4BDLA

Crystal structure of the gluk2 k531a lbd dimer in complex with glutamate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
RSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSAPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Correlating Efficacy and Desensitization with Gluk2 Ligand-Binding Domain Movements.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport
molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
total genus 81
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdlA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdlA02
4PQJA 1LGBC 4NEDA 3TODA 4KFQA 3TMGA 1M5EA 3PMXA 3K0VA 4AB5A 3TTKA 3KN3A 5H8NB 1BKAA 2R9JA 4QSCA 1YTVA 2H9BA 3LSLA 4GVOA 3PU5A 3F11A 5I2NB 5I59A 3QUJA 1J1NA 4G68C 4HS7A 3RQTA 1TXFA 2V3TA 4OVJA 1MPDA 1OLCA 1QULA 2RCBA 2Y7KA 3DP8A 3OELA 1B40A 2RC9A 4YZZA 4ESWA 3KOTA 1IUDA 1DSNA 1S50A 2DE4A 3C34A 3FVOA 3PUYE 4G4PA 1B2HA 3V83A 5CMBA 1Y20A 1B7HA 1LAXA 4KYEA 3UK4A 3PPPA 1XS5A 4LQ2A 1B0LA 4ZZEA 5TU0A 1AH5A 3FASA 3MVWA 3MVZA 1H44A 1FCKA 1VFDA 2I3WA 3O66A 1LFGA 3M8UA 2DE3A 4RK2A 5TP9B 5CBSA 4EUOA 5CI5A 1FTKA 1MY0A 3BFUA 3ILTB 2I0BA 3UP9A 2QSXA 1OQGA 2Z8FA 2DWJA 3FVKA 4KCCA 2AL4A 4Q0CA 4NF8B 4NE4A 3EHUA 4ONYA 3USDA 2IA4A 2OWTA 4GL0A 4P0IA 4ZE8A 1GTKA 3RNNA 3W15C 4C1UA 1Y3PA 1P1QA 5BWJA 3FVGA 3HHGA 3K02A 4BDMA 5ITPA 1URSA 4JB7A 4ZEIA 4RNSA 4XTCQ 4P11A 4IGTA 3U93A 1FW0A 1LLSA 1MXWA 4QFKA 3ONMA 3LSXA 3SETA 3P7IA 3MJNA 1JEVA 4NF6B 3TZAA 4FATA 5EYFA 3JZJA 3TCFA 3VE1B 4KI0E 4I8CA 4FEBA 3A3CA 2XHDA 4G8MA 4WXJA 3VVFA 1MXZA 1MY2A 4HW8A 1XVXA 2DOJA 2PYYA 4OESA 1AL3A 3FXUA 4O3CA 3TTRA 2FNCA 2DQVA 3ZKKA 1ATGA 1A40A 1SQYA 1FTMA 2A5SA 4R6YA 2XXWA 5DEXA 3G3KA 4F3GA 1N7WA 3LC8A 3DLNA 3K1NA 3MZ1A 4G8NA 4ZEBA 3T22A 2DSFA 3BKIB 3O29A 4EXLA 4HCWA 1B46A 2B65A 1NFTA 4F31B 1N76A 1UTHA 3MBPA 4FORA 2YJPA 1FTLA 3UGWA 1ZMGA 1B7UA 4PP0A 1SDXA 2D3IA 3K6UA 4IGRA 5EHMA 3SEWA 3PUXE 1NKXA 2GHAA 3K6XA 1CE2A 1I6AA 3RN8A 3IAZA 3VVDA 4AB6A 3C35A 4JWXA 3BBRA 3RT6B 5CC2A 3D4GA 3TCHA 2ANJA 3IOTA 4X9TA 4JSOA 2H25A 4ZE9A 1Q35A 1D3KA 3B6WA 4GFRA 1B0HA 1A54A 3O97A 4XKQA 3TELA 4ISUA 1OLAA 4JBZA 3V8XB 3QK6A 4U1OA 3KJ7A 2XXHA 2UVJA 1FQFA 3PV0E 3QIMA 3QSLA 1GVCA 4DIGA 4FE8A 3FVNA 1MQHA 3A3UA 1LAGE 2E0SA 3PUZE 1ANFA 1IIWA 1QUKA 1O7TA 3JYRA 5AA1A 3WAFA 1A7LA 2F6GA 4O3AA 1LBBA 3N5LA 4LA9A 3MUQA 2NOOA 4NF5A 3CG1A 1TFDA 1OVTA 4IY5A 5DVJA 5LOMA 4R2FA 2F78A 3B6QA 3CI8A 3HSTA 3I5OA 1LB9A 1UTBB 4BDRA 5I2KA 1IXHA 1QUJA 5CMMA 2NVUB 4KQPA 3I6VA 2QL3A 3PPNA 1TFAA 3GBAA 3MQ9A 4F2QA 4PFUA 2AYSA 2ESNA 4ZZAA 5JK4A 1FQEA 1B3EA 4XIGQ 1B7ZA 2HCAA 3IL1B 3O6IA 4KD5A 4OEUA 1ZJLA 4R6KA 4U23A 3IOWA 5I56B 2PVUA 4YKKA 3ZKLA 4LZ7A 1P1OA 4O3BA 3LBSA 5AA4A 2XD2A 4FECA 4NTLA 3EHSA 1UIUA 4C1TA 3O2AA 3R6UA 4F3BA 4R73A 1L5TA 2D5WA 4G68A 2A5TA 1GGGA 4KHZE 4ZEKA 1SVXB 1NNTA 1S7YA 1MQDA 2LAOA 3K6WA 2V3UA 3SDFA 3U72A 4G68B 2O84X 2FYIA 1MS7A 2YLNA 4U22A 2XXUA 2PMSA 1ELJA 1P1WA 1B1HA 2Q2CA 4N6PA 2Q89A 3PPOA 3MP1A 2Z23A 2HZKA 4M4GA 4MBPA 3TTNA 2O51A 1B4ZA 1YCJA 2XD3A 3EF7A 3OEKA 3IO6A 4KYSA 4LP2B 1XVYA 1IXIA 2XX9A 1SYIA 3IX1A 2F6PA 2O1MA 5DT6A 4IO3A 2HXWA 4F3PA 4U2RA 3MC2A 3FJGA 1XC1A 1P99A 2XXXA 3G3GA 3TKDA 2XX8A 2R71A 4P0GA 5I2KB 1MXYA 3U92A 1MM7A 2E1SA 4GQOA 4N13A 4TLMB 3KJTA 2H5YA 3PD9A 4GIZA 4RPNA 1I6QA 4OHNA 3V5AA 1A55A 1I6BA 3AXFA 2ZYMA 1WVJA 1US4A 3PGFA 5L8DA 1H43A 1JVYA 4QFLA 2O6AA 3IOVA 1NMUA 2DWIA 3HCQA 5J1DA 2G93A 1BIYA 2THIA 4ESXA 4E0XA 1PDAA 1Y3NA 2Q2AA 3OEMA 4LQ5A 1B32A 3CSGA 3FUZA 4DE8A 2XXTA 1BP5A 2RF1A 2VGQA 3LUYA 1NNFA 1N3WA 2XXIA 2M8CA 4U21A 4DLDA 4R9FA 3T9UA 5DVIA 5DTBA 2HFBA 3LSFB 4MLVA 2HAVA 1URGA 3IOUA 2Z8DA 5K2XA 4BLAA 1LCFA 4DXBA 5AA4B 3MVYA 2OK2A 4YKIA 4QSEA 5CBRA 2O68A 3LSWA 3PUWE 5I56A 3KBRA 5ELVA 5TP9A 3TAJA 2UVIA 3TCGA 5FTIA 4DXCA 2GFEA 4EF2A 2B3FA 2ZNSA 3HN0A 3ZS6A 4F29A 1LCTA 1R6ZA 1UTHB 2R6GE 4H67A 1EZPA 1B3HA 1P1NA 3KSXA 4Q8RA 4QFOA 2HZLA 5B70A 2DXRA 3MPKA 1JVXA 2PX1A 2Q9TA 1UTBA 2VD3A 3B7DA 3OD7A 1SYHA 1XHYA 1B4HA 3ECRA 3PMVA 4H8JA 4ZEDA 2REJA 3U8QA 3SESA 4R74A 4NF5B 1PC3A 2X7PA 2XXVA 3GLBA 4QSDA 4DXUA 4EQ9A 4YKJA 3U94A 2BJJX 1N0TA 1FQCA 3KZGA 3W9VA 3SERA 4MH5A 4TOZA 4RXLA 4ZDMA 3UIFA 2OBGA 4Z7EA 4IO6A 3CRBA 1II5A 2RC8A 2VD2A 5KZTA 1MPBA 1WODA 2PT2A 3OO6A 4ND9A 3TPAA 1A8EA 1MY1A 5ISUA 1URDA 3ZSFA 3KGCA 1XOCA 2I48A 4IY6A 3CFZA 3PMWA 1UIVA 4LUBA 2I4CA 2IEEA 2A5TB 4K3FA 3SEXA 5IAIA 3N6TA 1DPPA 3OO8A 1Z7ME 4U4SA 2YPNA 2DWAA 2O7IA 3Q28A 2D21A 4XKRA 2F5XA 1D9VA 3H6WA 1MH4A 4Q30B 3FIRA 4IO2A 4NMYA 4RK9A 1FTJA 3E13X 1QVSA 3T9VA 4GXSB 3OOAA 3RT8A 3HO7A 3MZBA 3DP6A 2ONKE 5HM4B 2GH9A 3M3LA 1SW2A 4F22A 4OFOA 1SI1A 1A99A 3G7WA 3MPLA 3OXNA 4JDFA 4BDNA 3O28A 3VVEA 1MPCA 4BDLA 3SKPA 3T66A 2DVZA 1OMPA 5FHMA 1ZLQA 4DDDA 1POY1 2ONRA 1LSTA 3H7MA 3K01A 3K00A 4LZ5A 4KCDA 4QFNA 4F1UA 1QKAA 4GF8A 4H1XA 4F19A 1B51A 3UN6A 1OQHA 3FGSA 3HPIA 5I59B 1AMFA 3T9XB 1US5A 4E0WA 2RC7A 1JW1A 3OO7A 4YICA 3FZVA 4NF8A 3K1MA 1YAEA 3B6TA 1HSJA 2V84A 3QXMA 4U1ZA 4ZS9A 2OCUA 1MDQA 5H8NA 4IO4A 3RUMA 3DM0A 1LFHA 1ZKBA 4GWOA 2Y7IA 3H6VA 2FA7A 4WEDA 1Q1KA 1F9BA 2NUVA 5CM6A 3THIA 3SEYA 3IB1A 4KYDA 4POWA 1ZTYA 1NL5A 4PFTA 1B52A 1EZ9A 3TQWA 3WAEA 2W7YA 3DP4A 3QAXA 2H99A 2QMXA 5I84A 3OSRA 2ONSA 4QFPA 3S2VA 1NH7A 1DTGA 2QS2A 2ZMBA 3CFLA 3OENA 4YB5A 4F2OA 2Q8JA 4WKMA 2AIXA 4MLQA 3DELB 1Y9UA 2I49A 1FQBA 1USYE 1JETA 2X26A 1B5HA 1VR5A 4WEPA 3UA8A 3CR9A 2OZZA 4GOTA 4F3SA 3VDFA 1GV8A 2OLBA 2VOZA 5M2VA 1B3GA 3C31A 3MWBA 4HTGA 4G2ZA 4TLLB 1YPNA 2DYXA 5CMKA 3C36A 1VFEA 2Q88A 1FQDA 3IJOB 1B58A 2P1SA 3E4RA 3MP6A 1Y1ZA 2UYEA 3G3JA 5EHSA 1H45A 3OSQA 1MQGA 4G8HA 4RPOA 3RY3A 5H8HA 1MXXA 1NNKA 4OYVA 1T0KA 3TQLA 1LAHE 5H8FB 2ZYKA 1D9YA 2QS3A 1OIBA 3FJMA 2GRVA 1H76A 3H06B 4H0WA 1M5DA 2ZYOA 4JWYA 4LZ8A 1Y4CA 1MQJA 3D4CA 5A5XB 4MF3A 2O1LA 3KEIA 3H3GA 4EXKA 1PBPA 4F1VA 5FHNA 4DZ1A 2HQ0A 2H98A 1AOVA 1B5IA 4QHQA 3IO4A 2F7CA 3GBBA 4XKNA 2F35A 1CB6A 2RINA 3E3KA 3MW0A 4OFJA 2VP1A 1MXUA 1MRPA 4XXUA 1QUIA 5H8FA 3MZ9A 2AL5A 2ZXTA 3O6HA 4JXIA 2DVCA 3FV2A 1B05A 1MXVA 2QS4A 1NNPA 4L17A 3KN8A 4NWDA 2UVGA 5AA2B 3O6GA 1IXGA 1USYH 4JWOA 4KPTA 4EF1A 5KCJA 3CIJA 3Q29A 1DPEA 4LONB 1WDNA 4OENA 4RYAA 4XKPA 2I6EA 5FHOA 1ZIUA 3GZGA 3PD8A 4BDQA 4G77A 2DXYA 3CG3A 2Y7RA 3KN7A 1BLFA 3L6GA 4PFYA 4RJZA 4PE5B 1A8FA 1HSLA 4OWDA 4R2BA 1N04A 5DVFA 5TPAA 3VLUA 4EQ7A 2QMWA 2ZYNA 4YMBA 4ELPA 4R72A 4POXA 2F36A 5L9MA 1SW5A 2REGA 3OMBA 4OFLA 3CVGA 3TFLA 2WKYA 3I3VA 2UYFA 3G3IA 3Q27A 4LATA 4ZEFA 5AE4A 1EU8A 1GR2A 3R7XA 1TT1A 3BFTA 4OTEA 2XXQA 4X1BA 1QJMA 3TTMA 3K2DA 3QYTA 4UA8A 4ELRA 5CRYA 4Q5TA 2I58A 5I2NA 4F18A 3N94A 1RKMA 4OQOA 2Y84A 1LBCA 3T9HB 1QW0A 1NH8A 2QJEA 3E9XA 4UACA 1DMBA 4RA1A 1OVBA 1XT8A 3EHTA 3IR1A 4JSDA 1DTZA 4PETA 2DS9A 1RYOA 2XX7A 5H8QA 4I1DA 5ICQA 3CFXA 4R75A 5JTYB 3PPRA 3RTFB 5F7VA 1KWHA 2NXOA 3C32A 4YAHX 4BDOA 2O69A 3ODBA 5I58B 1FTOA 2RKMA 3C9HA 3H6UA 1Z7NE 4H6DA 1B1XA 5DEXB 4R6HA 2DP8A 4H8IA 1EZOA 1QKBA 3N6UA 5K2YA 2DWHA 3TUSA 4ELOA 1MQIA 1TWYA 3M3KA 1M5CA 3IORA 1JNFA 2B3BA 5F1QA 4FEDA 3IB2A 4IO7A 5ICTA 4GLIA 1RYXA 2CZLA 5CMCA 3R26A 4NF6A 4TQUQ 4NF4B 5ITOA 2Z22A 4YB7A 4IO5A 4LVQA 1SW4A 1JW4A 3JV9A 2ABHA 5L9OA 3N26A 1B5JA 1IQ7A 1N7XA 4KR5A 2PT1A 4H5FA 3VLWA 5KCJB 1B3FA 4ELQA 1MM6A 2QPQA 4GL8A 5HBCA 4C0RA 1IEJA 2QRYA 3IB0A 3RLFE 1I69A 5DYHA 1O64A 3A09A 2F7BA 4YU0A 1MH3A 1JEUA 5H8SA 3TTLA 1AIVA 2V93A 4X48A 4IB2A 1Y4TA 1M5FA 1B9JA 4OERA 4PFWA 3PUVE 2Z8EA 3VFJA 1PEBA 5I57B 3UORA 5AA3A 4ECFA 1IXCA 4OETA 3M3FA 2UVHA 3VXCA 2F34A 2V3QA 4GRKA 4U4XA 4OXVA 5A5XA 1O63A 5KDTB 3S9MC 2ZNTA 3S9NC 3HV1A 3RGYA 3MP8A 4OZ9A 2OWSA 4H65A 5H8HB 3MAMA 2F7AA 4I62A 3ILUB 2F97A 1MG1A 2PBWA 3GXAA 5TPAB 3H6TA 1PB7A 5AA2D 2OJTA 1MDP1 1DOTA 2GHBA 3FV1A 3C4MA 3KG2A 4GD5A 4Z0IA 2ALUA 3IK6B 2I4BA 3KFMA 4FJPA 2XXPA 4R9GA 2H4IA 1Y1MA 5H8QB 3K4UA 2DE2A 1POTA 1JQFA 4YKPA 3CSBA 4F1YA 3EN3A 3MVXA 1P1UA 4FIMA 3Q25A 1SD3A 3VXBA 1EH3A 4NWCA 5I58A 5L9SA 2P0SA 2NWJA 4F39A 3SEUA 5AA2A 4H5GA 1BTJA 2O7UA 3SEVA 3U1OA 3V89B 4EQBA 5HPQA 3IJXB 1ZU0A 4QF9A 4AQ4A 2KLFA 2UXAA 5I57A 2RCAA 2XXRA 3FD3A 1UQWA 3H4ZA 1R1NA 3L6HA 1B6HA 3S4UA 4N07A 1B3LA 2HEUA 2VHAA 3FXQA 2CMOA 4OMBA 4FAJA 2F8DA 4NF4A 1LAFE 4THIA 1VE4A 3T96B 1PB8A 3RTWB 3VV5A 1Y3QA 2G29A 4QRZA 4ZECA 3S9EA 3O9PA 3VLVA 3QUFA 3G3FA 2Y7WA 3FXRA 4RY1A 3H03A 1R9LA 3K6VA 4YB6A 3Q26A 3TEPA 2QS1A 2Y7PA 1FQAA 3FATA 3PPQA 5JEIA 3FJ7A 4EDPA 2P2AA 1S9TA 4X1DA 1SBPA 1M5BA 1H3DA 4DCXA 5KDTA 2I3VA 2XXYA 1N84A 2ZNUA 1LB8A 4MFIA 1SI0A 1D4NA 1VSOA 1MY3A 2I0CA 1ZBMA 3KSJA 3K1PA 4I9DA 1MY4A 1JW5A 4M1VA 3C33A 3S9LC 4HCYA 3T93B 2HAUA 4DCYA 3TYHA 5BUUA 5FTHA 1PB9A 4GXAA 5B7DA 1SW1A 1IITA 2V25A 4OEVA 1PBQA 3LR1A 3TDJA 3RPWA 4YMAA 5JTYA 3W9WA 1LFIA 3EPEA 1R9QA 2X7QA 3G3HA 3EQ1A 3KOSA 1IZ1A 1N3XA 3HHFA 5IKBA 3OO9A 1HSEA
chains in the Genus database with same CATH superfamily
4PQJA 1LGBC 4NEDA 3PMXA 3K0VA 1BKAA 1YTVA 5IZ3A 4G68C 4HS7A 1QULA 2RCBA 2Y7KA 3OELA 3C34A 1S50A 3FVOA 3PUYE 3V83A 5CMBA 3RPLB 4KYEA 3UK4A 1AH5A 3FASA 1FBPA 2I3WA 5TP9B 5CI5A 4Q0CA 4NE4A 2OWTA 4ZE8A 4PDHA 1NV3A 4PF8A 4RNSA 2PCRA 4P11A 3U93A 1LLSA 1MXWA 4QFKA 4P3LA 4FATA 4MAGA 1RDYA 1MY2A 5I5PA 3B8BA 1DCUA 4KXPA 2XWOA 2DOJA 1AL3A 3FXUA 3TTRA 2DQVA 5H8FA 1A40A 1SQYA 4R6YA 3BKIB 4EXLA 2YJPA 4PP0A 2D3IA 4IGRA 1D9QA 1FPBA 1NKXA 2GHAA 3K6XA 1CE2A 3IAZA 4AB6A 4JSOA 2H25A 4AS5A 1B0HA 5F24A 3KJ7A 1ANFA 1O7TA 3JYRA 2F6GA 1OVTA 3B6QA 5I2KA 4BDRA 1QUJA 4O94A 4KQPA 1TFAA 3MQ9A 2AYSA 4ZZAA 1FQEA 1B3EA 3IL1B 1AOVA 2PVUA 4YKKA 4FECA 1UIUA 4C1TA 4G68A 4MJOA 1NNTA 2V3UA 4G68B 5ET5A 2FYIA 1MS7A 2FBPA 4N6PA 2HZKA 4MBPA 2FHYA 3OEKA 3EF7A 1XVYA 4IO3A 2HXWA 3MC2A 2XX8A 5I2KB 1MM7A 4N13A 4TLMB 1I6BA 3IFCA 1US4A 1JVYA 1IMCA 4O7MA 2Q2AA 1B32A 1BP5A 4DXBA 4NF0A 2Z8DA 1LCFA 4QXDA 4QSEA 1EYJA 3LSWA 3KBRA 4P47A 3TAJA 4DXCA 2GFEA 4X8RA 2R6GE 1P1NA 4QFOA 4GWYA 5B70A 2VD3A 3B7DA 1XHYA 3PMVA 3U8QA 4R74A 3U94A 4NHBA 3W9VA 1FBGA 2VPOA 3CRBA 5KZTA 1MPBA 1WODA 1DBZA 3KGCA 3CFZA 1UIVA 4LUBA 4U4SA 2YPNA 3Q28A 4XKRA 2F5XA 4Q30B 3FIRA 1QVSA 3OOAA 2ONKE 2GH9A 4OFOA 4O8MA 4BDNA 5LTCA 1LSTA 3H7MA 4KCDA 4H1XA 1OQHA 3FGSA 4GWZA 3T9XB 4NGUA 3OO7A 4NF8A 1YAEA 4U1ZA 1MDQA 2FA7A 4UABA 2H99A 3OSRA 1NH7A 3CFLA 4YB5A 2Q8JA 1B5HA 4WEPA 4F3SA 4MNCA 3VDFA 2OLBA 2VOZA 3MWBA 3C31A 4HTGA 2DYXA 5EHSA 1MQGA 4NN3A 2GRVA 1MQJA 4NX1A 2H98A 1B5IA 4QHQA 2F7CA 3GBBA 2RINA 3E3KA 4OA4A 2VP1A 1MXUA 1QUIA 3MZ9A 4JXIA 3FV2A 1MXVA 4L17A 4PFRA 3O6GA 1FBFA 3CIJA 4LONB 1WDNA 2I6EA 3GZGA 3SZPA 4G77A 2DXYA 3CG3A 3KN7A 4RJZA 1RDZA 2QMWA 4POXA 2F36A 5L9MA 3OMBA 2REGA 3CVGA 3G3IA 4LATA 5AE4A 2WYKA 1EU8A 5DW8A 3R7XA 3TTMA 2XXQA 3K2DA 4Q5TA 4F18A 3N94A 1LBCA 1OVBA 1LBYA 3EHTA 4QRZA 4MX6A 1RYOA 5H8QA 3PPRA 1KWHA 4BDOA 3ODBA 3H6UA 1B1XA 5K2YA 1TWYA 3M3KA 3IB2A 5ICTA 2CZLA 4TQUQ 4LVQA 1JW4A 5L9OA 5EQAA 4KR5A 3VLWA 1B3FA 1MM6A 1I69A 1O64A 4YU0A 1MH3A 1JEUA 4HE1A 4IB2A 1M5FA 2Z8EA 1PEBA 3VXCA 4GRKA 4OXVA 1O63A 4GWWA 2ZNTA 3HV1A 1FPEA 4OZ9A 4H65A 1PB7A 2OJTA 2GHBA 3IK6B 4FJPA 2H4IA 2DE2A 1POTA 5EYHA 3VXBA 5L9SA 2P0SA 3SEUA 4H5GA 2O7UA 1ZU0A 4QF9A 3T1BA 1UQWA 2HEUA 3FXQA 1IMDA 1LAFE 4JVIA 3RTWB 1Y3QA 3G3FA 3Q26A 2QS1A 1EYIA 3PPQA 4EDPA 2I3VA 4I40A 1SI0A 1VSOA 5ET8A 1ZBMA 4M1VA 3C33A 3S9LC 3T93B 3TYHA 2V25A 4OEVA 3LR1A 3TDJA 5JTYA 3EPEA 3MW0A 3HHFA 1FPIA 1HSEA 4MIJA 5IZZA 3PU5A 5EQ7A 2DDKA 1TXFA 2V3TA 4OVJA 1MPDA 1OLCA 3DP8A 1B40A 2RC9A 1IUDA 2DE4A 1B2HA 1B7HA 1FBEA 1XS5A 2FIXA 2HXRA 3NOHA 5TU0A 3MVWA 1H44A 3ROJA 1LFGA 3M8UA 5CBSA 2R8TA 2WBDA 4EUOA 1FTKA 2I0BA 1OQGA 4KCCA 4N91A 2L5VA 4C1UA 3W15C 1Y3PA 1P1QA 3FVGA 3HHGA 1FPKA 4JB7A 4ZEIA 5T3JA 4XTCQ 1FW0A 4AS4A 3ONMA 1JEVA 4KI0E 4I8CA 4FEBA 3VVFA 1MXZA 4O3CA 3ZKKA 2FNCA 4F3GA 5DEXA 1LBVA 4PTKA 1N7WA 3DLNA 3K1NA 1INPA 3T22A 4HCWA 2V4CA 1ZMGA 3SEWA 3PUXE 5CC2A 1Q35A 4GFRA 4XKQA 3TELA 4ISUA 4JBZA 3QK6A 2XXHA 3QIMA 3PUZE 2E0SA 4O3AA 3N5LA 3MUQA 1TFDA 4R2FA 2ZZVA 2F78A 1LB9A 1UTBB 1NUWA 1IXHA 3I6VA 3GBAA 4PFUA 4XIGQ 2F3DA 1P1OA 3EHSA 4P1EA 5IZ1A 3R6UA 4F3BA 4R73A 2D5WA 2A5TA 1GGGA 3RYDA 2LAOA 1VDWA 2O84X 2XXUA 1P1WA 4M4GA 4PBQA 3TTNA 4JVCA 2O1MA 1NV1A 2R71A 1MXYA 2E1SA 3KJTA 3PD9A 3V5AA 3AXFA 2QVUA 2F3BA 2O6AA 2G93A 1PDAA 3CSGA 4DE8A 2VGQA 3LUYA 5I7IA 3T9UA 3IOUA 5AA4B 4YKIA 5I56A 4N6KA 5TP9A 2UVIA 4H45A 4F29A 3HN0A 3E78A 3ZS6A 4H67A 4NQ8A 3RPLA 3MPKA 4N81A 2PX1A 3OD7A 3SESA 4NF5B 1PC3A 3GLBA 1K9ZA 2BJJX 4TOZA 4IO6A 2OX3A 4ND9A 1IMBA 2Q74A 2I4CA 2IEEA 2A5TB 3SEXA 5IAIA 1DPPA 2DWAA 3H6WA 1MH4A 1KZ8A 1FTJA 3HO7A 3MZBA 2CEYA 3MPLA 4JDFA 3SKPA 3T66A 1OMPA 1NUXA 3K00A 4F1UA 1B51A 3UN6A 3HPIA 2RC7A 4PFIA 4YICA 3FZVA 3RUMA 1HSJA 3QXMA 4ZS9A 4N8YA 4IO4A 3H6VA 1F9BA 3SEYA 1ZTYA 2W7YA 3QAXA 4QFPA 3S2VA 2QS2A 2ZMBA 3DELB 3CR9A 4G2ZA 5CMKA 2Q88A 1Y1ZA 3OSQA 1T0KA 1MXXA 1D9YA 3FJMA 1H76A 3H06B 5A5XB 2ZYOA 3D4CA 4MF3A 5FHNA 4XFEA 1K9YA 2CEXA 2ZXTA 2DVCA 2KR0A 4N17A 3KN8A 5AA2B 2UVGA 1IXGA 4P1LA 5KCJA 4KPTA 4XKPA 1ZIUA 3L6GA 1NV4A 4PFYA 5DVFA 5TPAA 3VLUA 4EQ7A 2CZKA 2P3VA 1SW5A 3I3VA 4I3YA 3HFUA 1GR2A 1NV5A 1FPLA 2WBBA 4X1BA 3QYTA 4P8BA 2I58A 4PCDA 1RKMA 5I3SA 2Y84A 2B4MA 4RA1A 4JSDA 1DTZA 2DS9A 4I1DA 5ICQA 3CFXA 5JTYB 2NXOA 3C32A 4GWXA 1FTOA 2RKMA 2DWHA 1MQIA 2BJIA 1JNFA 5IGAA 3BIGA 5CMCA 4NF6A 4NF4B 4XF5A 2Z22A 4YB7A 4IO5A 1Q9DA 3JV9A 3N26A 1B5JA 1N7XA 3KC0A 4ELQA 2QPQA 2PFYA 5DYHA 3A09A 3GYYA 5H8SA 3TTLA 1JP4A 1AIVA 2V93A 1KA1A 1B9JA 3PUVE 4XEQA 3M3FA 2UVHA 4U4XA 5KDTB 3S9NC 2OWSA 5H8HB 3MAMA 2F7AA 4I62A 5AA2D 3C4MA 2I4BA 5H8QB 3MYUA 1JQFA 4F1YA 1EYKA 3EN3A 4FIMA 1EH3A 1LEVA 1NV2A 4PFBA 2NWJA 4I3EA 1BTJA 3U1OA 3V89B 3IJXB 2KLFA 2RCAA 3FD3A 3S4UA 1B3LA 2VHAA 1VE4A 1PB8A 4ZECA 4X04A 3O9PA 4RY1A 3K6VA 2HPGA 3FATA 5JEIA 2P2AA 4X1DA 1H3DA 4DCXA 2ZNUA 3FXBA 3KSJA 1JW5A 5BUUA 1SW1A 1PBQA 1NV6A 4N15A 5EQ9A 3G3HA 3OO9A 3TMGA 3TTKA 3KN3A 5H8NB 1FBDA 2H9BA 3LSLA 4GVOA 3F11A 5I59A 3RQTA 4YZZA 1FSAA 1DSNA 1Y20A 1FPFA 4LQ2A 1B0LA 4ZZEA 3O66A 3MVZA 3S9MC 1FCKA 2DE3A 1MY0A 3BFUA 2Z8FA 2DWJA 2AL4A 4NF8B 3EHUA 4ONYA 2IA4A 4GL0A 1GTKA 3RNNA 5ITPA 2GQ1A 4PAFA 1URSA 4IGTA 1FTAA 2JJKA 1IMEA 3LSXA 3SETA 3P7IA 4NF6B 5EYFA 1LBXA 1NUYA 2XHDA 1FPJA 5J16A 1XVXA 4OESA 2A5SA 2XXWA 3G3KA 2QVRA 3LC8A 2PFZA 1B46A 5EYGA 1N76A 1UTHA 1YYZA 4FORA 4H46A 1FTLA 3UGWA 1B7UA 3K6UA 3C35A 3D4GA 2ANJA 4ZE9A 3B6WA 3O97A 1A54A 3V8XB 1FJ6A 1FQFA 4DIGA 4FE8A 1LAGE 1IIWA 1QUKA 3WAFA 4GBWA 4MNIA 1A7LA 4LA9A 2NOOA 4NF5A 4IY5A 5DVJA 3CI8A 3HSTA 3I5OA 4GX4A 1CNQA 1IMAA 3PPNA 4F2QA 4MNPA 2HCAA 4U23A 5I56B 3IOWA 4LZ7A 4O3BA 5AA4A 4N6DA 1L5TA 1SVXB 1S7YA 4O7IA 2PMSA 2Q2CA 3PPOA 3MP1A 2Z23A 5ESYA 1YCJA 4KYSA 4LP2B 1IXIA 1SYIA 3IX1A 5DT6A 4U2RA 3FJGA 1XC1A 1P99A 2XXXA 3TKDA 4N4UA 4P0GA 3U92A 4GQOA 2H5YA 4GIZA 4IR8A 4RPNA 1I6QA 4OHNA 3ISPA 2ZYMA 4GX3A 3PGFA 5L8DA 4PGNA 4PE3A 1NMUA 2DWIA 3OEMA 4LQ5A 1FPDA 3FUZA 4U21A 2RF1A 4HXVA 2XXIA 1N3WA 2M8CA 4DLDA 5DTBA 3LSFB 1URGA 5K2XA 4BLAA 2OK2A 4PF6A 4GX6A 5ELVA 3TCGA 4EF2A 2B3FA 1EZPA 1UTHB 1B3HA 4Q8RA 3KSXA 4MMPA 2HZLA 2DXRA 1JVXA 1UTBA 1SYHA 3ECRA 4ZEDA 4DXUA 1YXIA 4P56A 4YKJA 4MEVA 3SERA 4MH5A 4ZDMA 3UIFA 2OBGA 2RC8A 2VD2A 3PTYA 1A8EA 5ISUA 1URDA 1XOCA 4IY6A 4K3FA 1NUZA 3N6TA 1Z7ME 1RDXA 2O7IA 2D21A 4IO2A 4NMYA 4GXSB 3RT8A 3M3LA 1SW2A 4F22A 3G7WA 3O28A 1MPCA 5FHMA 5IM2A 1ZLQA 4DDDA 1POY1 2ONRA 3K01A 1QKAA 2XA5A 4F19A 5I59B 1AMFA 3B6TA 4HW8A 5H8NA 1LFHA 2Y7IA 4WEDA 1Q1KA 4PBHA 3IB1A 4PFTA 1B52A 1EZ9A 5I84A 3DP4A 4OVRA 2QMXA 4MHFA 4F2OA 1DTGA 3OENA 2QVVA 2AIXA 2I49A 1FQBA 2WYPA 2X26A 3UA8A 2OZZA 4TLLB 3QMFA 1YPNA 1VFEA 3IJOB 1FQDA 3E4RA 2UYEA 1H45A 3RY3A 1NNKA 4OANA 3TQLA 5H8FB 1OIBA 1FBCA 4JWYA 1Y4CA 3E79A 4EXKA 3IO4A 2F35A 1CB6A 3IFAA 2Y5KA 4XXUA 3D1RA 1LBWA 2AL5A 3O6HA 1USYH 4EF1A 5FHOA 3PD8A 1G0HA 1A8FA 1N04A 4DI4B 2ZYNA 2P3NA 4YMBA 4ELPA 4R72A 4ZEFA 5LDZA 3BFTA 4OTEA 4ELRA 1QJMA 3T9HB 1QW0A 1NH8A 2QJEA 1DMBA 2XX7A 1QGXA 2XXKA 3RTFB 5F7VA 2XWIA 4OVTA 2O69A 3C9HA 1Z7NE 5DEXB 4R6HA 2DP8A 1EZOA 5ET6A 3TUSA 1M5CA 5F1QA 4FEDA 2QFLA 4IO7A 1SW4A 2ABHA 4H5FA 2CZHA 4GL8A 4C0RA 2VPNA 3RLFE 2F7BA 4PAKA 4LN5A 4PFWA 3VFJA 3UORA 4OETA 2F34A 3RGYA 3MP8A 2F97A 1MG1A 3GXAA 5TPAB 1MDP1 1DOTA 3FV1A 3KG2A 4GD5A 4R9GA 2XXPA 4P9KA 1Y1MA 2CZIA 3K4UA 3CSBA 4NAPA 1SD3A 4NWCA 4F39A 5AA2A 3SEVA 4EQBA 2UXAA 5I57A 2XXRA 3L6HA 1B6HA 4N07A 2CMOA 4THIA 2G29A 2Y5LA 3S9EA 2Y7WA 1R9LA 2MKZA 3FJ7A 1S9TA 1M5BA 5KDTA 2XXYA 1LB8A 1D4NA 1MY3A 3K1PA 4HCYA 4DCYA 1FJ9A 5FTHA 1PB9A 4GXAA 1IITA 1R9QA 2X7QA 1IZ1A 1N3XA 5M2VA 3TODA 4KFQA 1M5EA 4AB5A 2R9JA 4QSCA 5I2NB 3QUJA 1J1NA 4ESWA 5FBPA 3KOTA 4G4PA 4G61A 3SDFA 1LAXA 3PPPA 1VFDA 4RK2A 3ILTB 3UP9A 2QSXA 3FVKA 1YZ0A 3USDA 4P0IA 5BWJA 4BDMA 3K02A 3MJNA 3TZAA 2WEFA 3VE1B 3JZJA 3TCFA 3A3CA 4G8MA 4WXJA 2PYYA 1ATGA 1FTMA 4ZEBA 4G8NA 3MZ1A 4GWUA 2DSFA 3O29A 2B65A 1NFTA 4F31B 1IMFA 3MBPA 1SDXA 5EHMA 1I6AA 3RN8A 4DI3D 3VVDA 4JWXA 2FIEA 3BBRA 3RT6B 3TCHA 3IOTA 4X9TA 1D3KA 1OLAA 4U1OA 2UVJA 3PV0E 1GVCA 3QSLA 4OVQA 3FVNA 1MQHA 3A3UA 2B4LA 5AA1A 1LBBA 3CG1A 1NV7A 5LOMA 3KC1A 5CMMA 2NVUB 1XI6A 2QL3A 1NV0A 2ESNA 5JK4A 1B7ZA 4KD5A 3O6IA 4OEUA 1ZJLA 4R6KA 3ZKLA 3LBSA 2XD2A 4NTLA 3O2AA 2Q8MA 4KHZE 4ZEKA 3U72A 1MQDA 3K6WA 2YLNA 4U22A 1ELJA 1B1HA 2Q89A 2O51A 1B4ZA 2XD3A 1AWBA 3IO6A 2XX9A 2F6PA 4F3PA 2VT5A 3G3GA 1KA0A 1A55A 1WVJA 1H43A 4QFLA 3IOVA 3HCQA 5J1DA 2THIA 1BIYA 4ESXA 4E0XA 1Y3NA 2XXTA 1NNFA 4R9FA 5DVIA 2HFBA 4MLVA 2HAVA 4NG7A 3MVYA 5CBRA 2O68A 3PUWE 3LV0A 5FTIA 2ZNSA 1LCTA 1R6ZA 4OVPA 2Q9TA 1B4HA 4H8JA 2REJA 4EQ9A 2X7PA 2XXVA 4QSDA 1N0TA 1FQCA 3KZGA 4RXLA 4Z7EA 1II5A 2PT2A 3OO6A 3TPAA 2ZZXA 1MY1A 3KBZA 3ZSFA 4PGPA 2I48A 3PMWA 3OO8A 1D9VA 1FBHA 4RK9A 1FRPA 3E13X 4OVSA 3T9VA 1DK4A 2FVZA 3DP6A 5HM4B 1SI1A 1A99A 3OXNA 4BDLA 3VVEA 4HE2A 2DVZA 4QFNA 4LZ5A 4GF8A 4E0WA 1US5A 1JW1A 3K1MA 2V84A 2OCUA 3DM0A 1ZKBA 4GWOA 2NUVA 3MSTA 5CM6A 3THIA 4KYDA 4DZ1A 4POWA 1NL5A 3TQWA 3WAEA 2ONSA 4WKMA 4MLQA 3LUZA 5EQ8A 1Y9UA 1USYE 1JETA 1VR5A 4GOTA 1GV8A 2XWVA 1SPIA 4PAIA 4GWSA 1B3GA 4MCOA 3C36A 3MP6A 1B58A 2P1SA 3G3JA 4G8HA 4RPOA 5H8HA 4OYVA 1LAHE 2ZYKA 2QS3A 4H0WA 4LZ8A 3T0JA 1M5DA 2O1LA 2ZZWA 3H3GA 3KEIA 1PBPA 4F1VA 2HQ0A 4XKNA 4OFJA 1MRPA 4HE0A 1G0IA 1B05A 2QS4A 4NWDA 1NNPA 4JWOA 3Q29A 1DPEA 4RYAA 4OENA 5A5LA 4BDQA 2Y7RA 1BLFA 3CHGA 4PE5B 1HSLA 4OWDA 4FBPA 4R2BA 4OFLA 3TFLA 2WKYA 2OWZA 2UYFA 3Q27A 1TT1A 5I2NA 4UA8A 2XWKA 5CRYA 1FPGA 4OQOA 3E9XA 4UACA 4PDDA 3IR1A 1XT8A 4PETA 4R75A 4YAHX 5I58B 4H6DA 4H8IA 1LBZA 1QKBA 3N6UA 4ELOA 3IORA 3A29A 2B3BA 4GLIA 1RYXA 3R26A 3EKIA 5ITOA 2WX9A 1NI9A 1IQ7A 5KCJB 2PT1A 5HBCA 4N8GA 1IEJA 2QRYA 3IB0A 4X48A 4QBAA 1Y4TA 4OERA 3BIHA 5I57B 5AA3A 1IXCA 3B50A 2V3QA 5A5XA 2KQZA 3ILUB 2PBWA 3H6TA 3U65A 4Z0IA 2ALUA 3KFMA 4ECFA 5IZ3B 4YKPA 1BK4A 3MVXA 1P1UA 3Q25A 5I58A 5HPQA 4JVDA 4AQ4A 3H4ZA 1R1NA 4GBVA 2HHMA 4OMBA 4FAJA 2F8DA 4NF4A 5ET7A 3T96B 3VV5A 3VLVA 3QUFA 3FBPA 3FXRA 3H03A 4YB6A 3TEPA 2Y7PA 1FQAA 1SBPA 4MFIA 1N84A 2I0CA 4I9DA 1MY4A 2HAUA 4PC9A 5B7DA 3RPWA 4YMAA 3W9WA 1LFIA 3KOSA 3EQ1A 5IKBA
chains in the Genus database with same CATH topology
4PQJA 1LGBC 4NEDA 3TODA 4KFQA 3TMGA 1M5EA 3PMXA 3K0VA 4AB5A 3TTKA 3KN3A 5H8NB 1BKAA 2R9JA 4QSCA 1YTVA 2H9BA 3LSLA 4GVOA 3PU5A 3F11A 5I2NB 5I59A 3QUJA 1J1NA 4G68C 4HS7A 3RQTA 1TXFA 2V3TA 4OVJA 1MPDA 1OLCA 1QULA 2RCBA 2Y7KA 3DP8A 3OELA 1B40A 2RC9A 4YZZA 4ESWA 3KOTA 1IUDA 1DSNA 1S50A 2DE4A 3C34A 3FVOA 3PUYE 4G4PA 1B2HA 3V83A 5CMBA 1Y20A 1B7HA 1LAXA 4KYEA 3UK4A 3PPPA 1XS5A 4LQ2A 1B0LA 4ZZEA 5TU0A 1AH5A 3FASA 3MVWA 3MVZA 1H44A 1FCKA 1VFDA 2I3WA 3O66A 1LFGA 3M8UA 2DE3A 4RK2A 5TP9B 5CBSA 4EUOA 5CI5A 1FTKA 1MY0A 3BFUA 3ILTB 2I0BA 3UP9A 2QSXA 1OQGA 2Z8FA 2DWJA 3FVKA 4KCCA 2AL4A 4Q0CA 4NF8B 4NE4A 3EHUA 4ONYA 3USDA 2IA4A 2OWTA 4GL0A 4P0IA 4ZE8A 1GTKA 3RNNA 3W15C 4C1UA 1Y3PA 1P1QA 5BWJA 3FVGA 3HHGA 3K02A 4BDMA 5ITPA 1URSA 4JB7A 4ZEIA 4RNSA 4XTCQ 4P11A 4IGTA 3U93A 1FW0A 1LLSA 1MXWA 4QFKA 3ONMA 3LSXA 3SETA 3P7IA 3MJNA 1JEVA 4NF6B 3TZAA 4FATA 5EYFA 3JZJA 3TCFA 3VE1B 4KI0E 4I8CA 4FEBA 3A3CA 2XHDA 4G8MA 4WXJA 3VVFA 1MXZA 1MY2A 4HW8A 1XVXA 2DOJA 2PYYA 4OESA 1AL3A 3FXUA 4O3CA 3TTRA 2FNCA 2DQVA 3ZKKA 1ATGA 1A40A 1SQYA 1FTMA 2A5SA 4R6YA 2XXWA 5DEXA 3G3KA 4F3GA 1N7WA 3LC8A 3DLNA 3K1NA 3MZ1A 4G8NA 4ZEBA 3T22A 2DSFA 3BKIB 3O29A 4EXLA 4HCWA 1B46A 2B65A 1NFTA 4F31B 1N76A 1UTHA 3MBPA 4FORA 2YJPA 1FTLA 3UGWA 1ZMGA 1B7UA 4PP0A 1SDXA 2D3IA 3K6UA 4IGRA 5EHMA 3SEWA 3PUXE 1NKXA 2GHAA 3K6XA 1CE2A 1I6AA 3RN8A 3IAZA 3VVDA 4AB6A 3C35A 4JWXA 3BBRA 3RT6B 5CC2A 3D4GA 3TCHA 2ANJA 3IOTA 4X9TA 4JSOA 2H25A 4ZE9A 1Q35A 1D3KA 3B6WA 4GFRA 1B0HA 1A54A 3O97A 4XKQA 3TELA 4ISUA 1OLAA 4JBZA 3V8XB 3QK6A 4U1OA 3KJ7A 2XXHA 2UVJA 1FQFA 3PV0E 3QIMA 3QSLA 1GVCA 4DIGA 4FE8A 3FVNA 1MQHA 3A3UA 1LAGE 2E0SA 3PUZE 1ANFA 1IIWA 1QUKA 1O7TA 3JYRA 5AA1A 3WAFA 1A7LA 2F6GA 4O3AA 1LBBA 3N5LA 4LA9A 3MUQA 2NOOA 4NF5A 3CG1A 1TFDA 1OVTA 4IY5A 5DVJA 5LOMA 4R2FA 2F78A 3B6QA 3CI8A 3HSTA 3I5OA 1LB9A 1UTBB 4BDRA 5I2KA 1IXHA 1QUJA 5CMMA 2NVUB 4KQPA 3I6VA 2QL3A 3PPNA 1TFAA 3GBAA 3MQ9A 4F2QA 4PFUA 2AYSA 2ESNA 4ZZAA 5JK4A 1FQEA 1B3EA 4XIGQ 1B7ZA 2HCAA 3IL1B 3O6IA 4KD5A 4OEUA 1ZJLA 4R6KA 4U23A 3IOWA 5I56B 2PVUA 4YKKA 3ZKLA 4LZ7A 1P1OA 4O3BA 3LBSA 5AA4A 2XD2A 4FECA 4NTLA 3EHSA 1UIUA 4C1TA 3O2AA 3R6UA 4F3BA 4R73A 1L5TA 2D5WA 4G68A 2A5TA 1GGGA 4KHZE 4ZEKA 1SVXB 1NNTA 1S7YA 1MQDA 2LAOA 3K6WA 2V3UA 3SDFA 3U72A 4G68B 2O84X 2FYIA 1MS7A 2YLNA 4U22A 2XXUA 2PMSA 1ELJA 1P1WA 1B1HA 2Q2CA 4N6PA 2Q89A 3PPOA 3MP1A 2Z23A 2HZKA 4M4GA 4MBPA 3TTNA 2O51A 1B4ZA 1YCJA 2XD3A 3EF7A 3OEKA 3IO6A 4KYSA 4LP2B 1XVYA 1IXIA 2XX9A 1SYIA 3IX1A 2F6PA 2O1MA 5DT6A 4IO3A 2HXWA 4F3PA 4U2RA 3MC2A 3FJGA 1XC1A 1P99A 2XXXA 3G3GA 3TKDA 2XX8A 2R71A 4P0GA 5I2KB 1MXYA 3U92A 1MM7A 2E1SA 4GQOA 4N13A 4TLMB 3KJTA 2H5YA 3PD9A 4GIZA 4RPNA 1I6QA 4OHNA 3V5AA 1A55A 1I6BA 3AXFA 2ZYMA 1WVJA 1US4A 3PGFA 5L8DA 1H43A 1JVYA 4QFLA 2O6AA 3IOVA 1NMUA 2DWIA 3HCQA 5J1DA 2G93A 1BIYA 2THIA 4ESXA 4E0XA 1PDAA 1Y3NA 2Q2AA 3OEMA 4LQ5A 1B32A 3CSGA 3FUZA 4DE8A 2XXTA 1BP5A 2RF1A 2VGQA 3LUYA 1NNFA 1N3WA 2XXIA 2M8CA 4U21A 4DLDA 4R9FA 3T9UA 5DVIA 5DTBA 2HFBA 3LSFB 4MLVA 2HAVA 1URGA 3IOUA 2Z8DA 5K2XA 4BLAA 1LCFA 4DXBA 5AA4B 3MVYA 2OK2A 4YKIA 4QSEA 5CBRA 2O68A 3LSWA 3PUWE 5I56A 3KBRA 5ELVA 5TP9A 3TAJA 2UVIA 3TCGA 5FTIA 4DXCA 2GFEA 4EF2A 2B3FA 2ZNSA 3HN0A 3ZS6A 4F29A 1LCTA 1R6ZA 1UTHB 2R6GE 4H67A 1EZPA 1B3HA 1P1NA 3KSXA 4Q8RA 4QFOA 2HZLA 5B70A 2DXRA 3MPKA 1JVXA 2PX1A 2Q9TA 1UTBA 2VD3A 3B7DA 3OD7A 1SYHA 1XHYA 1B4HA 3ECRA 3PMVA 4H8JA 4ZEDA 2REJA 3U8QA 3SESA 4R74A 4NF5B 1PC3A 2X7PA 2XXVA 3GLBA 4QSDA 4DXUA 4EQ9A 4YKJA 3U94A 2BJJX 1N0TA 1FQCA 3KZGA 3W9VA 3SERA 4MH5A 4TOZA 4RXLA 4ZDMA 3UIFA 2OBGA 4Z7EA 4IO6A 3CRBA 1II5A 2RC8A 2VD2A 5KZTA 1MPBA 1WODA 2PT2A 3OO6A 4ND9A 3TPAA 1A8EA 1MY1A 5ISUA 1URDA 3ZSFA 3KGCA 1XOCA 2I48A 4IY6A 3CFZA 3PMWA 1UIVA 4LUBA 2I4CA 2IEEA 2A5TB 4K3FA 3SEXA 5IAIA 3N6TA 1DPPA 3OO8A 1Z7ME 4U4SA 2YPNA 2DWAA 2O7IA 3Q28A 2D21A 4XKRA 2F5XA 1D9VA 3H6WA 1MH4A 4Q30B 3FIRA 4IO2A 4NMYA 4RK9A 1FTJA 3E13X 1QVSA 3T9VA 4GXSB 3OOAA 3RT8A 3HO7A 3MZBA 3DP6A 2ONKE 5HM4B 2GH9A 3M3LA 1SW2A 4F22A 4OFOA 1SI1A 1A99A 3G7WA 3MPLA 3OXNA 4JDFA 4BDNA 3O28A 3VVEA 1MPCA 4BDLA 3SKPA 3T66A 2DVZA 1OMPA 5FHMA 1ZLQA 4DDDA 1POY1 2ONRA 1LSTA 3H7MA 3K01A 3K00A 4LZ5A 4KCDA 4QFNA 4F1UA 1QKAA 4GF8A 4H1XA 4F19A 1B51A 3UN6A 1OQHA 3FGSA 3HPIA 5I59B 1AMFA 3T9XB 1US5A 4E0WA 2RC7A 1JW1A 3OO7A 4YICA 3FZVA 4NF8A 3K1MA 1YAEA 3B6TA 1HSJA 2V84A 3QXMA 4U1ZA 4ZS9A 2OCUA 1MDQA 5H8NA 4IO4A 3RUMA 3DM0A 1LFHA 1ZKBA 4GWOA 2Y7IA 3H6VA 2FA7A 4WEDA 1Q1KA 1F9BA 2NUVA 5CM6A 3THIA 3SEYA 3IB1A 4KYDA 4POWA 1ZTYA 1NL5A 4PFTA 1B52A 1EZ9A 3TQWA 3WAEA 2W7YA 3DP4A 3QAXA 2H99A 2QMXA 5I84A 3OSRA 2ONSA 4QFPA 3S2VA 1NH7A 1DTGA 2QS2A 2ZMBA 3CFLA 3OENA 4YB5A 4F2OA 2Q8JA 4WKMA 2AIXA 4MLQA 3DELB 1Y9UA 2I49A 1FQBA 1USYE 1JETA 2X26A 1B5HA 1VR5A 4WEPA 3UA8A 3CR9A 2OZZA 4GOTA 4F3SA 3VDFA 1GV8A 2OLBA 2VOZA 5M2VA 1B3GA 3C31A 3MWBA 4HTGA 4G2ZA 4TLLB 1YPNA 2DYXA 5CMKA 3C36A 1VFEA 2Q88A 1FQDA 3IJOB 1B58A 2P1SA 3E4RA 3MP6A 1Y1ZA 2UYEA 3G3JA 5EHSA 1H45A 3OSQA 1MQGA 4G8HA 4RPOA 3RY3A 5H8HA 1MXXA 1NNKA 4OYVA 1T0KA 3TQLA 1LAHE 5H8FB 2ZYKA 1D9YA 2QS3A 1OIBA 3FJMA 2GRVA 1H76A 3H06B 4H0WA 1M5DA 2ZYOA 4JWYA 4LZ8A 1Y4CA 1MQJA 3D4CA 5A5XB 4MF3A 2O1LA 3KEIA 3H3GA 4EXKA 1PBPA 4F1VA 5FHNA 4DZ1A 2HQ0A 2H98A 1AOVA 1B5IA 4QHQA 3IO4A 2F7CA 3GBBA 4XKNA 2F35A 1CB6A 2RINA 3E3KA 3MW0A 4OFJA 2VP1A 1MXUA 1MRPA 4XXUA 1QUIA 5H8FA 3MZ9A 2AL5A 2ZXTA 3O6HA 4JXIA 2DVCA 3FV2A 1B05A 1MXVA 2QS4A 1NNPA 4L17A 3KN8A 4NWDA 2UVGA 5AA2B 3O6GA 1IXGA 1USYH 4JWOA 4KPTA 4EF1A 5KCJA 3CIJA 3Q29A 1DPEA 4LONB 1WDNA 4OENA 4RYAA 4XKPA 2I6EA 5FHOA 1ZIUA 3GZGA 3PD8A 4BDQA 4G77A 2DXYA 3CG3A 2Y7RA 3KN7A 1BLFA 3L6GA 4PFYA 4RJZA 4PE5B 1A8FA 1HSLA 4OWDA 4R2BA 1N04A 5DVFA 5TPAA 3VLUA 4EQ7A 2QMWA 2ZYNA 4YMBA 4ELPA 4R72A 4POXA 2F36A 5L9MA 1SW5A 2REGA 3OMBA 4OFLA 3CVGA 3TFLA 2WKYA 3I3VA 2UYFA 3G3IA 3Q27A 4LATA 4ZEFA 5AE4A 1EU8A 1GR2A 3R7XA 1TT1A 3BFTA 4OTEA 2XXQA 4X1BA 1QJMA 3TTMA 3K2DA 3QYTA 4UA8A 4ELRA 5CRYA 4Q5TA 2I58A 5I2NA 4F18A 3N94A 1RKMA 4OQOA 2Y84A 1LBCA 3T9HB 1QW0A 1NH8A 2QJEA 3E9XA 4UACA 1DMBA 4RA1A 1OVBA 1XT8A 3EHTA 3IR1A 4JSDA 1DTZA 4PETA 2DS9A 1RYOA 2XX7A 5H8QA 4I1DA 5ICQA 3CFXA 4R75A 5JTYB 3PPRA 3RTFB 5F7VA 1KWHA 2NXOA 3C32A 4YAHX 4BDOA 2O69A 3ODBA 5I58B 1FTOA 2RKMA 3C9HA 3H6UA 1Z7NE 4H6DA 1B1XA 5DEXB 4R6HA 2DP8A 4H8IA 1EZOA 1QKBA 3N6UA 5K2YA 2DWHA 3TUSA 4ELOA 1MQIA 1TWYA 3M3KA 1M5CA 3IORA 1JNFA 2B3BA 5F1QA 4FEDA 3IB2A 4IO7A 5ICTA 4GLIA 1RYXA 2CZLA 5CMCA 3R26A 4NF6A 4TQUQ 4NF4B 5ITOA 2Z22A 4YB7A 4IO5A 4LVQA 1SW4A 1JW4A 3JV9A 2ABHA 5L9OA 3N26A 1B5JA 1IQ7A 1N7XA 4KR5A 2PT1A 4H5FA 3VLWA 5KCJB 1B3FA 4ELQA 1MM6A 2QPQA 4GL8A 5HBCA 4C0RA 1IEJA 2QRYA 3IB0A 3RLFE 1I69A 5DYHA 1O64A 3A09A 2F7BA 4YU0A 1MH3A 1JEUA 5H8SA 3TTLA 1AIVA 2V93A 4X48A 4IB2A 1Y4TA 1M5FA 1B9JA 4OERA 4PFWA 3PUVE 2Z8EA 3VFJA 1PEBA 5I57B 3UORA 5AA3A 4ECFA 1IXCA 4OETA 3M3FA 2UVHA 3VXCA 2F34A 2V3QA 4GRKA 4U4XA 4OXVA 5A5XA 1O63A 5KDTB 3S9MC 2ZNTA 3S9NC 3HV1A 3RGYA 3MP8A 4OZ9A 2OWSA 4H65A 5H8HB 3MAMA 2F7AA 4I62A 3ILUB 2F97A 1MG1A 2PBWA 3GXAA 5TPAB 3H6TA 1PB7A 5AA2D 2OJTA 1MDP1 1DOTA 2GHBA 3FV1A 3C4MA 3KG2A 4GD5A 4Z0IA 2ALUA 3IK6B 2I4BA 3KFMA 4FJPA 2XXPA 4R9GA 2H4IA 1Y1MA 5H8QB 3K4UA 2DE2A 1POTA 1JQFA 4YKPA 3CSBA 4F1YA 3EN3A 3MVXA 1P1UA 4FIMA 3Q25A 1SD3A 3VXBA 1EH3A 4NWCA 5I58A 5L9SA 2P0SA 2NWJA 4F39A 3SEUA 5AA2A 4H5GA 1BTJA 2O7UA 3SEVA 3U1OA 3V89B 4EQBA 5HPQA 3IJXB 1ZU0A 4QF9A 4AQ4A 2KLFA 2UXAA 5I57A 2RCAA 2XXRA 3FD3A 1UQWA 3H4ZA 1R1NA 3L6HA 1B6HA 3S4UA 4N07A 1B3LA 2HEUA 2VHAA 3FXQA 2CMOA 4OMBA 4FAJA 2F8DA 4NF4A 1LAFE 4THIA 1VE4A 3T96B 1PB8A 3RTWB 3VV5A 1Y3QA 2G29A 4QRZA 4ZECA 3S9EA 3O9PA 3VLVA 3QUFA 3G3FA 2Y7WA 3FXRA 4RY1A 3H03A 1R9LA 3K6VA 4YB6A 3Q26A 3TEPA 2QS1A 2Y7PA 1FQAA 3FATA 3PPQA 5JEIA 3FJ7A 4EDPA 2P2AA 1S9TA 4X1DA 1SBPA 1M5BA 1H3DA 4DCXA 5KDTA 2I3VA 2XXYA 1N84A 2ZNUA 1LB8A 4MFIA 1SI0A 1D4NA 1VSOA 1MY3A 2I0CA 1ZBMA 3KSJA 3K1PA 4I9DA 1MY4A 1JW5A 4M1VA 3C33A 3S9LC 4HCYA 3T93B 2HAUA 4DCYA 3TYHA 5BUUA 5FTHA 1PB9A 4GXAA 5B7DA 1SW1A 1IITA 2V25A 4OEVA 1PBQA 3LR1A 3TDJA 3RPWA 4YMAA 5JTYA 3W9WA 1LFIA 3EPEA 1R9QA 2X7QA 3G3HA 3EQ1A 3KOSA 1IZ1A 1N3XA 3HHFA 5IKBA 3OO9A 1HSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQJ A;  1LGB C;  4NED A;  3TOD A;  4KFQ A;  3TMG A;  1M5E A;  3PMX A;  3K0V A;  4AB5 A;  3TTK A;  3KN3 A;  5H8N B;  1BKA A;  2R9J A;  4QSC A;  1YTV A;  2H9B A;  3LSL A;  4GVO A;  3PU5 A;  3F11 A;  5I2N B;  5I59 A;  3QUJ A;  1J1N A;  4G68 C;  4HS7 A;  3RQT A;  1TXF A;  2V3T A;  4OVJ A;  1MPD A;  1OLC A;  1QUL A;  2RCB A;  2Y7K A;  3DP8 A;  3OEL A;  1B40 A;  2RC9 A;  4YZZ A;  4ESW A;  3KOT A;  1IUD A;  1DSN A;  1S50 A;  2DE4 A;  3C34 A;  3FVO A;  3PUY E;  4G4P A;  1B2H A;  3V83 A;  5CMB A;  1Y20 A;  1B7H A;  1LAX A;  4KYE A;  3UK4 A;  3PPP A;  1XS5 A;  4LQ2 A;  1B0L A;  4ZZE A;  5TU0 A;  1AH5 A;  3FAS A;  3MVW A;  3MVZ A;  1H44 A;  1FCK A;  1VFD A;  2I3W A;  3O66 A;  1LFG A;  3M8U A;  2DE3 A;  4RK2 A;  5TP9 B;  5CBS A;  4EUO A;  5CI5 A;  1FTK A;  1MY0 A;  3BFU A;  3ILT B;  2I0B A;  3UP9 A;  2QSX A;  1OQG A;  2Z8F A;  2DWJ A;  3FVK A;  4KCC A;  2AL4 A;  4Q0C A;  4NF8 B;  4NE4 A;  3EHU A;  4ONY A;  3USD A;  2IA4 A;  2OWT A;  4GL0 A;  4P0I A;  4ZE8 A;  1GTK A;  3RNN A;  3W15 C;  4C1U A;  1Y3P A;  1P1Q A;  5BWJ A;  3FVG A;  3HHG A;  3K02 A;  4BDM A;  5ITP A;  1URS A;  4JB7 A;  4ZEI A;  4RNS A;  4XTC Q;  4P11 A;  4IGT A;  3U93 A;  1FW0 A;  1LLS A;  1MXW A;  4QFK A;  3ONM A;  3LSX A;  3SET A;  3P7I A;  3MJN A;  1JEV A;  4NF6 B;  3TZA A;  4FAT A;  5EYF A;  3JZJ A;  3TCF A;  3VE1 B;  4KI0 E;  4I8C A;  4FEB A;  3A3C A;  2XHD A;  4G8M A;  4WXJ A;  3VVF A;  1MXZ A;  1MY2 A;  4HW8 A;  1XVX A;  2DOJ A;  2PYY A;  4OES A;  1AL3 A;  3FXU A;  4O3C A;  3TTR A;  2FNC A;  2DQV A;  3ZKK A;  1ATG A;  1A40 A;  1SQY A;  1FTM A;  2A5S A;  4R6Y A;  2XXW A;  5DEX A;  3G3K A;  4F3G A;  1N7W A;  3LC8 A;  3DLN A;  3K1N A;  3MZ1 A;  4G8N A;  4ZEB A;  3T22 A;  2DSF A;  3BKI B;  3O29 A;  4EXL A;  4HCW A;  1B46 A;  2B65 A;  1NFT A;  4F31 B;  1N76 A;  1UTH A;  3MBP A;  4FOR A;  2YJP A;  1FTL A;  3UGW A;  1ZMG A;  1B7U A;  4PP0 A;  1SDX A;  2D3I A;  3K6U A;  4IGR A;  5EHM A;  3SEW A;  3PUX E;  1NKX A;  2GHA A;  3K6X A;  1CE2 A;  1I6A A;  3RN8 A;  3IAZ A;  3VVD A;  4AB6 A;  3C35 A;  4JWX A;  3BBR A;  3RT6 B;  5CC2 A;  3D4G A;  3TCH A;  2ANJ A;  3IOT A;  4X9T A;  4JSO A;  2H25 A;  4ZE9 A;  1Q35 A;  1D3K A;  3B6W A;  4GFR A;  1B0H A;  1A54 A;  3O97 A;  4XKQ A;  3TEL A;  4ISU A;  1OLA A;  4JBZ A;  3V8X B;  3QK6 A;  4U1O A;  3KJ7 A;  2XXH A;  2UVJ A;  1FQF A;  3PV0 E;  3QIM A;  3QSL A;  1GVC A;  4DIG A;  4FE8 A;  3FVN A;  1MQH A;  3A3U A;  1LAG E;  2E0S A;  3PUZ E;  1ANF A;  1IIW A;  1QUK A;  1O7T A;  3JYR A;  5AA1 A;  3WAF A;  1A7L A;  2F6G A;  4O3A A;  1LBB A;  3N5L A;  4LA9 A;  3MUQ A;  2NOO A;  4NF5 A;  3CG1 A;  1TFD A;  1OVT A;  4IY5 A;  5DVJ A;  5LOM A;  4R2F A;  2F78 A;  3B6Q A;  3CI8 A;  3HST A;  3I5O A;  1LB9 A;  1UTB B;  4BDR A;  5I2K A;  1IXH A;  1QUJ A;  5CMM A;  2NVU B;  4KQP A;  3I6V A;  2QL3 A;  3PPN A;  1TFA A;  3GBA A;  3MQ9 A;  4F2Q A;  4PFU A;  2AYS A;  2ESN A;  4ZZA A;  5JK4 A;  1FQE A;  1B3E A;  4XIG Q;  1B7Z A;  2HCA A;  3IL1 B;  3O6I A;  4KD5 A;  4OEU A;  1ZJL A;  4R6K A;  4U23 A;  3IOW A;  5I56 B;  2PVU A;  4YKK A;  3ZKL A;  4LZ7 A;  1P1O A;  4O3B A;  3LBS A;  5AA4 A;  2XD2 A;  4FEC A;  4NTL A;  3EHS A;  1UIU A;  4C1T A;  3O2A A;  3R6U A;  4F3B A;  4R73 A;  1L5T A;  2D5W A;  4G68 A;  2A5T A;  1GGG A;  4KHZ E;  4ZEK A;  1SVX B;  1NNT A;  1S7Y A;  1MQD A;  2LAO A;  3K6W A;  2V3U A;  3SDF A;  3U72 A;  4G68 B;  2O84 X;  2FYI A;  1MS7 A;  2YLN A;  4U22 A;  2XXU A;  2PMS A;  1ELJ A;  1P1W A;  1B1H A;  2Q2C A;  4N6P A;  2Q89 A;  3PPO A;  3MP1 A;  2Z23 A;  2HZK A;  4M4G A;  4MBP A;  3TTN A;  2O51 A;  1B4Z A;  1YCJ A;  2XD3 A;  3EF7 A;  3OEK A;  3IO6 A;  4KYS A;  4LP2 B;  1XVY A;  1IXI A;  2XX9 A;  1SYI A;  3IX1 A;  2F6P A;  2O1M A;  5DT6 A;  4IO3 A;  2HXW A;  4F3P A;  4U2R A;  3MC2 A;  3FJG A;  1XC1 A;  1P99 A;  2XXX A;  3G3G A;  3TKD A;  2XX8 A;  2R71 A;  4P0G A;  5I2K B;  1MXY A;  3U92 A;  1MM7 A;  2E1S A;  4GQO A;  4N13 A;  4TLM B;  3KJT A;  2H5Y A;  3PD9 A;  4GIZ A;  4RPN A;  1I6Q A;  4OHN A;  3V5A A;  1A55 A;  1I6B A;  3AXF A;  2ZYM A;  1WVJ A;  1US4 A;  3PGF A;  5L8D A;  1H43 A;  1JVY A;  4QFL A;  2O6A A;  3IOV A;  1NMU A;  2DWI A;  3HCQ A;  5J1D A;  2G93 A;  1BIY A;  2THI A;  4ESX A;  4E0X A;  1PDA A;  1Y3N A;  2Q2A A;  3OEM A;  4LQ5 A;  1B32 A;  3CSG A;  3FUZ A;  4DE8 A;  2XXT A;  1BP5 A;  2RF1 A;  2VGQ A;  3LUY A;  1NNF A;  1N3W A;  2XXI A;  2M8C A;  4U21 A;  4DLD A;  4R9F A;  3T9U A;  5DVI A;  5DTB A;  2HFB A;  3LSF B;  4MLV A;  2HAV A;  1URG A;  3IOU A;  2Z8D A;  5K2X A;  4BLA A;  1LCF A;  4DXB A;  5AA4 B;  3MVY A;  2OK2 A;  4YKI A;  4QSE A;  5CBR A;  2O68 A;  3LSW A;  3PUW E;  5I56 A;  3KBR A;  5ELV A;  5TP9 A;  3TAJ A;  2UVI A;  3TCG A;  5FTI A;  4DXC A;  2GFE A;  4EF2 A;  2B3F A;  2ZNS A;  3HN0 A;  3ZS6 A;  4F29 A;  1LCT A;  1R6Z A;  1UTH B;  2R6G E;  4H67 A;  1EZP A;  1B3H A;  1P1N A;  3KSX A;  4Q8R A;  4QFO A;  2HZL A;  5B70 A;  2DXR A;  3MPK A;  1JVX A;  2PX1 A;  2Q9T A;  1UTB A;  2VD3 A;  3B7D A;  3OD7 A;  1SYH A;  1XHY A;  1B4H A;  3ECR A;  3PMV A;  4H8J A;  4ZED A;  2REJ A;  3U8Q A;  3SES A;  4R74 A;  4NF5 B;  1PC3 A;  2X7P A;  2XXV A;  3GLB A;  4QSD A;  4DXU A;  4EQ9 A;  4YKJ A;  3U94 A;  2BJJ X;  1N0T A;  1FQC A;  3KZG A;  3W9V A;  3SER A;  4MH5 A;  4TOZ A;  4RXL A;  4ZDM A;  3UIF A;  2OBG A;  4Z7E A;  4IO6 A;  3CRB A;  1II5 A;  2RC8 A;  2VD2 A;  5KZT A;  1MPB A;  1WOD A;  2PT2 A;  3OO6 A;  4ND9 A;  3TPA A;  1A8E A;  1MY1 A;  5ISU A;  1URD A;  3ZSF A;  3KGC A;  1XOC A;  2I48 A;  4IY6 A;  3CFZ A;  3PMW A;  1UIV A;  4LUB A;  2I4C A;  2IEE A;  2A5T B;  4K3F A;  3SEX A;  5IAI A;  3N6T A;  1DPP A;  3OO8 A;  1Z7M E;  4U4S A;  2YPN A;  2DWA A;  2O7I A;  3Q28 A;  2D21 A;  4XKR A;  2F5X A;  1D9V A;  3H6W A;  1MH4 A;  4Q30 B;  3FIR A;  4IO2 A;  4NMY A;  4RK9 A;  1FTJ A;  3E13 X;  1QVS A;  3T9V A;  4GXS B;  3OOA A;  3RT8 A;  3HO7 A;  3MZB A;  3DP6 A;  2ONK E;  5HM4 B;  2GH9 A;  3M3L A;  1SW2 A;  4F22 A;  4OFO A;  1SI1 A;  1A99 A;  3G7W A;  3MPL A;  3OXN A;  4JDF A;  4BDN A;  3O28 A;  3VVE A;  1MPC A;  4BDL A;  3SKP A;  3T66 A;  2DVZ A;  1OMP A;  5FHM A;  1ZLQ A;  4DDD A;  1POY 1;  2ONR A;  1LST A;  3H7M A;  3K01 A;  3K00 A;  4LZ5 A;  4KCD A;  4QFN A;  4F1U A;  1QKA A;  4GF8 A;  4H1X A;  4F19 A;  1B51 A;  3UN6 A;  1OQH A;  3FGS A;  3HPI A;  5I59 B;  1AMF A;  3T9X B;  1US5 A;  4E0W A;  2RC7 A;  1JW1 A;  3OO7 A;  4YIC A;  3FZV A;  4NF8 A;  3K1M A;  1YAE A;  3B6T A;  1HSJ A;  2V84 A;  3QXM A;  4U1Z A;  4ZS9 A;  2OCU A;  1MDQ A;  5H8N A;  4IO4 A;  3RUM A;  3DM0 A;  1LFH A;  1ZKB A;  4GWO A;  2Y7I A;  3H6V A;  2FA7 A;  4WED A;  1Q1K A;  1F9B A;  2NUV A;  5CM6 A;  3THI A;  3SEY A;  3IB1 A;  4KYD A;  4POW A;  1ZTY A;  1NL5 A;  4PFT A;  1B52 A;  1EZ9 A;  3TQW A;  3WAE A;  2W7Y A;  3DP4 A;  3QAX A;  2H99 A;  2QMX A;  5I84 A;  3OSR A;  2ONS A;  4QFP A;  3S2V A;  1NH7 A;  1DTG A;  2QS2 A;  2ZMB A;  3CFL A;  3OEN A;  4YB5 A;  4F2O A;  2Q8J A;  4WKM A;  2AIX A;  4MLQ A;  3DEL B;  1Y9U A;  2I49 A;  1FQB A;  1USY E;  1JET A;  2X26 A;  1B5H A;  1VR5 A;  4WEP A;  3UA8 A;  3CR9 A;  2OZZ A;  4GOT A;  4F3S A;  3VDF A;  1GV8 A;  2OLB A;  2VOZ A;  5M2V A;  1B3G A;  3C31 A;  3MWB A;  4HTG A;  4G2Z A;  4TLL B;  1YPN A;  2DYX A;  5CMK A;  3C36 A;  1VFE A;  2Q88 A;  1FQD A;  3IJO B;  1B58 A;  2P1S A;  3E4R A;  3MP6 A;  1Y1Z A;  2UYE A;  3G3J A;  5EHS A;  1H45 A;  3OSQ A;  1MQG A;  4G8H A;  4RPO A;  3RY3 A;  5H8H A;  1MXX A;  1NNK A;  4OYV A;  1T0K A;  3TQL A;  1LAH E;  5H8F B;  2ZYK A;  1D9Y A;  2QS3 A;  1OIB A;  3FJM A;  2GRV A;  1H76 A;  3H06 B;  4H0W A;  1M5D A;  2ZYO A;  4JWY A;  4LZ8 A;  1Y4C A;  1MQJ A;  3D4C A;  5A5X B;  4MF3 A;  2O1L A;  3KEI A;  3H3G A;  4EXK A;  1PBP A;  4F1V A;  5FHN A;  4DZ1 A;  2HQ0 A;  2H98 A;  1AOV A;  1B5I A;  4QHQ A;  3IO4 A;  2F7C A;  3GBB A;  4XKN A;  2F35 A;  1CB6 A;  2RIN A;  3E3K A;  3MW0 A;  4OFJ A;  2VP1 A;  1MXU A;  1MRP A;  4XXU A;  1QUI A;  5H8F A;  3MZ9 A;  2AL5 A;  2ZXT A;  3O6H A;  4JXI A;  2DVC A;  3FV2 A;  1B05 A;  1MXV A;  2QS4 A;  1NNP A;  4L17 A;  3KN8 A;  4NWD A;  2UVG A;  5AA2 B;  3O6G A;  1IXG A;  1USY H;  4JWO A;  4KPT A;  4EF1 A;  5KCJ A;  3CIJ A;  3Q29 A;  1DPE A;  4LON B;  1WDN A;  4OEN A;  4RYA A;  4XKP A;  2I6E A;  5FHO A;  1ZIU A;  3GZG A;  3PD8 A;  4BDQ A;  4G77 A;  2DXY A;  3CG3 A;  2Y7R A;  3KN7 A;  1BLF A;  3L6G A;  4PFY A;  4RJZ A;  4PE5 B;  1A8F A;  1HSL A;  4OWD A;  4R2B A;  1N04 A;  5DVF A;  5TPA A;  3VLU A;  4EQ7 A;  2QMW A;  2ZYN A;  4YMB A;  4ELP A;  4R72 A;  4POX A;  2F36 A;  5L9M A;  1SW5 A;  2REG A;  3OMB A;  4OFL A;  3CVG A;  3TFL A;  2WKY A;  3I3V A;  2UYF A;  3G3I A;  3Q27 A;  4LAT A;  4ZEF A;  5AE4 A;  1EU8 A;  1GR2 A;  3R7X A;  1TT1 A;  3BFT A;  4OTE A;  2XXQ A;  4X1B A;  1QJM A;  3TTM A;  3K2D A;  3QYT A;  4UA8 A;  4ELR A;  5CRY A;  4Q5T A;  2I58 A;  5I2N A;  4F18 A;  3N94 A;  1RKM A;  4OQO A;  2Y84 A;  1LBC A;  3T9H B;  1QW0 A;  1NH8 A;  2QJE A;  3E9X A;  4UAC A;  1DMB A;  4RA1 A;  1OVB A;  1XT8 A;  3EHT A;  3IR1 A;  4JSD A;  1DTZ A;  4PET A;  2DS9 A;  1RYO A;  2XX7 A;  5H8Q A;  4I1D A;  5ICQ A;  3CFX A;  4R75 A;  5JTY B;  3PPR A;  3RTF B;  5F7V A;  1KWH A;  2NXO A;  3C32 A;  4YAH X;  4BDO A;  2O69 A;  3ODB A;  5I58 B;  1FTO A;  2RKM A;  3C9H A;  3H6U A;  1Z7N E;  4H6D A;  1B1X A;  5DEX B;  4R6H A;  2DP8 A;  4H8I A;  1EZO A;  1QKB A;  3N6U A;  5K2Y A;  2DWH A;  3TUS A;  4ELO A;  1MQI A;  1TWY A;  3M3K A;  1M5C A;  3IOR A;  1JNF A;  2B3B A;  5F1Q A;  4FED A;  3IB2 A;  4IO7 A;  5ICT A;  4GLI A;  1RYX A;  2CZL A;  5CMC A;  3R26 A;  4NF6 A;  4TQU Q;  4NF4 B;  5ITO A;  2Z22 A;  4YB7 A;  4IO5 A;  4LVQ A;  1SW4 A;  1JW4 A;  3JV9 A;  2ABH A;  5L9O A;  3N26 A;  1B5J A;  1IQ7 A;  1N7X A;  4KR5 A;  2PT1 A;  4H5F A;  3VLW A;  5KCJ B;  1B3F A;  4ELQ A;  1MM6 A;  2QPQ A;  4GL8 A;  5HBC A;  4C0R A;  1IEJ A;  2QRY A;  3IB0 A;  3RLF E;  1I69 A;  5DYH A;  1O64 A;  3A09 A;  2F7B A;  4YU0 A;  1MH3 A;  1JEU A;  5H8S A;  3TTL A;  1AIV A;  2V93 A;  4X48 A;  4IB2 A;  1Y4T A;  1M5F A;  1B9J A;  4OER A;  4PFW A;  3PUV E;  2Z8E A;  3VFJ A;  1PEB A;  5I57 B;  3UOR A;  5AA3 A;  4ECF A;  1IXC A;  4OET A;  3M3F A;  2UVH A;  3VXC A;  2F34 A;  2V3Q A;  4GRK A;  4U4X A;  4OXV A;  5A5X A;  1O63 A;  5KDT B;  3S9M C;  2ZNT A;  3S9N C;  3HV1 A;  3RGY A;  3MP8 A;  4OZ9 A;  2OWS A;  4H65 A;  5H8H B;  3MAM A;  2F7A A;  4I62 A;  3ILU B;  2F97 A;  1MG1 A;  2PBW A;  3GXA A;  5TPA B;  3H6T A;  1PB7 A;  5AA2 D;  2OJT A;  1MDP 1;  1DOT A;  2GHB A;  3FV1 A;  3C4M A;  3KG2 A;  4GD5 A;  4Z0I A;  2ALU A;  3IK6 B;  2I4B A;  3KFM A;  4FJP A;  2XXP A;  4R9G A;  2H4I A;  1Y1M A;  5H8Q B;  3K4U A;  2DE2 A;  1POT A;  1JQF A;  4YKP A;  3CSB A;  4F1Y A;  3EN3 A;  3MVX A;  1P1U A;  4FIM A;  3Q25 A;  1SD3 A;  3VXB A;  1EH3 A;  4NWC A;  5I58 A;  5L9S A;  2P0S A;  2NWJ A;  4F39 A;  3SEU A;  5AA2 A;  4H5G A;  1BTJ A;  2O7U A;  3SEV A;  3U1O A;  3V89 B;  4EQB A;  5HPQ A;  3IJX B;  1ZU0 A;  4QF9 A;  4AQ4 A;  2KLF A;  2UXA A;  5I57 A;  2RCA A;  2XXR A;  3FD3 A;  1UQW A;  3H4Z A;  1R1N A;  3L6H A;  1B6H A;  3S4U A;  4N07 A;  1B3L A;  2HEU A;  2VHA A;  3FXQ A;  2CMO A;  4OMB A;  4FAJ A;  2F8D A;  4NF4 A;  1LAF E;  4THI A;  1VE4 A;  3T96 B;  1PB8 A;  3RTW B;  3VV5 A;  1Y3Q A;  2G29 A;  4QRZ A;  4ZEC A;  3S9E A;  3O9P A;  3VLV A;  3QUF A;  3G3F A;  2Y7W A;  3FXR A;  4RY1 A;  3H03 A;  1R9L A;  3K6V A;  4YB6 A;  3Q26 A;  3TEP A;  2QS1 A;  2Y7P A;  1FQA A;  3FAT A;  3PPQ A;  5JEI A;  3FJ7 A;  4EDP A;  2P2A A;  1S9T A;  4X1D A;  1SBP A;  1M5B A;  1H3D A;  4DCX A;  5KDT A;  2I3V A;  2XXY A;  1N84 A;  2ZNU A;  1LB8 A;  4MFI A;  1SI0 A;  1D4N A;  1VSO A;  1MY3 A;  2I0C A;  1ZBM A;  3KSJ A;  3K1P A;  4I9D A;  1MY4 A;  1JW5 A;  4M1V A;  3C33 A;  3S9L C;  4HCY A;  3T93 B;  2HAU A;  4DCY A;  3TYH A;  5BUU A;  5FTH A;  1PB9 A;  4GXA A;  5B7D A;  1SW1 A;  1IIT A;  2V25 A;  4OEV A;  1PBQ A;  3LR1 A;  3TDJ A;  3RPW A;  4YMA A;  5JTY A;  3W9W A;  1LFI A;  3EPE A;  1R9Q A;  2X7Q A;  3G3H A;  3EQ1 A;  3KOS A;  1IZ1 A;  1N3X A;  3HHF A;  5IKB A;  3OO9 A;  1HSE A; 
#chains in the Genus database with same CATH topology
 4PQJ A;  1LGB C;  4NED A;  3PMX A;  3K0V A;  1BKA A;  1YTV A;  5IZ3 A;  4G68 C;  4HS7 A;  1QUL A;  2RCB A;  2Y7K A;  3OEL A;  3C34 A;  1S50 A;  3FVO A;  3PUY E;  3V83 A;  5CMB A;  3RPL B;  4KYE A;  3UK4 A;  1AH5 A;  3FAS A;  1FBP A;  2I3W A;  5TP9 B;  5CI5 A;  4Q0C A;  4NE4 A;  2OWT A;  4ZE8 A;  4PDH A;  1NV3 A;  4PF8 A;  4RNS A;  2PCR A;  4P11 A;  3U93 A;  1LLS A;  1MXW A;  4QFK A;  4P3L A;  4FAT A;  4MAG A;  1RDY A;  1MY2 A;  5I5P A;  3B8B A;  1DCU A;  4KXP A;  2XWO A;  2DOJ A;  1AL3 A;  3FXU A;  3TTR A;  2DQV A;  5H8F A;  1A40 A;  1SQY A;  4R6Y A;  3BKI B;  4EXL A;  2YJP A;  4PP0 A;  2D3I A;  4IGR A;  1D9Q A;  1FPB A;  1NKX A;  2GHA A;  3K6X A;  1CE2 A;  3IAZ A;  4AB6 A;  4JSO A;  2H25 A;  4AS5 A;  1B0H A;  5F24 A;  3KJ7 A;  1ANF A;  1O7T A;  3JYR A;  2F6G A;  1OVT A;  3B6Q A;  5I2K A;  4BDR A;  1QUJ A;  4O94 A;  4KQP A;  1TFA A;  3MQ9 A;  2AYS A;  4ZZA A;  1FQE A;  1B3E A;  3IL1 B;  1AOV A;  2PVU A;  4YKK A;  4FEC A;  1UIU A;  4C1T A;  4G68 A;  4MJO A;  1NNT A;  2V3U A;  4G68 B;  5ET5 A;  2FYI A;  1MS7 A;  2FBP A;  4N6P A;  2HZK A;  4MBP A;  2FHY A;  3OEK A;  3EF7 A;  1XVY A;  4IO3 A;  2HXW A;  3MC2 A;  2XX8 A;  5I2K B;  1MM7 A;  4N13 A;  4TLM B;  1I6B A;  3IFC A;  1US4 A;  1JVY A;  1IMC A;  4O7M A;  2Q2A A;  1B32 A;  1BP5 A;  4DXB A;  4NF0 A;  2Z8D A;  1LCF A;  4QXD A;  4QSE A;  1EYJ A;  3LSW A;  3KBR A;  4P47 A;  3TAJ A;  4DXC A;  2GFE A;  4X8R A;  2R6G E;  1P1N A;  4QFO A;  4GWY A;  5B70 A;  2VD3 A;  3B7D A;  1XHY A;  3PMV A;  3U8Q A;  4R74 A;  3U94 A;  4NHB A;  3W9V A;  1FBG A;  2VPO A;  3CRB A;  5KZT A;  1MPB A;  1WOD A;  1DBZ A;  3KGC A;  3CFZ A;  1UIV A;  4LUB A;  4U4S A;  2YPN A;  3Q28 A;  4XKR A;  2F5X A;  4Q30 B;  3FIR A;  1QVS A;  3OOA A;  2ONK E;  2GH9 A;  4OFO A;  4O8M A;  4BDN A;  5LTC A;  1LST A;  3H7M A;  4KCD A;  4H1X A;  1OQH A;  3FGS A;  4GWZ A;  3T9X B;  4NGU A;  3OO7 A;  4NF8 A;  1YAE A;  4U1Z A;  1MDQ A;  2FA7 A;  4UAB A;  2H99 A;  3OSR A;  1NH7 A;  3CFL A;  4YB5 A;  2Q8J A;  1B5H A;  4WEP A;  4F3S A;  4MNC A;  3VDF A;  2OLB A;  2VOZ A;  3MWB A;  3C31 A;  4HTG A;  2DYX A;  5EHS A;  1MQG A;  4NN3 A;  2GRV A;  1MQJ A;  4NX1 A;  2H98 A;  1B5I A;  4QHQ A;  2F7C A;  3GBB A;  2RIN A;  3E3K A;  4OA4 A;  2VP1 A;  1MXU A;  1QUI A;  3MZ9 A;  4JXI A;  3FV2 A;  1MXV A;  4L17 A;  4PFR A;  3O6G A;  1FBF A;  3CIJ A;  4LON B;  1WDN A;  2I6E A;  3GZG A;  3SZP A;  4G77 A;  2DXY A;  3CG3 A;  3KN7 A;  4RJZ A;  1RDZ A;  2QMW A;  4POX A;  2F36 A;  5L9M A;  3OMB A;  2REG A;  3CVG A;  3G3I A;  4LAT A;  5AE4 A;  2WYK A;  1EU8 A;  5DW8 A;  3R7X A;  3TTM A;  2XXQ A;  3K2D A;  4Q5T A;  4F18 A;  3N94 A;  1LBC A;  1OVB A;  1LBY A;  3EHT A;  4QRZ A;  4MX6 A;  1RYO A;  5H8Q A;  3PPR A;  1KWH A;  4BDO A;  3ODB A;  3H6U A;  1B1X A;  5K2Y A;  1TWY A;  3M3K A;  3IB2 A;  5ICT A;  2CZL A;  4TQU Q;  4LVQ A;  1JW4 A;  5L9O A;  5EQA A;  4KR5 A;  3VLW A;  1B3F A;  1MM6 A;  1I69 A;  1O64 A;  4YU0 A;  1MH3 A;  1JEU A;  4HE1 A;  4IB2 A;  1M5F A;  2Z8E A;  1PEB A;  3VXC A;  4GRK A;  4OXV A;  1O63 A;  4GWW A;  2ZNT A;  3HV1 A;  1FPE A;  4OZ9 A;  4H65 A;  1PB7 A;  2OJT A;  2GHB A;  3IK6 B;  4FJP A;  2H4I A;  2DE2 A;  1POT A;  5EYH A;  3VXB A;  5L9S A;  2P0S A;  3SEU A;  4H5G A;  2O7U A;  1ZU0 A;  4QF9 A;  3T1B A;  1UQW A;  2HEU A;  3FXQ A;  1IMD A;  1LAF E;  4JVI A;  3RTW B;  1Y3Q A;  3G3F A;  3Q26 A;  2QS1 A;  1EYI A;  3PPQ A;  4EDP A;  2I3V A;  4I40 A;  1SI0 A;  1VSO A;  5ET8 A;  1ZBM A;  4M1V A;  3C33 A;  3S9L C;  3T93 B;  3TYH A;  2V25 A;  4OEV A;  3LR1 A;  3TDJ A;  5JTY A;  3EPE A;  3MW0 A;  3HHF A;  1FPI A;  1HSE A;  4MIJ A;  5IZZ A;  3PU5 A;  5EQ7 A;  2DDK A;  1TXF A;  2V3T A;  4OVJ A;  1MPD A;  1OLC A;  3DP8 A;  1B40 A;  2RC9 A;  1IUD A;  2DE4 A;  1B2H A;  1B7H A;  1FBE A;  1XS5 A;  2FIX A;  2HXR A;  3NOH A;  5TU0 A;  3MVW A;  1H44 A;  3ROJ A;  1LFG A;  3M8U A;  5CBS A;  2R8T A;  2WBD A;  4EUO A;  1FTK A;  2I0B A;  1OQG A;  4KCC A;  4N91 A;  2L5V A;  4C1U A;  3W15 C;  1Y3P A;  1P1Q A;  3FVG A;  3HHG A;  1FPK A;  4JB7 A;  4ZEI A;  5T3J A;  4XTC Q;  1FW0 A;  4AS4 A;  3ONM A;  1JEV A;  4KI0 E;  4I8C A;  4FEB A;  3VVF A;  1MXZ A;  4O3C A;  3ZKK A;  2FNC A;  4F3G A;  5DEX A;  1LBV A;  4PTK A;  1N7W A;  3DLN A;  3K1N A;  1INP A;  3T22 A;  4HCW A;  2V4C A;  1ZMG A;  3SEW A;  3PUX E;  5CC2 A;  1Q35 A;  4GFR A;  4XKQ A;  3TEL A;  4ISU A;  4JBZ A;  3QK6 A;  2XXH A;  3QIM A;  3PUZ E;  2E0S A;  4O3A A;  3N5L A;  3MUQ A;  1TFD A;  4R2F A;  2ZZV A;  2F78 A;  1LB9 A;  1UTB B;  1NUW A;  1IXH A;  3I6V A;  3GBA A;  4PFU A;  4XIG Q;  2F3D A;  1P1O A;  3EHS A;  4P1E A;  5IZ1 A;  3R6U A;  4F3B A;  4R73 A;  2D5W A;  2A5T A;  1GGG A;  3RYD A;  2LAO A;  1VDW A;  2O84 X;  2XXU A;  1P1W A;  4M4G A;  4PBQ A;  3TTN A;  4JVC A;  2O1M A;  1NV1 A;  2R71 A;  1MXY A;  2E1S A;  3KJT A;  3PD9 A;  3V5A A;  3AXF A;  2QVU A;  2F3B A;  2O6A A;  2G93 A;  1PDA A;  3CSG A;  4DE8 A;  2VGQ A;  3LUY A;  5I7I A;  3T9U A;  3IOU A;  5AA4 B;  4YKI A;  5I56 A;  4N6K A;  5TP9 A;  2UVI A;  4H45 A;  4F29 A;  3HN0 A;  3E78 A;  3ZS6 A;  4H67 A;  4NQ8 A;  3RPL A;  3MPK A;  4N81 A;  2PX1 A;  3OD7 A;  3SES A;  4NF5 B;  1PC3 A;  3GLB A;  1K9Z A;  2BJJ X;  4TOZ A;  4IO6 A;  2OX3 A;  4ND9 A;  1IMB A;  2Q74 A;  2I4C A;  2IEE A;  2A5T B;  3SEX A;  5IAI A;  1DPP A;  2DWA A;  3H6W A;  1MH4 A;  1KZ8 A;  1FTJ A;  3HO7 A;  3MZB A;  2CEY A;  3MPL A;  4JDF A;  3SKP A;  3T66 A;  1OMP A;  1NUX A;  3K00 A;  4F1U A;  1B51 A;  3UN6 A;  3HPI A;  2RC7 A;  4PFI A;  4YIC A;  3FZV A;  3RUM A;  1HSJ A;  3QXM A;  4ZS9 A;  4N8Y A;  4IO4 A;  3H6V A;  1F9B A;  3SEY A;  1ZTY A;  2W7Y A;  3QAX A;  4QFP A;  3S2V A;  2QS2 A;  2ZMB A;  3DEL B;  3CR9 A;  4G2Z A;  5CMK A;  2Q88 A;  1Y1Z A;  3OSQ A;  1T0K A;  1MXX A;  1D9Y A;  3FJM A;  1H76 A;  3H06 B;  5A5X B;  2ZYO A;  3D4C A;  4MF3 A;  5FHN A;  4XFE A;  1K9Y A;  2CEX A;  2ZXT A;  2DVC A;  2KR0 A;  4N17 A;  3KN8 A;  5AA2 B;  2UVG A;  1IXG A;  4P1L A;  5KCJ A;  4KPT A;  4XKP A;  1ZIU A;  3L6G A;  1NV4 A;  4PFY A;  5DVF A;  5TPA A;  3VLU A;  4EQ7 A;  2CZK A;  2P3V A;  1SW5 A;  3I3V A;  4I3Y A;  3HFU A;  1GR2 A;  1NV5 A;  1FPL A;  2WBB A;  4X1B A;  3QYT A;  4P8B A;  2I58 A;  4PCD A;  1RKM A;  5I3S A;  2Y84 A;  2B4M A;  4RA1 A;  4JSD A;  1DTZ A;  2DS9 A;  4I1D A;  5ICQ A;  3CFX A;  5JTY B;  2NXO A;  3C32 A;  4GWX A;  1FTO A;  2RKM A;  2DWH A;  1MQI A;  2BJI A;  1JNF A;  5IGA A;  3BIG A;  5CMC A;  4NF6 A;  4NF4 B;  4XF5 A;  2Z22 A;  4YB7 A;  4IO5 A;  1Q9D A;  3JV9 A;  3N26 A;  1B5J A;  1N7X A;  3KC0 A;  4ELQ A;  2QPQ A;  2PFY A;  5DYH A;  3A09 A;  3GYY A;  5H8S A;  3TTL A;  1JP4 A;  1AIV A;  2V93 A;  1KA1 A;  1B9J A;  3PUV E;  4XEQ A;  3M3F A;  2UVH A;  4U4X A;  5KDT B;  3S9N C;  2OWS A;  5H8H B;  3MAM A;  2F7A A;  4I62 A;  5AA2 D;  3C4M A;  2I4B A;  5H8Q B;  3MYU A;  1JQF A;  4F1Y A;  1EYK A;  3EN3 A;  4FIM A;  1EH3 A;  1LEV A;  1NV2 A;  4PFB A;  2NWJ A;  4I3E A;  1BTJ A;  3U1O A;  3V89 B;  3IJX B;  2KLF A;  2RCA A;  3FD3 A;  3S4U A;  1B3L A;  2VHA A;  1VE4 A;  1PB8 A;  4ZEC A;  4X04 A;  3O9P A;  4RY1 A;  3K6V A;  2HPG A;  3FAT A;  5JEI A;  2P2A A;  4X1D A;  1H3D A;  4DCX A;  2ZNU A;  3FXB A;  3KSJ A;  1JW5 A;  5BUU A;  1SW1 A;  1PBQ A;  1NV6 A;  4N15 A;  5EQ9 A;  3G3H A;  3OO9 A;  3TMG A;  3TTK A;  3KN3 A;  5H8N B;  1FBD A;  2H9B A;  3LSL A;  4GVO A;  3F11 A;  5I59 A;  3RQT A;  4YZZ A;  1FSA A;  1DSN A;  1Y20 A;  1FPF A;  4LQ2 A;  1B0L A;  4ZZE A;  3O66 A;  3MVZ A;  3S9M C;  1FCK A;  2DE3 A;  1MY0 A;  3BFU A;  2Z8F A;  2DWJ A;  2AL4 A;  4NF8 B;  3EHU A;  4ONY A;  2IA4 A;  4GL0 A;  1GTK A;  3RNN A;  5ITP A;  2GQ1 A;  4PAF A;  1URS A;  4IGT A;  1FTA A;  2JJK A;  1IME A;  3LSX A;  3SET A;  3P7I A;  4NF6 B;  5EYF A;  1LBX A;  1NUY A;  2XHD A;  1FPJ A;  5J16 A;  1XVX A;  4OES A;  2A5S A;  2XXW A;  3G3K A;  2QVR A;  3LC8 A;  2PFZ A;  1B46 A;  5EYG A;  1N76 A;  1UTH A;  1YYZ A;  4FOR A;  4H46 A;  1FTL A;  3UGW A;  1B7U A;  3K6U A;  3C35 A;  3D4G A;  2ANJ A;  4ZE9 A;  3B6W A;  3O97 A;  1A54 A;  3V8X B;  1FJ6 A;  1FQF A;  4DIG A;  4FE8 A;  1LAG E;  1IIW A;  1QUK A;  3WAF A;  4GBW A;  4MNI A;  1A7L A;  4LA9 A;  2NOO A;  4NF5 A;  4IY5 A;  5DVJ A;  3CI8 A;  3HST A;  3I5O A;  4GX4 A;  1CNQ A;  1IMA A;  3PPN A;  4F2Q A;  4MNP A;  2HCA A;  4U23 A;  5I56 B;  3IOW A;  4LZ7 A;  4O3B A;  5AA4 A;  4N6D A;  1L5T A;  1SVX B;  1S7Y A;  4O7I A;  2PMS A;  2Q2C A;  3PPO A;  3MP1 A;  2Z23 A;  5ESY A;  1YCJ A;  4KYS A;  4LP2 B;  1IXI A;  1SYI A;  3IX1 A;  5DT6 A;  4U2R A;  3FJG A;  1XC1 A;  1P99 A;  2XXX A;  3TKD A;  4N4U A;  4P0G A;  3U92 A;  4GQO A;  2H5Y A;  4GIZ A;  4IR8 A;  4RPN A;  1I6Q A;  4OHN A;  3ISP A;  2ZYM A;  4GX3 A;  3PGF A;  5L8D A;  4PGN A;  4PE3 A;  1NMU A;  2DWI A;  3OEM A;  4LQ5 A;  1FPD A;  3FUZ A;  4U21 A;  2RF1 A;  4HXV A;  2XXI A;  1N3W A;  2M8C A;  4DLD A;  5DTB A;  3LSF B;  1URG A;  5K2X A;  4BLA A;  2OK2 A;  4PF6 A;  4GX6 A;  5ELV A;  3TCG A;  4EF2 A;  2B3F A;  1EZP A;  1UTH B;  1B3H A;  4Q8R A;  3KSX A;  4MMP A;  2HZL A;  2DXR A;  1JVX A;  1UTB A;  1SYH A;  3ECR A;  4ZED A;  4DXU A;  1YXI A;  4P56 A;  4YKJ A;  4MEV A;  3SER A;  4MH5 A;  4ZDM A;  3UIF A;  2OBG A;  2RC8 A;  2VD2 A;  3PTY A;  1A8E A;  5ISU A;  1URD A;  1XOC A;  4IY6 A;  4K3F A;  1NUZ A;  3N6T A;  1Z7M E;  1RDX A;  2O7I A;  2D21 A;  4IO2 A;  4NMY A;  4GXS B;  3RT8 A;  3M3L A;  1SW2 A;  4F22 A;  3G7W A;  3O28 A;  1MPC A;  5FHM A;  5IM2 A;  1ZLQ A;  4DDD A;  1POY 1;  2ONR A;  3K01 A;  1QKA A;  2XA5 A;  4F19 A;  5I59 B;  1AMF A;  3B6T A;  4HW8 A;  5H8N A;  1LFH A;  2Y7I A;  4WED A;  1Q1K A;  4PBH A;  3IB1 A;  4PFT A;  1B52 A;  1EZ9 A;  5I84 A;  3DP4 A;  4OVR A;  2QMX A;  4MHF A;  4F2O A;  1DTG A;  3OEN A;  2QVV A;  2AIX A;  2I49 A;  1FQB A;  2WYP A;  2X26 A;  3UA8 A;  2OZZ A;  4TLL B;  3QMF A;  1YPN A;  1VFE A;  3IJO B;  1FQD A;  3E4R A;  2UYE A;  1H45 A;  3RY3 A;  1NNK A;  4OAN A;  3TQL A;  5H8F B;  1OIB A;  1FBC A;  4JWY A;  1Y4C A;  3E79 A;  4EXK A;  3IO4 A;  2F35 A;  1CB6 A;  3IFA A;  2Y5K A;  4XXU A;  3D1R A;  1LBW A;  2AL5 A;  3O6H A;  1USY H;  4EF1 A;  5FHO A;  3PD8 A;  1G0H A;  1A8F A;  1N04 A;  4DI4 B;  2ZYN A;  2P3N A;  4YMB A;  4ELP A;  4R72 A;  4ZEF A;  5LDZ A;  3BFT A;  4OTE A;  4ELR A;  1QJM A;  3T9H B;  1QW0 A;  1NH8 A;  2QJE A;  1DMB A;  2XX7 A;  1QGX A;  2XXK A;  3RTF B;  5F7V A;  2XWI A;  4OVT A;  2O69 A;  3C9H A;  1Z7N E;  5DEX B;  4R6H A;  2DP8 A;  1EZO A;  5ET6 A;  3TUS A;  1M5C A;  5F1Q A;  4FED A;  2QFL A;  4IO7 A;  1SW4 A;  2ABH A;  4H5F A;  2CZH A;  4GL8 A;  4C0R A;  2VPN A;  3RLF E;  2F7B A;  4PAK A;  4LN5 A;  4PFW A;  3VFJ A;  3UOR A;  4OET A;  2F34 A;  3RGY A;  3MP8 A;  2F97 A;  1MG1 A;  3GXA A;  5TPA B;  1MDP 1;  1DOT A;  3FV1 A;  3KG2 A;  4GD5 A;  4R9G A;  2XXP A;  4P9K A;  1Y1M A;  2CZI A;  3K4U A;  3CSB A;  4NAP A;  1SD3 A;  4NWC A;  4F39 A;  5AA2 A;  3SEV A;  4EQB A;  2UXA A;  5I57 A;  2XXR A;  3L6H A;  1B6H A;  4N07 A;  2CMO A;  4THI A;  2G29 A;  2Y5L A;  3S9E A;  2Y7W A;  1R9L A;  2MKZ A;  3FJ7 A;  1S9T A;  1M5B A;  5KDT A;  2XXY A;  1LB8 A;  1D4N A;  1MY3 A;  3K1P A;  4HCY A;  4DCY A;  1FJ9 A;  5FTH A;  1PB9 A;  4GXA A;  1IIT A;  1R9Q A;  2X7Q A;  1IZ1 A;  1N3X A;  5M2V A;  3TOD A;  4KFQ A;  1M5E A;  4AB5 A;  2R9J A;  4QSC A;  5I2N B;  3QUJ A;  1J1N A;  4ESW A;  5FBP A;  3KOT A;  4G4P A;  4G61 A;  3SDF A;  1LAX A;  3PPP A;  1VFD A;  4RK2 A;  3ILT B;  3UP9 A;  2QSX A;  3FVK A;  1YZ0 A;  3USD A;  4P0I A;  5BWJ A;  4BDM A;  3K02 A;  3MJN A;  3TZA A;  2WEF A;  3VE1 B;  3JZJ A;  3TCF A;  3A3C A;  4G8M A;  4WXJ A;  2PYY A;  1ATG A;  1FTM A;  4ZEB A;  4G8N A;  3MZ1 A;  4GWU A;  2DSF A;  3O29 A;  2B65 A;  1NFT A;  4F31 B;  1IMF A;  3MBP A;  1SDX A;  5EHM A;  1I6A A;  3RN8 A;  4DI3 D;  3VVD A;  4JWX A;  2FIE A;  3BBR A;  3RT6 B;  3TCH A;  3IOT A;  4X9T A;  1D3K A;  1OLA A;  4U1O A;  2UVJ A;  3PV0 E;  1GVC A;  3QSL A;  4OVQ A;  3FVN A;  1MQH A;  3A3U A;  2B4L A;  5AA1 A;  1LBB A;  3CG1 A;  1NV7 A;  5LOM A;  3KC1 A;  5CMM A;  2NVU B;  1XI6 A;  2QL3 A;  1NV0 A;  2ESN A;  5JK4 A;  1B7Z A;  4KD5 A;  3O6I A;  4OEU A;  1ZJL A;  4R6K A;  3ZKL A;  3LBS A;  2XD2 A;  4NTL A;  3O2A A;  2Q8M A;  4KHZ E;  4ZEK A;  3U72 A;  1MQD A;  3K6W A;  2YLN A;  4U22 A;  1ELJ A;  1B1H A;  2Q89 A;  2O51 A;  1B4Z A;  2XD3 A;  1AWB A;  3IO6 A;  2XX9 A;  2F6P A;  4F3P A;  2VT5 A;  3G3G A;  1KA0 A;  1A55 A;  1WVJ A;  1H43 A;  4QFL A;  3IOV A;  3HCQ A;  5J1D A;  2THI A;  1BIY A;  4ESX A;  4E0X A;  1Y3N A;  2XXT A;  1NNF A;  4R9F A;  5DVI A;  2HFB A;  4MLV A;  2HAV A;  4NG7 A;  3MVY A;  5CBR A;  2O68 A;  3PUW E;  3LV0 A;  5FTI A;  2ZNS A;  1LCT A;  1R6Z A;  4OVP A;  2Q9T A;  1B4H A;  4H8J A;  2REJ A;  4EQ9 A;  2X7P A;  2XXV A;  4QSD A;  1N0T A;  1FQC A;  3KZG A;  4RXL A;  4Z7E A;  1II5 A;  2PT2 A;  3OO6 A;  3TPA A;  2ZZX A;  1MY1 A;  3KBZ A;  3ZSF A;  4PGP A;  2I48 A;  3PMW A;  3OO8 A;  1D9V A;  1FBH A;  4RK9 A;  1FRP A;  3E13 X;  4OVS A;  3T9V A;  1DK4 A;  2FVZ A;  3DP6 A;  5HM4 B;  1SI1 A;  1A99 A;  3OXN A;  4BDL A;  3VVE A;  4HE2 A;  2DVZ A;  4QFN A;  4LZ5 A;  4GF8 A;  4E0W A;  1US5 A;  1JW1 A;  3K1M A;  2V84 A;  2OCU A;  3DM0 A;  1ZKB A;  4GWO A;  2NUV A;  3MST A;  5CM6 A;  3THI A;  4KYD A;  4DZ1 A;  4POW A;  1NL5 A;  3TQW A;  3WAE A;  2ONS A;  4WKM A;  4MLQ A;  3LUZ A;  5EQ8 A;  1Y9U A;  1USY E;  1JET A;  1VR5 A;  4GOT A;  1GV8 A;  2XWV A;  1SPI A;  4PAI A;  4GWS A;  1B3G A;  4MCO A;  3C36 A;  3MP6 A;  1B58 A;  2P1S A;  3G3J A;  4G8H A;  4RPO A;  5H8H A;  4OYV A;  1LAH E;  2ZYK A;  2QS3 A;  4H0W A;  4LZ8 A;  3T0J A;  1M5D A;  2O1L A;  2ZZW A;  3H3G A;  3KEI A;  1PBP A;  4F1V A;  2HQ0 A;  4XKN A;  4OFJ A;  1MRP A;  4HE0 A;  1G0I A;  1B05 A;  2QS4 A;  4NWD A;  1NNP A;  4JWO A;  3Q29 A;  1DPE A;  4RYA A;  4OEN A;  5A5L A;  4BDQ A;  2Y7R A;  1BLF A;  3CHG A;  4PE5 B;  1HSL A;  4OWD A;  4FBP A;  4R2B A;  4OFL A;  3TFL A;  2WKY A;  2OWZ A;  2UYF A;  3Q27 A;  1TT1 A;  5I2N A;  4UA8 A;  2XWK A;  5CRY A;  1FPG A;  4OQO A;  3E9X A;  4UAC A;  4PDD A;  3IR1 A;  1XT8 A;  4PET A;  4R75 A;  4YAH X;  5I58 B;  4H6D A;  4H8I A;  1LBZ A;  1QKB A;  3N6U A;  4ELO A;  3IOR A;  3A29 A;  2B3B A;  4GLI A;  1RYX A;  3R26 A;  3EKI A;  5ITO A;  2WX9 A;  1NI9 A;  1IQ7 A;  5KCJ B;  2PT1 A;  5HBC A;  4N8G A;  1IEJ A;  2QRY A;  3IB0 A;  4X48 A;  4QBA A;  1Y4T A;  4OER A;  3BIH A;  5I57 B;  5AA3 A;  1IXC A;  3B50 A;  2V3Q A;  5A5X A;  2KQZ A;  3ILU B;  2PBW A;  3H6T A;  3U65 A;  4Z0I A;  2ALU A;  3KFM A;  4ECF A;  5IZ3 B;  4YKP A;  1BK4 A;  3MVX A;  1P1U A;  3Q25 A;  5I58 A;  5HPQ A;  4JVD A;  4AQ4 A;  3H4Z A;  1R1N A;  4GBV A;  2HHM A;  4OMB A;  4FAJ A;  2F8D A;  4NF4 A;  5ET7 A;  3T96 B;  3VV5 A;  3VLV A;  3QUF A;  3FBP A;  3FXR A;  3H03 A;  4YB6 A;  3TEP A;  2Y7P A;  1FQA A;  1SBP A;  4MFI A;  1N84 A;  2I0C A;  4I9D A;  1MY4 A;  2HAU A;  4PC9 A;  5B7D A;  3RPW A;  4YMA A;  3W9W A;  1LFI A;  3KOS A;  3EQ1 A;  5IKB A; 
#chains in the Genus database with same CATH homology
 4PQJ A;  1LGB C;  4NED A;  3TOD A;  4KFQ A;  3TMG A;  1M5E A;  3PMX A;  3K0V A;  4AB5 A;  3TTK A;  3KN3 A;  5H8N B;  1BKA A;  2R9J A;  4QSC A;  1YTV A;  2H9B A;  3LSL A;  4GVO A;  3PU5 A;  3F11 A;  5I2N B;  5I59 A;  3QUJ A;  1J1N A;  4G68 C;  4HS7 A;  3RQT A;  1TXF A;  2V3T A;  4OVJ A;  1MPD A;  1OLC A;  1QUL A;  2RCB A;  2Y7K A;  3DP8 A;  3OEL A;  1B40 A;  2RC9 A;  4YZZ A;  4ESW A;  3KOT A;  1IUD A;  1DSN A;  1S50 A;  2DE4 A;  3C34 A;  3FVO A;  3PUY E;  4G4P A;  1B2H A;  3V83 A;  5CMB A;  1Y20 A;  1B7H A;  1LAX A;  4KYE A;  3UK4 A;  3PPP A;  1XS5 A;  4LQ2 A;  1B0L A;  4ZZE A;  5TU0 A;  1AH5 A;  3FAS A;  3MVW A;  3MVZ A;  1H44 A;  1FCK A;  1VFD A;  2I3W A;  3O66 A;  1LFG A;  3M8U A;  2DE3 A;  4RK2 A;  5TP9 B;  5CBS A;  4EUO A;  5CI5 A;  1FTK A;  1MY0 A;  3BFU A;  3ILT B;  2I0B A;  3UP9 A;  2QSX A;  1OQG A;  2Z8F A;  2DWJ A;  3FVK A;  4KCC A;  2AL4 A;  4Q0C A;  4NF8 B;  4NE4 A;  3EHU A;  4ONY A;  3USD A;  2IA4 A;  2OWT A;  4GL0 A;  4P0I A;  4ZE8 A;  1GTK A;  3RNN A;  3W15 C;  4C1U A;  1Y3P A;  1P1Q A;  5BWJ A;  3FVG A;  3HHG A;  3K02 A;  4BDM A;  5ITP A;  1URS A;  4JB7 A;  4ZEI A;  4RNS A;  4XTC Q;  4P11 A;  4IGT A;  3U93 A;  1FW0 A;  1LLS A;  1MXW A;  4QFK A;  3ONM A;  3LSX A;  3SET A;  3P7I A;  3MJN A;  1JEV A;  4NF6 B;  3TZA A;  4FAT A;  5EYF A;  3JZJ A;  3TCF A;  3VE1 B;  4KI0 E;  4I8C A;  4FEB A;  3A3C A;  2XHD A;  4G8M A;  4WXJ A;  3VVF A;  1MXZ A;  1MY2 A;  4HW8 A;  1XVX A;  2DOJ A;  2PYY A;  4OES A;  1AL3 A;  3FXU A;  4O3C A;  3TTR A;  2FNC A;  2DQV A;  3ZKK A;  1ATG A;  1A40 A;  1SQY A;  1FTM A;  2A5S A;  4R6Y A;  2XXW A;  5DEX A;  3G3K A;  4F3G A;  1N7W A;  3LC8 A;  3DLN A;  3K1N A;  3MZ1 A;  4G8N A;  4ZEB A;  3T22 A;  2DSF A;  3BKI B;  3O29 A;  4EXL A;  4HCW A;  1B46 A;  2B65 A;  1NFT A;  4F31 B;  1N76 A;  1UTH A;  3MBP A;  4FOR A;  2YJP A;  1FTL A;  3UGW A;  1ZMG A;  1B7U A;  4PP0 A;  1SDX A;  2D3I A;  3K6U A;  4IGR A;  5EHM A;  3SEW A;  3PUX E;  1NKX A;  2GHA A;  3K6X A;  1CE2 A;  1I6A A;  3RN8 A;  3IAZ A;  3VVD A;  4AB6 A;  3C35 A;  4JWX A;  3BBR A;  3RT6 B;  5CC2 A;  3D4G A;  3TCH A;  2ANJ A;  3IOT A;  4X9T A;  4JSO A;  2H25 A;  4ZE9 A;  1Q35 A;  1D3K A;  3B6W A;  4GFR A;  1B0H A;  1A54 A;  3O97 A;  4XKQ A;  3TEL A;  4ISU A;  1OLA A;  4JBZ A;  3V8X B;  3QK6 A;  4U1O A;  3KJ7 A;  2XXH A;  2UVJ A;  1FQF A;  3PV0 E;  3QIM A;  3QSL A;  1GVC A;  4DIG A;  4FE8 A;  3FVN A;  1MQH A;  3A3U A;  1LAG E;  2E0S A;  3PUZ E;  1ANF A;  1IIW A;  1QUK A;  1O7T A;  3JYR A;  5AA1 A;  3WAF A;  1A7L A;  2F6G A;  4O3A A;  1LBB A;  3N5L A;  4LA9 A;  3MUQ A;  2NOO A;  4NF5 A;  3CG1 A;  1TFD A;  1OVT A;  4IY5 A;  5DVJ A;  5LOM A;  4R2F A;  2F78 A;  3B6Q A;  3CI8 A;  3HST A;  3I5O A;  1LB9 A;  1UTB B;  4BDR A;  5I2K A;  1IXH A;  1QUJ A;  5CMM A;  2NVU B;  4KQP A;  3I6V A;  2QL3 A;  3PPN A;  1TFA A;  3GBA A;  3MQ9 A;  4F2Q A;  4PFU A;  2AYS A;  2ESN A;  4ZZA A;  5JK4 A;  1FQE A;  1B3E A;  4XIG Q;  1B7Z A;  2HCA A;  3IL1 B;  3O6I A;  4KD5 A;  4OEU A;  1ZJL A;  4R6K A;  4U23 A;  3IOW A;  5I56 B;  2PVU A;  4YKK A;  3ZKL A;  4LZ7 A;  1P1O A;  4O3B A;  3LBS A;  5AA4 A;  2XD2 A;  4FEC A;  4NTL A;  3EHS A;  1UIU A;  4C1T A;  3O2A A;  3R6U A;  4F3B A;  4R73 A;  1L5T A;  2D5W A;  4G68 A;  2A5T A;  1GGG A;  4KHZ E;  4ZEK A;  1SVX B;  1NNT A;  1S7Y A;  1MQD A;  2LAO A;  3K6W A;  2V3U A;  3SDF A;  3U72 A;  4G68 B;  2O84 X;  2FYI A;  1MS7 A;  2YLN A;  4U22 A;  2XXU A;  2PMS A;  1ELJ A;  1P1W A;  1B1H A;  2Q2C A;  4N6P A;  2Q89 A;  3PPO A;  3MP1 A;  2Z23 A;  2HZK A;  4M4G A;  4MBP A;  3TTN A;  2O51 A;  1B4Z A;  1YCJ A;  2XD3 A;  3EF7 A;  3OEK A;  3IO6 A;  4KYS A;  4LP2 B;  1XVY A;  1IXI A;  2XX9 A;  1SYI A;  3IX1 A;  2F6P A;  2O1M A;  5DT6 A;  4IO3 A;  2HXW A;  4F3P A;  4U2R A;  3MC2 A;  3FJG A;  1XC1 A;  1P99 A;  2XXX A;  3G3G A;  3TKD A;  2XX8 A;  2R71 A;  4P0G A;  5I2K B;  1MXY A;  3U92 A;  1MM7 A;  2E1S A;  4GQO A;  4N13 A;  4TLM B;  3KJT A;  2H5Y A;  3PD9 A;  4GIZ A;  4RPN A;  1I6Q A;  4OHN A;  3V5A A;  1A55 A;  1I6B A;  3AXF A;  2ZYM A;  1WVJ A;  1US4 A;  3PGF A;  5L8D A;  1H43 A;  1JVY A;  4QFL A;  2O6A A;  3IOV A;  1NMU A;  2DWI A;  3HCQ A;  5J1D A;  2G93 A;  1BIY A;  2THI A;  4ESX A;  4E0X A;  1PDA A;  1Y3N A;  2Q2A A;  3OEM A;  4LQ5 A;  1B32 A;  3CSG A;  3FUZ A;  4DE8 A;  2XXT A;  1BP5 A;  2RF1 A;  2VGQ A;  3LUY A;  1NNF A;  1N3W A;  2XXI A;  2M8C A;  4U21 A;  4DLD A;  4R9F A;  3T9U A;  5DVI A;  5DTB A;  2HFB A;  3LSF B;  4MLV A;  2HAV A;  1URG A;  3IOU A;  2Z8D A;  5K2X A;  4BLA A;  1LCF A;  4DXB A;  5AA4 B;  3MVY A;  2OK2 A;  4YKI A;  4QSE A;  5CBR A;  2O68 A;  3LSW A;  3PUW E;  5I56 A;  3KBR A;  5ELV A;  5TP9 A;  3TAJ A;  2UVI A;  3TCG A;  5FTI A;  4DXC A;  2GFE A;  4EF2 A;  2B3F A;  2ZNS A;  3HN0 A;  3ZS6 A;  4F29 A;  1LCT A;  1R6Z A;  1UTH B;  2R6G E;  4H67 A;  1EZP A;  1B3H A;  1P1N A;  3KSX A;  4Q8R A;  4QFO A;  2HZL A;  5B70 A;  2DXR A;  3MPK A;  1JVX A;  2PX1 A;  2Q9T A;  1UTB A;  2VD3 A;  3B7D A;  3OD7 A;  1SYH A;  1XHY A;  1B4H A;  3ECR A;  3PMV A;  4H8J A;  4ZED A;  2REJ A;  3U8Q A;  3SES A;  4R74 A;  4NF5 B;  1PC3 A;  2X7P A;  2XXV A;  3GLB A;  4QSD A;  4DXU A;  4EQ9 A;  4YKJ A;  3U94 A;  2BJJ X;  1N0T A;  1FQC A;  3KZG A;  3W9V A;  3SER A;  4MH5 A;  4TOZ A;  4RXL A;  4ZDM A;  3UIF A;  2OBG A;  4Z7E A;  4IO6 A;  3CRB A;  1II5 A;  2RC8 A;  2VD2 A;  5KZT A;  1MPB A;  1WOD A;  2PT2 A;  3OO6 A;  4ND9 A;  3TPA A;  1A8E A;  1MY1 A;  5ISU A;  1URD A;  3ZSF A;  3KGC A;  1XOC A;  2I48 A;  4IY6 A;  3CFZ A;  3PMW A;  1UIV A;  4LUB A;  2I4C A;  2IEE A;  2A5T B;  4K3F A;  3SEX A;  5IAI A;  3N6T A;  1DPP A;  3OO8 A;  1Z7M E;  4U4S A;  2YPN A;  2DWA A;  2O7I A;  3Q28 A;  2D21 A;  4XKR A;  2F5X A;  1D9V A;  3H6W A;  1MH4 A;  4Q30 B;  3FIR A;  4IO2 A;  4NMY A;  4RK9 A;  1FTJ A;  3E13 X;  1QVS A;  3T9V A;  4GXS B;  3OOA A;  3RT8 A;  3HO7 A;  3MZB A;  3DP6 A;  2ONK E;  5HM4 B;  2GH9 A;  3M3L A;  1SW2 A;  4F22 A;  4OFO A;  1SI1 A;  1A99 A;  3G7W A;  3MPL A;  3OXN A;  4JDF A;  4BDN A;  3O28 A;  3VVE A;  1MPC A;  4BDL A;  3SKP A;  3T66 A;  2DVZ A;  1OMP A;  5FHM A;  1ZLQ A;  4DDD A;  1POY 1;  2ONR A;  1LST A;  3H7M A;  3K01 A;  3K00 A;  4LZ5 A;  4KCD A;  4QFN A;  4F1U A;  1QKA A;  4GF8 A;  4H1X A;  4F19 A;  1B51 A;  3UN6 A;  1OQH A;  3FGS A;  3HPI A;  5I59 B;  1AMF A;  3T9X B;  1US5 A;  4E0W A;  2RC7 A;  1JW1 A;  3OO7 A;  4YIC A;  3FZV A;  4NF8 A;  3K1M A;  1YAE A;  3B6T A;  1HSJ A;  2V84 A;  3QXM A;  4U1Z A;  4ZS9 A;  2OCU A;  1MDQ A;  5H8N A;  4IO4 A;  3RUM A;  3DM0 A;  1LFH A;  1ZKB A;  4GWO A;  2Y7I A;  3H6V A;  2FA7 A;  4WED A;  1Q1K A;  1F9B A;  2NUV A;  5CM6 A;  3THI A;  3SEY A;  3IB1 A;  4KYD A;  4POW A;  1ZTY A;  1NL5 A;  4PFT A;  1B52 A;  1EZ9 A;  3TQW A;  3WAE A;  2W7Y A;  3DP4 A;  3QAX A;  2H99 A;  2QMX A;  5I84 A;  3OSR A;  2ONS A;  4QFP A;  3S2V A;  1NH7 A;  1DTG A;  2QS2 A;  2ZMB A;  3CFL A;  3OEN A;  4YB5 A;  4F2O A;  2Q8J A;  4WKM A;  2AIX A;  4MLQ A;  3DEL B;  1Y9U A;  2I49 A;  1FQB A;  1USY E;  1JET A;  2X26 A;  1B5H A;  1VR5 A;  4WEP A;  3UA8 A;  3CR9 A;  2OZZ A;  4GOT A;  4F3S A;  3VDF A;  1GV8 A;  2OLB A;  2VOZ A;  5M2V A;  1B3G A;  3C31 A;  3MWB A;  4HTG A;  4G2Z A;  4TLL B;  1YPN A;  2DYX A;  5CMK A;  3C36 A;  1VFE A;  2Q88 A;  1FQD A;  3IJO B;  1B58 A;  2P1S A;  3E4R A;  3MP6 A;  1Y1Z A;  2UYE A;  3G3J A;  5EHS A;  1H45 A;  3OSQ A;  1MQG A;  4G8H A;  4RPO A;  3RY3 A;  5H8H A;  1MXX A;  1NNK A;  4OYV A;  1T0K A;  3TQL A;  1LAH E;  5H8F B;  2ZYK A;  1D9Y A;  2QS3 A;  1OIB A;  3FJM A;  2GRV A;  1H76 A;  3H06 B;  4H0W A;  1M5D A;  2ZYO A;  4JWY A;  4LZ8 A;  1Y4C A;  1MQJ A;  3D4C A;  5A5X B;  4MF3 A;  2O1L A;  3KEI A;  3H3G A;  4EXK A;  1PBP A;  4F1V A;  5FHN A;  4DZ1 A;  2HQ0 A;  2H98 A;  1AOV A;  1B5I A;  4QHQ A;  3IO4 A;  2F7C A;  3GBB A;  4XKN A;  2F35 A;  1CB6 A;  2RIN A;  3E3K A;  3MW0 A;  4OFJ A;  2VP1 A;  1MXU A;  1MRP A;  4XXU A;  1QUI A;  5H8F A;  3MZ9 A;  2AL5 A;  2ZXT A;  3O6H A;  4JXI A;  2DVC A;  3FV2 A;  1B05 A;  1MXV A;  2QS4 A;  1NNP A;  4L17 A;  3KN8 A;  4NWD A;  2UVG A;  5AA2 B;  3O6G A;  1IXG A;  1USY H;  4JWO A;  4KPT A;  4EF1 A;  5KCJ A;  3CIJ A;  3Q29 A;  1DPE A;  4LON B;  1WDN A;  4OEN A;  4RYA A;  4XKP A;  2I6E A;  5FHO A;  1ZIU A;  3GZG A;  3PD8 A;  4BDQ A;  4G77 A;  2DXY A;  3CG3 A;  2Y7R A;  3KN7 A;  1BLF A;  3L6G A;  4PFY A;  4RJZ A;  4PE5 B;  1A8F A;  1HSL A;  4OWD A;  4R2B A;  1N04 A;  5DVF A;  5TPA A;  3VLU A;  4EQ7 A;  2QMW A;  2ZYN A;  4YMB A;  4ELP A;  4R72 A;  4POX A;  2F36 A;  5L9M A;  1SW5 A;  2REG A;  3OMB A;  4OFL A;  3CVG A;  3TFL A;  2WKY A;  3I3V A;  2UYF A;  3G3I A;  3Q27 A;  4LAT A;  4ZEF A;  5AE4 A;  1EU8 A;  1GR2 A;  3R7X A;  1TT1 A;  3BFT A;  4OTE A;  2XXQ A;  4X1B A;  1QJM A;  3TTM A;  3K2D A;  3QYT A;  4UA8 A;  4ELR A;  5CRY A;  4Q5T A;  2I58 A;  5I2N A;  4F18 A;  3N94 A;  1RKM A;  4OQO A;  2Y84 A;  1LBC A;  3T9H B;  1QW0 A;  1NH8 A;  2QJE A;  3E9X A;  4UAC A;  1DMB A;  4RA1 A;  1OVB A;  1XT8 A;  3EHT A;  3IR1 A;  4JSD A;  1DTZ A;  4PET A;  2DS9 A;  1RYO A;  2XX7 A;  5H8Q A;  4I1D A;  5ICQ A;  3CFX A;  4R75 A;  5JTY B;  3PPR A;  3RTF B;  5F7V A;  1KWH A;  2NXO A;  3C32 A;  4YAH X;  4BDO A;  2O69 A;  3ODB A;  5I58 B;  1FTO A;  2RKM A;  3C9H A;  3H6U A;  1Z7N E;  4H6D A;  1B1X A;  5DEX B;  4R6H A;  2DP8 A;  4H8I A;  1EZO A;  1QKB A;  3N6U A;  5K2Y A;  2DWH A;  3TUS A;  4ELO A;  1MQI A;  1TWY A;  3M3K A;  1M5C A;  3IOR A;  1JNF A;  2B3B A;  5F1Q A;  4FED A;  3IB2 A;  4IO7 A;  5ICT A;  4GLI A;  1RYX A;  2CZL A;  5CMC A;  3R26 A;  4NF6 A;  4TQU Q;  4NF4 B;  5ITO A;  2Z22 A;  4YB7 A;  4IO5 A;  4LVQ A;  1SW4 A;  1JW4 A;  3JV9 A;  2ABH A;  5L9O A;  3N26 A;  1B5J A;  1IQ7 A;  1N7X A;  4KR5 A;  2PT1 A;  4H5F A;  3VLW A;  5KCJ B;  1B3F A;  4ELQ A;  1MM6 A;  2QPQ A;  4GL8 A;  5HBC A;  4C0R A;  1IEJ A;  2QRY A;  3IB0 A;  3RLF E;  1I69 A;  5DYH A;  1O64 A;  3A09 A;  2F7B A;  4YU0 A;  1MH3 A;  1JEU A;  5H8S A;  3TTL A;  1AIV A;  2V93 A;  4X48 A;  4IB2 A;  1Y4T A;  1M5F A;  1B9J A;  4OER A;  4PFW A;  3PUV E;  2Z8E A;  3VFJ A;  1PEB A;  5I57 B;  3UOR A;  5AA3 A;  4ECF A;  1IXC A;  4OET A;  3M3F A;  2UVH A;  3VXC A;  2F34 A;  2V3Q A;  4GRK A;  4U4X A;  4OXV A;  5A5X A;  1O63 A;  5KDT B;  3S9M C;  2ZNT A;  3S9N C;  3HV1 A;  3RGY A;  3MP8 A;  4OZ9 A;  2OWS A;  4H65 A;  5H8H B;  3MAM A;  2F7A A;  4I62 A;  3ILU B;  2F97 A;  1MG1 A;  2PBW A;  3GXA A;  5TPA B;  3H6T A;  1PB7 A;  5AA2 D;  2OJT A;  1MDP 1;  1DOT A;  2GHB A;  3FV1 A;  3C4M A;  3KG2 A;  4GD5 A;  4Z0I A;  2ALU A;  3IK6 B;  2I4B A;  3KFM A;  4FJP A;  2XXP A;  4R9G A;  2H4I A;  1Y1M A;  5H8Q B;  3K4U A;  2DE2 A;  1POT A;  1JQF A;  4YKP A;  3CSB A;  4F1Y A;  3EN3 A;  3MVX A;  1P1U A;  4FIM A;  3Q25 A;  1SD3 A;  3VXB A;  1EH3 A;  4NWC A;  5I58 A;  5L9S A;  2P0S A;  2NWJ A;  4F39 A;  3SEU A;  5AA2 A;  4H5G A;  1BTJ A;  2O7U A;  3SEV A;  3U1O A;  3V89 B;  4EQB A;  5HPQ A;  3IJX B;  1ZU0 A;  4QF9 A;  4AQ4 A;  2KLF A;  2UXA A;  5I57 A;  2RCA A;  2XXR A;  3FD3 A;  1UQW A;  3H4Z A;  1R1N A;  3L6H A;  1B6H A;  3S4U A;  4N07 A;  1B3L A;  2HEU A;  2VHA A;  3FXQ A;  2CMO A;  4OMB A;  4FAJ A;  2F8D A;  4NF4 A;  1LAF E;  4THI A;  1VE4 A;  3T96 B;  1PB8 A;  3RTW B;  3VV5 A;  1Y3Q A;  2G29 A;  4QRZ A;  4ZEC A;  3S9E A;  3O9P A;  3VLV A;  3QUF A;  3G3F A;  2Y7W A;  3FXR A;  4RY1 A;  3H03 A;  1R9L A;  3K6V A;  4YB6 A;  3Q26 A;  3TEP A;  2QS1 A;  2Y7P A;  1FQA A;  3FAT A;  3PPQ A;  5JEI A;  3FJ7 A;  4EDP A;  2P2A A;  1S9T A;  4X1D A;  1SBP A;  1M5B A;  1H3D A;  4DCX A;  5KDT A;  2I3V A;  2XXY A;  1N84 A;  2ZNU A;  1LB8 A;  4MFI A;  1SI0 A;  1D4N A;  1VSO A;  1MY3 A;  2I0C A;  1ZBM A;  3KSJ A;  3K1P A;  4I9D A;  1MY4 A;  1JW5 A;  4M1V A;  3C33 A;  3S9L C;  4HCY A;  3T93 B;  2HAU A;  4DCY A;  3TYH A;  5BUU A;  5FTH A;  1PB9 A;  4GXA A;  5B7D A;  1SW1 A;  1IIT A;  2V25 A;  4OEV A;  1PBQ A;  3LR1 A;  3TDJ A;  3RPW A;  4YMA A;  5JTY A;  3W9W A;  1LFI A;  3EPE A;  1R9Q A;  2X7Q A;  3G3H A;  3EQ1 A;  3KOS A;  1IZ1 A;  1N3X A;  3HHF A;  5IKB A;  3OO9 A;  1HSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...