1EH3A

R210k n-terminal lobe human lactoferrin
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
324
structure length
324
Chain Sequence
RSVQWCAVSQPEATKCFQWQRNMRRVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLDWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIKESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LACTOFERRIN
publication title Crystal structure and iron-binding properties of the R210K mutant of the N-lobe of human lactoferrin: implications for iron release from transferrins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 107
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eh3A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eh3A02
4DE8A 4RYAA 3T9HB 3OO6A 4TLMB 5H8HB 1EZ9A 3PMXA 4ELOA 3TFLA 1B0HA 4FIMA 3WAFA 3OSQA 4GOTA 1PB8A 1Y3QA 1N3WA 2X7PA 2RINA 4F3GA 1M5CA 5L9MA 3MPLA 4OFOA 1MPDA 2F36A 1JETA 3VVEA 1QW0A 3K1MA 1SW1A 2YLNA 1S9TA 4QFLA 4H67A 3LR1A 2HAVA 1IITA 1SQYA 5I2KA 3SKPA 4KHZE 2I0CA 4IGTA 3C4MA 4OQOA 3PUYE 5H8FB 3PPOA 1QKAA 4YU0A 2A5SA 5TP9A 1BLFA 1JEUA 1M5EA 1NH8A 5FTHA 3IAZA 3IB1A 1Y9UA 1FTMA 4DIGA 1BTJA 3QIMA 2UYEA 4ZEDA 3TCGA 2F7BA 5I59B 2I3WA 4OFLA 3MZ9A 1NL5A 4IY6A 1IXHA 3CSGA 1IXCA 3C33A 1CE2A 3H6UA 4XTCQ 3KZGA 4ZE9A 1POTA 4ECFA 2NOOA 5TPAA 5CBRA 5AA1A 4JSOA 4H0WA 2XXWA 1HSJA 2A5TA 2ONRA 5B70A 1PB9A 5ICTA 4IO2A 3MP1A 2HQ0A 1GGGA 3RGYA 2I58A 3IOUA 3MP6A 3TZAA 4ZE8A 3MVZA 2OWSA 2D3IA 3SERA 4R75A 1KWHA 4UA8A 4NE4A 4QRZA 2GFEA 1URGA 4Q5TA 1R9QA 3Q25A 1UTHA 1FQEA 1LAGE 2DQVA 4R74A 5CI5A 3TKDA 1B3EA 3TYHA 2QS2A 2H9BA 1Z7ME 3PMWA 4ZEIA 4QSDA 1LCTA 2LAOA 1QUKA 4NF4B 1MQDA 1J1NA 3N94A 4NEDA 4OETA 2ZMBA 1VSOA 2OCUA 4BDNA 1UIUA 1P1NA 4BDMA 4XKQA 4XXUA 1SI0A 4BLAA 2HAUA 3LBSA 5CRYA 4Z0IA 4R6HA 4IY5A 3T9VA 2VP1A 3RPWA 4U1ZA 4HTGA 3K01A 2ZNUA 4RXLA 2AL4A 3USDA 5AA4A 4OMBA 5CMCA 2H4IA 5H8HA 3DP6A 3LSXA 1FW0A 2QMXA 1A55A 4WEPA 4C0RA 4FJPA 4F31B 2Z8FA 2H99A 5AE4A 4EUOA 3JYRA 3RN8A 2Y7RA 3S9MC 2PYYA 4DXCA 1MXVA 1LSTA 4TOZA 3RTFB 2GHBA 5DVIA 1B9JA 2ZYMA 3QUFA 1B4HA 1SW4A 2Q8JA 1MXXA 4TQUQ 4EDPA 1OVBA 2OLBA 2O68A 1P1UA 4AQ4A 1Q1KA 1A7LA 3RQTA 2OZZA 3O97A 4U1OA 1O7TA 1R6ZA 5JEIA 2B3FA 3PMVA 2ONKE 1B6HA 3IO4A 2B65A 3MVXA 4U21A 3MC2A 3FJMA 3T22A 4JB7A 1RYXA 5A5XA 1JW4A 3O2AA 4YKIA 3M3KA 1XVYA 3D4GA 3T93B 1MXYA 3N5LA 5DYHA 2I3VA 3G3IA 3T9UA 4I62A 1MXUA 3A09A 1EZOA 3MJNA 4EQ9A 4IO5A 3CR9A 3I3VA 4ISUA 4KYSA 1MH4A 3TMGA 1A99A 1US5A 1B3HA 2AIXA 2THIA 4E0XA 1B46A 4R9FA 5DTBA 4GLIA 1URDA 4P11A 1DSNA 1SD3A 5IKBA 2DE3A 3PPQA 3BBRA 3IR1A 4RPOA 4ZZEA 2Y7PA 3CG1A 4L17A 4NWDA 3CFZA 3O29A 5I2KB 3F11A 4G4PA 4WKMA 1SVXB 2X26A 2E1SA 4PP0A 2UVHA 2QRYA 2O7UA 5TP9B 1B7HA 3KOSA 2RC7A 3E4RA 5L9SA 3FD3A 3PUWE 3OELA 4N13A 4GRKA 3HO7A 4OVJA 1GV8A 4LONB 2ESNA 1YCJA 4H6DA 2E0SA 4QFOA 2F6GA 1XS5A 3SEYA 1PDAA 3CFLA 3H03A 3EF7A 3JV9A 1D9VA 4FEDA 4G8HA 4H8JA 2XX8A 5EHMA 5TPAB 4EF1A 1LB9A 4F2QA 2A5TB 3LSWA 3PPNA 2O6AA 3QUJA 4PFWA 2D21A 4QFKA 3VLWA 3C32A 3SEUA 1MQGA 3OENA 4QSEA 1UTHB 3A3CA 2REGA 4DDDA 4ELQA 3HN0A 1IEJA 2Y84A 1Z7NE 1NMUA 4IO4A 4PFYA 2F35A 1MM7A 2HZLA 4P0GA 2ZNTA 1LLSA 3KN7A 1ZIUA 3M3LA 1OVTA 2XX7A 1LFGA 4R9GA 1XVXA 1YTVA 3TTRA 4OTEA 4H5FA 5JK4A 2V3UA 1LBCA 1B58A 3MVYA 1WVJA 3W9VA 4IB2A 3FXRA 3T66A 1JW1A 4DCYA 3UORA 5CC2A 3FIRA 3Q29A 1ZTYA 1A54A 1R9LA 3CFXA 1H43A 4G68B 5IAIA 1DOTA 1MXZA 3AXFA 3C31A 1DPPA 4YMBA 4F3BA 1O64A 2PMSA 4WXJA 3MW0A 3K00A 1LGBC 3O6GA 2P1SA 4KYEA 3N6TA 2P2AA 1M5BA 2I4CA 3M8UA 4JDFA 2OJTA 1B3LA 1IZ1A 2PVUA 3KJTA 4Q8RA 4HCWA 1HSLA 4K3FA 1B0LA 3B6TA 2I48A 2QL3A 1A40A 2UVGA 1ZLQA 4EQ7A 3PUVE 2DSFA 3VVFA 2XHDA 2Q2CA 3FVGA 4YKPA 1MY1A 1FQBA 5CM6A 4FORA 1QUJA 4R73A 4YMAA 3S9LC 1LFHA 4IO6A 3LUYA 4O3CA 1B32A 5EYFA 2ZYNA 2DWHA 4OZ9A 1MY0A 1UTBA 1Y3PA 4OYVA 3HPIA 2V93A 3LSLA 5DEXA 1F9BA 1PC3A 4NF8B 4JWYA 3H4ZA 5A5XB 2QS3A 3IO6A 1T0KA 2XXYA 4LATA 3TQWA 2OK2A 4OERA 1B1HA 4KR5A 5BUUA 3U94A 2NXOA 3IOVA 3ECRA 3KOTA 2FA7A 1XC1A 3SEVA 1TFDA 2XXVA 4KI0E 2H98A 1MG1A 1XHYA 2HZKA 1FTLA 1MPBA 1MQIA 4LUBA 3RT6B 3DM0A 2Z8DA 4DCXA 1Y1MA 4YKKA 1VFDA 3V8XB 1N0TA 5KDTA 3I6VA 3PD9A 2Y7IA 3VXBA 1AOVA 2I0BA 2ZXTA 2I49A 4OEUA 3K2DA 1MDQA 4RY1A 4JBZA 1CB6A 4EXLA 4F1UA 1ZBMA 4GL0A 2OBGA 3K6VA 3ZSFA 1DMBA 5I56A 4KYDA 4NMYA 2Y7WA 3U93A 1B51A 2DVZA 1FQCA 5BWJA 1B5HA 4KCCA 2BJJX 3HV1A 4GIZA 1MRPA 4KPTA 1EH3A 4TLLB 3R6UA 4N6PA 2ZNSA 3ZKKA 1WODA 4LA9A 3G3FA 1O63A 3IB0A 4G68A 1B05A 1SI1A 3ZKLA 3O6IA 2O1MA 1MS7A 3V89B 2XXTA 1LBBA 1TXFA 4FEBA 4HS7A 3B6QA 4PETA 1MH3A 1VE4A 4F29A 2RCBA 2F97A 4Q0CA 4YZZA 2NUVA 1NKXA 1POY1 3PV0E 5CMMA 4H65A 2YPNA 3HHGA 4X9TA 4P0IA 2GHAA 2V3TA 3FV1A 3MVWA 4X1BA 2QMWA 3P7IA 2D5WA 3OO8A 3I5OA 3EN3A 4U2RA 3OSRA 4ONYA 3SDFA 3ODBA 2QJEA 3KN8A 4O3AA 3KJ7A 4WEDA 4U22A 4IO7A 5I58A 4YB5A 3MAMA 4JWXA 2Y7KA 2PBWA 5B7DA 3SEXA 3FJGA 3EHSA 4NF8A 2QS1A 2DYXA 3S4UA 1USYE 2HEUA 5ICQA 2I6EA 2R6GE 3TODA 1GTKA 1I6QA 3S2VA 4LQ5A 3TQLA 1RKMA 1D3KA 3S9EA 1Y20A 3L6HA 3G7WA 4GWOA 3O66A 3TELA 1JVYA 4GVOA 3KFMA 4G2ZA 1MM6A 3FZVA 2O84X 4LP2B 2O7IA 1OQHA 1H3DA 4GXSB 3RUMA 2DE2A 1QVSA 4KCDA 3C36A 3UK4A 3U1OA 4BDQA 4XKPA 2V84A 4POXA 4DLDA 2Q88A 2RC8A 4MFIA 1A8EA 2PT2A 4C1TA 1MXWA 4NWCA 3PU5A 1B7ZA 5AA2D 3VFJA 5JTYB 4DXBA 1B7UA 2VD2A 2XD2A 3TUSA 3G3JA 1P99A 3V83A 2GRVA 1UTBB 3ILTB 1OMPA 1NNFA 3E3KA 3G3GA 1ZMGA 3FATA 5DEXB 2VGQA 1FTOA 3N6UA 4FAJA 1EU8A 1Y4TA 2ABHA 1M5FA 3K1NA 3ZS6A 5DT6A 5FTIA 4RNSA 1UIVA 1AMFA 2XXQA 3DLNA 3MUQA 3FJ7A 2RF1A 2F7AA 2Q89A 3H06B 3T96B 4KFQA 1R1NA 1URSA 1IQ7A 3CIJA 3GZGA 3H6VA 2F5XA 4FE8A 4XIGQ 2F7CA 1PBQA 5AA3A 1ZKBA 4X1DA 3RTWB 3KSJA 4YKJA 4Z7EA 2GH9A 2FNCA 2XD3A 5FHOA 5CBSA 4HCYA 3QSLA 5KDTB 4LZ8A 1Q35A 1YPNA 3FXQA 5HPQA 1HSEA 4LVQA 1MDP1 2O1LA 5I57A 2ANJA 3CI8A 3MZBA 1NNTA 3O6HA 2Z22A 4OXVA 2DS9A 2DWJA 3GXAA 1L5TA 4LZ7A 1B1XA 2HFBA 4ESXA 4UACA 4LQ2A 4H8IA 4Q30B 3H6TA 1OIBA 1N7XA 5I56B 4JXIA 4QHQA 3MPKA 5EHSA 5KCJA 1I6BA 1S50A 3H6WA 4PE5B 5F7VA 5H8NA 4I9DA 2DWAA 4ESWA 4FECA 1QUIA 1MQHA 2XXIA 2R71A 1IXIA 2FYIA 3FXUA 3DELB 5DVJA 3IB2A 4YAHX 5ITOA 1PBPA 4YB6A 3W15C 3OEMA 4GQOA 3PGFA 5I84A 1XT8A 2UVIA 4DZ1A 3B6WA 4OFJA 4RPNA 4QF9A 2PT1A 1LCFA 2UVJA 4ND9A 2RKMA 1IXGA 3LC8A 4FATA 1ELJA 3UN6A 2B3BA 1NNPA 3IL1B 1B40A 1FQFA 4H5GA 3FASA 2O69A 1IUDA 2HCAA 2UXAA 4NF5A 1OLAA 2Q9TA 3DP8A 4KQPA 4F1VA 3OOAA 1FCKA 3CSBA 3QK6A 1Y1ZA 4THIA 3E13X 5JTYA 1QJMA 4YB7A 5DVFA 3PPRA 5H8SA 3SEWA 2UYFA 5I58B 4C1UA 1H44A 5AA2A 1FTJA 4X48A 2AYSA 2F34A 4MF3A 3K02A 3FVKA 4PQJA 3N26A 3H3GA 5H8QA 3FGSA 1FQAA 1SW2A 3EHTA 3ILUB 3UA8A 3KEIA 1QKBA 4OESA 3Q28A 1P1OA 3PUXE 1JW5A 4OHNA 5I2NA 5LOMA 4U23A 3IORA 3IOTA 3VVDA 1MQJA 3EPEA 5ISUA 5ITPA 4ELPA 4JWOA 1UQWA 3A3UA 1AIVA 3KSXA 1D4NA 3Q26A 1DTZA 1JVXA 2F8DA 1SDXA 1I69A 5F1QA 1XOCA 3UP9A 2ONSA 5HM4B 3K0VA 2G29A 4G68C 2WKYA 5FHMA 4F22A 1JQFA 1B2HA 3TCFA 3E9XA 4ZEBA 1LAFE 3W9WA 2DP8A 3H7MA 2KLFA 2RCAA 4ZZAA 2REJA 2M8CA 2YJPA 2ZYKA 1ZJLA 4R72A 4RK2A 1M5DA 3EHUA 2VHAA 4PFTA 1MY4A 1JEVA 2CMOA 3THIA 1WDNA 3GLBA 1P1WA 3BKIB 4F39A 1LFIA 3WAEA 3KGCA 3S9NC 1FQDA 4EF2A 4RA1A 2XXRA 4U4SA 1B4ZA 1SBPA 4ZDMA 3IJXB 3VV5A 3RNNA 5L8DA 4M1VA 2XXXA 3KG2A 3K4UA 1N76A 4N07A 4F3SA 3MQ9A 1H76A 2DVCA 1NNKA 4OENA 2F6PA 1RYOA 1QULA 3HCQA 2DXRA 2H25A 3TPAA 1US4A 1BKAA 3IX1A 4EQBA 2QSXA 1GVCA 3OEKA 4XKRA 5CMKA 1DPEA 5ELVA 2ZYOA 3ONMA 4ZECA 1MY2A 2PX1A 4GF8A 3KBRA 2Z8EA 3PPPA 3HSTA 4QFPA 4F19A 1BIYA 5I57B 3HHFA 3D4CA 4NF6B 3PUZE 4OWDA 1MPCA 2VD3A 1Y4CA 1USYH 4R2FA 2P0SA 3R26A 4R6YA 4AB6A 3U72A 1YAEA 3IK6B 2DWIA 4EXKA 2IA4A 2Q2AA 4RJZA 3PD8A 4BDOA 3FV2A 5KCJB 1N7WA 2XXPA 4R2BA 1VFEA 3OMBA 3FUZA 1EZPA 5J1DA 5H8NB 1B5JA 2AL5A 1N84A 3V5AA 4GL8A 4H1XA 3O9PA 3QXMA 2CZLA 3SESA 2OWTA 4BDRA 1SYHA 1N3XA 4M4GA 5H8FA 2XXUA 3OD7A 3TEPA 3TTKA 3LSFB 1LB8A 4POWA 4F18A 1ANFA 5L9OA 3L6GA 3C35A 5TU0A 2I4BA 2RC9A 4E0WA 3K6WA 3RT8A 3FVOA 1TT1A 5I59A 1Y3NA 2NWJA 5HBCA 4I1DA 1II5A 2G93A 3VLUA 3CG3A 3C34A 4LZ5A 3IJOB 1AL3A 1LAHE 2IEEA 4MLQA 4IO3A 3KN3A 1PB7A 2O51A 4ZEFA 1VR5A 1B3GA 3G3HA 4NF5B 4XKNA 3TDJA 3OXNA 1OLCA 4GD5A 3Q27A 4OEVA 4AB5A 2HXWA 4F3PA 2F78A 2ALUA 2DE4A 2X7QA 1H45A 4MH5A 1I6AA 1S7YA 2V25A 2QPQA 3MP8A 5AA2B 1TWYA 5K2XA 1B3FA 1JNFA 3K1PA 1B5IA 3UIFA 3DP4A 1DTGA 4MLVA 2DXYA 4RK9A 5H8QB 5KZTA 1BP5A 1ZU0A 5FHNA 3VE1B 4G8MA 3RY3A 2QS4A 3TTMA 1LAXA 3SETA 4NF4A 2VOZA 3CVGA 2H5YA 5CMBA 3VXCA 2Z23A 3TAJA 1TFAA 5I2NB 4ZEKA 3MZ1A 1N04A 3QYTA 1A8FA 3U8QA 3CRBA 4R6KA 4IGRA 3MBPA 3O28A 4BDLA 4HW8A 3RLFE 4U4XA 4GFRA 1SYIA 4I8CA 4PFUA 5K2YA 3UGWA 4NTLA 3TTNA 1PEBA 3FVNA 4G77A 2XXHA 4JSDA 3QAXA 3R7XA 1B52A 3EQ1A 1FTKA 3MWBA 4NF6A 4F1YA 1MY3A 2R9JA 3JZJA 2NVUB 4MBPA 1ATGA 5M2VA 3OO9A 3B7DA 3OO7A 4F2OA 3BFUA 1GR2A 1IIWA 3C9HA 3M3FA 3IOWA 4ZS9A 2W7YA 4ELRA 2DOJA 4O3BA 4QFNA 4QSCA 1SW5A 3U92A 1NFTA 4GXAA 4YICA 3GBBA 4G8NA 3TCHA 4DXUA 2XX9A 3G3KA 1NH7A 1OQGA 1AH5A 2V3QA 1P1QA 3VLVA 4KD5A 3TTLA 3BFTA 3T9XB 3VDFA 3GBAA 5AA4B 1D9YA 3K6UA 3K6XA
chains in the Genus database with same CATH superfamily
4DE8A 4RYAA 3T9HB 3OO6A 4TLMB 5H8HB 1EZ9A 3E78A 3PMXA 4ELOA 3TFLA 1B0HA 4FIMA 3WAFA 3OSQA 4GOTA 3T0JA 1PB8A 1Y3QA 1LBXA 1N3WA 4GX6A 2X7PA 2RINA 4F3GA 1M5CA 3KC0A 5L9MA 3MPLA 4OFOA 1MPDA 2PFYA 2F36A 1JETA 3VVEA 1QW0A 3K1MA 1SW1A 1Q9DA 1NV5A 2YLNA 1S9TA 4QFLA 4H67A 3LR1A 2WEFA 2HAVA 1IITA 1SQYA 5I2KA 3SKPA 4KHZE 2I0CA 4IGTA 2FBPA 2FHYA 3C4MA 4OQOA 3PUYE 5H8FB 3PPOA 1QKAA 4O8MA 4YU0A 2A5SA 5TP9A 1BLFA 1JEUA 1M5EA 1NH8A 5FTHA 3IAZA 5IGAA 2MKZA 3IB1A 1Y9UA 1FTMA 4DIGA 1BTJA 3QIMA 2UYEA 4ZEDA 3TCGA 2F7BA 5I59B 2I3WA 4OFLA 4XEQA 3MZ9A 1NL5A 4IY6A 4P8BA 1IXHA 3CSGA 1IXCA 3C33A 1CE2A 3H6UA 4XTCQ 3KZGA 4ZE9A 5ET8A 1POTA 4ECFA 2NOOA 5TPAA 3BIHA 5CBRA 5AA1A 4JSOA 4H0WA 2XXWA 1HSJA 2A5TA 4GX4A 2ONRA 5B70A 1PB9A 5ICTA 3A29A 4IO2A 3MP1A 2HQ0A 1GGGA 3RGYA 2HXRA 2I58A 3IOUA 5EQAA 2VT5A 3MP6A 3TZAA 4GWYA 4ZE8A 3MVZA 2OWSA 2D3IA 3SERA 4X04A 4R75A 1KWHA 4UA8A 4NE4A 4QRZA 2GFEA 1URGA 4Q5TA 1R9QA 3Q25A 4MX6A 1UTHA 1FQEA 1LAGE 1IMDA 2DQVA 4R74A 5CI5A 3TKDA 4GWUA 1B3EA 3TYHA 2QS2A 2H9BA 1Z7ME 3PMWA 4ZEIA 4QSDA 1LCTA 2LAOA 1QUKA 3CHGA 4NF4B 1IMBA 4XF5A 1MQDA 1J1NA 1CNQA 3N94A 4NEDA 4OETA 2ZMBA 4MCOA 1VSOA 2OCUA 4BDNA 1UIUA 1P1NA 4BDMA 4XKQA 4XXUA 1SI0A 2F3DA 4BLAA 2HAUA 3LBSA 5CRYA 4Z0IA 5DW8A 4NQ8A 4R6HA 3LV0A 4IY5A 2VP1A 3T9VA 3RPWA 4U1ZA 4HTGA 3K01A 2ZNUA 4RXLA 2AL4A 3USDA 5AA4A 4OMBA 5CMCA 1RDYA 2H4IA 4PTKA 4XFEA 5H8HA 3DP6A 3LSXA 1FW0A 2QMXA 3B50A 1A55A 4WEPA 4C0RA 4FJPA 2HHMA 4F31B 2Z8FA 2H99A 4EUOA 1DBZA 5AE4A 3JYRA 3RN8A 2Y7RA 3S9MC 2PYYA 4DXCA 1MXVA 1LSTA 4TOZA 3RTFB 2GHBA 3QMFA 5DVIA 1AWBA 1FRPA 1B9JA 2ZYMA 3QUFA 1B4HA 1SW4A 5I5PA 2Q8JA 1MXXA 4PCDA 4TQUQ 4EDPA 4OVSA 1OVBA 4OANA 2OLBA 2O68A 1P1UA 1XI6A 4AQ4A 1Q1KA 1A7LA 4PAIA 3RQTA 2OZZA 3O97A 4U1OA 1O7TA 1R6ZA 5JEIA 2B4MA 2B3FA 3PMVA 2ONKE 1NV6A 4X8RA 1B6HA 3IO4A 4NN3A 2B65A 3MVXA 4U21A 3MC2A 3FJMA 3T22A 4JB7A 1RYXA 4MNIA 5A5XA 1JW4A 3O2AA 4YKIA 3M3KA 3RPLA 2PFZA 1XVYA 3D4GA 3T93B 1FBPA 1MXYA 2KQZA 3N5LA 5DYHA 2I3VA 3G3IA 3T9UA 4GX3A 1FPEA 4I62A 3MSTA 1MXUA 3A09A 2ZZWA 1EZOA 1FPFA 3MJNA 4EQ9A 4IO5A 3CR9A 3I3VA 3IFCA 4ISUA 4KYSA 1MH4A 3TMGA 1A99A 1US5A 1B3HA 2AIXA 2THIA 4E0XA 1B46A 4R9FA 5DTBA 4GLIA 1URDA 4P11A 1SD3A 1DSNA 5IKBA 2DE3A 3PPQA 3BBRA 3IR1A 4RPOA 4ZZEA 2DDKA 3PTYA 2Y7PA 3CG1A 2Y5KA 4L17A 4NWDA 3CFZA 3O29A 5I2KB 3F11A 4G4PA 4WKMA 1SVXB 2X26A 5LDZA 2E1SA 4PP0A 2UVHA 2QRYA 2O7UA 5TP9B 1B7HA 4JVIA 3KOSA 4I3YA 2RC7A 3E4RA 5L9SA 3FD3A 3PUWE 1QGXA 1FBFA 3OELA 4N13A 4GRKA 3HO7A 4OVJA 1GV8A 4LONB 2ESNA 4H6DA 1YCJA 2XWKA 2E0SA 4QFOA 2F6GA 1XS5A 3SEYA 1PDAA 3CFLA 3H03A 3EF7A 3JV9A 2QVUA 3RYDA 1D9VA 3ISPA 4FEDA 3NOHA 4G8HA 4H8JA 2XX8A 5EHMA 5EYGA 5TPAB 4EF1A 1LB9A 4F2QA 2A5TB 3LSWA 3PPNA 4N8GA 2O6AA 3QUJA 4PFWA 4GBVA 2D21A 4QFKA 3VLWA 5IZZA 1NV2A 2B4LA 3C32A 3SEUA 1EYJA 1YYZA 1MQGA 2CEXA 3OENA 4QSEA 2FIEA 1UTHB 3A3CA 2REGA 4IR8A 2QVVA 4DDDA 4PF8A 4ELQA 1JP4A 3HN0A 1IEJA 2Y84A 4N6KA 1Z7NE 3KBZA 1NMUA 4IO4A 4PFYA 2F35A 1MM7A 2HZLA 4P0GA 1INPA 2ZNTA 3EKIA 1LLSA 4LN5A 3KN7A 1ZIUA 3M3LA 1OVTA 2XX7A 1LFGA 4R9GA 1XVXA 1YTVA 3TTRA 4OTEA 4H5FA 5JK4A 2V3UA 1NV0A 4P3LA 2VPNA 1LBCA 1B58A 3MVYA 1WVJA 3W9VA 4IB2A 3FXRA 5EYHA 3T66A 1JW1A 3MYUA 4DCYA 3UORA 5CC2A 3FIRA 3Q29A 1ZTYA 1A54A 1R9LA 3CFXA 1H43A 4G68B 5IAIA 1DOTA 1MXZA 3AXFA 1KA0A 3C31A 1DPPA 4YMBA 4F3BA 3HFUA 1O64A 2PMSA 4WXJA 3MW0A 3K00A 1LGBC 3O6GA 2P1SA 4KYEA 3N6TA 2P2AA 3ROJA 1M5BA 2I4CA 3M8UA 4JDFA 2OJTA 1B3LA 1IZ1A 3FBPA 2PVUA 3KJTA 4Q8RA 4HCWA 1HSLA 4K3FA 2OWZA 1B0LA 3B6TA 2I48A 2QL3A 1A40A 2UVGA 1ZLQA 4EQ7A 3PUVE 2Y5LA 2DSFA 4I3EA 3VVFA 2XHDA 2XWVA 2Q2CA 3FVGA 4YKPA 1MY1A 1FQBA 1FBGA 5CM6A 4FORA 2ZZVA 1QUJA 4R73A 4YMAA 3S9LC 1LFHA 4IO6A 3LUYA 4O3CA 1B32A 2HPGA 5EYFA 2L5VA 2ZYNA 2DWHA 4OZ9A 1MY0A 4JVDA 1UTBA 1Y3PA 4OYVA 3HPIA 2V93A 2CZKA 3LSLA 5DEXA 1F9BA 1PC3A 4NF8B 4JWYA 3H4ZA 5A5XB 2QS3A 3IO6A 3RPLB 1T0KA 3IFAA 2XXYA 4LATA 3TQWA 2OK2A 4OERA 1FPIA 1B1HA 4KR5A 5BUUA 3U94A 2QFLA 1NUXA 2NXOA 4OVPA 4HE1A 3IOVA 3ECRA 3KOTA 2FA7A 1XC1A 3SEVA 3BIGA 1LBVA 1TFDA 2XXVA 5FBPA 4KI0E 2H98A 1MG1A 1XHYA 2HZKA 4QBAA 1FTLA 4PC9A 4H45A 1MPBA 1MQIA 1KA1A 4LUBA 3RT6B 3DM0A 5J16A 2Z8DA 4OA4A 4DCXA 1Y1MA 4YKKA 1VFDA 3V8XB 5EQ7A 1N0TA 5KDTA 3I6VA 3PD9A 1DK4A 2Y7IA 4NHBA 3VXBA 2V4CA 1AOVA 2I0BA 2ZXTA 2I49A 4HE0A 1EYKA 4OEUA 3K2DA 1MDQA 2PCRA 4RY1A 4JBZA 4P1LA 5EQ8A 1CB6A 4EXLA 4F1UA 2WYKA 1RDZA 4PFBA 1ZBMA 4GL0A 2OBGA 3K6VA 3ZSFA 1DMBA 4PFIA 2WBDA 5I56A 4KYDA 1FBCA 4NMYA 1KZ8A 2Y7WA 3U93A 1B51A 2DVZA 1FQCA 5BWJA 1B5HA 4KCCA 2BJJX 3HV1A 4GIZA 1MRPA 4KPTA 1EH3A 4TLLB 4DI3D 3R6UA 4N6PA 2ZNSA 3ZKKA 1WODA 4MEVA 4LA9A 3G3FA 1O63A 3IB0A 2WYPA 1FPBA 4G68A 1B05A 1SI1A 3ZKLA 3O6IA 2O1MA 1MS7A 3V89B 2XXTA 1LBBA 1TXFA 4FEBA 4HS7A 3B6QA 4PETA 1MH3A 1VE4A 4F29A 2RCBA 2F97A 1FSAA 1LEVA 4Q0CA 4MJOA 4NX1A 3D1RA 4YZZA 2NUVA 1NKXA 1POY1 3PV0E 5CMMA 4H65A 5IZ3B 2YPNA 2CEYA 3HHGA 4X9TA 4P0IA 4GWZA 2GHAA 2V3TA 4P9KA 3FV1A 3MVWA 4X1BA 2QMWA 3P7IA 2D5WA 3OO8A 3I5OA 2CZIA 2P3VA 3EN3A 5EQ9A 4U2RA 3OSRA 4ONYA 3SDFA 3ODBA 2QJEA 1LBYA 3KN8A 4O3AA 3KJ7A 4WEDA 4U22A 4IO7A 5I58A 4YB5A 3MAMA 4JWXA 2Y7KA 2PBWA 5B7DA 3SEXA 3FJGA 3EHSA 3T1BA 4NF8A 2QS1A 2DYXA 3S4UA 1USYE 2HEUA 4HXVA 4HE2A 5ICQA 2I6EA 2R6GE 2XWIA 3TODA 1GTKA 1I6QA 3S2VA 4LQ5A 3TQLA 1RKMA 1D3KA 3S9EA 4PBQA 1Y20A 3L6HA 3G7WA 4GWOA 3O66A 3TELA 1JVYA 4GVOA 3KFMA 4G2ZA 1MM6A 3FZVA 2O84X 4LP2B 2O7IA 1OQHA 1RDXA 1H3DA 4GXSB 3RUMA 4GWWA 2DE2A 1QVSA 4KCDA 3C36A 4PDDA 3UK4A 3U1OA 4PF6A 4BDQA 4XKPA 2V84A 4POXA 1FPKA 4DLDA 2Q88A 2RC8A 4MFIA 4NF0A 1A8EA 2PT2A 4C1TA 1YZ0A 4PAFA 1MXWA 5ESYA 4NWCA 2VPOA 1B7ZA 3PU5A 5AA2D 3VFJA 5JTYB 4DXBA 1B7UA 2VD2A 2XD2A 1FBDA 3TUSA 2FVZA 1D9QA 3G3JA 1NUWA 1NUYA 1P99A 3V83A 2GRVA 1UTBB 3ILTB 1OMPA 4N8YA 1NNFA 3E3KA 4MAGA 3G3GA 1ZMGA 3FATA 5DEXB 2Q8MA 2VGQA 2WX9A 1IMCA 1FTOA 3N6UA 4FAJA 1EU8A 1Y4TA 2ABHA 1M5FA 3K1NA 3ZS6A 5DT6A 5FTIA 4RNSA 1UIVA 1AMFA 2XXQA 3DLNA 4G61A 3MUQA 4N17A 3FJ7A 1FBEA 2RF1A 2F7AA 2Q89A 3H06B 3T96B 4KFQA 4MMPA 1R1NA 1FPLA 1URSA 1IQ7A 1NV4A 3CIJA 3GZGA 3H6VA 2F5XA 1NUZA 4FE8A 4XIGQ 2F7CA 1PBQA 5AA3A 4AS4A 1ZKBA 4X1DA 4PGPA 3RTWB 3KSJA 1YXIA 1FTAA 4YKJA 4Z7EA 2FIXA 2GH9A 2FNCA 2XD3A 4P1EA 5FHOA 5CBSA 1NV7A 4HCYA 3QSLA 5KDTB 4LZ8A 1Q35A 1YPNA 3FXQA 5HPQA 1VDWA 1HSEA 4LVQA 1MDP1 2O1LA 5IZ3A 5I57A 2ANJA 5A5LA 3CI8A 3MZBA 1NNTA 3O6HA 2Z22A 4OXVA 2DS9A 4GBWA 2DWJA 3GXAA 4KXPA 1L5TA 4LZ7A 1B1XA 5ET7A 2HFBA 4ESXA 4UACA 5IZ1A 4LQ2A 4H8IA 4Q30B 3H6TA 1OIBA 1N7XA 5I56B 4JXIA 4QHQA 3MPKA 5EHSA 4GWSA 5KCJA 1K9ZA 1I6BA 1S50A 3H6WA 4PE5B 5F7VA 5H8NA 4I9DA 2DWAA 4ESWA 3B8BA 4FECA 1QUIA 1MQHA 4OVTA 2XXIA 4O94A 2R71A 1IXIA 2FYIA 3FXUA 3DELB 5T3JA 5DVJA 3IB2A 4YAHX 4I40A 5ITOA 1PBPA 3GYYA 4YB6A 3W15C 3OEMA 4GQOA 3E79A 3PGFA 5I84A 1IMEA 5F24A 1XT8A 2UVIA 4DZ1A 3B6WA 4OFJA 4RPNA 4QF9A 4PAKA 2PT1A 1LCFA 2UVJA 4ND9A 2RKMA 2ZZXA 1IMAA 1IXGA 3LC8A 4FATA 1ELJA 3UN6A 2B3BA 1NNPA 3IL1B 2KR0A 1B40A 1FQFA 4H5GA 3FASA 2O69A 1IUDA 2HCAA 1FJ9A 2UXAA 4NF5A 1OLAA 2Q9TA 3DP8A 4KQPA 4F1VA 3OOAA 1FCKA 3CSBA 3QK6A 1Y1ZA 4THIA 3E13X 5JTYA 4N15A 1QJMA 5LTCA 4YB7A 2QVRA 5DVFA 3PPRA 5H8SA 3SEWA 2UYFA 5I58B 4C1UA 1LBWA 1H44A 4GWXA 5AA2A 1FTJA 2R8TA 4X48A 4N91A 4P56A 2AYSA 1FPJA 2F34A 4MF3A 3K02A 3FVKA 4PQJA 3N26A 3H3GA 5H8QA 3FGSA 1FQAA 1SW2A 4DI4B 3EHTA 4PE3A 2F3BA 4UABA 3ILUB 3UA8A 3KEIA 1QKBA 4OESA 3Q28A 3U65A 4MNPA 1P1OA 3PUXE 1JW5A 4OHNA 5IM2A 5I2NA 5LOMA 4U23A 3IORA 3IOTA 3VVDA 1MQJA 3EPEA 5ISUA 5ITPA 2CZHA 4ELPA 4JWOA 1UQWA 2GQ1A 3A3UA 1AIVA 3KSXA 1D4NA 3Q26A 1DTZA 1JVXA 2BJIA 2F8DA 1SDXA 1I69A 5F1QA 1XOCA 3UP9A 2ONSA 1FBHA 5HM4B 3K0VA 2G29A 4G68C 2WKYA 5FHMA 4F22A 4MNCA 1JQFA 1B2HA 4MIJA 1LBZA 3TCFA 3E9XA 4ZEBA 1LAFE 3W9WA 2DP8A 3H7MA 2KLFA 2RCAA 4ZZAA 4OVQA 2REJA 2M8CA 2YJPA 2ZYKA 1ZJLA 4R72A 4RK2A 5I3SA 1M5DA 3EHUA 1EYIA 1G0IA 2VHAA 4PFTA 1MY4A 1JEVA 2CMOA 3THIA 1WDNA 4O7IA 3GLBA 2JJKA 1P1WA 3BKIB 4F39A 1LFIA 3WAEA 3KGCA 3S9NC 1FQDA 4EF2A 4RA1A 2XXRA 4U4SA 1B4ZA 1SBPA 4ZDMA 5ET6A 3IJXB 3VV5A 3RNNA 5L8DA 4M1VA 2XXXA 3KG2A 3K4UA 1N76A 4N07A 5I7IA 4F3SA 3MQ9A 1H76A 2DVCA 1NNKA 4OENA 2F6PA 1RYOA 4N81A 1QULA 3HCQA 2DXRA 2H25A 3TPAA 1US4A 3LUZA 1BKAA 1G0HA 3IX1A 4EQBA 2QSXA 1GVCA 3OEKA 4XKRA 5CMKA 1DPEA 2XA5A 5ELVA 2ZYOA 3ONMA 4ZECA 4PGNA 1DCUA 1FPGA 1MY2A 2PX1A 4GF8A 3KBRA 2Z8EA 3PPPA 3HSTA 4QFPA 4F19A 1BIYA 1NI9A 5I57B 3HHFA 3D4CA 4NF6B 2P3NA 3PUZE 4OWDA 1FJ6A 1NV1A 1MPCA 2VD3A 1Y4CA 1USYH 4R2FA 2P0SA 3R26A 4R6YA 4AB6A 3U72A 1YAEA 3IK6B 2DWIA 4EXKA 2IA4A 2Q2AA 4RJZA 4NGUA 3PD8A 4BDOA 3FV2A 5KCJB 1N7WA 2XXPA 4R2BA 1VFEA 4PDHA 1FPDA 3OMBA 3FUZA 1EZPA 5J1DA 5H8NB 1B5JA 2AL5A 1N84A 3V5AA 4GL8A 4H1XA 3O9PA 3QXMA 2CZLA 3SESA 2OWTA 4BDRA 1SYHA 1N3XA 4M4GA 5H8FA 2XXUA 3OD7A 4N6DA 3TEPA 3TTKA 3LSFB 2XWOA 1LB8A 4POWA 4F18A 1ANFA 5L9OA 3L6GA 3C35A 5TU0A 2I4BA 2RC9A 4H46A 3SZPA 4E0WA 3K6WA 3RT8A 3FVOA 1TT1A 5I59A 1IMFA 4NG7A 1Y3NA 2NWJA 5HBCA 4I1DA 1BK4A 1II5A 2G93A 4JVCA 3VLUA 3CG3A 3C34A 4LZ5A 3IJOB 1AL3A 1LAHE 2IEEA 4MLQA 4IO3A 3KN3A 4MHFA 1PB7A 2O51A 4ZEFA 1VR5A 4QXDA 1B3GA 3G3HA 4NF5B 4XKNA 3TDJA 3OXNA 5ET5A 1OLCA 4GD5A 3Q27A 4OEVA 4AB5A 2HXWA 2OX3A 4F3PA 2F78A 2ALUA 4N4UA 2DE4A 2X7QA 1H45A 4PFRA 4MH5A 1I6AA 1S7YA 2V25A 2QPQA 3MP8A 5AA2B 1TWYA 5K2XA 1B3FA 4PBHA 1JNFA 2XXKA 3K1PA 1B5IA 3UIFA 3DP4A 1DTGA 4MLVA 2DXYA 4RK9A 5H8QB 5KZTA 1BP5A 1ZU0A 5FHNA 3VE1B 1NV3A 4G8MA 3RY3A 2QS4A 3TTMA 1LAXA 3SETA 4NF4A 2VOZA 3CVGA 2H5YA 4OVRA 5CMBA 3VXCA 2Z23A 3TAJA 1TFAA 5I2NB 4ZEKA 3MZ1A 1N04A 3QYTA 1A8FA 3FXBA 4P47A 3U8QA 3CRBA 4R6KA 4IGRA 3MBPA 3O28A 4BDLA 4HW8A 3RLFE 4U4XA 4GFRA 1SYIA 4FBPA 4I8CA 2WBBA 4PFUA 5K2YA 3UGWA 4NTLA 3TTNA 1PEBA 3FVNA 4NAPA 4O7MA 4G77A 2XXHA 1SPIA 4JSDA 3QAXA 3R7XA 1B52A 3EQ1A 2Q74A 1FTKA 3MWBA 4NF6A 4F1YA 1MY3A 2R9JA 3JZJA 2NVUB 4MBPA 1ATGA 5M2VA 3OO9A 3B7DA 3OO7A 4F2OA 3BFUA 1GR2A 1IIWA 3C9HA 3M3FA 3IOWA 4ZS9A 2W7YA 4ELRA 2DOJA 4O3BA 4QFNA 4QSCA 1SW5A 3U92A 1NFTA 4GXAA 4AS5A 4YICA 3GBBA 4G8NA 3TCHA 4DXUA 2XX9A 3KC1A 1K9YA 3G3KA 1NH7A 1OQGA 1AH5A 2V3QA 1P1QA 3VLVA 4KD5A 3TTLA 3BFTA 3T9XB 3VDFA 3GBAA 5AA4B 1D9YA 3K6UA 3K6XA
chains in the Genus database with same CATH topology
4DE8A 4RYAA 3T9HB 3OO6A 4TLMB 5H8HB 1EZ9A 3PMXA 4ELOA 3TFLA 1B0HA 4FIMA 3WAFA 3OSQA 4GOTA 1PB8A 1Y3QA 1N3WA 2X7PA 2RINA 4F3GA 1M5CA 5L9MA 3MPLA 4OFOA 1MPDA 2F36A 1JETA 3VVEA 1QW0A 3K1MA 1SW1A 2YLNA 1S9TA 4QFLA 4H67A 3LR1A 2HAVA 1IITA 1SQYA 5I2KA 3SKPA 4KHZE 2I0CA 4IGTA 3C4MA 4OQOA 3PUYE 5H8FB 3PPOA 1QKAA 4YU0A 2A5SA 5TP9A 1BLFA 1JEUA 1M5EA 1NH8A 5FTHA 3IAZA 3IB1A 1Y9UA 1FTMA 4DIGA 1BTJA 3QIMA 2UYEA 4ZEDA 3TCGA 2F7BA 5I59B 2I3WA 4OFLA 3MZ9A 1NL5A 4IY6A 1IXHA 3CSGA 1IXCA 3C33A 1CE2A 3H6UA 4XTCQ 3KZGA 4ZE9A 1POTA 4ECFA 2NOOA 5TPAA 5CBRA 5AA1A 4JSOA 4H0WA 2XXWA 1HSJA 2A5TA 2ONRA 5B70A 1PB9A 5ICTA 4IO2A 3MP1A 2HQ0A 1GGGA 3RGYA 2I58A 3IOUA 3MP6A 3TZAA 4ZE8A 3MVZA 2OWSA 2D3IA 3SERA 4R75A 1KWHA 4UA8A 4NE4A 4QRZA 2GFEA 1URGA 4Q5TA 1R9QA 3Q25A 1UTHA 1FQEA 1LAGE 2DQVA 4R74A 5CI5A 3TKDA 1B3EA 3TYHA 2QS2A 2H9BA 1Z7ME 3PMWA 4ZEIA 4QSDA 1LCTA 2LAOA 1QUKA 4NF4B 1MQDA 1J1NA 3N94A 4NEDA 4OETA 2ZMBA 1VSOA 2OCUA 4BDNA 1UIUA 1P1NA 4BDMA 4XKQA 4XXUA 1SI0A 4BLAA 2HAUA 3LBSA 5CRYA 4Z0IA 4R6HA 4IY5A 3T9VA 2VP1A 3RPWA 4U1ZA 4HTGA 3K01A 2ZNUA 4RXLA 2AL4A 3USDA 5AA4A 4OMBA 5CMCA 2H4IA 5H8HA 3DP6A 3LSXA 1FW0A 2QMXA 1A55A 4WEPA 4C0RA 4FJPA 4F31B 2Z8FA 2H99A 5AE4A 4EUOA 3JYRA 3RN8A 2Y7RA 3S9MC 2PYYA 4DXCA 1MXVA 1LSTA 4TOZA 3RTFB 2GHBA 5DVIA 1B9JA 2ZYMA 3QUFA 1B4HA 1SW4A 2Q8JA 1MXXA 4TQUQ 4EDPA 1OVBA 2OLBA 2O68A 1P1UA 4AQ4A 1Q1KA 1A7LA 3RQTA 2OZZA 3O97A 4U1OA 1O7TA 1R6ZA 5JEIA 2B3FA 3PMVA 2ONKE 1B6HA 3IO4A 2B65A 3MVXA 4U21A 3MC2A 3FJMA 3T22A 4JB7A 1RYXA 5A5XA 1JW4A 3O2AA 4YKIA 3M3KA 1XVYA 3D4GA 3T93B 1MXYA 3N5LA 5DYHA 2I3VA 3G3IA 3T9UA 4I62A 1MXUA 3A09A 1EZOA 3MJNA 4EQ9A 4IO5A 3CR9A 3I3VA 4ISUA 4KYSA 1MH4A 3TMGA 1A99A 1US5A 1B3HA 2AIXA 2THIA 4E0XA 1B46A 4R9FA 5DTBA 4GLIA 1URDA 4P11A 1DSNA 1SD3A 5IKBA 2DE3A 3PPQA 3BBRA 3IR1A 4RPOA 4ZZEA 2Y7PA 3CG1A 4L17A 4NWDA 3CFZA 3O29A 5I2KB 3F11A 4G4PA 4WKMA 1SVXB 2X26A 2E1SA 4PP0A 2UVHA 2QRYA 2O7UA 5TP9B 1B7HA 3KOSA 2RC7A 3E4RA 5L9SA 3FD3A 3PUWE 3OELA 4N13A 4GRKA 3HO7A 4OVJA 1GV8A 4LONB 2ESNA 1YCJA 4H6DA 2E0SA 4QFOA 2F6GA 1XS5A 3SEYA 1PDAA 3CFLA 3H03A 3EF7A 3JV9A 1D9VA 4FEDA 4G8HA 4H8JA 2XX8A 5EHMA 5TPAB 4EF1A 1LB9A 4F2QA 2A5TB 3LSWA 3PPNA 2O6AA 3QUJA 4PFWA 2D21A 4QFKA 3VLWA 3C32A 3SEUA 1MQGA 3OENA 4QSEA 1UTHB 3A3CA 2REGA 4DDDA 4ELQA 3HN0A 1IEJA 2Y84A 1Z7NE 1NMUA 4IO4A 4PFYA 2F35A 1MM7A 2HZLA 4P0GA 2ZNTA 1LLSA 3KN7A 1ZIUA 3M3LA 1OVTA 2XX7A 1LFGA 4R9GA 1XVXA 1YTVA 3TTRA 4OTEA 4H5FA 5JK4A 2V3UA 1LBCA 1B58A 3MVYA 1WVJA 3W9VA 4IB2A 3FXRA 3T66A 1JW1A 4DCYA 3UORA 5CC2A 3FIRA 3Q29A 1ZTYA 1A54A 1R9LA 3CFXA 1H43A 4G68B 5IAIA 1DOTA 1MXZA 3AXFA 3C31A 1DPPA 4YMBA 4F3BA 1O64A 2PMSA 4WXJA 3MW0A 3K00A 1LGBC 3O6GA 2P1SA 4KYEA 3N6TA 2P2AA 1M5BA 2I4CA 3M8UA 4JDFA 2OJTA 1B3LA 1IZ1A 2PVUA 3KJTA 4Q8RA 4HCWA 1HSLA 4K3FA 1B0LA 3B6TA 2I48A 2QL3A 1A40A 2UVGA 1ZLQA 4EQ7A 3PUVE 2DSFA 3VVFA 2XHDA 2Q2CA 3FVGA 4YKPA 1MY1A 1FQBA 5CM6A 4FORA 1QUJA 4R73A 4YMAA 3S9LC 1LFHA 4IO6A 3LUYA 4O3CA 1B32A 5EYFA 2ZYNA 2DWHA 4OZ9A 1MY0A 1UTBA 1Y3PA 4OYVA 3HPIA 2V93A 3LSLA 5DEXA 1F9BA 1PC3A 4NF8B 4JWYA 3H4ZA 5A5XB 2QS3A 3IO6A 1T0KA 2XXYA 4LATA 3TQWA 2OK2A 4OERA 1B1HA 4KR5A 5BUUA 3U94A 2NXOA 3IOVA 3ECRA 3KOTA 2FA7A 1XC1A 3SEVA 1TFDA 2XXVA 4KI0E 2H98A 1MG1A 1XHYA 2HZKA 1FTLA 1MPBA 1MQIA 4LUBA 3RT6B 3DM0A 2Z8DA 4DCXA 1Y1MA 4YKKA 1VFDA 3V8XB 1N0TA 5KDTA 3I6VA 3PD9A 2Y7IA 3VXBA 1AOVA 2I0BA 2ZXTA 2I49A 4OEUA 3K2DA 1MDQA 4RY1A 4JBZA 1CB6A 4EXLA 4F1UA 1ZBMA 4GL0A 2OBGA 3K6VA 3ZSFA 1DMBA 5I56A 4KYDA 4NMYA 2Y7WA 3U93A 1B51A 2DVZA 1FQCA 5BWJA 1B5HA 4KCCA 2BJJX 3HV1A 4GIZA 1MRPA 4KPTA 1EH3A 4TLLB 3R6UA 4N6PA 2ZNSA 3ZKKA 1WODA 4LA9A 3G3FA 1O63A 3IB0A 4G68A 1B05A 1SI1A 3ZKLA 3O6IA 2O1MA 1MS7A 3V89B 2XXTA 1LBBA 1TXFA 4FEBA 4HS7A 3B6QA 4PETA 1MH3A 1VE4A 4F29A 2RCBA 2F97A 4Q0CA 4YZZA 2NUVA 1NKXA 1POY1 3PV0E 5CMMA 4H65A 2YPNA 3HHGA 4X9TA 4P0IA 2GHAA 2V3TA 3FV1A 3MVWA 4X1BA 2QMWA 3P7IA 2D5WA 3OO8A 3I5OA 3EN3A 4U2RA 3OSRA 4ONYA 3SDFA 3ODBA 2QJEA 3KN8A 4O3AA 3KJ7A 4WEDA 4U22A 4IO7A 5I58A 4YB5A 3MAMA 4JWXA 2Y7KA 2PBWA 5B7DA 3SEXA 3FJGA 3EHSA 4NF8A 2QS1A 2DYXA 3S4UA 1USYE 2HEUA 5ICQA 2I6EA 2R6GE 3TODA 1GTKA 1I6QA 3S2VA 4LQ5A 3TQLA 1RKMA 1D3KA 3S9EA 1Y20A 3L6HA 3G7WA 4GWOA 3O66A 3TELA 1JVYA 4GVOA 3KFMA 4G2ZA 1MM6A 3FZVA 2O84X 4LP2B 2O7IA 1OQHA 1H3DA 4GXSB 3RUMA 2DE2A 1QVSA 4KCDA 3C36A 3UK4A 3U1OA 4BDQA 4XKPA 2V84A 4POXA 4DLDA 2Q88A 2RC8A 4MFIA 1A8EA 2PT2A 4C1TA 1MXWA 4NWCA 3PU5A 1B7ZA 5AA2D 3VFJA 5JTYB 4DXBA 1B7UA 2VD2A 2XD2A 3TUSA 3G3JA 1P99A 3V83A 2GRVA 1UTBB 3ILTB 1OMPA 1NNFA 3E3KA 3G3GA 1ZMGA 3FATA 5DEXB 2VGQA 1FTOA 3N6UA 4FAJA 1EU8A 1Y4TA 2ABHA 1M5FA 3K1NA 3ZS6A 5DT6A 5FTIA 4RNSA 1UIVA 1AMFA 2XXQA 3DLNA 3MUQA 3FJ7A 2RF1A 2F7AA 2Q89A 3H06B 3T96B 4KFQA 1R1NA 1URSA 1IQ7A 3CIJA 3GZGA 3H6VA 2F5XA 4FE8A 4XIGQ 2F7CA 1PBQA 5AA3A 1ZKBA 4X1DA 3RTWB 3KSJA 4YKJA 4Z7EA 2GH9A 2FNCA 2XD3A 5FHOA 5CBSA 4HCYA 3QSLA 5KDTB 4LZ8A 1Q35A 1YPNA 3FXQA 5HPQA 1HSEA 4LVQA 1MDP1 2O1LA 5I57A 2ANJA 3CI8A 3MZBA 1NNTA 3O6HA 2Z22A 4OXVA 2DS9A 2DWJA 3GXAA 1L5TA 4LZ7A 1B1XA 2HFBA 4ESXA 4UACA 4LQ2A 4H8IA 4Q30B 3H6TA 1OIBA 1N7XA 5I56B 4JXIA 4QHQA 3MPKA 5EHSA 5KCJA 1I6BA 1S50A 3H6WA 4PE5B 5F7VA 5H8NA 4I9DA 2DWAA 4ESWA 4FECA 1QUIA 1MQHA 2XXIA 2R71A 1IXIA 2FYIA 3FXUA 3DELB 5DVJA 3IB2A 4YAHX 5ITOA 1PBPA 4YB6A 3W15C 3OEMA 4GQOA 3PGFA 5I84A 1XT8A 2UVIA 4DZ1A 3B6WA 4OFJA 4RPNA 4QF9A 2PT1A 1LCFA 2UVJA 4ND9A 2RKMA 1IXGA 3LC8A 4FATA 1ELJA 3UN6A 2B3BA 1NNPA 3IL1B 1B40A 1FQFA 4H5GA 3FASA 2O69A 1IUDA 2HCAA 2UXAA 4NF5A 1OLAA 2Q9TA 3DP8A 4KQPA 4F1VA 3OOAA 1FCKA 3CSBA 3QK6A 1Y1ZA 4THIA 3E13X 5JTYA 1QJMA 4YB7A 5DVFA 3PPRA 5H8SA 3SEWA 2UYFA 5I58B 4C1UA 1H44A 5AA2A 1FTJA 4X48A 2AYSA 2F34A 4MF3A 3K02A 3FVKA 4PQJA 3N26A 3H3GA 5H8QA 3FGSA 1FQAA 1SW2A 3EHTA 3ILUB 3UA8A 3KEIA 1QKBA 4OESA 3Q28A 1P1OA 3PUXE 1JW5A 4OHNA 5I2NA 5LOMA 4U23A 3IORA 3IOTA 3VVDA 1MQJA 3EPEA 5ISUA 5ITPA 4ELPA 4JWOA 1UQWA 3A3UA 1AIVA 3KSXA 1D4NA 3Q26A 1DTZA 1JVXA 2F8DA 1SDXA 1I69A 5F1QA 1XOCA 3UP9A 2ONSA 5HM4B 3K0VA 2G29A 4G68C 2WKYA 5FHMA 4F22A 1JQFA 1B2HA 3TCFA 3E9XA 4ZEBA 1LAFE 3W9WA 2DP8A 3H7MA 2KLFA 2RCAA 4ZZAA 2REJA 2M8CA 2YJPA 2ZYKA 1ZJLA 4R72A 4RK2A 1M5DA 3EHUA 2VHAA 4PFTA 1MY4A 1JEVA 2CMOA 3THIA 1WDNA 3GLBA 1P1WA 3BKIB 4F39A 1LFIA 3WAEA 3KGCA 3S9NC 1FQDA 4EF2A 4RA1A 2XXRA 4U4SA 1B4ZA 1SBPA 4ZDMA 3IJXB 3VV5A 3RNNA 5L8DA 4M1VA 2XXXA 3KG2A 3K4UA 1N76A 4N07A 4F3SA 3MQ9A 1H76A 2DVCA 1NNKA 4OENA 2F6PA 1RYOA 1QULA 3HCQA 2DXRA 2H25A 3TPAA 1US4A 1BKAA 3IX1A 4EQBA 2QSXA 1GVCA 3OEKA 4XKRA 5CMKA 1DPEA 5ELVA 2ZYOA 3ONMA 4ZECA 1MY2A 2PX1A 4GF8A 3KBRA 2Z8EA 3PPPA 3HSTA 4QFPA 4F19A 1BIYA 5I57B 3HHFA 3D4CA 4NF6B 3PUZE 4OWDA 1MPCA 2VD3A 1Y4CA 1USYH 4R2FA 2P0SA 3R26A 4R6YA 4AB6A 3U72A 1YAEA 3IK6B 2DWIA 4EXKA 2IA4A 2Q2AA 4RJZA 3PD8A 4BDOA 3FV2A 5KCJB 1N7WA 2XXPA 4R2BA 1VFEA 3OMBA 3FUZA 1EZPA 5J1DA 5H8NB 1B5JA 2AL5A 1N84A 3V5AA 4GL8A 4H1XA 3O9PA 3QXMA 2CZLA 3SESA 2OWTA 4BDRA 1SYHA 1N3XA 4M4GA 5H8FA 2XXUA 3OD7A 3TEPA 3TTKA 3LSFB 1LB8A 4POWA 4F18A 1ANFA 5L9OA 3L6GA 3C35A 5TU0A 2I4BA 2RC9A 4E0WA 3K6WA 3RT8A 3FVOA 1TT1A 5I59A 1Y3NA 2NWJA 5HBCA 4I1DA 1II5A 2G93A 3VLUA 3CG3A 3C34A 4LZ5A 3IJOB 1AL3A 1LAHE 2IEEA 4MLQA 4IO3A 3KN3A 1PB7A 2O51A 4ZEFA 1VR5A 1B3GA 3G3HA 4NF5B 4XKNA 3TDJA 3OXNA 1OLCA 4GD5A 3Q27A 4OEVA 4AB5A 2HXWA 4F3PA 2F78A 2ALUA 2DE4A 2X7QA 1H45A 4MH5A 1I6AA 1S7YA 2V25A 2QPQA 3MP8A 5AA2B 1TWYA 5K2XA 1B3FA 1JNFA 3K1PA 1B5IA 3UIFA 3DP4A 1DTGA 4MLVA 2DXYA 4RK9A 5H8QB 5KZTA 1BP5A 1ZU0A 5FHNA 3VE1B 4G8MA 3RY3A 2QS4A 3TTMA 1LAXA 3SETA 4NF4A 2VOZA 3CVGA 2H5YA 5CMBA 3VXCA 2Z23A 3TAJA 1TFAA 5I2NB 4ZEKA 3MZ1A 1N04A 3QYTA 1A8FA 3U8QA 3CRBA 4R6KA 4IGRA 3MBPA 3O28A 4BDLA 4HW8A 3RLFE 4U4XA 4GFRA 1SYIA 4I8CA 4PFUA 5K2YA 3UGWA 4NTLA 3TTNA 1PEBA 3FVNA 4G77A 2XXHA 4JSDA 3QAXA 3R7XA 1B52A 3EQ1A 1FTKA 3MWBA 4NF6A 4F1YA 1MY3A 2R9JA 3JZJA 2NVUB 4MBPA 1ATGA 5M2VA 3OO9A 3B7DA 3OO7A 4F2OA 3BFUA 1GR2A 1IIWA 3C9HA 3M3FA 3IOWA 4ZS9A 2W7YA 4ELRA 2DOJA 4O3BA 4QFNA 4QSCA 1SW5A 3U92A 1NFTA 4GXAA 4YICA 3GBBA 4G8NA 3TCHA 4DXUA 2XX9A 3G3KA 1NH7A 1OQGA 1AH5A 2V3QA 1P1QA 3VLVA 4KD5A 3TTLA 3BFTA 3T9XB 3VDFA 3GBAA 5AA4B 1D9YA 3K6UA 3K6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DE8 A;  4RYA A;  3T9H B;  3OO6 A;  4TLM B;  5H8H B;  1EZ9 A;  3PMX A;  4ELO A;  3TFL A;  1B0H A;  4FIM A;  3WAF A;  3OSQ A;  4GOT A;  1PB8 A;  1Y3Q A;  1N3W A;  2X7P A;  2RIN A;  4F3G A;  1M5C A;  5L9M A;  3MPL A;  4OFO A;  1MPD A;  2F36 A;  1JET A;  3VVE A;  1QW0 A;  3K1M A;  1SW1 A;  2YLN A;  1S9T A;  4QFL A;  4H67 A;  3LR1 A;  2HAV A;  1IIT A;  1SQY A;  5I2K A;  3SKP A;  4KHZ E;  2I0C A;  4IGT A;  3C4M A;  4OQO A;  3PUY E;  5H8F B;  3PPO A;  1QKA A;  4YU0 A;  2A5S A;  5TP9 A;  1BLF A;  1JEU A;  1M5E A;  1NH8 A;  5FTH A;  3IAZ A;  3IB1 A;  1Y9U A;  1FTM A;  4DIG A;  1BTJ A;  3QIM A;  2UYE A;  4ZED A;  3TCG A;  2F7B A;  5I59 B;  2I3W A;  4OFL A;  3MZ9 A;  1NL5 A;  4IY6 A;  1IXH A;  3CSG A;  1IXC A;  3C33 A;  1CE2 A;  3H6U A;  4XTC Q;  3KZG A;  4ZE9 A;  1POT A;  4ECF A;  2NOO A;  5TPA A;  5CBR A;  5AA1 A;  4JSO A;  4H0W A;  2XXW A;  1HSJ A;  2A5T A;  2ONR A;  5B70 A;  1PB9 A;  5ICT A;  4IO2 A;  3MP1 A;  2HQ0 A;  1GGG A;  3RGY A;  2I58 A;  3IOU A;  3MP6 A;  3TZA A;  4ZE8 A;  3MVZ A;  2OWS A;  2D3I A;  3SER A;  4R75 A;  1KWH A;  4UA8 A;  4NE4 A;  4QRZ A;  2GFE A;  1URG A;  4Q5T A;  1R9Q A;  3Q25 A;  1UTH A;  1FQE A;  1LAG E;  2DQV A;  4R74 A;  5CI5 A;  3TKD A;  1B3E A;  3TYH A;  2QS2 A;  2H9B A;  1Z7M E;  3PMW A;  4ZEI A;  4QSD A;  1LCT A;  2LAO A;  1QUK A;  4NF4 B;  1MQD A;  1J1N A;  3N94 A;  4NED A;  4OET A;  2ZMB A;  1VSO A;  2OCU A;  4BDN A;  1UIU A;  1P1N A;  4BDM A;  4XKQ A;  4XXU A;  1SI0 A;  4BLA A;  2HAU A;  3LBS A;  5CRY A;  4Z0I A;  4R6H A;  4IY5 A;  3T9V A;  2VP1 A;  3RPW A;  4U1Z A;  4HTG A;  3K01 A;  2ZNU A;  4RXL A;  2AL4 A;  3USD A;  5AA4 A;  4OMB A;  5CMC A;  2H4I A;  5H8H A;  3DP6 A;  3LSX A;  1FW0 A;  2QMX A;  1A55 A;  4WEP A;  4C0R A;  4FJP A;  4F31 B;  2Z8F A;  2H99 A;  5AE4 A;  4EUO A;  3JYR A;  3RN8 A;  2Y7R A;  3S9M C;  2PYY A;  4DXC A;  1MXV A;  1LST A;  4TOZ A;  3RTF B;  2GHB A;  5DVI A;  1B9J A;  2ZYM A;  3QUF A;  1B4H A;  1SW4 A;  2Q8J A;  1MXX A;  4TQU Q;  4EDP A;  1OVB A;  2OLB A;  2O68 A;  1P1U A;  4AQ4 A;  1Q1K A;  1A7L A;  3RQT A;  2OZZ A;  3O97 A;  4U1O A;  1O7T A;  1R6Z A;  5JEI A;  2B3F A;  3PMV A;  2ONK E;  1B6H A;  3IO4 A;  2B65 A;  3MVX A;  4U21 A;  3MC2 A;  3FJM A;  3T22 A;  4JB7 A;  1RYX A;  5A5X A;  1JW4 A;  3O2A A;  4YKI A;  3M3K A;  1XVY A;  3D4G A;  3T93 B;  1MXY A;  3N5L A;  5DYH A;  2I3V A;  3G3I A;  3T9U A;  4I62 A;  1MXU A;  3A09 A;  1EZO A;  3MJN A;  4EQ9 A;  4IO5 A;  3CR9 A;  3I3V A;  4ISU A;  4KYS A;  1MH4 A;  3TMG A;  1A99 A;  1US5 A;  1B3H A;  2AIX A;  2THI A;  4E0X A;  1B46 A;  4R9F A;  5DTB A;  4GLI A;  1URD A;  4P11 A;  1DSN A;  1SD3 A;  5IKB A;  2DE3 A;  3PPQ A;  3BBR A;  3IR1 A;  4RPO A;  4ZZE A;  2Y7P A;  3CG1 A;  4L17 A;  4NWD A;  3CFZ A;  3O29 A;  5I2K B;  3F11 A;  4G4P A;  4WKM A;  1SVX B;  2X26 A;  2E1S A;  4PP0 A;  2UVH A;  2QRY A;  2O7U A;  5TP9 B;  1B7H A;  3KOS A;  2RC7 A;  3E4R A;  5L9S A;  3FD3 A;  3PUW E;  3OEL A;  4N13 A;  4GRK A;  3HO7 A;  4OVJ A;  1GV8 A;  4LON B;  2ESN A;  1YCJ A;  4H6D A;  2E0S A;  4QFO A;  2F6G A;  1XS5 A;  3SEY A;  1PDA A;  3CFL A;  3H03 A;  3EF7 A;  3JV9 A;  1D9V A;  4FED A;  4G8H A;  4H8J A;  2XX8 A;  5EHM A;  5TPA B;  4EF1 A;  1LB9 A;  4F2Q A;  2A5T B;  3LSW A;  3PPN A;  2O6A A;  3QUJ A;  4PFW A;  2D21 A;  4QFK A;  3VLW A;  3C32 A;  3SEU A;  1MQG A;  3OEN A;  4QSE A;  1UTH B;  3A3C A;  2REG A;  4DDD A;  4ELQ A;  3HN0 A;  1IEJ A;  2Y84 A;  1Z7N E;  1NMU A;  4IO4 A;  4PFY A;  2F35 A;  1MM7 A;  2HZL A;  4P0G A;  2ZNT A;  1LLS A;  3KN7 A;  1ZIU A;  3M3L A;  1OVT A;  2XX7 A;  1LFG A;  4R9G A;  1XVX A;  1YTV A;  3TTR A;  4OTE A;  4H5F A;  5JK4 A;  2V3U A;  1LBC A;  1B58 A;  3MVY A;  1WVJ A;  3W9V A;  4IB2 A;  3FXR A;  3T66 A;  1JW1 A;  4DCY A;  3UOR A;  5CC2 A;  3FIR A;  3Q29 A;  1ZTY A;  1A54 A;  1R9L A;  3CFX A;  1H43 A;  4G68 B;  5IAI A;  1DOT A;  1MXZ A;  3AXF A;  3C31 A;  1DPP A;  4YMB A;  4F3B A;  1O64 A;  2PMS A;  4WXJ A;  3MW0 A;  3K00 A;  1LGB C;  3O6G A;  2P1S A;  4KYE A;  3N6T A;  2P2A A;  1M5B A;  2I4C A;  3M8U A;  4JDF A;  2OJT A;  1B3L A;  1IZ1 A;  2PVU A;  3KJT A;  4Q8R A;  4HCW A;  1HSL A;  4K3F A;  1B0L A;  3B6T A;  2I48 A;  2QL3 A;  1A40 A;  2UVG A;  1ZLQ A;  4EQ7 A;  3PUV E;  2DSF A;  3VVF A;  2XHD A;  2Q2C A;  3FVG A;  4YKP A;  1MY1 A;  1FQB A;  5CM6 A;  4FOR A;  1QUJ A;  4R73 A;  4YMA A;  3S9L C;  1LFH A;  4IO6 A;  3LUY A;  4O3C A;  1B32 A;  5EYF A;  2ZYN A;  2DWH A;  4OZ9 A;  1MY0 A;  1UTB A;  1Y3P A;  4OYV A;  3HPI A;  2V93 A;  3LSL A;  5DEX A;  1F9B A;  1PC3 A;  4NF8 B;  4JWY A;  3H4Z A;  5A5X B;  2QS3 A;  3IO6 A;  1T0K A;  2XXY A;  4LAT A;  3TQW A;  2OK2 A;  4OER A;  1B1H A;  4KR5 A;  5BUU A;  3U94 A;  2NXO A;  3IOV A;  3ECR A;  3KOT A;  2FA7 A;  1XC1 A;  3SEV A;  1TFD A;  2XXV A;  4KI0 E;  2H98 A;  1MG1 A;  1XHY A;  2HZK A;  1FTL A;  1MPB A;  1MQI A;  4LUB A;  3RT6 B;  3DM0 A;  2Z8D A;  4DCX A;  1Y1M A;  4YKK A;  1VFD A;  3V8X B;  1N0T A;  5KDT A;  3I6V A;  3PD9 A;  2Y7I A;  3VXB A;  1AOV A;  2I0B A;  2ZXT A;  2I49 A;  4OEU A;  3K2D A;  1MDQ A;  4RY1 A;  4JBZ A;  1CB6 A;  4EXL A;  4F1U A;  1ZBM A;  4GL0 A;  2OBG A;  3K6V A;  3ZSF A;  1DMB A;  5I56 A;  4KYD A;  4NMY A;  2Y7W A;  3U93 A;  1B51 A;  2DVZ A;  1FQC A;  5BWJ A;  1B5H A;  4KCC A;  2BJJ X;  3HV1 A;  4GIZ A;  1MRP A;  4KPT A;  1EH3 A;  4TLL B;  3R6U A;  4N6P A;  2ZNS A;  3ZKK A;  1WOD A;  4LA9 A;  3G3F A;  1O63 A;  3IB0 A;  4G68 A;  1B05 A;  1SI1 A;  3ZKL A;  3O6I A;  2O1M A;  1MS7 A;  3V89 B;  2XXT A;  1LBB A;  1TXF A;  4FEB A;  4HS7 A;  3B6Q A;  4PET A;  1MH3 A;  1VE4 A;  4F29 A;  2RCB A;  2F97 A;  4Q0C A;  4YZZ A;  2NUV A;  1NKX A;  1POY 1;  3PV0 E;  5CMM A;  4H65 A;  2YPN A;  3HHG A;  4X9T A;  4P0I A;  2GHA A;  2V3T A;  3FV1 A;  3MVW A;  4X1B A;  2QMW A;  3P7I A;  2D5W A;  3OO8 A;  3I5O A;  3EN3 A;  4U2R A;  3OSR A;  4ONY A;  3SDF A;  3ODB A;  2QJE A;  3KN8 A;  4O3A A;  3KJ7 A;  4WED A;  4U22 A;  4IO7 A;  5I58 A;  4YB5 A;  3MAM A;  4JWX A;  2Y7K A;  2PBW A;  5B7D A;  3SEX A;  3FJG A;  3EHS A;  4NF8 A;  2QS1 A;  2DYX A;  3S4U A;  1USY E;  2HEU A;  5ICQ A;  2I6E A;  2R6G E;  3TOD A;  1GTK A;  1I6Q A;  3S2V A;  4LQ5 A;  3TQL A;  1RKM A;  1D3K A;  3S9E A;  1Y20 A;  3L6H A;  3G7W A;  4GWO A;  3O66 A;  3TEL A;  1JVY A;  4GVO A;  3KFM A;  4G2Z A;  1MM6 A;  3FZV A;  2O84 X;  4LP2 B;  2O7I A;  1OQH A;  1H3D A;  4GXS B;  3RUM A;  2DE2 A;  1QVS A;  4KCD A;  3C36 A;  3UK4 A;  3U1O A;  4BDQ A;  4XKP A;  2V84 A;  4POX A;  4DLD A;  2Q88 A;  2RC8 A;  4MFI A;  1A8E A;  2PT2 A;  4C1T A;  1MXW A;  4NWC A;  3PU5 A;  1B7Z A;  5AA2 D;  3VFJ A;  5JTY B;  4DXB A;  1B7U A;  2VD2 A;  2XD2 A;  3TUS A;  3G3J A;  1P99 A;  3V83 A;  2GRV A;  1UTB B;  3ILT B;  1OMP A;  1NNF A;  3E3K A;  3G3G A;  1ZMG A;  3FAT A;  5DEX B;  2VGQ A;  1FTO A;  3N6U A;  4FAJ A;  1EU8 A;  1Y4T A;  2ABH A;  1M5F A;  3K1N A;  3ZS6 A;  5DT6 A;  5FTI A;  4RNS A;  1UIV A;  1AMF A;  2XXQ A;  3DLN A;  3MUQ A;  3FJ7 A;  2RF1 A;  2F7A A;  2Q89 A;  3H06 B;  3T96 B;  4KFQ A;  1R1N A;  1URS A;  1IQ7 A;  3CIJ A;  3GZG A;  3H6V A;  2F5X A;  4FE8 A;  4XIG Q;  2F7C A;  1PBQ A;  5AA3 A;  1ZKB A;  4X1D A;  3RTW B;  3KSJ A;  4YKJ A;  4Z7E A;  2GH9 A;  2FNC A;  2XD3 A;  5FHO A;  5CBS A;  4HCY A;  3QSL A;  5KDT B;  4LZ8 A;  1Q35 A;  1YPN A;  3FXQ A;  5HPQ A;  1HSE A;  4LVQ A;  1MDP 1;  2O1L A;  5I57 A;  2ANJ A;  3CI8 A;  3MZB A;  1NNT A;  3O6H A;  2Z22 A;  4OXV A;  2DS9 A;  2DWJ A;  3GXA A;  1L5T A;  4LZ7 A;  1B1X A;  2HFB A;  4ESX A;  4UAC A;  4LQ2 A;  4H8I A;  4Q30 B;  3H6T A;  1OIB A;  1N7X A;  5I56 B;  4JXI A;  4QHQ A;  3MPK A;  5EHS A;  5KCJ A;  1I6B A;  1S50 A;  3H6W A;  4PE5 B;  5F7V A;  5H8N A;  4I9D A;  2DWA A;  4ESW A;  4FEC A;  1QUI A;  1MQH A;  2XXI A;  2R71 A;  1IXI A;  2FYI A;  3FXU A;  3DEL B;  5DVJ A;  3IB2 A;  4YAH X;  5ITO A;  1PBP A;  4YB6 A;  3W15 C;  3OEM A;  4GQO A;  3PGF A;  5I84 A;  1XT8 A;  2UVI A;  4DZ1 A;  3B6W A;  4OFJ A;  4RPN A;  4QF9 A;  2PT1 A;  1LCF A;  2UVJ A;  4ND9 A;  2RKM A;  1IXG A;  3LC8 A;  4FAT A;  1ELJ A;  3UN6 A;  2B3B A;  1NNP A;  3IL1 B;  1B40 A;  1FQF A;  4H5G A;  3FAS A;  2O69 A;  1IUD A;  2HCA A;  2UXA A;  4NF5 A;  1OLA A;  2Q9T A;  3DP8 A;  4KQP A;  4F1V A;  3OOA A;  1FCK A;  3CSB A;  3QK6 A;  1Y1Z A;  4THI A;  3E13 X;  5JTY A;  1QJM A;  4YB7 A;  5DVF A;  3PPR A;  5H8S A;  3SEW A;  2UYF A;  5I58 B;  4C1U A;  1H44 A;  5AA2 A;  1FTJ A;  4X48 A;  2AYS A;  2F34 A;  4MF3 A;  3K02 A;  3FVK A;  4PQJ A;  3N26 A;  3H3G A;  5H8Q A;  3FGS A;  1FQA A;  1SW2 A;  3EHT A;  3ILU B;  3UA8 A;  3KEI A;  1QKB A;  4OES A;  3Q28 A;  1P1O A;  3PUX E;  1JW5 A;  4OHN A;  5I2N A;  5LOM A;  4U23 A;  3IOR A;  3IOT A;  3VVD A;  1MQJ A;  3EPE A;  5ISU A;  5ITP A;  4ELP A;  4JWO A;  1UQW A;  3A3U A;  1AIV A;  3KSX A;  1D4N A;  3Q26 A;  1DTZ A;  1JVX A;  2F8D A;  1SDX A;  1I69 A;  5F1Q A;  1XOC A;  3UP9 A;  2ONS A;  5HM4 B;  3K0V A;  2G29 A;  4G68 C;  2WKY A;  5FHM A;  4F22 A;  1JQF A;  1B2H A;  3TCF A;  3E9X A;  4ZEB A;  1LAF E;  3W9W A;  2DP8 A;  3H7M A;  2KLF A;  2RCA A;  4ZZA A;  2REJ A;  2M8C A;  2YJP A;  2ZYK A;  1ZJL A;  4R72 A;  4RK2 A;  1M5D A;  3EHU A;  2VHA A;  4PFT A;  1MY4 A;  1JEV A;  2CMO A;  3THI A;  1WDN A;  3GLB A;  1P1W A;  3BKI B;  4F39 A;  1LFI A;  3WAE A;  3KGC A;  3S9N C;  1FQD A;  4EF2 A;  4RA1 A;  2XXR A;  4U4S A;  1B4Z A;  1SBP A;  4ZDM A;  3IJX B;  3VV5 A;  3RNN A;  5L8D A;  4M1V A;  2XXX A;  3KG2 A;  3K4U A;  1N76 A;  4N07 A;  4F3S A;  3MQ9 A;  1H76 A;  2DVC A;  1NNK A;  4OEN A;  2F6P A;  1RYO A;  1QUL A;  3HCQ A;  2DXR A;  2H25 A;  3TPA A;  1US4 A;  1BKA A;  3IX1 A;  4EQB A;  2QSX A;  1GVC A;  3OEK A;  4XKR A;  5CMK A;  1DPE A;  5ELV A;  2ZYO A;  3ONM A;  4ZEC A;  1MY2 A;  2PX1 A;  4GF8 A;  3KBR A;  2Z8E A;  3PPP A;  3HST A;  4QFP A;  4F19 A;  1BIY A;  5I57 B;  3HHF A;  3D4C A;  4NF6 B;  3PUZ E;  4OWD A;  1MPC A;  2VD3 A;  1Y4C A;  1USY H;  4R2F A;  2P0S A;  3R26 A;  4R6Y A;  4AB6 A;  3U72 A;  1YAE A;  3IK6 B;  2DWI A;  4EXK A;  2IA4 A;  2Q2A A;  4RJZ A;  3PD8 A;  4BDO A;  3FV2 A;  5KCJ B;  1N7W A;  2XXP A;  4R2B A;  1VFE A;  3OMB A;  3FUZ A;  1EZP A;  5J1D A;  5H8N B;  1B5J A;  2AL5 A;  1N84 A;  3V5A A;  4GL8 A;  4H1X A;  3O9P A;  3QXM A;  2CZL A;  3SES A;  2OWT A;  4BDR A;  1SYH A;  1N3X A;  4M4G A;  5H8F A;  2XXU A;  3OD7 A;  3TEP A;  3TTK A;  3LSF B;  1LB8 A;  4POW A;  4F18 A;  1ANF A;  5L9O A;  3L6G A;  3C35 A;  5TU0 A;  2I4B A;  2RC9 A;  4E0W A;  3K6W A;  3RT8 A;  3FVO A;  1TT1 A;  5I59 A;  1Y3N A;  2NWJ A;  5HBC A;  4I1D A;  1II5 A;  2G93 A;  3VLU A;  3CG3 A;  3C34 A;  4LZ5 A;  3IJO B;  1AL3 A;  1LAH E;  2IEE A;  4MLQ A;  4IO3 A;  3KN3 A;  1PB7 A;  2O51 A;  4ZEF A;  1VR5 A;  1B3G A;  3G3H A;  4NF5 B;  4XKN A;  3TDJ A;  3OXN A;  1OLC A;  4GD5 A;  3Q27 A;  4OEV A;  4AB5 A;  2HXW A;  4F3P A;  2F78 A;  2ALU A;  2DE4 A;  2X7Q A;  1H45 A;  4MH5 A;  1I6A A;  1S7Y A;  2V25 A;  2QPQ A;  3MP8 A;  5AA2 B;  1TWY A;  5K2X A;  1B3F A;  1JNF A;  3K1P A;  1B5I A;  3UIF A;  3DP4 A;  1DTG A;  4MLV A;  2DXY A;  4RK9 A;  5H8Q B;  5KZT A;  1BP5 A;  1ZU0 A;  5FHN A;  3VE1 B;  4G8M A;  3RY3 A;  2QS4 A;  3TTM A;  1LAX A;  3SET A;  4NF4 A;  2VOZ A;  3CVG A;  2H5Y A;  5CMB A;  3VXC A;  2Z23 A;  3TAJ A;  1TFA A;  5I2N B;  4ZEK A;  3MZ1 A;  1N04 A;  3QYT A;  1A8F A;  3U8Q A;  3CRB A;  4R6K A;  4IGR A;  3MBP A;  3O28 A;  4BDL A;  4HW8 A;  3RLF E;  4U4X A;  4GFR A;  1SYI A;  4I8C A;  4PFU A;  5K2Y A;  3UGW A;  4NTL A;  3TTN A;  1PEB A;  3FVN A;  4G77 A;  2XXH A;  4JSD A;  3QAX A;  3R7X A;  1B52 A;  3EQ1 A;  1FTK A;  3MWB A;  4NF6 A;  4F1Y A;  1MY3 A;  2R9J A;  3JZJ A;  2NVU B;  4MBP A;  1ATG A;  5M2V A;  3OO9 A;  3B7D A;  3OO7 A;  4F2O A;  3BFU A;  1GR2 A;  1IIW A;  3C9H A;  3M3F A;  3IOW A;  4ZS9 A;  2W7Y A;  4ELR A;  2DOJ A;  4O3B A;  4QFN A;  4QSC A;  1SW5 A;  3U92 A;  1NFT A;  4GXA A;  4YIC A;  3GBB A;  4G8N A;  3TCH A;  4DXU A;  2XX9 A;  3G3K A;  1NH7 A;  1OQG A;  1AH5 A;  2V3Q A;  1P1Q A;  3VLV A;  4KD5 A;  3TTL A;  3BFT A;  3T9X B;  3VDF A;  3GBA A;  5AA4 B;  1D9Y A;  3K6U A;  3K6X A; 
#chains in the Genus database with same CATH topology
 4DE8 A;  4RYA A;  3T9H B;  3OO6 A;  4TLM B;  5H8H B;  1EZ9 A;  3E78 A;  3PMX A;  4ELO A;  3TFL A;  1B0H A;  4FIM A;  3WAF A;  3OSQ A;  4GOT A;  3T0J A;  1PB8 A;  1Y3Q A;  1LBX A;  1N3W A;  4GX6 A;  2X7P A;  2RIN A;  4F3G A;  1M5C A;  3KC0 A;  5L9M A;  3MPL A;  4OFO A;  1MPD A;  2PFY A;  2F36 A;  1JET A;  3VVE A;  1QW0 A;  3K1M A;  1SW1 A;  1Q9D A;  1NV5 A;  2YLN A;  1S9T A;  4QFL A;  4H67 A;  3LR1 A;  2WEF A;  2HAV A;  1IIT A;  1SQY A;  5I2K A;  3SKP A;  4KHZ E;  2I0C A;  4IGT A;  2FBP A;  2FHY A;  3C4M A;  4OQO A;  3PUY E;  5H8F B;  3PPO A;  1QKA A;  4O8M A;  4YU0 A;  2A5S A;  5TP9 A;  1BLF A;  1JEU A;  1M5E A;  1NH8 A;  5FTH A;  3IAZ A;  5IGA A;  2MKZ A;  3IB1 A;  1Y9U A;  1FTM A;  4DIG A;  1BTJ A;  3QIM A;  2UYE A;  4ZED A;  3TCG A;  2F7B A;  5I59 B;  2I3W A;  4OFL A;  4XEQ A;  3MZ9 A;  1NL5 A;  4IY6 A;  4P8B A;  1IXH A;  3CSG A;  1IXC A;  3C33 A;  1CE2 A;  3H6U A;  4XTC Q;  3KZG A;  4ZE9 A;  5ET8 A;  1POT A;  4ECF A;  2NOO A;  5TPA A;  3BIH A;  5CBR A;  5AA1 A;  4JSO A;  4H0W A;  2XXW A;  1HSJ A;  2A5T A;  4GX4 A;  2ONR A;  5B70 A;  1PB9 A;  5ICT A;  3A29 A;  4IO2 A;  3MP1 A;  2HQ0 A;  1GGG A;  3RGY A;  2HXR A;  2I58 A;  3IOU A;  5EQA A;  2VT5 A;  3MP6 A;  3TZA A;  4GWY A;  4ZE8 A;  3MVZ A;  2OWS A;  2D3I A;  3SER A;  4X04 A;  4R75 A;  1KWH A;  4UA8 A;  4NE4 A;  4QRZ A;  2GFE A;  1URG A;  4Q5T A;  1R9Q A;  3Q25 A;  4MX6 A;  1UTH A;  1FQE A;  1LAG E;  1IMD A;  2DQV A;  4R74 A;  5CI5 A;  3TKD A;  4GWU A;  1B3E A;  3TYH A;  2QS2 A;  2H9B A;  1Z7M E;  3PMW A;  4ZEI A;  4QSD A;  1LCT A;  2LAO A;  1QUK A;  3CHG A;  4NF4 B;  1IMB A;  4XF5 A;  1MQD A;  1J1N A;  1CNQ A;  3N94 A;  4NED A;  4OET A;  2ZMB A;  4MCO A;  1VSO A;  2OCU A;  4BDN A;  1UIU A;  1P1N A;  4BDM A;  4XKQ A;  4XXU A;  1SI0 A;  2F3D A;  4BLA A;  2HAU A;  3LBS A;  5CRY A;  4Z0I A;  5DW8 A;  4NQ8 A;  4R6H A;  3LV0 A;  4IY5 A;  2VP1 A;  3T9V A;  3RPW A;  4U1Z A;  4HTG A;  3K01 A;  2ZNU A;  4RXL A;  2AL4 A;  3USD A;  5AA4 A;  4OMB A;  5CMC A;  1RDY A;  2H4I A;  4PTK A;  4XFE A;  5H8H A;  3DP6 A;  3LSX A;  1FW0 A;  2QMX A;  3B50 A;  1A55 A;  4WEP A;  4C0R A;  4FJP A;  2HHM A;  4F31 B;  2Z8F A;  2H99 A;  4EUO A;  1DBZ A;  5AE4 A;  3JYR A;  3RN8 A;  2Y7R A;  3S9M C;  2PYY A;  4DXC A;  1MXV A;  1LST A;  4TOZ A;  3RTF B;  2GHB A;  3QMF A;  5DVI A;  1AWB A;  1FRP A;  1B9J A;  2ZYM A;  3QUF A;  1B4H A;  1SW4 A;  5I5P A;  2Q8J A;  1MXX A;  4PCD A;  4TQU Q;  4EDP A;  4OVS A;  1OVB A;  4OAN A;  2OLB A;  2O68 A;  1P1U A;  1XI6 A;  4AQ4 A;  1Q1K A;  1A7L A;  4PAI A;  3RQT A;  2OZZ A;  3O97 A;  4U1O A;  1O7T A;  1R6Z A;  5JEI A;  2B4M A;  2B3F A;  3PMV A;  2ONK E;  1NV6 A;  4X8R A;  1B6H A;  3IO4 A;  4NN3 A;  2B65 A;  3MVX A;  4U21 A;  3MC2 A;  3FJM A;  3T22 A;  4JB7 A;  1RYX A;  4MNI A;  5A5X A;  1JW4 A;  3O2A A;  4YKI A;  3M3K A;  3RPL A;  2PFZ A;  1XVY A;  3D4G A;  3T93 B;  1FBP A;  1MXY A;  2KQZ A;  3N5L A;  5DYH A;  2I3V A;  3G3I A;  3T9U A;  4GX3 A;  1FPE A;  4I62 A;  3MST A;  1MXU A;  3A09 A;  2ZZW A;  1EZO A;  1FPF A;  3MJN A;  4EQ9 A;  4IO5 A;  3CR9 A;  3I3V A;  3IFC A;  4ISU A;  4KYS A;  1MH4 A;  3TMG A;  1A99 A;  1US5 A;  1B3H A;  2AIX A;  2THI A;  4E0X A;  1B46 A;  4R9F A;  5DTB A;  4GLI A;  1URD A;  4P11 A;  1SD3 A;  1DSN A;  5IKB A;  2DE3 A;  3PPQ A;  3BBR A;  3IR1 A;  4RPO A;  4ZZE A;  2DDK A;  3PTY A;  2Y7P A;  3CG1 A;  2Y5K A;  4L17 A;  4NWD A;  3CFZ A;  3O29 A;  5I2K B;  3F11 A;  4G4P A;  4WKM A;  1SVX B;  2X26 A;  5LDZ A;  2E1S A;  4PP0 A;  2UVH A;  2QRY A;  2O7U A;  5TP9 B;  1B7H A;  4JVI A;  3KOS A;  4I3Y A;  2RC7 A;  3E4R A;  5L9S A;  3FD3 A;  3PUW E;  1QGX A;  1FBF A;  3OEL A;  4N13 A;  4GRK A;  3HO7 A;  4OVJ A;  1GV8 A;  4LON B;  2ESN A;  4H6D A;  1YCJ A;  2XWK A;  2E0S A;  4QFO A;  2F6G A;  1XS5 A;  3SEY A;  1PDA A;  3CFL A;  3H03 A;  3EF7 A;  3JV9 A;  2QVU A;  3RYD A;  1D9V A;  3ISP A;  4FED A;  3NOH A;  4G8H A;  4H8J A;  2XX8 A;  5EHM A;  5EYG A;  5TPA B;  4EF1 A;  1LB9 A;  4F2Q A;  2A5T B;  3LSW A;  3PPN A;  4N8G A;  2O6A A;  3QUJ A;  4PFW A;  4GBV A;  2D21 A;  4QFK A;  3VLW A;  5IZZ A;  1NV2 A;  2B4L A;  3C32 A;  3SEU A;  1EYJ A;  1YYZ A;  1MQG A;  2CEX A;  3OEN A;  4QSE A;  2FIE A;  1UTH B;  3A3C A;  2REG A;  4IR8 A;  2QVV A;  4DDD A;  4PF8 A;  4ELQ A;  1JP4 A;  3HN0 A;  1IEJ A;  2Y84 A;  4N6K A;  1Z7N E;  3KBZ A;  1NMU A;  4IO4 A;  4PFY A;  2F35 A;  1MM7 A;  2HZL A;  4P0G A;  1INP A;  2ZNT A;  3EKI A;  1LLS A;  4LN5 A;  3KN7 A;  1ZIU A;  3M3L A;  1OVT A;  2XX7 A;  1LFG A;  4R9G A;  1XVX A;  1YTV A;  3TTR A;  4OTE A;  4H5F A;  5JK4 A;  2V3U A;  1NV0 A;  4P3L A;  2VPN A;  1LBC A;  1B58 A;  3MVY A;  1WVJ A;  3W9V A;  4IB2 A;  3FXR A;  5EYH A;  3T66 A;  1JW1 A;  3MYU A;  4DCY A;  3UOR A;  5CC2 A;  3FIR A;  3Q29 A;  1ZTY A;  1A54 A;  1R9L A;  3CFX A;  1H43 A;  4G68 B;  5IAI A;  1DOT A;  1MXZ A;  3AXF A;  1KA0 A;  3C31 A;  1DPP A;  4YMB A;  4F3B A;  3HFU A;  1O64 A;  2PMS A;  4WXJ A;  3MW0 A;  3K00 A;  1LGB C;  3O6G A;  2P1S A;  4KYE A;  3N6T A;  2P2A A;  3ROJ A;  1M5B A;  2I4C A;  3M8U A;  4JDF A;  2OJT A;  1B3L A;  1IZ1 A;  3FBP A;  2PVU A;  3KJT A;  4Q8R A;  4HCW A;  1HSL A;  4K3F A;  2OWZ A;  1B0L A;  3B6T A;  2I48 A;  2QL3 A;  1A40 A;  2UVG A;  1ZLQ A;  4EQ7 A;  3PUV E;  2Y5L A;  2DSF A;  4I3E A;  3VVF A;  2XHD A;  2XWV A;  2Q2C A;  3FVG A;  4YKP A;  1MY1 A;  1FQB A;  1FBG A;  5CM6 A;  4FOR A;  2ZZV A;  1QUJ A;  4R73 A;  4YMA A;  3S9L C;  1LFH A;  4IO6 A;  3LUY A;  4O3C A;  1B32 A;  2HPG A;  5EYF A;  2L5V A;  2ZYN A;  2DWH A;  4OZ9 A;  1MY0 A;  4JVD A;  1UTB A;  1Y3P A;  4OYV A;  3HPI A;  2V93 A;  2CZK A;  3LSL A;  5DEX A;  1F9B A;  1PC3 A;  4NF8 B;  4JWY A;  3H4Z A;  5A5X B;  2QS3 A;  3IO6 A;  3RPL B;  1T0K A;  3IFA A;  2XXY A;  4LAT A;  3TQW A;  2OK2 A;  4OER A;  1FPI A;  1B1H A;  4KR5 A;  5BUU A;  3U94 A;  2QFL A;  1NUX A;  2NXO A;  4OVP A;  4HE1 A;  3IOV A;  3ECR A;  3KOT A;  2FA7 A;  1XC1 A;  3SEV A;  3BIG A;  1LBV A;  1TFD A;  2XXV A;  5FBP A;  4KI0 E;  2H98 A;  1MG1 A;  1XHY A;  2HZK A;  4QBA A;  1FTL A;  4PC9 A;  4H45 A;  1MPB A;  1MQI A;  1KA1 A;  4LUB A;  3RT6 B;  3DM0 A;  5J16 A;  2Z8D A;  4OA4 A;  4DCX A;  1Y1M A;  4YKK A;  1VFD A;  3V8X B;  5EQ7 A;  1N0T A;  5KDT A;  3I6V A;  3PD9 A;  1DK4 A;  2Y7I A;  4NHB A;  3VXB A;  2V4C A;  1AOV A;  2I0B A;  2ZXT A;  2I49 A;  4HE0 A;  1EYK A;  4OEU A;  3K2D A;  1MDQ A;  2PCR A;  4RY1 A;  4JBZ A;  4P1L A;  5EQ8 A;  1CB6 A;  4EXL A;  4F1U A;  2WYK A;  1RDZ A;  4PFB A;  1ZBM A;  4GL0 A;  2OBG A;  3K6V A;  3ZSF A;  1DMB A;  4PFI A;  2WBD A;  5I56 A;  4KYD A;  1FBC A;  4NMY A;  1KZ8 A;  2Y7W A;  3U93 A;  1B51 A;  2DVZ A;  1FQC A;  5BWJ A;  1B5H A;  4KCC A;  2BJJ X;  3HV1 A;  4GIZ A;  1MRP A;  4KPT A;  1EH3 A;  4TLL B;  4DI3 D;  3R6U A;  4N6P A;  2ZNS A;  3ZKK A;  1WOD A;  4MEV A;  4LA9 A;  3G3F A;  1O63 A;  3IB0 A;  2WYP A;  1FPB A;  4G68 A;  1B05 A;  1SI1 A;  3ZKL A;  3O6I A;  2O1M A;  1MS7 A;  3V89 B;  2XXT A;  1LBB A;  1TXF A;  4FEB A;  4HS7 A;  3B6Q A;  4PET A;  1MH3 A;  1VE4 A;  4F29 A;  2RCB A;  2F97 A;  1FSA A;  1LEV A;  4Q0C A;  4MJO A;  4NX1 A;  3D1R A;  4YZZ A;  2NUV A;  1NKX A;  1POY 1;  3PV0 E;  5CMM A;  4H65 A;  5IZ3 B;  2YPN A;  2CEY A;  3HHG A;  4X9T A;  4P0I A;  4GWZ A;  2GHA A;  2V3T A;  4P9K A;  3FV1 A;  3MVW A;  4X1B A;  2QMW A;  3P7I A;  2D5W A;  3OO8 A;  3I5O A;  2CZI A;  2P3V A;  3EN3 A;  5EQ9 A;  4U2R A;  3OSR A;  4ONY A;  3SDF A;  3ODB A;  2QJE A;  1LBY A;  3KN8 A;  4O3A A;  3KJ7 A;  4WED A;  4U22 A;  4IO7 A;  5I58 A;  4YB5 A;  3MAM A;  4JWX A;  2Y7K A;  2PBW A;  5B7D A;  3SEX A;  3FJG A;  3EHS A;  3T1B A;  4NF8 A;  2QS1 A;  2DYX A;  3S4U A;  1USY E;  2HEU A;  4HXV A;  4HE2 A;  5ICQ A;  2I6E A;  2R6G E;  2XWI A;  3TOD A;  1GTK A;  1I6Q A;  3S2V A;  4LQ5 A;  3TQL A;  1RKM A;  1D3K A;  3S9E A;  4PBQ A;  1Y20 A;  3L6H A;  3G7W A;  4GWO A;  3O66 A;  3TEL A;  1JVY A;  4GVO A;  3KFM A;  4G2Z A;  1MM6 A;  3FZV A;  2O84 X;  4LP2 B;  2O7I A;  1OQH A;  1RDX A;  1H3D A;  4GXS B;  3RUM A;  4GWW A;  2DE2 A;  1QVS A;  4KCD A;  3C36 A;  4PDD A;  3UK4 A;  3U1O A;  4PF6 A;  4BDQ A;  4XKP A;  2V84 A;  4POX A;  1FPK A;  4DLD A;  2Q88 A;  2RC8 A;  4MFI A;  4NF0 A;  1A8E A;  2PT2 A;  4C1T A;  1YZ0 A;  4PAF A;  1MXW A;  5ESY A;  4NWC A;  2VPO A;  1B7Z A;  3PU5 A;  5AA2 D;  3VFJ A;  5JTY B;  4DXB A;  1B7U A;  2VD2 A;  2XD2 A;  1FBD A;  3TUS A;  2FVZ A;  1D9Q A;  3G3J A;  1NUW A;  1NUY A;  1P99 A;  3V83 A;  2GRV A;  1UTB B;  3ILT B;  1OMP A;  4N8Y A;  1NNF A;  3E3K A;  4MAG A;  3G3G A;  1ZMG A;  3FAT A;  5DEX B;  2Q8M A;  2VGQ A;  2WX9 A;  1IMC A;  1FTO A;  3N6U A;  4FAJ A;  1EU8 A;  1Y4T A;  2ABH A;  1M5F A;  3K1N A;  3ZS6 A;  5DT6 A;  5FTI A;  4RNS A;  1UIV A;  1AMF A;  2XXQ A;  3DLN A;  4G61 A;  3MUQ A;  4N17 A;  3FJ7 A;  1FBE A;  2RF1 A;  2F7A A;  2Q89 A;  3H06 B;  3T96 B;  4KFQ A;  4MMP A;  1R1N A;  1FPL A;  1URS A;  1IQ7 A;  1NV4 A;  3CIJ A;  3GZG A;  3H6V A;  2F5X A;  1NUZ A;  4FE8 A;  4XIG Q;  2F7C A;  1PBQ A;  5AA3 A;  4AS4 A;  1ZKB A;  4X1D A;  4PGP A;  3RTW B;  3KSJ A;  1YXI A;  1FTA A;  4YKJ A;  4Z7E A;  2FIX A;  2GH9 A;  2FNC A;  2XD3 A;  4P1E A;  5FHO A;  5CBS A;  1NV7 A;  4HCY A;  3QSL A;  5KDT B;  4LZ8 A;  1Q35 A;  1YPN A;  3FXQ A;  5HPQ A;  1VDW A;  1HSE A;  4LVQ A;  1MDP 1;  2O1L A;  5IZ3 A;  5I57 A;  2ANJ A;  5A5L A;  3CI8 A;  3MZB A;  1NNT A;  3O6H A;  2Z22 A;  4OXV A;  2DS9 A;  4GBW A;  2DWJ A;  3GXA A;  4KXP A;  1L5T A;  4LZ7 A;  1B1X A;  5ET7 A;  2HFB A;  4ESX A;  4UAC A;  5IZ1 A;  4LQ2 A;  4H8I A;  4Q30 B;  3H6T A;  1OIB A;  1N7X A;  5I56 B;  4JXI A;  4QHQ A;  3MPK A;  5EHS A;  4GWS A;  5KCJ A;  1K9Z A;  1I6B A;  1S50 A;  3H6W A;  4PE5 B;  5F7V A;  5H8N A;  4I9D A;  2DWA A;  4ESW A;  3B8B A;  4FEC A;  1QUI A;  1MQH A;  4OVT A;  2XXI A;  4O94 A;  2R71 A;  1IXI A;  2FYI A;  3FXU A;  3DEL B;  5T3J A;  5DVJ A;  3IB2 A;  4YAH X;  4I40 A;  5ITO A;  1PBP A;  3GYY A;  4YB6 A;  3W15 C;  3OEM A;  4GQO A;  3E79 A;  3PGF A;  5I84 A;  1IME A;  5F24 A;  1XT8 A;  2UVI A;  4DZ1 A;  3B6W A;  4OFJ A;  4RPN A;  4QF9 A;  4PAK A;  2PT1 A;  1LCF A;  2UVJ A;  4ND9 A;  2RKM A;  2ZZX A;  1IMA A;  1IXG A;  3LC8 A;  4FAT A;  1ELJ A;  3UN6 A;  2B3B A;  1NNP A;  3IL1 B;  2KR0 A;  1B40 A;  1FQF A;  4H5G A;  3FAS A;  2O69 A;  1IUD A;  2HCA A;  1FJ9 A;  2UXA A;  4NF5 A;  1OLA A;  2Q9T A;  3DP8 A;  4KQP A;  4F1V A;  3OOA A;  1FCK A;  3CSB A;  3QK6 A;  1Y1Z A;  4THI A;  3E13 X;  5JTY A;  4N15 A;  1QJM A;  5LTC A;  4YB7 A;  2QVR A;  5DVF A;  3PPR A;  5H8S A;  3SEW A;  2UYF A;  5I58 B;  4C1U A;  1LBW A;  1H44 A;  4GWX A;  5AA2 A;  1FTJ A;  2R8T A;  4X48 A;  4N91 A;  4P56 A;  2AYS A;  1FPJ A;  2F34 A;  4MF3 A;  3K02 A;  3FVK A;  4PQJ A;  3N26 A;  3H3G A;  5H8Q A;  3FGS A;  1FQA A;  1SW2 A;  4DI4 B;  3EHT A;  4PE3 A;  2F3B A;  4UAB A;  3ILU B;  3UA8 A;  3KEI A;  1QKB A;  4OES A;  3Q28 A;  3U65 A;  4MNP A;  1P1O A;  3PUX E;  1JW5 A;  4OHN A;  5IM2 A;  5I2N A;  5LOM A;  4U23 A;  3IOR A;  3IOT A;  3VVD A;  1MQJ A;  3EPE A;  5ISU A;  5ITP A;  2CZH A;  4ELP A;  4JWO A;  1UQW A;  2GQ1 A;  3A3U A;  1AIV A;  3KSX A;  1D4N A;  3Q26 A;  1DTZ A;  1JVX A;  2BJI A;  2F8D A;  1SDX A;  1I69 A;  5F1Q A;  1XOC A;  3UP9 A;  2ONS A;  1FBH A;  5HM4 B;  3K0V A;  2G29 A;  4G68 C;  2WKY A;  5FHM A;  4F22 A;  4MNC A;  1JQF A;  1B2H A;  4MIJ A;  1LBZ A;  3TCF A;  3E9X A;  4ZEB A;  1LAF E;  3W9W A;  2DP8 A;  3H7M A;  2KLF A;  2RCA A;  4ZZA A;  4OVQ A;  2REJ A;  2M8C A;  2YJP A;  2ZYK A;  1ZJL A;  4R72 A;  4RK2 A;  5I3S A;  1M5D A;  3EHU A;  1EYI A;  1G0I A;  2VHA A;  4PFT A;  1MY4 A;  1JEV A;  2CMO A;  3THI A;  1WDN A;  4O7I A;  3GLB A;  2JJK A;  1P1W A;  3BKI B;  4F39 A;  1LFI A;  3WAE A;  3KGC A;  3S9N C;  1FQD A;  4EF2 A;  4RA1 A;  2XXR A;  4U4S A;  1B4Z A;  1SBP A;  4ZDM A;  5ET6 A;  3IJX B;  3VV5 A;  3RNN A;  5L8D A;  4M1V A;  2XXX A;  3KG2 A;  3K4U A;  1N76 A;  4N07 A;  5I7I A;  4F3S A;  3MQ9 A;  1H76 A;  2DVC A;  1NNK A;  4OEN A;  2F6P A;  1RYO A;  4N81 A;  1QUL A;  3HCQ A;  2DXR A;  2H25 A;  3TPA A;  1US4 A;  3LUZ A;  1BKA A;  1G0H A;  3IX1 A;  4EQB A;  2QSX A;  1GVC A;  3OEK A;  4XKR A;  5CMK A;  1DPE A;  2XA5 A;  5ELV A;  2ZYO A;  3ONM A;  4ZEC A;  4PGN A;  1DCU A;  1FPG A;  1MY2 A;  2PX1 A;  4GF8 A;  3KBR A;  2Z8E A;  3PPP A;  3HST A;  4QFP A;  4F19 A;  1BIY A;  1NI9 A;  5I57 B;  3HHF A;  3D4C A;  4NF6 B;  2P3N A;  3PUZ E;  4OWD A;  1FJ6 A;  1NV1 A;  1MPC A;  2VD3 A;  1Y4C A;  1USY H;  4R2F A;  2P0S A;  3R26 A;  4R6Y A;  4AB6 A;  3U72 A;  1YAE A;  3IK6 B;  2DWI A;  4EXK A;  2IA4 A;  2Q2A A;  4RJZ A;  4NGU A;  3PD8 A;  4BDO A;  3FV2 A;  5KCJ B;  1N7W A;  2XXP A;  4R2B A;  1VFE A;  4PDH A;  1FPD A;  3OMB A;  3FUZ A;  1EZP A;  5J1D A;  5H8N B;  1B5J A;  2AL5 A;  1N84 A;  3V5A A;  4GL8 A;  4H1X A;  3O9P A;  3QXM A;  2CZL A;  3SES A;  2OWT A;  4BDR A;  1SYH A;  1N3X A;  4M4G A;  5H8F A;  2XXU A;  3OD7 A;  4N6D A;  3TEP A;  3TTK A;  3LSF B;  2XWO A;  1LB8 A;  4POW A;  4F18 A;  1ANF A;  5L9O A;  3L6G A;  3C35 A;  5TU0 A;  2I4B A;  2RC9 A;  4H46 A;  3SZP A;  4E0W A;  3K6W A;  3RT8 A;  3FVO A;  1TT1 A;  5I59 A;  1IMF A;  4NG7 A;  1Y3N A;  2NWJ A;  5HBC A;  4I1D A;  1BK4 A;  1II5 A;  2G93 A;  4JVC A;  3VLU A;  3CG3 A;  3C34 A;  4LZ5 A;  3IJO B;  1AL3 A;  1LAH E;  2IEE A;  4MLQ A;  4IO3 A;  3KN3 A;  4MHF A;  1PB7 A;  2O51 A;  4ZEF A;  1VR5 A;  4QXD A;  1B3G A;  3G3H A;  4NF5 B;  4XKN A;  3TDJ A;  3OXN A;  5ET5 A;  1OLC A;  4GD5 A;  3Q27 A;  4OEV A;  4AB5 A;  2HXW A;  2OX3 A;  4F3P A;  2F78 A;  2ALU A;  4N4U A;  2DE4 A;  2X7Q A;  1H45 A;  4PFR A;  4MH5 A;  1I6A A;  1S7Y A;  2V25 A;  2QPQ A;  3MP8 A;  5AA2 B;  1TWY A;  5K2X A;  1B3F A;  4PBH A;  1JNF A;  2XXK A;  3K1P A;  1B5I A;  3UIF A;  3DP4 A;  1DTG A;  4MLV A;  2DXY A;  4RK9 A;  5H8Q B;  5KZT A;  1BP5 A;  1ZU0 A;  5FHN A;  3VE1 B;  1NV3 A;  4G8M A;  3RY3 A;  2QS4 A;  3TTM A;  1LAX A;  3SET A;  4NF4 A;  2VOZ A;  3CVG A;  2H5Y A;  4OVR A;  5CMB A;  3VXC A;  2Z23 A;  3TAJ A;  1TFA A;  5I2N B;  4ZEK A;  3MZ1 A;  1N04 A;  3QYT A;  1A8F A;  3FXB A;  4P47 A;  3U8Q A;  3CRB A;  4R6K A;  4IGR A;  3MBP A;  3O28 A;  4BDL A;  4HW8 A;  3RLF E;  4U4X A;  4GFR A;  1SYI A;  4FBP A;  4I8C A;  2WBB A;  4PFU A;  5K2Y A;  3UGW A;  4NTL A;  3TTN A;  1PEB A;  3FVN A;  4NAP A;  4O7M A;  4G77 A;  2XXH A;  1SPI A;  4JSD A;  3QAX A;  3R7X A;  1B52 A;  3EQ1 A;  2Q74 A;  1FTK A;  3MWB A;  4NF6 A;  4F1Y A;  1MY3 A;  2R9J A;  3JZJ A;  2NVU B;  4MBP A;  1ATG A;  5M2V A;  3OO9 A;  3B7D A;  3OO7 A;  4F2O A;  3BFU A;  1GR2 A;  1IIW A;  3C9H A;  3M3F A;  3IOW A;  4ZS9 A;  2W7Y A;  4ELR A;  2DOJ A;  4O3B A;  4QFN A;  4QSC A;  1SW5 A;  3U92 A;  1NFT A;  4GXA A;  4AS5 A;  4YIC A;  3GBB A;  4G8N A;  3TCH A;  4DXU A;  2XX9 A;  3KC1 A;  1K9Y A;  3G3K A;  1NH7 A;  1OQG A;  1AH5 A;  2V3Q A;  1P1Q A;  3VLV A;  4KD5 A;  3TTL A;  3BFT A;  3T9X B;  3VDF A;  3GBA A;  5AA4 B;  1D9Y A;  3K6U A;  3K6X A; 
#chains in the Genus database with same CATH homology
 4DE8 A;  4RYA A;  3T9H B;  3OO6 A;  4TLM B;  5H8H B;  1EZ9 A;  3PMX A;  4ELO A;  3TFL A;  1B0H A;  4FIM A;  3WAF A;  3OSQ A;  4GOT A;  1PB8 A;  1Y3Q A;  1N3W A;  2X7P A;  2RIN A;  4F3G A;  1M5C A;  5L9M A;  3MPL A;  4OFO A;  1MPD A;  2F36 A;  1JET A;  3VVE A;  1QW0 A;  3K1M A;  1SW1 A;  2YLN A;  1S9T A;  4QFL A;  4H67 A;  3LR1 A;  2HAV A;  1IIT A;  1SQY A;  5I2K A;  3SKP A;  4KHZ E;  2I0C A;  4IGT A;  3C4M A;  4OQO A;  3PUY E;  5H8F B;  3PPO A;  1QKA A;  4YU0 A;  2A5S A;  5TP9 A;  1BLF A;  1JEU A;  1M5E A;  1NH8 A;  5FTH A;  3IAZ A;  3IB1 A;  1Y9U A;  1FTM A;  4DIG A;  1BTJ A;  3QIM A;  2UYE A;  4ZED A;  3TCG A;  2F7B A;  5I59 B;  2I3W A;  4OFL A;  3MZ9 A;  1NL5 A;  4IY6 A;  1IXH A;  3CSG A;  1IXC A;  3C33 A;  1CE2 A;  3H6U A;  4XTC Q;  3KZG A;  4ZE9 A;  1POT A;  4ECF A;  2NOO A;  5TPA A;  5CBR A;  5AA1 A;  4JSO A;  4H0W A;  2XXW A;  1HSJ A;  2A5T A;  2ONR A;  5B70 A;  1PB9 A;  5ICT A;  4IO2 A;  3MP1 A;  2HQ0 A;  1GGG A;  3RGY A;  2I58 A;  3IOU A;  3MP6 A;  3TZA A;  4ZE8 A;  3MVZ A;  2OWS A;  2D3I A;  3SER A;  4R75 A;  1KWH A;  4UA8 A;  4NE4 A;  4QRZ A;  2GFE A;  1URG A;  4Q5T A;  1R9Q A;  3Q25 A;  1UTH A;  1FQE A;  1LAG E;  2DQV A;  4R74 A;  5CI5 A;  3TKD A;  1B3E A;  3TYH A;  2QS2 A;  2H9B A;  1Z7M E;  3PMW A;  4ZEI A;  4QSD A;  1LCT A;  2LAO A;  1QUK A;  4NF4 B;  1MQD A;  1J1N A;  3N94 A;  4NED A;  4OET A;  2ZMB A;  1VSO A;  2OCU A;  4BDN A;  1UIU A;  1P1N A;  4BDM A;  4XKQ A;  4XXU A;  1SI0 A;  4BLA A;  2HAU A;  3LBS A;  5CRY A;  4Z0I A;  4R6H A;  4IY5 A;  3T9V A;  2VP1 A;  3RPW A;  4U1Z A;  4HTG A;  3K01 A;  2ZNU A;  4RXL A;  2AL4 A;  3USD A;  5AA4 A;  4OMB A;  5CMC A;  2H4I A;  5H8H A;  3DP6 A;  3LSX A;  1FW0 A;  2QMX A;  1A55 A;  4WEP A;  4C0R A;  4FJP A;  4F31 B;  2Z8F A;  2H99 A;  5AE4 A;  4EUO A;  3JYR A;  3RN8 A;  2Y7R A;  3S9M C;  2PYY A;  4DXC A;  1MXV A;  1LST A;  4TOZ A;  3RTF B;  2GHB A;  5DVI A;  1B9J A;  2ZYM A;  3QUF A;  1B4H A;  1SW4 A;  2Q8J A;  1MXX A;  4TQU Q;  4EDP A;  1OVB A;  2OLB A;  2O68 A;  1P1U A;  4AQ4 A;  1Q1K A;  1A7L A;  3RQT A;  2OZZ A;  3O97 A;  4U1O A;  1O7T A;  1R6Z A;  5JEI A;  2B3F A;  3PMV A;  2ONK E;  1B6H A;  3IO4 A;  2B65 A;  3MVX A;  4U21 A;  3MC2 A;  3FJM A;  3T22 A;  4JB7 A;  1RYX A;  5A5X A;  1JW4 A;  3O2A A;  4YKI A;  3M3K A;  1XVY A;  3D4G A;  3T93 B;  1MXY A;  3N5L A;  5DYH A;  2I3V A;  3G3I A;  3T9U A;  4I62 A;  1MXU A;  3A09 A;  1EZO A;  3MJN A;  4EQ9 A;  4IO5 A;  3CR9 A;  3I3V A;  4ISU A;  4KYS A;  1MH4 A;  3TMG A;  1A99 A;  1US5 A;  1B3H A;  2AIX A;  2THI A;  4E0X A;  1B46 A;  4R9F A;  5DTB A;  4GLI A;  1URD A;  4P11 A;  1DSN A;  1SD3 A;  5IKB A;  2DE3 A;  3PPQ A;  3BBR A;  3IR1 A;  4RPO A;  4ZZE A;  2Y7P A;  3CG1 A;  4L17 A;  4NWD A;  3CFZ A;  3O29 A;  5I2K B;  3F11 A;  4G4P A;  4WKM A;  1SVX B;  2X26 A;  2E1S A;  4PP0 A;  2UVH A;  2QRY A;  2O7U A;  5TP9 B;  1B7H A;  3KOS A;  2RC7 A;  3E4R A;  5L9S A;  3FD3 A;  3PUW E;  3OEL A;  4N13 A;  4GRK A;  3HO7 A;  4OVJ A;  1GV8 A;  4LON B;  2ESN A;  1YCJ A;  4H6D A;  2E0S A;  4QFO A;  2F6G A;  1XS5 A;  3SEY A;  1PDA A;  3CFL A;  3H03 A;  3EF7 A;  3JV9 A;  1D9V A;  4FED A;  4G8H A;  4H8J A;  2XX8 A;  5EHM A;  5TPA B;  4EF1 A;  1LB9 A;  4F2Q A;  2A5T B;  3LSW A;  3PPN A;  2O6A A;  3QUJ A;  4PFW A;  2D21 A;  4QFK A;  3VLW A;  3C32 A;  3SEU A;  1MQG A;  3OEN A;  4QSE A;  1UTH B;  3A3C A;  2REG A;  4DDD A;  4ELQ A;  3HN0 A;  1IEJ A;  2Y84 A;  1Z7N E;  1NMU A;  4IO4 A;  4PFY A;  2F35 A;  1MM7 A;  2HZL A;  4P0G A;  2ZNT A;  1LLS A;  3KN7 A;  1ZIU A;  3M3L A;  1OVT A;  2XX7 A;  1LFG A;  4R9G A;  1XVX A;  1YTV A;  3TTR A;  4OTE A;  4H5F A;  5JK4 A;  2V3U A;  1LBC A;  1B58 A;  3MVY A;  1WVJ A;  3W9V A;  4IB2 A;  3FXR A;  3T66 A;  1JW1 A;  4DCY A;  3UOR A;  5CC2 A;  3FIR A;  3Q29 A;  1ZTY A;  1A54 A;  1R9L A;  3CFX A;  1H43 A;  4G68 B;  5IAI A;  1DOT A;  1MXZ A;  3AXF A;  3C31 A;  1DPP A;  4YMB A;  4F3B A;  1O64 A;  2PMS A;  4WXJ A;  3MW0 A;  3K00 A;  1LGB C;  3O6G A;  2P1S A;  4KYE A;  3N6T A;  2P2A A;  1M5B A;  2I4C A;  3M8U A;  4JDF A;  2OJT A;  1B3L A;  1IZ1 A;  2PVU A;  3KJT A;  4Q8R A;  4HCW A;  1HSL A;  4K3F A;  1B0L A;  3B6T A;  2I48 A;  2QL3 A;  1A40 A;  2UVG A;  1ZLQ A;  4EQ7 A;  3PUV E;  2DSF A;  3VVF A;  2XHD A;  2Q2C A;  3FVG A;  4YKP A;  1MY1 A;  1FQB A;  5CM6 A;  4FOR A;  1QUJ A;  4R73 A;  4YMA A;  3S9L C;  1LFH A;  4IO6 A;  3LUY A;  4O3C A;  1B32 A;  5EYF A;  2ZYN A;  2DWH A;  4OZ9 A;  1MY0 A;  1UTB A;  1Y3P A;  4OYV A;  3HPI A;  2V93 A;  3LSL A;  5DEX A;  1F9B A;  1PC3 A;  4NF8 B;  4JWY A;  3H4Z A;  5A5X B;  2QS3 A;  3IO6 A;  1T0K A;  2XXY A;  4LAT A;  3TQW A;  2OK2 A;  4OER A;  1B1H A;  4KR5 A;  5BUU A;  3U94 A;  2NXO A;  3IOV A;  3ECR A;  3KOT A;  2FA7 A;  1XC1 A;  3SEV A;  1TFD A;  2XXV A;  4KI0 E;  2H98 A;  1MG1 A;  1XHY A;  2HZK A;  1FTL A;  1MPB A;  1MQI A;  4LUB A;  3RT6 B;  3DM0 A;  2Z8D A;  4DCX A;  1Y1M A;  4YKK A;  1VFD A;  3V8X B;  1N0T A;  5KDT A;  3I6V A;  3PD9 A;  2Y7I A;  3VXB A;  1AOV A;  2I0B A;  2ZXT A;  2I49 A;  4OEU A;  3K2D A;  1MDQ A;  4RY1 A;  4JBZ A;  1CB6 A;  4EXL A;  4F1U A;  1ZBM A;  4GL0 A;  2OBG A;  3K6V A;  3ZSF A;  1DMB A;  5I56 A;  4KYD A;  4NMY A;  2Y7W A;  3U93 A;  1B51 A;  2DVZ A;  1FQC A;  5BWJ A;  1B5H A;  4KCC A;  2BJJ X;  3HV1 A;  4GIZ A;  1MRP A;  4KPT A;  1EH3 A;  4TLL B;  3R6U A;  4N6P A;  2ZNS A;  3ZKK A;  1WOD A;  4LA9 A;  3G3F A;  1O63 A;  3IB0 A;  4G68 A;  1B05 A;  1SI1 A;  3ZKL A;  3O6I A;  2O1M A;  1MS7 A;  3V89 B;  2XXT A;  1LBB A;  1TXF A;  4FEB A;  4HS7 A;  3B6Q A;  4PET A;  1MH3 A;  1VE4 A;  4F29 A;  2RCB A;  2F97 A;  4Q0C A;  4YZZ A;  2NUV A;  1NKX A;  1POY 1;  3PV0 E;  5CMM A;  4H65 A;  2YPN A;  3HHG A;  4X9T A;  4P0I A;  2GHA A;  2V3T A;  3FV1 A;  3MVW A;  4X1B A;  2QMW A;  3P7I A;  2D5W A;  3OO8 A;  3I5O A;  3EN3 A;  4U2R A;  3OSR A;  4ONY A;  3SDF A;  3ODB A;  2QJE A;  3KN8 A;  4O3A A;  3KJ7 A;  4WED A;  4U22 A;  4IO7 A;  5I58 A;  4YB5 A;  3MAM A;  4JWX A;  2Y7K A;  2PBW A;  5B7D A;  3SEX A;  3FJG A;  3EHS A;  4NF8 A;  2QS1 A;  2DYX A;  3S4U A;  1USY E;  2HEU A;  5ICQ A;  2I6E A;  2R6G E;  3TOD A;  1GTK A;  1I6Q A;  3S2V A;  4LQ5 A;  3TQL A;  1RKM A;  1D3K A;  3S9E A;  1Y20 A;  3L6H A;  3G7W A;  4GWO A;  3O66 A;  3TEL A;  1JVY A;  4GVO A;  3KFM A;  4G2Z A;  1MM6 A;  3FZV A;  2O84 X;  4LP2 B;  2O7I A;  1OQH A;  1H3D A;  4GXS B;  3RUM A;  2DE2 A;  1QVS A;  4KCD A;  3C36 A;  3UK4 A;  3U1O A;  4BDQ A;  4XKP A;  2V84 A;  4POX A;  4DLD A;  2Q88 A;  2RC8 A;  4MFI A;  1A8E A;  2PT2 A;  4C1T A;  1MXW A;  4NWC A;  3PU5 A;  1B7Z A;  5AA2 D;  3VFJ A;  5JTY B;  4DXB A;  1B7U A;  2VD2 A;  2XD2 A;  3TUS A;  3G3J A;  1P99 A;  3V83 A;  2GRV A;  1UTB B;  3ILT B;  1OMP A;  1NNF A;  3E3K A;  3G3G A;  1ZMG A;  3FAT A;  5DEX B;  2VGQ A;  1FTO A;  3N6U A;  4FAJ A;  1EU8 A;  1Y4T A;  2ABH A;  1M5F A;  3K1N A;  3ZS6 A;  5DT6 A;  5FTI A;  4RNS A;  1UIV A;  1AMF A;  2XXQ A;  3DLN A;  3MUQ A;  3FJ7 A;  2RF1 A;  2F7A A;  2Q89 A;  3H06 B;  3T96 B;  4KFQ A;  1R1N A;  1URS A;  1IQ7 A;  3CIJ A;  3GZG A;  3H6V A;  2F5X A;  4FE8 A;  4XIG Q;  2F7C A;  1PBQ A;  5AA3 A;  1ZKB A;  4X1D A;  3RTW B;  3KSJ A;  4YKJ A;  4Z7E A;  2GH9 A;  2FNC A;  2XD3 A;  5FHO A;  5CBS A;  4HCY A;  3QSL A;  5KDT B;  4LZ8 A;  1Q35 A;  1YPN A;  3FXQ A;  5HPQ A;  1HSE A;  4LVQ A;  1MDP 1;  2O1L A;  5I57 A;  2ANJ A;  3CI8 A;  3MZB A;  1NNT A;  3O6H A;  2Z22 A;  4OXV A;  2DS9 A;  2DWJ A;  3GXA A;  1L5T A;  4LZ7 A;  1B1X A;  2HFB A;  4ESX A;  4UAC A;  4LQ2 A;  4H8I A;  4Q30 B;  3H6T A;  1OIB A;  1N7X A;  5I56 B;  4JXI A;  4QHQ A;  3MPK A;  5EHS A;  5KCJ A;  1I6B A;  1S50 A;  3H6W A;  4PE5 B;  5F7V A;  5H8N A;  4I9D A;  2DWA A;  4ESW A;  4FEC A;  1QUI A;  1MQH A;  2XXI A;  2R71 A;  1IXI A;  2FYI A;  3FXU A;  3DEL B;  5DVJ A;  3IB2 A;  4YAH X;  5ITO A;  1PBP A;  4YB6 A;  3W15 C;  3OEM A;  4GQO A;  3PGF A;  5I84 A;  1XT8 A;  2UVI A;  4DZ1 A;  3B6W A;  4OFJ A;  4RPN A;  4QF9 A;  2PT1 A;  1LCF A;  2UVJ A;  4ND9 A;  2RKM A;  1IXG A;  3LC8 A;  4FAT A;  1ELJ A;  3UN6 A;  2B3B A;  1NNP A;  3IL1 B;  1B40 A;  1FQF A;  4H5G A;  3FAS A;  2O69 A;  1IUD A;  2HCA A;  2UXA A;  4NF5 A;  1OLA A;  2Q9T A;  3DP8 A;  4KQP A;  4F1V A;  3OOA A;  1FCK A;  3CSB A;  3QK6 A;  1Y1Z A;  4THI A;  3E13 X;  5JTY A;  1QJM A;  4YB7 A;  5DVF A;  3PPR A;  5H8S A;  3SEW A;  2UYF A;  5I58 B;  4C1U A;  1H44 A;  5AA2 A;  1FTJ A;  4X48 A;  2AYS A;  2F34 A;  4MF3 A;  3K02 A;  3FVK A;  4PQJ A;  3N26 A;  3H3G A;  5H8Q A;  3FGS A;  1FQA A;  1SW2 A;  3EHT A;  3ILU B;  3UA8 A;  3KEI A;  1QKB A;  4OES A;  3Q28 A;  1P1O A;  3PUX E;  1JW5 A;  4OHN A;  5I2N A;  5LOM A;  4U23 A;  3IOR A;  3IOT A;  3VVD A;  1MQJ A;  3EPE A;  5ISU A;  5ITP A;  4ELP A;  4JWO A;  1UQW A;  3A3U A;  1AIV A;  3KSX A;  1D4N A;  3Q26 A;  1DTZ A;  1JVX A;  2F8D A;  1SDX A;  1I69 A;  5F1Q A;  1XOC A;  3UP9 A;  2ONS A;  5HM4 B;  3K0V A;  2G29 A;  4G68 C;  2WKY A;  5FHM A;  4F22 A;  1JQF A;  1B2H A;  3TCF A;  3E9X A;  4ZEB A;  1LAF E;  3W9W A;  2DP8 A;  3H7M A;  2KLF A;  2RCA A;  4ZZA A;  2REJ A;  2M8C A;  2YJP A;  2ZYK A;  1ZJL A;  4R72 A;  4RK2 A;  1M5D A;  3EHU A;  2VHA A;  4PFT A;  1MY4 A;  1JEV A;  2CMO A;  3THI A;  1WDN A;  3GLB A;  1P1W A;  3BKI B;  4F39 A;  1LFI A;  3WAE A;  3KGC A;  3S9N C;  1FQD A;  4EF2 A;  4RA1 A;  2XXR A;  4U4S A;  1B4Z A;  1SBP A;  4ZDM A;  3IJX B;  3VV5 A;  3RNN A;  5L8D A;  4M1V A;  2XXX A;  3KG2 A;  3K4U A;  1N76 A;  4N07 A;  4F3S A;  3MQ9 A;  1H76 A;  2DVC A;  1NNK A;  4OEN A;  2F6P A;  1RYO A;  1QUL A;  3HCQ A;  2DXR A;  2H25 A;  3TPA A;  1US4 A;  1BKA A;  3IX1 A;  4EQB A;  2QSX A;  1GVC A;  3OEK A;  4XKR A;  5CMK A;  1DPE A;  5ELV A;  2ZYO A;  3ONM A;  4ZEC A;  1MY2 A;  2PX1 A;  4GF8 A;  3KBR A;  2Z8E A;  3PPP A;  3HST A;  4QFP A;  4F19 A;  1BIY A;  5I57 B;  3HHF A;  3D4C A;  4NF6 B;  3PUZ E;  4OWD A;  1MPC A;  2VD3 A;  1Y4C A;  1USY H;  4R2F A;  2P0S A;  3R26 A;  4R6Y A;  4AB6 A;  3U72 A;  1YAE A;  3IK6 B;  2DWI A;  4EXK A;  2IA4 A;  2Q2A A;  4RJZ A;  3PD8 A;  4BDO A;  3FV2 A;  5KCJ B;  1N7W A;  2XXP A;  4R2B A;  1VFE A;  3OMB A;  3FUZ A;  1EZP A;  5J1D A;  5H8N B;  1B5J A;  2AL5 A;  1N84 A;  3V5A A;  4GL8 A;  4H1X A;  3O9P A;  3QXM A;  2CZL A;  3SES A;  2OWT A;  4BDR A;  1SYH A;  1N3X A;  4M4G A;  5H8F A;  2XXU A;  3OD7 A;  3TEP A;  3TTK A;  3LSF B;  1LB8 A;  4POW A;  4F18 A;  1ANF A;  5L9O A;  3L6G A;  3C35 A;  5TU0 A;  2I4B A;  2RC9 A;  4E0W A;  3K6W A;  3RT8 A;  3FVO A;  1TT1 A;  5I59 A;  1Y3N A;  2NWJ A;  5HBC A;  4I1D A;  1II5 A;  2G93 A;  3VLU A;  3CG3 A;  3C34 A;  4LZ5 A;  3IJO B;  1AL3 A;  1LAH E;  2IEE A;  4MLQ A;  4IO3 A;  3KN3 A;  1PB7 A;  2O51 A;  4ZEF A;  1VR5 A;  1B3G A;  3G3H A;  4NF5 B;  4XKN A;  3TDJ A;  3OXN A;  1OLC A;  4GD5 A;  3Q27 A;  4OEV A;  4AB5 A;  2HXW A;  4F3P A;  2F78 A;  2ALU A;  2DE4 A;  2X7Q A;  1H45 A;  4MH5 A;  1I6A A;  1S7Y A;  2V25 A;  2QPQ A;  3MP8 A;  5AA2 B;  1TWY A;  5K2X A;  1B3F A;  1JNF A;  3K1P A;  1B5I A;  3UIF A;  3DP4 A;  1DTG A;  4MLV A;  2DXY A;  4RK9 A;  5H8Q B;  5KZT A;  1BP5 A;  1ZU0 A;  5FHN A;  3VE1 B;  4G8M A;  3RY3 A;  2QS4 A;  3TTM A;  1LAX A;  3SET A;  4NF4 A;  2VOZ A;  3CVG A;  2H5Y A;  5CMB A;  3VXC A;  2Z23 A;  3TAJ A;  1TFA A;  5I2N B;  4ZEK A;  3MZ1 A;  1N04 A;  3QYT A;  1A8F A;  3U8Q A;  3CRB A;  4R6K A;  4IGR A;  3MBP A;  3O28 A;  4BDL A;  4HW8 A;  3RLF E;  4U4X A;  4GFR A;  1SYI A;  4I8C A;  4PFU A;  5K2Y A;  3UGW A;  4NTL A;  3TTN A;  1PEB A;  3FVN A;  4G77 A;  2XXH A;  4JSD A;  3QAX A;  3R7X A;  1B52 A;  3EQ1 A;  1FTK A;  3MWB A;  4NF6 A;  4F1Y A;  1MY3 A;  2R9J A;  3JZJ A;  2NVU B;  4MBP A;  1ATG A;  5M2V A;  3OO9 A;  3B7D A;  3OO7 A;  4F2O A;  3BFU A;  1GR2 A;  1IIW A;  3C9H A;  3M3F A;  3IOW A;  4ZS9 A;  2W7Y A;  4ELR A;  2DOJ A;  4O3B A;  4QFN A;  4QSC A;  1SW5 A;  3U92 A;  1NFT A;  4GXA A;  4YIC A;  3GBB A;  4G8N A;  3TCH A;  4DXU A;  2XX9 A;  3G3K A;  1NH7 A;  1OQG A;  1AH5 A;  2V3Q A;  1P1Q A;  3VLV A;  4KD5 A;  3TTL A;  3BFT A;  3T9X B;  3VDF A;  3GBA A;  5AA4 B;  1D9Y A;  3K6U A;  3K6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...