1EH3A

R210k n-terminal lobe human lactoferrin
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
324
structure length
324
Chain Sequence
RSVQWCAVSQPEATKCFQWQRNMRRVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLDWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIKESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords LACTOFERRIN
publication title Crystal structure and iron-binding properties of the R210K mutant of the N-lobe of human lactoferrin: implications for iron release from transferrins.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eh3A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eh3A02
4IO6A 3CG1A 1ELJA 4G8HA 4RY1A 1ATGA 3K02A 5F7VA 1UTHB 4MLQA 1F9BA 1MQIA 3U72A 3VVEA 2WKYA 1DPPA 2LAOA 3FASA 2NXOA 4GQOA 5JTYA 3CFLA 3SEVA 3ZKKA 3FIRA 3O28A 1MXZA 5DYHA 4RYAA 1SDXA 1FTKA 3K1PA 1LCTA 4NWDA 3Q29A 4U4SA 1ZMGA 4GRKA 3VVDA 1DTGA 2DWJA 2I0BA 2AL5A 3MZ1A 1MG1A 3O66A 1DTZA 2QPQA 3RN8A 4KPTA 1B9JA 3EF7A 5M2VA 3QXMA 4QHQA 5I2NA 3B6WA 4THIA 4H67A 1ZJLA 3VXBA 3T9VA 1VSOA 1PB7A 3P7IA 5CMBA 1LB8A 3KSJA 5DT6A 3KN3A 4ZE9A 2PMSA 4F3BA 3H7MA 2GHAA 3H4ZA 3FJGA 1B3GA 4NF8B 2Y7PA 3T96B 3OXNA 1P1UA 3G3HA 4GXSB 1Y4CA 4OWDA 4TLMB 1FQFA 3BBRA 3FVOA 2V25A 4DIGA 2PT2A 3OOAA 2NOOA 2ZYKA 1B2HA 3FVGA 2AIXA 2OK2A 3MZ9A 1Y20A 3O97A 2IEEA 4EF2A 1GR2A 3TPAA 3E3KA 2DS9A 4NF6B 2XXXA 3MVWA 4LP2B 1A99A 3ZSFA 1Y3QA 1MQJA 1N7XA 4JWOA 2XXUA 4YAHX 3PV0E 1OQGA 5FHOA 2A5TB 2V3TA 5I58A 3UORA 3IX1A 4GL8A 1FTOA 4PE5B 4LA9A 4G77A 5AA2B 3PPOA 2H5YA 3HO7A 5TP9B 3MJNA 1JETA 4TQUQ 3PMVA 4F29A 2XXHA 4KYSA 3H06B 1TWYA 5DVIA 1XVYA 4EDPA 4JWYA 5DVJA 3N94A 1D9YA 1LFIA 2XXQA 3TCFA 1LFGA 4NWCA 1IXCA 2YJPA 1FTJA 3PGFA 1IXGA 3L6HA 1SI0A 1SD3A 4LVQA 5HPQA 1P1OA 1FTMA 1N04A 4HTGA 3IJXB 2GHBA 4GFRA 2ANJA 5IAIA 1P1QA 3ODBA 4U21A 3BKIB 4OVJA 3JYRA 1B46A 3N6UA 1OLCA 5CMCA 4WEPA 3VLWA 4RJZA 5EYFA 3DELB 5B70A 2RKMA 4X48A 4P0IA 4U4XA 4ZEIA 3TQWA 1TXFA 5KDTA 1MY1A 3TTNA 3A3CA 1PB8A 4HW8A 1MRPA 4F1VA 2I49A 3MUQA 4YZZA 2OJTA 4JDFA 1QVSA 2ZYOA 1LB9A 1VR5A 2XXWA 1UIUA 1ZIUA 5H8FA 3TYHA 1O64A 2Y84A 3KJ7A 3G3FA 2F5XA 3OELA 2RC9A 4DZ1A 1EZ9A 4FEDA 4XXUA 2F8DA 5JTYB 3TZAA 1JNFA 1MQGA 3USDA 3IJOB 3TMGA 3O29A 3EHUA 2HCAA 3WAEA 3KEIA 1USYH 2Q2CA 2UYEA 3MPLA 2O84X 4LZ8A 5KCJA 3K6XA 2ESNA 1BIYA 2DVCA 1AMFA 4F19A 1MPCA 5I2NB 4KFQA 4G8NA 4JBZA 2VOZA 1XHYA 1QUKA 3UA8A 2F34A 4F18A 4X1BA 4OFLA 4R6YA 1B4ZA 4FECA 2F35A 1MPBA 4FEBA 4POWA 4Q30B 3TELA 3QIMA 4ZZAA 5LOMA 1P1NA 2H99A 4YKPA 2PBWA 2I48A 2Z8EA 1JVYA 4I8CA 1ZLQA 3K6UA 4UACA 2XX9A 3U1OA 3RT8A 3C36A 3S4UA 5CC2A 1FW0A 2UVIA 3N5LA 4F2OA 2O6AA 4KCDA 2HFBA 3IOVA 4EF1A 1H43A 4NEDA 3U93A 3Q25A 5I2KA 1LBBA 3TTKA 3LBSA 1II5A 1SYIA 4OFJA 4P11A 3FXRA 2X26A 2ZXTA 3OSQA 1DSNA 1YTVA 2RC7A 4X9TA 2PVUA 1LAFE 4LATA 1HSJA 3FVNA 2DVZA 3IO6A 4WXJA 5I58B 3OD7A 1US5A 3IB2A 1B6HA 3PUYE 4O3AA 4GD5A 1MXYA 4IO7A 1SBPA 4GIZA 4ELOA 4R6KA 1BLFA 4E0XA 2ZNUA 1NH8A 3V8XB 1NL5A 4P0GA 5EHSA 1BTJA 3GLBA 3M3KA 5AA4A 2VD3A 4H1XA 4FATA 4F1UA 4QRZA 3KZGA 4BLAA 1GTKA 3K4UA 1XS5A 2DP8A 4QSDA 4EXKA 4R74A 1A40A 3TFLA 2V84A 3M8UA 1B0HA 1SQYA 3LSFB 4PFUA 5AA2D 4IGTA 1DOTA 3PU5A 1CB6A 5CBSA 1O63A 3A09A 1Y3NA 1B4HA 3N26A 4YKKA 3DP6A 4ESWA 2O69A 2D5WA 3W9VA 1B52A 2ABHA 1EZPA 3H3GA 4I62A 2Q89A 4KHZE 1GVCA 3MVXA 2W7YA 2VHAA 2ALUA 1MPDA 2QS3A 5KDTB 2UVJA 2DQVA 2AL4A 3PUXE 5FTHA 2ONKE 1A8EA 4L17A 1MXVA 3KSXA 3IO4A 1B51A 1SW5A 2KLFA 4JWXA 2THIA 1RKMA 3O6GA 2F6GA 5H8FB 4QFNA 1JVXA 3PPNA 1IIWA 2HXWA 1A54A 4QFOA 1FQBA 3WAFA 2DYXA 1D4NA 2DE2A 3I6VA 4RNSA 2UVHA 4OQOA 1M5FA 2OWTA 2AYSA 3CSGA 3MW0A 3TCGA 2B3BA 3QAXA 3ZKLA 1I6BA 5KZTA 3PPQA 5CI5A 3LC8A 2QS4A 4BDRA 3KOTA 4TLLB 5KCJB 3TTMA 3QSLA 2B3FA 3SESA 2Y7RA 5DVFA 4O3BA 2BJJX 2Q88A 2Q9TA 2RINA 1N7WA 3EPEA 4YKJA 3QK6A 3IOUA 3OMBA 2QMXA 1P1WA 3GBBA 4G68A 1H45A 3VFJA 5ITOA 2Y7KA 2ZNTA 4EXLA 2ZYNA 4H5FA 3CI8A 3S9LC 3DLNA 4KD5A 3MZBA 4QSCA 5TPAA 3T9XB 1MY4A 1PDAA 1RYOA 3MC2A 1LBCA 3FVKA 1LLSA 1QUIA 3MPKA 1PB9A 3S9MC 3MVZA 2RCAA 3SEYA 3FZVA 1Y3PA 2GH9A 4X1DA 3K0VA 1GGGA 5FHNA 3PPPA 4AQ4A 1OMPA 3FD3A 5I2KB 3PD8A 4KI0E 1CE2A 3VDFA 3K6WA 2X7PA 5AA1A 2ZMBA 1YPNA 2VGQA 2H25A 4KCCA 4YB7A 1JEVA 1LAGE 4NF4A 1JEUA 1PBQA 4RK9A 4YB6A 2UVGA 1MQDA 3PUZE 4OHNA 1KWHA 4FORA 4ND9A 4ONYA 2X7QA 4MH5A 1Y1ZA 2D3IA 4YMAA 4F22A 2OWSA 3KJTA 2O1LA 1P99A 5AA4B 4ESXA 3V89B 3MP8A 3OEMA 4G4PA 3FJMA 2HQ0A 3OO9A 1R9QA 3TUSA 3MP6A 2O68A 3I5OA 2CZLA 1NFTA 3W9WA 2I3WA 1PEBA 4GL0A 3S9NC 1Z7NE 1HSEA 2FNCA 4U2RA 4R6HA 3C35A 1N3WA 4ZZEA 1B58A 2Z23A 2G93A 5J1DA 2FYIA 3QYTA 1NKXA 3CSBA 2PX1A 3OENA 4NTLA 2F36A 3E9XA 3DM0A 1MY2A 2Q8JA 1LSTA 5JEIA 2GFEA 3FUZA 1B7ZA 1MM7A 3C4MA 3O2AA 1EU8A 3SEUA 1M5DA 2DXRA 3S9EA 3HHFA 3IOWA 3RT6B 3R7XA 2QL3A 2Y7IA 5HBCA 1B7HA 3D4GA 3V5AA 3KG2A 4QF9A 1B5JA 4BDQA 1QW0A 2F7CA 2V3UA 2I4BA 2XX8A 2DOJA 1JQFA 4DCYA 1QKAA 2E1SA 3HCQA 2RF1A 1J1NA 1OVBA 3HSTA 3RPWA 4GXAA 3EHTA 3F11A 4QSEA 4DXCA 1QULA 1EZOA 4KYDA 3C33A 3OO8A 4I9DA 2XD2A 1RYXA 5H8QA 3FV2A 5EHMA 3VE1B 4C1TA 2R6GE 3VLUA 5K2YA 3H6UA 5AA3A 4LZ5A 4H8JA 4LQ5A 5H8NA 3O6IA 4E0WA 4G68B 3ONMA 2QS1A 1FCKA 3Q28A 3TODA 4GOTA 5H8SA 2Z8FA 3KOSA 3PMWA 3T93B 1QUJA 2DXYA 5BUUA 4OEVA 2OLBA 5TPAB 3PUVE 1I6AA 4MF3A 1UIVA 4I1DA 5L9OA 1SW4A 4FE8A 1VFDA 4R2FA 1Q35A 5BWJA 3U8QA 4M4GA 1B40A 4N07A 5ELVA 3V83A 4F39A 4H0WA 3FXUA 1MXXA 4U22A 4Q8RA 1Y9UA 1M5EA 3BFUA 3PUWE 1IQ7A 2QMWA 3RLFE 3G3GA 3IB0A 5ICTA 3AXFA 1URGA 1VFEA 3RTFB 4NF4B 3HHGA 3HN0A 3IAZA 4ZEFA 4PQJA 3T22A 3C32A 4K3FA 1NMUA 1B0LA 3GXAA 4ELRA 2H9BA 5I57A 4XKPA 4DE8A 3M3LA 2XXIA 5I59A 2P2AA 4ECFA 1IITA 1URDA 4F3PA 4OESA 1Q1KA 5ITPA 1ANFA 4YU0A 1R1NA 4NMYA 4XKRA 2F97A 4R75A 3HV1A 3E4RA 3G3KA 4Q0CA 3CFZA 3K2DA 1B3HA 1N84A 1BP5A 2I6EA 2F78A 1A55A 5H8HA 2FA7A 3OO7A 2HZKA 3FGSA 3OEKA 1ZU0A 1S9TA 3TKDA 4H65A 4ZE8A 1I6QA 4PFYA 3GZGA 5HM4B 4FAJA 3ECRA 4BDNA 4LUBA 5I56A 3LR1A 1Z7ME 3T66A 3PPRA 3UK4A 2A5SA 4IO3A 2OBGA 3IL1B 5TU0A 1L5TA 2O7IA 4BDMA 3EHSA 3SETA 5AE4A 3TDJA 2Q2AA 4AB6A 3JZJA 3IOTA 4RPNA 2F7AA 5CM6A 5DTBA 4Z0IA 4U23A 1T0KA 4ZEDA 3ILTB 4DLDA 1PBPA 2CMOA 2QRYA 3S2VA 4HCYA 4OTEA 4Q5TA 4OYVA 1IXIA 5A5XA 5CMMA 1NH7A 4G2ZA 1QJMA 1B5HA 1VE4A 2UXAA 1LCFA 4MFIA 2R71A 3FV1A 1UQWA 2XXVA 4F1YA 3K00A 5FHMA 1A7LA 1M5BA 4MLVA 2Z8DA 1SYHA 3CG3A 2I4CA 4NE4A 4R73A 3K1NA 3PMXA 1R9LA 1MDQA 3K6VA 3KN8A 2D21A 2O51A 4YKIA 4YICA 3C31A 1OLAA 4ISUA 1USYE 3B7DA 2PYYA 3R26A 1FQDA 5H8QB 1N0TA 4QFPA 1B1HA 1MDP1 1FQEA 1US4A 3B6QA 4IY6A 2HAUA 1DPEA 3N6TA 2O1MA 2P1SA 5H8NB 5CRYA 3RTWB 1S7YA 4PFWA 3VVFA 1EH3A 3R6UA 1D9VA 4IGRA 3TTRA 2NVUB 3H6WA 4OXVA 4N6PA 3UN6A 5CBRA 4JSOA 4OERA 2I3VA 1NNFA 4F3GA 1A8FA 2XD3A 4BDLA 1BKAA 1MQHA 1MH3A 4PFTA 4G8MA 4EQ7A 4XKNA 1B5IA 2XX7A 3JV9A 2G29A 3RGYA 3E13X 3MWBA 1AIVA 1D3KA 2UYFA 4R9GA 2HAVA 3UIFA 3B6TA 4ZEKA 4RXLA 3K1MA 2REJA 1AL3A 4U1OA 4H8IA 4DXUA 4NF5A 3MP1A 3TEPA 1MXUA 3DP4A 4FIMA 3LSXA 5L9MA 4F31B 1IZ1A 1URSA 3RUMA 3G7WA 5I57B 3FJ7A 4YB5A 3HPIA 1JW4A 3T9UA 2ONSA 3Q27A 2ONRA 5I59B 4ELQA 3THIA 3M3FA 4JB7A 4H6DA 2R9JA 2ZYMA 4PETA 1B7UA 4OMBA 4HS7A 2NUVA 4G68C 3DP8A 4DCXA 4JXIA 4YMBA 3TAJA 3Q26A 2F7BA 1NNKA 2XXYA 4XTCQ 2O7UA 3MQ9A 5DEXA 2DWIA 2YLNA 2ZNSA 3CRBA 4M1VA 1OIBA 4R2BA 3IB1A 4AB5A 1M5CA 5H8HB 3MBPA 2XXPA 4IY5A 1YCJA 3KN7A 3KBRA 2I0CA 2QS2A 3D4CA 1UTBA 4Z7EA 1MY3A 1XC1A 1S50A 1B05A 3U94A 1FTLA 4C1UA 3C9HA 3TTLA 5I56B 4GVOA 2XXRA 3RQTA 4UA8A 3U92A 4EQBA 1ZBMA 1FQAA 3H6VA 5ICQA 2HZLA 2VP1A 3T9HB 2REGA 3VLVA 4BDOA 1UTHA 3EN3A 1LAHE 2B65A 2DSFA 3L6GA 5CMKA 2Y7WA 3K01A 3SEWA 2V93A 3G3JA 3SERA 2RCBA 5L9SA 4KYEA 3SKPA 4IO4A 3LSWA 1WDNA 5A5XB 2I58A 4RPOA 1N76A 4IB2A 4KR5A 4N13A 1XT8A 4F2QA 1PC3A 1O7TA 3TQLA 1MY0A 4TOZA 4ZEBA 1SVXB 4ZDMA 3IR1A 1I69A 3BFTA 1SI1A 5B7DA 1WVJA 1ZKBA 3O6HA 4LQ2A 3VXCA 3KFMA 3QUJA 1FQCA 4R9FA 3ZS6A 4FJPA 1LFHA 5F1QA 4OZ9A 2QJEA 4XIGQ 1TFDA 5FTIA 1IUDA 3TCHA 4GLIA 1NNPA 1R6ZA 3QUFA 2GRVA 1IEJA 1SW1A 1OVTA 1POTA 4OFOA 3KGCA 4NF8A 3CVGA 1B32A 2DE3A 1SW2A 2M8CA 4ELPA 1XOCA 4H5GA 3G3IA 2DWAA 1LGBC 3OO6A 5K2XA 2PT1A 3IORA 3RY3A 1H3DA 3SEXA 3ILUB 4C0RA 4MBPA 1N3XA 2OCUA 3EQ1A 3CIJA 4U1ZA 1TFAA 1HSLA 3SDFA 3GBAA 3I3VA 3OSRA 4DXBA 1B3FA 1YAEA 4NF6A 4OETA 1MXWA 3VV5A 1DMBA 2P0SA 1ZTYA 1NNTA 4F3SA 2Z22A 3UGWA 3A3UA 1TT1A 5IKBA 4HCWA 4KQPA 4XKQA 2DE4A 1OQHA 1B3LA 1JW1A 3IK6B 5JK4A 1GV8A 2QSXA 2A5TA 1MS7A 3FXQA 2RC8A 2V3QA 4EUOA 3PD9A 1XVXA 5AA2A 4POXA 4ZS9A 2IA4A 3RNNA 4NF5B 3UP9A 5TP9A 3MAMA 3W15C 2XXTA 1B1XA 1Y1MA 4RK2A 5ISUA 1MH4A 2VD2A 2YPNA 4RA1A 5L8DA 2DWHA 2NWJA 4IO2A 1IXHA 3CR9A 1JW5A 1QKBA 3CFXA 2H4IA 4QFKA 1H44A 4WEDA 4JSDA 4DDDA 1POY1 3C34A 4OEUA 1WODA 2H98A 4QFLA 3H03A 2E0SA 4GWOA 2HEUA 1Y4TA 5DEXB 4PP0A 3O9PA 4EQ9A 4IO5A 3FATA 4ZECA 4GF8A 4LONB 2XHDA 1AH5A 4WKMA 1B3EA 1LAXA 1MM6A 4R72A 2OZZA 4O3CA 1UTBB 3MVYA 1H76A 4OENA 4LZ7A 2F6PA 3H6TA 3LSLA 1AOVA 5I84A 3LUYA
chains in the Genus database with same CATH superfamily
5IZ3A 4IO6A 3CG1A 4N4UA 1ELJA 2XWIA 3KBZA 4G8HA 2FHYA 4RY1A 1IMBA 1ATGA 3K02A 5F7VA 1UTHB 4MLQA 1F9BA 1MQIA 3U72A 3VVEA 2WKYA 1DPPA 2LAOA 3FASA 2NXOA 4GQOA 5JTYA 3CFLA 3SEVA 3ZKKA 3FIRA 3O28A 1MXZA 5DYHA 4RYAA 1SDXA 1FTKA 3K1PA 1LCTA 4NWDA 3Q29A 4U4SA 1ZMGA 4GRKA 3VVDA 1DTGA 2DWJA 2I0BA 1FBEA 4GBWA 2AL5A 3MZ1A 1MG1A 3O66A 1DTZA 2QPQA 2QVVA 3RN8A 4KPTA 1B9JA 2Q74A 2WYKA 3EF7A 5M2VA 3QXMA 4QHQA 4JVIA 5FBPA 5I2NA 3B6WA 4THIA 4H67A 1ZJLA 3VXBA 3T9VA 1VSOA 4PF8A 1PB7A 3P7IA 5CMBA 4MMPA 1LB8A 3KSJA 5DT6A 3KN3A 4ZE9A 2PMSA 4F3BA 3H7MA 2GHAA 3H4ZA 3FJGA 3FXBA 1B3GA 4NF8B 2P3VA 2Y7PA 4OVQA 3T96B 3OXNA 1P1UA 3G3HA 4GXSB 1Y4CA 4OWDA 4TLMB 1FQFA 3BBRA 3FVOA 2V25A 4DIGA 4P3LA 2PT2A 3OOAA 4GWYA 2NOOA 2ZYKA 4G61A 3MYUA 1B2HA 3FVGA 4PFBA 2AIXA 2OK2A 3MZ9A 1DBZA 1Y20A 1FPGA 3O97A 2IEEA 4EF2A 1JP4A 2Y5KA 1GR2A 3TPAA 3E3KA 2DS9A 4NF6B 2XXXA 3MVWA 4LP2B 1A99A 4I3EA 3ZSFA 4HXVA 1Y3QA 1MQJA 2XWVA 1N7XA 4JWOA 3IFAA 2XXUA 4PCDA 4YAHX 1NV3A 3PV0E 1OQGA 5FHOA 2A5TB 2V3TA 5I58A 2XWKA 3UORA 3IX1A 4GL8A 1FTOA 4PE5B 4LA9A 4G77A 5AA2B 3PPOA 2H5YA 3HO7A 5TP9B 5IZZA 3MJNA 1NV4A 1JETA 4TQUQ 4FBPA 3PMVA 4F29A 2XXHA 4KYSA 1NUYA 3H06B 4PFIA 2GQ1A 1TWYA 5DVIA 1XVYA 4EDPA 4JWYA 5DVJA 3N94A 1D9YA 1LFIA 2XXQA 3TCFA 1LFGA 4NWCA 1IXCA 2YJPA 1FTJA 3PGFA 1IXGA 3L6HA 1SI0A 2ZZWA 1RDZA 1SD3A 1NUZA 4LVQA 5HPQA 5I7IA 1P1OA 1FTMA 1NV7A 1N04A 4HTGA 3IJXB 2GHBA 4GFRA 2ANJA 2OWZA 5IAIA 1P1QA 3ODBA 4U21A 4XF5A 3BKIB 4OVJA 3JYRA 1B46A 3N6UA 1OLCA 4X04A 5CMCA 4WEPA 3VLWA 4RJZA 5EYFA 1FPIA 3DELB 5B70A 2RKMA 3BIHA 4X48A 1FPJA 3KC0A 4P0IA 4U4XA 4ZEIA 1YXIA 3TQWA 1TXFA 5KDTA 1MY1A 3TTNA 1BK4A 1PB8A 3A3CA 4HW8A 1MRPA 4F1VA 2I49A 3MUQA 4YZZA 2OJTA 4JDFA 1QVSA 2ZYOA 1LB9A 1VR5A 2XXWA 1UIUA 1ZIUA 5H8FA 3TYHA 5IZ3B 1NV1A 1O64A 2Y84A 3KJ7A 3G3FA 2F5XA 3OELA 4DI4B 2RC9A 4DZ1A 1EZ9A 4FEDA 4XXUA 4AS4A 1LBWA 2F8DA 5JTYB 3TZAA 1JNFA 1MQGA 3USDA 1FSAA 3IJOB 4MJOA 4NQ8A 5EYGA 3TMGA 3O29A 3EHUA 4PDHA 2HCAA 3WAEA 3KEIA 1USYH 2Q2CA 1NV2A 2UYEA 3MPLA 4NX1A 2O84X 4LZ8A 5KCJA 1SPIA 3K6XA 2ESNA 1BIYA 4GWSA 2CZIA 2DVCA 1AMFA 4F19A 1MPCA 2V4CA 5IZ1A 5I2NB 4KFQA 1IMAA 4G8NA 4JBZA 2VOZA 1XHYA 1QUKA 3UA8A 1NV6A 2F34A 4F18A 4X1BA 4OFLA 4R6YA 1B4ZA 4FECA 2F35A 1MPBA 4FEBA 4POWA 4Q30B 3TELA 3QIMA 4ZZAA 3FBPA 5LOMA 1P1NA 2H99A 4NG7A 1NI9A 4YKPA 2PBWA 2I48A 2Z8EA 1JVYA 4I8CA 1ZLQA 3K6UA 4P8BA 1FPFA 4UACA 2XX9A 3U1OA 4XEQA 4N8GA 3RT8A 3C36A 4PTKA 3S4UA 5CC2A 1FW0A 4MNPA 2UVIA 3N5LA 4F2OA 4PF6A 2O6AA 4OVPA 4KCDA 2HFBA 3IOVA 4EF1A 1H43A 4NEDA 3U93A 3Q25A 5I2KA 2B4MA 2WEFA 1LBBA 3TTKA 3LBSA 1NUWA 1II5A 1SYIA 4OFJA 4P11A 1FBDA 3FXRA 2X26A 2ZXTA 3OSQA 1DSNA 1YTVA 2RC7A 4X9TA 2PVUA 1LAFE 4LATA 1HSJA 3FVNA 2DVZA 3IO6A 4WXJA 5I58B 3OD7A 1US5A 3IB2A 1B6HA 3PUYE 1Q9DA 4O3AA 4GD5A 1MXYA 4IO7A 1SBPA 4GIZA 4ELOA 4R6KA 1BLFA 4E0XA 2ZNUA 1NH8A 3V8XB 1NL5A 4P0GA 5EHSA 1BTJA 3GLBA 3M3KA 5AA4A 2VD3A 4H1XA 4FATA 4F1UA 4QRZA 3KZGA 4BLAA 1GTKA 3K4UA 1XS5A 2DP8A 4QSDA 4EXKA 1DCUA 4R74A 4LN5A 1A40A 1YZ0A 3TFLA 2V84A 3M8UA 1B0HA 1SQYA 3LSFB 4PFUA 5AA2D 4IGTA 1DOTA 3PU5A 1CB6A 4P1EA 5CBSA 1O63A 3A09A 1Y3NA 1B4HA 3N26A 4YKKA 3DP6A 4ESWA 2O69A 2D5WA 4GWUA 5LTCA 1B52A 2ABHA 3W9VA 1EZPA 3H3GA 4I62A 2Q89A 4KHZE 4I3YA 1GVCA 3MVXA 2W7YA 2VHAA 2ALUA 1MPDA 2QS3A 4I40A 5KDTB 2UVJA 2DQVA 2AL4A 4GX4A 3PUXE 5FTHA 2ONKE 1A8EA 4L17A 1MXVA 3KSXA 3IO4A 1B51A 1SW5A 4GX6A 2KLFA 4JWXA 2THIA 1RKMA 5ET8A 3O6GA 2F6GA 5H8FB 4QFNA 1JVXA 3PPNA 1IIWA 2FIXA 2HXWA 4N6KA 1A54A 4QFOA 1FQBA 1XI6A 3WAFA 2DYXA 1D4NA 5IM2A 2DE2A 3I6VA 4RNSA 2UVHA 4OQOA 3RPLA 1M5FA 2OWTA 2AYSA 3CSGA 3MW0A 3TCGA 2B3BA 3QAXA 3ZKLA 1I6BA 5KZTA 3PPQA 5CI5A 2BJIA 3LC8A 2QS4A 4BDRA 3KOTA 4TLLB 2WX9A 4MHFA 5KCJB 3TTMA 3QSLA 2B3FA 3SESA 1FJ9A 2Y7RA 1FJ6A 5DVFA 4O3BA 2BJJX 2Q88A 2Q9TA 2RINA 1N7WA 3EPEA 4YKJA 3QK6A 3IOUA 3OMBA 2QMXA 3LUZA 1P1WA 3GBBA 2PFYA 4G68A 1H45A 3VFJA 5ITOA 2Y7KA 2ZNTA 4EXLA 2ZYNA 4H5FA 3CI8A 1NV0A 3S9LC 3DLNA 4OVRA 4KD5A 3MZBA 4QSCA 5TPAA 2WYPA 3T9XB 1EYKA 1MY4A 1PDAA 1RDYA 1RYOA 3MC2A 1LBCA 3FVKA 1LLSA 1QUIA 2JJKA 3MPKA 1PB9A 3S9MC 3MVZA 2RCAA 3SEYA 3FZVA 1Y3PA 2GH9A 4X1DA 3K0VA 1GGGA 5FHNA 3PPPA 3E78A 4AQ4A 1OMPA 3FD3A 5I2KB 3PD8A 4KI0E 4PDDA 4N6DA 1CE2A 4MNCA 3VDFA 3K6WA 2X7PA 5AA1A 2ZMBA 1YPNA 4XFEA 2VGQA 2H25A 3ROJA 4KCCA 2MKZA 4YB7A 1JEVA 1LAGE 4NF4A 1JEUA 1PBQA 4RK9A 4YB6A 2UVGA 1MQDA 3ISPA 3PUZE 4OHNA 1KWHA 4FORA 4N91A 2VT5A 4ND9A 4ONYA 2X7QA 4MH5A 1Y1ZA 5IGAA 2D3IA 2VPOA 4YMAA 4F22A 2OWSA 3KC1A 3KJTA 2O1LA 1P99A 1QGXA 5AA4B 4ESXA 3V89B 3MP8A 3OEMA 4G4PA 3FJMA 3T1BA 2HQ0A 3OO9A 1R9QA 4PBHA 3TUSA 3MP6A 3IFCA 2O68A 3I5OA 2CZLA 1NFTA 3W9WA 2I3WA 1PEBA 4GL0A 3S9NC 1Z7NE 1HSEA 2FNCA 4U2RA 4R6HA 3C35A 1N3WA 1AWBA 4ZZEA 1B58A 2Z23A 2G93A 5EYHA 5J1DA 2FYIA 3QYTA 1NKXA 3CSBA 2PX1A 3OENA 4NTLA 2F36A 3E9XA 3DM0A 1MY2A 2Q8JA 1LSTA 5JEIA 2GFEA 3FUZA 1B7ZA 1MM7A 3C4MA 1NV5A 3O2AA 1EU8A 3SEUA 4AS5A 4O8MA 1M5DA 3MSTA 2DXRA 3S9EA 3HHFA 3PTYA 3IOWA 3RT6B 3R7XA 2QL3A 2Y7IA 5HBCA 1B7HA 3EKIA 3D4GA 3V5AA 3KG2A 4QF9A 1B5JA 1IMCA 4BDQA 1QW0A 2F7CA 3RPLB 2V3UA 5EQAA 2PFZA 2I4BA 2XX8A 2DOJA 2R8TA 1JQFA 4DCYA 1QKAA 2E1SA 3HCQA 2RF1A 1J1NA 1OVBA 3HSTA 3RPWA 4GXAA 4QBAA 3EHTA 3F11A 4QSEA 4DXCA 3HFUA 1QULA 3SZPA 1EZOA 4KYDA 3C33A 4OA4A 4OVSA 3OO8A 4I9DA 2XD2A 4N17A 1RYXA 5H8QA 3FV2A 5EHMA 3VE1B 5ET5A 4C1TA 2R6GE 2DDKA 4JVCA 3VLUA 5LDZA 5K2YA 3U65A 3H6UA 5AA3A 4LZ5A 4H8JA 4LQ5A 5H8NA 3O6IA 4E0WA 4G68B 3ONMA 2QS1A 1FCKA 3Q28A 3TODA 4GOTA 1EYIA 5H8SA 2Q8MA 1IMDA 2Z8FA 3KOSA 3PMWA 3T93B 1QUJA 2DXYA 5BUUA 4OEVA 2OLBA 2ZZVA 5TPAB 2HPGA 3PUVE 1I6AA 4MF3A 1UIVA 4I1DA 5L9OA 1SW4A 1FPBA 4FE8A 1VFDA 4R2FA 1Q35A 5BWJA 1LBZA 3U8QA 4M4GA 1B40A 2KR0A 4N07A 5ELVA 3V83A 4F39A 1FBCA 4UABA 4H0WA 3FXUA 1MXXA 4U22A 4GWZA 4Q8RA 1Y9UA 1M5EA 1KA0A 2XWOA 3BFUA 1IQ7A 2QMWA 3PUWE 3RLFE 3G3GA 3IB0A 5ICTA 3AXFA 3D1RA 1URGA 1VFEA 3RTFB 1CNQA 5ET7A 4NF4B 3HHGA 3HN0A 3IAZA 4ZEFA 4PQJA 3T22A 3C32A 4K3FA 1NMUA 1B0LA 3GXAA 4ELRA 2H9BA 5I57A 4KXPA 4XKPA 4DE8A 3M3LA 4PFRA 2XXIA 4PAKA 2FBPA 5I59A 2P2AA 4ECFA 1IITA 1URDA 4F3PA 4OESA 2CEYA 1Q1KA 4MAGA 5ITPA 1ANFA 4YU0A 5DW8A 1R1NA 4NMYA 4XKRA 2F97A 4R75A 4MIJA 3HV1A 3E4RA 3G3KA 4Q0CA 3CFZA 3K2DA 1YYZA 1B3HA 4OVTA 3B8BA 5I3SA 4NF0A 1N84A 1BP5A 2I6EA 2F78A 1A55A 5H8HA 5T3JA 2FA7A 3OO7A 2HZKA 3FGSA 1IMFA 3OEKA 1ZU0A 1S9TA 3TKDA 4H65A 4ZE8A 1I6QA 4PFYA 3GZGA 5HM4B 4FAJA 3ECRA 4BDNA 4LUBA 5I56A 3LR1A 4H46A 3QMFA 4PBQA 1Z7ME 3T66A 3PPRA 1FBHA 3UK4A 2A5SA 4IO3A 2OBGA 3IL1B 2HHMA 5TU0A 1L5TA 2O7IA 4BDMA 3EHSA 4PGNA 3SETA 5AE4A 3TDJA 2Q2AA 4AB6A 3JZJA 3IOTA 5EQ7A 4RPNA 2F7AA 5CM6A 5DTBA 4Z0IA 4U23A 1INPA 1T0KA 4ZEDA 3ILTB 4DLDA 1PBPA 4N81A 2CMOA 2QRYA 2F3DA 3S2VA 4HCYA 1EYJA 4OTEA 4Q5TA 4OYVA 1LBYA 1IXIA 1LEVA 5A5XA 5CMMA 1NH7A 4G2ZA 1QJMA 1B5HA 1VE4A 3BIGA 2UXAA 1LCFA 4MFIA 2R71A 3FV1A 1UQWA 2XXVA 4F1YA 3K00A 5FHMA 1FPDA 1A7LA 1M5BA 4MLVA 2Z8DA 1SYHA 4P47A 3CG3A 2I4CA 4NE4A 4R73A 3K1NA 3PMXA 1R9LA 1MDQA 3K6VA 3KN8A 4O94A 2D21A 2O51A 4YKIA 1RDXA 4YICA 3C31A 1OLAA 4ISUA 1USYE 3B7DA 2PYYA 3R26A 1FQDA 5H8QB 4OANA 1N0TA 4QFPA 1B1HA 1MDP1 1FQEA 1US4A 3B6QA 4IY6A 2HAUA 1DPEA 3N6TA 2VPNA 2O1MA 2P1SA 5H8NB 5CRYA 3GYYA 3RTWB 1S7YA 4PFWA 3VVFA 1EH3A 3R6UA 1D9VA 4IGRA 3TTRA 2NVUB 3H6WA 4OXVA 4N6PA 3UN6A 5CBRA 4JSOA 1LBVA 4OERA 2I3VA 1NNFA 4F3GA 1A8FA 2XD3A 4NAPA 4BDLA 1BKAA 5A5LA 1MQHA 1VDWA 1MH3A 4PFTA 1FBFA 4G8MA 4EQ7A 4XKNA 2B4LA 1B5IA 2XX7A 3JV9A 2G29A 3RGYA 3E13X 3MWBA 1AIVA 1D3KA 2UYFA 4R9GA 2KQZA 2HAVA 2ZZXA 3UIFA 3B6TA 4ZEKA 4RXLA 3K1MA 1FTAA 4H45A 2REJA 1AL3A 4U1OA 4QXDA 4H8IA 4GWXA 4HE0A 4DXUA 4NF5A 3MP1A 3TEPA 1MXUA 3DP4A 4FIMA 3LSXA 5L9MA 4F31B 1IZ1A 1URSA 2WBDA 3RUMA 1G0HA 3G7WA 5I57B 3FJ7A 3E79A 4YB5A 3HPIA 1JW4A 3T9UA 2ONSA 3Q27A 2ONRA 1K9ZA 5I59B 4O7IA 4ELQA 3THIA 3M3FA 4JB7A 5I5PA 4H6DA 2R9JA 2ZYMA 4PETA 4P1LA 1B7UA 4OMBA 2Y5LA 4HS7A 2NUVA 4G68C 3DP8A 4DCXA 4JXIA 4P56A 4NGUA 4YMBA 3TAJA 3Q26A 4PE3A 2F7BA 1NNKA 2XXYA 4XTCQ 2O7UA 3MQ9A 5DEXA 2DWIA 2YLNA 2ZNSA 3CRBA 5EQ8A 4M1VA 1OIBA 4R2BA 1FPEA 3IB1A 4AB5A 1M5CA 5H8HB 3MBPA 2XXPA 4HE1A 4IY5A 1YCJA 3KN7A 3KBRA 2FVZA 2I0CA 2QS2A 3D4CA 1UTBA 4Z7EA 1MY3A 1XC1A 1S50A 1B05A 3U94A 1FTLA 4C1UA 3C9HA 3TTLA 4MCOA 5I56B 2CEXA 4GVOA 2XXRA 1FRPA 3RQTA 4UA8A 3U92A 4EQBA 1ZBMA 1FQAA 3H6VA 4O7MA 5ICQA 2F3BA 4PGPA 2P3NA 2HZLA 2VP1A 3T9HB 2REGA 3VLVA 4BDOA 4MEVA 1UTHA 3EN3A 1LAHE 2B65A 2DSFA 3L6GA 5CMKA 2Y7WA 3K01A 3SEWA 2CZKA 2V93A 3G3JA 3SERA 4DI3D 2RCBA 5L9SA 4KYEA 3SKPA 4IO4A 4X8RA 3LSWA 1WDNA 5A5XB 2XA5A 2I58A 4RPOA 4HE2A 1N76A 4IB2A 4KR5A 4N13A 1XT8A 4F2QA 2PCRA 4NHBA 1PC3A 1O7TA 1D9QA 4NN3A 3TQLA 1MY0A 4TOZA 1DK4A 4ZEBA 1SVXB 4ZDMA 1FBGA 4MX6A 3IR1A 1I69A 3BFTA 1SI1A 3RYDA 2QVUA 5B7DA 1WVJA 1ZKBA 3O6HA 4LQ2A 3VXCA 5ET6A 3KFMA 3QUJA 1FQCA 2L5VA 4R9FA 3ZS6A 4FJPA 1LFHA 5F1QA 4OZ9A 2QJEA 4XIGQ 5F24A 1TFDA 4PAIA 5FTIA 1IUDA 3LV0A 3TCHA 4GLIA 1NNPA 1R6ZA 3QUFA 2GRVA 1IEJA 1SW1A 1OVTA 1POTA 4OFOA 3KGCA 4NF8A 3CVGA 1B32A 2DE3A 1SW2A 2M8CA 3B50A 4ELPA 1XOCA 4H5GA 3G3IA 2DWAA 2QFLA 1LGBC 3OO6A 5K2XA 2PT1A 3IORA 3RY3A 1IMEA 1H3DA 3SEXA 3ILUB 4C0RA 4MBPA 1K9YA 1N3XA 4GBVA 2OCUA 3EQ1A 3CIJA 4U1ZA 1TFAA 1LBXA 1HSLA 3SDFA 4N8YA 1NUXA 3GBAA 2CZHA 3I3VA 3OSRA 4DXBA 5EQ9A 1B3FA 1YAEA 4JVDA 4NF6A 4OETA 1MXWA 3VV5A 1DMBA 2P0SA 4PAFA 4GWWA 1ZTYA 1NNTA 4F3SA 2Z22A 3UGWA 3A3UA 1TT1A 5IKBA 4HCWA 4KQPA 4XKQA 2DE4A 1OQHA 1B3LA 5ESYA 1JW1A 3IK6B 5JK4A 1GV8A 2QSXA 2A5TA 1MS7A 3FXQA 2RC8A 2V3QA 4EUOA 3PD9A 1XVXA 1FPKA 5AA2A 4POXA 1FPLA 4ZS9A 2IA4A 3RNNA 4NF5B 3UP9A 3CHGA 5TP9A 4MNIA 3MAMA 3W15C 2XXTA 1B1XA 1Y1MA 4RK2A 5ISUA 1MH4A 2VD2A 2YPNA 4RA1A 5L8DA 2DWHA 2NWJA 4IO2A 1IXHA 3CR9A 1JW5A 4IR8A 2QVRA 1QKBA 3CFXA 2H4IA 4QFKA 1H44A 4WEDA 4JSDA 1G0IA 4DDDA 1POY1 3C34A 4OEUA 4GX3A 1WODA 2H98A 2FIEA 4QFLA 3H03A 2E0SA 4GWOA 2HEUA 1Y4TA 4P9KA 5DEXB 4PP0A 1FBPA 3O9PA 4EQ9A 2OX3A 4IO5A 3FATA 4ZECA 5J16A 4GF8A 4PC9A 4LONB 2XHDA 1AH5A 4WKMA 1B3EA 1LAXA 1MM6A 2HXRA 1KA1A 4R72A 2OZZA 4O3CA 1UTBB 3MVYA 1H76A 3NOHA 3A29A 4OENA 2WBBA 4LZ7A 2F6PA 3H6TA 4N15A 3T0JA 3LSLA 1KZ8A 1AOVA 2XXKA 5I84A 3LUYA
chains in the Genus database with same CATH topology
4IO6A 3CG1A 1ELJA 4G8HA 4RY1A 1ATGA 3K02A 5F7VA 1UTHB 4MLQA 1F9BA 1MQIA 3U72A 3VVEA 2WKYA 1DPPA 2LAOA 3FASA 2NXOA 4GQOA 5JTYA 3CFLA 3SEVA 3ZKKA 3FIRA 3O28A 1MXZA 5DYHA 4RYAA 1SDXA 1FTKA 3K1PA 1LCTA 4NWDA 3Q29A 4U4SA 1ZMGA 4GRKA 3VVDA 1DTGA 2DWJA 2I0BA 2AL5A 3MZ1A 1MG1A 3O66A 1DTZA 2QPQA 3RN8A 4KPTA 1B9JA 3EF7A 5M2VA 3QXMA 4QHQA 5I2NA 3B6WA 4THIA 4H67A 1ZJLA 3VXBA 3T9VA 1VSOA 1PB7A 3P7IA 5CMBA 1LB8A 3KSJA 5DT6A 3KN3A 4ZE9A 2PMSA 4F3BA 3H7MA 2GHAA 3H4ZA 3FJGA 1B3GA 4NF8B 2Y7PA 3T96B 3OXNA 1P1UA 3G3HA 4GXSB 1Y4CA 4OWDA 4TLMB 1FQFA 3BBRA 3FVOA 2V25A 4DIGA 2PT2A 3OOAA 2NOOA 2ZYKA 1B2HA 3FVGA 2AIXA 2OK2A 3MZ9A 1Y20A 3O97A 2IEEA 4EF2A 1GR2A 3TPAA 3E3KA 2DS9A 4NF6B 2XXXA 3MVWA 4LP2B 1A99A 3ZSFA 1Y3QA 1MQJA 1N7XA 4JWOA 2XXUA 4YAHX 3PV0E 1OQGA 5FHOA 2A5TB 2V3TA 5I58A 3UORA 3IX1A 4GL8A 1FTOA 4PE5B 4LA9A 4G77A 5AA2B 3PPOA 2H5YA 3HO7A 5TP9B 3MJNA 1JETA 4TQUQ 3PMVA 4F29A 2XXHA 4KYSA 3H06B 1TWYA 5DVIA 1XVYA 4EDPA 4JWYA 5DVJA 3N94A 1D9YA 1LFIA 2XXQA 3TCFA 1LFGA 4NWCA 1IXCA 2YJPA 1FTJA 3PGFA 1IXGA 3L6HA 1SI0A 1SD3A 4LVQA 5HPQA 1P1OA 1FTMA 1N04A 4HTGA 3IJXB 2GHBA 4GFRA 2ANJA 5IAIA 1P1QA 3ODBA 4U21A 3BKIB 4OVJA 3JYRA 1B46A 3N6UA 1OLCA 5CMCA 4WEPA 3VLWA 4RJZA 5EYFA 3DELB 5B70A 2RKMA 4X48A 4P0IA 4U4XA 4ZEIA 3TQWA 1TXFA 5KDTA 1MY1A 3TTNA 3A3CA 1PB8A 4HW8A 1MRPA 4F1VA 2I49A 3MUQA 4YZZA 2OJTA 4JDFA 1QVSA 2ZYOA 1LB9A 1VR5A 2XXWA 1UIUA 1ZIUA 5H8FA 3TYHA 1O64A 2Y84A 3KJ7A 3G3FA 2F5XA 3OELA 2RC9A 4DZ1A 1EZ9A 4FEDA 4XXUA 2F8DA 5JTYB 3TZAA 1JNFA 1MQGA 3USDA 3IJOB 3TMGA 3O29A 3EHUA 2HCAA 3WAEA 3KEIA 1USYH 2Q2CA 2UYEA 3MPLA 2O84X 4LZ8A 5KCJA 3K6XA 2ESNA 1BIYA 2DVCA 1AMFA 4F19A 1MPCA 5I2NB 4KFQA 4G8NA 4JBZA 2VOZA 1XHYA 1QUKA 3UA8A 2F34A 4F18A 4X1BA 4OFLA 4R6YA 1B4ZA 4FECA 2F35A 1MPBA 4FEBA 4POWA 4Q30B 3TELA 3QIMA 4ZZAA 5LOMA 1P1NA 2H99A 4YKPA 2PBWA 2I48A 2Z8EA 1JVYA 4I8CA 1ZLQA 3K6UA 4UACA 2XX9A 3U1OA 3RT8A 3C36A 3S4UA 5CC2A 1FW0A 2UVIA 3N5LA 4F2OA 2O6AA 4KCDA 2HFBA 3IOVA 4EF1A 1H43A 4NEDA 3U93A 3Q25A 5I2KA 1LBBA 3TTKA 3LBSA 1II5A 1SYIA 4OFJA 4P11A 3FXRA 2X26A 2ZXTA 3OSQA 1DSNA 1YTVA 2RC7A 4X9TA 2PVUA 1LAFE 4LATA 1HSJA 3FVNA 2DVZA 3IO6A 4WXJA 5I58B 3OD7A 1US5A 3IB2A 1B6HA 3PUYE 4O3AA 4GD5A 1MXYA 4IO7A 1SBPA 4GIZA 4ELOA 4R6KA 1BLFA 4E0XA 2ZNUA 1NH8A 3V8XB 1NL5A 4P0GA 5EHSA 1BTJA 3GLBA 3M3KA 5AA4A 2VD3A 4H1XA 4FATA 4F1UA 4QRZA 3KZGA 4BLAA 1GTKA 3K4UA 1XS5A 2DP8A 4QSDA 4EXKA 4R74A 1A40A 3TFLA 2V84A 3M8UA 1B0HA 1SQYA 3LSFB 4PFUA 5AA2D 4IGTA 1DOTA 3PU5A 1CB6A 5CBSA 1O63A 3A09A 1Y3NA 1B4HA 3N26A 4YKKA 3DP6A 4ESWA 2O69A 2D5WA 3W9VA 1B52A 2ABHA 1EZPA 3H3GA 4I62A 2Q89A 4KHZE 1GVCA 3MVXA 2W7YA 2VHAA 2ALUA 1MPDA 2QS3A 5KDTB 2UVJA 2DQVA 2AL4A 3PUXE 5FTHA 2ONKE 1A8EA 4L17A 1MXVA 3KSXA 3IO4A 1B51A 1SW5A 2KLFA 4JWXA 2THIA 1RKMA 3O6GA 2F6GA 5H8FB 4QFNA 1JVXA 3PPNA 1IIWA 2HXWA 1A54A 4QFOA 1FQBA 3WAFA 2DYXA 1D4NA 2DE2A 3I6VA 4RNSA 2UVHA 4OQOA 1M5FA 2OWTA 2AYSA 3CSGA 3MW0A 3TCGA 2B3BA 3QAXA 3ZKLA 1I6BA 5KZTA 3PPQA 5CI5A 3LC8A 2QS4A 4BDRA 3KOTA 4TLLB 5KCJB 3TTMA 3QSLA 2B3FA 3SESA 2Y7RA 5DVFA 4O3BA 2BJJX 2Q88A 2Q9TA 2RINA 1N7WA 3EPEA 4YKJA 3QK6A 3IOUA 3OMBA 2QMXA 1P1WA 3GBBA 4G68A 1H45A 3VFJA 5ITOA 2Y7KA 2ZNTA 4EXLA 2ZYNA 4H5FA 3CI8A 3S9LC 3DLNA 4KD5A 3MZBA 4QSCA 5TPAA 3T9XB 1MY4A 1PDAA 1RYOA 3MC2A 1LBCA 3FVKA 1LLSA 1QUIA 3MPKA 1PB9A 3S9MC 3MVZA 2RCAA 3SEYA 3FZVA 1Y3PA 2GH9A 4X1DA 3K0VA 1GGGA 5FHNA 3PPPA 4AQ4A 1OMPA 3FD3A 5I2KB 3PD8A 4KI0E 1CE2A 3VDFA 3K6WA 2X7PA 5AA1A 2ZMBA 1YPNA 2VGQA 2H25A 4KCCA 4YB7A 1JEVA 1LAGE 4NF4A 1JEUA 1PBQA 4RK9A 4YB6A 2UVGA 1MQDA 3PUZE 4OHNA 1KWHA 4FORA 4ND9A 4ONYA 2X7QA 4MH5A 1Y1ZA 2D3IA 4YMAA 4F22A 2OWSA 3KJTA 2O1LA 1P99A 5AA4B 4ESXA 3V89B 3MP8A 3OEMA 4G4PA 3FJMA 2HQ0A 3OO9A 1R9QA 3TUSA 3MP6A 2O68A 3I5OA 2CZLA 1NFTA 3W9WA 2I3WA 1PEBA 4GL0A 3S9NC 1Z7NE 1HSEA 2FNCA 4U2RA 4R6HA 3C35A 1N3WA 4ZZEA 1B58A 2Z23A 2G93A 5J1DA 2FYIA 3QYTA 1NKXA 3CSBA 2PX1A 3OENA 4NTLA 2F36A 3E9XA 3DM0A 1MY2A 2Q8JA 1LSTA 5JEIA 2GFEA 3FUZA 1B7ZA 1MM7A 3C4MA 3O2AA 1EU8A 3SEUA 1M5DA 2DXRA 3S9EA 3HHFA 3IOWA 3RT6B 3R7XA 2QL3A 2Y7IA 5HBCA 1B7HA 3D4GA 3V5AA 3KG2A 4QF9A 1B5JA 4BDQA 1QW0A 2F7CA 2V3UA 2I4BA 2XX8A 2DOJA 1JQFA 4DCYA 1QKAA 2E1SA 3HCQA 2RF1A 1J1NA 1OVBA 3HSTA 3RPWA 4GXAA 3EHTA 3F11A 4QSEA 4DXCA 1QULA 1EZOA 4KYDA 3C33A 3OO8A 4I9DA 2XD2A 1RYXA 5H8QA 3FV2A 5EHMA 3VE1B 4C1TA 2R6GE 3VLUA 5K2YA 3H6UA 5AA3A 4LZ5A 4H8JA 4LQ5A 5H8NA 3O6IA 4E0WA 4G68B 3ONMA 2QS1A 1FCKA 3Q28A 3TODA 4GOTA 5H8SA 2Z8FA 3KOSA 3PMWA 3T93B 1QUJA 2DXYA 5BUUA 4OEVA 2OLBA 5TPAB 3PUVE 1I6AA 4MF3A 1UIVA 4I1DA 5L9OA 1SW4A 4FE8A 1VFDA 4R2FA 1Q35A 5BWJA 3U8QA 4M4GA 1B40A 4N07A 5ELVA 3V83A 4F39A 4H0WA 3FXUA 1MXXA 4U22A 4Q8RA 1Y9UA 1M5EA 3BFUA 3PUWE 1IQ7A 2QMWA 3RLFE 3G3GA 3IB0A 5ICTA 3AXFA 1URGA 1VFEA 3RTFB 4NF4B 3HHGA 3HN0A 3IAZA 4ZEFA 4PQJA 3T22A 3C32A 4K3FA 1NMUA 1B0LA 3GXAA 4ELRA 2H9BA 5I57A 4XKPA 4DE8A 3M3LA 2XXIA 5I59A 2P2AA 4ECFA 1IITA 1URDA 4F3PA 4OESA 1Q1KA 5ITPA 1ANFA 4YU0A 1R1NA 4NMYA 4XKRA 2F97A 4R75A 3HV1A 3E4RA 3G3KA 4Q0CA 3CFZA 3K2DA 1B3HA 1N84A 1BP5A 2I6EA 2F78A 1A55A 5H8HA 2FA7A 3OO7A 2HZKA 3FGSA 3OEKA 1ZU0A 1S9TA 3TKDA 4H65A 4ZE8A 1I6QA 4PFYA 3GZGA 5HM4B 4FAJA 3ECRA 4BDNA 4LUBA 5I56A 3LR1A 1Z7ME 3T66A 3PPRA 3UK4A 2A5SA 4IO3A 2OBGA 3IL1B 5TU0A 1L5TA 2O7IA 4BDMA 3EHSA 3SETA 5AE4A 3TDJA 2Q2AA 4AB6A 3JZJA 3IOTA 4RPNA 2F7AA 5CM6A 5DTBA 4Z0IA 4U23A 1T0KA 4ZEDA 3ILTB 4DLDA 1PBPA 2CMOA 2QRYA 3S2VA 4HCYA 4OTEA 4Q5TA 4OYVA 1IXIA 5A5XA 5CMMA 1NH7A 4G2ZA 1QJMA 1B5HA 1VE4A 2UXAA 1LCFA 4MFIA 2R71A 3FV1A 1UQWA 2XXVA 4F1YA 3K00A 5FHMA 1A7LA 1M5BA 4MLVA 2Z8DA 1SYHA 3CG3A 2I4CA 4NE4A 4R73A 3K1NA 3PMXA 1R9LA 1MDQA 3K6VA 3KN8A 2D21A 2O51A 4YKIA 4YICA 3C31A 1OLAA 4ISUA 1USYE 3B7DA 2PYYA 3R26A 1FQDA 5H8QB 1N0TA 4QFPA 1B1HA 1MDP1 1FQEA 1US4A 3B6QA 4IY6A 2HAUA 1DPEA 3N6TA 2O1MA 2P1SA 5H8NB 5CRYA 3RTWB 1S7YA 4PFWA 3VVFA 1EH3A 3R6UA 1D9VA 4IGRA 3TTRA 2NVUB 3H6WA 4OXVA 4N6PA 3UN6A 5CBRA 4JSOA 4OERA 2I3VA 1NNFA 4F3GA 1A8FA 2XD3A 4BDLA 1BKAA 1MQHA 1MH3A 4PFTA 4G8MA 4EQ7A 4XKNA 1B5IA 2XX7A 3JV9A 2G29A 3RGYA 3E13X 3MWBA 1AIVA 1D3KA 2UYFA 4R9GA 2HAVA 3UIFA 3B6TA 4ZEKA 4RXLA 3K1MA 2REJA 1AL3A 4U1OA 4H8IA 4DXUA 4NF5A 3MP1A 3TEPA 1MXUA 3DP4A 4FIMA 3LSXA 5L9MA 4F31B 1IZ1A 1URSA 3RUMA 3G7WA 5I57B 3FJ7A 4YB5A 3HPIA 1JW4A 3T9UA 2ONSA 3Q27A 2ONRA 5I59B 4ELQA 3THIA 3M3FA 4JB7A 4H6DA 2R9JA 2ZYMA 4PETA 1B7UA 4OMBA 4HS7A 2NUVA 4G68C 3DP8A 4DCXA 4JXIA 4YMBA 3TAJA 3Q26A 2F7BA 1NNKA 2XXYA 4XTCQ 2O7UA 3MQ9A 5DEXA 2DWIA 2YLNA 2ZNSA 3CRBA 4M1VA 1OIBA 4R2BA 3IB1A 4AB5A 1M5CA 5H8HB 3MBPA 2XXPA 4IY5A 1YCJA 3KN7A 3KBRA 2I0CA 2QS2A 3D4CA 1UTBA 4Z7EA 1MY3A 1XC1A 1S50A 1B05A 3U94A 1FTLA 4C1UA 3C9HA 3TTLA 5I56B 4GVOA 2XXRA 3RQTA 4UA8A 3U92A 4EQBA 1ZBMA 1FQAA 3H6VA 5ICQA 2HZLA 2VP1A 3T9HB 2REGA 3VLVA 4BDOA 1UTHA 3EN3A 1LAHE 2B65A 2DSFA 3L6GA 5CMKA 2Y7WA 3K01A 3SEWA 2V93A 3G3JA 3SERA 2RCBA 5L9SA 4KYEA 3SKPA 4IO4A 3LSWA 1WDNA 5A5XB 2I58A 4RPOA 1N76A 4IB2A 4KR5A 4N13A 1XT8A 4F2QA 1PC3A 1O7TA 3TQLA 1MY0A 4TOZA 4ZEBA 1SVXB 4ZDMA 3IR1A 1I69A 3BFTA 1SI1A 5B7DA 1WVJA 1ZKBA 3O6HA 4LQ2A 3VXCA 3KFMA 3QUJA 1FQCA 4R9FA 3ZS6A 4FJPA 1LFHA 5F1QA 4OZ9A 2QJEA 4XIGQ 1TFDA 5FTIA 1IUDA 3TCHA 4GLIA 1NNPA 1R6ZA 3QUFA 2GRVA 1IEJA 1SW1A 1OVTA 1POTA 4OFOA 3KGCA 4NF8A 3CVGA 1B32A 2DE3A 1SW2A 2M8CA 4ELPA 1XOCA 4H5GA 3G3IA 2DWAA 1LGBC 3OO6A 5K2XA 2PT1A 3IORA 3RY3A 1H3DA 3SEXA 3ILUB 4C0RA 4MBPA 1N3XA 2OCUA 3EQ1A 3CIJA 4U1ZA 1TFAA 1HSLA 3SDFA 3GBAA 3I3VA 3OSRA 4DXBA 1B3FA 1YAEA 4NF6A 4OETA 1MXWA 3VV5A 1DMBA 2P0SA 1ZTYA 1NNTA 4F3SA 2Z22A 3UGWA 3A3UA 1TT1A 5IKBA 4HCWA 4KQPA 4XKQA 2DE4A 1OQHA 1B3LA 1JW1A 3IK6B 5JK4A 1GV8A 2QSXA 2A5TA 1MS7A 3FXQA 2RC8A 2V3QA 4EUOA 3PD9A 1XVXA 5AA2A 4POXA 4ZS9A 2IA4A 3RNNA 4NF5B 3UP9A 5TP9A 3MAMA 3W15C 2XXTA 1B1XA 1Y1MA 4RK2A 5ISUA 1MH4A 2VD2A 2YPNA 4RA1A 5L8DA 2DWHA 2NWJA 4IO2A 1IXHA 3CR9A 1JW5A 1QKBA 3CFXA 2H4IA 4QFKA 1H44A 4WEDA 4JSDA 4DDDA 1POY1 3C34A 4OEUA 1WODA 2H98A 4QFLA 3H03A 2E0SA 4GWOA 2HEUA 1Y4TA 5DEXB 4PP0A 3O9PA 4EQ9A 4IO5A 3FATA 4ZECA 4GF8A 4LONB 2XHDA 1AH5A 4WKMA 1B3EA 1LAXA 1MM6A 4R72A 2OZZA 4O3CA 1UTBB 3MVYA 1H76A 4OENA 4LZ7A 2F6PA 3H6TA 3LSLA 1AOVA 5I84A 3LUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO6 A;  3CG1 A;  1ELJ A;  4G8H A;  4RY1 A;  1ATG A;  3K02 A;  5F7V A;  1UTH B;  4MLQ A;  1F9B A;  1MQI A;  3U72 A;  3VVE A;  2WKY A;  1DPP A;  2LAO A;  3FAS A;  2NXO A;  4GQO A;  5JTY A;  3CFL A;  3SEV A;  3ZKK A;  3FIR A;  3O28 A;  1MXZ A;  5DYH A;  4RYA A;  1SDX A;  1FTK A;  3K1P A;  1LCT A;  4NWD A;  3Q29 A;  4U4S A;  1ZMG A;  4GRK A;  3VVD A;  1DTG A;  2DWJ A;  2I0B A;  2AL5 A;  3MZ1 A;  1MG1 A;  3O66 A;  1DTZ A;  2QPQ A;  3RN8 A;  4KPT A;  1B9J A;  3EF7 A;  5M2V A;  3QXM A;  4QHQ A;  5I2N A;  3B6W A;  4THI A;  4H67 A;  1ZJL A;  3VXB A;  3T9V A;  1VSO A;  1PB7 A;  3P7I A;  5CMB A;  1LB8 A;  3KSJ A;  5DT6 A;  3KN3 A;  4ZE9 A;  2PMS A;  4F3B A;  3H7M A;  2GHA A;  3H4Z A;  3FJG A;  1B3G A;  4NF8 B;  2Y7P A;  3T96 B;  3OXN A;  1P1U A;  3G3H A;  4GXS B;  1Y4C A;  4OWD A;  4TLM B;  1FQF A;  3BBR A;  3FVO A;  2V25 A;  4DIG A;  2PT2 A;  3OOA A;  2NOO A;  2ZYK A;  1B2H A;  3FVG A;  2AIX A;  2OK2 A;  3MZ9 A;  1Y20 A;  3O97 A;  2IEE A;  4EF2 A;  1GR2 A;  3TPA A;  3E3K A;  2DS9 A;  4NF6 B;  2XXX A;  3MVW A;  4LP2 B;  1A99 A;  3ZSF A;  1Y3Q A;  1MQJ A;  1N7X A;  4JWO A;  2XXU A;  4YAH X;  3PV0 E;  1OQG A;  5FHO A;  2A5T B;  2V3T A;  5I58 A;  3UOR A;  3IX1 A;  4GL8 A;  1FTO A;  4PE5 B;  4LA9 A;  4G77 A;  5AA2 B;  3PPO A;  2H5Y A;  3HO7 A;  5TP9 B;  3MJN A;  1JET A;  4TQU Q;  3PMV A;  4F29 A;  2XXH A;  4KYS A;  3H06 B;  1TWY A;  5DVI A;  1XVY A;  4EDP A;  4JWY A;  5DVJ A;  3N94 A;  1D9Y A;  1LFI A;  2XXQ A;  3TCF A;  1LFG A;  4NWC A;  1IXC A;  2YJP A;  1FTJ A;  3PGF A;  1IXG A;  3L6H A;  1SI0 A;  1SD3 A;  4LVQ A;  5HPQ A;  1P1O A;  1FTM A;  1N04 A;  4HTG A;  3IJX B;  2GHB A;  4GFR A;  2ANJ A;  5IAI A;  1P1Q A;  3ODB A;  4U21 A;  3BKI B;  4OVJ A;  3JYR A;  1B46 A;  3N6U A;  1OLC A;  5CMC A;  4WEP A;  3VLW A;  4RJZ A;  5EYF A;  3DEL B;  5B70 A;  2RKM A;  4X48 A;  4P0I A;  4U4X A;  4ZEI A;  3TQW A;  1TXF A;  5KDT A;  1MY1 A;  3TTN A;  3A3C A;  1PB8 A;  4HW8 A;  1MRP A;  4F1V A;  2I49 A;  3MUQ A;  4YZZ A;  2OJT A;  4JDF A;  1QVS A;  2ZYO A;  1LB9 A;  1VR5 A;  2XXW A;  1UIU A;  1ZIU A;  5H8F A;  3TYH A;  1O64 A;  2Y84 A;  3KJ7 A;  3G3F A;  2F5X A;  3OEL A;  2RC9 A;  4DZ1 A;  1EZ9 A;  4FED A;  4XXU A;  2F8D A;  5JTY B;  3TZA A;  1JNF A;  1MQG A;  3USD A;  3IJO B;  3TMG A;  3O29 A;  3EHU A;  2HCA A;  3WAE A;  3KEI A;  1USY H;  2Q2C A;  2UYE A;  3MPL A;  2O84 X;  4LZ8 A;  5KCJ A;  3K6X A;  2ESN A;  1BIY A;  2DVC A;  1AMF A;  4F19 A;  1MPC A;  5I2N B;  4KFQ A;  4G8N A;  4JBZ A;  2VOZ A;  1XHY A;  1QUK A;  3UA8 A;  2F34 A;  4F18 A;  4X1B A;  4OFL A;  4R6Y A;  1B4Z A;  4FEC A;  2F35 A;  1MPB A;  4FEB A;  4POW A;  4Q30 B;  3TEL A;  3QIM A;  4ZZA A;  5LOM A;  1P1N A;  2H99 A;  4YKP A;  2PBW A;  2I48 A;  2Z8E A;  1JVY A;  4I8C A;  1ZLQ A;  3K6U A;  4UAC A;  2XX9 A;  3U1O A;  3RT8 A;  3C36 A;  3S4U A;  5CC2 A;  1FW0 A;  2UVI A;  3N5L A;  4F2O A;  2O6A A;  4KCD A;  2HFB A;  3IOV A;  4EF1 A;  1H43 A;  4NED A;  3U93 A;  3Q25 A;  5I2K A;  1LBB A;  3TTK A;  3LBS A;  1II5 A;  1SYI A;  4OFJ A;  4P11 A;  3FXR A;  2X26 A;  2ZXT A;  3OSQ A;  1DSN A;  1YTV A;  2RC7 A;  4X9T A;  2PVU A;  1LAF E;  4LAT A;  1HSJ A;  3FVN A;  2DVZ A;  3IO6 A;  4WXJ A;  5I58 B;  3OD7 A;  1US5 A;  3IB2 A;  1B6H A;  3PUY E;  4O3A A;  4GD5 A;  1MXY A;  4IO7 A;  1SBP A;  4GIZ A;  4ELO A;  4R6K A;  1BLF A;  4E0X A;  2ZNU A;  1NH8 A;  3V8X B;  1NL5 A;  4P0G A;  5EHS A;  1BTJ A;  3GLB A;  3M3K A;  5AA4 A;  2VD3 A;  4H1X A;  4FAT A;  4F1U A;  4QRZ A;  3KZG A;  4BLA A;  1GTK A;  3K4U A;  1XS5 A;  2DP8 A;  4QSD A;  4EXK A;  4R74 A;  1A40 A;  3TFL A;  2V84 A;  3M8U A;  1B0H A;  1SQY A;  3LSF B;  4PFU A;  5AA2 D;  4IGT A;  1DOT A;  3PU5 A;  1CB6 A;  5CBS A;  1O63 A;  3A09 A;  1Y3N A;  1B4H A;  3N26 A;  4YKK A;  3DP6 A;  4ESW A;  2O69 A;  2D5W A;  3W9V A;  1B52 A;  2ABH A;  1EZP A;  3H3G A;  4I62 A;  2Q89 A;  4KHZ E;  1GVC A;  3MVX A;  2W7Y A;  2VHA A;  2ALU A;  1MPD A;  2QS3 A;  5KDT B;  2UVJ A;  2DQV A;  2AL4 A;  3PUX E;  5FTH A;  2ONK E;  1A8E A;  4L17 A;  1MXV A;  3KSX A;  3IO4 A;  1B51 A;  1SW5 A;  2KLF A;  4JWX A;  2THI A;  1RKM A;  3O6G A;  2F6G A;  5H8F B;  4QFN A;  1JVX A;  3PPN A;  1IIW A;  2HXW A;  1A54 A;  4QFO A;  1FQB A;  3WAF A;  2DYX A;  1D4N A;  2DE2 A;  3I6V A;  4RNS A;  2UVH A;  4OQO A;  1M5F A;  2OWT A;  2AYS A;  3CSG A;  3MW0 A;  3TCG A;  2B3B A;  3QAX A;  3ZKL A;  1I6B A;  5KZT A;  3PPQ A;  5CI5 A;  3LC8 A;  2QS4 A;  4BDR A;  3KOT A;  4TLL B;  5KCJ B;  3TTM A;  3QSL A;  2B3F A;  3SES A;  2Y7R A;  5DVF A;  4O3B A;  2BJJ X;  2Q88 A;  2Q9T A;  2RIN A;  1N7W A;  3EPE A;  4YKJ A;  3QK6 A;  3IOU A;  3OMB A;  2QMX A;  1P1W A;  3GBB A;  4G68 A;  1H45 A;  3VFJ A;  5ITO A;  2Y7K A;  2ZNT A;  4EXL A;  2ZYN A;  4H5F A;  3CI8 A;  3S9L C;  3DLN A;  4KD5 A;  3MZB A;  4QSC A;  5TPA A;  3T9X B;  1MY4 A;  1PDA A;  1RYO A;  3MC2 A;  1LBC A;  3FVK A;  1LLS A;  1QUI A;  3MPK A;  1PB9 A;  3S9M C;  3MVZ A;  2RCA A;  3SEY A;  3FZV A;  1Y3P A;  2GH9 A;  4X1D A;  3K0V A;  1GGG A;  5FHN A;  3PPP A;  4AQ4 A;  1OMP A;  3FD3 A;  5I2K B;  3PD8 A;  4KI0 E;  1CE2 A;  3VDF A;  3K6W A;  2X7P A;  5AA1 A;  2ZMB A;  1YPN A;  2VGQ A;  2H25 A;  4KCC A;  4YB7 A;  1JEV A;  1LAG E;  4NF4 A;  1JEU A;  1PBQ A;  4RK9 A;  4YB6 A;  2UVG A;  1MQD A;  3PUZ E;  4OHN A;  1KWH A;  4FOR A;  4ND9 A;  4ONY A;  2X7Q A;  4MH5 A;  1Y1Z A;  2D3I A;  4YMA A;  4F22 A;  2OWS A;  3KJT A;  2O1L A;  1P99 A;  5AA4 B;  4ESX A;  3V89 B;  3MP8 A;  3OEM A;  4G4P A;  3FJM A;  2HQ0 A;  3OO9 A;  1R9Q A;  3TUS A;  3MP6 A;  2O68 A;  3I5O A;  2CZL A;  1NFT A;  3W9W A;  2I3W A;  1PEB A;  4GL0 A;  3S9N C;  1Z7N E;  1HSE A;  2FNC A;  4U2R A;  4R6H A;  3C35 A;  1N3W A;  4ZZE A;  1B58 A;  2Z23 A;  2G93 A;  5J1D A;  2FYI A;  3QYT A;  1NKX A;  3CSB A;  2PX1 A;  3OEN A;  4NTL A;  2F36 A;  3E9X A;  3DM0 A;  1MY2 A;  2Q8J A;  1LST A;  5JEI A;  2GFE A;  3FUZ A;  1B7Z A;  1MM7 A;  3C4M A;  3O2A A;  1EU8 A;  3SEU A;  1M5D A;  2DXR A;  3S9E A;  3HHF A;  3IOW A;  3RT6 B;  3R7X A;  2QL3 A;  2Y7I A;  5HBC A;  1B7H A;  3D4G A;  3V5A A;  3KG2 A;  4QF9 A;  1B5J A;  4BDQ A;  1QW0 A;  2F7C A;  2V3U A;  2I4B A;  2XX8 A;  2DOJ A;  1JQF A;  4DCY A;  1QKA A;  2E1S A;  3HCQ A;  2RF1 A;  1J1N A;  1OVB A;  3HST A;  3RPW A;  4GXA A;  3EHT A;  3F11 A;  4QSE A;  4DXC A;  1QUL A;  1EZO A;  4KYD A;  3C33 A;  3OO8 A;  4I9D A;  2XD2 A;  1RYX A;  5H8Q A;  3FV2 A;  5EHM A;  3VE1 B;  4C1T A;  2R6G E;  3VLU A;  5K2Y A;  3H6U A;  5AA3 A;  4LZ5 A;  4H8J A;  4LQ5 A;  5H8N A;  3O6I A;  4E0W A;  4G68 B;  3ONM A;  2QS1 A;  1FCK A;  3Q28 A;  3TOD A;  4GOT A;  5H8S A;  2Z8F A;  3KOS A;  3PMW A;  3T93 B;  1QUJ A;  2DXY A;  5BUU A;  4OEV A;  2OLB A;  5TPA B;  3PUV E;  1I6A A;  4MF3 A;  1UIV A;  4I1D A;  5L9O A;  1SW4 A;  4FE8 A;  1VFD A;  4R2F A;  1Q35 A;  5BWJ A;  3U8Q A;  4M4G A;  1B40 A;  4N07 A;  5ELV A;  3V83 A;  4F39 A;  4H0W A;  3FXU A;  1MXX A;  4U22 A;  4Q8R A;  1Y9U A;  1M5E A;  3BFU A;  3PUW E;  1IQ7 A;  2QMW A;  3RLF E;  3G3G A;  3IB0 A;  5ICT A;  3AXF A;  1URG A;  1VFE A;  3RTF B;  4NF4 B;  3HHG A;  3HN0 A;  3IAZ A;  4ZEF A;  4PQJ A;  3T22 A;  3C32 A;  4K3F A;  1NMU A;  1B0L A;  3GXA A;  4ELR A;  2H9B A;  5I57 A;  4XKP A;  4DE8 A;  3M3L A;  2XXI A;  5I59 A;  2P2A A;  4ECF A;  1IIT A;  1URD A;  4F3P A;  4OES A;  1Q1K A;  5ITP A;  1ANF A;  4YU0 A;  1R1N A;  4NMY A;  4XKR A;  2F97 A;  4R75 A;  3HV1 A;  3E4R A;  3G3K A;  4Q0C A;  3CFZ A;  3K2D A;  1B3H A;  1N84 A;  1BP5 A;  2I6E A;  2F78 A;  1A55 A;  5H8H A;  2FA7 A;  3OO7 A;  2HZK A;  3FGS A;  3OEK A;  1ZU0 A;  1S9T A;  3TKD A;  4H65 A;  4ZE8 A;  1I6Q A;  4PFY A;  3GZG A;  5HM4 B;  4FAJ A;  3ECR A;  4BDN A;  4LUB A;  5I56 A;  3LR1 A;  1Z7M E;  3T66 A;  3PPR A;  3UK4 A;  2A5S A;  4IO3 A;  2OBG A;  3IL1 B;  5TU0 A;  1L5T A;  2O7I A;  4BDM A;  3EHS A;  3SET A;  5AE4 A;  3TDJ A;  2Q2A A;  4AB6 A;  3JZJ A;  3IOT A;  4RPN A;  2F7A A;  5CM6 A;  5DTB A;  4Z0I A;  4U23 A;  1T0K A;  4ZED A;  3ILT B;  4DLD A;  1PBP A;  2CMO A;  2QRY A;  3S2V A;  4HCY A;  4OTE A;  4Q5T A;  4OYV A;  1IXI A;  5A5X A;  5CMM A;  1NH7 A;  4G2Z A;  1QJM A;  1B5H A;  1VE4 A;  2UXA A;  1LCF A;  4MFI A;  2R71 A;  3FV1 A;  1UQW A;  2XXV A;  4F1Y A;  3K00 A;  5FHM A;  1A7L A;  1M5B A;  4MLV A;  2Z8D A;  1SYH A;  3CG3 A;  2I4C A;  4NE4 A;  4R73 A;  3K1N A;  3PMX A;  1R9L A;  1MDQ A;  3K6V A;  3KN8 A;  2D21 A;  2O51 A;  4YKI A;  4YIC A;  3C31 A;  1OLA A;  4ISU A;  1USY E;  3B7D A;  2PYY A;  3R26 A;  1FQD A;  5H8Q B;  1N0T A;  4QFP A;  1B1H A;  1MDP 1;  1FQE A;  1US4 A;  3B6Q A;  4IY6 A;  2HAU A;  1DPE A;  3N6T A;  2O1M A;  2P1S A;  5H8N B;  5CRY A;  3RTW B;  1S7Y A;  4PFW A;  3VVF A;  1EH3 A;  3R6U A;  1D9V A;  4IGR A;  3TTR A;  2NVU B;  3H6W A;  4OXV A;  4N6P A;  3UN6 A;  5CBR A;  4JSO A;  4OER A;  2I3V A;  1NNF A;  4F3G A;  1A8F A;  2XD3 A;  4BDL A;  1BKA A;  1MQH A;  1MH3 A;  4PFT A;  4G8M A;  4EQ7 A;  4XKN A;  1B5I A;  2XX7 A;  3JV9 A;  2G29 A;  3RGY A;  3E13 X;  3MWB A;  1AIV A;  1D3K A;  2UYF A;  4R9G A;  2HAV A;  3UIF A;  3B6T A;  4ZEK A;  4RXL A;  3K1M A;  2REJ A;  1AL3 A;  4U1O A;  4H8I A;  4DXU A;  4NF5 A;  3MP1 A;  3TEP A;  1MXU A;  3DP4 A;  4FIM A;  3LSX A;  5L9M A;  4F31 B;  1IZ1 A;  1URS A;  3RUM A;  3G7W A;  5I57 B;  3FJ7 A;  4YB5 A;  3HPI A;  1JW4 A;  3T9U A;  2ONS A;  3Q27 A;  2ONR A;  5I59 B;  4ELQ A;  3THI A;  3M3F A;  4JB7 A;  4H6D A;  2R9J A;  2ZYM A;  4PET A;  1B7U A;  4OMB A;  4HS7 A;  2NUV A;  4G68 C;  3DP8 A;  4DCX A;  4JXI A;  4YMB A;  3TAJ A;  3Q26 A;  2F7B A;  1NNK A;  2XXY A;  4XTC Q;  2O7U A;  3MQ9 A;  5DEX A;  2DWI A;  2YLN A;  2ZNS A;  3CRB A;  4M1V A;  1OIB A;  4R2B A;  3IB1 A;  4AB5 A;  1M5C A;  5H8H B;  3MBP A;  2XXP A;  4IY5 A;  1YCJ A;  3KN7 A;  3KBR A;  2I0C A;  2QS2 A;  3D4C A;  1UTB A;  4Z7E A;  1MY3 A;  1XC1 A;  1S50 A;  1B05 A;  3U94 A;  1FTL A;  4C1U A;  3C9H A;  3TTL A;  5I56 B;  4GVO A;  2XXR A;  3RQT A;  4UA8 A;  3U92 A;  4EQB A;  1ZBM A;  1FQA A;  3H6V A;  5ICQ A;  2HZL A;  2VP1 A;  3T9H B;  2REG A;  3VLV A;  4BDO A;  1UTH A;  3EN3 A;  1LAH E;  2B65 A;  2DSF A;  3L6G A;  5CMK A;  2Y7W A;  3K01 A;  3SEW A;  2V93 A;  3G3J A;  3SER A;  2RCB A;  5L9S A;  4KYE A;  3SKP A;  4IO4 A;  3LSW A;  1WDN A;  5A5X B;  2I58 A;  4RPO A;  1N76 A;  4IB2 A;  4KR5 A;  4N13 A;  1XT8 A;  4F2Q A;  1PC3 A;  1O7T A;  3TQL A;  1MY0 A;  4TOZ A;  4ZEB A;  1SVX B;  4ZDM A;  3IR1 A;  1I69 A;  3BFT A;  1SI1 A;  5B7D A;  1WVJ A;  1ZKB A;  3O6H A;  4LQ2 A;  3VXC A;  3KFM A;  3QUJ A;  1FQC A;  4R9F A;  3ZS6 A;  4FJP A;  1LFH A;  5F1Q A;  4OZ9 A;  2QJE A;  4XIG Q;  1TFD A;  5FTI A;  1IUD A;  3TCH A;  4GLI A;  1NNP A;  1R6Z A;  3QUF A;  2GRV A;  1IEJ A;  1SW1 A;  1OVT A;  1POT A;  4OFO A;  3KGC A;  4NF8 A;  3CVG A;  1B32 A;  2DE3 A;  1SW2 A;  2M8C A;  4ELP A;  1XOC A;  4H5G A;  3G3I A;  2DWA A;  1LGB C;  3OO6 A;  5K2X A;  2PT1 A;  3IOR A;  3RY3 A;  1H3D A;  3SEX A;  3ILU B;  4C0R A;  4MBP A;  1N3X A;  2OCU A;  3EQ1 A;  3CIJ A;  4U1Z A;  1TFA A;  1HSL A;  3SDF A;  3GBA A;  3I3V A;  3OSR A;  4DXB A;  1B3F A;  1YAE A;  4NF6 A;  4OET A;  1MXW A;  3VV5 A;  1DMB A;  2P0S A;  1ZTY A;  1NNT A;  4F3S A;  2Z22 A;  3UGW A;  3A3U A;  1TT1 A;  5IKB A;  4HCW A;  4KQP A;  4XKQ A;  2DE4 A;  1OQH A;  1B3L A;  1JW1 A;  3IK6 B;  5JK4 A;  1GV8 A;  2QSX A;  2A5T A;  1MS7 A;  3FXQ A;  2RC8 A;  2V3Q A;  4EUO A;  3PD9 A;  1XVX A;  5AA2 A;  4POX A;  4ZS9 A;  2IA4 A;  3RNN A;  4NF5 B;  3UP9 A;  5TP9 A;  3MAM A;  3W15 C;  2XXT A;  1B1X A;  1Y1M A;  4RK2 A;  5ISU A;  1MH4 A;  2VD2 A;  2YPN A;  4RA1 A;  5L8D A;  2DWH A;  2NWJ A;  4IO2 A;  1IXH A;  3CR9 A;  1JW5 A;  1QKB A;  3CFX A;  2H4I A;  4QFK A;  1H44 A;  4WED A;  4JSD A;  4DDD A;  1POY 1;  3C34 A;  4OEU A;  1WOD A;  2H98 A;  4QFL A;  3H03 A;  2E0S A;  4GWO A;  2HEU A;  1Y4T A;  5DEX B;  4PP0 A;  3O9P A;  4EQ9 A;  4IO5 A;  3FAT A;  4ZEC A;  4GF8 A;  4LON B;  2XHD A;  1AH5 A;  4WKM A;  1B3E A;  1LAX A;  1MM6 A;  4R72 A;  2OZZ A;  4O3C A;  1UTB B;  3MVY A;  1H76 A;  4OEN A;  4LZ7 A;  2F6P A;  3H6T A;  3LSL A;  1AOV A;  5I84 A;  3LUY A; 
#chains in the Genus database with same CATH topology
 5IZ3 A;  4IO6 A;  3CG1 A;  4N4U A;  1ELJ A;  2XWI A;  3KBZ A;  4G8H A;  2FHY A;  4RY1 A;  1IMB A;  1ATG A;  3K02 A;  5F7V A;  1UTH B;  4MLQ A;  1F9B A;  1MQI A;  3U72 A;  3VVE A;  2WKY A;  1DPP A;  2LAO A;  3FAS A;  2NXO A;  4GQO A;  5JTY A;  3CFL A;  3SEV A;  3ZKK A;  3FIR A;  3O28 A;  1MXZ A;  5DYH A;  4RYA A;  1SDX A;  1FTK A;  3K1P A;  1LCT A;  4NWD A;  3Q29 A;  4U4S A;  1ZMG A;  4GRK A;  3VVD A;  1DTG A;  2DWJ A;  2I0B A;  1FBE A;  4GBW A;  2AL5 A;  3MZ1 A;  1MG1 A;  3O66 A;  1DTZ A;  2QPQ A;  2QVV A;  3RN8 A;  4KPT A;  1B9J A;  2Q74 A;  2WYK A;  3EF7 A;  5M2V A;  3QXM A;  4QHQ A;  4JVI A;  5FBP A;  5I2N A;  3B6W A;  4THI A;  4H67 A;  1ZJL A;  3VXB A;  3T9V A;  1VSO A;  4PF8 A;  1PB7 A;  3P7I A;  5CMB A;  4MMP A;  1LB8 A;  3KSJ A;  5DT6 A;  3KN3 A;  4ZE9 A;  2PMS A;  4F3B A;  3H7M A;  2GHA A;  3H4Z A;  3FJG A;  3FXB A;  1B3G A;  4NF8 B;  2P3V A;  2Y7P A;  4OVQ A;  3T96 B;  3OXN A;  1P1U A;  3G3H A;  4GXS B;  1Y4C A;  4OWD A;  4TLM B;  1FQF A;  3BBR A;  3FVO A;  2V25 A;  4DIG A;  4P3L A;  2PT2 A;  3OOA A;  4GWY A;  2NOO A;  2ZYK A;  4G61 A;  3MYU A;  1B2H A;  3FVG A;  4PFB A;  2AIX A;  2OK2 A;  3MZ9 A;  1DBZ A;  1Y20 A;  1FPG A;  3O97 A;  2IEE A;  4EF2 A;  1JP4 A;  2Y5K A;  1GR2 A;  3TPA A;  3E3K A;  2DS9 A;  4NF6 B;  2XXX A;  3MVW A;  4LP2 B;  1A99 A;  4I3E A;  3ZSF A;  4HXV A;  1Y3Q A;  1MQJ A;  2XWV A;  1N7X A;  4JWO A;  3IFA A;  2XXU A;  4PCD A;  4YAH X;  1NV3 A;  3PV0 E;  1OQG A;  5FHO A;  2A5T B;  2V3T A;  5I58 A;  2XWK A;  3UOR A;  3IX1 A;  4GL8 A;  1FTO A;  4PE5 B;  4LA9 A;  4G77 A;  5AA2 B;  3PPO A;  2H5Y A;  3HO7 A;  5TP9 B;  5IZZ A;  3MJN A;  1NV4 A;  1JET A;  4TQU Q;  4FBP A;  3PMV A;  4F29 A;  2XXH A;  4KYS A;  1NUY A;  3H06 B;  4PFI A;  2GQ1 A;  1TWY A;  5DVI A;  1XVY A;  4EDP A;  4JWY A;  5DVJ A;  3N94 A;  1D9Y A;  1LFI A;  2XXQ A;  3TCF A;  1LFG A;  4NWC A;  1IXC A;  2YJP A;  1FTJ A;  3PGF A;  1IXG A;  3L6H A;  1SI0 A;  2ZZW A;  1RDZ A;  1SD3 A;  1NUZ A;  4LVQ A;  5HPQ A;  5I7I A;  1P1O A;  1FTM A;  1NV7 A;  1N04 A;  4HTG A;  3IJX B;  2GHB A;  4GFR A;  2ANJ A;  2OWZ A;  5IAI A;  1P1Q A;  3ODB A;  4U21 A;  4XF5 A;  3BKI B;  4OVJ A;  3JYR A;  1B46 A;  3N6U A;  1OLC A;  4X04 A;  5CMC A;  4WEP A;  3VLW A;  4RJZ A;  5EYF A;  1FPI A;  3DEL B;  5B70 A;  2RKM A;  3BIH A;  4X48 A;  1FPJ A;  3KC0 A;  4P0I A;  4U4X A;  4ZEI A;  1YXI A;  3TQW A;  1TXF A;  5KDT A;  1MY1 A;  3TTN A;  1BK4 A;  1PB8 A;  3A3C A;  4HW8 A;  1MRP A;  4F1V A;  2I49 A;  3MUQ A;  4YZZ A;  2OJT A;  4JDF A;  1QVS A;  2ZYO A;  1LB9 A;  1VR5 A;  2XXW A;  1UIU A;  1ZIU A;  5H8F A;  3TYH A;  5IZ3 B;  1NV1 A;  1O64 A;  2Y84 A;  3KJ7 A;  3G3F A;  2F5X A;  3OEL A;  4DI4 B;  2RC9 A;  4DZ1 A;  1EZ9 A;  4FED A;  4XXU A;  4AS4 A;  1LBW A;  2F8D A;  5JTY B;  3TZA A;  1JNF A;  1MQG A;  3USD A;  1FSA A;  3IJO B;  4MJO A;  4NQ8 A;  5EYG A;  3TMG A;  3O29 A;  3EHU A;  4PDH A;  2HCA A;  3WAE A;  3KEI A;  1USY H;  2Q2C A;  1NV2 A;  2UYE A;  3MPL A;  4NX1 A;  2O84 X;  4LZ8 A;  5KCJ A;  1SPI A;  3K6X A;  2ESN A;  1BIY A;  4GWS A;  2CZI A;  2DVC A;  1AMF A;  4F19 A;  1MPC A;  2V4C A;  5IZ1 A;  5I2N B;  4KFQ A;  1IMA A;  4G8N A;  4JBZ A;  2VOZ A;  1XHY A;  1QUK A;  3UA8 A;  1NV6 A;  2F34 A;  4F18 A;  4X1B A;  4OFL A;  4R6Y A;  1B4Z A;  4FEC A;  2F35 A;  1MPB A;  4FEB A;  4POW A;  4Q30 B;  3TEL A;  3QIM A;  4ZZA A;  3FBP A;  5LOM A;  1P1N A;  2H99 A;  4NG7 A;  1NI9 A;  4YKP A;  2PBW A;  2I48 A;  2Z8E A;  1JVY A;  4I8C A;  1ZLQ A;  3K6U A;  4P8B A;  1FPF A;  4UAC A;  2XX9 A;  3U1O A;  4XEQ A;  4N8G A;  3RT8 A;  3C36 A;  4PTK A;  3S4U A;  5CC2 A;  1FW0 A;  4MNP A;  2UVI A;  3N5L A;  4F2O A;  4PF6 A;  2O6A A;  4OVP A;  4KCD A;  2HFB A;  3IOV A;  4EF1 A;  1H43 A;  4NED A;  3U93 A;  3Q25 A;  5I2K A;  2B4M A;  2WEF A;  1LBB A;  3TTK A;  3LBS A;  1NUW A;  1II5 A;  1SYI A;  4OFJ A;  4P11 A;  1FBD A;  3FXR A;  2X26 A;  2ZXT A;  3OSQ A;  1DSN A;  1YTV A;  2RC7 A;  4X9T A;  2PVU A;  1LAF E;  4LAT A;  1HSJ A;  3FVN A;  2DVZ A;  3IO6 A;  4WXJ A;  5I58 B;  3OD7 A;  1US5 A;  3IB2 A;  1B6H A;  3PUY E;  1Q9D A;  4O3A A;  4GD5 A;  1MXY A;  4IO7 A;  1SBP A;  4GIZ A;  4ELO A;  4R6K A;  1BLF A;  4E0X A;  2ZNU A;  1NH8 A;  3V8X B;  1NL5 A;  4P0G A;  5EHS A;  1BTJ A;  3GLB A;  3M3K A;  5AA4 A;  2VD3 A;  4H1X A;  4FAT A;  4F1U A;  4QRZ A;  3KZG A;  4BLA A;  1GTK A;  3K4U A;  1XS5 A;  2DP8 A;  4QSD A;  4EXK A;  1DCU A;  4R74 A;  4LN5 A;  1A40 A;  1YZ0 A;  3TFL A;  2V84 A;  3M8U A;  1B0H A;  1SQY A;  3LSF B;  4PFU A;  5AA2 D;  4IGT A;  1DOT A;  3PU5 A;  1CB6 A;  4P1E A;  5CBS A;  1O63 A;  3A09 A;  1Y3N A;  1B4H A;  3N26 A;  4YKK A;  3DP6 A;  4ESW A;  2O69 A;  2D5W A;  4GWU A;  5LTC A;  1B52 A;  2ABH A;  3W9V A;  1EZP A;  3H3G A;  4I62 A;  2Q89 A;  4KHZ E;  4I3Y A;  1GVC A;  3MVX A;  2W7Y A;  2VHA A;  2ALU A;  1MPD A;  2QS3 A;  4I40 A;  5KDT B;  2UVJ A;  2DQV A;  2AL4 A;  4GX4 A;  3PUX E;  5FTH A;  2ONK E;  1A8E A;  4L17 A;  1MXV A;  3KSX A;  3IO4 A;  1B51 A;  1SW5 A;  4GX6 A;  2KLF A;  4JWX A;  2THI A;  1RKM A;  5ET8 A;  3O6G A;  2F6G A;  5H8F B;  4QFN A;  1JVX A;  3PPN A;  1IIW A;  2FIX A;  2HXW A;  4N6K A;  1A54 A;  4QFO A;  1FQB A;  1XI6 A;  3WAF A;  2DYX A;  1D4N A;  5IM2 A;  2DE2 A;  3I6V A;  4RNS A;  2UVH A;  4OQO A;  3RPL A;  1M5F A;  2OWT A;  2AYS A;  3CSG A;  3MW0 A;  3TCG A;  2B3B A;  3QAX A;  3ZKL A;  1I6B A;  5KZT A;  3PPQ A;  5CI5 A;  2BJI A;  3LC8 A;  2QS4 A;  4BDR A;  3KOT A;  4TLL B;  2WX9 A;  4MHF A;  5KCJ B;  3TTM A;  3QSL A;  2B3F A;  3SES A;  1FJ9 A;  2Y7R A;  1FJ6 A;  5DVF A;  4O3B A;  2BJJ X;  2Q88 A;  2Q9T A;  2RIN A;  1N7W A;  3EPE A;  4YKJ A;  3QK6 A;  3IOU A;  3OMB A;  2QMX A;  3LUZ A;  1P1W A;  3GBB A;  2PFY A;  4G68 A;  1H45 A;  3VFJ A;  5ITO A;  2Y7K A;  2ZNT A;  4EXL A;  2ZYN A;  4H5F A;  3CI8 A;  1NV0 A;  3S9L C;  3DLN A;  4OVR A;  4KD5 A;  3MZB A;  4QSC A;  5TPA A;  2WYP A;  3T9X B;  1EYK A;  1MY4 A;  1PDA A;  1RDY A;  1RYO A;  3MC2 A;  1LBC A;  3FVK A;  1LLS A;  1QUI A;  2JJK A;  3MPK A;  1PB9 A;  3S9M C;  3MVZ A;  2RCA A;  3SEY A;  3FZV A;  1Y3P A;  2GH9 A;  4X1D A;  3K0V A;  1GGG A;  5FHN A;  3PPP A;  3E78 A;  4AQ4 A;  1OMP A;  3FD3 A;  5I2K B;  3PD8 A;  4KI0 E;  4PDD A;  4N6D A;  1CE2 A;  4MNC A;  3VDF A;  3K6W A;  2X7P A;  5AA1 A;  2ZMB A;  1YPN A;  4XFE A;  2VGQ A;  2H25 A;  3ROJ A;  4KCC A;  2MKZ A;  4YB7 A;  1JEV A;  1LAG E;  4NF4 A;  1JEU A;  1PBQ A;  4RK9 A;  4YB6 A;  2UVG A;  1MQD A;  3ISP A;  3PUZ E;  4OHN A;  1KWH A;  4FOR A;  4N91 A;  2VT5 A;  4ND9 A;  4ONY A;  2X7Q A;  4MH5 A;  1Y1Z A;  5IGA A;  2D3I A;  2VPO A;  4YMA A;  4F22 A;  2OWS A;  3KC1 A;  3KJT A;  2O1L A;  1P99 A;  1QGX A;  5AA4 B;  4ESX A;  3V89 B;  3MP8 A;  3OEM A;  4G4P A;  3FJM A;  3T1B A;  2HQ0 A;  3OO9 A;  1R9Q A;  4PBH A;  3TUS A;  3MP6 A;  3IFC A;  2O68 A;  3I5O A;  2CZL A;  1NFT A;  3W9W A;  2I3W A;  1PEB A;  4GL0 A;  3S9N C;  1Z7N E;  1HSE A;  2FNC A;  4U2R A;  4R6H A;  3C35 A;  1N3W A;  1AWB A;  4ZZE A;  1B58 A;  2Z23 A;  2G93 A;  5EYH A;  5J1D A;  2FYI A;  3QYT A;  1NKX A;  3CSB A;  2PX1 A;  3OEN A;  4NTL A;  2F36 A;  3E9X A;  3DM0 A;  1MY2 A;  2Q8J A;  1LST A;  5JEI A;  2GFE A;  3FUZ A;  1B7Z A;  1MM7 A;  3C4M A;  1NV5 A;  3O2A A;  1EU8 A;  3SEU A;  4AS5 A;  4O8M A;  1M5D A;  3MST A;  2DXR A;  3S9E A;  3HHF A;  3PTY A;  3IOW A;  3RT6 B;  3R7X A;  2QL3 A;  2Y7I A;  5HBC A;  1B7H A;  3EKI A;  3D4G A;  3V5A A;  3KG2 A;  4QF9 A;  1B5J A;  1IMC A;  4BDQ A;  1QW0 A;  2F7C A;  3RPL B;  2V3U A;  5EQA A;  2PFZ A;  2I4B A;  2XX8 A;  2DOJ A;  2R8T A;  1JQF A;  4DCY A;  1QKA A;  2E1S A;  3HCQ A;  2RF1 A;  1J1N A;  1OVB A;  3HST A;  3RPW A;  4GXA A;  4QBA A;  3EHT A;  3F11 A;  4QSE A;  4DXC A;  3HFU A;  1QUL A;  3SZP A;  1EZO A;  4KYD A;  3C33 A;  4OA4 A;  4OVS A;  3OO8 A;  4I9D A;  2XD2 A;  4N17 A;  1RYX A;  5H8Q A;  3FV2 A;  5EHM A;  3VE1 B;  5ET5 A;  4C1T A;  2R6G E;  2DDK A;  4JVC A;  3VLU A;  5LDZ A;  5K2Y A;  3U65 A;  3H6U A;  5AA3 A;  4LZ5 A;  4H8J A;  4LQ5 A;  5H8N A;  3O6I A;  4E0W A;  4G68 B;  3ONM A;  2QS1 A;  1FCK A;  3Q28 A;  3TOD A;  4GOT A;  1EYI A;  5H8S A;  2Q8M A;  1IMD A;  2Z8F A;  3KOS A;  3PMW A;  3T93 B;  1QUJ A;  2DXY A;  5BUU A;  4OEV A;  2OLB A;  2ZZV A;  5TPA B;  2HPG A;  3PUV E;  1I6A A;  4MF3 A;  1UIV A;  4I1D A;  5L9O A;  1SW4 A;  1FPB A;  4FE8 A;  1VFD A;  4R2F A;  1Q35 A;  5BWJ A;  1LBZ A;  3U8Q A;  4M4G A;  1B40 A;  2KR0 A;  4N07 A;  5ELV A;  3V83 A;  4F39 A;  1FBC A;  4UAB A;  4H0W A;  3FXU A;  1MXX A;  4U22 A;  4GWZ A;  4Q8R A;  1Y9U A;  1M5E A;  1KA0 A;  2XWO A;  3BFU A;  1IQ7 A;  2QMW A;  3PUW E;  3RLF E;  3G3G A;  3IB0 A;  5ICT A;  3AXF A;  3D1R A;  1URG A;  1VFE A;  3RTF B;  1CNQ A;  5ET7 A;  4NF4 B;  3HHG A;  3HN0 A;  3IAZ A;  4ZEF A;  4PQJ A;  3T22 A;  3C32 A;  4K3F A;  1NMU A;  1B0L A;  3GXA A;  4ELR A;  2H9B A;  5I57 A;  4KXP A;  4XKP A;  4DE8 A;  3M3L A;  4PFR A;  2XXI A;  4PAK A;  2FBP A;  5I59 A;  2P2A A;  4ECF A;  1IIT A;  1URD A;  4F3P A;  4OES A;  2CEY A;  1Q1K A;  4MAG A;  5ITP A;  1ANF A;  4YU0 A;  5DW8 A;  1R1N A;  4NMY A;  4XKR A;  2F97 A;  4R75 A;  4MIJ A;  3HV1 A;  3E4R A;  3G3K A;  4Q0C A;  3CFZ A;  3K2D A;  1YYZ A;  1B3H A;  4OVT A;  3B8B A;  5I3S A;  4NF0 A;  1N84 A;  1BP5 A;  2I6E A;  2F78 A;  1A55 A;  5H8H A;  5T3J A;  2FA7 A;  3OO7 A;  2HZK A;  3FGS A;  1IMF A;  3OEK A;  1ZU0 A;  1S9T A;  3TKD A;  4H65 A;  4ZE8 A;  1I6Q A;  4PFY A;  3GZG A;  5HM4 B;  4FAJ A;  3ECR A;  4BDN A;  4LUB A;  5I56 A;  3LR1 A;  4H46 A;  3QMF A;  4PBQ A;  1Z7M E;  3T66 A;  3PPR A;  1FBH A;  3UK4 A;  2A5S A;  4IO3 A;  2OBG A;  3IL1 B;  2HHM A;  5TU0 A;  1L5T A;  2O7I A;  4BDM A;  3EHS A;  4PGN A;  3SET A;  5AE4 A;  3TDJ A;  2Q2A A;  4AB6 A;  3JZJ A;  3IOT A;  5EQ7 A;  4RPN A;  2F7A A;  5CM6 A;  5DTB A;  4Z0I A;  4U23 A;  1INP A;  1T0K A;  4ZED A;  3ILT B;  4DLD A;  1PBP A;  4N81 A;  2CMO A;  2QRY A;  2F3D A;  3S2V A;  4HCY A;  1EYJ A;  4OTE A;  4Q5T A;  4OYV A;  1LBY A;  1IXI A;  1LEV A;  5A5X A;  5CMM A;  1NH7 A;  4G2Z A;  1QJM A;  1B5H A;  1VE4 A;  3BIG A;  2UXA A;  1LCF A;  4MFI A;  2R71 A;  3FV1 A;  1UQW A;  2XXV A;  4F1Y A;  3K00 A;  5FHM A;  1FPD A;  1A7L A;  1M5B A;  4MLV A;  2Z8D A;  1SYH A;  4P47 A;  3CG3 A;  2I4C A;  4NE4 A;  4R73 A;  3K1N A;  3PMX A;  1R9L A;  1MDQ A;  3K6V A;  3KN8 A;  4O94 A;  2D21 A;  2O51 A;  4YKI A;  1RDX A;  4YIC A;  3C31 A;  1OLA A;  4ISU A;  1USY E;  3B7D A;  2PYY A;  3R26 A;  1FQD A;  5H8Q B;  4OAN A;  1N0T A;  4QFP A;  1B1H A;  1MDP 1;  1FQE A;  1US4 A;  3B6Q A;  4IY6 A;  2HAU A;  1DPE A;  3N6T A;  2VPN A;  2O1M A;  2P1S A;  5H8N B;  5CRY A;  3GYY A;  3RTW B;  1S7Y A;  4PFW A;  3VVF A;  1EH3 A;  3R6U A;  1D9V A;  4IGR A;  3TTR A;  2NVU B;  3H6W A;  4OXV A;  4N6P A;  3UN6 A;  5CBR A;  4JSO A;  1LBV A;  4OER A;  2I3V A;  1NNF A;  4F3G A;  1A8F A;  2XD3 A;  4NAP A;  4BDL A;  1BKA A;  5A5L A;  1MQH A;  1VDW A;  1MH3 A;  4PFT A;  1FBF A;  4G8M A;  4EQ7 A;  4XKN A;  2B4L A;  1B5I A;  2XX7 A;  3JV9 A;  2G29 A;  3RGY A;  3E13 X;  3MWB A;  1AIV A;  1D3K A;  2UYF A;  4R9G A;  2KQZ A;  2HAV A;  2ZZX A;  3UIF A;  3B6T A;  4ZEK A;  4RXL A;  3K1M A;  1FTA A;  4H45 A;  2REJ A;  1AL3 A;  4U1O A;  4QXD A;  4H8I A;  4GWX A;  4HE0 A;  4DXU A;  4NF5 A;  3MP1 A;  3TEP A;  1MXU A;  3DP4 A;  4FIM A;  3LSX A;  5L9M A;  4F31 B;  1IZ1 A;  1URS A;  2WBD A;  3RUM A;  1G0H A;  3G7W A;  5I57 B;  3FJ7 A;  3E79 A;  4YB5 A;  3HPI A;  1JW4 A;  3T9U A;  2ONS A;  3Q27 A;  2ONR A;  1K9Z A;  5I59 B;  4O7I A;  4ELQ A;  3THI A;  3M3F A;  4JB7 A;  5I5P A;  4H6D A;  2R9J A;  2ZYM A;  4PET A;  4P1L A;  1B7U A;  4OMB A;  2Y5L A;  4HS7 A;  2NUV A;  4G68 C;  3DP8 A;  4DCX A;  4JXI A;  4P56 A;  4NGU A;  4YMB A;  3TAJ A;  3Q26 A;  4PE3 A;  2F7B A;  1NNK A;  2XXY A;  4XTC Q;  2O7U A;  3MQ9 A;  5DEX A;  2DWI A;  2YLN A;  2ZNS A;  3CRB A;  5EQ8 A;  4M1V A;  1OIB A;  4R2B A;  1FPE A;  3IB1 A;  4AB5 A;  1M5C A;  5H8H B;  3MBP A;  2XXP A;  4HE1 A;  4IY5 A;  1YCJ A;  3KN7 A;  3KBR A;  2FVZ A;  2I0C A;  2QS2 A;  3D4C A;  1UTB A;  4Z7E A;  1MY3 A;  1XC1 A;  1S50 A;  1B05 A;  3U94 A;  1FTL A;  4C1U A;  3C9H A;  3TTL A;  4MCO A;  5I56 B;  2CEX A;  4GVO A;  2XXR A;  1FRP A;  3RQT A;  4UA8 A;  3U92 A;  4EQB A;  1ZBM A;  1FQA A;  3H6V A;  4O7M A;  5ICQ A;  2F3B A;  4PGP A;  2P3N A;  2HZL A;  2VP1 A;  3T9H B;  2REG A;  3VLV A;  4BDO A;  4MEV A;  1UTH A;  3EN3 A;  1LAH E;  2B65 A;  2DSF A;  3L6G A;  5CMK A;  2Y7W A;  3K01 A;  3SEW A;  2CZK A;  2V93 A;  3G3J A;  3SER A;  4DI3 D;  2RCB A;  5L9S A;  4KYE A;  3SKP A;  4IO4 A;  4X8R A;  3LSW A;  1WDN A;  5A5X B;  2XA5 A;  2I58 A;  4RPO A;  4HE2 A;  1N76 A;  4IB2 A;  4KR5 A;  4N13 A;  1XT8 A;  4F2Q A;  2PCR A;  4NHB A;  1PC3 A;  1O7T A;  1D9Q A;  4NN3 A;  3TQL A;  1MY0 A;  4TOZ A;  1DK4 A;  4ZEB A;  1SVX B;  4ZDM A;  1FBG A;  4MX6 A;  3IR1 A;  1I69 A;  3BFT A;  1SI1 A;  3RYD A;  2QVU A;  5B7D A;  1WVJ A;  1ZKB A;  3O6H A;  4LQ2 A;  3VXC A;  5ET6 A;  3KFM A;  3QUJ A;  1FQC A;  2L5V A;  4R9F A;  3ZS6 A;  4FJP A;  1LFH A;  5F1Q A;  4OZ9 A;  2QJE A;  4XIG Q;  5F24 A;  1TFD A;  4PAI A;  5FTI A;  1IUD A;  3LV0 A;  3TCH A;  4GLI A;  1NNP A;  1R6Z A;  3QUF A;  2GRV A;  1IEJ A;  1SW1 A;  1OVT A;  1POT A;  4OFO A;  3KGC A;  4NF8 A;  3CVG A;  1B32 A;  2DE3 A;  1SW2 A;  2M8C A;  3B50 A;  4ELP A;  1XOC A;  4H5G A;  3G3I A;  2DWA A;  2QFL A;  1LGB C;  3OO6 A;  5K2X A;  2PT1 A;  3IOR A;  3RY3 A;  1IME A;  1H3D A;  3SEX A;  3ILU B;  4C0R A;  4MBP A;  1K9Y A;  1N3X A;  4GBV A;  2OCU A;  3EQ1 A;  3CIJ A;  4U1Z A;  1TFA A;  1LBX A;  1HSL A;  3SDF A;  4N8Y A;  1NUX A;  3GBA A;  2CZH A;  3I3V A;  3OSR A;  4DXB A;  5EQ9 A;  1B3F A;  1YAE A;  4JVD A;  4NF6 A;  4OET A;  1MXW A;  3VV5 A;  1DMB A;  2P0S A;  4PAF A;  4GWW A;  1ZTY A;  1NNT A;  4F3S A;  2Z22 A;  3UGW A;  3A3U A;  1TT1 A;  5IKB A;  4HCW A;  4KQP A;  4XKQ A;  2DE4 A;  1OQH A;  1B3L A;  5ESY A;  1JW1 A;  3IK6 B;  5JK4 A;  1GV8 A;  2QSX A;  2A5T A;  1MS7 A;  3FXQ A;  2RC8 A;  2V3Q A;  4EUO A;  3PD9 A;  1XVX A;  1FPK A;  5AA2 A;  4POX A;  1FPL A;  4ZS9 A;  2IA4 A;  3RNN A;  4NF5 B;  3UP9 A;  3CHG A;  5TP9 A;  4MNI A;  3MAM A;  3W15 C;  2XXT A;  1B1X A;  1Y1M A;  4RK2 A;  5ISU A;  1MH4 A;  2VD2 A;  2YPN A;  4RA1 A;  5L8D A;  2DWH A;  2NWJ A;  4IO2 A;  1IXH A;  3CR9 A;  1JW5 A;  4IR8 A;  2QVR A;  1QKB A;  3CFX A;  2H4I A;  4QFK A;  1H44 A;  4WED A;  4JSD A;  1G0I A;  4DDD A;  1POY 1;  3C34 A;  4OEU A;  4GX3 A;  1WOD A;  2H98 A;  2FIE A;  4QFL A;  3H03 A;  2E0S A;  4GWO A;  2HEU A;  1Y4T A;  4P9K A;  5DEX B;  4PP0 A;  1FBP A;  3O9P A;  4EQ9 A;  2OX3 A;  4IO5 A;  3FAT A;  4ZEC A;  5J16 A;  4GF8 A;  4PC9 A;  4LON B;  2XHD A;  1AH5 A;  4WKM A;  1B3E A;  1LAX A;  1MM6 A;  2HXR A;  1KA1 A;  4R72 A;  2OZZ A;  4O3C A;  1UTB B;  3MVY A;  1H76 A;  3NOH A;  3A29 A;  4OEN A;  2WBB A;  4LZ7 A;  2F6P A;  3H6T A;  4N15 A;  3T0J A;  3LSL A;  1KZ8 A;  1AOV A;  2XXK A;  5I84 A;  3LUY A; 
#chains in the Genus database with same CATH homology
 4IO6 A;  3CG1 A;  1ELJ A;  4G8H A;  4RY1 A;  1ATG A;  3K02 A;  5F7V A;  1UTH B;  4MLQ A;  1F9B A;  1MQI A;  3U72 A;  3VVE A;  2WKY A;  1DPP A;  2LAO A;  3FAS A;  2NXO A;  4GQO A;  5JTY A;  3CFL A;  3SEV A;  3ZKK A;  3FIR A;  3O28 A;  1MXZ A;  5DYH A;  4RYA A;  1SDX A;  1FTK A;  3K1P A;  1LCT A;  4NWD A;  3Q29 A;  4U4S A;  1ZMG A;  4GRK A;  3VVD A;  1DTG A;  2DWJ A;  2I0B A;  2AL5 A;  3MZ1 A;  1MG1 A;  3O66 A;  1DTZ A;  2QPQ A;  3RN8 A;  4KPT A;  1B9J A;  3EF7 A;  5M2V A;  3QXM A;  4QHQ A;  5I2N A;  3B6W A;  4THI A;  4H67 A;  1ZJL A;  3VXB A;  3T9V A;  1VSO A;  1PB7 A;  3P7I A;  5CMB A;  1LB8 A;  3KSJ A;  5DT6 A;  3KN3 A;  4ZE9 A;  2PMS A;  4F3B A;  3H7M A;  2GHA A;  3H4Z A;  3FJG A;  1B3G A;  4NF8 B;  2Y7P A;  3T96 B;  3OXN A;  1P1U A;  3G3H A;  4GXS B;  1Y4C A;  4OWD A;  4TLM B;  1FQF A;  3BBR A;  3FVO A;  2V25 A;  4DIG A;  2PT2 A;  3OOA A;  2NOO A;  2ZYK A;  1B2H A;  3FVG A;  2AIX A;  2OK2 A;  3MZ9 A;  1Y20 A;  3O97 A;  2IEE A;  4EF2 A;  1GR2 A;  3TPA A;  3E3K A;  2DS9 A;  4NF6 B;  2XXX A;  3MVW A;  4LP2 B;  1A99 A;  3ZSF A;  1Y3Q A;  1MQJ A;  1N7X A;  4JWO A;  2XXU A;  4YAH X;  3PV0 E;  1OQG A;  5FHO A;  2A5T B;  2V3T A;  5I58 A;  3UOR A;  3IX1 A;  4GL8 A;  1FTO A;  4PE5 B;  4LA9 A;  4G77 A;  5AA2 B;  3PPO A;  2H5Y A;  3HO7 A;  5TP9 B;  3MJN A;  1JET A;  4TQU Q;  3PMV A;  4F29 A;  2XXH A;  4KYS A;  3H06 B;  1TWY A;  5DVI A;  1XVY A;  4EDP A;  4JWY A;  5DVJ A;  3N94 A;  1D9Y A;  1LFI A;  2XXQ A;  3TCF A;  1LFG A;  4NWC A;  1IXC A;  2YJP A;  1FTJ A;  3PGF A;  1IXG A;  3L6H A;  1SI0 A;  1SD3 A;  4LVQ A;  5HPQ A;  1P1O A;  1FTM A;  1N04 A;  4HTG A;  3IJX B;  2GHB A;  4GFR A;  2ANJ A;  5IAI A;  1P1Q A;  3ODB A;  4U21 A;  3BKI B;  4OVJ A;  3JYR A;  1B46 A;  3N6U A;  1OLC A;  5CMC A;  4WEP A;  3VLW A;  4RJZ A;  5EYF A;  3DEL B;  5B70 A;  2RKM A;  4X48 A;  4P0I A;  4U4X A;  4ZEI A;  3TQW A;  1TXF A;  5KDT A;  1MY1 A;  3TTN A;  3A3C A;  1PB8 A;  4HW8 A;  1MRP A;  4F1V A;  2I49 A;  3MUQ A;  4YZZ A;  2OJT A;  4JDF A;  1QVS A;  2ZYO A;  1LB9 A;  1VR5 A;  2XXW A;  1UIU A;  1ZIU A;  5H8F A;  3TYH A;  1O64 A;  2Y84 A;  3KJ7 A;  3G3F A;  2F5X A;  3OEL A;  2RC9 A;  4DZ1 A;  1EZ9 A;  4FED A;  4XXU A;  2F8D A;  5JTY B;  3TZA A;  1JNF A;  1MQG A;  3USD A;  3IJO B;  3TMG A;  3O29 A;  3EHU A;  2HCA A;  3WAE A;  3KEI A;  1USY H;  2Q2C A;  2UYE A;  3MPL A;  2O84 X;  4LZ8 A;  5KCJ A;  3K6X A;  2ESN A;  1BIY A;  2DVC A;  1AMF A;  4F19 A;  1MPC A;  5I2N B;  4KFQ A;  4G8N A;  4JBZ A;  2VOZ A;  1XHY A;  1QUK A;  3UA8 A;  2F34 A;  4F18 A;  4X1B A;  4OFL A;  4R6Y A;  1B4Z A;  4FEC A;  2F35 A;  1MPB A;  4FEB A;  4POW A;  4Q30 B;  3TEL A;  3QIM A;  4ZZA A;  5LOM A;  1P1N A;  2H99 A;  4YKP A;  2PBW A;  2I48 A;  2Z8E A;  1JVY A;  4I8C A;  1ZLQ A;  3K6U A;  4UAC A;  2XX9 A;  3U1O A;  3RT8 A;  3C36 A;  3S4U A;  5CC2 A;  1FW0 A;  2UVI A;  3N5L A;  4F2O A;  2O6A A;  4KCD A;  2HFB A;  3IOV A;  4EF1 A;  1H43 A;  4NED A;  3U93 A;  3Q25 A;  5I2K A;  1LBB A;  3TTK A;  3LBS A;  1II5 A;  1SYI A;  4OFJ A;  4P11 A;  3FXR A;  2X26 A;  2ZXT A;  3OSQ A;  1DSN A;  1YTV A;  2RC7 A;  4X9T A;  2PVU A;  1LAF E;  4LAT A;  1HSJ A;  3FVN A;  2DVZ A;  3IO6 A;  4WXJ A;  5I58 B;  3OD7 A;  1US5 A;  3IB2 A;  1B6H A;  3PUY E;  4O3A A;  4GD5 A;  1MXY A;  4IO7 A;  1SBP A;  4GIZ A;  4ELO A;  4R6K A;  1BLF A;  4E0X A;  2ZNU A;  1NH8 A;  3V8X B;  1NL5 A;  4P0G A;  5EHS A;  1BTJ A;  3GLB A;  3M3K A;  5AA4 A;  2VD3 A;  4H1X A;  4FAT A;  4F1U A;  4QRZ A;  3KZG A;  4BLA A;  1GTK A;  3K4U A;  1XS5 A;  2DP8 A;  4QSD A;  4EXK A;  4R74 A;  1A40 A;  3TFL A;  2V84 A;  3M8U A;  1B0H A;  1SQY A;  3LSF B;  4PFU A;  5AA2 D;  4IGT A;  1DOT A;  3PU5 A;  1CB6 A;  5CBS A;  1O63 A;  3A09 A;  1Y3N A;  1B4H A;  3N26 A;  4YKK A;  3DP6 A;  4ESW A;  2O69 A;  2D5W A;  3W9V A;  1B52 A;  2ABH A;  1EZP A;  3H3G A;  4I62 A;  2Q89 A;  4KHZ E;  1GVC A;  3MVX A;  2W7Y A;  2VHA A;  2ALU A;  1MPD A;  2QS3 A;  5KDT B;  2UVJ A;  2DQV A;  2AL4 A;  3PUX E;  5FTH A;  2ONK E;  1A8E A;  4L17 A;  1MXV A;  3KSX A;  3IO4 A;  1B51 A;  1SW5 A;  2KLF A;  4JWX A;  2THI A;  1RKM A;  3O6G A;  2F6G A;  5H8F B;  4QFN A;  1JVX A;  3PPN A;  1IIW A;  2HXW A;  1A54 A;  4QFO A;  1FQB A;  3WAF A;  2DYX A;  1D4N A;  2DE2 A;  3I6V A;  4RNS A;  2UVH A;  4OQO A;  1M5F A;  2OWT A;  2AYS A;  3CSG A;  3MW0 A;  3TCG A;  2B3B A;  3QAX A;  3ZKL A;  1I6B A;  5KZT A;  3PPQ A;  5CI5 A;  3LC8 A;  2QS4 A;  4BDR A;  3KOT A;  4TLL B;  5KCJ B;  3TTM A;  3QSL A;  2B3F A;  3SES A;  2Y7R A;  5DVF A;  4O3B A;  2BJJ X;  2Q88 A;  2Q9T A;  2RIN A;  1N7W A;  3EPE A;  4YKJ A;  3QK6 A;  3IOU A;  3OMB A;  2QMX A;  1P1W A;  3GBB A;  4G68 A;  1H45 A;  3VFJ A;  5ITO A;  2Y7K A;  2ZNT A;  4EXL A;  2ZYN A;  4H5F A;  3CI8 A;  3S9L C;  3DLN A;  4KD5 A;  3MZB A;  4QSC A;  5TPA A;  3T9X B;  1MY4 A;  1PDA A;  1RYO A;  3MC2 A;  1LBC A;  3FVK A;  1LLS A;  1QUI A;  3MPK A;  1PB9 A;  3S9M C;  3MVZ A;  2RCA A;  3SEY A;  3FZV A;  1Y3P A;  2GH9 A;  4X1D A;  3K0V A;  1GGG A;  5FHN A;  3PPP A;  4AQ4 A;  1OMP A;  3FD3 A;  5I2K B;  3PD8 A;  4KI0 E;  1CE2 A;  3VDF A;  3K6W A;  2X7P A;  5AA1 A;  2ZMB A;  1YPN A;  2VGQ A;  2H25 A;  4KCC A;  4YB7 A;  1JEV A;  1LAG E;  4NF4 A;  1JEU A;  1PBQ A;  4RK9 A;  4YB6 A;  2UVG A;  1MQD A;  3PUZ E;  4OHN A;  1KWH A;  4FOR A;  4ND9 A;  4ONY A;  2X7Q A;  4MH5 A;  1Y1Z A;  2D3I A;  4YMA A;  4F22 A;  2OWS A;  3KJT A;  2O1L A;  1P99 A;  5AA4 B;  4ESX A;  3V89 B;  3MP8 A;  3OEM A;  4G4P A;  3FJM A;  2HQ0 A;  3OO9 A;  1R9Q A;  3TUS A;  3MP6 A;  2O68 A;  3I5O A;  2CZL A;  1NFT A;  3W9W A;  2I3W A;  1PEB A;  4GL0 A;  3S9N C;  1Z7N E;  1HSE A;  2FNC A;  4U2R A;  4R6H A;  3C35 A;  1N3W A;  4ZZE A;  1B58 A;  2Z23 A;  2G93 A;  5J1D A;  2FYI A;  3QYT A;  1NKX A;  3CSB A;  2PX1 A;  3OEN A;  4NTL A;  2F36 A;  3E9X A;  3DM0 A;  1MY2 A;  2Q8J A;  1LST A;  5JEI A;  2GFE A;  3FUZ A;  1B7Z A;  1MM7 A;  3C4M A;  3O2A A;  1EU8 A;  3SEU A;  1M5D A;  2DXR A;  3S9E A;  3HHF A;  3IOW A;  3RT6 B;  3R7X A;  2QL3 A;  2Y7I A;  5HBC A;  1B7H A;  3D4G A;  3V5A A;  3KG2 A;  4QF9 A;  1B5J A;  4BDQ A;  1QW0 A;  2F7C A;  2V3U A;  2I4B A;  2XX8 A;  2DOJ A;  1JQF A;  4DCY A;  1QKA A;  2E1S A;  3HCQ A;  2RF1 A;  1J1N A;  1OVB A;  3HST A;  3RPW A;  4GXA A;  3EHT A;  3F11 A;  4QSE A;  4DXC A;  1QUL A;  1EZO A;  4KYD A;  3C33 A;  3OO8 A;  4I9D A;  2XD2 A;  1RYX A;  5H8Q A;  3FV2 A;  5EHM A;  3VE1 B;  4C1T A;  2R6G E;  3VLU A;  5K2Y A;  3H6U A;  5AA3 A;  4LZ5 A;  4H8J A;  4LQ5 A;  5H8N A;  3O6I A;  4E0W A;  4G68 B;  3ONM A;  2QS1 A;  1FCK A;  3Q28 A;  3TOD A;  4GOT A;  5H8S A;  2Z8F A;  3KOS A;  3PMW A;  3T93 B;  1QUJ A;  2DXY A;  5BUU A;  4OEV A;  2OLB A;  5TPA B;  3PUV E;  1I6A A;  4MF3 A;  1UIV A;  4I1D A;  5L9O A;  1SW4 A;  4FE8 A;  1VFD A;  4R2F A;  1Q35 A;  5BWJ A;  3U8Q A;  4M4G A;  1B40 A;  4N07 A;  5ELV A;  3V83 A;  4F39 A;  4H0W A;  3FXU A;  1MXX A;  4U22 A;  4Q8R A;  1Y9U A;  1M5E A;  3BFU A;  3PUW E;  1IQ7 A;  2QMW A;  3RLF E;  3G3G A;  3IB0 A;  5ICT A;  3AXF A;  1URG A;  1VFE A;  3RTF B;  4NF4 B;  3HHG A;  3HN0 A;  3IAZ A;  4ZEF A;  4PQJ A;  3T22 A;  3C32 A;  4K3F A;  1NMU A;  1B0L A;  3GXA A;  4ELR A;  2H9B A;  5I57 A;  4XKP A;  4DE8 A;  3M3L A;  2XXI A;  5I59 A;  2P2A A;  4ECF A;  1IIT A;  1URD A;  4F3P A;  4OES A;  1Q1K A;  5ITP A;  1ANF A;  4YU0 A;  1R1N A;  4NMY A;  4XKR A;  2F97 A;  4R75 A;  3HV1 A;  3E4R A;  3G3K A;  4Q0C A;  3CFZ A;  3K2D A;  1B3H A;  1N84 A;  1BP5 A;  2I6E A;  2F78 A;  1A55 A;  5H8H A;  2FA7 A;  3OO7 A;  2HZK A;  3FGS A;  3OEK A;  1ZU0 A;  1S9T A;  3TKD A;  4H65 A;  4ZE8 A;  1I6Q A;  4PFY A;  3GZG A;  5HM4 B;  4FAJ A;  3ECR A;  4BDN A;  4LUB A;  5I56 A;  3LR1 A;  1Z7M E;  3T66 A;  3PPR A;  3UK4 A;  2A5S A;  4IO3 A;  2OBG A;  3IL1 B;  5TU0 A;  1L5T A;  2O7I A;  4BDM A;  3EHS A;  3SET A;  5AE4 A;  3TDJ A;  2Q2A A;  4AB6 A;  3JZJ A;  3IOT A;  4RPN A;  2F7A A;  5CM6 A;  5DTB A;  4Z0I A;  4U23 A;  1T0K A;  4ZED A;  3ILT B;  4DLD A;  1PBP A;  2CMO A;  2QRY A;  3S2V A;  4HCY A;  4OTE A;  4Q5T A;  4OYV A;  1IXI A;  5A5X A;  5CMM A;  1NH7 A;  4G2Z A;  1QJM A;  1B5H A;  1VE4 A;  2UXA A;  1LCF A;  4MFI A;  2R71 A;  3FV1 A;  1UQW A;  2XXV A;  4F1Y A;  3K00 A;  5FHM A;  1A7L A;  1M5B A;  4MLV A;  2Z8D A;  1SYH A;  3CG3 A;  2I4C A;  4NE4 A;  4R73 A;  3K1N A;  3PMX A;  1R9L A;  1MDQ A;  3K6V A;  3KN8 A;  2D21 A;  2O51 A;  4YKI A;  4YIC A;  3C31 A;  1OLA A;  4ISU A;  1USY E;  3B7D A;  2PYY A;  3R26 A;  1FQD A;  5H8Q B;  1N0T A;  4QFP A;  1B1H A;  1MDP 1;  1FQE A;  1US4 A;  3B6Q A;  4IY6 A;  2HAU A;  1DPE A;  3N6T A;  2O1M A;  2P1S A;  5H8N B;  5CRY A;  3RTW B;  1S7Y A;  4PFW A;  3VVF A;  1EH3 A;  3R6U A;  1D9V A;  4IGR A;  3TTR A;  2NVU B;  3H6W A;  4OXV A;  4N6P A;  3UN6 A;  5CBR A;  4JSO A;  4OER A;  2I3V A;  1NNF A;  4F3G A;  1A8F A;  2XD3 A;  4BDL A;  1BKA A;  1MQH A;  1MH3 A;  4PFT A;  4G8M A;  4EQ7 A;  4XKN A;  1B5I A;  2XX7 A;  3JV9 A;  2G29 A;  3RGY A;  3E13 X;  3MWB A;  1AIV A;  1D3K A;  2UYF A;  4R9G A;  2HAV A;  3UIF A;  3B6T A;  4ZEK A;  4RXL A;  3K1M A;  2REJ A;  1AL3 A;  4U1O A;  4H8I A;  4DXU A;  4NF5 A;  3MP1 A;  3TEP A;  1MXU A;  3DP4 A;  4FIM A;  3LSX A;  5L9M A;  4F31 B;  1IZ1 A;  1URS A;  3RUM A;  3G7W A;  5I57 B;  3FJ7 A;  4YB5 A;  3HPI A;  1JW4 A;  3T9U A;  2ONS A;  3Q27 A;  2ONR A;  5I59 B;  4ELQ A;  3THI A;  3M3F A;  4JB7 A;  4H6D A;  2R9J A;  2ZYM A;  4PET A;  1B7U A;  4OMB A;  4HS7 A;  2NUV A;  4G68 C;  3DP8 A;  4DCX A;  4JXI A;  4YMB A;  3TAJ A;  3Q26 A;  2F7B A;  1NNK A;  2XXY A;  4XTC Q;  2O7U A;  3MQ9 A;  5DEX A;  2DWI A;  2YLN A;  2ZNS A;  3CRB A;  4M1V A;  1OIB A;  4R2B A;  3IB1 A;  4AB5 A;  1M5C A;  5H8H B;  3MBP A;  2XXP A;  4IY5 A;  1YCJ A;  3KN7 A;  3KBR A;  2I0C A;  2QS2 A;  3D4C A;  1UTB A;  4Z7E A;  1MY3 A;  1XC1 A;  1S50 A;  1B05 A;  3U94 A;  1FTL A;  4C1U A;  3C9H A;  3TTL A;  5I56 B;  4GVO A;  2XXR A;  3RQT A;  4UA8 A;  3U92 A;  4EQB A;  1ZBM A;  1FQA A;  3H6V A;  5ICQ A;  2HZL A;  2VP1 A;  3T9H B;  2REG A;  3VLV A;  4BDO A;  1UTH A;  3EN3 A;  1LAH E;  2B65 A;  2DSF A;  3L6G A;  5CMK A;  2Y7W A;  3K01 A;  3SEW A;  2V93 A;  3G3J A;  3SER A;  2RCB A;  5L9S A;  4KYE A;  3SKP A;  4IO4 A;  3LSW A;  1WDN A;  5A5X B;  2I58 A;  4RPO A;  1N76 A;  4IB2 A;  4KR5 A;  4N13 A;  1XT8 A;  4F2Q A;  1PC3 A;  1O7T A;  3TQL A;  1MY0 A;  4TOZ A;  4ZEB A;  1SVX B;  4ZDM A;  3IR1 A;  1I69 A;  3BFT A;  1SI1 A;  5B7D A;  1WVJ A;  1ZKB A;  3O6H A;  4LQ2 A;  3VXC A;  3KFM A;  3QUJ A;  1FQC A;  4R9F A;  3ZS6 A;  4FJP A;  1LFH A;  5F1Q A;  4OZ9 A;  2QJE A;  4XIG Q;  1TFD A;  5FTI A;  1IUD A;  3TCH A;  4GLI A;  1NNP A;  1R6Z A;  3QUF A;  2GRV A;  1IEJ A;  1SW1 A;  1OVT A;  1POT A;  4OFO A;  3KGC A;  4NF8 A;  3CVG A;  1B32 A;  2DE3 A;  1SW2 A;  2M8C A;  4ELP A;  1XOC A;  4H5G A;  3G3I A;  2DWA A;  1LGB C;  3OO6 A;  5K2X A;  2PT1 A;  3IOR A;  3RY3 A;  1H3D A;  3SEX A;  3ILU B;  4C0R A;  4MBP A;  1N3X A;  2OCU A;  3EQ1 A;  3CIJ A;  4U1Z A;  1TFA A;  1HSL A;  3SDF A;  3GBA A;  3I3V A;  3OSR A;  4DXB A;  1B3F A;  1YAE A;  4NF6 A;  4OET A;  1MXW A;  3VV5 A;  1DMB A;  2P0S A;  1ZTY A;  1NNT A;  4F3S A;  2Z22 A;  3UGW A;  3A3U A;  1TT1 A;  5IKB A;  4HCW A;  4KQP A;  4XKQ A;  2DE4 A;  1OQH A;  1B3L A;  1JW1 A;  3IK6 B;  5JK4 A;  1GV8 A;  2QSX A;  2A5T A;  1MS7 A;  3FXQ A;  2RC8 A;  2V3Q A;  4EUO A;  3PD9 A;  1XVX A;  5AA2 A;  4POX A;  4ZS9 A;  2IA4 A;  3RNN A;  4NF5 B;  3UP9 A;  5TP9 A;  3MAM A;  3W15 C;  2XXT A;  1B1X A;  1Y1M A;  4RK2 A;  5ISU A;  1MH4 A;  2VD2 A;  2YPN A;  4RA1 A;  5L8D A;  2DWH A;  2NWJ A;  4IO2 A;  1IXH A;  3CR9 A;  1JW5 A;  1QKB A;  3CFX A;  2H4I A;  4QFK A;  1H44 A;  4WED A;  4JSD A;  4DDD A;  1POY 1;  3C34 A;  4OEU A;  1WOD A;  2H98 A;  4QFL A;  3H03 A;  2E0S A;  4GWO A;  2HEU A;  1Y4T A;  5DEX B;  4PP0 A;  3O9P A;  4EQ9 A;  4IO5 A;  3FAT A;  4ZEC A;  4GF8 A;  4LON B;  2XHD A;  1AH5 A;  4WKM A;  1B3E A;  1LAX A;  1MM6 A;  4R72 A;  2OZZ A;  4O3C A;  1UTB B;  3MVY A;  1H76 A;  4OEN A;  4LZ7 A;  2F6P A;  3H6T A;  3LSL A;  1AOV A;  5I84 A;  3LUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...