4BDLA

Crystal structure of the gluk2 k531a lbd dimer in complex with glutamate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
RSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSAPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
publication title Correlating Efficacy and Desensitization with Gluk2 Ligand-Binding Domain Movements.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 81
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdlA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdlA02
4ELQA 2V84A 2ZXTA 3B7DA 3K6UA 3TEPA 1O7TA 3N6UA 5I57B 5KCJB 4EF2A 3MVYA 1JVYA 1H45A 3N94A 2HAUA 3CG1A 2O69A 3VVDA 2O7UA 5JEIA 3IR1A 3MWBA 3UGWA 4DDDA 4GRKA 1QUKA 5AA2B 3ILUB 3FVGA 3HSTA 1B46A 2XXWA 3QAXA 4XKQA 4G68B 3K0VA 5DEXA 4H0WA 5I56B 3ZKKA 3PPQA 1YPNA 3MVWA 1N84A 5I84A 4OXVA 4ONYA 4OZ9A 2O51A 4WKMA 3C4MA 4RK2A 4EQBA 5KDTA 1UTBB 4ECFA 3DLNA 2F78A 2UVJA 2Z8DA 5L8DA 5JTYB 1II5A 1DPPA 2XXVA 4QSCA 5A5XA 1FQFA 4U4XA 1B3GA 1URGA 1MH3A 5HPQA 3UORA 2DXRA 2XX8A 3O9PA 1FTKA 3CFLA 3MPLA 4F31B 2HXWA 3OELA 2RC9A 3V8XB 2PVUA 2OK2A 4RNSA 1NMUA 3HHGA 4U22A 5H8QB 3U1OA 3D4GA 2UYEA 4K3FA 4OMBA 2R71A 1MQJA 4G8MA 3IO6A 3IX1A 3AXFA 2DQVA 2VD3A 5CMCA 4X1BA 2NUVA 1F9BA 3BKIB 1TT1A 3N5LA 4THIA 1PBPA 4M1VA 4O3AA 1JW1A 1Y3PA 2QS2A 3IB2A 1NFTA 5I59B 2Z22A 4U1OA 1P1NA 1VFDA 1A8FA 1B05A 4DXCA 3SEUA 3RNNA 2B3FA 4GIZA 4QFPA 4KFQA 4FAJA 3KZGA 2O6AA 3C34A 2CZLA 5TP9B 2F7AA 2I48A 2NOOA 1H43A 1FCKA 4LVQA 5DVIA 4JSOA 4TLLB 3ZSFA 1FQAA 1LAXA 1USYH 1B5IA 4ZZAA 4QFLA 5HM4B 4BDOA 3MP6A 4OFOA 4R73A 3PD9A 5CM6A 3G3JA 2D5WA 1XT8A 2PYYA 4XIGQ 5L9SA 5CBRA 3FVNA 3ILTB 3TPAA 3U92A 3IOVA 1PB7A 2OBGA 2RF1A 5AA1A 3FZVA 3OEMA 1OQGA 5H8NA 1A99A 3SDFA 3C31A 5CMMA 2ZNTA 4GXAA 4U21A 1EZ9A 1B5JA 4MLVA 4JXIA 1ZLQA 4TLMB 1BKAA 4G2ZA 1JW4A 2Y7IA 1MQHA 4F3PA 3VFJA 4KYDA 4OHNA 1B1XA 3UN6A 5F1QA 2ZYKA 3MC2A 1DSNA 4KCCA 1VR5A 1B7UA 3MBPA 1ZJLA 2XXQA 3HO7A 1B4HA 5DEXB 3U93A 5JK4A 1XVXA 1JQFA 3OENA 3T93B 5FTHA 4HS7A 4GD5A 1QJMA 3N6TA 1A54A 1I6QA 3VVEA 4ZEBA 3PPPA 2OLBA 3HV1A 3H06B 1A8EA 3IOUA 1B9JA 4KYEA 2RCBA 3ZS6A 2P2AA 1LCFA 1UIUA 4NF4B 1L5TA 2X26A 3TFLA 4FEBA 1DMBA 1MQIA 3MW0A 2AL4A 4F3BA 2P1SA 3O97A 1M5DA 2ALUA 1LAGE 3MZBA 1WDNA 2XXXA 4FJPA 1OVBA 3A3UA 3H6VA 1IIWA 2Q88A 2V93A 2Y7RA 1SW2A 2F34A 4ZEDA 2E0SA 1ELJA 1EZOA 4BDRA 4YICA 1SDXA 2I49A 5CI5A 3Q27A 3O29A 4F2OA 3C32A 4DZ1A 4RXLA 5I2NA 2O84X 4OERA 3IO4A 4IB2A 3G3GA 1AH5A 2UXAA 4JWYA 1OQHA 4R6HA 1Y1MA 3K6WA 3CIJA 1IQ7A 1IITA 4OEVA 2Q9TA 2UVGA 2A5SA 3KSXA 3MJNA 4F39A 3H4ZA 1VSOA 2V3QA 3LSXA 3VE1B 3K4UA 1P1QA 5B7DA 1UTHA 1HSEA 2I4CA 3W15C 4DCYA 3R26A 3R6UA 2QL3A 3FIRA 2ZMBA 2H99A 1RKMA 3OO8A 4G8NA 3B6QA 1AL3A 4LP2B 3JZJA 1ZBMA 1Y4CA 4QFKA 3SEYA 2UVHA 1XS5A 2H5YA 4G4PA 1YCJA 1JNFA 3PPRA 2THIA 3O66A 2OCUA 5AA4A 3IAZA 4RPOA 4R9FA 4ND9A 2H25A 3MZ1A 4AB6A 3DP4A 3VXCA 3CR9A 3KN8A 4H67A 1LBCA 2B65A 3VV5A 2I0CA 3MQ9A 3A09A 1YTVA 3KBRA 4N07A 3IORA 3LUYA 2NVUB 3KOSA 4PP0A 1SYHA 4LATA 4IO3A 1URDA 1IZ1A 4IO2A 1BIYA 3K2DA 4F1YA 1ZKBA 3TCFA 4NF8A 5I58A 3FGSA 1RYOA 4TQUQ 2PMSA 3PUYE 2O1MA 1H76A 4UA8A 3QSLA 1DPEA 4QSDA 1R9QA 3KGCA 1LFIA 4FE8A 4OVJA 1B0LA 1NH7A 1ZU0A 1LLSA 1AOVA 1NL5A 1JETA 3HN0A 4Z7EA 2D21A 4OQOA 2B3BA 4ELRA 5FHOA 5BWJA 4M4GA 3IOWA 4G77A 1Y1ZA 1SYIA 2DYXA 4F2QA 2V25A 2H4IA 3QUJA 4EQ9A 3KJ7A 1R9LA 1UIVA 2ANJA 2Z23A 3VXBA 1D9YA 3PU5A 4JBZA 3L6GA 4OENA 4C1TA 3T9VA 2Y84A 4LONB 1GTKA 4PFUA 3SETA 4U1ZA 1FTLA 4QFNA 4DIGA 1USYE 2OWTA 1LGBC 1ANFA 4Q30B 2AYSA 4HCYA 4ESWA 3CRBA 3T9UA 3A3CA 1R6ZA 3G3FA 4ZEKA 5CMKA 1SW4A 2PX1A 2P0SA 4KCDA 4I8CA 1Y3QA 1MPCA 1QUIA 3RLFE 5DVJA 4RJZA 5K2XA 1YAEA 3QXMA 3L6HA 3LSLA 2O68A 4ZEFA 5CC2A 3D4CA 3G3KA 2I6EA 3O2AA 2HAVA 4YB7A 1HSLA 1AMFA 1MY1A 2F7CA 3OO6A 3MUQA 4H8JA 1B40A 3U8QA 4QRZA 2PBWA 3VLVA 2F8DA 4G8HA 4MH5A 3FXUA 3QUFA 2I58A 3KEIA 1AIVA 2KLFA 2R6GE 4BDNA 2PT1A 4Z0IA 2HCAA 2NWJA 1N0TA 2IA4A 5F7VA 1B3LA 1LFHA 1MXUA 4C0RA 3FUZA 1TXFA 3B6TA 4I1DA 5AA4B 2DWAA 3THIA 1NNTA 2XD2A 2F97A 1SQYA 5H8HB 3QK6A 1Y9UA 5ELVA 4OYVA 2E1SA 4ZS9A 3E13X 3ODBA 2Q8JA 5DYHA 3O28A 5TPAA 4NF6A 4F1UA 3EPEA 2I0BA 4YKJA 4MFIA 4IY6A 2HQ0A 2Y7PA 2F5XA 1PDAA 1RYXA 4YMAA 2DP8A 3FVKA 2AIXA 3LSWA 4Q0CA 4LQ5A 1DTZA 3VVFA 3UP9A 4KI0E 4PFTA 3Q26A 4NF8B 3C33A 1M5CA 1POY1 1ZMGA 1IXGA 2REGA 4NF5B 3T22A 3KOTA 3Q28A 2M8CA 3WAFA 4BDMA 1Y4TA 4JSDA 3OD7A 4HCWA 4YKKA 3DM0A 1TFAA 4FATA 3MVZA 3H03A 2RC8A 1HSJA 3HHFA 3M3FA 2PT2A 1B1HA 5M2VA 1B7HA 5AA3A 3FV1A 3CFZA 3OOAA 1MXVA 1LAFE 2ONKE 4XKRA 2VP1A 2NXOA 1J1NA 5FHMA 2F7BA 4OFLA 5L9MA 3G3HA 3IJOB 3FVOA 2VHAA 3IL1B 4EDPA 3V83A 1NKXA 3IK6B 4ZDMA 3TODA 1R1NA 4AQ4A 2G29A 3H3GA 3ZKLA 4IY5A 4EQ7A 5ICQA 5KDTB 4OWDA 3S4UA 1TFDA 2RKMA 1B0HA 2YJPA 3E9XA 1LFGA 3CG3A 3IB0A 1B6HA 4OTEA 3K6XA 3SEWA 1URSA 5KCJA 5A5XB 4DXBA 4TOZA 3BFUA 1A40A 5TU0A 3T9HB 3TTMA 1MS7A 1Y3NA 2GFEA 3SEVA 2OZZA 4F3GA 1MPBA 2QJEA 5AA2A 4GQOA 3KN7A 4R72A 4BDLA 1MQGA 1OIBA 4G68A 2X7PA 3TMGA 5HBCA 4RK9A 4ZE9A 2XXIA 4YMBA 3G7WA 5I56A 1BLFA 1DOTA 3FATA 1Y20A 1IXHA 1N76A 3FXQA 1EH3A 5AA2D 2V3TA 3PV0E 1MXYA 5FTIA 1KWHA 2DXYA 4EXLA 1FTOA 2XXRA 3TTLA 1US4A 4GXSB 5JTYA 4HTGA 1N04A 3GBAA 3PMXA 1H3DA 1IUDA 1D9VA 3M3LA 2UVIA 4NTLA 1B52A 3PUVE 4Q8RA 2R9JA 1FW0A 1B2HA 3VLUA 1MY3A 4FIMA 2QSXA 3OMBA 3F11A 4I62A 2Y7KA 3K1PA 4U2RA 4L17A 2VOZA 3CVGA 4GF8A 5TPAB 3S9EA 3FV2A 3BFTA 1MM6A 4X1DA 1CE2A 5H8QA 4FECA 1SW1A 3ECRA 2XXPA 1PB8A 4GL8A 4LZ8A 4N6PA 4ZE8A 4BDQA 3PUXE 1B3FA 2XXYA 4H8IA 3TQLA 4P0IA 4DE8A 1QW0A 1MPDA 4KR5A 5CBSA 3G3IA 3QIMA 4YKPA 3LC8A 4KHZE 1M5EA 4IO4A 1ZTYA 4WEDA 3KJTA 3RT6B 3I5OA 3OO7A 5IKBA 3FJ7A 2YPNA 5H8NB 2DWJA 4LA9A 5EHSA 4GVOA 3KSJA 5CMBA 2XD3A 4H6DA 4LZ7A 2ESNA 3M3KA 4YKIA 5ITOA 3TTRA 1SD3A 2GH9A 2VGQA 2Q2AA 1XC1A 2YLNA 5TP9A 3MPKA 3V5AA 5CRYA 4JWOA 4DXUA 3KG2A 4R6KA 2DE2A 3MVXA 4R74A 4QF9A 3OXNA 3IOTA 1M5FA 3TZAA 2CMOA 2DSFA 4ESXA 4FORA 1MY4A 4IGTA 1QKAA 3W9WA 3U94A 3HCQA 4H5FA 2F36A 2I4BA 2Z8FA 1UQWA 2DWIA 4RA1A 3LBSA 4R2BA 3RGYA 1VFEA 1Q1KA 2ABHA 4BLAA 1S50A 1DTGA 4N13A 3W9VA 2DVCA 1MH4A 3FASA 1D3KA 4H65A 4R6YA 4XKNA 3PMVA 1FTJA 3E4RA 3R7XA 3TQWA 2F6GA 4NWDA 3Q25A 1OMPA 4ISUA 2V3UA 1OVTA 2DE4A 4X48A 1PEBA 1POTA 1N3WA 3IJXB 3O6GA 3T66A 3UIFA 4C1UA 3SESA 2REJA 2QMXA 4U23A 3SEXA 3I6VA 1LBBA 1MXXA 2G93A 4PE5B 2DS9A 2O1LA 4MF3A 5J1DA 1XOCA 3BBRA 5DVFA 4YB6A 4I9DA 1P1WA 2I3VA 2FYIA 4QFOA 1FQCA 3K00A 4HW8A 1O63A 1ATGA 2HFBA 4G68C 1NH8A 4NE4A 4OESA 1OLAA 4RY1A 3RTFB 3SKPA 3Q29A 4XTCQ 5I2NB 4F29A 1B7ZA 3PUZE 1GVCA 4WEPA 4NF4A 2ZNSA 4IO6A 1ZIUA 1MRPA 3DELB 2XXUA 4XXUA 1LCTA 1I69A 3EN3A 3H7MA 2BJJX 3T96B 4OETA 1SI0A 3K1MA 4LUBA 4F19A 1LB9A 4R9GA 1UTHB 4P0GA 1B3EA 1LB8A 1SVXB 4PFYA 4F22A 2ZNUA 1Z7NE 4MLQA 3OSQA 4YZZA 1P99A 4ZEIA 1WODA 4LQ2A 3UK4A 3UA8A 4IGRA 3IB1A 4XKPA 4QSEA 1EZPA 5BUUA 4DLDA 1LAHE 5I2KA 3KN3A 2QRYA 3RN8A 2I3WA 3TUSA 3T9XB 3OO9A 2RCAA 4WXJA 1CB6A 2D3IA 5H8FA 4H1XA 1SI1A 3TCGA 4E0WA 3S9NC 1QKBA 1A55A 3EHTA 1NNPA 4KYSA 2DE3A 2RINA 1XHYA 3RUMA 1N7WA 2QMWA 4RPNA 1IEJA 2Q2CA 1B3HA 3GZGA 4IO5A 3V89B 4KPTA 2W7YA 5I58B 1Q35A 3FJGA 4NWCA 3RPWA 3K1NA 3MP8A 4X9TA 2DVZA 4GL0A 2HZKA 2GHBA 2Q89A 1JW5A 4JWXA 4PETA 1MY2A 4OFJA 1XVYA 4NEDA 1P1UA 1LSTA 4KQPA 3TTKA 3N26A 4UACA 1NNKA 3TCHA 1B51A 3B6WA 5FHNA 1A7LA 4ELPA 1FQBA 4DCXA 2ONSA 3GXAA 1GR2A 1BTJA 5K2YA 3QYTA 3GLBA 4MBPA 2DWHA 3DP6A 2GHAA 2GRVA 4IO7A 3C36A 1D4NA 4ZECA 3JV9A 2A5TA 4RYAA 3EHSA 3USDA 3TYHA 1US5A 1FQDA 1WVJA 3S9MC 2ZYOA 3EQ1A 4P11A 3I3VA 5ISUA 1MXZA 3O6HA 3OSRA 1N7XA 4LZ5A 2ZYNA 1T0KA 2OJTA 2OWSA 1MXWA 2XX9A 3TAJA 1QUJA 3K6VA 4PQJA 3E3KA 5I57A 1PBQA 3OEKA 4R75A 4F3SA 2F35A 5DTBA 3PPNA 2O7IA 3EHUA 5B70A 2AL5A 5AE4A 3H6TA 3FD3A 3MP1A 1MY0A 4Q5TA 4QHQA 5LOMA 1S7YA 2VD2A 3FJMA 2XXTA 1N3XA 4EXKA 3C9HA 1MG1A 2QPQA 3EF7A 2DOJA 1GV8A 3TELA 3S2VA 1MDQA 1SBPA 1NNFA 5KZTA 1I6BA 1UTBA 2LAOA 2H98A 5L9OA 1JEUA 1PC3A 2HZLA 3PPOA 2XHDA 2XXHA 4EF1A 1PB9A 5IAIA 1SW5A 3M8UA 2FNCA 4POXA 2QS4A 5I2KB 4PFWA 3CSBA 1EU8A 2F6PA 4R2FA 3VDFA 3JYRA 1JVXA 4NMYA 2Z8EA 4O3CA 5H8FB 1O64A 3K02A 3FXRA 2QS1A 3H6WA 4NF6B 2ONRA 2Y7WA 4JDFA 2HEUA 3RT8A 3CI8A 1FTMA 1B4ZA 2XX7A 4GWOA 2ZYMA 3TDJA 1QULA 1B5HA 4GOTA 3GBBA 1MQDA 4F1VA 5ICTA 1H44A 3TKDA 1BP5A 3PGFA 5EHMA 4YB5A 3CFXA 1IXIA 3VLWA 1TWYA 4AB5A 1I6AA 2QS3A 1MM7A 3PMWA 1P1OA 4FEDA 5EYFA 4ZZEA 5H8HA 3RQTA 1IXCA 2UYFA 4F18A 2FA7A 4JB7A 5I59A 4O3BA 4H5GA 3P7IA 4YAHX 2WKYA 3WAEA 1B32A 1FQEA 2IEEA 3ONMA 4U4SA 3RY3A 4ELOA 2RC7A 4EUOA 3S9LC 5DT6A 3O6IA 4GFRA 3CSGA 3PUWE 3PD8A 1MDP1 4KD5A 3LSFB 3H6UA 3MAMA 1B58A 2A5TB 3HPIA 1Z7ME 3TTNA 4OEUA 4NF5A 5H8SA 3MZ9A 4YU0A 4E0XA 1JEVA 3SERA 5ITPA 1S9TA 3C35A 3RTWB 2X7QA 1OLCA 1GGGA 1VE4A 4GLIA 1M5BA 2H9BA 3LR1A 1QVSA 3DP8A 4POWA 3KFMA 3K01A 3U72A
chains in the Genus database with same CATH superfamily
4ELQA 2V84A 2ZXTA 3B7DA 3K6UA 3TEPA 1O7TA 3N6UA 5I57B 1XI6A 5KCJB 4EF2A 4N8GA 3MVYA 1JVYA 1H45A 3N94A 2HAUA 3CG1A 2O69A 3VVDA 2O7UA 5JEIA 3IR1A 3MWBA 3UGWA 4DDDA 4GRKA 2XXKA 1QUKA 2Q8MA 5AA2B 3ILUB 3FVGA 3HSTA 1B46A 2XXWA 3QAXA 1KA0A 4XKQA 4G68B 3K0VA 3RPLB 5DEXA 4H0WA 5I56B 3ZKKA 4PBQA 3PPQA 1YPNA 3MVWA 1N84A 5I84A 1IMBA 4OXVA 4ONYA 4OZ9A 2O51A 4WKMA 3C4MA 4RK2A 4EQBA 5KDTA 1UTBB 4ECFA 3DLNA 2B4LA 2F78A 2UVJA 2Z8DA 5L8DA 5JTYB 1II5A 1DPPA 2XXVA 1IMFA 4QSCA 5A5XA 1FQFA 4U4XA 1B3GA 4LN5A 1URGA 1MH3A 5HPQA 3UORA 2DXRA 2QVVA 2XX8A 3O9PA 1FTKA 3CFLA 3MPLA 4F31B 2HXWA 3OELA 2RC9A 3V8XB 2PVUA 2OK2A 4RNSA 1NMUA 3HHGA 4U22A 5H8QB 4GWXA 3U1OA 3D4GA 2UYEA 4OMBA 4K3FA 2R71A 1MQJA 4JVIA 1FBPA 4G8MA 3IO6A 3IX1A 3AXFA 2DQVA 2VD3A 4PGPA 4QBAA 1FJ6A 5CMCA 4X1BA 4PGNA 2NUVA 1F9BA 3BKIB 1TT1A 1INPA 3B8BA 3N5LA 4QXDA 4THIA 1PBPA 4M1VA 4O3AA 1NV1A 1JW1A 3E79A 1Y3PA 2QS2A 3IB2A 1NFTA 5I59B 2Z22A 4U1OA 4N8YA 1P1NA 1VFDA 1A8FA 4N15A 1B05A 4DXCA 3SEUA 3RNNA 2B3FA 4GIZA 4QFPA 4KFQA 3KZGA 4FAJA 2O6AA 3C34A 2CZLA 5TP9B 2F7AA 5T3JA 2I48A 2NOOA 1H43A 1FCKA 4LVQA 5DVIA 4JSOA 4TLLB 3ZSFA 1FQAA 1LAXA 1USYH 1B5IA 4ZZAA 4QFLA 5HM4B 4BDOA 4P3LA 3MP6A 4MX6A 4OFOA 4R73A 4X8RA 3PD9A 5CM6A 3G3JA 2D5WA 1XT8A 2PYYA 4XIGQ 5L9SA 5CBRA 3FVNA 4NG7A 3ILTB 3TPAA 3U92A 3IOVA 1PB7A 2OBGA 2RF1A 5ET7A 5AA1A 3FZVA 4P9KA 3OEMA 4GWWA 1OQGA 1LBXA 5H8NA 1A99A 3SDFA 3C31A 1YXIA 5CMMA 2ZNTA 4GXAA 4U21A 1EZ9A 3D1RA 1B5JA 4MLVA 4JXIA 1ZLQA 4TLMB 1BKAA 4G2ZA 1JW4A 2Y7IA 1MQHA 3LV0A 2XWOA 4F3PA 3VFJA 4KYDA 4OHNA 1B1XA 3UN6A 2XWIA 1DBZA 5F1QA 2ZYKA 3MC2A 1DSNA 4KCCA 1VR5A 1B7UA 4AS5A 3MBPA 1ZJLA 2XXQA 3HO7A 1B4HA 2FIEA 5DEXB 3U93A 5JK4A 1DK4A 1XVXA 1JQFA 1CNQA 3OENA 3T93B 5FTHA 4HS7A 4GD5A 1QJMA 3N6TA 1A54A 1I6QA 3VVEA 4ZEBA 3PPPA 4PF8A 2OLBA 3HV1A 3H06B 1A8EA 3IOUA 1B9JA 4KYEA 4PFIA 2RCBA 3ZS6A 2P2AA 1LCFA 1UIUA 4NF4B 1L5TA 2X26A 3TFLA 2F3DA 5A5LA 4FEBA 1DMBA 3BIGA 1MQIA 3MW0A 2AL4A 4F3BA 1D9QA 2CZKA 2P1SA 3O97A 1M5DA 2ALUA 1LAGE 3LUZA 3MZBA 1WDNA 2XXXA 4FJPA 1OVBA 3A3UA 3H6VA 1IIWA 2F3BA 4UABA 3QMFA 2Q88A 2V93A 2Y7RA 1FJ9A 1SW2A 1Q9DA 2F34A 4ZEDA 4OVSA 2E0SA 1ELJA 1EZOA 5DW8A 4BDRA 4YICA 1SDXA 2I49A 5CI5A 3Q27A 3O29A 4F2OA 3C32A 4DZ1A 4RXLA 5I2NA 2O84X 4OERA 3IO4A 4IB2A 5EQ7A 3G3GA 1AH5A 2UXAA 4JWYA 1OQHA 4R6HA 1LBWA 1Y1MA 3K6WA 3CIJA 1IQ7A 1IITA 4OEVA 2Q9TA 2UVGA 2A5SA 3KSXA 3MJNA 5IGAA 4F39A 3H4ZA 1VSOA 2V3QA 3LSXA 3VE1B 3NOHA 3K4UA 4MEVA 1P1QA 4GX6A 5B7DA 1UTHA 1FBDA 2VPNA 2XA5A 1HSEA 2I4CA 3W15C 4DCYA 3R26A 3R6UA 2QL3A 3FIRA 2ZMBA 2H99A 1RKMA 3OO8A 4G8NA 3B6QA 1AL3A 4LP2B 3JZJA 1ZBMA 1Y4CA 2CEXA 4QFKA 3SEYA 1NV2A 2UVHA 1XS5A 2H5YA 4G4PA 1YCJA 1JNFA 3PPRA 2V4CA 2THIA 3O66A 4HE2A 2OCUA 5AA4A 3IAZA 4RPOA 4R9FA 5EQ8A 4ND9A 2H25A 3MZ1A 4PAIA 4AB6A 3DP4A 2PFYA 3VXCA 3CR9A 4OVTA 4GWYA 4NQ8A 4PAFA 1BK4A 3KN8A 4H67A 1LBCA 2B65A 3VV5A 2I0CA 3MQ9A 1IMDA 3A09A 1YTVA 3KBRA 2XWVA 3E78A 4N07A 4MCOA 3IORA 3LUYA 2NVUB 3KOSA 4PP0A 1SYHA 4LATA 4IO3A 1URDA 1IZ1A 4IO2A 1BIYA 1FPKA 3K2DA 4F1YA 1ZKBA 3TCFA 4NF8A 5I58A 3FGSA 1RYOA 4TQUQ 2PMSA 3PUYE 2O1MA 4PC9A 1H76A 4UA8A 3QSLA 1DPEA 4MJOA 4QSDA 1R9QA 3KGCA 1LFIA 4FE8A 4OVJA 1B0LA 1NH7A 3IFAA 1ZU0A 1LLSA 1EYKA 1NL5A 1AOVA 1JETA 4NHBA 3HN0A 4Z7EA 2D21A 4OQOA 1G0HA 2B3BA 4ELRA 5FHOA 5BWJA 4M4GA 3IOWA 4G77A 1Y1ZA 1SYIA 2DYXA 4F2QA 2V25A 2H4IA 3QUJA 4EQ9A 3KJ7A 2KQZA 1R9LA 1UIVA 4PAKA 2ANJA 2Z23A 3VXBA 1D9YA 3PU5A 4JBZA 1NUWA 3L6GA 4OENA 4C1TA 1FBCA 3T9VA 2Y84A 4LONB 1K9YA 2PFZA 1GTKA 4PFUA 3SETA 4U1ZA 1FTLA 4QFNA 4DIGA 1USYE 2OWTA 1LGBC 1ANFA 1KA1A 4Q30B 2AYSA 4HCYA 4ESWA 3CRBA 3T9UA 3A3CA 1R6ZA 2Q74A 1NV5A 3G3FA 4ZEKA 5CMKA 5IZ1A 3MYUA 1SW4A 2PX1A 2P0SA 2WYPA 4KCDA 4I8CA 1Y3QA 1MPCA 1QUIA 3RLFE 1RDXA 4N4UA 5DVJA 4RJZA 4FBPA 5K2XA 5J16A 1YAEA 3QXMA 4NGUA 3L6HA 3LSLA 1NI9A 2O68A 4ZEFA 5CC2A 3D4CA 3G3KA 2I6EA 3O2AA 2HAVA 4YB7A 1HSLA 2HHMA 4P56A 4GX3A 1AMFA 1MY1A 2F7CA 3OO6A 3MUQA 4H8JA 1B40A 3U8QA 5ET6A 4QRZA 2R8TA 1FBFA 2PBWA 3VLVA 2F8DA 4G8HA 4MH5A 3FXUA 3QUFA 2WBBA 2I58A 3KEIA 1AIVA 2DDKA 2KLFA 2R6GE 4PBHA 4BDNA 2GQ1A 2PT1A 4Z0IA 2HCAA 2NWJA 1N0TA 2IA4A 5F7VA 1B3LA 1LFHA 1MXUA 4C0RA 3FUZA 1TXFA 3KC0A 3B6TA 4MNCA 4I1DA 5AA4B 2DWAA 3THIA 1NNTA 2XD2A 2F97A 1SQYA 5H8HB 3QK6A 1Y9UA 5ELVA 4OYVA 2E1SA 4ZS9A 3E13X 5LTCA 3ODBA 2Q8JA 5DYHA 3O28A 5TPAA 4NF6A 4AS4A 4F1UA 3EPEA 2I0BA 4YKJA 4MFIA 3KC1A 4PFRA 4IY6A 2HQ0A 2Y7PA 2F5XA 1PDAA 1RYXA 4YMAA 3A29A 2DP8A 3FVKA 2AIXA 3LSWA 4Q0CA 4LQ5A 1DTZA 3VVFA 3UP9A 4KI0E 4IR8A 4PFTA 3Q26A 4NF8B 3C33A 1M5CA 1POY1 1ZMGA 1IXGA 2REGA 4NF5B 3T22A 3KOTA 4GBVA 3Q28A 2BJIA 2M8CA 3WAFA 4BDMA 2WYKA 1Y4TA 4JSDA 3OD7A 2ZZXA 4HCWA 4YKKA 3DM0A 4N6KA 1TFAA 4FATA 3MVZA 1QGXA 4GX4A 3H03A 2RC8A 1HSJA 3HHFA 3M3FA 4G61A 2PT2A 1B1HA 5M2VA 1B7HA 5AA3A 3FV1A 3CFZA 3OOAA 2HXRA 1MXVA 1LAFE 2ONKE 4XKRA 2VP1A 2NXOA 2CZIA 1J1NA 2F7BA 5FHMA 4OFLA 5L9MA 3G3HA 3IJOB 3FVOA 2VHAA 3IL1B 4EDPA 3V83A 1NKXA 3IK6B 4ZDMA 3TODA 1R1NA 2QVRA 4AQ4A 1IMCA 2G29A 3H3GA 3ZKLA 2PCRA 2FVZA 4IY5A 4N6DA 4EQ7A 4PDDA 5ICQA 5KDTB 4OWDA 3S4UA 1TFDA 2RKMA 1B0HA 2YJPA 3E9XA 4O8MA 1LFGA 3CG3A 3IB0A 1B6HA 4OTEA 1FPGA 3K6XA 3SEWA 5FBPA 1URSA 5KCJA 5A5XB 4DXBA 4TOZA 3BFUA 1A40A 5TU0A 3T9HB 3TTMA 1MS7A 1Y3NA 3EKIA 2GFEA 3SEVA 4GWZA 2OZZA 4F3GA 1MPBA 2QJEA 5AA2A 1NV0A 4GQOA 3KN7A 4R72A 4BDLA 1MQGA 1OIBA 4G68A 4NF0A 2X7PA 3TMGA 4GWUA 5HBCA 4RK9A 4ZE9A 2XXIA 4I3YA 4YMBA 2Y5LA 3G7WA 5I56A 3MSTA 1BLFA 1DOTA 3FATA 1Y20A 1IXHA 1N76A 3FXQA 1EH3A 1NV4A 5AA2D 1YYZA 2V3TA 3PV0E 1MXYA 5FTIA 1KWHA 1YZ0A 2DXYA 4EXLA 1FTOA 2XXRA 3TTLA 1US4A 4GXSB 1NV7A 5JTYA 2OX3A 4HTGA 1N04A 3GBAA 3PMXA 1H3DA 1IUDA 1D9VA 1EYIA 3M3LA 2UVIA 4NTLA 4XF5A 4I40A 4XFEA 1B52A 3PUVE 4JVCA 4Q8RA 4OVPA 2R9JA 1FW0A 1B2HA 3VLUA 1MY3A 4OVQA 4FIMA 2QSXA 3OMBA 3F11A 4I62A 2Y7KA 3K1PA 4U2RA 4L17A 4GF8A 2VOZA 3CVGA 5TPAB 3S9EA 1NUZA 3FV2A 3BFTA 1MM6A 1NV6A 4X1DA 5I5PA 1CE2A 5H8QA 3CHGA 4FECA 1SW1A 3ECRA 2XXPA 1PB8A 4GL8A 4LZ8A 4N6PA 4ZE8A 3KBZA 4BDQA 3PUXE 1B3FA 1K9ZA 2XXYA 4H8IA 3IFCA 3TQLA 4P0IA 4DE8A 1QW0A 1MPDA 4KR5A 5CBSA 3G3IA 3QIMA 4YKPA 3LC8A 4X04A 4KHZE 1M5EA 4IO4A 1ZTYA 4WEDA 3KJTA 3RT6B 3I5OA 3OO7A 5IKBA 3FJ7A 2YPNA 2MKZA 1FPLA 5H8NB 2DWJA 4LA9A 5EHSA 1JP4A 4GVOA 3KSJA 5CMBA 4MNPA 2XD3A 2Y5KA 4H6DA 4LZ7A 2ESNA 3M3KA 4HXVA 4YKIA 5ITOA 1IMAA 3TTRA 1SD3A 2GH9A 2VGQA 1G0IA 2Q2AA 1XC1A 2YLNA 4PTKA 5TP9A 3MPKA 2VT5A 3V5AA 5CRYA 4JWOA 4DXUA 3KG2A 4R6KA 2DE2A 3MVXA 4R74A 4NAPA 4PF6A 4QF9A 4DI3D 3OXNA 3IOTA 1M5FA 3TZAA 2CMOA 2DSFA 4ESXA 4FORA 1MY4A 4IGTA 1QKAA 3W9WA 2JJKA 3U94A 2L5VA 3HCQA 4H5FA 2F36A 3SZPA 2I4BA 2Z8FA 1UQWA 2DWIA 4RA1A 3LBSA 4MMPA 4R2BA 1FPFA 3RGYA 1VFEA 1Q1KA 2ABHA 4BLAA 1S50A 1DTGA 4N13A 3W9VA 2DVCA 2WEFA 1MH4A 4O7IA 3FASA 1D3KA 4H65A 4R6YA 4XKNA 3PMVA 1FTJA 3E4RA 4NN3A 3R7XA 3TQWA 2F6GA 4NWDA 3Q25A 1OMPA 5I7IA 4ISUA 4H45A 2V3UA 5EQAA 1OVTA 2DE4A 4X48A 1PEBA 2B4MA 5EYHA 1POTA 1N3WA 4MIJA 3IJXB 4DI4B 3O6GA 3T66A 3UIFA 4C1UA 3SESA 2REJA 2QMXA 4U23A 3SEXA 3T1BA 3I6VA 1LBBA 1MXXA 2G93A 4PE5B 2DS9A 2O1LA 4MF3A 5J1DA 1XOCA 3BBRA 4N91A 5DVFA 4YB6A 4I9DA 1P1WA 2I3VA 2FYIA 4QFOA 1FQCA 3K00A 4HW8A 1O63A 1ATGA 2HFBA 4G68C 1NH8A 4NE4A 4OESA 1OLAA 4RY1A 1SPIA 3RTFB 3SKPA 3Q29A 4XTCQ 5I2NB 4F29A 1B7ZA 1FBEA 1FPEA 3PUZE 1GVCA 4WEPA 4NF4A 2HPGA 2ZNSA 4IO6A 1ZIUA 1MRPA 3DELB 2XXUA 4XXUA 1LCTA 1I69A 1FTAA 3EN3A 3H7MA 2BJJX 4PE3A 1EYJA 3T96B 4OETA 1SI0A 3K1MA 4LUBA 4F19A 1LB9A 4R9GA 1UTHB 1FPDA 4P0GA 1B3EA 4P8BA 1LB8A 2QVUA 1SVXB 4PFYA 4F22A 2FHYA 2P3NA 4O94A 2ZNUA 4PCDA 1Z7NE 1VDWA 4MLQA 3OSQA 4YZZA 1P99A 4ZEIA 1WODA 2ZZVA 4LQ2A 3UK4A 3UA8A 1IMEA 4IGRA 3IB1A 4XKPA 4QSEA 1EZPA 5BUUA 4DLDA 1LAHE 5I2KA 3KN3A 1FPIA 2QRYA 1FBHA 3RN8A 2I3WA 3TUSA 3T9XB 3OO9A 2RCAA 4WXJA 1CB6A 2D3IA 3RYDA 4H1XA 5H8FA 4P1LA 1SI1A 4PFBA 3TCGA 4E0WA 3S9NC 1QKBA 1A55A 3EHTA 1NNPA 2FBPA 4KYSA 4XEQA 2DE3A 2RINA 1XHYA 4GWSA 2OWZA 3RUMA 1N7WA 2QMWA 4RPNA 1IEJA 2Q2CA 1B3HA 3GZGA 4IO5A 5IM2A 4KPTA 3V89B 2W7YA 5I58B 1Q35A 3FJGA 4NWCA 3RPWA 3K1NA 3MP8A 4X9TA 2DVZA 4GL0A 2WX9A 2CEYA 4HE1A 1LBYA 2GHBA 2HZKA 2Q89A 1JW5A 4JWXA 4PETA 1MY2A 4OFJA 4MNIA 1XVYA 4NEDA 1P1UA 1LSTA 4KQPA 3TTKA 4I3EA 1FRPA 3N26A 4UACA 1NNKA 4NX1A 3TCHA 1B51A 1KZ8A 3B6WA 5FHNA 1A7LA 4ELPA 1FQBA 4DCXA 2ONSA 3GXAA 4OANA 1GR2A 1BTJA 4O7MA 5K2YA 3QYTA 3GLBA 4MBPA 4JVDA 2DWHA 3DP6A 2GHAA 2GRVA 4IO7A 3C36A 1D4NA 4ZECA 3JV9A 2A5TA 4RYAA 3EHSA 5IZ3A 3USDA 3TYHA 4H46A 1US5A 5I3SA 1FQDA 1WVJA 3S9MC 2ZYOA 3EQ1A 4P11A 3I3VA 2QFLA 5ISUA 1MXZA 3O6HA 3OSRA 1N7XA 4LZ5A 5EYGA 3BIHA 2ZYNA 1T0KA 1RDYA 2OJTA 2OWSA 1MXWA 1AWBA 2XX9A 1NUYA 5ESYA 3TAJA 1QUJA 3K6VA 4PQJA 4N17A 3E3KA 5I57A 1PBQA 5F24A 3OEKA 4R75A 4F3SA 4OVRA 2F35A 3PTYA 5DTBA 3PPNA 2O7IA 3EHUA 5B70A 2AL5A 5AE4A 3H6TA 3FD3A 3MP1A 1MY0A 4Q5TA 4QHQA 1RDZA 5LOMA 1S7YA 3RPLA 1LBZA 2VD2A 3FJMA 2XXTA 1N3XA 5ET5A 3C9HA 4EXKA 1MG1A 2QPQA 3EF7A 2DOJA 1GV8A 3TELA 3S2VA 1MDQA 1SBPA 1NNFA 5KZTA 1I6BA 1NV3A 1UTBA 3ISPA 2LAOA 2H98A 1FPBA 5L9OA 1JEUA 1PC3A 2HZLA 3U65A 3PPOA 2XHDA 2XXHA 4EF1A 1PB9A 5IAIA 1SW5A 3M8UA 4MHFA 2FNCA 4N81A 3T0JA 5LDZA 4POXA 2QS4A 5I2KB 4PFWA 3CSBA 1EU8A 2F6PA 4R2FA 4GBWA 3VDFA 3JYRA 1JVXA 4NMYA 2Z8EA 4O3CA 3FXBA 1O64A 5H8FB 3K02A 3FXRA 2QS1A 3H6WA 4NF6B 2ONRA 2ZZWA 2Y7WA 4JDFA 2HEUA 3RT8A 3CI8A 1FTMA 2VPOA 1B4ZA 2XX7A 4GWOA 2ZYMA 4OA4A 3TDJA 1QULA 1B5HA 4GOTA 3GBBA 3B50A 1MQDA 4F1VA 5ICTA 1H44A 3TKDA 4HE0A 3GYYA 4MAGA 2FIXA 1BP5A 3PGFA 5EHMA 4YB5A 3CFXA 5ET8A 1IXIA 3VLWA 1TWYA 1FBGA 4AB5A 1I6AA 2QS3A 3FBPA 1MM7A 3PMWA 1P1OA 4FEDA 5EYFA 4P47A 2CZHA 4ZZEA 5H8HA 3RQTA 1IXCA 4KXPA 1LBVA 2UYFA 4F18A 2FA7A 4JB7A 4PDHA 5I59A 4O3BA 4H5GA 3P7IA 4YAHX 2WKYA 3WAEA 1B32A 1FQEA 2IEEA 3ONMA 2WBDA 4U4SA 3RY3A 4ELOA 2RC7A 4EUOA 3S9LC 5DT6A 5EQ9A 3O6IA 1DCUA 4GFRA 1NUXA 3HFUA 3CSGA 3PUWE 3PD8A 1MDP1 2XWKA 4KD5A 3LSFB 3H6UA 5IZZA 3MAMA 1B58A 2A5TB 3HPIA 5IZ3B 1FPJA 2KR0A 1Z7ME 3TTNA 4OEUA 3ROJA 4NF5A 5H8SA 3MZ9A 4YU0A 4E0XA 1JEVA 3SERA 5ITPA 1FSAA 1S9TA 3C35A 3RTWB 2X7QA 1OLCA 1GGGA 1VE4A 4GLIA 1M5BA 2H9BA 3LR1A 1QVSA 4P1EA 3DP8A 4POWA 3KFMA 3K01A 2P3VA 3U72A 1LEVA
chains in the Genus database with same CATH topology
4ELQA 2V84A 2ZXTA 3B7DA 3K6UA 3TEPA 1O7TA 3N6UA 5I57B 5KCJB 4EF2A 3MVYA 1JVYA 1H45A 3N94A 2HAUA 3CG1A 2O69A 3VVDA 2O7UA 5JEIA 3IR1A 3MWBA 3UGWA 4DDDA 4GRKA 1QUKA 5AA2B 3ILUB 3FVGA 3HSTA 1B46A 2XXWA 3QAXA 4XKQA 4G68B 3K0VA 5DEXA 4H0WA 5I56B 3ZKKA 3PPQA 1YPNA 3MVWA 1N84A 5I84A 4OXVA 4ONYA 4OZ9A 2O51A 4WKMA 3C4MA 4RK2A 4EQBA 5KDTA 1UTBB 4ECFA 3DLNA 2F78A 2UVJA 2Z8DA 5L8DA 5JTYB 1II5A 1DPPA 2XXVA 4QSCA 5A5XA 1FQFA 4U4XA 1B3GA 1URGA 1MH3A 5HPQA 3UORA 2DXRA 2XX8A 3O9PA 1FTKA 3CFLA 3MPLA 4F31B 2HXWA 3OELA 2RC9A 3V8XB 2PVUA 2OK2A 4RNSA 1NMUA 3HHGA 4U22A 5H8QB 3U1OA 3D4GA 2UYEA 4K3FA 4OMBA 2R71A 1MQJA 4G8MA 3IO6A 3IX1A 3AXFA 2DQVA 2VD3A 5CMCA 4X1BA 2NUVA 1F9BA 3BKIB 1TT1A 3N5LA 4THIA 1PBPA 4M1VA 4O3AA 1JW1A 1Y3PA 2QS2A 3IB2A 1NFTA 5I59B 2Z22A 4U1OA 1P1NA 1VFDA 1A8FA 1B05A 4DXCA 3SEUA 3RNNA 2B3FA 4GIZA 4QFPA 4KFQA 4FAJA 3KZGA 2O6AA 3C34A 2CZLA 5TP9B 2F7AA 2I48A 2NOOA 1H43A 1FCKA 4LVQA 5DVIA 4JSOA 4TLLB 3ZSFA 1FQAA 1LAXA 1USYH 1B5IA 4ZZAA 4QFLA 5HM4B 4BDOA 3MP6A 4OFOA 4R73A 3PD9A 5CM6A 3G3JA 2D5WA 1XT8A 2PYYA 4XIGQ 5L9SA 5CBRA 3FVNA 3ILTB 3TPAA 3U92A 3IOVA 1PB7A 2OBGA 2RF1A 5AA1A 3FZVA 3OEMA 1OQGA 5H8NA 1A99A 3SDFA 3C31A 5CMMA 2ZNTA 4GXAA 4U21A 1EZ9A 1B5JA 4MLVA 4JXIA 1ZLQA 4TLMB 1BKAA 4G2ZA 1JW4A 2Y7IA 1MQHA 4F3PA 3VFJA 4KYDA 4OHNA 1B1XA 3UN6A 5F1QA 2ZYKA 3MC2A 1DSNA 4KCCA 1VR5A 1B7UA 3MBPA 1ZJLA 2XXQA 3HO7A 1B4HA 5DEXB 3U93A 5JK4A 1XVXA 1JQFA 3OENA 3T93B 5FTHA 4HS7A 4GD5A 1QJMA 3N6TA 1A54A 1I6QA 3VVEA 4ZEBA 3PPPA 2OLBA 3HV1A 3H06B 1A8EA 3IOUA 1B9JA 4KYEA 2RCBA 3ZS6A 2P2AA 1LCFA 1UIUA 4NF4B 1L5TA 2X26A 3TFLA 4FEBA 1DMBA 1MQIA 3MW0A 2AL4A 4F3BA 2P1SA 3O97A 1M5DA 2ALUA 1LAGE 3MZBA 1WDNA 2XXXA 4FJPA 1OVBA 3A3UA 3H6VA 1IIWA 2Q88A 2V93A 2Y7RA 1SW2A 2F34A 4ZEDA 2E0SA 1ELJA 1EZOA 4BDRA 4YICA 1SDXA 2I49A 5CI5A 3Q27A 3O29A 4F2OA 3C32A 4DZ1A 4RXLA 5I2NA 2O84X 4OERA 3IO4A 4IB2A 3G3GA 1AH5A 2UXAA 4JWYA 1OQHA 4R6HA 1Y1MA 3K6WA 3CIJA 1IQ7A 1IITA 4OEVA 2Q9TA 2UVGA 2A5SA 3KSXA 3MJNA 4F39A 3H4ZA 1VSOA 2V3QA 3LSXA 3VE1B 3K4UA 1P1QA 5B7DA 1UTHA 1HSEA 2I4CA 3W15C 4DCYA 3R26A 3R6UA 2QL3A 3FIRA 2ZMBA 2H99A 1RKMA 3OO8A 4G8NA 3B6QA 1AL3A 4LP2B 3JZJA 1ZBMA 1Y4CA 4QFKA 3SEYA 2UVHA 1XS5A 2H5YA 4G4PA 1YCJA 1JNFA 3PPRA 2THIA 3O66A 2OCUA 5AA4A 3IAZA 4RPOA 4R9FA 4ND9A 2H25A 3MZ1A 4AB6A 3DP4A 3VXCA 3CR9A 3KN8A 4H67A 1LBCA 2B65A 3VV5A 2I0CA 3MQ9A 3A09A 1YTVA 3KBRA 4N07A 3IORA 3LUYA 2NVUB 3KOSA 4PP0A 1SYHA 4LATA 4IO3A 1URDA 1IZ1A 4IO2A 1BIYA 3K2DA 4F1YA 1ZKBA 3TCFA 4NF8A 5I58A 3FGSA 1RYOA 4TQUQ 2PMSA 3PUYE 2O1MA 1H76A 4UA8A 3QSLA 1DPEA 4QSDA 1R9QA 3KGCA 1LFIA 4FE8A 4OVJA 1B0LA 1NH7A 1ZU0A 1LLSA 1AOVA 1NL5A 1JETA 3HN0A 4Z7EA 2D21A 4OQOA 2B3BA 4ELRA 5FHOA 5BWJA 4M4GA 3IOWA 4G77A 1Y1ZA 1SYIA 2DYXA 4F2QA 2V25A 2H4IA 3QUJA 4EQ9A 3KJ7A 1R9LA 1UIVA 2ANJA 2Z23A 3VXBA 1D9YA 3PU5A 4JBZA 3L6GA 4OENA 4C1TA 3T9VA 2Y84A 4LONB 1GTKA 4PFUA 3SETA 4U1ZA 1FTLA 4QFNA 4DIGA 1USYE 2OWTA 1LGBC 1ANFA 4Q30B 2AYSA 4HCYA 4ESWA 3CRBA 3T9UA 3A3CA 1R6ZA 3G3FA 4ZEKA 5CMKA 1SW4A 2PX1A 2P0SA 4KCDA 4I8CA 1Y3QA 1MPCA 1QUIA 3RLFE 5DVJA 4RJZA 5K2XA 1YAEA 3QXMA 3L6HA 3LSLA 2O68A 4ZEFA 5CC2A 3D4CA 3G3KA 2I6EA 3O2AA 2HAVA 4YB7A 1HSLA 1AMFA 1MY1A 2F7CA 3OO6A 3MUQA 4H8JA 1B40A 3U8QA 4QRZA 2PBWA 3VLVA 2F8DA 4G8HA 4MH5A 3FXUA 3QUFA 2I58A 3KEIA 1AIVA 2KLFA 2R6GE 4BDNA 2PT1A 4Z0IA 2HCAA 2NWJA 1N0TA 2IA4A 5F7VA 1B3LA 1LFHA 1MXUA 4C0RA 3FUZA 1TXFA 3B6TA 4I1DA 5AA4B 2DWAA 3THIA 1NNTA 2XD2A 2F97A 1SQYA 5H8HB 3QK6A 1Y9UA 5ELVA 4OYVA 2E1SA 4ZS9A 3E13X 3ODBA 2Q8JA 5DYHA 3O28A 5TPAA 4NF6A 4F1UA 3EPEA 2I0BA 4YKJA 4MFIA 4IY6A 2HQ0A 2Y7PA 2F5XA 1PDAA 1RYXA 4YMAA 2DP8A 3FVKA 2AIXA 3LSWA 4Q0CA 4LQ5A 1DTZA 3VVFA 3UP9A 4KI0E 4PFTA 3Q26A 4NF8B 3C33A 1M5CA 1POY1 1ZMGA 1IXGA 2REGA 4NF5B 3T22A 3KOTA 3Q28A 2M8CA 3WAFA 4BDMA 1Y4TA 4JSDA 3OD7A 4HCWA 4YKKA 3DM0A 1TFAA 4FATA 3MVZA 3H03A 2RC8A 1HSJA 3HHFA 3M3FA 2PT2A 1B1HA 5M2VA 1B7HA 5AA3A 3FV1A 3CFZA 3OOAA 1MXVA 1LAFE 2ONKE 4XKRA 2VP1A 2NXOA 1J1NA 5FHMA 2F7BA 4OFLA 5L9MA 3G3HA 3IJOB 3FVOA 2VHAA 3IL1B 4EDPA 3V83A 1NKXA 3IK6B 4ZDMA 3TODA 1R1NA 4AQ4A 2G29A 3H3GA 3ZKLA 4IY5A 4EQ7A 5ICQA 5KDTB 4OWDA 3S4UA 1TFDA 2RKMA 1B0HA 2YJPA 3E9XA 1LFGA 3CG3A 3IB0A 1B6HA 4OTEA 3K6XA 3SEWA 1URSA 5KCJA 5A5XB 4DXBA 4TOZA 3BFUA 1A40A 5TU0A 3T9HB 3TTMA 1MS7A 1Y3NA 2GFEA 3SEVA 2OZZA 4F3GA 1MPBA 2QJEA 5AA2A 4GQOA 3KN7A 4R72A 4BDLA 1MQGA 1OIBA 4G68A 2X7PA 3TMGA 5HBCA 4RK9A 4ZE9A 2XXIA 4YMBA 3G7WA 5I56A 1BLFA 1DOTA 3FATA 1Y20A 1IXHA 1N76A 3FXQA 1EH3A 5AA2D 2V3TA 3PV0E 1MXYA 5FTIA 1KWHA 2DXYA 4EXLA 1FTOA 2XXRA 3TTLA 1US4A 4GXSB 5JTYA 4HTGA 1N04A 3GBAA 3PMXA 1H3DA 1IUDA 1D9VA 3M3LA 2UVIA 4NTLA 1B52A 3PUVE 4Q8RA 2R9JA 1FW0A 1B2HA 3VLUA 1MY3A 4FIMA 2QSXA 3OMBA 3F11A 4I62A 2Y7KA 3K1PA 4U2RA 4L17A 2VOZA 3CVGA 4GF8A 5TPAB 3S9EA 3FV2A 3BFTA 1MM6A 4X1DA 1CE2A 5H8QA 4FECA 1SW1A 3ECRA 2XXPA 1PB8A 4GL8A 4LZ8A 4N6PA 4ZE8A 4BDQA 3PUXE 1B3FA 2XXYA 4H8IA 3TQLA 4P0IA 4DE8A 1QW0A 1MPDA 4KR5A 5CBSA 3G3IA 3QIMA 4YKPA 3LC8A 4KHZE 1M5EA 4IO4A 1ZTYA 4WEDA 3KJTA 3RT6B 3I5OA 3OO7A 5IKBA 3FJ7A 2YPNA 5H8NB 2DWJA 4LA9A 5EHSA 4GVOA 3KSJA 5CMBA 2XD3A 4H6DA 4LZ7A 2ESNA 3M3KA 4YKIA 5ITOA 3TTRA 1SD3A 2GH9A 2VGQA 2Q2AA 1XC1A 2YLNA 5TP9A 3MPKA 3V5AA 5CRYA 4JWOA 4DXUA 3KG2A 4R6KA 2DE2A 3MVXA 4R74A 4QF9A 3OXNA 3IOTA 1M5FA 3TZAA 2CMOA 2DSFA 4ESXA 4FORA 1MY4A 4IGTA 1QKAA 3W9WA 3U94A 3HCQA 4H5FA 2F36A 2I4BA 2Z8FA 1UQWA 2DWIA 4RA1A 3LBSA 4R2BA 3RGYA 1VFEA 1Q1KA 2ABHA 4BLAA 1S50A 1DTGA 4N13A 3W9VA 2DVCA 1MH4A 3FASA 1D3KA 4H65A 4R6YA 4XKNA 3PMVA 1FTJA 3E4RA 3R7XA 3TQWA 2F6GA 4NWDA 3Q25A 1OMPA 4ISUA 2V3UA 1OVTA 2DE4A 4X48A 1PEBA 1POTA 1N3WA 3IJXB 3O6GA 3T66A 3UIFA 4C1UA 3SESA 2REJA 2QMXA 4U23A 3SEXA 3I6VA 1LBBA 1MXXA 2G93A 4PE5B 2DS9A 2O1LA 4MF3A 5J1DA 1XOCA 3BBRA 5DVFA 4YB6A 4I9DA 1P1WA 2I3VA 2FYIA 4QFOA 1FQCA 3K00A 4HW8A 1O63A 1ATGA 2HFBA 4G68C 1NH8A 4NE4A 4OESA 1OLAA 4RY1A 3RTFB 3SKPA 3Q29A 4XTCQ 5I2NB 4F29A 1B7ZA 3PUZE 1GVCA 4WEPA 4NF4A 2ZNSA 4IO6A 1ZIUA 1MRPA 3DELB 2XXUA 4XXUA 1LCTA 1I69A 3EN3A 3H7MA 2BJJX 3T96B 4OETA 1SI0A 3K1MA 4LUBA 4F19A 1LB9A 4R9GA 1UTHB 4P0GA 1B3EA 1LB8A 1SVXB 4PFYA 4F22A 2ZNUA 1Z7NE 4MLQA 3OSQA 4YZZA 1P99A 4ZEIA 1WODA 4LQ2A 3UK4A 3UA8A 4IGRA 3IB1A 4XKPA 4QSEA 1EZPA 5BUUA 4DLDA 1LAHE 5I2KA 3KN3A 2QRYA 3RN8A 2I3WA 3TUSA 3T9XB 3OO9A 2RCAA 4WXJA 1CB6A 2D3IA 5H8FA 4H1XA 1SI1A 3TCGA 4E0WA 3S9NC 1QKBA 1A55A 3EHTA 1NNPA 4KYSA 2DE3A 2RINA 1XHYA 3RUMA 1N7WA 2QMWA 4RPNA 1IEJA 2Q2CA 1B3HA 3GZGA 4IO5A 3V89B 4KPTA 2W7YA 5I58B 1Q35A 3FJGA 4NWCA 3RPWA 3K1NA 3MP8A 4X9TA 2DVZA 4GL0A 2HZKA 2GHBA 2Q89A 1JW5A 4JWXA 4PETA 1MY2A 4OFJA 1XVYA 4NEDA 1P1UA 1LSTA 4KQPA 3TTKA 3N26A 4UACA 1NNKA 3TCHA 1B51A 3B6WA 5FHNA 1A7LA 4ELPA 1FQBA 4DCXA 2ONSA 3GXAA 1GR2A 1BTJA 5K2YA 3QYTA 3GLBA 4MBPA 2DWHA 3DP6A 2GHAA 2GRVA 4IO7A 3C36A 1D4NA 4ZECA 3JV9A 2A5TA 4RYAA 3EHSA 3USDA 3TYHA 1US5A 1FQDA 1WVJA 3S9MC 2ZYOA 3EQ1A 4P11A 3I3VA 5ISUA 1MXZA 3O6HA 3OSRA 1N7XA 4LZ5A 2ZYNA 1T0KA 2OJTA 2OWSA 1MXWA 2XX9A 3TAJA 1QUJA 3K6VA 4PQJA 3E3KA 5I57A 1PBQA 3OEKA 4R75A 4F3SA 2F35A 5DTBA 3PPNA 2O7IA 3EHUA 5B70A 2AL5A 5AE4A 3H6TA 3FD3A 3MP1A 1MY0A 4Q5TA 4QHQA 5LOMA 1S7YA 2VD2A 3FJMA 2XXTA 1N3XA 4EXKA 3C9HA 1MG1A 2QPQA 3EF7A 2DOJA 1GV8A 3TELA 3S2VA 1MDQA 1SBPA 1NNFA 5KZTA 1I6BA 1UTBA 2LAOA 2H98A 5L9OA 1JEUA 1PC3A 2HZLA 3PPOA 2XHDA 2XXHA 4EF1A 1PB9A 5IAIA 1SW5A 3M8UA 2FNCA 4POXA 2QS4A 5I2KB 4PFWA 3CSBA 1EU8A 2F6PA 4R2FA 3VDFA 3JYRA 1JVXA 4NMYA 2Z8EA 4O3CA 5H8FB 1O64A 3K02A 3FXRA 2QS1A 3H6WA 4NF6B 2ONRA 2Y7WA 4JDFA 2HEUA 3RT8A 3CI8A 1FTMA 1B4ZA 2XX7A 4GWOA 2ZYMA 3TDJA 1QULA 1B5HA 4GOTA 3GBBA 1MQDA 4F1VA 5ICTA 1H44A 3TKDA 1BP5A 3PGFA 5EHMA 4YB5A 3CFXA 1IXIA 3VLWA 1TWYA 4AB5A 1I6AA 2QS3A 1MM7A 3PMWA 1P1OA 4FEDA 5EYFA 4ZZEA 5H8HA 3RQTA 1IXCA 2UYFA 4F18A 2FA7A 4JB7A 5I59A 4O3BA 4H5GA 3P7IA 4YAHX 2WKYA 3WAEA 1B32A 1FQEA 2IEEA 3ONMA 4U4SA 3RY3A 4ELOA 2RC7A 4EUOA 3S9LC 5DT6A 3O6IA 4GFRA 3CSGA 3PUWE 3PD8A 1MDP1 4KD5A 3LSFB 3H6UA 3MAMA 1B58A 2A5TB 3HPIA 1Z7ME 3TTNA 4OEUA 4NF5A 5H8SA 3MZ9A 4YU0A 4E0XA 1JEVA 3SERA 5ITPA 1S9TA 3C35A 3RTWB 2X7QA 1OLCA 1GGGA 1VE4A 4GLIA 1M5BA 2H9BA 3LR1A 1QVSA 3DP8A 4POWA 3KFMA 3K01A 3U72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ELQ A;  2V84 A;  2ZXT A;  3B7D A;  3K6U A;  3TEP A;  1O7T A;  3N6U A;  5I57 B;  5KCJ B;  4EF2 A;  3MVY A;  1JVY A;  1H45 A;  3N94 A;  2HAU A;  3CG1 A;  2O69 A;  3VVD A;  2O7U A;  5JEI A;  3IR1 A;  3MWB A;  3UGW A;  4DDD A;  4GRK A;  1QUK A;  5AA2 B;  3ILU B;  3FVG A;  3HST A;  1B46 A;  2XXW A;  3QAX A;  4XKQ A;  4G68 B;  3K0V A;  5DEX A;  4H0W A;  5I56 B;  3ZKK A;  3PPQ A;  1YPN A;  3MVW A;  1N84 A;  5I84 A;  4OXV A;  4ONY A;  4OZ9 A;  2O51 A;  4WKM A;  3C4M A;  4RK2 A;  4EQB A;  5KDT A;  1UTB B;  4ECF A;  3DLN A;  2F78 A;  2UVJ A;  2Z8D A;  5L8D A;  5JTY B;  1II5 A;  1DPP A;  2XXV A;  4QSC A;  5A5X A;  1FQF A;  4U4X A;  1B3G A;  1URG A;  1MH3 A;  5HPQ A;  3UOR A;  2DXR A;  2XX8 A;  3O9P A;  1FTK A;  3CFL A;  3MPL A;  4F31 B;  2HXW A;  3OEL A;  2RC9 A;  3V8X B;  2PVU A;  2OK2 A;  4RNS A;  1NMU A;  3HHG A;  4U22 A;  5H8Q B;  3U1O A;  3D4G A;  2UYE A;  4K3F A;  4OMB A;  2R71 A;  1MQJ A;  4G8M A;  3IO6 A;  3IX1 A;  3AXF A;  2DQV A;  2VD3 A;  5CMC A;  4X1B A;  2NUV A;  1F9B A;  3BKI B;  1TT1 A;  3N5L A;  4THI A;  1PBP A;  4M1V A;  4O3A A;  1JW1 A;  1Y3P A;  2QS2 A;  3IB2 A;  1NFT A;  5I59 B;  2Z22 A;  4U1O A;  1P1N A;  1VFD A;  1A8F A;  1B05 A;  4DXC A;  3SEU A;  3RNN A;  2B3F A;  4GIZ A;  4QFP A;  4KFQ A;  4FAJ A;  3KZG A;  2O6A A;  3C34 A;  2CZL A;  5TP9 B;  2F7A A;  2I48 A;  2NOO A;  1H43 A;  1FCK A;  4LVQ A;  5DVI A;  4JSO A;  4TLL B;  3ZSF A;  1FQA A;  1LAX A;  1USY H;  1B5I A;  4ZZA A;  4QFL A;  5HM4 B;  4BDO A;  3MP6 A;  4OFO A;  4R73 A;  3PD9 A;  5CM6 A;  3G3J A;  2D5W A;  1XT8 A;  2PYY A;  4XIG Q;  5L9S A;  5CBR A;  3FVN A;  3ILT B;  3TPA A;  3U92 A;  3IOV A;  1PB7 A;  2OBG A;  2RF1 A;  5AA1 A;  3FZV A;  3OEM A;  1OQG A;  5H8N A;  1A99 A;  3SDF A;  3C31 A;  5CMM A;  2ZNT A;  4GXA A;  4U21 A;  1EZ9 A;  1B5J A;  4MLV A;  4JXI A;  1ZLQ A;  4TLM B;  1BKA A;  4G2Z A;  1JW4 A;  2Y7I A;  1MQH A;  4F3P A;  3VFJ A;  4KYD A;  4OHN A;  1B1X A;  3UN6 A;  5F1Q A;  2ZYK A;  3MC2 A;  1DSN A;  4KCC A;  1VR5 A;  1B7U A;  3MBP A;  1ZJL A;  2XXQ A;  3HO7 A;  1B4H A;  5DEX B;  3U93 A;  5JK4 A;  1XVX A;  1JQF A;  3OEN A;  3T93 B;  5FTH A;  4HS7 A;  4GD5 A;  1QJM A;  3N6T A;  1A54 A;  1I6Q A;  3VVE A;  4ZEB A;  3PPP A;  2OLB A;  3HV1 A;  3H06 B;  1A8E A;  3IOU A;  1B9J A;  4KYE A;  2RCB A;  3ZS6 A;  2P2A A;  1LCF A;  1UIU A;  4NF4 B;  1L5T A;  2X26 A;  3TFL A;  4FEB A;  1DMB A;  1MQI A;  3MW0 A;  2AL4 A;  4F3B A;  2P1S A;  3O97 A;  1M5D A;  2ALU A;  1LAG E;  3MZB A;  1WDN A;  2XXX A;  4FJP A;  1OVB A;  3A3U A;  3H6V A;  1IIW A;  2Q88 A;  2V93 A;  2Y7R A;  1SW2 A;  2F34 A;  4ZED A;  2E0S A;  1ELJ A;  1EZO A;  4BDR A;  4YIC A;  1SDX A;  2I49 A;  5CI5 A;  3Q27 A;  3O29 A;  4F2O A;  3C32 A;  4DZ1 A;  4RXL A;  5I2N A;  2O84 X;  4OER A;  3IO4 A;  4IB2 A;  3G3G A;  1AH5 A;  2UXA A;  4JWY A;  1OQH A;  4R6H A;  1Y1M A;  3K6W A;  3CIJ A;  1IQ7 A;  1IIT A;  4OEV A;  2Q9T A;  2UVG A;  2A5S A;  3KSX A;  3MJN A;  4F39 A;  3H4Z A;  1VSO A;  2V3Q A;  3LSX A;  3VE1 B;  3K4U A;  1P1Q A;  5B7D A;  1UTH A;  1HSE A;  2I4C A;  3W15 C;  4DCY A;  3R26 A;  3R6U A;  2QL3 A;  3FIR A;  2ZMB A;  2H99 A;  1RKM A;  3OO8 A;  4G8N A;  3B6Q A;  1AL3 A;  4LP2 B;  3JZJ A;  1ZBM A;  1Y4C A;  4QFK A;  3SEY A;  2UVH A;  1XS5 A;  2H5Y A;  4G4P A;  1YCJ A;  1JNF A;  3PPR A;  2THI A;  3O66 A;  2OCU A;  5AA4 A;  3IAZ A;  4RPO A;  4R9F A;  4ND9 A;  2H25 A;  3MZ1 A;  4AB6 A;  3DP4 A;  3VXC A;  3CR9 A;  3KN8 A;  4H67 A;  1LBC A;  2B65 A;  3VV5 A;  2I0C A;  3MQ9 A;  3A09 A;  1YTV A;  3KBR A;  4N07 A;  3IOR A;  3LUY A;  2NVU B;  3KOS A;  4PP0 A;  1SYH A;  4LAT A;  4IO3 A;  1URD A;  1IZ1 A;  4IO2 A;  1BIY A;  3K2D A;  4F1Y A;  1ZKB A;  3TCF A;  4NF8 A;  5I58 A;  3FGS A;  1RYO A;  4TQU Q;  2PMS A;  3PUY E;  2O1M A;  1H76 A;  4UA8 A;  3QSL A;  1DPE A;  4QSD A;  1R9Q A;  3KGC A;  1LFI A;  4FE8 A;  4OVJ A;  1B0L A;  1NH7 A;  1ZU0 A;  1LLS A;  1AOV A;  1NL5 A;  1JET A;  3HN0 A;  4Z7E A;  2D21 A;  4OQO A;  2B3B A;  4ELR A;  5FHO A;  5BWJ A;  4M4G A;  3IOW A;  4G77 A;  1Y1Z A;  1SYI A;  2DYX A;  4F2Q A;  2V25 A;  2H4I A;  3QUJ A;  4EQ9 A;  3KJ7 A;  1R9L A;  1UIV A;  2ANJ A;  2Z23 A;  3VXB A;  1D9Y A;  3PU5 A;  4JBZ A;  3L6G A;  4OEN A;  4C1T A;  3T9V A;  2Y84 A;  4LON B;  1GTK A;  4PFU A;  3SET A;  4U1Z A;  1FTL A;  4QFN A;  4DIG A;  1USY E;  2OWT A;  1LGB C;  1ANF A;  4Q30 B;  2AYS A;  4HCY A;  4ESW A;  3CRB A;  3T9U A;  3A3C A;  1R6Z A;  3G3F A;  4ZEK A;  5CMK A;  1SW4 A;  2PX1 A;  2P0S A;  4KCD A;  4I8C A;  1Y3Q A;  1MPC A;  1QUI A;  3RLF E;  5DVJ A;  4RJZ A;  5K2X A;  1YAE A;  3QXM A;  3L6H A;  3LSL A;  2O68 A;  4ZEF A;  5CC2 A;  3D4C A;  3G3K A;  2I6E A;  3O2A A;  2HAV A;  4YB7 A;  1HSL A;  1AMF A;  1MY1 A;  2F7C A;  3OO6 A;  3MUQ A;  4H8J A;  1B40 A;  3U8Q A;  4QRZ A;  2PBW A;  3VLV A;  2F8D A;  4G8H A;  4MH5 A;  3FXU A;  3QUF A;  2I58 A;  3KEI A;  1AIV A;  2KLF A;  2R6G E;  4BDN A;  2PT1 A;  4Z0I A;  2HCA A;  2NWJ A;  1N0T A;  2IA4 A;  5F7V A;  1B3L A;  1LFH A;  1MXU A;  4C0R A;  3FUZ A;  1TXF A;  3B6T A;  4I1D A;  5AA4 B;  2DWA A;  3THI A;  1NNT A;  2XD2 A;  2F97 A;  1SQY A;  5H8H B;  3QK6 A;  1Y9U A;  5ELV A;  4OYV A;  2E1S A;  4ZS9 A;  3E13 X;  3ODB A;  2Q8J A;  5DYH A;  3O28 A;  5TPA A;  4NF6 A;  4F1U A;  3EPE A;  2I0B A;  4YKJ A;  4MFI A;  4IY6 A;  2HQ0 A;  2Y7P A;  2F5X A;  1PDA A;  1RYX A;  4YMA A;  2DP8 A;  3FVK A;  2AIX A;  3LSW A;  4Q0C A;  4LQ5 A;  1DTZ A;  3VVF A;  3UP9 A;  4KI0 E;  4PFT A;  3Q26 A;  4NF8 B;  3C33 A;  1M5C A;  1POY 1;  1ZMG A;  1IXG A;  2REG A;  4NF5 B;  3T22 A;  3KOT A;  3Q28 A;  2M8C A;  3WAF A;  4BDM A;  1Y4T A;  4JSD A;  3OD7 A;  4HCW A;  4YKK A;  3DM0 A;  1TFA A;  4FAT A;  3MVZ A;  3H03 A;  2RC8 A;  1HSJ A;  3HHF A;  3M3F A;  2PT2 A;  1B1H A;  5M2V A;  1B7H A;  5AA3 A;  3FV1 A;  3CFZ A;  3OOA A;  1MXV A;  1LAF E;  2ONK E;  4XKR A;  2VP1 A;  2NXO A;  1J1N A;  5FHM A;  2F7B A;  4OFL A;  5L9M A;  3G3H A;  3IJO B;  3FVO A;  2VHA A;  3IL1 B;  4EDP A;  3V83 A;  1NKX A;  3IK6 B;  4ZDM A;  3TOD A;  1R1N A;  4AQ4 A;  2G29 A;  3H3G A;  3ZKL A;  4IY5 A;  4EQ7 A;  5ICQ A;  5KDT B;  4OWD A;  3S4U A;  1TFD A;  2RKM A;  1B0H A;  2YJP A;  3E9X A;  1LFG A;  3CG3 A;  3IB0 A;  1B6H A;  4OTE A;  3K6X A;  3SEW A;  1URS A;  5KCJ A;  5A5X B;  4DXB A;  4TOZ A;  3BFU A;  1A40 A;  5TU0 A;  3T9H B;  3TTM A;  1MS7 A;  1Y3N A;  2GFE A;  3SEV A;  2OZZ A;  4F3G A;  1MPB A;  2QJE A;  5AA2 A;  4GQO A;  3KN7 A;  4R72 A;  4BDL A;  1MQG A;  1OIB A;  4G68 A;  2X7P A;  3TMG A;  5HBC A;  4RK9 A;  4ZE9 A;  2XXI A;  4YMB A;  3G7W A;  5I56 A;  1BLF A;  1DOT A;  3FAT A;  1Y20 A;  1IXH A;  1N76 A;  3FXQ A;  1EH3 A;  5AA2 D;  2V3T A;  3PV0 E;  1MXY A;  5FTI A;  1KWH A;  2DXY A;  4EXL A;  1FTO A;  2XXR A;  3TTL A;  1US4 A;  4GXS B;  5JTY A;  4HTG A;  1N04 A;  3GBA A;  3PMX A;  1H3D A;  1IUD A;  1D9V A;  3M3L A;  2UVI A;  4NTL A;  1B52 A;  3PUV E;  4Q8R A;  2R9J A;  1FW0 A;  1B2H A;  3VLU A;  1MY3 A;  4FIM A;  2QSX A;  3OMB A;  3F11 A;  4I62 A;  2Y7K A;  3K1P A;  4U2R A;  4L17 A;  2VOZ A;  3CVG A;  4GF8 A;  5TPA B;  3S9E A;  3FV2 A;  3BFT A;  1MM6 A;  4X1D A;  1CE2 A;  5H8Q A;  4FEC A;  1SW1 A;  3ECR A;  2XXP A;  1PB8 A;  4GL8 A;  4LZ8 A;  4N6P A;  4ZE8 A;  4BDQ A;  3PUX E;  1B3F A;  2XXY A;  4H8I A;  3TQL A;  4P0I A;  4DE8 A;  1QW0 A;  1MPD A;  4KR5 A;  5CBS A;  3G3I A;  3QIM A;  4YKP A;  3LC8 A;  4KHZ E;  1M5E A;  4IO4 A;  1ZTY A;  4WED A;  3KJT A;  3RT6 B;  3I5O A;  3OO7 A;  5IKB A;  3FJ7 A;  2YPN A;  5H8N B;  2DWJ A;  4LA9 A;  5EHS A;  4GVO A;  3KSJ A;  5CMB A;  2XD3 A;  4H6D A;  4LZ7 A;  2ESN A;  3M3K A;  4YKI A;  5ITO A;  3TTR A;  1SD3 A;  2GH9 A;  2VGQ A;  2Q2A A;  1XC1 A;  2YLN A;  5TP9 A;  3MPK A;  3V5A A;  5CRY A;  4JWO A;  4DXU A;  3KG2 A;  4R6K A;  2DE2 A;  3MVX A;  4R74 A;  4QF9 A;  3OXN A;  3IOT A;  1M5F A;  3TZA A;  2CMO A;  2DSF A;  4ESX A;  4FOR A;  1MY4 A;  4IGT A;  1QKA A;  3W9W A;  3U94 A;  3HCQ A;  4H5F A;  2F36 A;  2I4B A;  2Z8F A;  1UQW A;  2DWI A;  4RA1 A;  3LBS A;  4R2B A;  3RGY A;  1VFE A;  1Q1K A;  2ABH A;  4BLA A;  1S50 A;  1DTG A;  4N13 A;  3W9V A;  2DVC A;  1MH4 A;  3FAS A;  1D3K A;  4H65 A;  4R6Y A;  4XKN A;  3PMV A;  1FTJ A;  3E4R A;  3R7X A;  3TQW A;  2F6G A;  4NWD A;  3Q25 A;  1OMP A;  4ISU A;  2V3U A;  1OVT A;  2DE4 A;  4X48 A;  1PEB A;  1POT A;  1N3W A;  3IJX B;  3O6G A;  3T66 A;  3UIF A;  4C1U A;  3SES A;  2REJ A;  2QMX A;  4U23 A;  3SEX A;  3I6V A;  1LBB A;  1MXX A;  2G93 A;  4PE5 B;  2DS9 A;  2O1L A;  4MF3 A;  5J1D A;  1XOC A;  3BBR A;  5DVF A;  4YB6 A;  4I9D A;  1P1W A;  2I3V A;  2FYI A;  4QFO A;  1FQC A;  3K00 A;  4HW8 A;  1O63 A;  1ATG A;  2HFB A;  4G68 C;  1NH8 A;  4NE4 A;  4OES A;  1OLA A;  4RY1 A;  3RTF B;  3SKP A;  3Q29 A;  4XTC Q;  5I2N B;  4F29 A;  1B7Z A;  3PUZ E;  1GVC A;  4WEP A;  4NF4 A;  2ZNS A;  4IO6 A;  1ZIU A;  1MRP A;  3DEL B;  2XXU A;  4XXU A;  1LCT A;  1I69 A;  3EN3 A;  3H7M A;  2BJJ X;  3T96 B;  4OET A;  1SI0 A;  3K1M A;  4LUB A;  4F19 A;  1LB9 A;  4R9G A;  1UTH B;  4P0G A;  1B3E A;  1LB8 A;  1SVX B;  4PFY A;  4F22 A;  2ZNU A;  1Z7N E;  4MLQ A;  3OSQ A;  4YZZ A;  1P99 A;  4ZEI A;  1WOD A;  4LQ2 A;  3UK4 A;  3UA8 A;  4IGR A;  3IB1 A;  4XKP A;  4QSE A;  1EZP A;  5BUU A;  4DLD A;  1LAH E;  5I2K A;  3KN3 A;  2QRY A;  3RN8 A;  2I3W A;  3TUS A;  3T9X B;  3OO9 A;  2RCA A;  4WXJ A;  1CB6 A;  2D3I A;  5H8F A;  4H1X A;  1SI1 A;  3TCG A;  4E0W A;  3S9N C;  1QKB A;  1A55 A;  3EHT A;  1NNP A;  4KYS A;  2DE3 A;  2RIN A;  1XHY A;  3RUM A;  1N7W A;  2QMW A;  4RPN A;  1IEJ A;  2Q2C A;  1B3H A;  3GZG A;  4IO5 A;  3V89 B;  4KPT A;  2W7Y A;  5I58 B;  1Q35 A;  3FJG A;  4NWC A;  3RPW A;  3K1N A;  3MP8 A;  4X9T A;  2DVZ A;  4GL0 A;  2HZK A;  2GHB A;  2Q89 A;  1JW5 A;  4JWX A;  4PET A;  1MY2 A;  4OFJ A;  1XVY A;  4NED A;  1P1U A;  1LST A;  4KQP A;  3TTK A;  3N26 A;  4UAC A;  1NNK A;  3TCH A;  1B51 A;  3B6W A;  5FHN A;  1A7L A;  4ELP A;  1FQB A;  4DCX A;  2ONS A;  3GXA A;  1GR2 A;  1BTJ A;  5K2Y A;  3QYT A;  3GLB A;  4MBP A;  2DWH A;  3DP6 A;  2GHA A;  2GRV A;  4IO7 A;  3C36 A;  1D4N A;  4ZEC A;  3JV9 A;  2A5T A;  4RYA A;  3EHS A;  3USD A;  3TYH A;  1US5 A;  1FQD A;  1WVJ A;  3S9M C;  2ZYO A;  3EQ1 A;  4P11 A;  3I3V A;  5ISU A;  1MXZ A;  3O6H A;  3OSR A;  1N7X A;  4LZ5 A;  2ZYN A;  1T0K A;  2OJT A;  2OWS A;  1MXW A;  2XX9 A;  3TAJ A;  1QUJ A;  3K6V A;  4PQJ A;  3E3K A;  5I57 A;  1PBQ A;  3OEK A;  4R75 A;  4F3S A;  2F35 A;  5DTB A;  3PPN A;  2O7I A;  3EHU A;  5B70 A;  2AL5 A;  5AE4 A;  3H6T A;  3FD3 A;  3MP1 A;  1MY0 A;  4Q5T A;  4QHQ A;  5LOM A;  1S7Y A;  2VD2 A;  3FJM A;  2XXT A;  1N3X A;  4EXK A;  3C9H A;  1MG1 A;  2QPQ A;  3EF7 A;  2DOJ A;  1GV8 A;  3TEL A;  3S2V A;  1MDQ A;  1SBP A;  1NNF A;  5KZT A;  1I6B A;  1UTB A;  2LAO A;  2H98 A;  5L9O A;  1JEU A;  1PC3 A;  2HZL A;  3PPO A;  2XHD A;  2XXH A;  4EF1 A;  1PB9 A;  5IAI A;  1SW5 A;  3M8U A;  2FNC A;  4POX A;  2QS4 A;  5I2K B;  4PFW A;  3CSB A;  1EU8 A;  2F6P A;  4R2F A;  3VDF A;  3JYR A;  1JVX A;  4NMY A;  2Z8E A;  4O3C A;  5H8F B;  1O64 A;  3K02 A;  3FXR A;  2QS1 A;  3H6W A;  4NF6 B;  2ONR A;  2Y7W A;  4JDF A;  2HEU A;  3RT8 A;  3CI8 A;  1FTM A;  1B4Z A;  2XX7 A;  4GWO A;  2ZYM A;  3TDJ A;  1QUL A;  1B5H A;  4GOT A;  3GBB A;  1MQD A;  4F1V A;  5ICT A;  1H44 A;  3TKD A;  1BP5 A;  3PGF A;  5EHM A;  4YB5 A;  3CFX A;  1IXI A;  3VLW A;  1TWY A;  4AB5 A;  1I6A A;  2QS3 A;  1MM7 A;  3PMW A;  1P1O A;  4FED A;  5EYF A;  4ZZE A;  5H8H A;  3RQT A;  1IXC A;  2UYF A;  4F18 A;  2FA7 A;  4JB7 A;  5I59 A;  4O3B A;  4H5G A;  3P7I A;  4YAH X;  2WKY A;  3WAE A;  1B32 A;  1FQE A;  2IEE A;  3ONM A;  4U4S A;  3RY3 A;  4ELO A;  2RC7 A;  4EUO A;  3S9L C;  5DT6 A;  3O6I A;  4GFR A;  3CSG A;  3PUW E;  3PD8 A;  1MDP 1;  4KD5 A;  3LSF B;  3H6U A;  3MAM A;  1B58 A;  2A5T B;  3HPI A;  1Z7M E;  3TTN A;  4OEU A;  4NF5 A;  5H8S A;  3MZ9 A;  4YU0 A;  4E0X A;  1JEV A;  3SER A;  5ITP A;  1S9T A;  3C35 A;  3RTW B;  2X7Q A;  1OLC A;  1GGG A;  1VE4 A;  4GLI A;  1M5B A;  2H9B A;  3LR1 A;  1QVS A;  3DP8 A;  4POW A;  3KFM A;  3K01 A;  3U72 A; 
#chains in the Genus database with same CATH topology
 4ELQ A;  2V84 A;  2ZXT A;  3B7D A;  3K6U A;  3TEP A;  1O7T A;  3N6U A;  5I57 B;  1XI6 A;  5KCJ B;  4EF2 A;  4N8G A;  3MVY A;  1JVY A;  1H45 A;  3N94 A;  2HAU A;  3CG1 A;  2O69 A;  3VVD A;  2O7U A;  5JEI A;  3IR1 A;  3MWB A;  3UGW A;  4DDD A;  4GRK A;  2XXK A;  1QUK A;  2Q8M A;  5AA2 B;  3ILU B;  3FVG A;  3HST A;  1B46 A;  2XXW A;  3QAX A;  1KA0 A;  4XKQ A;  4G68 B;  3K0V A;  3RPL B;  5DEX A;  4H0W A;  5I56 B;  3ZKK A;  4PBQ A;  3PPQ A;  1YPN A;  3MVW A;  1N84 A;  5I84 A;  1IMB A;  4OXV A;  4ONY A;  4OZ9 A;  2O51 A;  4WKM A;  3C4M A;  4RK2 A;  4EQB A;  5KDT A;  1UTB B;  4ECF A;  3DLN A;  2B4L A;  2F78 A;  2UVJ A;  2Z8D A;  5L8D A;  5JTY B;  1II5 A;  1DPP A;  2XXV A;  1IMF A;  4QSC A;  5A5X A;  1FQF A;  4U4X A;  1B3G A;  4LN5 A;  1URG A;  1MH3 A;  5HPQ A;  3UOR A;  2DXR A;  2QVV A;  2XX8 A;  3O9P A;  1FTK A;  3CFL A;  3MPL A;  4F31 B;  2HXW A;  3OEL A;  2RC9 A;  3V8X B;  2PVU A;  2OK2 A;  4RNS A;  1NMU A;  3HHG A;  4U22 A;  5H8Q B;  4GWX A;  3U1O A;  3D4G A;  2UYE A;  4OMB A;  4K3F A;  2R71 A;  1MQJ A;  4JVI A;  1FBP A;  4G8M A;  3IO6 A;  3IX1 A;  3AXF A;  2DQV A;  2VD3 A;  4PGP A;  4QBA A;  1FJ6 A;  5CMC A;  4X1B A;  4PGN A;  2NUV A;  1F9B A;  3BKI B;  1TT1 A;  1INP A;  3B8B A;  3N5L A;  4QXD A;  4THI A;  1PBP A;  4M1V A;  4O3A A;  1NV1 A;  1JW1 A;  3E79 A;  1Y3P A;  2QS2 A;  3IB2 A;  1NFT A;  5I59 B;  2Z22 A;  4U1O A;  4N8Y A;  1P1N A;  1VFD A;  1A8F A;  4N15 A;  1B05 A;  4DXC A;  3SEU A;  3RNN A;  2B3F A;  4GIZ A;  4QFP A;  4KFQ A;  3KZG A;  4FAJ A;  2O6A A;  3C34 A;  2CZL A;  5TP9 B;  2F7A A;  5T3J A;  2I48 A;  2NOO A;  1H43 A;  1FCK A;  4LVQ A;  5DVI A;  4JSO A;  4TLL B;  3ZSF A;  1FQA A;  1LAX A;  1USY H;  1B5I A;  4ZZA A;  4QFL A;  5HM4 B;  4BDO A;  4P3L A;  3MP6 A;  4MX6 A;  4OFO A;  4R73 A;  4X8R A;  3PD9 A;  5CM6 A;  3G3J A;  2D5W A;  1XT8 A;  2PYY A;  4XIG Q;  5L9S A;  5CBR A;  3FVN A;  4NG7 A;  3ILT B;  3TPA A;  3U92 A;  3IOV A;  1PB7 A;  2OBG A;  2RF1 A;  5ET7 A;  5AA1 A;  3FZV A;  4P9K A;  3OEM A;  4GWW A;  1OQG A;  1LBX A;  5H8N A;  1A99 A;  3SDF A;  3C31 A;  1YXI A;  5CMM A;  2ZNT A;  4GXA A;  4U21 A;  1EZ9 A;  3D1R A;  1B5J A;  4MLV A;  4JXI A;  1ZLQ A;  4TLM B;  1BKA A;  4G2Z A;  1JW4 A;  2Y7I A;  1MQH A;  3LV0 A;  2XWO A;  4F3P A;  3VFJ A;  4KYD A;  4OHN A;  1B1X A;  3UN6 A;  2XWI A;  1DBZ A;  5F1Q A;  2ZYK A;  3MC2 A;  1DSN A;  4KCC A;  1VR5 A;  1B7U A;  4AS5 A;  3MBP A;  1ZJL A;  2XXQ A;  3HO7 A;  1B4H A;  2FIE A;  5DEX B;  3U93 A;  5JK4 A;  1DK4 A;  1XVX A;  1JQF A;  1CNQ A;  3OEN A;  3T93 B;  5FTH A;  4HS7 A;  4GD5 A;  1QJM A;  3N6T A;  1A54 A;  1I6Q A;  3VVE A;  4ZEB A;  3PPP A;  4PF8 A;  2OLB A;  3HV1 A;  3H06 B;  1A8E A;  3IOU A;  1B9J A;  4KYE A;  4PFI A;  2RCB A;  3ZS6 A;  2P2A A;  1LCF A;  1UIU A;  4NF4 B;  1L5T A;  2X26 A;  3TFL A;  2F3D A;  5A5L A;  4FEB A;  1DMB A;  3BIG A;  1MQI A;  3MW0 A;  2AL4 A;  4F3B A;  1D9Q A;  2CZK A;  2P1S A;  3O97 A;  1M5D A;  2ALU A;  1LAG E;  3LUZ A;  3MZB A;  1WDN A;  2XXX A;  4FJP A;  1OVB A;  3A3U A;  3H6V A;  1IIW A;  2F3B A;  4UAB A;  3QMF A;  2Q88 A;  2V93 A;  2Y7R A;  1FJ9 A;  1SW2 A;  1Q9D A;  2F34 A;  4ZED A;  4OVS A;  2E0S A;  1ELJ A;  1EZO A;  5DW8 A;  4BDR A;  4YIC A;  1SDX A;  2I49 A;  5CI5 A;  3Q27 A;  3O29 A;  4F2O A;  3C32 A;  4DZ1 A;  4RXL A;  5I2N A;  2O84 X;  4OER A;  3IO4 A;  4IB2 A;  5EQ7 A;  3G3G A;  1AH5 A;  2UXA A;  4JWY A;  1OQH A;  4R6H A;  1LBW A;  1Y1M A;  3K6W A;  3CIJ A;  1IQ7 A;  1IIT A;  4OEV A;  2Q9T A;  2UVG A;  2A5S A;  3KSX A;  3MJN A;  5IGA A;  4F39 A;  3H4Z A;  1VSO A;  2V3Q A;  3LSX A;  3VE1 B;  3NOH A;  3K4U A;  4MEV A;  1P1Q A;  4GX6 A;  5B7D A;  1UTH A;  1FBD A;  2VPN A;  2XA5 A;  1HSE A;  2I4C A;  3W15 C;  4DCY A;  3R26 A;  3R6U A;  2QL3 A;  3FIR A;  2ZMB A;  2H99 A;  1RKM A;  3OO8 A;  4G8N A;  3B6Q A;  1AL3 A;  4LP2 B;  3JZJ A;  1ZBM A;  1Y4C A;  2CEX A;  4QFK A;  3SEY A;  1NV2 A;  2UVH A;  1XS5 A;  2H5Y A;  4G4P A;  1YCJ A;  1JNF A;  3PPR A;  2V4C A;  2THI A;  3O66 A;  4HE2 A;  2OCU A;  5AA4 A;  3IAZ A;  4RPO A;  4R9F A;  5EQ8 A;  4ND9 A;  2H25 A;  3MZ1 A;  4PAI A;  4AB6 A;  3DP4 A;  2PFY A;  3VXC A;  3CR9 A;  4OVT A;  4GWY A;  4NQ8 A;  4PAF A;  1BK4 A;  3KN8 A;  4H67 A;  1LBC A;  2B65 A;  3VV5 A;  2I0C A;  3MQ9 A;  1IMD A;  3A09 A;  1YTV A;  3KBR A;  2XWV A;  3E78 A;  4N07 A;  4MCO A;  3IOR A;  3LUY A;  2NVU B;  3KOS A;  4PP0 A;  1SYH A;  4LAT A;  4IO3 A;  1URD A;  1IZ1 A;  4IO2 A;  1BIY A;  1FPK A;  3K2D A;  4F1Y A;  1ZKB A;  3TCF A;  4NF8 A;  5I58 A;  3FGS A;  1RYO A;  4TQU Q;  2PMS A;  3PUY E;  2O1M A;  4PC9 A;  1H76 A;  4UA8 A;  3QSL A;  1DPE A;  4MJO A;  4QSD A;  1R9Q A;  3KGC A;  1LFI A;  4FE8 A;  4OVJ A;  1B0L A;  1NH7 A;  3IFA A;  1ZU0 A;  1LLS A;  1EYK A;  1NL5 A;  1AOV A;  1JET A;  4NHB A;  3HN0 A;  4Z7E A;  2D21 A;  4OQO A;  1G0H A;  2B3B A;  4ELR A;  5FHO A;  5BWJ A;  4M4G A;  3IOW A;  4G77 A;  1Y1Z A;  1SYI A;  2DYX A;  4F2Q A;  2V25 A;  2H4I A;  3QUJ A;  4EQ9 A;  3KJ7 A;  2KQZ A;  1R9L A;  1UIV A;  4PAK A;  2ANJ A;  2Z23 A;  3VXB A;  1D9Y A;  3PU5 A;  4JBZ A;  1NUW A;  3L6G A;  4OEN A;  4C1T A;  1FBC A;  3T9V A;  2Y84 A;  4LON B;  1K9Y A;  2PFZ A;  1GTK A;  4PFU A;  3SET A;  4U1Z A;  1FTL A;  4QFN A;  4DIG A;  1USY E;  2OWT A;  1LGB C;  1ANF A;  1KA1 A;  4Q30 B;  2AYS A;  4HCY A;  4ESW A;  3CRB A;  3T9U A;  3A3C A;  1R6Z A;  2Q74 A;  1NV5 A;  3G3F A;  4ZEK A;  5CMK A;  5IZ1 A;  3MYU A;  1SW4 A;  2PX1 A;  2P0S A;  2WYP A;  4KCD A;  4I8C A;  1Y3Q A;  1MPC A;  1QUI A;  3RLF E;  1RDX A;  4N4U A;  5DVJ A;  4RJZ A;  4FBP A;  5K2X A;  5J16 A;  1YAE A;  3QXM A;  4NGU A;  3L6H A;  3LSL A;  1NI9 A;  2O68 A;  4ZEF A;  5CC2 A;  3D4C A;  3G3K A;  2I6E A;  3O2A A;  2HAV A;  4YB7 A;  1HSL A;  2HHM A;  4P56 A;  4GX3 A;  1AMF A;  1MY1 A;  2F7C A;  3OO6 A;  3MUQ A;  4H8J A;  1B40 A;  3U8Q A;  5ET6 A;  4QRZ A;  2R8T A;  1FBF A;  2PBW A;  3VLV A;  2F8D A;  4G8H A;  4MH5 A;  3FXU A;  3QUF A;  2WBB A;  2I58 A;  3KEI A;  1AIV A;  2DDK A;  2KLF A;  2R6G E;  4PBH A;  4BDN A;  2GQ1 A;  2PT1 A;  4Z0I A;  2HCA A;  2NWJ A;  1N0T A;  2IA4 A;  5F7V A;  1B3L A;  1LFH A;  1MXU A;  4C0R A;  3FUZ A;  1TXF A;  3KC0 A;  3B6T A;  4MNC A;  4I1D A;  5AA4 B;  2DWA A;  3THI A;  1NNT A;  2XD2 A;  2F97 A;  1SQY A;  5H8H B;  3QK6 A;  1Y9U A;  5ELV A;  4OYV A;  2E1S A;  4ZS9 A;  3E13 X;  5LTC A;  3ODB A;  2Q8J A;  5DYH A;  3O28 A;  5TPA A;  4NF6 A;  4AS4 A;  4F1U A;  3EPE A;  2I0B A;  4YKJ A;  4MFI A;  3KC1 A;  4PFR A;  4IY6 A;  2HQ0 A;  2Y7P A;  2F5X A;  1PDA A;  1RYX A;  4YMA A;  3A29 A;  2DP8 A;  3FVK A;  2AIX A;  3LSW A;  4Q0C A;  4LQ5 A;  1DTZ A;  3VVF A;  3UP9 A;  4KI0 E;  4IR8 A;  4PFT A;  3Q26 A;  4NF8 B;  3C33 A;  1M5C A;  1POY 1;  1ZMG A;  1IXG A;  2REG A;  4NF5 B;  3T22 A;  3KOT A;  4GBV A;  3Q28 A;  2BJI A;  2M8C A;  3WAF A;  4BDM A;  2WYK A;  1Y4T A;  4JSD A;  3OD7 A;  2ZZX A;  4HCW A;  4YKK A;  3DM0 A;  4N6K A;  1TFA A;  4FAT A;  3MVZ A;  1QGX A;  4GX4 A;  3H03 A;  2RC8 A;  1HSJ A;  3HHF A;  3M3F A;  4G61 A;  2PT2 A;  1B1H A;  5M2V A;  1B7H A;  5AA3 A;  3FV1 A;  3CFZ A;  3OOA A;  2HXR A;  1MXV A;  1LAF E;  2ONK E;  4XKR A;  2VP1 A;  2NXO A;  2CZI A;  1J1N A;  2F7B A;  5FHM A;  4OFL A;  5L9M A;  3G3H A;  3IJO B;  3FVO A;  2VHA A;  3IL1 B;  4EDP A;  3V83 A;  1NKX A;  3IK6 B;  4ZDM A;  3TOD A;  1R1N A;  2QVR A;  4AQ4 A;  1IMC A;  2G29 A;  3H3G A;  3ZKL A;  2PCR A;  2FVZ A;  4IY5 A;  4N6D A;  4EQ7 A;  4PDD A;  5ICQ A;  5KDT B;  4OWD A;  3S4U A;  1TFD A;  2RKM A;  1B0H A;  2YJP A;  3E9X A;  4O8M A;  1LFG A;  3CG3 A;  3IB0 A;  1B6H A;  4OTE A;  1FPG A;  3K6X A;  3SEW A;  5FBP A;  1URS A;  5KCJ A;  5A5X B;  4DXB A;  4TOZ A;  3BFU A;  1A40 A;  5TU0 A;  3T9H B;  3TTM A;  1MS7 A;  1Y3N A;  3EKI A;  2GFE A;  3SEV A;  4GWZ A;  2OZZ A;  4F3G A;  1MPB A;  2QJE A;  5AA2 A;  1NV0 A;  4GQO A;  3KN7 A;  4R72 A;  4BDL A;  1MQG A;  1OIB A;  4G68 A;  4NF0 A;  2X7P A;  3TMG A;  4GWU A;  5HBC A;  4RK9 A;  4ZE9 A;  2XXI A;  4I3Y A;  4YMB A;  2Y5L A;  3G7W A;  5I56 A;  3MST A;  1BLF A;  1DOT A;  3FAT A;  1Y20 A;  1IXH A;  1N76 A;  3FXQ A;  1EH3 A;  1NV4 A;  5AA2 D;  1YYZ A;  2V3T A;  3PV0 E;  1MXY A;  5FTI A;  1KWH A;  1YZ0 A;  2DXY A;  4EXL A;  1FTO A;  2XXR A;  3TTL A;  1US4 A;  4GXS B;  1NV7 A;  5JTY A;  2OX3 A;  4HTG A;  1N04 A;  3GBA A;  3PMX A;  1H3D A;  1IUD A;  1D9V A;  1EYI A;  3M3L A;  2UVI A;  4NTL A;  4XF5 A;  4I40 A;  4XFE A;  1B52 A;  3PUV E;  4JVC A;  4Q8R A;  4OVP A;  2R9J A;  1FW0 A;  1B2H A;  3VLU A;  1MY3 A;  4OVQ A;  4FIM A;  2QSX A;  3OMB A;  3F11 A;  4I62 A;  2Y7K A;  3K1P A;  4U2R A;  4L17 A;  4GF8 A;  2VOZ A;  3CVG A;  5TPA B;  3S9E A;  1NUZ A;  3FV2 A;  3BFT A;  1MM6 A;  1NV6 A;  4X1D A;  5I5P A;  1CE2 A;  5H8Q A;  3CHG A;  4FEC A;  1SW1 A;  3ECR A;  2XXP A;  1PB8 A;  4GL8 A;  4LZ8 A;  4N6P A;  4ZE8 A;  3KBZ A;  4BDQ A;  3PUX E;  1B3F A;  1K9Z A;  2XXY A;  4H8I A;  3IFC A;  3TQL A;  4P0I A;  4DE8 A;  1QW0 A;  1MPD A;  4KR5 A;  5CBS A;  3G3I A;  3QIM A;  4YKP A;  3LC8 A;  4X04 A;  4KHZ E;  1M5E A;  4IO4 A;  1ZTY A;  4WED A;  3KJT A;  3RT6 B;  3I5O A;  3OO7 A;  5IKB A;  3FJ7 A;  2YPN A;  2MKZ A;  1FPL A;  5H8N B;  2DWJ A;  4LA9 A;  5EHS A;  1JP4 A;  4GVO A;  3KSJ A;  5CMB A;  4MNP A;  2XD3 A;  2Y5K A;  4H6D A;  4LZ7 A;  2ESN A;  3M3K A;  4HXV A;  4YKI A;  5ITO A;  1IMA A;  3TTR A;  1SD3 A;  2GH9 A;  2VGQ A;  1G0I A;  2Q2A A;  1XC1 A;  2YLN A;  4PTK A;  5TP9 A;  3MPK A;  2VT5 A;  3V5A A;  5CRY A;  4JWO A;  4DXU A;  3KG2 A;  4R6K A;  2DE2 A;  3MVX A;  4R74 A;  4NAP A;  4PF6 A;  4QF9 A;  4DI3 D;  3OXN A;  3IOT A;  1M5F A;  3TZA A;  2CMO A;  2DSF A;  4ESX A;  4FOR A;  1MY4 A;  4IGT A;  1QKA A;  3W9W A;  2JJK A;  3U94 A;  2L5V A;  3HCQ A;  4H5F A;  2F36 A;  3SZP A;  2I4B A;  2Z8F A;  1UQW A;  2DWI A;  4RA1 A;  3LBS A;  4MMP A;  4R2B A;  1FPF A;  3RGY A;  1VFE A;  1Q1K A;  2ABH A;  4BLA A;  1S50 A;  1DTG A;  4N13 A;  3W9V A;  2DVC A;  2WEF A;  1MH4 A;  4O7I A;  3FAS A;  1D3K A;  4H65 A;  4R6Y A;  4XKN A;  3PMV A;  1FTJ A;  3E4R A;  4NN3 A;  3R7X A;  3TQW A;  2F6G A;  4NWD A;  3Q25 A;  1OMP A;  5I7I A;  4ISU A;  4H45 A;  2V3U A;  5EQA A;  1OVT A;  2DE4 A;  4X48 A;  1PEB A;  2B4M A;  5EYH A;  1POT A;  1N3W A;  4MIJ A;  3IJX B;  4DI4 B;  3O6G A;  3T66 A;  3UIF A;  4C1U A;  3SES A;  2REJ A;  2QMX A;  4U23 A;  3SEX A;  3T1B A;  3I6V A;  1LBB A;  1MXX A;  2G93 A;  4PE5 B;  2DS9 A;  2O1L A;  4MF3 A;  5J1D A;  1XOC A;  3BBR A;  4N91 A;  5DVF A;  4YB6 A;  4I9D A;  1P1W A;  2I3V A;  2FYI A;  4QFO A;  1FQC A;  3K00 A;  4HW8 A;  1O63 A;  1ATG A;  2HFB A;  4G68 C;  1NH8 A;  4NE4 A;  4OES A;  1OLA A;  4RY1 A;  1SPI A;  3RTF B;  3SKP A;  3Q29 A;  4XTC Q;  5I2N B;  4F29 A;  1B7Z A;  1FBE A;  1FPE A;  3PUZ E;  1GVC A;  4WEP A;  4NF4 A;  2HPG A;  2ZNS A;  4IO6 A;  1ZIU A;  1MRP A;  3DEL B;  2XXU A;  4XXU A;  1LCT A;  1I69 A;  1FTA A;  3EN3 A;  3H7M A;  2BJJ X;  4PE3 A;  1EYJ A;  3T96 B;  4OET A;  1SI0 A;  3K1M A;  4LUB A;  4F19 A;  1LB9 A;  4R9G A;  1UTH B;  1FPD A;  4P0G A;  1B3E A;  4P8B A;  1LB8 A;  2QVU A;  1SVX B;  4PFY A;  4F22 A;  2FHY A;  2P3N A;  4O94 A;  2ZNU A;  4PCD A;  1Z7N E;  1VDW A;  4MLQ A;  3OSQ A;  4YZZ A;  1P99 A;  4ZEI A;  1WOD A;  2ZZV A;  4LQ2 A;  3UK4 A;  3UA8 A;  1IME A;  4IGR A;  3IB1 A;  4XKP A;  4QSE A;  1EZP A;  5BUU A;  4DLD A;  1LAH E;  5I2K A;  3KN3 A;  1FPI A;  2QRY A;  1FBH A;  3RN8 A;  2I3W A;  3TUS A;  3T9X B;  3OO9 A;  2RCA A;  4WXJ A;  1CB6 A;  2D3I A;  3RYD A;  4H1X A;  5H8F A;  4P1L A;  1SI1 A;  4PFB A;  3TCG A;  4E0W A;  3S9N C;  1QKB A;  1A55 A;  3EHT A;  1NNP A;  2FBP A;  4KYS A;  4XEQ A;  2DE3 A;  2RIN A;  1XHY A;  4GWS A;  2OWZ A;  3RUM A;  1N7W A;  2QMW A;  4RPN A;  1IEJ A;  2Q2C A;  1B3H A;  3GZG A;  4IO5 A;  5IM2 A;  4KPT A;  3V89 B;  2W7Y A;  5I58 B;  1Q35 A;  3FJG A;  4NWC A;  3RPW A;  3K1N A;  3MP8 A;  4X9T A;  2DVZ A;  4GL0 A;  2WX9 A;  2CEY A;  4HE1 A;  1LBY A;  2GHB A;  2HZK A;  2Q89 A;  1JW5 A;  4JWX A;  4PET A;  1MY2 A;  4OFJ A;  4MNI A;  1XVY A;  4NED A;  1P1U A;  1LST A;  4KQP A;  3TTK A;  4I3E A;  1FRP A;  3N26 A;  4UAC A;  1NNK A;  4NX1 A;  3TCH A;  1B51 A;  1KZ8 A;  3B6W A;  5FHN A;  1A7L A;  4ELP A;  1FQB A;  4DCX A;  2ONS A;  3GXA A;  4OAN A;  1GR2 A;  1BTJ A;  4O7M A;  5K2Y A;  3QYT A;  3GLB A;  4MBP A;  4JVD A;  2DWH A;  3DP6 A;  2GHA A;  2GRV A;  4IO7 A;  3C36 A;  1D4N A;  4ZEC A;  3JV9 A;  2A5T A;  4RYA A;  3EHS A;  5IZ3 A;  3USD A;  3TYH A;  4H46 A;  1US5 A;  5I3S A;  1FQD A;  1WVJ A;  3S9M C;  2ZYO A;  3EQ1 A;  4P11 A;  3I3V A;  2QFL A;  5ISU A;  1MXZ A;  3O6H A;  3OSR A;  1N7X A;  4LZ5 A;  5EYG A;  3BIH A;  2ZYN A;  1T0K A;  1RDY A;  2OJT A;  2OWS A;  1MXW A;  1AWB A;  2XX9 A;  1NUY A;  5ESY A;  3TAJ A;  1QUJ A;  3K6V A;  4PQJ A;  4N17 A;  3E3K A;  5I57 A;  1PBQ A;  5F24 A;  3OEK A;  4R75 A;  4F3S A;  4OVR A;  2F35 A;  3PTY A;  5DTB A;  3PPN A;  2O7I A;  3EHU A;  5B70 A;  2AL5 A;  5AE4 A;  3H6T A;  3FD3 A;  3MP1 A;  1MY0 A;  4Q5T A;  4QHQ A;  1RDZ A;  5LOM A;  1S7Y A;  3RPL A;  1LBZ A;  2VD2 A;  3FJM A;  2XXT A;  1N3X A;  5ET5 A;  3C9H A;  4EXK A;  1MG1 A;  2QPQ A;  3EF7 A;  2DOJ A;  1GV8 A;  3TEL A;  3S2V A;  1MDQ A;  1SBP A;  1NNF A;  5KZT A;  1I6B A;  1NV3 A;  1UTB A;  3ISP A;  2LAO A;  2H98 A;  1FPB A;  5L9O A;  1JEU A;  1PC3 A;  2HZL A;  3U65 A;  3PPO A;  2XHD A;  2XXH A;  4EF1 A;  1PB9 A;  5IAI A;  1SW5 A;  3M8U A;  4MHF A;  2FNC A;  4N81 A;  3T0J A;  5LDZ A;  4POX A;  2QS4 A;  5I2K B;  4PFW A;  3CSB A;  1EU8 A;  2F6P A;  4R2F A;  4GBW A;  3VDF A;  3JYR A;  1JVX A;  4NMY A;  2Z8E A;  4O3C A;  3FXB A;  1O64 A;  5H8F B;  3K02 A;  3FXR A;  2QS1 A;  3H6W A;  4NF6 B;  2ONR A;  2ZZW A;  2Y7W A;  4JDF A;  2HEU A;  3RT8 A;  3CI8 A;  1FTM A;  2VPO A;  1B4Z A;  2XX7 A;  4GWO A;  2ZYM A;  4OA4 A;  3TDJ A;  1QUL A;  1B5H A;  4GOT A;  3GBB A;  3B50 A;  1MQD A;  4F1V A;  5ICT A;  1H44 A;  3TKD A;  4HE0 A;  3GYY A;  4MAG A;  2FIX A;  1BP5 A;  3PGF A;  5EHM A;  4YB5 A;  3CFX A;  5ET8 A;  1IXI A;  3VLW A;  1TWY A;  1FBG A;  4AB5 A;  1I6A A;  2QS3 A;  3FBP A;  1MM7 A;  3PMW A;  1P1O A;  4FED A;  5EYF A;  4P47 A;  2CZH A;  4ZZE A;  5H8H A;  3RQT A;  1IXC A;  4KXP A;  1LBV A;  2UYF A;  4F18 A;  2FA7 A;  4JB7 A;  4PDH A;  5I59 A;  4O3B A;  4H5G A;  3P7I A;  4YAH X;  2WKY A;  3WAE A;  1B32 A;  1FQE A;  2IEE A;  3ONM A;  2WBD A;  4U4S A;  3RY3 A;  4ELO A;  2RC7 A;  4EUO A;  3S9L C;  5DT6 A;  5EQ9 A;  3O6I A;  1DCU A;  4GFR A;  1NUX A;  3HFU A;  3CSG A;  3PUW E;  3PD8 A;  1MDP 1;  2XWK A;  4KD5 A;  3LSF B;  3H6U A;  5IZZ A;  3MAM A;  1B58 A;  2A5T B;  3HPI A;  5IZ3 B;  1FPJ A;  2KR0 A;  1Z7M E;  3TTN A;  4OEU A;  3ROJ A;  4NF5 A;  5H8S A;  3MZ9 A;  4YU0 A;  4E0X A;  1JEV A;  3SER A;  5ITP A;  1FSA A;  1S9T A;  3C35 A;  3RTW B;  2X7Q A;  1OLC A;  1GGG A;  1VE4 A;  4GLI A;  1M5B A;  2H9B A;  3LR1 A;  1QVS A;  4P1E A;  3DP8 A;  4POW A;  3KFM A;  3K01 A;  2P3V A;  3U72 A;  1LEV A; 
#chains in the Genus database with same CATH homology
 4ELQ A;  2V84 A;  2ZXT A;  3B7D A;  3K6U A;  3TEP A;  1O7T A;  3N6U A;  5I57 B;  5KCJ B;  4EF2 A;  3MVY A;  1JVY A;  1H45 A;  3N94 A;  2HAU A;  3CG1 A;  2O69 A;  3VVD A;  2O7U A;  5JEI A;  3IR1 A;  3MWB A;  3UGW A;  4DDD A;  4GRK A;  1QUK A;  5AA2 B;  3ILU B;  3FVG A;  3HST A;  1B46 A;  2XXW A;  3QAX A;  4XKQ A;  4G68 B;  3K0V A;  5DEX A;  4H0W A;  5I56 B;  3ZKK A;  3PPQ A;  1YPN A;  3MVW A;  1N84 A;  5I84 A;  4OXV A;  4ONY A;  4OZ9 A;  2O51 A;  4WKM A;  3C4M A;  4RK2 A;  4EQB A;  5KDT A;  1UTB B;  4ECF A;  3DLN A;  2F78 A;  2UVJ A;  2Z8D A;  5L8D A;  5JTY B;  1II5 A;  1DPP A;  2XXV A;  4QSC A;  5A5X A;  1FQF A;  4U4X A;  1B3G A;  1URG A;  1MH3 A;  5HPQ A;  3UOR A;  2DXR A;  2XX8 A;  3O9P A;  1FTK A;  3CFL A;  3MPL A;  4F31 B;  2HXW A;  3OEL A;  2RC9 A;  3V8X B;  2PVU A;  2OK2 A;  4RNS A;  1NMU A;  3HHG A;  4U22 A;  5H8Q B;  3U1O A;  3D4G A;  2UYE A;  4K3F A;  4OMB A;  2R71 A;  1MQJ A;  4G8M A;  3IO6 A;  3IX1 A;  3AXF A;  2DQV A;  2VD3 A;  5CMC A;  4X1B A;  2NUV A;  1F9B A;  3BKI B;  1TT1 A;  3N5L A;  4THI A;  1PBP A;  4M1V A;  4O3A A;  1JW1 A;  1Y3P A;  2QS2 A;  3IB2 A;  1NFT A;  5I59 B;  2Z22 A;  4U1O A;  1P1N A;  1VFD A;  1A8F A;  1B05 A;  4DXC A;  3SEU A;  3RNN A;  2B3F A;  4GIZ A;  4QFP A;  4KFQ A;  4FAJ A;  3KZG A;  2O6A A;  3C34 A;  2CZL A;  5TP9 B;  2F7A A;  2I48 A;  2NOO A;  1H43 A;  1FCK A;  4LVQ A;  5DVI A;  4JSO A;  4TLL B;  3ZSF A;  1FQA A;  1LAX A;  1USY H;  1B5I A;  4ZZA A;  4QFL A;  5HM4 B;  4BDO A;  3MP6 A;  4OFO A;  4R73 A;  3PD9 A;  5CM6 A;  3G3J A;  2D5W A;  1XT8 A;  2PYY A;  4XIG Q;  5L9S A;  5CBR A;  3FVN A;  3ILT B;  3TPA A;  3U92 A;  3IOV A;  1PB7 A;  2OBG A;  2RF1 A;  5AA1 A;  3FZV A;  3OEM A;  1OQG A;  5H8N A;  1A99 A;  3SDF A;  3C31 A;  5CMM A;  2ZNT A;  4GXA A;  4U21 A;  1EZ9 A;  1B5J A;  4MLV A;  4JXI A;  1ZLQ A;  4TLM B;  1BKA A;  4G2Z A;  1JW4 A;  2Y7I A;  1MQH A;  4F3P A;  3VFJ A;  4KYD A;  4OHN A;  1B1X A;  3UN6 A;  5F1Q A;  2ZYK A;  3MC2 A;  1DSN A;  4KCC A;  1VR5 A;  1B7U A;  3MBP A;  1ZJL A;  2XXQ A;  3HO7 A;  1B4H A;  5DEX B;  3U93 A;  5JK4 A;  1XVX A;  1JQF A;  3OEN A;  3T93 B;  5FTH A;  4HS7 A;  4GD5 A;  1QJM A;  3N6T A;  1A54 A;  1I6Q A;  3VVE A;  4ZEB A;  3PPP A;  2OLB A;  3HV1 A;  3H06 B;  1A8E A;  3IOU A;  1B9J A;  4KYE A;  2RCB A;  3ZS6 A;  2P2A A;  1LCF A;  1UIU A;  4NF4 B;  1L5T A;  2X26 A;  3TFL A;  4FEB A;  1DMB A;  1MQI A;  3MW0 A;  2AL4 A;  4F3B A;  2P1S A;  3O97 A;  1M5D A;  2ALU A;  1LAG E;  3MZB A;  1WDN A;  2XXX A;  4FJP A;  1OVB A;  3A3U A;  3H6V A;  1IIW A;  2Q88 A;  2V93 A;  2Y7R A;  1SW2 A;  2F34 A;  4ZED A;  2E0S A;  1ELJ A;  1EZO A;  4BDR A;  4YIC A;  1SDX A;  2I49 A;  5CI5 A;  3Q27 A;  3O29 A;  4F2O A;  3C32 A;  4DZ1 A;  4RXL A;  5I2N A;  2O84 X;  4OER A;  3IO4 A;  4IB2 A;  3G3G A;  1AH5 A;  2UXA A;  4JWY A;  1OQH A;  4R6H A;  1Y1M A;  3K6W A;  3CIJ A;  1IQ7 A;  1IIT A;  4OEV A;  2Q9T A;  2UVG A;  2A5S A;  3KSX A;  3MJN A;  4F39 A;  3H4Z A;  1VSO A;  2V3Q A;  3LSX A;  3VE1 B;  3K4U A;  1P1Q A;  5B7D A;  1UTH A;  1HSE A;  2I4C A;  3W15 C;  4DCY A;  3R26 A;  3R6U A;  2QL3 A;  3FIR A;  2ZMB A;  2H99 A;  1RKM A;  3OO8 A;  4G8N A;  3B6Q A;  1AL3 A;  4LP2 B;  3JZJ A;  1ZBM A;  1Y4C A;  4QFK A;  3SEY A;  2UVH A;  1XS5 A;  2H5Y A;  4G4P A;  1YCJ A;  1JNF A;  3PPR A;  2THI A;  3O66 A;  2OCU A;  5AA4 A;  3IAZ A;  4RPO A;  4R9F A;  4ND9 A;  2H25 A;  3MZ1 A;  4AB6 A;  3DP4 A;  3VXC A;  3CR9 A;  3KN8 A;  4H67 A;  1LBC A;  2B65 A;  3VV5 A;  2I0C A;  3MQ9 A;  3A09 A;  1YTV A;  3KBR A;  4N07 A;  3IOR A;  3LUY A;  2NVU B;  3KOS A;  4PP0 A;  1SYH A;  4LAT A;  4IO3 A;  1URD A;  1IZ1 A;  4IO2 A;  1BIY A;  3K2D A;  4F1Y A;  1ZKB A;  3TCF A;  4NF8 A;  5I58 A;  3FGS A;  1RYO A;  4TQU Q;  2PMS A;  3PUY E;  2O1M A;  1H76 A;  4UA8 A;  3QSL A;  1DPE A;  4QSD A;  1R9Q A;  3KGC A;  1LFI A;  4FE8 A;  4OVJ A;  1B0L A;  1NH7 A;  1ZU0 A;  1LLS A;  1AOV A;  1NL5 A;  1JET A;  3HN0 A;  4Z7E A;  2D21 A;  4OQO A;  2B3B A;  4ELR A;  5FHO A;  5BWJ A;  4M4G A;  3IOW A;  4G77 A;  1Y1Z A;  1SYI A;  2DYX A;  4F2Q A;  2V25 A;  2H4I A;  3QUJ A;  4EQ9 A;  3KJ7 A;  1R9L A;  1UIV A;  2ANJ A;  2Z23 A;  3VXB A;  1D9Y A;  3PU5 A;  4JBZ A;  3L6G A;  4OEN A;  4C1T A;  3T9V A;  2Y84 A;  4LON B;  1GTK A;  4PFU A;  3SET A;  4U1Z A;  1FTL A;  4QFN A;  4DIG A;  1USY E;  2OWT A;  1LGB C;  1ANF A;  4Q30 B;  2AYS A;  4HCY A;  4ESW A;  3CRB A;  3T9U A;  3A3C A;  1R6Z A;  3G3F A;  4ZEK A;  5CMK A;  1SW4 A;  2PX1 A;  2P0S A;  4KCD A;  4I8C A;  1Y3Q A;  1MPC A;  1QUI A;  3RLF E;  5DVJ A;  4RJZ A;  5K2X A;  1YAE A;  3QXM A;  3L6H A;  3LSL A;  2O68 A;  4ZEF A;  5CC2 A;  3D4C A;  3G3K A;  2I6E A;  3O2A A;  2HAV A;  4YB7 A;  1HSL A;  1AMF A;  1MY1 A;  2F7C A;  3OO6 A;  3MUQ A;  4H8J A;  1B40 A;  3U8Q A;  4QRZ A;  2PBW A;  3VLV A;  2F8D A;  4G8H A;  4MH5 A;  3FXU A;  3QUF A;  2I58 A;  3KEI A;  1AIV A;  2KLF A;  2R6G E;  4BDN A;  2PT1 A;  4Z0I A;  2HCA A;  2NWJ A;  1N0T A;  2IA4 A;  5F7V A;  1B3L A;  1LFH A;  1MXU A;  4C0R A;  3FUZ A;  1TXF A;  3B6T A;  4I1D A;  5AA4 B;  2DWA A;  3THI A;  1NNT A;  2XD2 A;  2F97 A;  1SQY A;  5H8H B;  3QK6 A;  1Y9U A;  5ELV A;  4OYV A;  2E1S A;  4ZS9 A;  3E13 X;  3ODB A;  2Q8J A;  5DYH A;  3O28 A;  5TPA A;  4NF6 A;  4F1U A;  3EPE A;  2I0B A;  4YKJ A;  4MFI A;  4IY6 A;  2HQ0 A;  2Y7P A;  2F5X A;  1PDA A;  1RYX A;  4YMA A;  2DP8 A;  3FVK A;  2AIX A;  3LSW A;  4Q0C A;  4LQ5 A;  1DTZ A;  3VVF A;  3UP9 A;  4KI0 E;  4PFT A;  3Q26 A;  4NF8 B;  3C33 A;  1M5C A;  1POY 1;  1ZMG A;  1IXG A;  2REG A;  4NF5 B;  3T22 A;  3KOT A;  3Q28 A;  2M8C A;  3WAF A;  4BDM A;  1Y4T A;  4JSD A;  3OD7 A;  4HCW A;  4YKK A;  3DM0 A;  1TFA A;  4FAT A;  3MVZ A;  3H03 A;  2RC8 A;  1HSJ A;  3HHF A;  3M3F A;  2PT2 A;  1B1H A;  5M2V A;  1B7H A;  5AA3 A;  3FV1 A;  3CFZ A;  3OOA A;  1MXV A;  1LAF E;  2ONK E;  4XKR A;  2VP1 A;  2NXO A;  1J1N A;  5FHM A;  2F7B A;  4OFL A;  5L9M A;  3G3H A;  3IJO B;  3FVO A;  2VHA A;  3IL1 B;  4EDP A;  3V83 A;  1NKX A;  3IK6 B;  4ZDM A;  3TOD A;  1R1N A;  4AQ4 A;  2G29 A;  3H3G A;  3ZKL A;  4IY5 A;  4EQ7 A;  5ICQ A;  5KDT B;  4OWD A;  3S4U A;  1TFD A;  2RKM A;  1B0H A;  2YJP A;  3E9X A;  1LFG A;  3CG3 A;  3IB0 A;  1B6H A;  4OTE A;  3K6X A;  3SEW A;  1URS A;  5KCJ A;  5A5X B;  4DXB A;  4TOZ A;  3BFU A;  1A40 A;  5TU0 A;  3T9H B;  3TTM A;  1MS7 A;  1Y3N A;  2GFE A;  3SEV A;  2OZZ A;  4F3G A;  1MPB A;  2QJE A;  5AA2 A;  4GQO A;  3KN7 A;  4R72 A;  4BDL A;  1MQG A;  1OIB A;  4G68 A;  2X7P A;  3TMG A;  5HBC A;  4RK9 A;  4ZE9 A;  2XXI A;  4YMB A;  3G7W A;  5I56 A;  1BLF A;  1DOT A;  3FAT A;  1Y20 A;  1IXH A;  1N76 A;  3FXQ A;  1EH3 A;  5AA2 D;  2V3T A;  3PV0 E;  1MXY A;  5FTI A;  1KWH A;  2DXY A;  4EXL A;  1FTO A;  2XXR A;  3TTL A;  1US4 A;  4GXS B;  5JTY A;  4HTG A;  1N04 A;  3GBA A;  3PMX A;  1H3D A;  1IUD A;  1D9V A;  3M3L A;  2UVI A;  4NTL A;  1B52 A;  3PUV E;  4Q8R A;  2R9J A;  1FW0 A;  1B2H A;  3VLU A;  1MY3 A;  4FIM A;  2QSX A;  3OMB A;  3F11 A;  4I62 A;  2Y7K A;  3K1P A;  4U2R A;  4L17 A;  2VOZ A;  3CVG A;  4GF8 A;  5TPA B;  3S9E A;  3FV2 A;  3BFT A;  1MM6 A;  4X1D A;  1CE2 A;  5H8Q A;  4FEC A;  1SW1 A;  3ECR A;  2XXP A;  1PB8 A;  4GL8 A;  4LZ8 A;  4N6P A;  4ZE8 A;  4BDQ A;  3PUX E;  1B3F A;  2XXY A;  4H8I A;  3TQL A;  4P0I A;  4DE8 A;  1QW0 A;  1MPD A;  4KR5 A;  5CBS A;  3G3I A;  3QIM A;  4YKP A;  3LC8 A;  4KHZ E;  1M5E A;  4IO4 A;  1ZTY A;  4WED A;  3KJT A;  3RT6 B;  3I5O A;  3OO7 A;  5IKB A;  3FJ7 A;  2YPN A;  5H8N B;  2DWJ A;  4LA9 A;  5EHS A;  4GVO A;  3KSJ A;  5CMB A;  2XD3 A;  4H6D A;  4LZ7 A;  2ESN A;  3M3K A;  4YKI A;  5ITO A;  3TTR A;  1SD3 A;  2GH9 A;  2VGQ A;  2Q2A A;  1XC1 A;  2YLN A;  5TP9 A;  3MPK A;  3V5A A;  5CRY A;  4JWO A;  4DXU A;  3KG2 A;  4R6K A;  2DE2 A;  3MVX A;  4R74 A;  4QF9 A;  3OXN A;  3IOT A;  1M5F A;  3TZA A;  2CMO A;  2DSF A;  4ESX A;  4FOR A;  1MY4 A;  4IGT A;  1QKA A;  3W9W A;  3U94 A;  3HCQ A;  4H5F A;  2F36 A;  2I4B A;  2Z8F A;  1UQW A;  2DWI A;  4RA1 A;  3LBS A;  4R2B A;  3RGY A;  1VFE A;  1Q1K A;  2ABH A;  4BLA A;  1S50 A;  1DTG A;  4N13 A;  3W9V A;  2DVC A;  1MH4 A;  3FAS A;  1D3K A;  4H65 A;  4R6Y A;  4XKN A;  3PMV A;  1FTJ A;  3E4R A;  3R7X A;  3TQW A;  2F6G A;  4NWD A;  3Q25 A;  1OMP A;  4ISU A;  2V3U A;  1OVT A;  2DE4 A;  4X48 A;  1PEB A;  1POT A;  1N3W A;  3IJX B;  3O6G A;  3T66 A;  3UIF A;  4C1U A;  3SES A;  2REJ A;  2QMX A;  4U23 A;  3SEX A;  3I6V A;  1LBB A;  1MXX A;  2G93 A;  4PE5 B;  2DS9 A;  2O1L A;  4MF3 A;  5J1D A;  1XOC A;  3BBR A;  5DVF A;  4YB6 A;  4I9D A;  1P1W A;  2I3V A;  2FYI A;  4QFO A;  1FQC A;  3K00 A;  4HW8 A;  1O63 A;  1ATG A;  2HFB A;  4G68 C;  1NH8 A;  4NE4 A;  4OES A;  1OLA A;  4RY1 A;  3RTF B;  3SKP A;  3Q29 A;  4XTC Q;  5I2N B;  4F29 A;  1B7Z A;  3PUZ E;  1GVC A;  4WEP A;  4NF4 A;  2ZNS A;  4IO6 A;  1ZIU A;  1MRP A;  3DEL B;  2XXU A;  4XXU A;  1LCT A;  1I69 A;  3EN3 A;  3H7M A;  2BJJ X;  3T96 B;  4OET A;  1SI0 A;  3K1M A;  4LUB A;  4F19 A;  1LB9 A;  4R9G A;  1UTH B;  4P0G A;  1B3E A;  1LB8 A;  1SVX B;  4PFY A;  4F22 A;  2ZNU A;  1Z7N E;  4MLQ A;  3OSQ A;  4YZZ A;  1P99 A;  4ZEI A;  1WOD A;  4LQ2 A;  3UK4 A;  3UA8 A;  4IGR A;  3IB1 A;  4XKP A;  4QSE A;  1EZP A;  5BUU A;  4DLD A;  1LAH E;  5I2K A;  3KN3 A;  2QRY A;  3RN8 A;  2I3W A;  3TUS A;  3T9X B;  3OO9 A;  2RCA A;  4WXJ A;  1CB6 A;  2D3I A;  5H8F A;  4H1X A;  1SI1 A;  3TCG A;  4E0W A;  3S9N C;  1QKB A;  1A55 A;  3EHT A;  1NNP A;  4KYS A;  2DE3 A;  2RIN A;  1XHY A;  3RUM A;  1N7W A;  2QMW A;  4RPN A;  1IEJ A;  2Q2C A;  1B3H A;  3GZG A;  4IO5 A;  3V89 B;  4KPT A;  2W7Y A;  5I58 B;  1Q35 A;  3FJG A;  4NWC A;  3RPW A;  3K1N A;  3MP8 A;  4X9T A;  2DVZ A;  4GL0 A;  2HZK A;  2GHB A;  2Q89 A;  1JW5 A;  4JWX A;  4PET A;  1MY2 A;  4OFJ A;  1XVY A;  4NED A;  1P1U A;  1LST A;  4KQP A;  3TTK A;  3N26 A;  4UAC A;  1NNK A;  3TCH A;  1B51 A;  3B6W A;  5FHN A;  1A7L A;  4ELP A;  1FQB A;  4DCX A;  2ONS A;  3GXA A;  1GR2 A;  1BTJ A;  5K2Y A;  3QYT A;  3GLB A;  4MBP A;  2DWH A;  3DP6 A;  2GHA A;  2GRV A;  4IO7 A;  3C36 A;  1D4N A;  4ZEC A;  3JV9 A;  2A5T A;  4RYA A;  3EHS A;  3USD A;  3TYH A;  1US5 A;  1FQD A;  1WVJ A;  3S9M C;  2ZYO A;  3EQ1 A;  4P11 A;  3I3V A;  5ISU A;  1MXZ A;  3O6H A;  3OSR A;  1N7X A;  4LZ5 A;  2ZYN A;  1T0K A;  2OJT A;  2OWS A;  1MXW A;  2XX9 A;  3TAJ A;  1QUJ A;  3K6V A;  4PQJ A;  3E3K A;  5I57 A;  1PBQ A;  3OEK A;  4R75 A;  4F3S A;  2F35 A;  5DTB A;  3PPN A;  2O7I A;  3EHU A;  5B70 A;  2AL5 A;  5AE4 A;  3H6T A;  3FD3 A;  3MP1 A;  1MY0 A;  4Q5T A;  4QHQ A;  5LOM A;  1S7Y A;  2VD2 A;  3FJM A;  2XXT A;  1N3X A;  4EXK A;  3C9H A;  1MG1 A;  2QPQ A;  3EF7 A;  2DOJ A;  1GV8 A;  3TEL A;  3S2V A;  1MDQ A;  1SBP A;  1NNF A;  5KZT A;  1I6B A;  1UTB A;  2LAO A;  2H98 A;  5L9O A;  1JEU A;  1PC3 A;  2HZL A;  3PPO A;  2XHD A;  2XXH A;  4EF1 A;  1PB9 A;  5IAI A;  1SW5 A;  3M8U A;  2FNC A;  4POX A;  2QS4 A;  5I2K B;  4PFW A;  3CSB A;  1EU8 A;  2F6P A;  4R2F A;  3VDF A;  3JYR A;  1JVX A;  4NMY A;  2Z8E A;  4O3C A;  5H8F B;  1O64 A;  3K02 A;  3FXR A;  2QS1 A;  3H6W A;  4NF6 B;  2ONR A;  2Y7W A;  4JDF A;  2HEU A;  3RT8 A;  3CI8 A;  1FTM A;  1B4Z A;  2XX7 A;  4GWO A;  2ZYM A;  3TDJ A;  1QUL A;  1B5H A;  4GOT A;  3GBB A;  1MQD A;  4F1V A;  5ICT A;  1H44 A;  3TKD A;  1BP5 A;  3PGF A;  5EHM A;  4YB5 A;  3CFX A;  1IXI A;  3VLW A;  1TWY A;  4AB5 A;  1I6A A;  2QS3 A;  1MM7 A;  3PMW A;  1P1O A;  4FED A;  5EYF A;  4ZZE A;  5H8H A;  3RQT A;  1IXC A;  2UYF A;  4F18 A;  2FA7 A;  4JB7 A;  5I59 A;  4O3B A;  4H5G A;  3P7I A;  4YAH X;  2WKY A;  3WAE A;  1B32 A;  1FQE A;  2IEE A;  3ONM A;  4U4S A;  3RY3 A;  4ELO A;  2RC7 A;  4EUO A;  3S9L C;  5DT6 A;  3O6I A;  4GFR A;  3CSG A;  3PUW E;  3PD8 A;  1MDP 1;  4KD5 A;  3LSF B;  3H6U A;  3MAM A;  1B58 A;  2A5T B;  3HPI A;  1Z7M E;  3TTN A;  4OEU A;  4NF5 A;  5H8S A;  3MZ9 A;  4YU0 A;  4E0X A;  1JEV A;  3SER A;  5ITP A;  1S9T A;  3C35 A;  3RTW B;  2X7Q A;  1OLC A;  1GGG A;  1VE4 A;  4GLI A;  1M5B A;  2H9B A;  3LR1 A;  1QVS A;  3DP8 A;  4POW A;  3KFM A;  3K01 A;  3U72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...