3G7WA

Islet amyloid polypeptide (iapp or amylin) residues 1 to 22 fused to maltose binding protein
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
393
structure length
393
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAKCNTATCATQRLANFLVHSSNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structures of IAPP (amylin) fusions suggest a mechanism for fibrillation and the role of insulin in the process
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein, hormone
molecule keywords Maltose-binding periplasmic protein, Islet amyloid polypepti
total genus 123
structure length 393
sequence length 393
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g7wA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g7wA01
3A3CA 1LB8A 1LCTA 2ZNSA 1Z7ME 3MVZA 5H8NB 3OO6A 5I57B 3N26A 2HZKA 2DVCA 3IAZA 1HSJA 3GZGA 3IX1A 3OSRA 4C1UA 2F7CA 4OZ9A 3Q28A 5L9OA 3QUFA 1P1NA 3T9UA 3K1MA 4YMBA 3CFLA 3GLBA 4ZE8A 5L9SA 2X7QA 4L17A 1DMBA 3FGSA 4KHZE 4OMBA 1URGA 4YKKA 3JYRA 5FHMA 4KPTA 3ECRA 4MF3A 3QK6A 4YICA 5K2XA 3RN8A 3TDJA 4ELRA 5I58A 3KN7A 2ABHA 3CIJA 1B46A 1MQIA 5I59A 2O68A 2O6AA 3CVGA 3IJXB 1A7LA 4QFLA 1L5TA 1MXZA 3MP6A 1MDP1 3PPQA 1VSOA 3PPNA 4ZS9A 1MM7A 2QRYA 4ZECA 2CZLA 3SKPA 3TPAA 1FQBA 3CG3A 4R74A 3OELA 1FTOA 2O69A 3UGWA 3W9VA 1N7XA 3QXMA 2P1SA 5M2VA 2OWSA 1SW5A 3RPWA 5A5XB 3CFZA 3CI8A 3TQLA 4YZZA 2H25A 3HPIA 3RTFB 2GFEA 3GBAA 1US4A 2AIXA 2Z8DA 3S9MC 1MY4A 1FTKA 4H1XA 3K6VA 1XHYA 1DPEA 2HCAA 2QS4A 3OO8A 1LBCA 1UIUA 4MLQA 4RJZA 3KSXA 1LSTA 3S9EA 3O6HA 1P1WA 2Q88A 4YKPA 5AA1A 3TTKA 1ZTYA 3K1PA 1P1UA 3DP8A 4FORA 3RTWB 2B65A 3DM0A 5DTBA 5KCJB 4GLIA 2V3QA 3SETA 3TODA 4G2ZA 3PUYE 1VFDA 1TFDA 2RF1A 4GQOA 4F2QA 2ONRA 3K2DA 2R9JA 3AXFA 4I62A 4OERA 1FQEA 4YB6A 4DXBA 1J1NA 3K00A 4RK2A 1SYHA 1UTBB 2D21A 2Q2AA 4NF6A 3N6TA 3LC8A 4QHQA 3RGYA 1B3HA 1XOCA 2O1MA 1MDQA 2M8CA 4JSOA 4O3BA 4OFLA 3VVDA 2Y7RA 3ILUB 3BKIB 4KR5A 3C31A 4BDQA 5ITPA 3OOAA 1H3DA 2F6PA 3MVWA 2X7PA 2NUVA 4OVJA 2H9BA 3IO4A 4F31B 2XHDA 3PPRA 2GH9A 1MQJA 5ELVA 5EYFA 3Q26A 5H8SA 2F36A 3O9PA 4KQPA 1B7HA 4AB5A 3BBRA 1B2HA 4O3CA 1ZU0A 2AYSA 1QJMA 3PUVE 2FNCA 3B6WA 4IGTA 1ATGA 1BTJA 1UTHA 1MM6A 1AH5A 1XT8A 2PT1A 2Y7PA 2ZYKA 3OSQA 4OEUA 4XKPA 1POTA 3A09A 3FVGA 1MPDA 1B9JA 2UVGA 1OVBA 2I48A 1IITA 1BIYA 1AIVA 1DSNA 2DWJA 4ELOA 4KCCA 5B7DA 1B4HA 4QSEA 5CMCA 3B6QA 3C32A 3PD8A 4H6DA 4ZEDA 4ESWA 5I58B 4EF2A 3B7DA 4NF8A 5FTIA 4AQ4A 2XX9A 4NF4A 3FXQA 3KJTA 3TCFA 4AB6A 1Y3PA 2FA7A 3IOWA 4IO5A 1OMPA 4N13A 2H5YA 3S2VA 3TTRA 4Q5TA 2GRVA 4RXLA 2O1LA 1QUKA 1SQYA 3MPKA 3OO7A 1PEBA 2HFBA 2WKYA 3O66A 4EQBA 1PB8A 3MVYA 4EQ7A 3IJOB 4U21A 5JTYA 3C36A 2RKMA 2DVZA 3DP4A 5F7VA 3O2AA 3H7MA 2ALUA 3VLUA 4H5GA 3CG1A 3QYTA 3GXAA 3LSFB 1A8EA 1B51A 1H76A 2F35A 3L6GA 5ICTA 4KYSA 3TELA 2V3UA 1D3KA 1A54A 1QKAA 2F7AA 3RLFE 4FEBA 2KLFA 4YB5A 3RQTA 2VD2A 3H4ZA 5BUUA 1VR5A 3I3VA 2DE4A 1JVXA 1LAGE 3T96B 1LLSA 2DYXA 2VGQA 2I4CA 2IEEA 2XXIA 2ZXTA 1XC1A 1B05A 1LBBA 2H99A 3K01A 4LA9A 2FYIA 4NMYA 5H8NA 4TLMB 3BFTA 4KI0E 2YLNA 1GV8A 3MPLA 3HCQA 1EU8A 4H8JA 5CM6A 4YKIA 3DELB 2XD2A 1F9BA 3L6HA 4H5FA 2XX8A 4IY5A 4G68A 4O3AA 1Q1KA 4NF5A 4BDMA 4K3FA 4YAHX 3U94A 4IO4A 3HO7A 2NWJA 3OENA 5TPAB 3PMWA 1LAFE 5TPAA 2XXYA 5ISUA 1NH8A 1DOTA 1RYXA 1R1NA 2ZYNA 4IO7A 5CMBA 4HCYA 3VXBA 4BDRA 5EHSA 4NF5B 4P0IA 3SEWA 4EUOA 1JVYA 1NMUA 2O7UA 3B6TA 2DOJA 1R9LA 2DS9A 3TCGA 5AA4A 3LSWA 1JNFA 2PYYA 1SW4A 2ANJA 3R6UA 1DTZA 3FJ7A 1ZIUA 3PGFA 2I6EA 4U1OA 4ND9A 1MY1A 2A5TA 2Q9TA 1NKXA 4PQJA 1DPPA 1MQDA 2Z8FA 4NF4B 2NOOA 3SERA 4DIGA 4MLVA 4NWCA 3VFJA 4RK9A 3CRBA 1ZMGA 4YU0A 1OQHA 3JZJA 3O29A 2D5WA 2R71A 4GXAA 4KCDA 4EQ9A 1MXVA 3IK6B 4LQ5A 3EHUA 4QRZA 5H8HA 1PB9A 3PV0E 4LQ2A 1DTGA 1B6HA 1USYH 1BKAA 2YPNA 2V3TA 3MVXA 3FD3A 3RT8A 3TYHA 4ESXA 1EZPA 4EDPA 3HV1A 1SDXA 3SDFA 3MP1A 4JXIA 5H8FB 1IIWA 3K4UA 3O28A 4U23A 4F3BA 1SI1A 3ZS6A 4XIGQ 1IEJA 2HXWA 4OFOA 3VLWA 4H65A 5L9MA 4F3SA 2V84A 3VXCA 1A40A 4HS7A 1US5A 3KJ7A 4EXKA 1N04A 4XKQA 1R6ZA 1YTVA 2XXWA 3KN8A 4NEDA 3UORA 5AE4A 4RA1A 3KEIA 3PPPA 4X1DA 4JWOA 3E13X 3OEKA 2HZLA 3ODBA 2DWIA 2QPQA 3SEUA 5AA2D 4RY1A 1A99A 1JW1A 5I59B 4GL8A 3UN6A 4YMAA 1AMFA 1LFGA 2ZNUA 1POY1 2I3WA 2F34A 4RPNA 3TQWA 2RCBA 3K6WA 3R7XA 1FTJA 2XXTA 3H6UA 3TTNA 3FJGA 1WDNA 1HSLA 1TFAA 4FE8A 1H43A 4DCXA 2XXPA 4G77A 1I69A 3Q25A 2VP1A 1FTLA 4TQUQ 4F3GA 4WEDA 4MFIA 4G8NA 4F2OA 1NNKA 4OTEA 5F1QA 4FAJA 1MS7A 5KDTA 4FECA 3G3JA 4IO2A 1I6BA 4LATA 3MC2A 2HAVA 5KDTB 3SESA 2DWHA 1Y9UA 3O97A 1WODA 3FASA 3Q27A 1B40A 4H0WA 4KYEA 3IORA 4OQOA 5CBSA 3H3GA 1GVCA 1PDAA 3TUSA 1N3XA 3TFLA 3D4CA 4PE5B 1BLFA 3N5LA 1IQ7A 1JETA 1MY0A 1OLCA 3HHFA 2XX7A 2Z23A 3IOUA 3KOSA 2OJTA 2Y7IA 3MQ9A 2I0CA 4QFNA 5KCJA 3MW0A 1URSA 2CMOA 2XD3A 1QUIA 4GOTA 3TTLA 4BLAA 4UA8A 1UQWA 3U72A 4JWYA 2PT2A 4I8CA 1AOVA 2F97A 2RC8A 4YB7A 2F78A 1NNPA 1TXFA 2P0SA 4G4PA 4LONB 4U1ZA 3M8UA 1KWHA 4G68B 2IA4A 5DT6A 2DE3A 3N94A 3THIA 3VE1B 2LAOA 5H8QB 3W15C 2VOZA 1TWYA 2OCUA 1LFIA 4QFPA 1O63A 2GHAA 2ONKE 4RPOA 5K2YA 4F39A 3C35A 5DEXA 2OK2A 1JEVA 1B5JA 5FHNA 2XXUA 3KFMA 5J1DA 3OXNA 1B5HA 4PFYA 1B58A 4OWDA 1OQGA 1Y1MA 3M3LA 4YKJA 1N7WA 5CRYA 1A55A 5H8FA 1MY3A 3IOVA 1MQHA 3LSXA 1IXGA 5DEXB 3OEMA 5ICQA 3I5OA 3G3FA 1Y3QA 2OLBA 1SD3A 3EQ1A 4OHNA 5FHOA 2XXVA 3UP9A 4Q0CA 4JWXA 4ZE9A 1CE2A 2E0SA 3ZKLA 4F19A 1MPCA 1B3GA 1YCJA 2NXOA 2PBWA 3E4RA 4KYDA 4ZEBA 4ONYA 3SEVA 4GWOA 3TCHA 3KZGA 2R6GE 3RT6B 3WAEA 4F1UA 3LSLA 1HSEA 2AL4A 1R9QA 1P1QA 2RCAA 3PD9A 2DSFA 1B32A 1S9TA 5CMKA 2D3IA 4R6KA 3UA8A 1EH3A 3EF7A 2QMWA 1M5DA 4R6YA 4F1VA 4Q8RA 3QAXA 3FVNA 1FQAA 4JB7A 2I49A 2B3BA 3MZ1A 3TZAA 3DLNA 4XKNA 4BDNA 2F8DA 1LGBC 3OD7A 4ZZAA 5L8DA 3TEPA 2THIA 1P1OA 5DVJA 4TLLB 2XXQA 5I2NA 2QMXA 3P7IA 4OENA 4NTLA 3MAMA 4U4SA 1M5BA 3U8QA 3VLVA 1Y3NA 1Z7NE 4G8HA 4F22A 2B3FA 3EHSA 4OXVA 4FATA 4ZZEA 3FV2A 3PUZE 2DWAA 2PVUA 2ZYOA 3H6WA 4M1VA 3CR9A 3RNNA 1D9YA 3K1NA 5H8QA 1Y4CA 1B0HA 3G3KA 1IXCA 1QULA 3V8XB 1FQDA 4GF8A 2XXRA 4WKMA 2A5SA 3E9XA 3FIRA 1NNFA 3K6XA 3QUJA 4JDFA 2NVUB 3VVFA 3FVOA 2QS1A 3I6VA 4NWDA 4KD5A 5HPQA 3T66A 3T9XB 3V83A 3QIMA 4U4XA 2DQVA 3MZ9A 4MBPA 3BFUA 1IUDA 3FZVA 3MBPA 2ZNTA 4C1TA 4R2BA 3PPOA 3SEXA 4F1YA 4R75A 2G93A 5DYHA 4DCYA 2OBGA 3T22A 2O51A 1B52A 3LBSA 2UVJA 4JBZA 4FIMA 1B4ZA 5CMMA 5EHMA 3C9HA 2DXRA 3KGCA 3KG2A 1NFTA 2G29A 5TP9A 2E1SA 3ILTB 4C0RA 5AA3A 1N76A 3CSGA 2F5XA 1I6QA 1Y20A 2OWTA 2DP8A 1USYE 5TP9B 4PFWA 1MQGA 3KSJA 1B1HA 4R9GA 2UYEA 1QUJA 1LFHA 1JEUA 2VHAA 5CBRA 1MG1A 1MRPA 1SVXB 1ELJA 4P11A 2XXXA 4GIZA 1SBPA 2GHBA 3LR1A 3TKDA 1BP5A 2Q89A 4X1BA 3DP6A 4QSDA 4NF8B 4DDDA 4E0XA 4IY6A 4ELPA 3O6GA 3M3FA 1M5FA 4PFUA 5HM4B 3ONMA 4ZEIA 3VDFA 3W9WA 1VFEA 3T9VA 2A5TB 5ITOA 3UK4A 1EZOA 1B3FA 1M5EA 2REJA 4N07A 5JEIA 4ECFA 5I56A 3H6TA 2V93A 3G3IA 2Y7WA 1FQFA 1NL5A 5AA4B 1FQCA 1B5IA 1NNTA 3KBRA 1Y4TA 1ZKBA 4R6HA 3VV5A 1Y1ZA 1LAHE 5CC2A 3SEYA 4DZ1A 1M5CA 3TMGA 4IB2A 1N84A 3HN0A 2O84X 2VD3A 4ISUA 4RYAA 1OIBA 2AL5A 2UVIA 3T93B 1TT1A 1D4NA 4BDLA 3K6UA 4OYVA 4F29A 4GXSB 5I57A 3GBBA 4JSDA 4LZ8A 5DVIA 1MXXA 4Z7EA 2RC7A 4LUBA 3C33A 2QSXA 3C34A 1LAXA 2UXAA 1NH7A 1ZBMA 3MJNA 2F7BA 3HHGA 3PU5A 4GL0A 3WAFA 4BDOA 4DXCA 4OETA 3V5AA 5KZTA 1LB9A 3OO9A 1RKMA 3E3KA 3PUWE 4H8IA 4KFQA 1S50A 5I2KB 4LVQA 2Q8JA 2DXYA 1GR2A 1QKBA 1P99A 3S9LC 2ONSA 1B7UA 4U22A 4IO3A 3JV9A 1H45A 2O7IA 1MXYA 1ZJLA 1N0TA 1O7TA 2RINA 1MXUA 3FJMA 3FATA 1EZ9A 4OFJA 2Q2CA 5LOMA 3G3GA 1JQFA 1GGGA 3FUZA 2Y84A 4H67A 2Z22A 4HTGA 1OLAA 4QFOA 2PX1A 3IB0A 3F11A 1SI0A 2W7YA 5JTYB 3TAJA 5AA2A 3O6IA 3QSLA 4LP2B 5B70A 2I0BA 5JK4A 1B7ZA 4PP0A 3EPEA 5A5XA 1PB7A 1IXIA 1H44A 1FTMA 5IAIA 1XS5A 3PUXE 3K0VA 1O64A 2P2AA 1ZLQA 3A3UA 3R26A 1IZ1A 1SW2A 2H4IA 2HAUA 2I3VA 2QL3A 2XXHA 2YJPA 4DLDA 2V25A 3H06B 3PMXA 4IGRA 3H6VA 2X26A 1MH4A 4XXUA 3U1OA 1B3LA 3S4UA 3KN3A 3PMVA 3G3HA 3RUMA 1T0KA 2PMSA 4LZ5A 4DE8A 5I84A 1PBQA 3IO6A 3D4GA 3CSBA 4Z0IA 2ESNA 4QF9A 4GRKA 1S7YA 5I2KA 1PBPA 5I56B 1B3EA 3M3KA 2OZZA 1ANFA 4MH5A 3MP8A 4R9FA 3U92A 1JW4A 4WXJA 3EN3A 1FCKA 2BJJX 5H8HB 3ZKKA 1I6AA 1MH3A 2I58A 1B1XA 1XVYA 1Q35A 2ZMBA 3IOTA 3K02A 1AL3A 1MPBA 3CFXA 4GFRA 4G8MA 3RY3A 3TTMA 5FTHA 1GTKA 5DVFA 1LCFA 3IR1A 3V89B 4OEVA 3VVEA 1VE4A 3S9NC 1II5A 3N6UA 2QS2A 4I9DA 4F3PA 3LUYA 4UACA 5IKBA 3MUQA 3HSTA 4HW8A 4THIA 1QW0A 2F6GA 1JW5A 1IXHA 4WEPA 4M4GA 1UTHB 4P0GA 3IB2A 2Y7KA 3U93A 4EXLA 3IL1B 4PETA 2ZYMA 4ZEFA 4GVOA 4ZEKA 4QFKA 4QSCA 3USDA 5BWJA 4FJPA 4HCWA 1URDA 2H98A 2I4BA 1YAEA 4ELQA 2DE2A 3Q29A 1WVJA 5HBCA 1MY2A 3MZBA 5AA2B 2HQ0A 4E0WA 3FV1A 3FXUA 3IB1A 1SYIA 3C4MA 2QJEA 4GD5A 1XVXA 4R72A 1QVSA 3OMBA 3KOTA 3G7WA 1YPNA 4G68C 4NF6B 1UIVA 4X9TA 1MXWA 5TU0A 4ZDMA 4F18A 1PC3A 1A8FA 4I1DA 1B0LA 4OESA 4U2RA 4DXUA 4PFTA 1CB6A 4POXA 5CI5A 4R73A 4NE4A 4POWA 4XTCQ 1D9VA 1SW1A 4XKRA 4EF1A 5I2NB 3UIFA 2HEUA 1RYOA 1N3WA 4R2FA 3H03A 4N6PA 3ZSFA 4TOZA 1FW0A 2RC9A 1OVTA 2QS3A 4LZ7A 4X48A 2Z8EA 3FVKA 3EHTA 4Q30B 4RNSA 2REGA 2UYFA 3MWBA 3T9HB 1UTBA 3FXRA 4FEDA 2UVHA 4IO6A
chains in the Genus database with same CATH superfamily
1LB8A 1LCTA 5H8NB 3NOHA 3IX1A 4C1UA 5L9OA 3QUFA 1P1NA 2XWIA 3K1MA 3T9UA 4YMBA 2GQ1A 2FIEA 4L17A 4KPTA 5K2XA 3RN8A 3KN7A 2O68A 3IFCA 3CVGA 1L5TA 3PPNA 1VSOA 4ZECA 3W9VA 3LUZA 2OWSA 2WBDA 4YZZA 2H25A 3HPIA 4N15A 2Z8DA 1MY4A 1DPEA 4LN5A 4P9KA 4MLQA 3S9EA 3KSXA 4PBQA 2Q88A 4YKPA 1ZTYA 3K1PA 5KCJB 4XFEA 1TFDA 3K2DA 4OERA 2B4LA 3TEPA 4NF6A 4OFLA 2Y7RA 5ITPA 3C31A 4BDQA 3OOAA 1H3DA 4QBAA 2NUVA 2H9BA 3PPRA 5ELVA 2FNCA 1UTHA 2XWVA 1MM6A 1XT8A 2ZYKA 3FVGA 3T1BA 1IITA 1NV3A 1B4HA 3B6QA 3PD8A 5I58B 2XX9A 2P3VA 3KJTA 1Y3PA 2FA7A 3IOWA 1OMPA 4N13A 4O7MA 4P1EA 4Q5TA 1QUKA 1NV1A 4MAGA 2WKYA 2V4CA 4N81A 5F7VA 3H7MA 2CEYA 3FBPA 1QGXA 5ICTA 1B51A 2F35A 3L6GA 3RQTA 3I3VA 1JVXA 2DYXA 3ECRA 4RY1A 3K01A 4NMYA 1LEVA 4TLMB 4KI0E 2YLNA 5CM6A 3HCQA 4UABA 4YKIA 4H5FA 4O3AA 2NWJA 5TPAA 1NH8A 5CMBA 4IO7A 4HCYA 2WEFA 4NF5B 1FPKA 1R9LA 3R6UA 1ZIUA 3PGFA 2I6EA 4U1OA 4PQJA 2XWKA 3CRBA 1ZMGA 1OQHA 3JZJA 4GXAA 2R71A 2MKZA 4EQ9A 1MXVA 5H8HA 4LQ5A 4QRZA 1PB9A 1USYH 5LTCA 1BKAA 2YPNA 3RT8A 1NI9A 2PFZA 3MP1A 1IIWA 3O28A 4F3BA 4XIGQ 1A40A 4HS7A 4EXKA 4XKQA 2XXWA 4RA1A 3KEIA 3PPPA 1JP4A 5I5PA 3KBZA 5I59B 3UN6A 1AMFA 3R7XA 2XXTA 1TFAA 1H43A 2XXPA 4G77A 3CHGA 2VP1A 4F3GA 4MFIA 4G8NA 4IO2A 2HAVA 5KDTB 2DWHA 3FASA 2B4MA 2OWZA 1N3XA 3D4CA 1BLFA 4YU0A 4PAIA 1URSA 2CMOA 2F97A 2RC8A 1NNPA 1KWHA 3N94A 2OCUA 1O63A 4O8MA 5DEXA 2ZZWA 4PFIA 3OXNA 1B58A 5CRYA 1MY3A 1MQHA 1FBGA 4OHNA 4Q0CA 4KYDA 3KZGA 2R6GE 1HSEA 1R9QA 1P1QA 2FHYA 5CMKA 3EF7A 4N6DA 3HFUA 4Q8RA 2Q74A 4PC9A 4XKNA 4I3YA 1G0HA 3OD7A 1P1OA 4TLLB 3P7IA 4OENA 1M5BA 4G8HA 4ZZEA 4HXVA 3RNNA 2DWAA 3PUZE 2ZYOA 3H6WA 2XXKA 1D9YA 3K1NA 3G3KA 4GF8A 4WKMA 2A5SA 3K6XA 5HPQA 2WX9A 4DI3D 4KD5A 3T9XB 3FZVA 2ZNTA 4DCYA 3LBSA 1B4ZA 5CMMA 3KGCA 3KG2A 3ILTB 4C0RA 1N76A 1I6QA 1Y20A 5TP9B 1USYE 4R9GA 1QUJA 4MNIA 3IFAA 2VHAA 5CBRA 1MG1A 4NN3A 5EQAA 3ONMA 3VDFA 4I3EA 5JEIA 5I56A 1FJ6A 1KA1A 2V93A 3G3IA 1FQFA 1NL5A 1EYKA 1ZKBA 4R6HA 5I7IA 1N84A 4RYAA 3T93B 1TT1A 4OANA 4F29A 4N6KA 3GBBA 4PAFA 5DVIA 1MXXA 4OVSA 4GL0A 4AS4A 1KA0A 1YZ0A 4H8IA 2Q8JA 2NVUB 3QMFA 2ONSA 3ROJA 1H45A 4OFJA 3FUZA 4PGPA 4HTGA 3MYUA 3F11A 5JTYB 5B70A 3O6IA 4PP0A 2JJKA 3R26A 1O64A 1IZ1A 1SW2A 4DLDA 2V25A 1FBFA 1MH4A 1B3LA 3PMVA 3KC1A 5I84A 3CSBA 1K9YA 4GRKA 1S7YA 1PBPA 1B3EA 2VPNA 4MH5A 3MP8A 3U92A 1JW4A 4H46A 2I58A 1AL3A 1MPBA 4G8MA 3RY3A 1LCFA 3VVEA 3S9NC 2QS2A 4I9DA 4UACA 4KXPA 4EF1A 4M4GA 2Y7KA 3IL1B 4PETA 4ZEFA 4GVOA 4QSCA 3Q29A 1WVJA 3MZBA 1Q9DA 3IB1A 4GD5A 1QVSA 3OMBA 3KOTA 3G7WA 1YPNA 4G68C 5TU0A 1PC3A 4DXUA 4DXBA 1CB6A 4POXA 4XKRA 3H03A 2RC9A 2QS3A 2Z8EA 4Q30B 2REGA 4FEDA 2UVHA 3A3CA 2DVCA 3IAZA 3GZGA 4OVPA 1FBDA 3MSTA 3Q28A 5A5LA 1FPJA 5L9SA 1DMBA 3FGSA 4PDDA 4YKKA 3JYRA 3TDJA 2L5VA 3CIJA 5I59A 1MDP1 3SKPA 3TPAA 3CG3A 1FTOA 2O69A 2P1SA 3CFZA 3GBAA 2P3NA 1FTKA 3K6VA 2QS4A 3OO8A 4RJZA 1LSTA 3ZS6A 1P1UA 3DP8A 4FORA 3SETA 4G2ZA 3PUYE 4I62A 2R9JA 3RPLA 4YB6A 1J1NA 3K00A 4RK2A 2D21A 2Q2AA 3ZKKA 4QHQA 1B3HA 2O1MA 4O3BA 3VVDA 3ILUB 3BKIB 4JVDA 4XF5A 2XHDA 2GH9A 1MQJA 5H8SA 3O9PA 4IGTA 4ZEIA 1ATGA 1BTJA 2PT1A 2Y7PA 3OSQA 4OEUA 4XKPA 2UVGA 1BIYA 1DSNA 4QSEA 4EF2A 3LV0A 3TCFA 4AB6A 4IO5A 4PAKA 4MNPA 2HFBA 3O66A 3MVYA 4GWUA 3IJOB 5JTYA 3C36A 3DP4A 3CG1A 3GXAA 1QKAA 2F7AA 3RLFE 4FEBA 1DBZA 1EYIA 4YB5A 5BUUA 1VR5A 4GX3A 3T96B 1LLSA 3QSLA 2I4CA 2XXIA 1LBBA 2H99A 4LA9A 3SZPA 4H8JA 2XD2A 4YAHX 3HO7A 3OENA 5TPAB 1LAFE 1NV0A 4P0IA 4EUOA 1JVYA 2DOJA 5AA4A 2PYYA 2ANJA 1DTZA 4N17A 4PF6A 1VDWA 1DPPA 4NF4B 3SERA 2NOOA 4MLVA 4NWCA 4X8RA 4KCDA 3IK6B 2V3TA 1EZPA 4EDPA 3HV1A 1SDXA 3SDFA 4JXIA 3K4UA 4U23A 3B8BA 1IEJA 2HXWA 5EQ8A 2OX3A 5IM2A 1US5A 3KJ7A 1YTVA 4NEDA 4JWOA 3OEKA 3ODBA 2DWIA 2QPQA 4GL8A 2ZNUA 2I3WA 2F34A 1IMDA 3TQWA 2VPOA 1FTJA 3H6UA 3TTNA 1WDNA 4DCXA 4F2OA 4FAJA 5KDTA 1Y9UA 5F24A 4H0WA 4AS5A 3IORA 3H3GA 3MQ9A 3KOSA 2Y7IA 2I0CA 4G61A 3TTLA 1QUIA 3ISPA 4UA8A 1UQWA 4GWYA 4JWYA 5IGAA 2F78A 4U1ZA 3UA8A 2IA4A 5DT6A 2LAOA 5H8QB 4QFPA 2GHAA 1B5HA 4OWDA 1OQGA 1Y1MA 1A55A 5DEXB 5ICQA 4GX6A 1BK4A 3EQ1A 5FHOA 2XXVA 3UP9A 4ZE9A 4F19A 5IZZA 1MPCA 1B3GA 1YCJA 4ZEBA 3TCHA 1LBXA 3RT6B 3WAEA 4NF0A 2RCAA 4PGNA 1S9TA 1EH3A 4R6YA 3QAXA 1FQAA 2B3BA 2QVRA 4BDNA 1LGBC 5L8DA 5DVJA 4NTLA 3EHSA 4FATA 3FV2A 3CR9A 5H8QA 1Y4CA 1B0HA 1IXCA 2XXRA 3FIRA 4JDFA 1NNFA 3QUJA 4OVTA 4F1VA 4NWDA 5EYGA 1IUDA 4C1TA 4R2BA 2OBGA 3T22A 1B52A 2UVJA 4FIMA 3C9HA 1NUWA 4P3LA 1NFTA 2G29A 5TP9A 3CSGA 1NV5A 2DP8A 1ELJA 4P11A 2XXXA 1SBPA 2PCRA 4E0XA 3DP6A 1LBYA 4IY6A 3W9WA 5ET5A 3T9VA 5ITOA 1B3FA 2REJA 1IMCA 1FQCA 3VV5A 1Y1ZA 3TMGA 4ISUA 1OIBA 1D4NA 4GXSB 5I57A 4H45A 4MCOA 3C34A 1LAXA 1NH7A 1ZBMA 3PU5A 3HHGA 4PFRA 4BDOA 4DXCA 3WAFA 1EYJA 5KZTA 1LB9A 4PCDA 5I2KB 3E3KA 4KFQA 2DXYA 1QKBA 4X04A 4O7IA 1B7UA 4U22A 4IO3A 2O7IA 1MXYA 2RINA 5LOMA 1JQFA 1GGGA 1SI0A 3TAJA 5AA2A 1B7ZA 5A5XA 1FTMA 3PUXE 3K0VA 3D1RA 2QL3A 2XXHA 3S4UA 3KN3A 1KZ8A 4DE8A 4LZ5A 3D4GA 2ESNA 5LDZA 5H8HB 1MH3A 4YB7A 1XVYA 2ZMBA 2HXRA 1AOVA 3CFXA 1FJ9A 5DVFA 5FTHA 3V89B 2F3DA 1FPIA 4F3PA 3LUYA 5IKBA 3MUQA 3HSTA 4THIA 1UTHB 3IB2A 4EXLA 4NG7A 4ELQA 2H98A 2DE2A 5HBCA 1MY2A 5AA2B 3FXUA 1SYIA 4X9TA 4NF6B 1UIVA 3KC0A 1A8FA 1B0LA 4OESA 4U2RA 4NE4A 5I2NB 2QVUA 2HEUA 1RYOA 4N6PA 1NV4A 4LZ7A 4X48A 4RNSA 2UYFA 3USDA 4ELOA 3MVZA 1Z7ME 5I57B 3N26A 4OZ9A 3CFLA 3GLBA 4ZE8A 2X7QA 4OMBA 1URGA 4MF3A 4YICA 4MHFA 5I58A 2ABHA 1MQIA 2O6AA 1NUYA 3IJXB 4QFLA 2ZZXA 3MP6A 4ZS9A 1MM7A 2QRYA 4R74A 3OELA 3UGWA 2XA5A 1N7XA 3QXMA 3RPWA 5A5XB 3TQLA 1CNQA 2GFEA 1US4A 4FBPA 1LBCA 1P1WA 4AB5A 3RTWB 2B65A 2V3QA 3TODA 3RYDA 3AXFA 1NUXA 1FQEA 3RGYA 3N6TA 3LC8A 1XOCA 2CZKA 4JSOA 2M8CA 3MVWA 2F36A 3RPLB 1ZU0A 3PUVE 3B6WA 3VE1B 4GWXA 1POTA 3A09A 2Q8MA 1B9JA 1OVBA 2I48A 1FBEA 1AIVA 2DWJA 4KCCA 4H6DA 4ZEDA 4MMPA 3GYYA 3FXQA 2CZIA 3S2VA 3TTRA 5IZ3A 2GRVA 4RXLA 1SQYA 3MPKA 3OO7A 2KR0A 2RKMA 3O2AA 2ALUA 3VLUA 4H5GA 3QYTA 3LSFB 3TELA 2V3UA 2KLFA 2VD2A 3H4ZA 1LAGE 2VGQA 2IEEA 1XC1A 1B05A 1GV8A 3MPLA 1EU8A 3DELB 1F9BA 1Q1KA 4K3FA 4IO4A 2CEXA 4P47A 1FBHA 2XXYA 4MIJA 2ZYNA 1DOTA 1D9QA 4BDRA 5EHSA 3SEWA 2XWOA 2O7UA 3B6TA 1MY1A 2A5TA 2Q9TA 1NKXA 1IMEA 4DIGA 4NAPA 2D5WA 3PV0E 4LQ2A 3TYHA 3FD3A 3T0JA 4ESXA 4MX6A 5H8FB 3VLWA 4OFOA 4H65A 4F3SA 2V84A 3VXCA 4XEQA 1N04A 1R6ZA 5J16A 3KN8A 4X1DA 3E13X 1G0IA 2HZLA 3SEUA 5AA2D 1A99A 1RDZA 4N91A 1JW1A 1LFGA 1POY1 2RCBA 2VT5A 2Y5KA 1HSLA 4DI4B 1I69A 3Q25A 1FTLA 4WEDA 3U65A 4OTEA 3G3JA 1I6BA 4LATA 3MC2A 1B40A 4KYEA 5CBSA 1YYZA 4OVQA 1PDAA 3TUSA 3TFLA 1JETA 1MY0A 1OLCA 3HHFA 2XX7A 2Z23A 3IOUA 4QFNA 1IMAA 4BLAA 2XD3A 4I8CA 5DW8A 2P0SA 4G4PA 3M8UA 4G68B 3W15C 2VOZA 1LFIA 4F39A 3C35A 2QFLA 1JEVA 1B5JA 5FHNA 5J1DA 4YKJA 1N7WA 4NHBA 3LSXA 3I5OA 1Y3QA 2OLBA 5ET6A 1NUZA 3SEVA 3E4RA 4GWOA 1FPGA 3PD9A 2D3IA 4R6KA 2QMWA 2FVZA 4JB7A 2I49A 3TZAA 3DLNA 2F8DA 2THIA 2XXQA 2QMXA 4MEVA 3U8QA 1Z7NE 4OXVA 1LBVA 3E78A 4M1VA 3E9XA 3VVFA 3FVOA 2QS1A 3V83A 3T66A 3QIMA 3MZ9A 4MBPA 1SPIA 3FXBA 2HPGA 3PPOA 4R75A 2G93A 5DYHA 2O51A 3E79A 4JBZA 4MNCA 5EHMA 1MQGA 2KQZA 1SVXB 3TKDA 2Q89A 4QSDA 4NF8B 4ELPA 5HM4B 3M3FA 4PFUA 1VFEA 4PE3A 1EZOA 3UK4A 4N07A 5AA4B 4GBWA 4IR8A 3KBRA 1Y4TA 5EQ7A 5CC2A 4DZ1A 4IB2A 2O84X 2UVIA 4BDLA 4OYVA 1FPLA 4JSDA 4HE0A 4LUBA 3C33A 3MJNA 2F7BA 3V5AA 3OO9A 1S50A 1NV6A 1P99A 3S9LC 5ISUA 1N0TA 1O7TA 3FJMA 3FATA 2Z22A 1OLAA 4QFOA 2PX1A 3IB0A 2W7YA 2I0BA 1PB7A 1H44A 5IAIA 1XS5A 1ZLQA 4KYSA 2H4IA 2I3VA 2YJPA 4IGRA 4XXUA 3H6VA 3G3HA 3RUMA 1T0KA 2PMSA 1FBCA 1PBQA 4QF9A 4MJOA 5I56B 3M3KA 1FTAA 2OZZA 1ANFA 4R9FA 4WXJA 1FCKA 1I6AA 3IOTA 4N4UA 1VE4A 1FPDA 4HW8A 2F6GA 1JW5A 1IXHA 1FPBA 1FPEA 4ZEKA 5BWJA 4FJPA 1URDA 4OVRA 2HQ0A 3FV1A 1XI6A 4F18A 1FSAA 4I1DA 4PFTA 4POWA 1D9VA 4NQ8A 4R2FA 4TOZA 1OVTA 3EHTA 3FXRA 3N5LA 4IO6A 2ZNSA 3OO6A 2HZKA 1IMFA 3OSRA 1HSJA 2F7CA 2QVVA 2FIXA 4KHZE 5FHMA 5IZ1A 2Y5LA 3QK6A 4ELRA 1B46A 4P1LA 1A7LA 1MXZA 3PPQA 2CZLA 1FQBA 5M2VA 1SW5A 3CI8A 3RTFB 2AIXA 3S9MC 2WYPA 4H1XA 1XHYA 2HCAA 5EQ9A 1UIUA 3O6HA 5IZ3B 5AA1A 3TTKA 3DM0A 5DTBA 4GLIA 4PF8A 2FBPA 1VFDA 4F2QA 2RF1A 4GQOA 2ONRA 1SYHA 1UTBB 1MDQA 4KR5A 2F6PA 4NGUA 2WYKA 2X7PA 4OVJA 4GWZA 3IO4A 4JVCA 4F31B 5EYFA 3Q26A 4KQPA 1B7HA 3BBRA 1B2HA 4O3CA 2AYSA 1QJMA 3PTYA 1AH5A 1MPDA 4GWWA 5B7DA 5CMCA 3C32A 4ESWA 3B7DA 4NF8A 3A29A 5FTIA 4AQ4A 4NF4A 4O94A 2H5YA 2O1LA 1PEBA 1PB8A 4EQ7A 4U21A 2DVZA 5ET8A 1A8EA 1H76A 1D3KA 1A54A 4PBHA 2DE4A 4LZ8A 2ZXTA 5H8NA 2FYIA 3BFTA 1FRPA 3L6HA 4IY5A 2XX8A 4G68A 4NF5A 4BDMA 3U94A 3PMWA 1RYXA 4ECFA 3VXBA 1R1NA 2F3BA 4F22A 1NMUA 2DS9A 3TCGA 1RDYA 3LSWA 1JNFA 1SW4A 3FJ7A 4ND9A 1MQDA 2Z8FA 3VFJA 4RK9A 3O29A 3EHUA 4HE1A 2PFYA 1DTGA 1B6HA 3MVXA 1K9ZA 1SI1A 5L9MA 4PFBA 3UORA 5AE4A 3B50A 4NX1A 1INPA 4YMAA 4RPNA 3K6WA 3FJGA 4FE8A 4TQUQ 5ET7A 1NNKA 5F1QA 1NV7A 1MS7A 4FECA 3SESA 3O97A 1WODA 3Q27A 4GX4A 4OQOA 1IMBA 1GVCA 4PE5B 1IQ7A 2OJTA 5KCJA 3MW0A 4GOTA 3BIGA 3U72A 2PT2A 4LONB 1TXFA 5JK4A 3THIA 2DE3A 4I40A 2R8TA 1TWYA 4RPOA 5K2YA 2ONKE 3BIHA 1FBPA 2OK2A 2XXUA 3KFMA 4PFYA 3M3LA 1RDXA 5H8FA 3IOVA 1IXGA 3OEMA 3G3FA 4N8YA 1SD3A 4JWXA 1CE2A 2E0SA 3ZKLA 2NXOA 2PBWA 4ONYA 4F1UA 3LSLA 2AL4A 2DSFA 1B32A 1M5DA 3FVNA 3MZ1A 4ZZAA 5I2NA 4U4SA 3MAMA 3VLVA 1Y3NA 2B3FA 2CZHA 2PVUA 4P8BA 5I3SA 1QULA 3V8XB 1FQDA 3I6VA 4U4XA 2DQVA 3BFUA 3MBPA 3SEXA 4F1YA 2DXRA 2E1SA 5AA3A 2F5XA 2OWTA 4PFWA 3KSJA 1B1HA 2UYEA 1LFHA 1JEUA 1MRPA 4GIZA 2GHBA 3LR1A 1BP5A 4X1BA 4DDDA 3O6GA 1M5FA 2A5TB 1M5EA 1AWBA 2ZZVA 2BJIA 1YXIA 3H6TA 1NV2A 2Y7WA 1B5IA 1NNTA 1LAHE 5EYHA 3SEYA 1M5CA 3HN0A 2VD3A 2AL5A 3K6UA 3EKIA 4JVIA 4Z7EA 2RC7A 2QSXA 2UXAA 1FPFA 4OETA 4GWSA 1RKMA 3PUWE 4PTKA 4LVQA 2WBBA 2HHMA 1GR2A 3JV9A 4QXDA 1ZJLA 1MXUA 1EZ9A 2Q2CA 3G3GA 2Y84A 4H67A 4LP2B 3EPEA 1IXIA 2P2AA 3A3UA 2HAUA 3H06B 3PMXA 3U1OA 2X26A 1LBZA 1DK4A 5ESYA 4HE2A 3IO6A 4Z0IA 3EN3A 2BJJX 5T3JA 1B1XA 5FBPA 1Q35A 4N8GA 3K02A 4GFRA 3TTMA 1GTKA 3IR1A 4OEVA 4P56A 1II5A 3N6UA 1QW0A 4WEPA 4P0GA 3U93A 1LBWA 2ZYMA 4QFKA 4HCWA 4OA4A 2DDKA 2I4BA 1YAEA 4E0WA 3C4MA 2QJEA 1XVXA 4R72A 1DCUA 1MXWA 4PDHA 4ZDMA 4GBVA 5CI5A 4EQBA 4R73A 4XTCQ 1SW1A 3UIFA 1N3WA 3ZSFA 1FW0A 3FVKA 3MWBA 3T9HB 1UTBA 5I2KA
chains in the Genus database with same CATH topology
3A3CA 1LB8A 1LCTA 2ZNSA 1Z7ME 3MVZA 5H8NB 3OO6A 5I57B 3N26A 2HZKA 2DVCA 3IAZA 1HSJA 3GZGA 3IX1A 3OSRA 4C1UA 2F7CA 4OZ9A 3Q28A 5L9OA 3QUFA 1P1NA 3T9UA 3K1MA 4YMBA 3CFLA 3GLBA 4ZE8A 5L9SA 2X7QA 4L17A 1DMBA 3FGSA 4KHZE 4OMBA 1URGA 4YKKA 3JYRA 5FHMA 4KPTA 3ECRA 4MF3A 3QK6A 4YICA 5K2XA 3RN8A 3TDJA 4ELRA 5I58A 3KN7A 2ABHA 3CIJA 1B46A 1MQIA 5I59A 2O68A 2O6AA 3CVGA 3IJXB 1A7LA 4QFLA 1L5TA 1MXZA 3MP6A 1MDP1 3PPQA 1VSOA 3PPNA 4ZS9A 1MM7A 2QRYA 4ZECA 2CZLA 3SKPA 3TPAA 1FQBA 3CG3A 4R74A 3OELA 1FTOA 2O69A 3UGWA 3W9VA 1N7XA 3QXMA 2P1SA 5M2VA 2OWSA 1SW5A 3RPWA 5A5XB 3CFZA 3CI8A 3TQLA 4YZZA 2H25A 3HPIA 3RTFB 2GFEA 3GBAA 1US4A 2AIXA 2Z8DA 3S9MC 1MY4A 1FTKA 4H1XA 3K6VA 1XHYA 1DPEA 2HCAA 2QS4A 3OO8A 1LBCA 1UIUA 4MLQA 4RJZA 3KSXA 1LSTA 3S9EA 3O6HA 1P1WA 2Q88A 4YKPA 5AA1A 3TTKA 1ZTYA 3K1PA 1P1UA 3DP8A 4FORA 3RTWB 2B65A 3DM0A 5DTBA 5KCJB 4GLIA 2V3QA 3SETA 3TODA 4G2ZA 3PUYE 1VFDA 1TFDA 2RF1A 4GQOA 4F2QA 2ONRA 3K2DA 2R9JA 3AXFA 4I62A 4OERA 1FQEA 4YB6A 4DXBA 1J1NA 3K00A 4RK2A 1SYHA 1UTBB 2D21A 2Q2AA 4NF6A 3N6TA 3LC8A 4QHQA 3RGYA 1B3HA 1XOCA 2O1MA 1MDQA 2M8CA 4JSOA 4O3BA 4OFLA 3VVDA 2Y7RA 3ILUB 3BKIB 4KR5A 3C31A 4BDQA 5ITPA 3OOAA 1H3DA 2F6PA 3MVWA 2X7PA 2NUVA 4OVJA 2H9BA 3IO4A 4F31B 2XHDA 3PPRA 2GH9A 1MQJA 5ELVA 5EYFA 3Q26A 5H8SA 2F36A 3O9PA 4KQPA 1B7HA 4AB5A 3BBRA 1B2HA 4O3CA 1ZU0A 2AYSA 1QJMA 3PUVE 2FNCA 3B6WA 4IGTA 1ATGA 1BTJA 1UTHA 1MM6A 1AH5A 1XT8A 2PT1A 2Y7PA 2ZYKA 3OSQA 4OEUA 4XKPA 1POTA 3A09A 3FVGA 1MPDA 1B9JA 2UVGA 1OVBA 2I48A 1IITA 1BIYA 1AIVA 1DSNA 2DWJA 4ELOA 4KCCA 5B7DA 1B4HA 4QSEA 5CMCA 3B6QA 3C32A 3PD8A 4H6DA 4ZEDA 4ESWA 5I58B 4EF2A 3B7DA 4NF8A 5FTIA 4AQ4A 2XX9A 4NF4A 3FXQA 3KJTA 3TCFA 4AB6A 1Y3PA 2FA7A 3IOWA 4IO5A 1OMPA 4N13A 2H5YA 3S2VA 3TTRA 4Q5TA 2GRVA 4RXLA 2O1LA 1QUKA 1SQYA 3MPKA 3OO7A 1PEBA 2HFBA 2WKYA 3O66A 4EQBA 1PB8A 3MVYA 4EQ7A 3IJOB 4U21A 5JTYA 3C36A 2RKMA 2DVZA 3DP4A 5F7VA 3O2AA 3H7MA 2ALUA 3VLUA 4H5GA 3CG1A 3QYTA 3GXAA 3LSFB 1A8EA 1B51A 1H76A 2F35A 3L6GA 5ICTA 4KYSA 3TELA 2V3UA 1D3KA 1A54A 1QKAA 2F7AA 3RLFE 4FEBA 2KLFA 4YB5A 3RQTA 2VD2A 3H4ZA 5BUUA 1VR5A 3I3VA 2DE4A 1JVXA 1LAGE 3T96B 1LLSA 2DYXA 2VGQA 2I4CA 2IEEA 2XXIA 2ZXTA 1XC1A 1B05A 1LBBA 2H99A 3K01A 4LA9A 2FYIA 4NMYA 5H8NA 4TLMB 3BFTA 4KI0E 2YLNA 1GV8A 3MPLA 3HCQA 1EU8A 4H8JA 5CM6A 4YKIA 3DELB 2XD2A 1F9BA 3L6HA 4H5FA 2XX8A 4IY5A 4G68A 4O3AA 1Q1KA 4NF5A 4BDMA 4K3FA 4YAHX 3U94A 4IO4A 3HO7A 2NWJA 3OENA 5TPAB 3PMWA 1LAFE 5TPAA 2XXYA 5ISUA 1NH8A 1DOTA 1RYXA 1R1NA 2ZYNA 4IO7A 5CMBA 4HCYA 3VXBA 4BDRA 5EHSA 4NF5B 4P0IA 3SEWA 4EUOA 1JVYA 1NMUA 2O7UA 3B6TA 2DOJA 1R9LA 2DS9A 3TCGA 5AA4A 3LSWA 1JNFA 2PYYA 1SW4A 2ANJA 3R6UA 1DTZA 3FJ7A 1ZIUA 3PGFA 2I6EA 4U1OA 4ND9A 1MY1A 2A5TA 2Q9TA 1NKXA 4PQJA 1DPPA 1MQDA 2Z8FA 4NF4B 2NOOA 3SERA 4DIGA 4MLVA 4NWCA 3VFJA 4RK9A 3CRBA 1ZMGA 4YU0A 1OQHA 3JZJA 3O29A 2D5WA 2R71A 4GXAA 4KCDA 4EQ9A 1MXVA 3IK6B 4LQ5A 3EHUA 4QRZA 5H8HA 1PB9A 3PV0E 4LQ2A 1DTGA 1B6HA 1USYH 1BKAA 2YPNA 2V3TA 3MVXA 3FD3A 3RT8A 3TYHA 4ESXA 1EZPA 4EDPA 3HV1A 1SDXA 3SDFA 3MP1A 4JXIA 5H8FB 1IIWA 3K4UA 3O28A 4U23A 4F3BA 1SI1A 3ZS6A 4XIGQ 1IEJA 2HXWA 4OFOA 3VLWA 4H65A 5L9MA 4F3SA 2V84A 3VXCA 1A40A 4HS7A 1US5A 3KJ7A 4EXKA 1N04A 4XKQA 1R6ZA 1YTVA 2XXWA 3KN8A 4NEDA 3UORA 5AE4A 4RA1A 3KEIA 3PPPA 4X1DA 4JWOA 3E13X 3OEKA 2HZLA 3ODBA 2DWIA 2QPQA 3SEUA 5AA2D 4RY1A 1A99A 1JW1A 5I59B 4GL8A 3UN6A 4YMAA 1AMFA 1LFGA 2ZNUA 1POY1 2I3WA 2F34A 4RPNA 3TQWA 2RCBA 3K6WA 3R7XA 1FTJA 2XXTA 3H6UA 3TTNA 3FJGA 1WDNA 1HSLA 1TFAA 4FE8A 1H43A 4DCXA 2XXPA 4G77A 1I69A 3Q25A 2VP1A 1FTLA 4TQUQ 4F3GA 4WEDA 4MFIA 4G8NA 4F2OA 1NNKA 4OTEA 5F1QA 4FAJA 1MS7A 5KDTA 4FECA 3G3JA 4IO2A 1I6BA 4LATA 3MC2A 2HAVA 5KDTB 3SESA 2DWHA 1Y9UA 3O97A 1WODA 3FASA 3Q27A 1B40A 4H0WA 4KYEA 3IORA 4OQOA 5CBSA 3H3GA 1GVCA 1PDAA 3TUSA 1N3XA 3TFLA 3D4CA 4PE5B 1BLFA 3N5LA 1IQ7A 1JETA 1MY0A 1OLCA 3HHFA 2XX7A 2Z23A 3IOUA 3KOSA 2OJTA 2Y7IA 3MQ9A 2I0CA 4QFNA 5KCJA 3MW0A 1URSA 2CMOA 2XD3A 1QUIA 4GOTA 3TTLA 4BLAA 4UA8A 1UQWA 3U72A 4JWYA 2PT2A 4I8CA 1AOVA 2F97A 2RC8A 4YB7A 2F78A 1NNPA 1TXFA 2P0SA 4G4PA 4LONB 4U1ZA 3M8UA 1KWHA 4G68B 2IA4A 5DT6A 2DE3A 3N94A 3THIA 3VE1B 2LAOA 5H8QB 3W15C 2VOZA 1TWYA 2OCUA 1LFIA 4QFPA 1O63A 2GHAA 2ONKE 4RPOA 5K2YA 4F39A 3C35A 5DEXA 2OK2A 1JEVA 1B5JA 5FHNA 2XXUA 3KFMA 5J1DA 3OXNA 1B5HA 4PFYA 1B58A 4OWDA 1OQGA 1Y1MA 3M3LA 4YKJA 1N7WA 5CRYA 1A55A 5H8FA 1MY3A 3IOVA 1MQHA 3LSXA 1IXGA 5DEXB 3OEMA 5ICQA 3I5OA 3G3FA 1Y3QA 2OLBA 1SD3A 3EQ1A 4OHNA 5FHOA 2XXVA 3UP9A 4Q0CA 4JWXA 4ZE9A 1CE2A 2E0SA 3ZKLA 4F19A 1MPCA 1B3GA 1YCJA 2NXOA 2PBWA 3E4RA 4KYDA 4ZEBA 4ONYA 3SEVA 4GWOA 3TCHA 3KZGA 2R6GE 3RT6B 3WAEA 4F1UA 3LSLA 1HSEA 2AL4A 1R9QA 1P1QA 2RCAA 3PD9A 2DSFA 1B32A 1S9TA 5CMKA 2D3IA 4R6KA 3UA8A 1EH3A 3EF7A 2QMWA 1M5DA 4R6YA 4F1VA 4Q8RA 3QAXA 3FVNA 1FQAA 4JB7A 2I49A 2B3BA 3MZ1A 3TZAA 3DLNA 4XKNA 4BDNA 2F8DA 1LGBC 3OD7A 4ZZAA 5L8DA 3TEPA 2THIA 1P1OA 5DVJA 4TLLB 2XXQA 5I2NA 2QMXA 3P7IA 4OENA 4NTLA 3MAMA 4U4SA 1M5BA 3U8QA 3VLVA 1Y3NA 1Z7NE 4G8HA 4F22A 2B3FA 3EHSA 4OXVA 4FATA 4ZZEA 3FV2A 3PUZE 2DWAA 2PVUA 2ZYOA 3H6WA 4M1VA 3CR9A 3RNNA 1D9YA 3K1NA 5H8QA 1Y4CA 1B0HA 3G3KA 1IXCA 1QULA 3V8XB 1FQDA 4GF8A 2XXRA 4WKMA 2A5SA 3E9XA 3FIRA 1NNFA 3K6XA 3QUJA 4JDFA 2NVUB 3VVFA 3FVOA 2QS1A 3I6VA 4NWDA 4KD5A 5HPQA 3T66A 3T9XB 3V83A 3QIMA 4U4XA 2DQVA 3MZ9A 4MBPA 3BFUA 1IUDA 3FZVA 3MBPA 2ZNTA 4C1TA 4R2BA 3PPOA 3SEXA 4F1YA 4R75A 2G93A 5DYHA 4DCYA 2OBGA 3T22A 2O51A 1B52A 3LBSA 2UVJA 4JBZA 4FIMA 1B4ZA 5CMMA 5EHMA 3C9HA 2DXRA 3KGCA 3KG2A 1NFTA 2G29A 5TP9A 2E1SA 3ILTB 4C0RA 5AA3A 1N76A 3CSGA 2F5XA 1I6QA 1Y20A 2OWTA 2DP8A 1USYE 5TP9B 4PFWA 1MQGA 3KSJA 1B1HA 4R9GA 2UYEA 1QUJA 1LFHA 1JEUA 2VHAA 5CBRA 1MG1A 1MRPA 1SVXB 1ELJA 4P11A 2XXXA 4GIZA 1SBPA 2GHBA 3LR1A 3TKDA 1BP5A 2Q89A 4X1BA 3DP6A 4QSDA 4NF8B 4DDDA 4E0XA 4IY6A 4ELPA 3O6GA 3M3FA 1M5FA 4PFUA 5HM4B 3ONMA 4ZEIA 3VDFA 3W9WA 1VFEA 3T9VA 2A5TB 5ITOA 3UK4A 1EZOA 1B3FA 1M5EA 2REJA 4N07A 5JEIA 4ECFA 5I56A 3H6TA 2V93A 3G3IA 2Y7WA 1FQFA 1NL5A 5AA4B 1FQCA 1B5IA 1NNTA 3KBRA 1Y4TA 1ZKBA 4R6HA 3VV5A 1Y1ZA 1LAHE 5CC2A 3SEYA 4DZ1A 1M5CA 3TMGA 4IB2A 1N84A 3HN0A 2O84X 2VD3A 4ISUA 4RYAA 1OIBA 2AL5A 2UVIA 3T93B 1TT1A 1D4NA 4BDLA 3K6UA 4OYVA 4F29A 4GXSB 5I57A 3GBBA 4JSDA 4LZ8A 5DVIA 1MXXA 4Z7EA 2RC7A 4LUBA 3C33A 2QSXA 3C34A 1LAXA 2UXAA 1NH7A 1ZBMA 3MJNA 2F7BA 3HHGA 3PU5A 4GL0A 3WAFA 4BDOA 4DXCA 4OETA 3V5AA 5KZTA 1LB9A 3OO9A 1RKMA 3E3KA 3PUWE 4H8IA 4KFQA 1S50A 5I2KB 4LVQA 2Q8JA 2DXYA 1GR2A 1QKBA 1P99A 3S9LC 2ONSA 1B7UA 4U22A 4IO3A 3JV9A 1H45A 2O7IA 1MXYA 1ZJLA 1N0TA 1O7TA 2RINA 1MXUA 3FJMA 3FATA 1EZ9A 4OFJA 2Q2CA 5LOMA 3G3GA 1JQFA 1GGGA 3FUZA 2Y84A 4H67A 2Z22A 4HTGA 1OLAA 4QFOA 2PX1A 3IB0A 3F11A 1SI0A 2W7YA 5JTYB 3TAJA 5AA2A 3O6IA 3QSLA 4LP2B 5B70A 2I0BA 5JK4A 1B7ZA 4PP0A 3EPEA 5A5XA 1PB7A 1IXIA 1H44A 1FTMA 5IAIA 1XS5A 3PUXE 3K0VA 1O64A 2P2AA 1ZLQA 3A3UA 3R26A 1IZ1A 1SW2A 2H4IA 2HAUA 2I3VA 2QL3A 2XXHA 2YJPA 4DLDA 2V25A 3H06B 3PMXA 4IGRA 3H6VA 2X26A 1MH4A 4XXUA 3U1OA 1B3LA 3S4UA 3KN3A 3PMVA 3G3HA 3RUMA 1T0KA 2PMSA 4LZ5A 4DE8A 5I84A 1PBQA 3IO6A 3D4GA 3CSBA 4Z0IA 2ESNA 4QF9A 4GRKA 1S7YA 5I2KA 1PBPA 5I56B 1B3EA 3M3KA 2OZZA 1ANFA 4MH5A 3MP8A 4R9FA 3U92A 1JW4A 4WXJA 3EN3A 1FCKA 2BJJX 5H8HB 3ZKKA 1I6AA 1MH3A 2I58A 1B1XA 1XVYA 1Q35A 2ZMBA 3IOTA 3K02A 1AL3A 1MPBA 3CFXA 4GFRA 4G8MA 3RY3A 3TTMA 5FTHA 1GTKA 5DVFA 1LCFA 3IR1A 3V89B 4OEVA 3VVEA 1VE4A 3S9NC 1II5A 3N6UA 2QS2A 4I9DA 4F3PA 3LUYA 4UACA 5IKBA 3MUQA 3HSTA 4HW8A 4THIA 1QW0A 2F6GA 1JW5A 1IXHA 4WEPA 4M4GA 1UTHB 4P0GA 3IB2A 2Y7KA 3U93A 4EXLA 3IL1B 4PETA 2ZYMA 4ZEFA 4GVOA 4ZEKA 4QFKA 4QSCA 3USDA 5BWJA 4FJPA 4HCWA 1URDA 2H98A 2I4BA 1YAEA 4ELQA 2DE2A 3Q29A 1WVJA 5HBCA 1MY2A 3MZBA 5AA2B 2HQ0A 4E0WA 3FV1A 3FXUA 3IB1A 1SYIA 3C4MA 2QJEA 4GD5A 1XVXA 4R72A 1QVSA 3OMBA 3KOTA 3G7WA 1YPNA 4G68C 4NF6B 1UIVA 4X9TA 1MXWA 5TU0A 4ZDMA 4F18A 1PC3A 1A8FA 4I1DA 1B0LA 4OESA 4U2RA 4DXUA 4PFTA 1CB6A 4POXA 5CI5A 4R73A 4NE4A 4POWA 4XTCQ 1D9VA 1SW1A 4XKRA 4EF1A 5I2NB 3UIFA 2HEUA 1RYOA 1N3WA 4R2FA 3H03A 4N6PA 3ZSFA 4TOZA 1FW0A 2RC9A 1OVTA 2QS3A 4LZ7A 4X48A 2Z8EA 3FVKA 3EHTA 4Q30B 4RNSA 2REGA 2UYFA 3MWBA 3T9HB 1UTBA 3FXRA 4FEDA 2UVHA 4IO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A3C A;  1LB8 A;  1LCT A;  2ZNS A;  1Z7M E;  3MVZ A;  5H8N B;  3OO6 A;  5I57 B;  3N26 A;  2HZK A;  2DVC A;  3IAZ A;  1HSJ A;  3GZG A;  3IX1 A;  3OSR A;  4C1U A;  2F7C A;  4OZ9 A;  3Q28 A;  5L9O A;  3QUF A;  1P1N A;  3T9U A;  3K1M A;  4YMB A;  3CFL A;  3GLB A;  4ZE8 A;  5L9S A;  2X7Q A;  4L17 A;  1DMB A;  3FGS A;  4KHZ E;  4OMB A;  1URG A;  4YKK A;  3JYR A;  5FHM A;  4KPT A;  3ECR A;  4MF3 A;  3QK6 A;  4YIC A;  5K2X A;  3RN8 A;  3TDJ A;  4ELR A;  5I58 A;  3KN7 A;  2ABH A;  3CIJ A;  1B46 A;  1MQI A;  5I59 A;  2O68 A;  2O6A A;  3CVG A;  3IJX B;  1A7L A;  4QFL A;  1L5T A;  1MXZ A;  3MP6 A;  1MDP 1;  3PPQ A;  1VSO A;  3PPN A;  4ZS9 A;  1MM7 A;  2QRY A;  4ZEC A;  2CZL A;  3SKP A;  3TPA A;  1FQB A;  3CG3 A;  4R74 A;  3OEL A;  1FTO A;  2O69 A;  3UGW A;  3W9V A;  1N7X A;  3QXM A;  2P1S A;  5M2V A;  2OWS A;  1SW5 A;  3RPW A;  5A5X B;  3CFZ A;  3CI8 A;  3TQL A;  4YZZ A;  2H25 A;  3HPI A;  3RTF B;  2GFE A;  3GBA A;  1US4 A;  2AIX A;  2Z8D A;  3S9M C;  1MY4 A;  1FTK A;  4H1X A;  3K6V A;  1XHY A;  1DPE A;  2HCA A;  2QS4 A;  3OO8 A;  1LBC A;  1UIU A;  4MLQ A;  4RJZ A;  3KSX A;  1LST A;  3S9E A;  3O6H A;  1P1W A;  2Q88 A;  4YKP A;  5AA1 A;  3TTK A;  1ZTY A;  3K1P A;  1P1U A;  3DP8 A;  4FOR A;  3RTW B;  2B65 A;  3DM0 A;  5DTB A;  5KCJ B;  4GLI A;  2V3Q A;  3SET A;  3TOD A;  4G2Z A;  3PUY E;  1VFD A;  1TFD A;  2RF1 A;  4GQO A;  4F2Q A;  2ONR A;  3K2D A;  2R9J A;  3AXF A;  4I62 A;  4OER A;  1FQE A;  4YB6 A;  4DXB A;  1J1N A;  3K00 A;  4RK2 A;  1SYH A;  1UTB B;  2D21 A;  2Q2A A;  4NF6 A;  3N6T A;  3LC8 A;  4QHQ A;  3RGY A;  1B3H A;  1XOC A;  2O1M A;  1MDQ A;  2M8C A;  4JSO A;  4O3B A;  4OFL A;  3VVD A;  2Y7R A;  3ILU B;  3BKI B;  4KR5 A;  3C31 A;  4BDQ A;  5ITP A;  3OOA A;  1H3D A;  2F6P A;  3MVW A;  2X7P A;  2NUV A;  4OVJ A;  2H9B A;  3IO4 A;  4F31 B;  2XHD A;  3PPR A;  2GH9 A;  1MQJ A;  5ELV A;  5EYF A;  3Q26 A;  5H8S A;  2F36 A;  3O9P A;  4KQP A;  1B7H A;  4AB5 A;  3BBR A;  1B2H A;  4O3C A;  1ZU0 A;  2AYS A;  1QJM A;  3PUV E;  2FNC A;  3B6W A;  4IGT A;  1ATG A;  1BTJ A;  1UTH A;  1MM6 A;  1AH5 A;  1XT8 A;  2PT1 A;  2Y7P A;  2ZYK A;  3OSQ A;  4OEU A;  4XKP A;  1POT A;  3A09 A;  3FVG A;  1MPD A;  1B9J A;  2UVG A;  1OVB A;  2I48 A;  1IIT A;  1BIY A;  1AIV A;  1DSN A;  2DWJ A;  4ELO A;  4KCC A;  5B7D A;  1B4H A;  4QSE A;  5CMC A;  3B6Q A;  3C32 A;  3PD8 A;  4H6D A;  4ZED A;  4ESW A;  5I58 B;  4EF2 A;  3B7D A;  4NF8 A;  5FTI A;  4AQ4 A;  2XX9 A;  4NF4 A;  3FXQ A;  3KJT A;  3TCF A;  4AB6 A;  1Y3P A;  2FA7 A;  3IOW A;  4IO5 A;  1OMP A;  4N13 A;  2H5Y A;  3S2V A;  3TTR A;  4Q5T A;  2GRV A;  4RXL A;  2O1L A;  1QUK A;  1SQY A;  3MPK A;  3OO7 A;  1PEB A;  2HFB A;  2WKY A;  3O66 A;  4EQB A;  1PB8 A;  3MVY A;  4EQ7 A;  3IJO B;  4U21 A;  5JTY A;  3C36 A;  2RKM A;  2DVZ A;  3DP4 A;  5F7V A;  3O2A A;  3H7M A;  2ALU A;  3VLU A;  4H5G A;  3CG1 A;  3QYT A;  3GXA A;  3LSF B;  1A8E A;  1B51 A;  1H76 A;  2F35 A;  3L6G A;  5ICT A;  4KYS A;  3TEL A;  2V3U A;  1D3K A;  1A54 A;  1QKA A;  2F7A A;  3RLF E;  4FEB A;  2KLF A;  4YB5 A;  3RQT A;  2VD2 A;  3H4Z A;  5BUU A;  1VR5 A;  3I3V A;  2DE4 A;  1JVX A;  1LAG E;  3T96 B;  1LLS A;  2DYX A;  2VGQ A;  2I4C A;  2IEE A;  2XXI A;  2ZXT A;  1XC1 A;  1B05 A;  1LBB A;  2H99 A;  3K01 A;  4LA9 A;  2FYI A;  4NMY A;  5H8N A;  4TLM B;  3BFT A;  4KI0 E;  2YLN A;  1GV8 A;  3MPL A;  3HCQ A;  1EU8 A;  4H8J A;  5CM6 A;  4YKI A;  3DEL B;  2XD2 A;  1F9B A;  3L6H A;  4H5F A;  2XX8 A;  4IY5 A;  4G68 A;  4O3A A;  1Q1K A;  4NF5 A;  4BDM A;  4K3F A;  4YAH X;  3U94 A;  4IO4 A;  3HO7 A;  2NWJ A;  3OEN A;  5TPA B;  3PMW A;  1LAF E;  5TPA A;  2XXY A;  5ISU A;  1NH8 A;  1DOT A;  1RYX A;  1R1N A;  2ZYN A;  4IO7 A;  5CMB A;  4HCY A;  3VXB A;  4BDR A;  5EHS A;  4NF5 B;  4P0I A;  3SEW A;  4EUO A;  1JVY A;  1NMU A;  2O7U A;  3B6T A;  2DOJ A;  1R9L A;  2DS9 A;  3TCG A;  5AA4 A;  3LSW A;  1JNF A;  2PYY A;  1SW4 A;  2ANJ A;  3R6U A;  1DTZ A;  3FJ7 A;  1ZIU A;  3PGF A;  2I6E A;  4U1O A;  4ND9 A;  1MY1 A;  2A5T A;  2Q9T A;  1NKX A;  4PQJ A;  1DPP A;  1MQD A;  2Z8F A;  4NF4 B;  2NOO A;  3SER A;  4DIG A;  4MLV A;  4NWC A;  3VFJ A;  4RK9 A;  3CRB A;  1ZMG A;  4YU0 A;  1OQH A;  3JZJ A;  3O29 A;  2D5W A;  2R71 A;  4GXA A;  4KCD A;  4EQ9 A;  1MXV A;  3IK6 B;  4LQ5 A;  3EHU A;  4QRZ A;  5H8H A;  1PB9 A;  3PV0 E;  4LQ2 A;  1DTG A;  1B6H A;  1USY H;  1BKA A;  2YPN A;  2V3T A;  3MVX A;  3FD3 A;  3RT8 A;  3TYH A;  4ESX A;  1EZP A;  4EDP A;  3HV1 A;  1SDX A;  3SDF A;  3MP1 A;  4JXI A;  5H8F B;  1IIW A;  3K4U A;  3O28 A;  4U23 A;  4F3B A;  1SI1 A;  3ZS6 A;  4XIG Q;  1IEJ A;  2HXW A;  4OFO A;  3VLW A;  4H65 A;  5L9M A;  4F3S A;  2V84 A;  3VXC A;  1A40 A;  4HS7 A;  1US5 A;  3KJ7 A;  4EXK A;  1N04 A;  4XKQ A;  1R6Z A;  1YTV A;  2XXW A;  3KN8 A;  4NED A;  3UOR A;  5AE4 A;  4RA1 A;  3KEI A;  3PPP A;  4X1D A;  4JWO A;  3E13 X;  3OEK A;  2HZL A;  3ODB A;  2DWI A;  2QPQ A;  3SEU A;  5AA2 D;  4RY1 A;  1A99 A;  1JW1 A;  5I59 B;  4GL8 A;  3UN6 A;  4YMA A;  1AMF A;  1LFG A;  2ZNU A;  1POY 1;  2I3W A;  2F34 A;  4RPN A;  3TQW A;  2RCB A;  3K6W A;  3R7X A;  1FTJ A;  2XXT A;  3H6U A;  3TTN A;  3FJG A;  1WDN A;  1HSL A;  1TFA A;  4FE8 A;  1H43 A;  4DCX A;  2XXP A;  4G77 A;  1I69 A;  3Q25 A;  2VP1 A;  1FTL A;  4TQU Q;  4F3G A;  4WED A;  4MFI A;  4G8N A;  4F2O A;  1NNK A;  4OTE A;  5F1Q A;  4FAJ A;  1MS7 A;  5KDT A;  4FEC A;  3G3J A;  4IO2 A;  1I6B A;  4LAT A;  3MC2 A;  2HAV A;  5KDT B;  3SES A;  2DWH A;  1Y9U A;  3O97 A;  1WOD A;  3FAS A;  3Q27 A;  1B40 A;  4H0W A;  4KYE A;  3IOR A;  4OQO A;  5CBS A;  3H3G A;  1GVC A;  1PDA A;  3TUS A;  1N3X A;  3TFL A;  3D4C A;  4PE5 B;  1BLF A;  3N5L A;  1IQ7 A;  1JET A;  1MY0 A;  1OLC A;  3HHF A;  2XX7 A;  2Z23 A;  3IOU A;  3KOS A;  2OJT A;  2Y7I A;  3MQ9 A;  2I0C A;  4QFN A;  5KCJ A;  3MW0 A;  1URS A;  2CMO A;  2XD3 A;  1QUI A;  4GOT A;  3TTL A;  4BLA A;  4UA8 A;  1UQW A;  3U72 A;  4JWY A;  2PT2 A;  4I8C A;  1AOV A;  2F97 A;  2RC8 A;  4YB7 A;  2F78 A;  1NNP A;  1TXF A;  2P0S A;  4G4P A;  4LON B;  4U1Z A;  3M8U A;  1KWH A;  4G68 B;  2IA4 A;  5DT6 A;  2DE3 A;  3N94 A;  3THI A;  3VE1 B;  2LAO A;  5H8Q B;  3W15 C;  2VOZ A;  1TWY A;  2OCU A;  1LFI A;  4QFP A;  1O63 A;  2GHA A;  2ONK E;  4RPO A;  5K2Y A;  4F39 A;  3C35 A;  5DEX A;  2OK2 A;  1JEV A;  1B5J A;  5FHN A;  2XXU A;  3KFM A;  5J1D A;  3OXN A;  1B5H A;  4PFY A;  1B58 A;  4OWD A;  1OQG A;  1Y1M A;  3M3L A;  4YKJ A;  1N7W A;  5CRY A;  1A55 A;  5H8F A;  1MY3 A;  3IOV A;  1MQH A;  3LSX A;  1IXG A;  5DEX B;  3OEM A;  5ICQ A;  3I5O A;  3G3F A;  1Y3Q A;  2OLB A;  1SD3 A;  3EQ1 A;  4OHN A;  5FHO A;  2XXV A;  3UP9 A;  4Q0C A;  4JWX A;  4ZE9 A;  1CE2 A;  2E0S A;  3ZKL A;  4F19 A;  1MPC A;  1B3G A;  1YCJ A;  2NXO A;  2PBW A;  3E4R A;  4KYD A;  4ZEB A;  4ONY A;  3SEV A;  4GWO A;  3TCH A;  3KZG A;  2R6G E;  3RT6 B;  3WAE A;  4F1U A;  3LSL A;  1HSE A;  2AL4 A;  1R9Q A;  1P1Q A;  2RCA A;  3PD9 A;  2DSF A;  1B32 A;  1S9T A;  5CMK A;  2D3I A;  4R6K A;  3UA8 A;  1EH3 A;  3EF7 A;  2QMW A;  1M5D A;  4R6Y A;  4F1V A;  4Q8R A;  3QAX A;  3FVN A;  1FQA A;  4JB7 A;  2I49 A;  2B3B A;  3MZ1 A;  3TZA A;  3DLN A;  4XKN A;  4BDN A;  2F8D A;  1LGB C;  3OD7 A;  4ZZA A;  5L8D A;  3TEP A;  2THI A;  1P1O A;  5DVJ A;  4TLL B;  2XXQ A;  5I2N A;  2QMX A;  3P7I A;  4OEN A;  4NTL A;  3MAM A;  4U4S A;  1M5B A;  3U8Q A;  3VLV A;  1Y3N A;  1Z7N E;  4G8H A;  4F22 A;  2B3F A;  3EHS A;  4OXV A;  4FAT A;  4ZZE A;  3FV2 A;  3PUZ E;  2DWA A;  2PVU A;  2ZYO A;  3H6W A;  4M1V A;  3CR9 A;  3RNN A;  1D9Y A;  3K1N A;  5H8Q A;  1Y4C A;  1B0H A;  3G3K A;  1IXC A;  1QUL A;  3V8X B;  1FQD A;  4GF8 A;  2XXR A;  4WKM A;  2A5S A;  3E9X A;  3FIR A;  1NNF A;  3K6X A;  3QUJ A;  4JDF A;  2NVU B;  3VVF A;  3FVO A;  2QS1 A;  3I6V A;  4NWD A;  4KD5 A;  5HPQ A;  3T66 A;  3T9X B;  3V83 A;  3QIM A;  4U4X A;  2DQV A;  3MZ9 A;  4MBP A;  3BFU A;  1IUD A;  3FZV A;  3MBP A;  2ZNT A;  4C1T A;  4R2B A;  3PPO A;  3SEX A;  4F1Y A;  4R75 A;  2G93 A;  5DYH A;  4DCY A;  2OBG A;  3T22 A;  2O51 A;  1B52 A;  3LBS A;  2UVJ A;  4JBZ A;  4FIM A;  1B4Z A;  5CMM A;  5EHM A;  3C9H A;  2DXR A;  3KGC A;  3KG2 A;  1NFT A;  2G29 A;  5TP9 A;  2E1S A;  3ILT B;  4C0R A;  5AA3 A;  1N76 A;  3CSG A;  2F5X A;  1I6Q A;  1Y20 A;  2OWT A;  2DP8 A;  1USY E;  5TP9 B;  4PFW A;  1MQG A;  3KSJ A;  1B1H A;  4R9G A;  2UYE A;  1QUJ A;  1LFH A;  1JEU A;  2VHA A;  5CBR A;  1MG1 A;  1MRP A;  1SVX B;  1ELJ A;  4P11 A;  2XXX A;  4GIZ A;  1SBP A;  2GHB A;  3LR1 A;  3TKD A;  1BP5 A;  2Q89 A;  4X1B A;  3DP6 A;  4QSD A;  4NF8 B;  4DDD A;  4E0X A;  4IY6 A;  4ELP A;  3O6G A;  3M3F A;  1M5F A;  4PFU A;  5HM4 B;  3ONM A;  4ZEI A;  3VDF A;  3W9W A;  1VFE A;  3T9V A;  2A5T B;  5ITO A;  3UK4 A;  1EZO A;  1B3F A;  1M5E A;  2REJ A;  4N07 A;  5JEI A;  4ECF A;  5I56 A;  3H6T A;  2V93 A;  3G3I A;  2Y7W A;  1FQF A;  1NL5 A;  5AA4 B;  1FQC A;  1B5I A;  1NNT A;  3KBR A;  1Y4T A;  1ZKB A;  4R6H A;  3VV5 A;  1Y1Z A;  1LAH E;  5CC2 A;  3SEY A;  4DZ1 A;  1M5C A;  3TMG A;  4IB2 A;  1N84 A;  3HN0 A;  2O84 X;  2VD3 A;  4ISU A;  4RYA A;  1OIB A;  2AL5 A;  2UVI A;  3T93 B;  1TT1 A;  1D4N A;  4BDL A;  3K6U A;  4OYV A;  4F29 A;  4GXS B;  5I57 A;  3GBB A;  4JSD A;  4LZ8 A;  5DVI A;  1MXX A;  4Z7E A;  2RC7 A;  4LUB A;  3C33 A;  2QSX A;  3C34 A;  1LAX A;  2UXA A;  1NH7 A;  1ZBM A;  3MJN A;  2F7B A;  3HHG A;  3PU5 A;  4GL0 A;  3WAF A;  4BDO A;  4DXC A;  4OET A;  3V5A A;  5KZT A;  1LB9 A;  3OO9 A;  1RKM A;  3E3K A;  3PUW E;  4H8I A;  4KFQ A;  1S50 A;  5I2K B;  4LVQ A;  2Q8J A;  2DXY A;  1GR2 A;  1QKB A;  1P99 A;  3S9L C;  2ONS A;  1B7U A;  4U22 A;  4IO3 A;  3JV9 A;  1H45 A;  2O7I A;  1MXY A;  1ZJL A;  1N0T A;  1O7T A;  2RIN A;  1MXU A;  3FJM A;  3FAT A;  1EZ9 A;  4OFJ A;  2Q2C A;  5LOM A;  3G3G A;  1JQF A;  1GGG A;  3FUZ A;  2Y84 A;  4H67 A;  2Z22 A;  4HTG A;  1OLA A;  4QFO A;  2PX1 A;  3IB0 A;  3F11 A;  1SI0 A;  2W7Y A;  5JTY B;  3TAJ A;  5AA2 A;  3O6I A;  3QSL A;  4LP2 B;  5B70 A;  2I0B A;  5JK4 A;  1B7Z A;  4PP0 A;  3EPE A;  5A5X A;  1PB7 A;  1IXI A;  1H44 A;  1FTM A;  5IAI A;  1XS5 A;  3PUX E;  3K0V A;  1O64 A;  2P2A A;  1ZLQ A;  3A3U A;  3R26 A;  1IZ1 A;  1SW2 A;  2H4I A;  2HAU A;  2I3V A;  2QL3 A;  2XXH A;  2YJP A;  4DLD A;  2V25 A;  3H06 B;  3PMX A;  4IGR A;  3H6V A;  2X26 A;  1MH4 A;  4XXU A;  3U1O A;  1B3L A;  3S4U A;  3KN3 A;  3PMV A;  3G3H A;  3RUM A;  1T0K A;  2PMS A;  4LZ5 A;  4DE8 A;  5I84 A;  1PBQ A;  3IO6 A;  3D4G A;  3CSB A;  4Z0I A;  2ESN A;  4QF9 A;  4GRK A;  1S7Y A;  5I2K A;  1PBP A;  5I56 B;  1B3E A;  3M3K A;  2OZZ A;  1ANF A;  4MH5 A;  3MP8 A;  4R9F A;  3U92 A;  1JW4 A;  4WXJ A;  3EN3 A;  1FCK A;  2BJJ X;  5H8H B;  3ZKK A;  1I6A A;  1MH3 A;  2I58 A;  1B1X A;  1XVY A;  1Q35 A;  2ZMB A;  3IOT A;  3K02 A;  1AL3 A;  1MPB A;  3CFX A;  4GFR A;  4G8M A;  3RY3 A;  3TTM A;  5FTH A;  1GTK A;  5DVF A;  1LCF A;  3IR1 A;  3V89 B;  4OEV A;  3VVE A;  1VE4 A;  3S9N C;  1II5 A;  3N6U A;  2QS2 A;  4I9D A;  4F3P A;  3LUY A;  4UAC A;  5IKB A;  3MUQ A;  3HST A;  4HW8 A;  4THI A;  1QW0 A;  2F6G A;  1JW5 A;  1IXH A;  4WEP A;  4M4G A;  1UTH B;  4P0G A;  3IB2 A;  2Y7K A;  3U93 A;  4EXL A;  3IL1 B;  4PET A;  2ZYM A;  4ZEF A;  4GVO A;  4ZEK A;  4QFK A;  4QSC A;  3USD A;  5BWJ A;  4FJP A;  4HCW A;  1URD A;  2H98 A;  2I4B A;  1YAE A;  4ELQ A;  2DE2 A;  3Q29 A;  1WVJ A;  5HBC A;  1MY2 A;  3MZB A;  5AA2 B;  2HQ0 A;  4E0W A;  3FV1 A;  3FXU A;  3IB1 A;  1SYI A;  3C4M A;  2QJE A;  4GD5 A;  1XVX A;  4R72 A;  1QVS A;  3OMB A;  3KOT A;  3G7W A;  1YPN A;  4G68 C;  4NF6 B;  1UIV A;  4X9T A;  1MXW A;  5TU0 A;  4ZDM A;  4F18 A;  1PC3 A;  1A8F A;  4I1D A;  1B0L A;  4OES A;  4U2R A;  4DXU A;  4PFT A;  1CB6 A;  4POX A;  5CI5 A;  4R73 A;  4NE4 A;  4POW A;  4XTC Q;  1D9V A;  1SW1 A;  4XKR A;  4EF1 A;  5I2N B;  3UIF A;  2HEU A;  1RYO A;  1N3W A;  4R2F A;  3H03 A;  4N6P A;  3ZSF A;  4TOZ A;  1FW0 A;  2RC9 A;  1OVT A;  2QS3 A;  4LZ7 A;  4X48 A;  2Z8E A;  3FVK A;  3EHT A;  4Q30 B;  4RNS A;  2REG A;  2UYF A;  3MWB A;  3T9H B;  1UTB A;  3FXR A;  4FED A;  2UVH A;  4IO6 A; 
#chains in the Genus database with same CATH topology
 1LB8 A;  1LCT A;  5H8N B;  3NOH A;  3IX1 A;  4C1U A;  5L9O A;  3QUF A;  1P1N A;  2XWI A;  3K1M A;  3T9U A;  4YMB A;  2GQ1 A;  2FIE A;  4L17 A;  4KPT A;  5K2X A;  3RN8 A;  3KN7 A;  2O68 A;  3IFC A;  3CVG A;  1L5T A;  3PPN A;  1VSO A;  4ZEC A;  3W9V A;  3LUZ A;  2OWS A;  2WBD A;  4YZZ A;  2H25 A;  3HPI A;  4N15 A;  2Z8D A;  1MY4 A;  1DPE A;  4LN5 A;  4P9K A;  4MLQ A;  3S9E A;  3KSX A;  4PBQ A;  2Q88 A;  4YKP A;  1ZTY A;  3K1P A;  5KCJ B;  4XFE A;  1TFD A;  3K2D A;  4OER A;  2B4L A;  3TEP A;  4NF6 A;  4OFL A;  2Y7R A;  5ITP A;  3C31 A;  4BDQ A;  3OOA A;  1H3D A;  4QBA A;  2NUV A;  2H9B A;  3PPR A;  5ELV A;  2FNC A;  1UTH A;  2XWV A;  1MM6 A;  1XT8 A;  2ZYK A;  3FVG A;  3T1B A;  1IIT A;  1NV3 A;  1B4H A;  3B6Q A;  3PD8 A;  5I58 B;  2XX9 A;  2P3V A;  3KJT A;  1Y3P A;  2FA7 A;  3IOW A;  1OMP A;  4N13 A;  4O7M A;  4P1E A;  4Q5T A;  1QUK A;  1NV1 A;  4MAG A;  2WKY A;  2V4C A;  4N81 A;  5F7V A;  3H7M A;  2CEY A;  3FBP A;  1QGX A;  5ICT A;  1B51 A;  2F35 A;  3L6G A;  3RQT A;  3I3V A;  1JVX A;  2DYX A;  3ECR A;  4RY1 A;  3K01 A;  4NMY A;  1LEV A;  4TLM B;  4KI0 E;  2YLN A;  5CM6 A;  3HCQ A;  4UAB A;  4YKI A;  4H5F A;  4O3A A;  2NWJ A;  5TPA A;  1NH8 A;  5CMB A;  4IO7 A;  4HCY A;  2WEF A;  4NF5 B;  1FPK A;  1R9L A;  3R6U A;  1ZIU A;  3PGF A;  2I6E A;  4U1O A;  4PQJ A;  2XWK A;  3CRB A;  1ZMG A;  1OQH A;  3JZJ A;  4GXA A;  2R71 A;  2MKZ A;  4EQ9 A;  1MXV A;  5H8H A;  4LQ5 A;  4QRZ A;  1PB9 A;  1USY H;  5LTC A;  1BKA A;  2YPN A;  3RT8 A;  1NI9 A;  2PFZ A;  3MP1 A;  1IIW A;  3O28 A;  4F3B A;  4XIG Q;  1A40 A;  4HS7 A;  4EXK A;  4XKQ A;  2XXW A;  4RA1 A;  3KEI A;  3PPP A;  1JP4 A;  5I5P A;  3KBZ A;  5I59 B;  3UN6 A;  1AMF A;  3R7X A;  2XXT A;  1TFA A;  1H43 A;  2XXP A;  4G77 A;  3CHG A;  2VP1 A;  4F3G A;  4MFI A;  4G8N A;  4IO2 A;  2HAV A;  5KDT B;  2DWH A;  3FAS A;  2B4M A;  2OWZ A;  1N3X A;  3D4C A;  1BLF A;  4YU0 A;  4PAI A;  1URS A;  2CMO A;  2F97 A;  2RC8 A;  1NNP A;  1KWH A;  3N94 A;  2OCU A;  1O63 A;  4O8M A;  5DEX A;  2ZZW A;  4PFI A;  3OXN A;  1B58 A;  5CRY A;  1MY3 A;  1MQH A;  1FBG A;  4OHN A;  4Q0C A;  4KYD A;  3KZG A;  2R6G E;  1HSE A;  1R9Q A;  1P1Q A;  2FHY A;  5CMK A;  3EF7 A;  4N6D A;  3HFU A;  4Q8R A;  2Q74 A;  4PC9 A;  4XKN A;  4I3Y A;  1G0H A;  3OD7 A;  1P1O A;  4TLL B;  3P7I A;  4OEN A;  1M5B A;  4G8H A;  4ZZE A;  4HXV A;  3RNN A;  2DWA A;  3PUZ E;  2ZYO A;  3H6W A;  2XXK A;  1D9Y A;  3K1N A;  3G3K A;  4GF8 A;  4WKM A;  2A5S A;  3K6X A;  5HPQ A;  2WX9 A;  4DI3 D;  4KD5 A;  3T9X B;  3FZV A;  2ZNT A;  4DCY A;  3LBS A;  1B4Z A;  5CMM A;  3KGC A;  3KG2 A;  3ILT B;  4C0R A;  1N76 A;  1I6Q A;  1Y20 A;  5TP9 B;  1USY E;  4R9G A;  1QUJ A;  4MNI A;  3IFA A;  2VHA A;  5CBR A;  1MG1 A;  4NN3 A;  5EQA A;  3ONM A;  3VDF A;  4I3E A;  5JEI A;  5I56 A;  1FJ6 A;  1KA1 A;  2V93 A;  3G3I A;  1FQF A;  1NL5 A;  1EYK A;  1ZKB A;  4R6H A;  5I7I A;  1N84 A;  4RYA A;  3T93 B;  1TT1 A;  4OAN A;  4F29 A;  4N6K A;  3GBB A;  4PAF A;  5DVI A;  1MXX A;  4OVS A;  4GL0 A;  4AS4 A;  1KA0 A;  1YZ0 A;  4H8I A;  2Q8J A;  2NVU B;  3QMF A;  2ONS A;  3ROJ A;  1H45 A;  4OFJ A;  3FUZ A;  4PGP A;  4HTG A;  3MYU A;  3F11 A;  5JTY B;  5B70 A;  3O6I A;  4PP0 A;  2JJK A;  3R26 A;  1O64 A;  1IZ1 A;  1SW2 A;  4DLD A;  2V25 A;  1FBF A;  1MH4 A;  1B3L A;  3PMV A;  3KC1 A;  5I84 A;  3CSB A;  1K9Y A;  4GRK A;  1S7Y A;  1PBP A;  1B3E A;  2VPN A;  4MH5 A;  3MP8 A;  3U92 A;  1JW4 A;  4H46 A;  2I58 A;  1AL3 A;  1MPB A;  4G8M A;  3RY3 A;  1LCF A;  3VVE A;  3S9N C;  2QS2 A;  4I9D A;  4UAC A;  4KXP A;  4EF1 A;  4M4G A;  2Y7K A;  3IL1 B;  4PET A;  4ZEF A;  4GVO A;  4QSC A;  3Q29 A;  1WVJ A;  3MZB A;  1Q9D A;  3IB1 A;  4GD5 A;  1QVS A;  3OMB A;  3KOT A;  3G7W A;  1YPN A;  4G68 C;  5TU0 A;  1PC3 A;  4DXU A;  4DXB A;  1CB6 A;  4POX A;  4XKR A;  3H03 A;  2RC9 A;  2QS3 A;  2Z8E A;  4Q30 B;  2REG A;  4FED A;  2UVH A;  3A3C A;  2DVC A;  3IAZ A;  3GZG A;  4OVP A;  1FBD A;  3MST A;  3Q28 A;  5A5L A;  1FPJ A;  5L9S A;  1DMB A;  3FGS A;  4PDD A;  4YKK A;  3JYR A;  3TDJ A;  2L5V A;  3CIJ A;  5I59 A;  1MDP 1;  3SKP A;  3TPA A;  3CG3 A;  1FTO A;  2O69 A;  2P1S A;  3CFZ A;  3GBA A;  2P3N A;  1FTK A;  3K6V A;  2QS4 A;  3OO8 A;  4RJZ A;  1LST A;  3ZS6 A;  1P1U A;  3DP8 A;  4FOR A;  3SET A;  4G2Z A;  3PUY E;  4I62 A;  2R9J A;  3RPL A;  4YB6 A;  1J1N A;  3K00 A;  4RK2 A;  2D21 A;  2Q2A A;  3ZKK A;  4QHQ A;  1B3H A;  2O1M A;  4O3B A;  3VVD A;  3ILU B;  3BKI B;  4JVD A;  4XF5 A;  2XHD A;  2GH9 A;  1MQJ A;  5H8S A;  3O9P A;  4IGT A;  4ZEI A;  1ATG A;  1BTJ A;  2PT1 A;  2Y7P A;  3OSQ A;  4OEU A;  4XKP A;  2UVG A;  1BIY A;  1DSN A;  4QSE A;  4EF2 A;  3LV0 A;  3TCF A;  4AB6 A;  4IO5 A;  4PAK A;  4MNP A;  2HFB A;  3O66 A;  3MVY A;  4GWU A;  3IJO B;  5JTY A;  3C36 A;  3DP4 A;  3CG1 A;  3GXA A;  1QKA A;  2F7A A;  3RLF E;  4FEB A;  1DBZ A;  1EYI A;  4YB5 A;  5BUU A;  1VR5 A;  4GX3 A;  3T96 B;  1LLS A;  3QSL A;  2I4C A;  2XXI A;  1LBB A;  2H99 A;  4LA9 A;  3SZP A;  4H8J A;  2XD2 A;  4YAH X;  3HO7 A;  3OEN A;  5TPA B;  1LAF E;  1NV0 A;  4P0I A;  4EUO A;  1JVY A;  2DOJ A;  5AA4 A;  2PYY A;  2ANJ A;  1DTZ A;  4N17 A;  4PF6 A;  1VDW A;  1DPP A;  4NF4 B;  3SER A;  2NOO A;  4MLV A;  4NWC A;  4X8R A;  4KCD A;  3IK6 B;  2V3T A;  1EZP A;  4EDP A;  3HV1 A;  1SDX A;  3SDF A;  4JXI A;  3K4U A;  4U23 A;  3B8B A;  1IEJ A;  2HXW A;  5EQ8 A;  2OX3 A;  5IM2 A;  1US5 A;  3KJ7 A;  1YTV A;  4NED A;  4JWO A;  3OEK A;  3ODB A;  2DWI A;  2QPQ A;  4GL8 A;  2ZNU A;  2I3W A;  2F34 A;  1IMD A;  3TQW A;  2VPO A;  1FTJ A;  3H6U A;  3TTN A;  1WDN A;  4DCX A;  4F2O A;  4FAJ A;  5KDT A;  1Y9U A;  5F24 A;  4H0W A;  4AS5 A;  3IOR A;  3H3G A;  3MQ9 A;  3KOS A;  2Y7I A;  2I0C A;  4G61 A;  3TTL A;  1QUI A;  3ISP A;  4UA8 A;  1UQW A;  4GWY A;  4JWY A;  5IGA A;  2F78 A;  4U1Z A;  3UA8 A;  2IA4 A;  5DT6 A;  2LAO A;  5H8Q B;  4QFP A;  2GHA A;  1B5H A;  4OWD A;  1OQG A;  1Y1M A;  1A55 A;  5DEX B;  5ICQ A;  4GX6 A;  1BK4 A;  3EQ1 A;  5FHO A;  2XXV A;  3UP9 A;  4ZE9 A;  4F19 A;  5IZZ A;  1MPC A;  1B3G A;  1YCJ A;  4ZEB A;  3TCH A;  1LBX A;  3RT6 B;  3WAE A;  4NF0 A;  2RCA A;  4PGN A;  1S9T A;  1EH3 A;  4R6Y A;  3QAX A;  1FQA A;  2B3B A;  2QVR A;  4BDN A;  1LGB C;  5L8D A;  5DVJ A;  4NTL A;  3EHS A;  4FAT A;  3FV2 A;  3CR9 A;  5H8Q A;  1Y4C A;  1B0H A;  1IXC A;  2XXR A;  3FIR A;  4JDF A;  1NNF A;  3QUJ A;  4OVT A;  4F1V A;  4NWD A;  5EYG A;  1IUD A;  4C1T A;  4R2B A;  2OBG A;  3T22 A;  1B52 A;  2UVJ A;  4FIM A;  3C9H A;  1NUW A;  4P3L A;  1NFT A;  2G29 A;  5TP9 A;  3CSG A;  1NV5 A;  2DP8 A;  1ELJ A;  4P11 A;  2XXX A;  1SBP A;  2PCR A;  4E0X A;  3DP6 A;  1LBY A;  4IY6 A;  3W9W A;  5ET5 A;  3T9V A;  5ITO A;  1B3F A;  2REJ A;  1IMC A;  1FQC A;  3VV5 A;  1Y1Z A;  3TMG A;  4ISU A;  1OIB A;  1D4N A;  4GXS B;  5I57 A;  4H45 A;  4MCO A;  3C34 A;  1LAX A;  1NH7 A;  1ZBM A;  3PU5 A;  3HHG A;  4PFR A;  4BDO A;  4DXC A;  3WAF A;  1EYJ A;  5KZT A;  1LB9 A;  4PCD A;  5I2K B;  3E3K A;  4KFQ A;  2DXY A;  1QKB A;  4X04 A;  4O7I A;  1B7U A;  4U22 A;  4IO3 A;  2O7I A;  1MXY A;  2RIN A;  5LOM A;  1JQF A;  1GGG A;  1SI0 A;  3TAJ A;  5AA2 A;  1B7Z A;  5A5X A;  1FTM A;  3PUX E;  3K0V A;  3D1R A;  2QL3 A;  2XXH A;  3S4U A;  3KN3 A;  1KZ8 A;  4DE8 A;  4LZ5 A;  3D4G A;  2ESN A;  5LDZ A;  5H8H B;  1MH3 A;  4YB7 A;  1XVY A;  2ZMB A;  2HXR A;  1AOV A;  3CFX A;  1FJ9 A;  5DVF A;  5FTH A;  3V89 B;  2F3D A;  1FPI A;  4F3P A;  3LUY A;  5IKB A;  3MUQ A;  3HST A;  4THI A;  1UTH B;  3IB2 A;  4EXL A;  4NG7 A;  4ELQ A;  2H98 A;  2DE2 A;  5HBC A;  1MY2 A;  5AA2 B;  3FXU A;  1SYI A;  4X9T A;  4NF6 B;  1UIV A;  3KC0 A;  1A8F A;  1B0L A;  4OES A;  4U2R A;  4NE4 A;  5I2N B;  2QVU A;  2HEU A;  1RYO A;  4N6P A;  1NV4 A;  4LZ7 A;  4X48 A;  4RNS A;  2UYF A;  3USD A;  4ELO A;  3MVZ A;  1Z7M E;  5I57 B;  3N26 A;  4OZ9 A;  3CFL A;  3GLB A;  4ZE8 A;  2X7Q A;  4OMB A;  1URG A;  4MF3 A;  4YIC A;  4MHF A;  5I58 A;  2ABH A;  1MQI A;  2O6A A;  1NUY A;  3IJX B;  4QFL A;  2ZZX A;  3MP6 A;  4ZS9 A;  1MM7 A;  2QRY A;  4R74 A;  3OEL A;  3UGW A;  2XA5 A;  1N7X A;  3QXM A;  3RPW A;  5A5X B;  3TQL A;  1CNQ A;  2GFE A;  1US4 A;  4FBP A;  1LBC A;  1P1W A;  4AB5 A;  3RTW B;  2B65 A;  2V3Q A;  3TOD A;  3RYD A;  3AXF A;  1NUX A;  1FQE A;  3RGY A;  3N6T A;  3LC8 A;  1XOC A;  2CZK A;  4JSO A;  2M8C A;  3MVW A;  2F36 A;  3RPL B;  1ZU0 A;  3PUV E;  3B6W A;  3VE1 B;  4GWX A;  1POT A;  3A09 A;  2Q8M A;  1B9J A;  1OVB A;  2I48 A;  1FBE A;  1AIV A;  2DWJ A;  4KCC A;  4H6D A;  4ZED A;  4MMP A;  3GYY A;  3FXQ A;  2CZI A;  3S2V A;  3TTR A;  5IZ3 A;  2GRV A;  4RXL A;  1SQY A;  3MPK A;  3OO7 A;  2KR0 A;  2RKM A;  3O2A A;  2ALU A;  3VLU A;  4H5G A;  3QYT A;  3LSF B;  3TEL A;  2V3U A;  2KLF A;  2VD2 A;  3H4Z A;  1LAG E;  2VGQ A;  2IEE A;  1XC1 A;  1B05 A;  1GV8 A;  3MPL A;  1EU8 A;  3DEL B;  1F9B A;  1Q1K A;  4K3F A;  4IO4 A;  2CEX A;  4P47 A;  1FBH A;  2XXY A;  4MIJ A;  2ZYN A;  1DOT A;  1D9Q A;  4BDR A;  5EHS A;  3SEW A;  2XWO A;  2O7U A;  3B6T A;  1MY1 A;  2A5T A;  2Q9T A;  1NKX A;  1IME A;  4DIG A;  4NAP A;  2D5W A;  3PV0 E;  4LQ2 A;  3TYH A;  3FD3 A;  3T0J A;  4ESX A;  4MX6 A;  5H8F B;  3VLW A;  4OFO A;  4H65 A;  4F3S A;  2V84 A;  3VXC A;  4XEQ A;  1N04 A;  1R6Z A;  5J16 A;  3KN8 A;  4X1D A;  3E13 X;  1G0I A;  2HZL A;  3SEU A;  5AA2 D;  1A99 A;  1RDZ A;  4N91 A;  1JW1 A;  1LFG A;  1POY 1;  2RCB A;  2VT5 A;  2Y5K A;  1HSL A;  4DI4 B;  1I69 A;  3Q25 A;  1FTL A;  4WED A;  3U65 A;  4OTE A;  3G3J A;  1I6B A;  4LAT A;  3MC2 A;  1B40 A;  4KYE A;  5CBS A;  1YYZ A;  4OVQ A;  1PDA A;  3TUS A;  3TFL A;  1JET A;  1MY0 A;  1OLC A;  3HHF A;  2XX7 A;  2Z23 A;  3IOU A;  4QFN A;  1IMA A;  4BLA A;  2XD3 A;  4I8C A;  5DW8 A;  2P0S A;  4G4P A;  3M8U A;  4G68 B;  3W15 C;  2VOZ A;  1LFI A;  4F39 A;  3C35 A;  2QFL A;  1JEV A;  1B5J A;  5FHN A;  5J1D A;  4YKJ A;  1N7W A;  4NHB A;  3LSX A;  3I5O A;  1Y3Q A;  2OLB A;  5ET6 A;  1NUZ A;  3SEV A;  3E4R A;  4GWO A;  1FPG A;  3PD9 A;  2D3I A;  4R6K A;  2QMW A;  2FVZ A;  4JB7 A;  2I49 A;  3TZA A;  3DLN A;  2F8D A;  2THI A;  2XXQ A;  2QMX A;  4MEV A;  3U8Q A;  1Z7N E;  4OXV A;  1LBV A;  3E78 A;  4M1V A;  3E9X A;  3VVF A;  3FVO A;  2QS1 A;  3V83 A;  3T66 A;  3QIM A;  3MZ9 A;  4MBP A;  1SPI A;  3FXB A;  2HPG A;  3PPO A;  4R75 A;  2G93 A;  5DYH A;  2O51 A;  3E79 A;  4JBZ A;  4MNC A;  5EHM A;  1MQG A;  2KQZ A;  1SVX B;  3TKD A;  2Q89 A;  4QSD A;  4NF8 B;  4ELP A;  5HM4 B;  3M3F A;  4PFU A;  1VFE A;  4PE3 A;  1EZO A;  3UK4 A;  4N07 A;  5AA4 B;  4GBW A;  4IR8 A;  3KBR A;  1Y4T A;  5EQ7 A;  5CC2 A;  4DZ1 A;  4IB2 A;  2O84 X;  2UVI A;  4BDL A;  4OYV A;  1FPL A;  4JSD A;  4HE0 A;  4LUB A;  3C33 A;  3MJN A;  2F7B A;  3V5A A;  3OO9 A;  1S50 A;  1NV6 A;  1P99 A;  3S9L C;  5ISU A;  1N0T A;  1O7T A;  3FJM A;  3FAT A;  2Z22 A;  1OLA A;  4QFO A;  2PX1 A;  3IB0 A;  2W7Y A;  2I0B A;  1PB7 A;  1H44 A;  5IAI A;  1XS5 A;  1ZLQ A;  4KYS A;  2H4I A;  2I3V A;  2YJP A;  4IGR A;  4XXU A;  3H6V A;  3G3H A;  3RUM A;  1T0K A;  2PMS A;  1FBC A;  1PBQ A;  4QF9 A;  4MJO A;  5I56 B;  3M3K A;  1FTA A;  2OZZ A;  1ANF A;  4R9F A;  4WXJ A;  1FCK A;  1I6A A;  3IOT A;  4N4U A;  1VE4 A;  1FPD A;  4HW8 A;  2F6G A;  1JW5 A;  1IXH A;  1FPB A;  1FPE A;  4ZEK A;  5BWJ A;  4FJP A;  1URD A;  4OVR A;  2HQ0 A;  3FV1 A;  1XI6 A;  4F18 A;  1FSA A;  4I1D A;  4PFT A;  4POW A;  1D9V A;  4NQ8 A;  4R2F A;  4TOZ A;  1OVT A;  3EHT A;  3FXR A;  3N5L A;  4IO6 A;  2ZNS A;  3OO6 A;  2HZK A;  1IMF A;  3OSR A;  1HSJ A;  2F7C A;  2QVV A;  2FIX A;  4KHZ E;  5FHM A;  5IZ1 A;  2Y5L A;  3QK6 A;  4ELR A;  1B46 A;  4P1L A;  1A7L A;  1MXZ A;  3PPQ A;  2CZL A;  1FQB A;  5M2V A;  1SW5 A;  3CI8 A;  3RTF B;  2AIX A;  3S9M C;  2WYP A;  4H1X A;  1XHY A;  2HCA A;  5EQ9 A;  1UIU A;  3O6H A;  5IZ3 B;  5AA1 A;  3TTK A;  3DM0 A;  5DTB A;  4GLI A;  4PF8 A;  2FBP A;  1VFD A;  4F2Q A;  2RF1 A;  4GQO A;  2ONR A;  1SYH A;  1UTB B;  1MDQ A;  4KR5 A;  2F6P A;  4NGU A;  2WYK A;  2X7P A;  4OVJ A;  4GWZ A;  3IO4 A;  4JVC A;  4F31 B;  5EYF A;  3Q26 A;  4KQP A;  1B7H A;  3BBR A;  1B2H A;  4O3C A;  2AYS A;  1QJM A;  3PTY A;  1AH5 A;  1MPD A;  4GWW A;  5B7D A;  5CMC A;  3C32 A;  4ESW A;  3B7D A;  4NF8 A;  3A29 A;  5FTI A;  4AQ4 A;  4NF4 A;  4O94 A;  2H5Y A;  2O1L A;  1PEB A;  1PB8 A;  4EQ7 A;  4U21 A;  2DVZ A;  5ET8 A;  1A8E A;  1H76 A;  1D3K A;  1A54 A;  4PBH A;  2DE4 A;  4LZ8 A;  2ZXT A;  5H8N A;  2FYI A;  3BFT A;  1FRP A;  3L6H A;  4IY5 A;  2XX8 A;  4G68 A;  4NF5 A;  4BDM A;  3U94 A;  3PMW A;  1RYX A;  4ECF A;  3VXB A;  1R1N A;  2F3B A;  4F22 A;  1NMU A;  2DS9 A;  3TCG A;  1RDY A;  3LSW A;  1JNF A;  1SW4 A;  3FJ7 A;  4ND9 A;  1MQD A;  2Z8F A;  3VFJ A;  4RK9 A;  3O29 A;  3EHU A;  4HE1 A;  2PFY A;  1DTG A;  1B6H A;  3MVX A;  1K9Z A;  1SI1 A;  5L9M A;  4PFB A;  3UOR A;  5AE4 A;  3B50 A;  4NX1 A;  1INP A;  4YMA A;  4RPN A;  3K6W A;  3FJG A;  4FE8 A;  4TQU Q;  5ET7 A;  1NNK A;  5F1Q A;  1NV7 A;  1MS7 A;  4FEC A;  3SES A;  3O97 A;  1WOD A;  3Q27 A;  4GX4 A;  4OQO A;  1IMB A;  1GVC A;  4PE5 B;  1IQ7 A;  2OJT A;  5KCJ A;  3MW0 A;  4GOT A;  3BIG A;  3U72 A;  2PT2 A;  4LON B;  1TXF A;  5JK4 A;  3THI A;  2DE3 A;  4I40 A;  2R8T A;  1TWY A;  4RPO A;  5K2Y A;  2ONK E;  3BIH A;  1FBP A;  2OK2 A;  2XXU A;  3KFM A;  4PFY A;  3M3L A;  1RDX A;  5H8F A;  3IOV A;  1IXG A;  3OEM A;  3G3F A;  4N8Y A;  1SD3 A;  4JWX A;  1CE2 A;  2E0S A;  3ZKL A;  2NXO A;  2PBW A;  4ONY A;  4F1U A;  3LSL A;  2AL4 A;  2DSF A;  1B32 A;  1M5D A;  3FVN A;  3MZ1 A;  4ZZA A;  5I2N A;  4U4S A;  3MAM A;  3VLV A;  1Y3N A;  2B3F A;  2CZH A;  2PVU A;  4P8B A;  5I3S A;  1QUL A;  3V8X B;  1FQD A;  3I6V A;  4U4X A;  2DQV A;  3BFU A;  3MBP A;  3SEX A;  4F1Y A;  2DXR A;  2E1S A;  5AA3 A;  2F5X A;  2OWT A;  4PFW A;  3KSJ A;  1B1H A;  2UYE A;  1LFH A;  1JEU A;  1MRP A;  4GIZ A;  2GHB A;  3LR1 A;  1BP5 A;  4X1B A;  4DDD A;  3O6G A;  1M5F A;  2A5T B;  1M5E A;  1AWB A;  2ZZV A;  2BJI A;  1YXI A;  3H6T A;  1NV2 A;  2Y7W A;  1B5I A;  1NNT A;  1LAH E;  5EYH A;  3SEY A;  1M5C A;  3HN0 A;  2VD3 A;  2AL5 A;  3K6U A;  3EKI A;  4JVI A;  4Z7E A;  2RC7 A;  2QSX A;  2UXA A;  1FPF A;  4OET A;  4GWS A;  1RKM A;  3PUW E;  4PTK A;  4LVQ A;  2WBB A;  2HHM A;  1GR2 A;  3JV9 A;  4QXD A;  1ZJL A;  1MXU A;  1EZ9 A;  2Q2C A;  3G3G A;  2Y84 A;  4H67 A;  4LP2 B;  3EPE A;  1IXI A;  2P2A A;  3A3U A;  2HAU A;  3H06 B;  3PMX A;  3U1O A;  2X26 A;  1LBZ A;  1DK4 A;  5ESY A;  4HE2 A;  3IO6 A;  4Z0I A;  3EN3 A;  2BJJ X;  5T3J A;  1B1X A;  5FBP A;  1Q35 A;  4N8G A;  3K02 A;  4GFR A;  3TTM A;  1GTK A;  3IR1 A;  4OEV A;  4P56 A;  1II5 A;  3N6U A;  1QW0 A;  4WEP A;  4P0G A;  3U93 A;  1LBW A;  2ZYM A;  4QFK A;  4HCW A;  4OA4 A;  2DDK A;  2I4B A;  1YAE A;  4E0W A;  3C4M A;  2QJE A;  1XVX A;  4R72 A;  1DCU A;  1MXW A;  4PDH A;  4ZDM A;  4GBV A;  5CI5 A;  4EQB A;  4R73 A;  4XTC Q;  1SW1 A;  3UIF A;  1N3W A;  3ZSF A;  1FW0 A;  3FVK A;  3MWB A;  3T9H B;  1UTB A;  5I2K A; 
#chains in the Genus database with same CATH homology
 3A3C A;  1LB8 A;  1LCT A;  2ZNS A;  1Z7M E;  3MVZ A;  5H8N B;  3OO6 A;  5I57 B;  3N26 A;  2HZK A;  2DVC A;  3IAZ A;  1HSJ A;  3GZG A;  3IX1 A;  3OSR A;  4C1U A;  2F7C A;  4OZ9 A;  3Q28 A;  5L9O A;  3QUF A;  1P1N A;  3T9U A;  3K1M A;  4YMB A;  3CFL A;  3GLB A;  4ZE8 A;  5L9S A;  2X7Q A;  4L17 A;  1DMB A;  3FGS A;  4KHZ E;  4OMB A;  1URG A;  4YKK A;  3JYR A;  5FHM A;  4KPT A;  3ECR A;  4MF3 A;  3QK6 A;  4YIC A;  5K2X A;  3RN8 A;  3TDJ A;  4ELR A;  5I58 A;  3KN7 A;  2ABH A;  3CIJ A;  1B46 A;  1MQI A;  5I59 A;  2O68 A;  2O6A A;  3CVG A;  3IJX B;  1A7L A;  4QFL A;  1L5T A;  1MXZ A;  3MP6 A;  1MDP 1;  3PPQ A;  1VSO A;  3PPN A;  4ZS9 A;  1MM7 A;  2QRY A;  4ZEC A;  2CZL A;  3SKP A;  3TPA A;  1FQB A;  3CG3 A;  4R74 A;  3OEL A;  1FTO A;  2O69 A;  3UGW A;  3W9V A;  1N7X A;  3QXM A;  2P1S A;  5M2V A;  2OWS A;  1SW5 A;  3RPW A;  5A5X B;  3CFZ A;  3CI8 A;  3TQL A;  4YZZ A;  2H25 A;  3HPI A;  3RTF B;  2GFE A;  3GBA A;  1US4 A;  2AIX A;  2Z8D A;  3S9M C;  1MY4 A;  1FTK A;  4H1X A;  3K6V A;  1XHY A;  1DPE A;  2HCA A;  2QS4 A;  3OO8 A;  1LBC A;  1UIU A;  4MLQ A;  4RJZ A;  3KSX A;  1LST A;  3S9E A;  3O6H A;  1P1W A;  2Q88 A;  4YKP A;  5AA1 A;  3TTK A;  1ZTY A;  3K1P A;  1P1U A;  3DP8 A;  4FOR A;  3RTW B;  2B65 A;  3DM0 A;  5DTB A;  5KCJ B;  4GLI A;  2V3Q A;  3SET A;  3TOD A;  4G2Z A;  3PUY E;  1VFD A;  1TFD A;  2RF1 A;  4GQO A;  4F2Q A;  2ONR A;  3K2D A;  2R9J A;  3AXF A;  4I62 A;  4OER A;  1FQE A;  4YB6 A;  4DXB A;  1J1N A;  3K00 A;  4RK2 A;  1SYH A;  1UTB B;  2D21 A;  2Q2A A;  4NF6 A;  3N6T A;  3LC8 A;  4QHQ A;  3RGY A;  1B3H A;  1XOC A;  2O1M A;  1MDQ A;  2M8C A;  4JSO A;  4O3B A;  4OFL A;  3VVD A;  2Y7R A;  3ILU B;  3BKI B;  4KR5 A;  3C31 A;  4BDQ A;  5ITP A;  3OOA A;  1H3D A;  2F6P A;  3MVW A;  2X7P A;  2NUV A;  4OVJ A;  2H9B A;  3IO4 A;  4F31 B;  2XHD A;  3PPR A;  2GH9 A;  1MQJ A;  5ELV A;  5EYF A;  3Q26 A;  5H8S A;  2F36 A;  3O9P A;  4KQP A;  1B7H A;  4AB5 A;  3BBR A;  1B2H A;  4O3C A;  1ZU0 A;  2AYS A;  1QJM A;  3PUV E;  2FNC A;  3B6W A;  4IGT A;  1ATG A;  1BTJ A;  1UTH A;  1MM6 A;  1AH5 A;  1XT8 A;  2PT1 A;  2Y7P A;  2ZYK A;  3OSQ A;  4OEU A;  4XKP A;  1POT A;  3A09 A;  3FVG A;  1MPD A;  1B9J A;  2UVG A;  1OVB A;  2I48 A;  1IIT A;  1BIY A;  1AIV A;  1DSN A;  2DWJ A;  4ELO A;  4KCC A;  5B7D A;  1B4H A;  4QSE A;  5CMC A;  3B6Q A;  3C32 A;  3PD8 A;  4H6D A;  4ZED A;  4ESW A;  5I58 B;  4EF2 A;  3B7D A;  4NF8 A;  5FTI A;  4AQ4 A;  2XX9 A;  4NF4 A;  3FXQ A;  3KJT A;  3TCF A;  4AB6 A;  1Y3P A;  2FA7 A;  3IOW A;  4IO5 A;  1OMP A;  4N13 A;  2H5Y A;  3S2V A;  3TTR A;  4Q5T A;  2GRV A;  4RXL A;  2O1L A;  1QUK A;  1SQY A;  3MPK A;  3OO7 A;  1PEB A;  2HFB A;  2WKY A;  3O66 A;  4EQB A;  1PB8 A;  3MVY A;  4EQ7 A;  3IJO B;  4U21 A;  5JTY A;  3C36 A;  2RKM A;  2DVZ A;  3DP4 A;  5F7V A;  3O2A A;  3H7M A;  2ALU A;  3VLU A;  4H5G A;  3CG1 A;  3QYT A;  3GXA A;  3LSF B;  1A8E A;  1B51 A;  1H76 A;  2F35 A;  3L6G A;  5ICT A;  4KYS A;  3TEL A;  2V3U A;  1D3K A;  1A54 A;  1QKA A;  2F7A A;  3RLF E;  4FEB A;  2KLF A;  4YB5 A;  3RQT A;  2VD2 A;  3H4Z A;  5BUU A;  1VR5 A;  3I3V A;  2DE4 A;  1JVX A;  1LAG E;  3T96 B;  1LLS A;  2DYX A;  2VGQ A;  2I4C A;  2IEE A;  2XXI A;  2ZXT A;  1XC1 A;  1B05 A;  1LBB A;  2H99 A;  3K01 A;  4LA9 A;  2FYI A;  4NMY A;  5H8N A;  4TLM B;  3BFT A;  4KI0 E;  2YLN A;  1GV8 A;  3MPL A;  3HCQ A;  1EU8 A;  4H8J A;  5CM6 A;  4YKI A;  3DEL B;  2XD2 A;  1F9B A;  3L6H A;  4H5F A;  2XX8 A;  4IY5 A;  4G68 A;  4O3A A;  1Q1K A;  4NF5 A;  4BDM A;  4K3F A;  4YAH X;  3U94 A;  4IO4 A;  3HO7 A;  2NWJ A;  3OEN A;  5TPA B;  3PMW A;  1LAF E;  5TPA A;  2XXY A;  5ISU A;  1NH8 A;  1DOT A;  1RYX A;  1R1N A;  2ZYN A;  4IO7 A;  5CMB A;  4HCY A;  3VXB A;  4BDR A;  5EHS A;  4NF5 B;  4P0I A;  3SEW A;  4EUO A;  1JVY A;  1NMU A;  2O7U A;  3B6T A;  2DOJ A;  1R9L A;  2DS9 A;  3TCG A;  5AA4 A;  3LSW A;  1JNF A;  2PYY A;  1SW4 A;  2ANJ A;  3R6U A;  1DTZ A;  3FJ7 A;  1ZIU A;  3PGF A;  2I6E A;  4U1O A;  4ND9 A;  1MY1 A;  2A5T A;  2Q9T A;  1NKX A;  4PQJ A;  1DPP A;  1MQD A;  2Z8F A;  4NF4 B;  2NOO A;  3SER A;  4DIG A;  4MLV A;  4NWC A;  3VFJ A;  4RK9 A;  3CRB A;  1ZMG A;  4YU0 A;  1OQH A;  3JZJ A;  3O29 A;  2D5W A;  2R71 A;  4GXA A;  4KCD A;  4EQ9 A;  1MXV A;  3IK6 B;  4LQ5 A;  3EHU A;  4QRZ A;  5H8H A;  1PB9 A;  3PV0 E;  4LQ2 A;  1DTG A;  1B6H A;  1USY H;  1BKA A;  2YPN A;  2V3T A;  3MVX A;  3FD3 A;  3RT8 A;  3TYH A;  4ESX A;  1EZP A;  4EDP A;  3HV1 A;  1SDX A;  3SDF A;  3MP1 A;  4JXI A;  5H8F B;  1IIW A;  3K4U A;  3O28 A;  4U23 A;  4F3B A;  1SI1 A;  3ZS6 A;  4XIG Q;  1IEJ A;  2HXW A;  4OFO A;  3VLW A;  4H65 A;  5L9M A;  4F3S A;  2V84 A;  3VXC A;  1A40 A;  4HS7 A;  1US5 A;  3KJ7 A;  4EXK A;  1N04 A;  4XKQ A;  1R6Z A;  1YTV A;  2XXW A;  3KN8 A;  4NED A;  3UOR A;  5AE4 A;  4RA1 A;  3KEI A;  3PPP A;  4X1D A;  4JWO A;  3E13 X;  3OEK A;  2HZL A;  3ODB A;  2DWI A;  2QPQ A;  3SEU A;  5AA2 D;  4RY1 A;  1A99 A;  1JW1 A;  5I59 B;  4GL8 A;  3UN6 A;  4YMA A;  1AMF A;  1LFG A;  2ZNU A;  1POY 1;  2I3W A;  2F34 A;  4RPN A;  3TQW A;  2RCB A;  3K6W A;  3R7X A;  1FTJ A;  2XXT A;  3H6U A;  3TTN A;  3FJG A;  1WDN A;  1HSL A;  1TFA A;  4FE8 A;  1H43 A;  4DCX A;  2XXP A;  4G77 A;  1I69 A;  3Q25 A;  2VP1 A;  1FTL A;  4TQU Q;  4F3G A;  4WED A;  4MFI A;  4G8N A;  4F2O A;  1NNK A;  4OTE A;  5F1Q A;  4FAJ A;  1MS7 A;  5KDT A;  4FEC A;  3G3J A;  4IO2 A;  1I6B A;  4LAT A;  3MC2 A;  2HAV A;  5KDT B;  3SES A;  2DWH A;  1Y9U A;  3O97 A;  1WOD A;  3FAS A;  3Q27 A;  1B40 A;  4H0W A;  4KYE A;  3IOR A;  4OQO A;  5CBS A;  3H3G A;  1GVC A;  1PDA A;  3TUS A;  1N3X A;  3TFL A;  3D4C A;  4PE5 B;  1BLF A;  3N5L A;  1IQ7 A;  1JET A;  1MY0 A;  1OLC A;  3HHF A;  2XX7 A;  2Z23 A;  3IOU A;  3KOS A;  2OJT A;  2Y7I A;  3MQ9 A;  2I0C A;  4QFN A;  5KCJ A;  3MW0 A;  1URS A;  2CMO A;  2XD3 A;  1QUI A;  4GOT A;  3TTL A;  4BLA A;  4UA8 A;  1UQW A;  3U72 A;  4JWY A;  2PT2 A;  4I8C A;  1AOV A;  2F97 A;  2RC8 A;  4YB7 A;  2F78 A;  1NNP A;  1TXF A;  2P0S A;  4G4P A;  4LON B;  4U1Z A;  3M8U A;  1KWH A;  4G68 B;  2IA4 A;  5DT6 A;  2DE3 A;  3N94 A;  3THI A;  3VE1 B;  2LAO A;  5H8Q B;  3W15 C;  2VOZ A;  1TWY A;  2OCU A;  1LFI A;  4QFP A;  1O63 A;  2GHA A;  2ONK E;  4RPO A;  5K2Y A;  4F39 A;  3C35 A;  5DEX A;  2OK2 A;  1JEV A;  1B5J A;  5FHN A;  2XXU A;  3KFM A;  5J1D A;  3OXN A;  1B5H A;  4PFY A;  1B58 A;  4OWD A;  1OQG A;  1Y1M A;  3M3L A;  4YKJ A;  1N7W A;  5CRY A;  1A55 A;  5H8F A;  1MY3 A;  3IOV A;  1MQH A;  3LSX A;  1IXG A;  5DEX B;  3OEM A;  5ICQ A;  3I5O A;  3G3F A;  1Y3Q A;  2OLB A;  1SD3 A;  3EQ1 A;  4OHN A;  5FHO A;  2XXV A;  3UP9 A;  4Q0C A;  4JWX A;  4ZE9 A;  1CE2 A;  2E0S A;  3ZKL A;  4F19 A;  1MPC A;  1B3G A;  1YCJ A;  2NXO A;  2PBW A;  3E4R A;  4KYD A;  4ZEB A;  4ONY A;  3SEV A;  4GWO A;  3TCH A;  3KZG A;  2R6G E;  3RT6 B;  3WAE A;  4F1U A;  3LSL A;  1HSE A;  2AL4 A;  1R9Q A;  1P1Q A;  2RCA A;  3PD9 A;  2DSF A;  1B32 A;  1S9T A;  5CMK A;  2D3I A;  4R6K A;  3UA8 A;  1EH3 A;  3EF7 A;  2QMW A;  1M5D A;  4R6Y A;  4F1V A;  4Q8R A;  3QAX A;  3FVN A;  1FQA A;  4JB7 A;  2I49 A;  2B3B A;  3MZ1 A;  3TZA A;  3DLN A;  4XKN A;  4BDN A;  2F8D A;  1LGB C;  3OD7 A;  4ZZA A;  5L8D A;  3TEP A;  2THI A;  1P1O A;  5DVJ A;  4TLL B;  2XXQ A;  5I2N A;  2QMX A;  3P7I A;  4OEN A;  4NTL A;  3MAM A;  4U4S A;  1M5B A;  3U8Q A;  3VLV A;  1Y3N A;  1Z7N E;  4G8H A;  4F22 A;  2B3F A;  3EHS A;  4OXV A;  4FAT A;  4ZZE A;  3FV2 A;  3PUZ E;  2DWA A;  2PVU A;  2ZYO A;  3H6W A;  4M1V A;  3CR9 A;  3RNN A;  1D9Y A;  3K1N A;  5H8Q A;  1Y4C A;  1B0H A;  3G3K A;  1IXC A;  1QUL A;  3V8X B;  1FQD A;  4GF8 A;  2XXR A;  4WKM A;  2A5S A;  3E9X A;  3FIR A;  1NNF A;  3K6X A;  3QUJ A;  4JDF A;  2NVU B;  3VVF A;  3FVO A;  2QS1 A;  3I6V A;  4NWD A;  4KD5 A;  5HPQ A;  3T66 A;  3T9X B;  3V83 A;  3QIM A;  4U4X A;  2DQV A;  3MZ9 A;  4MBP A;  3BFU A;  1IUD A;  3FZV A;  3MBP A;  2ZNT A;  4C1T A;  4R2B A;  3PPO A;  3SEX A;  4F1Y A;  4R75 A;  2G93 A;  5DYH A;  4DCY A;  2OBG A;  3T22 A;  2O51 A;  1B52 A;  3LBS A;  2UVJ A;  4JBZ A;  4FIM A;  1B4Z A;  5CMM A;  5EHM A;  3C9H A;  2DXR A;  3KGC A;  3KG2 A;  1NFT A;  2G29 A;  5TP9 A;  2E1S A;  3ILT B;  4C0R A;  5AA3 A;  1N76 A;  3CSG A;  2F5X A;  1I6Q A;  1Y20 A;  2OWT A;  2DP8 A;  1USY E;  5TP9 B;  4PFW A;  1MQG A;  3KSJ A;  1B1H A;  4R9G A;  2UYE A;  1QUJ A;  1LFH A;  1JEU A;  2VHA A;  5CBR A;  1MG1 A;  1MRP A;  1SVX B;  1ELJ A;  4P11 A;  2XXX A;  4GIZ A;  1SBP A;  2GHB A;  3LR1 A;  3TKD A;  1BP5 A;  2Q89 A;  4X1B A;  3DP6 A;  4QSD A;  4NF8 B;  4DDD A;  4E0X A;  4IY6 A;  4ELP A;  3O6G A;  3M3F A;  1M5F A;  4PFU A;  5HM4 B;  3ONM A;  4ZEI A;  3VDF A;  3W9W A;  1VFE A;  3T9V A;  2A5T B;  5ITO A;  3UK4 A;  1EZO A;  1B3F A;  1M5E A;  2REJ A;  4N07 A;  5JEI A;  4ECF A;  5I56 A;  3H6T A;  2V93 A;  3G3I A;  2Y7W A;  1FQF A;  1NL5 A;  5AA4 B;  1FQC A;  1B5I A;  1NNT A;  3KBR A;  1Y4T A;  1ZKB A;  4R6H A;  3VV5 A;  1Y1Z A;  1LAH E;  5CC2 A;  3SEY A;  4DZ1 A;  1M5C A;  3TMG A;  4IB2 A;  1N84 A;  3HN0 A;  2O84 X;  2VD3 A;  4ISU A;  4RYA A;  1OIB A;  2AL5 A;  2UVI A;  3T93 B;  1TT1 A;  1D4N A;  4BDL A;  3K6U A;  4OYV A;  4F29 A;  4GXS B;  5I57 A;  3GBB A;  4JSD A;  4LZ8 A;  5DVI A;  1MXX A;  4Z7E A;  2RC7 A;  4LUB A;  3C33 A;  2QSX A;  3C34 A;  1LAX A;  2UXA A;  1NH7 A;  1ZBM A;  3MJN A;  2F7B A;  3HHG A;  3PU5 A;  4GL0 A;  3WAF A;  4BDO A;  4DXC A;  4OET A;  3V5A A;  5KZT A;  1LB9 A;  3OO9 A;  1RKM A;  3E3K A;  3PUW E;  4H8I A;  4KFQ A;  1S50 A;  5I2K B;  4LVQ A;  2Q8J A;  2DXY A;  1GR2 A;  1QKB A;  1P99 A;  3S9L C;  2ONS A;  1B7U A;  4U22 A;  4IO3 A;  3JV9 A;  1H45 A;  2O7I A;  1MXY A;  1ZJL A;  1N0T A;  1O7T A;  2RIN A;  1MXU A;  3FJM A;  3FAT A;  1EZ9 A;  4OFJ A;  2Q2C A;  5LOM A;  3G3G A;  1JQF A;  1GGG A;  3FUZ A;  2Y84 A;  4H67 A;  2Z22 A;  4HTG A;  1OLA A;  4QFO A;  2PX1 A;  3IB0 A;  3F11 A;  1SI0 A;  2W7Y A;  5JTY B;  3TAJ A;  5AA2 A;  3O6I A;  3QSL A;  4LP2 B;  5B70 A;  2I0B A;  5JK4 A;  1B7Z A;  4PP0 A;  3EPE A;  5A5X A;  1PB7 A;  1IXI A;  1H44 A;  1FTM A;  5IAI A;  1XS5 A;  3PUX E;  3K0V A;  1O64 A;  2P2A A;  1ZLQ A;  3A3U A;  3R26 A;  1IZ1 A;  1SW2 A;  2H4I A;  2HAU A;  2I3V A;  2QL3 A;  2XXH A;  2YJP A;  4DLD A;  2V25 A;  3H06 B;  3PMX A;  4IGR A;  3H6V A;  2X26 A;  1MH4 A;  4XXU A;  3U1O A;  1B3L A;  3S4U A;  3KN3 A;  3PMV A;  3G3H A;  3RUM A;  1T0K A;  2PMS A;  4LZ5 A;  4DE8 A;  5I84 A;  1PBQ A;  3IO6 A;  3D4G A;  3CSB A;  4Z0I A;  2ESN A;  4QF9 A;  4GRK A;  1S7Y A;  5I2K A;  1PBP A;  5I56 B;  1B3E A;  3M3K A;  2OZZ A;  1ANF A;  4MH5 A;  3MP8 A;  4R9F A;  3U92 A;  1JW4 A;  4WXJ A;  3EN3 A;  1FCK A;  2BJJ X;  5H8H B;  3ZKK A;  1I6A A;  1MH3 A;  2I58 A;  1B1X A;  1XVY A;  1Q35 A;  2ZMB A;  3IOT A;  3K02 A;  1AL3 A;  1MPB A;  3CFX A;  4GFR A;  4G8M A;  3RY3 A;  3TTM A;  5FTH A;  1GTK A;  5DVF A;  1LCF A;  3IR1 A;  3V89 B;  4OEV A;  3VVE A;  1VE4 A;  3S9N C;  1II5 A;  3N6U A;  2QS2 A;  4I9D A;  4F3P A;  3LUY A;  4UAC A;  5IKB A;  3MUQ A;  3HST A;  4HW8 A;  4THI A;  1QW0 A;  2F6G A;  1JW5 A;  1IXH A;  4WEP A;  4M4G A;  1UTH B;  4P0G A;  3IB2 A;  2Y7K A;  3U93 A;  4EXL A;  3IL1 B;  4PET A;  2ZYM A;  4ZEF A;  4GVO A;  4ZEK A;  4QFK A;  4QSC A;  3USD A;  5BWJ A;  4FJP A;  4HCW A;  1URD A;  2H98 A;  2I4B A;  1YAE A;  4ELQ A;  2DE2 A;  3Q29 A;  1WVJ A;  5HBC A;  1MY2 A;  3MZB A;  5AA2 B;  2HQ0 A;  4E0W A;  3FV1 A;  3FXU A;  3IB1 A;  1SYI A;  3C4M A;  2QJE A;  4GD5 A;  1XVX A;  4R72 A;  1QVS A;  3OMB A;  3KOT A;  3G7W A;  1YPN A;  4G68 C;  4NF6 B;  1UIV A;  4X9T A;  1MXW A;  5TU0 A;  4ZDM A;  4F18 A;  1PC3 A;  1A8F A;  4I1D A;  1B0L A;  4OES A;  4U2R A;  4DXU A;  4PFT A;  1CB6 A;  4POX A;  5CI5 A;  4R73 A;  4NE4 A;  4POW A;  4XTC Q;  1D9V A;  1SW1 A;  4XKR A;  4EF1 A;  5I2N B;  3UIF A;  2HEU A;  1RYO A;  1N3W A;  4R2F A;  3H03 A;  4N6P A;  3ZSF A;  4TOZ A;  1FW0 A;  2RC9 A;  1OVT A;  2QS3 A;  4LZ7 A;  4X48 A;  2Z8E A;  3FVK A;  3EHT A;  4Q30 B;  4RNS A;  2REG A;  2UYF A;  3MWB A;  3T9H B;  1UTB A;  3FXR A;  4FED A;  2UVH A;  4IO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...