4P8BA

Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
YKSEYKMSLVLGPAFPWGKGGEIWADLVKQRTNGRINIKLYPGTSLVAGDQTREFSAIRQGVIDMAVGSTINWSPQVRELNLFSLPFLMPDYKALDALTQGEVGKSIFATLEKAGVVPLAWGENGFREVSNSKREIRKPEDLKGMKLRVVGSPLYIETFNALGANPTQMSWADAQPAMASGAVDGQENPQSVFAAAKLYTVGQKFVTTWGYVADPLIFVVNKQIWESWTPADREIVKQAAVDAGKQEIALARKGLAEPGAPAWKDMEAHGVKVTHLTPAEHDAFRKATAKVYDKWKKQIGTDLVTKAEGAIAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP-type transporter, periplasmic component
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Cupriavidus necator
total genus 106
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4p8bA00
4OVRA 4PGPA 4NN3A 4UABA 4MEVA 2PFZA 4NHBA 2WYKA 3FXBA 2VPNA 4N17A 4N15A 2HZLA 4N8GA 4LN5A 3B50A 4PF8A 5I5PA 2XXKA 2HPGA 3U65A 4NQ8A 4N6DA 4XFEA 4MNIA 4P8BA 4PDHA 2ZZXA 4PETA 5I7IA 4P1LA 2XWOA 2XA5A 4MHFA 4P56A 4YZZA 4PAFA 5CM6A 4PBHA 2PFYA 2XWIA 2ZZVA 2CEYA 2XWVA 4PFBA 4PAKA 4PDDA 4PE3A 4X04A 4N8YA 4OVSA 4XEQA 4O94A 2CEXA 4N91A 2V4CA 4MCOA 4PF6A 4N6KA 4X8RA 4NX1A 4N4UA 4PBQA 4NG7A 4DI4B 4OVTA 5IZZA 4PCDA 4NGUA 4NAPA 4MNCA 5IGAA 2WX9A 5LTCA 4PAIA 4O8MA 2WYPA 4P9KA 4P1EA 4PC9A 2HZKA 4O7MA 5IM2A 4OVPA 4MX6A 4YICA 2XWKA 4P3LA 4MNPA 2VPOA 2ZZWA 4PFRA 4OANA 4OA4A 4NF0A 4P47A 3GYYA 4PFIA 4MMPA 4MIJA 4XF5A 4DI3D 4PGNA 4MAGA 4OVQA
chains in the Genus database with same CATH superfamily
4OVRA 1TWYA 3Q25A 4NWCA 5ET8A 4H8JA 1QUIA 4ZZEA 1GR2A 1POTA 4GWWA 1LBCA 4DXUA 3O29A 3LV0A 1I69A 4LZ8A 3T9UA 4OWDA 2DWIA 4OFOA 1EU8A 1MQIA 1SD3A 3TPAA 2JJKA 3G7WA 2P3NA 2XXIA 3UP9A 1MPDA 1Y20A 5CM6A 3TTKA 3DP6A 3FXQA 1EZPA 2REJA 4EUOA 3G3HA 3IB2A 4PAKA 4PDDA 1LAFE 4RYAA 4N8YA 1DPEA 3TAJA 2D3IA 1YYZA 1VR5A 2V4CA 3C33A 2F97A 1FTKA 2M8CA 1NKXA 3QSLA 1LBXA 3SEUA 1FSAA 5IZZA 3HHGA 3K6WA 1NNFA 1S9TA 4OXVA 5LTCA 4O3CA 4FJPA 5HBCA 1MRPA 3OSQA 4GRKA 4IY6A 1B9JA 2F78A 2XWKA 2VPOA 1QKAA 4AQ4A 3KC1A 4PFRA 1VSOA 3PUZE 4NF4A 4U1OA 1LCTA 3B8BA 1MY1A 3BBRA 4ZEBA 2ESNA 3IJXB 2Q8JA 1I6BA 2ONKE 1Y1MA 1UTBB 2QS4A 1FQDA 2FIEA 1BKAA 2V3QA 5I58B 2FHYA 2GFEA 2PFZA 4XKNA 1IMEA 3FXBA 4O3BA 2PMSA 4LUBA 4PF8A 2HQ0A 2F34A 4TLLB 1D3KA 4NWDA 1QUKA 2O68A 1NUWA 4ELPA 5HPQA 4XFEA 1Y3PA 1YAEA 4PDHA 3PD9A 3O66A 1A55A 1RYOA 2XX8A 4HTGA 4JXIA 3IOUA 1HSEA 1IXCA 3KFMA 2XXWA 1XS5A 3G3KA 1ZTYA 3DELB 3SZPA 1AMFA 4OVSA 3AXFA 3IFAA 3ZKLA 1NV7A 4E0XA 5ITOA 2DVCA 1NL5A 1NV2A 3FASA 2X26A 3M3LA 1L5TA 1SW1A 1ZIUA 3FZVA 3S9NC 1ZLQA 1PB9A 4IO5A 5I2KB 1B46A 4QSDA 1IEJA 1EZOA 1DPPA 5TP9A 5DTBA 1DTZA 4YMBA 1SI0A 5IM2A 5I56B 4YKJA 1Q1KA 1NV5A 1T0KA 2R8TA 4PFYA 5H8NA 1MXXA 1D9QA 1EH3A 3PD8A 1KZ8A 1P1OA 3CHGA 4GIZA 4OFJA 1AOVA 3PGFA 4BDNA 2Z8DA 3OO9A 4G68B 4KFQA 4PFUA 4DI3D 5LOMA 3VVEA 1B3EA 4R2FA 4THIA 1JETA 5ISUA 2O69A 4LATA 1B4HA 3IL1B 2ANJA 5H8QA 2VPNA 2HZLA 1GTKA 2XX9A 1CB6A 5AA2D 4K3FA 1PB8A 4I1DA 5FBPA 4OEVA 4RY1A 2B4MA 3MJNA 4LZ7A 5IZ3A 4BDRA 2H25A 1NUXA 1IXGA 3IOVA 2XXQA 3HPIA 4YB7A 2XA5A 4POWA 1NMUA 1SPIA 3K4UA 2RC7A 4WEPA 3B7DA 1P1QA 3L6GA 2QMWA 1G0HA 3V8XB 3VE1B 3MPKA 4X04A 5CMCA 3KSJA 5EYHA 5L9SA 1US5A 4R9GA 3SKPA 4I8CA 1LBBA 4QRZA 4NF8B 1PDAA 3RT8A 4FATA 2XXPA 4PCDA 2H4IA 1A54A 3MQ9A 1XVXA 3CRBA 1URGA 1OMPA 4ELOA 1MDP1 4DIGA 3TTLA 1A99A 4GBWA 1LFHA 4KYDA 4F3PA 1P1WA 1PEBA 2D21A 3C31A 2OLBA 3CSGA 1ZJLA 2RC8A 4P0IA 1MXYA 4N6PA 2OCUA 4ELRA 2I4CA 4G2ZA 3K1PA 4NF5B 3SESA 2E1SA 3K1NA 2DXRA 2F7AA 3PMWA 4G8HA 1Q35A 1INPA 2I3WA 1SW2A 2Y7KA 4JWYA 3S4UA 2YPNA 2ONRA 3OEMA 3VLUA 1S7YA 1QJMA 4NE4A 2BJIA 4JWXA 4F29A 2AYSA 2FBPA 3HO7A 2ZMBA 3V89B 1B7UA 1RDYA 4KHZE 4GWUA 1TT1A 5DVFA 3K2DA 3QXMA 4OMBA 3CFZA 1NNTA 1MQGA 2Y7PA 4PAFA 4YMAA 1SW4A 4L17A 5EHSA 1JNFA 3BIGA 4ZDMA 4H46A 2Q8MA 3PPQA 4OZ9A 4PFTA 2PT1A 3M3KA 2ZZVA 1IQ7A 4EDPA 4G77A 2XXVA 4P0GA 4JVCA 2DE2A 4MBPA 3QUFA 1B7HA 1B32A 4PF6A 3D4CA 4X8RA 5KDTA 4N4UA 5K2YA 1M5FA 1SBPA 3KEIA 4R6KA 4HW8A 3DP4A 2R6GE 1M5BA 3T9XB 1EYIA 1LBWA 4H45A 2WYPA 3EHSA 3BKIB 1JQFA 1DOTA 1RDXA 2RC9A 1B51A 3SERA 1MM6A 3GXAA 4MNPA 3GBAA 3IK6B 4RXLA 2F36A 3QK6A 2PCRA 3IORA 4OTEA 3ROJA 1FBEA 4FE8A 1J1NA 2Q2AA 3OELA 5I59A 4P47A 3EQ1A 1BP5A 4GBVA 1PB7A 3K1MA 3JZJA 5L8DA 1F9BA 5I58A 2RKMA 4GWYA 3TDJA 4XIGQ 3PUVE 4MEVA 1D4NA 4U22A 3N6UA 4ESWA 3UA8A 1OVBA 3IJOB 3LUZA 3N5LA 4M1VA 3ZS6A 2X7QA 1AWBA 1USYH 1B5JA 3M3FA 4RPNA 3IR1A 3CIJA 2XXUA 2B3FA 3UORA 2Y5LA 1K9ZA 4Z0IA 5M2VA 2ALUA 1DK4A 4QHQA 2GQ1A 3TTNA 4ECFA 1NFTA 2ZYOA 1LFIA 4F2QA 4EQBA 3TODA 1P99A 2Y84A 1H43A 1B05A 2DP8A 3H6VA 1WODA 5CMBA 1HSLA 2OK2A 2H98A 4XKQA 4F1VA 5T3JA 1FTJA 1MXUA 1POY1 2A5TB 4RK9A 1GV8A 5CBSA 4QFPA 5LDZA 2CZHA 2O51A 2UXAA 1FJ6A 4ELQA 4O8MA 5I3SA 5TU0A 1NH8A 4IO4A 1AIVA 3FVKA 1UTHB 4I9DA 1H45A 2HFBA 2HAVA 4Q8RA 4QSCA 4OANA 3S2VA 4WEDA 2A5SA 3VDFA 2O7IA 3OEKA 4MMPA 4LQ5A 4JSOA 2O7UA 4MAGA 4DLDA 3PPRA 4PGPA 1USYE 2ONSA 2DSFA 3TEPA 4G8MA 2XD2A 1MY4A 2DXYA 2DWJA 5JK4A 2DVZA 4LN5A 3B50A 3O97A 3LSFB 1LB9A 2HPGA 3UK4A 5A5LA 4IO2A 1LAHE 5J1DA 1LFGA 3KN3A 3JV9A 4JVDA 4ONYA 1QKBA 1IZ1A 2V3TA 1YCJA 3KG2A 4ZECA 4QSEA 2FVZA 2QPQA 1FPIA 1PBPA 1N7XA 4ZEDA 4Q5TA 3O28A 4PFBA 4TOZA 5DVIA 3RY3A 2CZLA 4G8NA 2O1MA 4DE8A 5JEIA 1FBDA 1P1UA 2O6AA 3ILUB 2QMXA 3RTFB 2HZKA 4O7MA 1MQJA 2AL5A 3V83A 3ZKKA 2REGA 4I40A 3VFJA 1Y9UA 2ZYKA 1NV1A 2VHAA 3TUSA 4YKPA 3G3IA 4O3AA 4NF6A 3QMFA 4FECA 3I6VA 1FQCA 5IAIA 4OVQA 2PX1A 3VXBA 1PC3A 3W9VA 4PFWA 1DBZA 4OVJA 1JW4A 3Q29A 1R9LA 3FXRA 1ZBMA 4FEDA 5EQ7A 1XVYA 4ZS9A 4U4XA 3RN8A 4JWOA 4NQ8A 3TELA 2VOZA 4RA1A 3S9LC 3FVGA 3BFTA 1II5A 4JVIA 2F3BA 4HXVA 1MQDA 4QBAA 2XXHA 4R6YA 2I49A 4BLAA 2F8DA 5ET6A 2FNCA 3TYHA 3E13X 3U92A 4IO3A 1VFDA 3OSRA 3LBSA 4YB6A 1IIWA 4HCYA 1SYIA 2Z23A 5TPAA 4RK2A 1IMAA 5L9OA 4GL8A 2PVUA 2I48A 3VVFA 4NAPA 1G0IA 4N07A 3KC0A 3H6WA 2FYIA 4G61A 1TFDA 4BDQA 4LONB 3MSTA 1FPKA 3MUQA 1I6AA 5B7DA 2F6GA 2Q2CA 5B70A 2P3VA 5I2NA 3CI8A 2NWJA 4X9TA 3IAZA 5CMMA 2XXXA 5I57B 3RT6B 3PUYE 2DS9A 4EQ7A 3KOSA 4QXDA 1MH3A 1TXFA 2QVRA 4QFLA 3LC8A 3LUYA 2HXRA 2RF1A 4F31B 4AS4A 4UACA 3KJ7A 4E0WA 1FPFA 5AA1A 4JDFA 3OO6A 4GL0A 3TCHA 3HSTA 2H9BA 4IO7A 3H3GA 1MY2A 1IMDA 1N0TA 2XD3A 2KR0A 1B3LA 3Q28A 1RYXA 4GVOA 4F3GA 2QS1A 4MNIA 1I6QA 2ZZXA 3M8UA 5I7IA 2DWAA 4P1LA 2XWOA 3CVGA 2CMOA 4OHNA 5JTYB 5AA4B 2NUVA 3FATA 2P1SA 3H06B 5DT6A 2MKZA 3HFUA 4LVQA 4PE3A 2VGQA 3E4RA 1FQEA 1MQHA 3DLNA 4I3EA 5FHOA 2H5YA 5AA2B 2PBWA 4BDOA 2Q74A 1B5IA 2NVUB 3IOWA 1MY0A 4GFRA 1QVSA 1LAGE 5EQ9A 2UVGA 1FPDA 3C34A 3LSLA 5EYGA 4OVPA 3V5AA 4LQ2A 5KCJA 1NUZA 1Y3NA 2D5WA 1US4A 3R26A 3USDA 1RDZA 1FPBA 1XI6A 2E0SA 4NEDA 3O6GA 4R72A 1OQGA 3SEYA 4PGNA 5A5XA 4H1XA 2YLNA 5EQAA 2XXKA 3GBBA 1LBYA 5L9MA 3TMGA 4FEBA 3KOTA 1EYJA 2DWHA 2PT2A 2WYKA 5CC2A 1TFAA 1B5HA 2WEFA 1N3XA 3C9HA 3K6UA 1N7WA 3EN3A 3RYDA 3K00A 3LSXA 3IO4A 1N3WA 4R9FA 1A40A 4MJOA 1JW1A 4Q0CA 2CZKA 3FJGA 4GXSB 4EF2A 1D9VA 1FTOA 3SETA 3C35A 3F11A 3B6TA 2H99A 1IMFA 5ET7A 2ZYNA 4EQ9A 4TLMB 3G3GA 1FTLA 3WAEA 4GD5A 4QF9A 4N6KA 1FTMA 1OVTA 2QS2A 2CZIA 4ZEIA 4F19A 3I3VA 4XKPA 4NF4B 3R6UA 5DEXB 4OESA 1FQAA 4IY5A 4IGTA 1MPBA 5FHMA 3S9EA 1UIVA 5ESYA 2QFLA 1FBGA 5CMKA 4OENA 4BDMA 4HS7A 2OJTA 3MP1A 3MZ9A 4GLIA 4DXCA 2V93A 1JEVA 2B3BA 2Q9TA 3U8QA 3OENA 3VLWA 2F6PA 2XXRA 3MP8A 3Q26A 3H6TA 5ET5A 3TTRA 3PPOA 2Z8EA 4JSDA 4HE1A 4G4PA 1MG1A 4FORA 3I5OA 4H65A 2RCAA 3BIHA 4H5GA 4DZ1A 4F3BA 3O9PA 1UTBA 3MAMA 4GWOA 2GRVA 1O7TA 3EHTA 1NV0A 3S9MC 1NV4A 4YU0A 4TQUQ 2XXYA 3ZSFA 3FJMA 5HM4B 2QL3A 2RCBA 1Y4TA 4YZZA 3UN6A 2I4BA 3RGYA 3IB0A 4QFKA 4AS5A 3NOHA 1B0HA 1Y3QA 3CR9A 2QVUA 4LP2B 5F7VA 2I0CA 4POXA 1FBCA 2VP1A 4XEQA 1KA1A 5TP9B 3OD7A 2NOOA 4BDLA 4H67A 3C36A 1SW5A 2RINA 3KBZA 1XOCA 4N13A 1UIUA 5H8NB 1JVYA 4PTKA 2UYEA 1PBQA 4FAJA 1NV3A 1Y4CA 3PMXA 4ZZAA 5EHMA 1IXIA 3A29A 4MLQA 3W9WA 1NV6A 4LA9A 2UVJA 1QGXA 1OLCA 3T9VA 4OA4A 5I2KA 4XKRA 5H8QB 4C1TA 2GHAA 4UA8A 5ITPA 1Q9DA 4OQOA 1MY3A 5IKBA 5I56A 4X1BA 4H8IA 3T0JA 3K01A 1EYKA 3HCQA 3MBPA 5ELVA 2F5XA 2Y7IA 2ZNSA 4NN3A 4F3SA 1H44A 3FVOA 4EF1A 2GHBA 2O1LA 5H8HB 2THIA 4G68A 3CFXA 1FQBA 1MS7A 1LGBC 1AL3A 3GLBA 1B4ZA 3U65A 3OO8A 1XHYA 4FBPA 4U21A 3H7MA 3QAXA 1BK4A 2X7PA 4PETA 1ZKBA 5DVJA 3O6IA 4R6HA 4EXLA 5CI5A 3IOTA 1DTGA 4OYVA 3KN7A 3N94A 3FJ7A 1FBPA 2ZNUA 3T9HB 2DQVA 2XWVA 2FIXA 2B4LA 3IX1A 3FV2A 1SDXA 5H8SA 4LZ5A 4MCOA 3E79A 3E9XA 4HE2A 3QIMA 1IMBA 5BUUA 1OQHA 1URDA 3FBPA 2F3DA 1YTVA 1MPCA 2IEEA 3ONMA 1LBVA 4IR8A 3TCGA 1LSTA 3MZ1A 4F1UA 2AL4A 4F39A 4NF8A 3P7IA 3OXNA 3RTWB 2ZZWA 2QSXA 3ODBA 1RKMA 3N26A 2NXOA 1LCFA 4JBZA 2VD2A 4GWSA 1GVCA 3H03A 1IUDA 1R9QA 5ICQA 4OEUA 1DSNA 4RNSA 1O64A 1FRPA 4NF5A 2F7CA 4NHBA 3FXUA 3PUXE 4QFOA 3PV0E 3B6WA 3C4MA 1FTAA 1IITA 1MH4A 4PE5B 4KD5A 1FPEA 4G68C 3MPLA 3MVZA 3RQTA 3PMVA 2FA7A 2OWSA 2P0SA 4YKIA 2LAOA 3OOAA 2L5VA 4R73A 4AB6A 5KDTB 1SYHA 2UVIA 1MXZA 1FBHA 3TQWA 2XWIA 1B58A 1EZ9A 2DDKA 5FTHA 2ZNTA 2V25A 2DYXA 2CEXA 3KGCA 2HCAA 4JB7A 4NX1A 4PBQA 1NNKA 5DEXA 4NGUA 1B1HA 3MWBA 4I62A 5I59B 1BTJA 4R75A 4WXJA 3KSXA 3SEWA 4PQJA 4P3LA 1FBFA 1QUJA 1Z7ME 2KQZA 3KBRA 3SEVA 1H3DA 2Y7RA 4IB2A 4MIJA 1ELJA 1MDQA 3RPWA 2HXWA 1DMBA 2I58A 3EHUA 4GX3A 4C1UA 2G29A 1B7ZA 4KPTA 3QUJA 3U94A 1B52A 3DP8A 4KYEA 5KZTA 3IO6A 1YZ0A 2I6EA 4U2RA 4N17A 4N15A 3R7XA 1KWHA 3PPNA 3RUMA 1LEVA 2QS3A 2HAUA 3MW0A 5F24A 2XXTA 5K2XA 3DM0A 4N6DA 2G93A 4OERA 4ISUA 3W15C 2P2AA 1UQWA 1JVXA 1NI9A 2PYYA 3A09A 3TCFA 2HHMA 3HHFA 4MHFA 4MH5A 3THIA 3D1RA 4N81A 3RPLB 1B3HA 3GZGA 4IO6A 4ZEFA 2Z22A 1A7LA 2CEYA 3QYTA 5FHNA 1MM7A 3WAFA 3OO7A 4O94A 4U4SA 4GX6A 1FJ9A 4N91A 2HEUA 2OWTA 1OLAA 5EYFA 4ZE9A 4KXPA 1FCKA 1MXVA 3C32A 1FPLA 1ZMGA 3PU5A 1Z7NE 3MZBA 3BFUA 1XC1A 4YKKA 4GX4A 4KYSA 3UGWA 4QFNA 3L6HA 4PC9A 4MLVA 3FV1A 4MF3A 4NMYA 4GQOA 2A5TA 1QULA 1A8FA 3CG1A 4KQPA 3TQLA 1NUYA 1HSJA 5FTIA 4H6DA 2Y5KA 4ZE8A 1UTHA 5H8FB 2R71A 4H5FA 2R9JA 1LAXA 3K02A 3G3FA 5CRYA 3TTMA 3Q27A 4R74A 2QVVA 1DCUA 5H8HA 1LB8A 1M5CA 1B1XA 1SI1A 2I3VA 4GOTA 3U93A 5BWJA 5IZ1A 1LBZA 4ZEKA 3G3JA 1CE2A 3O6HA 4F18A 2V84A 2KLFA 1FQFA 1N04A 1B40A 4P8BA 1AH5A 1SQYA 4F1YA 4DXBA 1MXWA 4P56A 1JP4A 1JW5A 3KZGA 2ABHA 2VT5A 2XHDA 3KJTA 2QJEA 2PFYA 4GWXA 3MVYA 3VVDA 5I84A 1K9YA 5CBRA 3H4ZA 1GGGA 2UYFA 4DDDA 3LSWA 5EQ8A 1M5DA 4Q30B 2WX9A 3A3UA 4PAIA 4M4GA 1IMCA 4NF6B 4OETA 4PP0A 3E3KA 4F2OA 4GWZA 3HN0A 3IFCA 4XTCQ 3EPEA 1B6HA 4R2BA 3VXCA 1VE4A 3GYYA 1O63A 3EF7A 1URSA 4GXAA 4XXUA 2Y7WA 4RPOA 3FVNA 1KA0A 1FPGA 1CNQA 2V3UA 3FD3A 1M5EA 3D4GA 1YPNA 4DCXA 4N8GA 3K6XA 4U23A 3MYUA 1VDWA 2DOJA 1WVJA 1P1NA 3OMBA 2I0BA 3ISPA 4MFIA 5DW8A 2W7YA 2ZXTA 3PUWE 2VD3A 1B2HA 5TPAB 3RNNA 3TFLA 3MC2A 4U1ZA 1R1NA 3B6QA 3U1OA 3CFLA 3E78A 3SEXA 1OIBA 3N6TA 4RJZA 5F1QA 1QW0A 1XT8A 3EKIA 2IA4A 3UIFA 2Q88A 4KR5A 1JEUA 5ICTA 3T96B 3CSBA 4P11A 3LR1A 2OWZA 1BIYA 5I2NB 4MNCA 5IGAA 1NH7A 3CG3A 3ECRA 1ATGA 1N76A 3TKDA 5AE4A 4P9KA 4P1EA 2O84X 2DE3A 3FUZA 3U72A 4YICA 4OFLA 3FGSA 2XX7A 3H6UA 4FIMA 2BJJX 1N84A 1ANFA 4NF0A 4X1DA 2ZYMA 4IGRA 4PFIA 1VFEA 3IB1A 3MVWA 4C0RA 2WKYA 4HE0A 2YJPA 4I3YA 4DCYA 4X48A 4UABA 2OBGA 3PTYA 1R6ZA 2UVHA 3ILTB 3KN8A 2AIXA 1YXIA 5I57A 1B3GA 4EXKA 3SDFA 5I5PA 1A8EA 4YAHX 2GH9A 4GF8A 4YB5A 3T93B 4O7IA 1SVXB 1B0LA 3JYRA 3MVXA 5IZ3B 1B3FA 2OZZA 4H0WA 3MP6A 3RPLA 3VV5A 1H76A 3RLFE 2DE4A 4F22A 1D9YA 2F35A 4PBHA 1S50A 1NNPA 1IXHA 5J16A 3A3CA 2WBBA 5DYHA 4Z7EA 3TZAA 2Z8FA 3K6VA 4HCWA 1FW0A 5AA4A 5JTYA 1LLSA 3T1BA 2QRYA 5KCJB 5AA3A 2Q89A 4NG7A 4DI4B 2OX3A 4OVTA 1FPJA 2WBDA 1ZU0A 2F7BA 1Y1ZA 3T22A 5A5XB 4KI0E 5AA2A 4MX6A 3VLVA 1WDNA 4KCDA 3T66A 4AB5A 1BLFA 3K0VA 3PPPA 3O2AA 4NTLA 2B65A 5H8FA 4ESXA 3FIRA 4KCCA 4XF5A 4ND9A 4WKMA 3HV1A
chains in the Genus database with same CATH topology
4OVRA 5ET8A 4MEVA 1EYJA 4GWWA 3LV0A 1YZ0A 2WYKA 4N17A 4N15A 3LUZA 2WEFA 1LEVA 4M1VA 5F24A 3RYDA 1AWBA 2JJKA 4N6DA 2P3NA 4MJOA 2Y5LA 2CZKA 1NI9A 1K9ZA 2HHMA 4MHFA 1DK4A 3D1RA 4N81A 3RPLB 5CM6A 2GQ1A 2CEYA 4PAKA 4PDDA 4N8YA 1IMFA 5ET7A 4O94A 1YYZA 4GX6A 1FJ9A 4N91A 2V4CA 4N6KA 4F1VA 5T3JA 2CZIA 1LBXA 4KXPA 4F19A 1FSAA 5IZZA 1FPLA 5LDZA 2CZHA 5LTCA 1FJ6A 4O8MA 4GX4A 5I3SA 4PC9A 5ESYA 2QFLA 1FBGA 2XWKA 2VPOA 3KC1A 4PFRA 4OANA 3B8BA 1NUYA 2Q9TA 4MMPA 2Y5KA 4MAGA 5ET5A 2FIEA 4PGPA 2QVVA 1DCUA 2V3QA 4HE1A 2FHYA 2PFZA 1IMEA 3FXBA 3BIHA 5JK4A 2DVZA 4LN5A 3B50A 4PF8A 5IZ1A 1LBZA 2HPGA 5A5LA 4F18A 5J1DA 1NUWA 4JVDA 1NV0A 1NV4A 4XFEA 4P8BA 4PDHA 4P56A 4YZZA 1JP4A 2VT5A 2FVZA 2QPQA 1FPIA 2PFYA 4AS5A 3NOHA 2QVUA 4PFBA 4GWXA 3SZPA 4OVSA 1K9YA 1FBCA 3IFAA 4XEQA 1NV7A 1KA1A 1NV2A 1FBDA 3KBZA 5EQ8A 4PTKA 2WX9A 4PAIA 1IMCA 1NV3A 4GWZA 2HZKA 4O7MA 5IM2A 3A29A 3W9WA 1NV6A 1NV5A 2R8TA 3IFCA 1QGXA 1D9QA 1KZ8A 3CHGA 4I40A 4OA4A 1NV1A 3GYYA 3QMFA 1Q9DA 4DI3D 3T0JA 4OVQA 1EYKA 1KA0A 1FPGA 1CNQA 2F5XA 4NN3A 3W9VA 1DBZA 2VPNA 2HZLA 4N8GA 5EQ7A 3MYUA 1VDWA 5FBPA 3U65A 2B4MA 5IZ3A 4NQ8A 1NUXA 4FBPA 1BK4A 3ISPA 4PETA 5DW8A 2XA5A 4JVIA 2F3BA 4HXVA 1SPIA 4QBAA 1FBPA 3E78A 5ET6A 1G0HA 2XWVA 2FIXA 2B4LA 4X04A 5EYHA 3EKIA 4HCYA 4MCOA 3E79A 1IMAA 4HE2A 1IMBA 2OWZA 4PCDA 4NAPA 1G0IA 4MNCA 3FBPA 5IGAA 2F3DA 3KC0A 4G61A 4P9KA 1LBVA 4P1EA 3MSTA 4IR8A 1FPKA 4GBWA 2DE3A 4F1UA 4YICA 2ZZWA 2P3VA 4X9TA 4NF0A 4PFIA 4GWSA 4HE0A 4QXDA 1INPA 4I3YA 2QVRA 4UABA 2HXRA 3PTYA 1FRPA 4AS4A 4NHBA 1YXIA 1FPFA 5I5PA 2BJIA 1FTAA 2FBPA 4O7IA 1IMDA 2KR0A 1RDYA 1FPEA 4GWUA 4MNIA 5IZ3B 2ZZXA 5I7IA 4P1LA 3RPLA 2XWOA 2DE4A 4PAFA 2L5VA 4PBHA 3BIGA 2Q8MA 4H46A 1FBHA 5J16A 2MKZA 2XWIA 2ZZVA 3HFUA 2WBBA 4PE3A 2DDKA 4HCWA 4I3EA 4JVCA 2DE2A 2CEXA 3T1BA 4PF6A 4X8RA 4NX1A 4N4UA 2Q74A 4PBQA 4NG7A 4DI4B 2OX3A 4OVTA 4NGUA 1FPJA 5EQ9A 2WBDA 1EYIA 1FPDA 1LBWA 4H45A 2WYPA 1LBYA 5EYGA 1RDXA 4OVPA 4MX6A 1NUZA 4P3LA 1FBFA 4MNPA 2PCRA 2KQZA 3ROJA 1RDZA 1FBEA 1FPBA 1XI6A 4P47A 4MIJA 4XF5A 4GBVA 4PGNA 5EQAA 2XXKA 4GX3A 4GWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVR A;  4PGP A;  4NN3 A;  4UAB A;  4MEV A;  2PFZ A;  4NHB A;  2WYK A;  3FXB A;  2VPN A;  4N17 A;  4N15 A;  2HZL A;  4N8G A;  4LN5 A;  3B50 A;  4PF8 A;  5I5P A;  2XXK A;  2HPG A;  3U65 A;  4NQ8 A;  4N6D A;  4XFE A;  4MNI A;  4P8B A;  4PDH A;  2ZZX A;  4PET A;  5I7I A;  4P1L A;  2XWO A;  2XA5 A;  4MHF A;  4P56 A;  4YZZ A;  4PAF A;  5CM6 A;  4PBH A;  2PFY A;  2XWI A;  2ZZV A;  2CEY A;  2XWV A;  4PFB A;  4PAK A;  4PDD A;  4PE3 A;  4X04 A;  4N8Y A;  4OVS A;  4XEQ A;  4O94 A;  2CEX A;  4N91 A;  2V4C A;  4MCO A;  4PF6 A;  4N6K A;  4X8R A;  4NX1 A;  4N4U A;  4PBQ A;  4NG7 A;  4DI4 B;  4OVT A;  5IZZ A;  4PCD A;  4NGU A;  4NAP A;  4MNC A;  5IGA A;  2WX9 A;  5LTC A;  4PAI A;  4O8M A;  2WYP A;  4P9K A;  4P1E A;  4PC9 A;  2HZK A;  4O7M A;  5IM2 A;  4OVP A;  4MX6 A;  4YIC A;  2XWK A;  4P3L A;  4MNP A;  2VPO A;  2ZZW A;  4PFR A;  4OAN A;  4OA4 A;  4NF0 A;  4P47 A;  3GYY A;  4PFI A;  4MMP A;  4MIJ A;  4XF5 A;  4DI3 D;  4PGN A;  4MAG A;  4OVQ A; 
#chains in the Genus database with same CATH topology
 4OVR A;  1TWY A;  3Q25 A;  4NWC A;  5ET8 A;  4H8J A;  1QUI A;  4ZZE A;  1GR2 A;  1POT A;  4GWW A;  1LBC A;  4DXU A;  3O29 A;  3LV0 A;  1I69 A;  4LZ8 A;  3T9U A;  4OWD A;  2DWI A;  4OFO A;  1EU8 A;  1MQI A;  1SD3 A;  3TPA A;  2JJK A;  3G7W A;  2P3N A;  2XXI A;  3UP9 A;  1MPD A;  1Y20 A;  5CM6 A;  3TTK A;  3DP6 A;  3FXQ A;  1EZP A;  2REJ A;  4EUO A;  3G3H A;  3IB2 A;  4PAK A;  4PDD A;  1LAF E;  4RYA A;  4N8Y A;  1DPE A;  3TAJ A;  2D3I A;  1YYZ A;  1VR5 A;  2V4C A;  3C33 A;  2F97 A;  1FTK A;  2M8C A;  1NKX A;  3QSL A;  1LBX A;  3SEU A;  1FSA A;  5IZZ A;  3HHG A;  3K6W A;  1NNF A;  1S9T A;  4OXV A;  5LTC A;  4O3C A;  4FJP A;  5HBC A;  1MRP A;  3OSQ A;  4GRK A;  4IY6 A;  1B9J A;  2F78 A;  2XWK A;  2VPO A;  1QKA A;  4AQ4 A;  3KC1 A;  4PFR A;  1VSO A;  3PUZ E;  4NF4 A;  4U1O A;  1LCT A;  3B8B A;  1MY1 A;  3BBR A;  4ZEB A;  2ESN A;  3IJX B;  2Q8J A;  1I6B A;  2ONK E;  1Y1M A;  1UTB B;  2QS4 A;  1FQD A;  2FIE A;  1BKA A;  2V3Q A;  5I58 B;  2FHY A;  2GFE A;  2PFZ A;  4XKN A;  1IME A;  3FXB A;  4O3B A;  2PMS A;  4LUB A;  4PF8 A;  2HQ0 A;  2F34 A;  4TLL B;  1D3K A;  4NWD A;  1QUK A;  2O68 A;  1NUW A;  4ELP A;  5HPQ A;  4XFE A;  1Y3P A;  1YAE A;  4PDH A;  3PD9 A;  3O66 A;  1A55 A;  1RYO A;  2XX8 A;  4HTG A;  4JXI A;  3IOU A;  1HSE A;  1IXC A;  3KFM A;  2XXW A;  1XS5 A;  3G3K A;  1ZTY A;  3DEL B;  3SZP A;  1AMF A;  4OVS A;  3AXF A;  3IFA A;  3ZKL A;  1NV7 A;  4E0X A;  5ITO A;  2DVC A;  1NL5 A;  1NV2 A;  3FAS A;  2X26 A;  3M3L A;  1L5T A;  1SW1 A;  1ZIU A;  3FZV A;  3S9N C;  1ZLQ A;  1PB9 A;  4IO5 A;  5I2K B;  1B46 A;  4QSD A;  1IEJ A;  1EZO A;  1DPP A;  5TP9 A;  5DTB A;  1DTZ A;  4YMB A;  1SI0 A;  5IM2 A;  5I56 B;  4YKJ A;  1Q1K A;  1NV5 A;  1T0K A;  2R8T A;  4PFY A;  5H8N A;  1MXX A;  1D9Q A;  1EH3 A;  3PD8 A;  1KZ8 A;  1P1O A;  3CHG A;  4GIZ A;  4OFJ A;  1AOV A;  3PGF A;  4BDN A;  2Z8D A;  3OO9 A;  4G68 B;  4KFQ A;  4PFU A;  4DI3 D;  5LOM A;  3VVE A;  1B3E A;  4R2F A;  4THI A;  1JET A;  5ISU A;  2O69 A;  4LAT A;  1B4H A;  3IL1 B;  2ANJ A;  5H8Q A;  2VPN A;  2HZL A;  1GTK A;  2XX9 A;  1CB6 A;  5AA2 D;  4K3F A;  1PB8 A;  4I1D A;  5FBP A;  4OEV A;  4RY1 A;  2B4M A;  3MJN A;  4LZ7 A;  5IZ3 A;  4BDR A;  2H25 A;  1NUX A;  1IXG A;  3IOV A;  2XXQ A;  3HPI A;  4YB7 A;  2XA5 A;  4POW A;  1NMU A;  1SPI A;  3K4U A;  2RC7 A;  4WEP A;  3B7D A;  1P1Q A;  3L6G A;  2QMW A;  1G0H A;  3V8X B;  3VE1 B;  3MPK A;  4X04 A;  5CMC A;  3KSJ A;  5EYH A;  5L9S A;  1US5 A;  4R9G A;  3SKP A;  4I8C A;  1LBB A;  4QRZ A;  4NF8 B;  1PDA A;  3RT8 A;  4FAT A;  2XXP A;  4PCD A;  2H4I A;  1A54 A;  3MQ9 A;  1XVX A;  3CRB A;  1URG A;  1OMP A;  4ELO A;  1MDP 1;  4DIG A;  3TTL A;  1A99 A;  4GBW A;  1LFH A;  4KYD A;  4F3P A;  1P1W A;  1PEB A;  2D21 A;  3C31 A;  2OLB A;  3CSG A;  1ZJL A;  2RC8 A;  4P0I A;  1MXY A;  4N6P A;  2OCU A;  4ELR A;  2I4C A;  4G2Z A;  3K1P A;  4NF5 B;  3SES A;  2E1S A;  3K1N A;  2DXR A;  2F7A A;  3PMW A;  4G8H A;  1Q35 A;  1INP A;  2I3W A;  1SW2 A;  2Y7K A;  4JWY A;  3S4U A;  2YPN A;  2ONR A;  3OEM A;  3VLU A;  1S7Y A;  1QJM A;  4NE4 A;  2BJI A;  4JWX A;  4F29 A;  2AYS A;  2FBP A;  3HO7 A;  2ZMB A;  3V89 B;  1B7U A;  1RDY A;  4KHZ E;  4GWU A;  1TT1 A;  5DVF A;  3K2D A;  3QXM A;  4OMB A;  3CFZ A;  1NNT A;  1MQG A;  2Y7P A;  4PAF A;  4YMA A;  1SW4 A;  4L17 A;  5EHS A;  1JNF A;  3BIG A;  4ZDM A;  4H46 A;  2Q8M A;  3PPQ A;  4OZ9 A;  4PFT A;  2PT1 A;  3M3K A;  2ZZV A;  1IQ7 A;  4EDP A;  4G77 A;  2XXV A;  4P0G A;  4JVC A;  2DE2 A;  4MBP A;  3QUF A;  1B7H A;  1B32 A;  4PF6 A;  3D4C A;  4X8R A;  5KDT A;  4N4U A;  5K2Y A;  1M5F A;  1SBP A;  3KEI A;  4R6K A;  4HW8 A;  3DP4 A;  2R6G E;  1M5B A;  3T9X B;  1EYI A;  1LBW A;  4H45 A;  2WYP A;  3EHS A;  3BKI B;  1JQF A;  1DOT A;  1RDX A;  2RC9 A;  1B51 A;  3SER A;  1MM6 A;  3GXA A;  4MNP A;  3GBA A;  3IK6 B;  4RXL A;  2F36 A;  3QK6 A;  2PCR A;  3IOR A;  4OTE A;  3ROJ A;  1FBE A;  4FE8 A;  1J1N A;  2Q2A A;  3OEL A;  5I59 A;  4P47 A;  3EQ1 A;  1BP5 A;  4GBV A;  1PB7 A;  3K1M A;  3JZJ A;  5L8D A;  1F9B A;  5I58 A;  2RKM A;  4GWY A;  3TDJ A;  4XIG Q;  3PUV E;  4MEV A;  1D4N A;  4U22 A;  3N6U A;  4ESW A;  3UA8 A;  1OVB A;  3IJO B;  3LUZ A;  3N5L A;  4M1V A;  3ZS6 A;  2X7Q A;  1AWB A;  1USY H;  1B5J A;  3M3F A;  4RPN A;  3IR1 A;  3CIJ A;  2XXU A;  2B3F A;  3UOR A;  2Y5L A;  1K9Z A;  4Z0I A;  5M2V A;  2ALU A;  1DK4 A;  4QHQ A;  2GQ1 A;  3TTN A;  4ECF A;  1NFT A;  2ZYO A;  1LFI A;  4F2Q A;  4EQB A;  3TOD A;  1P99 A;  2Y84 A;  1H43 A;  1B05 A;  2DP8 A;  3H6V A;  1WOD A;  5CMB A;  1HSL A;  2OK2 A;  2H98 A;  4XKQ A;  4F1V A;  5T3J A;  1FTJ A;  1MXU A;  1POY 1;  2A5T B;  4RK9 A;  1GV8 A;  5CBS A;  4QFP A;  5LDZ A;  2CZH A;  2O51 A;  2UXA A;  1FJ6 A;  4ELQ A;  4O8M A;  5I3S A;  5TU0 A;  1NH8 A;  4IO4 A;  1AIV A;  3FVK A;  1UTH B;  4I9D A;  1H45 A;  2HFB A;  2HAV A;  4Q8R A;  4QSC A;  4OAN A;  3S2V A;  4WED A;  2A5S A;  3VDF A;  2O7I A;  3OEK A;  4MMP A;  4LQ5 A;  4JSO A;  2O7U A;  4MAG A;  4DLD A;  3PPR A;  4PGP A;  1USY E;  2ONS A;  2DSF A;  3TEP A;  4G8M A;  2XD2 A;  1MY4 A;  2DXY A;  2DWJ A;  5JK4 A;  2DVZ A;  4LN5 A;  3B50 A;  3O97 A;  3LSF B;  1LB9 A;  2HPG A;  3UK4 A;  5A5L A;  4IO2 A;  1LAH E;  5J1D A;  1LFG A;  3KN3 A;  3JV9 A;  4JVD A;  4ONY A;  1QKB A;  1IZ1 A;  2V3T A;  1YCJ A;  3KG2 A;  4ZEC A;  4QSE A;  2FVZ A;  2QPQ A;  1FPI A;  1PBP A;  1N7X A;  4ZED A;  4Q5T A;  3O28 A;  4PFB A;  4TOZ A;  5DVI A;  3RY3 A;  2CZL A;  4G8N A;  2O1M A;  4DE8 A;  5JEI A;  1FBD A;  1P1U A;  2O6A A;  3ILU B;  2QMX A;  3RTF B;  2HZK A;  4O7M A;  1MQJ A;  2AL5 A;  3V83 A;  3ZKK A;  2REG A;  4I40 A;  3VFJ A;  1Y9U A;  2ZYK A;  1NV1 A;  2VHA A;  3TUS A;  4YKP A;  3G3I A;  4O3A A;  4NF6 A;  3QMF A;  4FEC A;  3I6V A;  1FQC A;  5IAI A;  4OVQ A;  2PX1 A;  3VXB A;  1PC3 A;  3W9V A;  4PFW A;  1DBZ A;  4OVJ A;  1JW4 A;  3Q29 A;  1R9L A;  3FXR A;  1ZBM A;  4FED A;  5EQ7 A;  1XVY A;  4ZS9 A;  4U4X A;  3RN8 A;  4JWO A;  4NQ8 A;  3TEL A;  2VOZ A;  4RA1 A;  3S9L C;  3FVG A;  3BFT A;  1II5 A;  4JVI A;  2F3B A;  4HXV A;  1MQD A;  4QBA A;  2XXH A;  4R6Y A;  2I49 A;  4BLA A;  2F8D A;  5ET6 A;  2FNC A;  3TYH A;  3E13 X;  3U92 A;  4IO3 A;  1VFD A;  3OSR A;  3LBS A;  4YB6 A;  1IIW A;  4HCY A;  1SYI A;  2Z23 A;  5TPA A;  4RK2 A;  1IMA A;  5L9O A;  4GL8 A;  2PVU A;  2I48 A;  3VVF A;  4NAP A;  1G0I A;  4N07 A;  3KC0 A;  3H6W A;  2FYI A;  4G61 A;  1TFD A;  4BDQ A;  4LON B;  3MST A;  1FPK A;  3MUQ A;  1I6A A;  5B7D A;  2F6G A;  2Q2C A;  5B70 A;  2P3V A;  5I2N A;  3CI8 A;  2NWJ A;  4X9T A;  3IAZ A;  5CMM A;  2XXX A;  5I57 B;  3RT6 B;  3PUY E;  2DS9 A;  4EQ7 A;  3KOS A;  4QXD A;  1MH3 A;  1TXF A;  2QVR A;  4QFL A;  3LC8 A;  3LUY A;  2HXR A;  2RF1 A;  4F31 B;  4AS4 A;  4UAC A;  3KJ7 A;  4E0W A;  1FPF A;  5AA1 A;  4JDF A;  3OO6 A;  4GL0 A;  3TCH A;  3HST A;  2H9B A;  4IO7 A;  3H3G A;  1MY2 A;  1IMD A;  1N0T A;  2XD3 A;  2KR0 A;  1B3L A;  3Q28 A;  1RYX A;  4GVO A;  4F3G A;  2QS1 A;  4MNI A;  1I6Q A;  2ZZX A;  3M8U A;  5I7I A;  2DWA A;  4P1L A;  2XWO A;  3CVG A;  2CMO A;  4OHN A;  5JTY B;  5AA4 B;  2NUV A;  3FAT A;  2P1S A;  3H06 B;  5DT6 A;  2MKZ A;  3HFU A;  4LVQ A;  4PE3 A;  2VGQ A;  3E4R A;  1FQE A;  1MQH A;  3DLN A;  4I3E A;  5FHO A;  2H5Y A;  5AA2 B;  2PBW A;  4BDO A;  2Q74 A;  1B5I A;  2NVU B;  3IOW A;  1MY0 A;  4GFR A;  1QVS A;  1LAG E;  5EQ9 A;  2UVG A;  1FPD A;  3C34 A;  3LSL A;  5EYG A;  4OVP A;  3V5A A;  4LQ2 A;  5KCJ A;  1NUZ A;  1Y3N A;  2D5W A;  1US4 A;  3R26 A;  3USD A;  1RDZ A;  1FPB A;  1XI6 A;  2E0S A;  4NED A;  3O6G A;  4R72 A;  1OQG A;  3SEY A;  4PGN A;  5A5X A;  4H1X A;  2YLN A;  5EQA A;  2XXK A;  3GBB A;  1LBY A;  5L9M A;  3TMG A;  4FEB A;  3KOT A;  1EYJ A;  2DWH A;  2PT2 A;  2WYK A;  5CC2 A;  1TFA A;  1B5H A;  2WEF A;  1N3X A;  3C9H A;  3K6U A;  1N7W A;  3EN3 A;  3RYD A;  3K00 A;  3LSX A;  3IO4 A;  1N3W A;  4R9F A;  1A40 A;  4MJO A;  1JW1 A;  4Q0C A;  2CZK A;  3FJG A;  4GXS B;  4EF2 A;  1D9V A;  1FTO A;  3SET A;  3C35 A;  3F11 A;  3B6T A;  2H99 A;  1IMF A;  5ET7 A;  2ZYN A;  4EQ9 A;  4TLM B;  3G3G A;  1FTL A;  3WAE A;  4GD5 A;  4QF9 A;  4N6K A;  1FTM A;  1OVT A;  2QS2 A;  2CZI A;  4ZEI A;  4F19 A;  3I3V A;  4XKP A;  4NF4 B;  3R6U A;  5DEX B;  4OES A;  1FQA A;  4IY5 A;  4IGT A;  1MPB A;  5FHM A;  3S9E A;  1UIV A;  5ESY A;  2QFL A;  1FBG A;  5CMK A;  4OEN A;  4BDM A;  4HS7 A;  2OJT A;  3MP1 A;  3MZ9 A;  4GLI A;  4DXC A;  2V93 A;  1JEV A;  2B3B A;  2Q9T A;  3U8Q A;  3OEN A;  3VLW A;  2F6P A;  2XXR A;  3MP8 A;  3Q26 A;  3H6T A;  5ET5 A;  3TTR A;  3PPO A;  2Z8E A;  4JSD A;  4HE1 A;  4G4P A;  1MG1 A;  4FOR A;  3I5O A;  4H65 A;  2RCA A;  3BIH A;  4H5G A;  4DZ1 A;  4F3B A;  3O9P A;  1UTB A;  3MAM A;  4GWO A;  2GRV A;  1O7T A;  3EHT A;  1NV0 A;  3S9M C;  1NV4 A;  4YU0 A;  4TQU Q;  2XXY A;  3ZSF A;  3FJM A;  5HM4 B;  2QL3 A;  2RCB A;  1Y4T A;  4YZZ A;  3UN6 A;  2I4B A;  3RGY A;  3IB0 A;  4QFK A;  4AS5 A;  3NOH A;  1B0H A;  1Y3Q A;  3CR9 A;  2QVU A;  4LP2 B;  5F7V A;  2I0C A;  4POX A;  1FBC A;  2VP1 A;  4XEQ A;  1KA1 A;  5TP9 B;  3OD7 A;  2NOO A;  4BDL A;  4H67 A;  3C36 A;  1SW5 A;  2RIN A;  3KBZ A;  1XOC A;  4N13 A;  1UIU A;  5H8N B;  1JVY A;  4PTK A;  2UYE A;  1PBQ A;  4FAJ A;  1NV3 A;  1Y4C A;  3PMX A;  4ZZA A;  5EHM A;  1IXI A;  3A29 A;  4MLQ A;  3W9W A;  1NV6 A;  4LA9 A;  2UVJ A;  1QGX A;  1OLC A;  3T9V A;  4OA4 A;  5I2K A;  4XKR A;  5H8Q B;  4C1T A;  2GHA A;  4UA8 A;  5ITP A;  1Q9D A;  4OQO A;  1MY3 A;  5IKB A;  5I56 A;  4X1B A;  4H8I A;  3T0J A;  3K01 A;  1EYK A;  3HCQ A;  3MBP A;  5ELV A;  2F5X A;  2Y7I A;  2ZNS A;  4NN3 A;  4F3S A;  1H44 A;  3FVO A;  4EF1 A;  2GHB A;  2O1L A;  5H8H B;  2THI A;  4G68 A;  3CFX A;  1FQB A;  1MS7 A;  1LGB C;  1AL3 A;  3GLB A;  1B4Z A;  3U65 A;  3OO8 A;  1XHY A;  4FBP A;  4U21 A;  3H7M A;  3QAX A;  1BK4 A;  2X7P A;  4PET A;  1ZKB A;  5DVJ A;  3O6I A;  4R6H A;  4EXL A;  5CI5 A;  3IOT A;  1DTG A;  4OYV A;  3KN7 A;  3N94 A;  3FJ7 A;  1FBP A;  2ZNU A;  3T9H B;  2DQV A;  2XWV A;  2FIX A;  2B4L A;  3IX1 A;  3FV2 A;  1SDX A;  5H8S A;  4LZ5 A;  4MCO A;  3E79 A;  3E9X A;  4HE2 A;  3QIM A;  1IMB A;  5BUU A;  1OQH A;  1URD A;  3FBP A;  2F3D A;  1YTV A;  1MPC A;  2IEE A;  3ONM A;  1LBV A;  4IR8 A;  3TCG A;  1LST A;  3MZ1 A;  4F1U A;  2AL4 A;  4F39 A;  4NF8 A;  3P7I A;  3OXN A;  3RTW B;  2ZZW A;  2QSX A;  3ODB A;  1RKM A;  3N26 A;  2NXO A;  1LCF A;  4JBZ A;  2VD2 A;  4GWS A;  1GVC A;  3H03 A;  1IUD A;  1R9Q A;  5ICQ A;  4OEU A;  1DSN A;  4RNS A;  1O64 A;  1FRP A;  4NF5 A;  2F7C A;  4NHB A;  3FXU A;  3PUX E;  4QFO A;  3PV0 E;  3B6W A;  3C4M A;  1FTA A;  1IIT A;  1MH4 A;  4PE5 B;  4KD5 A;  1FPE A;  4G68 C;  3MPL A;  3MVZ A;  3RQT A;  3PMV A;  2FA7 A;  2OWS A;  2P0S A;  4YKI A;  2LAO A;  3OOA A;  2L5V A;  4R73 A;  4AB6 A;  5KDT B;  1SYH A;  2UVI A;  1MXZ A;  1FBH A;  3TQW A;  2XWI A;  1B58 A;  1EZ9 A;  2DDK A;  5FTH A;  2ZNT A;  2V25 A;  2DYX A;  2CEX A;  3KGC A;  2HCA A;  4JB7 A;  4NX1 A;  4PBQ A;  1NNK A;  5DEX A;  4NGU A;  1B1H A;  3MWB A;  4I62 A;  5I59 B;  1BTJ A;  4R75 A;  4WXJ A;  3KSX A;  3SEW A;  4PQJ A;  4P3L A;  1FBF A;  1QUJ A;  1Z7M E;  2KQZ A;  3KBR A;  3SEV A;  1H3D A;  2Y7R A;  4IB2 A;  4MIJ A;  1ELJ A;  1MDQ A;  3RPW A;  2HXW A;  1DMB A;  2I58 A;  3EHU A;  4GX3 A;  4C1U A;  2G29 A;  1B7Z A;  4KPT A;  3QUJ A;  3U94 A;  1B52 A;  3DP8 A;  4KYE A;  5KZT A;  3IO6 A;  1YZ0 A;  2I6E A;  4U2R A;  4N17 A;  4N15 A;  3R7X A;  1KWH A;  3PPN A;  3RUM A;  1LEV A;  2QS3 A;  2HAU A;  3MW0 A;  5F24 A;  2XXT A;  5K2X A;  3DM0 A;  4N6D A;  2G93 A;  4OER A;  4ISU A;  3W15 C;  2P2A A;  1UQW A;  1JVX A;  1NI9 A;  2PYY A;  3A09 A;  3TCF A;  2HHM A;  3HHF A;  4MHF A;  4MH5 A;  3THI A;  3D1R A;  4N81 A;  3RPL B;  1B3H A;  3GZG A;  4IO6 A;  4ZEF A;  2Z22 A;  1A7L A;  2CEY A;  3QYT A;  5FHN A;  1MM7 A;  3WAF A;  3OO7 A;  4O94 A;  4U4S A;  4GX6 A;  1FJ9 A;  4N91 A;  2HEU A;  2OWT A;  1OLA A;  5EYF A;  4ZE9 A;  4KXP A;  1FCK A;  1MXV A;  3C32 A;  1FPL A;  1ZMG A;  3PU5 A;  1Z7N E;  3MZB A;  3BFU A;  1XC1 A;  4YKK A;  4GX4 A;  4KYS A;  3UGW A;  4QFN A;  3L6H A;  4PC9 A;  4MLV A;  3FV1 A;  4MF3 A;  4NMY A;  4GQO A;  2A5T A;  1QUL A;  1A8F A;  3CG1 A;  4KQP A;  3TQL A;  1NUY A;  1HSJ A;  5FTI A;  4H6D A;  2Y5K A;  4ZE8 A;  1UTH A;  5H8F B;  2R71 A;  4H5F A;  2R9J A;  1LAX A;  3K02 A;  3G3F A;  5CRY A;  3TTM A;  3Q27 A;  4R74 A;  2QVV A;  1DCU A;  5H8H A;  1LB8 A;  1M5C A;  1B1X A;  1SI1 A;  2I3V A;  4GOT A;  3U93 A;  5BWJ A;  5IZ1 A;  1LBZ A;  4ZEK A;  3G3J A;  1CE2 A;  3O6H A;  4F18 A;  2V84 A;  2KLF A;  1FQF A;  1N04 A;  1B40 A;  4P8B A;  1AH5 A;  1SQY A;  4F1Y A;  4DXB A;  1MXW A;  4P56 A;  1JP4 A;  1JW5 A;  3KZG A;  2ABH A;  2VT5 A;  2XHD A;  3KJT A;  2QJE A;  2PFY A;  4GWX A;  3MVY A;  3VVD A;  5I84 A;  1K9Y A;  5CBR A;  3H4Z A;  1GGG A;  2UYF A;  4DDD A;  3LSW A;  5EQ8 A;  1M5D A;  4Q30 B;  2WX9 A;  3A3U A;  4PAI A;  4M4G A;  1IMC A;  4NF6 B;  4OET A;  4PP0 A;  3E3K A;  4F2O A;  4GWZ A;  3HN0 A;  3IFC A;  4XTC Q;  3EPE A;  1B6H A;  4R2B A;  3VXC A;  1VE4 A;  3GYY A;  1O63 A;  3EF7 A;  1URS A;  4GXA A;  4XXU A;  2Y7W A;  4RPO A;  3FVN A;  1KA0 A;  1FPG A;  1CNQ A;  2V3U A;  3FD3 A;  1M5E A;  3D4G A;  1YPN A;  4DCX A;  4N8G A;  3K6X A;  4U23 A;  3MYU A;  1VDW A;  2DOJ A;  1WVJ A;  1P1N A;  3OMB A;  2I0B A;  3ISP A;  4MFI A;  5DW8 A;  2W7Y A;  2ZXT A;  3PUW E;  2VD3 A;  1B2H A;  5TPA B;  3RNN A;  3TFL A;  3MC2 A;  4U1Z A;  1R1N A;  3B6Q A;  3U1O A;  3CFL A;  3E78 A;  3SEX A;  1OIB A;  3N6T A;  4RJZ A;  5F1Q A;  1QW0 A;  1XT8 A;  3EKI A;  2IA4 A;  3UIF A;  2Q88 A;  4KR5 A;  1JEU A;  5ICT A;  3T96 B;  3CSB A;  4P11 A;  3LR1 A;  2OWZ A;  1BIY A;  5I2N B;  4MNC A;  5IGA A;  1NH7 A;  3CG3 A;  3ECR A;  1ATG A;  1N76 A;  3TKD A;  5AE4 A;  4P9K A;  4P1E A;  2O84 X;  2DE3 A;  3FUZ A;  3U72 A;  4YIC A;  4OFL A;  3FGS A;  2XX7 A;  3H6U A;  4FIM A;  2BJJ X;  1N84 A;  1ANF A;  4NF0 A;  4X1D A;  2ZYM A;  4IGR A;  4PFI A;  1VFE A;  3IB1 A;  3MVW A;  4C0R A;  2WKY A;  4HE0 A;  2YJP A;  4I3Y A;  4DCY A;  4X48 A;  4UAB A;  2OBG A;  3PTY A;  1R6Z A;  2UVH A;  3ILT B;  3KN8 A;  2AIX A;  1YXI A;  5I57 A;  1B3G A;  4EXK A;  3SDF A;  5I5P A;  1A8E A;  4YAH X;  2GH9 A;  4GF8 A;  4YB5 A;  3T93 B;  4O7I A;  1SVX B;  1B0L A;  3JYR A;  3MVX A;  5IZ3 B;  1B3F A;  2OZZ A;  4H0W A;  3MP6 A;  3RPL A;  3VV5 A;  1H76 A;  3RLF E;  2DE4 A;  4F22 A;  1D9Y A;  2F35 A;  4PBH A;  1S50 A;  1NNP A;  1IXH A;  5J16 A;  3A3C A;  2WBB A;  5DYH A;  4Z7E A;  3TZA A;  2Z8F A;  3K6V A;  4HCW A;  1FW0 A;  5AA4 A;  5JTY A;  1LLS A;  3T1B A;  2QRY A;  5KCJ B;  5AA3 A;  2Q89 A;  4NG7 A;  4DI4 B;  2OX3 A;  4OVT A;  1FPJ A;  2WBD A;  1ZU0 A;  2F7B A;  1Y1Z A;  3T22 A;  5A5X B;  4KI0 E;  5AA2 A;  4MX6 A;  3VLV A;  1WDN A;  4KCD A;  3T66 A;  4AB5 A;  1BLF A;  3K0V A;  3PPP A;  3O2A A;  4NTL A;  2B65 A;  5H8F A;  4ESX A;  3FIR A;  4KCC A;  4XF5 A;  4ND9 A;  4WKM A;  3HV1 A; 
#chains in the Genus database with same CATH homology
 4OVR A;  5ET8 A;  4MEV A;  1EYJ A;  4GWW A;  3LV0 A;  1YZ0 A;  2WYK A;  4N17 A;  4N15 A;  3LUZ A;  2WEF A;  1LEV A;  4M1V A;  5F24 A;  3RYD A;  1AWB A;  2JJK A;  4N6D A;  2P3N A;  4MJO A;  2Y5L A;  2CZK A;  1NI9 A;  1K9Z A;  2HHM A;  4MHF A;  1DK4 A;  3D1R A;  4N81 A;  3RPL B;  5CM6 A;  2GQ1 A;  2CEY A;  4PAK A;  4PDD A;  4N8Y A;  1IMF A;  5ET7 A;  4O94 A;  1YYZ A;  4GX6 A;  1FJ9 A;  4N91 A;  2V4C A;  4N6K A;  4F1V A;  5T3J A;  2CZI A;  1LBX A;  4KXP A;  4F19 A;  1FSA A;  5IZZ A;  1FPL A;  5LDZ A;  2CZH A;  5LTC A;  1FJ6 A;  4O8M A;  4GX4 A;  5I3S A;  4PC9 A;  5ESY A;  2QFL A;  1FBG A;  2XWK A;  2VPO A;  3KC1 A;  4PFR A;  4OAN A;  3B8B A;  1NUY A;  2Q9T A;  4MMP A;  2Y5K A;  4MAG A;  5ET5 A;  2FIE A;  4PGP A;  2QVV A;  1DCU A;  2V3Q A;  4HE1 A;  2FHY A;  2PFZ A;  1IME A;  3FXB A;  3BIH A;  5JK4 A;  2DVZ A;  4LN5 A;  3B50 A;  4PF8 A;  5IZ1 A;  1LBZ A;  2HPG A;  5A5L A;  4F18 A;  5J1D A;  1NUW A;  4JVD A;  1NV0 A;  1NV4 A;  4XFE A;  4P8B A;  4PDH A;  4P56 A;  4YZZ A;  1JP4 A;  2VT5 A;  2FVZ A;  2QPQ A;  1FPI A;  2PFY A;  4AS5 A;  3NOH A;  2QVU A;  4PFB A;  4GWX A;  3SZP A;  4OVS A;  1K9Y A;  1FBC A;  3IFA A;  4XEQ A;  1NV7 A;  1KA1 A;  1NV2 A;  1FBD A;  3KBZ A;  5EQ8 A;  4PTK A;  2WX9 A;  4PAI A;  1IMC A;  1NV3 A;  4GWZ A;  2HZK A;  4O7M A;  5IM2 A;  3A29 A;  3W9W A;  1NV6 A;  1NV5 A;  2R8T A;  3IFC A;  1QGX A;  1D9Q A;  1KZ8 A;  3CHG A;  4I40 A;  4OA4 A;  1NV1 A;  3GYY A;  3QMF A;  1Q9D A;  4DI3 D;  3T0J A;  4OVQ A;  1EYK A;  1KA0 A;  1FPG A;  1CNQ A;  2F5X A;  4NN3 A;  3W9V A;  1DBZ A;  2VPN A;  2HZL A;  4N8G A;  5EQ7 A;  3MYU A;  1VDW A;  5FBP A;  3U65 A;  2B4M A;  5IZ3 A;  4NQ8 A;  1NUX A;  4FBP A;  1BK4 A;  3ISP A;  4PET A;  5DW8 A;  2XA5 A;  4JVI A;  2F3B A;  4HXV A;  1SPI A;  4QBA A;  1FBP A;  3E78 A;  5ET6 A;  1G0H A;  2XWV A;  2FIX A;  2B4L A;  4X04 A;  5EYH A;  3EKI A;  4HCY A;  4MCO A;  3E79 A;  1IMA A;  4HE2 A;  1IMB A;  2OWZ A;  4PCD A;  4NAP A;  1G0I A;  4MNC A;  3FBP A;  5IGA A;  2F3D A;  3KC0 A;  4G61 A;  4P9K A;  1LBV A;  4P1E A;  3MST A;  4IR8 A;  1FPK A;  4GBW A;  2DE3 A;  4F1U A;  4YIC A;  2ZZW A;  2P3V A;  4X9T A;  4NF0 A;  4PFI A;  4GWS A;  4HE0 A;  4QXD A;  1INP A;  4I3Y A;  2QVR A;  4UAB A;  2HXR A;  3PTY A;  1FRP A;  4AS4 A;  4NHB A;  1YXI A;  1FPF A;  5I5P A;  2BJI A;  1FTA A;  2FBP A;  4O7I A;  1IMD A;  2KR0 A;  1RDY A;  1FPE A;  4GWU A;  4MNI A;  5IZ3 B;  2ZZX A;  5I7I A;  4P1L A;  3RPL A;  2XWO A;  2DE4 A;  4PAF A;  2L5V A;  4PBH A;  3BIG A;  2Q8M A;  4H46 A;  1FBH A;  5J16 A;  2MKZ A;  2XWI A;  2ZZV A;  3HFU A;  2WBB A;  4PE3 A;  2DDK A;  4HCW A;  4I3E A;  4JVC A;  2DE2 A;  2CEX A;  3T1B A;  4PF6 A;  4X8R A;  4NX1 A;  4N4U A;  2Q74 A;  4PBQ A;  4NG7 A;  4DI4 B;  2OX3 A;  4OVT A;  4NGU A;  1FPJ A;  5EQ9 A;  2WBD A;  1EYI A;  1FPD A;  1LBW A;  4H45 A;  2WYP A;  1LBY A;  5EYG A;  1RDX A;  4OVP A;  4MX6 A;  1NUZ A;  4P3L A;  1FBF A;  4MNP A;  2PCR A;  2KQZ A;  3ROJ A;  1RDZ A;  1FBE A;  1FPB A;  1XI6 A;  4P47 A;  4MIJ A;  4XF5 A;  4GBV A;  4PGN A;  5EQA A;  2XXK A;  4GX3 A;  4GWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...