1IIWA

Glur0 ligand binding core: closed-cleft ligand-free structure
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
226
structure length
221
Chain Sequence
GSAMALKVGVVGNPPFVFYGAFTGISLDVWRAVAESQKWNSEYVRQNSISAGITAVAEGELDILIGPISVTPERAAIEGITFTQPYFSSGIGLLIPGTATPLFRSVGDLKNKEVAVVRDTTAVDWANFYQADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNLNLEVTEIRVSLEPYGFVLKENSPLQKTINVEMLNLLYSRVIAEFTERWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms for ligand binding to GluR0 ion channels: crystal structures of the glutamate and serine complexes and a closed apo state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Membrane protein
molecule keywords Slr1257 protein
total genus 69
structure length 221
sequence length 226
ec nomenclature
pdb deposition date 2001-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iiwA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iiwA02
1RKMA 3H4ZA 4OEVA 4U21A 3GBAA 3PMVA 3I3VA 3RT8A 1TFAA 3FXRA 4RNSA 3Q29A 2XXTA 3CFLA 4HW8A 2G29A 4FE8A 5AE4A 1Q35A 4RXLA 1GVCA 5TPAA 4R6YA 2XX7A 1YPNA 4BDLA 1OVBA 5F1QA 1MY4A 3C4MA 3C33A 4XXUA 3N6TA 4FECA 4LQ5A 1P1QA 4GXSB 1JNFA 2FYIA 3AXFA 1ELJA 4C1TA 1QULA 3TTKA 1A54A 4LA9A 4R74A 3FD3A 3K6VA 3UA8A 3CR9A 2ONRA 1YAEA 2OLBA 1DPEA 1MQHA 1MS7A 4JDFA 4I9DA 1DSNA 4EDPA 1VR5A 1Y3PA 2V93A 1H44A 4R72A 3JYRA 5H8HB 2V3UA 4L17A 2DE3A 4IO3A 3ZSFA 1B1HA 4OTEA 1TT1A 1WODA 3MZ1A 4TLMB 4ZEKA 1POY1 4KYSA 4OXVA 2F5XA 2DYXA 4O3AA 4GLIA 4K3FA 1PDAA 3KSXA 1N76A 2HZLA 2NOOA 1IUDA 1AMFA 2Q89A 2Y84A 3QSLA 4OZ9A 4H67A 2ZNSA 4HCWA 2RC9A 3PUVE 4NF8A 4YKJA 1RYOA 5DT6A 1LAXA 2XX9A 3CG3A 1Z7ME 1OLCA 2DWIA 3E3KA 5L9MA 3RNNA 3QUJA 4OERA 3IX1A 1LCTA 4IGTA 1SBPA 3E9XA 4I1DA 4UACA 3OSRA 1GR2A 2I0BA 2F78A 2NXOA 3G3KA 1GV8A 3CFZA 4ZECA 3TUSA 5AA3A 5I58A 2Z23A 3VV5A 1MDQA 2I3VA 3G3GA 1FW0A 2DVCA 3B7DA 3SEVA 2Y7PA 3VLUA 4DDDA 2F6GA 4C1UA 1UIUA 1Y3NA 3OXNA 2F97A 4OHNA 5TPAB 1N7XA 3KN7A 3SEXA 5K2XA 2DOJA 1PBQA 2X7PA 2VHAA 4JSOA 1NMUA 3S4UA 5TP9B 4YMAA 2AYSA 5ISUA 1S7YA 2VD2A 1AH5A 4QFPA 1Y4CA 3BBRA 5AA1A 3RTWB 3H6UA 3DP4A 3M8UA 1MXYA 3N6UA 2RC7A 1BKAA 2BJJX 2RINA 3K1NA 3MQ9A 4JBZA 3EF7A 1AIVA 4YICA 2RKMA 3WAFA 2REGA 2I58A 3S2VA 2ZXTA 5HPQA 1VE4A 2HEUA 4M4GA 4R73A 3VFJA 5J1DA 3PU5A 3DP8A 1B4ZA 1QJMA 4IGRA 2UVIA 1I69A 1II5A 1UTBA 4R2FA 1MY2A 3CRBA 4F3PA 4RA1A 3PPNA 4MLQA 4YKKA 4GXAA 1ANFA 1LSTA 4GOTA 4DE8A 3FASA 3IORA 2ZYNA 1N84A 1O64A 3PUYE 3OOAA 4OENA 3T9XB 5AA2B 4NF6A 1JW1A 3G3FA 2YJPA 3MVWA 4ZE8A 3RY3A 4WEPA 3VVFA 1M5DA 4F18A 1Y4TA 5LOMA 2H25A 4ZEBA 4DCXA 4FEBA 4U4SA 1QW0A 1SDXA 4H6DA 3TTLA 5I57A 5KZTA 2B3BA 3K4UA 1SYHA 3K6XA 1D4NA 1QVSA 3U1OA 1TWYA 2CMOA 4NF4A 1LCFA 1LBCA 1LBBA 1YTVA 3IO6A 5H8NA 4H0WA 2I6EA 4JWXA 2PX1A 3FJGA 1XOCA 1OIBA 3S9LC 4BDRA 3FXUA 1US5A 2I3WA 3SERA 5HM4B 1DTGA 4OVJA 1L5TA 2DWAA 4ELOA 1A7LA 1NFTA 2UYEA 3R26A 2AL5A 1NNFA 1MXVA 1D9YA 2O7IA 1QUIA 3C9HA 3Q25A 1MM7A 1FQFA 1US4A 2E0SA 3PGFA 3CSGA 1H3DA 4KPTA 3TDJA 1MG1A 3VVEA 5TP9A 5B7DA 5I56B 5JEIA 2ZYMA 2XXUA 4YU0A 3IO4A 1EZ9A 4RK2A 1R6ZA 5DEXA 3K6UA 3P7IA 4JWOA 4NEDA 3E13X 1N3WA 4HTGA 4OWDA 1Y20A 1B3LA 3KJTA 2D21A 4F1VA 5KCJB 2WKYA 2O51A 1BIYA 3G7WA 3O2AA 3PD9A 2F6PA 3K6WA 4MH5A 3ILUB 1IEJA 4U1ZA 3G3JA 1DOTA 4XKRA 2QRYA 4ESWA 3LR1A 1MXWA 4F3GA 4GWOA 2DWHA 4NF6B 1I6AA 4POXA 4RPOA 2PBWA 4WEDA 4ECFA 3H6VA 3RLFE 5CBSA 3MP8A 4QSDA 2YLNA 1J1NA 4PP0A 2Q2AA 3IOVA 4PE5B 3TZAA 2QS1A 1D3KA 2QJEA 1P1WA 4H8JA 2H99A 1XHYA 2X26A 3LSXA 5FTHA 4FIMA 4OYVA 1Z7NE 3O6HA 3SDFA 3B6QA 2O1LA 4NTLA 4F3BA 4QFLA 4QF9A 4XKPA 5AA2D 5H8FA 4NF5A 4O3CA 2ZNUA 3N26A 3QK6A 4GL0A 3RN8A 1A55A 2M8CA 3K1PA 3M3LA 3OD7A 3Q26A 4HCYA 4ND9A 4U23A 1B4HA 1OLAA 4ELRA 5H8QA 1IZ1A 2GRVA 1B1XA 3KGCA 4N13A 1JVYA 4YKIA 1SQYA 5H8FB 4EUOA 4Q8RA 1HSJA 2QS3A 3A3CA 1MXUA 4OFOA 1YCJA 3IB1A 4R6HA 1NL5A 3FVGA 1IQ7A 1B46A 1Y9UA 4PFWA 1UTBB 2XX8A 2H4IA 4XKNA 4NWCA 1PEBA 3T96B 1FTLA 4DXUA 5KDTA 3IR1A 4Q30B 1MQJA 3T66A 5IKBA 4XKQA 3T22A 1D9VA 3USDA 4AB6A 3LUYA 5A5XA 3W9VA 4LATA 1B5JA 3B6WA 4ELQA 3EHSA 3VLWA 1MPDA 1XVYA 2UVJA 4LUBA 2ZYOA 1IXHA 2AL4A 2OJTA 2Y7KA 4GVOA 4OFJA 1PC3A 4LZ7A 1UQWA 3FXQA 4IO7A 4RJZA 1CE2A 3TODA 1NNKA 1PB7A 3ZKKA 3IOUA 3CG1A 5DVIA 3OO7A 3TTMA 4LP2B 3MVYA 1B6HA 4QHQA 2XXIA 1H45A 1LGBC 3HO7A 3MPLA 3PMXA 1M5CA 1MQIA 3K01A 3TQLA 1F9BA 3VVDA 3I6VA 5CM6A 2P2AA 5CMKA 3LBSA 3QAXA 2XXPA 3MC2A 3OO6A 3C36A 2G93A 3FVKA 3MJNA 4P0GA 3RTFB 5I59A 4EQ7A 3OELA 4G2ZA 1POTA 3PUWE 4G68B 1H76A 2XXVA 3HPIA 4OFLA 4EQBA 1HSEA 2DS9A 1IXIA 2F7BA 5L9SA 4IO4A 1Y1ZA 3RQTA 4F1YA 3FV1A 3ONMA 3I5OA 3OENA 1NNPA 5DVFA 2XXQA 3OO8A 4OQOA 5I2NB 3LSWA 5I59B 1PB9A 4ESXA 2V3TA 3E4RA 3MWBA 1VFDA 3QYTA 4G68A 4ISUA 1OQGA 5BWJA 3HHGA 2PT1A 1EZPA 4BDQA 5FTIA 4JSDA 5HBCA 3IJXB 2R6GE 4TOZA 5H8SA 4X1DA 2F8DA 1ZTYA 1CB6A 2GFEA 4KHZE 5CMCA 1DTZA 3BFTA 3IB0A 3FZVA 1B3FA 3N5LA 3N94A 4OESA 4F29A 3PD8A 1M5EA 5B70A 2DE2A 1QKAA 3K02A 3H6TA 4NF5B 3UIFA 4DXCA 1ZLQA 1N7WA 3U92A 4EXKA 1P1NA 2V84A 2Q9TA 3ZS6A 4ZE9A 1HSLA 4M1VA 1MM6A 3PPPA 1VSOA 5M2VA 2ONKE 3EHTA 1MXZA 3UN6A 1NH8A 1MQDA 4Q0CA 1EZOA 3IK6B 1JEUA 3IL1B 2O6AA 1B5HA 1BP5A 1MY1A 2HQ0A 3JZJA 4YMBA 3K00A 4G4PA 4P11A 1TXFA 4RYAA 1ZBMA 2Q88A 4GL8A 4YKPA 2NVUB 3V5AA 5EHSA 2HAVA 5L9OA 1DMBA 1SW5A 1AOVA 2OWSA 2RC8A 4Z7EA 3FJMA 1FTMA 1N04A 1MPCA 3IB2A 1PBPA 3IAZA 4F39A 1P99A 2ABHA 4NMYA 2YPNA 4AQ4A 5JK4A 1UTHA 5KCJA 4DXBA 1I6QA 4IY5A 4IB2A 5FHOA 3HN0A 3S9NC 3L6GA 1B3HA 3OEMA 1LAFE 1QUKA 2XXYA 1Y3QA 3TMGA 4BDOA 1BTJA 1DPPA 1LLSA 2OZZA 4H1XA 1O63A 2I4BA 3VDFA 1ZU0A 5I2NA 1B7HA 3CSBA 3FUZA 1IXCA 3O28A 2O68A 1USYH 3VXBA 4BDNA 3IJOB 4I8CA 5EYFA 3T9HB 1BLFA 3CVGA 5DEXB 4TQUQ 4F2QA 4RY1A 2UVHA 2H9BA 2DP8A 2F36A 2VOZA 5L8DA 1GGGA 3T9UA 1SI0A 1B7UA 3CI8A 3KSJA 1ZIUA 4WXJA 1B3GA 2UXAA 3EQ1A 4G77A 4FJPA 1B3EA 3EHUA 2ALUA 1MH4A 2O1MA 2VP1A 1SD3A 3PPOA 2DQVA 1QKBA 1ZKBA 4NE4A 4PFYA 4R6KA 4E0XA 2XD3A 2ZNTA 3OSQA 4OEUA 2AIXA 1S50A 2X7QA 3H3GA 2F7CA 3D4CA 4MBPA 3KFMA 3O9PA 2CZLA 5K2YA 5JTYA 3MZ9A 4ZS9A 2Y7RA 2I0CA 1N0TA 1SVXB 4HS7A 2IEEA 4IO5A 4F22A 4I62A 2FA7A 1LAGE 5JTYB 1JVXA 1LB8A 3MP6A 4GF8A 3IOTA 5I56A 1GTKA 2VGQA 4H8IA 2A5SA 3L6HA 4OMBA 2O69A 4IO6A 3S9MC 2ESNA 2OCUA 1B32A 3MW0A 3SKPA 4G68C 1FQDA 3PPQA 3KOSA 2QMXA 3U94A 1B58A 3FVNA 3DP6A 1URSA 4X48A 3RUMA 3TTRA 3U8QA 1A8EA 4F2OA 4FAJA 3C32A 1UTHB 2H5YA 2XXHA 3HV1A 3TAJA 1XC1A 2R71A 2PMSA 2VD3A 4JXIA 4WKMA 2NWJA 1R9QA 4NWDA 3R7XA 4X1BA 3PUZE 2A5TB 5I2KA 1URGA 4G8NA 3F11A 2PYYA 4H5GA 4ZDMA 3SEYA 3DM0A 3O6GA 4F1UA 1LAHE 4KR5A 4ZZEA 1P1UA 2GHAA 3MBPA 3QXMA 3VLVA 1EU8A 1FTJA 4GQOA 3R6UA 4KFQA 3VXCA 4POWA 2DVZA 2O7UA 3H7MA 1MH3A 1P1OA 4KYEA 1RYXA 1MY3A 2HFBA 4X9TA 2RF1A 5ELVA 3ZKLA 3H6WA 3O6IA 3DELB 1B52A 4IY6A 4LVQA 2RCAA 5EHMA 2ONSA 3D4GA 3TTNA 3EN3A 2FNCA 3TCHA 3FIRA 4FEDA 4R75A 4U1OA 1B7ZA 2H98A 4ELPA 3KOTA 4GIZA 3B6TA 3Q27A 5FHMA 1SW1A 1FQEA 2GHBA 1ZMGA 1H43A 4H5FA 3HSTA 2V3QA 4KCCA 4LQ2A 4LZ8A 4QSCA 1A99A 1R9LA 2Z22A 3MVZA 4JB7A 2Y7WA 3U72A 3UK4A 2XHDA 3EPEA 2QMWA 1M5FA 2B3FA 3PV0E 5DVJA 1A40A 3RPWA 2W7YA 1B05A 2QS4A 4YZZA 5A5XB 4R9FA 3V89B 4NF8B 4QSEA 3TCGA 2KLFA 4GD5A 4KYDA 5CRYA 1LB9A 3BFUA 2DXRA 4UA8A 3TFLA 3KEIA 4F31B 3K2DA 1MXXA 4P0IA 4R2BA 5ITOA 4F3SA 2B65A 3A09A 4XTCQ 3H06B 1FCKA 4GRKA 2I4CA 1LFIA 2F35A 1JQFA 3GLBA 5CMMA 5I57B 4LZ5A 4G8MA 1M5BA 1MY0A 1SW4A 3LSFB 1N3XA 3JV9A 2Z8FA 1B40A 3PUXE 2REJA 4G8HA 4PETA 4U2RA 3VE1B 3S9EA 1B0HA 2E1SA 2PVUA 4FATA 1SI1A 2HZKA 1QUJA 3K1MA 3O97A 4ONYA 2P1SA 2Q8JA 3THIA 3C31A 3TYHA 5I84A 3FV2A 2DE4A 4EXLA 5AA4B 5BUUA 4RPNA 1URDA 3U93A 3UORA 3WAEA 3TPAA 3T93B 4Z0IA 2XXWA 4PFUA 3O66A 2V25A 3C35A 3ILTB 3QIMA 3PPRA 4QFKA 4DZ1A 1ATGA 1USYE 1WDNA 1XVXA 2IA4A 2XD2A 3LC8A 3RGYA 5CC2A 1LFGA 4YAHX 1XT8A 2I49A 1WVJA 3HHFA 3W9WA 1XS5A 3KJ7A 3LSLA 1R1NA 1VFEA 4F19A 2Z8DA 5CMBA 5AA2A 3TEPA 4EF1A 4KCDA 2QL3A 4GFRA 1JETA 1Y1MA 2GH9A 1MPBA 2OWTA 1B5IA 3MAMA 4MF3A 1B51A 4U4XA 5FHNA 1KWHA 3GXAA 3GZGA 4U22A 1OMPA 3A3UA 4ZZAA 3RT6B 1AL3A 3M3FA 2DWJA 3UGWA 1JW5A 4KD5A 1O7TA 2UVGA 1T0KA 2Q2CA 2HAUA 1IXGA 1JEVA 3PMWA 4THIA 1MDP1 4PQJA 1OQHA 4C0RA 4BLAA 2QSXA 4YB7A 4DIGA 2A5TA 2QPQA 1ZJLA 2R9JA 2Z8EA 5I2KB 5H8NB 3HCQA 4YB6A 2D3IA 3K0VA 4KQPA 4ZEFA 5AA4A 2D5WA 1B0LA 3BKIB 1FQCA 3FJ7A 3G3HA 3KZGA 3M3KA 3OMBA 3KN3A 4R9GA 5H8HA 4QFNA 4DCYA 2ZMBA 3TQWA 4OETA 3C34A 3SEUA 3T9VA 3V83A 3TELA 4N07A 4XIGQ 1I6BA 3TCFA 2HXWA 1FTOA 5CBRA 3FGSA 3O29A 4YB5A 4ZEDA 3MZBA 5I58B 3MVXA 3GBBA 1FQAA 1FQBA 3KBRA 1MQGA 3OEKA 4LONB 4QRZA 2PT2A 2DSFA 3KG2A 2DXYA 3W15C 4DLDA 3Q28A 3MPKA 1Q1KA 2ANJA 2F7AA 5F7VA 3V8XB 4PFTA 3DLNA 4O3BA 2I48A 2XXXA 4MFIA 3SEWA 1IITA 1OVTA 4RK9A 1S9TA 4FORA 2QS2A 1NKXA 3MUQA 4KI0E 3CIJA 3MP1A 4AB5A 4IO2A 4EF2A 3OO9A 1SW2A 4NF4B 1NH7A 3FATA 2OBGA 3CFXA 1UIVA 2UYFA 4E0WA 5IAIA 3G3IA 4MLVA 4BDMA 3KN8A 2NUVA 3UP9A 5TU0A 2ZYKA 2O84X 5ICTA 1NNTA 2Y7IA 1FTKA 5H8QB 3ODBA 4ZEIA 4TLLB 2F34A 2OK2A 4EQ9A 5ICQA 1LFHA 2LAOA 3IOWA 4H65A 4Q5TA 4QFOA 5DYHA 4JWYA 1IIWA 1SYIA 3SESA 1TFDA 2P0SA 3ECRA 1B9JA 3H03A 4N6PA 3FVOA 2RCBA 2THIA 1JW4A 1B2HA 2XXRA 3QUFA 5ITPA 1EH3A 5DTBA 5KDTB 1A8FA 3TKDA 1PB8A 2HCAA 1MRPA 3SETA 5CI5A
chains in the Genus database with same CATH superfamily
1EYJA 3PMVA 3RT8A 3I3VA 3U65A 1Q35A 1GVCA 5F1QA 2WYKA 1MY4A 4XXUA 4PBHA 3N6TA 3AXFA 1ELJA 3FD3A 1YAEA 1DPEA 1MQHA 4JDFA 1DSNA 2V93A 2DE3A 3ZSFA 1B1HA 1WODA 4ZEKA 4OXVA 2HZLA 2Y84A 4HCWA 4NF8A 5DT6A 1LAXA 1Z7ME 3RNNA 1LCTA 2CZIA 4UACA 3TUSA 3B8BA 2KQZA 3CFZA 5AA3A 1MDQA 4MMPA 1N7XA 5K2XA 1PBQA 2VHAA 1NMUA 1S7YA 5AA1A 1NUYA 3DP4A 3N6UA 1BKAA 4JBZA 4YICA 2RKMA 2REGA 1VE4A 4M4GA 3PU5A 4HE2A 5ET5A 1D9QA 1I69A 1II5A 4R2FA 1CNQA 4GXAA 1LSTA 4GOTA 3FASA 3T9XB 3G3FA 2YJPA 3MVWA 4ZE8A 1M5DA 5LOMA 4DCXA 4U4SA 1SDXA 5I57A 3K4UA 2DDKA 1D4NA 1LBCA 1YTVA 5H8NA 1OIBA 3SERA 5HM4B 1DTGA 4ELOA 3C9HA 1QUIA 3Q25A 4GWUA 3TDJA 1H3DA 2ZYMA 1EZ9A 3K6UA 4NEDA 4HTGA 1N3WA 2R8TA 3KJTA 4F1VA 2O51A 3PD9A 4U1ZA 4PGNA 2F6PA 3G3JA 4ESWA 4F3GA 2QRYA 5EQ8A 3KC1A 4WEDA 3H6VA 5CBSA 3MP8A 4QSDA 3TZAA 1D3KA 2QJEA 4H8JA 2FVZA 3SDFA 3O6HA 3B6QA 5H8FA 3RN8A 3K1PA 1OLAA 5H8QA 4N13A 1JVYA 1IQ7A 1Y9UA 4PFWA 4XKNA 4NWCA 1DBZA 4XKQA 1D9VA 3USDA 3LUYA 4LATA 4ELQA 3EHSA 4LUBA 2Y7KA 1PB7A 3CG1A 1FBEA 1F9BA 2XXPA 3RTFB 3FVKA 1FTAA 4EQ7A 2XXVA 5L9SA 1YXIA 4F1YA 3OENA 5DVFA 4OQOA 3E4RA 3MWBA 4ISUA 1OQGA 1EZPA 4BDQA 4JVDA 5H8SA 1FBFA 2F8DA 5CMCA 4KHZE 5B70A 1ZLQA 3U92A 2WBBA 1VSOA 2ONKE 1NH8A 1EZOA 1B5HA 4P11A 2NVUB 3V5AA 4MNPA 5EHSA 2RC8A 4OVSA 4NMYA 2YPNA 1UTHA 4DXBA 3S9NC 1LAFE 1QUKA 2OZZA 1IXCA 1USYH 3IJOB 4I8CA 4I40A 1AWBA 3T9HB 4RY1A 2H9BA 1ZIUA 2DQVA 1QKBA 4NE4A 2ZNTA 4OEUA 2X7QA 3KFMA 3O9PA 1FBGA 2Y7RA 2IEEA 1LB8A 1GTKA 4H8IA 2A5SA 1FPBA 3S9MC 1B32A 4I3EA 3SKPA 1B58A 1A8EA 3C32A 1UTHB 2H5YA 4NGUA 4WKMA 3PUZE 4ZDMA 3O6GA 4F1UA 4KFQA 3VXCA 1MH3A 3ZKLA 4X9TA 3H6WA 1B52A 2ONSA 3EN3A 2FNCA 3KOTA 2GHBA 1ZMGA 4LZ8A 3MVZA 4JB7A 3UK4A 1NUXA 4KYDA 1IMFA 4P0IA 3KC0A 2I4CA 2F35A 1JQFA 3GLBA 5I57B 4G8MA 1MY0A 4PETA 3S9EA 2XXKA 2HZKA 3O97A 5I84A 2DE4A 5ET7A 3TPAA 2XXWA 3QIMA 3PPRA 3RGYA 1WVJA 3KJ7A 3LSLA 1R1NA 2HHMA 4KCDA 2OWTA 1B5IA 3GZGA 1OMPA 1XI6A 1AL3A 5LDZA 2DWJA 4KD5A 1O7TA 3T0JA 1IXGA 4PQJA 1FPLA 2A5TA 1ZJLA 5H8NB 2VT5A 3HCQA 2D3IA 4KQPA 1B0LA 1FQCA 3M3KA 3OMBA 4R9GA 2FBPA 4QFNA 4DCYA 3TQWA 4OETA 3C34A 3SEUA 3T9VA 3TELA 5IGAA 4ZEDA 3MZBA 1FQAA 4QRZA 3KG2A 2WYPA 4IR8A 1EYKA 4NAPA 2ANJA 3DLNA 1DK4A 2I48A 2FHYA 5EYHA 3SEWA 4RK9A 2QS2A 3MUQA 3CIJA 4GBVA 3FXBA 3OO9A 1NH7A 2OBGA 3CFXA 4KXPA 2UYFA 4BDMA 2NUVA 5TU0A 2Y7IA 3ODBA 4TLLB 2LAOA 3LV0A 5DYHA 4N6PA 1B9JA 2XXRA 1JW4A 5DTBA 1MRPA 3H4ZA 3GBAA 4N6DA 3FXRA 4RNSA 2G29A 2XX7A 1YPNA 4BDLA 3C4MA 4C1TA 3TTKA 1A54A 4LA9A 3K6VA 3CR9A 4I3YA 1IMDA 1VR5A 1LBVA 1H44A 3JYRA 4L17A 4OTEA 1TT1A 4PDHA 4TLMB 4PDDA 1POY1 4O3AA 4K3FA 1N76A 2NOOA 2Q89A 1IUDA 4OZ9A 2RC9A 3PUVE 3CG3A 2XX9A 3E3KA 5L9MA 4OERA 3IX1A 4IGTA 1SBPA 4HE0A 2OWZA 3OSRA 2I0BA 3G3KA 2NXOA 4ZECA 5I58A 2I3VA 5IM2A 3B7DA 3VLUA 1Y3NA 5TPAB 4OHNA 1KA0A 3SEXA 4YMAA 3BBRA 3H6UA 2B4MA 2RC7A 2BJJX 2RINA 2I58A 3S2VA 5J1DA 1JP4A 3DP8A 1QJMA 1B4ZA 4IGRA 2UVIA 1UTBA 2FIEA 4F3PA 3PPNA 4MLQA 5IZ3B 4DE8A 3IORA 1N84A 1O64A 4NF6A 3VVFA 4ZEBA 1QW0A 1LBXA 5KZTA 2B3BA 3K6XA 1SYHA 3U1OA 1TWYA 2CMOA 4NF4A 2WEFA 3IO6A 2PX1A 3FJGA 1L5TA 1MXVA 2AL5A 1MM7A 3PGFA 3CSGA 4MIJA 4RK2A 3P7IA 4JWOA 1Y20A 2D21A 2QFLA 1BIYA 3G7WA 3O2AA 1IEJA 1DOTA 3LR1A 1MXWA 4POXA 4RPOA 2PBWA 3RLFE 2YLNA 1J1NA 1NV0A 4PE5B 1P1WA 5EYGA 5FTHA 3E79A 3RPLA 4QFLA 4QF9A 4XKPA 5AA2D 4O3CA 2ZNUA 4GBWA 2M8CA 4ND9A 3Q26A 4HCYA 2GRVA 3KGCA 3A3CA 2QS3A 1MXUA 1UTBB 2XX8A 5KDTA 1FPEA 1YYZA 1IMBA 5A5XA 2UVJA 1XVYA 1IXHA 2OJTA 4GVOA 1PC3A 3FXQA 4IO7A 1CE2A 3MVYA 4QHQA 4O7IA 1H45A 3HO7A 3MPLA 3ROJA 3TQLA 2P2AA 3OO6A 2G93A 2PCRA 4G2ZA 1POTA 4G68B 2DS9A 2F7BA 1Y1ZA 3ONMA 3I5OA 5ESYA 5I2NB 3OO8A 4ESXA 1VFDA 4P56A 3IJXB 1ZTYA 1DTZA 3IB0A 3N5LA 3FZVA 3N94A 4OESA 4P8BA 2DE2A 3K02A 4DXCA 4ZE9A 1MM6A 3PPPA 1MXZA 5I3SA 3IK6B 1JEUA 3JZJA 1BP5A 3K00A 1TXFA 3BIHA 4YKPA 2Q88A 1DMBA 3B50A 4Z7EA 3IB2A 1MPCA 4F39A 5JK4A 5KCJA 4MJOA 1I6QA 4IY5A 4IB2A 4NHBA 5FHOA 2Y5LA 1B3HA 4N15A 4H46A 4H1XA 3VDFA 1ZU0A 5LTCA 5I2NA 3FUZA 3VXBA 3CVGA 5DEXB 5L8DA 1GGGA 2P3NA 4AS5A 1B7UA 3CI8A 4OANA 2UXAA 4FJPA 1MH4A 3OSQA 2F7CA 5FBPA 5JTYA 4PE3A 1N0TA 4F22A 1RDXA 2FA7A 1LAGE 5I56A 2ESNA 4MHFA 4G68C 1URSA 4X48A 4F2OA 1LEVA 2R71A 2NWJA 4NWDA 2A5TB 1NUWA 4G8NA 1FPJA 3F11A 4H5GA 1LAHE 4KR5A 4ZZEA 2GHAA 1EU8A 1FTJA 4GQOA 4POWA 1KA1A 2O7UA 1K9YA 2HFBA 5ET6A 1Q9DA 3B6TA 2Y7WA 3PV0E 1M5FA 2W7YA 4YZZA 3D1RA 2DXRA 3GYYA 3K2DA 5EQ9A 5ITOA 4F3SA 4XTCQ 3H06B 5CMMA 1M5BA 3LSFB 3PUXE 2Z8FA 2REJA 4NN3A 1B0HA 4FATA 2P1SA 3U93A 3T93B 5DW8A 3O66A 3C35A 1VDWA 4QFKA 2IA4A 1XVXA 2XD2A 4GWZA 2CEXA 5CC2A 3HHFA 1XS5A 1FRPA 2WBDA 1VFEA 3TEPA 4EF1A 4GFRA 1JETA 2GH9A 1MPBA 3A3UA 4ZZAA 2Q2CA 1JEVA 1MDP1 4BLAA 4YB7A 2Z8EA 2D5WA 3FJ7A 5H8HA 5J16A 3V83A 4N07A 4XIGQ 5CBRA 3O29A 1NV5A 1FQBA 1MQGA 2DSFA 4DLDA 1K9ZA 3Q28A 2F7AA 4MFIA 4KI0E 3FBPA 4MNCA 5IAIA 1LBZA 1NNTA 2QVUA 3IOWA 4Q5TA 1SYIA 1TFDA 3FVOA 2RCBA 2THIA 3QUFA 2ZZVA 1EH3A 1A8FA 2WX9A 1PB8A 1EYIA 3SETA 4OEVA 4U21A 3Q29A 4HW8A 4FE8A 5AE4A 4RXLA 1FJ9A 4FECA 1JNFA 2FYIA 1G0IA 2OLBA 4PAIA 4EDPA 1Y3PA 5H8HB 4OVQA 4IO3A 1INPA 4KYSA 1FBHA 2DYXA 4NG7A 5TP9B 4YKJA 2ZNSA 1RYOA 2KR0A 3QUJA 5A5LA 1GR2A 2F78A 2ZZWA 1GV8A 1KZ8A 4QXDA 1IMCA 2Z23A 3VV5A 1FW0A 4GX4A 4DDDA 2F6GA 3PTYA 1UIUA 2F97A 3KN7A 4PBQA 3EKIA 4P1LA 4JSOA 4N91A 2GQ1A 4QFPA 1Y4CA 2HEUA 3CRBA 4RA1A 2ZYNA 3PUYE 5AA2B 1JW1A 3RY3A 4X04A 3MSTA 1Y4TA 2H25A 4H6DA 2XWVA 3TTLA 1LCFA 4H0WA 4JWXA 1XOCA 3S9LC 4BDRA 3FXUA 4OVJA 5I7IA 1A7LA 1NFTA 1FSAA 2UYEA 1D9YA 2O7IA 1FJ6A 1FQFA 4PGPA 3VVEA 5B7DA 5TP9A 5I56B 5JEIA 4YU0A 3IO4A 5DEXA 4OA4A 4OWDA 2CEYA 5KCJB 3ILUB 4GWOA 4NF6B 3IOVA 2Q8MA 2QS1A 2H99A 1XHYA 2X26A 4OYVA 1Z7NE 2O1LA 4NTLA 4F3BA 3QK6A 4GL0A 3M3LA 3OD7A 4ELRA 1IZ1A 1B1XA 4YKIA 5H8FB 1HSJA 4OFOA 3ISPA 4R6HA 3FVGA 1B46A 2H4IA 3T96B 3IR1A 4Q30B 3T66A 3RYDA 4AB6A 2Y5KA 3W9VA 3B6WA 4HE1A 3VLWA 2ZYOA 2AL4A 4LZ7A 1UQWA 4RJZA 3TODA 1NNKA 3ZKKA 4N4UA 3IOUA 1B6HA 2BJIA 1LGBC 3PMXA 1RDZA 4DI3D 1MQIA 3I6VA 5CM6A 5CMKA 3LBSA 4P0GA 4PFBA 4N8GA 3MJNA 3NOHA 3PUWE 3HPIA 4OFLA 1HSEA 1IXIA 3RQTA 3FV1A 1NNPA 3LSWA 2F3BA 2V3TA 1RDYA 4G68A 5BWJA 4PAKA 5FTIA 4JSDA 5HBCA 4X1DA 1NV2A 1CB6A 2GFEA 3BFTA 4F29A 1QKAA 3UIFA 2XWKA 2V84A 3ZS6A 1HSLA 3IFAA 5M2VA 3EHTA 4GWXA 3UN6A 4Q0CA 1IMAA 2O6AA 2HPGA 4G4PA 4C1UA 1BK4A 2ABHA 4JVIA 4PTKA 2PFZA 3OEMA 2XXYA 3TMGA 1Y3QA 1BTJA 1LLSA 2I4BA 4BDNA 3O28A 2B4LA 2O68A 4P1EA 4O94A 4TQUQ 3T9UA 3EQ1A 4G77A 2ALUA 1IMEA 4GX3A 4PFYA 4R6KA 2XD3A 1S50A 3D4CA 4MBPA 4MNIA 4PAFA 3MZ9A 1SVXB 4HS7A 4IO5A 4I62A 5JTYB 4GF8A 2VGQA 2L5VA 4PC9A 3MW0A 3PPQA 3KOSA 3U94A 3TTRA 3RUMA 5EQ7A 4MCOA 4NX1A 5EQAA 4JVCA 2XXHA 3TAJA 1XC1A 2PMSA 4X1BA 5I2KA 1URGA 3SEYA 5IZ1A 3DM0A 1DCUA 1P1UA 3MBPA 2DVZA 1P1OA 3QMFA 1RYXA 1MY3A 2RF1A 3O6IA 5T3JA 5EHMA 2RCAA 4N17A 3FIRA 4U1OA 4R75A 4ELPA 1B7ZA 4GIZA 1NV6A 5FHMA 1SW1A 1FQEA 1H43A 4LQ2A 3HSTA 4XEQA 2Z22A 3U72A 5DVJA 1B05A 4MX6A 4QSEA 3TCGA 2KLFA 1LB9A 3BFUA 4UA8A 3TFLA 3KEIA 1MXXA 3E78A 4R2BA 2B65A 1FCKA 4DI4B 1SW4A 1N3XA 3JV9A 3VE1B 1B40A 4U2RA 2E1SA 1QUJA 3K1MA 4ONYA 3THIA 3C31A 1FBDA 4EXLA 4XFEA 5BUUA 4X8RA 3UORA 4Z0IA 4PFRA 3ILTB 1USYE 1LFGA 1FPIA 4YAHX 1XT8A 2I49A 4F19A 2Z8DA 5CMBA 5AA2A 2QL3A 3MAMA 1NV4A 5FHNA 4U22A 3RT6B 3M3FA 2UVGA 4THIA 4DIGA 2QPQA 2R9JA 2OX3A 1FPFA 4YB6A 3K0VA 4ZEFA 5AA4A 3BKIB 2V4CA 3KZGA 4N81A 4NQ8A 1I6BA 1FTOA 3FGSA 1QGXA 4O8MA 3GBBA 3RPLB 3KBRA 3OEKA 2JJKA 2DXYA 3W15C 3MPKA 1Q1KA 3V8XB 1S9TA 1NKXA 3A29A 4IO2A 4EF2A 1FPDA 3FATA 3G3IA 4MLVA 3KN8A 2ZYKA 4XF5A 4EQ9A 1FTKA 4ZEIA 5ICQA 2F34A 2OK2A 1LFHA 2Q74A 4H65A 4QFOA 4JWYA 1IIWA 3SESA 3ECRA 4HXVA 1B2HA 5KDTB 1FPGA 2QVRA 1B4HA 3KSJA 5CI5A 1RKMA 4LN5A 1TFAA 2XXTA 3CFLA 4OVTA 5TPAA 4R6YA 1OVBA 4FBPA 3C33A 4LQ5A 1P1QA 4GXSB 1QULA 4R74A 3UA8A 2ONRA 1MS7A 4I9DA 4NF0A 4R72A 2V3UA 3MZ1A 2F5XA 4GLIA 1PDAA 3KSXA 3QSLA 5I59A 1AMFA 4H67A 4P3LA 1OLCA 2DWIA 4GWSA 1LBWA 3E9XA 4I1DA 3G3GA 2DVCA 3SEVA 2Y7PA 3OXNA 5IZZA 2DOJA 2X7PA 3S4UA 5ISUA 2AYSA 2VD2A 1AH5A 1LBYA 2F3DA 3RTWB 3M8UA 1MXYA 3K1NA 3MQ9A 3EF7A 1G0HA 1AIVA 4UABA 3WAFA 5HPQA 2ZXTA 4R73A 3VFJA 1MY2A 4YKKA 4PF6A 1NUZA 1ANFA 2CZHA 3OOAA 4OENA 3MYUA 4F18A 4WEPA 4FEBA 1QVSA 1LBBA 2I6EA 1US5A 2I3WA 2DWAA 3R26A 1NNFA 5ET8A 1T0KA 4KPTA 1US4A 2E0SA 1MG1A 2XXUA 1R6ZA 3E13X 1B3LA 2WKYA 4XKRA 4MH5A 3K6WA 5CRYA 4C0RA 2DWHA 1I6AA 4ECFA 4GX6A 4PP0A 2Q2AA 3LSXA 4FIMA 3KBZA 5F24A 4NF5A 3N26A 1A55A 4U23A 4EUOA 1SQYA 4Q8RA 1YCJA 3IB1A 3BIGA 1NL5A 1NI9A 1PEBA 1FTLA 4DXUA 1MQJA 5IKBA 3T22A 2HXRA 4PF8A 1B5JA 1MPDA 4OFJA 5DVIA 3OO7A 3CHGA 3TTMA 4LP2B 2XXIA 1M5CA 2ZZXA 3K01A 3VVDA 3QAXA 3MC2A 3C36A 2XWOA 3OELA 1H76A 4EQBA 4IO4A 2XXQA 5I59B 1PB9A 3QYTA 3HHGA 2PT1A 2R6GE 4TOZA 1B3FA 3PD8A 1M5EA 2QVVA 3H6TA 2XWIA 2VPOA 4NF5B 1N7WA 4EXKA 1P1NA 2Q9TA 4M1VA 4GWWA 1MQDA 3IL1B 1MY1A 2HQ0A 4YMBA 4RYAA 1ZBMA 4GL8A 2HAVA 4P47A 2CZKA 4P9KA 5L9OA 1SW5A 1AOVA 2OWSA 3FJMA 1FTMA 1N04A 3IAZA 1PBPA 1P99A 2MKZA 4AQ4A 4PCDA 3HN0A 3L6GA 4BDOA 1DPPA 1O63A 1B7HA 3CSBA 5EYFA 1BLFA 4F2QA 2UVHA 2DP8A 2F36A 2VOZA 1SI0A 4WXJA 1B3GA 1B3EA 3EHUA 2O1MA 2VP1A 1SD3A 3PPOA 4E0XA 1ZKBA 1NV1A 2AIXA 3H3GA 2CZLA 5K2YA 4ZS9A 1YZ0A 2I0CA 3HFUA 4O7MA 1JVXA 3MP6A 3IOTA 3L6HA 4OMBA 2O69A 4IO6A 2OCUA 4MAGA 1NV3A 1FQDA 2QMXA 3FVNA 3DP6A 4FAJA 3U8QA 3HV1A 2VD3A 3R7XA 4JXIA 1R9QA 1FBPA 2P3VA 2PYYA 5I5PA 3QXMA 3VLVA 3R6UA 1NV7A 3H7MA 4N8YA 4KYEA 1FPKA 5ELVA 3DELB 4IY6A 4LVQA 3D4GA 3TTNA 3TCHA 4FEDA 2H98A 3Q27A 3T1BA 4QSCA 4H5FA 2V3QA 4KCCA 1A99A 1R9LA 1SPIA 2XHDA 3EPEA 2QMWA 2B3FA 3SZPA 1A40A 3RPWA 2QS4A 5A5XB 4R9FA 3V89B 4NF8B 4GD5A 4F31B 3IFCA 3A09A 4GRKA 1LFIA 4LZ5A 3LUZA 4G61A 4G8HA 2XA5A 4H45A 4AS4A 2PVUA 4N6KA 1SI1A 2Q8JA 2FIXA 3TYHA 3FV2A 5AA4B 4RPNA 1URDA 3WAEA 4PFIA 4PFUA 2V25A 4DZ1A 1ATGA 1WDNA 3LC8A 2VPNA 3W9WA 1Y1MA 4MF3A 1B51A 4U4XA 1KWHA 3GXAA 3UGWA 1JW5A 3PMWA 1OQHA 2QSXA 5I2KB 4MEVA 3G3HA 4OVPA 3KN3A 2PFYA 2ZMBA 3TCFA 2HXWA 1FBCA 4YB5A 5I58B 3MVXA 4LONB 5IZ3A 2PT2A 5F7VA 4PFTA 4O3BA 4GWYA 2XXXA 1IITA 1OVTA 4QBAA 4FORA 4OVRA 3MP1A 4AB5A 1SW2A 4NF4B 1UIVA 4E0WA 3UP9A 2O84X 5ICTA 5H8QB 2P0SA 3H03A 5ITPA 3TKDA 2HCAA 2HAUA
chains in the Genus database with same CATH topology
1RKMA 3H4ZA 4OEVA 4U21A 3GBAA 3PMVA 3I3VA 3RT8A 1TFAA 3FXRA 4RNSA 3Q29A 2XXTA 3CFLA 4HW8A 2G29A 4FE8A 5AE4A 1Q35A 4RXLA 1GVCA 5TPAA 4R6YA 2XX7A 1YPNA 4BDLA 1OVBA 5F1QA 1MY4A 3C4MA 3C33A 4XXUA 3N6TA 4FECA 4LQ5A 1P1QA 4GXSB 1JNFA 2FYIA 3AXFA 1ELJA 4C1TA 1QULA 3TTKA 1A54A 4LA9A 4R74A 3FD3A 3K6VA 3UA8A 3CR9A 2ONRA 1YAEA 2OLBA 1DPEA 1MQHA 1MS7A 4JDFA 4I9DA 1DSNA 4EDPA 1VR5A 1Y3PA 2V93A 1H44A 4R72A 3JYRA 5H8HB 2V3UA 4L17A 2DE3A 4IO3A 3ZSFA 1B1HA 4OTEA 1TT1A 1WODA 3MZ1A 4TLMB 4ZEKA 1POY1 4KYSA 4OXVA 2F5XA 2DYXA 4O3AA 4GLIA 4K3FA 1PDAA 3KSXA 1N76A 2HZLA 2NOOA 1IUDA 1AMFA 2Q89A 2Y84A 3QSLA 4OZ9A 4H67A 2ZNSA 4HCWA 2RC9A 3PUVE 4NF8A 4YKJA 1RYOA 5DT6A 1LAXA 2XX9A 3CG3A 1Z7ME 1OLCA 2DWIA 3E3KA 5L9MA 3RNNA 3QUJA 4OERA 3IX1A 1LCTA 4IGTA 1SBPA 3E9XA 4I1DA 4UACA 3OSRA 1GR2A 2I0BA 2F78A 2NXOA 3G3KA 1GV8A 3CFZA 4ZECA 3TUSA 5AA3A 5I58A 2Z23A 3VV5A 1MDQA 2I3VA 3G3GA 1FW0A 2DVCA 3B7DA 3SEVA 2Y7PA 3VLUA 4DDDA 2F6GA 4C1UA 1UIUA 1Y3NA 3OXNA 2F97A 4OHNA 5TPAB 1N7XA 3KN7A 3SEXA 5K2XA 2DOJA 1PBQA 2X7PA 2VHAA 4JSOA 1NMUA 3S4UA 5TP9B 4YMAA 2AYSA 5ISUA 1S7YA 2VD2A 1AH5A 4QFPA 1Y4CA 3BBRA 5AA1A 3RTWB 3H6UA 3DP4A 3M8UA 1MXYA 3N6UA 2RC7A 1BKAA 2BJJX 2RINA 3K1NA 3MQ9A 4JBZA 3EF7A 1AIVA 4YICA 2RKMA 3WAFA 2REGA 2I58A 3S2VA 2ZXTA 5HPQA 1VE4A 2HEUA 4M4GA 4R73A 3VFJA 5J1DA 3PU5A 3DP8A 1B4ZA 1QJMA 4IGRA 2UVIA 1I69A 1II5A 1UTBA 4R2FA 1MY2A 3CRBA 4F3PA 4RA1A 3PPNA 4MLQA 4YKKA 4GXAA 1ANFA 1LSTA 4GOTA 4DE8A 3FASA 3IORA 2ZYNA 1N84A 1O64A 3PUYE 3OOAA 4OENA 3T9XB 5AA2B 4NF6A 1JW1A 3G3FA 2YJPA 3MVWA 4ZE8A 3RY3A 4WEPA 3VVFA 1M5DA 4F18A 1Y4TA 5LOMA 2H25A 4ZEBA 4DCXA 4FEBA 4U4SA 1QW0A 1SDXA 4H6DA 3TTLA 5I57A 5KZTA 2B3BA 3K4UA 1SYHA 3K6XA 1D4NA 1QVSA 3U1OA 1TWYA 2CMOA 4NF4A 1LCFA 1LBCA 1LBBA 1YTVA 3IO6A 5H8NA 4H0WA 2I6EA 4JWXA 2PX1A 3FJGA 1XOCA 1OIBA 3S9LC 4BDRA 3FXUA 1US5A 2I3WA 3SERA 5HM4B 1DTGA 4OVJA 1L5TA 2DWAA 4ELOA 1A7LA 1NFTA 2UYEA 3R26A 2AL5A 1NNFA 1MXVA 1D9YA 2O7IA 1QUIA 3C9HA 3Q25A 1MM7A 1FQFA 1US4A 2E0SA 3PGFA 3CSGA 1H3DA 4KPTA 3TDJA 1MG1A 3VVEA 5TP9A 5B7DA 5I56B 5JEIA 2ZYMA 2XXUA 4YU0A 3IO4A 1EZ9A 4RK2A 1R6ZA 5DEXA 3K6UA 3P7IA 4JWOA 4NEDA 3E13X 1N3WA 4HTGA 4OWDA 1Y20A 1B3LA 3KJTA 2D21A 4F1VA 5KCJB 2WKYA 2O51A 1BIYA 3G7WA 3O2AA 3PD9A 2F6PA 3K6WA 4MH5A 3ILUB 1IEJA 4U1ZA 3G3JA 1DOTA 4XKRA 2QRYA 4ESWA 3LR1A 1MXWA 4F3GA 4GWOA 2DWHA 4NF6B 1I6AA 4POXA 4RPOA 2PBWA 4WEDA 4ECFA 3H6VA 3RLFE 5CBSA 3MP8A 4QSDA 2YLNA 1J1NA 4PP0A 2Q2AA 3IOVA 4PE5B 3TZAA 2QS1A 1D3KA 2QJEA 1P1WA 4H8JA 2H99A 1XHYA 2X26A 3LSXA 5FTHA 4FIMA 4OYVA 1Z7NE 3O6HA 3SDFA 3B6QA 2O1LA 4NTLA 4F3BA 4QFLA 4QF9A 4XKPA 5AA2D 5H8FA 4NF5A 4O3CA 2ZNUA 3N26A 3QK6A 4GL0A 3RN8A 1A55A 2M8CA 3K1PA 3M3LA 3OD7A 3Q26A 4HCYA 4ND9A 4U23A 1B4HA 1OLAA 4ELRA 5H8QA 1IZ1A 2GRVA 1B1XA 3KGCA 4N13A 1JVYA 4YKIA 1SQYA 5H8FB 4EUOA 4Q8RA 1HSJA 2QS3A 3A3CA 1MXUA 4OFOA 1YCJA 3IB1A 4R6HA 1NL5A 3FVGA 1IQ7A 1B46A 1Y9UA 4PFWA 1UTBB 2XX8A 2H4IA 4XKNA 4NWCA 1PEBA 3T96B 1FTLA 4DXUA 5KDTA 3IR1A 4Q30B 1MQJA 3T66A 5IKBA 4XKQA 3T22A 1D9VA 3USDA 4AB6A 3LUYA 5A5XA 3W9VA 4LATA 1B5JA 3B6WA 4ELQA 3EHSA 3VLWA 1MPDA 1XVYA 2UVJA 4LUBA 2ZYOA 1IXHA 2AL4A 2OJTA 2Y7KA 4GVOA 4OFJA 1PC3A 4LZ7A 1UQWA 3FXQA 4IO7A 4RJZA 1CE2A 3TODA 1NNKA 1PB7A 3ZKKA 3IOUA 3CG1A 5DVIA 3OO7A 3TTMA 4LP2B 3MVYA 1B6HA 4QHQA 2XXIA 1H45A 1LGBC 3HO7A 3MPLA 3PMXA 1M5CA 1MQIA 3K01A 3TQLA 1F9BA 3VVDA 3I6VA 5CM6A 2P2AA 5CMKA 3LBSA 3QAXA 2XXPA 3MC2A 3OO6A 3C36A 2G93A 3FVKA 3MJNA 4P0GA 3RTFB 5I59A 4EQ7A 3OELA 4G2ZA 1POTA 3PUWE 4G68B 1H76A 2XXVA 3HPIA 4OFLA 4EQBA 1HSEA 2DS9A 1IXIA 2F7BA 5L9SA 4IO4A 1Y1ZA 3RQTA 4F1YA 3FV1A 3ONMA 3I5OA 3OENA 1NNPA 5DVFA 2XXQA 3OO8A 4OQOA 5I2NB 3LSWA 5I59B 1PB9A 4ESXA 2V3TA 3E4RA 3MWBA 1VFDA 3QYTA 4G68A 4ISUA 1OQGA 5BWJA 3HHGA 2PT1A 1EZPA 4BDQA 5FTIA 4JSDA 5HBCA 3IJXB 2R6GE 4TOZA 5H8SA 4X1DA 2F8DA 1ZTYA 1CB6A 2GFEA 4KHZE 5CMCA 1DTZA 3BFTA 3IB0A 3FZVA 1B3FA 3N5LA 3N94A 4OESA 4F29A 3PD8A 1M5EA 5B70A 2DE2A 1QKAA 3K02A 3H6TA 4NF5B 3UIFA 4DXCA 1ZLQA 1N7WA 3U92A 4EXKA 1P1NA 2V84A 2Q9TA 3ZS6A 4ZE9A 1HSLA 4M1VA 1MM6A 3PPPA 1VSOA 5M2VA 2ONKE 3EHTA 1MXZA 3UN6A 1NH8A 1MQDA 4Q0CA 1EZOA 3IK6B 1JEUA 3IL1B 2O6AA 1B5HA 1BP5A 1MY1A 2HQ0A 3JZJA 4YMBA 3K00A 4G4PA 4P11A 1TXFA 4RYAA 1ZBMA 2Q88A 4GL8A 4YKPA 2NVUB 3V5AA 5EHSA 2HAVA 5L9OA 1DMBA 1SW5A 1AOVA 2OWSA 2RC8A 4Z7EA 3FJMA 1FTMA 1N04A 1MPCA 3IB2A 1PBPA 3IAZA 4F39A 1P99A 2ABHA 4NMYA 2YPNA 4AQ4A 5JK4A 1UTHA 5KCJA 4DXBA 1I6QA 4IY5A 4IB2A 5FHOA 3HN0A 3S9NC 3L6GA 1B3HA 3OEMA 1LAFE 1QUKA 2XXYA 1Y3QA 3TMGA 4BDOA 1BTJA 1DPPA 1LLSA 2OZZA 4H1XA 1O63A 2I4BA 3VDFA 1ZU0A 5I2NA 1B7HA 3CSBA 3FUZA 1IXCA 3O28A 2O68A 1USYH 3VXBA 4BDNA 3IJOB 4I8CA 5EYFA 3T9HB 1BLFA 3CVGA 5DEXB 4TQUQ 4F2QA 4RY1A 2UVHA 2H9BA 2DP8A 2F36A 2VOZA 5L8DA 1GGGA 3T9UA 1SI0A 1B7UA 3CI8A 3KSJA 1ZIUA 4WXJA 1B3GA 2UXAA 3EQ1A 4G77A 4FJPA 1B3EA 3EHUA 2ALUA 1MH4A 2O1MA 2VP1A 1SD3A 3PPOA 2DQVA 1QKBA 1ZKBA 4NE4A 4PFYA 4R6KA 4E0XA 2XD3A 2ZNTA 3OSQA 4OEUA 2AIXA 1S50A 2X7QA 3H3GA 2F7CA 3D4CA 4MBPA 3KFMA 3O9PA 2CZLA 5K2YA 5JTYA 3MZ9A 4ZS9A 2Y7RA 2I0CA 1N0TA 1SVXB 4HS7A 2IEEA 4IO5A 4F22A 4I62A 2FA7A 1LAGE 5JTYB 1JVXA 1LB8A 3MP6A 4GF8A 3IOTA 5I56A 1GTKA 2VGQA 4H8IA 2A5SA 3L6HA 4OMBA 2O69A 4IO6A 3S9MC 2ESNA 2OCUA 1B32A 3MW0A 3SKPA 4G68C 1FQDA 3PPQA 3KOSA 2QMXA 3U94A 1B58A 3FVNA 3DP6A 1URSA 4X48A 3RUMA 3TTRA 3U8QA 1A8EA 4F2OA 4FAJA 3C32A 1UTHB 2H5YA 2XXHA 3HV1A 3TAJA 1XC1A 2R71A 2PMSA 2VD3A 4JXIA 4WKMA 2NWJA 1R9QA 4NWDA 3R7XA 4X1BA 3PUZE 2A5TB 5I2KA 1URGA 4G8NA 3F11A 2PYYA 4H5GA 4ZDMA 3SEYA 3DM0A 3O6GA 4F1UA 1LAHE 4KR5A 4ZZEA 1P1UA 2GHAA 3MBPA 3QXMA 3VLVA 1EU8A 1FTJA 4GQOA 3R6UA 4KFQA 3VXCA 4POWA 2DVZA 2O7UA 3H7MA 1MH3A 1P1OA 4KYEA 1RYXA 1MY3A 2HFBA 4X9TA 2RF1A 5ELVA 3ZKLA 3H6WA 3O6IA 3DELB 1B52A 4IY6A 4LVQA 2RCAA 5EHMA 2ONSA 3D4GA 3TTNA 3EN3A 2FNCA 3TCHA 3FIRA 4FEDA 4R75A 4U1OA 1B7ZA 2H98A 4ELPA 3KOTA 4GIZA 3B6TA 3Q27A 5FHMA 1SW1A 1FQEA 2GHBA 1ZMGA 1H43A 4H5FA 3HSTA 2V3QA 4KCCA 4LQ2A 4LZ8A 4QSCA 1A99A 1R9LA 2Z22A 3MVZA 4JB7A 2Y7WA 3U72A 3UK4A 2XHDA 3EPEA 2QMWA 1M5FA 2B3FA 3PV0E 5DVJA 1A40A 3RPWA 2W7YA 1B05A 2QS4A 4YZZA 5A5XB 4R9FA 3V89B 4NF8B 4QSEA 3TCGA 2KLFA 4GD5A 4KYDA 5CRYA 1LB9A 3BFUA 2DXRA 4UA8A 3TFLA 3KEIA 4F31B 3K2DA 1MXXA 4P0IA 4R2BA 5ITOA 4F3SA 2B65A 3A09A 4XTCQ 3H06B 1FCKA 4GRKA 2I4CA 1LFIA 2F35A 1JQFA 3GLBA 5CMMA 5I57B 4LZ5A 4G8MA 1M5BA 1MY0A 1SW4A 3LSFB 1N3XA 3JV9A 2Z8FA 1B40A 3PUXE 2REJA 4G8HA 4PETA 4U2RA 3VE1B 3S9EA 1B0HA 2E1SA 2PVUA 4FATA 1SI1A 2HZKA 1QUJA 3K1MA 3O97A 4ONYA 2P1SA 2Q8JA 3THIA 3C31A 3TYHA 5I84A 3FV2A 2DE4A 4EXLA 5AA4B 5BUUA 4RPNA 1URDA 3U93A 3UORA 3WAEA 3TPAA 3T93B 4Z0IA 2XXWA 4PFUA 3O66A 2V25A 3C35A 3ILTB 3QIMA 3PPRA 4QFKA 4DZ1A 1ATGA 1USYE 1WDNA 1XVXA 2IA4A 2XD2A 3LC8A 3RGYA 5CC2A 1LFGA 4YAHX 1XT8A 2I49A 1WVJA 3HHFA 3W9WA 1XS5A 3KJ7A 3LSLA 1R1NA 1VFEA 4F19A 2Z8DA 5CMBA 5AA2A 3TEPA 4EF1A 4KCDA 2QL3A 4GFRA 1JETA 1Y1MA 2GH9A 1MPBA 2OWTA 1B5IA 3MAMA 4MF3A 1B51A 4U4XA 5FHNA 1KWHA 3GXAA 3GZGA 4U22A 1OMPA 3A3UA 4ZZAA 3RT6B 1AL3A 3M3FA 2DWJA 3UGWA 1JW5A 4KD5A 1O7TA 2UVGA 1T0KA 2Q2CA 2HAUA 1IXGA 1JEVA 3PMWA 4THIA 1MDP1 4PQJA 1OQHA 4C0RA 4BLAA 2QSXA 4YB7A 4DIGA 2A5TA 2QPQA 1ZJLA 2R9JA 2Z8EA 5I2KB 5H8NB 3HCQA 4YB6A 2D3IA 3K0VA 4KQPA 4ZEFA 5AA4A 2D5WA 1B0LA 3BKIB 1FQCA 3FJ7A 3G3HA 3KZGA 3M3KA 3OMBA 3KN3A 4R9GA 5H8HA 4QFNA 4DCYA 2ZMBA 3TQWA 4OETA 3C34A 3SEUA 3T9VA 3V83A 3TELA 4N07A 4XIGQ 1I6BA 3TCFA 2HXWA 1FTOA 5CBRA 3FGSA 3O29A 4YB5A 4ZEDA 3MZBA 5I58B 3MVXA 3GBBA 1FQAA 1FQBA 3KBRA 1MQGA 3OEKA 4LONB 4QRZA 2PT2A 2DSFA 3KG2A 2DXYA 3W15C 4DLDA 3Q28A 3MPKA 1Q1KA 2ANJA 2F7AA 5F7VA 3V8XB 4PFTA 3DLNA 4O3BA 2I48A 2XXXA 4MFIA 3SEWA 1IITA 1OVTA 4RK9A 1S9TA 4FORA 2QS2A 1NKXA 3MUQA 4KI0E 3CIJA 3MP1A 4AB5A 4IO2A 4EF2A 3OO9A 1SW2A 4NF4B 1NH7A 3FATA 2OBGA 3CFXA 1UIVA 2UYFA 4E0WA 5IAIA 3G3IA 4MLVA 4BDMA 3KN8A 2NUVA 3UP9A 5TU0A 2ZYKA 2O84X 5ICTA 1NNTA 2Y7IA 1FTKA 5H8QB 3ODBA 4ZEIA 4TLLB 2F34A 2OK2A 4EQ9A 5ICQA 1LFHA 2LAOA 3IOWA 4H65A 4Q5TA 4QFOA 5DYHA 4JWYA 1IIWA 1SYIA 3SESA 1TFDA 2P0SA 3ECRA 1B9JA 3H03A 4N6PA 3FVOA 2RCBA 2THIA 1JW4A 1B2HA 2XXRA 3QUFA 5ITPA 1EH3A 5DTBA 5KDTB 1A8FA 3TKDA 1PB8A 2HCAA 1MRPA 3SETA 5CI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKM A;  3H4Z A;  4OEV A;  4U21 A;  3GBA A;  3PMV A;  3I3V A;  3RT8 A;  1TFA A;  3FXR A;  4RNS A;  3Q29 A;  2XXT A;  3CFL A;  4HW8 A;  2G29 A;  4FE8 A;  5AE4 A;  1Q35 A;  4RXL A;  1GVC A;  5TPA A;  4R6Y A;  2XX7 A;  1YPN A;  4BDL A;  1OVB A;  5F1Q A;  1MY4 A;  3C4M A;  3C33 A;  4XXU A;  3N6T A;  4FEC A;  4LQ5 A;  1P1Q A;  4GXS B;  1JNF A;  2FYI A;  3AXF A;  1ELJ A;  4C1T A;  1QUL A;  3TTK A;  1A54 A;  4LA9 A;  4R74 A;  3FD3 A;  3K6V A;  3UA8 A;  3CR9 A;  2ONR A;  1YAE A;  2OLB A;  1DPE A;  1MQH A;  1MS7 A;  4JDF A;  4I9D A;  1DSN A;  4EDP A;  1VR5 A;  1Y3P A;  2V93 A;  1H44 A;  4R72 A;  3JYR A;  5H8H B;  2V3U A;  4L17 A;  2DE3 A;  4IO3 A;  3ZSF A;  1B1H A;  4OTE A;  1TT1 A;  1WOD A;  3MZ1 A;  4TLM B;  4ZEK A;  1POY 1;  4KYS A;  4OXV A;  2F5X A;  2DYX A;  4O3A A;  4GLI A;  4K3F A;  1PDA A;  3KSX A;  1N76 A;  2HZL A;  2NOO A;  1IUD A;  1AMF A;  2Q89 A;  2Y84 A;  3QSL A;  4OZ9 A;  4H67 A;  2ZNS A;  4HCW A;  2RC9 A;  3PUV E;  4NF8 A;  4YKJ A;  1RYO A;  5DT6 A;  1LAX A;  2XX9 A;  3CG3 A;  1Z7M E;  1OLC A;  2DWI A;  3E3K A;  5L9M A;  3RNN A;  3QUJ A;  4OER A;  3IX1 A;  1LCT A;  4IGT A;  1SBP A;  3E9X A;  4I1D A;  4UAC A;  3OSR A;  1GR2 A;  2I0B A;  2F78 A;  2NXO A;  3G3K A;  1GV8 A;  3CFZ A;  4ZEC A;  3TUS A;  5AA3 A;  5I58 A;  2Z23 A;  3VV5 A;  1MDQ A;  2I3V A;  3G3G A;  1FW0 A;  2DVC A;  3B7D A;  3SEV A;  2Y7P A;  3VLU A;  4DDD A;  2F6G A;  4C1U A;  1UIU A;  1Y3N A;  3OXN A;  2F97 A;  4OHN A;  5TPA B;  1N7X A;  3KN7 A;  3SEX A;  5K2X A;  2DOJ A;  1PBQ A;  2X7P A;  2VHA A;  4JSO A;  1NMU A;  3S4U A;  5TP9 B;  4YMA A;  2AYS A;  5ISU A;  1S7Y A;  2VD2 A;  1AH5 A;  4QFP A;  1Y4C A;  3BBR A;  5AA1 A;  3RTW B;  3H6U A;  3DP4 A;  3M8U A;  1MXY A;  3N6U A;  2RC7 A;  1BKA A;  2BJJ X;  2RIN A;  3K1N A;  3MQ9 A;  4JBZ A;  3EF7 A;  1AIV A;  4YIC A;  2RKM A;  3WAF A;  2REG A;  2I58 A;  3S2V A;  2ZXT A;  5HPQ A;  1VE4 A;  2HEU A;  4M4G A;  4R73 A;  3VFJ A;  5J1D A;  3PU5 A;  3DP8 A;  1B4Z A;  1QJM A;  4IGR A;  2UVI A;  1I69 A;  1II5 A;  1UTB A;  4R2F A;  1MY2 A;  3CRB A;  4F3P A;  4RA1 A;  3PPN A;  4MLQ A;  4YKK A;  4GXA A;  1ANF A;  1LST A;  4GOT A;  4DE8 A;  3FAS A;  3IOR A;  2ZYN A;  1N84 A;  1O64 A;  3PUY E;  3OOA A;  4OEN A;  3T9X B;  5AA2 B;  4NF6 A;  1JW1 A;  3G3F A;  2YJP A;  3MVW A;  4ZE8 A;  3RY3 A;  4WEP A;  3VVF A;  1M5D A;  4F18 A;  1Y4T A;  5LOM A;  2H25 A;  4ZEB A;  4DCX A;  4FEB A;  4U4S A;  1QW0 A;  1SDX A;  4H6D A;  3TTL A;  5I57 A;  5KZT A;  2B3B A;  3K4U A;  1SYH A;  3K6X A;  1D4N A;  1QVS A;  3U1O A;  1TWY A;  2CMO A;  4NF4 A;  1LCF A;  1LBC A;  1LBB A;  1YTV A;  3IO6 A;  5H8N A;  4H0W A;  2I6E A;  4JWX A;  2PX1 A;  3FJG A;  1XOC A;  1OIB A;  3S9L C;  4BDR A;  3FXU A;  1US5 A;  2I3W A;  3SER A;  5HM4 B;  1DTG A;  4OVJ A;  1L5T A;  2DWA A;  4ELO A;  1A7L A;  1NFT A;  2UYE A;  3R26 A;  2AL5 A;  1NNF A;  1MXV A;  1D9Y A;  2O7I A;  1QUI A;  3C9H A;  3Q25 A;  1MM7 A;  1FQF A;  1US4 A;  2E0S A;  3PGF A;  3CSG A;  1H3D A;  4KPT A;  3TDJ A;  1MG1 A;  3VVE A;  5TP9 A;  5B7D A;  5I56 B;  5JEI A;  2ZYM A;  2XXU A;  4YU0 A;  3IO4 A;  1EZ9 A;  4RK2 A;  1R6Z A;  5DEX A;  3K6U A;  3P7I A;  4JWO A;  4NED A;  3E13 X;  1N3W A;  4HTG A;  4OWD A;  1Y20 A;  1B3L A;  3KJT A;  2D21 A;  4F1V A;  5KCJ B;  2WKY A;  2O51 A;  1BIY A;  3G7W A;  3O2A A;  3PD9 A;  2F6P A;  3K6W A;  4MH5 A;  3ILU B;  1IEJ A;  4U1Z A;  3G3J A;  1DOT A;  4XKR A;  2QRY A;  4ESW A;  3LR1 A;  1MXW A;  4F3G A;  4GWO A;  2DWH A;  4NF6 B;  1I6A A;  4POX A;  4RPO A;  2PBW A;  4WED A;  4ECF A;  3H6V A;  3RLF E;  5CBS A;  3MP8 A;  4QSD A;  2YLN A;  1J1N A;  4PP0 A;  2Q2A A;  3IOV A;  4PE5 B;  3TZA A;  2QS1 A;  1D3K A;  2QJE A;  1P1W A;  4H8J A;  2H99 A;  1XHY A;  2X26 A;  3LSX A;  5FTH A;  4FIM A;  4OYV A;  1Z7N E;  3O6H A;  3SDF A;  3B6Q A;  2O1L A;  4NTL A;  4F3B A;  4QFL A;  4QF9 A;  4XKP A;  5AA2 D;  5H8F A;  4NF5 A;  4O3C A;  2ZNU A;  3N26 A;  3QK6 A;  4GL0 A;  3RN8 A;  1A55 A;  2M8C A;  3K1P A;  3M3L A;  3OD7 A;  3Q26 A;  4HCY A;  4ND9 A;  4U23 A;  1B4H A;  1OLA A;  4ELR A;  5H8Q A;  1IZ1 A;  2GRV A;  1B1X A;  3KGC A;  4N13 A;  1JVY A;  4YKI A;  1SQY A;  5H8F B;  4EUO A;  4Q8R A;  1HSJ A;  2QS3 A;  3A3C A;  1MXU A;  4OFO A;  1YCJ A;  3IB1 A;  4R6H A;  1NL5 A;  3FVG A;  1IQ7 A;  1B46 A;  1Y9U A;  4PFW A;  1UTB B;  2XX8 A;  2H4I A;  4XKN A;  4NWC A;  1PEB A;  3T96 B;  1FTL A;  4DXU A;  5KDT A;  3IR1 A;  4Q30 B;  1MQJ A;  3T66 A;  5IKB A;  4XKQ A;  3T22 A;  1D9V A;  3USD A;  4AB6 A;  3LUY A;  5A5X A;  3W9V A;  4LAT A;  1B5J A;  3B6W A;  4ELQ A;  3EHS A;  3VLW A;  1MPD A;  1XVY A;  2UVJ A;  4LUB A;  2ZYO A;  1IXH A;  2AL4 A;  2OJT A;  2Y7K A;  4GVO A;  4OFJ A;  1PC3 A;  4LZ7 A;  1UQW A;  3FXQ A;  4IO7 A;  4RJZ A;  1CE2 A;  3TOD A;  1NNK A;  1PB7 A;  3ZKK A;  3IOU A;  3CG1 A;  5DVI A;  3OO7 A;  3TTM A;  4LP2 B;  3MVY A;  1B6H A;  4QHQ A;  2XXI A;  1H45 A;  1LGB C;  3HO7 A;  3MPL A;  3PMX A;  1M5C A;  1MQI A;  3K01 A;  3TQL A;  1F9B A;  3VVD A;  3I6V A;  5CM6 A;  2P2A A;  5CMK A;  3LBS A;  3QAX A;  2XXP A;  3MC2 A;  3OO6 A;  3C36 A;  2G93 A;  3FVK A;  3MJN A;  4P0G A;  3RTF B;  5I59 A;  4EQ7 A;  3OEL A;  4G2Z A;  1POT A;  3PUW E;  4G68 B;  1H76 A;  2XXV A;  3HPI A;  4OFL A;  4EQB A;  1HSE A;  2DS9 A;  1IXI A;  2F7B A;  5L9S A;  4IO4 A;  1Y1Z A;  3RQT A;  4F1Y A;  3FV1 A;  3ONM A;  3I5O A;  3OEN A;  1NNP A;  5DVF A;  2XXQ A;  3OO8 A;  4OQO A;  5I2N B;  3LSW A;  5I59 B;  1PB9 A;  4ESX A;  2V3T A;  3E4R A;  3MWB A;  1VFD A;  3QYT A;  4G68 A;  4ISU A;  1OQG A;  5BWJ A;  3HHG A;  2PT1 A;  1EZP A;  4BDQ A;  5FTI A;  4JSD A;  5HBC A;  3IJX B;  2R6G E;  4TOZ A;  5H8S A;  4X1D A;  2F8D A;  1ZTY A;  1CB6 A;  2GFE A;  4KHZ E;  5CMC A;  1DTZ A;  3BFT A;  3IB0 A;  3FZV A;  1B3F A;  3N5L A;  3N94 A;  4OES A;  4F29 A;  3PD8 A;  1M5E A;  5B70 A;  2DE2 A;  1QKA A;  3K02 A;  3H6T A;  4NF5 B;  3UIF A;  4DXC A;  1ZLQ A;  1N7W A;  3U92 A;  4EXK A;  1P1N A;  2V84 A;  2Q9T A;  3ZS6 A;  4ZE9 A;  1HSL A;  4M1V A;  1MM6 A;  3PPP A;  1VSO A;  5M2V A;  2ONK E;  3EHT A;  1MXZ A;  3UN6 A;  1NH8 A;  1MQD A;  4Q0C A;  1EZO A;  3IK6 B;  1JEU A;  3IL1 B;  2O6A A;  1B5H A;  1BP5 A;  1MY1 A;  2HQ0 A;  3JZJ A;  4YMB A;  3K00 A;  4G4P A;  4P11 A;  1TXF A;  4RYA A;  1ZBM A;  2Q88 A;  4GL8 A;  4YKP A;  2NVU B;  3V5A A;  5EHS A;  2HAV A;  5L9O A;  1DMB A;  1SW5 A;  1AOV A;  2OWS A;  2RC8 A;  4Z7E A;  3FJM A;  1FTM A;  1N04 A;  1MPC A;  3IB2 A;  1PBP A;  3IAZ A;  4F39 A;  1P99 A;  2ABH A;  4NMY A;  2YPN A;  4AQ4 A;  5JK4 A;  1UTH A;  5KCJ A;  4DXB A;  1I6Q A;  4IY5 A;  4IB2 A;  5FHO A;  3HN0 A;  3S9N C;  3L6G A;  1B3H A;  3OEM A;  1LAF E;  1QUK A;  2XXY A;  1Y3Q A;  3TMG A;  4BDO A;  1BTJ A;  1DPP A;  1LLS A;  2OZZ A;  4H1X A;  1O63 A;  2I4B A;  3VDF A;  1ZU0 A;  5I2N A;  1B7H A;  3CSB A;  3FUZ A;  1IXC A;  3O28 A;  2O68 A;  1USY H;  3VXB A;  4BDN A;  3IJO B;  4I8C A;  5EYF A;  3T9H B;  1BLF A;  3CVG A;  5DEX B;  4TQU Q;  4F2Q A;  4RY1 A;  2UVH A;  2H9B A;  2DP8 A;  2F36 A;  2VOZ A;  5L8D A;  1GGG A;  3T9U A;  1SI0 A;  1B7U A;  3CI8 A;  3KSJ A;  1ZIU A;  4WXJ A;  1B3G A;  2UXA A;  3EQ1 A;  4G77 A;  4FJP A;  1B3E A;  3EHU A;  2ALU A;  1MH4 A;  2O1M A;  2VP1 A;  1SD3 A;  3PPO A;  2DQV A;  1QKB A;  1ZKB A;  4NE4 A;  4PFY A;  4R6K A;  4E0X A;  2XD3 A;  2ZNT A;  3OSQ A;  4OEU A;  2AIX A;  1S50 A;  2X7Q A;  3H3G A;  2F7C A;  3D4C A;  4MBP A;  3KFM A;  3O9P A;  2CZL A;  5K2Y A;  5JTY A;  3MZ9 A;  4ZS9 A;  2Y7R A;  2I0C A;  1N0T A;  1SVX B;  4HS7 A;  2IEE A;  4IO5 A;  4F22 A;  4I62 A;  2FA7 A;  1LAG E;  5JTY B;  1JVX A;  1LB8 A;  3MP6 A;  4GF8 A;  3IOT A;  5I56 A;  1GTK A;  2VGQ A;  4H8I A;  2A5S A;  3L6H A;  4OMB A;  2O69 A;  4IO6 A;  3S9M C;  2ESN A;  2OCU A;  1B32 A;  3MW0 A;  3SKP A;  4G68 C;  1FQD A;  3PPQ A;  3KOS A;  2QMX A;  3U94 A;  1B58 A;  3FVN A;  3DP6 A;  1URS A;  4X48 A;  3RUM A;  3TTR A;  3U8Q A;  1A8E A;  4F2O A;  4FAJ A;  3C32 A;  1UTH B;  2H5Y A;  2XXH A;  3HV1 A;  3TAJ A;  1XC1 A;  2R71 A;  2PMS A;  2VD3 A;  4JXI A;  4WKM A;  2NWJ A;  1R9Q A;  4NWD A;  3R7X A;  4X1B A;  3PUZ E;  2A5T B;  5I2K A;  1URG A;  4G8N A;  3F11 A;  2PYY A;  4H5G A;  4ZDM A;  3SEY A;  3DM0 A;  3O6G A;  4F1U A;  1LAH E;  4KR5 A;  4ZZE A;  1P1U A;  2GHA A;  3MBP A;  3QXM A;  3VLV A;  1EU8 A;  1FTJ A;  4GQO A;  3R6U A;  4KFQ A;  3VXC A;  4POW A;  2DVZ A;  2O7U A;  3H7M A;  1MH3 A;  1P1O A;  4KYE A;  1RYX A;  1MY3 A;  2HFB A;  4X9T A;  2RF1 A;  5ELV A;  3ZKL A;  3H6W A;  3O6I A;  3DEL B;  1B52 A;  4IY6 A;  4LVQ A;  2RCA A;  5EHM A;  2ONS A;  3D4G A;  3TTN A;  3EN3 A;  2FNC A;  3TCH A;  3FIR A;  4FED A;  4R75 A;  4U1O A;  1B7Z A;  2H98 A;  4ELP A;  3KOT A;  4GIZ A;  3B6T A;  3Q27 A;  5FHM A;  1SW1 A;  1FQE A;  2GHB A;  1ZMG A;  1H43 A;  4H5F A;  3HST A;  2V3Q A;  4KCC A;  4LQ2 A;  4LZ8 A;  4QSC A;  1A99 A;  1R9L A;  2Z22 A;  3MVZ A;  4JB7 A;  2Y7W A;  3U72 A;  3UK4 A;  2XHD A;  3EPE A;  2QMW A;  1M5F A;  2B3F A;  3PV0 E;  5DVJ A;  1A40 A;  3RPW A;  2W7Y A;  1B05 A;  2QS4 A;  4YZZ A;  5A5X B;  4R9F A;  3V89 B;  4NF8 B;  4QSE A;  3TCG A;  2KLF A;  4GD5 A;  4KYD A;  5CRY A;  1LB9 A;  3BFU A;  2DXR A;  4UA8 A;  3TFL A;  3KEI A;  4F31 B;  3K2D A;  1MXX A;  4P0I A;  4R2B A;  5ITO A;  4F3S A;  2B65 A;  3A09 A;  4XTC Q;  3H06 B;  1FCK A;  4GRK A;  2I4C A;  1LFI A;  2F35 A;  1JQF A;  3GLB A;  5CMM A;  5I57 B;  4LZ5 A;  4G8M A;  1M5B A;  1MY0 A;  1SW4 A;  3LSF B;  1N3X A;  3JV9 A;  2Z8F A;  1B40 A;  3PUX E;  2REJ A;  4G8H A;  4PET A;  4U2R A;  3VE1 B;  3S9E A;  1B0H A;  2E1S A;  2PVU A;  4FAT A;  1SI1 A;  2HZK A;  1QUJ A;  3K1M A;  3O97 A;  4ONY A;  2P1S A;  2Q8J A;  3THI A;  3C31 A;  3TYH A;  5I84 A;  3FV2 A;  2DE4 A;  4EXL A;  5AA4 B;  5BUU A;  4RPN A;  1URD A;  3U93 A;  3UOR A;  3WAE A;  3TPA A;  3T93 B;  4Z0I A;  2XXW A;  4PFU A;  3O66 A;  2V25 A;  3C35 A;  3ILT B;  3QIM A;  3PPR A;  4QFK A;  4DZ1 A;  1ATG A;  1USY E;  1WDN A;  1XVX A;  2IA4 A;  2XD2 A;  3LC8 A;  3RGY A;  5CC2 A;  1LFG A;  4YAH X;  1XT8 A;  2I49 A;  1WVJ A;  3HHF A;  3W9W A;  1XS5 A;  3KJ7 A;  3LSL A;  1R1N A;  1VFE A;  4F19 A;  2Z8D A;  5CMB A;  5AA2 A;  3TEP A;  4EF1 A;  4KCD A;  2QL3 A;  4GFR A;  1JET A;  1Y1M A;  2GH9 A;  1MPB A;  2OWT A;  1B5I A;  3MAM A;  4MF3 A;  1B51 A;  4U4X A;  5FHN A;  1KWH A;  3GXA A;  3GZG A;  4U22 A;  1OMP A;  3A3U A;  4ZZA A;  3RT6 B;  1AL3 A;  3M3F A;  2DWJ A;  3UGW A;  1JW5 A;  4KD5 A;  1O7T A;  2UVG A;  1T0K A;  2Q2C A;  2HAU A;  1IXG A;  1JEV A;  3PMW A;  4THI A;  1MDP 1;  4PQJ A;  1OQH A;  4C0R A;  4BLA A;  2QSX A;  4YB7 A;  4DIG A;  2A5T A;  2QPQ A;  1ZJL A;  2R9J A;  2Z8E A;  5I2K B;  5H8N B;  3HCQ A;  4YB6 A;  2D3I A;  3K0V A;  4KQP A;  4ZEF A;  5AA4 A;  2D5W A;  1B0L A;  3BKI B;  1FQC A;  3FJ7 A;  3G3H A;  3KZG A;  3M3K A;  3OMB A;  3KN3 A;  4R9G A;  5H8H A;  4QFN A;  4DCY A;  2ZMB A;  3TQW A;  4OET A;  3C34 A;  3SEU A;  3T9V A;  3V83 A;  3TEL A;  4N07 A;  4XIG Q;  1I6B A;  3TCF A;  2HXW A;  1FTO A;  5CBR A;  3FGS A;  3O29 A;  4YB5 A;  4ZED A;  3MZB A;  5I58 B;  3MVX A;  3GBB A;  1FQA A;  1FQB A;  3KBR A;  1MQG A;  3OEK A;  4LON B;  4QRZ A;  2PT2 A;  2DSF A;  3KG2 A;  2DXY A;  3W15 C;  4DLD A;  3Q28 A;  3MPK A;  1Q1K A;  2ANJ A;  2F7A A;  5F7V A;  3V8X B;  4PFT A;  3DLN A;  4O3B A;  2I48 A;  2XXX A;  4MFI A;  3SEW A;  1IIT A;  1OVT A;  4RK9 A;  1S9T A;  4FOR A;  2QS2 A;  1NKX A;  3MUQ A;  4KI0 E;  3CIJ A;  3MP1 A;  4AB5 A;  4IO2 A;  4EF2 A;  3OO9 A;  1SW2 A;  4NF4 B;  1NH7 A;  3FAT A;  2OBG A;  3CFX A;  1UIV A;  2UYF A;  4E0W A;  5IAI A;  3G3I A;  4MLV A;  4BDM A;  3KN8 A;  2NUV A;  3UP9 A;  5TU0 A;  2ZYK A;  2O84 X;  5ICT A;  1NNT A;  2Y7I A;  1FTK A;  5H8Q B;  3ODB A;  4ZEI A;  4TLL B;  2F34 A;  2OK2 A;  4EQ9 A;  5ICQ A;  1LFH A;  2LAO A;  3IOW A;  4H65 A;  4Q5T A;  4QFO A;  5DYH A;  4JWY A;  1IIW A;  1SYI A;  3SES A;  1TFD A;  2P0S A;  3ECR A;  1B9J A;  3H03 A;  4N6P A;  3FVO A;  2RCB A;  2THI A;  1JW4 A;  1B2H A;  2XXR A;  3QUF A;  5ITP A;  1EH3 A;  5DTB A;  5KDT B;  1A8F A;  3TKD A;  1PB8 A;  2HCA A;  1MRP A;  3SET A;  5CI5 A; 
#chains in the Genus database with same CATH topology
 1EYJ A;  3PMV A;  3RT8 A;  3I3V A;  3U65 A;  1Q35 A;  1GVC A;  5F1Q A;  2WYK A;  1MY4 A;  4XXU A;  4PBH A;  3N6T A;  3AXF A;  1ELJ A;  3FD3 A;  1YAE A;  1DPE A;  1MQH A;  4JDF A;  1DSN A;  2V93 A;  2DE3 A;  3ZSF A;  1B1H A;  1WOD A;  4ZEK A;  4OXV A;  2HZL A;  2Y84 A;  4HCW A;  4NF8 A;  5DT6 A;  1LAX A;  1Z7M E;  3RNN A;  1LCT A;  2CZI A;  4UAC A;  3TUS A;  3B8B A;  2KQZ A;  3CFZ A;  5AA3 A;  1MDQ A;  4MMP A;  1N7X A;  5K2X A;  1PBQ A;  2VHA A;  1NMU A;  1S7Y A;  5AA1 A;  1NUY A;  3DP4 A;  3N6U A;  1BKA A;  4JBZ A;  4YIC A;  2RKM A;  2REG A;  1VE4 A;  4M4G A;  3PU5 A;  4HE2 A;  5ET5 A;  1D9Q A;  1I69 A;  1II5 A;  4R2F A;  1CNQ A;  4GXA A;  1LST A;  4GOT A;  3FAS A;  3T9X B;  3G3F A;  2YJP A;  3MVW A;  4ZE8 A;  1M5D A;  5LOM A;  4DCX A;  4U4S A;  1SDX A;  5I57 A;  3K4U A;  2DDK A;  1D4N A;  1LBC A;  1YTV A;  5H8N A;  1OIB A;  3SER A;  5HM4 B;  1DTG A;  4ELO A;  3C9H A;  1QUI A;  3Q25 A;  4GWU A;  3TDJ A;  1H3D A;  2ZYM A;  1EZ9 A;  3K6U A;  4NED A;  4HTG A;  1N3W A;  2R8T A;  3KJT A;  4F1V A;  2O51 A;  3PD9 A;  4U1Z A;  4PGN A;  2F6P A;  3G3J A;  4ESW A;  4F3G A;  2QRY A;  5EQ8 A;  3KC1 A;  4WED A;  3H6V A;  5CBS A;  3MP8 A;  4QSD A;  3TZA A;  1D3K A;  2QJE A;  4H8J A;  2FVZ A;  3SDF A;  3O6H A;  3B6Q A;  5H8F A;  3RN8 A;  3K1P A;  1OLA A;  5H8Q A;  4N13 A;  1JVY A;  1IQ7 A;  1Y9U A;  4PFW A;  4XKN A;  4NWC A;  1DBZ A;  4XKQ A;  1D9V A;  3USD A;  3LUY A;  4LAT A;  4ELQ A;  3EHS A;  4LUB A;  2Y7K A;  1PB7 A;  3CG1 A;  1FBE A;  1F9B A;  2XXP A;  3RTF B;  3FVK A;  1FTA A;  4EQ7 A;  2XXV A;  5L9S A;  1YXI A;  4F1Y A;  3OEN A;  5DVF A;  4OQO A;  3E4R A;  3MWB A;  4ISU A;  1OQG A;  1EZP A;  4BDQ A;  4JVD A;  5H8S A;  1FBF A;  2F8D A;  5CMC A;  4KHZ E;  5B70 A;  1ZLQ A;  3U92 A;  2WBB A;  1VSO A;  2ONK E;  1NH8 A;  1EZO A;  1B5H A;  4P11 A;  2NVU B;  3V5A A;  4MNP A;  5EHS A;  2RC8 A;  4OVS A;  4NMY A;  2YPN A;  1UTH A;  4DXB A;  3S9N C;  1LAF E;  1QUK A;  2OZZ A;  1IXC A;  1USY H;  3IJO B;  4I8C A;  4I40 A;  1AWB A;  3T9H B;  4RY1 A;  2H9B A;  1ZIU A;  2DQV A;  1QKB A;  4NE4 A;  2ZNT A;  4OEU A;  2X7Q A;  3KFM A;  3O9P A;  1FBG A;  2Y7R A;  2IEE A;  1LB8 A;  1GTK A;  4H8I A;  2A5S A;  1FPB A;  3S9M C;  1B32 A;  4I3E A;  3SKP A;  1B58 A;  1A8E A;  3C32 A;  1UTH B;  2H5Y A;  4NGU A;  4WKM A;  3PUZ E;  4ZDM A;  3O6G A;  4F1U A;  4KFQ A;  3VXC A;  1MH3 A;  3ZKL A;  4X9T A;  3H6W A;  1B52 A;  2ONS A;  3EN3 A;  2FNC A;  3KOT A;  2GHB A;  1ZMG A;  4LZ8 A;  3MVZ A;  4JB7 A;  3UK4 A;  1NUX A;  4KYD A;  1IMF A;  4P0I A;  3KC0 A;  2I4C A;  2F35 A;  1JQF A;  3GLB A;  5I57 B;  4G8M A;  1MY0 A;  4PET A;  3S9E A;  2XXK A;  2HZK A;  3O97 A;  5I84 A;  2DE4 A;  5ET7 A;  3TPA A;  2XXW A;  3QIM A;  3PPR A;  3RGY A;  1WVJ A;  3KJ7 A;  3LSL A;  1R1N A;  2HHM A;  4KCD A;  2OWT A;  1B5I A;  3GZG A;  1OMP A;  1XI6 A;  1AL3 A;  5LDZ A;  2DWJ A;  4KD5 A;  1O7T A;  3T0J A;  1IXG A;  4PQJ A;  1FPL A;  2A5T A;  1ZJL A;  5H8N B;  2VT5 A;  3HCQ A;  2D3I A;  4KQP A;  1B0L A;  1FQC A;  3M3K A;  3OMB A;  4R9G A;  2FBP A;  4QFN A;  4DCY A;  3TQW A;  4OET A;  3C34 A;  3SEU A;  3T9V A;  3TEL A;  5IGA A;  4ZED A;  3MZB A;  1FQA A;  4QRZ A;  3KG2 A;  2WYP A;  4IR8 A;  1EYK A;  4NAP A;  2ANJ A;  3DLN A;  1DK4 A;  2I48 A;  2FHY A;  5EYH A;  3SEW A;  4RK9 A;  2QS2 A;  3MUQ A;  3CIJ A;  4GBV A;  3FXB A;  3OO9 A;  1NH7 A;  2OBG A;  3CFX A;  4KXP A;  2UYF A;  4BDM A;  2NUV A;  5TU0 A;  2Y7I A;  3ODB A;  4TLL B;  2LAO A;  3LV0 A;  5DYH A;  4N6P A;  1B9J A;  2XXR A;  1JW4 A;  5DTB A;  1MRP A;  3H4Z A;  3GBA A;  4N6D A;  3FXR A;  4RNS A;  2G29 A;  2XX7 A;  1YPN A;  4BDL A;  3C4M A;  4C1T A;  3TTK A;  1A54 A;  4LA9 A;  3K6V A;  3CR9 A;  4I3Y A;  1IMD A;  1VR5 A;  1LBV A;  1H44 A;  3JYR A;  4L17 A;  4OTE A;  1TT1 A;  4PDH A;  4TLM B;  4PDD A;  1POY 1;  4O3A A;  4K3F A;  1N76 A;  2NOO A;  2Q89 A;  1IUD A;  4OZ9 A;  2RC9 A;  3PUV E;  3CG3 A;  2XX9 A;  3E3K A;  5L9M A;  4OER A;  3IX1 A;  4IGT A;  1SBP A;  4HE0 A;  2OWZ A;  3OSR A;  2I0B A;  3G3K A;  2NXO A;  4ZEC A;  5I58 A;  2I3V A;  5IM2 A;  3B7D A;  3VLU A;  1Y3N A;  5TPA B;  4OHN A;  1KA0 A;  3SEX A;  4YMA A;  3BBR A;  3H6U A;  2B4M A;  2RC7 A;  2BJJ X;  2RIN A;  2I58 A;  3S2V A;  5J1D A;  1JP4 A;  3DP8 A;  1QJM A;  1B4Z A;  4IGR A;  2UVI A;  1UTB A;  2FIE A;  4F3P A;  3PPN A;  4MLQ A;  5IZ3 B;  4DE8 A;  3IOR A;  1N84 A;  1O64 A;  4NF6 A;  3VVF A;  4ZEB A;  1QW0 A;  1LBX A;  5KZT A;  2B3B A;  3K6X A;  1SYH A;  3U1O A;  1TWY A;  2CMO A;  4NF4 A;  2WEF A;  3IO6 A;  2PX1 A;  3FJG A;  1L5T A;  1MXV A;  2AL5 A;  1MM7 A;  3PGF A;  3CSG A;  4MIJ A;  4RK2 A;  3P7I A;  4JWO A;  1Y20 A;  2D21 A;  2QFL A;  1BIY A;  3G7W A;  3O2A A;  1IEJ A;  1DOT A;  3LR1 A;  1MXW A;  4POX A;  4RPO A;  2PBW A;  3RLF E;  2YLN A;  1J1N A;  1NV0 A;  4PE5 B;  1P1W A;  5EYG A;  5FTH A;  3E79 A;  3RPL A;  4QFL A;  4QF9 A;  4XKP A;  5AA2 D;  4O3C A;  2ZNU A;  4GBW A;  2M8C A;  4ND9 A;  3Q26 A;  4HCY A;  2GRV A;  3KGC A;  3A3C A;  2QS3 A;  1MXU A;  1UTB B;  2XX8 A;  5KDT A;  1FPE A;  1YYZ A;  1IMB A;  5A5X A;  2UVJ A;  1XVY A;  1IXH A;  2OJT A;  4GVO A;  1PC3 A;  3FXQ A;  4IO7 A;  1CE2 A;  3MVY A;  4QHQ A;  4O7I A;  1H45 A;  3HO7 A;  3MPL A;  3ROJ A;  3TQL A;  2P2A A;  3OO6 A;  2G93 A;  2PCR A;  4G2Z A;  1POT A;  4G68 B;  2DS9 A;  2F7B A;  1Y1Z A;  3ONM A;  3I5O A;  5ESY A;  5I2N B;  3OO8 A;  4ESX A;  1VFD A;  4P56 A;  3IJX B;  1ZTY A;  1DTZ A;  3IB0 A;  3N5L A;  3FZV A;  3N94 A;  4OES A;  4P8B A;  2DE2 A;  3K02 A;  4DXC A;  4ZE9 A;  1MM6 A;  3PPP A;  1MXZ A;  5I3S A;  3IK6 B;  1JEU A;  3JZJ A;  1BP5 A;  3K00 A;  1TXF A;  3BIH A;  4YKP A;  2Q88 A;  1DMB A;  3B50 A;  4Z7E A;  3IB2 A;  1MPC A;  4F39 A;  5JK4 A;  5KCJ A;  4MJO A;  1I6Q A;  4IY5 A;  4IB2 A;  4NHB A;  5FHO A;  2Y5L A;  1B3H A;  4N15 A;  4H46 A;  4H1X A;  3VDF A;  1ZU0 A;  5LTC A;  5I2N A;  3FUZ A;  3VXB A;  3CVG A;  5DEX B;  5L8D A;  1GGG A;  2P3N A;  4AS5 A;  1B7U A;  3CI8 A;  4OAN A;  2UXA A;  4FJP A;  1MH4 A;  3OSQ A;  2F7C A;  5FBP A;  5JTY A;  4PE3 A;  1N0T A;  4F22 A;  1RDX A;  2FA7 A;  1LAG E;  5I56 A;  2ESN A;  4MHF A;  4G68 C;  1URS A;  4X48 A;  4F2O A;  1LEV A;  2R71 A;  2NWJ A;  4NWD A;  2A5T B;  1NUW A;  4G8N A;  1FPJ A;  3F11 A;  4H5G A;  1LAH E;  4KR5 A;  4ZZE A;  2GHA A;  1EU8 A;  1FTJ A;  4GQO A;  4POW A;  1KA1 A;  2O7U A;  1K9Y A;  2HFB A;  5ET6 A;  1Q9D A;  3B6T A;  2Y7W A;  3PV0 E;  1M5F A;  2W7Y A;  4YZZ A;  3D1R A;  2DXR A;  3GYY A;  3K2D A;  5EQ9 A;  5ITO A;  4F3S A;  4XTC Q;  3H06 B;  5CMM A;  1M5B A;  3LSF B;  3PUX E;  2Z8F A;  2REJ A;  4NN3 A;  1B0H A;  4FAT A;  2P1S A;  3U93 A;  3T93 B;  5DW8 A;  3O66 A;  3C35 A;  1VDW A;  4QFK A;  2IA4 A;  1XVX A;  2XD2 A;  4GWZ A;  2CEX A;  5CC2 A;  3HHF A;  1XS5 A;  1FRP A;  2WBD A;  1VFE A;  3TEP A;  4EF1 A;  4GFR A;  1JET A;  2GH9 A;  1MPB A;  3A3U A;  4ZZA A;  2Q2C A;  1JEV A;  1MDP 1;  4BLA A;  4YB7 A;  2Z8E A;  2D5W A;  3FJ7 A;  5H8H A;  5J16 A;  3V83 A;  4N07 A;  4XIG Q;  5CBR A;  3O29 A;  1NV5 A;  1FQB A;  1MQG A;  2DSF A;  4DLD A;  1K9Z A;  3Q28 A;  2F7A A;  4MFI A;  4KI0 E;  3FBP A;  4MNC A;  5IAI A;  1LBZ A;  1NNT A;  2QVU A;  3IOW A;  4Q5T A;  1SYI A;  1TFD A;  3FVO A;  2RCB A;  2THI A;  3QUF A;  2ZZV A;  1EH3 A;  1A8F A;  2WX9 A;  1PB8 A;  1EYI A;  3SET A;  4OEV A;  4U21 A;  3Q29 A;  4HW8 A;  4FE8 A;  5AE4 A;  4RXL A;  1FJ9 A;  4FEC A;  1JNF A;  2FYI A;  1G0I A;  2OLB A;  4PAI A;  4EDP A;  1Y3P A;  5H8H B;  4OVQ A;  4IO3 A;  1INP A;  4KYS A;  1FBH A;  2DYX A;  4NG7 A;  5TP9 B;  4YKJ A;  2ZNS A;  1RYO A;  2KR0 A;  3QUJ A;  5A5L A;  1GR2 A;  2F78 A;  2ZZW A;  1GV8 A;  1KZ8 A;  4QXD A;  1IMC A;  2Z23 A;  3VV5 A;  1FW0 A;  4GX4 A;  4DDD A;  2F6G A;  3PTY A;  1UIU A;  2F97 A;  3KN7 A;  4PBQ A;  3EKI A;  4P1L A;  4JSO A;  4N91 A;  2GQ1 A;  4QFP A;  1Y4C A;  2HEU A;  3CRB A;  4RA1 A;  2ZYN A;  3PUY E;  5AA2 B;  1JW1 A;  3RY3 A;  4X04 A;  3MST A;  1Y4T A;  2H25 A;  4H6D A;  2XWV A;  3TTL A;  1LCF A;  4H0W A;  4JWX A;  1XOC A;  3S9L C;  4BDR A;  3FXU A;  4OVJ A;  5I7I A;  1A7L A;  1NFT A;  1FSA A;  2UYE A;  1D9Y A;  2O7I A;  1FJ6 A;  1FQF A;  4PGP A;  3VVE A;  5B7D A;  5TP9 A;  5I56 B;  5JEI A;  4YU0 A;  3IO4 A;  5DEX A;  4OA4 A;  4OWD A;  2CEY A;  5KCJ B;  3ILU B;  4GWO A;  4NF6 B;  3IOV A;  2Q8M A;  2QS1 A;  2H99 A;  1XHY A;  2X26 A;  4OYV A;  1Z7N E;  2O1L A;  4NTL A;  4F3B A;  3QK6 A;  4GL0 A;  3M3L A;  3OD7 A;  4ELR A;  1IZ1 A;  1B1X A;  4YKI A;  5H8F B;  1HSJ A;  4OFO A;  3ISP A;  4R6H A;  3FVG A;  1B46 A;  2H4I A;  3T96 B;  3IR1 A;  4Q30 B;  3T66 A;  3RYD A;  4AB6 A;  2Y5K A;  3W9V A;  3B6W A;  4HE1 A;  3VLW A;  2ZYO A;  2AL4 A;  4LZ7 A;  1UQW A;  4RJZ A;  3TOD A;  1NNK A;  3ZKK A;  4N4U A;  3IOU A;  1B6H A;  2BJI A;  1LGB C;  3PMX A;  1RDZ A;  4DI3 D;  1MQI A;  3I6V A;  5CM6 A;  5CMK A;  3LBS A;  4P0G A;  4PFB A;  4N8G A;  3MJN A;  3NOH A;  3PUW E;  3HPI A;  4OFL A;  1HSE A;  1IXI A;  3RQT A;  3FV1 A;  1NNP A;  3LSW A;  2F3B A;  2V3T A;  1RDY A;  4G68 A;  5BWJ A;  4PAK A;  5FTI A;  4JSD A;  5HBC A;  4X1D A;  1NV2 A;  1CB6 A;  2GFE A;  3BFT A;  4F29 A;  1QKA A;  3UIF A;  2XWK A;  2V84 A;  3ZS6 A;  1HSL A;  3IFA A;  5M2V A;  3EHT A;  4GWX A;  3UN6 A;  4Q0C A;  1IMA A;  2O6A A;  2HPG A;  4G4P A;  4C1U A;  1BK4 A;  2ABH A;  4JVI A;  4PTK A;  2PFZ A;  3OEM A;  2XXY A;  3TMG A;  1Y3Q A;  1BTJ A;  1LLS A;  2I4B A;  4BDN A;  3O28 A;  2B4L A;  2O68 A;  4P1E A;  4O94 A;  4TQU Q;  3T9U A;  3EQ1 A;  4G77 A;  2ALU A;  1IME A;  4GX3 A;  4PFY A;  4R6K A;  2XD3 A;  1S50 A;  3D4C A;  4MBP A;  4MNI A;  4PAF A;  3MZ9 A;  1SVX B;  4HS7 A;  4IO5 A;  4I62 A;  5JTY B;  4GF8 A;  2VGQ A;  2L5V A;  4PC9 A;  3MW0 A;  3PPQ A;  3KOS A;  3U94 A;  3TTR A;  3RUM A;  5EQ7 A;  4MCO A;  4NX1 A;  5EQA A;  4JVC A;  2XXH A;  3TAJ A;  1XC1 A;  2PMS A;  4X1B A;  5I2K A;  1URG A;  3SEY A;  5IZ1 A;  3DM0 A;  1DCU A;  1P1U A;  3MBP A;  2DVZ A;  1P1O A;  3QMF A;  1RYX A;  1MY3 A;  2RF1 A;  3O6I A;  5T3J A;  5EHM A;  2RCA A;  4N17 A;  3FIR A;  4U1O A;  4R75 A;  4ELP A;  1B7Z A;  4GIZ A;  1NV6 A;  5FHM A;  1SW1 A;  1FQE A;  1H43 A;  4LQ2 A;  3HST A;  4XEQ A;  2Z22 A;  3U72 A;  5DVJ A;  1B05 A;  4MX6 A;  4QSE A;  3TCG A;  2KLF A;  1LB9 A;  3BFU A;  4UA8 A;  3TFL A;  3KEI A;  1MXX A;  3E78 A;  4R2B A;  2B65 A;  1FCK A;  4DI4 B;  1SW4 A;  1N3X A;  3JV9 A;  3VE1 B;  1B40 A;  4U2R A;  2E1S A;  1QUJ A;  3K1M A;  4ONY A;  3THI A;  3C31 A;  1FBD A;  4EXL A;  4XFE A;  5BUU A;  4X8R A;  3UOR A;  4Z0I A;  4PFR A;  3ILT B;  1USY E;  1LFG A;  1FPI A;  4YAH X;  1XT8 A;  2I49 A;  4F19 A;  2Z8D A;  5CMB A;  5AA2 A;  2QL3 A;  3MAM A;  1NV4 A;  5FHN A;  4U22 A;  3RT6 B;  3M3F A;  2UVG A;  4THI A;  4DIG A;  2QPQ A;  2R9J A;  2OX3 A;  1FPF A;  4YB6 A;  3K0V A;  4ZEF A;  5AA4 A;  3BKI B;  2V4C A;  3KZG A;  4N81 A;  4NQ8 A;  1I6B A;  1FTO A;  3FGS A;  1QGX A;  4O8M A;  3GBB A;  3RPL B;  3KBR A;  3OEK A;  2JJK A;  2DXY A;  3W15 C;  3MPK A;  1Q1K A;  3V8X B;  1S9T A;  1NKX A;  3A29 A;  4IO2 A;  4EF2 A;  1FPD A;  3FAT A;  3G3I A;  4MLV A;  3KN8 A;  2ZYK A;  4XF5 A;  4EQ9 A;  1FTK A;  4ZEI A;  5ICQ A;  2F34 A;  2OK2 A;  1LFH A;  2Q74 A;  4H65 A;  4QFO A;  4JWY A;  1IIW A;  3SES A;  3ECR A;  4HXV A;  1B2H A;  5KDT B;  1FPG A;  2QVR A;  1B4H A;  3KSJ A;  5CI5 A;  1RKM A;  4LN5 A;  1TFA A;  2XXT A;  3CFL A;  4OVT A;  5TPA A;  4R6Y A;  1OVB A;  4FBP A;  3C33 A;  4LQ5 A;  1P1Q A;  4GXS B;  1QUL A;  4R74 A;  3UA8 A;  2ONR A;  1MS7 A;  4I9D A;  4NF0 A;  4R72 A;  2V3U A;  3MZ1 A;  2F5X A;  4GLI A;  1PDA A;  3KSX A;  3QSL A;  5I59 A;  1AMF A;  4H67 A;  4P3L A;  1OLC A;  2DWI A;  4GWS A;  1LBW A;  3E9X A;  4I1D A;  3G3G A;  2DVC A;  3SEV A;  2Y7P A;  3OXN A;  5IZZ A;  2DOJ A;  2X7P A;  3S4U A;  5ISU A;  2AYS A;  2VD2 A;  1AH5 A;  1LBY A;  2F3D A;  3RTW B;  3M8U A;  1MXY A;  3K1N A;  3MQ9 A;  3EF7 A;  1G0H A;  1AIV A;  4UAB A;  3WAF A;  5HPQ A;  2ZXT A;  4R73 A;  3VFJ A;  1MY2 A;  4YKK A;  4PF6 A;  1NUZ A;  1ANF A;  2CZH A;  3OOA A;  4OEN A;  3MYU A;  4F18 A;  4WEP A;  4FEB A;  1QVS A;  1LBB A;  2I6E A;  1US5 A;  2I3W A;  2DWA A;  3R26 A;  1NNF A;  5ET8 A;  1T0K A;  4KPT A;  1US4 A;  2E0S A;  1MG1 A;  2XXU A;  1R6Z A;  3E13 X;  1B3L A;  2WKY A;  4XKR A;  4MH5 A;  3K6W A;  5CRY A;  4C0R A;  2DWH A;  1I6A A;  4ECF A;  4GX6 A;  4PP0 A;  2Q2A A;  3LSX A;  4FIM A;  3KBZ A;  5F24 A;  4NF5 A;  3N26 A;  1A55 A;  4U23 A;  4EUO A;  1SQY A;  4Q8R A;  1YCJ A;  3IB1 A;  3BIG A;  1NL5 A;  1NI9 A;  1PEB A;  1FTL A;  4DXU A;  1MQJ A;  5IKB A;  3T22 A;  2HXR A;  4PF8 A;  1B5J A;  1MPD A;  4OFJ A;  5DVI A;  3OO7 A;  3CHG A;  3TTM A;  4LP2 B;  2XXI A;  1M5C A;  2ZZX A;  3K01 A;  3VVD A;  3QAX A;  3MC2 A;  3C36 A;  2XWO A;  3OEL A;  1H76 A;  4EQB A;  4IO4 A;  2XXQ A;  5I59 B;  1PB9 A;  3QYT A;  3HHG A;  2PT1 A;  2R6G E;  4TOZ A;  1B3F A;  3PD8 A;  1M5E A;  2QVV A;  3H6T A;  2XWI A;  2VPO A;  4NF5 B;  1N7W A;  4EXK A;  1P1N A;  2Q9T A;  4M1V A;  4GWW A;  1MQD A;  3IL1 B;  1MY1 A;  2HQ0 A;  4YMB A;  4RYA A;  1ZBM A;  4GL8 A;  2HAV A;  4P47 A;  2CZK A;  4P9K A;  5L9O A;  1SW5 A;  1AOV A;  2OWS A;  3FJM A;  1FTM A;  1N04 A;  3IAZ A;  1PBP A;  1P99 A;  2MKZ A;  4AQ4 A;  4PCD A;  3HN0 A;  3L6G A;  4BDO A;  1DPP A;  1O63 A;  1B7H A;  3CSB A;  5EYF A;  1BLF A;  4F2Q A;  2UVH A;  2DP8 A;  2F36 A;  2VOZ A;  1SI0 A;  4WXJ A;  1B3G A;  1B3E A;  3EHU A;  2O1M A;  2VP1 A;  1SD3 A;  3PPO A;  4E0X A;  1ZKB A;  1NV1 A;  2AIX A;  3H3G A;  2CZL A;  5K2Y A;  4ZS9 A;  1YZ0 A;  2I0C A;  3HFU A;  4O7M A;  1JVX A;  3MP6 A;  3IOT A;  3L6H A;  4OMB A;  2O69 A;  4IO6 A;  2OCU A;  4MAG A;  1NV3 A;  1FQD A;  2QMX A;  3FVN A;  3DP6 A;  4FAJ A;  3U8Q A;  3HV1 A;  2VD3 A;  3R7X A;  4JXI A;  1R9Q A;  1FBP A;  2P3V A;  2PYY A;  5I5P A;  3QXM A;  3VLV A;  3R6U A;  1NV7 A;  3H7M A;  4N8Y A;  4KYE A;  1FPK A;  5ELV A;  3DEL B;  4IY6 A;  4LVQ A;  3D4G A;  3TTN A;  3TCH A;  4FED A;  2H98 A;  3Q27 A;  3T1B A;  4QSC A;  4H5F A;  2V3Q A;  4KCC A;  1A99 A;  1R9L A;  1SPI A;  2XHD A;  3EPE A;  2QMW A;  2B3F A;  3SZP A;  1A40 A;  3RPW A;  2QS4 A;  5A5X B;  4R9F A;  3V89 B;  4NF8 B;  4GD5 A;  4F31 B;  3IFC A;  3A09 A;  4GRK A;  1LFI A;  4LZ5 A;  3LUZ A;  4G61 A;  4G8H A;  2XA5 A;  4H45 A;  4AS4 A;  2PVU A;  4N6K A;  1SI1 A;  2Q8J A;  2FIX A;  3TYH A;  3FV2 A;  5AA4 B;  4RPN A;  1URD A;  3WAE A;  4PFI A;  4PFU A;  2V25 A;  4DZ1 A;  1ATG A;  1WDN A;  3LC8 A;  2VPN A;  3W9W A;  1Y1M A;  4MF3 A;  1B51 A;  4U4X A;  1KWH A;  3GXA A;  3UGW A;  1JW5 A;  3PMW A;  1OQH A;  2QSX A;  5I2K B;  4MEV A;  3G3H A;  4OVP A;  3KN3 A;  2PFY A;  2ZMB A;  3TCF A;  2HXW A;  1FBC A;  4YB5 A;  5I58 B;  3MVX A;  4LON B;  5IZ3 A;  2PT2 A;  5F7V A;  4PFT A;  4O3B A;  4GWY A;  2XXX A;  1IIT A;  1OVT A;  4QBA A;  4FOR A;  4OVR A;  3MP1 A;  4AB5 A;  1SW2 A;  4NF4 B;  1UIV A;  4E0W A;  3UP9 A;  2O84 X;  5ICT A;  5H8Q B;  2P0S A;  3H03 A;  5ITP A;  3TKD A;  2HCA A;  2HAU A; 
#chains in the Genus database with same CATH homology
 1RKM A;  3H4Z A;  4OEV A;  4U21 A;  3GBA A;  3PMV A;  3I3V A;  3RT8 A;  1TFA A;  3FXR A;  4RNS A;  3Q29 A;  2XXT A;  3CFL A;  4HW8 A;  2G29 A;  4FE8 A;  5AE4 A;  1Q35 A;  4RXL A;  1GVC A;  5TPA A;  4R6Y A;  2XX7 A;  1YPN A;  4BDL A;  1OVB A;  5F1Q A;  1MY4 A;  3C4M A;  3C33 A;  4XXU A;  3N6T A;  4FEC A;  4LQ5 A;  1P1Q A;  4GXS B;  1JNF A;  2FYI A;  3AXF A;  1ELJ A;  4C1T A;  1QUL A;  3TTK A;  1A54 A;  4LA9 A;  4R74 A;  3FD3 A;  3K6V A;  3UA8 A;  3CR9 A;  2ONR A;  1YAE A;  2OLB A;  1DPE A;  1MQH A;  1MS7 A;  4JDF A;  4I9D A;  1DSN A;  4EDP A;  1VR5 A;  1Y3P A;  2V93 A;  1H44 A;  4R72 A;  3JYR A;  5H8H B;  2V3U A;  4L17 A;  2DE3 A;  4IO3 A;  3ZSF A;  1B1H A;  4OTE A;  1TT1 A;  1WOD A;  3MZ1 A;  4TLM B;  4ZEK A;  1POY 1;  4KYS A;  4OXV A;  2F5X A;  2DYX A;  4O3A A;  4GLI A;  4K3F A;  1PDA A;  3KSX A;  1N76 A;  2HZL A;  2NOO A;  1IUD A;  1AMF A;  2Q89 A;  2Y84 A;  3QSL A;  4OZ9 A;  4H67 A;  2ZNS A;  4HCW A;  2RC9 A;  3PUV E;  4NF8 A;  4YKJ A;  1RYO A;  5DT6 A;  1LAX A;  2XX9 A;  3CG3 A;  1Z7M E;  1OLC A;  2DWI A;  3E3K A;  5L9M A;  3RNN A;  3QUJ A;  4OER A;  3IX1 A;  1LCT A;  4IGT A;  1SBP A;  3E9X A;  4I1D A;  4UAC A;  3OSR A;  1GR2 A;  2I0B A;  2F78 A;  2NXO A;  3G3K A;  1GV8 A;  3CFZ A;  4ZEC A;  3TUS A;  5AA3 A;  5I58 A;  2Z23 A;  3VV5 A;  1MDQ A;  2I3V A;  3G3G A;  1FW0 A;  2DVC A;  3B7D A;  3SEV A;  2Y7P A;  3VLU A;  4DDD A;  2F6G A;  4C1U A;  1UIU A;  1Y3N A;  3OXN A;  2F97 A;  4OHN A;  5TPA B;  1N7X A;  3KN7 A;  3SEX A;  5K2X A;  2DOJ A;  1PBQ A;  2X7P A;  2VHA A;  4JSO A;  1NMU A;  3S4U A;  5TP9 B;  4YMA A;  2AYS A;  5ISU A;  1S7Y A;  2VD2 A;  1AH5 A;  4QFP A;  1Y4C A;  3BBR A;  5AA1 A;  3RTW B;  3H6U A;  3DP4 A;  3M8U A;  1MXY A;  3N6U A;  2RC7 A;  1BKA A;  2BJJ X;  2RIN A;  3K1N A;  3MQ9 A;  4JBZ A;  3EF7 A;  1AIV A;  4YIC A;  2RKM A;  3WAF A;  2REG A;  2I58 A;  3S2V A;  2ZXT A;  5HPQ A;  1VE4 A;  2HEU A;  4M4G A;  4R73 A;  3VFJ A;  5J1D A;  3PU5 A;  3DP8 A;  1B4Z A;  1QJM A;  4IGR A;  2UVI A;  1I69 A;  1II5 A;  1UTB A;  4R2F A;  1MY2 A;  3CRB A;  4F3P A;  4RA1 A;  3PPN A;  4MLQ A;  4YKK A;  4GXA A;  1ANF A;  1LST A;  4GOT A;  4DE8 A;  3FAS A;  3IOR A;  2ZYN A;  1N84 A;  1O64 A;  3PUY E;  3OOA A;  4OEN A;  3T9X B;  5AA2 B;  4NF6 A;  1JW1 A;  3G3F A;  2YJP A;  3MVW A;  4ZE8 A;  3RY3 A;  4WEP A;  3VVF A;  1M5D A;  4F18 A;  1Y4T A;  5LOM A;  2H25 A;  4ZEB A;  4DCX A;  4FEB A;  4U4S A;  1QW0 A;  1SDX A;  4H6D A;  3TTL A;  5I57 A;  5KZT A;  2B3B A;  3K4U A;  1SYH A;  3K6X A;  1D4N A;  1QVS A;  3U1O A;  1TWY A;  2CMO A;  4NF4 A;  1LCF A;  1LBC A;  1LBB A;  1YTV A;  3IO6 A;  5H8N A;  4H0W A;  2I6E A;  4JWX A;  2PX1 A;  3FJG A;  1XOC A;  1OIB A;  3S9L C;  4BDR A;  3FXU A;  1US5 A;  2I3W A;  3SER A;  5HM4 B;  1DTG A;  4OVJ A;  1L5T A;  2DWA A;  4ELO A;  1A7L A;  1NFT A;  2UYE A;  3R26 A;  2AL5 A;  1NNF A;  1MXV A;  1D9Y A;  2O7I A;  1QUI A;  3C9H A;  3Q25 A;  1MM7 A;  1FQF A;  1US4 A;  2E0S A;  3PGF A;  3CSG A;  1H3D A;  4KPT A;  3TDJ A;  1MG1 A;  3VVE A;  5TP9 A;  5B7D A;  5I56 B;  5JEI A;  2ZYM A;  2XXU A;  4YU0 A;  3IO4 A;  1EZ9 A;  4RK2 A;  1R6Z A;  5DEX A;  3K6U A;  3P7I A;  4JWO A;  4NED A;  3E13 X;  1N3W A;  4HTG A;  4OWD A;  1Y20 A;  1B3L A;  3KJT A;  2D21 A;  4F1V A;  5KCJ B;  2WKY A;  2O51 A;  1BIY A;  3G7W A;  3O2A A;  3PD9 A;  2F6P A;  3K6W A;  4MH5 A;  3ILU B;  1IEJ A;  4U1Z A;  3G3J A;  1DOT A;  4XKR A;  2QRY A;  4ESW A;  3LR1 A;  1MXW A;  4F3G A;  4GWO A;  2DWH A;  4NF6 B;  1I6A A;  4POX A;  4RPO A;  2PBW A;  4WED A;  4ECF A;  3H6V A;  3RLF E;  5CBS A;  3MP8 A;  4QSD A;  2YLN A;  1J1N A;  4PP0 A;  2Q2A A;  3IOV A;  4PE5 B;  3TZA A;  2QS1 A;  1D3K A;  2QJE A;  1P1W A;  4H8J A;  2H99 A;  1XHY A;  2X26 A;  3LSX A;  5FTH A;  4FIM A;  4OYV A;  1Z7N E;  3O6H A;  3SDF A;  3B6Q A;  2O1L A;  4NTL A;  4F3B A;  4QFL A;  4QF9 A;  4XKP A;  5AA2 D;  5H8F A;  4NF5 A;  4O3C A;  2ZNU A;  3N26 A;  3QK6 A;  4GL0 A;  3RN8 A;  1A55 A;  2M8C A;  3K1P A;  3M3L A;  3OD7 A;  3Q26 A;  4HCY A;  4ND9 A;  4U23 A;  1B4H A;  1OLA A;  4ELR A;  5H8Q A;  1IZ1 A;  2GRV A;  1B1X A;  3KGC A;  4N13 A;  1JVY A;  4YKI A;  1SQY A;  5H8F B;  4EUO A;  4Q8R A;  1HSJ A;  2QS3 A;  3A3C A;  1MXU A;  4OFO A;  1YCJ A;  3IB1 A;  4R6H A;  1NL5 A;  3FVG A;  1IQ7 A;  1B46 A;  1Y9U A;  4PFW A;  1UTB B;  2XX8 A;  2H4I A;  4XKN A;  4NWC A;  1PEB A;  3T96 B;  1FTL A;  4DXU A;  5KDT A;  3IR1 A;  4Q30 B;  1MQJ A;  3T66 A;  5IKB A;  4XKQ A;  3T22 A;  1D9V A;  3USD A;  4AB6 A;  3LUY A;  5A5X A;  3W9V A;  4LAT A;  1B5J A;  3B6W A;  4ELQ A;  3EHS A;  3VLW A;  1MPD A;  1XVY A;  2UVJ A;  4LUB A;  2ZYO A;  1IXH A;  2AL4 A;  2OJT A;  2Y7K A;  4GVO A;  4OFJ A;  1PC3 A;  4LZ7 A;  1UQW A;  3FXQ A;  4IO7 A;  4RJZ A;  1CE2 A;  3TOD A;  1NNK A;  1PB7 A;  3ZKK A;  3IOU A;  3CG1 A;  5DVI A;  3OO7 A;  3TTM A;  4LP2 B;  3MVY A;  1B6H A;  4QHQ A;  2XXI A;  1H45 A;  1LGB C;  3HO7 A;  3MPL A;  3PMX A;  1M5C A;  1MQI A;  3K01 A;  3TQL A;  1F9B A;  3VVD A;  3I6V A;  5CM6 A;  2P2A A;  5CMK A;  3LBS A;  3QAX A;  2XXP A;  3MC2 A;  3OO6 A;  3C36 A;  2G93 A;  3FVK A;  3MJN A;  4P0G A;  3RTF B;  5I59 A;  4EQ7 A;  3OEL A;  4G2Z A;  1POT A;  3PUW E;  4G68 B;  1H76 A;  2XXV A;  3HPI A;  4OFL A;  4EQB A;  1HSE A;  2DS9 A;  1IXI A;  2F7B A;  5L9S A;  4IO4 A;  1Y1Z A;  3RQT A;  4F1Y A;  3FV1 A;  3ONM A;  3I5O A;  3OEN A;  1NNP A;  5DVF A;  2XXQ A;  3OO8 A;  4OQO A;  5I2N B;  3LSW A;  5I59 B;  1PB9 A;  4ESX A;  2V3T A;  3E4R A;  3MWB A;  1VFD A;  3QYT A;  4G68 A;  4ISU A;  1OQG A;  5BWJ A;  3HHG A;  2PT1 A;  1EZP A;  4BDQ A;  5FTI A;  4JSD A;  5HBC A;  3IJX B;  2R6G E;  4TOZ A;  5H8S A;  4X1D A;  2F8D A;  1ZTY A;  1CB6 A;  2GFE A;  4KHZ E;  5CMC A;  1DTZ A;  3BFT A;  3IB0 A;  3FZV A;  1B3F A;  3N5L A;  3N94 A;  4OES A;  4F29 A;  3PD8 A;  1M5E A;  5B70 A;  2DE2 A;  1QKA A;  3K02 A;  3H6T A;  4NF5 B;  3UIF A;  4DXC A;  1ZLQ A;  1N7W A;  3U92 A;  4EXK A;  1P1N A;  2V84 A;  2Q9T A;  3ZS6 A;  4ZE9 A;  1HSL A;  4M1V A;  1MM6 A;  3PPP A;  1VSO A;  5M2V A;  2ONK E;  3EHT A;  1MXZ A;  3UN6 A;  1NH8 A;  1MQD A;  4Q0C A;  1EZO A;  3IK6 B;  1JEU A;  3IL1 B;  2O6A A;  1B5H A;  1BP5 A;  1MY1 A;  2HQ0 A;  3JZJ A;  4YMB A;  3K00 A;  4G4P A;  4P11 A;  1TXF A;  4RYA A;  1ZBM A;  2Q88 A;  4GL8 A;  4YKP A;  2NVU B;  3V5A A;  5EHS A;  2HAV A;  5L9O A;  1DMB A;  1SW5 A;  1AOV A;  2OWS A;  2RC8 A;  4Z7E A;  3FJM A;  1FTM A;  1N04 A;  1MPC A;  3IB2 A;  1PBP A;  3IAZ A;  4F39 A;  1P99 A;  2ABH A;  4NMY A;  2YPN A;  4AQ4 A;  5JK4 A;  1UTH A;  5KCJ A;  4DXB A;  1I6Q A;  4IY5 A;  4IB2 A;  5FHO A;  3HN0 A;  3S9N C;  3L6G A;  1B3H A;  3OEM A;  1LAF E;  1QUK A;  2XXY A;  1Y3Q A;  3TMG A;  4BDO A;  1BTJ A;  1DPP A;  1LLS A;  2OZZ A;  4H1X A;  1O63 A;  2I4B A;  3VDF A;  1ZU0 A;  5I2N A;  1B7H A;  3CSB A;  3FUZ A;  1IXC A;  3O28 A;  2O68 A;  1USY H;  3VXB A;  4BDN A;  3IJO B;  4I8C A;  5EYF A;  3T9H B;  1BLF A;  3CVG A;  5DEX B;  4TQU Q;  4F2Q A;  4RY1 A;  2UVH A;  2H9B A;  2DP8 A;  2F36 A;  2VOZ A;  5L8D A;  1GGG A;  3T9U A;  1SI0 A;  1B7U A;  3CI8 A;  3KSJ A;  1ZIU A;  4WXJ A;  1B3G A;  2UXA A;  3EQ1 A;  4G77 A;  4FJP A;  1B3E A;  3EHU A;  2ALU A;  1MH4 A;  2O1M A;  2VP1 A;  1SD3 A;  3PPO A;  2DQV A;  1QKB A;  1ZKB A;  4NE4 A;  4PFY A;  4R6K A;  4E0X A;  2XD3 A;  2ZNT A;  3OSQ A;  4OEU A;  2AIX A;  1S50 A;  2X7Q A;  3H3G A;  2F7C A;  3D4C A;  4MBP A;  3KFM A;  3O9P A;  2CZL A;  5K2Y A;  5JTY A;  3MZ9 A;  4ZS9 A;  2Y7R A;  2I0C A;  1N0T A;  1SVX B;  4HS7 A;  2IEE A;  4IO5 A;  4F22 A;  4I62 A;  2FA7 A;  1LAG E;  5JTY B;  1JVX A;  1LB8 A;  3MP6 A;  4GF8 A;  3IOT A;  5I56 A;  1GTK A;  2VGQ A;  4H8I A;  2A5S A;  3L6H A;  4OMB A;  2O69 A;  4IO6 A;  3S9M C;  2ESN A;  2OCU A;  1B32 A;  3MW0 A;  3SKP A;  4G68 C;  1FQD A;  3PPQ A;  3KOS A;  2QMX A;  3U94 A;  1B58 A;  3FVN A;  3DP6 A;  1URS A;  4X48 A;  3RUM A;  3TTR A;  3U8Q A;  1A8E A;  4F2O A;  4FAJ A;  3C32 A;  1UTH B;  2H5Y A;  2XXH A;  3HV1 A;  3TAJ A;  1XC1 A;  2R71 A;  2PMS A;  2VD3 A;  4JXI A;  4WKM A;  2NWJ A;  1R9Q A;  4NWD A;  3R7X A;  4X1B A;  3PUZ E;  2A5T B;  5I2K A;  1URG A;  4G8N A;  3F11 A;  2PYY A;  4H5G A;  4ZDM A;  3SEY A;  3DM0 A;  3O6G A;  4F1U A;  1LAH E;  4KR5 A;  4ZZE A;  1P1U A;  2GHA A;  3MBP A;  3QXM A;  3VLV A;  1EU8 A;  1FTJ A;  4GQO A;  3R6U A;  4KFQ A;  3VXC A;  4POW A;  2DVZ A;  2O7U A;  3H7M A;  1MH3 A;  1P1O A;  4KYE A;  1RYX A;  1MY3 A;  2HFB A;  4X9T A;  2RF1 A;  5ELV A;  3ZKL A;  3H6W A;  3O6I A;  3DEL B;  1B52 A;  4IY6 A;  4LVQ A;  2RCA A;  5EHM A;  2ONS A;  3D4G A;  3TTN A;  3EN3 A;  2FNC A;  3TCH A;  3FIR A;  4FED A;  4R75 A;  4U1O A;  1B7Z A;  2H98 A;  4ELP A;  3KOT A;  4GIZ A;  3B6T A;  3Q27 A;  5FHM A;  1SW1 A;  1FQE A;  2GHB A;  1ZMG A;  1H43 A;  4H5F A;  3HST A;  2V3Q A;  4KCC A;  4LQ2 A;  4LZ8 A;  4QSC A;  1A99 A;  1R9L A;  2Z22 A;  3MVZ A;  4JB7 A;  2Y7W A;  3U72 A;  3UK4 A;  2XHD A;  3EPE A;  2QMW A;  1M5F A;  2B3F A;  3PV0 E;  5DVJ A;  1A40 A;  3RPW A;  2W7Y A;  1B05 A;  2QS4 A;  4YZZ A;  5A5X B;  4R9F A;  3V89 B;  4NF8 B;  4QSE A;  3TCG A;  2KLF A;  4GD5 A;  4KYD A;  5CRY A;  1LB9 A;  3BFU A;  2DXR A;  4UA8 A;  3TFL A;  3KEI A;  4F31 B;  3K2D A;  1MXX A;  4P0I A;  4R2B A;  5ITO A;  4F3S A;  2B65 A;  3A09 A;  4XTC Q;  3H06 B;  1FCK A;  4GRK A;  2I4C A;  1LFI A;  2F35 A;  1JQF A;  3GLB A;  5CMM A;  5I57 B;  4LZ5 A;  4G8M A;  1M5B A;  1MY0 A;  1SW4 A;  3LSF B;  1N3X A;  3JV9 A;  2Z8F A;  1B40 A;  3PUX E;  2REJ A;  4G8H A;  4PET A;  4U2R A;  3VE1 B;  3S9E A;  1B0H A;  2E1S A;  2PVU A;  4FAT A;  1SI1 A;  2HZK A;  1QUJ A;  3K1M A;  3O97 A;  4ONY A;  2P1S A;  2Q8J A;  3THI A;  3C31 A;  3TYH A;  5I84 A;  3FV2 A;  2DE4 A;  4EXL A;  5AA4 B;  5BUU A;  4RPN A;  1URD A;  3U93 A;  3UOR A;  3WAE A;  3TPA A;  3T93 B;  4Z0I A;  2XXW A;  4PFU A;  3O66 A;  2V25 A;  3C35 A;  3ILT B;  3QIM A;  3PPR A;  4QFK A;  4DZ1 A;  1ATG A;  1USY E;  1WDN A;  1XVX A;  2IA4 A;  2XD2 A;  3LC8 A;  3RGY A;  5CC2 A;  1LFG A;  4YAH X;  1XT8 A;  2I49 A;  1WVJ A;  3HHF A;  3W9W A;  1XS5 A;  3KJ7 A;  3LSL A;  1R1N A;  1VFE A;  4F19 A;  2Z8D A;  5CMB A;  5AA2 A;  3TEP A;  4EF1 A;  4KCD A;  2QL3 A;  4GFR A;  1JET A;  1Y1M A;  2GH9 A;  1MPB A;  2OWT A;  1B5I A;  3MAM A;  4MF3 A;  1B51 A;  4U4X A;  5FHN A;  1KWH A;  3GXA A;  3GZG A;  4U22 A;  1OMP A;  3A3U A;  4ZZA A;  3RT6 B;  1AL3 A;  3M3F A;  2DWJ A;  3UGW A;  1JW5 A;  4KD5 A;  1O7T A;  2UVG A;  1T0K A;  2Q2C A;  2HAU A;  1IXG A;  1JEV A;  3PMW A;  4THI A;  1MDP 1;  4PQJ A;  1OQH A;  4C0R A;  4BLA A;  2QSX A;  4YB7 A;  4DIG A;  2A5T A;  2QPQ A;  1ZJL A;  2R9J A;  2Z8E A;  5I2K B;  5H8N B;  3HCQ A;  4YB6 A;  2D3I A;  3K0V A;  4KQP A;  4ZEF A;  5AA4 A;  2D5W A;  1B0L A;  3BKI B;  1FQC A;  3FJ7 A;  3G3H A;  3KZG A;  3M3K A;  3OMB A;  3KN3 A;  4R9G A;  5H8H A;  4QFN A;  4DCY A;  2ZMB A;  3TQW A;  4OET A;  3C34 A;  3SEU A;  3T9V A;  3V83 A;  3TEL A;  4N07 A;  4XIG Q;  1I6B A;  3TCF A;  2HXW A;  1FTO A;  5CBR A;  3FGS A;  3O29 A;  4YB5 A;  4ZED A;  3MZB A;  5I58 B;  3MVX A;  3GBB A;  1FQA A;  1FQB A;  3KBR A;  1MQG A;  3OEK A;  4LON B;  4QRZ A;  2PT2 A;  2DSF A;  3KG2 A;  2DXY A;  3W15 C;  4DLD A;  3Q28 A;  3MPK A;  1Q1K A;  2ANJ A;  2F7A A;  5F7V A;  3V8X B;  4PFT A;  3DLN A;  4O3B A;  2I48 A;  2XXX A;  4MFI A;  3SEW A;  1IIT A;  1OVT A;  4RK9 A;  1S9T A;  4FOR A;  2QS2 A;  1NKX A;  3MUQ A;  4KI0 E;  3CIJ A;  3MP1 A;  4AB5 A;  4IO2 A;  4EF2 A;  3OO9 A;  1SW2 A;  4NF4 B;  1NH7 A;  3FAT A;  2OBG A;  3CFX A;  1UIV A;  2UYF A;  4E0W A;  5IAI A;  3G3I A;  4MLV A;  4BDM A;  3KN8 A;  2NUV A;  3UP9 A;  5TU0 A;  2ZYK A;  2O84 X;  5ICT A;  1NNT A;  2Y7I A;  1FTK A;  5H8Q B;  3ODB A;  4ZEI A;  4TLL B;  2F34 A;  2OK2 A;  4EQ9 A;  5ICQ A;  1LFH A;  2LAO A;  3IOW A;  4H65 A;  4Q5T A;  4QFO A;  5DYH A;  4JWY A;  1IIW A;  1SYI A;  3SES A;  1TFD A;  2P0S A;  3ECR A;  1B9J A;  3H03 A;  4N6P A;  3FVO A;  2RCB A;  2THI A;  1JW4 A;  1B2H A;  2XXR A;  3QUF A;  5ITP A;  1EH3 A;  5DTB A;  5KDT B;  1A8F A;  3TKD A;  1PB8 A;  2HCA A;  1MRP A;  3SET A;  5CI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...