4P8BA

Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
b'YKSEYKMSLVLGPAFPWGKGGEIWADLVKQRTNGRINIKLYPGTSLVAGDQTREFSAIRQGVIDMAVGSTINWSPQVRELNLFSLPFLMPDYKALDALTQGEVGKSIFATLEKAGVVPLAWGENGFREVSNSKREIRKPEDLKGMKLRVVGSPLYIETFNALGANPTQMSWADAQPAMASGAVDGQENPQSVFAAAKLYTVGQKFVTTWGYVADPLIFVVNKQIWESWTPADREIVKQAAVDAGKQEIALARKGLAEPGAPAWKDMEAHGVKVTHLTPAEHDAFRKATAKVYDKWKKQIGTDLVTKAEGAIAKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP-type transporter, periplasmic component
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Cupriavidus necator
molecule tags Transport protein
total genus 106
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4p8bA00
4YZZA 2VPNA 2XWKA 4OVQA 5I7IA 4NG7A 4NHBA 4OANA 2WYPA 2HZLA 4DI4B 2CEYA 2PFYA 4P1EA 4PBQA 5IZZA 4O8MA 4YICA 4X8RA 4LN5A 4P8BA 2XXKA 2CEXA 4PF6A 2XWIA 4PETA 4PF8A 4P56A 4X04A 4N8GA 4OVSA 4MCOA 2PFZA 2XWVA 4XFEA 4MIJA 5I5PA 4N91A 3GYYA 4UABA 4NQ8A 4PBHA 2XA5A 4XEQA 4N6KA 4MHFA 4MNPA 4O94A 4PAFA 4PGPA 4XF5A 4N15A 4NF0A 4PFBA 4OVTA 4N4UA 2ZZXA 4OVRA 2VPOA 4NN3A 2V4CA 4MMPA 2WYKA 5CM6A 5IM2A 4NGUA 4NX1A 3FXBA 4MEVA 4N8YA 5LTCA 2HZKA 3U65A 2XWOA 4PFIA 4OVPA 4P47A 4PAKA 4PAIA 4P1LA 3B50A 4N17A 4P9KA 4PDDA 4PDHA 4PFRA 4MNIA 4MAGA 4NAPA 2WX9A 4MX6A 2ZZVA 4PC9A 4MNCA 4PGNA 4O7MA 4PE3A 4DI3D 4P3LA 2HPGA 2ZZWA 4PCDA 5IGAA 4N6DA 4OA4A
chains in the Genus database with same CATH superfamily
1B1HA 4OVQA 2O51A 2NXOA 4NG7A 1B2HA 2JJKA 1G0IA 1XI6A 3H6TA 1PC3A 1EZPA 3SZPA 3N5LA 4XXUA 4YMAA 3K0VA 1NV4A 3KN7A 1NUYA 4GL8A 3M3KA 3PPRA 2VHAA 2PYYA 5ET8A 1Y20A 1Y1MA 4N91A 3IAZA 4BDLA 3I3VA 4GXAA 2ABHA 2XXPA 1FTLA 3OELA 1M5DA 4OTEA 1EYIA 4GXSB 4OZ9A 2Y7IA 3PUXE 4KXPA 4PFBA 5FBPA 4HS7A 4H0WA 5IZ3B 1B3FA 1ZKBA 2UYFA 5KDTA 4FEDA 2HHMA 2OZZA 4HCWA 2VD2A 4NF4A 4RK9A 2QMXA 1B0LA 3G3IA 1QW0A 5I56A 3QK6A 3O66A 2HAUA 3UP9A 5FTIA 3RYDA 1GVCA 4HXVA 3MYUA 3RPLB 1CNQA 2D3IA 4NEDA 3TQWA 3KJTA 2ZYOA 2CZHA 2CZKA 1EZOA 2OK2A 3ZSFA 4RK2A 5KCJA 1FPLA 2QVRA 4QRZA 3K2DA 3K6VA 2GHBA 4GWOA 5FHNA 3H6VA 3MUQA 3KFMA 1PDAA 1ZMGA 4P1EA 2QS1A 3D4GA 3O6IA 3EF7A 4O8MA 3ROJA 2RKMA 1D9QA 1GGGA 4ECFA 4MH5A 3RTWB 2OLBA 4ZZAA 1DK4A 3O6HA 3CFZA 1LFGA 1R6ZA 1MY2A 4NTLA 3TTMA 3MZ9A 2IEEA 5TP9A 4PBHA 3S4UA 1SQYA 2Q74A 4F39A 2ZYKA 4F22A 4X48A 1NH8A 5JEIA 2XXRA 1VDWA 1SPIA 1ZTYA 3EN3A 3B6WA 1M5CA 3H03A 3H06B 4NGUA 4QBAA 3KJ7A 5JTYA 1MPBA 4BDOA 1VFDA 3KG2A 1FTOA 5CMKA 3UK4A 3MVWA 4JVDA 4IGTA 4P1LA 1USYE 4LZ8A 1P1OA 1USYH 3ILTB 1MPCA 4RXLA 2DE2A 3RNNA 3N6UA 4ND9A 3PUZE 4P3LA 4YB7A 3FVNA 5IGAA 3IFCA 3MVXA 4N6PA 3DELB 3U92A 4PFTA 2O6AA 3T22A 3FZVA 5I3SA 4NF5B 4JWYA 4OQOA 3A09A 2FYIA 3CFLA 3FJ7A 4U1ZA 1BIYA 1VE4A 3LBSA 1YPNA 4X9TA 2GH9A 4ISUA 4NF4B 5DVFA 1XHYA 4MCOA 3A3UA 5I56B 4IO5A 2F78A 5H8FA 4KFQA 1FPDA 5F7VA 1NV2A 4Q30B 1BKAA 5DTBA 2DXRA 2YLNA 4ZEFA 1JQFA 3JYRA 1NV7A 1JP4A 3H6WA 2GHAA 1FPFA 4PE5B 1PBPA 1IQ7A 1EYKA 2B3BA 4RA1A 1LGBC 3PV0E 1MY3A 4XKPA 2VPOA 1S7YA 4YU0A 1MH4A 3D1RA 3MC2A 2KQZA 3L6HA 5KCJB 3QXMA 1Q1KA 3CG3A 3PPQA 1LBVA 4PFIA 4P47A 1O63A 3IJXB 3MPKA 2QPQA 3IO4A 1M5EA 1IXGA 1N7WA 1SI0A 3TCFA 5KZTA 3TTRA 1LBYA 3TCHA 5L9OA 2HEUA 4Z0IA 2Z22A 5I2NA 2HPGA 1FQAA 5TP9B 1NMUA 2I3WA 3VVDA 2CZIA 4NF8A 5A5XA 1DTZA 4YZZA 4MFIA 5I7IA 4IR8A 2HZLA 1LCTA 3G3FA 4AS4A 5FHMA 1MS7A 4DI4B 3F11A 4QFOA 4EXLA 4HW8A 1HSLA 5TU0A 2O84X 5K2YA 5JTYB 2PX1A 3ZKLA 4LVQA 3PPOA 3M3LA 4X04A 1II5A 2VD3A 1POY1 1B40A 3G3JA 4ZECA 3GYYA 1KA1A 3FBPA 4GWYA 2XXVA 4MF3A 2V25A 3UORA 3RLFE 4HE2A 4C0RA 4MHFA 3G7WA 1Z7ME 2OBGA 1WVJA 1Y3QA 5ICQA 3FJMA 1S9TA 2I4CA 5J1DA 4GWWA 4LQ5A 3PMXA 2V3TA 4MJOA 5CBSA 1RDZA 3PUYE 2FBPA 3O2AA 3FV1A 5LOMA 4Q5TA 4YKPA 2R9JA 2CMOA 3LV0A 4ZZEA 3U1OA 2F7BA 4M4GA 1MDP1 2DWHA 3R7XA 4GBWA 4NMYA 4MX6A 3MZBA 3SEUA 5H8FB 4O3AA 3TKDA 4N07A 1LBBA 2DYXA 4N6DA 1MXYA 1OLCA 2Q2AA 3LC8A 4PFYA 4H8IA 1B4ZA 1YXIA 4BDQA 2E0SA 4ESXA 3S9EA 2L5VA 2REGA 1FTJA 4XKRA 1PB9A 3EPEA 4U21A 3V83A 4EXKA 1S50A 2ZXTA 1B5IA 4QFNA 4GX4A 1H76A 3IL1B 5H8HA 1OIBA 1LAGE 2ONRA 1IMEA 2CEXA 2XXKA 3G3HA 4KHZE 2UYEA 4N8GA 2YJPA 5IZ3A 1A7LA 3G3GA 5AA4B 3PTYA 4DLDA 1MM6A 2DP8A 1LB9A 4ESWA 5ET7A 3E3KA 3E9XA 3IJOB 4THIA 1A8EA 1OMPA 3FIRA 4OVTA 1LCFA 5I2NB 2HCAA 2F6PA 2DSFA 3ILUB 4X1BA 3HV1A 4NF8B 2AIXA 4ZS9A 4IY6A 4H67A 1EU8A 5FTHA 3R26A 4WEPA 1LBWA 2XHDA 5ITPA 2O68A 1HSEA 4H65A 4OXVA 3I6VA 3O97A 4P9KA 3IX1A 4KCDA 1BP5A 1B7HA 4MNIA 3PD8A 2RC7A 3O9PA 2F3BA 2XD3A 1URSA 1NNPA 1KZ8A 2ZZWA 2F7AA 1QGXA 1SBPA 4PCDA 3FV2A 2O69A 5DT6A 1FQDA 3O29A 4ZEKA 4ELRA 2XXTA 4H1XA 2UVHA 3HO7A 1MQJA 4PFWA 1IXCA 3U8QA 4XKQA 2ZNTA 4GWSA 1N84A 5IZZA 2FVZA 1FW0A 4OENA 4OMBA 1DBZA 1NUZA 5EYFA 3RQTA 1GTKA 4LQ2A 3MWBA 2XX9A 4ZE8A 1A55A 2E1SA 4KQPA 1FBCA 1P99A 4Q0CA 1K9ZA 3TTKA 2X7PA 4DXCA 2THIA 2DDKA 1NNFA 2QS2A 1NUXA 1VR5A 4OYVA 4GQOA 4NF6A 5L9MA 2Z8FA 4N4UA 2Q89A 3UA8A 1FBGA 1DPPA 3OD7A 3B8BA 1SW2A 3TDJA 4OVRA 4LATA 4QFKA 2REJA 1JW4A 4H5GA 4FATA 1MXVA 1LAXA 1IMAA 5AE4A 2HFBA 2DQVA 3MZ1A 3TZAA 2XXIA 3HSTA 4GWZA 3W9WA 1NV1A 1P1QA 1QVSA 5H8HB 1Q35A 5I2KA 3G3KA 4NF5A 1OQGA 1SYIA 4OETA 4BDNA 5CRYA 4F1UA 3HHFA 3E13X 5EQ7A 1G0HA 3VVEA 2ZNUA 1PEBA 2P3VA 2F7CA 2OWZA 4H46A 3TCGA 3VE1B 2PMSA 4OA4A 2KLFA 5EQ9A 3E4RA 1DMBA 2UVGA 3M8UA 4OFOA 2QS3A 1KWHA 3THIA 2QRYA 4O3CA 1NNKA 1LAFE 4KPTA 1ZU0A 4WEDA 4R75A 1R9LA 2OX3A 4YICA 1PB7A 5AA2D 3PMVA 3MQ9A 1R1NA 3EHTA 2Q2CA 3K6XA 4GD5A 4U1OA 1O7TA 4MIJA 3KC1A 5ITOA 1INPA 2XXWA 5DVJA 1SW5A 4LZ7A 2O1LA 3C4MA 4MLQA 3VLVA 4O94A 2DVCA 1SYHA 3KEIA 4I40A 3B6QA 4ONYA 4IB2A 4WXJA 5T3JA 1JVXA 1POTA 2ZZXA 4R74A 4OHNA 1YTVA 4H8JA 4RJZA 4YB5A 4RPNA 3U93A 2OWSA 1LBCA 1SW4A 3FATA 4G2ZA 2VT5A 3EQ1A 1US5A 3BBRA 3P7IA 1WODA 1FQEA 4IO2A 3Q28A 3S9NC 3S9LC 2RC9A 3UN6A 3ZS6A 1A8FA 2DE4A 2Y7PA 4NAPA 1P1UA 1B6HA 1VSOA 3ODBA 3UIFA 2ZZVA 3K6WA 1GR2A 4O7MA 4FBPA 2PT1A 4ZE9A 5EYGA 2OJTA 4OEUA 5LDZA 1FPBA 2BJIA 4KYSA 1DCUA 2QSXA 1NV0A 4H5FA 3RUMA 1Y4TA 2VPNA 2BJJX 1FCKA 5IKBA 2Q9TA 4NF6B 4F3PA 4I9DA 4GL0A 1YZ0A 2I0BA 1QUKA 5H8SA 4DIGA 2OCUA 1H45A 2AYSA 3OO9A 4G68B 4GLIA 5ELVA 4X8RA 1PB8A 2UVJA 4U4XA 1D9YA 3C9HA 3PGFA 1D4NA 2ZYNA 2I58A 3OO6A 5I5PA 5EQ8A 5I2KB 2NUVA 1WDNA 1B32A 4N13A 2PVUA 1GV8A 1BLFA 4NQ8A 2PCRA 3K6UA 4TLMB 2ESNA 4MNPA 3IOTA 4XF5A 1IMDA 3VLWA 3C33A 1LSTA 3IR1A 2LAOA 4GF8A 2DXYA 3E78A 1DOTA 2F35A 3GXAA 1FBEA 1FQBA 4PFUA 5A5LA 4H6DA 3BFTA 2P3NA 3CRBA 4MEVA 2F36A 2Y7WA 1FJ6A 3K1PA 5CC2A 2HXWA 3MP1A 3U65A 1QJMA 2RCBA 1P1NA 4R73A 1P1WA 1JEUA 3FXUA 3MP8A 4QFLA 1B3HA 4JSDA 2CZLA 1CB6A 4QSDA 5AA3A 1T0KA 3VDFA 1B1XA 4GRKA 5J16A 3HPIA 1BK4A 1Y4CA 4JWOA 4IO6A 4IO4A 4PGNA 1DSNA 5IZ1A 2WEFA 3QUFA 4E0XA 1UIUA 5EQAA 2I0CA 1URGA 1TXFA 2XD2A 2DE3A 5AA4A 4EQ9A 3LSFB 1IMCA 3TMGA 4GX6A 2P2AA 3KN3A 4FIMA 1B7UA 4PBQA 2QL3A 3TFLA 1I69A 1ELJA 1QUJA 5I58B 4I3EA 4G8NA 3RGYA 2D21A 4HE1A 4Q8RA 1MXWA 4R2BA 3MJNA 5F24A 1MQIA 4P56A 1NFTA 5CI5A 1O64A 4GOTA 4OVSA 1MM7A 3GZGA 2XXHA 1FTMA 3OEKA 5IAIA 3RPWA 3BIHA 4DXBA 3RT8A 5TPAB 3SETA 4XEQA 3Q29A 4N15A 4OWDA 3OENA 3OO7A 1US4A 3T9XB 3C35A 4KD5A 4U23A 5DYHA 4MMPA 1TFAA 5I57B 2IA4A 1MY1A 1YCJA 4POXA 1XOCA 5HBCA 2DVZA 4JDFA 2FNCA 3RY3A 3PUVE 4OVPA 1B4HA 4OERA 3DP8A 2A5SA 1B0HA 1N76A 5CMBA 4GWXA 2XXXA 4MNCA 4KR5A 1JVYA 2F6GA 4POWA 3ECRA 4DI3D 4FJPA 4F2QA 1QULA 1B3EA 1SD3A 1FPGA 3QSLA 2V84A 2ALUA 1N04A 2WYPA 4FEBA 4G61A 2DS9A 3GLBA 3LSWA 3H6UA 4JB7A 1ZIUA 3N94A 1RDYA 2Y84A 2PFYA 3HCQA 3S9MC 5H8NB 4GBVA 3KSJA 1D9VA 5F1QA 2NOOA 3DM0A 4IO7A 3LUZA 5ESYA 2DWIA 3IOUA 4F31B 4MLVA 3QMFA 3RTFB 4XFEA 1RKMA 2H5YA 3ISPA 4XIGQ 4R6KA 2Y7RA 3O28A 3SEWA 4O7IA 3U72A 4PAFA 4QXDA 4PGPA 5ET5A 4F2OA 4IY5A 5ISUA 3OMBA 1B3LA 4C1TA 4XTCQ 3TTLA 5DW8A 3K02A 2XXQA 3HN0A 4PP0A 3PUWE 1JEVA 1A99A 2ANJA 3KC0A 1MQHA 4TQUQ 1QUIA 1AIVA 3B6TA 3IO6A 2G29A 3BFUA 4TLLB 1AOVA 2Y5KA 2F8DA 3QYTA 1UIVA 1FPEA 1LBZA 4YKIA 3CSGA 4PFRA 1MY0A 3T9UA 1KA0A 2B4MA 2F5XA 3C32A 3CR9A 3O6GA 2G93A 2DWAA 4JBZA 1OVTA 2I6EA 2GQ1A 3FJGA 1IIWA 3UGWA 4YMBA 1JETA 1JW5A 3T93B 4R2FA 1B52A 2D5WA 1XVYA 3VVFA 3TELA 1URDA 1FPIA 2UXAA 3K1MA 3PD9A 3H7MA 1M5FA 4JSOA 3W9VA 4PF6A 2I4BA 4MBPA 2O1MA 4PETA 1FPJA 1UTHA 3CI8A 2XWVA 2ZYMA 4E0WA 1FTAA 5JK4A 4BDRA 1IMBA 1B51A 4GVOA 3MPLA 1F9BA 4NF0A 2H25A 4GX3A 3ONMA 3K01A 4JWXA 3TAJA 4QF9A 4X1DA 2Y5LA 4OESA 3MBPA 1XS5A 3HHGA 1MG1A 1SI1A 4ELOA 2H99A 3CSBA 4R6YA 1B5HA 2FA7A 3V5AA 4TOZA 3N26A 4JXIA 2H4IA 3CHGA 1B7ZA 1FPKA 5FHOA 3LSLA 4G68A 5L8DA 1I6BA 3TODA 4NE4A 2V3UA 3T1BA 5ICTA 5M2VA 2W7YA 2QFLA 3GBAA 1YAEA 4YB6A 1LEVA 3VXCA 4AB6A 2H9BA 3S2VA 5CBRA 4ZDMA 5B70A 4F1YA 4EUOA 4K3FA 4I1DA 1H44A 4G8MA 3TUSA 4AS5A 4DZ1A 3USDA 2XX8A 1EYJA 1N0TA 4IO3A 1NV5A 4QSCA 5EHMA 3FVOA 3A29A 4FECA 3T96B 3PPPA 3SERA 3T66A 2XA5A 2HXRA 3Q26A 4LONB 2Z8EA 2I49A 1EH3A 5I59B 3CFXA 1FTKA 4M1VA 4EQ7A 3WAEA 1NL5A 3NOHA 5BUUA 3FD3A 4RYAA 5LTCA 1EZ9A 2QMWA 2O7IA 3EHSA 1B3GA 4AQ4A 1ATGA 2XWOA 4YKJA 4F18A 3C31A 3BIGA 4NWCA 1FSAA 5CMMA 3B7DA 2H98A 1BTJA 4GWUA 4PDHA 4YAHX 3WAFA 2R71A 4MAGA 3SESA 1UTHB 4ZEDA 1MXUA 4BLAA 5I58A 4C1UA 1OLAA 1TWYA 1DTGA 5EYHA 4EDPA 1RDXA 1IXIA 1B46A 3SEVA 1MXZA 3DP6A 4R9FA 1N3WA 2YPNA 2I3VA 4ZEBA 1NI9A 3IK6B 3FVGA 5H8QB 2ONKE 2Q88A 1AL3A 2NWJA 5TPAA 2A5TB 2Z23A 1FJ9A 4HTGA 4PQJA 2ONSA 3M3FA 3DLNA 2FHYA 4EF1A 3W15C 4G8HA 3FUZA 4UA8A 4HE0A 4OFJA 4KYDA 4KCCA 4LN5A 4R72A 3KOTA 1H43A 5HM4B 1OVBA 5AA1A 5I57A 1FBFA 1LAHE 4H45A 5DVIA 4JVIA 4P0GA 3T9VA 3OSRA 2VOZA 1I6QA 5L9SA 3VLUA 1NV3A 3AXFA 1A54A 1NUWA 3L6GA 4QFPA 4FAJA 2R8TA 4NN3A 5ET6A 4N8YA 3C36A 2HZKA 1I6AA 4AB5A 4HCYA 4GIZA 4DCXA 4PAKA 4PAIA 1OQHA 3BKIB 1IITA 3IOWA 4G77A 4FORA 4U4SA 1CE2A 4PC9A 3KBZA 5H8NA 3MW0A 1LBXA 1JNFA 3KN8A 3LR1A 1RYXA 5KDTB 3OSQA 5AA2A 1UTBA 1ZJLA 2HAVA 4NHBA 3CIJA 1AMFA 4OANA 5CMCA 3KBRA 1Y3PA 4DXUA 2CEYA 3IB1A 3TTNA 4PTKA 4O3BA 4U2RA 4F3GA 2Q8MA 2PT2A 4QHQA 4RNSA 3VV5A 4LP2B 4OFLA 5HPQA 2I48A 2XWIA 3SDFA 2PFZA 2RCAA 2ZMBA 4DDDA 2QVVA 3RN8A 2QJEA 3VXBA 1JW1A 3TPAA 2DWJA 1VFEA 3KZGA 3FXQA 2AL4A 1ANFA 1Q9DA 2GFEA 1ZLQA 4ELQA 4DCYA 1NH7A 2V4CA 3SKPA 4OEVA 2WYKA 4KYEA 5IM2A 1NNTA 1IZ1A 3QIMA 3V89B 2FIEA 2F97A 3VFJA 4IGRA 4QSEA 2X26A 2F34A 2F3DA 3PMWA 1LFHA 2VP1A 3FGSA 3DP4A 5EHSA 2WX9A 3QAXA 3Q27A 2ZNSA 1D3KA 3IB2A 4F3BA 1IMFA 4U22A 1RYOA 4LA9A 1MDQA 3H4ZA 3ZKKA 2X7QA 2Y7KA 3KOSA 4I62A 3LUYA 2XWKA 3KGCA 4I3YA 3T0JA 5B7DA 4KI0E 4I8CA 5DEXA 2QVUA 2XX7A 1PBQA 3CG1A 4OVJA 1N3XA 2B65A 4P0IA 4RY1A 1UQWA 1TT1A 1H3DA 2KR0A 1L5TA 4ELPA 3K1NA 4G68C 4L17A 3OOAA 1FQFA 1LFIA 4PF8A 1ZBMA 1XC1A 3OEMA 1Y1ZA 3C34A 4UABA 1A40A 4DE8A 1SVXB 1LB8A 3IB0A 1NV6A 1N7XA 2XXUA 3MP6A 1AH5A 3CVGA 4YKKA 1MRPA 1XT8A 3MVZA 5AA2B 3E79A 3K00A 2DOJA 3KSXA 3LSXA 1UTBB 3IOVA 4WKMA 1YYZA 4NX1A 3FXBA 5I84A 1HSJA 4GFRA 3QUJA 4XKNA 2V3QA 2NVUB 4F29A 1IXHA 3RT6B 2RF1A 1MPDA 1MQGA 1B9JA 3B50A 1FBDA 3IFAA 2Q8JA 4PDDA 3R6UA 1IUDA 3SEYA 2PBWA 2QS4A 1B58A 4LZ5A 2V93A 3IORA 3SEXA 1IEJA 2R6GE 1B5JA 1J1NA 2RC8A 3JZJA 3FASA 3MSTA 1R9QA 2WBDA 1FRPA 1LLSA 2OWTA 3I5OA 2O7UA 3A3CA 2FIXA 2VGQA 2GRVA 2P0SA 3FVKA 4EQBA 4EF2A 5BWJA 5I59A 2P1SA 4UACA 4N81A 4P8BA 3PU5A 4LUBA 1Z7NE 1MXXA 4P11A 3N6TA 4G4PA 4Z7EA 3FXRA 2HQ0A 5A5XB 3D4CA 2B3FA 3RPLA 4FE8A 2MKZA 3TYHA 2XXYA 4R6HA 1FBPA 4N6KA 3U94A 4ZEIA 1XVXA 3HFUA 3GBBA 4F3SA 3PPNA 4RPOA 1SW1A 1NKXA 1FQCA 3MAMA 2UVIA 1MQDA 2Z8DA 3MVYA 5CM6A 3Q25A 3TQLA 1M5BA 5DEXB 3OXNA 1FBHA 1Y3NA 4BDMA 2WKYA 1B05A 3T9HB 2WBBA 4N17A 1MY4A 5H8QA 3TEPA 3V8XB 3JV9A 1K9YA 2A5TA 4NWDA 1QKBA 3OO8A 3EHUA 3EKIA 3K4UA 2RINA 1MH3A 1QKAA 3H3GA 1DPEA 4PE3A 2M8CA 4F19A 4F1VA 1SDXA 1TFDA 2B4LA 4JVCA 1AWBA 4R9GA 2AL5A 5K2XA 1Y9UA
chains in the Genus database with same CATH topology
4OVQA 1NI9A 2DE3A 4NG7A 2JJKA 1G0IA 1YXIA 1IMCA 1XI6A 2L5VA 4GX6A 1FJ9A 3SZPA 4PBQA 2FHYA 4GX4A 1NV4A 4HE0A 4I3EA 4LN5A 2XXKA 1IMEA 2CEXA 4HE1A 5F24A 1NUYA 4P56A 4N8GA 1FBFA 5IZ3A 4OVSA 4H45A 5ET8A 4N91A 3BIHA 3PTYA 4JVIA 5ET7A 4XEQA 1EYIA 1NV3A 4N15A 4KXPA 4PFBA 4OVTA 1NUWA 5FBPA 2R8TA 4NN3A 4MMPA 5ET6A 5IZ3B 4N8YA 2HZKA 2DVZA 4HCYA 2HHMA 4HCWA 1LBWA 4OVPA 4PAKA 4PAIA 4P9KA 4MNIA 4GWXA 3RYDA 4PC9A 2F3BA 4MNCA 3KBZA 4HXVA 4DI3D 1LBXA 3MYUA 3RPLB 1CNQA 1KZ8A 2ZZWA 1QGXA 4PCDA 2CZKA 2CZHA 1FPGA 1FPLA 2QVRA 4NHBA 4OANA 2WYPA 4G61A 1RDYA 2CEYA 2PFYA 4PTKA 4P1EA 4GWSA 2Q8MA 5IZZA 2FVZA 4O8MA 3ROJA 1D9QA 4GBVA 1DBZA 1NUZA 2XWIA 1FBCA 3LUZA 5ESYA 1DK4A 2PFZA 1K9ZA 3QMFA 4XFEA 3ISPA 2QVVA 2DDKA 1NUXA 4PBHA 4O7IA 4PAFA 4QXDA 2Q74A 4PGPA 5ET5A 4N4UA 1VDWA 1SPIA 1FBGA 1Q9DA 3B8BA 5DW8A 4OVRA 2V4CA 2WYKA 3KC0A 4NGUA 5IM2A 4QBAA 1IMAA 2Y5KA 2FIEA 4JVDA 1FPEA 4P1LA 1LBZA 4GWZA 3W9WA 1NV1A 2F3DA 4PFRA 2WX9A 1KA0A 4F1UA 2B4MA 2F5XA 5EQ7A 2DE2A 1G0HA 4P3LA 2P3VA 1IMFA 2OWZA 4H46A 5IGAA 3IFCA 2GQ1A 4OA4A 2XWKA 5EQ9A 4I3YA 3T0JA 2QVUA 5I3SA 1FPIA 2OX3A 4X9TA 4YICA 2KR0A 3W9VA 4PF6A 4PETA 4PF8A 1FPJA 4MCOA 2XWVA 4MIJA 1FPDA 1NV2A 4UABA 3KC1A 1INPA 1NV6A 1FTAA 1NV7A 5JK4A 1JP4A 1IMBA 4O94A 1FPFA 4I40A 4NF0A 4GX3A 5T3JA 1EYKA 2ZZXA 3E79A 2Y5LA 2VPOA 3D1RA 1YYZA 2KQZA 2VT5A 4NX1A 3FXBA 2V3QA 1LBVA 4PFIA 4P47A 3B50A 1FBDA 2QPQA 3IFAA 4PDDA 3CHGA 2DE4A 4NAPA 1FPKA 2ZZVA 1LBYA 4O7MA 4FBPA 5EYGA 2HPGA 5LDZA 1FPBA 2BJIA 1DCUA 1NV0A 3T1BA 2CZIA 4YZZA 2QFLA 2VPNA 3MSTA 2WBDA 2Q9TA 5I7IA 1FRPA 4IR8A 2HZLA 1YZ0A 1LEVA 4AS4A 2FIXA 4DI4B 4AS5A 4X8RA 4N81A 4P8BA 1EYJA 4X04A 1NV5A 5I5PA 5EQ8A 3GYYA 1KA1A 3A29A 3FBPA 4GWYA 3RPLA 4NQ8A 2MKZA 2PCRA 1FBPA 2XA5A 4HE2A 2HXRA 4N6KA 4MHFA 4MNPA 4XF5A 1IMDA 3HFUA 4M1VA 3E78A 1FBEA 5J1DA 5A5LA 3NOHA 4GWWA 5CM6A 2P3NA 4MEVA 4MJOA 5LTCA 1FJ6A 1FBHA 3U65A 1RDZA 2FBPA 2XWOA 4F18A 2WBBA 3BIGA 1FSAA 4N17A 3LV0A 4GWUA 1K9YA 4PDHA 4GBWA 4MAGA 5J16A 4MX6A 1BK4A 3EKIA 4PGNA 4PE3A 5IZ1A 4F19A 4F1VA 2WEFA 2B4LA 5EYHA 4JVCA 1AWBA 5EQAA 4N6DA 1RDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZZ A;  2VPN A;  2XWK A;  4OVQ A;  5I7I A;  4NG7 A;  4NHB A;  4OAN A;  2WYP A;  2HZL A;  4DI4 B;  2CEY A;  2PFY A;  4P1E A;  4PBQ A;  5IZZ A;  4O8M A;  4YIC A;  4X8R A;  4LN5 A;  4P8B A;  2XXK A;  2CEX A;  4PF6 A;  2XWI A;  4PET A;  4PF8 A;  4P56 A;  4X04 A;  4N8G A;  4OVS A;  4MCO A;  2PFZ A;  2XWV A;  4XFE A;  4MIJ A;  5I5P A;  4N91 A;  3GYY A;  4UAB A;  4NQ8 A;  4PBH A;  2XA5 A;  4XEQ A;  4N6K A;  4MHF A;  4MNP A;  4O94 A;  4PAF A;  4PGP A;  4XF5 A;  4N15 A;  4NF0 A;  4PFB A;  4OVT A;  4N4U A;  2ZZX A;  4OVR A;  2VPO A;  4NN3 A;  2V4C A;  4MMP A;  2WYK A;  5CM6 A;  5IM2 A;  4NGU A;  4NX1 A;  3FXB A;  4MEV A;  4N8Y A;  5LTC A;  2HZK A;  3U65 A;  2XWO A;  4PFI A;  4OVP A;  4P47 A;  4PAK A;  4PAI A;  4P1L A;  3B50 A;  4N17 A;  4P9K A;  4PDD A;  4PDH A;  4PFR A;  4MNI A;  4MAG A;  4NAP A;  2WX9 A;  4MX6 A;  2ZZV A;  4PC9 A;  4MNC A;  4PGN A;  4O7M A;  4PE3 A;  4DI3 D;  4P3L A;  2HPG A;  2ZZW A;  4PCD A;  5IGA A;  4N6D A;  4OA4 A; 
#chains in the Genus database with same CATH topology
 1B1H A;  4OVQ A;  2O51 A;  2NXO A;  4NG7 A;  1B2H A;  2JJK A;  1G0I A;  1XI6 A;  3H6T A;  1PC3 A;  1EZP A;  3SZP A;  3N5L A;  4XXU A;  4YMA A;  3K0V A;  1NV4 A;  3KN7 A;  1NUY A;  4GL8 A;  3M3K A;  3PPR A;  2VHA A;  2PYY A;  5ET8 A;  1Y20 A;  1Y1M A;  4N91 A;  3IAZ A;  4BDL A;  3I3V A;  4GXA A;  2ABH A;  2XXP A;  1FTL A;  3OEL A;  1M5D A;  4OTE A;  1EYI A;  4GXS B;  4OZ9 A;  2Y7I A;  3PUX E;  4KXP A;  4PFB A;  5FBP A;  4HS7 A;  4H0W A;  5IZ3 B;  1B3F A;  1ZKB A;  2UYF A;  5KDT A;  4FED A;  2HHM A;  2OZZ A;  4HCW A;  2VD2 A;  4NF4 A;  4RK9 A;  2QMX A;  1B0L A;  3G3I A;  1QW0 A;  5I56 A;  3QK6 A;  3O66 A;  2HAU A;  3UP9 A;  5FTI A;  3RYD A;  1GVC A;  4HXV A;  3MYU A;  3RPL B;  1CNQ A;  2D3I A;  4NED A;  3TQW A;  3KJT A;  2ZYO A;  2CZH A;  2CZK A;  1EZO A;  2OK2 A;  3ZSF A;  4RK2 A;  5KCJ A;  1FPL A;  2QVR A;  4QRZ A;  3K2D A;  3K6V A;  2GHB A;  4GWO A;  5FHN A;  3H6V A;  3MUQ A;  3KFM A;  1PDA A;  1ZMG A;  4P1E A;  2QS1 A;  3D4G A;  3O6I A;  3EF7 A;  4O8M A;  3ROJ A;  2RKM A;  1D9Q A;  1GGG A;  4ECF A;  4MH5 A;  3RTW B;  2OLB A;  4ZZA A;  1DK4 A;  3O6H A;  3CFZ A;  1LFG A;  1R6Z A;  1MY2 A;  4NTL A;  3TTM A;  3MZ9 A;  2IEE A;  5TP9 A;  4PBH A;  3S4U A;  1SQY A;  2Q74 A;  4F39 A;  2ZYK A;  4F22 A;  4X48 A;  1NH8 A;  5JEI A;  2XXR A;  1VDW A;  1SPI A;  1ZTY A;  3EN3 A;  3B6W A;  1M5C A;  3H03 A;  3H06 B;  4NGU A;  4QBA A;  3KJ7 A;  5JTY A;  1MPB A;  4BDO A;  1VFD A;  3KG2 A;  1FTO A;  5CMK A;  3UK4 A;  3MVW A;  4JVD A;  4IGT A;  4P1L A;  1USY E;  4LZ8 A;  1P1O A;  1USY H;  3ILT B;  1MPC A;  4RXL A;  2DE2 A;  3RNN A;  3N6U A;  4ND9 A;  3PUZ E;  4P3L A;  4YB7 A;  3FVN A;  5IGA A;  3IFC A;  3MVX A;  4N6P A;  3DEL B;  3U92 A;  4PFT A;  2O6A A;  3T22 A;  3FZV A;  5I3S A;  4NF5 B;  4JWY A;  4OQO A;  3A09 A;  2FYI A;  3CFL A;  3FJ7 A;  4U1Z A;  1BIY A;  1VE4 A;  3LBS A;  1YPN A;  4X9T A;  2GH9 A;  4ISU A;  4NF4 B;  5DVF A;  1XHY A;  4MCO A;  3A3U A;  5I56 B;  4IO5 A;  2F78 A;  5H8F A;  4KFQ A;  1FPD A;  5F7V A;  1NV2 A;  4Q30 B;  1BKA A;  5DTB A;  2DXR A;  2YLN A;  4ZEF A;  1JQF A;  3JYR A;  1NV7 A;  1JP4 A;  3H6W A;  2GHA A;  1FPF A;  4PE5 B;  1PBP A;  1IQ7 A;  1EYK A;  2B3B A;  4RA1 A;  1LGB C;  3PV0 E;  1MY3 A;  4XKP A;  2VPO A;  1S7Y A;  4YU0 A;  1MH4 A;  3D1R A;  3MC2 A;  2KQZ A;  3L6H A;  5KCJ B;  3QXM A;  1Q1K A;  3CG3 A;  3PPQ A;  1LBV A;  4PFI A;  4P47 A;  1O63 A;  3IJX B;  3MPK A;  2QPQ A;  3IO4 A;  1M5E A;  1IXG A;  1N7W A;  1SI0 A;  3TCF A;  5KZT A;  3TTR A;  1LBY A;  3TCH A;  5L9O A;  2HEU A;  4Z0I A;  2Z22 A;  5I2N A;  2HPG A;  1FQA A;  5TP9 B;  1NMU A;  2I3W A;  3VVD A;  2CZI A;  4NF8 A;  5A5X A;  1DTZ A;  4YZZ A;  4MFI A;  5I7I A;  4IR8 A;  2HZL A;  1LCT A;  3G3F A;  4AS4 A;  5FHM A;  1MS7 A;  4DI4 B;  3F11 A;  4QFO A;  4EXL A;  4HW8 A;  1HSL A;  5TU0 A;  2O84 X;  5K2Y A;  5JTY B;  2PX1 A;  3ZKL A;  4LVQ A;  3PPO A;  3M3L A;  4X04 A;  1II5 A;  2VD3 A;  1POY 1;  1B40 A;  3G3J A;  4ZEC A;  3GYY A;  1KA1 A;  3FBP A;  4GWY A;  2XXV A;  4MF3 A;  2V25 A;  3UOR A;  3RLF E;  4HE2 A;  4C0R A;  4MHF A;  3G7W A;  1Z7M E;  2OBG A;  1WVJ A;  1Y3Q A;  5ICQ A;  3FJM A;  1S9T A;  2I4C A;  5J1D A;  4GWW A;  4LQ5 A;  3PMX A;  2V3T A;  4MJO A;  5CBS A;  1RDZ A;  3PUY E;  2FBP A;  3O2A A;  3FV1 A;  5LOM A;  4Q5T A;  4YKP A;  2R9J A;  2CMO A;  3LV0 A;  4ZZE A;  3U1O A;  2F7B A;  4M4G A;  1MDP 1;  2DWH A;  3R7X A;  4GBW A;  4NMY A;  4MX6 A;  3MZB A;  3SEU A;  5H8F B;  4O3A A;  3TKD A;  4N07 A;  1LBB A;  2DYX A;  4N6D A;  1MXY A;  1OLC A;  2Q2A A;  3LC8 A;  4PFY A;  4H8I A;  1B4Z A;  1YXI A;  4BDQ A;  2E0S A;  4ESX A;  3S9E A;  2L5V A;  2REG A;  1FTJ A;  4XKR A;  1PB9 A;  3EPE A;  4U21 A;  3V83 A;  4EXK A;  1S50 A;  2ZXT A;  1B5I A;  4QFN A;  4GX4 A;  1H76 A;  3IL1 B;  5H8H A;  1OIB A;  1LAG E;  2ONR A;  1IME A;  2CEX A;  2XXK A;  3G3H A;  4KHZ E;  2UYE A;  4N8G A;  2YJP A;  5IZ3 A;  1A7L A;  3G3G A;  5AA4 B;  3PTY A;  4DLD A;  1MM6 A;  2DP8 A;  1LB9 A;  4ESW A;  5ET7 A;  3E3K A;  3E9X A;  3IJO B;  4THI A;  1A8E A;  1OMP A;  3FIR A;  4OVT A;  1LCF A;  5I2N B;  2HCA A;  2F6P A;  2DSF A;  3ILU B;  4X1B A;  3HV1 A;  4NF8 B;  2AIX A;  4ZS9 A;  4IY6 A;  4H67 A;  1EU8 A;  5FTH A;  3R26 A;  4WEP A;  1LBW A;  2XHD A;  5ITP A;  2O68 A;  1HSE A;  4H65 A;  4OXV A;  3I6V A;  3O97 A;  4P9K A;  3IX1 A;  4KCD A;  1BP5 A;  1B7H A;  4MNI A;  3PD8 A;  2RC7 A;  3O9P A;  2F3B A;  2XD3 A;  1URS A;  1NNP A;  1KZ8 A;  2ZZW A;  2F7A A;  1QGX A;  1SBP A;  4PCD A;  3FV2 A;  2O69 A;  5DT6 A;  1FQD A;  3O29 A;  4ZEK A;  4ELR A;  2XXT A;  4H1X A;  2UVH A;  3HO7 A;  1MQJ A;  4PFW A;  1IXC A;  3U8Q A;  4XKQ A;  2ZNT A;  4GWS A;  1N84 A;  5IZZ A;  2FVZ A;  1FW0 A;  4OEN A;  4OMB A;  1DBZ A;  1NUZ A;  5EYF A;  3RQT A;  1GTK A;  4LQ2 A;  3MWB A;  2XX9 A;  4ZE8 A;  1A55 A;  2E1S A;  4KQP A;  1FBC A;  1P99 A;  4Q0C A;  1K9Z A;  3TTK A;  2X7P A;  4DXC A;  2THI A;  2DDK A;  1NNF A;  2QS2 A;  1NUX A;  1VR5 A;  4OYV A;  4GQO A;  4NF6 A;  5L9M A;  2Z8F A;  4N4U A;  2Q89 A;  3UA8 A;  1FBG A;  1DPP A;  3OD7 A;  3B8B A;  1SW2 A;  3TDJ A;  4OVR A;  4LAT A;  4QFK A;  2REJ A;  1JW4 A;  4H5G A;  4FAT A;  1MXV A;  1LAX A;  1IMA A;  5AE4 A;  2HFB A;  2DQV A;  3MZ1 A;  3TZA A;  2XXI A;  3HST A;  4GWZ A;  3W9W A;  1NV1 A;  1P1Q A;  1QVS A;  5H8H B;  1Q35 A;  5I2K A;  3G3K A;  4NF5 A;  1OQG A;  1SYI A;  4OET A;  4BDN A;  5CRY A;  4F1U A;  3HHF A;  3E13 X;  5EQ7 A;  1G0H A;  3VVE A;  2ZNU A;  1PEB A;  2P3V A;  2F7C A;  2OWZ A;  4H46 A;  3TCG A;  3VE1 B;  2PMS A;  4OA4 A;  2KLF A;  5EQ9 A;  3E4R A;  1DMB A;  2UVG A;  3M8U A;  4OFO A;  2QS3 A;  1KWH A;  3THI A;  2QRY A;  4O3C A;  1NNK A;  1LAF E;  4KPT A;  1ZU0 A;  4WED A;  4R75 A;  1R9L A;  2OX3 A;  4YIC A;  1PB7 A;  5AA2 D;  3PMV A;  3MQ9 A;  1R1N A;  3EHT A;  2Q2C A;  3K6X A;  4GD5 A;  4U1O A;  1O7T A;  4MIJ A;  3KC1 A;  5ITO A;  1INP A;  2XXW A;  5DVJ A;  1SW5 A;  4LZ7 A;  2O1L A;  3C4M A;  4MLQ A;  3VLV A;  4O94 A;  2DVC A;  1SYH A;  3KEI A;  4I40 A;  3B6Q A;  4ONY A;  4IB2 A;  4WXJ A;  5T3J A;  1JVX A;  1POT A;  2ZZX A;  4R74 A;  4OHN A;  1YTV A;  4H8J A;  4RJZ A;  4YB5 A;  4RPN A;  3U93 A;  2OWS A;  1LBC A;  1SW4 A;  3FAT A;  4G2Z A;  2VT5 A;  3EQ1 A;  1US5 A;  3BBR A;  3P7I A;  1WOD A;  1FQE A;  4IO2 A;  3Q28 A;  3S9N C;  3S9L C;  2RC9 A;  3UN6 A;  3ZS6 A;  1A8F A;  2DE4 A;  2Y7P A;  4NAP A;  1P1U A;  1B6H A;  1VSO A;  3ODB A;  3UIF A;  2ZZV A;  3K6W A;  1GR2 A;  4O7M A;  4FBP A;  2PT1 A;  4ZE9 A;  5EYG A;  2OJT A;  4OEU A;  5LDZ A;  1FPB A;  2BJI A;  4KYS A;  1DCU A;  2QSX A;  1NV0 A;  4H5F A;  3RUM A;  1Y4T A;  2VPN A;  2BJJ X;  1FCK A;  5IKB A;  2Q9T A;  4NF6 B;  4F3P A;  4I9D A;  4GL0 A;  1YZ0 A;  2I0B A;  1QUK A;  5H8S A;  4DIG A;  2OCU A;  1H45 A;  2AYS A;  3OO9 A;  4G68 B;  4GLI A;  5ELV A;  4X8R A;  1PB8 A;  2UVJ A;  4U4X A;  1D9Y A;  3C9H A;  3PGF A;  1D4N A;  2ZYN A;  2I58 A;  3OO6 A;  5I5P A;  5EQ8 A;  5I2K B;  2NUV A;  1WDN A;  1B32 A;  4N13 A;  2PVU A;  1GV8 A;  1BLF A;  4NQ8 A;  2PCR A;  3K6U A;  4TLM B;  2ESN A;  4MNP A;  3IOT A;  4XF5 A;  1IMD A;  3VLW A;  3C33 A;  1LST A;  3IR1 A;  2LAO A;  4GF8 A;  2DXY A;  3E78 A;  1DOT A;  2F35 A;  3GXA A;  1FBE A;  1FQB A;  4PFU A;  5A5L A;  4H6D A;  3BFT A;  2P3N A;  3CRB A;  4MEV A;  2F36 A;  2Y7W A;  1FJ6 A;  3K1P A;  5CC2 A;  2HXW A;  3MP1 A;  3U65 A;  1QJM A;  2RCB A;  1P1N A;  4R73 A;  1P1W A;  1JEU A;  3FXU A;  3MP8 A;  4QFL A;  1B3H A;  4JSD A;  2CZL A;  1CB6 A;  4QSD A;  5AA3 A;  1T0K A;  3VDF A;  1B1X A;  4GRK A;  5J16 A;  3HPI A;  1BK4 A;  1Y4C A;  4JWO A;  4IO6 A;  4IO4 A;  4PGN A;  1DSN A;  5IZ1 A;  2WEF A;  3QUF A;  4E0X A;  1UIU A;  5EQA A;  2I0C A;  1URG A;  1TXF A;  2XD2 A;  2DE3 A;  5AA4 A;  4EQ9 A;  3LSF B;  1IMC A;  3TMG A;  4GX6 A;  2P2A A;  3KN3 A;  4FIM A;  1B7U A;  4PBQ A;  2QL3 A;  3TFL A;  1I69 A;  1ELJ A;  1QUJ A;  5I58 B;  4I3E A;  4G8N A;  3RGY A;  2D21 A;  4HE1 A;  4Q8R A;  1MXW A;  4R2B A;  3MJN A;  5F24 A;  1MQI A;  4P56 A;  1NFT A;  5CI5 A;  1O64 A;  4GOT A;  4OVS A;  1MM7 A;  3GZG A;  2XXH A;  1FTM A;  3OEK A;  5IAI A;  3RPW A;  3BIH A;  4DXB A;  3RT8 A;  5TPA B;  3SET A;  4XEQ A;  3Q29 A;  4N15 A;  4OWD A;  3OEN A;  3OO7 A;  1US4 A;  3T9X B;  3C35 A;  4KD5 A;  4U23 A;  5DYH A;  4MMP A;  1TFA A;  5I57 B;  2IA4 A;  1MY1 A;  1YCJ A;  4POX A;  1XOC A;  5HBC A;  2DVZ A;  4JDF A;  2FNC A;  3RY3 A;  3PUV E;  4OVP A;  1B4H A;  4OER A;  3DP8 A;  2A5S A;  1B0H A;  1N76 A;  5CMB A;  4GWX A;  2XXX A;  4MNC A;  4KR5 A;  1JVY A;  2F6G A;  4POW A;  3ECR A;  4DI3 D;  4FJP A;  4F2Q A;  1QUL A;  1B3E A;  1SD3 A;  1FPG A;  3QSL A;  2V84 A;  2ALU A;  1N04 A;  2WYP A;  4FEB A;  4G61 A;  2DS9 A;  3GLB A;  3LSW A;  3H6U A;  4JB7 A;  1ZIU A;  3N94 A;  1RDY A;  2Y84 A;  2PFY A;  3HCQ A;  3S9M C;  5H8N B;  4GBV A;  3KSJ A;  1D9V A;  5F1Q A;  2NOO A;  3DM0 A;  4IO7 A;  3LUZ A;  5ESY A;  2DWI A;  3IOU A;  4F31 B;  4MLV A;  3QMF A;  3RTF B;  4XFE A;  1RKM A;  2H5Y A;  3ISP A;  4XIG Q;  4R6K A;  2Y7R A;  3O28 A;  3SEW A;  4O7I A;  3U72 A;  4PAF A;  4QXD A;  4PGP A;  5ET5 A;  4F2O A;  4IY5 A;  5ISU A;  3OMB A;  1B3L A;  4C1T A;  4XTC Q;  3TTL A;  5DW8 A;  3K02 A;  2XXQ A;  3HN0 A;  4PP0 A;  3PUW E;  1JEV A;  1A99 A;  2ANJ A;  3KC0 A;  1MQH A;  4TQU Q;  1QUI A;  1AIV A;  3B6T A;  3IO6 A;  2G29 A;  3BFU A;  4TLL B;  1AOV A;  2Y5K A;  2F8D A;  3QYT A;  1UIV A;  1FPE A;  1LBZ A;  4YKI A;  3CSG A;  4PFR A;  1MY0 A;  3T9U A;  1KA0 A;  2B4M A;  2F5X A;  3C32 A;  3CR9 A;  3O6G A;  2G93 A;  2DWA A;  4JBZ A;  1OVT A;  2I6E A;  2GQ1 A;  3FJG A;  1IIW A;  3UGW A;  4YMB A;  1JET A;  1JW5 A;  3T93 B;  4R2F A;  1B52 A;  2D5W A;  1XVY A;  3VVF A;  3TEL A;  1URD A;  1FPI A;  2UXA A;  3K1M A;  3PD9 A;  3H7M A;  1M5F A;  4JSO A;  3W9V A;  4PF6 A;  2I4B A;  4MBP A;  2O1M A;  4PET A;  1FPJ A;  1UTH A;  3CI8 A;  2XWV A;  2ZYM A;  4E0W A;  1FTA A;  5JK4 A;  4BDR A;  1IMB A;  1B51 A;  4GVO A;  3MPL A;  1F9B A;  4NF0 A;  2H25 A;  4GX3 A;  3ONM A;  3K01 A;  4JWX A;  3TAJ A;  4QF9 A;  4X1D A;  2Y5L A;  4OES A;  3MBP A;  1XS5 A;  3HHG A;  1MG1 A;  1SI1 A;  4ELO A;  2H99 A;  3CSB A;  4R6Y A;  1B5H A;  2FA7 A;  3V5A A;  4TOZ A;  3N26 A;  4JXI A;  2H4I A;  3CHG A;  1B7Z A;  1FPK A;  5FHO A;  3LSL A;  4G68 A;  5L8D A;  1I6B A;  3TOD A;  4NE4 A;  2V3U A;  3T1B A;  5ICT A;  5M2V A;  2W7Y A;  2QFL A;  3GBA A;  1YAE A;  4YB6 A;  1LEV A;  3VXC A;  4AB6 A;  2H9B A;  3S2V A;  5CBR A;  4ZDM A;  5B70 A;  4F1Y A;  4EUO A;  4K3F A;  4I1D A;  1H44 A;  4G8M A;  3TUS A;  4AS5 A;  4DZ1 A;  3USD A;  2XX8 A;  1EYJ A;  1N0T A;  4IO3 A;  1NV5 A;  4QSC A;  5EHM A;  3FVO A;  3A29 A;  4FEC A;  3T96 B;  3PPP A;  3SER A;  3T66 A;  2XA5 A;  2HXR A;  3Q26 A;  4LON B;  2Z8E A;  2I49 A;  1EH3 A;  5I59 B;  3CFX A;  1FTK A;  4M1V A;  4EQ7 A;  3WAE A;  1NL5 A;  3NOH A;  5BUU A;  3FD3 A;  4RYA A;  5LTC A;  1EZ9 A;  2QMW A;  2O7I A;  3EHS A;  1B3G A;  4AQ4 A;  1ATG A;  2XWO A;  4YKJ A;  4F18 A;  3C31 A;  3BIG A;  4NWC A;  1FSA A;  5CMM A;  3B7D A;  2H98 A;  1BTJ A;  4GWU A;  4PDH A;  4YAH X;  3WAF A;  2R71 A;  4MAG A;  3SES A;  1UTH B;  4ZED A;  1MXU A;  4BLA A;  5I58 A;  4C1U A;  1OLA A;  1TWY A;  1DTG A;  5EYH A;  4EDP A;  1RDX A;  1IXI A;  1B46 A;  3SEV A;  1MXZ A;  3DP6 A;  4R9F A;  1N3W A;  2YPN A;  2I3V A;  4ZEB A;  1NI9 A;  3IK6 B;  3FVG A;  5H8Q B;  2ONK E;  2Q88 A;  1AL3 A;  2NWJ A;  5TPA A;  2A5T B;  2Z23 A;  1FJ9 A;  4HTG A;  4PQJ A;  2ONS A;  3M3F A;  3DLN A;  2FHY A;  4EF1 A;  3W15 C;  4G8H A;  3FUZ A;  4UA8 A;  4HE0 A;  4OFJ A;  4KYD A;  4KCC A;  4LN5 A;  4R72 A;  3KOT A;  1H43 A;  5HM4 B;  1OVB A;  5AA1 A;  5I57 A;  1FBF A;  1LAH E;  4H45 A;  5DVI A;  4JVI A;  4P0G A;  3T9V A;  3OSR A;  2VOZ A;  1I6Q A;  5L9S A;  3VLU A;  1NV3 A;  3AXF A;  1A54 A;  1NUW A;  3L6G A;  4QFP A;  4FAJ A;  2R8T A;  4NN3 A;  5ET6 A;  4N8Y A;  3C36 A;  2HZK A;  1I6A A;  4AB5 A;  4HCY A;  4GIZ A;  4DCX A;  4PAK A;  4PAI A;  1OQH A;  3BKI B;  1IIT A;  3IOW A;  4G77 A;  4FOR A;  4U4S A;  1CE2 A;  4PC9 A;  3KBZ A;  5H8N A;  3MW0 A;  1LBX A;  1JNF A;  3KN8 A;  3LR1 A;  1RYX A;  5KDT B;  3OSQ A;  5AA2 A;  1UTB A;  1ZJL A;  2HAV A;  4NHB A;  3CIJ A;  1AMF A;  4OAN A;  5CMC A;  3KBR A;  1Y3P A;  4DXU A;  2CEY A;  3IB1 A;  3TTN A;  4PTK A;  4O3B A;  4U2R A;  4F3G A;  2Q8M A;  2PT2 A;  4QHQ A;  4RNS A;  3VV5 A;  4LP2 B;  4OFL A;  5HPQ A;  2I48 A;  2XWI A;  3SDF A;  2PFZ A;  2RCA A;  2ZMB A;  4DDD A;  2QVV A;  3RN8 A;  2QJE A;  3VXB A;  1JW1 A;  3TPA A;  2DWJ A;  1VFE A;  3KZG A;  3FXQ A;  2AL4 A;  1ANF A;  1Q9D A;  2GFE A;  1ZLQ A;  4ELQ A;  4DCY A;  1NH7 A;  2V4C A;  3SKP A;  4OEV A;  2WYK A;  4KYE A;  5IM2 A;  1NNT A;  1IZ1 A;  3QIM A;  3V89 B;  2FIE A;  2F97 A;  3VFJ A;  4IGR A;  4QSE A;  2X26 A;  2F34 A;  2F3D A;  3PMW A;  1LFH A;  2VP1 A;  3FGS A;  3DP4 A;  5EHS A;  2WX9 A;  3QAX A;  3Q27 A;  2ZNS A;  1D3K A;  3IB2 A;  4F3B A;  1IMF A;  4U22 A;  1RYO A;  4LA9 A;  1MDQ A;  3H4Z A;  3ZKK A;  2X7Q A;  2Y7K A;  3KOS A;  4I62 A;  3LUY A;  2XWK A;  3KGC A;  4I3Y A;  3T0J A;  5B7D A;  4KI0 E;  4I8C A;  5DEX A;  2QVU A;  2XX7 A;  1PBQ A;  3CG1 A;  4OVJ A;  1N3X A;  2B65 A;  4P0I A;  4RY1 A;  1UQW A;  1TT1 A;  1H3D A;  2KR0 A;  1L5T A;  4ELP A;  3K1N A;  4G68 C;  4L17 A;  3OOA A;  1FQF A;  1LFI A;  4PF8 A;  1ZBM A;  1XC1 A;  3OEM A;  1Y1Z A;  3C34 A;  4UAB A;  1A40 A;  4DE8 A;  1SVX B;  1LB8 A;  3IB0 A;  1NV6 A;  1N7X A;  2XXU A;  3MP6 A;  1AH5 A;  3CVG A;  4YKK A;  1MRP A;  1XT8 A;  3MVZ A;  5AA2 B;  3E79 A;  3K00 A;  2DOJ A;  3KSX A;  3LSX A;  1UTB B;  3IOV A;  4WKM A;  1YYZ A;  4NX1 A;  3FXB A;  5I84 A;  1HSJ A;  4GFR A;  3QUJ A;  4XKN A;  2V3Q A;  2NVU B;  4F29 A;  1IXH A;  3RT6 B;  2RF1 A;  1MPD A;  1MQG A;  1B9J A;  3B50 A;  1FBD A;  3IFA A;  2Q8J A;  4PDD A;  3R6U A;  1IUD A;  3SEY A;  2PBW A;  2QS4 A;  1B58 A;  4LZ5 A;  2V93 A;  3IOR A;  3SEX A;  1IEJ A;  2R6G E;  1B5J A;  1J1N A;  2RC8 A;  3JZJ A;  3FAS A;  3MST A;  1R9Q A;  2WBD A;  1FRP A;  1LLS A;  2OWT A;  3I5O A;  2O7U A;  3A3C A;  2FIX A;  2VGQ A;  2GRV A;  2P0S A;  3FVK A;  4EQB A;  4EF2 A;  5BWJ A;  5I59 A;  2P1S A;  4UAC A;  4N81 A;  4P8B A;  3PU5 A;  4LUB A;  1Z7N E;  1MXX A;  4P11 A;  3N6T A;  4G4P A;  4Z7E A;  3FXR A;  2HQ0 A;  5A5X B;  3D4C A;  2B3F A;  3RPL A;  4FE8 A;  2MKZ A;  3TYH A;  2XXY A;  4R6H A;  1FBP A;  4N6K A;  3U94 A;  4ZEI A;  1XVX A;  3HFU A;  3GBB A;  4F3S A;  3PPN A;  4RPO A;  1SW1 A;  1NKX A;  1FQC A;  3MAM A;  2UVI A;  1MQD A;  2Z8D A;  3MVY A;  5CM6 A;  3Q25 A;  3TQL A;  1M5B A;  5DEX B;  3OXN A;  1FBH A;  1Y3N A;  4BDM A;  2WKY A;  1B05 A;  3T9H B;  2WBB A;  4N17 A;  1MY4 A;  5H8Q A;  3TEP A;  3V8X B;  3JV9 A;  1K9Y A;  2A5T A;  4NWD A;  1QKB A;  3OO8 A;  3EHU A;  3EKI A;  3K4U A;  2RIN A;  1MH3 A;  1QKA A;  3H3G A;  1DPE A;  4PE3 A;  2M8C A;  4F19 A;  4F1V A;  1SDX A;  1TFD A;  2B4L A;  4JVC A;  1AWB A;  4R9G A;  2AL5 A;  5K2X A;  1Y9U A; 
#chains in the Genus database with same CATH homology
 4OVQ A;  1NI9 A;  2DE3 A;  4NG7 A;  2JJK A;  1G0I A;  1YXI A;  1IMC A;  1XI6 A;  2L5V A;  4GX6 A;  1FJ9 A;  3SZP A;  4PBQ A;  2FHY A;  4GX4 A;  1NV4 A;  4HE0 A;  4I3E A;  4LN5 A;  2XXK A;  1IME A;  2CEX A;  4HE1 A;  5F24 A;  1NUY A;  4P56 A;  4N8G A;  1FBF A;  5IZ3 A;  4OVS A;  4H45 A;  5ET8 A;  4N91 A;  3BIH A;  3PTY A;  4JVI A;  5ET7 A;  4XEQ A;  1EYI A;  1NV3 A;  4N15 A;  4KXP A;  4PFB A;  4OVT A;  1NUW A;  5FBP A;  2R8T A;  4NN3 A;  4MMP A;  5ET6 A;  5IZ3 B;  4N8Y A;  2HZK A;  2DVZ A;  4HCY A;  2HHM A;  4HCW A;  1LBW A;  4OVP A;  4PAK A;  4PAI A;  4P9K A;  4MNI A;  4GWX A;  3RYD A;  4PC9 A;  2F3B A;  4MNC A;  3KBZ A;  4HXV A;  4DI3 D;  1LBX A;  3MYU A;  3RPL B;  1CNQ A;  1KZ8 A;  2ZZW A;  1QGX A;  4PCD A;  2CZK A;  2CZH A;  1FPG A;  1FPL A;  2QVR A;  4NHB A;  4OAN A;  2WYP A;  4G61 A;  1RDY A;  2CEY A;  2PFY A;  4PTK A;  4P1E A;  4GWS A;  2Q8M A;  5IZZ A;  2FVZ A;  4O8M A;  3ROJ A;  1D9Q A;  4GBV A;  1DBZ A;  1NUZ A;  2XWI A;  1FBC A;  3LUZ A;  5ESY A;  1DK4 A;  2PFZ A;  1K9Z A;  3QMF A;  4XFE A;  3ISP A;  2QVV A;  2DDK A;  1NUX A;  4PBH A;  4O7I A;  4PAF A;  4QXD A;  2Q74 A;  4PGP A;  5ET5 A;  4N4U A;  1VDW A;  1SPI A;  1FBG A;  1Q9D A;  3B8B A;  5DW8 A;  4OVR A;  2V4C A;  2WYK A;  3KC0 A;  4NGU A;  5IM2 A;  4QBA A;  1IMA A;  2Y5K A;  2FIE A;  4JVD A;  1FPE A;  4P1L A;  1LBZ A;  4GWZ A;  3W9W A;  1NV1 A;  2F3D A;  4PFR A;  2WX9 A;  1KA0 A;  4F1U A;  2B4M A;  2F5X A;  5EQ7 A;  2DE2 A;  1G0H A;  4P3L A;  2P3V A;  1IMF A;  2OWZ A;  4H46 A;  5IGA A;  3IFC A;  2GQ1 A;  4OA4 A;  2XWK A;  5EQ9 A;  4I3Y A;  3T0J A;  2QVU A;  5I3S A;  1FPI A;  2OX3 A;  4X9T A;  4YIC A;  2KR0 A;  3W9V A;  4PF6 A;  4PET A;  4PF8 A;  1FPJ A;  4MCO A;  2XWV A;  4MIJ A;  1FPD A;  1NV2 A;  4UAB A;  3KC1 A;  1INP A;  1NV6 A;  1FTA A;  1NV7 A;  5JK4 A;  1JP4 A;  1IMB A;  4O94 A;  1FPF A;  4I40 A;  4NF0 A;  4GX3 A;  5T3J A;  1EYK A;  2ZZX A;  3E79 A;  2Y5L A;  2VPO A;  3D1R A;  1YYZ A;  2KQZ A;  2VT5 A;  4NX1 A;  3FXB A;  2V3Q A;  1LBV A;  4PFI A;  4P47 A;  3B50 A;  1FBD A;  2QPQ A;  3IFA A;  4PDD A;  3CHG A;  2DE4 A;  4NAP A;  1FPK A;  2ZZV A;  1LBY A;  4O7M A;  4FBP A;  5EYG A;  2HPG A;  5LDZ A;  1FPB A;  2BJI A;  1DCU A;  1NV0 A;  3T1B A;  2CZI A;  4YZZ A;  2QFL A;  2VPN A;  3MST A;  2WBD A;  2Q9T A;  5I7I A;  1FRP A;  4IR8 A;  2HZL A;  1YZ0 A;  1LEV A;  4AS4 A;  2FIX A;  4DI4 B;  4AS5 A;  4X8R A;  4N81 A;  4P8B A;  1EYJ A;  4X04 A;  1NV5 A;  5I5P A;  5EQ8 A;  3GYY A;  1KA1 A;  3A29 A;  3FBP A;  4GWY A;  3RPL A;  4NQ8 A;  2MKZ A;  2PCR A;  1FBP A;  2XA5 A;  4HE2 A;  2HXR A;  4N6K A;  4MHF A;  4MNP A;  4XF5 A;  1IMD A;  3HFU A;  4M1V A;  3E78 A;  1FBE A;  5J1D A;  5A5L A;  3NOH A;  4GWW A;  5CM6 A;  2P3N A;  4MEV A;  4MJO A;  5LTC A;  1FJ6 A;  1FBH A;  3U65 A;  1RDZ A;  2FBP A;  2XWO A;  4F18 A;  2WBB A;  3BIG A;  1FSA A;  4N17 A;  3LV0 A;  4GWU A;  1K9Y A;  4PDH A;  4GBW A;  4MAG A;  5J16 A;  4MX6 A;  1BK4 A;  3EKI A;  4PGN A;  4PE3 A;  5IZ1 A;  4F19 A;  4F1V A;  2WEF A;  2B4L A;  5EYH A;  4JVC A;  1AWB A;  5EQA A;  4N6D A;  1RDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...