1IIWA

Glur0 ligand binding core: closed-cleft ligand-free structure
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
226
structure length
221
Chain Sequence
GSAMALKVGVVGNPPFVFYGAFTGISLDVWRAVAESQKWNSEYVRQNSISAGITAVAEGELDILIGPISVTPERAAIEGITFTQPYFSSGIGLLIPGTATPLFRSVGDLKNKEVAVVRDTTAVDWANFYQADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNLNLEVTEIRVSLEPYGFVLKENSPLQKTINVEMLNLLYSRVIAEFTERWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Slr1257 protein
publication title Mechanisms for ligand binding to GluR0 ion channels: crystal structures of the glutamate and serine complexes and a closed apo state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
total genus 69
structure length 221
sequence length 226
ec nomenclature
pdb deposition date 2001-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iiwA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iiwA02
4H5FA 1VSOA 4JWXA 3C33A 3MPLA 4AB5A 4LATA 5I2NA 1Y4TA 1MPDA 4IB2A 1IQ7A 1B46A 4NTLA 4YB7A 4Z7EA 3CFLA 4F18A 2ZXTA 1URGA 2R9JA 4KFQA 4TLMB 5CBRA 4BDQA 1B3EA 3M3LA 5ICTA 4FJPA 1LGBC 2XX8A 2XD3A 1A99A 5AA2B 5DTBA 1B1XA 2GHBA 5BWJA 5EHSA 4RPNA 2F5XA 2CMOA 3FVKA 1UTHA 1SI1A 2RCAA 3KOSA 1MPCA 2O69A 4OYVA 4OHNA 4GL0A 1O7TA 4YU0A 5A5XB 4XXUA 3FXRA 4JDFA 1Q35A 1JW4A 4G8NA 3FATA 3KSXA 1RKMA 3W9VA 3Q28A 4NF5B 4GWOA 2W7YA 2XX9A 2A5TA 3LSXA 3MZ9A 5FHOA 4LA9A 1LB9A 2O68A 5CMKA 1MM7A 3MZBA 3LC8A 1QUIA 4LZ7A 2ONSA 1A55A 3JYRA 1B5HA 3LUYA 3S4UA 1XS5A 3TKDA 3PD9A 5M2VA 3KZGA 5H8FA 5CBSA 4BDMA 1XOCA 5I59B 1MS7A 2YJPA 3MC2A 4U23A 5AA1A 3FXQA 2XHDA 2PMSA 2VP1A 1LCTA 3EHSA 1B6HA 1MY4A 1EZPA 1FTKA 1SYHA 3OSQA 3RPWA 1N7WA 1AIVA 5CRYA 3DELB 3JV9A 4FORA 1MXYA 2ONKE 2DE2A 1I6BA 2UVJA 4QSCA 1JNFA 1BP5A 5TPAB 3ZKLA 1IXGA 1VFEA 1PC3A 3MQ9A 1MQJA 1Y3QA 3K1MA 1DSNA 3DM0A 4R6YA 3IK6B 1B58A 1QUJA 4OFJA 4X1DA 3QXMA 4FAJA 4PP0A 3U93A 2XXRA 4KR5A 3IR1A 1JW1A 3SEUA 3K00A 2ZYMA 3MBPA 2RF1A 3KJTA 4GLIA 2I6EA 4HW8A 3H03A 4NF8B 4ZEIA 4XKRA 1B32A 3PUZE 4ZE8A 3RQTA 3OXNA 3GLBA 4C0RA 5I57A 4HTGA 3VVEA 3OO9A 4YZZA 3OELA 2H4IA 1EH3A 4WEPA 2X7QA 3VLWA 4DIGA 1R6ZA 4XKNA 2VGQA 1PDAA 1NH8A 3KOTA 4OZ9A 4ELQA 1IEJA 5IKBA 3GXAA 1LCFA 2QMXA 2RCBA 4F2OA 1MM6A 5CI5A 3D4GA 3H4ZA 3IO6A 1XC1A 3OD7A 4G68B 2ANJA 2FA7A 4OFLA 4ELRA 3MAMA 1ZLQA 3VDFA 3U92A 3CFZA 1ELJA 1NFTA 3SDFA 3M3FA 4EDPA 5KCJA 2YLNA 2Z8EA 3BKIB 2P2AA 4IGTA 5L9SA 4QFPA 1OVTA 3F11A 5H8QB 4DE8A 4F3GA 3SEVA 2P1SA 1LAGE 1FQDA 1MPBA 5H8SA 1LAFE 4JWOA 1US5A 1B5JA 3IB0A 3TTMA 2XXQA 4Q0CA 2PYYA 4PETA 1OLAA 1CB6A 4H5GA 3O97A 3FZVA 2DWAA 1B2HA 1TWYA 3ILTB 3RLFE 3BFUA 4O3CA 4EUOA 1DOTA 2DVCA 4RNSA 4KD5A 1ZIUA 4JXIA 2O1LA 4R2FA 1MQGA 3DP8A 2LAOA 2A5TB 4N07A 1AL3A 4WKMA 1D9VA 3MWBA 1Y3NA 4NF4A 3G3GA 2ZYKA 3TMGA 4R2BA 2DXRA 4H8JA 1LBCA 4IO5A 2Y7PA 3BBRA 1P1UA 4R75A 3Q27A 3QAXA 2X7PA 3MUQA 3K6WA 2Q9TA 3O9PA 3KN7A 1IXCA 1D9YA 2O6AA 1S7YA 2XXIA 4MF3A 5AA4B 3V89B 2XXTA 2Z22A 4MBPA 4ESXA 3RUMA 4JB7A 1OVBA 3O29A 3SERA 5ITOA 5JTYB 4N13A 4EQ7A 1O64A 2PX1A 4GXSB 2PBWA 1Y1MA 2QJEA 2Y84A 2OCUA 4NWDA 1IXIA 4C1UA 3W15C 4HCYA 4GRKA 4ECFA 3HO7A 4KI0E 3A09A 3MP1A 1IIWA 2HZKA 2V3UA 3PPPA 1MH3A 1SVXB 3TQWA 5H8NA 2M8CA 4DXCA 4BDOA 5TP9A 2Q8JA 1UTBA 3U8QA 2QS3A 4RK9A 4NF6B 4OERA 1M5EA 4OMBA 1B3HA 3FV2A 1H76A 3R6UA 1MG1A 2QRYA 4JBZA 4LUBA 3K6UA 1NNFA 4F1VA 3E9XA 5DT6A 4UACA 3MP6A 4G77A 4IO3A 1A40A 4KYSA 3HN0A 2ZYOA 4PQJA 3S9EA 2ABHA 3MW0A 1A8FA 4OESA 4R74A 2OK2A 4P0GA 2I49A 4WEDA 3PGFA 4MH5A 3IL1B 4ZEBA 1PB7A 3FVNA 4DCYA 3HHGA 2E1SA 1QW0A 1USYH 1FW0A 1MDP1 2DWJA 4F3PA 5I84A 3T9VA 3A3UA 3IO4A 4KCDA 5B70A 2BJJX 3TCFA 4DXUA 3KN3A 4JWYA 5F7VA 4TLLB 4XTCQ 3DLNA 4ZZEA 1WVJA 2VHAA 4ZEKA 5DVIA 3B6TA 1Y9UA 1HSLA 4RJZA 1S50A 4EQBA 1MY2A 1Q1KA 4MFIA 4U4SA 1JQFA 4FEDA 3H7MA 3VV5A 4U4XA 2OLBA 2RC7A 1DPEA 1YPNA 3IOTA 1PBPA 2REGA 2XXHA 3MJNA 5I56A 4X1BA 3OEKA 1VFDA 4FEBA 4X9TA 1US4A 3SEWA 4H0WA 3EHTA 1MXZA 2DVZA 3QUFA 4EXLA 1BIYA 2Z8DA 3TZAA 2PT2A 1RYXA 4NE4A 4PFTA 1B40A 1ANFA 2F6GA 1M5CA 5IAIA 3H6WA 1QKAA 2RC8A 3HPIA 2AL5A 1B3LA 3UK4A 3RN8A 3D4CA 5CMBA 1POY1 1BTJA 1OQHA 5FHMA 2XX7A 3CSBA 5H8HA 4R6KA 2UVGA 2QL3A 3Q29A 1B3GA 1B5IA 1MH4A 1MQIA 1BLFA 2VD2A 3FXUA 3MVYA 3EQ1A 2WKYA 4KCCA 5JEIA 2PVUA 2A5SA 4G2ZA 1OIBA 2ZNSA 2IEEA 1MXVA 4ZEFA 4MLQA 4FE8A 2OBGA 2XD2A 5CMCA 1QULA 1NNTA 4I62A 4F1UA 3SESA 3IOVA 1SDXA 5F1QA 3CSGA 3FUZA 3OSRA 3FJGA 3K1NA 2Y7RA 4BLAA 4H8IA 1QKBA 3G7WA 4LZ8A 3VLUA 1IUDA 4QF9A 3KN8A 1SW2A 3OO8A 2X26A 1MXUA 3G3HA 3KGCA 3QIMA 1LFIA 2Y7WA 3E4RA 1QUKA 1FQFA 5CM6A 2RC9A 3TTLA 3EPEA 3PPOA 4U1OA 1LAHE 1JEUA 4FATA 2QS4A 3S9LC 3I6VA 1OMPA 4GL8A 3U72A 4NWCA 1GTKA 2Q2AA 1B4ZA 3B6QA 4QRZA 2R71A 1I6QA 3U1OA 3G3KA 3T9HB 3ZS6A 3SEYA 3TELA 1LFHA 2UYFA 3VVFA 5H8NB 4YMBA 4HS7A 4FIMA 5EHMA 5DEXA 4F1YA 2KLFA 2RINA 1NNKA 1JVYA 5KDTA 3PUYE 1P1WA 1ZU0A 4LQ5A 4YKPA 4JSOA 4OEUA 3TYHA 3USDA 1R1NA 1R9LA 1ZBMA 1YTVA 2RKMA 4NMYA 4ND9A 3BFTA 1WDNA 2O1MA 1M5BA 2H98A 3L6HA 1LLSA 3CI8A 5I58A 2F7BA 3V5AA 1B7HA 5I2KB 3WAEA 4OWDA 3PMXA 2H9BA 4RK2A 4G68C 4DDDA 3TAJA 1B52A 2DWIA 4C1TA 2ONRA 2V25A 4IY6A 4F3SA 1MXWA 2Z8FA 4M4GA 4G8MA 1KWHA 2FYIA 4PE5B 4ISUA 1B9JA 2UYEA 5I2NB 5AA2D 4R9FA 4ZE9A 1LB8A 3LSLA 1Y4CA 2DWHA 3KSJA 1EZOA 3T93B 2OWTA 3B7DA 5HM4B 1WODA 3O28A 1JVXA 4ZECA 2THIA 1D4NA 4IO2A 1QVSA 5AA2A 3RGYA 1B05A 5AA3A 2AIXA 1H43A 5ISUA 1UIVA 1SI0A 3VFJA 4YKKA 3V8XB 2DE3A 5ICQA 1TFAA 4EQ9A 2B65A 1AOVA 1FQEA 3QSLA 1UTHB 3N6TA 1Y1ZA 1B1HA 4YB6A 5A5XA 2QS2A 5I56B 3H06B 1Z7ME 1AH5A 3M3KA 5ITPA 1D3KA 4U2RA 3O66A 4NF5A 3SKPA 4L17A 2H25A 3N6UA 2DOJA 2B3BA 4AQ4A 3C35A 1N3XA 3UA8A 2XXUA 3OEMA 3UN6A 1TT1A 4DXBA 1FTMA 1PBQA 1SW5A 3VVDA 1RYOA 2UVIA 1XT8A 1IITA 2H5YA 3TDJA 1A54A 5I59A 4EF2A 4ZZAA 1HSJA 1H3DA 4THIA 2HXWA 1H45A 5H8FB 1XVYA 4AB6A 1LAXA 3PPNA 1P1OA 2G93A 4BDRA 2QSXA 4YKJA 4OETA 5DVFA 2F7CA 4YICA 4EF1A 1P1NA 5JK4A 4LP2B 4F2QA 2V93A 3RT6B 3IOUA 3O6IA 4POWA 4IGRA 1S9TA 4LONB 2D21A 1J1NA 2NXOA 2IA4A 3LSWA 3IJXB 2HZLA 3KEIA 2QS1A 5TPAA 3C31A 3HHFA 3UIFA 3S9NC 3RT8A 1SW4A 3G3FA 3H3GA 3T22A 4QHQA 2I4CA 4RA1A 4RXLA 3TODA 4ELOA 1AMFA 4OEVA 1MRPA 1M5FA 1MDQA 2QMWA 3THIA 4NEDA 2HEUA 1M5DA 4GOTA 3CIJA 1NH7A 3TQLA 3M8UA 3KG2A 2F34A 2ZNUA 4NF8A 1IZ1A 3IB1A 4ELPA 3K0VA 3QYTA 2XXXA 1FQBA 3PMVA 1LSTA 1UIUA 3CG3A 4ZDMA 3MVZA 1MQHA 1IXHA 3K1PA 3IB2A 5I57B 4YMAA 3TEPA 3EHUA 1MY0A 3UORA 2F7AA 3FJ7A 4O3AA 5TU0A 4RPOA 1I69A 3JZJA 3DP6A 1NL5A 3RNNA 4R73A 2Q2CA 2D3IA 1JW5A 4LVQA 3MPKA 3ONMA 1P99A 1PB9A 2F97A 1FCKA 4G68A 3MVWA 1P1QA 5EYFA 2Y7IA 1DTZA 2UVHA 4R9GA 1ZTYA 2FNCA 3IAZA 4HCWA 4OXVA 4WXJA 1YAEA 5H8QA 3FGSA 5KCJB 2DS9A 3C4MA 1T0KA 2VD3A 4YAHX 5DVJA 3K2DA 4QFKA 3O6GA 3MZ1A 2I3WA 2O51A 1USYE 5L9MA 2VOZA 3AXFA 3TTNA 1LBBA 3PV0E 3OO7A 3N5LA 2ZYNA 4F3BA 5LOMA 4U22A 2AYSA 1URSA 4H65A 1FTLA 1Y20A 1GGGA 4GXAA 3PUVE 3V83A 4DZ1A 2DP8A 4GF8A 3E13X 3HSTA 1B0LA 3GBBA 3OMBA 1SQYA 1B7ZA 1ATGA 4KYDA 4F22A 4G4PA 4G8HA 3IORA 1R9QA 1Z7NE 3IOWA 4NF4B 3K02A 2V84A 3PD8A 2QPQA 3PUXE 1F9BA 2ESNA 5BUUA 1DTGA 4PFYA 5AA4A 1UQWA 4BDLA 1FQAA 2DXYA 4GFRA 1PEBA 2XXYA 2I3VA 4GD5A 5JTYA 2OZZA 4U1ZA 2XXWA 3FV1A 1LFGA 2REJA 1A8EA 3O6HA 3IX1A 2V3TA 3TUSA 3TCGA 4H1XA 3H6TA 1BKAA 3KJ7A 2HQ0A 3C9HA 1MY3A 3ECRA 3T66A 3PU5A 1II5A 4QFNA 2Q89A 2Q88A 4QSEA 1EU8A 3SEXA 4F39A 3FVGA 4OTEA 5DYHA 3I5OA 2XXVA 4N6PA 4IO6A 2GRVA 2CZLA 5J1DA 3TTKA 3VLVA 2DYXA 3EN3A 4NF6A 1I6AA 1O63A 4OVJA 1N3WA 5TP9B 1UTBB 4Q5TA 1CE2A 3ZKKA 4Z0IA 3OO6A 1MY1A 2G29A 3E3KA 2Z23A 3I3VA 4FECA 3K01A 2AL4A 3N26A 4BDNA 4P0IA 3TCHA 4KYEA 3LBSA 4Q30B 4PFUA 1SW1A 3C36A 2PT1A 4I9DA 2HAVA 5K2XA 4E0XA 2GFEA 4I1DA 1FTJA 5K2YA 4XKPA 2ZMBA 3PPRA 3C34A 3T9UA 1N04A 4OENA 3ODBA 2NWJA 4LQ2A 1FTOA 4IO7A 4O3BA 3R7XA 4QSDA 3Q25A 1VE4A 4U21A 1B7UA 1OQGA 3P7IA 1FQCA 1ZJLA 1ZKBA 1GVCA 3Q26A 4F19A 3K6VA 4YKIA 2F36A 1ZMGA 2NVUB 3PMWA 3RY3A 3CG1A 2F6PA 1B4HA 4X48A 5FHNA 2R6GE 3SETA 4ESWA 4P11A 3CVGA 3GBAA 2V3QA 3S2VA 4RY1A 3LR1A 3T96B 3TPAA 4GIZA 5HPQA 1JEVA 1SBPA 2OWSA 3TFLA 3OENA 3KFMA 1TXFA 2I0BA 2DQVA 1GV8A 2DE4A 4QFLA 2F35A 2O7UA 2GH9A 3H6UA 1SD3A 1VR5A 1XVXA 4YB5A 3FJMA 3QUJA 1HSEA 4IO4A 4TQUQ 4DLDA 2F78A 1JETA 1B3FA 4QFOA 4ZEDA 1NNPA 2HAUA 1Y3PA 2F8DA 3VXBA 5H8HB 2Y7KA 2HCAA 2UXAA 2E0SA 3VE1B 4GQOA 3MVXA 4ONYA 3CFXA 1N84A 2NUVA 4H6DA 4KHZE 2B3FA 2DSFA 1GR2A 3C32A 3PPQA 5B7DA 1DMBA 5AE4A 3B6WA 3A3CA 1NKXA 4F31B 1B0HA 3G3JA 3ILUB 3CR9A 1MXXA 4F29A 4OQOA 5ELVA 4IY5A 4XKQA 3WAFA 2I58A 1NMUA 3CRBA 3FD3A 4KPTA 3W9WA 3RTWB 1SYIA 4UA8A 3T9XB 4DCXA 5KZTA 5HBCA 1XHYA 1EZ9A 3PUWE 1TFDA 4R72A 1B51A 3U94A 2ALUA 4POXA 2NOOA 3K4UA 2H99A 4E0WA 3EF7A 3IJOB 3K6XA 3UP9A 2HFBA 4LZ5A 3FASA 2P0SA 3OOAA 4ZS9A 1N7XA 3HCQA 1N76A 2YPNA 3FVOA 1A7LA 2O84X 4K3FA 2XXPA 3N94A 5FTIA 4M1VA 1L5TA 4KQPA 3S9MC 5L9OA 4RYAA 3RTFB 1DPPA 3O2AA 4Q8RA 3G3IA 3R26A 3GZGA 2I4BA 3UGWA 5DEXB 4TOZA 3L6GA 1OLCA 4XIGQ 2O7IA 3LSFB 5KDTB 3FIRA 5FTHA 3DP4A 4GVOA 4I8CA 1N0TA 1POTA 4JSDA 4R6HA 3QK6A 2OJTA 1PB8A 1YCJA 3VXCA 2ZNTA 2GHAA 5I2KA 4PFWA 5L8DA 1URDA 4EXKA 2I48A 1QJMA 5I58B 2D5WA 3HV1A 2I0CA 4MLVA 3H6VA 3TTRA 3ZSFA 1MQDA 1H44A 4H67A 5CC2A 4OFOA 5CMMA 3MP8A 3KBRA
chains in the Genus database with same CATH superfamily
4H5FA 1VSOA 4OVQA 4JWXA 3C33A 3MPLA 4AB5A 4LATA 5I2NA 5EQ7A 1Y4TA 1MPDA 4IB2A 1IQ7A 1B46A 4NTLA 4HXVA 4YB7A 4N6KA 4Z7EA 3CFLA 4F18A 2ZXTA 4NQ8A 1KA0A 1URGA 2R9JA 3BIGA 4KFQA 4O94A 4TLMB 5CBRA 4BDQA 1B3EA 1RDZA 3M3LA 5ICTA 4FJPA 1LGBC 2XX8A 2XD3A 4P1LA 1A99A 5AA2B 5DTBA 1B1XA 2GHBA 5BWJA 5EHSA 4RPNA 2F5XA 2CMOA 2WYKA 3FVKA 1UTHA 4XFEA 1SI1A 2RCAA 3KOSA 1MPCA 2O69A 4OYVA 4OHNA 4GL0A 1O7TA 4YU0A 5A5XB 1FPDA 4PTKA 4XXUA 3FXRA 4JDFA 1Q35A 3KC1A 1JW4A 4G8NA 3FATA 3KSXA 1RKMA 3W9VA 3Q28A 4NF5B 4GWOA 1CNQA 2W7YA 2XX9A 2A5TA 3LSXA 3MZ9A 1G0HA 4N8GA 5FHOA 4LA9A 4PF8A 1LB9A 2O68A 5CMKA 1MM7A 3MZBA 3LC8A 1QUIA 4DI3D 4LZ7A 2ONSA 1A55A 3JYRA 1B5HA 3LUYA 1FPBA 3S4UA 1XS5A 3TKDA 3PD9A 5M2VA 3KZGA 3KBZA 5H8FA 2VT5A 5CBSA 4BDMA 1XOCA 5EQ8A 5I59B 1MS7A 2YJPA 3MC2A 4MCOA 4U23A 3MYUA 5AA1A 3FXQA 1D9QA 2XHDA 2PMSA 2VP1A 2QVRA 1LCTA 3EHSA 1YXIA 1B6HA 1MY4A 1NUYA 1EZPA 1FTKA 1SYHA 2ZZXA 3OSQA 1FJ9A 3RPWA 1N7WA 1AIVA 5CRYA 3DELB 3JV9A 4FORA 1MXYA 2ONKE 2DE2A 1I6BA 3A29A 2UVJA 4IR8A 4QSCA 4MMPA 1NUZA 5ET5A 1JNFA 1BP5A 5TPAB 3ZKLA 4X8RA 1IXGA 1VFEA 1PC3A 3MQ9A 1MQJA 1Y3QA 3K1MA 1DSNA 3DM0A 4R6YA 3IK6B 4OANA 1B58A 1QUJA 4OFJA 1XI6A 4QBAA 4X1DA 3QXMA 4FAJA 4PP0A 4MX6A 1IMEA 3U93A 1IMCA 2XXRA 1EYJA 4KR5A 3IR1A 5IM2A 1JW1A 4X04A 4NAPA 3SEUA 1NUXA 3K00A 2ZYMA 3B8BA 3MBPA 2RF1A 3KJTA 4GLIA 2I6EA 4HW8A 3H03A 4NF8B 4ZEIA 4XKRA 1B32A 3PUZE 1NV3A 4ZE8A 3RQTA 3OXNA 3GLBA 4C0RA 2L5VA 5I57A 4HTGA 3VVEA 3OO9A 4YZZA 1NV2A 3OELA 2H4IA 1EH3A 4WEPA 2X7QA 3VLWA 4DIGA 1R6ZA 4XKNA 2VGQA 1PDAA 1NH8A 3KOTA 4OZ9A 4ELQA 1IEJA 5IKBA 3GXAA 1LCFA 2QMXA 4N81A 2RCBA 4P9KA 4F2OA 1MM6A 5CI5A 3D4GA 3H4ZA 4G61A 3IO6A 1XC1A 3OD7A 4G68B 2ANJA 1BK4A 2FA7A 4OFLA 4ELRA 3MAMA 1ZLQA 2V4CA 3VDFA 4O7IA 3U92A 4HE0A 3CFZA 1ELJA 1NFTA 1KA1A 3SDFA 3M3FA 4EDPA 2CZIA 5KCJA 5EYGA 2YLNA 4GWSA 2Z8EA 3BKIB 2P2AA 4P47A 4IGTA 5L9SA 4QFPA 1DK4A 2Q8MA 1OVTA 3F11A 5H8QB 4DE8A 4F3GA 3SEVA 2P1SA 3ROJA 1LAGE 1FQDA 1MPBA 5H8SA 1LAFE 3CHGA 4JWOA 1US5A 1B5JA 3IB0A 3TTMA 2XXQA 4Q0CA 2PYYA 4PETA 1OLAA 1CB6A 4H5GA 3O97A 3FZVA 2DWAA 1B2HA 1TWYA 3ILTB 3RLFE 3BFUA 4O3CA 1RDXA 4EUOA 1DOTA 2DVCA 4RNSA 2HPGA 4KD5A 1ZIUA 4JXIA 2O1LA 4R2FA 1MQGA 3DP8A 2LAOA 3U65A 2A5TB 4N07A 1AL3A 4WKMA 1D9VA 3MWBA 1Y3NA 4NF4A 3G3GA 5LTCA 2ZYKA 3TMGA 4R2BA 2DXRA 4H8JA 1LBCA 4IO5A 2Y7PA 3BBRA 1P1UA 4P8BA 4R75A 3Q27A 3QAXA 2X7PA 3MUQA 3K6WA 2Q9TA 3O9PA 3KN7A 4JVCA 1IXCA 1D9YA 2O6AA 1S7YA 2XXIA 4MF3A 5AA4B 3V89B 2XXTA 2Z22A 4MBPA 4ESXA 3RUMA 4JB7A 1OVBA 3O29A 3SERA 5ITOA 1LBYA 5JTYB 4N13A 4EQ7A 1O64A 2PX1A 4PF6A 4GXSB 2PBWA 1Y1MA 2QJEA 1G0IA 2Y84A 2OCUA 4PBHA 4NWDA 1IXIA 4C1UA 3W15C 4HCYA 2FIEA 4OVPA 1NV7A 4GWUA 2F3BA 4GRKA 4ECFA 2WBBA 3HO7A 3NOHA 4KI0E 3A09A 3MP1A 3B50A 1IIWA 2HZKA 2V3UA 3PPPA 1MH3A 1SVXB 3TQWA 4O7MA 1NV1A 5H8NA 2M8CA 4DXCA 4BDOA 5TP9A 1QGXA 1UTBA 2Q8JA 2HXRA 2KR0A 3U8QA 2QS3A 4RK9A 4NF6B 4PAFA 4OERA 1M5EA 4OMBA 1B3HA 3FV2A 1H76A 3R6UA 1MG1A 2PFYA 2QRYA 4JBZA 1FBGA 4LUBA 3K6UA 1NNFA 4F1VA 3E9XA 5DT6A 4UACA 3MP6A 4G77A 4IO3A 1A40A 1KZ8A 4KYSA 3HN0A 5IZ3B 2ZYOA 4PQJA 3S9EA 2ABHA 3MW0A 1FBFA 1A8FA 4OESA 4I3YA 4R74A 2OK2A 4P0GA 2I49A 4WEDA 3PGFA 4MH5A 3IL1B 4ZEBA 1PB7A 3FVNA 1IMDA 4DCYA 3HHGA 2E1SA 1QW0A 1USYH 1FW0A 1MDP1 2DWJA 4F3PA 5I84A 3T9VA 3A3UA 3IO4A 4KCDA 2MKZA 5B70A 2BJJX 3TCFA 4DXUA 3KN3A 4JWYA 5F7VA 4TLLB 4XTCQ 3DLNA 4ZZEA 1WVJA 2VHAA 4ZEKA 5DVIA 3B6TA 1Y9UA 1HSLA 2P3VA 4RJZA 4JVDA 1S50A 4EQBA 1MY2A 1Q1KA 4PE3A 4MFIA 4U4SA 1JQFA 4FEDA 3H7MA 3VV5A 4U4XA 5ET6A 2QFLA 2OLBA 2RC7A 1DPEA 1YPNA 3IOTA 4NG7A 1PBPA 2REGA 2XXHA 3MJNA 5I56A 4X1BA 3OEKA 1VFDA 4FEBA 4X9TA 1US4A 3SEWA 4H0WA 3EHTA 1MXZA 2DVZA 3QUFA 4EXLA 1BIYA 2Z8DA 3TZAA 2PT2A 1RYXA 4NE4A 5LDZA 4PFTA 1B40A 1ANFA 2F6GA 1M5CA 5IAIA 3H6WA 4I3EA 1QKAA 2RC8A 2WBDA 3HPIA 2AL5A 1B3LA 3UK4A 3RN8A 1LBXA 2JJKA 3D4CA 5CMBA 1POY1 1BTJA 1OQHA 5FHMA 2XX7A 3CSBA 5H8HA 1NV0A 4R6KA 3FBPA 2UVGA 3RPLA 2QL3A 3Q29A 1B3GA 1B5IA 1MH4A 1MQIA 1BLFA 2VD2A 3RYDA 3FXUA 3QMFA 1DBZA 3MVYA 3EQ1A 4GWZA 2WKYA 4KCCA 5JEIA 2CZKA 2PVUA 2A5SA 1FJ6A 4G2ZA 1OIBA 4PGNA 2ZNSA 2IEEA 1MXVA 4ZEFA 4MLQA 4FE8A 2OBGA 2XD2A 5CMCA 1QULA 1FPFA 1NNTA 4I62A 4F1UA 3SESA 3IOVA 1SDXA 5F1QA 3CSGA 3FUZA 3OSRA 3FJGA 3K1NA 2Y7RA 4BLAA 4H8IA 1QKBA 3G7WA 4LZ8A 3VLUA 1IUDA 1FBEA 4QF9A 5DW8A 3KN8A 1SW2A 3OO8A 2X26A 1MXUA 3G3HA 3KGCA 2XWIA 3QIMA 1LFIA 4GWYA 2Y7WA 3E4RA 1QUKA 5I7IA 1FQFA 5CM6A 1NV5A 3T0JA 4NF0A 2RC9A 3TTLA 3EPEA 3PPOA 4U1OA 1LAHE 5T3JA 1YYZA 2WX9A 1JEUA 4FATA 4GX4A 2QS4A 3S9LC 3I6VA 1OMPA 4GL8A 3U72A 4NWCA 1GTKA 2Q2AA 1B4ZA 4MHFA 3B6QA 4QRZA 2R71A 1I6QA 3U1OA 3G3KA 2KQZA 3T9HB 3SEYA 3ZS6A 3TELA 1LFHA 1K9ZA 2UYFA 2Y5LA 3VVFA 5H8NB 4HS7A 4YMBA 4FIMA 5EHMA 5DEXA 4F1YA 2KLFA 2RINA 1NNKA 1JVYA 5KDTA 3PUYE 1P1WA 1ZU0A 4GBVA 4LQ5A 4YKPA 4JSOA 4N4UA 4OEUA 1IMFA 3TYHA 3USDA 1R1NA 1R9LA 1ZBMA 1YTVA 4HE2A 2RKMA 4NMYA 2WYPA 4ND9A 3BFTA 4P3LA 1WDNA 2O1MA 1M5BA 2H98A 3L6HA 1LLSA 3CI8A 5IGAA 5I58A 2F7BA 3V5AA 1B7HA 5I2KB 3WAEA 4OWDA 3PMXA 4NX1A 2H9BA 4RK2A 4G68C 4DDDA 3TAJA 4PCDA 4P1EA 2FHYA 1B52A 2DWIA 4C1TA 2ONRA 2V25A 3FXBA 4IY6A 4F3SA 1MXWA 2Z8FA 4M4GA 4G8MA 1NV6A 1KWHA 2CEYA 2FYIA 4PE5B 4ISUA 1B9JA 2UYEA 5I2NB 5AA2D 4R9FA 4ZE9A 3D1RA 1LB8A 3LSLA 1Y4CA 2DWHA 1FPIA 4NHBA 3KSJA 1EZOA 3T93B 2OWTA 3B7DA 5HM4B 4AS4A 1WODA 3O28A 4PBQA 1JVXA 4ZECA 2THIA 2XWVA 1D4NA 4IO2A 1QVSA 5AA2A 3RGYA 1B05A 5AA3A 2AIXA 2FVZA 1H43A 5ISUA 1IMBA 1UIVA 1SI0A 3VFJA 4YKKA 2F3DA 3V8XB 2DE3A 1DCUA 5ICQA 1TFAA 4EQ9A 5EYHA 2B65A 1AOVA 1FQEA 3QSLA 1UTHB 3N6TA 1Y1ZA 1B1HA 4YB6A 5I5PA 5A5XA 2QS2A 1INPA 5I56B 3H06B 1Z7ME 4PAKA 4DI4B 1AH5A 3M3KA 5ITPA 1D3KA 4U2RA 3O66A 4NF5A 3KC0A 4KXPA 3SKPA 4L17A 2H25A 3N6UA 2DOJA 2B3BA 4AQ4A 3C35A 1N3XA 3UA8A 1SPIA 2XXUA 3OEMA 2XA5A 3UN6A 1TT1A 4DXBA 1FTMA 1PBQA 1SW5A 3VVDA 1RYOA 2WEFA 2B4LA 2QVUA 2UVIA 2OX3A 1XT8A 1IITA 2H5YA 3TDJA 1A54A 5I59A 4EF2A 4ZZAA 1HSJA 1H3DA 4THIA 2HXWA 1H45A 5H8FB 1XVYA 5ESYA 1LAXA 4AB6A 5J16A 3PPNA 1P1OA 2G93A 4BDRA 2QSXA 4YKJA 4QXDA 4OETA 5DVFA 2F7CA 4YICA 4EF1A 1P1NA 4PFBA 2R8TA 3MSTA 5JK4A 4LP2B 4F2QA 2V93A 3RT6B 4H46A 3IOUA 3O6IA 4POWA 4IGRA 1S9TA 4LONB 2D21A 1J1NA 2NXOA 2IA4A 4O8MA 3LSWA 3IJXB 2HZLA 3KEIA 2QS1A 5TPAA 3ISPA 3C31A 3HHFA 3UIFA 3S9NC 3RT8A 1SW4A 2HHMA 3G3FA 3LV0A 3H3GA 3T22A 4QHQA 2I4CA 4N17A 4RA1A 4RXLA 3TODA 4ELOA 1AMFA 4OEVA 1MRPA 1M5FA 1MDQA 2QMWA 3THIA 4NEDA 2HEUA 1M5DA 4GOTA 3CIJA 4PC9A 1NH7A 4FBPA 3TQLA 4GWWA 3M8UA 3KG2A 3HFUA 1K9YA 2F34A 2ZNUA 4NF8A 4MNIA 1IZ1A 4OVTA 3IB1A 4ELPA 3K0VA 3QYTA 2XXXA 1FQBA 2GQ1A 3EKIA 4XF5A 3PMVA 1LSTA 1UIUA 3CG3A 4ZDMA 1FPJA 1LBWA 3MVZA 1MQHA 3T1BA 1IXHA 3K1PA 3IB2A 5I57B 4I40A 4YMAA 3TEPA 3EHUA 1MY0A 4N91A 3UORA 2F7AA 3FJ7A 4O3AA 5IZZA 5TU0A 4RPOA 1I69A 3JZJA 1FRPA 3DP6A 1NL5A 4MNCA 3RNNA 1EYKA 4R73A 2Q2CA 2D3IA 1JW5A 4LVQA 3MPKA 3ONMA 5IZ1A 1P99A 1PB9A 2F97A 1FCKA 4G68A 3MVWA 1P1QA 4OVRA 5EYFA 5ET8A 2Y7IA 1DTZA 2UVHA 2OWZA 4R9GA 1ZTYA 2FNCA 3IAZA 4PDDA 4HCWA 4OXVA 4WXJA 1YAEA 5H8QA 3FGSA 5KCJB 3LUZA 2DS9A 3C4MA 3GYYA 1T0KA 2VD3A 1FBCA 4PFIA 4YAHX 5DVJA 3K2DA 4QFKA 3O6GA 3MZ1A 2I3WA 2O51A 1USYE 5L9MA 2VOZA 3AXFA 1JP4A 3TTNA 2XXKA 1LBBA 3PV0E 3OO7A 3N5LA 2ZYNA 4F3BA 4PGPA 5LOMA 4U22A 2FIXA 2AYSA 3PTYA 1URSA 1AWBA 4H65A 1FTLA 1Y20A 1GGGA 4GXAA 3PUVE 1FTAA 3V83A 4DZ1A 2BJIA 2DP8A 4GF8A 5I3SA 3E13X 4MNPA 3HSTA 4PFRA 1B0LA 3SZPA 2Y5KA 3GBBA 3OMBA 1SQYA 2XWKA 1B7ZA 1ATGA 3BIHA 4KYDA 4F22A 4G4PA 5EQ9A 4G8HA 2PCRA 3IORA 1R9QA 1Z7NE 3IOWA 2VPNA 4NF4B 1LBVA 1RDYA 3K02A 2V84A 3PD8A 2QPQA 3PUXE 1F9BA 2ESNA 5BUUA 1DTGA 4PFYA 5AA4A 1UQWA 4BDLA 1FQAA 2DXYA 4GFRA 1PEBA 2XXYA 2I3VA 4GD5A 5JTYA 2OZZA 4U1ZA 5ET7A 2XXWA 3FV1A 1LFGA 2REJA 1A8EA 3O6HA 3IX1A 2V3TA 3TUSA 3TCGA 4H1XA 3H6TA 1BKAA 3KJ7A 2HQ0A 3C9HA 1MY3A 3ECRA 3T66A 3PU5A 1II5A 4QFNA 2Q89A 2Q88A 4LN5A 4QSEA 1EU8A 4MEVA 3SEXA 4F39A 3FVGA 4OTEA 5DYHA 3I5OA 2XXVA 4N6PA 4IO6A 2GRVA 2CZLA 5J1DA 3TTKA 4N6DA 5EQAA 3VLVA 2DYXA 3EN3A 4NF6A 1I6AA 1O63A 5A5LA 4OVJA 1N3WA 2Q74A 2VPOA 5TP9B 4MJOA 1UTBB 4Q5TA 1CE2A 3ZKKA 4Z0IA 3OO6A 1MY1A 2G29A 3E3KA 2Z23A 3I3VA 4FECA 3K01A 2AL4A 3N26A 4BDNA 1FPKA 4P0IA 3TCHA 1FBDA 4KYEA 3LBSA 4Q30B 4PFUA 1SW1A 2ZZWA 5IZ3A 2DDKA 3C36A 2PT1A 4I9DA 2HAVA 2B4MA 5K2XA 4E0XA 2GFEA 1EYIA 4I1DA 1FTJA 1FPLA 4H45A 5K2YA 4XKPA 1YZ0A 2ZMBA 3PPRA 3C34A 3T9UA 2XWOA 1N04A 1LBZA 2P3NA 3IFCA 4OENA 3ODBA 2NWJA 4LQ2A 1FTOA 4IO7A 4O3BA 3R7XA 4QSDA 3Q25A 2PFZA 1VE4A 4U21A 1B7UA 1OQGA 3P7IA 1FQCA 1ZJLA 4NN3A 2CZHA 1ZKBA 3E78A 1GVCA 3Q26A 4F19A 3K6VA 2CEXA 4YKIA 2F36A 1ZMGA 2NVUB 3PMWA 3RY3A 3CG1A 4MAGA 4P56A 2F6PA 1B4HA 4UABA 4X48A 5FHNA 2R6GE 3SETA 4N8YA 1VDWA 4ESWA 4P11A 3CVGA 3GBAA 2V3QA 3S2VA 4RY1A 5F24A 3LR1A 3T96B 3TPAA 4GIZA 5HPQA 1JEVA 1SBPA 2OWSA 3TFLA 3IFAA 3OENA 3KFMA 1TXFA 2I0BA 2DQVA 1GV8A 2DE4A 4QFLA 2F35A 2O7UA 2GH9A 3H6UA 4AS5A 1LEVA 1FPGA 1SD3A 1VR5A 1XVXA 4YB5A 3FJMA 3QUJA 1HSEA 4IO4A 4TQUQ 4DLDA 2F78A 1JETA 1B3FA 4QFOA 4ZEDA 1NNPA 2HAUA 1Y3PA 2F8DA 3VXBA 5H8HB 2Y7KA 3RPLB 2HCAA 2UXAA 1FSAA 2FBPA 2ZZVA 2E0SA 3VE1B 4GQOA 3MVXA 4ONYA 3CFXA 4PAIA 1N84A 2NUVA 1FBHA 4H6DA 4KHZE 2QVVA 2B3FA 4PDHA 2DSFA 1GR2A 3C32A 3PPQA 5B7DA 1DMBA 5AE4A 4GBWA 3B6WA 3A3CA 1NKXA 4F31B 1B0HA 3G3JA 3ILUB 3CR9A 1MXXA 4F29A 4OQOA 4GX6A 5ELVA 4IY5A 4XKQA 3WAFA 2I58A 1NMUA 3CRBA 3FD3A 4KPTA 1IMAA 3W9WA 3RTWB 1SYIA 1FPEA 4UA8A 3T9XB 4DCXA 5KZTA 5HBCA 1XHYA 1EZ9A 3PUWE 1TFDA 4R72A 4OVSA 1Q9DA 1B51A 3U94A 2ALUA 4POXA 2NOOA 3K4UA 2H99A 4E0WA 3EF7A 3IJOB 3K6XA 1NV4A 3UP9A 2HFBA 4LZ5A 1NI9A 3FASA 4HE1A 2P0SA 1NUWA 3OOAA 4ZS9A 1N7XA 3HCQA 1N76A 2YPNA 4N15A 3FVOA 1A7LA 2O84X 4K3FA 2XXPA 3N94A 5FTIA 4JVIA 4M1VA 1L5TA 4KQPA 3S9MC 5L9OA 4RYAA 4XEQA 1DPPA 3RTFB 3O2AA 4Q8RA 3G3IA 3R26A 3GZGA 2I4BA 3UGWA 5DEXB 4TOZA 3E79A 3L6GA 1OLCA 4XIGQ 2O7IA 3LSFB 4NGUA 5KDTB 3FIRA 4OA4A 1FBPA 5FTHA 3DP4A 4GVOA 4I8CA 1N0TA 1POTA 4JSDA 4R6HA 3QK6A 2OJTA 1PB8A 1YCJA 3VXCA 4MIJA 2ZNTA 2GHAA 5I2KA 4PFWA 5L8DA 1URDA 4EXKA 2I48A 1QJMA 4GWXA 5I58B 2D5WA 3HV1A 2I0CA 4MLVA 3H6VA 3TTRA 3ZSFA 1MQDA 5FBPA 1H44A 4H67A 5CC2A 4OFOA 5CMMA 3MP8A 3KBRA 4GX3A
chains in the Genus database with same CATH topology
4H5FA 1VSOA 4JWXA 3C33A 3MPLA 4AB5A 4LATA 5I2NA 1Y4TA 1MPDA 4IB2A 1IQ7A 1B46A 4NTLA 4YB7A 4Z7EA 3CFLA 4F18A 2ZXTA 1URGA 2R9JA 4KFQA 4TLMB 5CBRA 4BDQA 1B3EA 3M3LA 5ICTA 4FJPA 1LGBC 2XX8A 2XD3A 1A99A 5AA2B 5DTBA 1B1XA 2GHBA 5BWJA 5EHSA 4RPNA 2F5XA 2CMOA 3FVKA 1UTHA 1SI1A 2RCAA 3KOSA 1MPCA 2O69A 4OYVA 4OHNA 4GL0A 1O7TA 4YU0A 5A5XB 4XXUA 3FXRA 4JDFA 1Q35A 1JW4A 4G8NA 3FATA 3KSXA 1RKMA 3W9VA 3Q28A 4NF5B 4GWOA 2W7YA 2XX9A 2A5TA 3LSXA 3MZ9A 5FHOA 4LA9A 1LB9A 2O68A 5CMKA 1MM7A 3MZBA 3LC8A 1QUIA 4LZ7A 2ONSA 1A55A 3JYRA 1B5HA 3LUYA 3S4UA 1XS5A 3TKDA 3PD9A 5M2VA 3KZGA 5H8FA 5CBSA 4BDMA 1XOCA 5I59B 1MS7A 2YJPA 3MC2A 4U23A 5AA1A 3FXQA 2XHDA 2PMSA 2VP1A 1LCTA 3EHSA 1B6HA 1MY4A 1EZPA 1FTKA 1SYHA 3OSQA 3RPWA 1N7WA 1AIVA 5CRYA 3DELB 3JV9A 4FORA 1MXYA 2ONKE 2DE2A 1I6BA 2UVJA 4QSCA 1JNFA 1BP5A 5TPAB 3ZKLA 1IXGA 1VFEA 1PC3A 3MQ9A 1MQJA 1Y3QA 3K1MA 1DSNA 3DM0A 4R6YA 3IK6B 1B58A 1QUJA 4OFJA 4X1DA 3QXMA 4FAJA 4PP0A 3U93A 2XXRA 4KR5A 3IR1A 1JW1A 3SEUA 3K00A 2ZYMA 3MBPA 2RF1A 3KJTA 4GLIA 2I6EA 4HW8A 3H03A 4NF8B 4ZEIA 4XKRA 1B32A 3PUZE 4ZE8A 3RQTA 3OXNA 3GLBA 4C0RA 5I57A 4HTGA 3VVEA 3OO9A 4YZZA 3OELA 2H4IA 1EH3A 4WEPA 2X7QA 3VLWA 4DIGA 1R6ZA 4XKNA 2VGQA 1PDAA 1NH8A 3KOTA 4OZ9A 4ELQA 1IEJA 5IKBA 3GXAA 1LCFA 2QMXA 2RCBA 4F2OA 1MM6A 5CI5A 3D4GA 3H4ZA 3IO6A 1XC1A 3OD7A 4G68B 2ANJA 2FA7A 4OFLA 4ELRA 3MAMA 1ZLQA 3VDFA 3U92A 3CFZA 1ELJA 1NFTA 3SDFA 3M3FA 4EDPA 5KCJA 2YLNA 2Z8EA 3BKIB 2P2AA 4IGTA 5L9SA 4QFPA 1OVTA 3F11A 5H8QB 4DE8A 4F3GA 3SEVA 2P1SA 1LAGE 1FQDA 1MPBA 5H8SA 1LAFE 4JWOA 1US5A 1B5JA 3IB0A 3TTMA 2XXQA 4Q0CA 2PYYA 4PETA 1OLAA 1CB6A 4H5GA 3O97A 3FZVA 2DWAA 1B2HA 1TWYA 3ILTB 3RLFE 3BFUA 4O3CA 4EUOA 1DOTA 2DVCA 4RNSA 4KD5A 1ZIUA 4JXIA 2O1LA 4R2FA 1MQGA 3DP8A 2LAOA 2A5TB 4N07A 1AL3A 4WKMA 1D9VA 3MWBA 1Y3NA 4NF4A 3G3GA 2ZYKA 3TMGA 4R2BA 2DXRA 4H8JA 1LBCA 4IO5A 2Y7PA 3BBRA 1P1UA 4R75A 3Q27A 3QAXA 2X7PA 3MUQA 3K6WA 2Q9TA 3O9PA 3KN7A 1IXCA 1D9YA 2O6AA 1S7YA 2XXIA 4MF3A 5AA4B 3V89B 2XXTA 2Z22A 4MBPA 4ESXA 3RUMA 4JB7A 1OVBA 3O29A 3SERA 5ITOA 5JTYB 4N13A 4EQ7A 1O64A 2PX1A 4GXSB 2PBWA 1Y1MA 2QJEA 2Y84A 2OCUA 4NWDA 1IXIA 4C1UA 3W15C 4HCYA 4GRKA 4ECFA 3HO7A 4KI0E 3A09A 3MP1A 1IIWA 2HZKA 2V3UA 3PPPA 1MH3A 1SVXB 3TQWA 5H8NA 2M8CA 4DXCA 4BDOA 5TP9A 2Q8JA 1UTBA 3U8QA 2QS3A 4RK9A 4NF6B 4OERA 1M5EA 4OMBA 1B3HA 3FV2A 1H76A 3R6UA 1MG1A 2QRYA 4JBZA 4LUBA 3K6UA 1NNFA 4F1VA 3E9XA 5DT6A 4UACA 3MP6A 4G77A 4IO3A 1A40A 4KYSA 3HN0A 2ZYOA 4PQJA 3S9EA 2ABHA 3MW0A 1A8FA 4OESA 4R74A 2OK2A 4P0GA 2I49A 4WEDA 3PGFA 4MH5A 3IL1B 4ZEBA 1PB7A 3FVNA 4DCYA 3HHGA 2E1SA 1QW0A 1USYH 1FW0A 1MDP1 2DWJA 4F3PA 5I84A 3T9VA 3A3UA 3IO4A 4KCDA 5B70A 2BJJX 3TCFA 4DXUA 3KN3A 4JWYA 5F7VA 4TLLB 4XTCQ 3DLNA 4ZZEA 1WVJA 2VHAA 4ZEKA 5DVIA 3B6TA 1Y9UA 1HSLA 4RJZA 1S50A 4EQBA 1MY2A 1Q1KA 4MFIA 4U4SA 1JQFA 4FEDA 3H7MA 3VV5A 4U4XA 2OLBA 2RC7A 1DPEA 1YPNA 3IOTA 1PBPA 2REGA 2XXHA 3MJNA 5I56A 4X1BA 3OEKA 1VFDA 4FEBA 4X9TA 1US4A 3SEWA 4H0WA 3EHTA 1MXZA 2DVZA 3QUFA 4EXLA 1BIYA 2Z8DA 3TZAA 2PT2A 1RYXA 4NE4A 4PFTA 1B40A 1ANFA 2F6GA 1M5CA 5IAIA 3H6WA 1QKAA 2RC8A 3HPIA 2AL5A 1B3LA 3UK4A 3RN8A 3D4CA 5CMBA 1POY1 1BTJA 1OQHA 5FHMA 2XX7A 3CSBA 5H8HA 4R6KA 2UVGA 2QL3A 3Q29A 1B3GA 1B5IA 1MH4A 1MQIA 1BLFA 2VD2A 3FXUA 3MVYA 3EQ1A 2WKYA 4KCCA 5JEIA 2PVUA 2A5SA 4G2ZA 1OIBA 2ZNSA 2IEEA 1MXVA 4ZEFA 4MLQA 4FE8A 2OBGA 2XD2A 5CMCA 1QULA 1NNTA 4I62A 4F1UA 3SESA 3IOVA 1SDXA 5F1QA 3CSGA 3FUZA 3OSRA 3FJGA 3K1NA 2Y7RA 4BLAA 4H8IA 1QKBA 3G7WA 4LZ8A 3VLUA 1IUDA 4QF9A 3KN8A 1SW2A 3OO8A 2X26A 1MXUA 3G3HA 3KGCA 3QIMA 1LFIA 2Y7WA 3E4RA 1QUKA 1FQFA 5CM6A 2RC9A 3TTLA 3EPEA 3PPOA 4U1OA 1LAHE 1JEUA 4FATA 2QS4A 3S9LC 3I6VA 1OMPA 4GL8A 3U72A 4NWCA 1GTKA 2Q2AA 1B4ZA 3B6QA 4QRZA 2R71A 1I6QA 3U1OA 3G3KA 3T9HB 3ZS6A 3SEYA 3TELA 1LFHA 2UYFA 3VVFA 5H8NB 4YMBA 4HS7A 4FIMA 5EHMA 5DEXA 4F1YA 2KLFA 2RINA 1NNKA 1JVYA 5KDTA 3PUYE 1P1WA 1ZU0A 4LQ5A 4YKPA 4JSOA 4OEUA 3TYHA 3USDA 1R1NA 1R9LA 1ZBMA 1YTVA 2RKMA 4NMYA 4ND9A 3BFTA 1WDNA 2O1MA 1M5BA 2H98A 3L6HA 1LLSA 3CI8A 5I58A 2F7BA 3V5AA 1B7HA 5I2KB 3WAEA 4OWDA 3PMXA 2H9BA 4RK2A 4G68C 4DDDA 3TAJA 1B52A 2DWIA 4C1TA 2ONRA 2V25A 4IY6A 4F3SA 1MXWA 2Z8FA 4M4GA 4G8MA 1KWHA 2FYIA 4PE5B 4ISUA 1B9JA 2UYEA 5I2NB 5AA2D 4R9FA 4ZE9A 1LB8A 3LSLA 1Y4CA 2DWHA 3KSJA 1EZOA 3T93B 2OWTA 3B7DA 5HM4B 1WODA 3O28A 1JVXA 4ZECA 2THIA 1D4NA 4IO2A 1QVSA 5AA2A 3RGYA 1B05A 5AA3A 2AIXA 1H43A 5ISUA 1UIVA 1SI0A 3VFJA 4YKKA 3V8XB 2DE3A 5ICQA 1TFAA 4EQ9A 2B65A 1AOVA 1FQEA 3QSLA 1UTHB 3N6TA 1Y1ZA 1B1HA 4YB6A 5A5XA 2QS2A 5I56B 3H06B 1Z7ME 1AH5A 3M3KA 5ITPA 1D3KA 4U2RA 3O66A 4NF5A 3SKPA 4L17A 2H25A 3N6UA 2DOJA 2B3BA 4AQ4A 3C35A 1N3XA 3UA8A 2XXUA 3OEMA 3UN6A 1TT1A 4DXBA 1FTMA 1PBQA 1SW5A 3VVDA 1RYOA 2UVIA 1XT8A 1IITA 2H5YA 3TDJA 1A54A 5I59A 4EF2A 4ZZAA 1HSJA 1H3DA 4THIA 2HXWA 1H45A 5H8FB 1XVYA 4AB6A 1LAXA 3PPNA 1P1OA 2G93A 4BDRA 2QSXA 4YKJA 4OETA 5DVFA 2F7CA 4YICA 4EF1A 1P1NA 5JK4A 4LP2B 4F2QA 2V93A 3RT6B 3IOUA 3O6IA 4POWA 4IGRA 1S9TA 4LONB 2D21A 1J1NA 2NXOA 2IA4A 3LSWA 3IJXB 2HZLA 3KEIA 2QS1A 5TPAA 3C31A 3HHFA 3UIFA 3S9NC 3RT8A 1SW4A 3G3FA 3H3GA 3T22A 4QHQA 2I4CA 4RA1A 4RXLA 3TODA 4ELOA 1AMFA 4OEVA 1MRPA 1M5FA 1MDQA 2QMWA 3THIA 4NEDA 2HEUA 1M5DA 4GOTA 3CIJA 1NH7A 3TQLA 3M8UA 3KG2A 2F34A 2ZNUA 4NF8A 1IZ1A 3IB1A 4ELPA 3K0VA 3QYTA 2XXXA 1FQBA 3PMVA 1LSTA 1UIUA 3CG3A 4ZDMA 3MVZA 1MQHA 1IXHA 3K1PA 3IB2A 5I57B 4YMAA 3TEPA 3EHUA 1MY0A 3UORA 2F7AA 3FJ7A 4O3AA 5TU0A 4RPOA 1I69A 3JZJA 3DP6A 1NL5A 3RNNA 4R73A 2Q2CA 2D3IA 1JW5A 4LVQA 3MPKA 3ONMA 1P99A 1PB9A 2F97A 1FCKA 4G68A 3MVWA 1P1QA 5EYFA 2Y7IA 1DTZA 2UVHA 4R9GA 1ZTYA 2FNCA 3IAZA 4HCWA 4OXVA 4WXJA 1YAEA 5H8QA 3FGSA 5KCJB 2DS9A 3C4MA 1T0KA 2VD3A 4YAHX 5DVJA 3K2DA 4QFKA 3O6GA 3MZ1A 2I3WA 2O51A 1USYE 5L9MA 2VOZA 3AXFA 3TTNA 1LBBA 3PV0E 3OO7A 3N5LA 2ZYNA 4F3BA 5LOMA 4U22A 2AYSA 1URSA 4H65A 1FTLA 1Y20A 1GGGA 4GXAA 3PUVE 3V83A 4DZ1A 2DP8A 4GF8A 3E13X 3HSTA 1B0LA 3GBBA 3OMBA 1SQYA 1B7ZA 1ATGA 4KYDA 4F22A 4G4PA 4G8HA 3IORA 1R9QA 1Z7NE 3IOWA 4NF4B 3K02A 2V84A 3PD8A 2QPQA 3PUXE 1F9BA 2ESNA 5BUUA 1DTGA 4PFYA 5AA4A 1UQWA 4BDLA 1FQAA 2DXYA 4GFRA 1PEBA 2XXYA 2I3VA 4GD5A 5JTYA 2OZZA 4U1ZA 2XXWA 3FV1A 1LFGA 2REJA 1A8EA 3O6HA 3IX1A 2V3TA 3TUSA 3TCGA 4H1XA 3H6TA 1BKAA 3KJ7A 2HQ0A 3C9HA 1MY3A 3ECRA 3T66A 3PU5A 1II5A 4QFNA 2Q89A 2Q88A 4QSEA 1EU8A 3SEXA 4F39A 3FVGA 4OTEA 5DYHA 3I5OA 2XXVA 4N6PA 4IO6A 2GRVA 2CZLA 5J1DA 3TTKA 3VLVA 2DYXA 3EN3A 4NF6A 1I6AA 1O63A 4OVJA 1N3WA 5TP9B 1UTBB 4Q5TA 1CE2A 3ZKKA 4Z0IA 3OO6A 1MY1A 2G29A 3E3KA 2Z23A 3I3VA 4FECA 3K01A 2AL4A 3N26A 4BDNA 4P0IA 3TCHA 4KYEA 3LBSA 4Q30B 4PFUA 1SW1A 3C36A 2PT1A 4I9DA 2HAVA 5K2XA 4E0XA 2GFEA 4I1DA 1FTJA 5K2YA 4XKPA 2ZMBA 3PPRA 3C34A 3T9UA 1N04A 4OENA 3ODBA 2NWJA 4LQ2A 1FTOA 4IO7A 4O3BA 3R7XA 4QSDA 3Q25A 1VE4A 4U21A 1B7UA 1OQGA 3P7IA 1FQCA 1ZJLA 1ZKBA 1GVCA 3Q26A 4F19A 3K6VA 4YKIA 2F36A 1ZMGA 2NVUB 3PMWA 3RY3A 3CG1A 2F6PA 1B4HA 4X48A 5FHNA 2R6GE 3SETA 4ESWA 4P11A 3CVGA 3GBAA 2V3QA 3S2VA 4RY1A 3LR1A 3T96B 3TPAA 4GIZA 5HPQA 1JEVA 1SBPA 2OWSA 3TFLA 3OENA 3KFMA 1TXFA 2I0BA 2DQVA 1GV8A 2DE4A 4QFLA 2F35A 2O7UA 2GH9A 3H6UA 1SD3A 1VR5A 1XVXA 4YB5A 3FJMA 3QUJA 1HSEA 4IO4A 4TQUQ 4DLDA 2F78A 1JETA 1B3FA 4QFOA 4ZEDA 1NNPA 2HAUA 1Y3PA 2F8DA 3VXBA 5H8HB 2Y7KA 2HCAA 2UXAA 2E0SA 3VE1B 4GQOA 3MVXA 4ONYA 3CFXA 1N84A 2NUVA 4H6DA 4KHZE 2B3FA 2DSFA 1GR2A 3C32A 3PPQA 5B7DA 1DMBA 5AE4A 3B6WA 3A3CA 1NKXA 4F31B 1B0HA 3G3JA 3ILUB 3CR9A 1MXXA 4F29A 4OQOA 5ELVA 4IY5A 4XKQA 3WAFA 2I58A 1NMUA 3CRBA 3FD3A 4KPTA 3W9WA 3RTWB 1SYIA 4UA8A 3T9XB 4DCXA 5KZTA 5HBCA 1XHYA 1EZ9A 3PUWE 1TFDA 4R72A 1B51A 3U94A 2ALUA 4POXA 2NOOA 3K4UA 2H99A 4E0WA 3EF7A 3IJOB 3K6XA 3UP9A 2HFBA 4LZ5A 3FASA 2P0SA 3OOAA 4ZS9A 1N7XA 3HCQA 1N76A 2YPNA 3FVOA 1A7LA 2O84X 4K3FA 2XXPA 3N94A 5FTIA 4M1VA 1L5TA 4KQPA 3S9MC 5L9OA 4RYAA 3RTFB 1DPPA 3O2AA 4Q8RA 3G3IA 3R26A 3GZGA 2I4BA 3UGWA 5DEXB 4TOZA 3L6GA 1OLCA 4XIGQ 2O7IA 3LSFB 5KDTB 3FIRA 5FTHA 3DP4A 4GVOA 4I8CA 1N0TA 1POTA 4JSDA 4R6HA 3QK6A 2OJTA 1PB8A 1YCJA 3VXCA 2ZNTA 2GHAA 5I2KA 4PFWA 5L8DA 1URDA 4EXKA 2I48A 1QJMA 5I58B 2D5WA 3HV1A 2I0CA 4MLVA 3H6VA 3TTRA 3ZSFA 1MQDA 1H44A 4H67A 5CC2A 4OFOA 5CMMA 3MP8A 3KBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H5F A;  1VSO A;  4JWX A;  3C33 A;  3MPL A;  4AB5 A;  4LAT A;  5I2N A;  1Y4T A;  1MPD A;  4IB2 A;  1IQ7 A;  1B46 A;  4NTL A;  4YB7 A;  4Z7E A;  3CFL A;  4F18 A;  2ZXT A;  1URG A;  2R9J A;  4KFQ A;  4TLM B;  5CBR A;  4BDQ A;  1B3E A;  3M3L A;  5ICT A;  4FJP A;  1LGB C;  2XX8 A;  2XD3 A;  1A99 A;  5AA2 B;  5DTB A;  1B1X A;  2GHB A;  5BWJ A;  5EHS A;  4RPN A;  2F5X A;  2CMO A;  3FVK A;  1UTH A;  1SI1 A;  2RCA A;  3KOS A;  1MPC A;  2O69 A;  4OYV A;  4OHN A;  4GL0 A;  1O7T A;  4YU0 A;  5A5X B;  4XXU A;  3FXR A;  4JDF A;  1Q35 A;  1JW4 A;  4G8N A;  3FAT A;  3KSX A;  1RKM A;  3W9V A;  3Q28 A;  4NF5 B;  4GWO A;  2W7Y A;  2XX9 A;  2A5T A;  3LSX A;  3MZ9 A;  5FHO A;  4LA9 A;  1LB9 A;  2O68 A;  5CMK A;  1MM7 A;  3MZB A;  3LC8 A;  1QUI A;  4LZ7 A;  2ONS A;  1A55 A;  3JYR A;  1B5H A;  3LUY A;  3S4U A;  1XS5 A;  3TKD A;  3PD9 A;  5M2V A;  3KZG A;  5H8F A;  5CBS A;  4BDM A;  1XOC A;  5I59 B;  1MS7 A;  2YJP A;  3MC2 A;  4U23 A;  5AA1 A;  3FXQ A;  2XHD A;  2PMS A;  2VP1 A;  1LCT A;  3EHS A;  1B6H A;  1MY4 A;  1EZP A;  1FTK A;  1SYH A;  3OSQ A;  3RPW A;  1N7W A;  1AIV A;  5CRY A;  3DEL B;  3JV9 A;  4FOR A;  1MXY A;  2ONK E;  2DE2 A;  1I6B A;  2UVJ A;  4QSC A;  1JNF A;  1BP5 A;  5TPA B;  3ZKL A;  1IXG A;  1VFE A;  1PC3 A;  3MQ9 A;  1MQJ A;  1Y3Q A;  3K1M A;  1DSN A;  3DM0 A;  4R6Y A;  3IK6 B;  1B58 A;  1QUJ A;  4OFJ A;  4X1D A;  3QXM A;  4FAJ A;  4PP0 A;  3U93 A;  2XXR A;  4KR5 A;  3IR1 A;  1JW1 A;  3SEU A;  3K00 A;  2ZYM A;  3MBP A;  2RF1 A;  3KJT A;  4GLI A;  2I6E A;  4HW8 A;  3H03 A;  4NF8 B;  4ZEI A;  4XKR A;  1B32 A;  3PUZ E;  4ZE8 A;  3RQT A;  3OXN A;  3GLB A;  4C0R A;  5I57 A;  4HTG A;  3VVE A;  3OO9 A;  4YZZ A;  3OEL A;  2H4I A;  1EH3 A;  4WEP A;  2X7Q A;  3VLW A;  4DIG A;  1R6Z A;  4XKN A;  2VGQ A;  1PDA A;  1NH8 A;  3KOT A;  4OZ9 A;  4ELQ A;  1IEJ A;  5IKB A;  3GXA A;  1LCF A;  2QMX A;  2RCB A;  4F2O A;  1MM6 A;  5CI5 A;  3D4G A;  3H4Z A;  3IO6 A;  1XC1 A;  3OD7 A;  4G68 B;  2ANJ A;  2FA7 A;  4OFL A;  4ELR A;  3MAM A;  1ZLQ A;  3VDF A;  3U92 A;  3CFZ A;  1ELJ A;  1NFT A;  3SDF A;  3M3F A;  4EDP A;  5KCJ A;  2YLN A;  2Z8E A;  3BKI B;  2P2A A;  4IGT A;  5L9S A;  4QFP A;  1OVT A;  3F11 A;  5H8Q B;  4DE8 A;  4F3G A;  3SEV A;  2P1S A;  1LAG E;  1FQD A;  1MPB A;  5H8S A;  1LAF E;  4JWO A;  1US5 A;  1B5J A;  3IB0 A;  3TTM A;  2XXQ A;  4Q0C A;  2PYY A;  4PET A;  1OLA A;  1CB6 A;  4H5G A;  3O97 A;  3FZV A;  2DWA A;  1B2H A;  1TWY A;  3ILT B;  3RLF E;  3BFU A;  4O3C A;  4EUO A;  1DOT A;  2DVC A;  4RNS A;  4KD5 A;  1ZIU A;  4JXI A;  2O1L A;  4R2F A;  1MQG A;  3DP8 A;  2LAO A;  2A5T B;  4N07 A;  1AL3 A;  4WKM A;  1D9V A;  3MWB A;  1Y3N A;  4NF4 A;  3G3G A;  2ZYK A;  3TMG A;  4R2B A;  2DXR A;  4H8J A;  1LBC A;  4IO5 A;  2Y7P A;  3BBR A;  1P1U A;  4R75 A;  3Q27 A;  3QAX A;  2X7P A;  3MUQ A;  3K6W A;  2Q9T A;  3O9P A;  3KN7 A;  1IXC A;  1D9Y A;  2O6A A;  1S7Y A;  2XXI A;  4MF3 A;  5AA4 B;  3V89 B;  2XXT A;  2Z22 A;  4MBP A;  4ESX A;  3RUM A;  4JB7 A;  1OVB A;  3O29 A;  3SER A;  5ITO A;  5JTY B;  4N13 A;  4EQ7 A;  1O64 A;  2PX1 A;  4GXS B;  2PBW A;  1Y1M A;  2QJE A;  2Y84 A;  2OCU A;  4NWD A;  1IXI A;  4C1U A;  3W15 C;  4HCY A;  4GRK A;  4ECF A;  3HO7 A;  4KI0 E;  3A09 A;  3MP1 A;  1IIW A;  2HZK A;  2V3U A;  3PPP A;  1MH3 A;  1SVX B;  3TQW A;  5H8N A;  2M8C A;  4DXC A;  4BDO A;  5TP9 A;  2Q8J A;  1UTB A;  3U8Q A;  2QS3 A;  4RK9 A;  4NF6 B;  4OER A;  1M5E A;  4OMB A;  1B3H A;  3FV2 A;  1H76 A;  3R6U A;  1MG1 A;  2QRY A;  4JBZ A;  4LUB A;  3K6U A;  1NNF A;  4F1V A;  3E9X A;  5DT6 A;  4UAC A;  3MP6 A;  4G77 A;  4IO3 A;  1A40 A;  4KYS A;  3HN0 A;  2ZYO A;  4PQJ A;  3S9E A;  2ABH A;  3MW0 A;  1A8F A;  4OES A;  4R74 A;  2OK2 A;  4P0G A;  2I49 A;  4WED A;  3PGF A;  4MH5 A;  3IL1 B;  4ZEB A;  1PB7 A;  3FVN A;  4DCY A;  3HHG A;  2E1S A;  1QW0 A;  1USY H;  1FW0 A;  1MDP 1;  2DWJ A;  4F3P A;  5I84 A;  3T9V A;  3A3U A;  3IO4 A;  4KCD A;  5B70 A;  2BJJ X;  3TCF A;  4DXU A;  3KN3 A;  4JWY A;  5F7V A;  4TLL B;  4XTC Q;  3DLN A;  4ZZE A;  1WVJ A;  2VHA A;  4ZEK A;  5DVI A;  3B6T A;  1Y9U A;  1HSL A;  4RJZ A;  1S50 A;  4EQB A;  1MY2 A;  1Q1K A;  4MFI A;  4U4S A;  1JQF A;  4FED A;  3H7M A;  3VV5 A;  4U4X A;  2OLB A;  2RC7 A;  1DPE A;  1YPN A;  3IOT A;  1PBP A;  2REG A;  2XXH A;  3MJN A;  5I56 A;  4X1B A;  3OEK A;  1VFD A;  4FEB A;  4X9T A;  1US4 A;  3SEW A;  4H0W A;  3EHT A;  1MXZ A;  2DVZ A;  3QUF A;  4EXL A;  1BIY A;  2Z8D A;  3TZA A;  2PT2 A;  1RYX A;  4NE4 A;  4PFT A;  1B40 A;  1ANF A;  2F6G A;  1M5C A;  5IAI A;  3H6W A;  1QKA A;  2RC8 A;  3HPI A;  2AL5 A;  1B3L A;  3UK4 A;  3RN8 A;  3D4C A;  5CMB A;  1POY 1;  1BTJ A;  1OQH A;  5FHM A;  2XX7 A;  3CSB A;  5H8H A;  4R6K A;  2UVG A;  2QL3 A;  3Q29 A;  1B3G A;  1B5I A;  1MH4 A;  1MQI A;  1BLF A;  2VD2 A;  3FXU A;  3MVY A;  3EQ1 A;  2WKY A;  4KCC A;  5JEI A;  2PVU A;  2A5S A;  4G2Z A;  1OIB A;  2ZNS A;  2IEE A;  1MXV A;  4ZEF A;  4MLQ A;  4FE8 A;  2OBG A;  2XD2 A;  5CMC A;  1QUL A;  1NNT A;  4I62 A;  4F1U A;  3SES A;  3IOV A;  1SDX A;  5F1Q A;  3CSG A;  3FUZ A;  3OSR A;  3FJG A;  3K1N A;  2Y7R A;  4BLA A;  4H8I A;  1QKB A;  3G7W A;  4LZ8 A;  3VLU A;  1IUD A;  4QF9 A;  3KN8 A;  1SW2 A;  3OO8 A;  2X26 A;  1MXU A;  3G3H A;  3KGC A;  3QIM A;  1LFI A;  2Y7W A;  3E4R A;  1QUK A;  1FQF A;  5CM6 A;  2RC9 A;  3TTL A;  3EPE A;  3PPO A;  4U1O A;  1LAH E;  1JEU A;  4FAT A;  2QS4 A;  3S9L C;  3I6V A;  1OMP A;  4GL8 A;  3U72 A;  4NWC A;  1GTK A;  2Q2A A;  1B4Z A;  3B6Q A;  4QRZ A;  2R71 A;  1I6Q A;  3U1O A;  3G3K A;  3T9H B;  3ZS6 A;  3SEY A;  3TEL A;  1LFH A;  2UYF A;  3VVF A;  5H8N B;  4YMB A;  4HS7 A;  4FIM A;  5EHM A;  5DEX A;  4F1Y A;  2KLF A;  2RIN A;  1NNK A;  1JVY A;  5KDT A;  3PUY E;  1P1W A;  1ZU0 A;  4LQ5 A;  4YKP A;  4JSO A;  4OEU A;  3TYH A;  3USD A;  1R1N A;  1R9L A;  1ZBM A;  1YTV A;  2RKM A;  4NMY A;  4ND9 A;  3BFT A;  1WDN A;  2O1M A;  1M5B A;  2H98 A;  3L6H A;  1LLS A;  3CI8 A;  5I58 A;  2F7B A;  3V5A A;  1B7H A;  5I2K B;  3WAE A;  4OWD A;  3PMX A;  2H9B A;  4RK2 A;  4G68 C;  4DDD A;  3TAJ A;  1B52 A;  2DWI A;  4C1T A;  2ONR A;  2V25 A;  4IY6 A;  4F3S A;  1MXW A;  2Z8F A;  4M4G A;  4G8M A;  1KWH A;  2FYI A;  4PE5 B;  4ISU A;  1B9J A;  2UYE A;  5I2N B;  5AA2 D;  4R9F A;  4ZE9 A;  1LB8 A;  3LSL A;  1Y4C A;  2DWH A;  3KSJ A;  1EZO A;  3T93 B;  2OWT A;  3B7D A;  5HM4 B;  1WOD A;  3O28 A;  1JVX A;  4ZEC A;  2THI A;  1D4N A;  4IO2 A;  1QVS A;  5AA2 A;  3RGY A;  1B05 A;  5AA3 A;  2AIX A;  1H43 A;  5ISU A;  1UIV A;  1SI0 A;  3VFJ A;  4YKK A;  3V8X B;  2DE3 A;  5ICQ A;  1TFA A;  4EQ9 A;  2B65 A;  1AOV A;  1FQE A;  3QSL A;  1UTH B;  3N6T A;  1Y1Z A;  1B1H A;  4YB6 A;  5A5X A;  2QS2 A;  5I56 B;  3H06 B;  1Z7M E;  1AH5 A;  3M3K A;  5ITP A;  1D3K A;  4U2R A;  3O66 A;  4NF5 A;  3SKP A;  4L17 A;  2H25 A;  3N6U A;  2DOJ A;  2B3B A;  4AQ4 A;  3C35 A;  1N3X A;  3UA8 A;  2XXU A;  3OEM A;  3UN6 A;  1TT1 A;  4DXB A;  1FTM A;  1PBQ A;  1SW5 A;  3VVD A;  1RYO A;  2UVI A;  1XT8 A;  1IIT A;  2H5Y A;  3TDJ A;  1A54 A;  5I59 A;  4EF2 A;  4ZZA A;  1HSJ A;  1H3D A;  4THI A;  2HXW A;  1H45 A;  5H8F B;  1XVY A;  4AB6 A;  1LAX A;  3PPN A;  1P1O A;  2G93 A;  4BDR A;  2QSX A;  4YKJ A;  4OET A;  5DVF A;  2F7C A;  4YIC A;  4EF1 A;  1P1N A;  5JK4 A;  4LP2 B;  4F2Q A;  2V93 A;  3RT6 B;  3IOU A;  3O6I A;  4POW A;  4IGR A;  1S9T A;  4LON B;  2D21 A;  1J1N A;  2NXO A;  2IA4 A;  3LSW A;  3IJX B;  2HZL A;  3KEI A;  2QS1 A;  5TPA A;  3C31 A;  3HHF A;  3UIF A;  3S9N C;  3RT8 A;  1SW4 A;  3G3F A;  3H3G A;  3T22 A;  4QHQ A;  2I4C A;  4RA1 A;  4RXL A;  3TOD A;  4ELO A;  1AMF A;  4OEV A;  1MRP A;  1M5F A;  1MDQ A;  2QMW A;  3THI A;  4NED A;  2HEU A;  1M5D A;  4GOT A;  3CIJ A;  1NH7 A;  3TQL A;  3M8U A;  3KG2 A;  2F34 A;  2ZNU A;  4NF8 A;  1IZ1 A;  3IB1 A;  4ELP A;  3K0V A;  3QYT A;  2XXX A;  1FQB A;  3PMV A;  1LST A;  1UIU A;  3CG3 A;  4ZDM A;  3MVZ A;  1MQH A;  1IXH A;  3K1P A;  3IB2 A;  5I57 B;  4YMA A;  3TEP A;  3EHU A;  1MY0 A;  3UOR A;  2F7A A;  3FJ7 A;  4O3A A;  5TU0 A;  4RPO A;  1I69 A;  3JZJ A;  3DP6 A;  1NL5 A;  3RNN A;  4R73 A;  2Q2C A;  2D3I A;  1JW5 A;  4LVQ A;  3MPK A;  3ONM A;  1P99 A;  1PB9 A;  2F97 A;  1FCK A;  4G68 A;  3MVW A;  1P1Q A;  5EYF A;  2Y7I A;  1DTZ A;  2UVH A;  4R9G A;  1ZTY A;  2FNC A;  3IAZ A;  4HCW A;  4OXV A;  4WXJ A;  1YAE A;  5H8Q A;  3FGS A;  5KCJ B;  2DS9 A;  3C4M A;  1T0K A;  2VD3 A;  4YAH X;  5DVJ A;  3K2D A;  4QFK A;  3O6G A;  3MZ1 A;  2I3W A;  2O51 A;  1USY E;  5L9M A;  2VOZ A;  3AXF A;  3TTN A;  1LBB A;  3PV0 E;  3OO7 A;  3N5L A;  2ZYN A;  4F3B A;  5LOM A;  4U22 A;  2AYS A;  1URS A;  4H65 A;  1FTL A;  1Y20 A;  1GGG A;  4GXA A;  3PUV E;  3V83 A;  4DZ1 A;  2DP8 A;  4GF8 A;  3E13 X;  3HST A;  1B0L A;  3GBB A;  3OMB A;  1SQY A;  1B7Z A;  1ATG A;  4KYD A;  4F22 A;  4G4P A;  4G8H A;  3IOR A;  1R9Q A;  1Z7N E;  3IOW A;  4NF4 B;  3K02 A;  2V84 A;  3PD8 A;  2QPQ A;  3PUX E;  1F9B A;  2ESN A;  5BUU A;  1DTG A;  4PFY A;  5AA4 A;  1UQW A;  4BDL A;  1FQA A;  2DXY A;  4GFR A;  1PEB A;  2XXY A;  2I3V A;  4GD5 A;  5JTY A;  2OZZ A;  4U1Z A;  2XXW A;  3FV1 A;  1LFG A;  2REJ A;  1A8E A;  3O6H A;  3IX1 A;  2V3T A;  3TUS A;  3TCG A;  4H1X A;  3H6T A;  1BKA A;  3KJ7 A;  2HQ0 A;  3C9H A;  1MY3 A;  3ECR A;  3T66 A;  3PU5 A;  1II5 A;  4QFN A;  2Q89 A;  2Q88 A;  4QSE A;  1EU8 A;  3SEX A;  4F39 A;  3FVG A;  4OTE A;  5DYH A;  3I5O A;  2XXV A;  4N6P A;  4IO6 A;  2GRV A;  2CZL A;  5J1D A;  3TTK A;  3VLV A;  2DYX A;  3EN3 A;  4NF6 A;  1I6A A;  1O63 A;  4OVJ A;  1N3W A;  5TP9 B;  1UTB B;  4Q5T A;  1CE2 A;  3ZKK A;  4Z0I A;  3OO6 A;  1MY1 A;  2G29 A;  3E3K A;  2Z23 A;  3I3V A;  4FEC A;  3K01 A;  2AL4 A;  3N26 A;  4BDN A;  4P0I A;  3TCH A;  4KYE A;  3LBS A;  4Q30 B;  4PFU A;  1SW1 A;  3C36 A;  2PT1 A;  4I9D A;  2HAV A;  5K2X A;  4E0X A;  2GFE A;  4I1D A;  1FTJ A;  5K2Y A;  4XKP A;  2ZMB A;  3PPR A;  3C34 A;  3T9U A;  1N04 A;  4OEN A;  3ODB A;  2NWJ A;  4LQ2 A;  1FTO A;  4IO7 A;  4O3B A;  3R7X A;  4QSD A;  3Q25 A;  1VE4 A;  4U21 A;  1B7U A;  1OQG A;  3P7I A;  1FQC A;  1ZJL A;  1ZKB A;  1GVC A;  3Q26 A;  4F19 A;  3K6V A;  4YKI A;  2F36 A;  1ZMG A;  2NVU B;  3PMW A;  3RY3 A;  3CG1 A;  2F6P A;  1B4H A;  4X48 A;  5FHN A;  2R6G E;  3SET A;  4ESW A;  4P11 A;  3CVG A;  3GBA A;  2V3Q A;  3S2V A;  4RY1 A;  3LR1 A;  3T96 B;  3TPA A;  4GIZ A;  5HPQ A;  1JEV A;  1SBP A;  2OWS A;  3TFL A;  3OEN A;  3KFM A;  1TXF A;  2I0B A;  2DQV A;  1GV8 A;  2DE4 A;  4QFL A;  2F35 A;  2O7U A;  2GH9 A;  3H6U A;  1SD3 A;  1VR5 A;  1XVX A;  4YB5 A;  3FJM A;  3QUJ A;  1HSE A;  4IO4 A;  4TQU Q;  4DLD A;  2F78 A;  1JET A;  1B3F A;  4QFO A;  4ZED A;  1NNP A;  2HAU A;  1Y3P A;  2F8D A;  3VXB A;  5H8H B;  2Y7K A;  2HCA A;  2UXA A;  2E0S A;  3VE1 B;  4GQO A;  3MVX A;  4ONY A;  3CFX A;  1N84 A;  2NUV A;  4H6D A;  4KHZ E;  2B3F A;  2DSF A;  1GR2 A;  3C32 A;  3PPQ A;  5B7D A;  1DMB A;  5AE4 A;  3B6W A;  3A3C A;  1NKX A;  4F31 B;  1B0H A;  3G3J A;  3ILU B;  3CR9 A;  1MXX A;  4F29 A;  4OQO A;  5ELV A;  4IY5 A;  4XKQ A;  3WAF A;  2I58 A;  1NMU A;  3CRB A;  3FD3 A;  4KPT A;  3W9W A;  3RTW B;  1SYI A;  4UA8 A;  3T9X B;  4DCX A;  5KZT A;  5HBC A;  1XHY A;  1EZ9 A;  3PUW E;  1TFD A;  4R72 A;  1B51 A;  3U94 A;  2ALU A;  4POX A;  2NOO A;  3K4U A;  2H99 A;  4E0W A;  3EF7 A;  3IJO B;  3K6X A;  3UP9 A;  2HFB A;  4LZ5 A;  3FAS A;  2P0S A;  3OOA A;  4ZS9 A;  1N7X A;  3HCQ A;  1N76 A;  2YPN A;  3FVO A;  1A7L A;  2O84 X;  4K3F A;  2XXP A;  3N94 A;  5FTI A;  4M1V A;  1L5T A;  4KQP A;  3S9M C;  5L9O A;  4RYA A;  3RTF B;  1DPP A;  3O2A A;  4Q8R A;  3G3I A;  3R26 A;  3GZG A;  2I4B A;  3UGW A;  5DEX B;  4TOZ A;  3L6G A;  1OLC A;  4XIG Q;  2O7I A;  3LSF B;  5KDT B;  3FIR A;  5FTH A;  3DP4 A;  4GVO A;  4I8C A;  1N0T A;  1POT A;  4JSD A;  4R6H A;  3QK6 A;  2OJT A;  1PB8 A;  1YCJ A;  3VXC A;  2ZNT A;  2GHA A;  5I2K A;  4PFW A;  5L8D A;  1URD A;  4EXK A;  2I48 A;  1QJM A;  5I58 B;  2D5W A;  3HV1 A;  2I0C A;  4MLV A;  3H6V A;  3TTR A;  3ZSF A;  1MQD A;  1H44 A;  4H67 A;  5CC2 A;  4OFO A;  5CMM A;  3MP8 A;  3KBR A; 
#chains in the Genus database with same CATH topology
 4H5F A;  1VSO A;  4OVQ A;  4JWX A;  3C33 A;  3MPL A;  4AB5 A;  4LAT A;  5I2N A;  5EQ7 A;  1Y4T A;  1MPD A;  4IB2 A;  1IQ7 A;  1B46 A;  4NTL A;  4HXV A;  4YB7 A;  4N6K A;  4Z7E A;  3CFL A;  4F18 A;  2ZXT A;  4NQ8 A;  1KA0 A;  1URG A;  2R9J A;  3BIG A;  4KFQ A;  4O94 A;  4TLM B;  5CBR A;  4BDQ A;  1B3E A;  1RDZ A;  3M3L A;  5ICT A;  4FJP A;  1LGB C;  2XX8 A;  2XD3 A;  4P1L A;  1A99 A;  5AA2 B;  5DTB A;  1B1X A;  2GHB A;  5BWJ A;  5EHS A;  4RPN A;  2F5X A;  2CMO A;  2WYK A;  3FVK A;  1UTH A;  4XFE A;  1SI1 A;  2RCA A;  3KOS A;  1MPC A;  2O69 A;  4OYV A;  4OHN A;  4GL0 A;  1O7T A;  4YU0 A;  5A5X B;  1FPD A;  4PTK A;  4XXU A;  3FXR A;  4JDF A;  1Q35 A;  3KC1 A;  1JW4 A;  4G8N A;  3FAT A;  3KSX A;  1RKM A;  3W9V A;  3Q28 A;  4NF5 B;  4GWO A;  1CNQ A;  2W7Y A;  2XX9 A;  2A5T A;  3LSX A;  3MZ9 A;  1G0H A;  4N8G A;  5FHO A;  4LA9 A;  4PF8 A;  1LB9 A;  2O68 A;  5CMK A;  1MM7 A;  3MZB A;  3LC8 A;  1QUI A;  4DI3 D;  4LZ7 A;  2ONS A;  1A55 A;  3JYR A;  1B5H A;  3LUY A;  1FPB A;  3S4U A;  1XS5 A;  3TKD A;  3PD9 A;  5M2V A;  3KZG A;  3KBZ A;  5H8F A;  2VT5 A;  5CBS A;  4BDM A;  1XOC A;  5EQ8 A;  5I59 B;  1MS7 A;  2YJP A;  3MC2 A;  4MCO A;  4U23 A;  3MYU A;  5AA1 A;  3FXQ A;  1D9Q A;  2XHD A;  2PMS A;  2VP1 A;  2QVR A;  1LCT A;  3EHS A;  1YXI A;  1B6H A;  1MY4 A;  1NUY A;  1EZP A;  1FTK A;  1SYH A;  2ZZX A;  3OSQ A;  1FJ9 A;  3RPW A;  1N7W A;  1AIV A;  5CRY A;  3DEL B;  3JV9 A;  4FOR A;  1MXY A;  2ONK E;  2DE2 A;  1I6B A;  3A29 A;  2UVJ A;  4IR8 A;  4QSC A;  4MMP A;  1NUZ A;  5ET5 A;  1JNF A;  1BP5 A;  5TPA B;  3ZKL A;  4X8R A;  1IXG A;  1VFE A;  1PC3 A;  3MQ9 A;  1MQJ A;  1Y3Q A;  3K1M A;  1DSN A;  3DM0 A;  4R6Y A;  3IK6 B;  4OAN A;  1B58 A;  1QUJ A;  4OFJ A;  1XI6 A;  4QBA A;  4X1D A;  3QXM A;  4FAJ A;  4PP0 A;  4MX6 A;  1IME A;  3U93 A;  1IMC A;  2XXR A;  1EYJ A;  4KR5 A;  3IR1 A;  5IM2 A;  1JW1 A;  4X04 A;  4NAP A;  3SEU A;  1NUX A;  3K00 A;  2ZYM A;  3B8B A;  3MBP A;  2RF1 A;  3KJT A;  4GLI A;  2I6E A;  4HW8 A;  3H03 A;  4NF8 B;  4ZEI A;  4XKR A;  1B32 A;  3PUZ E;  1NV3 A;  4ZE8 A;  3RQT A;  3OXN A;  3GLB A;  4C0R A;  2L5V A;  5I57 A;  4HTG A;  3VVE A;  3OO9 A;  4YZZ A;  1NV2 A;  3OEL A;  2H4I A;  1EH3 A;  4WEP A;  2X7Q A;  3VLW A;  4DIG A;  1R6Z A;  4XKN A;  2VGQ A;  1PDA A;  1NH8 A;  3KOT A;  4OZ9 A;  4ELQ A;  1IEJ A;  5IKB A;  3GXA A;  1LCF A;  2QMX A;  4N81 A;  2RCB A;  4P9K A;  4F2O A;  1MM6 A;  5CI5 A;  3D4G A;  3H4Z A;  4G61 A;  3IO6 A;  1XC1 A;  3OD7 A;  4G68 B;  2ANJ A;  1BK4 A;  2FA7 A;  4OFL A;  4ELR A;  3MAM A;  1ZLQ A;  2V4C A;  3VDF A;  4O7I A;  3U92 A;  4HE0 A;  3CFZ A;  1ELJ A;  1NFT A;  1KA1 A;  3SDF A;  3M3F A;  4EDP A;  2CZI A;  5KCJ A;  5EYG A;  2YLN A;  4GWS A;  2Z8E A;  3BKI B;  2P2A A;  4P47 A;  4IGT A;  5L9S A;  4QFP A;  1DK4 A;  2Q8M A;  1OVT A;  3F11 A;  5H8Q B;  4DE8 A;  4F3G A;  3SEV A;  2P1S A;  3ROJ A;  1LAG E;  1FQD A;  1MPB A;  5H8S A;  1LAF E;  3CHG A;  4JWO A;  1US5 A;  1B5J A;  3IB0 A;  3TTM A;  2XXQ A;  4Q0C A;  2PYY A;  4PET A;  1OLA A;  1CB6 A;  4H5G A;  3O97 A;  3FZV A;  2DWA A;  1B2H A;  1TWY A;  3ILT B;  3RLF E;  3BFU A;  4O3C A;  1RDX A;  4EUO A;  1DOT A;  2DVC A;  4RNS A;  2HPG A;  4KD5 A;  1ZIU A;  4JXI A;  2O1L A;  4R2F A;  1MQG A;  3DP8 A;  2LAO A;  3U65 A;  2A5T B;  4N07 A;  1AL3 A;  4WKM A;  1D9V A;  3MWB A;  1Y3N A;  4NF4 A;  3G3G A;  5LTC A;  2ZYK A;  3TMG A;  4R2B A;  2DXR A;  4H8J A;  1LBC A;  4IO5 A;  2Y7P A;  3BBR A;  1P1U A;  4P8B A;  4R75 A;  3Q27 A;  3QAX A;  2X7P A;  3MUQ A;  3K6W A;  2Q9T A;  3O9P A;  3KN7 A;  4JVC A;  1IXC A;  1D9Y A;  2O6A A;  1S7Y A;  2XXI A;  4MF3 A;  5AA4 B;  3V89 B;  2XXT A;  2Z22 A;  4MBP A;  4ESX A;  3RUM A;  4JB7 A;  1OVB A;  3O29 A;  3SER A;  5ITO A;  1LBY A;  5JTY B;  4N13 A;  4EQ7 A;  1O64 A;  2PX1 A;  4PF6 A;  4GXS B;  2PBW A;  1Y1M A;  2QJE A;  1G0I A;  2Y84 A;  2OCU A;  4PBH A;  4NWD A;  1IXI A;  4C1U A;  3W15 C;  4HCY A;  2FIE A;  4OVP A;  1NV7 A;  4GWU A;  2F3B A;  4GRK A;  4ECF A;  2WBB A;  3HO7 A;  3NOH A;  4KI0 E;  3A09 A;  3MP1 A;  3B50 A;  1IIW A;  2HZK A;  2V3U A;  3PPP A;  1MH3 A;  1SVX B;  3TQW A;  4O7M A;  1NV1 A;  5H8N A;  2M8C A;  4DXC A;  4BDO A;  5TP9 A;  1QGX A;  1UTB A;  2Q8J A;  2HXR A;  2KR0 A;  3U8Q A;  2QS3 A;  4RK9 A;  4NF6 B;  4PAF A;  4OER A;  1M5E A;  4OMB A;  1B3H A;  3FV2 A;  1H76 A;  3R6U A;  1MG1 A;  2PFY A;  2QRY A;  4JBZ A;  1FBG A;  4LUB A;  3K6U A;  1NNF A;  4F1V A;  3E9X A;  5DT6 A;  4UAC A;  3MP6 A;  4G77 A;  4IO3 A;  1A40 A;  1KZ8 A;  4KYS A;  3HN0 A;  5IZ3 B;  2ZYO A;  4PQJ A;  3S9E A;  2ABH A;  3MW0 A;  1FBF A;  1A8F A;  4OES A;  4I3Y A;  4R74 A;  2OK2 A;  4P0G A;  2I49 A;  4WED A;  3PGF A;  4MH5 A;  3IL1 B;  4ZEB A;  1PB7 A;  3FVN A;  1IMD A;  4DCY A;  3HHG A;  2E1S A;  1QW0 A;  1USY H;  1FW0 A;  1MDP 1;  2DWJ A;  4F3P A;  5I84 A;  3T9V A;  3A3U A;  3IO4 A;  4KCD A;  2MKZ A;  5B70 A;  2BJJ X;  3TCF A;  4DXU A;  3KN3 A;  4JWY A;  5F7V A;  4TLL B;  4XTC Q;  3DLN A;  4ZZE A;  1WVJ A;  2VHA A;  4ZEK A;  5DVI A;  3B6T A;  1Y9U A;  1HSL A;  2P3V A;  4RJZ A;  4JVD A;  1S50 A;  4EQB A;  1MY2 A;  1Q1K A;  4PE3 A;  4MFI A;  4U4S A;  1JQF A;  4FED A;  3H7M A;  3VV5 A;  4U4X A;  5ET6 A;  2QFL A;  2OLB A;  2RC7 A;  1DPE A;  1YPN A;  3IOT A;  4NG7 A;  1PBP A;  2REG A;  2XXH A;  3MJN A;  5I56 A;  4X1B A;  3OEK A;  1VFD A;  4FEB A;  4X9T A;  1US4 A;  3SEW A;  4H0W A;  3EHT A;  1MXZ A;  2DVZ A;  3QUF A;  4EXL A;  1BIY A;  2Z8D A;  3TZA A;  2PT2 A;  1RYX A;  4NE4 A;  5LDZ A;  4PFT A;  1B40 A;  1ANF A;  2F6G A;  1M5C A;  5IAI A;  3H6W A;  4I3E A;  1QKA A;  2RC8 A;  2WBD A;  3HPI A;  2AL5 A;  1B3L A;  3UK4 A;  3RN8 A;  1LBX A;  2JJK A;  3D4C A;  5CMB A;  1POY 1;  1BTJ A;  1OQH A;  5FHM A;  2XX7 A;  3CSB A;  5H8H A;  1NV0 A;  4R6K A;  3FBP A;  2UVG A;  3RPL A;  2QL3 A;  3Q29 A;  1B3G A;  1B5I A;  1MH4 A;  1MQI A;  1BLF A;  2VD2 A;  3RYD A;  3FXU A;  3QMF A;  1DBZ A;  3MVY A;  3EQ1 A;  4GWZ A;  2WKY A;  4KCC A;  5JEI A;  2CZK A;  2PVU A;  2A5S A;  1FJ6 A;  4G2Z A;  1OIB A;  4PGN A;  2ZNS A;  2IEE A;  1MXV A;  4ZEF A;  4MLQ A;  4FE8 A;  2OBG A;  2XD2 A;  5CMC A;  1QUL A;  1FPF A;  1NNT A;  4I62 A;  4F1U A;  3SES A;  3IOV A;  1SDX A;  5F1Q A;  3CSG A;  3FUZ A;  3OSR A;  3FJG A;  3K1N A;  2Y7R A;  4BLA A;  4H8I A;  1QKB A;  3G7W A;  4LZ8 A;  3VLU A;  1IUD A;  1FBE A;  4QF9 A;  5DW8 A;  3KN8 A;  1SW2 A;  3OO8 A;  2X26 A;  1MXU A;  3G3H A;  3KGC A;  2XWI A;  3QIM A;  1LFI A;  4GWY A;  2Y7W A;  3E4R A;  1QUK A;  5I7I A;  1FQF A;  5CM6 A;  1NV5 A;  3T0J A;  4NF0 A;  2RC9 A;  3TTL A;  3EPE A;  3PPO A;  4U1O A;  1LAH E;  5T3J A;  1YYZ A;  2WX9 A;  1JEU A;  4FAT A;  4GX4 A;  2QS4 A;  3S9L C;  3I6V A;  1OMP A;  4GL8 A;  3U72 A;  4NWC A;  1GTK A;  2Q2A A;  1B4Z A;  4MHF A;  3B6Q A;  4QRZ A;  2R71 A;  1I6Q A;  3U1O A;  3G3K A;  2KQZ A;  3T9H B;  3SEY A;  3ZS6 A;  3TEL A;  1LFH A;  1K9Z A;  2UYF A;  2Y5L A;  3VVF A;  5H8N B;  4HS7 A;  4YMB A;  4FIM A;  5EHM A;  5DEX A;  4F1Y A;  2KLF A;  2RIN A;  1NNK A;  1JVY A;  5KDT A;  3PUY E;  1P1W A;  1ZU0 A;  4GBV A;  4LQ5 A;  4YKP A;  4JSO A;  4N4U A;  4OEU A;  1IMF A;  3TYH A;  3USD A;  1R1N A;  1R9L A;  1ZBM A;  1YTV A;  4HE2 A;  2RKM A;  4NMY A;  2WYP A;  4ND9 A;  3BFT A;  4P3L A;  1WDN A;  2O1M A;  1M5B A;  2H98 A;  3L6H A;  1LLS A;  3CI8 A;  5IGA A;  5I58 A;  2F7B A;  3V5A A;  1B7H A;  5I2K B;  3WAE A;  4OWD A;  3PMX A;  4NX1 A;  2H9B A;  4RK2 A;  4G68 C;  4DDD A;  3TAJ A;  4PCD A;  4P1E A;  2FHY A;  1B52 A;  2DWI A;  4C1T A;  2ONR A;  2V25 A;  3FXB A;  4IY6 A;  4F3S A;  1MXW A;  2Z8F A;  4M4G A;  4G8M A;  1NV6 A;  1KWH A;  2CEY A;  2FYI A;  4PE5 B;  4ISU A;  1B9J A;  2UYE A;  5I2N B;  5AA2 D;  4R9F A;  4ZE9 A;  3D1R A;  1LB8 A;  3LSL A;  1Y4C A;  2DWH A;  1FPI A;  4NHB A;  3KSJ A;  1EZO A;  3T93 B;  2OWT A;  3B7D A;  5HM4 B;  4AS4 A;  1WOD A;  3O28 A;  4PBQ A;  1JVX A;  4ZEC A;  2THI A;  2XWV A;  1D4N A;  4IO2 A;  1QVS A;  5AA2 A;  3RGY A;  1B05 A;  5AA3 A;  2AIX A;  2FVZ A;  1H43 A;  5ISU A;  1IMB A;  1UIV A;  1SI0 A;  3VFJ A;  4YKK A;  2F3D A;  3V8X B;  2DE3 A;  1DCU A;  5ICQ A;  1TFA A;  4EQ9 A;  5EYH A;  2B65 A;  1AOV A;  1FQE A;  3QSL A;  1UTH B;  3N6T A;  1Y1Z A;  1B1H A;  4YB6 A;  5I5P A;  5A5X A;  2QS2 A;  1INP A;  5I56 B;  3H06 B;  1Z7M E;  4PAK A;  4DI4 B;  1AH5 A;  3M3K A;  5ITP A;  1D3K A;  4U2R A;  3O66 A;  4NF5 A;  3KC0 A;  4KXP A;  3SKP A;  4L17 A;  2H25 A;  3N6U A;  2DOJ A;  2B3B A;  4AQ4 A;  3C35 A;  1N3X A;  3UA8 A;  1SPI A;  2XXU A;  3OEM A;  2XA5 A;  3UN6 A;  1TT1 A;  4DXB A;  1FTM A;  1PBQ A;  1SW5 A;  3VVD A;  1RYO A;  2WEF A;  2B4L A;  2QVU A;  2UVI A;  2OX3 A;  1XT8 A;  1IIT A;  2H5Y A;  3TDJ A;  1A54 A;  5I59 A;  4EF2 A;  4ZZA A;  1HSJ A;  1H3D A;  4THI A;  2HXW A;  1H45 A;  5H8F B;  1XVY A;  5ESY A;  1LAX A;  4AB6 A;  5J16 A;  3PPN A;  1P1O A;  2G93 A;  4BDR A;  2QSX A;  4YKJ A;  4QXD A;  4OET A;  5DVF A;  2F7C A;  4YIC A;  4EF1 A;  1P1N A;  4PFB A;  2R8T A;  3MST A;  5JK4 A;  4LP2 B;  4F2Q A;  2V93 A;  3RT6 B;  4H46 A;  3IOU A;  3O6I A;  4POW A;  4IGR A;  1S9T A;  4LON B;  2D21 A;  1J1N A;  2NXO A;  2IA4 A;  4O8M A;  3LSW A;  3IJX B;  2HZL A;  3KEI A;  2QS1 A;  5TPA A;  3ISP A;  3C31 A;  3HHF A;  3UIF A;  3S9N C;  3RT8 A;  1SW4 A;  2HHM A;  3G3F A;  3LV0 A;  3H3G A;  3T22 A;  4QHQ A;  2I4C A;  4N17 A;  4RA1 A;  4RXL A;  3TOD A;  4ELO A;  1AMF A;  4OEV A;  1MRP A;  1M5F A;  1MDQ A;  2QMW A;  3THI A;  4NED A;  2HEU A;  1M5D A;  4GOT A;  3CIJ A;  4PC9 A;  1NH7 A;  4FBP A;  3TQL A;  4GWW A;  3M8U A;  3KG2 A;  3HFU A;  1K9Y A;  2F34 A;  2ZNU A;  4NF8 A;  4MNI A;  1IZ1 A;  4OVT A;  3IB1 A;  4ELP A;  3K0V A;  3QYT A;  2XXX A;  1FQB A;  2GQ1 A;  3EKI A;  4XF5 A;  3PMV A;  1LST A;  1UIU A;  3CG3 A;  4ZDM A;  1FPJ A;  1LBW A;  3MVZ A;  1MQH A;  3T1B A;  1IXH A;  3K1P A;  3IB2 A;  5I57 B;  4I40 A;  4YMA A;  3TEP A;  3EHU A;  1MY0 A;  4N91 A;  3UOR A;  2F7A A;  3FJ7 A;  4O3A A;  5IZZ A;  5TU0 A;  4RPO A;  1I69 A;  3JZJ A;  1FRP A;  3DP6 A;  1NL5 A;  4MNC A;  3RNN A;  1EYK A;  4R73 A;  2Q2C A;  2D3I A;  1JW5 A;  4LVQ A;  3MPK A;  3ONM A;  5IZ1 A;  1P99 A;  1PB9 A;  2F97 A;  1FCK A;  4G68 A;  3MVW A;  1P1Q A;  4OVR A;  5EYF A;  5ET8 A;  2Y7I A;  1DTZ A;  2UVH A;  2OWZ A;  4R9G A;  1ZTY A;  2FNC A;  3IAZ A;  4PDD A;  4HCW A;  4OXV A;  4WXJ A;  1YAE A;  5H8Q A;  3FGS A;  5KCJ B;  3LUZ A;  2DS9 A;  3C4M A;  3GYY A;  1T0K A;  2VD3 A;  1FBC A;  4PFI A;  4YAH X;  5DVJ A;  3K2D A;  4QFK A;  3O6G A;  3MZ1 A;  2I3W A;  2O51 A;  1USY E;  5L9M A;  2VOZ A;  3AXF A;  1JP4 A;  3TTN A;  2XXK A;  1LBB A;  3PV0 E;  3OO7 A;  3N5L A;  2ZYN A;  4F3B A;  4PGP A;  5LOM A;  4U22 A;  2FIX A;  2AYS A;  3PTY A;  1URS A;  1AWB A;  4H65 A;  1FTL A;  1Y20 A;  1GGG A;  4GXA A;  3PUV E;  1FTA A;  3V83 A;  4DZ1 A;  2BJI A;  2DP8 A;  4GF8 A;  5I3S A;  3E13 X;  4MNP A;  3HST A;  4PFR A;  1B0L A;  3SZP A;  2Y5K A;  3GBB A;  3OMB A;  1SQY A;  2XWK A;  1B7Z A;  1ATG A;  3BIH A;  4KYD A;  4F22 A;  4G4P A;  5EQ9 A;  4G8H A;  2PCR A;  3IOR A;  1R9Q A;  1Z7N E;  3IOW A;  2VPN A;  4NF4 B;  1LBV A;  1RDY A;  3K02 A;  2V84 A;  3PD8 A;  2QPQ A;  3PUX E;  1F9B A;  2ESN A;  5BUU A;  1DTG A;  4PFY A;  5AA4 A;  1UQW A;  4BDL A;  1FQA A;  2DXY A;  4GFR A;  1PEB A;  2XXY A;  2I3V A;  4GD5 A;  5JTY A;  2OZZ A;  4U1Z A;  5ET7 A;  2XXW A;  3FV1 A;  1LFG A;  2REJ A;  1A8E A;  3O6H A;  3IX1 A;  2V3T A;  3TUS A;  3TCG A;  4H1X A;  3H6T A;  1BKA A;  3KJ7 A;  2HQ0 A;  3C9H A;  1MY3 A;  3ECR A;  3T66 A;  3PU5 A;  1II5 A;  4QFN A;  2Q89 A;  2Q88 A;  4LN5 A;  4QSE A;  1EU8 A;  4MEV A;  3SEX A;  4F39 A;  3FVG A;  4OTE A;  5DYH A;  3I5O A;  2XXV A;  4N6P A;  4IO6 A;  2GRV A;  2CZL A;  5J1D A;  3TTK A;  4N6D A;  5EQA A;  3VLV A;  2DYX A;  3EN3 A;  4NF6 A;  1I6A A;  1O63 A;  5A5L A;  4OVJ A;  1N3W A;  2Q74 A;  2VPO A;  5TP9 B;  4MJO A;  1UTB B;  4Q5T A;  1CE2 A;  3ZKK A;  4Z0I A;  3OO6 A;  1MY1 A;  2G29 A;  3E3K A;  2Z23 A;  3I3V A;  4FEC A;  3K01 A;  2AL4 A;  3N26 A;  4BDN A;  1FPK A;  4P0I A;  3TCH A;  1FBD A;  4KYE A;  3LBS A;  4Q30 B;  4PFU A;  1SW1 A;  2ZZW A;  5IZ3 A;  2DDK A;  3C36 A;  2PT1 A;  4I9D A;  2HAV A;  2B4M A;  5K2X A;  4E0X A;  2GFE A;  1EYI A;  4I1D A;  1FTJ A;  1FPL A;  4H45 A;  5K2Y A;  4XKP A;  1YZ0 A;  2ZMB A;  3PPR A;  3C34 A;  3T9U A;  2XWO A;  1N04 A;  1LBZ A;  2P3N A;  3IFC A;  4OEN A;  3ODB A;  2NWJ A;  4LQ2 A;  1FTO A;  4IO7 A;  4O3B A;  3R7X A;  4QSD A;  3Q25 A;  2PFZ A;  1VE4 A;  4U21 A;  1B7U A;  1OQG A;  3P7I A;  1FQC A;  1ZJL A;  4NN3 A;  2CZH A;  1ZKB A;  3E78 A;  1GVC A;  3Q26 A;  4F19 A;  3K6V A;  2CEX A;  4YKI A;  2F36 A;  1ZMG A;  2NVU B;  3PMW A;  3RY3 A;  3CG1 A;  4MAG A;  4P56 A;  2F6P A;  1B4H A;  4UAB A;  4X48 A;  5FHN A;  2R6G E;  3SET A;  4N8Y A;  1VDW A;  4ESW A;  4P11 A;  3CVG A;  3GBA A;  2V3Q A;  3S2V A;  4RY1 A;  5F24 A;  3LR1 A;  3T96 B;  3TPA A;  4GIZ A;  5HPQ A;  1JEV A;  1SBP A;  2OWS A;  3TFL A;  3IFA A;  3OEN A;  3KFM A;  1TXF A;  2I0B A;  2DQV A;  1GV8 A;  2DE4 A;  4QFL A;  2F35 A;  2O7U A;  2GH9 A;  3H6U A;  4AS5 A;  1LEV A;  1FPG A;  1SD3 A;  1VR5 A;  1XVX A;  4YB5 A;  3FJM A;  3QUJ A;  1HSE A;  4IO4 A;  4TQU Q;  4DLD A;  2F78 A;  1JET A;  1B3F A;  4QFO A;  4ZED A;  1NNP A;  2HAU A;  1Y3P A;  2F8D A;  3VXB A;  5H8H B;  2Y7K A;  3RPL B;  2HCA A;  2UXA A;  1FSA A;  2FBP A;  2ZZV A;  2E0S A;  3VE1 B;  4GQO A;  3MVX A;  4ONY A;  3CFX A;  4PAI A;  1N84 A;  2NUV A;  1FBH A;  4H6D A;  4KHZ E;  2QVV A;  2B3F A;  4PDH A;  2DSF A;  1GR2 A;  3C32 A;  3PPQ A;  5B7D A;  1DMB A;  5AE4 A;  4GBW A;  3B6W A;  3A3C A;  1NKX A;  4F31 B;  1B0H A;  3G3J A;  3ILU B;  3CR9 A;  1MXX A;  4F29 A;  4OQO A;  4GX6 A;  5ELV A;  4IY5 A;  4XKQ A;  3WAF A;  2I58 A;  1NMU A;  3CRB A;  3FD3 A;  4KPT A;  1IMA A;  3W9W A;  3RTW B;  1SYI A;  1FPE A;  4UA8 A;  3T9X B;  4DCX A;  5KZT A;  5HBC A;  1XHY A;  1EZ9 A;  3PUW E;  1TFD A;  4R72 A;  4OVS A;  1Q9D A;  1B51 A;  3U94 A;  2ALU A;  4POX A;  2NOO A;  3K4U A;  2H99 A;  4E0W A;  3EF7 A;  3IJO B;  3K6X A;  1NV4 A;  3UP9 A;  2HFB A;  4LZ5 A;  1NI9 A;  3FAS A;  4HE1 A;  2P0S A;  1NUW A;  3OOA A;  4ZS9 A;  1N7X A;  3HCQ A;  1N76 A;  2YPN A;  4N15 A;  3FVO A;  1A7L A;  2O84 X;  4K3F A;  2XXP A;  3N94 A;  5FTI A;  4JVI A;  4M1V A;  1L5T A;  4KQP A;  3S9M C;  5L9O A;  4RYA A;  4XEQ A;  1DPP A;  3RTF B;  3O2A A;  4Q8R A;  3G3I A;  3R26 A;  3GZG A;  2I4B A;  3UGW A;  5DEX B;  4TOZ A;  3E79 A;  3L6G A;  1OLC A;  4XIG Q;  2O7I A;  3LSF B;  4NGU A;  5KDT B;  3FIR A;  4OA4 A;  1FBP A;  5FTH A;  3DP4 A;  4GVO A;  4I8C A;  1N0T A;  1POT A;  4JSD A;  4R6H A;  3QK6 A;  2OJT A;  1PB8 A;  1YCJ A;  3VXC A;  4MIJ A;  2ZNT A;  2GHA A;  5I2K A;  4PFW A;  5L8D A;  1URD A;  4EXK A;  2I48 A;  1QJM A;  4GWX A;  5I58 B;  2D5W A;  3HV1 A;  2I0C A;  4MLV A;  3H6V A;  3TTR A;  3ZSF A;  1MQD A;  5FBP A;  1H44 A;  4H67 A;  5CC2 A;  4OFO A;  5CMM A;  3MP8 A;  3KBR A;  4GX3 A; 
#chains in the Genus database with same CATH homology
 4H5F A;  1VSO A;  4JWX A;  3C33 A;  3MPL A;  4AB5 A;  4LAT A;  5I2N A;  1Y4T A;  1MPD A;  4IB2 A;  1IQ7 A;  1B46 A;  4NTL A;  4YB7 A;  4Z7E A;  3CFL A;  4F18 A;  2ZXT A;  1URG A;  2R9J A;  4KFQ A;  4TLM B;  5CBR A;  4BDQ A;  1B3E A;  3M3L A;  5ICT A;  4FJP A;  1LGB C;  2XX8 A;  2XD3 A;  1A99 A;  5AA2 B;  5DTB A;  1B1X A;  2GHB A;  5BWJ A;  5EHS A;  4RPN A;  2F5X A;  2CMO A;  3FVK A;  1UTH A;  1SI1 A;  2RCA A;  3KOS A;  1MPC A;  2O69 A;  4OYV A;  4OHN A;  4GL0 A;  1O7T A;  4YU0 A;  5A5X B;  4XXU A;  3FXR A;  4JDF A;  1Q35 A;  1JW4 A;  4G8N A;  3FAT A;  3KSX A;  1RKM A;  3W9V A;  3Q28 A;  4NF5 B;  4GWO A;  2W7Y A;  2XX9 A;  2A5T A;  3LSX A;  3MZ9 A;  5FHO A;  4LA9 A;  1LB9 A;  2O68 A;  5CMK A;  1MM7 A;  3MZB A;  3LC8 A;  1QUI A;  4LZ7 A;  2ONS A;  1A55 A;  3JYR A;  1B5H A;  3LUY A;  3S4U A;  1XS5 A;  3TKD A;  3PD9 A;  5M2V A;  3KZG A;  5H8F A;  5CBS A;  4BDM A;  1XOC A;  5I59 B;  1MS7 A;  2YJP A;  3MC2 A;  4U23 A;  5AA1 A;  3FXQ A;  2XHD A;  2PMS A;  2VP1 A;  1LCT A;  3EHS A;  1B6H A;  1MY4 A;  1EZP A;  1FTK A;  1SYH A;  3OSQ A;  3RPW A;  1N7W A;  1AIV A;  5CRY A;  3DEL B;  3JV9 A;  4FOR A;  1MXY A;  2ONK E;  2DE2 A;  1I6B A;  2UVJ A;  4QSC A;  1JNF A;  1BP5 A;  5TPA B;  3ZKL A;  1IXG A;  1VFE A;  1PC3 A;  3MQ9 A;  1MQJ A;  1Y3Q A;  3K1M A;  1DSN A;  3DM0 A;  4R6Y A;  3IK6 B;  1B58 A;  1QUJ A;  4OFJ A;  4X1D A;  3QXM A;  4FAJ A;  4PP0 A;  3U93 A;  2XXR A;  4KR5 A;  3IR1 A;  1JW1 A;  3SEU A;  3K00 A;  2ZYM A;  3MBP A;  2RF1 A;  3KJT A;  4GLI A;  2I6E A;  4HW8 A;  3H03 A;  4NF8 B;  4ZEI A;  4XKR A;  1B32 A;  3PUZ E;  4ZE8 A;  3RQT A;  3OXN A;  3GLB A;  4C0R A;  5I57 A;  4HTG A;  3VVE A;  3OO9 A;  4YZZ A;  3OEL A;  2H4I A;  1EH3 A;  4WEP A;  2X7Q A;  3VLW A;  4DIG A;  1R6Z A;  4XKN A;  2VGQ A;  1PDA A;  1NH8 A;  3KOT A;  4OZ9 A;  4ELQ A;  1IEJ A;  5IKB A;  3GXA A;  1LCF A;  2QMX A;  2RCB A;  4F2O A;  1MM6 A;  5CI5 A;  3D4G A;  3H4Z A;  3IO6 A;  1XC1 A;  3OD7 A;  4G68 B;  2ANJ A;  2FA7 A;  4OFL A;  4ELR A;  3MAM A;  1ZLQ A;  3VDF A;  3U92 A;  3CFZ A;  1ELJ A;  1NFT A;  3SDF A;  3M3F A;  4EDP A;  5KCJ A;  2YLN A;  2Z8E A;  3BKI B;  2P2A A;  4IGT A;  5L9S A;  4QFP A;  1OVT A;  3F11 A;  5H8Q B;  4DE8 A;  4F3G A;  3SEV A;  2P1S A;  1LAG E;  1FQD A;  1MPB A;  5H8S A;  1LAF E;  4JWO A;  1US5 A;  1B5J A;  3IB0 A;  3TTM A;  2XXQ A;  4Q0C A;  2PYY A;  4PET A;  1OLA A;  1CB6 A;  4H5G A;  3O97 A;  3FZV A;  2DWA A;  1B2H A;  1TWY A;  3ILT B;  3RLF E;  3BFU A;  4O3C A;  4EUO A;  1DOT A;  2DVC A;  4RNS A;  4KD5 A;  1ZIU A;  4JXI A;  2O1L A;  4R2F A;  1MQG A;  3DP8 A;  2LAO A;  2A5T B;  4N07 A;  1AL3 A;  4WKM A;  1D9V A;  3MWB A;  1Y3N A;  4NF4 A;  3G3G A;  2ZYK A;  3TMG A;  4R2B A;  2DXR A;  4H8J A;  1LBC A;  4IO5 A;  2Y7P A;  3BBR A;  1P1U A;  4R75 A;  3Q27 A;  3QAX A;  2X7P A;  3MUQ A;  3K6W A;  2Q9T A;  3O9P A;  3KN7 A;  1IXC A;  1D9Y A;  2O6A A;  1S7Y A;  2XXI A;  4MF3 A;  5AA4 B;  3V89 B;  2XXT A;  2Z22 A;  4MBP A;  4ESX A;  3RUM A;  4JB7 A;  1OVB A;  3O29 A;  3SER A;  5ITO A;  5JTY B;  4N13 A;  4EQ7 A;  1O64 A;  2PX1 A;  4GXS B;  2PBW A;  1Y1M A;  2QJE A;  2Y84 A;  2OCU A;  4NWD A;  1IXI A;  4C1U A;  3W15 C;  4HCY A;  4GRK A;  4ECF A;  3HO7 A;  4KI0 E;  3A09 A;  3MP1 A;  1IIW A;  2HZK A;  2V3U A;  3PPP A;  1MH3 A;  1SVX B;  3TQW A;  5H8N A;  2M8C A;  4DXC A;  4BDO A;  5TP9 A;  2Q8J A;  1UTB A;  3U8Q A;  2QS3 A;  4RK9 A;  4NF6 B;  4OER A;  1M5E A;  4OMB A;  1B3H A;  3FV2 A;  1H76 A;  3R6U A;  1MG1 A;  2QRY A;  4JBZ A;  4LUB A;  3K6U A;  1NNF A;  4F1V A;  3E9X A;  5DT6 A;  4UAC A;  3MP6 A;  4G77 A;  4IO3 A;  1A40 A;  4KYS A;  3HN0 A;  2ZYO A;  4PQJ A;  3S9E A;  2ABH A;  3MW0 A;  1A8F A;  4OES A;  4R74 A;  2OK2 A;  4P0G A;  2I49 A;  4WED A;  3PGF A;  4MH5 A;  3IL1 B;  4ZEB A;  1PB7 A;  3FVN A;  4DCY A;  3HHG A;  2E1S A;  1QW0 A;  1USY H;  1FW0 A;  1MDP 1;  2DWJ A;  4F3P A;  5I84 A;  3T9V A;  3A3U A;  3IO4 A;  4KCD A;  5B70 A;  2BJJ X;  3TCF A;  4DXU A;  3KN3 A;  4JWY A;  5F7V A;  4TLL B;  4XTC Q;  3DLN A;  4ZZE A;  1WVJ A;  2VHA A;  4ZEK A;  5DVI A;  3B6T A;  1Y9U A;  1HSL A;  4RJZ A;  1S50 A;  4EQB A;  1MY2 A;  1Q1K A;  4MFI A;  4U4S A;  1JQF A;  4FED A;  3H7M A;  3VV5 A;  4U4X A;  2OLB A;  2RC7 A;  1DPE A;  1YPN A;  3IOT A;  1PBP A;  2REG A;  2XXH A;  3MJN A;  5I56 A;  4X1B A;  3OEK A;  1VFD A;  4FEB A;  4X9T A;  1US4 A;  3SEW A;  4H0W A;  3EHT A;  1MXZ A;  2DVZ A;  3QUF A;  4EXL A;  1BIY A;  2Z8D A;  3TZA A;  2PT2 A;  1RYX A;  4NE4 A;  4PFT A;  1B40 A;  1ANF A;  2F6G A;  1M5C A;  5IAI A;  3H6W A;  1QKA A;  2RC8 A;  3HPI A;  2AL5 A;  1B3L A;  3UK4 A;  3RN8 A;  3D4C A;  5CMB A;  1POY 1;  1BTJ A;  1OQH A;  5FHM A;  2XX7 A;  3CSB A;  5H8H A;  4R6K A;  2UVG A;  2QL3 A;  3Q29 A;  1B3G A;  1B5I A;  1MH4 A;  1MQI A;  1BLF A;  2VD2 A;  3FXU A;  3MVY A;  3EQ1 A;  2WKY A;  4KCC A;  5JEI A;  2PVU A;  2A5S A;  4G2Z A;  1OIB A;  2ZNS A;  2IEE A;  1MXV A;  4ZEF A;  4MLQ A;  4FE8 A;  2OBG A;  2XD2 A;  5CMC A;  1QUL A;  1NNT A;  4I62 A;  4F1U A;  3SES A;  3IOV A;  1SDX A;  5F1Q A;  3CSG A;  3FUZ A;  3OSR A;  3FJG A;  3K1N A;  2Y7R A;  4BLA A;  4H8I A;  1QKB A;  3G7W A;  4LZ8 A;  3VLU A;  1IUD A;  4QF9 A;  3KN8 A;  1SW2 A;  3OO8 A;  2X26 A;  1MXU A;  3G3H A;  3KGC A;  3QIM A;  1LFI A;  2Y7W A;  3E4R A;  1QUK A;  1FQF A;  5CM6 A;  2RC9 A;  3TTL A;  3EPE A;  3PPO A;  4U1O A;  1LAH E;  1JEU A;  4FAT A;  2QS4 A;  3S9L C;  3I6V A;  1OMP A;  4GL8 A;  3U72 A;  4NWC A;  1GTK A;  2Q2A A;  1B4Z A;  3B6Q A;  4QRZ A;  2R71 A;  1I6Q A;  3U1O A;  3G3K A;  3T9H B;  3ZS6 A;  3SEY A;  3TEL A;  1LFH A;  2UYF A;  3VVF A;  5H8N B;  4YMB A;  4HS7 A;  4FIM A;  5EHM A;  5DEX A;  4F1Y A;  2KLF A;  2RIN A;  1NNK A;  1JVY A;  5KDT A;  3PUY E;  1P1W A;  1ZU0 A;  4LQ5 A;  4YKP A;  4JSO A;  4OEU A;  3TYH A;  3USD A;  1R1N A;  1R9L A;  1ZBM A;  1YTV A;  2RKM A;  4NMY A;  4ND9 A;  3BFT A;  1WDN A;  2O1M A;  1M5B A;  2H98 A;  3L6H A;  1LLS A;  3CI8 A;  5I58 A;  2F7B A;  3V5A A;  1B7H A;  5I2K B;  3WAE A;  4OWD A;  3PMX A;  2H9B A;  4RK2 A;  4G68 C;  4DDD A;  3TAJ A;  1B52 A;  2DWI A;  4C1T A;  2ONR A;  2V25 A;  4IY6 A;  4F3S A;  1MXW A;  2Z8F A;  4M4G A;  4G8M A;  1KWH A;  2FYI A;  4PE5 B;  4ISU A;  1B9J A;  2UYE A;  5I2N B;  5AA2 D;  4R9F A;  4ZE9 A;  1LB8 A;  3LSL A;  1Y4C A;  2DWH A;  3KSJ A;  1EZO A;  3T93 B;  2OWT A;  3B7D A;  5HM4 B;  1WOD A;  3O28 A;  1JVX A;  4ZEC A;  2THI A;  1D4N A;  4IO2 A;  1QVS A;  5AA2 A;  3RGY A;  1B05 A;  5AA3 A;  2AIX A;  1H43 A;  5ISU A;  1UIV A;  1SI0 A;  3VFJ A;  4YKK A;  3V8X B;  2DE3 A;  5ICQ A;  1TFA A;  4EQ9 A;  2B65 A;  1AOV A;  1FQE A;  3QSL A;  1UTH B;  3N6T A;  1Y1Z A;  1B1H A;  4YB6 A;  5A5X A;  2QS2 A;  5I56 B;  3H06 B;  1Z7M E;  1AH5 A;  3M3K A;  5ITP A;  1D3K A;  4U2R A;  3O66 A;  4NF5 A;  3SKP A;  4L17 A;  2H25 A;  3N6U A;  2DOJ A;  2B3B A;  4AQ4 A;  3C35 A;  1N3X A;  3UA8 A;  2XXU A;  3OEM A;  3UN6 A;  1TT1 A;  4DXB A;  1FTM A;  1PBQ A;  1SW5 A;  3VVD A;  1RYO A;  2UVI A;  1XT8 A;  1IIT A;  2H5Y A;  3TDJ A;  1A54 A;  5I59 A;  4EF2 A;  4ZZA A;  1HSJ A;  1H3D A;  4THI A;  2HXW A;  1H45 A;  5H8F B;  1XVY A;  4AB6 A;  1LAX A;  3PPN A;  1P1O A;  2G93 A;  4BDR A;  2QSX A;  4YKJ A;  4OET A;  5DVF A;  2F7C A;  4YIC A;  4EF1 A;  1P1N A;  5JK4 A;  4LP2 B;  4F2Q A;  2V93 A;  3RT6 B;  3IOU A;  3O6I A;  4POW A;  4IGR A;  1S9T A;  4LON B;  2D21 A;  1J1N A;  2NXO A;  2IA4 A;  3LSW A;  3IJX B;  2HZL A;  3KEI A;  2QS1 A;  5TPA A;  3C31 A;  3HHF A;  3UIF A;  3S9N C;  3RT8 A;  1SW4 A;  3G3F A;  3H3G A;  3T22 A;  4QHQ A;  2I4C A;  4RA1 A;  4RXL A;  3TOD A;  4ELO A;  1AMF A;  4OEV A;  1MRP A;  1M5F A;  1MDQ A;  2QMW A;  3THI A;  4NED A;  2HEU A;  1M5D A;  4GOT A;  3CIJ A;  1NH7 A;  3TQL A;  3M8U A;  3KG2 A;  2F34 A;  2ZNU A;  4NF8 A;  1IZ1 A;  3IB1 A;  4ELP A;  3K0V A;  3QYT A;  2XXX A;  1FQB A;  3PMV A;  1LST A;  1UIU A;  3CG3 A;  4ZDM A;  3MVZ A;  1MQH A;  1IXH A;  3K1P A;  3IB2 A;  5I57 B;  4YMA A;  3TEP A;  3EHU A;  1MY0 A;  3UOR A;  2F7A A;  3FJ7 A;  4O3A A;  5TU0 A;  4RPO A;  1I69 A;  3JZJ A;  3DP6 A;  1NL5 A;  3RNN A;  4R73 A;  2Q2C A;  2D3I A;  1JW5 A;  4LVQ A;  3MPK A;  3ONM A;  1P99 A;  1PB9 A;  2F97 A;  1FCK A;  4G68 A;  3MVW A;  1P1Q A;  5EYF A;  2Y7I A;  1DTZ A;  2UVH A;  4R9G A;  1ZTY A;  2FNC A;  3IAZ A;  4HCW A;  4OXV A;  4WXJ A;  1YAE A;  5H8Q A;  3FGS A;  5KCJ B;  2DS9 A;  3C4M A;  1T0K A;  2VD3 A;  4YAH X;  5DVJ A;  3K2D A;  4QFK A;  3O6G A;  3MZ1 A;  2I3W A;  2O51 A;  1USY E;  5L9M A;  2VOZ A;  3AXF A;  3TTN A;  1LBB A;  3PV0 E;  3OO7 A;  3N5L A;  2ZYN A;  4F3B A;  5LOM A;  4U22 A;  2AYS A;  1URS A;  4H65 A;  1FTL A;  1Y20 A;  1GGG A;  4GXA A;  3PUV E;  3V83 A;  4DZ1 A;  2DP8 A;  4GF8 A;  3E13 X;  3HST A;  1B0L A;  3GBB A;  3OMB A;  1SQY A;  1B7Z A;  1ATG A;  4KYD A;  4F22 A;  4G4P A;  4G8H A;  3IOR A;  1R9Q A;  1Z7N E;  3IOW A;  4NF4 B;  3K02 A;  2V84 A;  3PD8 A;  2QPQ A;  3PUX E;  1F9B A;  2ESN A;  5BUU A;  1DTG A;  4PFY A;  5AA4 A;  1UQW A;  4BDL A;  1FQA A;  2DXY A;  4GFR A;  1PEB A;  2XXY A;  2I3V A;  4GD5 A;  5JTY A;  2OZZ A;  4U1Z A;  2XXW A;  3FV1 A;  1LFG A;  2REJ A;  1A8E A;  3O6H A;  3IX1 A;  2V3T A;  3TUS A;  3TCG A;  4H1X A;  3H6T A;  1BKA A;  3KJ7 A;  2HQ0 A;  3C9H A;  1MY3 A;  3ECR A;  3T66 A;  3PU5 A;  1II5 A;  4QFN A;  2Q89 A;  2Q88 A;  4QSE A;  1EU8 A;  3SEX A;  4F39 A;  3FVG A;  4OTE A;  5DYH A;  3I5O A;  2XXV A;  4N6P A;  4IO6 A;  2GRV A;  2CZL A;  5J1D A;  3TTK A;  3VLV A;  2DYX A;  3EN3 A;  4NF6 A;  1I6A A;  1O63 A;  4OVJ A;  1N3W A;  5TP9 B;  1UTB B;  4Q5T A;  1CE2 A;  3ZKK A;  4Z0I A;  3OO6 A;  1MY1 A;  2G29 A;  3E3K A;  2Z23 A;  3I3V A;  4FEC A;  3K01 A;  2AL4 A;  3N26 A;  4BDN A;  4P0I A;  3TCH A;  4KYE A;  3LBS A;  4Q30 B;  4PFU A;  1SW1 A;  3C36 A;  2PT1 A;  4I9D A;  2HAV A;  5K2X A;  4E0X A;  2GFE A;  4I1D A;  1FTJ A;  5K2Y A;  4XKP A;  2ZMB A;  3PPR A;  3C34 A;  3T9U A;  1N04 A;  4OEN A;  3ODB A;  2NWJ A;  4LQ2 A;  1FTO A;  4IO7 A;  4O3B A;  3R7X A;  4QSD A;  3Q25 A;  1VE4 A;  4U21 A;  1B7U A;  1OQG A;  3P7I A;  1FQC A;  1ZJL A;  1ZKB A;  1GVC A;  3Q26 A;  4F19 A;  3K6V A;  4YKI A;  2F36 A;  1ZMG A;  2NVU B;  3PMW A;  3RY3 A;  3CG1 A;  2F6P A;  1B4H A;  4X48 A;  5FHN A;  2R6G E;  3SET A;  4ESW A;  4P11 A;  3CVG A;  3GBA A;  2V3Q A;  3S2V A;  4RY1 A;  3LR1 A;  3T96 B;  3TPA A;  4GIZ A;  5HPQ A;  1JEV A;  1SBP A;  2OWS A;  3TFL A;  3OEN A;  3KFM A;  1TXF A;  2I0B A;  2DQV A;  1GV8 A;  2DE4 A;  4QFL A;  2F35 A;  2O7U A;  2GH9 A;  3H6U A;  1SD3 A;  1VR5 A;  1XVX A;  4YB5 A;  3FJM A;  3QUJ A;  1HSE A;  4IO4 A;  4TQU Q;  4DLD A;  2F78 A;  1JET A;  1B3F A;  4QFO A;  4ZED A;  1NNP A;  2HAU A;  1Y3P A;  2F8D A;  3VXB A;  5H8H B;  2Y7K A;  2HCA A;  2UXA A;  2E0S A;  3VE1 B;  4GQO A;  3MVX A;  4ONY A;  3CFX A;  1N84 A;  2NUV A;  4H6D A;  4KHZ E;  2B3F A;  2DSF A;  1GR2 A;  3C32 A;  3PPQ A;  5B7D A;  1DMB A;  5AE4 A;  3B6W A;  3A3C A;  1NKX A;  4F31 B;  1B0H A;  3G3J A;  3ILU B;  3CR9 A;  1MXX A;  4F29 A;  4OQO A;  5ELV A;  4IY5 A;  4XKQ A;  3WAF A;  2I58 A;  1NMU A;  3CRB A;  3FD3 A;  4KPT A;  3W9W A;  3RTW B;  1SYI A;  4UA8 A;  3T9X B;  4DCX A;  5KZT A;  5HBC A;  1XHY A;  1EZ9 A;  3PUW E;  1TFD A;  4R72 A;  1B51 A;  3U94 A;  2ALU A;  4POX A;  2NOO A;  3K4U A;  2H99 A;  4E0W A;  3EF7 A;  3IJO B;  3K6X A;  3UP9 A;  2HFB A;  4LZ5 A;  3FAS A;  2P0S A;  3OOA A;  4ZS9 A;  1N7X A;  3HCQ A;  1N76 A;  2YPN A;  3FVO A;  1A7L A;  2O84 X;  4K3F A;  2XXP A;  3N94 A;  5FTI A;  4M1V A;  1L5T A;  4KQP A;  3S9M C;  5L9O A;  4RYA A;  3RTF B;  1DPP A;  3O2A A;  4Q8R A;  3G3I A;  3R26 A;  3GZG A;  2I4B A;  3UGW A;  5DEX B;  4TOZ A;  3L6G A;  1OLC A;  4XIG Q;  2O7I A;  3LSF B;  5KDT B;  3FIR A;  5FTH A;  3DP4 A;  4GVO A;  4I8C A;  1N0T A;  1POT A;  4JSD A;  4R6H A;  3QK6 A;  2OJT A;  1PB8 A;  1YCJ A;  3VXC A;  2ZNT A;  2GHA A;  5I2K A;  4PFW A;  5L8D A;  1URD A;  4EXK A;  2I48 A;  1QJM A;  5I58 B;  2D5W A;  3HV1 A;  2I0C A;  4MLV A;  3H6V A;  3TTR A;  3ZSF A;  1MQD A;  1H44 A;  4H67 A;  5CC2 A;  4OFO A;  5CMM A;  3MP8 A;  3KBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...