4IO4A

Crystal structure of the avglur1 ligand binding domain complex with serine at 1.94 angstrom resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
247
structure length
244
Chain Sequence
SARLKGITLRIGVIESVPFTIVANVIDRNTTKLTGYVLDLIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKKKWFQTKACP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords AvGluR1 ligand binding domain
publication title Anions Mediate Ligand Binding in Adineta vaga Glutamate Receptor Ion Channels.
pubmed doi rcsb
source organism Adineta vaga
total genus 76
structure length 244
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io4A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io4A02
2QS3A 5I56A 4FECA 2RCBA 1GGGA 3K00A 3SESA 1R9LA 3LUYA 4XKRA 2UVGA 2F36A 2VP1A 1OQGA 1A40A 1JNFA 3IK6B 4G68A 3ZKLA 3MVXA 3FVKA 4LUBA 1P99A 4G4PA 2OWSA 1FTOA 3H6VA 2Q89A 2PMSA 5FTIA 1SYIA 4KI0E 4X1BA 5LOMA 3O29A 3G3GA 2ONRA 3OOAA 3MZBA 3FVNA 2RC7A 3IJXB 3G3KA 4ZEFA 2DVCA 1H45A 2I4BA 5DTBA 1FQDA 2VOZA 5CMMA 1SVXB 3V5AA 2NWJA 1SW2A 3PGFA 1Y3NA 3VLVA 1JVYA 3SETA 3CFLA 1ELJA 3IJOB 1QULA 5DEXA 3DELB 3MP6A 3K6UA 4U4XA 1UQWA 3IB0A 4YB7A 2RINA 2ZYOA 5FHOA 3GBAA 4GXSB 5TPAA 5CRYA 3FD3A 2OZZA 1FCKA 3H7MA 1I6AA 2E0SA 4JWXA 1MG1A 2ANJA 4QSCA 2GRVA 1FQEA 5KCJB 2Y7WA 4ND9A 4ZEKA 3I6VA 2V3TA 1Q1KA 4RK2A 3O28A 1VFDA 1LBCA 2QL3A 4H6DA 4RJZA 1LB9A 4N6PA 3SERA 2F35A 1M5CA 1Y20A 1B52A 1NNKA 4Q30B 3EHSA 1I69A 3PD9A 1NH7A 4JSDA 3LBSA 1J1NA 3KJ7A 4OFOA 4TQUQ 1SBPA 1H76A 3T66A 2HCAA 5H8QA 4GXAA 2DQVA 3DP6A 3TKDA 4F3GA 1OQHA 4NF8A 1L5TA 4U1ZA 1ZBMA 3I3VA 5I56B 4ISUA 2QPQA 3OSQA 2Z22A 3HN0A 1B1HA 3PUZE 2GHBA 4XXUA 4G77A 4FEBA 2O68A 4DXUA 2DWJA 1IITA 2QJEA 5JEIA 3PPPA 4XTCQ 3PPOA 5AA2D 3TELA 1B3LA 4G68C 4G68B 4Q5TA 3FJ7A 1N84A 1SD3A 4GL8A 1B40A 3IO4A 3C35A 2XXRA 2QSXA 3SEWA 1AIVA 2XXQA 3A3UA 1WVJA 2X7QA 1PB9A 3FIRA 2B3BA 4H1XA 2UYEA 1OIBA 5DVJA 2XX9A 4AQ4A 1JQFA 5I59A 1AL3A 3UORA 4F19A 3L6HA 4F31B 3S9LC 3TAJA 3MVYA 1AH5A 2F7BA 2OJTA 2ONSA 5DEXB 4QHQA 5CC2A 3UP9A 3N6TA 4BDMA 4QSEA 1D4NA 3QK6A 1LSTA 1P1OA 4OESA 4ECFA 3D4CA 3B7DA 1Y3QA 5TPAB 3DLNA 3WAFA 4ESWA 4JXIA 4WEDA 2THIA 3U8QA 4HCWA 5L8DA 3TYHA 1P1QA 2G93A 4QFPA 3VVDA 3TDJA 5CMCA 5JK4A 3KSXA 4IY6A 2RCAA 4OZ9A 1URSA 3T93B 3K2DA 2P2AA 3PMVA 1DTGA 4DXBA 1LAHE 2Q9TA 3V83A 1B32A 1LCFA 4RPOA 1M5EA 1Y9UA 1F9BA 3R6UA 3DP4A 3VE1B 2XXWA 4OHNA 1XHYA 3KG2A 3G3HA 3UN6A 4QSDA 4IGRA 1M5DA 4GLIA 4TLLB 2F6PA 4H8IA 4X48A 4QRZA 5BWJA 2REJA 1POY1 2O1MA 2X26A 3MPLA 4KHZE 2FNCA 3VVFA 3CG1A 5H8QB 1MXWA 2Q2CA 1D9YA 3JV9A 2YPNA 4UA8A 4Q8RA 4O3AA 1B7ZA 3TCFA 2NXOA 3WAEA 1FTMA 2AL5A 5J1DA 3IOUA 2XXYA 4U23A 4QFOA 4KCCA 2QS1A 3PPQA 3S9MC 5JTYA 1SW4A 3E13X 4BLAA 3PPRA 4U2RA 3B6TA 4JBZA 1PEBA 4YAHX 4JB7A 4EQBA 3FATA 4WKMA 3TTRA 4QFKA 2ESNA 3E9XA 2I6EA 2ZNTA 2ZYNA 3JYRA 4NWDA 2I4CA 5BUUA 3OO9A 3O66A 5I59B 1Y4CA 4GVOA 4R74A 1JW4A 5FHNA 3U94A 1VFEA 3G7WA 3JZJA 4HCYA 5CBRA 1B7HA 1IXCA 3RQTA 2V3UA 3LSXA 3HSTA 1SI1A 3TTKA 3KN7A 4N07A 3VV5A 1H3DA 1SW1A 5I2NA 2UVHA 1N0TA 3LSWA 4JWYA 2GH9A 4RA1A 4EQ7A 2UVIA 3HHFA 5ISUA 1NNPA 3EF7A 4YMBA 4THIA 2O51A 1MM6A 3MZ1A 1ZMGA 4WXJA 4FATA 4FE8A 5TP9A 4EUOA 3TEPA 2F7AA 3KJTA 4FEDA 3H03A 2H4IA 2F6GA 3ZS6A 5TU0A 3FJGA 4IO7A 4YKPA 3PUYE 2WKYA 2RF1A 4BDRA 2HZLA 5ICTA 2DWIA 4MH5A 4F22A 5FHMA 4DCYA 4KYDA 2PT2A 5F7VA 1ZIUA 2FYIA 2HXWA 4PQJA 1BLFA 1N7XA 3RTFB 3U93A 3KN8A 3OD7A 2O7UA 5CBSA 2I3WA 4BDNA 3IB1A 1II5A 3VLUA 1LB8A 1R1NA 3MBPA 4F2OA 5JTYB 4OEVA 2ZXTA 4DIGA 4DE8A 4LQ2A 1I6QA 4YB5A 1MDQA 2ALUA 4F2QA 4ELPA 1A8FA 1MXVA 4HTGA 2DYXA 1IEJA 5I58A 1CE2A 2CZLA 2DWHA 5HPQA 2DXRA 2QMXA 1ZTYA 4LONB 1I6BA 4G8MA 4QFNA 1LGBC 1B3EA 1POTA 1JEUA 3ZSFA 3H3GA 3QYTA 1EH3A 1PBPA 1MY3A 3SEUA 4YKKA 2CMOA 4FIMA 1GTKA 1QUIA 4Z0IA 2W7YA 1MY1A 3UIFA 3TMGA 3TPAA 1YTVA 1PDAA 4HW8A 1VSOA 3GZGA 4C1UA 2P0SA 5KDTA 4DLDA 3ODBA 1Q35A 5HM4B 2V3QA 3EPEA 3KFMA 5IKBA 3T22A 3DM0A 2V25A 5I2NB 1S7YA 2B65A 3TQLA 1NMUA 3OSRA 4PE5B 3QSLA 5CMKA 3OENA 1MQDA 3KN3A 3MVWA 4U21A 2UVJA 4IGTA 3MAMA 3K6VA 1B3FA 4O3CA 4LZ8A 5TP9B 3ECRA 4H5FA 3C36A 1UTBA 4ELOA 2GHAA 1URGA 4M4GA 3FXUA 4OENA 1A7LA 3MC2A 3ILUB 4IO5A 1A54A 2ZNUA 5ITOA 2F8DA 4XKPA 1Y1ZA 1DMBA 1MXYA 4C0RA 3TTMA 2FA7A 2YJPA 3EQ1A 4ZZEA 5F1QA 2OWTA 2R6GE 3PMXA 3H6WA 4POWA 4PFTA 4DZ1A 3K1NA 2XXUA 4OMBA 3KOSA 3FV1A 1BKAA 4H0WA 5AA1A 3MQ9A 2O84X 1YAEA 1YPNA 3K1PA 1LCTA 3IB2A 2ABHA 2HAUA 2QRYA 4GQOA 2HEUA 4XIGQ 1AMFA 3RT8A 1URDA 1XOCA 2E1SA 3FXQA 1S9TA 1R9QA 3HPIA 1MY4A 1MQHA 1FQAA 4F1UA 3PV0E 4YU0A 4FAJA 3MVZA 1MXZA 1LBBA 1B51A 1B5JA 5I58B 1NNFA 2OCUA 3LR1A 5M2VA 5I57A 3IORA 4G8HA 4R72A 1H44A 3V8XB 2GFEA 1B4HA 1N3WA 3QIMA 2DE3A 4R6HA 4R6KA 1LFIA 3P7IA 1RYXA 5DVFA 4OTEA 2DE4A 3U72A 2VD3A 1QKBA 5AA2A 3VXBA 5B7DA 3H06B 4H65A 4LATA 2D5WA 3QXMA 4MLQA 4I8CA 3TCGA 2OK2A 3QUJA 1HSJA 5KDTB 4P11A 3M3LA 4BDLA 3PMWA 2I0CA 1GR2A 1SQYA 3KOTA 2Y7KA 1UIVA 2QS4A 1GV8A 1IIWA 4IO6A 3N94A 2Y7RA 2R9JA 3R26A 2OLBA 1OLAA 3HV1A 1LLSA 2XD3A 3RGYA 3AXFA 4GL0A 4X9TA 4ZS9A 5H8FA 4DDDA 4EXKA 2LAOA 3MP1A 4GWOA 1VR5A 2V84A 3C31A 1UTBB 3B6WA 4YB6A 4GRKA 4P0GA 2A5TA 3TUSA 2Y7PA 1XC1A 4F18A 4FJPA 3T9XB 4RK9A 4C1TA 3TODA 3PU5A 4ZEDA 2PT1A 2F78A 3MW0A 2I0BA 3UA8A 2Y84A 1B3GA 4XKQA 5H8NA 4NF8B 4MFIA 3CRBA 5AE4A 2O7IA 5ICQA 3O97A 3G3JA 2VGQA 3U1OA 4KD5A 3GBBA 2G29A 4EF1A 3VDFA 4IO3A 2Q88A 4G8NA 4PFWA 1QUKA 2Z23A 1B3HA 3L6GA 1EU8A 4DXCA 1S50A 1EZPA 3HCQA 4U22A 1YCJA 1FTLA 4R2FA 3IOTA 3SDFA 3C32A 1TFDA 3SKPA 3K6XA 4NEDA 3RY3A 5I2KA 1M5BA 3VLWA 3THIA 1PC3A 2O69A 5I84A 3ONMA 1JVXA 1NNTA 1BP5A 1MPCA 1DTZA 4FORA 2H25A 2Z8DA 3EHTA 3H6TA 5H8HA 2DS9A 2NUVA 5I57B 3K02A 4NWCA 2DP8A 4RXLA 2H98A 2Q2AA 4YKJA 1SYHA 4AB6A 4OWDA 4YZZA 1WODA 3E4RA 3G3IA 2I49A 2AIXA 2A5SA 2PVUA 1USYH 3SEXA 5A5XA 4F39A 2ZYMA 2PYYA 4JDFA 4I9DA 4I62A 1IXGA 3N26A 5EHSA 5AA3A 1A99A 4JWOA 3OEKA 1FTKA 1Z7ME 2V93A 3SEVA 3TTLA 1LAGE 1TT1A 1BTJA 2XX8A 4U4SA 4MF3A 4OEUA 3OXNA 2DWAA 3FZVA 3FJMA 4JSOA 3PUXE 4LA9A 5H8FB 2O1LA 3CSBA 1XT8A 3C9HA 3O6HA 2DE2A 4KYSA 4TLMB 1RYOA 5HBCA 2A5TB 4M1VA 1QVSA 2ZMBA 4IO4A 4E0WA 1QJMA 3KZGA 1B5IA 2Y7IA 1B5HA 1NH8A 3FVGA 4KR5A 5H8NB 3PUWE 2XHDA 1H43A 5L9OA 1IQ7A 1Z7NE 1DPPA 3G3FA 2Z8FA 4KQPA 3IR1A 3PPNA 1SW5A 3RN8A 4ZDMA 3UK4A 3V89B 1QUJA 1P1UA 4PFUA 3M3KA 1NKXA 4N13A 1ANFA 1UTHA 3W9VA 4PETA 3W9WA 1B46A 4BDQA 3CSGA 4KFQA 3Q26A 3O6GA 5I2KB 1MM7A 3MZ9A 5L9SA 1MY0A 1MH3A 3OEMA 3S9NC 3QAXA 2RKMA 3ILTB 1UIUA 3CFZA 3K01A 4R9FA 4XKNA 3OMBA 4LQ5A 4NF5A 3O9PA 5AA4A 5H8HB 3E3KA 1B0HA 3FXRA 4ELQA 3KEIA 4POXA 3IAZA 3OO6A 1N7WA 4R2BA 5KZTA 4F1VA 1IXIA 3Q27A 3ZKKA 1FQFA 1XVXA 2DVZA 3A09A 4ZE8A 1VE4A 3RNNA 4R9GA 3K1MA 5A5XB 3K0VA 4ONYA 4ELRA 3C34A 3TFLA 1TXFA 1N3XA 3K6WA 5EYFA 3PD8A 4IY5A 1MY2A 5K2YA 4EF2A 3TZAA 5DYHA 1OLCA 3GXAA 2F97A 1KWHA 1JW1A 3T9UA 3T9VA 1MQJA 4UACA 2F5XA 2IA4A 1DSNA 4GF8A 3FV2A 1B4ZA 4OFLA 1D3KA 3RUMA 1OMPA 3KGCA 3R7XA 3K4UA 4U1OA 2Q8JA 2XXPA 2H5YA 3VFJA 1MQGA 1QKAA 1M5FA 1A55A 4BDOA 3FASA 2XXIA 4R75A 4YMAA 4DCXA 2KLFA 4NTLA 1IZ1A 1MDP1 4KYEA 1B58A 1B2HA 3BKIB 5EHMA 2PBWA 3LSFB 3MUQA 2HZKA 1B1XA 4QF9A 3S2VA 3C4MA 1B6HA 1EZ9A 1LAFE 3MWBA 3N6UA 1UTHB 2ZYKA 1RKMA 1QW0A 1B9JA 1XS5A 4PFYA 4Q0CA 1MH4A 3MJNA 4ZECA 5CMBA 4AB5A 4MLVA 2I48A 3BFUA 4LZ7A 2DSFA 4EDPA 4EXLA 3OO8A 4NF4A 1O63A 3RPWA 1MPDA 5CI5A 1OVTA 3Q29A 4ZE9A 5K2XA 3IL1B 3SEYA 4NF5B 1SDXA 2O6AA 5AA4B 5B70A 2B3FA 1PBQA 4MBPA 1JETA 4R73A 4LZ5A 4LVQA 3OELA 1EZOA 2AYSA 4RYAA 4OFJA 4NF6A 4P0IA 3TCHA 2P1SA 3W15C 1IUDA 4H67A 1FW0A 4L17A 3LSLA 2QMWA 3Q25A 3M8UA 4ZEIA 3KSJA 3U92A 2F7CA 3HO7A 1A8EA 1MQIA 1B05A 1HSLA 2I58A 1MRPA 1ZKBA 3EN3A 2VHAA 1JW5A 3IOWA 1GVCA 2H9BA 2XXTA 1US5A 5H8SA 2VD2A 2XX7A 4H5GA 2D3IA 4F1YA 1CB6A 3A3CA 2HAVA 2Z8EA 3O6IA 4WEPA 3PUVE 2UYFA 1BIYA 2F34A 4RY1A 3VVEA 4K3FA 3S9EA 3MPKA 3TTNA 4IO2A 4NE4A 1USYE 4I1DA 1SI0A 1DOTA 1HSEA 4R6YA 3B6QA 4LP2B 4KPTA 1N76A 1NFTA 4IB2A 3CFXA 2ZNSA 4O3BA 3FVOA 3CR9A 1Y3PA 4F3PA 3EHUA 3CIJA 3N5LA 3LC8A 1OVBA 1P1NA 2NOOA 3MP8A 3FGSA 1MS7A 3I5OA 3CVGA 4QFLA 3FUZA 1T0KA 3KBRA 2BJJX 2OBGA 4GIZA 2RC8A 1N04A 4OERA 3Q28A 4GFRA 3UGWA 2AL4A 3H6UA 4RNSA 1LFHA 3F11A 2DOJA 1ZLQA 3C33A 1IXHA 3T9HB 3IO6A 4NF4B 4ZEBA 1MXXA 3HHGA 5DT6A 3IX1A 5L9MA 4YICA 3RLFE 4F29A 1TFAA 4G2ZA 4H8JA 5ITPA 2XXXA 4OETA 4EQ9A 3CI8A 1Y1MA 1P1WA 1O7TA 4F3SA 3RT6B 4E0XA 5AA2B 1Y4TA 2HQ0A 4TOZA 2IEEA 1LAXA 3D4GA 4KCDA 4PP0A 3GLBA 1MXUA 5IAIA 3VXCA 2D21A 4NF6B 1WDNA 3DP8A 2QS2A 3IOVA 2M8CA 5KCJA 3QUFA 2UXAA 2R71A 1B7UA 2XD2A 3TQWA 4Z7EA 4ESXA 1NL5A 1DPEA 5FTHA 1FQBA 3S4UA 1FTJA 4RPNA 4X1DA 1PB8A 2NVUB 2REGA 1D9VA 3BBRA 3CG3A 1FQCA 3T96B 2XXVA 4GOTA 4OQOA 1ATGA 1PB7A 4YKIA 2PX1A 1ZU0A 3H4ZA 1XVYA 1LFGA 3USDA 1US4A 1ZJLA 3BFTA 3OO7A 2H99A 4GD5A 1JEVA 1O64A 5ELVA 3O2AA 1MPBA 2RC9A 3M3FA 2YLNA 1AOVA 2ONKE 2X7PA 5DVIA 2XXHA 4OVJA 4F3BA 4ZZAA 5CM6A 1R6ZA 4HS7A 3RTWB 4NMYA 2HFBA 2I3VA 1TWYA 2DXYA 4OXVA 1B0LA 4OYVA
chains in the Genus database with same CATH superfamily
2QS3A 5I56A 4FECA 1IMAA 2RCBA 1GGGA 3K00A 3SESA 1R9LA 3LUYA 2QVVA 4XKRA 2UVGA 2F36A 2F3BA 2VP1A 1OQGA 1A40A 1JNFA 3IK6B 4G68A 3ZKLA 3MVXA 3FVKA 4LUBA 1P99A 4G4PA 2OWSA 1FTOA 3H6VA 2Q89A 2PMSA 5FTIA 1FRPA 1SYIA 4KI0E 4X1BA 5LOMA 3O29A 3G3GA 2ONRA 3OOAA 3MZBA 3FVNA 2RC7A 3IJXB 3G3KA 4ZEFA 2DVCA 1H45A 2I4BA 5DTBA 1FQDA 2VOZA 5CMMA 1SVXB 3V5AA 2NWJA 1SW2A 3PGFA 1DCUA 1Y3NA 3VLVA 1JVYA 3SETA 3CFLA 1ELJA 3IJOB 1QULA 5DEXA 3DELB 3MP6A 3K6UA 4U4XA 1UQWA 3IB0A 4YB7A 2RINA 2ZYOA 5FHOA 3GBAA 4NX1A 4GXSB 3KC1A 5TPAA 5CRYA 3FD3A 4PBHA 2OZZA 1FCKA 3H7MA 1I6AA 2V4CA 2E0SA 4JWXA 1MG1A 4PAFA 2ANJA 4QSCA 2GRVA 1FQEA 5KCJB 4P47A 4PAIA 2Y7WA 4ND9A 4ZEKA 3BIGA 3I6VA 2V3TA 1Q1KA 4RK2A 3O28A 5IZ3A 1VFDA 1LBCA 2QL3A 1NV0A 4H6DA 4RJZA 1LB9A 4N6PA 3SERA 1BK4A 2F35A 1M5CA 1Y20A 1B52A 2XWIA 1NNKA 4Q30B 3EHSA 1FJ9A 1I69A 3PD9A 2CEYA 1NH7A 4JSDA 3LBSA 3ISPA 1J1NA 3KJ7A 4OFOA 4TQUQ 1SBPA 1H76A 3T66A 2HCAA 5EYHA 5H8QA 4GXAA 2DQVA 3DP6A 3TKDA 4F3GA 1OQHA 4NF8A 1L5TA 4U1ZA 1ZBMA 4OVSA 3I3VA 5I56B 1INPA 4ISUA 2QPQA 3OSQA 2Z22A 4MNCA 4OA4A 3HN0A 1B1HA 3PUZE 2GHBA 4XXUA 5I3SA 4G77A 4FEBA 2O68A 4DXUA 2DWJA 1IITA 2QJEA 5JEIA 3PPPA 4XTCQ 3PPOA 5AA2D 3TELA 1B3LA 4G68C 4PFBA 4G68B 4Q5TA 3FJ7A 1N84A 1SD3A 4GL8A 1FPDA 1B40A 3T1BA 2CEXA 3IO4A 3C35A 2XXRA 2QSXA 2PFYA 3SEWA 1AIVA 2XXQA 3A3UA 1WVJA 2X7QA 1PB9A 2QVUA 3FIRA 2B3BA 4I3EA 4H1XA 2UYEA 1OIBA 5DVJA 2XX9A 4OVPA 4AQ4A 1JQFA 5I59A 1AL3A 3UORA 2FBPA 4N6KA 4F19A 3L6HA 4F31B 3S9LC 3TAJA 3MVYA 3MYUA 4XEQA 1AH5A 2F7BA 2OJTA 2ONSA 4GX6A 5DEXB 4QHQA 2Y5LA 5CC2A 4N8GA 3UP9A 3N6TA 4BDMA 4QSEA 1D4NA 3QK6A 1LSTA 1P1OA 1NV5A 4OESA 4ECFA 3D4CA 3B7DA 4N15A 1Y3QA 1NUYA 5TPAB 3DLNA 3WAFA 4ESWA 4JXIA 4WEDA 2THIA 3U8QA 4HCWA 5L8DA 3TYHA 1P1QA 2CZIA 2G93A 4QFPA 2FVZA 3VVDA 3TDJA 5CMCA 4OVQA 5JK4A 4DI3D 3KSXA 4IY6A 2RCAA 4N81A 4OZ9A 1URSA 3T93B 3K2DA 2P2AA 3PMVA 4GWSA 1DTGA 5IZ3B 4DXBA 1LAHE 2Q9TA 3V83A 1B32A 1LCFA 1YZ0A 4O7IA 1VDWA 1EYJA 4RPOA 1M5EA 4MIJA 1Y9UA 5I7IA 1F9BA 3R6UA 3DP4A 4O94A 3VE1B 2XXWA 4OHNA 1XHYA 3KG2A 3G3HA 3UN6A 4QSDA 3HFUA 4IGRA 1M5DA 4GLIA 4TLLB 2F6PA 4H8IA 4X48A 4NHBA 4QRZA 5BWJA 2REJA 1POY1 2O1MA 2X26A 3MPLA 4KHZE 2FNCA 3VVFA 3CG1A 5H8QB 1MXWA 2Q2CA 1D9YA 3JV9A 2YPNA 2P3VA 3RPLA 4UA8A 4HXVA 4QXDA 2HXRA 4Q8RA 4O3AA 4GWXA 1B7ZA 3TCFA 2NXOA 3WAEA 1FTMA 2AL5A 5J1DA 3IOUA 2XXYA 4U23A 4N4UA 4QFOA 4KCCA 2QS1A 4I3YA 3PPQA 3S9MC 5JTYA 1SW4A 3E13X 4BLAA 1QGXA 3PPRA 4U2RA 2XA5A 1EYKA 3B6TA 4JBZA 1PEBA 4YAHX 4JB7A 4EQBA 3FATA 4WKMA 3TTRA 4P8BA 4QFKA 2ESNA 3E9XA 2I6EA 4QBAA 2ZNTA 4N6DA 5LTCA 2ZYNA 3JYRA 4NWDA 2I4CA 5BUUA 3OO9A 3O66A 5I59B 1FTAA 1Y4CA 4GVOA 4R74A 1JW4A 5FHNA 3U94A 1VFEA 1FPJA 3G7WA 3JZJA 4HCYA 5CBRA 5FBPA 1B7HA 4MCOA 1IXCA 5ET7A 3RQTA 2HHMA 2V3UA 3LSXA 3HSTA 1SI1A 3TTKA 4NG7A 3KN7A 4N07A 3VV5A 1H3DA 1SW1A 5I2NA 2UVHA 1N0TA 3LSWA 4JWYA 2GH9A 4RA1A 4EQ7A 2UVIA 3U65A 3HHFA 5ISUA 1NNPA 3EF7A 4YMBA 4THIA 2O51A 1MM6A 1Q9DA 3MZ1A 1ZMGA 4WXJA 4FATA 4MNIA 4FE8A 3CHGA 5TP9A 2JJKA 4EUOA 3TEPA 2F7AA 3KJTA 4FEDA 1FPIA 2PCRA 3H03A 2H4IA 1NV7A 1KA1A 2F6GA 3ZS6A 1G0HA 5TU0A 3FJGA 4IO7A 4YKPA 3PUYE 2WKYA 2RF1A 4BDRA 2HZLA 5ICTA 2WYPA 2DWIA 3LV0A 4MH5A 4F22A 1FBEA 5FHMA 4DCYA 3KC0A 4KYDA 2PT2A 5A5LA 4PCDA 5F7VA 1ZIUA 2FYIA 2HXWA 4PQJA 5ESYA 1BLFA 3RPLB 4MMPA 1N7XA 5EYGA 3RTFB 3U93A 1CNQA 3KN8A 3OD7A 2O7UA 5CBSA 2I3WA 4BDNA 3IB1A 1II5A 3VLUA 1LB8A 1R1NA 3MBPA 4F2OA 4PF8A 3LUZA 5JTYB 2FIEA 4OEVA 2ZXTA 2WBDA 4DIGA 4DE8A 4LQ2A 1I6QA 1FPLA 2GQ1A 4YB5A 1MDQA 3D1RA 2ALUA 4F2QA 4DI4B 4ELPA 1A8FA 1MXVA 4HTGA 2DYXA 1IEJA 5I58A 1CE2A 2CZLA 1NUZA 2DWHA 5HPQA 2DXRA 2QMXA 1ZTYA 4LONB 1I6BA 4G8MA 4QFNA 1LGBC 1B3EA 1POTA 1JEUA 3ZSFA 3H3GA 3QYTA 1EH3A 1PBPA 1MY3A 3SEUA 4YKKA 2CMOA 4FIMA 1GTKA 1QUIA 4Z0IA 2W7YA 1NV4A 1MY1A 3UIFA 3TMGA 3TPAA 1YTVA 3A29A 1PDAA 4HW8A 1VSOA 1KZ8A 3GZGA 4C1UA 1DK4A 4GBVA 2P0SA 5KDTA 4DLDA 3ODBA 1Q35A 5HM4B 2V3QA 3EPEA 3KFMA 1JP4A 5IZ1A 5IKBA 4MNPA 3EKIA 2F3DA 3T22A 3DM0A 2V25A 5I2NB 1S7YA 2B65A 3TQLA 1NMUA 3OSRA 4PE5B 3QSLA 5CMKA 3OENA 5F24A 1FPEA 1MQDA 3KN3A 3MVWA 4U21A 2UVJA 4IGTA 3MAMA 3K6VA 2WEFA 1B3FA 4O3CA 4LZ8A 5TP9B 3ECRA 4H5FA 3C36A 1UTBA 4XFEA 4ELOA 2GHAA 1URGA 4M4GA 3FXUA 4OENA 5IZZA 1A7LA 3MC2A 4P1EA 3ILUB 4IO5A 1A54A 1LBYA 2ZNUA 2WYKA 5ITOA 2F8DA 4XKPA 1Y1ZA 1DMBA 1MXYA 3IFAA 4C0RA 3TTMA 2FA7A 2YJPA 3EQ1A 4ZZEA 5F1QA 2OWTA 2R6GE 2HPGA 3PMXA 3H6WA 4POWA 3SZPA 4PFTA 2ZZXA 4PF6A 4DZ1A 3K1NA 2XXUA 4OMBA 3KOSA 3FV1A 1BKAA 4H0WA 5AA1A 3MQ9A 2O84X 1YAEA 1YPNA 3K1PA 1LCTA 1FPGA 3IB2A 2ABHA 2HAUA 2QRYA 4GQOA 2Q74A 2HEUA 4XIGQ 1AMFA 3RT8A 1URDA 1XOCA 2E1SA 3FXQA 4O8MA 1S9TA 1R9QA 3HPIA 1MY4A 1MQHA 1FQAA 4F1UA 3PV0E 4YU0A 4FAJA 2L5VA 4X04A 4P3LA 3MVZA 4PGPA 1MXZA 1LBBA 1B51A 4MJOA 1B5JA 5I58B 1NNFA 2OCUA 1YXIA 3LR1A 5M2VA 5I57A 3IORA 4G8HA 4R72A 1H44A 3V8XB 2GFEA 1B4HA 1N3WA 3QIMA 4P56A 2DE3A 4R6HA 4OVRA 4R6KA 1LFIA 3P7IA 1RYXA 5DVFA 4OTEA 4AS4A 2DE4A 3U72A 2VD3A 4HE0A 1QKBA 5AA2A 3VXBA 5B7DA 3H06B 4H65A 4LATA 2D5WA 3QXMA 4MLQA 4I8CA 3TCGA 2OK2A 3QUJA 1HSJA 4GWUA 5KDTB 4P11A 3M3LA 4BDLA 3PMWA 2I0CA 1GR2A 1SQYA 3KOTA 2Y7KA 1UIVA 2KQZA 2QS4A 1GV8A 1IIWA 4IO6A 3N94A 2Y7RA 4GBWA 2R9JA 3R26A 2OLBA 1OLAA 3HV1A 1LLSA 2XD3A 3RGYA 4NGUA 1FPBA 3AXFA 4GL0A 4GX4A 2FIXA 4X9TA 4ZS9A 5H8FA 4DDDA 4EXKA 4PAKA 2ZZWA 2LAOA 3MP1A 4GWOA 1VR5A 2V84A 3C31A 1UTBB 3B6WA 4YB6A 4GRKA 4P0GA 2A5TA 3TUSA 2Y7PA 1XC1A 4F18A 4FJPA 3T9XB 4RK9A 4C1TA 3TODA 2P3NA 3PU5A 4ZEDA 2PT1A 2F78A 3MW0A 2I0BA 3UA8A 2Y84A 1B3GA 4XKQA 2B4LA 5H8NA 4NF8B 4MFIA 3CRBA 5AE4A 2O7IA 1FPFA 5ICQA 3O97A 3G3JA 2VGQA 4JVCA 3U1OA 4KD5A 3GBBA 2G29A 4EF1A 3VDFA 4IO3A 2Q88A 4G8NA 4PFWA 1QUKA 2Z23A 1B3HA 3L6GA 1EU8A 4DXCA 1S50A 1EZPA 3HCQA 1FJ6A 4U22A 1YCJA 1LBZA 1FTLA 4R2FA 3IOTA 4AS5A 3SDFA 3C32A 1TFDA 3SKPA 3K6XA 4NEDA 3RY3A 4PDDA 4HE1A 5I2KA 1M5BA 3VLWA 3THIA 1PC3A 2O69A 4PE3A 5I84A 3E79A 3ONMA 1JVXA 1NNTA 1BP5A 1FBCA 1MPCA 1DTZA 4FORA 2H25A 2Z8DA 3EHTA 2XWVA 3H6TA 4N91A 5H8HA 2DS9A 2NUVA 5I57B 4NN3A 3K02A 4NWCA 2DP8A 2Y5KA 4RXLA 2H98A 2Q2AA 4YKJA 1SYHA 4AB6A 4OWDA 4YZZA 1WODA 3E4RA 1LEVA 5J16A 3G3IA 2I49A 2AIXA 2A5SA 2PVUA 1USYH 1NV6A 4PTKA 3SEXA 5A5XA 4F39A 2ZYMA 4MX6A 2PYYA 4JDFA 4I9DA 2WX9A 1IXGA 4I62A 3N26A 1G0IA 5EHSA 5AA3A 1A99A 4JWOA 4P9KA 3OEKA 1FTKA 4FBPA 1Z7ME 2V93A 3SEVA 3TTLA 1LAGE 1TT1A 1BTJA 2XX8A 4U4SA 4IR8A 4MF3A 5LDZA 4OEUA 1KA0A 3OXNA 2DWAA 3FZVA 3FJMA 4JSOA 4NAPA 3KBZA 3PUXE 4LA9A 5H8FB 2O1LA 3CSBA 1XT8A 3C9HA 3O6HA 2DE2A 4KYSA 4TLMB 1FBPA 2VPOA 1RYOA 5HBCA 2A5TB 4M1VA 4O7MA 2ZZVA 1QVSA 2ZMBA 4PFRA 4IO4A 4E0WA 1QJMA 3KZGA 1B5IA 2WBBA 2Y7IA 1B5HA 1NH8A 3FBPA 3FVGA 4KR5A 5H8NB 2FHYA 4G61A 3PUWE 2XHDA 1H43A 4OVTA 5L9OA 1IQ7A 4I40A 1Z7NE 1DPPA 3G3FA 2Z8FA 2VPNA 1DBZA 4KQPA 3IR1A 3PPNA 5EQ9A 1SW5A 3RN8A 5I5PA 1NV3A 4ZDMA 3UK4A 3V89B 1QUJA 1P1UA 4PFUA 3M3KA 1NKXA 4N13A 1ANFA 1UTHA 3W9VA 1D9QA 2OX3A 4PETA 3W9WA 1B46A 4BDQA 3CSGA 4GWWA 4KFQA 2XWOA 3Q26A 3O6GA 5I2KB 1MM7A 3MZ9A 5L9SA 1MY0A 2VT5A 1MH3A 3OEMA 3S9NC 3QAXA 4GX3A 2RKMA 3GYYA 3ILTB 1UIUA 3CFZA 3K01A 4UABA 4R9FA 2OWZA 4XKNA 3OMBA 4LQ5A 1RDZA 4NF5A 3O9PA 4NQ8A 5AA4A 5H8HB 3E3KA 1B0HA 3FXRA 4ELQA 3KEIA 4POXA 3IAZA 3OO6A 1N7WA 4R2BA 5KZTA 4F1VA 1IXIA 3Q27A 3ZKKA 1FQFA 1XVXA 2DVZA 3A09A 4ZE8A 1VE4A 3RNNA 4R9GA 5IM2A 3K1MA 1NUXA 2CZKA 5A5XB 3K0VA 1K9ZA 4ONYA 4ELRA 3C34A 3TFLA 1TXFA 1N3XA 1NUWA 3K6WA 5EYFA 3PD8A 4IY5A 1MY2A 5K2YA 4EF2A 3TZAA 5DYHA 4PDHA 1IMDA 1OLCA 3GXAA 2F97A 1AWBA 1KWHA 1JW1A 3T9UA 3T9VA 3ROJA 4MAGA 1IMBA 2B4MA 1MQJA 4UACA 4XF5A 2F5XA 2IA4A 1DSNA 4GF8A 3FV2A 4GWYA 1B4ZA 4OFLA 1D3KA 3RUMA 1LBWA 1OMPA 3KGCA 3R7XA 3K4UA 3FXBA 4U1OA 2Q8JA 2XXPA 2H5YA 2Q8MA 3VFJA 1MQGA 1FSAA 1QKAA 1M5FA 4NF0A 2DDKA 1A55A 4BDOA 3FASA 4PGNA 2XXIA 1RDYA 4N8YA 4R75A 4YMAA 4DCXA 2KLFA 4NTLA 1IZ1A 1MDP1 4KYEA 1B58A 1B2HA 3BKIB 5DW8A 5EHMA 5ET5A 2PBWA 3LSFB 3MUQA 2HZKA 4H45A 1B1XA 4MHFA 4QF9A 1XI6A 4HE2A 3S2VA 3C4MA 1B6HA 1EZ9A 1LAFE 3MWBA 3N6UA 1UTHB 2ZYKA 1RKMA 1QW0A 1B9JA 1XS5A 4PFYA 4Q0CA 1MH4A 3MJNA 4ZECA 5CMBA 4AB5A 4MLVA 2I48A 3BFUA 4LZ7A 2DSFA 4EDPA 4EXLA 3OO8A 4NF4A 4PC9A 1O63A 3RPWA 2R8TA 1MPDA 5CI5A 1OVTA 1YYZA 3Q29A 4ZE9A 2BJIA 5K2XA 3IL1B 3SEYA 4NF5B 1SDXA 2O6AA 5AA4B 5B70A 2B3FA 2XXKA 1PBQA 4MBPA 1JETA 4R73A 4LZ5A 4LVQA 2PFZA 3OELA 1EZOA 2AYSA 2QFLA 4RYAA 4OFJA 4NF6A 4P0IA 3TCHA 3E78A 2P1SA 3W15C 1IUDA 4H67A 1FW0A 4L17A 3LSLA 2QMWA 3Q25A 3M8UA 4ZEIA 1LBXA 3KSJA 5ET8A 3U92A 4MEVA 2F7CA 3HO7A 1A8EA 1MQIA 1B05A 1HSLA 2I58A 5EQ7A 1LBVA 1MRPA 1ZKBA 3EN3A 2VHAA 1JW5A 3IOWA 1GVCA 2H9BA 2XXTA 1US5A 5H8SA 2VD2A 2XX7A 4H5GA 2CZHA 2D3IA 4F1YA 1CB6A 3A3CA 2HAVA 2KR0A 2Z8EA 3O6IA 4WEPA 3PUVE 2UYFA 1BIYA 2F34A 4RY1A 3VVEA 4N17A 5T3JA 4K3FA 3S9EA 3MPKA 3TTNA 4IO2A 4NE4A 3PTYA 1USYE 4I1DA 1SI0A 1DOTA 1HSEA 4R6YA 3B6QA 4LP2B 4KPTA 1IMEA 1N76A 3B50A 4KXPA 4OANA 1NFTA 4IB2A 3CFXA 2ZNSA 4O3BA 3FVOA 3CR9A 1FBHA 1Y3PA 4F3PA 3EHUA 3CIJA 3N5LA 3LC8A 4PFIA 1OVBA 1P1NA 2NOOA 3MP8A 3FGSA 1MS7A 1NV2A 3CVGA 3I5OA 4QFLA 3FUZA 1T0KA 3KBRA 2BJJX 2OBGA 4GIZA 2RC8A 1N04A 4OERA 3Q28A 4GFRA 3UGWA 2AL4A 4H46A 3H6UA 4RNSA 1LFHA 1NI9A 3F11A 2DOJA 1ZLQA 3C33A 1IXHA 3T9HB 3IO6A 4NF4B 4ZEBA 1MXXA 3HHGA 2XWKA 5DT6A 3IX1A 5L9MA 1NV1A 4YICA 3RLFE 4F29A 1TFAA 4G2ZA 4H8JA 5ITPA 1IMCA 2XXXA 2MKZA 4OETA 4EQ9A 3CI8A 1Y1MA 1P1WA 3NOHA 5ET6A 1O7TA 4F3SA 3RT6B 4E0XA 5AA2B 3QMFA 1Y4TA 2HQ0A 1SPIA 4LN5A 4TOZA 2IEEA 1LAXA 1FBFA 4KCDA 3D4GA 4PP0A 1IMFA 3MSTA 1FBDA 3GLBA 1MXUA 5IAIA 5EQ8A 3VXCA 2D21A 4NF6B 1WDNA 3DP8A 2QS2A 3IOVA 2M8CA 5KCJA 3QUFA 2UXAA 2R71A 4P1LA 1B7UA 4PBQA 2XD2A 3TQWA 4Z7EA 4ESXA 1FPKA 1NL5A 1K9YA 4JVDA 1DPEA 5FTHA 1FQBA 3BIHA 3S4UA 1FTJA 2QVRA 4RPNA 4JVIA 4X1DA 1PB8A 2NVUB 3RYDA 1RDXA 2REGA 1FBGA 1D9VA 3BBRA 3CG3A 1FQCA 3T96B 2XXVA 4GOTA 4OQOA 1ATGA 1PB7A 4YKIA 2PX1A 1ZU0A 3H4ZA 1XVYA 1LFGA 4X8RA 3USDA 5IGAA 1US4A 1EYIA 1ZJLA 3BFTA 3OO7A 2H99A 3IFCA 4GD5A 1JEVA 1O64A 5ELVA 3O2AA 1MPBA 2RC9A 3M3FA 3T0JA 2YLNA 1AOVA 2ONKE 2X7PA 5DVIA 2XXHA 4OVJA 4F3BA 4ZZAA 3B8BA 5CM6A 1R6ZA 4HS7A 3RTWB 4NMYA 2HFBA 2I3VA 1TWYA 2DXYA 4GWZA 4OXVA 1B0LA 4OYVA 5EQAA
chains in the Genus database with same CATH topology
2QS3A 5I56A 4FECA 2RCBA 1GGGA 3K00A 3SESA 1R9LA 3LUYA 4XKRA 2UVGA 2F36A 2VP1A 1OQGA 1A40A 1JNFA 3IK6B 4G68A 3ZKLA 3MVXA 3FVKA 4LUBA 1P99A 4G4PA 2OWSA 1FTOA 3H6VA 2Q89A 2PMSA 5FTIA 1SYIA 4KI0E 4X1BA 5LOMA 3O29A 3G3GA 2ONRA 3OOAA 3MZBA 3FVNA 2RC7A 3IJXB 3G3KA 4ZEFA 2DVCA 1H45A 2I4BA 5DTBA 1FQDA 2VOZA 5CMMA 1SVXB 3V5AA 2NWJA 1SW2A 3PGFA 1Y3NA 3VLVA 1JVYA 3SETA 3CFLA 1ELJA 3IJOB 1QULA 5DEXA 3DELB 3MP6A 3K6UA 4U4XA 1UQWA 3IB0A 4YB7A 2RINA 2ZYOA 5FHOA 3GBAA 4GXSB 5TPAA 5CRYA 3FD3A 2OZZA 1FCKA 3H7MA 1I6AA 2E0SA 4JWXA 1MG1A 2ANJA 4QSCA 2GRVA 1FQEA 5KCJB 2Y7WA 4ND9A 4ZEKA 3I6VA 2V3TA 1Q1KA 4RK2A 3O28A 1VFDA 1LBCA 2QL3A 4H6DA 4RJZA 1LB9A 4N6PA 3SERA 2F35A 1M5CA 1Y20A 1B52A 1NNKA 4Q30B 3EHSA 1I69A 3PD9A 1NH7A 4JSDA 3LBSA 1J1NA 3KJ7A 4OFOA 4TQUQ 1SBPA 1H76A 3T66A 2HCAA 5H8QA 4GXAA 2DQVA 3DP6A 3TKDA 4F3GA 1OQHA 4NF8A 1L5TA 4U1ZA 1ZBMA 3I3VA 5I56B 4ISUA 2QPQA 3OSQA 2Z22A 3HN0A 1B1HA 3PUZE 2GHBA 4XXUA 4G77A 4FEBA 2O68A 4DXUA 2DWJA 1IITA 2QJEA 5JEIA 3PPPA 4XTCQ 3PPOA 5AA2D 3TELA 1B3LA 4G68C 4G68B 4Q5TA 3FJ7A 1N84A 1SD3A 4GL8A 1B40A 3IO4A 3C35A 2XXRA 2QSXA 3SEWA 1AIVA 2XXQA 3A3UA 1WVJA 2X7QA 1PB9A 3FIRA 2B3BA 4H1XA 2UYEA 1OIBA 5DVJA 2XX9A 4AQ4A 1JQFA 5I59A 1AL3A 3UORA 4F19A 3L6HA 4F31B 3S9LC 3TAJA 3MVYA 1AH5A 2F7BA 2OJTA 2ONSA 5DEXB 4QHQA 5CC2A 3UP9A 3N6TA 4BDMA 4QSEA 1D4NA 3QK6A 1LSTA 1P1OA 4OESA 4ECFA 3D4CA 3B7DA 1Y3QA 5TPAB 3DLNA 3WAFA 4ESWA 4JXIA 4WEDA 2THIA 3U8QA 4HCWA 5L8DA 3TYHA 1P1QA 2G93A 4QFPA 3VVDA 3TDJA 5CMCA 5JK4A 3KSXA 4IY6A 2RCAA 4OZ9A 1URSA 3T93B 3K2DA 2P2AA 3PMVA 1DTGA 4DXBA 1LAHE 2Q9TA 3V83A 1B32A 1LCFA 4RPOA 1M5EA 1Y9UA 1F9BA 3R6UA 3DP4A 3VE1B 2XXWA 4OHNA 1XHYA 3KG2A 3G3HA 3UN6A 4QSDA 4IGRA 1M5DA 4GLIA 4TLLB 2F6PA 4H8IA 4X48A 4QRZA 5BWJA 2REJA 1POY1 2O1MA 2X26A 3MPLA 4KHZE 2FNCA 3VVFA 3CG1A 5H8QB 1MXWA 2Q2CA 1D9YA 3JV9A 2YPNA 4UA8A 4Q8RA 4O3AA 1B7ZA 3TCFA 2NXOA 3WAEA 1FTMA 2AL5A 5J1DA 3IOUA 2XXYA 4U23A 4QFOA 4KCCA 2QS1A 3PPQA 3S9MC 5JTYA 1SW4A 3E13X 4BLAA 3PPRA 4U2RA 3B6TA 4JBZA 1PEBA 4YAHX 4JB7A 4EQBA 3FATA 4WKMA 3TTRA 4QFKA 2ESNA 3E9XA 2I6EA 2ZNTA 2ZYNA 3JYRA 4NWDA 2I4CA 5BUUA 3OO9A 3O66A 5I59B 1Y4CA 4GVOA 4R74A 1JW4A 5FHNA 3U94A 1VFEA 3G7WA 3JZJA 4HCYA 5CBRA 1B7HA 1IXCA 3RQTA 2V3UA 3LSXA 3HSTA 1SI1A 3TTKA 3KN7A 4N07A 3VV5A 1H3DA 1SW1A 5I2NA 2UVHA 1N0TA 3LSWA 4JWYA 2GH9A 4RA1A 4EQ7A 2UVIA 3HHFA 5ISUA 1NNPA 3EF7A 4YMBA 4THIA 2O51A 1MM6A 3MZ1A 1ZMGA 4WXJA 4FATA 4FE8A 5TP9A 4EUOA 3TEPA 2F7AA 3KJTA 4FEDA 3H03A 2H4IA 2F6GA 3ZS6A 5TU0A 3FJGA 4IO7A 4YKPA 3PUYE 2WKYA 2RF1A 4BDRA 2HZLA 5ICTA 2DWIA 4MH5A 4F22A 5FHMA 4DCYA 4KYDA 2PT2A 5F7VA 1ZIUA 2FYIA 2HXWA 4PQJA 1BLFA 1N7XA 3RTFB 3U93A 3KN8A 3OD7A 2O7UA 5CBSA 2I3WA 4BDNA 3IB1A 1II5A 3VLUA 1LB8A 1R1NA 3MBPA 4F2OA 5JTYB 4OEVA 2ZXTA 4DIGA 4DE8A 4LQ2A 1I6QA 4YB5A 1MDQA 2ALUA 4F2QA 4ELPA 1A8FA 1MXVA 4HTGA 2DYXA 1IEJA 5I58A 1CE2A 2CZLA 2DWHA 5HPQA 2DXRA 2QMXA 1ZTYA 4LONB 1I6BA 4G8MA 4QFNA 1LGBC 1B3EA 1POTA 1JEUA 3ZSFA 3H3GA 3QYTA 1EH3A 1PBPA 1MY3A 3SEUA 4YKKA 2CMOA 4FIMA 1GTKA 1QUIA 4Z0IA 2W7YA 1MY1A 3UIFA 3TMGA 3TPAA 1YTVA 1PDAA 4HW8A 1VSOA 3GZGA 4C1UA 2P0SA 5KDTA 4DLDA 3ODBA 1Q35A 5HM4B 2V3QA 3EPEA 3KFMA 5IKBA 3T22A 3DM0A 2V25A 5I2NB 1S7YA 2B65A 3TQLA 1NMUA 3OSRA 4PE5B 3QSLA 5CMKA 3OENA 1MQDA 3KN3A 3MVWA 4U21A 2UVJA 4IGTA 3MAMA 3K6VA 1B3FA 4O3CA 4LZ8A 5TP9B 3ECRA 4H5FA 3C36A 1UTBA 4ELOA 2GHAA 1URGA 4M4GA 3FXUA 4OENA 1A7LA 3MC2A 3ILUB 4IO5A 1A54A 2ZNUA 5ITOA 2F8DA 4XKPA 1Y1ZA 1DMBA 1MXYA 4C0RA 3TTMA 2FA7A 2YJPA 3EQ1A 4ZZEA 5F1QA 2OWTA 2R6GE 3PMXA 3H6WA 4POWA 4PFTA 4DZ1A 3K1NA 2XXUA 4OMBA 3KOSA 3FV1A 1BKAA 4H0WA 5AA1A 3MQ9A 2O84X 1YAEA 1YPNA 3K1PA 1LCTA 3IB2A 2ABHA 2HAUA 2QRYA 4GQOA 2HEUA 4XIGQ 1AMFA 3RT8A 1URDA 1XOCA 2E1SA 3FXQA 1S9TA 1R9QA 3HPIA 1MY4A 1MQHA 1FQAA 4F1UA 3PV0E 4YU0A 4FAJA 3MVZA 1MXZA 1LBBA 1B51A 1B5JA 5I58B 1NNFA 2OCUA 3LR1A 5M2VA 5I57A 3IORA 4G8HA 4R72A 1H44A 3V8XB 2GFEA 1B4HA 1N3WA 3QIMA 2DE3A 4R6HA 4R6KA 1LFIA 3P7IA 1RYXA 5DVFA 4OTEA 2DE4A 3U72A 2VD3A 1QKBA 5AA2A 3VXBA 5B7DA 3H06B 4H65A 4LATA 2D5WA 3QXMA 4MLQA 4I8CA 3TCGA 2OK2A 3QUJA 1HSJA 5KDTB 4P11A 3M3LA 4BDLA 3PMWA 2I0CA 1GR2A 1SQYA 3KOTA 2Y7KA 1UIVA 2QS4A 1GV8A 1IIWA 4IO6A 3N94A 2Y7RA 2R9JA 3R26A 2OLBA 1OLAA 3HV1A 1LLSA 2XD3A 3RGYA 3AXFA 4GL0A 4X9TA 4ZS9A 5H8FA 4DDDA 4EXKA 2LAOA 3MP1A 4GWOA 1VR5A 2V84A 3C31A 1UTBB 3B6WA 4YB6A 4GRKA 4P0GA 2A5TA 3TUSA 2Y7PA 1XC1A 4F18A 4FJPA 3T9XB 4RK9A 4C1TA 3TODA 3PU5A 4ZEDA 2PT1A 2F78A 3MW0A 2I0BA 3UA8A 2Y84A 1B3GA 4XKQA 5H8NA 4NF8B 4MFIA 3CRBA 5AE4A 2O7IA 5ICQA 3O97A 3G3JA 2VGQA 3U1OA 4KD5A 3GBBA 2G29A 4EF1A 3VDFA 4IO3A 2Q88A 4G8NA 4PFWA 1QUKA 2Z23A 1B3HA 3L6GA 1EU8A 4DXCA 1S50A 1EZPA 3HCQA 4U22A 1YCJA 1FTLA 4R2FA 3IOTA 3SDFA 3C32A 1TFDA 3SKPA 3K6XA 4NEDA 3RY3A 5I2KA 1M5BA 3VLWA 3THIA 1PC3A 2O69A 5I84A 3ONMA 1JVXA 1NNTA 1BP5A 1MPCA 1DTZA 4FORA 2H25A 2Z8DA 3EHTA 3H6TA 5H8HA 2DS9A 2NUVA 5I57B 3K02A 4NWCA 2DP8A 4RXLA 2H98A 2Q2AA 4YKJA 1SYHA 4AB6A 4OWDA 4YZZA 1WODA 3E4RA 3G3IA 2I49A 2AIXA 2A5SA 2PVUA 1USYH 3SEXA 5A5XA 4F39A 2ZYMA 2PYYA 4JDFA 4I9DA 4I62A 1IXGA 3N26A 5EHSA 5AA3A 1A99A 4JWOA 3OEKA 1FTKA 1Z7ME 2V93A 3SEVA 3TTLA 1LAGE 1TT1A 1BTJA 2XX8A 4U4SA 4MF3A 4OEUA 3OXNA 2DWAA 3FZVA 3FJMA 4JSOA 3PUXE 4LA9A 5H8FB 2O1LA 3CSBA 1XT8A 3C9HA 3O6HA 2DE2A 4KYSA 4TLMB 1RYOA 5HBCA 2A5TB 4M1VA 1QVSA 2ZMBA 4IO4A 4E0WA 1QJMA 3KZGA 1B5IA 2Y7IA 1B5HA 1NH8A 3FVGA 4KR5A 5H8NB 3PUWE 2XHDA 1H43A 5L9OA 1IQ7A 1Z7NE 1DPPA 3G3FA 2Z8FA 4KQPA 3IR1A 3PPNA 1SW5A 3RN8A 4ZDMA 3UK4A 3V89B 1QUJA 1P1UA 4PFUA 3M3KA 1NKXA 4N13A 1ANFA 1UTHA 3W9VA 4PETA 3W9WA 1B46A 4BDQA 3CSGA 4KFQA 3Q26A 3O6GA 5I2KB 1MM7A 3MZ9A 5L9SA 1MY0A 1MH3A 3OEMA 3S9NC 3QAXA 2RKMA 3ILTB 1UIUA 3CFZA 3K01A 4R9FA 4XKNA 3OMBA 4LQ5A 4NF5A 3O9PA 5AA4A 5H8HB 3E3KA 1B0HA 3FXRA 4ELQA 3KEIA 4POXA 3IAZA 3OO6A 1N7WA 4R2BA 5KZTA 4F1VA 1IXIA 3Q27A 3ZKKA 1FQFA 1XVXA 2DVZA 3A09A 4ZE8A 1VE4A 3RNNA 4R9GA 3K1MA 5A5XB 3K0VA 4ONYA 4ELRA 3C34A 3TFLA 1TXFA 1N3XA 3K6WA 5EYFA 3PD8A 4IY5A 1MY2A 5K2YA 4EF2A 3TZAA 5DYHA 1OLCA 3GXAA 2F97A 1KWHA 1JW1A 3T9UA 3T9VA 1MQJA 4UACA 2F5XA 2IA4A 1DSNA 4GF8A 3FV2A 1B4ZA 4OFLA 1D3KA 3RUMA 1OMPA 3KGCA 3R7XA 3K4UA 4U1OA 2Q8JA 2XXPA 2H5YA 3VFJA 1MQGA 1QKAA 1M5FA 1A55A 4BDOA 3FASA 2XXIA 4R75A 4YMAA 4DCXA 2KLFA 4NTLA 1IZ1A 1MDP1 4KYEA 1B58A 1B2HA 3BKIB 5EHMA 2PBWA 3LSFB 3MUQA 2HZKA 1B1XA 4QF9A 3S2VA 3C4MA 1B6HA 1EZ9A 1LAFE 3MWBA 3N6UA 1UTHB 2ZYKA 1RKMA 1QW0A 1B9JA 1XS5A 4PFYA 4Q0CA 1MH4A 3MJNA 4ZECA 5CMBA 4AB5A 4MLVA 2I48A 3BFUA 4LZ7A 2DSFA 4EDPA 4EXLA 3OO8A 4NF4A 1O63A 3RPWA 1MPDA 5CI5A 1OVTA 3Q29A 4ZE9A 5K2XA 3IL1B 3SEYA 4NF5B 1SDXA 2O6AA 5AA4B 5B70A 2B3FA 1PBQA 4MBPA 1JETA 4R73A 4LZ5A 4LVQA 3OELA 1EZOA 2AYSA 4RYAA 4OFJA 4NF6A 4P0IA 3TCHA 2P1SA 3W15C 1IUDA 4H67A 1FW0A 4L17A 3LSLA 2QMWA 3Q25A 3M8UA 4ZEIA 3KSJA 3U92A 2F7CA 3HO7A 1A8EA 1MQIA 1B05A 1HSLA 2I58A 1MRPA 1ZKBA 3EN3A 2VHAA 1JW5A 3IOWA 1GVCA 2H9BA 2XXTA 1US5A 5H8SA 2VD2A 2XX7A 4H5GA 2D3IA 4F1YA 1CB6A 3A3CA 2HAVA 2Z8EA 3O6IA 4WEPA 3PUVE 2UYFA 1BIYA 2F34A 4RY1A 3VVEA 4K3FA 3S9EA 3MPKA 3TTNA 4IO2A 4NE4A 1USYE 4I1DA 1SI0A 1DOTA 1HSEA 4R6YA 3B6QA 4LP2B 4KPTA 1N76A 1NFTA 4IB2A 3CFXA 2ZNSA 4O3BA 3FVOA 3CR9A 1Y3PA 4F3PA 3EHUA 3CIJA 3N5LA 3LC8A 1OVBA 1P1NA 2NOOA 3MP8A 3FGSA 1MS7A 3I5OA 3CVGA 4QFLA 3FUZA 1T0KA 3KBRA 2BJJX 2OBGA 4GIZA 2RC8A 1N04A 4OERA 3Q28A 4GFRA 3UGWA 2AL4A 3H6UA 4RNSA 1LFHA 3F11A 2DOJA 1ZLQA 3C33A 1IXHA 3T9HB 3IO6A 4NF4B 4ZEBA 1MXXA 3HHGA 5DT6A 3IX1A 5L9MA 4YICA 3RLFE 4F29A 1TFAA 4G2ZA 4H8JA 5ITPA 2XXXA 4OETA 4EQ9A 3CI8A 1Y1MA 1P1WA 1O7TA 4F3SA 3RT6B 4E0XA 5AA2B 1Y4TA 2HQ0A 4TOZA 2IEEA 1LAXA 3D4GA 4KCDA 4PP0A 3GLBA 1MXUA 5IAIA 3VXCA 2D21A 4NF6B 1WDNA 3DP8A 2QS2A 3IOVA 2M8CA 5KCJA 3QUFA 2UXAA 2R71A 1B7UA 2XD2A 3TQWA 4Z7EA 4ESXA 1NL5A 1DPEA 5FTHA 1FQBA 3S4UA 1FTJA 4RPNA 4X1DA 1PB8A 2NVUB 2REGA 1D9VA 3BBRA 3CG3A 1FQCA 3T96B 2XXVA 4GOTA 4OQOA 1ATGA 1PB7A 4YKIA 2PX1A 1ZU0A 3H4ZA 1XVYA 1LFGA 3USDA 1US4A 1ZJLA 3BFTA 3OO7A 2H99A 4GD5A 1JEVA 1O64A 5ELVA 3O2AA 1MPBA 2RC9A 3M3FA 2YLNA 1AOVA 2ONKE 2X7PA 5DVIA 2XXHA 4OVJA 4F3BA 4ZZAA 5CM6A 1R6ZA 4HS7A 3RTWB 4NMYA 2HFBA 2I3VA 1TWYA 2DXYA 4OXVA 1B0LA 4OYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QS3 A;  5I56 A;  4FEC A;  2RCB A;  1GGG A;  3K00 A;  3SES A;  1R9L A;  3LUY A;  4XKR A;  2UVG A;  2F36 A;  2VP1 A;  1OQG A;  1A40 A;  1JNF A;  3IK6 B;  4G68 A;  3ZKL A;  3MVX A;  3FVK A;  4LUB A;  1P99 A;  4G4P A;  2OWS A;  1FTO A;  3H6V A;  2Q89 A;  2PMS A;  5FTI A;  1SYI A;  4KI0 E;  4X1B A;  5LOM A;  3O29 A;  3G3G A;  2ONR A;  3OOA A;  3MZB A;  3FVN A;  2RC7 A;  3IJX B;  3G3K A;  4ZEF A;  2DVC A;  1H45 A;  2I4B A;  5DTB A;  1FQD A;  2VOZ A;  5CMM A;  1SVX B;  3V5A A;  2NWJ A;  1SW2 A;  3PGF A;  1Y3N A;  3VLV A;  1JVY A;  3SET A;  3CFL A;  1ELJ A;  3IJO B;  1QUL A;  5DEX A;  3DEL B;  3MP6 A;  3K6U A;  4U4X A;  1UQW A;  3IB0 A;  4YB7 A;  2RIN A;  2ZYO A;  5FHO A;  3GBA A;  4GXS B;  5TPA A;  5CRY A;  3FD3 A;  2OZZ A;  1FCK A;  3H7M A;  1I6A A;  2E0S A;  4JWX A;  1MG1 A;  2ANJ A;  4QSC A;  2GRV A;  1FQE A;  5KCJ B;  2Y7W A;  4ND9 A;  4ZEK A;  3I6V A;  2V3T A;  1Q1K A;  4RK2 A;  3O28 A;  1VFD A;  1LBC A;  2QL3 A;  4H6D A;  4RJZ A;  1LB9 A;  4N6P A;  3SER A;  2F35 A;  1M5C A;  1Y20 A;  1B52 A;  1NNK A;  4Q30 B;  3EHS A;  1I69 A;  3PD9 A;  1NH7 A;  4JSD A;  3LBS A;  1J1N A;  3KJ7 A;  4OFO A;  4TQU Q;  1SBP A;  1H76 A;  3T66 A;  2HCA A;  5H8Q A;  4GXA A;  2DQV A;  3DP6 A;  3TKD A;  4F3G A;  1OQH A;  4NF8 A;  1L5T A;  4U1Z A;  1ZBM A;  3I3V A;  5I56 B;  4ISU A;  2QPQ A;  3OSQ A;  2Z22 A;  3HN0 A;  1B1H A;  3PUZ E;  2GHB A;  4XXU A;  4G77 A;  4FEB A;  2O68 A;  4DXU A;  2DWJ A;  1IIT A;  2QJE A;  5JEI A;  3PPP A;  4XTC Q;  3PPO A;  5AA2 D;  3TEL A;  1B3L A;  4G68 C;  4G68 B;  4Q5T A;  3FJ7 A;  1N84 A;  1SD3 A;  4GL8 A;  1B40 A;  3IO4 A;  3C35 A;  2XXR A;  2QSX A;  3SEW A;  1AIV A;  2XXQ A;  3A3U A;  1WVJ A;  2X7Q A;  1PB9 A;  3FIR A;  2B3B A;  4H1X A;  2UYE A;  1OIB A;  5DVJ A;  2XX9 A;  4AQ4 A;  1JQF A;  5I59 A;  1AL3 A;  3UOR A;  4F19 A;  3L6H A;  4F31 B;  3S9L C;  3TAJ A;  3MVY A;  1AH5 A;  2F7B A;  2OJT A;  2ONS A;  5DEX B;  4QHQ A;  5CC2 A;  3UP9 A;  3N6T A;  4BDM A;  4QSE A;  1D4N A;  3QK6 A;  1LST A;  1P1O A;  4OES A;  4ECF A;  3D4C A;  3B7D A;  1Y3Q A;  5TPA B;  3DLN A;  3WAF A;  4ESW A;  4JXI A;  4WED A;  2THI A;  3U8Q A;  4HCW A;  5L8D A;  3TYH A;  1P1Q A;  2G93 A;  4QFP A;  3VVD A;  3TDJ A;  5CMC A;  5JK4 A;  3KSX A;  4IY6 A;  2RCA A;  4OZ9 A;  1URS A;  3T93 B;  3K2D A;  2P2A A;  3PMV A;  1DTG A;  4DXB A;  1LAH E;  2Q9T A;  3V83 A;  1B32 A;  1LCF A;  4RPO A;  1M5E A;  1Y9U A;  1F9B A;  3R6U A;  3DP4 A;  3VE1 B;  2XXW A;  4OHN A;  1XHY A;  3KG2 A;  3G3H A;  3UN6 A;  4QSD A;  4IGR A;  1M5D A;  4GLI A;  4TLL B;  2F6P A;  4H8I A;  4X48 A;  4QRZ A;  5BWJ A;  2REJ A;  1POY 1;  2O1M A;  2X26 A;  3MPL A;  4KHZ E;  2FNC A;  3VVF A;  3CG1 A;  5H8Q B;  1MXW A;  2Q2C A;  1D9Y A;  3JV9 A;  2YPN A;  4UA8 A;  4Q8R A;  4O3A A;  1B7Z A;  3TCF A;  2NXO A;  3WAE A;  1FTM A;  2AL5 A;  5J1D A;  3IOU A;  2XXY A;  4U23 A;  4QFO A;  4KCC A;  2QS1 A;  3PPQ A;  3S9M C;  5JTY A;  1SW4 A;  3E13 X;  4BLA A;  3PPR A;  4U2R A;  3B6T A;  4JBZ A;  1PEB A;  4YAH X;  4JB7 A;  4EQB A;  3FAT A;  4WKM A;  3TTR A;  4QFK A;  2ESN A;  3E9X A;  2I6E A;  2ZNT A;  2ZYN A;  3JYR A;  4NWD A;  2I4C A;  5BUU A;  3OO9 A;  3O66 A;  5I59 B;  1Y4C A;  4GVO A;  4R74 A;  1JW4 A;  5FHN A;  3U94 A;  1VFE A;  3G7W A;  3JZJ A;  4HCY A;  5CBR A;  1B7H A;  1IXC A;  3RQT A;  2V3U A;  3LSX A;  3HST A;  1SI1 A;  3TTK A;  3KN7 A;  4N07 A;  3VV5 A;  1H3D A;  1SW1 A;  5I2N A;  2UVH A;  1N0T A;  3LSW A;  4JWY A;  2GH9 A;  4RA1 A;  4EQ7 A;  2UVI A;  3HHF A;  5ISU A;  1NNP A;  3EF7 A;  4YMB A;  4THI A;  2O51 A;  1MM6 A;  3MZ1 A;  1ZMG A;  4WXJ A;  4FAT A;  4FE8 A;  5TP9 A;  4EUO A;  3TEP A;  2F7A A;  3KJT A;  4FED A;  3H03 A;  2H4I A;  2F6G A;  3ZS6 A;  5TU0 A;  3FJG A;  4IO7 A;  4YKP A;  3PUY E;  2WKY A;  2RF1 A;  4BDR A;  2HZL A;  5ICT A;  2DWI A;  4MH5 A;  4F22 A;  5FHM A;  4DCY A;  4KYD A;  2PT2 A;  5F7V A;  1ZIU A;  2FYI A;  2HXW A;  4PQJ A;  1BLF A;  1N7X A;  3RTF B;  3U93 A;  3KN8 A;  3OD7 A;  2O7U A;  5CBS A;  2I3W A;  4BDN A;  3IB1 A;  1II5 A;  3VLU A;  1LB8 A;  1R1N A;  3MBP A;  4F2O A;  5JTY B;  4OEV A;  2ZXT A;  4DIG A;  4DE8 A;  4LQ2 A;  1I6Q A;  4YB5 A;  1MDQ A;  2ALU A;  4F2Q A;  4ELP A;  1A8F A;  1MXV A;  4HTG A;  2DYX A;  1IEJ A;  5I58 A;  1CE2 A;  2CZL A;  2DWH A;  5HPQ A;  2DXR A;  2QMX A;  1ZTY A;  4LON B;  1I6B A;  4G8M A;  4QFN A;  1LGB C;  1B3E A;  1POT A;  1JEU A;  3ZSF A;  3H3G A;  3QYT A;  1EH3 A;  1PBP A;  1MY3 A;  3SEU A;  4YKK A;  2CMO A;  4FIM A;  1GTK A;  1QUI A;  4Z0I A;  2W7Y A;  1MY1 A;  3UIF A;  3TMG A;  3TPA A;  1YTV A;  1PDA A;  4HW8 A;  1VSO A;  3GZG A;  4C1U A;  2P0S A;  5KDT A;  4DLD A;  3ODB A;  1Q35 A;  5HM4 B;  2V3Q A;  3EPE A;  3KFM A;  5IKB A;  3T22 A;  3DM0 A;  2V25 A;  5I2N B;  1S7Y A;  2B65 A;  3TQL A;  1NMU A;  3OSR A;  4PE5 B;  3QSL A;  5CMK A;  3OEN A;  1MQD A;  3KN3 A;  3MVW A;  4U21 A;  2UVJ A;  4IGT A;  3MAM A;  3K6V A;  1B3F A;  4O3C A;  4LZ8 A;  5TP9 B;  3ECR A;  4H5F A;  3C36 A;  1UTB A;  4ELO A;  2GHA A;  1URG A;  4M4G A;  3FXU A;  4OEN A;  1A7L A;  3MC2 A;  3ILU B;  4IO5 A;  1A54 A;  2ZNU A;  5ITO A;  2F8D A;  4XKP A;  1Y1Z A;  1DMB A;  1MXY A;  4C0R A;  3TTM A;  2FA7 A;  2YJP A;  3EQ1 A;  4ZZE A;  5F1Q A;  2OWT A;  2R6G E;  3PMX A;  3H6W A;  4POW A;  4PFT A;  4DZ1 A;  3K1N A;  2XXU A;  4OMB A;  3KOS A;  3FV1 A;  1BKA A;  4H0W A;  5AA1 A;  3MQ9 A;  2O84 X;  1YAE A;  1YPN A;  3K1P A;  1LCT A;  3IB2 A;  2ABH A;  2HAU A;  2QRY A;  4GQO A;  2HEU A;  4XIG Q;  1AMF A;  3RT8 A;  1URD A;  1XOC A;  2E1S A;  3FXQ A;  1S9T A;  1R9Q A;  3HPI A;  1MY4 A;  1MQH A;  1FQA A;  4F1U A;  3PV0 E;  4YU0 A;  4FAJ A;  3MVZ A;  1MXZ A;  1LBB A;  1B51 A;  1B5J A;  5I58 B;  1NNF A;  2OCU A;  3LR1 A;  5M2V A;  5I57 A;  3IOR A;  4G8H A;  4R72 A;  1H44 A;  3V8X B;  2GFE A;  1B4H A;  1N3W A;  3QIM A;  2DE3 A;  4R6H A;  4R6K A;  1LFI A;  3P7I A;  1RYX A;  5DVF A;  4OTE A;  2DE4 A;  3U72 A;  2VD3 A;  1QKB A;  5AA2 A;  3VXB A;  5B7D A;  3H06 B;  4H65 A;  4LAT A;  2D5W A;  3QXM A;  4MLQ A;  4I8C A;  3TCG A;  2OK2 A;  3QUJ A;  1HSJ A;  5KDT B;  4P11 A;  3M3L A;  4BDL A;  3PMW A;  2I0C A;  1GR2 A;  1SQY A;  3KOT A;  2Y7K A;  1UIV A;  2QS4 A;  1GV8 A;  1IIW A;  4IO6 A;  3N94 A;  2Y7R A;  2R9J A;  3R26 A;  2OLB A;  1OLA A;  3HV1 A;  1LLS A;  2XD3 A;  3RGY A;  3AXF A;  4GL0 A;  4X9T A;  4ZS9 A;  5H8F A;  4DDD A;  4EXK A;  2LAO A;  3MP1 A;  4GWO A;  1VR5 A;  2V84 A;  3C31 A;  1UTB B;  3B6W A;  4YB6 A;  4GRK A;  4P0G A;  2A5T A;  3TUS A;  2Y7P A;  1XC1 A;  4F18 A;  4FJP A;  3T9X B;  4RK9 A;  4C1T A;  3TOD A;  3PU5 A;  4ZED A;  2PT1 A;  2F78 A;  3MW0 A;  2I0B A;  3UA8 A;  2Y84 A;  1B3G A;  4XKQ A;  5H8N A;  4NF8 B;  4MFI A;  3CRB A;  5AE4 A;  2O7I A;  5ICQ A;  3O97 A;  3G3J A;  2VGQ A;  3U1O A;  4KD5 A;  3GBB A;  2G29 A;  4EF1 A;  3VDF A;  4IO3 A;  2Q88 A;  4G8N A;  4PFW A;  1QUK A;  2Z23 A;  1B3H A;  3L6G A;  1EU8 A;  4DXC A;  1S50 A;  1EZP A;  3HCQ A;  4U22 A;  1YCJ A;  1FTL A;  4R2F A;  3IOT A;  3SDF A;  3C32 A;  1TFD A;  3SKP A;  3K6X A;  4NED A;  3RY3 A;  5I2K A;  1M5B A;  3VLW A;  3THI A;  1PC3 A;  2O69 A;  5I84 A;  3ONM A;  1JVX A;  1NNT A;  1BP5 A;  1MPC A;  1DTZ A;  4FOR A;  2H25 A;  2Z8D A;  3EHT A;  3H6T A;  5H8H A;  2DS9 A;  2NUV A;  5I57 B;  3K02 A;  4NWC A;  2DP8 A;  4RXL A;  2H98 A;  2Q2A A;  4YKJ A;  1SYH A;  4AB6 A;  4OWD A;  4YZZ A;  1WOD A;  3E4R A;  3G3I A;  2I49 A;  2AIX A;  2A5S A;  2PVU A;  1USY H;  3SEX A;  5A5X A;  4F39 A;  2ZYM A;  2PYY A;  4JDF A;  4I9D A;  4I62 A;  1IXG A;  3N26 A;  5EHS A;  5AA3 A;  1A99 A;  4JWO A;  3OEK A;  1FTK A;  1Z7M E;  2V93 A;  3SEV A;  3TTL A;  1LAG E;  1TT1 A;  1BTJ A;  2XX8 A;  4U4S A;  4MF3 A;  4OEU A;  3OXN A;  2DWA A;  3FZV A;  3FJM A;  4JSO A;  3PUX E;  4LA9 A;  5H8F B;  2O1L A;  3CSB A;  1XT8 A;  3C9H A;  3O6H A;  2DE2 A;  4KYS A;  4TLM B;  1RYO A;  5HBC A;  2A5T B;  4M1V A;  1QVS A;  2ZMB A;  4IO4 A;  4E0W A;  1QJM A;  3KZG A;  1B5I A;  2Y7I A;  1B5H A;  1NH8 A;  3FVG A;  4KR5 A;  5H8N B;  3PUW E;  2XHD A;  1H43 A;  5L9O A;  1IQ7 A;  1Z7N E;  1DPP A;  3G3F A;  2Z8F A;  4KQP A;  3IR1 A;  3PPN A;  1SW5 A;  3RN8 A;  4ZDM A;  3UK4 A;  3V89 B;  1QUJ A;  1P1U A;  4PFU A;  3M3K A;  1NKX A;  4N13 A;  1ANF A;  1UTH A;  3W9V A;  4PET A;  3W9W A;  1B46 A;  4BDQ A;  3CSG A;  4KFQ A;  3Q26 A;  3O6G A;  5I2K B;  1MM7 A;  3MZ9 A;  5L9S A;  1MY0 A;  1MH3 A;  3OEM A;  3S9N C;  3QAX A;  2RKM A;  3ILT B;  1UIU A;  3CFZ A;  3K01 A;  4R9F A;  4XKN A;  3OMB A;  4LQ5 A;  4NF5 A;  3O9P A;  5AA4 A;  5H8H B;  3E3K A;  1B0H A;  3FXR A;  4ELQ A;  3KEI A;  4POX A;  3IAZ A;  3OO6 A;  1N7W A;  4R2B A;  5KZT A;  4F1V A;  1IXI A;  3Q27 A;  3ZKK A;  1FQF A;  1XVX A;  2DVZ A;  3A09 A;  4ZE8 A;  1VE4 A;  3RNN A;  4R9G A;  3K1M A;  5A5X B;  3K0V A;  4ONY A;  4ELR A;  3C34 A;  3TFL A;  1TXF A;  1N3X A;  3K6W A;  5EYF A;  3PD8 A;  4IY5 A;  1MY2 A;  5K2Y A;  4EF2 A;  3TZA A;  5DYH A;  1OLC A;  3GXA A;  2F97 A;  1KWH A;  1JW1 A;  3T9U A;  3T9V A;  1MQJ A;  4UAC A;  2F5X A;  2IA4 A;  1DSN A;  4GF8 A;  3FV2 A;  1B4Z A;  4OFL A;  1D3K A;  3RUM A;  1OMP A;  3KGC A;  3R7X A;  3K4U A;  4U1O A;  2Q8J A;  2XXP A;  2H5Y A;  3VFJ A;  1MQG A;  1QKA A;  1M5F A;  1A55 A;  4BDO A;  3FAS A;  2XXI A;  4R75 A;  4YMA A;  4DCX A;  2KLF A;  4NTL A;  1IZ1 A;  1MDP 1;  4KYE A;  1B58 A;  1B2H A;  3BKI B;  5EHM A;  2PBW A;  3LSF B;  3MUQ A;  2HZK A;  1B1X A;  4QF9 A;  3S2V A;  3C4M A;  1B6H A;  1EZ9 A;  1LAF E;  3MWB A;  3N6U A;  1UTH B;  2ZYK A;  1RKM A;  1QW0 A;  1B9J A;  1XS5 A;  4PFY A;  4Q0C A;  1MH4 A;  3MJN A;  4ZEC A;  5CMB A;  4AB5 A;  4MLV A;  2I48 A;  3BFU A;  4LZ7 A;  2DSF A;  4EDP A;  4EXL A;  3OO8 A;  4NF4 A;  1O63 A;  3RPW A;  1MPD A;  5CI5 A;  1OVT A;  3Q29 A;  4ZE9 A;  5K2X A;  3IL1 B;  3SEY A;  4NF5 B;  1SDX A;  2O6A A;  5AA4 B;  5B70 A;  2B3F A;  1PBQ A;  4MBP A;  1JET A;  4R73 A;  4LZ5 A;  4LVQ A;  3OEL A;  1EZO A;  2AYS A;  4RYA A;  4OFJ A;  4NF6 A;  4P0I A;  3TCH A;  2P1S A;  3W15 C;  1IUD A;  4H67 A;  1FW0 A;  4L17 A;  3LSL A;  2QMW A;  3Q25 A;  3M8U A;  4ZEI A;  3KSJ A;  3U92 A;  2F7C A;  3HO7 A;  1A8E A;  1MQI A;  1B05 A;  1HSL A;  2I58 A;  1MRP A;  1ZKB A;  3EN3 A;  2VHA A;  1JW5 A;  3IOW A;  1GVC A;  2H9B A;  2XXT A;  1US5 A;  5H8S A;  2VD2 A;  2XX7 A;  4H5G A;  2D3I A;  4F1Y A;  1CB6 A;  3A3C A;  2HAV A;  2Z8E A;  3O6I A;  4WEP A;  3PUV E;  2UYF A;  1BIY A;  2F34 A;  4RY1 A;  3VVE A;  4K3F A;  3S9E A;  3MPK A;  3TTN A;  4IO2 A;  4NE4 A;  1USY E;  4I1D A;  1SI0 A;  1DOT A;  1HSE A;  4R6Y A;  3B6Q A;  4LP2 B;  4KPT A;  1N76 A;  1NFT A;  4IB2 A;  3CFX A;  2ZNS A;  4O3B A;  3FVO A;  3CR9 A;  1Y3P A;  4F3P A;  3EHU A;  3CIJ A;  3N5L A;  3LC8 A;  1OVB A;  1P1N A;  2NOO A;  3MP8 A;  3FGS A;  1MS7 A;  3I5O A;  3CVG A;  4QFL A;  3FUZ A;  1T0K A;  3KBR A;  2BJJ X;  2OBG A;  4GIZ A;  2RC8 A;  1N04 A;  4OER A;  3Q28 A;  4GFR A;  3UGW A;  2AL4 A;  3H6U A;  4RNS A;  1LFH A;  3F11 A;  2DOJ A;  1ZLQ A;  3C33 A;  1IXH A;  3T9H B;  3IO6 A;  4NF4 B;  4ZEB A;  1MXX A;  3HHG A;  5DT6 A;  3IX1 A;  5L9M A;  4YIC A;  3RLF E;  4F29 A;  1TFA A;  4G2Z A;  4H8J A;  5ITP A;  2XXX A;  4OET A;  4EQ9 A;  3CI8 A;  1Y1M A;  1P1W A;  1O7T A;  4F3S A;  3RT6 B;  4E0X A;  5AA2 B;  1Y4T A;  2HQ0 A;  4TOZ A;  2IEE A;  1LAX A;  3D4G A;  4KCD A;  4PP0 A;  3GLB A;  1MXU A;  5IAI A;  3VXC A;  2D21 A;  4NF6 B;  1WDN A;  3DP8 A;  2QS2 A;  3IOV A;  2M8C A;  5KCJ A;  3QUF A;  2UXA A;  2R71 A;  1B7U A;  2XD2 A;  3TQW A;  4Z7E A;  4ESX A;  1NL5 A;  1DPE A;  5FTH A;  1FQB A;  3S4U A;  1FTJ A;  4RPN A;  4X1D A;  1PB8 A;  2NVU B;  2REG A;  1D9V A;  3BBR A;  3CG3 A;  1FQC A;  3T96 B;  2XXV A;  4GOT A;  4OQO A;  1ATG A;  1PB7 A;  4YKI A;  2PX1 A;  1ZU0 A;  3H4Z A;  1XVY A;  1LFG A;  3USD A;  1US4 A;  1ZJL A;  3BFT A;  3OO7 A;  2H99 A;  4GD5 A;  1JEV A;  1O64 A;  5ELV A;  3O2A A;  1MPB A;  2RC9 A;  3M3F A;  2YLN A;  1AOV A;  2ONK E;  2X7P A;  5DVI A;  2XXH A;  4OVJ A;  4F3B A;  4ZZA A;  5CM6 A;  1R6Z A;  4HS7 A;  3RTW B;  4NMY A;  2HFB A;  2I3V A;  1TWY A;  2DXY A;  4OXV A;  1B0L A;  4OYV A; 
#chains in the Genus database with same CATH topology
 2QS3 A;  5I56 A;  4FEC A;  1IMA A;  2RCB A;  1GGG A;  3K00 A;  3SES A;  1R9L A;  3LUY A;  2QVV A;  4XKR A;  2UVG A;  2F36 A;  2F3B A;  2VP1 A;  1OQG A;  1A40 A;  1JNF A;  3IK6 B;  4G68 A;  3ZKL A;  3MVX A;  3FVK A;  4LUB A;  1P99 A;  4G4P A;  2OWS A;  1FTO A;  3H6V A;  2Q89 A;  2PMS A;  5FTI A;  1FRP A;  1SYI A;  4KI0 E;  4X1B A;  5LOM A;  3O29 A;  3G3G A;  2ONR A;  3OOA A;  3MZB A;  3FVN A;  2RC7 A;  3IJX B;  3G3K A;  4ZEF A;  2DVC A;  1H45 A;  2I4B A;  5DTB A;  1FQD A;  2VOZ A;  5CMM A;  1SVX B;  3V5A A;  2NWJ A;  1SW2 A;  3PGF A;  1DCU A;  1Y3N A;  3VLV A;  1JVY A;  3SET A;  3CFL A;  1ELJ A;  3IJO B;  1QUL A;  5DEX A;  3DEL B;  3MP6 A;  3K6U A;  4U4X A;  1UQW A;  3IB0 A;  4YB7 A;  2RIN A;  2ZYO A;  5FHO A;  3GBA A;  4NX1 A;  4GXS B;  3KC1 A;  5TPA A;  5CRY A;  3FD3 A;  4PBH A;  2OZZ A;  1FCK A;  3H7M A;  1I6A A;  2V4C A;  2E0S A;  4JWX A;  1MG1 A;  4PAF A;  2ANJ A;  4QSC A;  2GRV A;  1FQE A;  5KCJ B;  4P47 A;  4PAI A;  2Y7W A;  4ND9 A;  4ZEK A;  3BIG A;  3I6V A;  2V3T A;  1Q1K A;  4RK2 A;  3O28 A;  5IZ3 A;  1VFD A;  1LBC A;  2QL3 A;  1NV0 A;  4H6D A;  4RJZ A;  1LB9 A;  4N6P A;  3SER A;  1BK4 A;  2F35 A;  1M5C A;  1Y20 A;  1B52 A;  2XWI A;  1NNK A;  4Q30 B;  3EHS A;  1FJ9 A;  1I69 A;  3PD9 A;  2CEY A;  1NH7 A;  4JSD A;  3LBS A;  3ISP A;  1J1N A;  3KJ7 A;  4OFO A;  4TQU Q;  1SBP A;  1H76 A;  3T66 A;  2HCA A;  5EYH A;  5H8Q A;  4GXA A;  2DQV A;  3DP6 A;  3TKD A;  4F3G A;  1OQH A;  4NF8 A;  1L5T A;  4U1Z A;  1ZBM A;  4OVS A;  3I3V A;  5I56 B;  1INP A;  4ISU A;  2QPQ A;  3OSQ A;  2Z22 A;  4MNC A;  4OA4 A;  3HN0 A;  1B1H A;  3PUZ E;  2GHB A;  4XXU A;  5I3S A;  4G77 A;  4FEB A;  2O68 A;  4DXU A;  2DWJ A;  1IIT A;  2QJE A;  5JEI A;  3PPP A;  4XTC Q;  3PPO A;  5AA2 D;  3TEL A;  1B3L A;  4G68 C;  4PFB A;  4G68 B;  4Q5T A;  3FJ7 A;  1N84 A;  1SD3 A;  4GL8 A;  1FPD A;  1B40 A;  3T1B A;  2CEX A;  3IO4 A;  3C35 A;  2XXR A;  2QSX A;  2PFY A;  3SEW A;  1AIV A;  2XXQ A;  3A3U A;  1WVJ A;  2X7Q A;  1PB9 A;  2QVU A;  3FIR A;  2B3B A;  4I3E A;  4H1X A;  2UYE A;  1OIB A;  5DVJ A;  2XX9 A;  4OVP A;  4AQ4 A;  1JQF A;  5I59 A;  1AL3 A;  3UOR A;  2FBP A;  4N6K A;  4F19 A;  3L6H A;  4F31 B;  3S9L C;  3TAJ A;  3MVY A;  3MYU A;  4XEQ A;  1AH5 A;  2F7B A;  2OJT A;  2ONS A;  4GX6 A;  5DEX B;  4QHQ A;  2Y5L A;  5CC2 A;  4N8G A;  3UP9 A;  3N6T A;  4BDM A;  4QSE A;  1D4N A;  3QK6 A;  1LST A;  1P1O A;  1NV5 A;  4OES A;  4ECF A;  3D4C A;  3B7D A;  4N15 A;  1Y3Q A;  1NUY A;  5TPA B;  3DLN A;  3WAF A;  4ESW A;  4JXI A;  4WED A;  2THI A;  3U8Q A;  4HCW A;  5L8D A;  3TYH A;  1P1Q A;  2CZI A;  2G93 A;  4QFP A;  2FVZ A;  3VVD A;  3TDJ A;  5CMC A;  4OVQ A;  5JK4 A;  4DI3 D;  3KSX A;  4IY6 A;  2RCA A;  4N81 A;  4OZ9 A;  1URS A;  3T93 B;  3K2D A;  2P2A A;  3PMV A;  4GWS A;  1DTG A;  5IZ3 B;  4DXB A;  1LAH E;  2Q9T A;  3V83 A;  1B32 A;  1LCF A;  1YZ0 A;  4O7I A;  1VDW A;  1EYJ A;  4RPO A;  1M5E A;  4MIJ A;  1Y9U A;  5I7I A;  1F9B A;  3R6U A;  3DP4 A;  4O94 A;  3VE1 B;  2XXW A;  4OHN A;  1XHY A;  3KG2 A;  3G3H A;  3UN6 A;  4QSD A;  3HFU A;  4IGR A;  1M5D A;  4GLI A;  4TLL B;  2F6P A;  4H8I A;  4X48 A;  4NHB A;  4QRZ A;  5BWJ A;  2REJ A;  1POY 1;  2O1M A;  2X26 A;  3MPL A;  4KHZ E;  2FNC A;  3VVF A;  3CG1 A;  5H8Q B;  1MXW A;  2Q2C A;  1D9Y A;  3JV9 A;  2YPN A;  2P3V A;  3RPL A;  4UA8 A;  4HXV A;  4QXD A;  2HXR A;  4Q8R A;  4O3A A;  4GWX A;  1B7Z A;  3TCF A;  2NXO A;  3WAE A;  1FTM A;  2AL5 A;  5J1D A;  3IOU A;  2XXY A;  4U23 A;  4N4U A;  4QFO A;  4KCC A;  2QS1 A;  4I3Y A;  3PPQ A;  3S9M C;  5JTY A;  1SW4 A;  3E13 X;  4BLA A;  1QGX A;  3PPR A;  4U2R A;  2XA5 A;  1EYK A;  3B6T A;  4JBZ A;  1PEB A;  4YAH X;  4JB7 A;  4EQB A;  3FAT A;  4WKM A;  3TTR A;  4P8B A;  4QFK A;  2ESN A;  3E9X A;  2I6E A;  4QBA A;  2ZNT A;  4N6D A;  5LTC A;  2ZYN A;  3JYR A;  4NWD A;  2I4C A;  5BUU A;  3OO9 A;  3O66 A;  5I59 B;  1FTA A;  1Y4C A;  4GVO A;  4R74 A;  1JW4 A;  5FHN A;  3U94 A;  1VFE A;  1FPJ A;  3G7W A;  3JZJ A;  4HCY A;  5CBR A;  5FBP A;  1B7H A;  4MCO A;  1IXC A;  5ET7 A;  3RQT A;  2HHM A;  2V3U A;  3LSX A;  3HST A;  1SI1 A;  3TTK A;  4NG7 A;  3KN7 A;  4N07 A;  3VV5 A;  1H3D A;  1SW1 A;  5I2N A;  2UVH A;  1N0T A;  3LSW A;  4JWY A;  2GH9 A;  4RA1 A;  4EQ7 A;  2UVI A;  3U65 A;  3HHF A;  5ISU A;  1NNP A;  3EF7 A;  4YMB A;  4THI A;  2O51 A;  1MM6 A;  1Q9D A;  3MZ1 A;  1ZMG A;  4WXJ A;  4FAT A;  4MNI A;  4FE8 A;  3CHG A;  5TP9 A;  2JJK A;  4EUO A;  3TEP A;  2F7A A;  3KJT A;  4FED A;  1FPI A;  2PCR A;  3H03 A;  2H4I A;  1NV7 A;  1KA1 A;  2F6G A;  3ZS6 A;  1G0H A;  5TU0 A;  3FJG A;  4IO7 A;  4YKP A;  3PUY E;  2WKY A;  2RF1 A;  4BDR A;  2HZL A;  5ICT A;  2WYP A;  2DWI A;  3LV0 A;  4MH5 A;  4F22 A;  1FBE A;  5FHM A;  4DCY A;  3KC0 A;  4KYD A;  2PT2 A;  5A5L A;  4PCD A;  5F7V A;  1ZIU A;  2FYI A;  2HXW A;  4PQJ A;  5ESY A;  1BLF A;  3RPL B;  4MMP A;  1N7X A;  5EYG A;  3RTF B;  3U93 A;  1CNQ A;  3KN8 A;  3OD7 A;  2O7U A;  5CBS A;  2I3W A;  4BDN A;  3IB1 A;  1II5 A;  3VLU A;  1LB8 A;  1R1N A;  3MBP A;  4F2O A;  4PF8 A;  3LUZ A;  5JTY B;  2FIE A;  4OEV A;  2ZXT A;  2WBD A;  4DIG A;  4DE8 A;  4LQ2 A;  1I6Q A;  1FPL A;  2GQ1 A;  4YB5 A;  1MDQ A;  3D1R A;  2ALU A;  4F2Q A;  4DI4 B;  4ELP A;  1A8F A;  1MXV A;  4HTG A;  2DYX A;  1IEJ A;  5I58 A;  1CE2 A;  2CZL A;  1NUZ A;  2DWH A;  5HPQ A;  2DXR A;  2QMX A;  1ZTY A;  4LON B;  1I6B A;  4G8M A;  4QFN A;  1LGB C;  1B3E A;  1POT A;  1JEU A;  3ZSF A;  3H3G A;  3QYT A;  1EH3 A;  1PBP A;  1MY3 A;  3SEU A;  4YKK A;  2CMO A;  4FIM A;  1GTK A;  1QUI A;  4Z0I A;  2W7Y A;  1NV4 A;  1MY1 A;  3UIF A;  3TMG A;  3TPA A;  1YTV A;  3A29 A;  1PDA A;  4HW8 A;  1VSO A;  1KZ8 A;  3GZG A;  4C1U A;  1DK4 A;  4GBV A;  2P0S A;  5KDT A;  4DLD A;  3ODB A;  1Q35 A;  5HM4 B;  2V3Q A;  3EPE A;  3KFM A;  1JP4 A;  5IZ1 A;  5IKB A;  4MNP A;  3EKI A;  2F3D A;  3T22 A;  3DM0 A;  2V25 A;  5I2N B;  1S7Y A;  2B65 A;  3TQL A;  1NMU A;  3OSR A;  4PE5 B;  3QSL A;  5CMK A;  3OEN A;  5F24 A;  1FPE A;  1MQD A;  3KN3 A;  3MVW A;  4U21 A;  2UVJ A;  4IGT A;  3MAM A;  3K6V A;  2WEF A;  1B3F A;  4O3C A;  4LZ8 A;  5TP9 B;  3ECR A;  4H5F A;  3C36 A;  1UTB A;  4XFE A;  4ELO A;  2GHA A;  1URG A;  4M4G A;  3FXU A;  4OEN A;  5IZZ A;  1A7L A;  3MC2 A;  4P1E A;  3ILU B;  4IO5 A;  1A54 A;  1LBY A;  2ZNU A;  2WYK A;  5ITO A;  2F8D A;  4XKP A;  1Y1Z A;  1DMB A;  1MXY A;  3IFA A;  4C0R A;  3TTM A;  2FA7 A;  2YJP A;  3EQ1 A;  4ZZE A;  5F1Q A;  2OWT A;  2R6G E;  2HPG A;  3PMX A;  3H6W A;  4POW A;  3SZP A;  4PFT A;  2ZZX A;  4PF6 A;  4DZ1 A;  3K1N A;  2XXU A;  4OMB A;  3KOS A;  3FV1 A;  1BKA A;  4H0W A;  5AA1 A;  3MQ9 A;  2O84 X;  1YAE A;  1YPN A;  3K1P A;  1LCT A;  1FPG A;  3IB2 A;  2ABH A;  2HAU A;  2QRY A;  4GQO A;  2Q74 A;  2HEU A;  4XIG Q;  1AMF A;  3RT8 A;  1URD A;  1XOC A;  2E1S A;  3FXQ A;  4O8M A;  1S9T A;  1R9Q A;  3HPI A;  1MY4 A;  1MQH A;  1FQA A;  4F1U A;  3PV0 E;  4YU0 A;  4FAJ A;  2L5V A;  4X04 A;  4P3L A;  3MVZ A;  4PGP A;  1MXZ A;  1LBB A;  1B51 A;  4MJO A;  1B5J A;  5I58 B;  1NNF A;  2OCU A;  1YXI A;  3LR1 A;  5M2V A;  5I57 A;  3IOR A;  4G8H A;  4R72 A;  1H44 A;  3V8X B;  2GFE A;  1B4H A;  1N3W A;  3QIM A;  4P56 A;  2DE3 A;  4R6H A;  4OVR A;  4R6K A;  1LFI A;  3P7I A;  1RYX A;  5DVF A;  4OTE A;  4AS4 A;  2DE4 A;  3U72 A;  2VD3 A;  4HE0 A;  1QKB A;  5AA2 A;  3VXB A;  5B7D A;  3H06 B;  4H65 A;  4LAT A;  2D5W A;  3QXM A;  4MLQ A;  4I8C A;  3TCG A;  2OK2 A;  3QUJ A;  1HSJ A;  4GWU A;  5KDT B;  4P11 A;  3M3L A;  4BDL A;  3PMW A;  2I0C A;  1GR2 A;  1SQY A;  3KOT A;  2Y7K A;  1UIV A;  2KQZ A;  2QS4 A;  1GV8 A;  1IIW A;  4IO6 A;  3N94 A;  2Y7R A;  4GBW A;  2R9J A;  3R26 A;  2OLB A;  1OLA A;  3HV1 A;  1LLS A;  2XD3 A;  3RGY A;  4NGU A;  1FPB A;  3AXF A;  4GL0 A;  4GX4 A;  2FIX A;  4X9T A;  4ZS9 A;  5H8F A;  4DDD A;  4EXK A;  4PAK A;  2ZZW A;  2LAO A;  3MP1 A;  4GWO A;  1VR5 A;  2V84 A;  3C31 A;  1UTB B;  3B6W A;  4YB6 A;  4GRK A;  4P0G A;  2A5T A;  3TUS A;  2Y7P A;  1XC1 A;  4F18 A;  4FJP A;  3T9X B;  4RK9 A;  4C1T A;  3TOD A;  2P3N A;  3PU5 A;  4ZED A;  2PT1 A;  2F78 A;  3MW0 A;  2I0B A;  3UA8 A;  2Y84 A;  1B3G A;  4XKQ A;  2B4L A;  5H8N A;  4NF8 B;  4MFI A;  3CRB A;  5AE4 A;  2O7I A;  1FPF A;  5ICQ A;  3O97 A;  3G3J A;  2VGQ A;  4JVC A;  3U1O A;  4KD5 A;  3GBB A;  2G29 A;  4EF1 A;  3VDF A;  4IO3 A;  2Q88 A;  4G8N A;  4PFW A;  1QUK A;  2Z23 A;  1B3H A;  3L6G A;  1EU8 A;  4DXC A;  1S50 A;  1EZP A;  3HCQ A;  1FJ6 A;  4U22 A;  1YCJ A;  1LBZ A;  1FTL A;  4R2F A;  3IOT A;  4AS5 A;  3SDF A;  3C32 A;  1TFD A;  3SKP A;  3K6X A;  4NED A;  3RY3 A;  4PDD A;  4HE1 A;  5I2K A;  1M5B A;  3VLW A;  3THI A;  1PC3 A;  2O69 A;  4PE3 A;  5I84 A;  3E79 A;  3ONM A;  1JVX A;  1NNT A;  1BP5 A;  1FBC A;  1MPC A;  1DTZ A;  4FOR A;  2H25 A;  2Z8D A;  3EHT A;  2XWV A;  3H6T A;  4N91 A;  5H8H A;  2DS9 A;  2NUV A;  5I57 B;  4NN3 A;  3K02 A;  4NWC A;  2DP8 A;  2Y5K A;  4RXL A;  2H98 A;  2Q2A A;  4YKJ A;  1SYH A;  4AB6 A;  4OWD A;  4YZZ A;  1WOD A;  3E4R A;  1LEV A;  5J16 A;  3G3I A;  2I49 A;  2AIX A;  2A5S A;  2PVU A;  1USY H;  1NV6 A;  4PTK A;  3SEX A;  5A5X A;  4F39 A;  2ZYM A;  4MX6 A;  2PYY A;  4JDF A;  4I9D A;  2WX9 A;  1IXG A;  4I62 A;  3N26 A;  1G0I A;  5EHS A;  5AA3 A;  1A99 A;  4JWO A;  4P9K A;  3OEK A;  1FTK A;  4FBP A;  1Z7M E;  2V93 A;  3SEV A;  3TTL A;  1LAG E;  1TT1 A;  1BTJ A;  2XX8 A;  4U4S A;  4IR8 A;  4MF3 A;  5LDZ A;  4OEU A;  1KA0 A;  3OXN A;  2DWA A;  3FZV A;  3FJM A;  4JSO A;  4NAP A;  3KBZ A;  3PUX E;  4LA9 A;  5H8F B;  2O1L A;  3CSB A;  1XT8 A;  3C9H A;  3O6H A;  2DE2 A;  4KYS A;  4TLM B;  1FBP A;  2VPO A;  1RYO A;  5HBC A;  2A5T B;  4M1V A;  4O7M A;  2ZZV A;  1QVS A;  2ZMB A;  4PFR A;  4IO4 A;  4E0W A;  1QJM A;  3KZG A;  1B5I A;  2WBB A;  2Y7I A;  1B5H A;  1NH8 A;  3FBP A;  3FVG A;  4KR5 A;  5H8N B;  2FHY A;  4G61 A;  3PUW E;  2XHD A;  1H43 A;  4OVT A;  5L9O A;  1IQ7 A;  4I40 A;  1Z7N E;  1DPP A;  3G3F A;  2Z8F A;  2VPN A;  1DBZ A;  4KQP A;  3IR1 A;  3PPN A;  5EQ9 A;  1SW5 A;  3RN8 A;  5I5P A;  1NV3 A;  4ZDM A;  3UK4 A;  3V89 B;  1QUJ A;  1P1U A;  4PFU A;  3M3K A;  1NKX A;  4N13 A;  1ANF A;  1UTH A;  3W9V A;  1D9Q A;  2OX3 A;  4PET A;  3W9W A;  1B46 A;  4BDQ A;  3CSG A;  4GWW A;  4KFQ A;  2XWO A;  3Q26 A;  3O6G A;  5I2K B;  1MM7 A;  3MZ9 A;  5L9S A;  1MY0 A;  2VT5 A;  1MH3 A;  3OEM A;  3S9N C;  3QAX A;  4GX3 A;  2RKM A;  3GYY A;  3ILT B;  1UIU A;  3CFZ A;  3K01 A;  4UAB A;  4R9F A;  2OWZ A;  4XKN A;  3OMB A;  4LQ5 A;  1RDZ A;  4NF5 A;  3O9P A;  4NQ8 A;  5AA4 A;  5H8H B;  3E3K A;  1B0H A;  3FXR A;  4ELQ A;  3KEI A;  4POX A;  3IAZ A;  3OO6 A;  1N7W A;  4R2B A;  5KZT A;  4F1V A;  1IXI A;  3Q27 A;  3ZKK A;  1FQF A;  1XVX A;  2DVZ A;  3A09 A;  4ZE8 A;  1VE4 A;  3RNN A;  4R9G A;  5IM2 A;  3K1M A;  1NUX A;  2CZK A;  5A5X B;  3K0V A;  1K9Z A;  4ONY A;  4ELR A;  3C34 A;  3TFL A;  1TXF A;  1N3X A;  1NUW A;  3K6W A;  5EYF A;  3PD8 A;  4IY5 A;  1MY2 A;  5K2Y A;  4EF2 A;  3TZA A;  5DYH A;  4PDH A;  1IMD A;  1OLC A;  3GXA A;  2F97 A;  1AWB A;  1KWH A;  1JW1 A;  3T9U A;  3T9V A;  3ROJ A;  4MAG A;  1IMB A;  2B4M A;  1MQJ A;  4UAC A;  4XF5 A;  2F5X A;  2IA4 A;  1DSN A;  4GF8 A;  3FV2 A;  4GWY A;  1B4Z A;  4OFL A;  1D3K A;  3RUM A;  1LBW A;  1OMP A;  3KGC A;  3R7X A;  3K4U A;  3FXB A;  4U1O A;  2Q8J A;  2XXP A;  2H5Y A;  2Q8M A;  3VFJ A;  1MQG A;  1FSA A;  1QKA A;  1M5F A;  4NF0 A;  2DDK A;  1A55 A;  4BDO A;  3FAS A;  4PGN A;  2XXI A;  1RDY A;  4N8Y A;  4R75 A;  4YMA A;  4DCX A;  2KLF A;  4NTL A;  1IZ1 A;  1MDP 1;  4KYE A;  1B58 A;  1B2H A;  3BKI B;  5DW8 A;  5EHM A;  5ET5 A;  2PBW A;  3LSF B;  3MUQ A;  2HZK A;  4H45 A;  1B1X A;  4MHF A;  4QF9 A;  1XI6 A;  4HE2 A;  3S2V A;  3C4M A;  1B6H A;  1EZ9 A;  1LAF E;  3MWB A;  3N6U A;  1UTH B;  2ZYK A;  1RKM A;  1QW0 A;  1B9J A;  1XS5 A;  4PFY A;  4Q0C A;  1MH4 A;  3MJN A;  4ZEC A;  5CMB A;  4AB5 A;  4MLV A;  2I48 A;  3BFU A;  4LZ7 A;  2DSF A;  4EDP A;  4EXL A;  3OO8 A;  4NF4 A;  4PC9 A;  1O63 A;  3RPW A;  2R8T A;  1MPD A;  5CI5 A;  1OVT A;  1YYZ A;  3Q29 A;  4ZE9 A;  2BJI A;  5K2X A;  3IL1 B;  3SEY A;  4NF5 B;  1SDX A;  2O6A A;  5AA4 B;  5B70 A;  2B3F A;  2XXK A;  1PBQ A;  4MBP A;  1JET A;  4R73 A;  4LZ5 A;  4LVQ A;  2PFZ A;  3OEL A;  1EZO A;  2AYS A;  2QFL A;  4RYA A;  4OFJ A;  4NF6 A;  4P0I A;  3TCH A;  3E78 A;  2P1S A;  3W15 C;  1IUD A;  4H67 A;  1FW0 A;  4L17 A;  3LSL A;  2QMW A;  3Q25 A;  3M8U A;  4ZEI A;  1LBX A;  3KSJ A;  5ET8 A;  3U92 A;  4MEV A;  2F7C A;  3HO7 A;  1A8E A;  1MQI A;  1B05 A;  1HSL A;  2I58 A;  5EQ7 A;  1LBV A;  1MRP A;  1ZKB A;  3EN3 A;  2VHA A;  1JW5 A;  3IOW A;  1GVC A;  2H9B A;  2XXT A;  1US5 A;  5H8S A;  2VD2 A;  2XX7 A;  4H5G A;  2CZH A;  2D3I A;  4F1Y A;  1CB6 A;  3A3C A;  2HAV A;  2KR0 A;  2Z8E A;  3O6I A;  4WEP A;  3PUV E;  2UYF A;  1BIY A;  2F34 A;  4RY1 A;  3VVE A;  4N17 A;  5T3J A;  4K3F A;  3S9E A;  3MPK A;  3TTN A;  4IO2 A;  4NE4 A;  3PTY A;  1USY E;  4I1D A;  1SI0 A;  1DOT A;  1HSE A;  4R6Y A;  3B6Q A;  4LP2 B;  4KPT A;  1IME A;  1N76 A;  3B50 A;  4KXP A;  4OAN A;  1NFT A;  4IB2 A;  3CFX A;  2ZNS A;  4O3B A;  3FVO A;  3CR9 A;  1FBH A;  1Y3P A;  4F3P A;  3EHU A;  3CIJ A;  3N5L A;  3LC8 A;  4PFI A;  1OVB A;  1P1N A;  2NOO A;  3MP8 A;  3FGS A;  1MS7 A;  1NV2 A;  3CVG A;  3I5O A;  4QFL A;  3FUZ A;  1T0K A;  3KBR A;  2BJJ X;  2OBG A;  4GIZ A;  2RC8 A;  1N04 A;  4OER A;  3Q28 A;  4GFR A;  3UGW A;  2AL4 A;  4H46 A;  3H6U A;  4RNS A;  1LFH A;  1NI9 A;  3F11 A;  2DOJ A;  1ZLQ A;  3C33 A;  1IXH A;  3T9H B;  3IO6 A;  4NF4 B;  4ZEB A;  1MXX A;  3HHG A;  2XWK A;  5DT6 A;  3IX1 A;  5L9M A;  1NV1 A;  4YIC A;  3RLF E;  4F29 A;  1TFA A;  4G2Z A;  4H8J A;  5ITP A;  1IMC A;  2XXX A;  2MKZ A;  4OET A;  4EQ9 A;  3CI8 A;  1Y1M A;  1P1W A;  3NOH A;  5ET6 A;  1O7T A;  4F3S A;  3RT6 B;  4E0X A;  5AA2 B;  3QMF A;  1Y4T A;  2HQ0 A;  1SPI A;  4LN5 A;  4TOZ A;  2IEE A;  1LAX A;  1FBF A;  4KCD A;  3D4G A;  4PP0 A;  1IMF A;  3MST A;  1FBD A;  3GLB A;  1MXU A;  5IAI A;  5EQ8 A;  3VXC A;  2D21 A;  4NF6 B;  1WDN A;  3DP8 A;  2QS2 A;  3IOV A;  2M8C A;  5KCJ A;  3QUF A;  2UXA A;  2R71 A;  4P1L A;  1B7U A;  4PBQ A;  2XD2 A;  3TQW A;  4Z7E A;  4ESX A;  1FPK A;  1NL5 A;  1K9Y A;  4JVD A;  1DPE A;  5FTH A;  1FQB A;  3BIH A;  3S4U A;  1FTJ A;  2QVR A;  4RPN A;  4JVI A;  4X1D A;  1PB8 A;  2NVU B;  3RYD A;  1RDX A;  2REG A;  1FBG A;  1D9V A;  3BBR A;  3CG3 A;  1FQC A;  3T96 B;  2XXV A;  4GOT A;  4OQO A;  1ATG A;  1PB7 A;  4YKI A;  2PX1 A;  1ZU0 A;  3H4Z A;  1XVY A;  1LFG A;  4X8R A;  3USD A;  5IGA A;  1US4 A;  1EYI A;  1ZJL A;  3BFT A;  3OO7 A;  2H99 A;  3IFC A;  4GD5 A;  1JEV A;  1O64 A;  5ELV A;  3O2A A;  1MPB A;  2RC9 A;  3M3F A;  3T0J A;  2YLN A;  1AOV A;  2ONK E;  2X7P A;  5DVI A;  2XXH A;  4OVJ A;  4F3B A;  4ZZA A;  3B8B A;  5CM6 A;  1R6Z A;  4HS7 A;  3RTW B;  4NMY A;  2HFB A;  2I3V A;  1TWY A;  2DXY A;  4GWZ A;  4OXV A;  1B0L A;  4OYV A;  5EQA A; 
#chains in the Genus database with same CATH homology
 2QS3 A;  5I56 A;  4FEC A;  2RCB A;  1GGG A;  3K00 A;  3SES A;  1R9L A;  3LUY A;  4XKR A;  2UVG A;  2F36 A;  2VP1 A;  1OQG A;  1A40 A;  1JNF A;  3IK6 B;  4G68 A;  3ZKL A;  3MVX A;  3FVK A;  4LUB A;  1P99 A;  4G4P A;  2OWS A;  1FTO A;  3H6V A;  2Q89 A;  2PMS A;  5FTI A;  1SYI A;  4KI0 E;  4X1B A;  5LOM A;  3O29 A;  3G3G A;  2ONR A;  3OOA A;  3MZB A;  3FVN A;  2RC7 A;  3IJX B;  3G3K A;  4ZEF A;  2DVC A;  1H45 A;  2I4B A;  5DTB A;  1FQD A;  2VOZ A;  5CMM A;  1SVX B;  3V5A A;  2NWJ A;  1SW2 A;  3PGF A;  1Y3N A;  3VLV A;  1JVY A;  3SET A;  3CFL A;  1ELJ A;  3IJO B;  1QUL A;  5DEX A;  3DEL B;  3MP6 A;  3K6U A;  4U4X A;  1UQW A;  3IB0 A;  4YB7 A;  2RIN A;  2ZYO A;  5FHO A;  3GBA A;  4GXS B;  5TPA A;  5CRY A;  3FD3 A;  2OZZ A;  1FCK A;  3H7M A;  1I6A A;  2E0S A;  4JWX A;  1MG1 A;  2ANJ A;  4QSC A;  2GRV A;  1FQE A;  5KCJ B;  2Y7W A;  4ND9 A;  4ZEK A;  3I6V A;  2V3T A;  1Q1K A;  4RK2 A;  3O28 A;  1VFD A;  1LBC A;  2QL3 A;  4H6D A;  4RJZ A;  1LB9 A;  4N6P A;  3SER A;  2F35 A;  1M5C A;  1Y20 A;  1B52 A;  1NNK A;  4Q30 B;  3EHS A;  1I69 A;  3PD9 A;  1NH7 A;  4JSD A;  3LBS A;  1J1N A;  3KJ7 A;  4OFO A;  4TQU Q;  1SBP A;  1H76 A;  3T66 A;  2HCA A;  5H8Q A;  4GXA A;  2DQV A;  3DP6 A;  3TKD A;  4F3G A;  1OQH A;  4NF8 A;  1L5T A;  4U1Z A;  1ZBM A;  3I3V A;  5I56 B;  4ISU A;  2QPQ A;  3OSQ A;  2Z22 A;  3HN0 A;  1B1H A;  3PUZ E;  2GHB A;  4XXU A;  4G77 A;  4FEB A;  2O68 A;  4DXU A;  2DWJ A;  1IIT A;  2QJE A;  5JEI A;  3PPP A;  4XTC Q;  3PPO A;  5AA2 D;  3TEL A;  1B3L A;  4G68 C;  4G68 B;  4Q5T A;  3FJ7 A;  1N84 A;  1SD3 A;  4GL8 A;  1B40 A;  3IO4 A;  3C35 A;  2XXR A;  2QSX A;  3SEW A;  1AIV A;  2XXQ A;  3A3U A;  1WVJ A;  2X7Q A;  1PB9 A;  3FIR A;  2B3B A;  4H1X A;  2UYE A;  1OIB A;  5DVJ A;  2XX9 A;  4AQ4 A;  1JQF A;  5I59 A;  1AL3 A;  3UOR A;  4F19 A;  3L6H A;  4F31 B;  3S9L C;  3TAJ A;  3MVY A;  1AH5 A;  2F7B A;  2OJT A;  2ONS A;  5DEX B;  4QHQ A;  5CC2 A;  3UP9 A;  3N6T A;  4BDM A;  4QSE A;  1D4N A;  3QK6 A;  1LST A;  1P1O A;  4OES A;  4ECF A;  3D4C A;  3B7D A;  1Y3Q A;  5TPA B;  3DLN A;  3WAF A;  4ESW A;  4JXI A;  4WED A;  2THI A;  3U8Q A;  4HCW A;  5L8D A;  3TYH A;  1P1Q A;  2G93 A;  4QFP A;  3VVD A;  3TDJ A;  5CMC A;  5JK4 A;  3KSX A;  4IY6 A;  2RCA A;  4OZ9 A;  1URS A;  3T93 B;  3K2D A;  2P2A A;  3PMV A;  1DTG A;  4DXB A;  1LAH E;  2Q9T A;  3V83 A;  1B32 A;  1LCF A;  4RPO A;  1M5E A;  1Y9U A;  1F9B A;  3R6U A;  3DP4 A;  3VE1 B;  2XXW A;  4OHN A;  1XHY A;  3KG2 A;  3G3H A;  3UN6 A;  4QSD A;  4IGR A;  1M5D A;  4GLI A;  4TLL B;  2F6P A;  4H8I A;  4X48 A;  4QRZ A;  5BWJ A;  2REJ A;  1POY 1;  2O1M A;  2X26 A;  3MPL A;  4KHZ E;  2FNC A;  3VVF A;  3CG1 A;  5H8Q B;  1MXW A;  2Q2C A;  1D9Y A;  3JV9 A;  2YPN A;  4UA8 A;  4Q8R A;  4O3A A;  1B7Z A;  3TCF A;  2NXO A;  3WAE A;  1FTM A;  2AL5 A;  5J1D A;  3IOU A;  2XXY A;  4U23 A;  4QFO A;  4KCC A;  2QS1 A;  3PPQ A;  3S9M C;  5JTY A;  1SW4 A;  3E13 X;  4BLA A;  3PPR A;  4U2R A;  3B6T A;  4JBZ A;  1PEB A;  4YAH X;  4JB7 A;  4EQB A;  3FAT A;  4WKM A;  3TTR A;  4QFK A;  2ESN A;  3E9X A;  2I6E A;  2ZNT A;  2ZYN A;  3JYR A;  4NWD A;  2I4C A;  5BUU A;  3OO9 A;  3O66 A;  5I59 B;  1Y4C A;  4GVO A;  4R74 A;  1JW4 A;  5FHN A;  3U94 A;  1VFE A;  3G7W A;  3JZJ A;  4HCY A;  5CBR A;  1B7H A;  1IXC A;  3RQT A;  2V3U A;  3LSX A;  3HST A;  1SI1 A;  3TTK A;  3KN7 A;  4N07 A;  3VV5 A;  1H3D A;  1SW1 A;  5I2N A;  2UVH A;  1N0T A;  3LSW A;  4JWY A;  2GH9 A;  4RA1 A;  4EQ7 A;  2UVI A;  3HHF A;  5ISU A;  1NNP A;  3EF7 A;  4YMB A;  4THI A;  2O51 A;  1MM6 A;  3MZ1 A;  1ZMG A;  4WXJ A;  4FAT A;  4FE8 A;  5TP9 A;  4EUO A;  3TEP A;  2F7A A;  3KJT A;  4FED A;  3H03 A;  2H4I A;  2F6G A;  3ZS6 A;  5TU0 A;  3FJG A;  4IO7 A;  4YKP A;  3PUY E;  2WKY A;  2RF1 A;  4BDR A;  2HZL A;  5ICT A;  2DWI A;  4MH5 A;  4F22 A;  5FHM A;  4DCY A;  4KYD A;  2PT2 A;  5F7V A;  1ZIU A;  2FYI A;  2HXW A;  4PQJ A;  1BLF A;  1N7X A;  3RTF B;  3U93 A;  3KN8 A;  3OD7 A;  2O7U A;  5CBS A;  2I3W A;  4BDN A;  3IB1 A;  1II5 A;  3VLU A;  1LB8 A;  1R1N A;  3MBP A;  4F2O A;  5JTY B;  4OEV A;  2ZXT A;  4DIG A;  4DE8 A;  4LQ2 A;  1I6Q A;  4YB5 A;  1MDQ A;  2ALU A;  4F2Q A;  4ELP A;  1A8F A;  1MXV A;  4HTG A;  2DYX A;  1IEJ A;  5I58 A;  1CE2 A;  2CZL A;  2DWH A;  5HPQ A;  2DXR A;  2QMX A;  1ZTY A;  4LON B;  1I6B A;  4G8M A;  4QFN A;  1LGB C;  1B3E A;  1POT A;  1JEU A;  3ZSF A;  3H3G A;  3QYT A;  1EH3 A;  1PBP A;  1MY3 A;  3SEU A;  4YKK A;  2CMO A;  4FIM A;  1GTK A;  1QUI A;  4Z0I A;  2W7Y A;  1MY1 A;  3UIF A;  3TMG A;  3TPA A;  1YTV A;  1PDA A;  4HW8 A;  1VSO A;  3GZG A;  4C1U A;  2P0S A;  5KDT A;  4DLD A;  3ODB A;  1Q35 A;  5HM4 B;  2V3Q A;  3EPE A;  3KFM A;  5IKB A;  3T22 A;  3DM0 A;  2V25 A;  5I2N B;  1S7Y A;  2B65 A;  3TQL A;  1NMU A;  3OSR A;  4PE5 B;  3QSL A;  5CMK A;  3OEN A;  1MQD A;  3KN3 A;  3MVW A;  4U21 A;  2UVJ A;  4IGT A;  3MAM A;  3K6V A;  1B3F A;  4O3C A;  4LZ8 A;  5TP9 B;  3ECR A;  4H5F A;  3C36 A;  1UTB A;  4ELO A;  2GHA A;  1URG A;  4M4G A;  3FXU A;  4OEN A;  1A7L A;  3MC2 A;  3ILU B;  4IO5 A;  1A54 A;  2ZNU A;  5ITO A;  2F8D A;  4XKP A;  1Y1Z A;  1DMB A;  1MXY A;  4C0R A;  3TTM A;  2FA7 A;  2YJP A;  3EQ1 A;  4ZZE A;  5F1Q A;  2OWT A;  2R6G E;  3PMX A;  3H6W A;  4POW A;  4PFT A;  4DZ1 A;  3K1N A;  2XXU A;  4OMB A;  3KOS A;  3FV1 A;  1BKA A;  4H0W A;  5AA1 A;  3MQ9 A;  2O84 X;  1YAE A;  1YPN A;  3K1P A;  1LCT A;  3IB2 A;  2ABH A;  2HAU A;  2QRY A;  4GQO A;  2HEU A;  4XIG Q;  1AMF A;  3RT8 A;  1URD A;  1XOC A;  2E1S A;  3FXQ A;  1S9T A;  1R9Q A;  3HPI A;  1MY4 A;  1MQH A;  1FQA A;  4F1U A;  3PV0 E;  4YU0 A;  4FAJ A;  3MVZ A;  1MXZ A;  1LBB A;  1B51 A;  1B5J A;  5I58 B;  1NNF A;  2OCU A;  3LR1 A;  5M2V A;  5I57 A;  3IOR A;  4G8H A;  4R72 A;  1H44 A;  3V8X B;  2GFE A;  1B4H A;  1N3W A;  3QIM A;  2DE3 A;  4R6H A;  4R6K A;  1LFI A;  3P7I A;  1RYX A;  5DVF A;  4OTE A;  2DE4 A;  3U72 A;  2VD3 A;  1QKB A;  5AA2 A;  3VXB A;  5B7D A;  3H06 B;  4H65 A;  4LAT A;  2D5W A;  3QXM A;  4MLQ A;  4I8C A;  3TCG A;  2OK2 A;  3QUJ A;  1HSJ A;  5KDT B;  4P11 A;  3M3L A;  4BDL A;  3PMW A;  2I0C A;  1GR2 A;  1SQY A;  3KOT A;  2Y7K A;  1UIV A;  2QS4 A;  1GV8 A;  1IIW A;  4IO6 A;  3N94 A;  2Y7R A;  2R9J A;  3R26 A;  2OLB A;  1OLA A;  3HV1 A;  1LLS A;  2XD3 A;  3RGY A;  3AXF A;  4GL0 A;  4X9T A;  4ZS9 A;  5H8F A;  4DDD A;  4EXK A;  2LAO A;  3MP1 A;  4GWO A;  1VR5 A;  2V84 A;  3C31 A;  1UTB B;  3B6W A;  4YB6 A;  4GRK A;  4P0G A;  2A5T A;  3TUS A;  2Y7P A;  1XC1 A;  4F18 A;  4FJP A;  3T9X B;  4RK9 A;  4C1T A;  3TOD A;  3PU5 A;  4ZED A;  2PT1 A;  2F78 A;  3MW0 A;  2I0B A;  3UA8 A;  2Y84 A;  1B3G A;  4XKQ A;  5H8N A;  4NF8 B;  4MFI A;  3CRB A;  5AE4 A;  2O7I A;  5ICQ A;  3O97 A;  3G3J A;  2VGQ A;  3U1O A;  4KD5 A;  3GBB A;  2G29 A;  4EF1 A;  3VDF A;  4IO3 A;  2Q88 A;  4G8N A;  4PFW A;  1QUK A;  2Z23 A;  1B3H A;  3L6G A;  1EU8 A;  4DXC A;  1S50 A;  1EZP A;  3HCQ A;  4U22 A;  1YCJ A;  1FTL A;  4R2F A;  3IOT A;  3SDF A;  3C32 A;  1TFD A;  3SKP A;  3K6X A;  4NED A;  3RY3 A;  5I2K A;  1M5B A;  3VLW A;  3THI A;  1PC3 A;  2O69 A;  5I84 A;  3ONM A;  1JVX A;  1NNT A;  1BP5 A;  1MPC A;  1DTZ A;  4FOR A;  2H25 A;  2Z8D A;  3EHT A;  3H6T A;  5H8H A;  2DS9 A;  2NUV A;  5I57 B;  3K02 A;  4NWC A;  2DP8 A;  4RXL A;  2H98 A;  2Q2A A;  4YKJ A;  1SYH A;  4AB6 A;  4OWD A;  4YZZ A;  1WOD A;  3E4R A;  3G3I A;  2I49 A;  2AIX A;  2A5S A;  2PVU A;  1USY H;  3SEX A;  5A5X A;  4F39 A;  2ZYM A;  2PYY A;  4JDF A;  4I9D A;  4I62 A;  1IXG A;  3N26 A;  5EHS A;  5AA3 A;  1A99 A;  4JWO A;  3OEK A;  1FTK A;  1Z7M E;  2V93 A;  3SEV A;  3TTL A;  1LAG E;  1TT1 A;  1BTJ A;  2XX8 A;  4U4S A;  4MF3 A;  4OEU A;  3OXN A;  2DWA A;  3FZV A;  3FJM A;  4JSO A;  3PUX E;  4LA9 A;  5H8F B;  2O1L A;  3CSB A;  1XT8 A;  3C9H A;  3O6H A;  2DE2 A;  4KYS A;  4TLM B;  1RYO A;  5HBC A;  2A5T B;  4M1V A;  1QVS A;  2ZMB A;  4IO4 A;  4E0W A;  1QJM A;  3KZG A;  1B5I A;  2Y7I A;  1B5H A;  1NH8 A;  3FVG A;  4KR5 A;  5H8N B;  3PUW E;  2XHD A;  1H43 A;  5L9O A;  1IQ7 A;  1Z7N E;  1DPP A;  3G3F A;  2Z8F A;  4KQP A;  3IR1 A;  3PPN A;  1SW5 A;  3RN8 A;  4ZDM A;  3UK4 A;  3V89 B;  1QUJ A;  1P1U A;  4PFU A;  3M3K A;  1NKX A;  4N13 A;  1ANF A;  1UTH A;  3W9V A;  4PET A;  3W9W A;  1B46 A;  4BDQ A;  3CSG A;  4KFQ A;  3Q26 A;  3O6G A;  5I2K B;  1MM7 A;  3MZ9 A;  5L9S A;  1MY0 A;  1MH3 A;  3OEM A;  3S9N C;  3QAX A;  2RKM A;  3ILT B;  1UIU A;  3CFZ A;  3K01 A;  4R9F A;  4XKN A;  3OMB A;  4LQ5 A;  4NF5 A;  3O9P A;  5AA4 A;  5H8H B;  3E3K A;  1B0H A;  3FXR A;  4ELQ A;  3KEI A;  4POX A;  3IAZ A;  3OO6 A;  1N7W A;  4R2B A;  5KZT A;  4F1V A;  1IXI A;  3Q27 A;  3ZKK A;  1FQF A;  1XVX A;  2DVZ A;  3A09 A;  4ZE8 A;  1VE4 A;  3RNN A;  4R9G A;  3K1M A;  5A5X B;  3K0V A;  4ONY A;  4ELR A;  3C34 A;  3TFL A;  1TXF A;  1N3X A;  3K6W A;  5EYF A;  3PD8 A;  4IY5 A;  1MY2 A;  5K2Y A;  4EF2 A;  3TZA A;  5DYH A;  1OLC A;  3GXA A;  2F97 A;  1KWH A;  1JW1 A;  3T9U A;  3T9V A;  1MQJ A;  4UAC A;  2F5X A;  2IA4 A;  1DSN A;  4GF8 A;  3FV2 A;  1B4Z A;  4OFL A;  1D3K A;  3RUM A;  1OMP A;  3KGC A;  3R7X A;  3K4U A;  4U1O A;  2Q8J A;  2XXP A;  2H5Y A;  3VFJ A;  1MQG A;  1QKA A;  1M5F A;  1A55 A;  4BDO A;  3FAS A;  2XXI A;  4R75 A;  4YMA A;  4DCX A;  2KLF A;  4NTL A;  1IZ1 A;  1MDP 1;  4KYE A;  1B58 A;  1B2H A;  3BKI B;  5EHM A;  2PBW A;  3LSF B;  3MUQ A;  2HZK A;  1B1X A;  4QF9 A;  3S2V A;  3C4M A;  1B6H A;  1EZ9 A;  1LAF E;  3MWB A;  3N6U A;  1UTH B;  2ZYK A;  1RKM A;  1QW0 A;  1B9J A;  1XS5 A;  4PFY A;  4Q0C A;  1MH4 A;  3MJN A;  4ZEC A;  5CMB A;  4AB5 A;  4MLV A;  2I48 A;  3BFU A;  4LZ7 A;  2DSF A;  4EDP A;  4EXL A;  3OO8 A;  4NF4 A;  1O63 A;  3RPW A;  1MPD A;  5CI5 A;  1OVT A;  3Q29 A;  4ZE9 A;  5K2X A;  3IL1 B;  3SEY A;  4NF5 B;  1SDX A;  2O6A A;  5AA4 B;  5B70 A;  2B3F A;  1PBQ A;  4MBP A;  1JET A;  4R73 A;  4LZ5 A;  4LVQ A;  3OEL A;  1EZO A;  2AYS A;  4RYA A;  4OFJ A;  4NF6 A;  4P0I A;  3TCH A;  2P1S A;  3W15 C;  1IUD A;  4H67 A;  1FW0 A;  4L17 A;  3LSL A;  2QMW A;  3Q25 A;  3M8U A;  4ZEI A;  3KSJ A;  3U92 A;  2F7C A;  3HO7 A;  1A8E A;  1MQI A;  1B05 A;  1HSL A;  2I58 A;  1MRP A;  1ZKB A;  3EN3 A;  2VHA A;  1JW5 A;  3IOW A;  1GVC A;  2H9B A;  2XXT A;  1US5 A;  5H8S A;  2VD2 A;  2XX7 A;  4H5G A;  2D3I A;  4F1Y A;  1CB6 A;  3A3C A;  2HAV A;  2Z8E A;  3O6I A;  4WEP A;  3PUV E;  2UYF A;  1BIY A;  2F34 A;  4RY1 A;  3VVE A;  4K3F A;  3S9E A;  3MPK A;  3TTN A;  4IO2 A;  4NE4 A;  1USY E;  4I1D A;  1SI0 A;  1DOT A;  1HSE A;  4R6Y A;  3B6Q A;  4LP2 B;  4KPT A;  1N76 A;  1NFT A;  4IB2 A;  3CFX A;  2ZNS A;  4O3B A;  3FVO A;  3CR9 A;  1Y3P A;  4F3P A;  3EHU A;  3CIJ A;  3N5L A;  3LC8 A;  1OVB A;  1P1N A;  2NOO A;  3MP8 A;  3FGS A;  1MS7 A;  3I5O A;  3CVG A;  4QFL A;  3FUZ A;  1T0K A;  3KBR A;  2BJJ X;  2OBG A;  4GIZ A;  2RC8 A;  1N04 A;  4OER A;  3Q28 A;  4GFR A;  3UGW A;  2AL4 A;  3H6U A;  4RNS A;  1LFH A;  3F11 A;  2DOJ A;  1ZLQ A;  3C33 A;  1IXH A;  3T9H B;  3IO6 A;  4NF4 B;  4ZEB A;  1MXX A;  3HHG A;  5DT6 A;  3IX1 A;  5L9M A;  4YIC A;  3RLF E;  4F29 A;  1TFA A;  4G2Z A;  4H8J A;  5ITP A;  2XXX A;  4OET A;  4EQ9 A;  3CI8 A;  1Y1M A;  1P1W A;  1O7T A;  4F3S A;  3RT6 B;  4E0X A;  5AA2 B;  1Y4T A;  2HQ0 A;  4TOZ A;  2IEE A;  1LAX A;  3D4G A;  4KCD A;  4PP0 A;  3GLB A;  1MXU A;  5IAI A;  3VXC A;  2D21 A;  4NF6 B;  1WDN A;  3DP8 A;  2QS2 A;  3IOV A;  2M8C A;  5KCJ A;  3QUF A;  2UXA A;  2R71 A;  1B7U A;  2XD2 A;  3TQW A;  4Z7E A;  4ESX A;  1NL5 A;  1DPE A;  5FTH A;  1FQB A;  3S4U A;  1FTJ A;  4RPN A;  4X1D A;  1PB8 A;  2NVU B;  2REG A;  1D9V A;  3BBR A;  3CG3 A;  1FQC A;  3T96 B;  2XXV A;  4GOT A;  4OQO A;  1ATG A;  1PB7 A;  4YKI A;  2PX1 A;  1ZU0 A;  3H4Z A;  1XVY A;  1LFG A;  3USD A;  1US4 A;  1ZJL A;  3BFT A;  3OO7 A;  2H99 A;  4GD5 A;  1JEV A;  1O64 A;  5ELV A;  3O2A A;  1MPB A;  2RC9 A;  3M3F A;  2YLN A;  1AOV A;  2ONK E;  2X7P A;  5DVI A;  2XXH A;  4OVJ A;  4F3B A;  4ZZA A;  5CM6 A;  1R6Z A;  4HS7 A;  3RTW B;  4NMY A;  2HFB A;  2I3V A;  1TWY A;  2DXY A;  4OXV A;  1B0L A;  4OYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...