3G7WA

Islet amyloid polypeptide (iapp or amylin) residues 1 to 22 fused to maltose binding protein
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
393
structure length
393
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAKCNTATCATQRLANFLVHSSNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structures of IAPP (amylin) fusions suggest a mechanism for fibrillation and the role of insulin in the process
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein, hormone
molecule keywords Maltose-binding periplasmic protein, Islet amyloid polypepti
total genus 123
structure length 393
sequence length 393
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g7wA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g7wA01
3JZJA 2ABHA 3OENA 3KGCA 3OSRA 4GL0A 1RKMA 3T9HB 4NWDA 4OWDA 4F19A 2O7IA 1RYOA 1Y9UA 4XTCQ 3TCFA 4I1DA 4C0RA 4TQUQ 4EF1A 3EQ1A 4YICA 1BP5A 2GFEA 1XVYA 1SI1A 3GXAA 3MP1A 2Z8EA 2IA4A 2UYFA 4OETA 5TU0A 4H0WA 4DXCA 3MPKA 1N84A 1QJMA 4F1YA 2Y7KA 4F39A 3PD8A 4POXA 1QUKA 5CC2A 3KBRA 3LC8A 3K6WA 4RNSA 4AB5A 3H4ZA 5L9OA 2QMWA 3ILTB 3MJNA 4E0WA 4F3GA 1F9BA 2B65A 1EZ9A 3PGFA 1HSLA 5I56B 3I6VA 4OYVA 4GVOA 4M4GA 3TQLA 5H8QA 1N3WA 4GRKA 3EF7A 3TYHA 3FV1A 3TCGA 1IIWA 4KCDA 1ZMGA 3IOUA 4RY1A 5H8HA 2XXIA 4KYSA 4N07A 3RGYA 2F6PA 5H8FA 3OELA 3GBBA 1MXVA 3S9NC 3VVFA 5K2XA 2NUVA 1B51A 1N7WA 3G3IA 2OCUA 4X9TA 1TWYA 1ZIUA 5CRYA 3VXCA 1PB8A 2QMXA 2ZYKA 1SQYA 3C33A 3IR1A 2RKMA 1UTHA 4OTEA 4PETA 2XXYA 4WKMA 2UVGA 2VP1A 3DP6A 4R74A 5H8FB 3U94A 4P11A 1MPCA 3TPAA 4DCXA 2P0SA 5KDTB 2I0BA 4YKIA 2CZLA 3H06B 2H25A 4EXKA 1B3LA 3V5AA 4OERA 1MG1A 2HXWA 3KJ7A 1A8EA 1ZLQA 2DSFA 3CSGA 4ELOA 4H1XA 2QS2A 2F7BA 4F22A 4R6HA 1FQBA 3CFZA 4RK9A 3TKDA 1OMPA 1US4A 1LCFA 1A40A 3OO8A 4IB2A 2ALUA 4IO4A 4PFUA 1B7HA 3T96B 4YMAA 2O1LA 4KCCA 1ZJLA 4G77A 4LP2B 4MFIA 2Q88A 3EN3A 1R1NA 2FA7A 2DYXA 3OXNA 1O64A 1LSTA 5ISUA 1H3DA 4ZECA 5HBCA 1SW1A 5TPAA 2DWIA 4GFRA 1AOVA 2XXXA 4NF6B 3IB0A 4BDNA 2XX7A 3QIMA 2R9JA 1NNTA 1URDA 3K6UA 1I69A 3TTMA 5ITPA 2VHAA 4R72A 1P1OA 3IORA 4LVQA 1L5TA 5IKBA 1R6ZA 1MY1A 2AL4A 1MXWA 1UTBA 1B52A 3P7IA 4LATA 3IK6B 4YB6A 1J1NA 3MAMA 4UACA 2OLBA 4GXAA 4H65A 4NF5A 4TLLB 5B70A 1VFDA 1ZU0A 2Y7IA 2DE2A 2VGQA 3FZVA 3W15C 1LAFE 3MW0A 4JWOA 3MVZA 3MC2A 1P1QA 2DWAA 4LZ7A 1H44A 3O2AA 4DCYA 4LZ8A 1LBCA 1SW5A 3FJGA 3Q25A 4L17A 3KG2A 3KSXA 5L9SA 2YPNA 4KR5A 2ZYNA 3CRBA 2ZNTA 1D4NA 4PFYA 4U23A 4GQOA 2A5TB 4KI0E 2ZNSA 3RLFE 3TDJA 1EH3A 4ECFA 3OEMA 4HTGA 2XXQA 5CMCA 2THIA 2UVJA 1NKXA 4ESWA 2HFBA 3HHGA 1CE2A 1M5FA 4NF8A 3U72A 2ZMBA 4MLVA 2H98A 1UQWA 1MM6A 1OVBA 1BLFA 2V3QA 3MVWA 1MXXA 5DYHA 4H8JA 1UTHB 3VVEA 1OLAA 3OOAA 1HSEA 5AA2B 3G3HA 2ANJA 4FATA 3CFLA 2CMOA 2O68A 1VSOA 3O97A 2O1MA 2RC9A 1OIBA 1DPEA 2F7CA 3E3KA 3OMBA 3PPRA 4R2BA 1PDAA 1B3EA 3IOWA 4LONB 4NF8B 3M8UA 1M5EA 5CMMA 3TTKA 3R7XA 2F7AA 4DDDA 2VOZA 2HZKA 2Y7WA 1Y1ZA 1Y3PA 4X48A 2F6GA 3FVKA 4LA9A 4Q0CA 3SETA 4EQBA 2G93A 1B1HA 3PU5A 5AA2D 1MQGA 2QJEA 1B5IA 3L6HA 2OZZA 2F36A 1FTOA 3MZ1A 3Q28A 3M3FA 4I8CA 2UVHA 2D5WA 1O63A 1B0LA 4R9GA 1SDXA 4I62A 2I49A 1O7TA 3N5LA 3GLBA 2V3TA 3KOTA 2AYSA 3KN8A 5M2VA 1S50A 3GZGA 3Q26A 4XKPA 1MDP1 4FJPA 5ELVA 1FQEA 3TFLA 5I59B 3VE1B 1B3GA 3W9VA 3PV0E 3N6UA 1A55A 1OQGA 3N94A 5ICQA 3E4RA 1Q1KA 5H8NB 2I58A 4ZZEA 3TTNA 2GHBA 1SVXB 1B0HA 2DVZA 3LSFB 1PBQA 2FYIA 2QSXA 4Q8RA 3OEKA 2DE3A 2RC8A 2REJA 1S9TA 3O66A 4GWOA 5JTYB 2F35A 2UVIA 3FXUA 1IXGA 1IITA 5JK4A 3THIA 1EZPA 5I58B 3I5OA 2DWJA 1GR2A 2Q9TA 4O3AA 2A5TA 3F11A 2QS4A 4ZEKA 3TQWA 3PUVE 3TODA 3IAZA 5KCJB 1ATGA 2NVUB 5I2KA 4EF2A 3B6QA 1JW5A 4OVJA 4HW8A 1R9QA 3K0VA 2Z22A 3DP8A 4QFLA 4JWXA 3SDFA 3S2VA 3TTLA 1D3KA 3CI8A 1TFDA 2I4BA 2PT1A 1PB7A 1MQIA 3C31A 3IJXB 4OFLA 1PB9A 3UA8A 3PMXA 5I57B 1LAGE 3Q27A 2V25A 2XHDA 3VLWA 5I2NB 3K6VA 4BLAA 2I3WA 3Q29A 2DWHA 3K1NA 4GLIA 1IZ1A 5F1QA 1IXIA 2HCAA 3EHSA 2XXHA 3FV2A 4ZE8A 2P2AA 5AA4B 1Y20A 4UA8A 2Y84A 4GF8A 4JXIA 3U93A 2GH9A 3TUSA 2YJPA 5KDTA 4BDMA 4PP0A 2B3BA 3FIRA 1P1UA 3CIJA 2RCBA 3PPNA 4MLQA 3OD7A 4IY5A 3K1MA 2HAVA 1MDQA 1LLSA 4TLMB 4RPNA 1LFGA 3G3JA 4HCWA 5H8HB 1Y3NA 4YKKA 5I2NA 3G3FA 4ZEIA 3S9MC 5A5XB 1BTJA 3B6TA 4R9FA 4JDFA 4RYAA 4ZE9A 2F78A 1M5BA 3CG3A 4H6DA 5TP9B 3MWBA 4THIA 1KWHA 1XVXA 3C4MA 3VLUA 3FASA 3FXRA 3OO6A 1VFEA 3BBRA 5CBRA 4EQ7A 3O6IA 3UIFA 2XXPA 3PPQA 4C1TA 3UK4A 5KCJA 1LGBC 3MQ9A 1POY1 1EZOA 2ZXTA 3HV1A 4IO2A 3DLNA 3H6WA 1LB8A 2Q2AA 4MF3A 2OK2A 3RY3A 5EYFA 1HSJA 1LFIA 3PUYE 2I6EA 4F1VA 1MY4A 1MY0A 1FTLA 3LSLA 4IY6A 4QFOA 4BDLA 5IAIA 3OO7A 3C32A 1XT8A 1UIVA 2IEEA 4LZ5A 1VE4A 2NOOA 2ZNUA 3LBSA 4NWCA 4YMBA 2O69A 3LR1A 3QUJA 1FTMA 4IGRA 5AA4A 1DPPA 4ZEDA 5J1DA 2D3IA 3E13X 4FORA 4LUBA 1Q35A 5FHMA 4GIZA 2O84X 4F2OA 4FEDA 1SYIA 1B46A 2PT2A 3H3GA 3MP6A 2FNCA 4G2ZA 4ONYA 2XX8A 4OHNA 3B6WA 3EPEA 5H8QB 4NE4A 1P1NA 2VD3A 3PD9A 4FECA 4XKNA 4IGTA 5DTBA 3CR9A 1JQFA 4NTLA 1MPDA 2ESNA 4ZEBA 1DTGA 3KJTA 2QL3A 3MBPA 4LQ2A 4O3BA 4GXSB 1B2HA 4U4XA 2E0SA 3SKPA 4U1OA 2H5YA 3EHUA 4FEBA 4YKJA 2HZLA 1Y4TA 2XD2A 4YB5A 5ITOA 4G68B 4JWYA 3VV5A 4BDRA 4F31B 1MS7A 3HPIA 3S9EA 4R6KA 5AA1A 3VXBA 4PQJA 4DZ1A 1FQDA 2F5XA 4ND9A 2W7YA 4DXUA 1YCJA 2KLFA 2Z8DA 4NMYA 1PBPA 3IO6A 3S4UA 1B5JA 4F18A 5CBSA 3I3VA 3FVNA 4RXLA 1ELJA 1H43A 3QSLA 2H9BA 3U8QA 3FD3A 5KZTA 3G7WA 3SERA 4ELQA 1NMUA 3QYTA 3SEYA 4QF9A 1NNPA 3B7DA 3FVGA 1YTVA 1N7XA 2P1SA 1OVTA 4R73A 4RK2A 2X26A 3IB1A 4QSEA 5FHNA 1QULA 2O7UA 2XXRA 3PMVA 4FIMA 1SBPA 4PFTA 3ZKKA 1JVYA 3H03A 5L8DA 1GGGA 2PBWA 3O29A 4ISUA 1B7UA 2RINA 4QFNA 1B3HA 1B6HA 1YPNA 4ZEFA 3RN8A 3T93B 1AL3A 4IO6A 2R71A 5TP9A 2DVCA 2GRVA 4QFPA 1H76A 3BFUA 1JNFA 2Q2CA 3DM0A 3D4CA 3IOTA 2LAOA 3K01A 4H67A 4OXVA 5H8SA 3T66A 1Y4CA 3VFJA 1PC3A 2F34A 1QKAA 2UYEA 4XKRA 2O51A 3SEXA 2ONRA 2QS3A 1FCKA 1II5A 1JETA 2V84A 2F97A 4G8HA 4Z0IA 3R26A 1B05A 1NNKA 3IL1B 3SEUA 4G4PA 3PUXE 2Q89A 4JSOA 1JW4A 4OESA 2R6GE 3FATA 1H45A 1MQHA 3K6XA 1DOTA 1AMFA 1B1XA 3T9XB 2NXOA 3ZKLA 4NEDA 2I0CA 5EHSA 3CSBA 3MVXA 3RNNA 1LBBA 4POWA 3A3UA 4U21A 4E0XA 1I6BA 3FXQA 2DQVA 1MH4A 2BJJX 4I9DA 3KEIA 5BUUA 3RTWB 3RT6B 1FTKA 2ZYMA 5I56A 3MZBA 1YAEA 2I48A 2PMSA 3U92A 4EUOA 3O9PA 5DEXB 4X1BA 1NNFA 1A54A 3K2DA 4ESXA 4YAHX 5JEIA 3O6HA 5LOMA 3V89B 2H99A 1MH3A 3MZ9A 4IO3A 4ELPA 3JYRA 1TT1A 3IJOB 1JEVA 1M5CA 1FTJA 3E9XA 3H6VA 4NF4A 2PX1A 4DE8A 4Q30B 4F3PA 3HCQA 4Q5TA 5I58A 3LSXA 5AA2A 2DE4A 3TMGA 1D9YA 2ONSA 4NF5B 4R75A 1POTA 3H6UA 3G3KA 5H8NA 2YLNA 1P99A 2GHAA 3SEWA 1A99A 1UTBB 1WVJA 4KD5A 3JV9A 2DP8A 1SD3A 2XXTA 3N26A 3N6TA 3L6GA 1LB9A 3IOVA 2Q8JA 1XC1A 2PYYA 4NF6A 4PFWA 2HQ0A 3FGSA 3M3KA 4QHQA 3RPWA 3ODBA 4LQ5A 4OFJA 5TPAB 1OQHA 4C1UA 4FE8A 3K00A 4H5GA 4ZDMA 4NF4B 2Y7PA 2I4CA 3RQTA 3W9WA 3ONMA 3VDFA 3TELA 1LFHA 1IUDA 3PUWE 1ZTYA 1TFAA 2HAUA 3FJ7A 1S7YA 1FQFA 2I3VA 4H5FA 2X7PA 1MPBA 1JVXA 1SYHA 2HEUA 2Y7RA 4IO7A 2DXRA 3D4GA 3KZGA 4DIGA 4F3BA 5FTIA 1Y3QA 3QAXA 3WAFA 1JW1A 1AIVA 1QKBA 1AH5A 1A7LA 3LUYA 4DXBA 3G3GA 1XHYA 4R6YA 2OJTA 2Z8FA 1DSNA 1NL5A 1USYE 2ZYOA 3A09A 3PMWA 4KQPA 4PE5B 4QRZA 4U1ZA 3WAEA 4WEPA 3C35A 1T0KA 3KN3A 4IO5A 4YZZA 1P1WA 2QPQA 5B7DA 1B7ZA 2VD2A 5DVJA 3S9LC 1SI0A 2RC7A 3IB2A 5DVFA 3RUMA 1URGA 1DTZA 4OFOA 3SESA 5HM4B 1B40A 1MM7A 1IXCA 3TCHA 5I84A 4H8IA 2G29A 3ECRA 4N13A 3PPPA 2QS1A 1IEJA 5F7VA 1Z7ME 3UGWA 4XIGQ 1B5HA 1N76A 4EXLA 3HO7A 3PUZE 3PPOA 4QSCA 3BKIB 3FVOA 2XXUA 1M5DA 3M3LA 1MQDA 2XD3A 3MUQA 4EDPA 1MXZA 3TEPA 4XKQA 4P0IA 5DT6A 3ZS6A 3HSTA 2WKYA 1FW0A 1MRPA 2F8DA 1I6QA 3OSQA 4GD5A 3H6TA 3KSJA 4OENA 3KFMA 5FTHA 5CM6A 5HPQA 4WEDA 2OWTA 3KN7A 2NWJA 1Y1MA 4GOTA 3RT8A 1MY2A 4DLDA 3C36A 1SW4A 3LSWA 1IXHA 4YU0A 3CG1A 2A5SA 4KPTA 5CI5A 1VR5A 5AE4A 2DOJA 2QRYA 2H4IA 4P0GA 1NH8A 1PEBA 1QUIA 1ZKBA 3U1OA 1B32A 4O3CA 1DMBA 1JEUA 4U2RA 5CMBA 5CMKA 3K4UA 3K1PA 2M8CA 2XXWA 2AIXA 3KOSA 5K2YA 3C34A 3TZAA 5DVIA 3DELB 3MP8A 1RYXA 2OBGA 5FHOA 3ZSFA 4X1DA 3VLVA 3FJMA 4BDOA 4K3FA 1NH7A 4YKPA 4JB7A 1SW2A 4R2FA 3ILUB 1GV8A 3V8XB 2ONKE 3HHFA 2XX9A 4BDQA 3T9UA 3HN0A 5A5XA 3AXFA 1URSA 2X7QA 4RPOA 3A3CA 4ZZAA 3V83A 1US5A 5DEXA 3C9HA 5I59A 4XXUA 2E1SA 4OEUA 3EHTA 1BKAA 3UN6A 1R9LA 1FQAA 4GL8A 1BIYA 3UORA 5BWJA 4U22A 1QW0A 1FQCA 3GBAA 4OQOA 3FUZA 1ANFA 4G8MA 4TOZA 2OWSA 4RJZA 1N3XA 1IQ7A 1B3FA 1I6AA 2Z23A 4MH5A 5EHMA 1XOCA 4ZS9A 2DXYA 1WDNA 3CVGA 1TXFA 4G68C 4Z7EA 5AA3A 1N0TA 1OLCA 1LAHE 2RF1A 4ELRA 4KHZE 4YB7A 4MBPA 1USYH 3H7MA 2REGA 4WXJA 3MVYA 3R6UA 3IX1A 1B4ZA 3CFXA 1A8FA 4OZ9A 3K02A 1LAXA 3BFTA 4KYDA 1ZBMA 1UIUA 1QUJA 4HCYA 3T9VA 2DS9A 3USDA 3IO4A 1D9VA 3UP9A 1B58A 3DP4A 3QK6A 1GVCA 1QVSA 2RCAA 1MXUA 4HS7A 4F3SA 4OMBA 2XXVA 1XS5A 4G8NA 1WODA 3O28A 3TTRA 4G68A 2AL5A 1N04A 2UXAA 1GTKA 2D21A 4KFQA 3RTFB 3VVDA 3O6GA 5I2KB 1MQJA 2V93A 4JBZA 4QFKA 4U4SA 4RA1A 5I57A 1CB6A 3OO9A 5ICTA 4M1VA 4EQ9A 4JSDA 1B4HA 3QXMA 1EU8A 4F1UA 1Z7NE 1B9JA 4QSDA 3SEVA 1LCTA 2PVUA 5JTYA 2O6AA 1NFTA 3QUFA 3T22A 2V3UA 4F29A 4F2QA 2B3FA 4KYEA 5L9MA 4OEVA 1MXYA 4AB6A 4N6PA 4AQ4A 4FAJA 3MPLA 3TAJA 1MY3A
chains in the Genus database with same CATH superfamily
3OENA 1RKMA 4NWDA 1Y9UA 4C0RA 4FBPA 4TQUQ 1G0IA 4GX3A 1XVYA 1SI1A 2UYFA 4H0WA 4F1YA 2XWIA 1INPA 4AB5A 5IM2A 3H4ZA 5L9OA 2QMWA 2XXKA 1HSLA 4GVOA 4M4GA 1N3WA 3FV1A 1IIWA 4KCDA 1LBXA 3SEXA 3RGYA 3OELA 2NUVA 1ZIUA 3VXCA 4WKMA 3DP6A 2WBBA 1IMAA 5KDTB 2H25A 3V5AA 4P9KA 1A8EA 1ZLQA 2QS2A 3IFAA 1FQBA 2O1LA 4KCCA 1ZJLA 3EN3A 2DYXA 5ISUA 1SW1A 1AOVA 2XXXA 3QIMA 1NNTA 1I69A 2VHAA 4OANA 1P1OA 4R72A 4LVQA 5IKBA 1R6ZA 2AL4A 3A29A 3P7IA 4NF0A 3MAMA 4NF5A 4TLLB 1VFDA 2DE2A 4PDDA 4KXPA 4L17A 3Q25A 3KSXA 4U23A 1D4NA 3OEMA 4HTGA 5CMCA 2UVJA 4ESWA 2HFBA 4MLVA 2H98A 4O94A 1BLFA 2V3QA 3MVWA 4H8JA 5AA2B 4FATA 2RC9A 1OIBA 4R2BA 1PDAA 1B3EA 4HE0A 1FBDA 1Y3PA 4X48A 2F6GA 4LA9A 4EQBA 5JEIA 2WX9A 3PU5A 3L6HA 4I8CA 1FTOA 1B0LA 2I49A 3KN8A 3GZGA 3Q26A 3W9VA 3PV0E 1OQGA 5H8NB 2Q8MA 2DVZA 1PBQA 2FYIA 2QSXA 3OEKA 2DE3A 2RC8A 3O66A 1NUWA 4GWOA 2F35A 2UVIA 5JK4A 1GR2A 3F11A 4ZEKA 4HW8A 4QFLA 3TTLA 1D3KA 2PT1A 3IJXB 4OFLA 1LAGE 2V25A 2XHDA 2DDKA 3FV2A 2P2AA 3T1BA 5KDTA 4PP0A 1FJ9A 5IZ1A 2VPNA 4MLQA 4IY5A 4TLMB 4HCWA 4YKKA 5I2NA 3G3FA 3B6TA 4R9FA 4O7MA 4GBVA 4H6DA 1CNQA 3MWBA 4N4UA 2L5VA 2QVVA 1VFEA 2XXPA 5KCJA 4C1TA 3UK4A 1LGBC 2ZXTA 4MF3A 1LB8A 3RY3A 1MY0A 4BDLA 2XWVA 4NWCA 4P3LA 2O69A 3LR1A 5AA4A 3E13X 4LUBA 4FEDA 3MP6A 2FNCA 4ONYA 2XX8A 3B6WA 1P1NA 4XKNA 5DTBA 3CR9A 1JQFA 2FIXA 1B2HA 4U4XA 3SKPA 4FEBA 2XD2A 3HPIA 4R6KA 5AA1A 1K9YA 4DZ1A 5F24A 2F5XA 4ND9A 1PBPA 1B5JA 4PF8A 5CBSA 5KZTA 3U8QA 1NMUA 3QYTA 4QF9A 3B7DA 1N7XA 4PFBA 2O7UA 4FIMA 3PMVA 1SBPA 1GV8A 3TTKA 1B7UA 4ZEFA 4QFNA 1AL3A 4IO6A 2R71A 4P1EA 2GRVA 1JNFA 3IFCA 1SPIA 4OXVA 4DLDA 1Y4CA 5BWJA 2F34A 2ONRA 1JETA 4G8HA 1NNKA 4OESA 3FATA 1MQHA 3K6XA 1DOTA 1B1XA 3A3UA 1I6BA 2BJJX 2I48A 3U92A 5DEXB 4X1BA 5ESYA 1A54A 3O6HA 1MH3A 3MZ9A 1NV0A 3E9XA 4Q30B 3LSXA 2ONSA 3JV9A 3N6TA 1SD3A 5J16A 3IOVA 1XC1A 4PFWA 4QHQA 4C1UA 4FE8A 5I7IA 4P47A 2Y7PA 3ONMA 5LDZA 2HXRA 1S7YA 1MPBA 1SYHA 4X04A 2DXRA 4DIGA 1LBYA 1Y3QA 5FTIA 3WAFA 1AIVA 4XFEA 3G3GA 4R6YA 5M2VA 3PMWA 4KQPA 4WEPA 4YZZA 4PFIA 2RC7A 1NV7A 1DTZA 4MAGA 5HM4B 4H8IA 4N13A 5F7VA 1Z7ME 3UGWA 3FVOA 1MXZA 3ZS6A 2WKYA 4O7IA 3KBZA 3OSQA 1FPEA 3KSJA 2OWTA 3KN7A 2FIEA 3RT8A 2H4IA 1QUIA 5CMBA 5IZZA 3K4UA 3KOSA 4H45A 5K2YA 5DVIA 4X1DA 4BDOA 4YKPA 4R2FA 3ILUB 2ONKE 2XX9A 3C9HA 4XXUA 3EHTA 1R9LA 5L8DA 1FQCA 4OQOA 4TOZA 1I6AA 5EHMA 5AA3A 4Z7EA 4JVIA 1OLCA 4GWZA 4MBPA 2REGA 4WXJA 3MVYA 1LAXA 4KYDA 1FRPA 1QUJA 4PAIA 4HS7A 2Y5KA 4OMBA 1XS5A 1N04A 2UXAA 3RTFB 2D21A 3VVDA 2V93A 5ET8A 4M1VA 1B4HA 3QXMA 3SEVA 3QUFA 5T3JA 4F2QA 4KYEA 1MY3A 3JZJA 3KGCA 4OWDA 4XTCQ 3LV0A 4I1DA 1FPBA 2Z8EA 4OETA 4DXCA 1N84A 2Y7KA 4F39A 3PD8A 5CC2A 3LC8A 4RNSA 4E0WA 4F3GA 1F9BA 3PGFA 3I6VA 3TQLA 5H8QA 3IOUA 4QBAA 5H8FA 1MXVA 3VVFA 1N7WA 2OCUA 1PB8A 2QMXA 2RKMA 4MHFA 4PETA 5H8FB 2UVGA 3U94A 1MPCA 3TPAA 4DCXA 2P0SA 2CZLA 4OERA 1MG1A 3KJ7A 5ET6A 2F7BA 4OVPA 3TKDA 4IB2A 1A40A 1B7HA 4MFIA 3OXNA 1O64A 5TPAA 1EYKA 4BDNA 5ITPA 1B52A 4LATA 1J1NA 4GXAA 3FZVA 2Y7IA 2VGQA 3W15C 4JWOA 4MEVA 2DWAA 1H44A 4PFYA 2ZNTA 2A5TB 4KI0E 1EH3A 3HHGA 1CE2A 1M5FA 1KA1A 1MM6A 1OVBA 1UTHB 3VVEA 1YYZA 3OOAA 3G3HA 2ANJA 3O97A 3E3KA 4LONB 1M5EA 5CMMA 2VOZA 2Y7WA 1NUYA 3FVKA 4Q0CA 5AA2D 1B1HA 2QJEA 3MZ1A 3M3FA 4GWYA 2UVHA 1O63A 4XKPA 5I59B 4FJPA 1FQEA 3VE1B 1B3GA 3N6UA 3TTNA 4PAKA 2REJA 3FXUA 1EZPA 5I58B 3I5OA 2DWJA 2A5TA 5KCJB 3IAZA 2NVUB 5I2KA 4EF2A 1JW5A 4OVJA 1R9QA 2Z22A 3DP8A 3SDFA 4QXDA 1TFDA 3MYUA 5I2NB 3K6VA 4BLAA 2DWHA 3K1NA 3FBPA 4GLIA 4ZE8A 5AA4B 1Y20A 2CZHA 4BDMA 3PTYA 3CIJA 4G61A 2RCBA 2WEFA 1D9QA 2HAVA 1MDQA 5H8HB 1LFGA 4GWUA 4JDFA 4ZE9A 1M5BA 4THIA 4MX6A 2CEYA 5CBRA 4EQ7A 3O6IA 1VDWA 3UIFA 3MQ9A 2Q2AA 2I6EA 2KR0A 4F1VA 1MY4A 1FTLA 3LSLA 3OO7A 3C32A 2ZNUA 3LBSA 4GBWA 3E78A 5J1DA 2D3IA 4FORA 5FHMA 4GIZA 2O84X 4PC9A 5H8QB 4G2ZA 1FPLA 4OHNA 3PD9A 4FECA 4DI3D 4NTLA 1MPDA 1DTGA 2QL3A 2E0SA 4U1OA 2H5YA 3EHUA 4BDRA 5ITOA 4G68B 1MS7A 3E79A 2KQZA 1YCJA 2Z8DA 3IO6A 2F3BA 2H9BA 1NNPA 3FVGA 1YTVA 2P1SA 4R73A 4QSEA 3IB1A 5FHNA 1QULA 2XXRA 1JVYA 2PBWA 4ISUA 1YPNA 1H76A 3BFUA 2Q2CA 3T66A 5H8SA 3VFJA 4F29A 2UYEA 1QKAA 2O51A 2QS3A 1IMBA 1FCKA 4Z0IA 3R26A 1B05A 3SEUA 1YZ0A 2XA5A 2Q89A 4JSOA 4H46A 4MNPA 1NV2A 4NEDA 4PGPA 2BJIA 3CSBA 1LBBA 4POWA 4I40A 4NHBA 3KEIA 5BUUA 3RT6B 1FTKA 1IMFA 5I56A 2PMSA 5IZ3B 1JEVA 3H6VA 1FTJA 4NF5B 2XWOA 3G3KA 5H8NA 3SEWA 1P99A 2GHAA 1A99A 3N26A 3UP9A 4NF6A 3ROJA 4OFJA 1RDZA 3VDFA 1LFHA 2VT5A 4HE1A 3PUWE 3FJ7A 2X7PA 2HEUA 3D4GA 3KZGA 1A7LA 3LUYA 4PCDA 4DXBA 1NV4A 2ZYOA 1DSNA 3A09A 1P1WA 2QPQA 5B7DA 1B7ZA 3RUMA 3IB2A 1B40A 1MM7A 1IXCA 5I84A 1IEJA 3BIHA 4NG7A 4EXLA 1N76A 2OWZA 3M3LA 2XXUA 4OVRA 1MQDA 2XD3A 4EDPA 4P0IA 3HSTA 1FW0A 2Q74A 4P1LA 1SW4A 4YU0A 3CG1A 4KPTA 1VR5A 2DOJA 1NH8A 1B32A 4U2RA 2M8CA 2FVZA 2PFZA 3MP8A 3ZSFA 3VLVA 2OX3A 1NH7A 4JB7A 1SW2A 3V8XB 4N6KA 3B8BA 3HN0A 2FBPA 2X7QA 4ZZAA 5DEXA 1LBZA 4OEUA 4G8MA 1N3XA 4P8BA 5A5XA 1XOCA 2DXYA 1TXFA 1N0TA 2RF1A 4N17A 3H7MA 3USDA 4HCYA 3IO4A 3DP4A 1MXUA 2CZKA 4KFQA 4F22A 1GTKA 5I57A 5I2KB 1MQJA 2QFLA 1CB6A 5EYHA 5JTYA 1LCTA 2PVUA 2O6AA 2WBDA 2ZZVA 1EYJA 5L9MA 4I3EA 4FAJA 3MPLA 3HCQA 3T9HB 2O7IA 3TCFA 4PF6A 4EF1A 3EQ1A 4YICA 1BP5A 2GFEA 1FTAA 3GXAA 5TU0A 4POXA 3KBRA 3ILTB 3MJNA 1EZ9A 5I56B 4OYVA 3EF7A 3TCGA 4N07A 3GBBA 4XF5A 3S9NC 5K2XA 1B51A 3G3IA 5CRYA 4OTEA 1RDYA 1SQYA 2XXYA 4R74A 2VP1A 2I0BA 4YKIA 4EXKA 1B3LA 1NV3A 2HPGA 1FPDA 4LN5A 4ELOA 3OO8A 2ALUA 4IO4A 4PFUA 3T96B 4G77A 2FA7A 1FBCA 1LSTA 5HBCA 4GFRA 3IB0A 1NUZA 2XX7A 1YXIA 2R9JA 3IORA 1L5TA 3CHGA 1MXWA 4YB6A 4UACA 4H65A 1ZU0A 3MVZA 4LZ7A 3O2AA 4LZ8A 1LBCA 3FJGA 3KG2A 5L9SA 4ZDMA 4GQOA 4N6DA 2ZNSA 2XXQA 1NKXA 4NF8A 2ZMBA 1UQWA 4O8MA 3HFUA 4AS5A 2CMOA 2O68A 1DPEA 2F7CA 3OMBA 3IOWA 3M8UA 2F7AA 3SETA 2G93A 5IGAA 1B5IA 4R9GA 1S50A 5ELVA 3LUZA 3TFLA 3N94A 5DW8A 1FPJA 2I58A 4ZZEA 2GHBA 1S9TA 5JTYB 3THIA 2Q9TA 2QS4A 3TODA 1ATGA 3EKIA 4N8GA 4JWXA 3S2VA 2I4BA 1MQIA 5I57B 3VLWA 5I5PA 5F1QA 3EHSA 2XXHA 3BIGA 2R8TA 4UA8A 3U93A 2GH9A 5ET7A 1EYIA 2B3BA 3FXBA 4N15A 3K1MA 1FPGA 3D1RA 1LLSA 4PBQA 4RPNA 1Y3NA 3S9MC 5A5XB 5TP9B 3CG3A 1KWHA 1XVXA 3VLUA 3FXRA 4UABA 3OO6A 1EZOA 4IO2A 3DLNA 3H6WA 5EYFA 1LFIA 4QFOA 4IY6A 1XT8A 2NOOA 4YMBA 4AS4A 1FTMA 4ZEDA 3T0JA 2QVUA 3EPEA 2VD3A 4MJOA 4XEQA 4PAFA 2ESNA 4ZEBA 4O3BA 3KJTA 4LQ2A 4GXSB 4NQ8A 4YKJA 2HZLA 1Y4TA 1FPFA 4MMPA 4JWYA 2W7YA 4F18A 4RXLA 3FVNA 1ELJA 4NAPA 3G7WA 4ELQA 2HHMA 1FBEA 4PFTA 3ZKKA 3H03A 1GGGA 3O29A 3T93B 3RN8A 5TP9A 4QFPA 3K01A 4H67A 3D4CA 5EQ7A 2CEXA 4XKRA 2V84A 1LBVA 1G0HA 1NV1A 1AMFA 3ZKLA 5EHSA 4E0XA 2DQVA 1MH4A 3RTWB 2F3DA 3MZBA 4N8YA 3MSTA 4PBHA 5LOMA 3V89B 3JYRA 4NN3A 2PX1A 4Q5TA 2DE4A 4R75A 1POTA 1DK4A 1UTBB 1WVJA 4EQ9A 2PCRA 1FPKA 2HQ0A 3M3KA 4LQ5A 5TPAB 2PFYA 4H5GA 4NF4B 3RQTA 3W9WA 3TELA 1ZTYA 1TFAA 2HAUA 2B4MA 4IO7A 2Y7RA 2V4CA 3QAXA 1JW1A 1QKBA 2FHYA 2Z8FA 1NL5A 2WYPA 4U1ZA 1T0KA 3C35A 4IO5A 2VD2A 3S9LC 5A5LA 1SI0A 5DVFA 4OFOA 4OVQA 2QS1A 4XIGQ 3HO7A 3PUZE 4QSCA 3BKIB 1M5DA 3MUQA 3TEPA 5DT6A 1MRPA 1I6QA 2ZZXA 3H6TA 5FTHA 2B4LA 1FPIA 3KFMA 4OENA 1K9ZA 1Y1MA 4GOTA 3C36A 4P0GA 1PEBA 4HE2A 3NOHA 5CMKA 1NV6A 4O3CA 1DMBA 1JEUA 3K1PA 3C34A 1AWBA 1RYXA 2OBGA 3FJMA 4K3FA 1QGXA 1KZ8A 3T9UA 1US5A 2E1SA 5EQ8A 1FQAA 1BIYA 3UORA 4U22A 3V83A 3FUZA 1ANFA 4F31B 4RJZA 1IQ7A 1WDNA 4G68C 1NI9A 1LAHE 4ELRA 1USYH 3R6UA 1B4ZA 1A8FA 4OZ9A 1BK4A 3K02A 3BFTA 3T9VA 1B58A 1QVSA 4F3SA 1WODA 4G68A 4JBZA 4U4SA 4RA1A 1EU8A 1B9JA 4QSDA 5LTCA 4PE3A 1NFTA 3T22A 4AB6A 4N6PA 4AQ4A 4OA4A 3OSRA 2ABHA 4GL0A 1FBHA 4F19A 1RYOA 3RPLA 3MP1A 1Q9DA 5FBPA 2IA4A 4NGUA 3MPKA 1QJMA 2JJKA 4N81A 1QUKA 3K6WA 2B65A 4PTKA 2MKZA 4GRKA 3TYHA 4RY1A 1ZMGA 5H8HA 2XXIA 4KYSA 2F6PA 4X9TA 1TWYA 3C33A 2ZYKA 3IR1A 4EUOA 1UTHA 4P11A 3H06B 2HXWA 2DSFA 3CSGA 4H1XA 4R6HA 5ET5A 3CFZA 4RK9A 1US4A 1OMPA 1LCFA 2Y5LA 4YMAA 4LP2B 2Q88A 1R1NA 1H3DA 4ZECA 2DWIA 4NF6B 3K6UA 1URDA 5EYGA 4GX6A 3TTMA 3U65A 1MY1A 1UTBA 3IK6B 2OLBA 1LAFE 3MW0A 3MC2A 1P1QA 5I3SA 4DCYA 1SW5A 2YPNA 4KR5A 2ZYNA 3CRBA 3RLFE 3TDJA 4ECFA 4OVSA 2THIA 1IMEA 3U72A 1MXXA 5DYHA 1OLAA 1HSEA 3CFLA 1FJ6A 1VSOA 3PPRA 2O1MA 1XI6A 4NF8B 4PGNA 3R7XA 4DDDA 2HZKA 1Y1ZA 4I3YA 1MQGA 3Q28A 2OZZA 2F36A 2D5WA 1SDXA 4I62A 4MNCA 3N5LA 1O7TA 3GLBA 2V3TA 3KOTA 2AYSA 1LBWA 1MDP1 1A55A 5ICQA 3E4RA 1Q1KA 3ISPA 1SVXB 1B0HA 3LSFB 4Q8RA 1KA0A 4GX4A 5IZ3A 1IXGA 1IITA 4O3AA 3TQWA 3PUVE 3B6QA 3K0VA 1FBGA 3CI8A 1PB7A 3C31A 3UA8A 1PB9A 3PMXA 3Q27A 2I3WA 3Q29A 1IZ1A 1IXIA 2HCAA 3QMFA 2Y84A 4GF8A 4JXIA 3TUSA 4HXVA 2YJPA 1IMDA 1DBZA 3FIRA 1P1UA 3PPNA 3OD7A 4GWWA 3G3JA 4ZEIA 1BTJA 4RYAA 2F78A 5EQ9A 3C4MA 3FASA 3GYYA 3BBRA 3PPQA 1POY1 3HV1A 2OK2A 1HSJA 3SZPA 3PUYE 4N91A 5IAIA 1UIVA 2IEEA 4LZ5A 1VE4A 3QUJA 4IGRA 1DPPA 4JVDA 1Q35A 4F2OA 1SYIA 1B46A 2PT2A 3H3GA 4JVCA 4NE4A 1RDXA 4IGTA 4MIJA 3MBPA 1FBPA 5EQAA 4YB5A 3VV5A 3S9EA 3RPLB 3VXBA 4PQJA 1FQDA 2KLFA 4NMYA 1NV5A 3S4UA 1LEVA 3I3VA 4MCOA 1H43A 3QSLA 3FD3A 3SERA 3SEYA 4X8RA 4OVTA 1OVTA 4RK2A 2X26A 2XWKA 2RINA 1B3HA 1B6HA 2DVCA 3DM0A 3IOTA 2LAOA 5B70A 1PC3A 1II5A 2F97A 3IL1B 4G4PA 3PUXE 1JW4A 2R6GE 1H45A 3T9XB 2NXOA 2I0CA 3MVXA 3RNNA 4U21A 1DCUA 3FXQA 4I9DA 2ZYMA 1YAEA 3O9PA 1NNFA 2VPOA 3K2DA 3KC1A 4ESXA 4YAHX 1FSAA 2H99A 3B50A 4IO3A 4ELPA 1TT1A 3IJOB 1M5CA 4NF4A 4DE8A 4F3PA 4MNIA 5I58A 5AA2A 3TMGA 1D9YA 3H6UA 4GWSA 2YLNA 4KD5A 2Q8JA 2DP8A 2XXTA 4GWXA 5I59A 3L6GA 1LB9A 2PYYA 3RPWA 3KC0A 3FGSA 4PDHA 3ODBA 1OQHA 3K00A 2I4CA 1IUDA 4H5FA 1FQFA 1JP4A 2I3VA 4DXUA 1JVXA 4DI4B 4F3BA 4PFRA 1AH5A 1XHYA 4PE5B 2OJTA 4QRZA 1USYE 3WAEA 3KN3A 5DVJA 1URGA 3SESA 4NX1A 3TCHA 2G29A 2ZZWA 3ECRA 3PPPA 1B5HA 2P3NA 3PPOA 4XKQA 2F8DA 4GD5A 5HPQA 5CM6A 4WEDA 2NWJA 1MY2A 3LSWA 1IXHA 5AE4A 2A5SA 5CI5A 3RYDA 2QRYA 1ZKBA 3U1OA 2P3VA 2CZIA 2XXWA 2AIXA 3TZAA 1FBFA 1NUXA 3DELB 1IMCA 5FHOA 4IR8A 3HHFA 4BDQA 3AXFA 1URSA 4RPOA 3A3CA 3UN6A 1BKAA 4GL8A 1QW0A 3GBAA 4YB7A 2OWSA 4ZS9A 1B3FA 2Z23A 4MH5A 3CVGA 4KHZE 2QVRA 3IX1A 3CFXA 4P56A 1ZBMA 1UIUA 2DS9A 2GQ1A 1D9VA 3QK6A 1GVCA 2RCAA 3TTRA 2XXVA 4G8NA 3O28A 2AL5A 3O6GA 4QFKA 3OO9A 5ICTA 4JSDA 4F1UA 1Z7NE 2V3UA 2B3FA 4OEVA 1MXYA 2WYKA 3TAJA
chains in the Genus database with same CATH topology
3JZJA 2ABHA 3OENA 3KGCA 3OSRA 4GL0A 1RKMA 3T9HB 4NWDA 4OWDA 4F19A 2O7IA 1RYOA 1Y9UA 4XTCQ 3TCFA 4I1DA 4C0RA 4TQUQ 4EF1A 3EQ1A 4YICA 1BP5A 2GFEA 1XVYA 1SI1A 3GXAA 3MP1A 2Z8EA 2IA4A 2UYFA 4OETA 5TU0A 4H0WA 4DXCA 3MPKA 1N84A 1QJMA 4F1YA 2Y7KA 4F39A 3PD8A 4POXA 1QUKA 5CC2A 3KBRA 3LC8A 3K6WA 4RNSA 4AB5A 3H4ZA 5L9OA 2QMWA 3ILTB 3MJNA 4E0WA 4F3GA 1F9BA 2B65A 1EZ9A 3PGFA 1HSLA 5I56B 3I6VA 4OYVA 4GVOA 4M4GA 3TQLA 5H8QA 1N3WA 4GRKA 3EF7A 3TYHA 3FV1A 3TCGA 1IIWA 4KCDA 1ZMGA 3IOUA 4RY1A 5H8HA 2XXIA 4KYSA 4N07A 3RGYA 2F6PA 5H8FA 3OELA 3GBBA 1MXVA 3S9NC 3VVFA 5K2XA 2NUVA 1B51A 1N7WA 3G3IA 2OCUA 4X9TA 1TWYA 1ZIUA 5CRYA 3VXCA 1PB8A 2QMXA 2ZYKA 1SQYA 3C33A 3IR1A 2RKMA 1UTHA 4OTEA 4PETA 2XXYA 4WKMA 2UVGA 2VP1A 3DP6A 4R74A 5H8FB 3U94A 4P11A 1MPCA 3TPAA 4DCXA 2P0SA 5KDTB 2I0BA 4YKIA 2CZLA 3H06B 2H25A 4EXKA 1B3LA 3V5AA 4OERA 1MG1A 2HXWA 3KJ7A 1A8EA 1ZLQA 2DSFA 3CSGA 4ELOA 4H1XA 2QS2A 2F7BA 4F22A 4R6HA 1FQBA 3CFZA 4RK9A 3TKDA 1OMPA 1US4A 1LCFA 1A40A 3OO8A 4IB2A 2ALUA 4IO4A 4PFUA 1B7HA 3T96B 4YMAA 2O1LA 4KCCA 1ZJLA 4G77A 4LP2B 4MFIA 2Q88A 3EN3A 1R1NA 2FA7A 2DYXA 3OXNA 1O64A 1LSTA 5ISUA 1H3DA 4ZECA 5HBCA 1SW1A 5TPAA 2DWIA 4GFRA 1AOVA 2XXXA 4NF6B 3IB0A 4BDNA 2XX7A 3QIMA 2R9JA 1NNTA 1URDA 3K6UA 1I69A 3TTMA 5ITPA 2VHAA 4R72A 1P1OA 3IORA 4LVQA 1L5TA 5IKBA 1R6ZA 1MY1A 2AL4A 1MXWA 1UTBA 1B52A 3P7IA 4LATA 3IK6B 4YB6A 1J1NA 3MAMA 4UACA 2OLBA 4GXAA 4H65A 4NF5A 4TLLB 5B70A 1VFDA 1ZU0A 2Y7IA 2DE2A 2VGQA 3FZVA 3W15C 1LAFE 3MW0A 4JWOA 3MVZA 3MC2A 1P1QA 2DWAA 4LZ7A 1H44A 3O2AA 4DCYA 4LZ8A 1LBCA 1SW5A 3FJGA 3Q25A 4L17A 3KG2A 3KSXA 5L9SA 2YPNA 4KR5A 2ZYNA 3CRBA 2ZNTA 1D4NA 4PFYA 4U23A 4GQOA 2A5TB 4KI0E 2ZNSA 3RLFE 3TDJA 1EH3A 4ECFA 3OEMA 4HTGA 2XXQA 5CMCA 2THIA 2UVJA 1NKXA 4ESWA 2HFBA 3HHGA 1CE2A 1M5FA 4NF8A 3U72A 2ZMBA 4MLVA 2H98A 1UQWA 1MM6A 1OVBA 1BLFA 2V3QA 3MVWA 1MXXA 5DYHA 4H8JA 1UTHB 3VVEA 1OLAA 3OOAA 1HSEA 5AA2B 3G3HA 2ANJA 4FATA 3CFLA 2CMOA 2O68A 1VSOA 3O97A 2O1MA 2RC9A 1OIBA 1DPEA 2F7CA 3E3KA 3OMBA 3PPRA 4R2BA 1PDAA 1B3EA 3IOWA 4LONB 4NF8B 3M8UA 1M5EA 5CMMA 3TTKA 3R7XA 2F7AA 4DDDA 2VOZA 2HZKA 2Y7WA 1Y1ZA 1Y3PA 4X48A 2F6GA 3FVKA 4LA9A 4Q0CA 3SETA 4EQBA 2G93A 1B1HA 3PU5A 5AA2D 1MQGA 2QJEA 1B5IA 3L6HA 2OZZA 2F36A 1FTOA 3MZ1A 3Q28A 3M3FA 4I8CA 2UVHA 2D5WA 1O63A 1B0LA 4R9GA 1SDXA 4I62A 2I49A 1O7TA 3N5LA 3GLBA 2V3TA 3KOTA 2AYSA 3KN8A 5M2VA 1S50A 3GZGA 3Q26A 4XKPA 1MDP1 4FJPA 5ELVA 1FQEA 3TFLA 5I59B 3VE1B 1B3GA 3W9VA 3PV0E 3N6UA 1A55A 1OQGA 3N94A 5ICQA 3E4RA 1Q1KA 5H8NB 2I58A 4ZZEA 3TTNA 2GHBA 1SVXB 1B0HA 2DVZA 3LSFB 1PBQA 2FYIA 2QSXA 4Q8RA 3OEKA 2DE3A 2RC8A 2REJA 1S9TA 3O66A 4GWOA 5JTYB 2F35A 2UVIA 3FXUA 1IXGA 1IITA 5JK4A 3THIA 1EZPA 5I58B 3I5OA 2DWJA 1GR2A 2Q9TA 4O3AA 2A5TA 3F11A 2QS4A 4ZEKA 3TQWA 3PUVE 3TODA 3IAZA 5KCJB 1ATGA 2NVUB 5I2KA 4EF2A 3B6QA 1JW5A 4OVJA 4HW8A 1R9QA 3K0VA 2Z22A 3DP8A 4QFLA 4JWXA 3SDFA 3S2VA 3TTLA 1D3KA 3CI8A 1TFDA 2I4BA 2PT1A 1PB7A 1MQIA 3C31A 3IJXB 4OFLA 1PB9A 3UA8A 3PMXA 5I57B 1LAGE 3Q27A 2V25A 2XHDA 3VLWA 5I2NB 3K6VA 4BLAA 2I3WA 3Q29A 2DWHA 3K1NA 4GLIA 1IZ1A 5F1QA 1IXIA 2HCAA 3EHSA 2XXHA 3FV2A 4ZE8A 2P2AA 5AA4B 1Y20A 4UA8A 2Y84A 4GF8A 4JXIA 3U93A 2GH9A 3TUSA 2YJPA 5KDTA 4BDMA 4PP0A 2B3BA 3FIRA 1P1UA 3CIJA 2RCBA 3PPNA 4MLQA 3OD7A 4IY5A 3K1MA 2HAVA 1MDQA 1LLSA 4TLMB 4RPNA 1LFGA 3G3JA 4HCWA 5H8HB 1Y3NA 4YKKA 5I2NA 3G3FA 4ZEIA 3S9MC 5A5XB 1BTJA 3B6TA 4R9FA 4JDFA 4RYAA 4ZE9A 2F78A 1M5BA 3CG3A 4H6DA 5TP9B 3MWBA 4THIA 1KWHA 1XVXA 3C4MA 3VLUA 3FASA 3FXRA 3OO6A 1VFEA 3BBRA 5CBRA 4EQ7A 3O6IA 3UIFA 2XXPA 3PPQA 4C1TA 3UK4A 5KCJA 1LGBC 3MQ9A 1POY1 1EZOA 2ZXTA 3HV1A 4IO2A 3DLNA 3H6WA 1LB8A 2Q2AA 4MF3A 2OK2A 3RY3A 5EYFA 1HSJA 1LFIA 3PUYE 2I6EA 4F1VA 1MY4A 1MY0A 1FTLA 3LSLA 4IY6A 4QFOA 4BDLA 5IAIA 3OO7A 3C32A 1XT8A 1UIVA 2IEEA 4LZ5A 1VE4A 2NOOA 2ZNUA 3LBSA 4NWCA 4YMBA 2O69A 3LR1A 3QUJA 1FTMA 4IGRA 5AA4A 1DPPA 4ZEDA 5J1DA 2D3IA 3E13X 4FORA 4LUBA 1Q35A 5FHMA 4GIZA 2O84X 4F2OA 4FEDA 1SYIA 1B46A 2PT2A 3H3GA 3MP6A 2FNCA 4G2ZA 4ONYA 2XX8A 4OHNA 3B6WA 3EPEA 5H8QB 4NE4A 1P1NA 2VD3A 3PD9A 4FECA 4XKNA 4IGTA 5DTBA 3CR9A 1JQFA 4NTLA 1MPDA 2ESNA 4ZEBA 1DTGA 3KJTA 2QL3A 3MBPA 4LQ2A 4O3BA 4GXSB 1B2HA 4U4XA 2E0SA 3SKPA 4U1OA 2H5YA 3EHUA 4FEBA 4YKJA 2HZLA 1Y4TA 2XD2A 4YB5A 5ITOA 4G68B 4JWYA 3VV5A 4BDRA 4F31B 1MS7A 3HPIA 3S9EA 4R6KA 5AA1A 3VXBA 4PQJA 4DZ1A 1FQDA 2F5XA 4ND9A 2W7YA 4DXUA 1YCJA 2KLFA 2Z8DA 4NMYA 1PBPA 3IO6A 3S4UA 1B5JA 4F18A 5CBSA 3I3VA 3FVNA 4RXLA 1ELJA 1H43A 3QSLA 2H9BA 3U8QA 3FD3A 5KZTA 3G7WA 3SERA 4ELQA 1NMUA 3QYTA 3SEYA 4QF9A 1NNPA 3B7DA 3FVGA 1YTVA 1N7XA 2P1SA 1OVTA 4R73A 4RK2A 2X26A 3IB1A 4QSEA 5FHNA 1QULA 2O7UA 2XXRA 3PMVA 4FIMA 1SBPA 4PFTA 3ZKKA 1JVYA 3H03A 5L8DA 1GGGA 2PBWA 3O29A 4ISUA 1B7UA 2RINA 4QFNA 1B3HA 1B6HA 1YPNA 4ZEFA 3RN8A 3T93B 1AL3A 4IO6A 2R71A 5TP9A 2DVCA 2GRVA 4QFPA 1H76A 3BFUA 1JNFA 2Q2CA 3DM0A 3D4CA 3IOTA 2LAOA 3K01A 4H67A 4OXVA 5H8SA 3T66A 1Y4CA 3VFJA 1PC3A 2F34A 1QKAA 2UYEA 4XKRA 2O51A 3SEXA 2ONRA 2QS3A 1FCKA 1II5A 1JETA 2V84A 2F97A 4G8HA 4Z0IA 3R26A 1B05A 1NNKA 3IL1B 3SEUA 4G4PA 3PUXE 2Q89A 4JSOA 1JW4A 4OESA 2R6GE 3FATA 1H45A 1MQHA 3K6XA 1DOTA 1AMFA 1B1XA 3T9XB 2NXOA 3ZKLA 4NEDA 2I0CA 5EHSA 3CSBA 3MVXA 3RNNA 1LBBA 4POWA 3A3UA 4U21A 4E0XA 1I6BA 3FXQA 2DQVA 1MH4A 2BJJX 4I9DA 3KEIA 5BUUA 3RTWB 3RT6B 1FTKA 2ZYMA 5I56A 3MZBA 1YAEA 2I48A 2PMSA 3U92A 4EUOA 3O9PA 5DEXB 4X1BA 1NNFA 1A54A 3K2DA 4ESXA 4YAHX 5JEIA 3O6HA 5LOMA 3V89B 2H99A 1MH3A 3MZ9A 4IO3A 4ELPA 3JYRA 1TT1A 3IJOB 1JEVA 1M5CA 1FTJA 3E9XA 3H6VA 4NF4A 2PX1A 4DE8A 4Q30B 4F3PA 3HCQA 4Q5TA 5I58A 3LSXA 5AA2A 2DE4A 3TMGA 1D9YA 2ONSA 4NF5B 4R75A 1POTA 3H6UA 3G3KA 5H8NA 2YLNA 1P99A 2GHAA 3SEWA 1A99A 1UTBB 1WVJA 4KD5A 3JV9A 2DP8A 1SD3A 2XXTA 3N26A 3N6TA 3L6GA 1LB9A 3IOVA 2Q8JA 1XC1A 2PYYA 4NF6A 4PFWA 2HQ0A 3FGSA 3M3KA 4QHQA 3RPWA 3ODBA 4LQ5A 4OFJA 5TPAB 1OQHA 4C1UA 4FE8A 3K00A 4H5GA 4ZDMA 4NF4B 2Y7PA 2I4CA 3RQTA 3W9WA 3ONMA 3VDFA 3TELA 1LFHA 1IUDA 3PUWE 1ZTYA 1TFAA 2HAUA 3FJ7A 1S7YA 1FQFA 2I3VA 4H5FA 2X7PA 1MPBA 1JVXA 1SYHA 2HEUA 2Y7RA 4IO7A 2DXRA 3D4GA 3KZGA 4DIGA 4F3BA 5FTIA 1Y3QA 3QAXA 3WAFA 1JW1A 1AIVA 1QKBA 1AH5A 1A7LA 3LUYA 4DXBA 3G3GA 1XHYA 4R6YA 2OJTA 2Z8FA 1DSNA 1NL5A 1USYE 2ZYOA 3A09A 3PMWA 4KQPA 4PE5B 4QRZA 4U1ZA 3WAEA 4WEPA 3C35A 1T0KA 3KN3A 4IO5A 4YZZA 1P1WA 2QPQA 5B7DA 1B7ZA 2VD2A 5DVJA 3S9LC 1SI0A 2RC7A 3IB2A 5DVFA 3RUMA 1URGA 1DTZA 4OFOA 3SESA 5HM4B 1B40A 1MM7A 1IXCA 3TCHA 5I84A 4H8IA 2G29A 3ECRA 4N13A 3PPPA 2QS1A 1IEJA 5F7VA 1Z7ME 3UGWA 4XIGQ 1B5HA 1N76A 4EXLA 3HO7A 3PUZE 3PPOA 4QSCA 3BKIB 3FVOA 2XXUA 1M5DA 3M3LA 1MQDA 2XD3A 3MUQA 4EDPA 1MXZA 3TEPA 4XKQA 4P0IA 5DT6A 3ZS6A 3HSTA 2WKYA 1FW0A 1MRPA 2F8DA 1I6QA 3OSQA 4GD5A 3H6TA 3KSJA 4OENA 3KFMA 5FTHA 5CM6A 5HPQA 4WEDA 2OWTA 3KN7A 2NWJA 1Y1MA 4GOTA 3RT8A 1MY2A 4DLDA 3C36A 1SW4A 3LSWA 1IXHA 4YU0A 3CG1A 2A5SA 4KPTA 5CI5A 1VR5A 5AE4A 2DOJA 2QRYA 2H4IA 4P0GA 1NH8A 1PEBA 1QUIA 1ZKBA 3U1OA 1B32A 4O3CA 1DMBA 1JEUA 4U2RA 5CMBA 5CMKA 3K4UA 3K1PA 2M8CA 2XXWA 2AIXA 3KOSA 5K2YA 3C34A 3TZAA 5DVIA 3DELB 3MP8A 1RYXA 2OBGA 5FHOA 3ZSFA 4X1DA 3VLVA 3FJMA 4BDOA 4K3FA 1NH7A 4YKPA 4JB7A 1SW2A 4R2FA 3ILUB 1GV8A 3V8XB 2ONKE 3HHFA 2XX9A 4BDQA 3T9UA 3HN0A 5A5XA 3AXFA 1URSA 2X7QA 4RPOA 3A3CA 4ZZAA 3V83A 1US5A 5DEXA 3C9HA 5I59A 4XXUA 2E1SA 4OEUA 3EHTA 1BKAA 3UN6A 1R9LA 1FQAA 4GL8A 1BIYA 3UORA 5BWJA 4U22A 1QW0A 1FQCA 3GBAA 4OQOA 3FUZA 1ANFA 4G8MA 4TOZA 2OWSA 4RJZA 1N3XA 1IQ7A 1B3FA 1I6AA 2Z23A 4MH5A 5EHMA 1XOCA 4ZS9A 2DXYA 1WDNA 3CVGA 1TXFA 4G68C 4Z7EA 5AA3A 1N0TA 1OLCA 1LAHE 2RF1A 4ELRA 4KHZE 4YB7A 4MBPA 1USYH 3H7MA 2REGA 4WXJA 3MVYA 3R6UA 3IX1A 1B4ZA 3CFXA 1A8FA 4OZ9A 3K02A 1LAXA 3BFTA 4KYDA 1ZBMA 1UIUA 1QUJA 4HCYA 3T9VA 2DS9A 3USDA 3IO4A 1D9VA 3UP9A 1B58A 3DP4A 3QK6A 1GVCA 1QVSA 2RCAA 1MXUA 4HS7A 4F3SA 4OMBA 2XXVA 1XS5A 4G8NA 1WODA 3O28A 3TTRA 4G68A 2AL5A 1N04A 2UXAA 1GTKA 2D21A 4KFQA 3RTFB 3VVDA 3O6GA 5I2KB 1MQJA 2V93A 4JBZA 4QFKA 4U4SA 4RA1A 5I57A 1CB6A 3OO9A 5ICTA 4M1VA 4EQ9A 4JSDA 1B4HA 3QXMA 1EU8A 4F1UA 1Z7NE 1B9JA 4QSDA 3SEVA 1LCTA 2PVUA 5JTYA 2O6AA 1NFTA 3QUFA 3T22A 2V3UA 4F29A 4F2QA 2B3FA 4KYEA 5L9MA 4OEVA 1MXYA 4AB6A 4N6PA 4AQ4A 4FAJA 3MPLA 3TAJA 1MY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JZJ A;  2ABH A;  3OEN A;  3KGC A;  3OSR A;  4GL0 A;  1RKM A;  3T9H B;  4NWD A;  4OWD A;  4F19 A;  2O7I A;  1RYO A;  1Y9U A;  4XTC Q;  3TCF A;  4I1D A;  4C0R A;  4TQU Q;  4EF1 A;  3EQ1 A;  4YIC A;  1BP5 A;  2GFE A;  1XVY A;  1SI1 A;  3GXA A;  3MP1 A;  2Z8E A;  2IA4 A;  2UYF A;  4OET A;  5TU0 A;  4H0W A;  4DXC A;  3MPK A;  1N84 A;  1QJM A;  4F1Y A;  2Y7K A;  4F39 A;  3PD8 A;  4POX A;  1QUK A;  5CC2 A;  3KBR A;  3LC8 A;  3K6W A;  4RNS A;  4AB5 A;  3H4Z A;  5L9O A;  2QMW A;  3ILT B;  3MJN A;  4E0W A;  4F3G A;  1F9B A;  2B65 A;  1EZ9 A;  3PGF A;  1HSL A;  5I56 B;  3I6V A;  4OYV A;  4GVO A;  4M4G A;  3TQL A;  5H8Q A;  1N3W A;  4GRK A;  3EF7 A;  3TYH A;  3FV1 A;  3TCG A;  1IIW A;  4KCD A;  1ZMG A;  3IOU A;  4RY1 A;  5H8H A;  2XXI A;  4KYS A;  4N07 A;  3RGY A;  2F6P A;  5H8F A;  3OEL A;  3GBB A;  1MXV A;  3S9N C;  3VVF A;  5K2X A;  2NUV A;  1B51 A;  1N7W A;  3G3I A;  2OCU A;  4X9T A;  1TWY A;  1ZIU A;  5CRY A;  3VXC A;  1PB8 A;  2QMX A;  2ZYK A;  1SQY A;  3C33 A;  3IR1 A;  2RKM A;  1UTH A;  4OTE A;  4PET A;  2XXY A;  4WKM A;  2UVG A;  2VP1 A;  3DP6 A;  4R74 A;  5H8F B;  3U94 A;  4P11 A;  1MPC A;  3TPA A;  4DCX A;  2P0S A;  5KDT B;  2I0B A;  4YKI A;  2CZL A;  3H06 B;  2H25 A;  4EXK A;  1B3L A;  3V5A A;  4OER A;  1MG1 A;  2HXW A;  3KJ7 A;  1A8E A;  1ZLQ A;  2DSF A;  3CSG A;  4ELO A;  4H1X A;  2QS2 A;  2F7B A;  4F22 A;  4R6H A;  1FQB A;  3CFZ A;  4RK9 A;  3TKD A;  1OMP A;  1US4 A;  1LCF A;  1A40 A;  3OO8 A;  4IB2 A;  2ALU A;  4IO4 A;  4PFU A;  1B7H A;  3T96 B;  4YMA A;  2O1L A;  4KCC A;  1ZJL A;  4G77 A;  4LP2 B;  4MFI A;  2Q88 A;  3EN3 A;  1R1N A;  2FA7 A;  2DYX A;  3OXN A;  1O64 A;  1LST A;  5ISU A;  1H3D A;  4ZEC A;  5HBC A;  1SW1 A;  5TPA A;  2DWI A;  4GFR A;  1AOV A;  2XXX A;  4NF6 B;  3IB0 A;  4BDN A;  2XX7 A;  3QIM A;  2R9J A;  1NNT A;  1URD A;  3K6U A;  1I69 A;  3TTM A;  5ITP A;  2VHA A;  4R72 A;  1P1O A;  3IOR A;  4LVQ A;  1L5T A;  5IKB A;  1R6Z A;  1MY1 A;  2AL4 A;  1MXW A;  1UTB A;  1B52 A;  3P7I A;  4LAT A;  3IK6 B;  4YB6 A;  1J1N A;  3MAM A;  4UAC A;  2OLB A;  4GXA A;  4H65 A;  4NF5 A;  4TLL B;  5B70 A;  1VFD A;  1ZU0 A;  2Y7I A;  2DE2 A;  2VGQ A;  3FZV A;  3W15 C;  1LAF E;  3MW0 A;  4JWO A;  3MVZ A;  3MC2 A;  1P1Q A;  2DWA A;  4LZ7 A;  1H44 A;  3O2A A;  4DCY A;  4LZ8 A;  1LBC A;  1SW5 A;  3FJG A;  3Q25 A;  4L17 A;  3KG2 A;  3KSX A;  5L9S A;  2YPN A;  4KR5 A;  2ZYN A;  3CRB A;  2ZNT A;  1D4N A;  4PFY A;  4U23 A;  4GQO A;  2A5T B;  4KI0 E;  2ZNS A;  3RLF E;  3TDJ A;  1EH3 A;  4ECF A;  3OEM A;  4HTG A;  2XXQ A;  5CMC A;  2THI A;  2UVJ A;  1NKX A;  4ESW A;  2HFB A;  3HHG A;  1CE2 A;  1M5F A;  4NF8 A;  3U72 A;  2ZMB A;  4MLV A;  2H98 A;  1UQW A;  1MM6 A;  1OVB A;  1BLF A;  2V3Q A;  3MVW A;  1MXX A;  5DYH A;  4H8J A;  1UTH B;  3VVE A;  1OLA A;  3OOA A;  1HSE A;  5AA2 B;  3G3H A;  2ANJ A;  4FAT A;  3CFL A;  2CMO A;  2O68 A;  1VSO A;  3O97 A;  2O1M A;  2RC9 A;  1OIB A;  1DPE A;  2F7C A;  3E3K A;  3OMB A;  3PPR A;  4R2B A;  1PDA A;  1B3E A;  3IOW A;  4LON B;  4NF8 B;  3M8U A;  1M5E A;  5CMM A;  3TTK A;  3R7X A;  2F7A A;  4DDD A;  2VOZ A;  2HZK A;  2Y7W A;  1Y1Z A;  1Y3P A;  4X48 A;  2F6G A;  3FVK A;  4LA9 A;  4Q0C A;  3SET A;  4EQB A;  2G93 A;  1B1H A;  3PU5 A;  5AA2 D;  1MQG A;  2QJE A;  1B5I A;  3L6H A;  2OZZ A;  2F36 A;  1FTO A;  3MZ1 A;  3Q28 A;  3M3F A;  4I8C A;  2UVH A;  2D5W A;  1O63 A;  1B0L A;  4R9G A;  1SDX A;  4I62 A;  2I49 A;  1O7T A;  3N5L A;  3GLB A;  2V3T A;  3KOT A;  2AYS A;  3KN8 A;  5M2V A;  1S50 A;  3GZG A;  3Q26 A;  4XKP A;  1MDP 1;  4FJP A;  5ELV A;  1FQE A;  3TFL A;  5I59 B;  3VE1 B;  1B3G A;  3W9V A;  3PV0 E;  3N6U A;  1A55 A;  1OQG A;  3N94 A;  5ICQ A;  3E4R A;  1Q1K A;  5H8N B;  2I58 A;  4ZZE A;  3TTN A;  2GHB A;  1SVX B;  1B0H A;  2DVZ A;  3LSF B;  1PBQ A;  2FYI A;  2QSX A;  4Q8R A;  3OEK A;  2DE3 A;  2RC8 A;  2REJ A;  1S9T A;  3O66 A;  4GWO A;  5JTY B;  2F35 A;  2UVI A;  3FXU A;  1IXG A;  1IIT A;  5JK4 A;  3THI A;  1EZP A;  5I58 B;  3I5O A;  2DWJ A;  1GR2 A;  2Q9T A;  4O3A A;  2A5T A;  3F11 A;  2QS4 A;  4ZEK A;  3TQW A;  3PUV E;  3TOD A;  3IAZ A;  5KCJ B;  1ATG A;  2NVU B;  5I2K A;  4EF2 A;  3B6Q A;  1JW5 A;  4OVJ A;  4HW8 A;  1R9Q A;  3K0V A;  2Z22 A;  3DP8 A;  4QFL A;  4JWX A;  3SDF A;  3S2V A;  3TTL A;  1D3K A;  3CI8 A;  1TFD A;  2I4B A;  2PT1 A;  1PB7 A;  1MQI A;  3C31 A;  3IJX B;  4OFL A;  1PB9 A;  3UA8 A;  3PMX A;  5I57 B;  1LAG E;  3Q27 A;  2V25 A;  2XHD A;  3VLW A;  5I2N B;  3K6V A;  4BLA A;  2I3W A;  3Q29 A;  2DWH A;  3K1N A;  4GLI A;  1IZ1 A;  5F1Q A;  1IXI A;  2HCA A;  3EHS A;  2XXH A;  3FV2 A;  4ZE8 A;  2P2A A;  5AA4 B;  1Y20 A;  4UA8 A;  2Y84 A;  4GF8 A;  4JXI A;  3U93 A;  2GH9 A;  3TUS A;  2YJP A;  5KDT A;  4BDM A;  4PP0 A;  2B3B A;  3FIR A;  1P1U A;  3CIJ A;  2RCB A;  3PPN A;  4MLQ A;  3OD7 A;  4IY5 A;  3K1M A;  2HAV A;  1MDQ A;  1LLS A;  4TLM B;  4RPN A;  1LFG A;  3G3J A;  4HCW A;  5H8H B;  1Y3N A;  4YKK A;  5I2N A;  3G3F A;  4ZEI A;  3S9M C;  5A5X B;  1BTJ A;  3B6T A;  4R9F A;  4JDF A;  4RYA A;  4ZE9 A;  2F78 A;  1M5B A;  3CG3 A;  4H6D A;  5TP9 B;  3MWB A;  4THI A;  1KWH A;  1XVX A;  3C4M A;  3VLU A;  3FAS A;  3FXR A;  3OO6 A;  1VFE A;  3BBR A;  5CBR A;  4EQ7 A;  3O6I A;  3UIF A;  2XXP A;  3PPQ A;  4C1T A;  3UK4 A;  5KCJ A;  1LGB C;  3MQ9 A;  1POY 1;  1EZO A;  2ZXT A;  3HV1 A;  4IO2 A;  3DLN A;  3H6W A;  1LB8 A;  2Q2A A;  4MF3 A;  2OK2 A;  3RY3 A;  5EYF A;  1HSJ A;  1LFI A;  3PUY E;  2I6E A;  4F1V A;  1MY4 A;  1MY0 A;  1FTL A;  3LSL A;  4IY6 A;  4QFO A;  4BDL A;  5IAI A;  3OO7 A;  3C32 A;  1XT8 A;  1UIV A;  2IEE A;  4LZ5 A;  1VE4 A;  2NOO A;  2ZNU A;  3LBS A;  4NWC A;  4YMB A;  2O69 A;  3LR1 A;  3QUJ A;  1FTM A;  4IGR A;  5AA4 A;  1DPP A;  4ZED A;  5J1D A;  2D3I A;  3E13 X;  4FOR A;  4LUB A;  1Q35 A;  5FHM A;  4GIZ A;  2O84 X;  4F2O A;  4FED A;  1SYI A;  1B46 A;  2PT2 A;  3H3G A;  3MP6 A;  2FNC A;  4G2Z A;  4ONY A;  2XX8 A;  4OHN A;  3B6W A;  3EPE A;  5H8Q B;  4NE4 A;  1P1N A;  2VD3 A;  3PD9 A;  4FEC A;  4XKN A;  4IGT A;  5DTB A;  3CR9 A;  1JQF A;  4NTL A;  1MPD A;  2ESN A;  4ZEB A;  1DTG A;  3KJT A;  2QL3 A;  3MBP A;  4LQ2 A;  4O3B A;  4GXS B;  1B2H A;  4U4X A;  2E0S A;  3SKP A;  4U1O A;  2H5Y A;  3EHU A;  4FEB A;  4YKJ A;  2HZL A;  1Y4T A;  2XD2 A;  4YB5 A;  5ITO A;  4G68 B;  4JWY A;  3VV5 A;  4BDR A;  4F31 B;  1MS7 A;  3HPI A;  3S9E A;  4R6K A;  5AA1 A;  3VXB A;  4PQJ A;  4DZ1 A;  1FQD A;  2F5X A;  4ND9 A;  2W7Y A;  4DXU A;  1YCJ A;  2KLF A;  2Z8D A;  4NMY A;  1PBP A;  3IO6 A;  3S4U A;  1B5J A;  4F18 A;  5CBS A;  3I3V A;  3FVN A;  4RXL A;  1ELJ A;  1H43 A;  3QSL A;  2H9B A;  3U8Q A;  3FD3 A;  5KZT A;  3G7W A;  3SER A;  4ELQ A;  1NMU A;  3QYT A;  3SEY A;  4QF9 A;  1NNP A;  3B7D A;  3FVG A;  1YTV A;  1N7X A;  2P1S A;  1OVT A;  4R73 A;  4RK2 A;  2X26 A;  3IB1 A;  4QSE A;  5FHN A;  1QUL A;  2O7U A;  2XXR A;  3PMV A;  4FIM A;  1SBP A;  4PFT A;  3ZKK A;  1JVY A;  3H03 A;  5L8D A;  1GGG A;  2PBW A;  3O29 A;  4ISU A;  1B7U A;  2RIN A;  4QFN A;  1B3H A;  1B6H A;  1YPN A;  4ZEF A;  3RN8 A;  3T93 B;  1AL3 A;  4IO6 A;  2R71 A;  5TP9 A;  2DVC A;  2GRV A;  4QFP A;  1H76 A;  3BFU A;  1JNF A;  2Q2C A;  3DM0 A;  3D4C A;  3IOT A;  2LAO A;  3K01 A;  4H67 A;  4OXV A;  5H8S A;  3T66 A;  1Y4C A;  3VFJ A;  1PC3 A;  2F34 A;  1QKA A;  2UYE A;  4XKR A;  2O51 A;  3SEX A;  2ONR A;  2QS3 A;  1FCK A;  1II5 A;  1JET A;  2V84 A;  2F97 A;  4G8H A;  4Z0I A;  3R26 A;  1B05 A;  1NNK A;  3IL1 B;  3SEU A;  4G4P A;  3PUX E;  2Q89 A;  4JSO A;  1JW4 A;  4OES A;  2R6G E;  3FAT A;  1H45 A;  1MQH A;  3K6X A;  1DOT A;  1AMF A;  1B1X A;  3T9X B;  2NXO A;  3ZKL A;  4NED A;  2I0C A;  5EHS A;  3CSB A;  3MVX A;  3RNN A;  1LBB A;  4POW A;  3A3U A;  4U21 A;  4E0X A;  1I6B A;  3FXQ A;  2DQV A;  1MH4 A;  2BJJ X;  4I9D A;  3KEI A;  5BUU A;  3RTW B;  3RT6 B;  1FTK A;  2ZYM A;  5I56 A;  3MZB A;  1YAE A;  2I48 A;  2PMS A;  3U92 A;  4EUO A;  3O9P A;  5DEX B;  4X1B A;  1NNF A;  1A54 A;  3K2D A;  4ESX A;  4YAH X;  5JEI A;  3O6H A;  5LOM A;  3V89 B;  2H99 A;  1MH3 A;  3MZ9 A;  4IO3 A;  4ELP A;  3JYR A;  1TT1 A;  3IJO B;  1JEV A;  1M5C A;  1FTJ A;  3E9X A;  3H6V A;  4NF4 A;  2PX1 A;  4DE8 A;  4Q30 B;  4F3P A;  3HCQ A;  4Q5T A;  5I58 A;  3LSX A;  5AA2 A;  2DE4 A;  3TMG A;  1D9Y A;  2ONS A;  4NF5 B;  4R75 A;  1POT A;  3H6U A;  3G3K A;  5H8N A;  2YLN A;  1P99 A;  2GHA A;  3SEW A;  1A99 A;  1UTB B;  1WVJ A;  4KD5 A;  3JV9 A;  2DP8 A;  1SD3 A;  2XXT A;  3N26 A;  3N6T A;  3L6G A;  1LB9 A;  3IOV A;  2Q8J A;  1XC1 A;  2PYY A;  4NF6 A;  4PFW A;  2HQ0 A;  3FGS A;  3M3K A;  4QHQ A;  3RPW A;  3ODB A;  4LQ5 A;  4OFJ A;  5TPA B;  1OQH A;  4C1U A;  4FE8 A;  3K00 A;  4H5G A;  4ZDM A;  4NF4 B;  2Y7P A;  2I4C A;  3RQT A;  3W9W A;  3ONM A;  3VDF A;  3TEL A;  1LFH A;  1IUD A;  3PUW E;  1ZTY A;  1TFA A;  2HAU A;  3FJ7 A;  1S7Y A;  1FQF A;  2I3V A;  4H5F A;  2X7P A;  1MPB A;  1JVX A;  1SYH A;  2HEU A;  2Y7R A;  4IO7 A;  2DXR A;  3D4G A;  3KZG A;  4DIG A;  4F3B A;  5FTI A;  1Y3Q A;  3QAX A;  3WAF A;  1JW1 A;  1AIV A;  1QKB A;  1AH5 A;  1A7L A;  3LUY A;  4DXB A;  3G3G A;  1XHY A;  4R6Y A;  2OJT A;  2Z8F A;  1DSN A;  1NL5 A;  1USY E;  2ZYO A;  3A09 A;  3PMW A;  4KQP A;  4PE5 B;  4QRZ A;  4U1Z A;  3WAE A;  4WEP A;  3C35 A;  1T0K A;  3KN3 A;  4IO5 A;  4YZZ A;  1P1W A;  2QPQ A;  5B7D A;  1B7Z A;  2VD2 A;  5DVJ A;  3S9L C;  1SI0 A;  2RC7 A;  3IB2 A;  5DVF A;  3RUM A;  1URG A;  1DTZ A;  4OFO A;  3SES A;  5HM4 B;  1B40 A;  1MM7 A;  1IXC A;  3TCH A;  5I84 A;  4H8I A;  2G29 A;  3ECR A;  4N13 A;  3PPP A;  2QS1 A;  1IEJ A;  5F7V A;  1Z7M E;  3UGW A;  4XIG Q;  1B5H A;  1N76 A;  4EXL A;  3HO7 A;  3PUZ E;  3PPO A;  4QSC A;  3BKI B;  3FVO A;  2XXU A;  1M5D A;  3M3L A;  1MQD A;  2XD3 A;  3MUQ A;  4EDP A;  1MXZ A;  3TEP A;  4XKQ A;  4P0I A;  5DT6 A;  3ZS6 A;  3HST A;  2WKY A;  1FW0 A;  1MRP A;  2F8D A;  1I6Q A;  3OSQ A;  4GD5 A;  3H6T A;  3KSJ A;  4OEN A;  3KFM A;  5FTH A;  5CM6 A;  5HPQ A;  4WED A;  2OWT A;  3KN7 A;  2NWJ A;  1Y1M A;  4GOT A;  3RT8 A;  1MY2 A;  4DLD A;  3C36 A;  1SW4 A;  3LSW A;  1IXH A;  4YU0 A;  3CG1 A;  2A5S A;  4KPT A;  5CI5 A;  1VR5 A;  5AE4 A;  2DOJ A;  2QRY A;  2H4I A;  4P0G A;  1NH8 A;  1PEB A;  1QUI A;  1ZKB A;  3U1O A;  1B32 A;  4O3C A;  1DMB A;  1JEU A;  4U2R A;  5CMB A;  5CMK A;  3K4U A;  3K1P A;  2M8C A;  2XXW A;  2AIX A;  3KOS A;  5K2Y A;  3C34 A;  3TZA A;  5DVI A;  3DEL B;  3MP8 A;  1RYX A;  2OBG A;  5FHO A;  3ZSF A;  4X1D A;  3VLV A;  3FJM A;  4BDO A;  4K3F A;  1NH7 A;  4YKP A;  4JB7 A;  1SW2 A;  4R2F A;  3ILU B;  1GV8 A;  3V8X B;  2ONK E;  3HHF A;  2XX9 A;  4BDQ A;  3T9U A;  3HN0 A;  5A5X A;  3AXF A;  1URS A;  2X7Q A;  4RPO A;  3A3C A;  4ZZA A;  3V83 A;  1US5 A;  5DEX A;  3C9H A;  5I59 A;  4XXU A;  2E1S A;  4OEU A;  3EHT A;  1BKA A;  3UN6 A;  1R9L A;  1FQA A;  4GL8 A;  1BIY A;  3UOR A;  5BWJ A;  4U22 A;  1QW0 A;  1FQC A;  3GBA A;  4OQO A;  3FUZ A;  1ANF A;  4G8M A;  4TOZ A;  2OWS A;  4RJZ A;  1N3X A;  1IQ7 A;  1B3F A;  1I6A A;  2Z23 A;  4MH5 A;  5EHM A;  1XOC A;  4ZS9 A;  2DXY A;  1WDN A;  3CVG A;  1TXF A;  4G68 C;  4Z7E A;  5AA3 A;  1N0T A;  1OLC A;  1LAH E;  2RF1 A;  4ELR A;  4KHZ E;  4YB7 A;  4MBP A;  1USY H;  3H7M A;  2REG A;  4WXJ A;  3MVY A;  3R6U A;  3IX1 A;  1B4Z A;  3CFX A;  1A8F A;  4OZ9 A;  3K02 A;  1LAX A;  3BFT A;  4KYD A;  1ZBM A;  1UIU A;  1QUJ A;  4HCY A;  3T9V A;  2DS9 A;  3USD A;  3IO4 A;  1D9V A;  3UP9 A;  1B58 A;  3DP4 A;  3QK6 A;  1GVC A;  1QVS A;  2RCA A;  1MXU A;  4HS7 A;  4F3S A;  4OMB A;  2XXV A;  1XS5 A;  4G8N A;  1WOD A;  3O28 A;  3TTR A;  4G68 A;  2AL5 A;  1N04 A;  2UXA A;  1GTK A;  2D21 A;  4KFQ A;  3RTF B;  3VVD A;  3O6G A;  5I2K B;  1MQJ A;  2V93 A;  4JBZ A;  4QFK A;  4U4S A;  4RA1 A;  5I57 A;  1CB6 A;  3OO9 A;  5ICT A;  4M1V A;  4EQ9 A;  4JSD A;  1B4H A;  3QXM A;  1EU8 A;  4F1U A;  1Z7N E;  1B9J A;  4QSD A;  3SEV A;  1LCT A;  2PVU A;  5JTY A;  2O6A A;  1NFT A;  3QUF A;  3T22 A;  2V3U A;  4F29 A;  4F2Q A;  2B3F A;  4KYE A;  5L9M A;  4OEV A;  1MXY A;  4AB6 A;  4N6P A;  4AQ4 A;  4FAJ A;  3MPL A;  3TAJ A;  1MY3 A; 
#chains in the Genus database with same CATH topology
 3OEN A;  1RKM A;  4NWD A;  1Y9U A;  4C0R A;  4FBP A;  4TQU Q;  1G0I A;  4GX3 A;  1XVY A;  1SI1 A;  2UYF A;  4H0W A;  4F1Y A;  2XWI A;  1INP A;  4AB5 A;  5IM2 A;  3H4Z A;  5L9O A;  2QMW A;  2XXK A;  1HSL A;  4GVO A;  4M4G A;  1N3W A;  3FV1 A;  1IIW A;  4KCD A;  1LBX A;  3SEX A;  3RGY A;  3OEL A;  2NUV A;  1ZIU A;  3VXC A;  4WKM A;  3DP6 A;  2WBB A;  1IMA A;  5KDT B;  2H25 A;  3V5A A;  4P9K A;  1A8E A;  1ZLQ A;  2QS2 A;  3IFA A;  1FQB A;  2O1L A;  4KCC A;  1ZJL A;  3EN3 A;  2DYX A;  5ISU A;  1SW1 A;  1AOV A;  2XXX A;  3QIM A;  1NNT A;  1I69 A;  2VHA A;  4OAN A;  1P1O A;  4R72 A;  4LVQ A;  5IKB A;  1R6Z A;  2AL4 A;  3A29 A;  3P7I A;  4NF0 A;  3MAM A;  4NF5 A;  4TLL B;  1VFD A;  2DE2 A;  4PDD A;  4KXP A;  4L17 A;  3Q25 A;  3KSX A;  4U23 A;  1D4N A;  3OEM A;  4HTG A;  5CMC A;  2UVJ A;  4ESW A;  2HFB A;  4MLV A;  2H98 A;  4O94 A;  1BLF A;  2V3Q A;  3MVW A;  4H8J A;  5AA2 B;  4FAT A;  2RC9 A;  1OIB A;  4R2B A;  1PDA A;  1B3E A;  4HE0 A;  1FBD A;  1Y3P A;  4X48 A;  2F6G A;  4LA9 A;  4EQB A;  5JEI A;  2WX9 A;  3PU5 A;  3L6H A;  4I8C A;  1FTO A;  1B0L A;  2I49 A;  3KN8 A;  3GZG A;  3Q26 A;  3W9V A;  3PV0 E;  1OQG A;  5H8N B;  2Q8M A;  2DVZ A;  1PBQ A;  2FYI A;  2QSX A;  3OEK A;  2DE3 A;  2RC8 A;  3O66 A;  1NUW A;  4GWO A;  2F35 A;  2UVI A;  5JK4 A;  1GR2 A;  3F11 A;  4ZEK A;  4HW8 A;  4QFL A;  3TTL A;  1D3K A;  2PT1 A;  3IJX B;  4OFL A;  1LAG E;  2V25 A;  2XHD A;  2DDK A;  3FV2 A;  2P2A A;  3T1B A;  5KDT A;  4PP0 A;  1FJ9 A;  5IZ1 A;  2VPN A;  4MLQ A;  4IY5 A;  4TLM B;  4HCW A;  4YKK A;  5I2N A;  3G3F A;  3B6T A;  4R9F A;  4O7M A;  4GBV A;  4H6D A;  1CNQ A;  3MWB A;  4N4U A;  2L5V A;  2QVV A;  1VFE A;  2XXP A;  5KCJ A;  4C1T A;  3UK4 A;  1LGB C;  2ZXT A;  4MF3 A;  1LB8 A;  3RY3 A;  1MY0 A;  4BDL A;  2XWV A;  4NWC A;  4P3L A;  2O69 A;  3LR1 A;  5AA4 A;  3E13 X;  4LUB A;  4FED A;  3MP6 A;  2FNC A;  4ONY A;  2XX8 A;  3B6W A;  1P1N A;  4XKN A;  5DTB A;  3CR9 A;  1JQF A;  2FIX A;  1B2H A;  4U4X A;  3SKP A;  4FEB A;  2XD2 A;  3HPI A;  4R6K A;  5AA1 A;  1K9Y A;  4DZ1 A;  5F24 A;  2F5X A;  4ND9 A;  1PBP A;  1B5J A;  4PF8 A;  5CBS A;  5KZT A;  3U8Q A;  1NMU A;  3QYT A;  4QF9 A;  3B7D A;  1N7X A;  4PFB A;  2O7U A;  4FIM A;  3PMV A;  1SBP A;  1GV8 A;  3TTK A;  1B7U A;  4ZEF A;  4QFN A;  1AL3 A;  4IO6 A;  2R71 A;  4P1E A;  2GRV A;  1JNF A;  3IFC A;  1SPI A;  4OXV A;  4DLD A;  1Y4C A;  5BWJ A;  2F34 A;  2ONR A;  1JET A;  4G8H A;  1NNK A;  4OES A;  3FAT A;  1MQH A;  3K6X A;  1DOT A;  1B1X A;  3A3U A;  1I6B A;  2BJJ X;  2I48 A;  3U92 A;  5DEX B;  4X1B A;  5ESY A;  1A54 A;  3O6H A;  1MH3 A;  3MZ9 A;  1NV0 A;  3E9X A;  4Q30 B;  3LSX A;  2ONS A;  3JV9 A;  3N6T A;  1SD3 A;  5J16 A;  3IOV A;  1XC1 A;  4PFW A;  4QHQ A;  4C1U A;  4FE8 A;  5I7I A;  4P47 A;  2Y7P A;  3ONM A;  5LDZ A;  2HXR A;  1S7Y A;  1MPB A;  1SYH A;  4X04 A;  2DXR A;  4DIG A;  1LBY A;  1Y3Q A;  5FTI A;  3WAF A;  1AIV A;  4XFE A;  3G3G A;  4R6Y A;  5M2V A;  3PMW A;  4KQP A;  4WEP A;  4YZZ A;  4PFI A;  2RC7 A;  1NV7 A;  1DTZ A;  4MAG A;  5HM4 B;  4H8I A;  4N13 A;  5F7V A;  1Z7M E;  3UGW A;  3FVO A;  1MXZ A;  3ZS6 A;  2WKY A;  4O7I A;  3KBZ A;  3OSQ A;  1FPE A;  3KSJ A;  2OWT A;  3KN7 A;  2FIE A;  3RT8 A;  2H4I A;  1QUI A;  5CMB A;  5IZZ A;  3K4U A;  3KOS A;  4H45 A;  5K2Y A;  5DVI A;  4X1D A;  4BDO A;  4YKP A;  4R2F A;  3ILU B;  2ONK E;  2XX9 A;  3C9H A;  4XXU A;  3EHT A;  1R9L A;  5L8D A;  1FQC A;  4OQO A;  4TOZ A;  1I6A A;  5EHM A;  5AA3 A;  4Z7E A;  4JVI A;  1OLC A;  4GWZ A;  4MBP A;  2REG A;  4WXJ A;  3MVY A;  1LAX A;  4KYD A;  1FRP A;  1QUJ A;  4PAI A;  4HS7 A;  2Y5K A;  4OMB A;  1XS5 A;  1N04 A;  2UXA A;  3RTF B;  2D21 A;  3VVD A;  2V93 A;  5ET8 A;  4M1V A;  1B4H A;  3QXM A;  3SEV A;  3QUF A;  5T3J A;  4F2Q A;  4KYE A;  1MY3 A;  3JZJ A;  3KGC A;  4OWD A;  4XTC Q;  3LV0 A;  4I1D A;  1FPB A;  2Z8E A;  4OET A;  4DXC A;  1N84 A;  2Y7K A;  4F39 A;  3PD8 A;  5CC2 A;  3LC8 A;  4RNS A;  4E0W A;  4F3G A;  1F9B A;  3PGF A;  3I6V A;  3TQL A;  5H8Q A;  3IOU A;  4QBA A;  5H8F A;  1MXV A;  3VVF A;  1N7W A;  2OCU A;  1PB8 A;  2QMX A;  2RKM A;  4MHF A;  4PET A;  5H8F B;  2UVG A;  3U94 A;  1MPC A;  3TPA A;  4DCX A;  2P0S A;  2CZL A;  4OER A;  1MG1 A;  3KJ7 A;  5ET6 A;  2F7B A;  4OVP A;  3TKD A;  4IB2 A;  1A40 A;  1B7H A;  4MFI A;  3OXN A;  1O64 A;  5TPA A;  1EYK A;  4BDN A;  5ITP A;  1B52 A;  4LAT A;  1J1N A;  4GXA A;  3FZV A;  2Y7I A;  2VGQ A;  3W15 C;  4JWO A;  4MEV A;  2DWA A;  1H44 A;  4PFY A;  2ZNT A;  2A5T B;  4KI0 E;  1EH3 A;  3HHG A;  1CE2 A;  1M5F A;  1KA1 A;  1MM6 A;  1OVB A;  1UTH B;  3VVE A;  1YYZ A;  3OOA A;  3G3H A;  2ANJ A;  3O97 A;  3E3K A;  4LON B;  1M5E A;  5CMM A;  2VOZ A;  2Y7W A;  1NUY A;  3FVK A;  4Q0C A;  5AA2 D;  1B1H A;  2QJE A;  3MZ1 A;  3M3F A;  4GWY A;  2UVH A;  1O63 A;  4XKP A;  5I59 B;  4FJP A;  1FQE A;  3VE1 B;  1B3G A;  3N6U A;  3TTN A;  4PAK A;  2REJ A;  3FXU A;  1EZP A;  5I58 B;  3I5O A;  2DWJ A;  2A5T A;  5KCJ B;  3IAZ A;  2NVU B;  5I2K A;  4EF2 A;  1JW5 A;  4OVJ A;  1R9Q A;  2Z22 A;  3DP8 A;  3SDF A;  4QXD A;  1TFD A;  3MYU A;  5I2N B;  3K6V A;  4BLA A;  2DWH A;  3K1N A;  3FBP A;  4GLI A;  4ZE8 A;  5AA4 B;  1Y20 A;  2CZH A;  4BDM A;  3PTY A;  3CIJ A;  4G61 A;  2RCB A;  2WEF A;  1D9Q A;  2HAV A;  1MDQ A;  5H8H B;  1LFG A;  4GWU A;  4JDF A;  4ZE9 A;  1M5B A;  4THI A;  4MX6 A;  2CEY A;  5CBR A;  4EQ7 A;  3O6I A;  1VDW A;  3UIF A;  3MQ9 A;  2Q2A A;  2I6E A;  2KR0 A;  4F1V A;  1MY4 A;  1FTL A;  3LSL A;  3OO7 A;  3C32 A;  2ZNU A;  3LBS A;  4GBW A;  3E78 A;  5J1D A;  2D3I A;  4FOR A;  5FHM A;  4GIZ A;  2O84 X;  4PC9 A;  5H8Q B;  4G2Z A;  1FPL A;  4OHN A;  3PD9 A;  4FEC A;  4DI3 D;  4NTL A;  1MPD A;  1DTG A;  2QL3 A;  2E0S A;  4U1O A;  2H5Y A;  3EHU A;  4BDR A;  5ITO A;  4G68 B;  1MS7 A;  3E79 A;  2KQZ A;  1YCJ A;  2Z8D A;  3IO6 A;  2F3B A;  2H9B A;  1NNP A;  3FVG A;  1YTV A;  2P1S A;  4R73 A;  4QSE A;  3IB1 A;  5FHN A;  1QUL A;  2XXR A;  1JVY A;  2PBW A;  4ISU A;  1YPN A;  1H76 A;  3BFU A;  2Q2C A;  3T66 A;  5H8S A;  3VFJ A;  4F29 A;  2UYE A;  1QKA A;  2O51 A;  2QS3 A;  1IMB A;  1FCK A;  4Z0I A;  3R26 A;  1B05 A;  3SEU A;  1YZ0 A;  2XA5 A;  2Q89 A;  4JSO A;  4H46 A;  4MNP A;  1NV2 A;  4NED A;  4PGP A;  2BJI A;  3CSB A;  1LBB A;  4POW A;  4I40 A;  4NHB A;  3KEI A;  5BUU A;  3RT6 B;  1FTK A;  1IMF A;  5I56 A;  2PMS A;  5IZ3 B;  1JEV A;  3H6V A;  1FTJ A;  4NF5 B;  2XWO A;  3G3K A;  5H8N A;  3SEW A;  1P99 A;  2GHA A;  1A99 A;  3N26 A;  3UP9 A;  4NF6 A;  3ROJ A;  4OFJ A;  1RDZ A;  3VDF A;  1LFH A;  2VT5 A;  4HE1 A;  3PUW E;  3FJ7 A;  2X7P A;  2HEU A;  3D4G A;  3KZG A;  1A7L A;  3LUY A;  4PCD A;  4DXB A;  1NV4 A;  2ZYO A;  1DSN A;  3A09 A;  1P1W A;  2QPQ A;  5B7D A;  1B7Z A;  3RUM A;  3IB2 A;  1B40 A;  1MM7 A;  1IXC A;  5I84 A;  1IEJ A;  3BIH A;  4NG7 A;  4EXL A;  1N76 A;  2OWZ A;  3M3L A;  2XXU A;  4OVR A;  1MQD A;  2XD3 A;  4EDP A;  4P0I A;  3HST A;  1FW0 A;  2Q74 A;  4P1L A;  1SW4 A;  4YU0 A;  3CG1 A;  4KPT A;  1VR5 A;  2DOJ A;  1NH8 A;  1B32 A;  4U2R A;  2M8C A;  2FVZ A;  2PFZ A;  3MP8 A;  3ZSF A;  3VLV A;  2OX3 A;  1NH7 A;  4JB7 A;  1SW2 A;  3V8X B;  4N6K A;  3B8B A;  3HN0 A;  2FBP A;  2X7Q A;  4ZZA A;  5DEX A;  1LBZ A;  4OEU A;  4G8M A;  1N3X A;  4P8B A;  5A5X A;  1XOC A;  2DXY A;  1TXF A;  1N0T A;  2RF1 A;  4N17 A;  3H7M A;  3USD A;  4HCY A;  3IO4 A;  3DP4 A;  1MXU A;  2CZK A;  4KFQ A;  4F22 A;  1GTK A;  5I57 A;  5I2K B;  1MQJ A;  2QFL A;  1CB6 A;  5EYH A;  5JTY A;  1LCT A;  2PVU A;  2O6A A;  2WBD A;  2ZZV A;  1EYJ A;  5L9M A;  4I3E A;  4FAJ A;  3MPL A;  3HCQ A;  3T9H B;  2O7I A;  3TCF A;  4PF6 A;  4EF1 A;  3EQ1 A;  4YIC A;  1BP5 A;  2GFE A;  1FTA A;  3GXA A;  5TU0 A;  4POX A;  3KBR A;  3ILT B;  3MJN A;  1EZ9 A;  5I56 B;  4OYV A;  3EF7 A;  3TCG A;  4N07 A;  3GBB A;  4XF5 A;  3S9N C;  5K2X A;  1B51 A;  3G3I A;  5CRY A;  4OTE A;  1RDY A;  1SQY A;  2XXY A;  4R74 A;  2VP1 A;  2I0B A;  4YKI A;  4EXK A;  1B3L A;  1NV3 A;  2HPG A;  1FPD A;  4LN5 A;  4ELO A;  3OO8 A;  2ALU A;  4IO4 A;  4PFU A;  3T96 B;  4G77 A;  2FA7 A;  1FBC A;  1LST A;  5HBC A;  4GFR A;  3IB0 A;  1NUZ A;  2XX7 A;  1YXI A;  2R9J A;  3IOR A;  1L5T A;  3CHG A;  1MXW A;  4YB6 A;  4UAC A;  4H65 A;  1ZU0 A;  3MVZ A;  4LZ7 A;  3O2A A;  4LZ8 A;  1LBC A;  3FJG A;  3KG2 A;  5L9S A;  4ZDM A;  4GQO A;  4N6D A;  2ZNS A;  2XXQ A;  1NKX A;  4NF8 A;  2ZMB A;  1UQW A;  4O8M A;  3HFU A;  4AS5 A;  2CMO A;  2O68 A;  1DPE A;  2F7C A;  3OMB A;  3IOW A;  3M8U A;  2F7A A;  3SET A;  2G93 A;  5IGA A;  1B5I A;  4R9G A;  1S50 A;  5ELV A;  3LUZ A;  3TFL A;  3N94 A;  5DW8 A;  1FPJ A;  2I58 A;  4ZZE A;  2GHB A;  1S9T A;  5JTY B;  3THI A;  2Q9T A;  2QS4 A;  3TOD A;  1ATG A;  3EKI A;  4N8G A;  4JWX A;  3S2V A;  2I4B A;  1MQI A;  5I57 B;  3VLW A;  5I5P A;  5F1Q A;  3EHS A;  2XXH A;  3BIG A;  2R8T A;  4UA8 A;  3U93 A;  2GH9 A;  5ET7 A;  1EYI A;  2B3B A;  3FXB A;  4N15 A;  3K1M A;  1FPG A;  3D1R A;  1LLS A;  4PBQ A;  4RPN A;  1Y3N A;  3S9M C;  5A5X B;  5TP9 B;  3CG3 A;  1KWH A;  1XVX A;  3VLU A;  3FXR A;  4UAB A;  3OO6 A;  1EZO A;  4IO2 A;  3DLN A;  3H6W A;  5EYF A;  1LFI A;  4QFO A;  4IY6 A;  1XT8 A;  2NOO A;  4YMB A;  4AS4 A;  1FTM A;  4ZED A;  3T0J A;  2QVU A;  3EPE A;  2VD3 A;  4MJO A;  4XEQ A;  4PAF A;  2ESN A;  4ZEB A;  4O3B A;  3KJT A;  4LQ2 A;  4GXS B;  4NQ8 A;  4YKJ A;  2HZL A;  1Y4T A;  1FPF A;  4MMP A;  4JWY A;  2W7Y A;  4F18 A;  4RXL A;  3FVN A;  1ELJ A;  4NAP A;  3G7W A;  4ELQ A;  2HHM A;  1FBE A;  4PFT A;  3ZKK A;  3H03 A;  1GGG A;  3O29 A;  3T93 B;  3RN8 A;  5TP9 A;  4QFP A;  3K01 A;  4H67 A;  3D4C A;  5EQ7 A;  2CEX A;  4XKR A;  2V84 A;  1LBV A;  1G0H A;  1NV1 A;  1AMF A;  3ZKL A;  5EHS A;  4E0X A;  2DQV A;  1MH4 A;  3RTW B;  2F3D A;  3MZB A;  4N8Y A;  3MST A;  4PBH A;  5LOM A;  3V89 B;  3JYR A;  4NN3 A;  2PX1 A;  4Q5T A;  2DE4 A;  4R75 A;  1POT A;  1DK4 A;  1UTB B;  1WVJ A;  4EQ9 A;  2PCR A;  1FPK A;  2HQ0 A;  3M3K A;  4LQ5 A;  5TPA B;  2PFY A;  4H5G A;  4NF4 B;  3RQT A;  3W9W A;  3TEL A;  1ZTY A;  1TFA A;  2HAU A;  2B4M A;  4IO7 A;  2Y7R A;  2V4C A;  3QAX A;  1JW1 A;  1QKB A;  2FHY A;  2Z8F A;  1NL5 A;  2WYP A;  4U1Z A;  1T0K A;  3C35 A;  4IO5 A;  2VD2 A;  3S9L C;  5A5L A;  1SI0 A;  5DVF A;  4OFO A;  4OVQ A;  2QS1 A;  4XIG Q;  3HO7 A;  3PUZ E;  4QSC A;  3BKI B;  1M5D A;  3MUQ A;  3TEP A;  5DT6 A;  1MRP A;  1I6Q A;  2ZZX A;  3H6T A;  5FTH A;  2B4L A;  1FPI A;  3KFM A;  4OEN A;  1K9Z A;  1Y1M A;  4GOT A;  3C36 A;  4P0G A;  1PEB A;  4HE2 A;  3NOH A;  5CMK A;  1NV6 A;  4O3C A;  1DMB A;  1JEU A;  3K1P A;  3C34 A;  1AWB A;  1RYX A;  2OBG A;  3FJM A;  4K3F A;  1QGX A;  1KZ8 A;  3T9U A;  1US5 A;  2E1S A;  5EQ8 A;  1FQA A;  1BIY A;  3UOR A;  4U22 A;  3V83 A;  3FUZ A;  1ANF A;  4F31 B;  4RJZ A;  1IQ7 A;  1WDN A;  4G68 C;  1NI9 A;  1LAH E;  4ELR A;  1USY H;  3R6U A;  1B4Z A;  1A8F A;  4OZ9 A;  1BK4 A;  3K02 A;  3BFT A;  3T9V A;  1B58 A;  1QVS A;  4F3S A;  1WOD A;  4G68 A;  4JBZ A;  4U4S A;  4RA1 A;  1EU8 A;  1B9J A;  4QSD A;  5LTC A;  4PE3 A;  1NFT A;  3T22 A;  4AB6 A;  4N6P A;  4AQ4 A;  4OA4 A;  3OSR A;  2ABH A;  4GL0 A;  1FBH A;  4F19 A;  1RYO A;  3RPL A;  3MP1 A;  1Q9D A;  5FBP A;  2IA4 A;  4NGU A;  3MPK A;  1QJM A;  2JJK A;  4N81 A;  1QUK A;  3K6W A;  2B65 A;  4PTK A;  2MKZ A;  4GRK A;  3TYH A;  4RY1 A;  1ZMG A;  5H8H A;  2XXI A;  4KYS A;  2F6P A;  4X9T A;  1TWY A;  3C33 A;  2ZYK A;  3IR1 A;  4EUO A;  1UTH A;  4P11 A;  3H06 B;  2HXW A;  2DSF A;  3CSG A;  4H1X A;  4R6H A;  5ET5 A;  3CFZ A;  4RK9 A;  1US4 A;  1OMP A;  1LCF A;  2Y5L A;  4YMA A;  4LP2 B;  2Q88 A;  1R1N A;  1H3D A;  4ZEC A;  2DWI A;  4NF6 B;  3K6U A;  1URD A;  5EYG A;  4GX6 A;  3TTM A;  3U65 A;  1MY1 A;  1UTB A;  3IK6 B;  2OLB A;  1LAF E;  3MW0 A;  3MC2 A;  1P1Q A;  5I3S A;  4DCY A;  1SW5 A;  2YPN A;  4KR5 A;  2ZYN A;  3CRB A;  3RLF E;  3TDJ A;  4ECF A;  4OVS A;  2THI A;  1IME A;  3U72 A;  1MXX A;  5DYH A;  1OLA A;  1HSE A;  3CFL A;  1FJ6 A;  1VSO A;  3PPR A;  2O1M A;  1XI6 A;  4NF8 B;  4PGN A;  3R7X A;  4DDD A;  2HZK A;  1Y1Z A;  4I3Y A;  1MQG A;  3Q28 A;  2OZZ A;  2F36 A;  2D5W A;  1SDX A;  4I62 A;  4MNC A;  3N5L A;  1O7T A;  3GLB A;  2V3T A;  3KOT A;  2AYS A;  1LBW A;  1MDP 1;  1A55 A;  5ICQ A;  3E4R A;  1Q1K A;  3ISP A;  1SVX B;  1B0H A;  3LSF B;  4Q8R A;  1KA0 A;  4GX4 A;  5IZ3 A;  1IXG A;  1IIT A;  4O3A A;  3TQW A;  3PUV E;  3B6Q A;  3K0V A;  1FBG A;  3CI8 A;  1PB7 A;  3C31 A;  3UA8 A;  1PB9 A;  3PMX A;  3Q27 A;  2I3W A;  3Q29 A;  1IZ1 A;  1IXI A;  2HCA A;  3QMF A;  2Y84 A;  4GF8 A;  4JXI A;  3TUS A;  4HXV A;  2YJP A;  1IMD A;  1DBZ A;  3FIR A;  1P1U A;  3PPN A;  3OD7 A;  4GWW A;  3G3J A;  4ZEI A;  1BTJ A;  4RYA A;  2F78 A;  5EQ9 A;  3C4M A;  3FAS A;  3GYY A;  3BBR A;  3PPQ A;  1POY 1;  3HV1 A;  2OK2 A;  1HSJ A;  3SZP A;  3PUY E;  4N91 A;  5IAI A;  1UIV A;  2IEE A;  4LZ5 A;  1VE4 A;  3QUJ A;  4IGR A;  1DPP A;  4JVD A;  1Q35 A;  4F2O A;  1SYI A;  1B46 A;  2PT2 A;  3H3G A;  4JVC A;  4NE4 A;  1RDX A;  4IGT A;  4MIJ A;  3MBP A;  1FBP A;  5EQA A;  4YB5 A;  3VV5 A;  3S9E A;  3RPL B;  3VXB A;  4PQJ A;  1FQD A;  2KLF A;  4NMY A;  1NV5 A;  3S4U A;  1LEV A;  3I3V A;  4MCO A;  1H43 A;  3QSL A;  3FD3 A;  3SER A;  3SEY A;  4X8R A;  4OVT A;  1OVT A;  4RK2 A;  2X26 A;  2XWK A;  2RIN A;  1B3H A;  1B6H A;  2DVC A;  3DM0 A;  3IOT A;  2LAO A;  5B70 A;  1PC3 A;  1II5 A;  2F97 A;  3IL1 B;  4G4P A;  3PUX E;  1JW4 A;  2R6G E;  1H45 A;  3T9X B;  2NXO A;  2I0C A;  3MVX A;  3RNN A;  4U21 A;  1DCU A;  3FXQ A;  4I9D A;  2ZYM A;  1YAE A;  3O9P A;  1NNF A;  2VPO A;  3K2D A;  3KC1 A;  4ESX A;  4YAH X;  1FSA A;  2H99 A;  3B50 A;  4IO3 A;  4ELP A;  1TT1 A;  3IJO B;  1M5C A;  4NF4 A;  4DE8 A;  4F3P A;  4MNI A;  5I58 A;  5AA2 A;  3TMG A;  1D9Y A;  3H6U A;  4GWS A;  2YLN A;  4KD5 A;  2Q8J A;  2DP8 A;  2XXT A;  4GWX A;  5I59 A;  3L6G A;  1LB9 A;  2PYY A;  3RPW A;  3KC0 A;  3FGS A;  4PDH A;  3ODB A;  1OQH A;  3K00 A;  2I4C A;  1IUD A;  4H5F A;  1FQF A;  1JP4 A;  2I3V A;  4DXU A;  1JVX A;  4DI4 B;  4F3B A;  4PFR A;  1AH5 A;  1XHY A;  4PE5 B;  2OJT A;  4QRZ A;  1USY E;  3WAE A;  3KN3 A;  5DVJ A;  1URG A;  3SES A;  4NX1 A;  3TCH A;  2G29 A;  2ZZW A;  3ECR A;  3PPP A;  1B5H A;  2P3N A;  3PPO A;  4XKQ A;  2F8D A;  4GD5 A;  5HPQ A;  5CM6 A;  4WED A;  2NWJ A;  1MY2 A;  3LSW A;  1IXH A;  5AE4 A;  2A5S A;  5CI5 A;  3RYD A;  2QRY A;  1ZKB A;  3U1O A;  2P3V A;  2CZI A;  2XXW A;  2AIX A;  3TZA A;  1FBF A;  1NUX A;  3DEL B;  1IMC A;  5FHO A;  4IR8 A;  3HHF A;  4BDQ A;  3AXF A;  1URS A;  4RPO A;  3A3C A;  3UN6 A;  1BKA A;  4GL8 A;  1QW0 A;  3GBA A;  4YB7 A;  2OWS A;  4ZS9 A;  1B3F A;  2Z23 A;  4MH5 A;  3CVG A;  4KHZ E;  2QVR A;  3IX1 A;  3CFX A;  4P56 A;  1ZBM A;  1UIU A;  2DS9 A;  2GQ1 A;  1D9V A;  3QK6 A;  1GVC A;  2RCA A;  3TTR A;  2XXV A;  4G8N A;  3O28 A;  2AL5 A;  3O6G A;  4QFK A;  3OO9 A;  5ICT A;  4JSD A;  4F1U A;  1Z7N E;  2V3U A;  2B3F A;  4OEV A;  1MXY A;  2WYK A;  3TAJ A; 
#chains in the Genus database with same CATH homology
 3JZJ A;  2ABH A;  3OEN A;  3KGC A;  3OSR A;  4GL0 A;  1RKM A;  3T9H B;  4NWD A;  4OWD A;  4F19 A;  2O7I A;  1RYO A;  1Y9U A;  4XTC Q;  3TCF A;  4I1D A;  4C0R A;  4TQU Q;  4EF1 A;  3EQ1 A;  4YIC A;  1BP5 A;  2GFE A;  1XVY A;  1SI1 A;  3GXA A;  3MP1 A;  2Z8E A;  2IA4 A;  2UYF A;  4OET A;  5TU0 A;  4H0W A;  4DXC A;  3MPK A;  1N84 A;  1QJM A;  4F1Y A;  2Y7K A;  4F39 A;  3PD8 A;  4POX A;  1QUK A;  5CC2 A;  3KBR A;  3LC8 A;  3K6W A;  4RNS A;  4AB5 A;  3H4Z A;  5L9O A;  2QMW A;  3ILT B;  3MJN A;  4E0W A;  4F3G A;  1F9B A;  2B65 A;  1EZ9 A;  3PGF A;  1HSL A;  5I56 B;  3I6V A;  4OYV A;  4GVO A;  4M4G A;  3TQL A;  5H8Q A;  1N3W A;  4GRK A;  3EF7 A;  3TYH A;  3FV1 A;  3TCG A;  1IIW A;  4KCD A;  1ZMG A;  3IOU A;  4RY1 A;  5H8H A;  2XXI A;  4KYS A;  4N07 A;  3RGY A;  2F6P A;  5H8F A;  3OEL A;  3GBB A;  1MXV A;  3S9N C;  3VVF A;  5K2X A;  2NUV A;  1B51 A;  1N7W A;  3G3I A;  2OCU A;  4X9T A;  1TWY A;  1ZIU A;  5CRY A;  3VXC A;  1PB8 A;  2QMX A;  2ZYK A;  1SQY A;  3C33 A;  3IR1 A;  2RKM A;  1UTH A;  4OTE A;  4PET A;  2XXY A;  4WKM A;  2UVG A;  2VP1 A;  3DP6 A;  4R74 A;  5H8F B;  3U94 A;  4P11 A;  1MPC A;  3TPA A;  4DCX A;  2P0S A;  5KDT B;  2I0B A;  4YKI A;  2CZL A;  3H06 B;  2H25 A;  4EXK A;  1B3L A;  3V5A A;  4OER A;  1MG1 A;  2HXW A;  3KJ7 A;  1A8E A;  1ZLQ A;  2DSF A;  3CSG A;  4ELO A;  4H1X A;  2QS2 A;  2F7B A;  4F22 A;  4R6H A;  1FQB A;  3CFZ A;  4RK9 A;  3TKD A;  1OMP A;  1US4 A;  1LCF A;  1A40 A;  3OO8 A;  4IB2 A;  2ALU A;  4IO4 A;  4PFU A;  1B7H A;  3T96 B;  4YMA A;  2O1L A;  4KCC A;  1ZJL A;  4G77 A;  4LP2 B;  4MFI A;  2Q88 A;  3EN3 A;  1R1N A;  2FA7 A;  2DYX A;  3OXN A;  1O64 A;  1LST A;  5ISU A;  1H3D A;  4ZEC A;  5HBC A;  1SW1 A;  5TPA A;  2DWI A;  4GFR A;  1AOV A;  2XXX A;  4NF6 B;  3IB0 A;  4BDN A;  2XX7 A;  3QIM A;  2R9J A;  1NNT A;  1URD A;  3K6U A;  1I69 A;  3TTM A;  5ITP A;  2VHA A;  4R72 A;  1P1O A;  3IOR A;  4LVQ A;  1L5T A;  5IKB A;  1R6Z A;  1MY1 A;  2AL4 A;  1MXW A;  1UTB A;  1B52 A;  3P7I A;  4LAT A;  3IK6 B;  4YB6 A;  1J1N A;  3MAM A;  4UAC A;  2OLB A;  4GXA A;  4H65 A;  4NF5 A;  4TLL B;  5B70 A;  1VFD A;  1ZU0 A;  2Y7I A;  2DE2 A;  2VGQ A;  3FZV A;  3W15 C;  1LAF E;  3MW0 A;  4JWO A;  3MVZ A;  3MC2 A;  1P1Q A;  2DWA A;  4LZ7 A;  1H44 A;  3O2A A;  4DCY A;  4LZ8 A;  1LBC A;  1SW5 A;  3FJG A;  3Q25 A;  4L17 A;  3KG2 A;  3KSX A;  5L9S A;  2YPN A;  4KR5 A;  2ZYN A;  3CRB A;  2ZNT A;  1D4N A;  4PFY A;  4U23 A;  4GQO A;  2A5T B;  4KI0 E;  2ZNS A;  3RLF E;  3TDJ A;  1EH3 A;  4ECF A;  3OEM A;  4HTG A;  2XXQ A;  5CMC A;  2THI A;  2UVJ A;  1NKX A;  4ESW A;  2HFB A;  3HHG A;  1CE2 A;  1M5F A;  4NF8 A;  3U72 A;  2ZMB A;  4MLV A;  2H98 A;  1UQW A;  1MM6 A;  1OVB A;  1BLF A;  2V3Q A;  3MVW A;  1MXX A;  5DYH A;  4H8J A;  1UTH B;  3VVE A;  1OLA A;  3OOA A;  1HSE A;  5AA2 B;  3G3H A;  2ANJ A;  4FAT A;  3CFL A;  2CMO A;  2O68 A;  1VSO A;  3O97 A;  2O1M A;  2RC9 A;  1OIB A;  1DPE A;  2F7C A;  3E3K A;  3OMB A;  3PPR A;  4R2B A;  1PDA A;  1B3E A;  3IOW A;  4LON B;  4NF8 B;  3M8U A;  1M5E A;  5CMM A;  3TTK A;  3R7X A;  2F7A A;  4DDD A;  2VOZ A;  2HZK A;  2Y7W A;  1Y1Z A;  1Y3P A;  4X48 A;  2F6G A;  3FVK A;  4LA9 A;  4Q0C A;  3SET A;  4EQB A;  2G93 A;  1B1H A;  3PU5 A;  5AA2 D;  1MQG A;  2QJE A;  1B5I A;  3L6H A;  2OZZ A;  2F36 A;  1FTO A;  3MZ1 A;  3Q28 A;  3M3F A;  4I8C A;  2UVH A;  2D5W A;  1O63 A;  1B0L A;  4R9G A;  1SDX A;  4I62 A;  2I49 A;  1O7T A;  3N5L A;  3GLB A;  2V3T A;  3KOT A;  2AYS A;  3KN8 A;  5M2V A;  1S50 A;  3GZG A;  3Q26 A;  4XKP A;  1MDP 1;  4FJP A;  5ELV A;  1FQE A;  3TFL A;  5I59 B;  3VE1 B;  1B3G A;  3W9V A;  3PV0 E;  3N6U A;  1A55 A;  1OQG A;  3N94 A;  5ICQ A;  3E4R A;  1Q1K A;  5H8N B;  2I58 A;  4ZZE A;  3TTN A;  2GHB A;  1SVX B;  1B0H A;  2DVZ A;  3LSF B;  1PBQ A;  2FYI A;  2QSX A;  4Q8R A;  3OEK A;  2DE3 A;  2RC8 A;  2REJ A;  1S9T A;  3O66 A;  4GWO A;  5JTY B;  2F35 A;  2UVI A;  3FXU A;  1IXG A;  1IIT A;  5JK4 A;  3THI A;  1EZP A;  5I58 B;  3I5O A;  2DWJ A;  1GR2 A;  2Q9T A;  4O3A A;  2A5T A;  3F11 A;  2QS4 A;  4ZEK A;  3TQW A;  3PUV E;  3TOD A;  3IAZ A;  5KCJ B;  1ATG A;  2NVU B;  5I2K A;  4EF2 A;  3B6Q A;  1JW5 A;  4OVJ A;  4HW8 A;  1R9Q A;  3K0V A;  2Z22 A;  3DP8 A;  4QFL A;  4JWX A;  3SDF A;  3S2V A;  3TTL A;  1D3K A;  3CI8 A;  1TFD A;  2I4B A;  2PT1 A;  1PB7 A;  1MQI A;  3C31 A;  3IJX B;  4OFL A;  1PB9 A;  3UA8 A;  3PMX A;  5I57 B;  1LAG E;  3Q27 A;  2V25 A;  2XHD A;  3VLW A;  5I2N B;  3K6V A;  4BLA A;  2I3W A;  3Q29 A;  2DWH A;  3K1N A;  4GLI A;  1IZ1 A;  5F1Q A;  1IXI A;  2HCA A;  3EHS A;  2XXH A;  3FV2 A;  4ZE8 A;  2P2A A;  5AA4 B;  1Y20 A;  4UA8 A;  2Y84 A;  4GF8 A;  4JXI A;  3U93 A;  2GH9 A;  3TUS A;  2YJP A;  5KDT A;  4BDM A;  4PP0 A;  2B3B A;  3FIR A;  1P1U A;  3CIJ A;  2RCB A;  3PPN A;  4MLQ A;  3OD7 A;  4IY5 A;  3K1M A;  2HAV A;  1MDQ A;  1LLS A;  4TLM B;  4RPN A;  1LFG A;  3G3J A;  4HCW A;  5H8H B;  1Y3N A;  4YKK A;  5I2N A;  3G3F A;  4ZEI A;  3S9M C;  5A5X B;  1BTJ A;  3B6T A;  4R9F A;  4JDF A;  4RYA A;  4ZE9 A;  2F78 A;  1M5B A;  3CG3 A;  4H6D A;  5TP9 B;  3MWB A;  4THI A;  1KWH A;  1XVX A;  3C4M A;  3VLU A;  3FAS A;  3FXR A;  3OO6 A;  1VFE A;  3BBR A;  5CBR A;  4EQ7 A;  3O6I A;  3UIF A;  2XXP A;  3PPQ A;  4C1T A;  3UK4 A;  5KCJ A;  1LGB C;  3MQ9 A;  1POY 1;  1EZO A;  2ZXT A;  3HV1 A;  4IO2 A;  3DLN A;  3H6W A;  1LB8 A;  2Q2A A;  4MF3 A;  2OK2 A;  3RY3 A;  5EYF A;  1HSJ A;  1LFI A;  3PUY E;  2I6E A;  4F1V A;  1MY4 A;  1MY0 A;  1FTL A;  3LSL A;  4IY6 A;  4QFO A;  4BDL A;  5IAI A;  3OO7 A;  3C32 A;  1XT8 A;  1UIV A;  2IEE A;  4LZ5 A;  1VE4 A;  2NOO A;  2ZNU A;  3LBS A;  4NWC A;  4YMB A;  2O69 A;  3LR1 A;  3QUJ A;  1FTM A;  4IGR A;  5AA4 A;  1DPP A;  4ZED A;  5J1D A;  2D3I A;  3E13 X;  4FOR A;  4LUB A;  1Q35 A;  5FHM A;  4GIZ A;  2O84 X;  4F2O A;  4FED A;  1SYI A;  1B46 A;  2PT2 A;  3H3G A;  3MP6 A;  2FNC A;  4G2Z A;  4ONY A;  2XX8 A;  4OHN A;  3B6W A;  3EPE A;  5H8Q B;  4NE4 A;  1P1N A;  2VD3 A;  3PD9 A;  4FEC A;  4XKN A;  4IGT A;  5DTB A;  3CR9 A;  1JQF A;  4NTL A;  1MPD A;  2ESN A;  4ZEB A;  1DTG A;  3KJT A;  2QL3 A;  3MBP A;  4LQ2 A;  4O3B A;  4GXS B;  1B2H A;  4U4X A;  2E0S A;  3SKP A;  4U1O A;  2H5Y A;  3EHU A;  4FEB A;  4YKJ A;  2HZL A;  1Y4T A;  2XD2 A;  4YB5 A;  5ITO A;  4G68 B;  4JWY A;  3VV5 A;  4BDR A;  4F31 B;  1MS7 A;  3HPI A;  3S9E A;  4R6K A;  5AA1 A;  3VXB A;  4PQJ A;  4DZ1 A;  1FQD A;  2F5X A;  4ND9 A;  2W7Y A;  4DXU A;  1YCJ A;  2KLF A;  2Z8D A;  4NMY A;  1PBP A;  3IO6 A;  3S4U A;  1B5J A;  4F18 A;  5CBS A;  3I3V A;  3FVN A;  4RXL A;  1ELJ A;  1H43 A;  3QSL A;  2H9B A;  3U8Q A;  3FD3 A;  5KZT A;  3G7W A;  3SER A;  4ELQ A;  1NMU A;  3QYT A;  3SEY A;  4QF9 A;  1NNP A;  3B7D A;  3FVG A;  1YTV A;  1N7X A;  2P1S A;  1OVT A;  4R73 A;  4RK2 A;  2X26 A;  3IB1 A;  4QSE A;  5FHN A;  1QUL A;  2O7U A;  2XXR A;  3PMV A;  4FIM A;  1SBP A;  4PFT A;  3ZKK A;  1JVY A;  3H03 A;  5L8D A;  1GGG A;  2PBW A;  3O29 A;  4ISU A;  1B7U A;  2RIN A;  4QFN A;  1B3H A;  1B6H A;  1YPN A;  4ZEF A;  3RN8 A;  3T93 B;  1AL3 A;  4IO6 A;  2R71 A;  5TP9 A;  2DVC A;  2GRV A;  4QFP A;  1H76 A;  3BFU A;  1JNF A;  2Q2C A;  3DM0 A;  3D4C A;  3IOT A;  2LAO A;  3K01 A;  4H67 A;  4OXV A;  5H8S A;  3T66 A;  1Y4C A;  3VFJ A;  1PC3 A;  2F34 A;  1QKA A;  2UYE A;  4XKR A;  2O51 A;  3SEX A;  2ONR A;  2QS3 A;  1FCK A;  1II5 A;  1JET A;  2V84 A;  2F97 A;  4G8H A;  4Z0I A;  3R26 A;  1B05 A;  1NNK A;  3IL1 B;  3SEU A;  4G4P A;  3PUX E;  2Q89 A;  4JSO A;  1JW4 A;  4OES A;  2R6G E;  3FAT A;  1H45 A;  1MQH A;  3K6X A;  1DOT A;  1AMF A;  1B1X A;  3T9X B;  2NXO A;  3ZKL A;  4NED A;  2I0C A;  5EHS A;  3CSB A;  3MVX A;  3RNN A;  1LBB A;  4POW A;  3A3U A;  4U21 A;  4E0X A;  1I6B A;  3FXQ A;  2DQV A;  1MH4 A;  2BJJ X;  4I9D A;  3KEI A;  5BUU A;  3RTW B;  3RT6 B;  1FTK A;  2ZYM A;  5I56 A;  3MZB A;  1YAE A;  2I48 A;  2PMS A;  3U92 A;  4EUO A;  3O9P A;  5DEX B;  4X1B A;  1NNF A;  1A54 A;  3K2D A;  4ESX A;  4YAH X;  5JEI A;  3O6H A;  5LOM A;  3V89 B;  2H99 A;  1MH3 A;  3MZ9 A;  4IO3 A;  4ELP A;  3JYR A;  1TT1 A;  3IJO B;  1JEV A;  1M5C A;  1FTJ A;  3E9X A;  3H6V A;  4NF4 A;  2PX1 A;  4DE8 A;  4Q30 B;  4F3P A;  3HCQ A;  4Q5T A;  5I58 A;  3LSX A;  5AA2 A;  2DE4 A;  3TMG A;  1D9Y A;  2ONS A;  4NF5 B;  4R75 A;  1POT A;  3H6U A;  3G3K A;  5H8N A;  2YLN A;  1P99 A;  2GHA A;  3SEW A;  1A99 A;  1UTB B;  1WVJ A;  4KD5 A;  3JV9 A;  2DP8 A;  1SD3 A;  2XXT A;  3N26 A;  3N6T A;  3L6G A;  1LB9 A;  3IOV A;  2Q8J A;  1XC1 A;  2PYY A;  4NF6 A;  4PFW A;  2HQ0 A;  3FGS A;  3M3K A;  4QHQ A;  3RPW A;  3ODB A;  4LQ5 A;  4OFJ A;  5TPA B;  1OQH A;  4C1U A;  4FE8 A;  3K00 A;  4H5G A;  4ZDM A;  4NF4 B;  2Y7P A;  2I4C A;  3RQT A;  3W9W A;  3ONM A;  3VDF A;  3TEL A;  1LFH A;  1IUD A;  3PUW E;  1ZTY A;  1TFA A;  2HAU A;  3FJ7 A;  1S7Y A;  1FQF A;  2I3V A;  4H5F A;  2X7P A;  1MPB A;  1JVX A;  1SYH A;  2HEU A;  2Y7R A;  4IO7 A;  2DXR A;  3D4G A;  3KZG A;  4DIG A;  4F3B A;  5FTI A;  1Y3Q A;  3QAX A;  3WAF A;  1JW1 A;  1AIV A;  1QKB A;  1AH5 A;  1A7L A;  3LUY A;  4DXB A;  3G3G A;  1XHY A;  4R6Y A;  2OJT A;  2Z8F A;  1DSN A;  1NL5 A;  1USY E;  2ZYO A;  3A09 A;  3PMW A;  4KQP A;  4PE5 B;  4QRZ A;  4U1Z A;  3WAE A;  4WEP A;  3C35 A;  1T0K A;  3KN3 A;  4IO5 A;  4YZZ A;  1P1W A;  2QPQ A;  5B7D A;  1B7Z A;  2VD2 A;  5DVJ A;  3S9L C;  1SI0 A;  2RC7 A;  3IB2 A;  5DVF A;  3RUM A;  1URG A;  1DTZ A;  4OFO A;  3SES A;  5HM4 B;  1B40 A;  1MM7 A;  1IXC A;  3TCH A;  5I84 A;  4H8I A;  2G29 A;  3ECR A;  4N13 A;  3PPP A;  2QS1 A;  1IEJ A;  5F7V A;  1Z7M E;  3UGW A;  4XIG Q;  1B5H A;  1N76 A;  4EXL A;  3HO7 A;  3PUZ E;  3PPO A;  4QSC A;  3BKI B;  3FVO A;  2XXU A;  1M5D A;  3M3L A;  1MQD A;  2XD3 A;  3MUQ A;  4EDP A;  1MXZ A;  3TEP A;  4XKQ A;  4P0I A;  5DT6 A;  3ZS6 A;  3HST A;  2WKY A;  1FW0 A;  1MRP A;  2F8D A;  1I6Q A;  3OSQ A;  4GD5 A;  3H6T A;  3KSJ A;  4OEN A;  3KFM A;  5FTH A;  5CM6 A;  5HPQ A;  4WED A;  2OWT A;  3KN7 A;  2NWJ A;  1Y1M A;  4GOT A;  3RT8 A;  1MY2 A;  4DLD A;  3C36 A;  1SW4 A;  3LSW A;  1IXH A;  4YU0 A;  3CG1 A;  2A5S A;  4KPT A;  5CI5 A;  1VR5 A;  5AE4 A;  2DOJ A;  2QRY A;  2H4I A;  4P0G A;  1NH8 A;  1PEB A;  1QUI A;  1ZKB A;  3U1O A;  1B32 A;  4O3C A;  1DMB A;  1JEU A;  4U2R A;  5CMB A;  5CMK A;  3K4U A;  3K1P A;  2M8C A;  2XXW A;  2AIX A;  3KOS A;  5K2Y A;  3C34 A;  3TZA A;  5DVI A;  3DEL B;  3MP8 A;  1RYX A;  2OBG A;  5FHO A;  3ZSF A;  4X1D A;  3VLV A;  3FJM A;  4BDO A;  4K3F A;  1NH7 A;  4YKP A;  4JB7 A;  1SW2 A;  4R2F A;  3ILU B;  1GV8 A;  3V8X B;  2ONK E;  3HHF A;  2XX9 A;  4BDQ A;  3T9U A;  3HN0 A;  5A5X A;  3AXF A;  1URS A;  2X7Q A;  4RPO A;  3A3C A;  4ZZA A;  3V83 A;  1US5 A;  5DEX A;  3C9H A;  5I59 A;  4XXU A;  2E1S A;  4OEU A;  3EHT A;  1BKA A;  3UN6 A;  1R9L A;  1FQA A;  4GL8 A;  1BIY A;  3UOR A;  5BWJ A;  4U22 A;  1QW0 A;  1FQC A;  3GBA A;  4OQO A;  3FUZ A;  1ANF A;  4G8M A;  4TOZ A;  2OWS A;  4RJZ A;  1N3X A;  1IQ7 A;  1B3F A;  1I6A A;  2Z23 A;  4MH5 A;  5EHM A;  1XOC A;  4ZS9 A;  2DXY A;  1WDN A;  3CVG A;  1TXF A;  4G68 C;  4Z7E A;  5AA3 A;  1N0T A;  1OLC A;  1LAH E;  2RF1 A;  4ELR A;  4KHZ E;  4YB7 A;  4MBP A;  1USY H;  3H7M A;  2REG A;  4WXJ A;  3MVY A;  3R6U A;  3IX1 A;  1B4Z A;  3CFX A;  1A8F A;  4OZ9 A;  3K02 A;  1LAX A;  3BFT A;  4KYD A;  1ZBM A;  1UIU A;  1QUJ A;  4HCY A;  3T9V A;  2DS9 A;  3USD A;  3IO4 A;  1D9V A;  3UP9 A;  1B58 A;  3DP4 A;  3QK6 A;  1GVC A;  1QVS A;  2RCA A;  1MXU A;  4HS7 A;  4F3S A;  4OMB A;  2XXV A;  1XS5 A;  4G8N A;  1WOD A;  3O28 A;  3TTR A;  4G68 A;  2AL5 A;  1N04 A;  2UXA A;  1GTK A;  2D21 A;  4KFQ A;  3RTF B;  3VVD A;  3O6G A;  5I2K B;  1MQJ A;  2V93 A;  4JBZ A;  4QFK A;  4U4S A;  4RA1 A;  5I57 A;  1CB6 A;  3OO9 A;  5ICT A;  4M1V A;  4EQ9 A;  4JSD A;  1B4H A;  3QXM A;  1EU8 A;  4F1U A;  1Z7N E;  1B9J A;  4QSD A;  3SEV A;  1LCT A;  2PVU A;  5JTY A;  2O6A A;  1NFT A;  3QUF A;  3T22 A;  2V3U A;  4F29 A;  4F2Q A;  2B3F A;  4KYE A;  5L9M A;  4OEV A;  1MXY A;  4AB6 A;  4N6P A;  4AQ4 A;  4FAJ A;  3MPL A;  3TAJ A;  1MY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...