 A;  4QFP A;  1MDP 1;  4H0W A;  1POT A;  5FTI A;  4TLM B;  3VXC A;  2UVG A;  1T0K A;  1SW4 A;  4RYA A;  2ONS A;  3N6U A;  3K6U A;  5KDT A;  3PMW A;  2O1L A;  5L9S A;  4FEC A;  3IOW A;  4PP0 A;  1D9Y A;  2Y7R A;  4XTC Q;  1B3E A;  3PPO A;  3UGW A;  5AA2 D;  2PBW A;  1MPC A;  2UXA A;  3TQL A;  3H03 A;  2HZK A;  2OBG A;  3TKD A;  1B40 A;  1VFD A;  2ONK E;  1FTK A;  4KYS A;  1ANF A;  3MZ1 A;  1MQI A;  1MY4 A;  4RPN A;  4IO2 A;  3IJX B;  1POY 1;  4C1T A;  1AL3 A;  5ISU A;  1ZTY A;  5FHN A;  4OFO A;  3JYR A;  3PU5 A;  1GR2 A;  3UK4 A;  1JW5 A;  3IB0 A;  4OYV A;  2F7C A;  3I3V A;  1O64 A;  3TTM A;  3LBS A;  2Y84 A;  5B70 A;  2ZMB A;  1NNT A;  4KQP A;  3JZJ A;  1SYI A;  1ELJ A;  4QFO A;  3R26 A;  1URD A;  3K6X A;  1H76 A;  1USY H;  1Y1Z A;  3ZS6 A;  4G2Z A;  1MDQ A;  2Y7P A;  1TWY A;  5B7D A;  2UVJ A;  1XS5 A;  3KOS A;  5CM6 A;  1Y3P A;  3KZG A;  4EXL A;  2VHA A;  2XXQ A;  1MQJ A;  1B5H A;  1B4H A;  1N0T A;  3IL1 B;  2PYY A;  3UIF A;  3LSL A;  4GWO A;  4EXK A;  4FAJ A;  4BDL A;  4OES A;  3MPL A;  4N6P A;  3H06 B;  3MWB A;  2R6G E;  3HPI A;  4PFT A;  4GFR A;  4M1V A;  3I6V A;  2DXY A;  2ZYM A;  4ZDM A;  4ZEI A;  1XVY A;  4G8M A;  4HW8 A;  1USY E;  4NF6 B;  3GZG A;  3SKP A;  2OJT A;  1RYO A;  2E1S A;  3FVK A;  5DVJ A;  4EQ7 A;  3ZSF A;  1LFG A;  1EZP A;  3CG1 A;  1LCF A;  1I6A A;  2D21 A;  1B3H A;  5H8N B;  3PMX A;  2NVU B;  1DOT A;  4NF6 A;  1Y3Q A;  2O1M A;  3IB2 A;  2ESN A;  3FUZ A;  4DXC A;  4G4P A;  2Z23 A;  4U23 A;  2DYX A;  4OHN A;  3PPR A;  2RC8 A;  2XXY A;  1DPE A;  2RKM A;  3PPQ A;  1XVX A;  4TQU Q;  1D9V A;  4MFI A;  3I5O A;  4O3A A;  3U92 A;  1B1H A;  4OQO A;  3VFJ A;  1MXV A;  3U94 A;  1DMB A;  4H6D A;  2XXI A;  1OVT A;  3PPN A;  2H98 A;  4KYE A;  4IY6 A;  3RT8 A;  1NMU A;  4ZEB A;  1P1Q A;  3Q28 A;  4TLL B;  4NE4 A;  3H3G A;  1B58 A;  2X7P A;  2F7B A;  3CR9 A;  2UYE A;  3KBR A;  3LSW A;  4NF5 A;  4BLA A;  3E3K A;  4G77 A;  4DLD A;  4C1U A;  4OEN A;  1KWH A;  2PT1 A;  4ELQ A;  1UQW A;  5ELV A;  1A7L A;  1H44 A;  1Y9U A;  4F3B A;  4ZEC A;  3D4G A;  4OFL A;  2ONR A;  2XXT A;  4R72 A;  4POX A;  4PE5 B;  3CSG A;  2Y7W A;  4DDD A;  1JEV A;  3B6Q A;  2LAO A;  5JK4 A;  2X7Q A;  4H8I A;  3RT6 B;  3O6G A;  3OEK A;  3V89 B;  5FHM A;  3EF7 A;  1MRP A;  5DEX B;  3EHU A;  1MH3 A;  2HEU A;  3ZKL A;  2AL5 A;  4NED A;  4BDN A;  1JVY A;  5ICT A;  1M5F A;  2E0S A;  3A3C A;  4LON B;  3C32 A;  5TU0 A;  3TDJ A;  4BDR A;  4DZ1 A;  1JVX A;  2FNC A;  3KSX A;  3PD8 A;  2GH9 A;  5H8Q A;  4R74 A;  3TYH A;  1URG A;  4F3S A;  1H43 A;  2F5X A;  4POW A;  4IO4 A;  1B1X A;  5I58 B;  2F6P A;  4WKM A;  1XT8 A;  2DWJ A;  2ZNU A;  5IKB A;  2RF1 A;  4JXI A;  4TOZ A;  2GFE A;  5F7V A;  3DP8 A;  3PGF A;  2H9B A;  1OVB A;  1LB9 A;  2F35 A;  4GQO A;  4FIM A;  1PB8 A;  1N76 A;  4GL0 A;  2Z8D A;  3LC8 A;  3PUX E;  1QKB A;  1Y3N A;  1BLF A;  3MVZ A;  1DSN A;  1UTH A;  1A8F A;  5FHO A;  4LQ5 A;  1YPN A;  3TTN A;  2HFB A;  3LSX A;  3FAS A;  3O28 A;  1FW0 A;  3FVO A;  3K00 A;  1MY1 A;  2Q88 A;  3U8Q A;  2QL3 A;  5L9O A;  3TCF A;  4R9F A;  3TQW A;  2A5T B;  1IXG A;  3TCH A;  2H25 A;  5ITP A;  2F97 A;  1IIT A;  1MXW A;  3RTF B;  1Y4C A;  3IAZ A;  4LZ5 A;  3IO4 A;  5K2Y A;  3IOR A;  1DTZ A;  3Q26 A;  5FTH A;  3T9V A;  3K2D A;  1N7W A;  4G8N A;  1DPP A;  2THI A;  2QS1 A;  4R73 A;  3TTL A;  4YMB A;  4NWC A;  3IB1 A;  5H8H B;  1NL5 A;  5AA3 A;  2BJJ X;  3BKI B;  3FJ7 A;  3VXB A;  1QUK A;  1II5 A;  4KYD A;  1I6B A;  2QMX A;  2Q89 A;  3IK6 B;  3OEN A;  1FQE A;  3PD9 A;  3FJG A;  1AIV A;  3BBR A;  3QK6 A;  4U22 A;  3CI8 A;  4WEP A;  4U1Z A;  2NXO A;  1FTL A;  4XKR A;  4DCX A;  1EH3 A;  2V25 A;  1F9B A;  4I62 A;  5I59 B;  1BTJ A;  1ZJL A;  3OO6 A;  2YPN A;  2H4I A;  3PUW E;  3MZB A;  5I56 A;  4F22 A;  2DOJ A;  2DS9 A;  5DVF A;  5I59 A;  4XKP A;  3KFM A;  1S9T A;  3FXQ A;  4ZEK A;  2I6E A;  1MY3 A;  4YKK A;  1LFH A;  1GGG A;  2O68 A;  1JW1 A;  3SES A;  1D4N A;  5DYH A;  4WXJ A;  3T93 B;  4AB5 A;  1CB6 A;  5TP9 B;  3RN8 A;  1N3W A;  3OMB A;  1B3L A;  4QSE A;  4ZZA A;  4F29 A;  5H8F A;  1MM7 A;  3RLF E;  1MPB A;  5DVI A;  3H7M A;  4LAT A;  2O6A A;  5TP9 A;  3C34 A;  3W15 C;  3MUQ A;  4OER A;  2YJP A;  3SEV A;  4ECF A;  5CMK A;  2GHA A;  1LB8 A;  3MBP A;  2ALU A;  4OXV A;  3TPA A;  4DE8 A;  3C36 A;  2VD3 A;  3B6T A;  3C35 A;  4ZE8 A;  3GLB A;  5CBS A;  1Y4T A;  4P0G A;  1FCK A;  5TPA B;  5M2V A;  1VE4 A;  1FQF A;  4MLQ A;  1B0H A;  4YKI A;  2QS2 A;  3OD7 A;  1S7Y A;  2KLF A;  3TAJ A;  3SEX A;  4NF4 B;  1BKA A;  5ITO A;  5IAI A;  2Q8J A;  5TPA A;  4ELP A;  3PV0 E;  2DSF A;  3OO8 A;  3K0V A;  3RY3 A;  4X9T A;  3WAE A;  2YLN A;  2F78 A;  3KJ7 A;  2XX7 A;  3DLN A;  3LUY A;  4U21 A;  3VLV A;  1B9J A;  3C9H A;  4Q8R A;  4XKQ A;  3S2V A;  4Z7E A;  3H6W A;  4G8H A;  4DIG A;  4GLI A;  4IGR A;  4DXU A;  4G68 C;  4GRK A;  1FQD A;  3HV1 A;  4F18 A;  4L17 A;  2Y7K A;  4N07 A;  5L9M A;  1Z7M E;  4P11 A;  1NNK A;  4FED A;  4YIC A;  4ZS9 A;  1ZIU A;  4EF1 A;  3IO6 A;  1UIV A;  3S9E A;  4JSO A;  3OO7 A;  4I8C A;  4MBP A;  3KEI A;  1IIW A;  3QXM A;  1FQA A;  3CRB A;  3TZA A;  2O84 X;  4EQ9 A;  3EQ1 A;  1GVC A;  2I3V A;  1DTG A;  2Z8F A;  4QF9 A;  3R6U A;  3WAF A;  4NMY A;  1R1N A;  1B3F A;  3HHF A;  3USD A;  5JTY B;  3O97 A;  3A09 A;  1D3K A;  4OWD A;  3L6H A;  3MQ9 A;  3N26 A;  3G3H A;  4IO6 A;  1MQH A;  3EPE A;  4IO5 A;  4JDF A;  4G68 B;  2GHB A;  3MP6 A;  5JTY A;  4YU0 A;  4RNS A;  4GIZ A;  1N7X A;  3PPP A;  3CVG A;  3H6U A;  4H5G A;  2P0S A;  1M5B A;  1I69 A;  1OLA A;  3FXU A;  5H8N A;  2ZNT A;  3G3F A;  3MAM A;  4PET A;  1IXH A;  2B3B A;  4G68 A;  5AA1 A;  5BUU A;  2ANJ A;  4BDQ A;  3U93 A;  1MG1 A;  3M3L A;  3S4U A;  1OQH A;  4LVQ A;  3OOA A;  1PDA A;  1NNP A;  2D3I A;  3B6W A;  4YB7 A;  4XXU A;  1B7Z A;  3EHT A;  2REJ A;  4GXS B;  5J1D A;  5EHM A;  4OFJ A;  1M5C A;  4FEB A;  3BFT A;  1LAH E;  1TFA A;  4OVJ A;  3B7D A;  4IB2 A;  4RK9 A;  1WVJ A;  2DWH A;  1HSJ A;  2FA7 A;  1ZBM A;  4OET A;  4U1O A;  1N84 A;  3O6H A;  2I0B A;  1J1N A;  3T96 B;  1AH5 A;  1IZ1 A;  4DXB A;  1NH8 A;  1QJM A;  4QSC A;  1MPD A;  2NOO A;  1BIY A;  4LA9 A;  4YZZ A;  1EZO A;  2IA4 A;  4R6H A;  1LAX A;  3FXR A;  1SYH A;  3IOU A;  4Z0I A;  4IO3 A;  4U4X A;  4GD5 A;  4EF2 A;  1BP5 A;  4MH5 A;  2AIX A;  1O7T A;  3TCG A;  4R75 A;  2W7Y A;  3EHS A;  2G93 A;  3ONM A;  1A54 A;  1IUD A;  1OMP A;  2REG A;  1B5J A;  1FQC A;  3LR1 A;  2XD3 A;  4JSD A;  3CFL A;  4AQ4 A;  2NWJ A;  3F11 A;  5ICQ A;  4X1B A;  5DEX A;  1YTV A;  2H5Y A;  1MY0 A;  3PUY E;  4R9G A;  1Y20 A;  4YKJ A;  2O7I A;  1PC3 A;  4MF3 A;  2CZL A;  1AOV A;  1MS7 A;  1N04 A;  2DVZ A;  2AL4 A;  3SEU A;  5I2N B;  4NF8 B;  3CFZ A;  2DWA A;  4H8J A;  1LCT A;  5AE4 A;  3RGY A;  1B7H A;  5I58 A;  2ZXT A;  4IGT A;  4PFU A;  4KFQ A;  5I2N A;  1LLS A;  2CMO A;  5HM4 B;  2VGQ A;  4EUO A;  1PB9 A;  5CI5 A;  3K1P A;  1UIU A;  4KI0 E;  3IR1 A;  4OMB A;  4JWX A;  1B46 A;  3U72 A;  1N3X A;  4PQJ A;  1OIB A;  3DP6 A;  4H1X A;  1SBP A;  3QSL A;  2XHD A;  1QKA A;  1GTK A;  4F3G A;  1GV8 A;  3MW0 A;  5HPQ A;  2V84 A;  2F36 A;  3QUF A;  2DE4 A;  3MP1 A;  4YB6 A;  4R2B A;  3S9L C;  1XC1 A;  1PB7 A;  3OSQ A;  3VE1 B;  2UVH A;  4UAC A;  2A5T A;  3RPW A;  3FVN A;  1A40 A;  1IXI A;  3PUV E;  3D4C A;  3Q27 A;  2DP8 A;  1B5I A;  1MQG A;  2M8C A;  4X48 A;  4LQ2 A;  4PFW A;  1I6Q A;  3M8U A;  3C33 A;  1LBC A;  1PEB A;  1UTB B;  4RK2 A;  3IJO B;  4HCW A;  2D5W A;  1Z7N E;  2PVU A;  3JV9 A;  5H8H A;  3M3F A;  3SEY A;  3SET A;  4KD5 A;  2F34 A;  2HXW A;  3RNN A;  1TT1 A;  1EZ9 A;  1PBP A;  2G29 A;  2VOZ A;  1UTB A;  3ZKK A;  4M4G A;  5BWJ A;  4NWD A;  2A5S A;  3E13 X;  2I4B A;  4R6Y A;  2RIN A;  1LAG E;  3OSR A;  3S9N C;  4QHQ A;  5AA4 B;  3IOT A;  3IOV A;  2P1S A;  1A55 A;  1NH7 A;  2DQV A;  3ODB A;  3V83 A;  2AYS A;  3MVX A;  1XHY A;  3L6G A;  1ZLQ A;  2XXP A;  3UOR A;  2O7U A;  5F1Q A;  5AA4 A;  2F8D A;  1ZU0 A;  3R7X A;  2X26 A;  2I3W A;  3E4R A;  3E9X A;  3K6V A;  4YMA A;  1B7U A;  3G3I A;  2R71 A;  3K6W A;  2QJE A;  4IY5 A;  3OEL A;  1PBQ A;  5CMM A;  1P99 A;  3MVY A;  4N13 A;  1H45 A;  3G3K A;  3G3J A;  1LGB C;  2XXH A;  4Q30 B;  2HCA A;  4GXA A;  2FYI A;  3SDF A;  3Q29 A;  4XIG Q;  1M5E A;  4EQB A;  3MPK A;  2UYF A;  3T9U A;  4NTL A;  3HCQ A;  3TTR A;  3CSB A;  3IX1 A;  2R9J A;  3W9V A;  4YKP A;  4KHZ E;  1US4 A;  3OXN A;  1IXC A;  4GF8 A;  3K02 A;  1H3D A;  5LOM A;  1QUI A;  4F19 A;  3O2A A;  1XOC A;  2XX9 A;  4E0X A;  4ESX A;  2QPQ A;  1ZKB A;  4C0R A;  4ONY A;  1RKM A;  1SW2 A;  5CRY A;  4QSD A;  1WDN A;  3O66 A;  1VR5 A;  1O63 A;  3FVG A;  3TOD A;  3ECR A;  2DE3 A;  3SEW A;  3DP4 A;  2XD2 A;  4NF4 A;  4E0W A;  2O69 A;  4FE8 A;  3H6T A;  3KJT A;  1Q1K A;  4ND9 A;  3ILU B;  3N5L A;  4I1D A;  2OZZ A;  2NUV A;  2Q2C A;  2DE2 A;  1L5T A;  1SW1 A;  1QVS A;  1B05 A;  2OLB A;  2OWT A;  1QUJ A;  1JQF A;  2PMS A;  2F6G A;  3VV5 A;  4FOR A;  3FGS A;  3VVD A;  3MVW A;  3RUM A;  3T9H B;  3V8X B;  3SER A;  2Q2A A;  4U2R A;  2OWS A;  4JBZ A;  1MM6 A;  2Z22 A;  1B4Z A;  3KG2 A;  3W9W A;  4K3F A;  1JW4 A;  3TUS A;  2RCA A;  1URS A;  3EN3 A;  2PT2 A;  3TFL A;  1QUL A;  4H5F A;  4OEU A;  4OTE A;  3KN7 A;  4ZE9 A;  4KCC A;  1LFI A;  4F2Q A;  4KCD A;  4EDP A;  5JEI A;  2VD2 A;  3CG3 A;  3HHG A;  1IQ7 A;  3O9P A;  4HCY A;  4QRZ A;  3TEL A;  1B2H A;  5A5X B;  2XXV A;  4RPO A;  3UA8 A;  4F1V A;  4MLV A;  3C4M A;  3OEM A;  3PUZ E;  1WOD A;  2XX8 A;  4RY1 A;  4WED A;  4RXL A;  1LAF E;  3Q25 A;  4IO7 A;  3TMG A;  2WKY A;  5A5X A;  3K4U A;  3M3K A;  3N94 A;  4JB7 A;  1B32 A;  3CIJ A;  1TFD A;  5DTB A;  1SW5 A;  1P1N A;  1NFT A;  2Y7I A;  5DT6 A;  4NF5 B;  5KCJ B;  1TXF A;  4R2F A;  4ISU A;  4ELR A;  2ZYK A;  3U1O A;  1IEJ A;  3MP8 A;  3THI A;  3UP9 A;  1NKX A;  4UA8 A;  3MC2 A;  2H99 A;  2V3Q A;  1S50 A;  5I84 A;  2ZYN A;  2Q9T A;  1MH4 A;  3VDF A;  2QRY A;  4FJP A;  4QFN A;  5KCJ A;  2DVC A;  4KR5 A;  4GL8 A;  1FTM A;  2I4C A;  4THI A;  3HN0 A;  3KGC A;  1P1U A;  4ELO A;  3T66 A;  1VFE A;  1CE2 A;  1HSE A;  2F7A A;  1JNF A;  3FJM A;  3HO7 A;  4F1Y A;  3P7I A;  4P0I A;  5EHS A;  3FV1 A;  4YAH X;  1R9Q A;  1A8E A;  3UN6 A;  3MZ9 A;  2OCU A;  2QSX A;  1MXU A;  2XXR A;  4F2O A;  2VP1 A;  1Q35 A;  4ZED A;  3K01 A;  1FQB A;  5H8Q B;  3FZV A;  2IEE A;  4QFL A;  3BFU A;  1AMF A;  2HQ0 A;  4O3B A;  1US5 A;  3FIR A;  4I9D A;  2OK2 A;  3ILT B;  1SD3 A;  4ESW A;  3QYT A;  5H8S A;  4F1U A;  2HAV A;  2DXR A;  3T22 A;  1B52 A;  2DWI A;  1NNF A;  4ZZE A;  4OEV A;  3CFX A;  3TEP A;  2O51 A;  5I2K B;  4JWY A;  3GBB A;  4QFK A;  1Y1M A;  2V3U A;  1FTO A;  1UTH B;  4DCY A;  4NF8 A;  2RC7 A;  2I0C A;  1B0L A;  1EU8 A;  3VLW A;  4F31 B;  5I2K A;  3AXF A;  4O3C A;  3RQT A;  2I49 A;  5CMB A;  2RC9 A;  3VVF A;  2PX1 A;  3N6T A;  3T9X B;  3FD3 A;  4GVO A;  1SDX A;  1MQD A;  2ABH A;  1YCJ A;  2B3F A;  5CBR A;  1OLC A;  1RYX A;  2QS4 A;  1VSO A;  4LUB A;  4GOT A;  4RJZ A;  1SVX B;  4RA1 A;  4LZ8 A;  3V5A A;  3KSJ A;  3RTW B;  1P1O A;  1B3G A;  1LBB A;  5AA2 B;  5EYF A;  1JET A;  3FAT A;  3OO9 A;  3H6V A;  4X1D A;  3FV2 A;  2UVI A;  3QIM A;  1MXX A;  4XKN A;  5I57 B;  4LZ7 A;  4YB5 A;  3QAX A;  5AA2 A;  3VLU A;  2XXU A;  5KZT A;  4PFY A;  3PMV A;  3DEL B;  1OQG A;  4LP2 B;  1A99 A;  2I48 A;  4JWO A;  5I57 A;  4FAT A;  1ZMG A;  3QUJ A;  5K2X A;  3K1N A;  4OZ9 A;  1R6Z A;  4BDO A;  3VVE A;  3TTK A;  4HTG A;  1MXZ A;  1ATG A;  2GRV A;  4H65 A;  3HST A;  1HSL A;  4F3P A;  2Z8E A;  1MXY A;  1MY2 A;  2XXW A;  2QS3 A;  4BDM A;  2V93 A;  1FTJ A;  4AB6 A;  1SI0 A;  1YAE A;  2XXX A;  5I56 B;  3O29 A;  3H4Z A;  1QW0 A;  4H67 A;  3A3U A;  1SQY A;  4Q5T A;  5L8D A;  3MJN A;  1B6H A;  4HS7 A;  2HAU A;  2ZYO A;  4R6K A;  3G3G A;  2P2A A;  3S9M C;  3GBA A;  3K1M A;  1SI1 A;  1JEU A;  3DM0 A;  5CMC A;  4KPT A;  5CC2 A;  3G7W A;  4U4S A;  3KN3 A;  1P1W A;  5H8F B;  4Q0C A;  3C31 A;  4F39 A;  2B65 A;  2ZNS A;  2HZL A;  3KOT A;  2RCB A;  3KN8 A;  3GXA A;  1R9L A;  4ZEF A;  5KDT B;  1B51 A;  5HBC A;  2V3T A;  1M5D A;  2QMW A;  3LSF B; 
#chains in the Genus database with same CATH topology
 3O6I A;  2GQ1 A;  1LST A;  2I58 A;  1EYI A;  1MDP 1;  4H0W A;  1POT A;  4QFP A;  5FTI A;  4TLM B;  3VXC A;  2UVG A;  1T0K A;  1SW4 A;  4RYA A;  2ONS A;  3N6U A;  3K6U A;  5KDT A;  4PBH A;  3PMW A;  5ET6 A;  2O1L A;  5L9S A;  4FEC A;  3IOW A;  4PP0 A;  1D9Y A;  2FBP A;  1IMD A;  2Y7R A;  4XTC Q;  1B3E A;  2L5V A;  3PPO A;  3UGW A;  5AA2 D;  2PBW A;  1MPC A;  2UXA A;  3TQL A;  3H03 A;  2HZK A;  2OBG A;  3TKD A;  5I5P A;  1B40 A;  1VFD A;  2ONK E;  1FTK A;  2OX3 A;  4KYS A;  1ANF A;  3MZ1 A;  1MQI A;  1MY4 A;  1KZ8 A;  5IZ1 A;  4HE1 A;  4RPN A;  3KC0 A;  4IO2 A;  5EQ8 A;  3IJX B;  1POY 1;  4C1T A;  4O7M A;  1AL3 A;  5ISU A;  1ZTY A;  5FHN A;  4OFO A;  3JYR A;  4X8R A;  3PU5 A;  1GR2 A;  3UK4 A;  3D1R A;  1JW5 A;  3IB0 A;  1FPJ A;  4OYV A;  2F7C A;  3I3V A;  1O64 A;  3TTM A;  3LBS A;  2Y84 A;  5B70 A;  2ZMB A;  1NNT A;  3T1B A;  4KQP A;  3JZJ A;  1SYI A;  1ELJ A;  3GYY A;  4QFO A;  3R26 A;  1URD A;  3K6X A;  4X04 A;  1H76 A;  2WX9 A;  1USY H;  1Y1Z A;  3ZS6 A;  4P1L A;  4PGN A;  4G2Z A;  1MDQ A;  2Y7P A;  1TWY A;  1XI6 A;  5B7D A;  2UVJ A;  1XS5 A;  3KOS A;  5CM6 A;  1Y3P A;  3KZG A;  4EXL A;  2VHA A;  2XXQ A;  1MQJ A;  1B5H A;  1B4H A;  4NN3 A;  1N0T A;  3IL1 B;  2PYY A;  3UIF A;  1LBW A;  3LSL A;  4GWO A;  4EXK A;  4FAJ A;  2PFY A;  4BDL A;  4N4U A;  4OES A;  3B8B A;  3MPL A;  4N6P A;  3H06 B;  1IMF A;  3MWB A;  2R6G E;  3HPI A;  4PFT A;  4GFR A;  4M1V A;  3I6V A;  2DXY A;  4GWW A;  2ZYM A;  4ZDM A;  4O7I A;  4ZEI A;  1XVY A;  4G8M A;  4HW8 A;  1USY E;  4NF6 B;  3GZG A;  3SKP A;  2OJT A;  1RYO A;  2E1S A;  3FVK A;  5DVJ A;  4EQ7 A;  3ZSF A;  1LFG A;  1EZP A;  3CG1 A;  1LCF A;  5I7I A;  1I6A A;  2D21 A;  1B3H A;  1RDY A;  4PGP A;  5H8N B;  3PMX A;  2NVU B;  1DOT A;  4NF6 A;  4NGU A;  1Y3Q A;  2O1M A;  3IB2 A;  2ESN A;  3FUZ A;  4DXC A;  4G4P A;  2Z23 A;  4U23 A;  1NUW A;  2DYX A;  4OHN A;  3PPR A;  2RC8 A;  2XXY A;  1DPE A;  2VPN A;  2RKM A;  3PPQ A;  1XVX A;  2KQZ A;  4TQU Q;  1D9V A;  4MFI A;  2WYP A;  4O3A A;  1FBE A;  3I5O A;  3U92 A;  1B1H A;  4OQO A;  3VFJ A;  4DI3 D;  1MXV A;  3U94 A;  1DMB A;  4H6D A;  2XXI A;  4QXD A;  1OVT A;  3PPN A;  2H98 A;  4KYE A;  4IY6 A;  4O8M A;  3RT8 A;  1NMU A;  2FIE A;  4ZEB A;  2Y5L A;  1P1Q A;  3Q28 A;  4TLL B;  4NE4 A;  3H3G A;  1B58 A;  2X7P A;  5IM2 A;  4PBQ A;  2F7B A;  3CR9 A;  2UYE A;  3KBR A;  3LSW A;  4NF5 A;  4BLA A;  3E3K A;  2F3D A;  4G77 A;  4DLD A;  4C1U A;  4OEN A;  2WBB A;  1KWH A;  1G0I A;  2B4M A;  2PT1 A;  4ELQ A;  3IFA A;  1UQW A;  3LUZ A;  5ELV A;  4DI4 B;  4PAF A;  1A7L A;  1FPK A;  1H44 A;  1Y9U A;  4F3B A;  4ZEC A;  3D4G A;  4OFL A;  2ONR A;  2XXT A;  4R72 A;  5IZ3 B;  4POX A;  4PE5 B;  3LV0 A;  3CSG A;  2Y7W A;  4DDD A;  1JEV A;  3B6Q A;  2LAO A;  5JK4 A;  2X7Q A;  4H8I A;  4GWY A;  3RT6 B;  3O6G A;  4GWZ A;  3KBZ A;  3OEK A;  5ESY A;  3V89 B;  5FHM A;  3EF7 A;  1MRP A;  5DEX B;  1NUY A;  5IZ3 A;  3EHU A;  1MH3 A;  2HEU A;  3ZKL A;  2AL5 A;  4NED A;  4BDN A;  1JVY A;  5ICT A;  4JVD A;  1M5F A;  3FXB A;  2E0S A;  3A3C A;  4LON B;  3C32 A;  5TU0 A;  3TDJ A;  4BDR A;  4UAB A;  4DZ1 A;  1JVX A;  2FNC A;  3KSX A;  3PD8 A;  2GH9 A;  5H8Q A;  4R74 A;  3TYH A;  3ISP A;  1URG A;  1DK4 A;  4F3S A;  1H43 A;  4MMP A;  4GWS A;  2F5X A;  4POW A;  4IO4 A;  1B1X A;  5I58 B;  2F6P A;  1KA0 A;  1K9Y A;  4WKM A;  1XT8 A;  3PTY A;  2DWJ A;  2ZNU A;  4OVT A;  5IKB A;  2RF1 A;  2WBD A;  4JXI A;  1FTA A;  4TOZ A;  2GFE A;  1DCU A;  5F7V A;  4JVI A;  3DP8 A;  3PGF A;  2H9B A;  1OVB A;  1LB9 A;  2F35 A;  4GQO A;  4FIM A;  1PB8 A;  1N76 A;  4GL0 A;  2Z8D A;  3LC8 A;  3PUX E;  1QKB A;  4P56 A;  1Y3N A;  1BLF A;  3MVZ A;  1DSN A;  1UTH A;  1A8F A;  5FHO A;  4LQ5 A;  1YPN A;  1JP4 A;  3TTN A;  2HFB A;  3LSX A;  3FAS A;  3BIG A;  3O28 A;  1FW0 A;  3FVO A;  5I3S A;  3K00 A;  1MY1 A;  2Q88 A;  3U8Q A;  2QL3 A;  5L9O A;  3TCF A;  4R9F A;  3TQW A;  2A5T B;  1IXG A;  3TCH A;  3B50 A;  2H25 A;  5ITP A;  2F97 A;  1IIT A;  1MXW A;  3RTF B;  1Y4C A;  4P8B A;  3IAZ A;  4LZ5 A;  2XXK A;  3IO4 A;  5K2Y A;  3IOR A;  1DTZ A;  4LN5 A;  3Q26 A;  5FTH A;  3T9V A;  3K2D A;  1N7W A;  4G8N A;  1DPP A;  4MNI A;  2THI A;  2QS1 A;  4R73 A;  3TTL A;  4YMB A;  4NWC A;  3IB1 A;  5H8H B;  1NL5 A;  5AA3 A;  1CNQ A;  2BJJ X;  3BKI B;  3FJ7 A;  3VXB A;  1QUK A;  1II5 A;  4KYD A;  4NF0 A;  1I6B A;  2QMX A;  1NV3 A;  2Q89 A;  1NUX A;  3IK6 B;  3OEN A;  2HXR A;  4N8Y A;  2R8T A;  3NOH A;  1FQE A;  3PD9 A;  3FJG A;  1FSA A;  1AIV A;  1NUZ A;  3BBR A;  3QK6 A;  4U22 A;  1DBZ A;  3CI8 A;  4WEP A;  1FPF A;  4U1Z A;  2NXO A;  1FTL A;  4XKR A;  4DCX A;  2V4C A;  1EH3 A;  4N8G A;  2V25 A;  1F9B A;  4I62 A;  5I59 B;  4GX6 A;  1BTJ A;  4PF8 A;  1ZJL A;  3OO6 A;  1EYJ A;  2YPN A;  2H4I A;  3PUW E;  3MZB A;  5I56 A;  4F22 A;  2DOJ A;  2DS9 A;  5DVF A;  1SPI A;  5I59 A;  4XKP A;  3QMF A;  4GX3 A;  3KFM A;  1S9T A;  3FXQ A;  4OVQ A;  4ZEK A;  2I6E A;  1MY3 A;  4YKK A;  1LFH A;  1GGG A;  2O68 A;  1JW1 A;  3SES A;  1D4N A;  5DYH A;  4WXJ A;  3T93 B;  4MIJ A;  4AB5 A;  2FVZ A;  1CB6 A;  1FPI A;  5TP9 B;  3RN8 A;  1N3W A;  1LBX A;  3OMB A;  5EQA A;  1B3L A;  4MEV A;  4QSE A;  4ZZA A;  4F29 A;  5H8F A;  1MM7 A;  3RLF E;  1MPB A;  5DVI A;  3H7M A;  4LAT A;  2O6A A;  2WEF A;  5TP9 A;  3C34 A;  3W15 C;  3MUQ A;  4OER A;  2YJP A;  3SEV A;  4ECF A;  5CMK A;  2GHA A;  1LB8 A;  3MBP A;  2Y5K A;  2ALU A;  4OXV A;  3TPA A;  4DE8 A;  3C36 A;  2VD3 A;  3B6T A;  3C35 A;  5ET5 A;  4ZE8 A;  3GLB A;  5CBS A;  1Y4T A;  4P0G A;  1FCK A;  5TPA B;  4PC9 A;  1FPD A;  5M2V A;  1VE4 A;  1FQF A;  4NQ8 A;  4MLQ A;  1B0H A;  4YKI A;  2QS2 A;  3OD7 A;  1S7Y A;  2KLF A;  3TAJ A;  3SEX A;  4NF4 B;  1BKA A;  5ITO A;  2XWO A;  5IAI A;  2Q8J A;  1LEV A;  5TPA A;  4ELP A;  3PV0 E;  1RDX A;  2DSF A;  3OO8 A;  3K0V A;  3RY3 A;  4X9T A;  3WAE A;  1FJ6 A;  1NV1 A;  2YLN A;  3ROJ A;  1KA1 A;  2F78 A;  3KJ7 A;  2XX7 A;  3DLN A;  3LUY A;  4U21 A;  3VLV A;  2P3N A;  1B9J A;  2QVV A;  3C9H A;  4H45 A;  1YZ0 A;  4Q8R A;  4XKQ A;  3S2V A;  4OA4 A;  2HHM A;  4Z7E A;  3H6W A;  4G8H A;  4DIG A;  4GLI A;  4IGR A;  4DXU A;  4G68 C;  4GRK A;  1FQD A;  3HV1 A;  4F18 A;  4L17 A;  2XWV A;  2Y7K A;  4N07 A;  5L9M A;  1Z7M E;  4P11 A;  1NNK A;  4FED A;  4YIC A;  4ZS9 A;  1ZIU A;  4EF1 A;  3IO6 A;  2WYK A;  1UIV A;  2VT5 A;  3S9E A;  4JSO A;  3OO7 A;  4I8C A;  4MBP A;  3EKI A;  3KEI A;  1IIW A;  3QXM A;  1FQA A;  3CRB A;  3TZA A;  2O84 X;  2PFZ A;  4EQ9 A;  3EQ1 A;  1GVC A;  2I3V A;  1DTG A;  2Z8F A;  1NV2 A;  4QF9 A;  3R6U A;  4P47 A;  5FBP A;  1LBZ A;  3WAF A;  4NMY A;  1R1N A;  1B3F A;  3HHF A;  4MHF A;  3USD A;  5JTY B;  3O97 A;  3A09 A;  1D3K A;  2Q74 A;  4OWD A;  3L6H A;  3MQ9 A;  3SZP A;  3N26 A;  3G3H A;  4IO6 A;  1MQH A;  3EPE A;  4IO5 A;  4JDF A;  4G68 B;  2GHB A;  3MP6 A;  5JTY A;  4YU0 A;  4RNS A;  4GIZ A;  1N7X A;  3PPP A;  3CVG A;  3H6U A;  2FIX A;  4H5G A;  2P0S A;  1M5B A;  1I69 A;  1OLA A;  3FXU A;  5H8N A;  2ZNT A;  3G3F A;  3MAM A;  4PET A;  1IXH A;  2B3B A;  4G68 A;  5AA1 A;  2JJK A;  5BUU A;  4FBP A;  2ANJ A;  4BDQ A;  3U93 A;  1NV7 A;  1MG1 A;  3M3L A;  3S4U A;  4LVQ A;  1OQH A;  3OOA A;  1PDA A;  1NNP A;  2D3I A;  3B6W A;  4YB7 A;  4XXU A;  1B7Z A;  3EHT A;  2REJ A;  4GXS B;  5J1D A;  5EHM A;  4OFJ A;  1M5C A;  4FEB A;  3BFT A;  1LAH E;  1TFA A;  4OVJ A;  3B7D A;  4IB2 A;  4RK9 A;  1WVJ A;  1NV4 A;  2DWH A;  1HSJ A;  2FA7 A;  1ZBM A;  4OET A;  4U1O A;  4GWX A;  1N84 A;  3O6H A;  2I0B A;  2CZK A;  1J1N A;  2PCR A;  3T96 B;  1AH5 A;  1IZ1 A;  4DXB A;  1NH8 A;  1AWB A;  1QJM A;  2CEX A;  1FPL A;  4QSC A;  1MPD A;  2NOO A;  1BIY A;  4LA9 A;  4YZZ A;  5LDZ A;  4OVP A;  1EZO A;  2IA4 A;  4R6H A;  4PAK A;  1LAX A;  3FXR A;  1SYH A;  3IOU A;  4Z0I A;  4IO3 A;  4U4X A;  4GD5 A;  1BP5 A;  4EF2 A;  4MH5 A;  2AIX A;  1O7T A;  3TCG A;  4R75 A;  2W7Y A;  3EHS A;  4NG7 A;  2G93 A;  3ONM A;  2F3B A;  1A54 A;  1IUD A;  1OMP A;  2REG A;  1B5J A;  1FQC A;  3LR1 A;  2XD3 A;  1NV6 A;  4JSD A;  3CFL A;  1IMA A;  4AQ4 A;  2NWJ A;  4N6D A;  4N91 A;  3F11 A;  2QVU A;  5ICQ A;  4X1B A;  5DEX A;  5J16 A;  1YTV A;  2H5Y A;  1MY0 A;  3PUY E;  4R9G A;  1Y20 A;  4YKJ A;  2O7I A;  1PC3 A;  4MF3 A;  2CZL A;  1AOV A;  1MS7 A;  1N04 A;  2DVZ A;  2AL4 A;  3SEU A;  5I2N B;  4I3Y A;  4NF8 B;  3CFZ A;  2DWA A;  4H8J A;  1LCT A;  5AE4 A;  3RGY A;  1B7H A;  5I58 A;  2ZXT A;  5A5L A;  4IGT A;  4PFU A;  4I40 A;  4KFQ A;  5I2N A;  2VPO A;  1LLS A;  2CMO A;  5HM4 B;  2VGQ A;  4EUO A;  1PB9 A;  5CI5 A;  3K1P A;  1UIU A;  4KI0 E;  4P3L A;  3IR1 A;  4JVC A;  4OMB A;  4JWX A;  1B46 A;  3T0J A;  4N6K A;  3U72 A;  1N3X A;  4PQJ A;  1OIB A;  3DP6 A;  4H1X A;  1SBP A;  3QSL A;  2XHD A;  1QKA A;  1GTK A;  2XWI A;  4F3G A;  4MCO A;  1GV8 A;  3MW0 A;  4AS4 A;  5HPQ A;  2V84 A;  2F36 A;  4HE2 A;  3QUF A;  2DE4 A;  1FBG A;  3MP1 A;  4YB6 A;  4R2B A;  3S9L C;  1XC1 A;  1PB7 A;  3OSQ A;  3VE1 B;  2UVH A;  4UAC A;  5ET8 A;  2A5T A;  3RPW A;  3FVN A;  1A40 A;  1IXI A;  3PUV E;  4NHB A;  3D4C A;  3Q27 A;  2DP8 A;  1B5I A;  1MQG A;  2M8C A;  1FBP A;  4X48 A;  4LQ2 A;  4PFW A;  1I6Q A;  3M8U A;  3C33 A;  1LBC A;  3E78 A;  1PEB A;  1UTB B;  1FRP A;  4RK2 A;  3IJO B;  4HCW A;  2D5W A;  1FBH A;  1Z7N E;  2PVU A;  3JV9 A;  5H8H A;  3M3F A;  3SEY A;  3SET A;  4KD5 A;  2Q8M A;  2F34 A;  2HXW A;  2P3V A;  2ZZW A;  3RNN A;  1TT1 A;  1IMB A;  1EZ9 A;  1PBP A;  2G29 A;  2VOZ A;  1UTB A;  3ZKK A;  2B4L A;  4M4G A;  5BWJ A;  2ZZV A;  4NWD A;  2A5S A;  3E13 X;  2I4B A;  4R6Y A;  2RIN A;  1IMC A;  1LAG E;  3OSR A;  3S9N C;  4QHQ A;  5AA4 B;  3IOT A;  3IOV A;  2P1S A;  1A55 A;  1NH7 A;  2DQV A;  3ODB A;  3V83 A;  2AYS A;  3MVX A;  3RPL B;  1XHY A;  3L6G A;  1ZLQ A;  2XXP A;  3UOR A;  2O7U A;  4N17 A;  1FBF A;  5F1Q A;  5AA4 A;  2F8D A;  2HPG A;  1LBY A;  1ZU0 A;  3R7X A;  2X26 A;  4PE3 A;  2I3W A;  4NAP A;  1NV5 A;  3E4R A;  3E9X A;  3K6V A;  4YMA A;  1B7U A;  3G3I A;  2R71 A;  3K6W A;  2QJE A;  4IY5 A;  3OEL A;  4OVS A;  1PBQ A;  3RPL A;  5CMM A;  1P99 A;  3MVY A;  4N13 A;  1H45 A;  3G3K A;  3G3J A;  2DDK A;  1LGB C;  2XXH A;  4Q30 B;  2HCA A;  4GXA A;  2FYI A;  3SDF A;  3Q29 A;  1YXI A;  4XIG Q;  1M5E A;  1D9Q A;  4EQB A;  3MPK A;  2UYF A;  3T9U A;  4NTL A;  3HCQ A;  3TTR A;  3CSB A;  3IX1 A;  2R9J A;  3W9V A;  4YKP A;  4KHZ E;  1US4 A;  1Q9D A;  3OXN A;  1IXC A;  4GF8 A;  3K02 A;  4PF6 A;  1H3D A;  5LOM A;  4MNC A;  1QUI A;  4F19 A;  3O2A A;  3MST A;  1XOC A;  2XX9 A;  4E0X A;  4ESX A;  1LBV A;  2QPQ A;  1ZKB A;  5T3J A;  4C0R A;  4ONY A;  4PCD A;  1RKM A;  1SW2 A;  5CRY A;  4QSD A;  1WDN A;  3O66 A;  1VR5 A;  1O63 A;  3FVG A;  3TOD A;  3ECR A;  2DE3 A;  3SEW A;  3DP4 A;  2XD2 A;  4NF4 A;  4E0W A;  2QFL A;  2O69 A;  2CEY A;  4IR8 A;  4FE8 A;  4P1E A;  3H6T A;  3KJT A;  4N15 A;  1Q1K A;  4ND9 A;  3ILU B;  3N5L A;  4PDH A;  4KXP A;  4I1D A;  2OZZ A;  2NUV A;  2Q2C A;  2DE2 A;  1L5T A;  1SW1 A;  1QVS A;  1B05 A;  2OLB A;  2OWT A;  1QUJ A;  1JQF A;  2PMS A;  2F6G A;  3VV5 A;  4FOR A;  2FHY A;  3FGS A;  3VVD A;  3MVW A;  3RUM A;  3T9H B;  3V8X B;  3SER A;  2Q2A A;  4PTK A;  4U2R A;  2OWS A;  4JBZ A;  1MM6 A;  2Z22 A;  1B4Z A;  3KG2 A;  3W9W A;  4K3F A;  2XWK A;  1JW4 A;  3TUS A;  2RCA A;  1URS A;  3EN3 A;  2PT2 A;  5DW8 A;  3TFL A;  1QUL A;  4H5F A;  4OEU A;  4OTE A;  3KN7 A;  4ZE9 A;  4KCC A;  1LFI A;  4F2Q A;  4KCD A;  4EDP A;  5JEI A;  2VD2 A;  3CG3 A;  3HHG A;  1IQ7 A;  3O9P A;  4HCY A;  4QRZ A;  3TEL A;  1B2H A;  5F24 A;  5A5X B;  2XXV A;  4RPO A;  3UA8 A;  4HXV A;  1FBC A;  4F1V A;  4MLV A;  3C4M A;  3OEM A;  3PUZ E;  1WOD A;  4AS5 A;  2XX8 A;  4RY1 A;  4WED A;  4G61 A;  1INP A;  4RXL A;  1LAF E;  4XF5 A;  3Q25 A;  4IO7 A;  3TMG A;  2WKY A;  1YYZ A;  4PFI A;  5A5X A;  1G0H A;  3K4U A;  3M3K A;  4XFE A;  3N94 A;  3U65 A;  3FBP A;  4JB7 A;  1B32 A;  3CIJ A;  1TFD A;  5DTB A;  1SW5 A;  1P1N A;  1NFT A;  2Y7I A;  5DT6 A;  4NF5 B;  5KCJ B;  1TXF A;  4R2F A;  4ISU A;  5EYH A;  4ELR A;  2ZYK A;  3U1O A;  1IEJ A;  3MP8 A;  3THI A;  3UP9 A;  1NKX A;  4UA8 A;  3MC2 A;  2H99 A;  2V3Q A;  1S50 A;  3RYD A;  5I84 A;  2ZYN A;  2Q9T A;  1MH4 A;  5ET7 A;  3VDF A;  2QRY A;  1FBD A;  4FJP A;  4QFN A;  5KCJ A;  2DVC A;  4KR5 A;  4GL8 A;  1FTM A;  2I4C A;  4THI A;  3HN0 A;  3KGC A;  1P1U A;  4ELO A;  5IZZ A;  3T66 A;  4OVR A;  1VFE A;  1CE2 A;  1HSE A;  4PFB A;  2F7A A;  4I3E A;  1JNF A;  3HFU A;  3FJM A;  3HO7 A;  4F1Y A;  3P7I A;  4P0I A;  5EHS A;  4MNP A;  3FV1 A;  4YAH X;  1R9Q A;  1A8E A;  3UN6 A;  3MZ9 A;  2OCU A;  2QSX A;  1MXU A;  2XXR A;  4F2O A;  2VP1 A;  1Q35 A;  4ZED A;  3K01 A;  1FQB A;  2MKZ A;  5LTC A;  4OAN A;  5H8Q B;  3FZV A;  1NI9 A;  2IEE A;  1FJ9 A;  4QFL A;  4PDD A;  3BFU A;  1AMF A;  2HQ0 A;  4O3B A;  1US5 A;  5EQ7 A;  3FIR A;  4I9D A;  2OK2 A;  3ILT B;  1SD3 A;  4ESW A;  5EQ9 A;  4PFR A;  3QYT A;  4HE0 A;  5H8S A;  4F1U A;  2HAV A;  2DXR A;  3T22 A;  4MAG A;  1B52 A;  2DWI A;  1NNF A;  4ZZE A;  4OEV A;  3CFX A;  3TEP A;  2O51 A;  5I2K B;  4JWY A;  1RDZ A;  3GBB A;  4QFK A;  1Y1M A;  2V3U A;  2XA5 A;  1FTO A;  1UTH B;  4DCY A;  4NF8 A;  2RC7 A;  2I0C A;  1B0L A;  1EU8 A;  3VLW A;  1QGX A;  4F31 B;  5I2K A;  3AXF A;  4O3C A;  3RQT A;  2I49 A;  5CMB A;  2RC9 A;  3VVF A;  2PX1 A;  3N6T A;  3T9X B;  3FD3 A;  4GVO A;  1SDX A;  1MQD A;  4XEQ A;  2ABH A;  1YCJ A;  2B3F A;  5CBR A;  4MX6 A;  1OLC A;  1RYX A;  2QS4 A;  4PAI A;  1VSO A;  4LUB A;  4GOT A;  4RJZ A;  1SVX B;  2ZZX A;  4RA1 A;  4LZ8 A;  3V5A A;  3KSJ A;  4O94 A;  3RTW B;  1P1O A;  1B3G A;  1LBB A;  5AA2 B;  1IME A;  5EYF A;  4GX4 A;  1JET A;  4QBA A;  2BJI A;  3FAT A;  4GBW A;  3OO9 A;  3H6V A;  4X1D A;  3FV2 A;  2UVI A;  3QIM A;  1MXX A;  4XKN A;  1FPE A;  5I57 B;  4LZ7 A;  4YB5 A;  3QAX A;  5AA2 A;  3KC1 A;  5IGA A;  3VLU A;  3BIH A;  2QVR A;  4GBV A;  2CZH A;  2XXU A;  5KZT A;  4PFY A;  3PMV A;  3DEL B;  1OQG A;  4LP2 B;  1A99 A;  2I48 A;  4JWO A;  5I57 A;  5EYG A;  4FAT A;  1ZMG A;  3QUJ A;  3K1N A;  4OZ9 A;  5K2X A;  1R6Z A;  3MYU A;  4BDO A;  3VVE A;  3TTK A;  4HTG A;  4NX1 A;  1NV0 A;  4H65 A;  1MXZ A;  1ATG A;  2GRV A;  3CHG A;  3HST A;  1HSL A;  4F3P A;  2Z8E A;  1MXY A;  1MY2 A;  2XXW A;  2QS3 A;  4BDM A;  2V93 A;  1FTJ A;  4AB6 A;  1SI0 A;  1YAE A;  2XXX A;  5I56 B;  3O29 A;  2KR0 A;  2CZI A;  3H4Z A;  1QW0 A;  4H67 A;  1EYK A;  3A3U A;  1SQY A;  4Q5T A;  5L8D A;  3MJN A;  1B6H A;  4HS7 A;  2HAU A;  2OWZ A;  2ZYO A;  3IFC A;  4N81 A;  4R6K A;  1FPG A;  3E79 A;  3G3G A;  2P2A A;  3S9M C;  3GBA A;  1BK4 A;  4H46 A;  3K1M A;  1SI1 A;  1JEU A;  3DM0 A;  5CMC A;  4KPT A;  4P9K A;  5CC2 A;  3G7W A;  4U4S A;  3KN3 A;  1P1W A;  4MJO A;  5H8F B;  4Q0C A;  3C31 A;  4F39 A;  2B65 A;  2ZNS A;  2HZL A;  3KOT A;  2RCB A;  3KN8 A;  1VDW A;  3A29 A;  3GXA A;  1FPB A;  1R9L A;  4GWU A;  4ZEF A;  5KDT B;  1B51 A;  5HBC A;  2V3T A;  1M5D A;  1K9Z A;  2QMW A;  3LSF B; 
#chains in the Genus database with same CATH homology
 3O6I A;  1LST A;  2I58 A;  4QFP A;  1MDP 1;  4H0W A;  1POT A;  5FTI A;  4TLM B;  3VXC A;  2UVG A;  1T0K A;  1SW4 A;  4RYA A;  2ONS A;  3N6U A;  3K6U A;  5KDT A;  3PMW A;  2O1L A;  5L9S A;  4FEC A;  3IOW A;  4PP0 A;  1D9Y A;  2Y7R A;  4XTC Q;  1B3E A;  3PPO A;  3UGW A;  5AA2 D;  2PBW A;  1MPC A;  2UXA A;  3TQL A;  3H03 A;  2HZK A;  2OBG A;  3TKD A;  1B40 A;  1VFD A;  2ONK E;  1FTK A;  4KYS A;  1ANF A;  3MZ1 A;  1MQI A;  1MY4 A;  4RPN A;  4IO2 A;  3IJX B;  1POY 1;  4C1T A;  1AL3 A;  5ISU A;  1ZTY A;  5FHN A;  4OFO A;  3JYR A;  3PU5 A;  1GR2 A;  3UK4 A;  1JW5 A;  3IB0 A;  4OYV A;  2F7C A;  3I3V A;  1O64 A;  3TTM A;  3LBS A;  2Y84 A;  5B70 A;  2ZMB A;  1NNT A;  4KQP A;  3JZJ A;  1SYI A;  1ELJ A;  4QFO A;  3R26 A;  1URD A;  3K6X A;  1H76 A;  1USY H;  1Y1Z A;  3ZS6 A;  4G2Z A;  1MDQ A;  2Y7P A;  1TWY A;  5B7D A;  2UVJ A;  1XS5 A;  3KOS A;  5CM6 A;  1Y3P A;  3KZG A;  4EXL A;  2VHA A;  2XXQ A;  1MQJ A;  1B5H A;  1B4H A;  1N0T A;  3IL1 B;  2PYY A;  3UIF A;  3LSL A;  4GWO A;  4EXK A;  4FAJ A;  4BDL A;  4OES A;  3MPL A;  4N6P A;  3H06 B;  3MWB A;  2R6G E;  3HPI A;  4PFT A;  4GFR A;  4M1V A;  3I6V A;  2DXY A;  2ZYM A;  4ZDM A;  4ZEI A;  1XVY A;  4G8M A;  4HW8 A;  1USY E;  4NF6 B;  3GZG A;  3SKP A;  2OJT A;  1RYO A;  2E1S A;  3FVK A;  5DVJ A;  4EQ7 A;  3ZSF A;  1LFG A;  1EZP A;  3CG1 A;  1LCF A;  1I6A A;  2D21 A;  1B3H A;  5H8N B;  3PMX A;  2NVU B;  1DOT A;  4NF6 A;  1Y3Q A;  2O1M A;  3IB2 A;  2ESN A;  3FUZ A;  4DXC A;  4G4P A;  2Z23 A;  4U23 A;  2DYX A;  4OHN A;  3PPR A;  2RC8 A;  2XXY A;  1DPE A;  2RKM A;  3PPQ A;  1XVX A;  4TQU Q;  1D9V A;  4MFI A;  3I5O A;  4O3A A;  3U92 A;  1B1H A;  4OQO A;  3VFJ A;  1MXV A;  3U94 A;  1DMB A;  4H6D A;  2XXI A;  1OVT A;  3PPN A;  2H98 A;  4KYE A;  4IY6 A;  3RT8 A;  1NMU A;  4ZEB A;  1P1Q A;  3Q28 A;  4TLL B;  4NE4 A;  3H3G A;  1B58 A;  2X7P A;  2F7B A;  3CR9 A;  2UYE A;  3KBR A;  3LSW A;  4NF5 A;  4BLA A;  3E3K A;  4G77 A;  4DLD A;  4C1U A;  4OEN A;  1KWH A;  2PT1 A;  4ELQ A;  1UQW A;  5ELV A;  1A7L A;  1H44 A;  1Y9U A;  4F3B A;  4ZEC A;  3D4G A;  4OFL A;  2ONR A;  2XXT A;  4R72 A;  4POX A;  4PE5 B;  3CSG A;  2Y7W A;  4DDD A;  1JEV A;  3B6Q A;  2LAO A;  5JK4 A;  2X7Q A;  4H8I A;  3RT6 B;  3O6G A;  3OEK A;  3V89 B;  5FHM A;  3EF7 A;  1MRP A;  5DEX B;  3EHU A;  1MH3 A;  2HEU A;  3ZKL A;  2AL5 A;  4NED A;  4BDN A;  1JVY A;  5ICT A;  1M5F A;  2E0S A;  3A3C A;  4LON B;  3C32 A;  5TU0 A;  3TDJ A;  4BDR A;  4DZ1 A;  1JVX A;  2FNC A;  3KSX A;  3PD8 A;  2GH9 A;  5H8Q A;  4R74 A;  3TYH A;  1URG A;  4F3S A;  1H43 A;  2F5X A;  4POW A;  4IO4 A;  1B1X A;  5I58 B;  2F6P A;  4WKM A;  1XT8 A;  2DWJ A;  2ZNU A;  5IKB A;  2RF1 A;  4JXI A;  4TOZ A;  2GFE A;  5F7V A;  3DP8 A;  3PGF A;  2H9B A;  1OVB A;  1LB9 A;  2F35 A;  4GQO A;  4FIM A;  1PB8 A;  1N76 A;  4GL0 A;  2Z8D A;  3LC8 A;  3PUX E;  1QKB A;  1Y3N A;  1BLF A;  3MVZ A;  1DSN A;  1UTH A;  1A8F A;  5FHO A;  4LQ5 A;  1YPN A;  3TTN A;  2HFB A;  3LSX A;  3FAS A;  3O28 A;  1FW0 A;  3FVO A;  3K00 A;  1MY1 A;  2Q88 A;  3U8Q A;  2QL3 A;  5L9O A;  3TCF A;  4R9F A;  3TQW A;  2A5T B;  1IXG A;  3TCH A;  2H25 A;  5ITP A;  2F97 A;  1IIT A;  1MXW A;  3RTF B;  1Y4C A;  3IAZ A;  4LZ5 A;  3IO4 A;  5K2Y A;  3IOR A;  1DTZ A;  3Q26 A;  5FTH A;  3T9V A;  3K2D A;  1N7W A;  4G8N A;  1DPP A;  2THI A;  2QS1 A;  4R73 A;  3TTL A;  4YMB A;  4NWC A;  3IB1 A;  5H8H B;  1NL5 A;  5AA3 A;  2BJJ X;  3BKI B;  3FJ7 A;  3VXB A;  1QUK A;  1II5 A;  4KYD A;  1I6B A;  2QMX A;  2Q89 A;  3IK6 B;  3OEN A;  1FQE A;  3PD9 A;  3FJG A;  1AIV A;  3BBR A;  3QK6 A;  4U22 A;  3CI8 A;  4WEP A;  4U1Z A;  2NXO A;  1FTL A;  4XKR A;  4DCX A;  1EH3 A;  2V25 A;  1F9B A;  4I62 A;  5I59 B;  1BTJ A;  1ZJL A;  3OO6 A;  2YPN A;  2H4I A;  3PUW E;  3MZB A;  5I56 A;  4F22 A;  2DOJ A;  2DS9 A;  5DVF A;  5I59 A;  4XKP A;  3KFM A;  1S9T A;  3FXQ A;  4ZEK A;  2I6E A;  1MY3 A;  4YKK A;  1LFH A;  1GGG A;  2O68 A;  1JW1 A;  3SES A;  1D4N A;  5DYH A;  4WXJ A;  3T93 B;  4AB5 A;  1CB6 A;  5TP9 B;  3RN8 A;  1N3W A;  3OMB A;  1B3L A;  4QSE A;  4ZZA A;  4F29 A;  5H8F A;  1MM7 A;  3RLF E;  1MPB A;  5DVI A;  3H7M A;  4LAT A;  2O6A A;  5TP9 A;  3C34 A;  3W15 C;  3MUQ A;  4OER A;  2YJP A;  3SEV A;  4ECF A;  5CMK A;  2GHA A;  1LB8 A;  3MBP A;  2ALU A;  4OXV A;  3TPA A;  4DE8 A;  3C36 A;  2VD3 A;  3B6T A;  3C35 A;  4ZE8 A;  3GLB A;  5CBS A;  1Y4T A;  4P0G A;  1FCK A;  5TPA B;  5M2V A;  1VE4 A;  1FQF A;  4MLQ A;  1B0H A;  4YKI A;  2QS2 A;  3OD7 A;  1S7Y A;  2KLF A;  3TAJ A;  3SEX A;  4NF4 B;  1BKA A;  5ITO A;  5IAI A;  2Q8J A;  5TPA A;  4ELP A;  3PV0 E;  2DSF A;  3OO8 A;  3K0V A;  3RY3 A;  4X9T A;  3WAE A;  2YLN A;  2F78 A;  3KJ7 A;  2XX7 A;  3DLN A;  3LUY A;  4U21 A;  3VLV A;  1B9J A;  3C9H A;  4Q8R A;  4XKQ A;  3S2V A;  4Z7E A;  3H6W A;  4G8H A;  4DIG A;  4GLI A;  4IGR A;  4DXU A;  4G68 C;  4GRK A;  1FQD A;  3HV1 A;  4F18 A;  4L17 A;  2Y7K A;  4N07 A;  5L9M A;  1Z7M E;  4P11 A;  1NNK A;  4FED A;  4YIC A;  4ZS9 A;  1ZIU A;  4EF1 A;  3IO6 A;  1UIV A;  3S9E A;  4JSO A;  3OO7 A;  4I8C A;  4MBP A;  3KEI A;  1IIW A;  3QXM A;  1FQA A;  3CRB A;  3TZA A;  2O84 X;  4EQ9 A;  3EQ1 A;  1GVC A;  2I3V A;  1DTG A;  2Z8F A;  4QF9 A;  3R6U A;  3WAF A;  4NMY A;  1R1N A;  1B3F A;  3HHF A;  3USD A;  5JTY B;  3O97 A;  3A09 A;  1D3K A;  4OWD A;  3L6H A;  3MQ9 A;  3N26 A;  3G3H A;  4IO6 A;  1MQH A;  3EPE A;  4IO5 A;  4JDF A;  4G68 B;  2GHB A;  3MP6 A;  5JTY A;  4YU0 A;  4RNS A;  4GIZ A;  1N7X A;  3PPP A;  3CVG A;  3H6U A;  4H5G A;  2P0S A;  1M5B A;  1I69 A;  1OLA A;  3FXU A;  5H8N A;  2ZNT A;  3G3F A;  3MAM A;  4PET A;  1IXH A;  2B3B A;  4G68 A;  5AA1 A;  5BUU A;  2ANJ A;  4BDQ A;  3U93 A;  1MG1 A;  3M3L A;  3S4U A;  1OQH A;  4LVQ A;  3OOA A;  1PDA A;  1NNP A;  2D3I A;  3B6W A;  4YB7 A;  4XXU A;  1B7Z A;  3EHT A;  2REJ A;  4GXS B;  5J1D A;  5EHM A;  4OFJ A;  1M5C A;  4FEB A;  3BFT A;  1LAH E;  1TFA A;  4OVJ A;  3B7D A;  4IB2 A;  4RK9 A;  1WVJ A;  2DWH A;  1HSJ A;  2FA7 A;  1ZBM A;  4OET A;  4U1O A;  1N84 A;  3O6H A;  2I0B A;  1J1N A;  3T96 B;  1AH5 A;  1IZ1 A;  4DXB A;  1NH8 A;  1QJM A;  4QSC A;  1MPD A;  2NOO A;  1BIY A;  4LA9 A;  4YZZ A;  1EZO A;  2IA4 A;  4R6H A;  1LAX A;  3FXR A;  1SYH A;  3IOU A;  4Z0I A;  4IO3 A;  4U4X A;  4GD5 A;  4EF2 A;  1BP5 A;  4MH5 A;  2AIX A;  1O7T A;  3TCG A;  4R75 A;  2W7Y A;  3EHS A;  2G93 A;  3ONM A;  1A54 A;  1IUD A;  1OMP A;  2REG A;  1B5J A;  1FQC A;  3LR1 A;  2XD3 A;  4JSD A;  3CFL A;  4AQ4 A;  2NWJ A;  3F11 A;  5ICQ A;  4X1B A;  5DEX A;  1YTV A;  2H5Y A;  1MY0 A;  3PUY E;  4R9G A;  1Y20 A;  4YKJ A;  2O7I A;  1PC3 A;  4MF3 A;  2CZL A;  1AOV A;  1MS7 A;  1N04 A;  2DVZ A;  2AL4 A;  3SEU A;  5I2N B;  4NF8 B;  3CFZ A;  2DWA A;  4H8J A;  1LCT A;  5AE4 A;  3RGY A;  1B7H A;  5I58 A;  2ZXT A;  4IGT A;  4PFU A;  4KFQ A;  5I2N A;  1LLS A;  2CMO A;  5HM4 B;  2VGQ A;  4EUO A;  1PB9 A;  5CI5 A;  3K1P A;  1UIU A;  4KI0 E;  3IR1 A;  4OMB A;  4JWX A;  1B46 A;  3U72 A;  1N3X A;  4PQJ A;  1OIB A;  3DP6 A;  4H1X A;  1SBP A;  3QSL A;  2XHD A;  1QKA A;  1GTK A;  4F3G A;  1GV8 A;  3MW0 A;  5HPQ A;  2V84 A;  2F36 A;  3QUF A;  2DE4 A;  3MP1 A;  4YB6 A;  4R2B A;  3S9L C;  1XC1 A;  1PB7 A;  3OSQ A;  3VE1 B;  2UVH A;  4UAC A;  2A5T A;  3RPW A;  3FVN A;  1A40 A;  1IXI A;  3PUV E;  3D4C A;  3Q27 A;  2DP8 A;  1B5I A;  1MQG A;  2M8C A;  4X48 A;  4LQ2 A;  4PFW A;  1I6Q A;  3M8U A;  3C33 A;  1LBC A;  1PEB A;  1UTB B;  4RK2 A;  3IJO B;  4HCW A;  2D5W A;  1Z7N E;  2PVU A;  3JV9 A;  5H8H A;  3M3F A;  3SEY A;  3SET A;  4KD5 A;  2F34 A;  2HXW A;  3RNN A;  1TT1 A;  1EZ9 A;  1PBP A;  2G29 A;  2VOZ A;  1UTB A;  3ZKK A;  4M4G A;  5BWJ A;  4NWD A;  2A5S A;  3E13 X;  2I4B A;  4R6Y A;  2RIN A;  1LAG E;  3OSR A;  3S9N C;  4QHQ A;  5AA4 B;  3IOT A;  3IOV A;  2P1S A;  1A55 A;  1NH7 A;  2DQV A;  3ODB A;  3V83 A;  2AYS A;  3MVX A;  1XHY A;  3L6G A;  1ZLQ A;  2XXP A;  3UOR A;  2O7U A;  5F1Q A;  5AA4 A;  2F8D A;  1ZU0 A;  3R7X A;  2X26 A;  2I3W A;  3E4R A;  3E9X A;  3K6V A;  4YMA A;  1B7U A;  3G3I A;  2R71 A;  3K6W A;  2QJE A;  4IY5 A;  3OEL A;  1PBQ A;  5CMM A;  1P99 A;  3MVY A;  4N13 A;  1H45 A;  3G3K A;  3G3J A;  1LGB C;  2XXH A;  4Q30 B;  2HCA A;  4GXA A;  2FYI A;  3SDF A;  3Q29 A;  4XIG Q;  1M5E A;  4EQB A;  3MPK A;  2UYF A;  3T9U A;  4NTL A;  3HCQ A;  3TTR A;  3CSB A;  3IX1 A;  2R9J A;  3W9V A;  4YKP A;  4KHZ E;  1US4 A;  3OXN A;  1IXC A;  4GF8 A;  3K02 A;  1H3D A;  5LOM A;  1QUI A;  4F19 A;  3O2A A;  1XOC A;  2XX9 A;  4E0X A;  4ESX A;  2QPQ A;  1ZKB A;  4C0R A;  4ONY A;  1RKM A;  1SW2 A;  5CRY A;  4QSD A;  1WDN A;  3O66 A;  1VR5 A;  1O63 A;  3FVG A;  3TOD A;  3ECR A;  2DE3 A;  3SEW A;  3DP4 A;  2XD2 A;  4NF4 A;  4E0W A;  2O69 A;  4FE8 A;  3H6T A;  3KJT A;  1Q1K A;  4ND9 A;  3ILU B;  3N5L A;  4I1D A;  2OZZ A;  2NUV A;  2Q2C A;  2DE2 A;  1L5T A;  1SW1 A;  1QVS A;  1B05 A;  2OLB A;  2OWT A;  1QUJ A;  1JQF A;  2PMS A;  2F6G A;  3VV5 A;  4FOR A;  3FGS A;  3VVD A;  3MVW A;  3RUM A;  3T9H B;  3V8X B;  3SER A;  2Q2A A;  4U2R A;  2OWS A;  4JBZ A;  1MM6 A;  2Z22 A;  1B4Z A;  3KG2 A;  3W9W A;  4K3F A;  1JW4 A;  3TUS A;  2RCA A;  1URS A;  3EN3 A;  2PT2 A;  3TFL A;  1QUL A;  4H5F A;  4OEU A;  4OTE A;  3KN7 A;  4ZE9 A;  4KCC A;  1LFI A;  4F2Q A;  4KCD A;  4EDP A;  5JEI A;  2VD2 A;  3CG3 A;  3HHG A;  1IQ7 A;  3O9P A;  4HCY A;  4QRZ A;  3TEL A;  1B2H A;  5A5X B;  2XXV A;  4RPO A;  3UA8 A;  4F1V A;  4MLV A;  3C4M A;  3OEM A;  3PUZ E;  1WOD A;  2XX8 A;  4RY1 A;  4WED A;  4RXL A;  1LAF E;  3Q25 A;  4IO7 A;  3TMG A;  2WKY A;  5A5X A;  3K4U A;  3M3K A;  3N94 A;  4JB7 A;  1B32 A;  3CIJ A;  1TFD A;  5DTB A;  1SW5 A;  1P1N A;  1NFT A;  2Y7I A;  5DT6 A;  4NF5 B;  5KCJ B;  1TXF A;  4R2F A;  4ISU A;  4ELR A;  2ZYK A;  3U1O A;  1IEJ A;  3MP8 A;  3THI A;  3UP9 A;  1NKX A;  4UA8 A;  3MC2 A;  2H99 A;  2V3Q A;  1S50 A;  5I84 A;  2ZYN A;  2Q9T A;  1MH4 A;  3VDF A;  2QRY A;  4FJP A;  4QFN A;  5KCJ A;  2DVC A;  4KR5 A;  4GL8 A;  1FTM A;  2I4C A;  4THI A;  3HN0 A;  3KGC A;  1P1U A;  4ELO A;  3T66 A;  1VFE A;  1CE2 A;  1HSE A;  2F7A A;  1JNF A;  3FJM A;  3HO7 A;  4F1Y A;  3P7I A;  4P0I A;  5EHS A;  3FV1 A;  4YAH X;  1R9Q A;  1A8E A;  3UN6 A;  3MZ9 A;  2OCU A;  2QSX A;  1MXU A;  2XXR A;  4F2O A;  2VP1 A;  1Q35 A;  4ZED A;  3K01 A;  1FQB A;  5H8Q B;  3FZV A;  2IEE A;  4QFL A;  3BFU A;  1AMF A;  2HQ0 A;  4O3B A;  1US5 A;  3FIR A;  4I9D A;  2OK2 A;  3ILT B;  1SD3 A;  4ESW A;  3QYT A;  5H8S A;  4F1U A;  2HAV A;  2DXR A;  3T22 A;  1B52 A;  2DWI A;  1NNF A;  4ZZE A;  4OEV A;  3CFX A;  3TEP A;  2O51 A;  5I2K B;  4JWY A;  3GBB A;  4QFK A;  1Y1M A;  2V3U A;  1FTO A;  1UTH B;  4DCY A;  4NF8 A;  2RC7 A;  2I0C A;  1B0L A;  1EU8 A;  3VLW A;  4F31 B;  5I2K A;  3AXF A;  4O3C A;  3RQT A;  2I49 A;  5CMB A;  2RC9 A;  3VVF A;  2PX1 A;  3N6T A;  3T9X B;  3FD3 A;  4GVO A;  1SDX A;  1MQD A;  2ABH A;  1YCJ A;  2B3F A;  5CBR A;  1OLC A;  1RYX A;  2QS4 A;  1VSO A;  4LUB A;  4GOT A;  4RJZ A;  1SVX B;  4RA1 A;  4LZ8 A;  3V5A A;  3KSJ A;  3RTW B;  1P1O A;  1B3G A;  1LBB A;  5AA2 B;  5EYF A;  1JET A;  3FAT A;  3OO9 A;  3H6V A;  4X1D A;  3FV2 A;  2UVI A;  3QIM A;  1MXX A;  4XKN A;  5I57 B;  4LZ7 A;  4YB5 A;  3QAX A;  5AA2 A;  3VLU A;  2XXU A;  5KZT A;  4PFY A;  3PMV A;  3DEL B;  1OQG A;  4LP2 B;  1A99 A;  2I48 A;  4JWO A;  5I57 A;  4FAT A;  1ZMG A;  3QUJ A;  5K2X A;  3K1N A;  4OZ9 A;  1R6Z A;  4BDO A;  3VVE A;  3TTK A;  4HTG A;  1MXZ A;  1ATG A;  2GRV A;  4H65 A;  3HST A;  1HSL A;  4F3P A;  2Z8E A;  1MXY A;  1MY2 A;  2XXW A;  2QS3 A;  4BDM A;  2V93 A;  1FTJ A;  4AB6 A;  1SI0 A;  1YAE A;  2XXX A;  5I56 B;  3O29 A;  3H4Z A;  1QW0 A;  4H67 A;  3A3U A;  1SQY A;  4Q5T A;  5L8D A;  3MJN A;  1B6H A;  4HS7 A;  2HAU A;  2ZYO A;  4R6K A;  3G3G A;  2P2A A;  3S9M C;  3GBA A;  3K1M A;  1SI1 A;  1JEU A;  3DM0 A;  5CMC A;  4KPT A;  5CC2 A;  3G7W A;  4U4S A;  3KN3 A;  1P1W A;  5H8F B;  4Q0C A;  3C31 A;  4F39 A;  2B65 A;  2ZNS A;  2HZL A;  3KOT A;  2RCB A;  3KN8 A;  3GXA A;  1R9L A;  4ZEF A;  5KDT B;  1B51 A;  5HBC A;  2V3T A;  1M5D A;  2QMW A;  3LSF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...