4BDLA

Crystal structure of the gluk2 k531a lbd dimer in complex with glutamate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
RSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSAPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
publication title Correlating Efficacy and Desensitization with Gluk2 Ligand-Binding Domain Movements.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport
total genus 81
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdlA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdlA02
3DP8A 1MQIA 2F8DA 4NMYA 3KZGA 3UA8A 4Z7EA 3RT6B 3KOTA 2GRVA 2FA7A 3FXRA 3EHUA 1Y3NA 3IB2A 1XVXA 2QS2A 4XKQA 1DMBA 4OFJA 3OEMA 4QRZA 2F7BA 4IY6A 3U72A 1NKXA 4MFIA 4KD5A 1I6AA 4FECA 1USYE 4BDOA 3RGYA 4YKPA 4PFYA 5KCJB 1URDA 2V3QA 3UN6A 4LZ5A 1DPPA 2Y7PA 4BLAA 3O2AA 1Q1KA 2DOJA 1MY4A 1SVXB 3DELB 4BDNA 3M3FA 4ZEBA 2PMSA 2DE2A 4G68B 5IKBA 4AB6A 1EZOA 3K01A 3IO4A 4QSCA 3QUFA 4RK9A 4OXVA 1RKMA 2F35A 4OFOA 3FXQA 4ZS9A 1WODA 3OXNA 4KQPA 4X9TA 1NNPA 4IGTA 2QS3A 5DT6A 2B3BA 2QRYA 5DYHA 3CG1A 2AIXA 2HEUA 2I0BA 2V25A 3SEWA 2RKMA 2F36A 5M2VA 4R9FA 1A8FA 4F29A 3K6WA 2Y7RA 4RK2A 1ZU0A 5BWJA 3FD3A 5TP9A 4XKRA 3PU5A 5JK4A 4U1ZA 2DWAA 1MY3A 4LUBA 4U4XA 1US5A 1PB7A 2Z8DA 1JEUA 4PFWA 1A40A 3BKIB 1ZKBA 3T96B 3LSXA 1B0LA 1R6ZA 4QFOA 3O28A 4JB7A 5TPAB 1P1QA 1SYIA 4IO3A 4DXBA 5AA2D 1Y20A 2P1SA 5A5XA 1QVSA 2ZNSA 1UTHB 2OWTA 4Q8RA 1B1XA 5FHMA 3PPOA 3B6QA 3TTLA 4YB5A 1AIVA 2OBGA 3GXAA 3EN3A 1URSA 2Q89A 1HSEA 2DSFA 3O66A 3L6HA 3H6UA 3K6XA 3VLUA 3OMBA 4HTGA 1LFIA 4RNSA 3RTWB 2XHDA 4LZ8A 3FUZA 2AL5A 2I49A 1MQHA 3A3UA 4JSOA 4R6HA 2GHBA 4U2RA 1MG1A 4IO6A 1XC1A 1MDP1 4NF8A 3MP8A 4C0RA 1YAEA 4O3AA 4BDQA 3EHSA 5H8SA 3W9WA 4E0WA 3THIA 2F5XA 2HZLA 1MRPA 3MWBA 1BKAA 3S9NC 4L17A 4ZEDA 4EF1A 3G3HA 4H5FA 1OLCA 1P1NA 1N04A 3HSTA 1N7WA 3MZ1A 4U4SA 3OO6A 3PUZE 1UIUA 2OLBA 4FEBA 3SEUA 3M3LA 5K2XA 4HS7A 4F19A 2F78A 3G3KA 3TODA 2V3UA 2HAVA 5L9SA 1JQFA 4I9DA 2RC8A 5LOMA 1LAHE 2Q2AA 4ZE8A 3FATA 1D9YA 2YJPA 2WKYA 1RYXA 3O97A 5TP9B 1MQGA 1DTZA 2DWIA 3VVFA 4IO4A 1GVCA 5H8HA 1SDXA 4U23A 2I4CA 3QSLA 1LCTA 2H9BA 4G4PA 3FXUA 3K0VA 2H25A 4MH5A 3W9VA 4F1UA 4H6DA 3S4UA 5A5XB 3OO8A 1XOCA 1SW1A 4R75A 5HM4B 3FJMA 2H4IA 5CC2A 2GFEA 3E13X 3C31A 1QJMA 2BJJX 3V8XB 4ZE9A 4ND9A 3K1MA 1A55A 4G8MA 3A3CA 4ONYA 4KYDA 2V84A 4RA1A 4H67A 3U94A 3VXCA 3OO7A 4Q30B 1MH3A 5H8FA 3PUWE 4F22A 1PC3A 1URGA 4KHZE 2CZLA 2O1MA 5I59B 3FJ7A 3TCHA 1VE4A 1FQCA 1D3KA 3T9XB 1D4NA 1ZLQA 4EQ9A 5ITPA 4YKKA 4LATA 3U1OA 4NF8B 4R73A 3HHGA 2PVUA 3IB0A 4NWDA 4N13A 3SKPA 5CRYA 1SYHA 4E0XA 4U22A 1NH8A 2QS1A 5F7VA 4I1DA 3UK4A 1WVJA 1LAFE 3N6TA 1VR5A 4QFPA 5AE4A 1VFDA 2DE3A 5HPQA 4OESA 1QUKA 1EU8A 2UXAA 3H06B 1UQWA 1IQ7A 4PFTA 1LBCA 2XXWA 3HHFA 4KR5A 3E4RA 3O6GA 4DCXA 4F39A 4RPNA 5DVIA 4R74A 4ECFA 1JETA 2HAUA 4NF6B 1II5A 5FTIA 4GF8A 3A09A 3S9MC 5I56A 3C36A 5H8HB 2DP8A 4LQ5A 4RXLA 1QKAA 3W15C 3M8UA 3Q26A 1QKBA 3RUMA 3TAJA 2GH9A 4IO5A 4ELQA 1N0TA 3IK6B 3K4UA 5I2KA 5I57A 2F6PA 1LLSA 3ZSFA 4XTCQ 3K1NA 4IB2A 2QS4A 4F3PA 1O7TA 2RCBA 4U21A 2DWHA 1OVTA 3LBSA 2ONKE 1JW1A 2O7IA 3TTNA 3CFXA 4OVJA 4POXA 1B51A 3TUSA 1M5BA 2LAOA 3MVYA 3L6GA 5H8FB 3SEXA 3MUQA 1SW4A 1B58A 3GBBA 2ABHA 1LFGA 3PUVE 4GLIA 3PUYE 1N76A 1BLFA 4IGRA 3LSWA 4JWXA 3SERA 4ZEFA 3ECRA 3O9PA 3H7MA 4LZ7A 3IJOB 1FQAA 1B3FA 4KI0E 3I3VA 1T0KA 1FW0A 1B7HA 2Q88A 4ESXA 2Y7IA 3T9UA 4YB6A 4NE4A 4FATA 1SW2A 2UVIA 2XD3A 2E0SA 2VP1A 4WKMA 3OELA 1H45A 5EHSA 2Y7WA 3PPQA 1FTLA 2ESNA 3LSLA 1OMPA 2RC7A 1QULA 3VFJA 3O29A 3U92A 1VFEA 4GL0A 4X48A 3SETA 4RJZA 3IX1A 4QFKA 3O6HA 4G8HA 3JYRA 3T9HB 4ZEIA 4NF5A 4TOZA 2DWJA 3D4GA 1SW5A 2F7AA 1TXFA 4FIMA 2ZXTA 5B70A 3IR1A 2I3WA 3AXFA 3U8QA 3PMXA 2P0SA 4MBPA 1IZ1A 2DYXA 1Y1ZA 3CVGA 3K2DA 1QUJA 5I56B 4GL8A 3CG3A 2ANJA 1JVXA 3OSQA 1S50A 4FE8A 5I2KB 5I57B 4JWOA 1FQBA 1Y3QA 2ZNTA 1MQJA 1A54A 3KN3A 2NXOA 2A5TA 3S9LC 2OK2A 1B5JA 3JV9A 1SBPA 3CFZA 1JW4A 1OLAA 1IXCA 3RN8A 2D5WA 2FNCA 2O7UA 3PPRA 4KCDA 4H8IA 3MP6A 3PV0E 2HXWA 3CRBA 3Q27A 1B46A 2HCAA 4WEDA 3DP4A 2R71A 3KBRA 4DE8A 3IOWA 2DXYA 1B3EA 1H76A 2XXVA 5I84A 4FORA 3K00A 1TFDA 4GVOA 2RC9A 3U93A 2X7QA 3SESA 4LONB 2O51A 1S9TA 3CFLA 1JEVA 3IOVA 1B52A 2HZKA 1I69A 4F3SA 1TFAA 3FVNA 4GWOA 3FVOA 4MLQA 3TCGA 2IA4A 4GRKA 1IXIA 3DLNA 2DXRA 1PB8A 2XXTA 2NUVA 1KWHA 3I5OA 4KPTA 4QSDA 3RY3A 4DDDA 4THIA 2VOZA 3HO7A 1LB8A 1ANFA 1VSOA 4LVQA 1MM6A 4YAHX 3C9HA 4C1UA 4OETA 2I48A 4QF9A 4H5GA 4R6YA 5AA3A 1MPCA 4TLMB 4OENA 2Q8JA 3TPAA 3O6IA 1B40A 3BBRA 1N3XA 3MAMA 1M5EA 4QHQA 4FEDA 2V3TA 2I4BA 1H43A 2F7CA 3QUJA 1IIWA 4OFLA 3S9EA 3T93B 3IAZA 3MVWA 3EQ1A 2QMWA 2DVCA 1MQDA 2A5TB 3CSGA 3S2VA 4RY1A 1IUDA 1FQFA 1R1NA 1CE2A 1NFTA 3H03A 1J1NA 1AL3A 1XS5A 1MXUA 1QUIA 5EYFA 3OSRA 1POTA 2XXYA 3B6TA 3QAXA 5I2NA 2FYIA 1NH7A 1ZJLA 2ZYNA 1N84A 3TDJA 2AL4A 2O6AA 1P1OA 1B3LA 2ZMBA 4F18A 1LBBA 3MVZA 2UVJA 4EUOA 3Q29A 3PPPA 5DVJA 4YZZA 1GTKA 4RPOA 1CB6A 3B7DA 4NTLA 3IOTA 1LCFA 4R2FA 2DE4A 3G3JA 3TTRA 2RCAA 2GHAA 4N6PA 3HCQA 3TCFA 5CMBA 3QK6A 1AOVA 3RT8A 1P1WA 1PB9A 1B0HA 1B32A 4GFRA 4G8NA 5F1QA 1ZTYA 3GBAA 2H5YA 1MPDA 1EZPA 1JVYA 4R2BA 4EXKA 3VVDA 3LUYA 4DLDA 4H65A 4AB5A 4XKPA 4FAJA 3TYHA 2E1SA 1SI0A 1LFHA 4PETA 4DIGA 4IO2A 4BDRA 3VV5A 3FVKA 3GLBA 3N94A 3TTMA 4I62A 3ZS6A 3ZKKA 3PMWA 3TQLA 1DSNA 1FQDA 3MVXA 5BUUA 3UP9A 2DS9A 5IAIA 1R9LA 3DM0A 5AA1A 2XXXA 2XXQA 4ZDMA 4OWDA 4O3CA 3N26A 4F1VA 3MBPA 1BP5A 2Q2CA 4GQOA 3KSJA 1PBQA 2ONRA 4EDPA 2NOOA 4GIZA 2UYFA 3K6UA 1FQEA 1B4HA 4ESWA 4YMBA 2ZNUA 3G7WA 1XVYA 4NEDA 3FV1A 3UORA 3K6VA 3VDFA 4G68A 5ICTA 2O68A 3ODBA 4ZZEA 5H8QA 1EH3A 1XT8A 5JTYA 1YPNA 1O64A 1OIBA 1WDNA 1IXGA 1MXZA 1POY1 1MY2A 2CMOA 1FCKA 1YCJA 3HPIA 4ZECA 3G3GA 2XXIA 5CBSA 4TQUQ 1FTKA 2Z8FA 2O84X 3TZAA 3R7XA 5FTHA 2A5SA 2RINA 4OTEA 3H4ZA 1GGGA 5FHNA 1ZBMA 1USYH 2G93A 2W7YA 3N6UA 2B65A 1NL5A 4Q0CA 4LA9A 4EF2A 2ZYMA 4WEPA 2QMXA 5H8NA 1MY0A 1GR2A 4EQ7A 3QXMA 3LR1A 4QFNA 2I0CA 2Z8EA 4UA8A 2AYSA 2F97A 4OERA 1B5IA 4PE5B 1IEJA 4ELPA 1UTHA 3FASA 4YKIA 3TEPA 2QPQA 1GV8A 3USDA 2VHAA 3GZGA 2VD3A 4H8JA 5ELVA 2YPNA 3N5LA 4HCWA 4P11A 2O69A 2OCUA 1A8EA 2XX8A 5ICQA 3FIRA 3VLWA 3KN8A 1MH4A 4MLVA 4QSEA 4OYVA 4DXUA 4YU0A 1I6BA 2XXHA 3PD9A 2I3VA 3FVGA 1ZMGA 4K3FA 1UIVA 2X7PA 1Z7ME 3M3KA 1QW0A 3SDFA 5AA4A 4R6KA 3VLVA 5I58A 3T9VA 4X1DA 3FJGA 3BFUA 5JEIA 5HBCA 3T66A 2F34A 3PGFA 3OD7A 3EF7A 3RNNA 1H44A 1MM7A 3MP1A 3PD8A 1IITA 4ISUA 4H1XA 5DVFA 1R9QA 3PPNA 1B2HA 5CBRA 2XX7A 3T22A 3K02A 5H8QB 5JTYB 4BDMA 3R26A 3JZJA 1AH5A 3MJNA 4P0IA 1NNTA 1MXWA 3FV2A 3H6VA 4M1VA 4OMBA 3OOAA 4G68C 3TQWA 3P7IA 3IL1B 3F11A 1MPBA 3FGSA 4Q5TA 3H6WA 4H0WA 3PUXE 2B3FA 1M5DA 3IORA 1Q35A 2KLFA 1HSLA 5B7DA 4UACA 4LQ2A 2DVZA 1Y4TA 1TWYA 3D4CA 3SEVA 3EPEA 5H8NB 3VXBA 3ILUB 5CM6A 3RQTA 1Z7NE 2F6GA 4PFUA 2RF1A 4OEVA 1MS7A 2DQVA 3WAEA 1BIYA 1SD3A 4FJPA 3OENA 3C33A 3KGCA 4EXLA 1Y9UA 4F2OA 1P99A 3K1PA 2REGA 4XIGQ 1M5CA 1B5HA 3TMGA 1JW5A 2UVGA 4GOTA 3V5AA 5DEXA 2PT2A 4DCYA 3E9XA 2P2AA 4ZEKA 3B6WA 3SEYA 4Z0IA 2REJA 5KZTA 4ZZAA 3VVEA 2PBWA 2Y84A 2XXRA 5K2YA 4MF3A 3IB1A 1M5FA 2QL3A 2NVUB 5I59A 5AA4B 1S7YA 4F3BA 3KN7A 5I58B 1PDAA 4GXSB 1IXHA 1XHYA 3KEIA 1MDQA 4HW8A 4KFQA 3V83A 4NF5B 1EZ9A 2O1LA 4EQBA 3IJXB 3MZBA 3PMVA 3C4MA 3CIJA 2ZYOA 3EHTA 4GXAA 1LGBC 1LAGE 3BFTA 1ATGA 2QJEA 1A99A 2Y7KA 1MY1A 3UIFA 2HFBA 4JSDA 2D21A 5L9OA 4I8CA 2I58A 3VE1B 1AMFA 4IO7A 1N3WA 3Q25A 4OQOA 2Z23A 2V93A 4WXJA 1UTBA 1YTVA 2X26A 4ELOA 2NWJA 4JXIA 5CMKA 1OQHA 2Q9TA 4YICA 3OO9A 2VD2A 4YB7A 3KOSA 4NF4A 4NF6A 1DPEA 3RLFE 5AA2A 3DP6A 3TFLA 3G3FA 1ELJA 3MZ9A 3HN0A 4OZ9A 4P0GA 2VGQA 2YLNA 4BDLA 1NNFA 5TU0A 1B3HA 4GD5A 4LP2B 1DOTA 3C35A 1Y3PA 5KDTA 4R9GA 1D9VA 3KSXA 4G2ZA 4OHNA 2ALUA 2R9JA 4DZ1A 1SQYA 1B9JA 2XD2A 3TTKA 1NNKA 3KG2A 4U1OA 5DEXB 4F31B 4KYSA 1O63A 2OJTA 1JNFA 1RYOA 3OEKA 1MXVA 4KYEA 4POWA 3H6TA 5DTBA 2QSXA 3WAFA 4ELRA 1HSJA 3QIMA 4F1YA 5ITOA 5J1DA 4RYAA 1B7ZA 4PQJA 4HCYA 1TT1A 2R6GE 4R72A 1F9BA 2XXUA 2XXPA 4XKNA 3RPWA 3ILTB 2OWSA 5CMMA 1OQGA 1FTJA 1FTOA 2Z22A 4F2QA 4JDFA 1B05A 3V89B 4PP0A 2ZYKA 1MXXA 3IO6A 3RTFB 5KCJA 3KFMA 4N07A 3KJ7A 5CMCA 1A7LA 3CSBA 2I6EA 3TELA 3ZKLA 1B3GA 3MQ9A 4TLLB 1FTMA 3G3IA 3MW0A 4C1TA 2H98A 1B1HA 4JWYA 4YKJA 1UTBB 4IY5A 2XX9A 1B7UA 3CR9A 3CI8A 1US4A 2UYEA 1PBPA 3FZVA 1SI1A 3C32A 5FHOA 3IOUA 3C34A 5L9MA 3KJTA 5L8DA 3MPLA 4NF4B 1MXYA 1Y4CA 5I2NB 2PX1A 2THIA 1LAXA 5AA2B 3LSFB 3UGWA 3MPKA 2M8CA 2PYYA 4YMAA 4OEUA 3HV1A 4M4GA 4G77A 2ONSA 1NMUA 5ISUA 4QFLA 2UVHA 3Q28A 2D3IA 3TKDA 4AQ4A 4XXUA 5KDTB 1L5TA 1I6QA 2IEEA 3H3GA 1DTGA 2HQ0A 3ONMA 2H99A 1B6HA 4KCCA 3MC2A 1H3DA 3I6VA 4F3GA 1OVBA 4O3BA 1PEBA 4X1BA 3E3KA 1Y1MA 1LSTA 2PT1A 3LC8A 1N7XA 1B4ZA 1BTJA 5EHMA 5TPAA 5CI5A 1ZIUA 2OZZA 3R6UA 4NWCA 4JBZA 2G29A 4DXCA 1P1UA 3QYTA 1LB9A
chains in the Genus database with same CATH superfamily
3DP8A 1MQIA 2F8DA 3SZPA 4NMYA 3KZGA 4AS4A 3UA8A 4Z7EA 3RT6B 3KOTA 1RDYA 2GRVA 2FA7A 3FXRA 3EHUA 1Y3NA 3IB2A 4QBAA 1XVXA 2QS2A 4XKQA 1DMBA 1FJ9A 4OFJA 3OEMA 4QRZA 2F7BA 4IY6A 3U72A 1NKXA 4MFIA 4KD5A 1I6AA 4FECA 1USYE 4BDOA 3RGYA 2XWOA 4YKPA 4PFYA 5KCJB 1URDA 5T3JA 2V3QA 3UN6A 4LZ5A 1DPPA 1NUZA 2Y7PA 4BLAA 3O2AA 1Q1KA 2DOJA 1MY4A 1SVXB 3DELB 4BDNA 3M3FA 4ZEBA 2PMSA 4GWWA 2DE2A 4G68B 5IKBA 4AB6A 1EZOA 3K01A 3IO4A 4QSCA 3QUFA 4RK9A 4OXVA 1RKMA 2F35A 4OFOA 3T1BA 3FXQA 4ZS9A 1WODA 3OXNA 4KQPA 4X9TA 1NNPA 4IGTA 2QS3A 3MSTA 4MAGA 5DT6A 2B3BA 2QRYA 5DYHA 3CG1A 2AIXA 2BJIA 2HEUA 2I0BA 2V25A 3SEWA 2RKMA 2F36A 2Q74A 5M2VA 4R9FA 1YZ0A 1A8FA 4PGNA 4F29A 1IMAA 3K6WA 2Y7RA 4RK2A 1ZU0A 5BWJA 3FD3A 4LN5A 1FRPA 5TP9A 4XKRA 2ZZWA 3PU5A 5JK4A 4U1ZA 4JVDA 2DWAA 1MY3A 4LUBA 4U4XA 1US5A 1PB7A 2Z8DA 1JEUA 4PFWA 1A40A 3BKIB 1ZKBA 3T96B 3LSXA 1B0LA 1R6ZA 4QFOA 3O28A 1EYIA 4JB7A 5TPAB 5ET5A 1P1QA 1SYIA 4IO3A 4DXBA 3BIHA 5AA2D 1Y20A 2P1SA 5A5XA 1QVSA 2ZNSA 1UTHB 4KXPA 1FPFA 2OWTA 4Q8RA 1B1XA 4MNCA 5FHMA 3PPOA 3B6QA 3TTLA 4YB5A 1AIVA 2OBGA 3GXAA 2CZIA 3B8BA 3EN3A 1URSA 2Q89A 1HSEA 4GBVA 2DSFA 4JVCA 3O66A 2XA5A 3L6HA 3H6UA 4PF6A 3K6XA 3VLUA 3OMBA 4HTGA 1LFIA 4RNSA 3RTWB 2XHDA 4LZ8A 3FUZA 2GQ1A 2AL5A 2I49A 1MQHA 3A3UA 4JSOA 4R6HA 2GHBA 4U2RA 4OVQA 2PFYA 4P1LA 1MG1A 4IO6A 1FPJA 4NG7A 4NAPA 4XEQA 1XC1A 1MDP1 4NF8A 3MP8A 4C0RA 1YAEA 1KZ8A 4O3AA 4BDQA 3EHSA 5IZZA 5H8SA 3W9WA 4E0WA 3THIA 2F5XA 2HZLA 1MRPA 5ET7A 3MWBA 1BKAA 3S9NC 2ZZXA 4L17A 4ZEDA 3KC1A 4EF1A 5FBPA 3G3HA 4H5FA 1OLCA 1P1NA 1N04A 3HSTA 5EQ8A 1N7WA 3MZ1A 4U4SA 3OO6A 3PUZE 1FBEA 1UIUA 2OLBA 4FEBA 4N91A 3SEUA 3M3LA 5K2XA 4HS7A 4F19A 2F78A 3G3KA 3TODA 2V3UA 2HAVA 1NUWA 5L9SA 1JQFA 4I9DA 1IMCA 2RC8A 5LOMA 1LAHE 2Q2AA 4ZE8A 4P47A 4OANA 3FATA 2KR0A 1D9YA 2QVRA 2YJPA 2WKYA 1RYXA 3O97A 5TP9B 1MQGA 1DTZA 2DWIA 3VVFA 4IO4A 1GVCA 5H8HA 1SDXA 4U23A 2I4CA 3QSLA 1IMFA 1LCTA 2H9BA 4G4PA 3FXUA 3K0VA 2H25A 4MH5A 3W9VA 1NI9A 4F1UA 4H6DA 1IMDA 3OO8A 3S4UA 5A5XB 1XOCA 1SW1A 4R75A 5HM4B 3FJMA 2H4IA 5CC2A 2GFEA 3E13X 3C31A 1QJMA 2BJJX 1INPA 3V8XB 4ZE9A 4ND9A 3K1MA 1A55A 4G8MA 4O8MA 3A3CA 4ONYA 4KYDA 2V84A 4RA1A 4H67A 1NV7A 4I3EA 3OO7A 4Q30B 3U94A 3VXCA 4IR8A 1MH3A 5H8FA 3PUWE 4F22A 2B4MA 1PC3A 1URGA 4KHZE 2CZLA 2O1MA 2HXRA 5I59B 3FJ7A 3TCHA 1VE4A 1FQCA 5IGAA 1D3KA 3T9XB 4P3LA 1D4NA 1ZLQA 3LUZA 4EQ9A 5ITPA 4YKKA 4N6KA 4LATA 4NF8B 3U1OA 4PAFA 4R73A 3HHGA 2PVUA 3IB0A 4NWDA 4N13A 3SKPA 5CRYA 1SYHA 4E0XA 4U22A 1NH8A 2L5VA 2QS1A 5F7VA 4I1DA 3UK4A 1DK4A 1WVJA 1LAFE 3N6TA 1VR5A 4QFPA 5AE4A 1VFDA 2DE3A 2VPOA 5HPQA 4OESA 1QUKA 1EU8A 2UXAA 3H06B 1UQWA 1IQ7A 4PFTA 1LBCA 2XXWA 3HHFA 4KR5A 3E4RA 3LV0A 3O6GA 4GWXA 4DCXA 4NF0A 4F39A 4RPNA 5DVIA 4R74A 2WEFA 1LBWA 4ECFA 1JETA 2HAUA 4NF6B 1II5A 1NV0A 5FTIA 4GF8A 3A09A 3S9MC 5I56A 3C36A 5H8HB 2DP8A 1NV5A 3IFCA 4LQ5A 4RXLA 1QKAA 2Q8MA 3W15C 3M8UA 3Q26A 1QKBA 3RUMA 3TAJA 2GH9A 4IO5A 1FSAA 4ELQA 1N0TA 1NV3A 3IK6B 3K4UA 5I2KA 5I57A 5ESYA 4PDDA 2F6PA 1LLSA 3ZSFA 4XTCQ 3RYDA 3K1NA 4IB2A 2QS4A 4MCOA 4F3PA 1O7TA 2RCBA 1KA1A 4U21A 2DWHA 1OVTA 3LBSA 1FPGA 2ONKE 1JW1A 2O7IA 3TTNA 2VT5A 3CFXA 4OVJA 4POXA 1B51A 5EQ9A 3TUSA 1M5BA 2LAOA 3MVYA 5J16A 3L6GA 5H8FB 3SEXA 3MUQA 1SW4A 3EKIA 1B58A 4X8RA 5ET8A 3GBBA 4N81A 2ABHA 4P9KA 1LFGA 3PUVE 3U65A 4GLIA 5ET6A 3PUYE 1FBHA 1N76A 1BLFA 4IGRA 1FPLA 3LSWA 5F24A 4JWXA 3SERA 4ZEFA 3ECRA 3O9PA 3H7MA 4LZ7A 3IJOB 1CNQA 1FQAA 4NX1A 1B3FA 4KI0E 3I3VA 1T0KA 1FW0A 1B7HA 2Q88A 2FIXA 4ESXA 3MYUA 2Y7IA 3T9UA 4YB6A 2F3DA 4NE4A 4FATA 1SW2A 2UVIA 2XD3A 2E0SA 2VP1A 4DI4B 4WKMA 3OELA 3RPLA 1H45A 4I40A 5EHSA 2Y7WA 3PPQA 1FTLA 2ESNA 5I7IA 3LSLA 1OMPA 2OWZA 4GX4A 2RC7A 4PFRA 1QULA 3VFJA 3O29A 3U92A 1VFEA 4GL0A 4X48A 3SETA 4RJZA 3IX1A 4QFKA 3O6HA 4G8HA 3JYRA 3T9HB 4ZEIA 4NF5A 4TOZA 4X04A 4GWYA 2DWJA 3D4GA 4P56A 1SW5A 2F7AA 1TXFA 4FIMA 2ZXTA 4PBQA 5B70A 3IR1A 2I3WA 1K9YA 1NV1A 3AXFA 3U8QA 3PMXA 1BK4A 2P0SA 4MBPA 1IZ1A 2DYXA 1Y1ZA 3CVGA 3K2DA 1QUJA 5I56B 4GL8A 4HE1A 3CG3A 1FPEA 2ANJA 1JVXA 3OSQA 1NV4A 1S50A 4FE8A 5I2KB 5I57B 4GBWA 4JWOA 4NGUA 1FQBA 1Y3QA 2ZNTA 1MQJA 1A54A 3KN3A 2HPGA 1LEVA 5I5PA 2NXOA 2A5TA 2WYPA 3S9LC 2OK2A 1B5JA 3JV9A 2DDKA 1SBPA 3CFZA 1JW4A 1OLAA 1IXCA 4N6DA 3RN8A 2D5WA 2FNCA 2PCRA 2O7UA 3PPRA 5EQAA 4KCDA 4H8IA 3MP6A 3PV0E 2HXWA 3CRBA 3Q27A 3GYYA 5LDZA 1B46A 2HCAA 4WEDA 3DP4A 2R71A 3KBRA 4DE8A 3IOWA 2DXYA 2KQZA 1B3EA 1H76A 3HFUA 2XXVA 5I84A 4FORA 3K00A 1TFDA 4GVOA 2RC9A 3U93A 2X7QA 3SESA 1FBGA 4LONB 2O51A 1S9TA 3CFLA 1JEVA 3IOVA 1B52A 2HZKA 1I69A 2F3BA 4F3SA 4PAIA 1TFAA 3FVNA 4GWOA 3FVOA 1KA0A 4MLQA 3TCGA 2IA4A 4GWZA 4GRKA 1IXIA 3DLNA 2DXRA 1PB8A 3RPLB 2XXTA 2NUVA 1KWHA 3I5OA 4KPTA 4QSDA 2QVVA 3RY3A 4DDDA 4MJOA 4THIA 1FBCA 2VOZA 3HO7A 1LB8A 1EYKA 1ANFA 1VSOA 4LVQA 1MM6A 4YAHX 3C9HA 4MIJA 4C1UA 4OETA 4P8BA 4H46A 2I48A 4QF9A 4OVTA 4H5GA 4R6YA 5AA3A 1MPCA 4TLMB 4OENA 2Q8JA 3TPAA 3O6IA 1B40A 3BBRA 1N3XA 1SPIA 3MAMA 2XWVA 1M5EA 4QHQA 3A29A 4FEDA 1EYJA 2V3TA 2I4BA 3ISPA 4NN3A 1H43A 2F7CA 3QUJA 1IIWA 4OFLA 3S9EA 3T93B 2WBDA 2FIEA 3IAZA 3MVWA 3EQ1A 2QMWA 2DVCA 5EYGA 1MQDA 2A5TB 3CSGA 3S2VA 4QXDA 2FBPA 4RY1A 2VPNA 1IUDA 4P1EA 1FQFA 1R1NA 3ROJA 1CE2A 1NV2A 1NFTA 3H03A 1J1NA 1AL3A 4MEVA 2Y5LA 1XS5A 1MXUA 1K9ZA 1QUIA 5EYFA 3OSRA 1POTA 2XXYA 3B6TA 3QAXA 5I2NA 2FYIA 1NH7A 4O7MA 1ZJLA 2ZYNA 1N84A 3TDJA 2AL4A 2O6AA 1P1OA 1B3LA 2ZMBA 4F18A 4O7IA 1LBBA 3MVZA 2UVJA 4EUOA 3Q29A 3PPPA 5DVJA 4YZZA 1GTKA 4RPOA 1CB6A 3B7DA 4NTLA 3IOTA 2P3NA 1LCFA 4R2FA 2DE4A 3G3JA 3TTRA 2RCAA 1JP4A 2GHAA 1DCUA 1AWBA 4N6PA 3HCQA 3TCFA 5CMBA 3QK6A 1AOVA 3RT8A 1P1WA 1PB9A 1B0HA 1B32A 4GFRA 4G8NA 5F1QA 1ZTYA 4NHBA 1YYZA 3GBAA 2WYKA 2H5YA 1MPDA 4MX6A 1EZPA 1JVYA 4R2BA 4EXKA 3VVDA 3LUYA 1DBZA 4DLDA 4H65A 4AB5A 4XKPA 4FAJA 3TYHA 2E1SA 1SI0A 1LFHA 4PETA 2WBBA 4DIGA 4IO2A 4BDRA 3VV5A 3FVKA 3GLBA 3N94A 3TTMA 1LBVA 4I62A 3ZS6A 3ZKKA 4PAKA 5DW8A 3PMWA 3TQLA 1DSNA 1FQDA 3MVXA 5BUUA 3UP9A 2DS9A 5IAIA 3IFAA 1R9LA 3DM0A 5AA1A 2XXXA 2XXQA 4ZDMA 4GX6A 4OWDA 4O3CA 3N26A 4F1VA 2FHYA 3MBPA 1BP5A 2Q2CA 4GQOA 3KSJA 4MNIA 1PBQA 2ONRA 4EDPA 2NOOA 4GIZA 4PFBA 2UYFA 3K6UA 1FQEA 1B4HA 4ESWA 4YMBA 2ZNUA 3G7WA 1XVYA 4NEDA 3FV1A 3UORA 4UABA 4PC9A 3K6VA 3VDFA 4G68A 5ICTA 2O68A 3ODBA 4ZZEA 5H8QA 1EH3A 1XT8A 5JTYA 1YPNA 1O64A 1OIBA 1WDNA 1IXGA 1MXZA 1POY1 2HHMA 4FBPA 1MY2A 2CMOA 4NQ8A 1FCKA 1YCJA 3HPIA 4ZECA 3G3GA 2XXIA 5CBSA 4TQUQ 1FTKA 2Z8FA 4OVRA 3CHGA 1FJ6A 2O84X 3TZAA 3R7XA 5FTHA 2A5SA 2RINA 4OTEA 3H4ZA 1GGGA 5FHNA 4PGPA 1ZBMA 5EYHA 1USYH 2G93A 2W7YA 3N6UA 2XWKA 2B65A 1NL5A 3BIGA 4OVSA 4Q0CA 4MHFA 4LA9A 4EF2A 2ZYMA 4WEPA 2QMXA 5H8NA 1MY0A 4PCDA 1GR2A 4EQ7A 1VDWA 3QXMA 3LR1A 4QFNA 2I0CA 2Z8EA 4UA8A 2AYSA 4PDHA 2F97A 4OERA 1B5IA 4PE5B 1IEJA 4ELPA 1UTHA 3FASA 4YKIA 3TEPA 2QPQA 1FTAA 1GV8A 3USDA 2VHAA 1LBXA 3GZGA 2VD3A 4H8JA 5ELVA 2YPNA 3N5LA 4HCWA 4P11A 2O69A 2OCUA 4MMPA 1A8EA 1D9QA 2XX8A 5ICQA 3FIRA 3VLWA 3KN8A 1MH4A 4MLVA 4QSEA 4JVIA 2CZHA 3T0JA 4OYVA 4DXUA 4YU0A 1I6BA 2CZKA 2XXHA 3PD9A 2I3VA 3FVGA 1ZMGA 4K3FA 1UIVA 2X7PA 2MKZA 1Z7ME 3M3KA 1QW0A 3SDFA 5AA4A 4R6KA 3VLVA 5I58A 3T9VA 4X1DA 3FJGA 3BFUA 5JEIA 5HBCA 3T66A 2F34A 3PGFA 3OD7A 3EF7A 3RNNA 1H44A 1MM7A 3MP1A 4GWSA 3FXBA 1IMBA 3PD8A 1IITA 4ISUA 4H1XA 5DVFA 1YXIA 1R9QA 3PPNA 1B2HA 5CBRA 2XX7A 3T22A 1FPKA 3K02A 5H8QB 5JTYB 4BDMA 3R26A 3JZJA 1AH5A 3MJNA 4P0IA 1NNTA 2XXKA 1MXWA 1G0HA 3FV2A 3H6VA 4M1VA 4OMBA 3OOAA 4G68C 3TQWA 3P7IA 3IL1B 3F11A 1MPBA 3FGSA 2Y5KA 4Q5TA 3H6WA 4H0WA 3PUXE 2B3FA 1M5DA 3IORA 1Q35A 2KLFA 1HSLA 5B7DA 4UACA 2CEYA 2ZZVA 4LQ2A 2DVZA 1Y4TA 5IM2A 1TWYA 3D4CA 3SEVA 3EPEA 5H8NB 4HE2A 3VXBA 3ILUB 3KBZA 4HXVA 5CM6A 3RQTA 1Z7NE 2F6GA 2FVZA 4PFUA 2RF1A 4OEVA 4DI3D 1MS7A 2DQVA 3WAEA 1BIYA 1SD3A 4FJPA 3OENA 3C33A 3KGCA 4EXLA 1Y9UA 4F2OA 1P99A 3K1PA 2REGA 4XIGQ 1M5CA 1B5HA 3TMGA 1JW5A 4OA4A 2UVGA 4GOTA 3V5AA 5DEXA 5IZ3A 2PT2A 4DCYA 1XI6A 3E9XA 2P2AA 4ZEKA 3B6WA 3SEYA 4Z0IA 2QVUA 2REJA 4ZZAA 5KZTA 1FBDA 3E79A 3VVEA 1IMEA 2PBWA 2Y84A 2XXRA 5K2YA 4MF3A 3IB1A 1M5FA 2V4CA 2QL3A 2NVUB 5I59A 5AA4B 1S7YA 4F3BA 3KN7A 5I58B 1PDAA 4GXSB 1IXHA 1XHYA 3KEIA 1MDQA 4HW8A 1FBFA 4KFQA 3V83A 4NF5B 1EZ9A 2O1LA 4EQBA 3IJXB 3MZBA 3PMVA 3C4MA 3CIJA 1NUYA 2ZYOA 3EHTA 4GXAA 1LGBC 1RDZA 1LAGE 3BFTA 1ATGA 2QJEA 1A99A 2Y7KA 1MY1A 3UIFA 2HFBA 4JSDA 2D21A 5L9OA 4I8CA 2I58A 3VE1B 1FPIA 2QFLA 1AMFA 2P3VA 4N8YA 5EQ7A 4IO7A 1N3WA 3Q25A 4OQOA 3E78A 2Z23A 2V93A 4N4UA 2CEXA 3KC0A 4WXJA 4G61A 1UTBA 1YTVA 2X26A 4ELOA 3FBPA 2NWJA 4JXIA 5CMKA 1OQHA 2Q9TA 4YICA 1NV6A 3OO9A 2VD2A 2R8TA 4YB7A 3KOSA 4NF4A 4NF6A 1DPEA 3RLFE 5AA2A 4N8GA 3DP6A 3TFLA 3G3FA 4GWUA 1ELJA 3MZ9A 1NUXA 3HN0A 4OZ9A 4P0GA 2VGQA 2PFZA 4PTKA 2YLNA 4BDLA 1G0IA 1NNFA 5TU0A 1B3HA 4GD5A 4LP2B 4PF8A 1QGXA 1DOTA 3C35A 1Y3PA 5KDTA 2XWIA 4H45A 1D9VA 3KSXA 4R9GA 4XF5A 4G2ZA 4OHNA 4N17A 2ALUA 2R9JA 4OVPA 4DZ1A 3B50A 1SQYA 1B9JA 2XD2A 3TTKA 1NNKA 3KG2A 4U1OA 5DEXB 4F31B 4KYSA 5IZ3B 1O63A 2OJTA 1JNFA 1RYOA 3OEKA 1MXVA 4KYEA 2WX9A 4POWA 3H6TA 5DTBA 2QSXA 3WAFA 4ELRA 4PE3A 5LTCA 1LBYA 1HSJA 3QIMA 4F1YA 5ITOA 5J1DA 4RYAA 1FPDA 1Q9DA 1B7ZA 4PQJA 4HCYA 1TT1A 2R6GE 4R72A 4MNPA 1F9BA 4O94A 2XXUA 4PFIA 2XXPA 4XKNA 5A5LA 3RPWA 5IZ1A 3ILTB 2OWSA 5CMMA 1OQGA 1FTJA 1FTOA 2Z22A 4F2QA 4JDFA 1B05A 3V89B 4PP0A 2ZYKA 4XFEA 1MXXA 3IO6A 3RTFB 5KCJA 3KFMA 4N07A 2OX3A 3KJ7A 1FBPA 5CMCA 1A7LA 3CSBA 2I6EA 3TELA 5I3SA 3ZKLA 4N15A 1B3GA 3MQ9A 4TLLB 2JJKA 1FTMA 3G3IA 3MW0A 4C1TA 1LBZA 2H98A 1B1HA 4JWYA 4YKJA 1UTBB 4IY5A 2XX9A 1B7UA 3CR9A 3CI8A 1US4A 2UYEA 1PBPA 3FZVA 1SI1A 3C32A 3IOUA 5FHOA 3C34A 3PTYA 5L9MA 3KJTA 5L8DA 3MPLA 4NF4B 1MXYA 1Y4CA 5I2NB 2PX1A 2THIA 1LAXA 5AA2B 3LSFB 3UGWA 1FPBA 3MPKA 2M8CA 2PYYA 4YMAA 4OEUA 3HV1A 4M4GA 4G77A 2ONSA 1NMUA 4AS5A 5ISUA 4QFLA 2UVHA 3Q28A 4PBHA 2D3IA 3TKDA 4AQ4A 4XXUA 5KDTB 1L5TA 1I6QA 2IEEA 3D1RA 3NOHA 3H3GA 1DTGA 3ONMA 2HQ0A 4I3YA 2H99A 2B4LA 1B6HA 4KCCA 3MC2A 4HE0A 1H3DA 3I6VA 4F3GA 1OVBA 4O3BA 1PEBA 4X1BA 3QMFA 3E3KA 1Y1MA 1LSTA 2PT1A 3LC8A 1RDXA 4GX3A 1N7XA 1B4ZA 1BTJA 5EHMA 5TPAA 1ZIUA 5CI5A 2OZZA 3R6UA 4NWCA 4JBZA 2G29A 4DXCA 1P1UA 3QYTA 1LB9A
chains in the Genus database with same CATH topology
3DP8A 1MQIA 2F8DA 4NMYA 3KZGA 3UA8A 4Z7EA 3RT6B 3KOTA 2GRVA 2FA7A 3FXRA 3EHUA 1Y3NA 3IB2A 1XVXA 2QS2A 4XKQA 1DMBA 4OFJA 3OEMA 4QRZA 2F7BA 4IY6A 3U72A 1NKXA 4MFIA 4KD5A 1I6AA 4FECA 1USYE 4BDOA 3RGYA 4YKPA 4PFYA 5KCJB 1URDA 2V3QA 3UN6A 4LZ5A 1DPPA 2Y7PA 4BLAA 3O2AA 1Q1KA 2DOJA 1MY4A 1SVXB 3DELB 4BDNA 3M3FA 4ZEBA 2PMSA 2DE2A 4G68B 5IKBA 4AB6A 1EZOA 3K01A 3IO4A 4QSCA 3QUFA 4RK9A 4OXVA 1RKMA 2F35A 4OFOA 3FXQA 4ZS9A 1WODA 3OXNA 4KQPA 4X9TA 1NNPA 4IGTA 2QS3A 5DT6A 2B3BA 2QRYA 5DYHA 3CG1A 2AIXA 2HEUA 2I0BA 2V25A 3SEWA 2RKMA 2F36A 5M2VA 4R9FA 1A8FA 4F29A 3K6WA 2Y7RA 4RK2A 1ZU0A 5BWJA 3FD3A 5TP9A 4XKRA 3PU5A 5JK4A 4U1ZA 2DWAA 1MY3A 4LUBA 4U4XA 1US5A 1PB7A 2Z8DA 1JEUA 4PFWA 1A40A 3BKIB 1ZKBA 3T96B 3LSXA 1B0LA 1R6ZA 4QFOA 3O28A 4JB7A 5TPAB 1P1QA 1SYIA 4IO3A 4DXBA 5AA2D 1Y20A 2P1SA 5A5XA 1QVSA 2ZNSA 1UTHB 2OWTA 4Q8RA 1B1XA 5FHMA 3PPOA 3B6QA 3TTLA 4YB5A 1AIVA 2OBGA 3GXAA 3EN3A 1URSA 2Q89A 1HSEA 2DSFA 3O66A 3L6HA 3H6UA 3K6XA 3VLUA 3OMBA 4HTGA 1LFIA 4RNSA 3RTWB 2XHDA 4LZ8A 3FUZA 2AL5A 2I49A 1MQHA 3A3UA 4JSOA 4R6HA 2GHBA 4U2RA 1MG1A 4IO6A 1XC1A 1MDP1 4NF8A 3MP8A 4C0RA 1YAEA 4O3AA 4BDQA 3EHSA 5H8SA 3W9WA 4E0WA 3THIA 2F5XA 2HZLA 1MRPA 3MWBA 1BKAA 3S9NC 4L17A 4ZEDA 4EF1A 3G3HA 4H5FA 1OLCA 1P1NA 1N04A 3HSTA 1N7WA 3MZ1A 4U4SA 3OO6A 3PUZE 1UIUA 2OLBA 4FEBA 3SEUA 3M3LA 5K2XA 4HS7A 4F19A 2F78A 3G3KA 3TODA 2V3UA 2HAVA 5L9SA 1JQFA 4I9DA 2RC8A 5LOMA 1LAHE 2Q2AA 4ZE8A 3FATA 1D9YA 2YJPA 2WKYA 1RYXA 3O97A 5TP9B 1MQGA 1DTZA 2DWIA 3VVFA 4IO4A 1GVCA 5H8HA 1SDXA 4U23A 2I4CA 3QSLA 1LCTA 2H9BA 4G4PA 3FXUA 3K0VA 2H25A 4MH5A 3W9VA 4F1UA 4H6DA 3S4UA 5A5XB 3OO8A 1XOCA 1SW1A 4R75A 5HM4B 3FJMA 2H4IA 5CC2A 2GFEA 3E13X 3C31A 1QJMA 2BJJX 3V8XB 4ZE9A 4ND9A 3K1MA 1A55A 4G8MA 3A3CA 4ONYA 4KYDA 2V84A 4RA1A 4H67A 3U94A 3VXCA 3OO7A 4Q30B 1MH3A 5H8FA 3PUWE 4F22A 1PC3A 1URGA 4KHZE 2CZLA 2O1MA 5I59B 3FJ7A 3TCHA 1VE4A 1FQCA 1D3KA 3T9XB 1D4NA 1ZLQA 4EQ9A 5ITPA 4YKKA 4LATA 3U1OA 4NF8B 4R73A 3HHGA 2PVUA 3IB0A 4NWDA 4N13A 3SKPA 5CRYA 1SYHA 4E0XA 4U22A 1NH8A 2QS1A 5F7VA 4I1DA 3UK4A 1WVJA 1LAFE 3N6TA 1VR5A 4QFPA 5AE4A 1VFDA 2DE3A 5HPQA 4OESA 1QUKA 1EU8A 2UXAA 3H06B 1UQWA 1IQ7A 4PFTA 1LBCA 2XXWA 3HHFA 4KR5A 3E4RA 3O6GA 4DCXA 4F39A 4RPNA 5DVIA 4R74A 4ECFA 1JETA 2HAUA 4NF6B 1II5A 5FTIA 4GF8A 3A09A 3S9MC 5I56A 3C36A 5H8HB 2DP8A 4LQ5A 4RXLA 1QKAA 3W15C 3M8UA 3Q26A 1QKBA 3RUMA 3TAJA 2GH9A 4IO5A 4ELQA 1N0TA 3IK6B 3K4UA 5I2KA 5I57A 2F6PA 1LLSA 3ZSFA 4XTCQ 3K1NA 4IB2A 2QS4A 4F3PA 1O7TA 2RCBA 4U21A 2DWHA 1OVTA 3LBSA 2ONKE 1JW1A 2O7IA 3TTNA 3CFXA 4OVJA 4POXA 1B51A 3TUSA 1M5BA 2LAOA 3MVYA 3L6GA 5H8FB 3SEXA 3MUQA 1SW4A 1B58A 3GBBA 2ABHA 1LFGA 3PUVE 4GLIA 3PUYE 1N76A 1BLFA 4IGRA 3LSWA 4JWXA 3SERA 4ZEFA 3ECRA 3O9PA 3H7MA 4LZ7A 3IJOB 1FQAA 1B3FA 4KI0E 3I3VA 1T0KA 1FW0A 1B7HA 2Q88A 4ESXA 2Y7IA 3T9UA 4YB6A 4NE4A 4FATA 1SW2A 2UVIA 2XD3A 2E0SA 2VP1A 4WKMA 3OELA 1H45A 5EHSA 2Y7WA 3PPQA 1FTLA 2ESNA 3LSLA 1OMPA 2RC7A 1QULA 3VFJA 3O29A 3U92A 1VFEA 4GL0A 4X48A 3SETA 4RJZA 3IX1A 4QFKA 3O6HA 4G8HA 3JYRA 3T9HB 4ZEIA 4NF5A 4TOZA 2DWJA 3D4GA 1SW5A 2F7AA 1TXFA 4FIMA 2ZXTA 5B70A 3IR1A 2I3WA 3AXFA 3U8QA 3PMXA 2P0SA 4MBPA 1IZ1A 2DYXA 1Y1ZA 3CVGA 3K2DA 1QUJA 5I56B 4GL8A 3CG3A 2ANJA 1JVXA 3OSQA 1S50A 4FE8A 5I2KB 5I57B 4JWOA 1FQBA 1Y3QA 2ZNTA 1MQJA 1A54A 3KN3A 2NXOA 2A5TA 3S9LC 2OK2A 1B5JA 3JV9A 1SBPA 3CFZA 1JW4A 1OLAA 1IXCA 3RN8A 2D5WA 2FNCA 2O7UA 3PPRA 4KCDA 4H8IA 3MP6A 3PV0E 2HXWA 3CRBA 3Q27A 1B46A 2HCAA 4WEDA 3DP4A 2R71A 3KBRA 4DE8A 3IOWA 2DXYA 1B3EA 1H76A 2XXVA 5I84A 4FORA 3K00A 1TFDA 4GVOA 2RC9A 3U93A 2X7QA 3SESA 4LONB 2O51A 1S9TA 3CFLA 1JEVA 3IOVA 1B52A 2HZKA 1I69A 4F3SA 1TFAA 3FVNA 4GWOA 3FVOA 4MLQA 3TCGA 2IA4A 4GRKA 1IXIA 3DLNA 2DXRA 1PB8A 2XXTA 2NUVA 1KWHA 3I5OA 4KPTA 4QSDA 3RY3A 4DDDA 4THIA 2VOZA 3HO7A 1LB8A 1ANFA 1VSOA 4LVQA 1MM6A 4YAHX 3C9HA 4C1UA 4OETA 2I48A 4QF9A 4H5GA 4R6YA 5AA3A 1MPCA 4TLMB 4OENA 2Q8JA 3TPAA 3O6IA 1B40A 3BBRA 1N3XA 3MAMA 1M5EA 4QHQA 4FEDA 2V3TA 2I4BA 1H43A 2F7CA 3QUJA 1IIWA 4OFLA 3S9EA 3T93B 3IAZA 3MVWA 3EQ1A 2QMWA 2DVCA 1MQDA 2A5TB 3CSGA 3S2VA 4RY1A 1IUDA 1FQFA 1R1NA 1CE2A 1NFTA 3H03A 1J1NA 1AL3A 1XS5A 1MXUA 1QUIA 5EYFA 3OSRA 1POTA 2XXYA 3B6TA 3QAXA 5I2NA 2FYIA 1NH7A 1ZJLA 2ZYNA 1N84A 3TDJA 2AL4A 2O6AA 1P1OA 1B3LA 2ZMBA 4F18A 1LBBA 3MVZA 2UVJA 4EUOA 3Q29A 3PPPA 5DVJA 4YZZA 1GTKA 4RPOA 1CB6A 3B7DA 4NTLA 3IOTA 1LCFA 4R2FA 2DE4A 3G3JA 3TTRA 2RCAA 2GHAA 4N6PA 3HCQA 3TCFA 5CMBA 3QK6A 1AOVA 3RT8A 1P1WA 1PB9A 1B0HA 1B32A 4GFRA 4G8NA 5F1QA 1ZTYA 3GBAA 2H5YA 1MPDA 1EZPA 1JVYA 4R2BA 4EXKA 3VVDA 3LUYA 4DLDA 4H65A 4AB5A 4XKPA 4FAJA 3TYHA 2E1SA 1SI0A 1LFHA 4PETA 4DIGA 4IO2A 4BDRA 3VV5A 3FVKA 3GLBA 3N94A 3TTMA 4I62A 3ZS6A 3ZKKA 3PMWA 3TQLA 1DSNA 1FQDA 3MVXA 5BUUA 3UP9A 2DS9A 5IAIA 1R9LA 3DM0A 5AA1A 2XXXA 2XXQA 4ZDMA 4OWDA 4O3CA 3N26A 4F1VA 3MBPA 1BP5A 2Q2CA 4GQOA 3KSJA 1PBQA 2ONRA 4EDPA 2NOOA 4GIZA 2UYFA 3K6UA 1FQEA 1B4HA 4ESWA 4YMBA 2ZNUA 3G7WA 1XVYA 4NEDA 3FV1A 3UORA 3K6VA 3VDFA 4G68A 5ICTA 2O68A 3ODBA 4ZZEA 5H8QA 1EH3A 1XT8A 5JTYA 1YPNA 1O64A 1OIBA 1WDNA 1IXGA 1MXZA 1POY1 1MY2A 2CMOA 1FCKA 1YCJA 3HPIA 4ZECA 3G3GA 2XXIA 5CBSA 4TQUQ 1FTKA 2Z8FA 2O84X 3TZAA 3R7XA 5FTHA 2A5SA 2RINA 4OTEA 3H4ZA 1GGGA 5FHNA 1ZBMA 1USYH 2G93A 2W7YA 3N6UA 2B65A 1NL5A 4Q0CA 4LA9A 4EF2A 2ZYMA 4WEPA 2QMXA 5H8NA 1MY0A 1GR2A 4EQ7A 3QXMA 3LR1A 4QFNA 2I0CA 2Z8EA 4UA8A 2AYSA 2F97A 4OERA 1B5IA 4PE5B 1IEJA 4ELPA 1UTHA 3FASA 4YKIA 3TEPA 2QPQA 1GV8A 3USDA 2VHAA 3GZGA 2VD3A 4H8JA 5ELVA 2YPNA 3N5LA 4HCWA 4P11A 2O69A 2OCUA 1A8EA 2XX8A 5ICQA 3FIRA 3VLWA 3KN8A 1MH4A 4MLVA 4QSEA 4OYVA 4DXUA 4YU0A 1I6BA 2XXHA 3PD9A 2I3VA 3FVGA 1ZMGA 4K3FA 1UIVA 2X7PA 1Z7ME 3M3KA 1QW0A 3SDFA 5AA4A 4R6KA 3VLVA 5I58A 3T9VA 4X1DA 3FJGA 3BFUA 5JEIA 5HBCA 3T66A 2F34A 3PGFA 3OD7A 3EF7A 3RNNA 1H44A 1MM7A 3MP1A 3PD8A 1IITA 4ISUA 4H1XA 5DVFA 1R9QA 3PPNA 1B2HA 5CBRA 2XX7A 3T22A 3K02A 5H8QB 5JTYB 4BDMA 3R26A 3JZJA 1AH5A 3MJNA 4P0IA 1NNTA 1MXWA 3FV2A 3H6VA 4M1VA 4OMBA 3OOAA 4G68C 3TQWA 3P7IA 3IL1B 3F11A 1MPBA 3FGSA 4Q5TA 3H6WA 4H0WA 3PUXE 2B3FA 1M5DA 3IORA 1Q35A 2KLFA 1HSLA 5B7DA 4UACA 4LQ2A 2DVZA 1Y4TA 1TWYA 3D4CA 3SEVA 3EPEA 5H8NB 3VXBA 3ILUB 5CM6A 3RQTA 1Z7NE 2F6GA 4PFUA 2RF1A 4OEVA 1MS7A 2DQVA 3WAEA 1BIYA 1SD3A 4FJPA 3OENA 3C33A 3KGCA 4EXLA 1Y9UA 4F2OA 1P99A 3K1PA 2REGA 4XIGQ 1M5CA 1B5HA 3TMGA 1JW5A 2UVGA 4GOTA 3V5AA 5DEXA 2PT2A 4DCYA 3E9XA 2P2AA 4ZEKA 3B6WA 3SEYA 4Z0IA 2REJA 5KZTA 4ZZAA 3VVEA 2PBWA 2Y84A 2XXRA 5K2YA 4MF3A 3IB1A 1M5FA 2QL3A 2NVUB 5I59A 5AA4B 1S7YA 4F3BA 3KN7A 5I58B 1PDAA 4GXSB 1IXHA 1XHYA 3KEIA 1MDQA 4HW8A 4KFQA 3V83A 4NF5B 1EZ9A 2O1LA 4EQBA 3IJXB 3MZBA 3PMVA 3C4MA 3CIJA 2ZYOA 3EHTA 4GXAA 1LGBC 1LAGE 3BFTA 1ATGA 2QJEA 1A99A 2Y7KA 1MY1A 3UIFA 2HFBA 4JSDA 2D21A 5L9OA 4I8CA 2I58A 3VE1B 1AMFA 4IO7A 1N3WA 3Q25A 4OQOA 2Z23A 2V93A 4WXJA 1UTBA 1YTVA 2X26A 4ELOA 2NWJA 4JXIA 5CMKA 1OQHA 2Q9TA 4YICA 3OO9A 2VD2A 4YB7A 3KOSA 4NF4A 4NF6A 1DPEA 3RLFE 5AA2A 3DP6A 3TFLA 3G3FA 1ELJA 3MZ9A 3HN0A 4OZ9A 4P0GA 2VGQA 2YLNA 4BDLA 1NNFA 5TU0A 1B3HA 4GD5A 4LP2B 1DOTA 3C35A 1Y3PA 5KDTA 4R9GA 1D9VA 3KSXA 4G2ZA 4OHNA 2ALUA 2R9JA 4DZ1A 1SQYA 1B9JA 2XD2A 3TTKA 1NNKA 3KG2A 4U1OA 5DEXB 4F31B 4KYSA 1O63A 2OJTA 1JNFA 1RYOA 3OEKA 1MXVA 4KYEA 4POWA 3H6TA 5DTBA 2QSXA 3WAFA 4ELRA 1HSJA 3QIMA 4F1YA 5ITOA 5J1DA 4RYAA 1B7ZA 4PQJA 4HCYA 1TT1A 2R6GE 4R72A 1F9BA 2XXUA 2XXPA 4XKNA 3RPWA 3ILTB 2OWSA 5CMMA 1OQGA 1FTJA 1FTOA 2Z22A 4F2QA 4JDFA 1B05A 3V89B 4PP0A 2ZYKA 1MXXA 3IO6A 3RTFB 5KCJA 3KFMA 4N07A 3KJ7A 5CMCA 1A7LA 3CSBA 2I6EA 3TELA 3ZKLA 1B3GA 3MQ9A 4TLLB 1FTMA 3G3IA 3MW0A 4C1TA 2H98A 1B1HA 4JWYA 4YKJA 1UTBB 4IY5A 2XX9A 1B7UA 3CR9A 3CI8A 1US4A 2UYEA 1PBPA 3FZVA 1SI1A 3C32A 5FHOA 3IOUA 3C34A 5L9MA 3KJTA 5L8DA 3MPLA 4NF4B 1MXYA 1Y4CA 5I2NB 2PX1A 2THIA 1LAXA 5AA2B 3LSFB 3UGWA 3MPKA 2M8CA 2PYYA 4YMAA 4OEUA 3HV1A 4M4GA 4G77A 2ONSA 1NMUA 5ISUA 4QFLA 2UVHA 3Q28A 2D3IA 3TKDA 4AQ4A 4XXUA 5KDTB 1L5TA 1I6QA 2IEEA 3H3GA 1DTGA 2HQ0A 3ONMA 2H99A 1B6HA 4KCCA 3MC2A 1H3DA 3I6VA 4F3GA 1OVBA 4O3BA 1PEBA 4X1BA 3E3KA 1Y1MA 1LSTA 2PT1A 3LC8A 1N7XA 1B4ZA 1BTJA 5EHMA 5TPAA 5CI5A 1ZIUA 2OZZA 3R6UA 4NWCA 4JBZA 2G29A 4DXCA 1P1UA 3QYTA 1LB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DP8 A;  1MQI A;  2F8D A;  4NMY A;  3KZG A;  3UA8 A;  4Z7E A;  3RT6 B;  3KOT A;  2GRV A;  2FA7 A;  3FXR A;  3EHU A;  1Y3N A;  3IB2 A;  1XVX A;  2QS2 A;  4XKQ A;  1DMB A;  4OFJ A;  3OEM A;  4QRZ A;  2F7B A;  4IY6 A;  3U72 A;  1NKX A;  4MFI A;  4KD5 A;  1I6A A;  4FEC A;  1USY E;  4BDO A;  3RGY A;  4YKP A;  4PFY A;  5KCJ B;  1URD A;  2V3Q A;  3UN6 A;  4LZ5 A;  1DPP A;  2Y7P A;  4BLA A;  3O2A A;  1Q1K A;  2DOJ A;  1MY4 A;  1SVX B;  3DEL B;  4BDN A;  3M3F A;  4ZEB A;  2PMS A;  2DE2 A;  4G68 B;  5IKB A;  4AB6 A;  1EZO A;  3K01 A;  3IO4 A;  4QSC A;  3QUF A;  4RK9 A;  4OXV A;  1RKM A;  2F35 A;  4OFO A;  3FXQ A;  4ZS9 A;  1WOD A;  3OXN A;  4KQP A;  4X9T A;  1NNP A;  4IGT A;  2QS3 A;  5DT6 A;  2B3B A;  2QRY A;  5DYH A;  3CG1 A;  2AIX A;  2HEU A;  2I0B A;  2V25 A;  3SEW A;  2RKM A;  2F36 A;  5M2V A;  4R9F A;  1A8F A;  4F29 A;  3K6W A;  2Y7R A;  4RK2 A;  1ZU0 A;  5BWJ A;  3FD3 A;  5TP9 A;  4XKR A;  3PU5 A;  5JK4 A;  4U1Z A;  2DWA A;  1MY3 A;  4LUB A;  4U4X A;  1US5 A;  1PB7 A;  2Z8D A;  1JEU A;  4PFW A;  1A40 A;  3BKI B;  1ZKB A;  3T96 B;  3LSX A;  1B0L A;  1R6Z A;  4QFO A;  3O28 A;  4JB7 A;  5TPA B;  1P1Q A;  1SYI A;  4IO3 A;  4DXB A;  5AA2 D;  1Y20 A;  2P1S A;  5A5X A;  1QVS A;  2ZNS A;  1UTH B;  2OWT A;  4Q8R A;  1B1X A;  5FHM A;  3PPO A;  3B6Q A;  3TTL A;  4YB5 A;  1AIV A;  2OBG A;  3GXA A;  3EN3 A;  1URS A;  2Q89 A;  1HSE A;  2DSF A;  3O66 A;  3L6H A;  3H6U A;  3K6X A;  3VLU A;  3OMB A;  4HTG A;  1LFI A;  4RNS A;  3RTW B;  2XHD A;  4LZ8 A;  3FUZ A;  2AL5 A;  2I49 A;  1MQH A;  3A3U A;  4JSO A;  4R6H A;  2GHB A;  4U2R A;  1MG1 A;  4IO6 A;  1XC1 A;  1MDP 1;  4NF8 A;  3MP8 A;  4C0R A;  1YAE A;  4O3A A;  4BDQ A;  3EHS A;  5H8S A;  3W9W A;  4E0W A;  3THI A;  2F5X A;  2HZL A;  1MRP A;  3MWB A;  1BKA A;  3S9N C;  4L17 A;  4ZED A;  4EF1 A;  3G3H A;  4H5F A;  1OLC A;  1P1N A;  1N04 A;  3HST A;  1N7W A;  3MZ1 A;  4U4S A;  3OO6 A;  3PUZ E;  1UIU A;  2OLB A;  4FEB A;  3SEU A;  3M3L A;  5K2X A;  4HS7 A;  4F19 A;  2F78 A;  3G3K A;  3TOD A;  2V3U A;  2HAV A;  5L9S A;  1JQF A;  4I9D A;  2RC8 A;  5LOM A;  1LAH E;  2Q2A A;  4ZE8 A;  3FAT A;  1D9Y A;  2YJP A;  2WKY A;  1RYX A;  3O97 A;  5TP9 B;  1MQG A;  1DTZ A;  2DWI A;  3VVF A;  4IO4 A;  1GVC A;  5H8H A;  1SDX A;  4U23 A;  2I4C A;  3QSL A;  1LCT A;  2H9B A;  4G4P A;  3FXU A;  3K0V A;  2H25 A;  4MH5 A;  3W9V A;  4F1U A;  4H6D A;  3S4U A;  5A5X B;  3OO8 A;  1XOC A;  1SW1 A;  4R75 A;  5HM4 B;  3FJM A;  2H4I A;  5CC2 A;  2GFE A;  3E13 X;  3C31 A;  1QJM A;  2BJJ X;  3V8X B;  4ZE9 A;  4ND9 A;  3K1M A;  1A55 A;  4G8M A;  3A3C A;  4ONY A;  4KYD A;  2V84 A;  4RA1 A;  4H67 A;  3U94 A;  3VXC A;  3OO7 A;  4Q30 B;  1MH3 A;  5H8F A;  3PUW E;  4F22 A;  1PC3 A;  1URG A;  4KHZ E;  2CZL A;  2O1M A;  5I59 B;  3FJ7 A;  3TCH A;  1VE4 A;  1FQC A;  1D3K A;  3T9X B;  1D4N A;  1ZLQ A;  4EQ9 A;  5ITP A;  4YKK A;  4LAT A;  3U1O A;  4NF8 B;  4R73 A;  3HHG A;  2PVU A;  3IB0 A;  4NWD A;  4N13 A;  3SKP A;  5CRY A;  1SYH A;  4E0X A;  4U22 A;  1NH8 A;  2QS1 A;  5F7V A;  4I1D A;  3UK4 A;  1WVJ A;  1LAF E;  3N6T A;  1VR5 A;  4QFP A;  5AE4 A;  1VFD A;  2DE3 A;  5HPQ A;  4OES A;  1QUK A;  1EU8 A;  2UXA A;  3H06 B;  1UQW A;  1IQ7 A;  4PFT A;  1LBC A;  2XXW A;  3HHF A;  4KR5 A;  3E4R A;  3O6G A;  4DCX A;  4F39 A;  4RPN A;  5DVI A;  4R74 A;  4ECF A;  1JET A;  2HAU A;  4NF6 B;  1II5 A;  5FTI A;  4GF8 A;  3A09 A;  3S9M C;  5I56 A;  3C36 A;  5H8H B;  2DP8 A;  4LQ5 A;  4RXL A;  1QKA A;  3W15 C;  3M8U A;  3Q26 A;  1QKB A;  3RUM A;  3TAJ A;  2GH9 A;  4IO5 A;  4ELQ A;  1N0T A;  3IK6 B;  3K4U A;  5I2K A;  5I57 A;  2F6P A;  1LLS A;  3ZSF A;  4XTC Q;  3K1N A;  4IB2 A;  2QS4 A;  4F3P A;  1O7T A;  2RCB A;  4U21 A;  2DWH A;  1OVT A;  3LBS A;  2ONK E;  1JW1 A;  2O7I A;  3TTN A;  3CFX A;  4OVJ A;  4POX A;  1B51 A;  3TUS A;  1M5B A;  2LAO A;  3MVY A;  3L6G A;  5H8F B;  3SEX A;  3MUQ A;  1SW4 A;  1B58 A;  3GBB A;  2ABH A;  1LFG A;  3PUV E;  4GLI A;  3PUY E;  1N76 A;  1BLF A;  4IGR A;  3LSW A;  4JWX A;  3SER A;  4ZEF A;  3ECR A;  3O9P A;  3H7M A;  4LZ7 A;  3IJO B;  1FQA A;  1B3F A;  4KI0 E;  3I3V A;  1T0K A;  1FW0 A;  1B7H A;  2Q88 A;  4ESX A;  2Y7I A;  3T9U A;  4YB6 A;  4NE4 A;  4FAT A;  1SW2 A;  2UVI A;  2XD3 A;  2E0S A;  2VP1 A;  4WKM A;  3OEL A;  1H45 A;  5EHS A;  2Y7W A;  3PPQ A;  1FTL A;  2ESN A;  3LSL A;  1OMP A;  2RC7 A;  1QUL A;  3VFJ A;  3O29 A;  3U92 A;  1VFE A;  4GL0 A;  4X48 A;  3SET A;  4RJZ A;  3IX1 A;  4QFK A;  3O6H A;  4G8H A;  3JYR A;  3T9H B;  4ZEI A;  4NF5 A;  4TOZ A;  2DWJ A;  3D4G A;  1SW5 A;  2F7A A;  1TXF A;  4FIM A;  2ZXT A;  5B70 A;  3IR1 A;  2I3W A;  3AXF A;  3U8Q A;  3PMX A;  2P0S A;  4MBP A;  1IZ1 A;  2DYX A;  1Y1Z A;  3CVG A;  3K2D A;  1QUJ A;  5I56 B;  4GL8 A;  3CG3 A;  2ANJ A;  1JVX A;  3OSQ A;  1S50 A;  4FE8 A;  5I2K B;  5I57 B;  4JWO A;  1FQB A;  1Y3Q A;  2ZNT A;  1MQJ A;  1A54 A;  3KN3 A;  2NXO A;  2A5T A;  3S9L C;  2OK2 A;  1B5J A;  3JV9 A;  1SBP A;  3CFZ A;  1JW4 A;  1OLA A;  1IXC A;  3RN8 A;  2D5W A;  2FNC A;  2O7U A;  3PPR A;  4KCD A;  4H8I A;  3MP6 A;  3PV0 E;  2HXW A;  3CRB A;  3Q27 A;  1B46 A;  2HCA A;  4WED A;  3DP4 A;  2R71 A;  3KBR A;  4DE8 A;  3IOW A;  2DXY A;  1B3E A;  1H76 A;  2XXV A;  5I84 A;  4FOR A;  3K00 A;  1TFD A;  4GVO A;  2RC9 A;  3U93 A;  2X7Q A;  3SES A;  4LON B;  2O51 A;  1S9T A;  3CFL A;  1JEV A;  3IOV A;  1B52 A;  2HZK A;  1I69 A;  4F3S A;  1TFA A;  3FVN A;  4GWO A;  3FVO A;  4MLQ A;  3TCG A;  2IA4 A;  4GRK A;  1IXI A;  3DLN A;  2DXR A;  1PB8 A;  2XXT A;  2NUV A;  1KWH A;  3I5O A;  4KPT A;  4QSD A;  3RY3 A;  4DDD A;  4THI A;  2VOZ A;  3HO7 A;  1LB8 A;  1ANF A;  1VSO A;  4LVQ A;  1MM6 A;  4YAH X;  3C9H A;  4C1U A;  4OET A;  2I48 A;  4QF9 A;  4H5G A;  4R6Y A;  5AA3 A;  1MPC A;  4TLM B;  4OEN A;  2Q8J A;  3TPA A;  3O6I A;  1B40 A;  3BBR A;  1N3X A;  3MAM A;  1M5E A;  4QHQ A;  4FED A;  2V3T A;  2I4B A;  1H43 A;  2F7C A;  3QUJ A;  1IIW A;  4OFL A;  3S9E A;  3T93 B;  3IAZ A;  3MVW A;  3EQ1 A;  2QMW A;  2DVC A;  1MQD A;  2A5T B;  3CSG A;  3S2V A;  4RY1 A;  1IUD A;  1FQF A;  1R1N A;  1CE2 A;  1NFT A;  3H03 A;  1J1N A;  1AL3 A;  1XS5 A;  1MXU A;  1QUI A;  5EYF A;  3OSR A;  1POT A;  2XXY A;  3B6T A;  3QAX A;  5I2N A;  2FYI A;  1NH7 A;  1ZJL A;  2ZYN A;  1N84 A;  3TDJ A;  2AL4 A;  2O6A A;  1P1O A;  1B3L A;  2ZMB A;  4F18 A;  1LBB A;  3MVZ A;  2UVJ A;  4EUO A;  3Q29 A;  3PPP A;  5DVJ A;  4YZZ A;  1GTK A;  4RPO A;  1CB6 A;  3B7D A;  4NTL A;  3IOT A;  1LCF A;  4R2F A;  2DE4 A;  3G3J A;  3TTR A;  2RCA A;  2GHA A;  4N6P A;  3HCQ A;  3TCF A;  5CMB A;  3QK6 A;  1AOV A;  3RT8 A;  1P1W A;  1PB9 A;  1B0H A;  1B32 A;  4GFR A;  4G8N A;  5F1Q A;  1ZTY A;  3GBA A;  2H5Y A;  1MPD A;  1EZP A;  1JVY A;  4R2B A;  4EXK A;  3VVD A;  3LUY A;  4DLD A;  4H65 A;  4AB5 A;  4XKP A;  4FAJ A;  3TYH A;  2E1S A;  1SI0 A;  1LFH A;  4PET A;  4DIG A;  4IO2 A;  4BDR A;  3VV5 A;  3FVK A;  3GLB A;  3N94 A;  3TTM A;  4I62 A;  3ZS6 A;  3ZKK A;  3PMW A;  3TQL A;  1DSN A;  1FQD A;  3MVX A;  5BUU A;  3UP9 A;  2DS9 A;  5IAI A;  1R9L A;  3DM0 A;  5AA1 A;  2XXX A;  2XXQ A;  4ZDM A;  4OWD A;  4O3C A;  3N26 A;  4F1V A;  3MBP A;  1BP5 A;  2Q2C A;  4GQO A;  3KSJ A;  1PBQ A;  2ONR A;  4EDP A;  2NOO A;  4GIZ A;  2UYF A;  3K6U A;  1FQE A;  1B4H A;  4ESW A;  4YMB A;  2ZNU A;  3G7W A;  1XVY A;  4NED A;  3FV1 A;  3UOR A;  3K6V A;  3VDF A;  4G68 A;  5ICT A;  2O68 A;  3ODB A;  4ZZE A;  5H8Q A;  1EH3 A;  1XT8 A;  5JTY A;  1YPN A;  1O64 A;  1OIB A;  1WDN A;  1IXG A;  1MXZ A;  1POY 1;  1MY2 A;  2CMO A;  1FCK A;  1YCJ A;  3HPI A;  4ZEC A;  3G3G A;  2XXI A;  5CBS A;  4TQU Q;  1FTK A;  2Z8F A;  2O84 X;  3TZA A;  3R7X A;  5FTH A;  2A5S A;  2RIN A;  4OTE A;  3H4Z A;  1GGG A;  5FHN A;  1ZBM A;  1USY H;  2G93 A;  2W7Y A;  3N6U A;  2B65 A;  1NL5 A;  4Q0C A;  4LA9 A;  4EF2 A;  2ZYM A;  4WEP A;  2QMX A;  5H8N A;  1MY0 A;  1GR2 A;  4EQ7 A;  3QXM A;  3LR1 A;  4QFN A;  2I0C A;  2Z8E A;  4UA8 A;  2AYS A;  2F97 A;  4OER A;  1B5I A;  4PE5 B;  1IEJ A;  4ELP A;  1UTH A;  3FAS A;  4YKI A;  3TEP A;  2QPQ A;  1GV8 A;  3USD A;  2VHA A;  3GZG A;  2VD3 A;  4H8J A;  5ELV A;  2YPN A;  3N5L A;  4HCW A;  4P11 A;  2O69 A;  2OCU A;  1A8E A;  2XX8 A;  5ICQ A;  3FIR A;  3VLW A;  3KN8 A;  1MH4 A;  4MLV A;  4QSE A;  4OYV A;  4DXU A;  4YU0 A;  1I6B A;  2XXH A;  3PD9 A;  2I3V A;  3FVG A;  1ZMG A;  4K3F A;  1UIV A;  2X7P A;  1Z7M E;  3M3K A;  1QW0 A;  3SDF A;  5AA4 A;  4R6K A;  3VLV A;  5I58 A;  3T9V A;  4X1D A;  3FJG A;  3BFU A;  5JEI A;  5HBC A;  3T66 A;  2F34 A;  3PGF A;  3OD7 A;  3EF7 A;  3RNN A;  1H44 A;  1MM7 A;  3MP1 A;  3PD8 A;  1IIT A;  4ISU A;  4H1X A;  5DVF A;  1R9Q A;  3PPN A;  1B2H A;  5CBR A;  2XX7 A;  3T22 A;  3K02 A;  5H8Q B;  5JTY B;  4BDM A;  3R26 A;  3JZJ A;  1AH5 A;  3MJN A;  4P0I A;  1NNT A;  1MXW A;  3FV2 A;  3H6V A;  4M1V A;  4OMB A;  3OOA A;  4G68 C;  3TQW A;  3P7I A;  3IL1 B;  3F11 A;  1MPB A;  3FGS A;  4Q5T A;  3H6W A;  4H0W A;  3PUX E;  2B3F A;  1M5D A;  3IOR A;  1Q35 A;  2KLF A;  1HSL A;  5B7D A;  4UAC A;  4LQ2 A;  2DVZ A;  1Y4T A;  1TWY A;  3D4C A;  3SEV A;  3EPE A;  5H8N B;  3VXB A;  3ILU B;  5CM6 A;  3RQT A;  1Z7N E;  2F6G A;  4PFU A;  2RF1 A;  4OEV A;  1MS7 A;  2DQV A;  3WAE A;  1BIY A;  1SD3 A;  4FJP A;  3OEN A;  3C33 A;  3KGC A;  4EXL A;  1Y9U A;  4F2O A;  1P99 A;  3K1P A;  2REG A;  4XIG Q;  1M5C A;  1B5H A;  3TMG A;  1JW5 A;  2UVG A;  4GOT A;  3V5A A;  5DEX A;  2PT2 A;  4DCY A;  3E9X A;  2P2A A;  4ZEK A;  3B6W A;  3SEY A;  4Z0I A;  2REJ A;  5KZT A;  4ZZA A;  3VVE A;  2PBW A;  2Y84 A;  2XXR A;  5K2Y A;  4MF3 A;  3IB1 A;  1M5F A;  2QL3 A;  2NVU B;  5I59 A;  5AA4 B;  1S7Y A;  4F3B A;  3KN7 A;  5I58 B;  1PDA A;  4GXS B;  1IXH A;  1XHY A;  3KEI A;  1MDQ A;  4HW8 A;  4KFQ A;  3V83 A;  4NF5 B;  1EZ9 A;  2O1L A;  4EQB A;  3IJX B;  3MZB A;  3PMV A;  3C4M A;  3CIJ A;  2ZYO A;  3EHT A;  4GXA A;  1LGB C;  1LAG E;  3BFT A;  1ATG A;  2QJE A;  1A99 A;  2Y7K A;  1MY1 A;  3UIF A;  2HFB A;  4JSD A;  2D21 A;  5L9O A;  4I8C A;  2I58 A;  3VE1 B;  1AMF A;  4IO7 A;  1N3W A;  3Q25 A;  4OQO A;  2Z23 A;  2V93 A;  4WXJ A;  1UTB A;  1YTV A;  2X26 A;  4ELO A;  2NWJ A;  4JXI A;  5CMK A;  1OQH A;  2Q9T A;  4YIC A;  3OO9 A;  2VD2 A;  4YB7 A;  3KOS A;  4NF4 A;  4NF6 A;  1DPE A;  3RLF E;  5AA2 A;  3DP6 A;  3TFL A;  3G3F A;  1ELJ A;  3MZ9 A;  3HN0 A;  4OZ9 A;  4P0G A;  2VGQ A;  2YLN A;  4BDL A;  1NNF A;  5TU0 A;  1B3H A;  4GD5 A;  4LP2 B;  1DOT A;  3C35 A;  1Y3P A;  5KDT A;  4R9G A;  1D9V A;  3KSX A;  4G2Z A;  4OHN A;  2ALU A;  2R9J A;  4DZ1 A;  1SQY A;  1B9J A;  2XD2 A;  3TTK A;  1NNK A;  3KG2 A;  4U1O A;  5DEX B;  4F31 B;  4KYS A;  1O63 A;  2OJT A;  1JNF A;  1RYO A;  3OEK A;  1MXV A;  4KYE A;  4POW A;  3H6T A;  5DTB A;  2QSX A;  3WAF A;  4ELR A;  1HSJ A;  3QIM A;  4F1Y A;  5ITO A;  5J1D A;  4RYA A;  1B7Z A;  4PQJ A;  4HCY A;  1TT1 A;  2R6G E;  4R72 A;  1F9B A;  2XXU A;  2XXP A;  4XKN A;  3RPW A;  3ILT B;  2OWS A;  5CMM A;  1OQG A;  1FTJ A;  1FTO A;  2Z22 A;  4F2Q A;  4JDF A;  1B05 A;  3V89 B;  4PP0 A;  2ZYK A;  1MXX A;  3IO6 A;  3RTF B;  5KCJ A;  3KFM A;  4N07 A;  3KJ7 A;  5CMC A;  1A7L A;  3CSB A;  2I6E A;  3TEL A;  3ZKL A;  1B3G A;  3MQ9 A;  4TLL B;  1FTM A;  3G3I A;  3MW0 A;  4C1T A;  2H98 A;  1B1H A;  4JWY A;  4YKJ A;  1UTB B;  4IY5 A;  2XX9 A;  1B7U A;  3CR9 A;  3CI8 A;  1US4 A;  2UYE A;  1PBP A;  3FZV A;  1SI1 A;  3C32 A;  5FHO A;  3IOU A;  3C34 A;  5L9M A;  3KJT A;  5L8D A;  3MPL A;  4NF4 B;  1MXY A;  1Y4C A;  5I2N B;  2PX1 A;  2THI A;  1LAX A;  5AA2 B;  3LSF B;  3UGW A;  3MPK A;  2M8C A;  2PYY A;  4YMA A;  4OEU A;  3HV1 A;  4M4G A;  4G77 A;  2ONS A;  1NMU A;  5ISU A;  4QFL A;  2UVH A;  3Q28 A;  2D3I A;  3TKD A;  4AQ4 A;  4XXU A;  5KDT B;  1L5T A;  1I6Q A;  2IEE A;  3H3G A;  1DTG A;  2HQ0 A;  3ONM A;  2H99 A;  1B6H A;  4KCC A;  3MC2 A;  1H3D A;  3I6V A;  4F3G A;  1OVB A;  4O3B A;  1PEB A;  4X1B A;  3E3K A;  1Y1M A;  1LST A;  2PT1 A;  3LC8 A;  1N7X A;  1B4Z A;  1BTJ A;  5EHM A;  5TPA A;  5CI5 A;  1ZIU A;  2OZZ A;  3R6U A;  4NWC A;  4JBZ A;  2G29 A;  4DXC A;  1P1U A;  3QYT A;  1LB9 A; 
#chains in the Genus database with same CATH topology
 3DP8 A;  1MQI A;  2F8D A;  3SZP A;  4NMY A;  3KZG A;  4AS4 A;  3UA8 A;  4Z7E A;  3RT6 B;  3KOT A;  1RDY A;  2GRV A;  2FA7 A;  3FXR A;  3EHU A;  1Y3N A;  3IB2 A;  4QBA A;  1XVX A;  2QS2 A;  4XKQ A;  1DMB A;  1FJ9 A;  4OFJ A;  3OEM A;  4QRZ A;  2F7B A;  4IY6 A;  3U72 A;  1NKX A;  4MFI A;  4KD5 A;  1I6A A;  4FEC A;  1USY E;  4BDO A;  3RGY A;  2XWO A;  4YKP A;  4PFY A;  5KCJ B;  1URD A;  5T3J A;  2V3Q A;  3UN6 A;  4LZ5 A;  1DPP A;  1NUZ A;  2Y7P A;  4BLA A;  3O2A A;  1Q1K A;  2DOJ A;  1MY4 A;  1SVX B;  3DEL B;  4BDN A;  3M3F A;  4ZEB A;  2PMS A;  4GWW A;  2DE2 A;  4G68 B;  5IKB A;  4AB6 A;  1EZO A;  3K01 A;  3IO4 A;  4QSC A;  3QUF A;  4RK9 A;  4OXV A;  1RKM A;  2F35 A;  4OFO A;  3T1B A;  3FXQ A;  4ZS9 A;  1WOD A;  3OXN A;  4KQP A;  4X9T A;  1NNP A;  4IGT A;  2QS3 A;  3MST A;  4MAG A;  5DT6 A;  2B3B A;  2QRY A;  5DYH A;  3CG1 A;  2AIX A;  2BJI A;  2HEU A;  2I0B A;  2V25 A;  3SEW A;  2RKM A;  2F36 A;  2Q74 A;  5M2V A;  4R9F A;  1YZ0 A;  1A8F A;  4PGN A;  4F29 A;  1IMA A;  3K6W A;  2Y7R A;  4RK2 A;  1ZU0 A;  5BWJ A;  3FD3 A;  4LN5 A;  1FRP A;  5TP9 A;  4XKR A;  2ZZW A;  3PU5 A;  5JK4 A;  4U1Z A;  4JVD A;  2DWA A;  1MY3 A;  4LUB A;  4U4X A;  1US5 A;  1PB7 A;  2Z8D A;  1JEU A;  4PFW A;  1A40 A;  3BKI B;  1ZKB A;  3T96 B;  3LSX A;  1B0L A;  1R6Z A;  4QFO A;  3O28 A;  1EYI A;  4JB7 A;  5TPA B;  5ET5 A;  1P1Q A;  1SYI A;  4IO3 A;  4DXB A;  3BIH A;  5AA2 D;  1Y20 A;  2P1S A;  5A5X A;  1QVS A;  2ZNS A;  1UTH B;  4KXP A;  1FPF A;  2OWT A;  4Q8R A;  1B1X A;  4MNC A;  5FHM A;  3PPO A;  3B6Q A;  3TTL A;  4YB5 A;  1AIV A;  2OBG A;  3GXA A;  2CZI A;  3B8B A;  3EN3 A;  1URS A;  2Q89 A;  1HSE A;  4GBV A;  2DSF A;  4JVC A;  3O66 A;  2XA5 A;  3L6H A;  3H6U A;  4PF6 A;  3K6X A;  3VLU A;  3OMB A;  4HTG A;  1LFI A;  4RNS A;  3RTW B;  2XHD A;  4LZ8 A;  3FUZ A;  2GQ1 A;  2AL5 A;  2I49 A;  1MQH A;  3A3U A;  4JSO A;  4R6H A;  2GHB A;  4U2R A;  4OVQ A;  2PFY A;  4P1L A;  1MG1 A;  4IO6 A;  1FPJ A;  4NG7 A;  4NAP A;  4XEQ A;  1XC1 A;  1MDP 1;  4NF8 A;  3MP8 A;  4C0R A;  1YAE A;  1KZ8 A;  4O3A A;  4BDQ A;  3EHS A;  5IZZ A;  5H8S A;  3W9W A;  4E0W A;  3THI A;  2F5X A;  2HZL A;  1MRP A;  5ET7 A;  3MWB A;  1BKA A;  3S9N C;  2ZZX A;  4L17 A;  4ZED A;  3KC1 A;  4EF1 A;  5FBP A;  3G3H A;  4H5F A;  1OLC A;  1P1N A;  1N04 A;  3HST A;  5EQ8 A;  1N7W A;  3MZ1 A;  4U4S A;  3OO6 A;  3PUZ E;  1FBE A;  1UIU A;  2OLB A;  4FEB A;  4N91 A;  3SEU A;  3M3L A;  5K2X A;  4HS7 A;  4F19 A;  2F78 A;  3G3K A;  3TOD A;  2V3U A;  2HAV A;  1NUW A;  5L9S A;  1JQF A;  4I9D A;  1IMC A;  2RC8 A;  5LOM A;  1LAH E;  2Q2A A;  4ZE8 A;  4P47 A;  4OAN A;  3FAT A;  2KR0 A;  1D9Y A;  2QVR A;  2YJP A;  2WKY A;  1RYX A;  3O97 A;  5TP9 B;  1MQG A;  1DTZ A;  2DWI A;  3VVF A;  4IO4 A;  1GVC A;  5H8H A;  1SDX A;  4U23 A;  2I4C A;  3QSL A;  1IMF A;  1LCT A;  2H9B A;  4G4P A;  3FXU A;  3K0V A;  2H25 A;  4MH5 A;  3W9V A;  1NI9 A;  4F1U A;  4H6D A;  1IMD A;  3OO8 A;  3S4U A;  5A5X B;  1XOC A;  1SW1 A;  4R75 A;  5HM4 B;  3FJM A;  2H4I A;  5CC2 A;  2GFE A;  3E13 X;  3C31 A;  1QJM A;  2BJJ X;  1INP A;  3V8X B;  4ZE9 A;  4ND9 A;  3K1M A;  1A55 A;  4G8M A;  4O8M A;  3A3C A;  4ONY A;  4KYD A;  2V84 A;  4RA1 A;  4H67 A;  1NV7 A;  4I3E A;  3OO7 A;  4Q30 B;  3U94 A;  3VXC A;  4IR8 A;  1MH3 A;  5H8F A;  3PUW E;  4F22 A;  2B4M A;  1PC3 A;  1URG A;  4KHZ E;  2CZL A;  2O1M A;  2HXR A;  5I59 B;  3FJ7 A;  3TCH A;  1VE4 A;  1FQC A;  5IGA A;  1D3K A;  3T9X B;  4P3L A;  1D4N A;  1ZLQ A;  3LUZ A;  4EQ9 A;  5ITP A;  4YKK A;  4N6K A;  4LAT A;  4NF8 B;  3U1O A;  4PAF A;  4R73 A;  3HHG A;  2PVU A;  3IB0 A;  4NWD A;  4N13 A;  3SKP A;  5CRY A;  1SYH A;  4E0X A;  4U22 A;  1NH8 A;  2L5V A;  2QS1 A;  5F7V A;  4I1D A;  3UK4 A;  1DK4 A;  1WVJ A;  1LAF E;  3N6T A;  1VR5 A;  4QFP A;  5AE4 A;  1VFD A;  2DE3 A;  2VPO A;  5HPQ A;  4OES A;  1QUK A;  1EU8 A;  2UXA A;  3H06 B;  1UQW A;  1IQ7 A;  4PFT A;  1LBC A;  2XXW A;  3HHF A;  4KR5 A;  3E4R A;  3LV0 A;  3O6G A;  4GWX A;  4DCX A;  4NF0 A;  4F39 A;  4RPN A;  5DVI A;  4R74 A;  2WEF A;  1LBW A;  4ECF A;  1JET A;  2HAU A;  4NF6 B;  1II5 A;  1NV0 A;  5FTI A;  4GF8 A;  3A09 A;  3S9M C;  5I56 A;  3C36 A;  5H8H B;  2DP8 A;  1NV5 A;  3IFC A;  4LQ5 A;  4RXL A;  1QKA A;  2Q8M A;  3W15 C;  3M8U A;  3Q26 A;  1QKB A;  3RUM A;  3TAJ A;  2GH9 A;  4IO5 A;  1FSA A;  4ELQ A;  1N0T A;  1NV3 A;  3IK6 B;  3K4U A;  5I2K A;  5I57 A;  5ESY A;  4PDD A;  2F6P A;  1LLS A;  3ZSF A;  4XTC Q;  3RYD A;  3K1N A;  4IB2 A;  2QS4 A;  4MCO A;  4F3P A;  1O7T A;  2RCB A;  1KA1 A;  4U21 A;  2DWH A;  1OVT A;  3LBS A;  1FPG A;  2ONK E;  1JW1 A;  2O7I A;  3TTN A;  2VT5 A;  3CFX A;  4OVJ A;  4POX A;  1B51 A;  5EQ9 A;  3TUS A;  1M5B A;  2LAO A;  3MVY A;  5J16 A;  3L6G A;  5H8F B;  3SEX A;  3MUQ A;  1SW4 A;  3EKI A;  1B58 A;  4X8R A;  5ET8 A;  3GBB A;  4N81 A;  2ABH A;  4P9K A;  1LFG A;  3PUV E;  3U65 A;  4GLI A;  5ET6 A;  3PUY E;  1FBH A;  1N76 A;  1BLF A;  4IGR A;  1FPL A;  3LSW A;  5F24 A;  4JWX A;  3SER A;  4ZEF A;  3ECR A;  3O9P A;  3H7M A;  4LZ7 A;  3IJO B;  1CNQ A;  1FQA A;  4NX1 A;  1B3F A;  4KI0 E;  3I3V A;  1T0K A;  1FW0 A;  1B7H A;  2Q88 A;  2FIX A;  4ESX A;  3MYU A;  2Y7I A;  3T9U A;  4YB6 A;  2F3D A;  4NE4 A;  4FAT A;  1SW2 A;  2UVI A;  2XD3 A;  2E0S A;  2VP1 A;  4DI4 B;  4WKM A;  3OEL A;  3RPL A;  1H45 A;  4I40 A;  5EHS A;  2Y7W A;  3PPQ A;  1FTL A;  2ESN A;  5I7I A;  3LSL A;  1OMP A;  2OWZ A;  4GX4 A;  2RC7 A;  4PFR A;  1QUL A;  3VFJ A;  3O29 A;  3U92 A;  1VFE A;  4GL0 A;  4X48 A;  3SET A;  4RJZ A;  3IX1 A;  4QFK A;  3O6H A;  4G8H A;  3JYR A;  3T9H B;  4ZEI A;  4NF5 A;  4TOZ A;  4X04 A;  4GWY A;  2DWJ A;  3D4G A;  4P56 A;  1SW5 A;  2F7A A;  1TXF A;  4FIM A;  2ZXT A;  4PBQ A;  5B70 A;  3IR1 A;  2I3W A;  1K9Y A;  1NV1 A;  3AXF A;  3U8Q A;  3PMX A;  1BK4 A;  2P0S A;  4MBP A;  1IZ1 A;  2DYX A;  1Y1Z A;  3CVG A;  3K2D A;  1QUJ A;  5I56 B;  4GL8 A;  4HE1 A;  3CG3 A;  1FPE A;  2ANJ A;  1JVX A;  3OSQ A;  1NV4 A;  1S50 A;  4FE8 A;  5I2K B;  5I57 B;  4GBW A;  4JWO A;  4NGU A;  1FQB A;  1Y3Q A;  2ZNT A;  1MQJ A;  1A54 A;  3KN3 A;  2HPG A;  1LEV A;  5I5P A;  2NXO A;  2A5T A;  2WYP A;  3S9L C;  2OK2 A;  1B5J A;  3JV9 A;  2DDK A;  1SBP A;  3CFZ A;  1JW4 A;  1OLA A;  1IXC A;  4N6D A;  3RN8 A;  2D5W A;  2FNC A;  2PCR A;  2O7U A;  3PPR A;  5EQA A;  4KCD A;  4H8I A;  3MP6 A;  3PV0 E;  2HXW A;  3CRB A;  3Q27 A;  3GYY A;  5LDZ A;  1B46 A;  2HCA A;  4WED A;  3DP4 A;  2R71 A;  3KBR A;  4DE8 A;  3IOW A;  2DXY A;  2KQZ A;  1B3E A;  1H76 A;  3HFU A;  2XXV A;  5I84 A;  4FOR A;  3K00 A;  1TFD A;  4GVO A;  2RC9 A;  3U93 A;  2X7Q A;  3SES A;  1FBG A;  4LON B;  2O51 A;  1S9T A;  3CFL A;  1JEV A;  3IOV A;  1B52 A;  2HZK A;  1I69 A;  2F3B A;  4F3S A;  4PAI A;  1TFA A;  3FVN A;  4GWO A;  3FVO A;  1KA0 A;  4MLQ A;  3TCG A;  2IA4 A;  4GWZ A;  4GRK A;  1IXI A;  3DLN A;  2DXR A;  1PB8 A;  3RPL B;  2XXT A;  2NUV A;  1KWH A;  3I5O A;  4KPT A;  4QSD A;  2QVV A;  3RY3 A;  4DDD A;  4MJO A;  4THI A;  1FBC A;  2VOZ A;  3HO7 A;  1LB8 A;  1EYK A;  1ANF A;  1VSO A;  4LVQ A;  1MM6 A;  4YAH X;  3C9H A;  4MIJ A;  4C1U A;  4OET A;  4P8B A;  4H46 A;  2I48 A;  4QF9 A;  4OVT A;  4H5G A;  4R6Y A;  5AA3 A;  1MPC A;  4TLM B;  4OEN A;  2Q8J A;  3TPA A;  3O6I A;  1B40 A;  3BBR A;  1N3X A;  1SPI A;  3MAM A;  2XWV A;  1M5E A;  4QHQ A;  3A29 A;  4FED A;  1EYJ A;  2V3T A;  2I4B A;  3ISP A;  4NN3 A;  1H43 A;  2F7C A;  3QUJ A;  1IIW A;  4OFL A;  3S9E A;  3T93 B;  2WBD A;  2FIE A;  3IAZ A;  3MVW A;  3EQ1 A;  2QMW A;  2DVC A;  5EYG A;  1MQD A;  2A5T B;  3CSG A;  3S2V A;  4QXD A;  2FBP A;  4RY1 A;  2VPN A;  1IUD A;  4P1E A;  1FQF A;  1R1N A;  3ROJ A;  1CE2 A;  1NV2 A;  1NFT A;  3H03 A;  1J1N A;  1AL3 A;  4MEV A;  2Y5L A;  1XS5 A;  1MXU A;  1K9Z A;  1QUI A;  5EYF A;  3OSR A;  1POT A;  2XXY A;  3B6T A;  3QAX A;  5I2N A;  2FYI A;  1NH7 A;  4O7M A;  1ZJL A;  2ZYN A;  1N84 A;  3TDJ A;  2AL4 A;  2O6A A;  1P1O A;  1B3L A;  2ZMB A;  4F18 A;  4O7I A;  1LBB A;  3MVZ A;  2UVJ A;  4EUO A;  3Q29 A;  3PPP A;  5DVJ A;  4YZZ A;  1GTK A;  4RPO A;  1CB6 A;  3B7D A;  4NTL A;  3IOT A;  2P3N A;  1LCF A;  4R2F A;  2DE4 A;  3G3J A;  3TTR A;  2RCA A;  1JP4 A;  2GHA A;  1DCU A;  1AWB A;  4N6P A;  3HCQ A;  3TCF A;  5CMB A;  3QK6 A;  1AOV A;  3RT8 A;  1P1W A;  1PB9 A;  1B0H A;  1B32 A;  4GFR A;  4G8N A;  5F1Q A;  1ZTY A;  4NHB A;  1YYZ A;  3GBA A;  2WYK A;  2H5Y A;  1MPD A;  4MX6 A;  1EZP A;  1JVY A;  4R2B A;  4EXK A;  3VVD A;  3LUY A;  1DBZ A;  4DLD A;  4H65 A;  4AB5 A;  4XKP A;  4FAJ A;  3TYH A;  2E1S A;  1SI0 A;  1LFH A;  4PET A;  2WBB A;  4DIG A;  4IO2 A;  4BDR A;  3VV5 A;  3FVK A;  3GLB A;  3N94 A;  3TTM A;  1LBV A;  4I62 A;  3ZS6 A;  3ZKK A;  4PAK A;  5DW8 A;  3PMW A;  3TQL A;  1DSN A;  1FQD A;  3MVX A;  5BUU A;  3UP9 A;  2DS9 A;  5IAI A;  3IFA A;  1R9L A;  3DM0 A;  5AA1 A;  2XXX A;  2XXQ A;  4ZDM A;  4GX6 A;  4OWD A;  4O3C A;  3N26 A;  4F1V A;  2FHY A;  3MBP A;  1BP5 A;  2Q2C A;  4GQO A;  3KSJ A;  4MNI A;  1PBQ A;  2ONR A;  4EDP A;  2NOO A;  4GIZ A;  4PFB A;  2UYF A;  3K6U A;  1FQE A;  1B4H A;  4ESW A;  4YMB A;  2ZNU A;  3G7W A;  1XVY A;  4NED A;  3FV1 A;  3UOR A;  4UAB A;  4PC9 A;  3K6V A;  3VDF A;  4G68 A;  5ICT A;  2O68 A;  3ODB A;  4ZZE A;  5H8Q A;  1EH3 A;  1XT8 A;  5JTY A;  1YPN A;  1O64 A;  1OIB A;  1WDN A;  1IXG A;  1MXZ A;  1POY 1;  2HHM A;  4FBP A;  1MY2 A;  2CMO A;  4NQ8 A;  1FCK A;  1YCJ A;  3HPI A;  4ZEC A;  3G3G A;  2XXI A;  5CBS A;  4TQU Q;  1FTK A;  2Z8F A;  4OVR A;  3CHG A;  1FJ6 A;  2O84 X;  3TZA A;  3R7X A;  5FTH A;  2A5S A;  2RIN A;  4OTE A;  3H4Z A;  1GGG A;  5FHN A;  4PGP A;  1ZBM A;  5EYH A;  1USY H;  2G93 A;  2W7Y A;  3N6U A;  2XWK A;  2B65 A;  1NL5 A;  3BIG A;  4OVS A;  4Q0C A;  4MHF A;  4LA9 A;  4EF2 A;  2ZYM A;  4WEP A;  2QMX A;  5H8N A;  1MY0 A;  4PCD A;  1GR2 A;  4EQ7 A;  1VDW A;  3QXM A;  3LR1 A;  4QFN A;  2I0C A;  2Z8E A;  4UA8 A;  2AYS A;  4PDH A;  2F97 A;  4OER A;  1B5I A;  4PE5 B;  1IEJ A;  4ELP A;  1UTH A;  3FAS A;  4YKI A;  3TEP A;  2QPQ A;  1FTA A;  1GV8 A;  3USD A;  2VHA A;  1LBX A;  3GZG A;  2VD3 A;  4H8J A;  5ELV A;  2YPN A;  3N5L A;  4HCW A;  4P11 A;  2O69 A;  2OCU A;  4MMP A;  1A8E A;  1D9Q A;  2XX8 A;  5ICQ A;  3FIR A;  3VLW A;  3KN8 A;  1MH4 A;  4MLV A;  4QSE A;  4JVI A;  2CZH A;  3T0J A;  4OYV A;  4DXU A;  4YU0 A;  1I6B A;  2CZK A;  2XXH A;  3PD9 A;  2I3V A;  3FVG A;  1ZMG A;  4K3F A;  1UIV A;  2X7P A;  2MKZ A;  1Z7M E;  3M3K A;  1QW0 A;  3SDF A;  5AA4 A;  4R6K A;  3VLV A;  5I58 A;  3T9V A;  4X1D A;  3FJG A;  3BFU A;  5JEI A;  5HBC A;  3T66 A;  2F34 A;  3PGF A;  3OD7 A;  3EF7 A;  3RNN A;  1H44 A;  1MM7 A;  3MP1 A;  4GWS A;  3FXB A;  1IMB A;  3PD8 A;  1IIT A;  4ISU A;  4H1X A;  5DVF A;  1YXI A;  1R9Q A;  3PPN A;  1B2H A;  5CBR A;  2XX7 A;  3T22 A;  1FPK A;  3K02 A;  5H8Q B;  5JTY B;  4BDM A;  3R26 A;  3JZJ A;  1AH5 A;  3MJN A;  4P0I A;  1NNT A;  2XXK A;  1MXW A;  1G0H A;  3FV2 A;  3H6V A;  4M1V A;  4OMB A;  3OOA A;  4G68 C;  3TQW A;  3P7I A;  3IL1 B;  3F11 A;  1MPB A;  3FGS A;  2Y5K A;  4Q5T A;  3H6W A;  4H0W A;  3PUX E;  2B3F A;  1M5D A;  3IOR A;  1Q35 A;  2KLF A;  1HSL A;  5B7D A;  4UAC A;  2CEY A;  2ZZV A;  4LQ2 A;  2DVZ A;  1Y4T A;  5IM2 A;  1TWY A;  3D4C A;  3SEV A;  3EPE A;  5H8N B;  4HE2 A;  3VXB A;  3ILU B;  3KBZ A;  4HXV A;  5CM6 A;  3RQT A;  1Z7N E;  2F6G A;  2FVZ A;  4PFU A;  2RF1 A;  4OEV A;  4DI3 D;  1MS7 A;  2DQV A;  3WAE A;  1BIY A;  1SD3 A;  4FJP A;  3OEN A;  3C33 A;  3KGC A;  4EXL A;  1Y9U A;  4F2O A;  1P99 A;  3K1P A;  2REG A;  4XIG Q;  1M5C A;  1B5H A;  3TMG A;  1JW5 A;  4OA4 A;  2UVG A;  4GOT A;  3V5A A;  5DEX A;  5IZ3 A;  2PT2 A;  4DCY A;  1XI6 A;  3E9X A;  2P2A A;  4ZEK A;  3B6W A;  3SEY A;  4Z0I A;  2QVU A;  2REJ A;  4ZZA A;  5KZT A;  1FBD A;  3E79 A;  3VVE A;  1IME A;  2PBW A;  2Y84 A;  2XXR A;  5K2Y A;  4MF3 A;  3IB1 A;  1M5F A;  2V4C A;  2QL3 A;  2NVU B;  5I59 A;  5AA4 B;  1S7Y A;  4F3B A;  3KN7 A;  5I58 B;  1PDA A;  4GXS B;  1IXH A;  1XHY A;  3KEI A;  1MDQ A;  4HW8 A;  1FBF A;  4KFQ A;  3V83 A;  4NF5 B;  1EZ9 A;  2O1L A;  4EQB A;  3IJX B;  3MZB A;  3PMV A;  3C4M A;  3CIJ A;  1NUY A;  2ZYO A;  3EHT A;  4GXA A;  1LGB C;  1RDZ A;  1LAG E;  3BFT A;  1ATG A;  2QJE A;  1A99 A;  2Y7K A;  1MY1 A;  3UIF A;  2HFB A;  4JSD A;  2D21 A;  5L9O A;  4I8C A;  2I58 A;  3VE1 B;  1FPI A;  2QFL A;  1AMF A;  2P3V A;  4N8Y A;  5EQ7 A;  4IO7 A;  1N3W A;  3Q25 A;  4OQO A;  3E78 A;  2Z23 A;  2V93 A;  4N4U A;  2CEX A;  3KC0 A;  4WXJ A;  4G61 A;  1UTB A;  1YTV A;  2X26 A;  4ELO A;  3FBP A;  2NWJ A;  4JXI A;  5CMK A;  1OQH A;  2Q9T A;  4YIC A;  1NV6 A;  3OO9 A;  2VD2 A;  2R8T A;  4YB7 A;  3KOS A;  4NF4 A;  4NF6 A;  1DPE A;  3RLF E;  5AA2 A;  4N8G A;  3DP6 A;  3TFL A;  3G3F A;  4GWU A;  1ELJ A;  3MZ9 A;  1NUX A;  3HN0 A;  4OZ9 A;  4P0G A;  2VGQ A;  2PFZ A;  4PTK A;  2YLN A;  4BDL A;  1G0I A;  1NNF A;  5TU0 A;  1B3H A;  4GD5 A;  4LP2 B;  4PF8 A;  1QGX A;  1DOT A;  3C35 A;  1Y3P A;  5KDT A;  2XWI A;  4H45 A;  1D9V A;  3KSX A;  4R9G A;  4XF5 A;  4G2Z A;  4OHN A;  4N17 A;  2ALU A;  2R9J A;  4OVP A;  4DZ1 A;  3B50 A;  1SQY A;  1B9J A;  2XD2 A;  3TTK A;  1NNK A;  3KG2 A;  4U1O A;  5DEX B;  4F31 B;  4KYS A;  5IZ3 B;  1O63 A;  2OJT A;  1JNF A;  1RYO A;  3OEK A;  1MXV A;  4KYE A;  2WX9 A;  4POW A;  3H6T A;  5DTB A;  2QSX A;  3WAF A;  4ELR A;  4PE3 A;  5LTC A;  1LBY A;  1HSJ A;  3QIM A;  4F1Y A;  5ITO A;  5J1D A;  4RYA A;  1FPD A;  1Q9D A;  1B7Z A;  4PQJ A;  4HCY A;  1TT1 A;  2R6G E;  4R72 A;  4MNP A;  1F9B A;  4O94 A;  2XXU A;  4PFI A;  2XXP A;  4XKN A;  5A5L A;  3RPW A;  5IZ1 A;  3ILT B;  2OWS A;  5CMM A;  1OQG A;  1FTJ A;  1FTO A;  2Z22 A;  4F2Q A;  4JDF A;  1B05 A;  3V89 B;  4PP0 A;  2ZYK A;  4XFE A;  1MXX A;  3IO6 A;  3RTF B;  5KCJ A;  3KFM A;  4N07 A;  2OX3 A;  3KJ7 A;  1FBP A;  5CMC A;  1A7L A;  3CSB A;  2I6E A;  3TEL A;  5I3S A;  3ZKL A;  4N15 A;  1B3G A;  3MQ9 A;  4TLL B;  2JJK A;  1FTM A;  3G3I A;  3MW0 A;  4C1T A;  1LBZ A;  2H98 A;  1B1H A;  4JWY A;  4YKJ A;  1UTB B;  4IY5 A;  2XX9 A;  1B7U A;  3CR9 A;  3CI8 A;  1US4 A;  2UYE A;  1PBP A;  3FZV A;  1SI1 A;  3C32 A;  3IOU A;  5FHO A;  3C34 A;  3PTY A;  5L9M A;  3KJT A;  5L8D A;  3MPL A;  4NF4 B;  1MXY A;  1Y4C A;  5I2N B;  2PX1 A;  2THI A;  1LAX A;  5AA2 B;  3LSF B;  3UGW A;  1FPB A;  3MPK A;  2M8C A;  2PYY A;  4YMA A;  4OEU A;  3HV1 A;  4M4G A;  4G77 A;  2ONS A;  1NMU A;  4AS5 A;  5ISU A;  4QFL A;  2UVH A;  3Q28 A;  4PBH A;  2D3I A;  3TKD A;  4AQ4 A;  4XXU A;  5KDT B;  1L5T A;  1I6Q A;  2IEE A;  3D1R A;  3NOH A;  3H3G A;  1DTG A;  3ONM A;  2HQ0 A;  4I3Y A;  2H99 A;  2B4L A;  1B6H A;  4KCC A;  3MC2 A;  4HE0 A;  1H3D A;  3I6V A;  4F3G A;  1OVB A;  4O3B A;  1PEB A;  4X1B A;  3QMF A;  3E3K A;  1Y1M A;  1LST A;  2PT1 A;  3LC8 A;  1RDX A;  4GX3 A;  1N7X A;  1B4Z A;  1BTJ A;  5EHM A;  5TPA A;  1ZIU A;  5CI5 A;  2OZZ A;  3R6U A;  4NWC A;  4JBZ A;  2G29 A;  4DXC A;  1P1U A;  3QYT A;  1LB9 A; 
#chains in the Genus database with same CATH homology
 3DP8 A;  1MQI A;  2F8D A;  4NMY A;  3KZG A;  3UA8 A;  4Z7E A;  3RT6 B;  3KOT A;  2GRV A;  2FA7 A;  3FXR A;  3EHU A;  1Y3N A;  3IB2 A;  1XVX A;  2QS2 A;  4XKQ A;  1DMB A;  4OFJ A;  3OEM A;  4QRZ A;  2F7B A;  4IY6 A;  3U72 A;  1NKX A;  4MFI A;  4KD5 A;  1I6A A;  4FEC A;  1USY E;  4BDO A;  3RGY A;  4YKP A;  4PFY A;  5KCJ B;  1URD A;  2V3Q A;  3UN6 A;  4LZ5 A;  1DPP A;  2Y7P A;  4BLA A;  3O2A A;  1Q1K A;  2DOJ A;  1MY4 A;  1SVX B;  3DEL B;  4BDN A;  3M3F A;  4ZEB A;  2PMS A;  2DE2 A;  4G68 B;  5IKB A;  4AB6 A;  1EZO A;  3K01 A;  3IO4 A;  4QSC A;  3QUF A;  4RK9 A;  4OXV A;  1RKM A;  2F35 A;  4OFO A;  3FXQ A;  4ZS9 A;  1WOD A;  3OXN A;  4KQP A;  4X9T A;  1NNP A;  4IGT A;  2QS3 A;  5DT6 A;  2B3B A;  2QRY A;  5DYH A;  3CG1 A;  2AIX A;  2HEU A;  2I0B A;  2V25 A;  3SEW A;  2RKM A;  2F36 A;  5M2V A;  4R9F A;  1A8F A;  4F29 A;  3K6W A;  2Y7R A;  4RK2 A;  1ZU0 A;  5BWJ A;  3FD3 A;  5TP9 A;  4XKR A;  3PU5 A;  5JK4 A;  4U1Z A;  2DWA A;  1MY3 A;  4LUB A;  4U4X A;  1US5 A;  1PB7 A;  2Z8D A;  1JEU A;  4PFW A;  1A40 A;  3BKI B;  1ZKB A;  3T96 B;  3LSX A;  1B0L A;  1R6Z A;  4QFO A;  3O28 A;  4JB7 A;  5TPA B;  1P1Q A;  1SYI A;  4IO3 A;  4DXB A;  5AA2 D;  1Y20 A;  2P1S A;  5A5X A;  1QVS A;  2ZNS A;  1UTH B;  2OWT A;  4Q8R A;  1B1X A;  5FHM A;  3PPO A;  3B6Q A;  3TTL A;  4YB5 A;  1AIV A;  2OBG A;  3GXA A;  3EN3 A;  1URS A;  2Q89 A;  1HSE A;  2DSF A;  3O66 A;  3L6H A;  3H6U A;  3K6X A;  3VLU A;  3OMB A;  4HTG A;  1LFI A;  4RNS A;  3RTW B;  2XHD A;  4LZ8 A;  3FUZ A;  2AL5 A;  2I49 A;  1MQH A;  3A3U A;  4JSO A;  4R6H A;  2GHB A;  4U2R A;  1MG1 A;  4IO6 A;  1XC1 A;  1MDP 1;  4NF8 A;  3MP8 A;  4C0R A;  1YAE A;  4O3A A;  4BDQ A;  3EHS A;  5H8S A;  3W9W A;  4E0W A;  3THI A;  2F5X A;  2HZL A;  1MRP A;  3MWB A;  1BKA A;  3S9N C;  4L17 A;  4ZED A;  4EF1 A;  3G3H A;  4H5F A;  1OLC A;  1P1N A;  1N04 A;  3HST A;  1N7W A;  3MZ1 A;  4U4S A;  3OO6 A;  3PUZ E;  1UIU A;  2OLB A;  4FEB A;  3SEU A;  3M3L A;  5K2X A;  4HS7 A;  4F19 A;  2F78 A;  3G3K A;  3TOD A;  2V3U A;  2HAV A;  5L9S A;  1JQF A;  4I9D A;  2RC8 A;  5LOM A;  1LAH E;  2Q2A A;  4ZE8 A;  3FAT A;  1D9Y A;  2YJP A;  2WKY A;  1RYX A;  3O97 A;  5TP9 B;  1MQG A;  1DTZ A;  2DWI A;  3VVF A;  4IO4 A;  1GVC A;  5H8H A;  1SDX A;  4U23 A;  2I4C A;  3QSL A;  1LCT A;  2H9B A;  4G4P A;  3FXU A;  3K0V A;  2H25 A;  4MH5 A;  3W9V A;  4F1U A;  4H6D A;  3S4U A;  5A5X B;  3OO8 A;  1XOC A;  1SW1 A;  4R75 A;  5HM4 B;  3FJM A;  2H4I A;  5CC2 A;  2GFE A;  3E13 X;  3C31 A;  1QJM A;  2BJJ X;  3V8X B;  4ZE9 A;  4ND9 A;  3K1M A;  1A55 A;  4G8M A;  3A3C A;  4ONY A;  4KYD A;  2V84 A;  4RA1 A;  4H67 A;  3U94 A;  3VXC A;  3OO7 A;  4Q30 B;  1MH3 A;  5H8F A;  3PUW E;  4F22 A;  1PC3 A;  1URG A;  4KHZ E;  2CZL A;  2O1M A;  5I59 B;  3FJ7 A;  3TCH A;  1VE4 A;  1FQC A;  1D3K A;  3T9X B;  1D4N A;  1ZLQ A;  4EQ9 A;  5ITP A;  4YKK A;  4LAT A;  3U1O A;  4NF8 B;  4R73 A;  3HHG A;  2PVU A;  3IB0 A;  4NWD A;  4N13 A;  3SKP A;  5CRY A;  1SYH A;  4E0X A;  4U22 A;  1NH8 A;  2QS1 A;  5F7V A;  4I1D A;  3UK4 A;  1WVJ A;  1LAF E;  3N6T A;  1VR5 A;  4QFP A;  5AE4 A;  1VFD A;  2DE3 A;  5HPQ A;  4OES A;  1QUK A;  1EU8 A;  2UXA A;  3H06 B;  1UQW A;  1IQ7 A;  4PFT A;  1LBC A;  2XXW A;  3HHF A;  4KR5 A;  3E4R A;  3O6G A;  4DCX A;  4F39 A;  4RPN A;  5DVI A;  4R74 A;  4ECF A;  1JET A;  2HAU A;  4NF6 B;  1II5 A;  5FTI A;  4GF8 A;  3A09 A;  3S9M C;  5I56 A;  3C36 A;  5H8H B;  2DP8 A;  4LQ5 A;  4RXL A;  1QKA A;  3W15 C;  3M8U A;  3Q26 A;  1QKB A;  3RUM A;  3TAJ A;  2GH9 A;  4IO5 A;  4ELQ A;  1N0T A;  3IK6 B;  3K4U A;  5I2K A;  5I57 A;  2F6P A;  1LLS A;  3ZSF A;  4XTC Q;  3K1N A;  4IB2 A;  2QS4 A;  4F3P A;  1O7T A;  2RCB A;  4U21 A;  2DWH A;  1OVT A;  3LBS A;  2ONK E;  1JW1 A;  2O7I A;  3TTN A;  3CFX A;  4OVJ A;  4POX A;  1B51 A;  3TUS A;  1M5B A;  2LAO A;  3MVY A;  3L6G A;  5H8F B;  3SEX A;  3MUQ A;  1SW4 A;  1B58 A;  3GBB A;  2ABH A;  1LFG A;  3PUV E;  4GLI A;  3PUY E;  1N76 A;  1BLF A;  4IGR A;  3LSW A;  4JWX A;  3SER A;  4ZEF A;  3ECR A;  3O9P A;  3H7M A;  4LZ7 A;  3IJO B;  1FQA A;  1B3F A;  4KI0 E;  3I3V A;  1T0K A;  1FW0 A;  1B7H A;  2Q88 A;  4ESX A;  2Y7I A;  3T9U A;  4YB6 A;  4NE4 A;  4FAT A;  1SW2 A;  2UVI A;  2XD3 A;  2E0S A;  2VP1 A;  4WKM A;  3OEL A;  1H45 A;  5EHS A;  2Y7W A;  3PPQ A;  1FTL A;  2ESN A;  3LSL A;  1OMP A;  2RC7 A;  1QUL A;  3VFJ A;  3O29 A;  3U92 A;  1VFE A;  4GL0 A;  4X48 A;  3SET A;  4RJZ A;  3IX1 A;  4QFK A;  3O6H A;  4G8H A;  3JYR A;  3T9H B;  4ZEI A;  4NF5 A;  4TOZ A;  2DWJ A;  3D4G A;  1SW5 A;  2F7A A;  1TXF A;  4FIM A;  2ZXT A;  5B70 A;  3IR1 A;  2I3W A;  3AXF A;  3U8Q A;  3PMX A;  2P0S A;  4MBP A;  1IZ1 A;  2DYX A;  1Y1Z A;  3CVG A;  3K2D A;  1QUJ A;  5I56 B;  4GL8 A;  3CG3 A;  2ANJ A;  1JVX A;  3OSQ A;  1S50 A;  4FE8 A;  5I2K B;  5I57 B;  4JWO A;  1FQB A;  1Y3Q A;  2ZNT A;  1MQJ A;  1A54 A;  3KN3 A;  2NXO A;  2A5T A;  3S9L C;  2OK2 A;  1B5J A;  3JV9 A;  1SBP A;  3CFZ A;  1JW4 A;  1OLA A;  1IXC A;  3RN8 A;  2D5W A;  2FNC A;  2O7U A;  3PPR A;  4KCD A;  4H8I A;  3MP6 A;  3PV0 E;  2HXW A;  3CRB A;  3Q27 A;  1B46 A;  2HCA A;  4WED A;  3DP4 A;  2R71 A;  3KBR A;  4DE8 A;  3IOW A;  2DXY A;  1B3E A;  1H76 A;  2XXV A;  5I84 A;  4FOR A;  3K00 A;  1TFD A;  4GVO A;  2RC9 A;  3U93 A;  2X7Q A;  3SES A;  4LON B;  2O51 A;  1S9T A;  3CFL A;  1JEV A;  3IOV A;  1B52 A;  2HZK A;  1I69 A;  4F3S A;  1TFA A;  3FVN A;  4GWO A;  3FVO A;  4MLQ A;  3TCG A;  2IA4 A;  4GRK A;  1IXI A;  3DLN A;  2DXR A;  1PB8 A;  2XXT A;  2NUV A;  1KWH A;  3I5O A;  4KPT A;  4QSD A;  3RY3 A;  4DDD A;  4THI A;  2VOZ A;  3HO7 A;  1LB8 A;  1ANF A;  1VSO A;  4LVQ A;  1MM6 A;  4YAH X;  3C9H A;  4C1U A;  4OET A;  2I48 A;  4QF9 A;  4H5G A;  4R6Y A;  5AA3 A;  1MPC A;  4TLM B;  4OEN A;  2Q8J A;  3TPA A;  3O6I A;  1B40 A;  3BBR A;  1N3X A;  3MAM A;  1M5E A;  4QHQ A;  4FED A;  2V3T A;  2I4B A;  1H43 A;  2F7C A;  3QUJ A;  1IIW A;  4OFL A;  3S9E A;  3T93 B;  3IAZ A;  3MVW A;  3EQ1 A;  2QMW A;  2DVC A;  1MQD A;  2A5T B;  3CSG A;  3S2V A;  4RY1 A;  1IUD A;  1FQF A;  1R1N A;  1CE2 A;  1NFT A;  3H03 A;  1J1N A;  1AL3 A;  1XS5 A;  1MXU A;  1QUI A;  5EYF A;  3OSR A;  1POT A;  2XXY A;  3B6T A;  3QAX A;  5I2N A;  2FYI A;  1NH7 A;  1ZJL A;  2ZYN A;  1N84 A;  3TDJ A;  2AL4 A;  2O6A A;  1P1O A;  1B3L A;  2ZMB A;  4F18 A;  1LBB A;  3MVZ A;  2UVJ A;  4EUO A;  3Q29 A;  3PPP A;  5DVJ A;  4YZZ A;  1GTK A;  4RPO A;  1CB6 A;  3B7D A;  4NTL A;  3IOT A;  1LCF A;  4R2F A;  2DE4 A;  3G3J A;  3TTR A;  2RCA A;  2GHA A;  4N6P A;  3HCQ A;  3TCF A;  5CMB A;  3QK6 A;  1AOV A;  3RT8 A;  1P1W A;  1PB9 A;  1B0H A;  1B32 A;  4GFR A;  4G8N A;  5F1Q A;  1ZTY A;  3GBA A;  2H5Y A;  1MPD A;  1EZP A;  1JVY A;  4R2B A;  4EXK A;  3VVD A;  3LUY A;  4DLD A;  4H65 A;  4AB5 A;  4XKP A;  4FAJ A;  3TYH A;  2E1S A;  1SI0 A;  1LFH A;  4PET A;  4DIG A;  4IO2 A;  4BDR A;  3VV5 A;  3FVK A;  3GLB A;  3N94 A;  3TTM A;  4I62 A;  3ZS6 A;  3ZKK A;  3PMW A;  3TQL A;  1DSN A;  1FQD A;  3MVX A;  5BUU A;  3UP9 A;  2DS9 A;  5IAI A;  1R9L A;  3DM0 A;  5AA1 A;  2XXX A;  2XXQ A;  4ZDM A;  4OWD A;  4O3C A;  3N26 A;  4F1V A;  3MBP A;  1BP5 A;  2Q2C A;  4GQO A;  3KSJ A;  1PBQ A;  2ONR A;  4EDP A;  2NOO A;  4GIZ A;  2UYF A;  3K6U A;  1FQE A;  1B4H A;  4ESW A;  4YMB A;  2ZNU A;  3G7W A;  1XVY A;  4NED A;  3FV1 A;  3UOR A;  3K6V A;  3VDF A;  4G68 A;  5ICT A;  2O68 A;  3ODB A;  4ZZE A;  5H8Q A;  1EH3 A;  1XT8 A;  5JTY A;  1YPN A;  1O64 A;  1OIB A;  1WDN A;  1IXG A;  1MXZ A;  1POY 1;  1MY2 A;  2CMO A;  1FCK A;  1YCJ A;  3HPI A;  4ZEC A;  3G3G A;  2XXI A;  5CBS A;  4TQU Q;  1FTK A;  2Z8F A;  2O84 X;  3TZA A;  3R7X A;  5FTH A;  2A5S A;  2RIN A;  4OTE A;  3H4Z A;  1GGG A;  5FHN A;  1ZBM A;  1USY H;  2G93 A;  2W7Y A;  3N6U A;  2B65 A;  1NL5 A;  4Q0C A;  4LA9 A;  4EF2 A;  2ZYM A;  4WEP A;  2QMX A;  5H8N A;  1MY0 A;  1GR2 A;  4EQ7 A;  3QXM A;  3LR1 A;  4QFN A;  2I0C A;  2Z8E A;  4UA8 A;  2AYS A;  2F97 A;  4OER A;  1B5I A;  4PE5 B;  1IEJ A;  4ELP A;  1UTH A;  3FAS A;  4YKI A;  3TEP A;  2QPQ A;  1GV8 A;  3USD A;  2VHA A;  3GZG A;  2VD3 A;  4H8J A;  5ELV A;  2YPN A;  3N5L A;  4HCW A;  4P11 A;  2O69 A;  2OCU A;  1A8E A;  2XX8 A;  5ICQ A;  3FIR A;  3VLW A;  3KN8 A;  1MH4 A;  4MLV A;  4QSE A;  4OYV A;  4DXU A;  4YU0 A;  1I6B A;  2XXH A;  3PD9 A;  2I3V A;  3FVG A;  1ZMG A;  4K3F A;  1UIV A;  2X7P A;  1Z7M E;  3M3K A;  1QW0 A;  3SDF A;  5AA4 A;  4R6K A;  3VLV A;  5I58 A;  3T9V A;  4X1D A;  3FJG A;  3BFU A;  5JEI A;  5HBC A;  3T66 A;  2F34 A;  3PGF A;  3OD7 A;  3EF7 A;  3RNN A;  1H44 A;  1MM7 A;  3MP1 A;  3PD8 A;  1IIT A;  4ISU A;  4H1X A;  5DVF A;  1R9Q A;  3PPN A;  1B2H A;  5CBR A;  2XX7 A;  3T22 A;  3K02 A;  5H8Q B;  5JTY B;  4BDM A;  3R26 A;  3JZJ A;  1AH5 A;  3MJN A;  4P0I A;  1NNT A;  1MXW A;  3FV2 A;  3H6V A;  4M1V A;  4OMB A;  3OOA A;  4G68 C;  3TQW A;  3P7I A;  3IL1 B;  3F11 A;  1MPB A;  3FGS A;  4Q5T A;  3H6W A;  4H0W A;  3PUX E;  2B3F A;  1M5D A;  3IOR A;  1Q35 A;  2KLF A;  1HSL A;  5B7D A;  4UAC A;  4LQ2 A;  2DVZ A;  1Y4T A;  1TWY A;  3D4C A;  3SEV A;  3EPE A;  5H8N B;  3VXB A;  3ILU B;  5CM6 A;  3RQT A;  1Z7N E;  2F6G A;  4PFU A;  2RF1 A;  4OEV A;  1MS7 A;  2DQV A;  3WAE A;  1BIY A;  1SD3 A;  4FJP A;  3OEN A;  3C33 A;  3KGC A;  4EXL A;  1Y9U A;  4F2O A;  1P99 A;  3K1P A;  2REG A;  4XIG Q;  1M5C A;  1B5H A;  3TMG A;  1JW5 A;  2UVG A;  4GOT A;  3V5A A;  5DEX A;  2PT2 A;  4DCY A;  3E9X A;  2P2A A;  4ZEK A;  3B6W A;  3SEY A;  4Z0I A;  2REJ A;  5KZT A;  4ZZA A;  3VVE A;  2PBW A;  2Y84 A;  2XXR A;  5K2Y A;  4MF3 A;  3IB1 A;  1M5F A;  2QL3 A;  2NVU B;  5I59 A;  5AA4 B;  1S7Y A;  4F3B A;  3KN7 A;  5I58 B;  1PDA A;  4GXS B;  1IXH A;  1XHY A;  3KEI A;  1MDQ A;  4HW8 A;  4KFQ A;  3V83 A;  4NF5 B;  1EZ9 A;  2O1L A;  4EQB A;  3IJX B;  3MZB A;  3PMV A;  3C4M A;  3CIJ A;  2ZYO A;  3EHT A;  4GXA A;  1LGB C;  1LAG E;  3BFT A;  1ATG A;  2QJE A;  1A99 A;  2Y7K A;  1MY1 A;  3UIF A;  2HFB A;  4JSD A;  2D21 A;  5L9O A;  4I8C A;  2I58 A;  3VE1 B;  1AMF A;  4IO7 A;  1N3W A;  3Q25 A;  4OQO A;  2Z23 A;  2V93 A;  4WXJ A;  1UTB A;  1YTV A;  2X26 A;  4ELO A;  2NWJ A;  4JXI A;  5CMK A;  1OQH A;  2Q9T A;  4YIC A;  3OO9 A;  2VD2 A;  4YB7 A;  3KOS A;  4NF4 A;  4NF6 A;  1DPE A;  3RLF E;  5AA2 A;  3DP6 A;  3TFL A;  3G3F A;  1ELJ A;  3MZ9 A;  3HN0 A;  4OZ9 A;  4P0G A;  2VGQ A;  2YLN A;  4BDL A;  1NNF A;  5TU0 A;  1B3H A;  4GD5 A;  4LP2 B;  1DOT A;  3C35 A;  1Y3P A;  5KDT A;  4R9G A;  1D9V A;  3KSX A;  4G2Z A;  4OHN A;  2ALU A;  2R9J A;  4DZ1 A;  1SQY A;  1B9J A;  2XD2 A;  3TTK A;  1NNK A;  3KG2 A;  4U1O A;  5DEX B;  4F31 B;  4KYS A;  1O63 A;  2OJT A;  1JNF A;  1RYO A;  3OEK A;  1MXV A;  4KYE A;  4POW A;  3H6T A;  5DTB A;  2QSX A;  3WAF A;  4ELR A;  1HSJ A;  3QIM A;  4F1Y A;  5ITO A;  5J1D A;  4RYA A;  1B7Z A;  4PQJ A;  4HCY A;  1TT1 A;  2R6G E;  4R72 A;  1F9B A;  2XXU A;  2XXP A;  4XKN A;  3RPW A;  3ILT B;  2OWS A;  5CMM A;  1OQG A;  1FTJ A;  1FTO A;  2Z22 A;  4F2Q A;  4JDF A;  1B05 A;  3V89 B;  4PP0 A;  2ZYK A;  1MXX A;  3IO6 A;  3RTF B;  5KCJ A;  3KFM A;  4N07 A;  3KJ7 A;  5CMC A;  1A7L A;  3CSB A;  2I6E A;  3TEL A;  3ZKL A;  1B3G A;  3MQ9 A;  4TLL B;  1FTM A;  3G3I A;  3MW0 A;  4C1T A;  2H98 A;  1B1H A;  4JWY A;  4YKJ A;  1UTB B;  4IY5 A;  2XX9 A;  1B7U A;  3CR9 A;  3CI8 A;  1US4 A;  2UYE A;  1PBP A;  3FZV A;  1SI1 A;  3C32 A;  5FHO A;  3IOU A;  3C34 A;  5L9M A;  3KJT A;  5L8D A;  3MPL A;  4NF4 B;  1MXY A;  1Y4C A;  5I2N B;  2PX1 A;  2THI A;  1LAX A;  5AA2 B;  3LSF B;  3UGW A;  3MPK A;  2M8C A;  2PYY A;  4YMA A;  4OEU A;  3HV1 A;  4M4G A;  4G77 A;  2ONS A;  1NMU A;  5ISU A;  4QFL A;  2UVH A;  3Q28 A;  2D3I A;  3TKD A;  4AQ4 A;  4XXU A;  5KDT B;  1L5T A;  1I6Q A;  2IEE A;  3H3G A;  1DTG A;  2HQ0 A;  3ONM A;  2H99 A;  1B6H A;  4KCC A;  3MC2 A;  1H3D A;  3I6V A;  4F3G A;  1OVB A;  4O3B A;  1PEB A;  4X1B A;  3E3K A;  1Y1M A;  1LST A;  2PT1 A;  3LC8 A;  1N7X A;  1B4Z A;  1BTJ A;  5EHM A;  5TPA A;  5CI5 A;  1ZIU A;  2OZZ A;  3R6U A;  4NWC A;  4JBZ A;  2G29 A;  4DXC A;  1P1U A;  3QYT A;  1LB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...