1IIWA

Glur0 ligand binding core: closed-cleft ligand-free structure
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
226
structure length
221
Chain Sequence
GSAMALKVGVVGNPPFVFYGAFTGISLDVWRAVAESQKWNSEYVRQNSISAGITAVAEGELDILIGPISVTPERAAIEGITFTQPYFSSGIGLLIPGTATPLFRSVGDLKNKEVAVVRDTTAVDWANFYQADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNLNLEVTEIRVSLEPYGFVLKENSPLQKTINVEMLNLLYSRVIAEFTERWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms for ligand binding to GluR0 ion channels: crystal structures of the glutamate and serine complexes and a closed apo state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Membrane protein
molecule keywords Slr1257 protein
total genus 69
structure length 221
sequence length 226
ec nomenclature
pdb deposition date 2001-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iiwA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1iiwA02
2I6EA 2RCBA 3RLFE 3SEYA 4QHQA 5J1DA 3FASA 1N7WA 1PB8A 5AA1A 4AQ4A 2DE4A 2E0SA 5HM4B 2F35A 5CMCA 2FYIA 3K02A 3K1MA 1B4ZA 2QSXA 4N6PA 3FVKA 4X48A 2V93A 3Q28A 4WKMA 3S4UA 1VR5A 2RKMA 4ZZAA 4H5FA 3Q26A 1LLSA 5TP9A 5ICQA 2ZYKA 1BP5A 5B70A 1FQDA 3LR1A 3TEPA 3H03A 4H0WA 3FXRA 5CMMA 5IAIA 1NL5A 3EHUA 4IO6A 3O28A 4FIMA 4BDNA 3MP1A 5DTBA 3VFJA 1O64A 2I58A 3USDA 4H65A 3O29A 3E3KA 3BKIB 3EPEA 1N7XA 2LAOA 3IB2A 1JW4A 1WODA 2CMOA 2OLBA 4F31B 1I6AA 3LUYA 3UK4A 1TT1A 4BDLA 5I58A 1B5HA 3DP6A 1OMPA 3U72A 3M3KA 1MDP1 1XT8A 1MDQA 3W9VA 4QFKA 1JW5A 5H8SA 3TPAA 1QUJA 1H76A 4P0IA 1D4NA 2DE2A 4LZ5A 4TOZA 3OO9A 4MFIA 4Z0IA 1B3LA 1RYXA 4HCYA 3MUQA 4IGTA 3VVFA 1ELJA 3IOWA 3H3GA 4F3SA 1Y3QA 1DPEA 1UIUA 3P7IA 1LFGA 4H8IA 3KJ7A 3K2DA 3K1PA 3QYTA 3TDJA 4TLMB 1J1NA 3RNNA 3DELB 4MLQA 1P99A 1MXVA 1R1NA 2XHDA 3OMBA 3OSQA 3LSFB 1VFEA 4PFYA 4YAHX 3A3UA 5TPAA 4DE8A 4ESWA 4KYDA 2I3WA 4P0GA 5K2XA 5KDTB 1XC1A 4U2RA 1A54A 2UVIA 1IITA 5AA2A 1AIVA 1H43A 1R6ZA 2ANJA 1SW5A 2V84A 4QFLA 2I4CA 4KR5A 3O9PA 4NF6B 4YKPA 4XKPA 1Y4CA 3I3VA 4H67A 4ISUA 5DVIA 4YMAA 3IO4A 1ZU0A 3MPLA 4O3AA 3PU5A 1M5BA 4DIGA 1UIVA 1VSOA 3FJMA 3MWBA 4NMYA 4R74A 3RQTA 4H6DA 3PMXA 3M8UA 4MH5A 2PT2A 3W9WA 4LQ5A 1FTLA 2HFBA 2QS1A 3QK6A 1POTA 4HW8A 4F1YA 1H3DA 4ZEIA 4C0RA 4ELQA 3WAEA 4NF8B 1BKAA 3MBPA 1QW0A 4U23A 4ELPA 1BTJA 1POY1 1URGA 3OD7A 1N3WA 3IB0A 4GXSB 2A5TB 3PPPA 4GXAA 2HZKA 4JWOA 4AB5A 2DS9A 3G7WA 2ONSA 4LZ8A 5BWJA 3RGYA 2DVZA 1QVSA 3K00A 2F8DA 3A09A 3IK6B 1AOVA 3KN7A 3TQWA 4XTCQ 4POWA 3CG3A 3VDFA 2REJA 4EDPA 1B05A 4F22A 1SW2A 1A8FA 1EH3A 2DQVA 1M5EA 2XD3A 3K6VA 3SEXA 2ZNUA 3DP4A 3PUYE 1FQCA 1IEJA 1N04A 4G4PA 1TXFA 2VD2A 1MXYA 3C4MA 2XXYA 4R6KA 5DEXB 2F7BA 1LBCA 2F36A 3T22A 3A3CA 1RKMA 3K1NA 3C36A 3MJNA 4JDFA 4R6HA 3S9EA 2ZMBA 1EZOA 1MXWA 4XIGQ 3CFXA 2Z8FA 3FATA 4RPOA 1JETA 3V89B 2R71A 4QSCA 5AA2D 1A8EA 1B7UA 2F6PA 2P1SA 2PBWA 2RC9A 2GRVA 3FGSA 3H6VA 3HN0A 1Y20A 4JBZA 4NTLA 4PFWA 2PYYA 4R2BA 2QPQA 1FTOA 3CVGA 3FZVA 3OEKA 1QULA 3QUFA 2Y7KA 3K6WA 4X1DA 4EF1A 4OENA 4JB7A 1MH4A 5M2VA 2Q89A 3G3JA 3IJXB 3LSLA 1P1WA 4DCYA 2XX8A 2O7IA 3C33A 3KGCA 1ANFA 1LB8A 1SBPA 1OLCA 3H06B 1O63A 1IIWA 1DPPA 4OXVA 3V5AA 3VE1B 3OO7A 3JV9A 3OO6A 4OTEA 5H8FB 1IUDA 1NKXA 4F29A 5CBRA 3R7XA 3K4UA 1JQFA 3G3KA 1UTHA 3RT6B 4OYVA 3FXUA 3T9XB 3G3IA 2OK2A 1PB9A 2THIA 4IB2A 5F7VA 1LAFE 2XD2A 3PPOA 1GTKA 4QSEA 1I6QA 2H98A 4OEUA 2KLFA 4F3GA 3AXFA 3EF7A 3MW0A 1NMUA 3C31A 4LZ7A 3SKPA 3V8XB 4EXKA 4GQOA 1B0LA 2B3FA 4G2ZA 2ABHA 4F18A 1USYE 1LB9A 4IO7A 3C32A 1TFAA 3L6HA 3Q25A 2HZLA 4QRZA 3H6UA 3ZSFA 2OJTA 1N3XA 3IJOB 3QSLA 1TWYA 5ITOA 4BDQA 1CE2A 3HPIA 3UN6A 3C34A 4NWDA 1FQAA 3FJGA 4LATA 5H8HB 5L9OA 4ZS9A 3TAJA 4DXCA 1MY2A 4YKJA 1ZIUA 3U92A 1NNTA 2I0CA 4R75A 4JWXA 5CC2A 3H6TA 1QUKA 5I59B 1ZKBA 2R6GE 4ZEBA 1XVXA 3ILTB 4X9TA 4YKIA 3W15C 1MM7A 1SYIA 1L5TA 5TU0A 4X1BA 1MPBA 5DVJA 2NWJA 1DSNA 4YICA 3N6UA 3OO8A 4PE5B 1YAEA 2F5XA 1YCJA 3FIRA 1DTZA 1Y4TA 2NUVA 2V25A 3HHFA 3IOTA 4WEPA 3PUVE 1OIBA 3VVEA 4DCXA 4NF4B 4YZZA 5L9SA 3B6WA 5AA4B 4U4SA 5AA3A 3E4RA 3M3FA 4R72A 1SYHA 1PEBA 5CMBA 4F19A 2XX7A 2I3VA 2UXAA 1MS7A 1T0KA 3LSXA 4OESA 5DT6A 1SVXB 2Z8DA 1FQEA 3PD8A 2O1MA 2HAVA 3O6IA 1P1UA 3TELA 3HV1A 1MQHA 3KN8A 1PC3A 2RINA 4QFOA 1B3FA 1LAHE 3D4GA 3TCFA 1P1NA 3QXMA 4R73A 3U93A 4ZE9A 3ONMA 3GZGA 5F1QA 2O68A 5I56B 2XXUA 3CI8A 4XXUA 4RJZA 1SD3A 4G68B 3UIFA 1B32A 2YLNA 3TTRA 3G3GA 4HTGA 4EUOA 1MQDA 1QKAA 5I2NA 4ESXA 2AIXA 1I6BA 3T96B 3N5LA 1N84A 1WDNA 3SESA 4N13A 1Q35A 4JXIA 4XKQA 3KSXA 4GL8A 3VLUA 3OEMA 5DYHA 4UACA 4F2OA 2WKYA 3DP8A 2X26A 2D3IA 5L9MA 4H1XA 4OMBA 3DM0A 4QSDA 1S7YA 1LCFA 1UTBA 1VFDA 1B5JA 1JNFA 2HXWA 3KBRA 4ECFA 4YMBA 4Z7EA 4GIZA 2QS3A 3CFLA 3PMWA 5FHNA 5H8FA 2W7YA 3Q29A 3FUZA 2F78A 1UTHB 2IEEA 4BDRA 3V83A 3ZKKA 3JZJA 4LQ2A 5JTYA 1NFTA 1MXXA 2D21A 2QL3A 3MVZA 3N26A 1MY3A 2V3QA 3IB1A 3S9MC 1A40A 1S9TA 4YKKA 1B3EA 3GLBA 4ELOA 3LSWA 4XKRA 4F39A 1IQ7A 3MVYA 1B7HA 1R9LA 1LFIA 2O51A 1DMBA 4ZEFA 5K2YA 4C1UA 4EQ9A 2VP1A 2DOJA 4O3CA 1JEVA 2ONKE 4PP0A 2DWHA 3R26A 4E0XA 5CBSA 3OENA 3RPWA 4RA1A 3K6XA 5L8DA 2PX1A 1HSEA 2Q2CA 1RYOA 4KYSA 4DDDA 1EZPA 1Z7NE 5H8NB 5EYFA 3ODBA 1FW0A 3LBSA 2ZNTA 3IR1A 4NWCA 4TLLB 1GV8A 3TTLA 3TTMA 1OQHA 2OWSA 4G8HA 4NF6A 3TTKA 1Y1ZA 1Z7ME 3IX1A 2ESNA 1PBQA 3PUXE 1N76A 3OXNA 1UTBB 3KFMA 4LP2B 2VOZA 2A5SA 4EQ7A 2Y7IA 3ILUB 5EHMA 4Q8RA 2ZYNA 2HQ0A 1N0TA 3CFZA 4MLVA 3TODA 1NH8A 3TTNA 4RY1A 3T9VA 2DXYA 5TP9B 4EXLA 1NNPA 3OOAA 2QMWA 3S2VA 1PBPA 3ZKLA 1B3GA 2DWAA 1OLAA 3KEIA 3CSBA 4I62A 4RXLA 3VXCA 3GBAA 5JK4A 4YB5A 3SETA 4ZE8A 3KZGA 2A5TA 1DOTA 1TFDA 4OFOA 2RC8A 3H7MA 2QS2A 3MZBA 1H45A 2XXHA 4ZEDA 4KCDA 4F2QA 2Y84A 2I0BA 3WAFA 1MQGA 5I58B 3K01A 2YJPA 2UVHA 1AH5A 1GGGA 3QIMA 3MAMA 2XXVA 4FEBA 1YTVA 2UVJA 3CG1A 3HHGA 5CRYA 3RUMA 3T66A 1B9JA 3FV2A 4GFRA 5KCJA 1DTGA 5I57A 3T93B 3E13X 3U1OA 4KHZE 4RNSA 1D9VA 3BFUA 2XXRA 1GVCA 4F1UA 4L17A 4THIA 1US4A 2DVCA 4ZZEA 3TKDA 3B6QA 2DYXA 4ONYA 1Y1MA 4FJPA 1H44A 4JWYA 4LVQA 3SERA 4DXBA 3HCQA 3IL1B 1O7TA 3C9HA 1EU8A 2CZLA 4NF5B 4I1DA 5CMKA 1B5IA 3EHTA 3S9NC 1Q1KA 1WVJA 2IA4A 4Q5TA 3TMGA 2XXPA 1AMFA 1IZ1A 1MY4A 1URSA 1OVBA 3UP9A 4NF4A 5IKBA 5DEXA 3EN3A 3TQLA 1SW1A 3UGWA 2O1LA 2Y7RA 1IXCA 2HCAA 4GWOA 5FTHA 5FHMA 1SI1A 3RT8A 3VV5A 1MQJA 4IO3A 4YU0A 1HSLA 2F7AA 3MC2A 3O6HA 3CSGA 1F9BA 2GHBA 2P2AA 3M3LA 4OVJA 5KZTA 1FTJA 4U1OA 3OELA 1B40A 2V3TA 2UYFA 4G68C 4F3PA 1B58A 2RCAA 2VHAA 1FCKA 2OWTA 2PVUA 1JVYA 2P0SA 4PETA 4H5GA 2UVGA 4M4GA 5A5XA 4FE8A 3FXQA 3UA8A 1OVTA 3B6TA 1I69A 3DLNA 3PD9A 4OZ9A 5FTIA 5ICTA 4JSDA 4NEDA 3R6UA 3N94A 1USYH 4TQUQ 1ZTYA 3PUZE 2REGA 2Y7PA 1FQBA 4OEVA 5I56A 1LAXA 4IY6A 4FAJA 1B0HA 2I4BA 4ND9A 1SI0A 4G8NA 2AL5A 4KCCA 4LA9A 3O66A 4O3BA 4ELRA 4GOTA 2GHAA 3FVOA 4QF9A 2V3UA 4C1TA 4F1VA 1MY0A 2X7PA 2DWIA 2I49A 1B46A 1R9QA 3MPKA 4EF2A 2QS4A 2Y7WA 1NNKA 4GL0A 1ZLQA 1II5A 1CB6A 2FNCA 2UYEA 3KOTA 1D3KA 4PFUA 5HBCA 3THIA 1NNFA 1PDAA 2H9BA 2Z22A 2M8CA 1P1OA 4FECA 1B51A 4H8JA 4U1ZA 1LCTA 5JTYB 2ZXTA 1LFHA 1LBBA 2Q88A 1MM6A 3FVGA 4RK9A 4KI0E 4OQOA 1MRPA 2G29A 1MG1A 1Y3PA 5FHOA 4R2FA 4U22A 3TFLA 1A7LA 3QAXA 5ISUA 4R9FA 3I5OA 2RC7A 1M5CA 1ATGA 2ONRA 4OWDA 4OFLA 1XS5A 2GH9A 5H8HA 4DZ1A 5AA4A 3FV1A 4JSOA 4G77A 4MF3A 2NVUB 1LGBC 1OQGA 4KQPA 4LUBA 1XOCA 3VXBA 3PV0E 4PFTA 1B2HA 3U8QA 1MXUA 4DLDA 5I59A 2O84X 2X7QA 3PMVA 4NE4A 1IXHA 3BFTA 1LSTA 1IXGA 2I48A 1QJMA 3E9XA 3OSRA 2GFEA 3KN3A 3TZAA 4BDOA 1D9YA 4IO4A 2H5YA 5I2NB 3MP8A 1MPCA 4IGRA 3RTFB 3TUSA 4Q0CA 1QKBA 2G93A 3T9UA 3S9LC 2HEUA 2BJJX 4LONB 5BUUA 1B4HA 2NOOA 4UA8A 5AA2B 1B7ZA 2QJEA 2VGQA 3PPRA 4POXA 2AL4A 4ZDMA 4F3BA 4NF5A 3FD3A 3TYHA 3JYRA 1P1QA 1M5FA 2NXOA 2RF1A 2PT1A 4NF8A 1SW4A 3EHSA 3MQ9A 4Q30B 3SEWA 1SQYA 3IOUA 4BLAA 1BIYA 3D4CA 2FA7A 2B3BA 5JEIA 3CRBA 4WXJA 2Q8JA 2Q2AA 3B7DA 3GXAA 4I9DA 5EHSA 4YB7A 4FATA 5H8QA 3SEVA 3LC8A 5I2KB 1MPDA 3G3FA 1HSJA 1KWHA 1UQWA 4U4XA 3F11A 1VE4A 1FQFA 1URDA 1XHYA 4R9GA 4XKNA 1NH7A 3L6GA 5AE4A 1EZ9A 1FTKA 2R9JA 5HPQA 2YPNA 3FVNA 2DXRA 3KJTA 3HO7A 1GR2A 3IO6A 3MVXA 1AL3A 2ZNSA 3PPNA 3ECRA 4OHNA 5H8NA 4GLIA 5TPAB 5CI5A 1FTMA 5KDTA 1B1HA 2F6GA 2OZZA 5I2KA 3TCGA 2AYSA 4M1VA 4QFPA 4DXUA 1JEUA 2O6AA 3RN8A 4ZECA 2ZYMA 4HS7A 2E1SA 3FJ7A 3SEUA 3VLWA 3N6TA 4BDMA 4GD5A 5I57B 3VVDA 2XXTA 3O97A 3MP6A 1LAGE 3CR9A 3H4ZA 3KSJA 4KFQA 2OCUA 5LOMA 2H25A 1S50A 4EQBA 4GF8A 4KYEA 1SDXA 4IY5A 3C35A 5ELVA 2B65A 3PGFA 4MBPA 2XXWA 1B1XA 4QFNA 4KD5A 4WEDA 4FORA 3CIJA 3MVWA 4G68A 3PUWE 4HCWA 1ZMGA 1B3HA 3G3HA 1JW1A 3UORA 4OFJA 3T9HB 3O6GA 3H6WA 2DP8A 3IOVA 3ZS6A 5H8QB 1B52A 1PB7A 5B7DA 2DE3A 2XXQA 3EQ1A 3O2AA 4U21A 4ZEKA 5CM6A 2O69A 2H4IA 3KOSA 2VD3A 2QRYA 1MY1A 1Y9UA 2DWJA 2O7UA 3KG2A 4FEDA 3IAZA 4OERA 2PMSA 1B6HA 2QMXA 2OBGA 4K3FA 1M5DA 4OETA 4I8CA 1ZBMA 1A99A 1YPNA 4RK2A 4KPTA 1QUIA 1MH3A 2F34A 3HSTA 3GBBA 3IORA 4YB6A 5DVFA 3RTWB 3SDFA 2Q9TA 3VLVA 3QUJA 4RYAA 2F7CA 1A55A 1BLFA 1MXZA 2HAUA 3MZ9A 4RPNA 5A5XB 2XX9A 3K6UA 3U94A 4IO5A 3Q27A 3PPQA 5KCJB 1ZJLA 3K0VA 1US5A 2ZYOA 1XVYA 1IXIA 2ALUA 2D5WA 5I84A 4R6YA 4GVOA 4E0WA 1MQIA 2Z23A 3TCHA 4PQJA 3RY3A 1Y3NA 4IO2A 4G8MA 3MZ1A 1JVXA 4P11A 2F97A 2DSFA 2XXXA 2Z8EA 3BBRA 4GRKA 5ITPA 2H99A 2XXIA 4N07A 4AB6A 3I6VA
chains in the Genus database with same CATH superfamily
4QHQA 2PFZA 3FASA 1N7WA 1PB8A 2E0SA 2FYIA 2QSXA 3MSTA 2KQZA 4ZZAA 5TP9A 5ICQA 5B70A 3EHUA 4FIMA 4H65A 5IZ3B 2MKZA 1JW4A 2CMOA 1B5HA 3M3KA 3W9VA 1JW5A 3B50A 3TPAA 1QUJA 1H76A 4P1LA 1ELJA 3H3GA 1DPEA 3P7IA 1LFGA 4H8IA 3KJ7A 4I3EA 4OVSA 3OMBA 2XHDA 3OSQA 2I3WA 4P0GA 5KDTB 4PGNA 1SW5A 4QFLA 4KR5A 4YMAA 3IO4A 1ZU0A 3MPLA 4O3AA 4O7MA 3MWBA 4NMYA 5IGAA 1POTA 4NF8B 4U23A 3A29A 1N3WA 2A5TB 4MNPA 2HZKA 4N6KA 4LZ8A 3K00A 3A09A 3KN7A 4HE1A 3CG3A 5IZ1A 1LBWA 1A8FA 1M5EA 2ZNUA 2L5VA 1TXFA 3T22A 4R6KA 1LBCA 3MJNA 4JDFA 2ZMBA 1EZOA 1MXWA 3LV0A 3CFXA 3V89B 4QSCA 1A8EA 3HN0A 4PFWA 2QPQA 3QUFA 2Y7KA 3K6WA 2FIXA 4OENA 4JB7A 3IJXB 3LSLA 1P1WA 2XX8A 3C33A 1FBPA 3H06B 3V5AA 4OTEA 5H8FB 1NKXA 4PAFA 1EYIA 1IMEA 4OEUA 4GX4A 3C31A 3V8XB 4EXKA 1NUYA 3L6HA 1TFAA 2GQ1A 3ZSFA 1CE2A 3UN6A 5H8HB 5L9OA 4ZS9A 1NNTA 1XVXA 1SYIA 1L5TA 5TU0A 1MPBA 1YCJA 4WEPA 2V25A 3IOTA 4DCXA 4MEVA 3E4RA 3M3FA 1PEBA 2XX7A 3BIHA 5DT6A 5ET7A 4N15A 4ZE9A 1LAHE 3TCFA 3U93A 3ONMA 3GZGA 2O68A 5I56B 1B32A 3TTRA 3G3GA 1N84A 3SESA 4JXIA 1IMCA 2D3IA 3DM0A 1S7YA 1VFDA 4Z7EA 2QS3A 2W7YA 3Q29A 1MXXA 2QL3A 3MVZA 1MY3A 2V3QA 1S9TA 1B3EA 4X8RA 2WBBA 4ZEFA 2VP1A 2DWHA 3RPWA 2F3DA 3ODBA 3LBSA 1QGXA 3IX1A 2OWZA 2A5SA 5EHMA 2ZYNA 4MLVA 4RY1A 4GWYA 5TP9B 3OOAA 4I62A 4RXLA 3IFCA 1NUXA 1H45A 4KCDA 4OA4A 2YJPA 2XXVA 2UVJA 3RUMA 1DTGA 2XXRA 1GVCA 2DVCA 4O7IA 1Y1MA 4LVQA 4JWYA 4DXBA 3HCQA 2XA5A 3C9HA 2CZLA 1B5IA 1Q1KA 3TMGA 2XXPA 2FVZA 1AMFA 2Q74A 3EN3A 3TQLA 2Y7RA 4PGPA 4OVJA 5KZTA 2GHBA 3M3LA 3OELA 4UABA 4G68C 2VHAA 4F3GA 2PVUA 4PETA 4M4GA 4OZ9A 1LAXA 1SI0A 2AL5A 4GBVA 4X04A 3FVOA 2X7PA 2DWIA 1B46A 3MPKA 4EF2A 2QS4A 1II5A 2FNCA 2UYEA 1PDAA 4OQOA 1Y3PA 4U22A 3QAXA 1M5CA 2ONRA 2GH9A 1FBGA 1OQGA 4KXPA 4LUBA 3E78A 5ET6A 5I59A 1FBHA 3PMVA 3BFTA 1IXGA 3OSRA 2GFEA 3KN3A 4BDOA 4N8YA 4IO4A 3TUSA 1MPCA 4IGRA 3T9UA 2BJJX 5I56A 4POXA 4PCDA 2P3NA 2RF1A 4Q30B 3IOUA 2FA7A 1FPLA 4WXJA 2Q2AA 3SEVA 1MPDA 4U4XA 1HSJA 4DI3D 3F11A 1VE4A 1T0KA 5HPQA 3PPNA 2QVRA 3HO7A 5H8NA 1GR2A 5I7IA 1AL3A 2PFYA 2QVUA 2AYSA 4DXUA 3RN8A 4PDHA 4BDMA 4AS4A 1FBFA 3H4ZA 3KSJA 5ET8A 4OVQA 3PGFA 4MBPA 2XXWA 4KD5A 4FORA 3CIJA 3MVWA 4G68A 5T3JA 3NOHA 3G3HA 3UORA 3T9HB 2DP8A 3ZS6A 3EKIA 5B7DA 3EQ1A 1SPIA 2QRYA 4FEDA 5EQ9A 3KG2A 4OERA 1B6HA 1M5DA 4GWSA 4YB6A 4KPTA 1QUIA 1MH3A 3HSTA 3IORA 3GBBA 3SDFA 4RYAA 1BLFA 1MXZA 2HAUA 1IMBA 1NV1A 5KCJB 3K0VA 1US5A 2ZYOA 1IXIA 2D5WA 2P3VA 1MQIA 2Z23A 4IO2A 3MZ1A 1JVXA 2XXXA 2Z8EA 4N07A 4AB6A 3LSXA 2I6EA 1INPA 3SEYA 4MAGA 5AA1A 4AS5A 4AQ4A 2DE4A 5HM4B 2F35A 3K02A 3K1MA 1B4ZA 1RDZA 4X48A 2V93A 1EYKA 2ZYKA 1BP5A 1FQDA 3TEPA 3H03A 2VPNA 3FXRA 1NL5A 4IO6A 3D1RA 2LAOA 5CMKA 1WODA 1I6AA 5I58A 3U72A 1XT8A 4GWUA 4JVIA 4TOZA 3OO9A 2HXRA 4Z0IA 3MUQA 3IOWA 1FJ9A 1UIUA 3K2DA 5LDZA 3DELB 4MLQA 1P99A 4G61A 4YAHX 3LSFB 1VFEA 4PFYA 4PF8A 4DE8A 5K2XA 2CEYA 1IITA 1H43A 1R6ZA 4O8MA 2CEXA 1Y4CA 5ET5A 4ISUA 4DIGA 1UIVA 3RQTA 2PT2A 3W9WA 4MX6A 2HFBA 3QK6A 1H3DA 3WAEA 1FBCA 3MBPA 4ELPA 1BTJA 1URGA 4GXSB 3OD7A 4AB5A 5BWJA 3G7WA 1DK4A 1AOVA 4EDPA 1B05A 1EH3A 2XD3A 2Q8MA 2B4MA 4G4PA 3C4MA 3C36A 4P9KA 1JETA 1B7UA 2XWOA 2GRVA 4R2BA 1FTOA 5DW8A 5M2VA 3G3JA 3KGCA 1LB8A 1DPPA 4N17A 1IUDA 4F29A 1JQFA 3RT6B 3T9XB 1KA0A 1VDWA 2THIA 5F7VA 3PPOA 3MW0A 4LZ7A 3SKPA 2B3FA 4G2ZA 2ABHA 1FPKA 2HZLA 3H6UA 1N3XA 4GX3A 3HPIA 5EQAA 2JJKA 3TAJA 1MY2A 3H6TA 4NHBA 4ZEBA 4ELOA 1MM7A 2NWJA 5DVJA 4XF5A 4YICA 4PE5B 3FIRA 3TTNA 3PUVE 1OIBA 3B6WA 1LBXA 4U4SA 5AA3A 4R72A 1SYHA 2I3VA 5ESYA 4PAKA 1AWBA 4OESA 4P8BA 4PF6A 1P1UA 3CHGA 3TELA 1MQHA 3KN8A 1FPFA 4QFOA 1B3FA 5AA2D 3QXMA 4R73A 5F1QA 3CI8A 4XXUA 4G68B 3UIFA 2YLNA 5EYHA 4HTGA 1MQDA 1I6BA 3T96B 4N13A 1Q35A 4GL8A 1NUWA 4UACA 3DP8A 1NV6A 4MNIA 5L9MA 1B5JA 3CFLA 5FHNA 3PMWA 3FUZA 2F78A 2IEEA 4BDRA 3ISPA 3N26A 3IB1A 3S9MC 1YXIA 3GLBA 3LSWA 1LFIA 4FBPA 5J16A 1DMBA 4EQ9A 2DOJA 4O3CA 2ONKE 1HSEA 1RYOA 4P56A 1FW0A 2ZNTA 3IR1A 3TTLA 3TTMA 1OQHA 4G8HA 3TTKA 3PUXE 3B8BA 1UTBB 4EQ7A 2VOZA 4Q8RA 1YYZA 3ILUB 1N0TA 3TODA 2XWVA 1PBPA 1FRPA 3GYYA 3ZKLA 1OLAA 3VXCA 3CSBA 5IM2A 4YB5A 4ZE8A 4OFOA 2A5TA 1DOTA 1TFDA 2CZKA 1KZ8A 2FBPA 2RC8A 2FIEA 3RYDA 5I58B 1NI9A 1AH5A 3MAMA 4FEBA 3CG1A 5CRYA 3T66A 5KCJA 3FV2A 4GFRA 5I57A 3T93B 4KHZE 4ZZEA 3TKDA 1H44A 4HXVA 1O7TA 1EU8A 4NF5B 1MY4A 1SW1A 1IXCA 5FBPA 4PAIA 1MQJA 3U65A 4YU0A 1HSLA 2F7AA 3MC2A 3CSGA 1FTJA 2V3TA 2RCAA 2P0SA 4H5GA 3FXQA 3UA8A 1OVTA 3B6TA 3PD9A 4NEDA 1FQBA 2WBDA 2OX3A 4FAJA 4ND9A 4KCCA 4ELRA 1YZ0A 2V3UA 4F1VA 2I49A 1ZLQA 5HBCA 3THIA 2H9BA 2M8CA 4U1ZA 1LFHA 2Q88A 1MRPA 2G29A 1MG1A 2WYKA 5ISUA 3I5OA 4OWDA 5H8HA 4G77A 4GWZA 3U8QA 3FXBA 2X7QA 1IXHA 1LSTA 2I48A 1QJMA 3MP8A 4Q0CA 1IMFA 4LONB 2NOOA 5AA2B 4ZDMA 1G0HA 3JYRA 1NV5A 1SW4A 3SEWA 1SQYA 5JEIA 3CRBA 2Q8JA 4I9DA 5EHSA 3G3FA 1KWHA 1UQWA 1RDYA 1XHYA 3L6GA 1FTKA 2YPNA 2DXRA 3IO6A 4E0WA 3MVXA 5TPAB 1K9YA 2BJIA 1FTMA 5I2KA 3TCGA 1DCUA 2E1SA 5I57B 4GD5A 4MMPA 2XXTA 1LAGE 3CR9A 5A5LA 2OCUA 2H25A 4GF8A 1EYJA 4IY5A 2B65A 4HCWA 5H8QB 1B52A 2ZZVA 2VD3A 4PFUA 1MY1A 2DWJA 2FHYA 2QMXA 4RK2A 4K3FA 4I8CA 4I3YA 3VLVA 3MZ9A 2WEFA 4IO5A 1FPBA 1ZJLA 4GVOA 4H46A 3TCHA 4PQJA 4N6DA 4NQ8A 3BBRA 3VE1B 3I6VA 2RCBA 5J1DA 4NGUA 5CMCA 3FVKA 3MYUA 3Q28A 4WKMA 3Q26A 1FPGA 5CMMA 5IAIA 3VFJA 3USDA 3LUYA 3DP6A 1MDQA 5H8SA 4P0IA 2DE2A 4LZ5A 1RYXA 3VVFA 3TDJA 4TLMB 1J1NA 2ZZXA 3A3UA 5TPAA 4ESWA 4KYDA 4U2RA 1A54A 4PFIA 2ANJA 2I4CA 3O9PA 4NF6B 4YKPA 3I3VA 4H67A 5DVIA 4P47A 1M5BA 1VSOA 3FJMA 4MH5A 4LQ5A 4F1YA 4ZEIA 4C0RA 1POY1 4GXAA 4JWOA 3RGYA 1QVSA 3IK6B 4POWA 3VDFA 2REJA 1SW2A 2DQVA 2XXKA 5F24A 3KC1A 3PUYE 1IEJA 2VD2A 5DEXB 2XXYA 1RKMA 4R6HA 4XIGQ 4RPOA 2PBWA 2F6PA 2P1SA 3H6VA 5I2KB 4BDQA 4NTLA 4YKJA 4JBZA 3CVGA 3FZVA 4X1DA 4EF1A 1MH4A 1LBVA 4DCYA 1ANFA 1SBPA 4OXVA 2VPOA 3OO6A 4PTKA 5CBRA 3R7XA 1UTHA 3T1BA 3G3IA 4IB2A 1LAFE 2XD2A 1GTKA 1I6QA 2KLFA 3AXFA 4MIJA 1NMUA 1B0LA 4F18A 1USYE 1LB9A 3Q25A 2OJTA 3IJOB 5ITOA 4NWDA 1FQAA 4LATA 1ZIUA 5CC2A 1QUKA 2R6GE 4YKIA 3ILTB 1DSNA 3N6UA 2F5XA 4MCOA 4NF4B 5AA4B 5CMBA 4F19A 1SVXB 2O1MA 2RINA 1P1NA 4RJZA 4EUOA 4ESXA 1WDNA 3KSXA 3VLUA 3OEMA 2X26A 4OMBA 5LOMA 1UTBA 2HXWA 1JNFA 4NF0A 4ECFA 4MJOA 4GIZA 5H8FA 3ZKKA 3JZJA 5JTYA 1NFTA 2D21A 2F3BA 4IR8A 4YKKA 3KBZA 4XKRA 1R9LA 5K2YA 4C1UA 4PP0A 4E0XA 5L8DA 2PX1A 2Q2CA 1EZPA 4TLLB 2ZZWA 2OWSA 2ESNA 1N76A 3OXNA 2Y7IA 2HQ0A 3CFZA 1NH8A 3T9VA 3E79A 2QFLA 1NNPA 2QMWA 3S2VA 2CZIA 1Q9DA 4O94A 2DWAA 3KEIA 3GBAA 3SETA 3RPLA 4ZEDA 4F2QA 1G0IA 2I0BA 3WAFA 3K01A 2UVHA 1FJ6A 3QIMA 1YTVA 4GX6A 3E13X 1D9VA 4F1UA 2DYXA 1WVJA 2IA4A 1LEVA 1URSA 1OVBA 3UP9A 4NF4A 3UGWA 4GWOA 1LBYA 5FTHA 1F9BA 2P2AA 1B40A 4F3PA 1B58A 3VVEA 1FCKA 2OWTA 1JVYA 1FSAA 4FE8A 4PBHA 3BIGA 1I69A 5FTIA 4JSDA 3N94A 4TQUQ 1ZTYA 2REGA 2Y7PA 1B0HA 2Y5LA 1RDXA 4G8NA 4LA9A 4GOTA 1MY0A 2Y7WA 4GL0A 1NNKA 4DDDA 3KOTA 5CM6A 4H8JA 1P1OA 4FECA 1B51A 5JTYB 4KI0E 4P3LA 4R2FA 3TFLA 1A7LA 4N4UA 4R9FA 2RC7A 1ATGA 4DZ1A 4OFLA 1XS5A 5AA4A 3FV1A 4JSOA 2NVUB 1XOCA 4PFTA 1XI6A 1B2HA 1MXUA 4DLDA 2O84X 4NE4A 5I2NB 2H5YA 3RTFB 2G93A 4PE3A 2HEUA 4UA8A 1FPDA 1B7ZA 1P1QA 4PFBA 3MQ9A 1KA1A 3D4CA 3B7DA 4YB7A 5H8QA 3LC8A 4R9GA 1URDA 5AE4A 1EZ9A 2R9JA 2ZNSA 4OHNA 5KDTA 1B1HA 2OZZA 3QMFA 4N8GA 3SEUA 3VLWA 5LTCA 3VVDA 3O97A 3MP6A 4KYEA 5ELVA 1FPEA 4QFNA 3PUWE 1JW1A 4HE2A 2DE3A 4U21A 3O2AA 4ZEKA 2O69A 2H4IA 3KOSA 1Y9UA 4RA1A 2O7UA 2PMSA 2OBGA 4MNCA 1ZBMA 1YPNA 5DVFA 3RTWB 2F34A 4GBWA 3QUJA 2F7CA 1A55A 4RPNA 4N91A 2XX9A 3U94A 1NUZA 1XVYA 3RPLB 2PCRA 4R6YA 3RY3A 1Y3NA 4P11A 2DSFA 5ITPA 2H99A 3RLFE 4I40A 4OVRA 1BK4A 4N6PA 2V4CA 3S4UA 4P1EA 1VR5A 2RKMA 4H5FA 1LLSA 3LR1A 4H0WA 1FBDA 3O28A 4BDNA 3MP1A 5DTBA 1O64A 2I58A 3O29A 3E3KA 3BKIB 1CNQA 3EPEA 1N7XA 4F31B 3IB2A 2OLBA 3UK4A 1TT1A 4BDLA 1OMPA 1MDP1 4QFKA 2WYPA 4MHFA 1D4NA 4MFIA 1B3LA 4HCYA 4IGTA 4F3SA 1Y3QA 5I3SA 3K1PA 3QYTA 3RNNA 1MXVA 1R1NA 3HFUA 4HE0A 1XC1A 2UVIA 4N81A 5AA2A 4GWXA 1AIVA 2V84A 4XKPA 3PU5A 4XEQA 4R74A 2KR0A 4H6DA 3PMXA 3M8UA 4JVCA 5I5PA 1FTLA 4HW8A 2QS1A 4ELQA 1BKAA 1QW0A 3IB0A 3PPPA 2DS9A 2ONSA 2DVZA 2F8DA 3TQWA 4XTCQ 3KC0A 4F22A 3K6VA 3SEXA 3DP4A 1FQCA 1N04A 4H45A 1MXYA 2F7BA 2F36A 3A3CA 3K1NA 2Z8FA 3FATA 2R71A 3FGSA 3S9EA 2RC9A 4L17A 1Y20A 2PYYA 3OEKA 1QULA 2WX9A 2Q89A 2O7IA 1K9ZA 1OLCA 1O63A 1IIWA 3OO7A 3JV9A 3K4UA 3G3KA 4OYVA 3FXUA 2OK2A 1PB9A 4QSEA 2H98A 3EF7A 4GQOA 2QVVA 3T0JA 4IO7A 3C32A 4QRZA 3QSLA 1TWYA 3C34A 2Y5KA 3FJGA 4DXCA 3U92A 2I0CA 4R75A 4JWXA 5IZZA 5I59B 1ZKBA 3W15C 4X9TA 4X1BA 3OO8A 1YAEA 1DTZA 1Y4TA 2NUVA 3HHFA 2R8TA 5L9SA 4YZZA 1FPJA 2UXAA 1MS7A 2Z8DA 1FQEA 3PD8A 2HAVA 3O6IA 3HV1A 1PC3A 3D4GA 4OANA 3PTYA 2XXUA 4QBAA 1SD3A 4NX1A 1FPIA 1QKAA 5I2NA 2AIXA 4NAPA 3N5LA 4LN5A 1LBZA 4F2OA 5DYHA 2WKYA 4H1XA 4QSDA 1LCFA 3KBRA 4YMBA 1UTHB 3V83A 4LQ2A 1DBZA 1A40A 4F39A 1IQ7A 3MVYA 1B7HA 2O51A 4OVPA 1JEVA 3R26A 5CBSA 3OENA 3K6XA 4KYSA 1Z7NE 5H8NB 5EYFA 1GV8A 4NWCA 4NF6A 1Y1ZA 1Z7ME 1PBQA 2DDKA 3KFMA 4LP2B 3ROJA 2DXYA 4EXLA 1B3GA 5JK4A 3KZGA 4GWWA 5IZ3A 3MZBA 3H7MA 2QS2A 2XXHA 4OVTA 2Y84A 1MQGA 1GGGA 3HHGA 1B9JA 3U1OA 4RNSA 1NV2A 3BFUA 4THIA 1US4A 1NV4A 3B6QA 4ONYA 3SERA 4FJPA 3IL1B 2XWKA 4I1DA 3EHTA 3S9NC 4Q5TA 1IZ1A 5IKBA 5DEXA 2O1LA 2HCAA 5FHMA 1SI1A 3RT8A 3VV5A 4IO3A 3O6HA 5EQ8A 4U1OA 2UYFA 2UVGA 5A5XA 3DLNA 5ICTA 3R6UA 1USYH 3PUZE 4OEVA 4IY6A 2I4BA 4O3BA 3O66A 4PC9A 2GHAA 4QF9A 4C1TA 4PFRA 1NV0A 1R9QA 1CB6A 1D3KA 1NNFA 2Z22A 1NV7A 4XFEA 1LCTA 2ZXTA 1IMDA 1LBBA 1MM6A 3FVGA 4RK9A 5FHOA 2HPGA 1JP4A 4MF3A 1LGBC 4KQPA 3VXBA 3PV0E 3E9XA 3TZAA 1D9YA 1QKBA 3S9LC 1FBEA 5BUUA 1B4HA 2QJEA 2VGQA 4F3BA 3PPRA 2AL4A 4NF5A 3FD3A 3TYHA 2B4LA 2XWIA 1M5FA 2CZHA 4NG7A 3SZPA 2NXOA 2PT1A 4NF8A 3EHSA 4BLAA 1BIYA 2B3BA 3GXAA 4PDDA 4FATA 4JVDA 1FQFA 4XKNA 1NH7A 3KJTA 3FVNA 3IFAA 3ECRA 4GLIA 5CI5A 2F6GA 4M1VA 4QFPA 1JEUA 2O6AA 4ZECA 2ZYMA 4HS7A 3FJ7A 3N6TA 5EQ7A 4KFQA 4NN3A 1S50A 4EQBA 4PBQA 1SDXA 4QXDA 3C35A 4WEDA 1B1XA 4DI4B 1ZMGA 1NV3A 1B3HA 3FBPA 4OFJA 3O6GA 3H6WA 3IOVA 1PB7A 2XXQA 1FTAA 3IAZA 4XKQA 2VT5A 4OETA 1A99A 2Q9TA 3LUZA 5A5XB 3K6UA 5EYGA 1IMAA 3Q27A 3PPQA 2ALUA 5I84A 4G8MA 2HHMA 2F97A 4GRKA 1D9QA 2XXIA
chains in the Genus database with same CATH topology
2I6EA 2RCBA 3RLFE 3SEYA 4QHQA 5J1DA 3FASA 1N7WA 1PB8A 5AA1A 4AQ4A 2DE4A 2E0SA 5HM4B 2F35A 5CMCA 2FYIA 3K02A 3K1MA 1B4ZA 2QSXA 4N6PA 3FVKA 4X48A 2V93A 3Q28A 4WKMA 3S4UA 1VR5A 2RKMA 4ZZAA 4H5FA 3Q26A 1LLSA 5TP9A 5ICQA 2ZYKA 1BP5A 5B70A 1FQDA 3LR1A 3TEPA 3H03A 4H0WA 3FXRA 5CMMA 5IAIA 1NL5A 3EHUA 4IO6A 3O28A 4FIMA 4BDNA 3MP1A 5DTBA 3VFJA 1O64A 2I58A 3USDA 4H65A 3O29A 3E3KA 3BKIB 3EPEA 1N7XA 2LAOA 3IB2A 1JW4A 1WODA 2CMOA 2OLBA 4F31B 1I6AA 3LUYA 3UK4A 1TT1A 4BDLA 5I58A 1B5HA 3DP6A 1OMPA 3U72A 3M3KA 1MDP1 1XT8A 1MDQA 3W9VA 4QFKA 1JW5A 5H8SA 3TPAA 1QUJA 1H76A 4P0IA 1D4NA 2DE2A 4LZ5A 4TOZA 3OO9A 4MFIA 4Z0IA 1B3LA 1RYXA 4HCYA 3MUQA 4IGTA 3VVFA 1ELJA 3IOWA 3H3GA 4F3SA 1Y3QA 1DPEA 1UIUA 3P7IA 1LFGA 4H8IA 3KJ7A 3K2DA 3K1PA 3QYTA 3TDJA 4TLMB 1J1NA 3RNNA 3DELB 4MLQA 1P99A 1MXVA 1R1NA 2XHDA 3OMBA 3OSQA 3LSFB 1VFEA 4PFYA 4YAHX 3A3UA 5TPAA 4DE8A 4ESWA 4KYDA 2I3WA 4P0GA 5K2XA 5KDTB 1XC1A 4U2RA 1A54A 2UVIA 1IITA 5AA2A 1AIVA 1H43A 1R6ZA 2ANJA 1SW5A 2V84A 4QFLA 2I4CA 4KR5A 3O9PA 4NF6B 4YKPA 4XKPA 1Y4CA 3I3VA 4H67A 4ISUA 5DVIA 4YMAA 3IO4A 1ZU0A 3MPLA 4O3AA 3PU5A 1M5BA 4DIGA 1UIVA 1VSOA 3FJMA 3MWBA 4NMYA 4R74A 3RQTA 4H6DA 3PMXA 3M8UA 4MH5A 2PT2A 3W9WA 4LQ5A 1FTLA 2HFBA 2QS1A 3QK6A 1POTA 4HW8A 4F1YA 1H3DA 4ZEIA 4C0RA 4ELQA 3WAEA 4NF8B 1BKAA 3MBPA 1QW0A 4U23A 4ELPA 1BTJA 1POY1 1URGA 3OD7A 1N3WA 3IB0A 4GXSB 2A5TB 3PPPA 4GXAA 2HZKA 4JWOA 4AB5A 2DS9A 3G7WA 2ONSA 4LZ8A 5BWJA 3RGYA 2DVZA 1QVSA 3K00A 2F8DA 3A09A 3IK6B 1AOVA 3KN7A 3TQWA 4XTCQ 4POWA 3CG3A 3VDFA 2REJA 4EDPA 1B05A 4F22A 1SW2A 1A8FA 1EH3A 2DQVA 1M5EA 2XD3A 3K6VA 3SEXA 2ZNUA 3DP4A 3PUYE 1FQCA 1IEJA 1N04A 4G4PA 1TXFA 2VD2A 1MXYA 3C4MA 2XXYA 4R6KA 5DEXB 2F7BA 1LBCA 2F36A 3T22A 3A3CA 1RKMA 3K1NA 3C36A 3MJNA 4JDFA 4R6HA 3S9EA 2ZMBA 1EZOA 1MXWA 4XIGQ 3CFXA 2Z8FA 3FATA 4RPOA 1JETA 3V89B 2R71A 4QSCA 5AA2D 1A8EA 1B7UA 2F6PA 2P1SA 2PBWA 2RC9A 2GRVA 3FGSA 3H6VA 3HN0A 1Y20A 4JBZA 4NTLA 4PFWA 2PYYA 4R2BA 2QPQA 1FTOA 3CVGA 3FZVA 3OEKA 1QULA 3QUFA 2Y7KA 3K6WA 4X1DA 4EF1A 4OENA 4JB7A 1MH4A 5M2VA 2Q89A 3G3JA 3IJXB 3LSLA 1P1WA 4DCYA 2XX8A 2O7IA 3C33A 3KGCA 1ANFA 1LB8A 1SBPA 1OLCA 3H06B 1O63A 1IIWA 1DPPA 4OXVA 3V5AA 3VE1B 3OO7A 3JV9A 3OO6A 4OTEA 5H8FB 1IUDA 1NKXA 4F29A 5CBRA 3R7XA 3K4UA 1JQFA 3G3KA 1UTHA 3RT6B 4OYVA 3FXUA 3T9XB 3G3IA 2OK2A 1PB9A 2THIA 4IB2A 5F7VA 1LAFE 2XD2A 3PPOA 1GTKA 4QSEA 1I6QA 2H98A 4OEUA 2KLFA 4F3GA 3AXFA 3EF7A 3MW0A 1NMUA 3C31A 4LZ7A 3SKPA 3V8XB 4EXKA 4GQOA 1B0LA 2B3FA 4G2ZA 2ABHA 4F18A 1USYE 1LB9A 4IO7A 3C32A 1TFAA 3L6HA 3Q25A 2HZLA 4QRZA 3H6UA 3ZSFA 2OJTA 1N3XA 3IJOB 3QSLA 1TWYA 5ITOA 4BDQA 1CE2A 3HPIA 3UN6A 3C34A 4NWDA 1FQAA 3FJGA 4LATA 5H8HB 5L9OA 4ZS9A 3TAJA 4DXCA 1MY2A 4YKJA 1ZIUA 3U92A 1NNTA 2I0CA 4R75A 4JWXA 5CC2A 3H6TA 1QUKA 5I59B 1ZKBA 2R6GE 4ZEBA 1XVXA 3ILTB 4X9TA 4YKIA 3W15C 1MM7A 1SYIA 1L5TA 5TU0A 4X1BA 1MPBA 5DVJA 2NWJA 1DSNA 4YICA 3N6UA 3OO8A 4PE5B 1YAEA 2F5XA 1YCJA 3FIRA 1DTZA 1Y4TA 2NUVA 2V25A 3HHFA 3IOTA 4WEPA 3PUVE 1OIBA 3VVEA 4DCXA 4NF4B 4YZZA 5L9SA 3B6WA 5AA4B 4U4SA 5AA3A 3E4RA 3M3FA 4R72A 1SYHA 1PEBA 5CMBA 4F19A 2XX7A 2I3VA 2UXAA 1MS7A 1T0KA 3LSXA 4OESA 5DT6A 1SVXB 2Z8DA 1FQEA 3PD8A 2O1MA 2HAVA 3O6IA 1P1UA 3TELA 3HV1A 1MQHA 3KN8A 1PC3A 2RINA 4QFOA 1B3FA 1LAHE 3D4GA 3TCFA 1P1NA 3QXMA 4R73A 3U93A 4ZE9A 3ONMA 3GZGA 5F1QA 2O68A 5I56B 2XXUA 3CI8A 4XXUA 4RJZA 1SD3A 4G68B 3UIFA 1B32A 2YLNA 3TTRA 3G3GA 4HTGA 4EUOA 1MQDA 1QKAA 5I2NA 4ESXA 2AIXA 1I6BA 3T96B 3N5LA 1N84A 1WDNA 3SESA 4N13A 1Q35A 4JXIA 4XKQA 3KSXA 4GL8A 3VLUA 3OEMA 5DYHA 4UACA 4F2OA 2WKYA 3DP8A 2X26A 2D3IA 5L9MA 4H1XA 4OMBA 3DM0A 4QSDA 1S7YA 1LCFA 1UTBA 1VFDA 1B5JA 1JNFA 2HXWA 3KBRA 4ECFA 4YMBA 4Z7EA 4GIZA 2QS3A 3CFLA 3PMWA 5FHNA 5H8FA 2W7YA 3Q29A 3FUZA 2F78A 1UTHB 2IEEA 4BDRA 3V83A 3ZKKA 3JZJA 4LQ2A 5JTYA 1NFTA 1MXXA 2D21A 2QL3A 3MVZA 3N26A 1MY3A 2V3QA 3IB1A 3S9MC 1A40A 1S9TA 4YKKA 1B3EA 3GLBA 4ELOA 3LSWA 4XKRA 4F39A 1IQ7A 3MVYA 1B7HA 1R9LA 1LFIA 2O51A 1DMBA 4ZEFA 5K2YA 4C1UA 4EQ9A 2VP1A 2DOJA 4O3CA 1JEVA 2ONKE 4PP0A 2DWHA 3R26A 4E0XA 5CBSA 3OENA 3RPWA 4RA1A 3K6XA 5L8DA 2PX1A 1HSEA 2Q2CA 1RYOA 4KYSA 4DDDA 1EZPA 1Z7NE 5H8NB 5EYFA 3ODBA 1FW0A 3LBSA 2ZNTA 3IR1A 4NWCA 4TLLB 1GV8A 3TTLA 3TTMA 1OQHA 2OWSA 4G8HA 4NF6A 3TTKA 1Y1ZA 1Z7ME 3IX1A 2ESNA 1PBQA 3PUXE 1N76A 3OXNA 1UTBB 3KFMA 4LP2B 2VOZA 2A5SA 4EQ7A 2Y7IA 3ILUB 5EHMA 4Q8RA 2ZYNA 2HQ0A 1N0TA 3CFZA 4MLVA 3TODA 1NH8A 3TTNA 4RY1A 3T9VA 2DXYA 5TP9B 4EXLA 1NNPA 3OOAA 2QMWA 3S2VA 1PBPA 3ZKLA 1B3GA 2DWAA 1OLAA 3KEIA 3CSBA 4I62A 4RXLA 3VXCA 3GBAA 5JK4A 4YB5A 3SETA 4ZE8A 3KZGA 2A5TA 1DOTA 1TFDA 4OFOA 2RC8A 3H7MA 2QS2A 3MZBA 1H45A 2XXHA 4ZEDA 4KCDA 4F2QA 2Y84A 2I0BA 3WAFA 1MQGA 5I58B 3K01A 2YJPA 2UVHA 1AH5A 1GGGA 3QIMA 3MAMA 2XXVA 4FEBA 1YTVA 2UVJA 3CG1A 3HHGA 5CRYA 3RUMA 3T66A 1B9JA 3FV2A 4GFRA 5KCJA 1DTGA 5I57A 3T93B 3E13X 3U1OA 4KHZE 4RNSA 1D9VA 3BFUA 2XXRA 1GVCA 4F1UA 4L17A 4THIA 1US4A 2DVCA 4ZZEA 3TKDA 3B6QA 2DYXA 4ONYA 1Y1MA 4FJPA 1H44A 4JWYA 4LVQA 3SERA 4DXBA 3HCQA 3IL1B 1O7TA 3C9HA 1EU8A 2CZLA 4NF5B 4I1DA 5CMKA 1B5IA 3EHTA 3S9NC 1Q1KA 1WVJA 2IA4A 4Q5TA 3TMGA 2XXPA 1AMFA 1IZ1A 1MY4A 1URSA 1OVBA 3UP9A 4NF4A 5IKBA 5DEXA 3EN3A 3TQLA 1SW1A 3UGWA 2O1LA 2Y7RA 1IXCA 2HCAA 4GWOA 5FTHA 5FHMA 1SI1A 3RT8A 3VV5A 1MQJA 4IO3A 4YU0A 1HSLA 2F7AA 3MC2A 3O6HA 3CSGA 1F9BA 2GHBA 2P2AA 3M3LA 4OVJA 5KZTA 1FTJA 4U1OA 3OELA 1B40A 2V3TA 2UYFA 4G68C 4F3PA 1B58A 2RCAA 2VHAA 1FCKA 2OWTA 2PVUA 1JVYA 2P0SA 4PETA 4H5GA 2UVGA 4M4GA 5A5XA 4FE8A 3FXQA 3UA8A 1OVTA 3B6TA 1I69A 3DLNA 3PD9A 4OZ9A 5FTIA 5ICTA 4JSDA 4NEDA 3R6UA 3N94A 1USYH 4TQUQ 1ZTYA 3PUZE 2REGA 2Y7PA 1FQBA 4OEVA 5I56A 1LAXA 4IY6A 4FAJA 1B0HA 2I4BA 4ND9A 1SI0A 4G8NA 2AL5A 4KCCA 4LA9A 3O66A 4O3BA 4ELRA 4GOTA 2GHAA 3FVOA 4QF9A 2V3UA 4C1TA 4F1VA 1MY0A 2X7PA 2DWIA 2I49A 1B46A 1R9QA 3MPKA 4EF2A 2QS4A 2Y7WA 1NNKA 4GL0A 1ZLQA 1II5A 1CB6A 2FNCA 2UYEA 3KOTA 1D3KA 4PFUA 5HBCA 3THIA 1NNFA 1PDAA 2H9BA 2Z22A 2M8CA 1P1OA 4FECA 1B51A 4H8JA 4U1ZA 1LCTA 5JTYB 2ZXTA 1LFHA 1LBBA 2Q88A 1MM6A 3FVGA 4RK9A 4KI0E 4OQOA 1MRPA 2G29A 1MG1A 1Y3PA 5FHOA 4R2FA 4U22A 3TFLA 1A7LA 3QAXA 5ISUA 4R9FA 3I5OA 2RC7A 1M5CA 1ATGA 2ONRA 4OWDA 4OFLA 1XS5A 2GH9A 5H8HA 4DZ1A 5AA4A 3FV1A 4JSOA 4G77A 4MF3A 2NVUB 1LGBC 1OQGA 4KQPA 4LUBA 1XOCA 3VXBA 3PV0E 4PFTA 1B2HA 3U8QA 1MXUA 4DLDA 5I59A 2O84X 2X7QA 3PMVA 4NE4A 1IXHA 3BFTA 1LSTA 1IXGA 2I48A 1QJMA 3E9XA 3OSRA 2GFEA 3KN3A 3TZAA 4BDOA 1D9YA 4IO4A 2H5YA 5I2NB 3MP8A 1MPCA 4IGRA 3RTFB 3TUSA 4Q0CA 1QKBA 2G93A 3T9UA 3S9LC 2HEUA 2BJJX 4LONB 5BUUA 1B4HA 2NOOA 4UA8A 5AA2B 1B7ZA 2QJEA 2VGQA 3PPRA 4POXA 2AL4A 4ZDMA 4F3BA 4NF5A 3FD3A 3TYHA 3JYRA 1P1QA 1M5FA 2NXOA 2RF1A 2PT1A 4NF8A 1SW4A 3EHSA 3MQ9A 4Q30B 3SEWA 1SQYA 3IOUA 4BLAA 1BIYA 3D4CA 2FA7A 2B3BA 5JEIA 3CRBA 4WXJA 2Q8JA 2Q2AA 3B7DA 3GXAA 4I9DA 5EHSA 4YB7A 4FATA 5H8QA 3SEVA 3LC8A 5I2KB 1MPDA 3G3FA 1HSJA 1KWHA 1UQWA 4U4XA 3F11A 1VE4A 1FQFA 1URDA 1XHYA 4R9GA 4XKNA 1NH7A 3L6GA 5AE4A 1EZ9A 1FTKA 2R9JA 5HPQA 2YPNA 3FVNA 2DXRA 3KJTA 3HO7A 1GR2A 3IO6A 3MVXA 1AL3A 2ZNSA 3PPNA 3ECRA 4OHNA 5H8NA 4GLIA 5TPAB 5CI5A 1FTMA 5KDTA 1B1HA 2F6GA 2OZZA 5I2KA 3TCGA 2AYSA 4M1VA 4QFPA 4DXUA 1JEUA 2O6AA 3RN8A 4ZECA 2ZYMA 4HS7A 2E1SA 3FJ7A 3SEUA 3VLWA 3N6TA 4BDMA 4GD5A 5I57B 3VVDA 2XXTA 3O97A 3MP6A 1LAGE 3CR9A 3H4ZA 3KSJA 4KFQA 2OCUA 5LOMA 2H25A 1S50A 4EQBA 4GF8A 4KYEA 1SDXA 4IY5A 3C35A 5ELVA 2B65A 3PGFA 4MBPA 2XXWA 1B1XA 4QFNA 4KD5A 4WEDA 4FORA 3CIJA 3MVWA 4G68A 3PUWE 4HCWA 1ZMGA 1B3HA 3G3HA 1JW1A 3UORA 4OFJA 3T9HB 3O6GA 3H6WA 2DP8A 3IOVA 3ZS6A 5H8QB 1B52A 1PB7A 5B7DA 2DE3A 2XXQA 3EQ1A 3O2AA 4U21A 4ZEKA 5CM6A 2O69A 2H4IA 3KOSA 2VD3A 2QRYA 1MY1A 1Y9UA 2DWJA 2O7UA 3KG2A 4FEDA 3IAZA 4OERA 2PMSA 1B6HA 2QMXA 2OBGA 4K3FA 1M5DA 4OETA 4I8CA 1ZBMA 1A99A 1YPNA 4RK2A 4KPTA 1QUIA 1MH3A 2F34A 3HSTA 3GBBA 3IORA 4YB6A 5DVFA 3RTWB 3SDFA 2Q9TA 3VLVA 3QUJA 4RYAA 2F7CA 1A55A 1BLFA 1MXZA 2HAUA 3MZ9A 4RPNA 5A5XB 2XX9A 3K6UA 3U94A 4IO5A 3Q27A 3PPQA 5KCJB 1ZJLA 3K0VA 1US5A 2ZYOA 1XVYA 1IXIA 2ALUA 2D5WA 5I84A 4R6YA 4GVOA 4E0WA 1MQIA 2Z23A 3TCHA 4PQJA 3RY3A 1Y3NA 4IO2A 4G8MA 3MZ1A 1JVXA 4P11A 2F97A 2DSFA 2XXXA 2Z8EA 3BBRA 4GRKA 5ITPA 2H99A 2XXIA 4N07A 4AB6A 3I6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6E A;  2RCB A;  3RLF E;  3SEY A;  4QHQ A;  5J1D A;  3FAS A;  1N7W A;  1PB8 A;  5AA1 A;  4AQ4 A;  2DE4 A;  2E0S A;  5HM4 B;  2F35 A;  5CMC A;  2FYI A;  3K02 A;  3K1M A;  1B4Z A;  2QSX A;  4N6P A;  3FVK A;  4X48 A;  2V93 A;  3Q28 A;  4WKM A;  3S4U A;  1VR5 A;  2RKM A;  4ZZA A;  4H5F A;  3Q26 A;  1LLS A;  5TP9 A;  5ICQ A;  2ZYK A;  1BP5 A;  5B70 A;  1FQD A;  3LR1 A;  3TEP A;  3H03 A;  4H0W A;  3FXR A;  5CMM A;  5IAI A;  1NL5 A;  3EHU A;  4IO6 A;  3O28 A;  4FIM A;  4BDN A;  3MP1 A;  5DTB A;  3VFJ A;  1O64 A;  2I58 A;  3USD A;  4H65 A;  3O29 A;  3E3K A;  3BKI B;  3EPE A;  1N7X A;  2LAO A;  3IB2 A;  1JW4 A;  1WOD A;  2CMO A;  2OLB A;  4F31 B;  1I6A A;  3LUY A;  3UK4 A;  1TT1 A;  4BDL A;  5I58 A;  1B5H A;  3DP6 A;  1OMP A;  3U72 A;  3M3K A;  1MDP 1;  1XT8 A;  1MDQ A;  3W9V A;  4QFK A;  1JW5 A;  5H8S A;  3TPA A;  1QUJ A;  1H76 A;  4P0I A;  1D4N A;  2DE2 A;  4LZ5 A;  4TOZ A;  3OO9 A;  4MFI A;  4Z0I A;  1B3L A;  1RYX A;  4HCY A;  3MUQ A;  4IGT A;  3VVF A;  1ELJ A;  3IOW A;  3H3G A;  4F3S A;  1Y3Q A;  1DPE A;  1UIU A;  3P7I A;  1LFG A;  4H8I A;  3KJ7 A;  3K2D A;  3K1P A;  3QYT A;  3TDJ A;  4TLM B;  1J1N A;  3RNN A;  3DEL B;  4MLQ A;  1P99 A;  1MXV A;  1R1N A;  2XHD A;  3OMB A;  3OSQ A;  3LSF B;  1VFE A;  4PFY A;  4YAH X;  3A3U A;  5TPA A;  4DE8 A;  4ESW A;  4KYD A;  2I3W A;  4P0G A;  5K2X A;  5KDT B;  1XC1 A;  4U2R A;  1A54 A;  2UVI A;  1IIT A;  5AA2 A;  1AIV A;  1H43 A;  1R6Z A;  2ANJ A;  1SW5 A;  2V84 A;  4QFL A;  2I4C A;  4KR5 A;  3O9P A;  4NF6 B;  4YKP A;  4XKP A;  1Y4C A;  3I3V A;  4H67 A;  4ISU A;  5DVI A;  4YMA A;  3IO4 A;  1ZU0 A;  3MPL A;  4O3A A;  3PU5 A;  1M5B A;  4DIG A;  1UIV A;  1VSO A;  3FJM A;  3MWB A;  4NMY A;  4R74 A;  3RQT A;  4H6D A;  3PMX A;  3M8U A;  4MH5 A;  2PT2 A;  3W9W A;  4LQ5 A;  1FTL A;  2HFB A;  2QS1 A;  3QK6 A;  1POT A;  4HW8 A;  4F1Y A;  1H3D A;  4ZEI A;  4C0R A;  4ELQ A;  3WAE A;  4NF8 B;  1BKA A;  3MBP A;  1QW0 A;  4U23 A;  4ELP A;  1BTJ A;  1POY 1;  1URG A;  3OD7 A;  1N3W A;  3IB0 A;  4GXS B;  2A5T B;  3PPP A;  4GXA A;  2HZK A;  4JWO A;  4AB5 A;  2DS9 A;  3G7W A;  2ONS A;  4LZ8 A;  5BWJ A;  3RGY A;  2DVZ A;  1QVS A;  3K00 A;  2F8D A;  3A09 A;  3IK6 B;  1AOV A;  3KN7 A;  3TQW A;  4XTC Q;  4POW A;  3CG3 A;  3VDF A;  2REJ A;  4EDP A;  1B05 A;  4F22 A;  1SW2 A;  1A8F A;  1EH3 A;  2DQV A;  1M5E A;  2XD3 A;  3K6V A;  3SEX A;  2ZNU A;  3DP4 A;  3PUY E;  1FQC A;  1IEJ A;  1N04 A;  4G4P A;  1TXF A;  2VD2 A;  1MXY A;  3C4M A;  2XXY A;  4R6K A;  5DEX B;  2F7B A;  1LBC A;  2F36 A;  3T22 A;  3A3C A;  1RKM A;  3K1N A;  3C36 A;  3MJN A;  4JDF A;  4R6H A;  3S9E A;  2ZMB A;  1EZO A;  1MXW A;  4XIG Q;  3CFX A;  2Z8F A;  3FAT A;  4RPO A;  1JET A;  3V89 B;  2R71 A;  4QSC A;  5AA2 D;  1A8E A;  1B7U A;  2F6P A;  2P1S A;  2PBW A;  2RC9 A;  2GRV A;  3FGS A;  3H6V A;  3HN0 A;  1Y20 A;  4JBZ A;  4NTL A;  4PFW A;  2PYY A;  4R2B A;  2QPQ A;  1FTO A;  3CVG A;  3FZV A;  3OEK A;  1QUL A;  3QUF A;  2Y7K A;  3K6W A;  4X1D A;  4EF1 A;  4OEN A;  4JB7 A;  1MH4 A;  5M2V A;  2Q89 A;  3G3J A;  3IJX B;  3LSL A;  1P1W A;  4DCY A;  2XX8 A;  2O7I A;  3C33 A;  3KGC A;  1ANF A;  1LB8 A;  1SBP A;  1OLC A;  3H06 B;  1O63 A;  1IIW A;  1DPP A;  4OXV A;  3V5A A;  3VE1 B;  3OO7 A;  3JV9 A;  3OO6 A;  4OTE A;  5H8F B;  1IUD A;  1NKX A;  4F29 A;  5CBR A;  3R7X A;  3K4U A;  1JQF A;  3G3K A;  1UTH A;  3RT6 B;  4OYV A;  3FXU A;  3T9X B;  3G3I A;  2OK2 A;  1PB9 A;  2THI A;  4IB2 A;  5F7V A;  1LAF E;  2XD2 A;  3PPO A;  1GTK A;  4QSE A;  1I6Q A;  2H98 A;  4OEU A;  2KLF A;  4F3G A;  3AXF A;  3EF7 A;  3MW0 A;  1NMU A;  3C31 A;  4LZ7 A;  3SKP A;  3V8X B;  4EXK A;  4GQO A;  1B0L A;  2B3F A;  4G2Z A;  2ABH A;  4F18 A;  1USY E;  1LB9 A;  4IO7 A;  3C32 A;  1TFA A;  3L6H A;  3Q25 A;  2HZL A;  4QRZ A;  3H6U A;  3ZSF A;  2OJT A;  1N3X A;  3IJO B;  3QSL A;  1TWY A;  5ITO A;  4BDQ A;  1CE2 A;  3HPI A;  3UN6 A;  3C34 A;  4NWD A;  1FQA A;  3FJG A;  4LAT A;  5H8H B;  5L9O A;  4ZS9 A;  3TAJ A;  4DXC A;  1MY2 A;  4YKJ A;  1ZIU A;  3U92 A;  1NNT A;  2I0C A;  4R75 A;  4JWX A;  5CC2 A;  3H6T A;  1QUK A;  5I59 B;  1ZKB A;  2R6G E;  4ZEB A;  1XVX A;  3ILT B;  4X9T A;  4YKI A;  3W15 C;  1MM7 A;  1SYI A;  1L5T A;  5TU0 A;  4X1B A;  1MPB A;  5DVJ A;  2NWJ A;  1DSN A;  4YIC A;  3N6U A;  3OO8 A;  4PE5 B;  1YAE A;  2F5X A;  1YCJ A;  3FIR A;  1DTZ A;  1Y4T A;  2NUV A;  2V25 A;  3HHF A;  3IOT A;  4WEP A;  3PUV E;  1OIB A;  3VVE A;  4DCX A;  4NF4 B;  4YZZ A;  5L9S A;  3B6W A;  5AA4 B;  4U4S A;  5AA3 A;  3E4R A;  3M3F A;  4R72 A;  1SYH A;  1PEB A;  5CMB A;  4F19 A;  2XX7 A;  2I3V A;  2UXA A;  1MS7 A;  1T0K A;  3LSX A;  4OES A;  5DT6 A;  1SVX B;  2Z8D A;  1FQE A;  3PD8 A;  2O1M A;  2HAV A;  3O6I A;  1P1U A;  3TEL A;  3HV1 A;  1MQH A;  3KN8 A;  1PC3 A;  2RIN A;  4QFO A;  1B3F A;  1LAH E;  3D4G A;  3TCF A;  1P1N A;  3QXM A;  4R73 A;  3U93 A;  4ZE9 A;  3ONM A;  3GZG A;  5F1Q A;  2O68 A;  5I56 B;  2XXU A;  3CI8 A;  4XXU A;  4RJZ A;  1SD3 A;  4G68 B;  3UIF A;  1B32 A;  2YLN A;  3TTR A;  3G3G A;  4HTG A;  4EUO A;  1MQD A;  1QKA A;  5I2N A;  4ESX A;  2AIX A;  1I6B A;  3T96 B;  3N5L A;  1N84 A;  1WDN A;  3SES A;  4N13 A;  1Q35 A;  4JXI A;  4XKQ A;  3KSX A;  4GL8 A;  3VLU A;  3OEM A;  5DYH A;  4UAC A;  4F2O A;  2WKY A;  3DP8 A;  2X26 A;  2D3I A;  5L9M A;  4H1X A;  4OMB A;  3DM0 A;  4QSD A;  1S7Y A;  1LCF A;  1UTB A;  1VFD A;  1B5J A;  1JNF A;  2HXW A;  3KBR A;  4ECF A;  4YMB A;  4Z7E A;  4GIZ A;  2QS3 A;  3CFL A;  3PMW A;  5FHN A;  5H8F A;  2W7Y A;  3Q29 A;  3FUZ A;  2F78 A;  1UTH B;  2IEE A;  4BDR A;  3V83 A;  3ZKK A;  3JZJ A;  4LQ2 A;  5JTY A;  1NFT A;  1MXX A;  2D21 A;  2QL3 A;  3MVZ A;  3N26 A;  1MY3 A;  2V3Q A;  3IB1 A;  3S9M C;  1A40 A;  1S9T A;  4YKK A;  1B3E A;  3GLB A;  4ELO A;  3LSW A;  4XKR A;  4F39 A;  1IQ7 A;  3MVY A;  1B7H A;  1R9L A;  1LFI A;  2O51 A;  1DMB A;  4ZEF A;  5K2Y A;  4C1U A;  4EQ9 A;  2VP1 A;  2DOJ A;  4O3C A;  1JEV A;  2ONK E;  4PP0 A;  2DWH A;  3R26 A;  4E0X A;  5CBS A;  3OEN A;  3RPW A;  4RA1 A;  3K6X A;  5L8D A;  2PX1 A;  1HSE A;  2Q2C A;  1RYO A;  4KYS A;  4DDD A;  1EZP A;  1Z7N E;  5H8N B;  5EYF A;  3ODB A;  1FW0 A;  3LBS A;  2ZNT A;  3IR1 A;  4NWC A;  4TLL B;  1GV8 A;  3TTL A;  3TTM A;  1OQH A;  2OWS A;  4G8H A;  4NF6 A;  3TTK A;  1Y1Z A;  1Z7M E;  3IX1 A;  2ESN A;  1PBQ A;  3PUX E;  1N76 A;  3OXN A;  1UTB B;  3KFM A;  4LP2 B;  2VOZ A;  2A5S A;  4EQ7 A;  2Y7I A;  3ILU B;  5EHM A;  4Q8R A;  2ZYN A;  2HQ0 A;  1N0T A;  3CFZ A;  4MLV A;  3TOD A;  1NH8 A;  3TTN A;  4RY1 A;  3T9V A;  2DXY A;  5TP9 B;  4EXL A;  1NNP A;  3OOA A;  2QMW A;  3S2V A;  1PBP A;  3ZKL A;  1B3G A;  2DWA A;  1OLA A;  3KEI A;  3CSB A;  4I62 A;  4RXL A;  3VXC A;  3GBA A;  5JK4 A;  4YB5 A;  3SET A;  4ZE8 A;  3KZG A;  2A5T A;  1DOT A;  1TFD A;  4OFO A;  2RC8 A;  3H7M A;  2QS2 A;  3MZB A;  1H45 A;  2XXH A;  4ZED A;  4KCD A;  4F2Q A;  2Y84 A;  2I0B A;  3WAF A;  1MQG A;  5I58 B;  3K01 A;  2YJP A;  2UVH A;  1AH5 A;  1GGG A;  3QIM A;  3MAM A;  2XXV A;  4FEB A;  1YTV A;  2UVJ A;  3CG1 A;  3HHG A;  5CRY A;  3RUM A;  3T66 A;  1B9J A;  3FV2 A;  4GFR A;  5KCJ A;  1DTG A;  5I57 A;  3T93 B;  3E13 X;  3U1O A;  4KHZ E;  4RNS A;  1D9V A;  3BFU A;  2XXR A;  1GVC A;  4F1U A;  4L17 A;  4THI A;  1US4 A;  2DVC A;  4ZZE A;  3TKD A;  3B6Q A;  2DYX A;  4ONY A;  1Y1M A;  4FJP A;  1H44 A;  4JWY A;  4LVQ A;  3SER A;  4DXB A;  3HCQ A;  3IL1 B;  1O7T A;  3C9H A;  1EU8 A;  2CZL A;  4NF5 B;  4I1D A;  5CMK A;  1B5I A;  3EHT A;  3S9N C;  1Q1K A;  1WVJ A;  2IA4 A;  4Q5T A;  3TMG A;  2XXP A;  1AMF A;  1IZ1 A;  1MY4 A;  1URS A;  1OVB A;  3UP9 A;  4NF4 A;  5IKB A;  5DEX A;  3EN3 A;  3TQL A;  1SW1 A;  3UGW A;  2O1L A;  2Y7R A;  1IXC A;  2HCA A;  4GWO A;  5FTH A;  5FHM A;  1SI1 A;  3RT8 A;  3VV5 A;  1MQJ A;  4IO3 A;  4YU0 A;  1HSL A;  2F7A A;  3MC2 A;  3O6H A;  3CSG A;  1F9B A;  2GHB A;  2P2A A;  3M3L A;  4OVJ A;  5KZT A;  1FTJ A;  4U1O A;  3OEL A;  1B40 A;  2V3T A;  2UYF A;  4G68 C;  4F3P A;  1B58 A;  2RCA A;  2VHA A;  1FCK A;  2OWT A;  2PVU A;  1JVY A;  2P0S A;  4PET A;  4H5G A;  2UVG A;  4M4G A;  5A5X A;  4FE8 A;  3FXQ A;  3UA8 A;  1OVT A;  3B6T A;  1I69 A;  3DLN A;  3PD9 A;  4OZ9 A;  5FTI A;  5ICT A;  4JSD A;  4NED A;  3R6U A;  3N94 A;  1USY H;  4TQU Q;  1ZTY A;  3PUZ E;  2REG A;  2Y7P A;  1FQB A;  4OEV A;  5I56 A;  1LAX A;  4IY6 A;  4FAJ A;  1B0H A;  2I4B A;  4ND9 A;  1SI0 A;  4G8N A;  2AL5 A;  4KCC A;  4LA9 A;  3O66 A;  4O3B A;  4ELR A;  4GOT A;  2GHA A;  3FVO A;  4QF9 A;  2V3U A;  4C1T A;  4F1V A;  1MY0 A;  2X7P A;  2DWI A;  2I49 A;  1B46 A;  1R9Q A;  3MPK A;  4EF2 A;  2QS4 A;  2Y7W A;  1NNK A;  4GL0 A;  1ZLQ A;  1II5 A;  1CB6 A;  2FNC A;  2UYE A;  3KOT A;  1D3K A;  4PFU A;  5HBC A;  3THI A;  1NNF A;  1PDA A;  2H9B A;  2Z22 A;  2M8C A;  1P1O A;  4FEC A;  1B51 A;  4H8J A;  4U1Z A;  1LCT A;  5JTY B;  2ZXT A;  1LFH A;  1LBB A;  2Q88 A;  1MM6 A;  3FVG A;  4RK9 A;  4KI0 E;  4OQO A;  1MRP A;  2G29 A;  1MG1 A;  1Y3P A;  5FHO A;  4R2F A;  4U22 A;  3TFL A;  1A7L A;  3QAX A;  5ISU A;  4R9F A;  3I5O A;  2RC7 A;  1M5C A;  1ATG A;  2ONR A;  4OWD A;  4OFL A;  1XS5 A;  2GH9 A;  5H8H A;  4DZ1 A;  5AA4 A;  3FV1 A;  4JSO A;  4G77 A;  4MF3 A;  2NVU B;  1LGB C;  1OQG A;  4KQP A;  4LUB A;  1XOC A;  3VXB A;  3PV0 E;  4PFT A;  1B2H A;  3U8Q A;  1MXU A;  4DLD A;  5I59 A;  2O84 X;  2X7Q A;  3PMV A;  4NE4 A;  1IXH A;  3BFT A;  1LST A;  1IXG A;  2I48 A;  1QJM A;  3E9X A;  3OSR A;  2GFE A;  3KN3 A;  3TZA A;  4BDO A;  1D9Y A;  4IO4 A;  2H5Y A;  5I2N B;  3MP8 A;  1MPC A;  4IGR A;  3RTF B;  3TUS A;  4Q0C A;  1QKB A;  2G93 A;  3T9U A;  3S9L C;  2HEU A;  2BJJ X;  4LON B;  5BUU A;  1B4H A;  2NOO A;  4UA8 A;  5AA2 B;  1B7Z A;  2QJE A;  2VGQ A;  3PPR A;  4POX A;  2AL4 A;  4ZDM A;  4F3B A;  4NF5 A;  3FD3 A;  3TYH A;  3JYR A;  1P1Q A;  1M5F A;  2NXO A;  2RF1 A;  2PT1 A;  4NF8 A;  1SW4 A;  3EHS A;  3MQ9 A;  4Q30 B;  3SEW A;  1SQY A;  3IOU A;  4BLA A;  1BIY A;  3D4C A;  2FA7 A;  2B3B A;  5JEI A;  3CRB A;  4WXJ A;  2Q8J A;  2Q2A A;  3B7D A;  3GXA A;  4I9D A;  5EHS A;  4YB7 A;  4FAT A;  5H8Q A;  3SEV A;  3LC8 A;  5I2K B;  1MPD A;  3G3F A;  1HSJ A;  1KWH A;  1UQW A;  4U4X A;  3F11 A;  1VE4 A;  1FQF A;  1URD A;  1XHY A;  4R9G A;  4XKN A;  1NH7 A;  3L6G A;  5AE4 A;  1EZ9 A;  1FTK A;  2R9J A;  5HPQ A;  2YPN A;  3FVN A;  2DXR A;  3KJT A;  3HO7 A;  1GR2 A;  3IO6 A;  3MVX A;  1AL3 A;  2ZNS A;  3PPN A;  3ECR A;  4OHN A;  5H8N A;  4GLI A;  5TPA B;  5CI5 A;  1FTM A;  5KDT A;  1B1H A;  2F6G A;  2OZZ A;  5I2K A;  3TCG A;  2AYS A;  4M1V A;  4QFP A;  4DXU A;  1JEU A;  2O6A A;  3RN8 A;  4ZEC A;  2ZYM A;  4HS7 A;  2E1S A;  3FJ7 A;  3SEU A;  3VLW A;  3N6T A;  4BDM A;  4GD5 A;  5I57 B;  3VVD A;  2XXT A;  3O97 A;  3MP6 A;  1LAG E;  3CR9 A;  3H4Z A;  3KSJ A;  4KFQ A;  2OCU A;  5LOM A;  2H25 A;  1S50 A;  4EQB A;  4GF8 A;  4KYE A;  1SDX A;  4IY5 A;  3C35 A;  5ELV A;  2B65 A;  3PGF A;  4MBP A;  2XXW A;  1B1X A;  4QFN A;  4KD5 A;  4WED A;  4FOR A;  3CIJ A;  3MVW A;  4G68 A;  3PUW E;  4HCW A;  1ZMG A;  1B3H A;  3G3H A;  1JW1 A;  3UOR A;  4OFJ A;  3T9H B;  3O6G A;  3H6W A;  2DP8 A;  3IOV A;  3ZS6 A;  5H8Q B;  1B52 A;  1PB7 A;  5B7D A;  2DE3 A;  2XXQ A;  3EQ1 A;  3O2A A;  4U21 A;  4ZEK A;  5CM6 A;  2O69 A;  2H4I A;  3KOS A;  2VD3 A;  2QRY A;  1MY1 A;  1Y9U A;  2DWJ A;  2O7U A;  3KG2 A;  4FED A;  3IAZ A;  4OER A;  2PMS A;  1B6H A;  2QMX A;  2OBG A;  4K3F A;  1M5D A;  4OET A;  4I8C A;  1ZBM A;  1A99 A;  1YPN A;  4RK2 A;  4KPT A;  1QUI A;  1MH3 A;  2F34 A;  3HST A;  3GBB A;  3IOR A;  4YB6 A;  5DVF A;  3RTW B;  3SDF A;  2Q9T A;  3VLV A;  3QUJ A;  4RYA A;  2F7C A;  1A55 A;  1BLF A;  1MXZ A;  2HAU A;  3MZ9 A;  4RPN A;  5A5X B;  2XX9 A;  3K6U A;  3U94 A;  4IO5 A;  3Q27 A;  3PPQ A;  5KCJ B;  1ZJL A;  3K0V A;  1US5 A;  2ZYO A;  1XVY A;  1IXI A;  2ALU A;  2D5W A;  5I84 A;  4R6Y A;  4GVO A;  4E0W A;  1MQI A;  2Z23 A;  3TCH A;  4PQJ A;  3RY3 A;  1Y3N A;  4IO2 A;  4G8M A;  3MZ1 A;  1JVX A;  4P11 A;  2F97 A;  2DSF A;  2XXX A;  2Z8E A;  3BBR A;  4GRK A;  5ITP A;  2H99 A;  2XXI A;  4N07 A;  4AB6 A;  3I6V A; 
#chains in the Genus database with same CATH topology
 4QHQ A;  2PFZ A;  3FAS A;  1N7W A;  1PB8 A;  2E0S A;  2FYI A;  2QSX A;  3MST A;  2KQZ A;  4ZZA A;  5TP9 A;  5ICQ A;  5B70 A;  3EHU A;  4FIM A;  4H65 A;  5IZ3 B;  2MKZ A;  1JW4 A;  2CMO A;  1B5H A;  3M3K A;  3W9V A;  1JW5 A;  3B50 A;  3TPA A;  1QUJ A;  1H76 A;  4P1L A;  1ELJ A;  3H3G A;  1DPE A;  3P7I A;  1LFG A;  4H8I A;  3KJ7 A;  4I3E A;  4OVS A;  3OMB A;  2XHD A;  3OSQ A;  2I3W A;  4P0G A;  5KDT B;  4PGN A;  1SW5 A;  4QFL A;  4KR5 A;  4YMA A;  3IO4 A;  1ZU0 A;  3MPL A;  4O3A A;  4O7M A;  3MWB A;  4NMY A;  5IGA A;  1POT A;  4NF8 B;  4U23 A;  3A29 A;  1N3W A;  2A5T B;  4MNP A;  2HZK A;  4N6K A;  4LZ8 A;  3K00 A;  3A09 A;  3KN7 A;  4HE1 A;  3CG3 A;  5IZ1 A;  1LBW A;  1A8F A;  1M5E A;  2ZNU A;  2L5V A;  1TXF A;  3T22 A;  4R6K A;  1LBC A;  3MJN A;  4JDF A;  2ZMB A;  1EZO A;  1MXW A;  3LV0 A;  3CFX A;  3V89 B;  4QSC A;  1A8E A;  3HN0 A;  4PFW A;  2QPQ A;  3QUF A;  2Y7K A;  3K6W A;  2FIX A;  4OEN A;  4JB7 A;  3IJX B;  3LSL A;  1P1W A;  2XX8 A;  3C33 A;  1FBP A;  3H06 B;  3V5A A;  4OTE A;  5H8F B;  1NKX A;  4PAF A;  1EYI A;  1IME A;  4OEU A;  4GX4 A;  3C31 A;  3V8X B;  4EXK A;  1NUY A;  3L6H A;  1TFA A;  2GQ1 A;  3ZSF A;  1CE2 A;  3UN6 A;  5H8H B;  5L9O A;  4ZS9 A;  1NNT A;  1XVX A;  1SYI A;  1L5T A;  5TU0 A;  1MPB A;  1YCJ A;  4WEP A;  2V25 A;  3IOT A;  4DCX A;  4MEV A;  3E4R A;  3M3F A;  1PEB A;  2XX7 A;  3BIH A;  5DT6 A;  5ET7 A;  4N15 A;  4ZE9 A;  1LAH E;  3TCF A;  3U93 A;  3ONM A;  3GZG A;  2O68 A;  5I56 B;  1B32 A;  3TTR A;  3G3G A;  1N84 A;  3SES A;  4JXI A;  1IMC A;  2D3I A;  3DM0 A;  1S7Y A;  1VFD A;  4Z7E A;  2QS3 A;  2W7Y A;  3Q29 A;  1MXX A;  2QL3 A;  3MVZ A;  1MY3 A;  2V3Q A;  1S9T A;  1B3E A;  4X8R A;  2WBB A;  4ZEF A;  2VP1 A;  2DWH A;  3RPW A;  2F3D A;  3ODB A;  3LBS A;  1QGX A;  3IX1 A;  2OWZ A;  2A5S A;  5EHM A;  2ZYN A;  4MLV A;  4RY1 A;  4GWY A;  5TP9 B;  3OOA A;  4I62 A;  4RXL A;  3IFC A;  1NUX A;  1H45 A;  4KCD A;  4OA4 A;  2YJP A;  2XXV A;  2UVJ A;  3RUM A;  1DTG A;  2XXR A;  1GVC A;  2DVC A;  4O7I A;  1Y1M A;  4LVQ A;  4JWY A;  4DXB A;  3HCQ A;  2XA5 A;  3C9H A;  2CZL A;  1B5I A;  1Q1K A;  3TMG A;  2XXP A;  2FVZ A;  1AMF A;  2Q74 A;  3EN3 A;  3TQL A;  2Y7R A;  4PGP A;  4OVJ A;  5KZT A;  2GHB A;  3M3L A;  3OEL A;  4UAB A;  4G68 C;  2VHA A;  4F3G A;  2PVU A;  4PET A;  4M4G A;  4OZ9 A;  1LAX A;  1SI0 A;  2AL5 A;  4GBV A;  4X04 A;  3FVO A;  2X7P A;  2DWI A;  1B46 A;  3MPK A;  4EF2 A;  2QS4 A;  1II5 A;  2FNC A;  2UYE A;  1PDA A;  4OQO A;  1Y3P A;  4U22 A;  3QAX A;  1M5C A;  2ONR A;  2GH9 A;  1FBG A;  1OQG A;  4KXP A;  4LUB A;  3E78 A;  5ET6 A;  5I59 A;  1FBH A;  3PMV A;  3BFT A;  1IXG A;  3OSR A;  2GFE A;  3KN3 A;  4BDO A;  4N8Y A;  4IO4 A;  3TUS A;  1MPC A;  4IGR A;  3T9U A;  2BJJ X;  5I56 A;  4POX A;  4PCD A;  2P3N A;  2RF1 A;  4Q30 B;  3IOU A;  2FA7 A;  1FPL A;  4WXJ A;  2Q2A A;  3SEV A;  1MPD A;  4U4X A;  1HSJ A;  4DI3 D;  3F11 A;  1VE4 A;  1T0K A;  5HPQ A;  3PPN A;  2QVR A;  3HO7 A;  5H8N A;  1GR2 A;  5I7I A;  1AL3 A;  2PFY A;  2QVU A;  2AYS A;  4DXU A;  3RN8 A;  4PDH A;  4BDM A;  4AS4 A;  1FBF A;  3H4Z A;  3KSJ A;  5ET8 A;  4OVQ A;  3PGF A;  4MBP A;  2XXW A;  4KD5 A;  4FOR A;  3CIJ A;  3MVW A;  4G68 A;  5T3J A;  3NOH A;  3G3H A;  3UOR A;  3T9H B;  2DP8 A;  3ZS6 A;  3EKI A;  5B7D A;  3EQ1 A;  1SPI A;  2QRY A;  4FED A;  5EQ9 A;  3KG2 A;  4OER A;  1B6H A;  1M5D A;  4GWS A;  4YB6 A;  4KPT A;  1QUI A;  1MH3 A;  3HST A;  3IOR A;  3GBB A;  3SDF A;  4RYA A;  1BLF A;  1MXZ A;  2HAU A;  1IMB A;  1NV1 A;  5KCJ B;  3K0V A;  1US5 A;  2ZYO A;  1IXI A;  2D5W A;  2P3V A;  1MQI A;  2Z23 A;  4IO2 A;  3MZ1 A;  1JVX A;  2XXX A;  2Z8E A;  4N07 A;  4AB6 A;  3LSX A;  2I6E A;  1INP A;  3SEY A;  4MAG A;  5AA1 A;  4AS5 A;  4AQ4 A;  2DE4 A;  5HM4 B;  2F35 A;  3K02 A;  3K1M A;  1B4Z A;  1RDZ A;  4X48 A;  2V93 A;  1EYK A;  2ZYK A;  1BP5 A;  1FQD A;  3TEP A;  3H03 A;  2VPN A;  3FXR A;  1NL5 A;  4IO6 A;  3D1R A;  2LAO A;  5CMK A;  1WOD A;  1I6A A;  5I58 A;  3U72 A;  1XT8 A;  4GWU A;  4JVI A;  4TOZ A;  3OO9 A;  2HXR A;  4Z0I A;  3MUQ A;  3IOW A;  1FJ9 A;  1UIU A;  3K2D A;  5LDZ A;  3DEL B;  4MLQ A;  1P99 A;  4G61 A;  4YAH X;  3LSF B;  1VFE A;  4PFY A;  4PF8 A;  4DE8 A;  5K2X A;  2CEY A;  1IIT A;  1H43 A;  1R6Z A;  4O8M A;  2CEX A;  1Y4C A;  5ET5 A;  4ISU A;  4DIG A;  1UIV A;  3RQT A;  2PT2 A;  3W9W A;  4MX6 A;  2HFB A;  3QK6 A;  1H3D A;  3WAE A;  1FBC A;  3MBP A;  4ELP A;  1BTJ A;  1URG A;  4GXS B;  3OD7 A;  4AB5 A;  5BWJ A;  3G7W A;  1DK4 A;  1AOV A;  4EDP A;  1B05 A;  1EH3 A;  2XD3 A;  2Q8M A;  2B4M A;  4G4P A;  3C4M A;  3C36 A;  4P9K A;  1JET A;  1B7U A;  2XWO A;  2GRV A;  4R2B A;  1FTO A;  5DW8 A;  5M2V A;  3G3J A;  3KGC A;  1LB8 A;  1DPP A;  4N17 A;  1IUD A;  4F29 A;  1JQF A;  3RT6 B;  3T9X B;  1KA0 A;  1VDW A;  2THI A;  5F7V A;  3PPO A;  3MW0 A;  4LZ7 A;  3SKP A;  2B3F A;  4G2Z A;  2ABH A;  1FPK A;  2HZL A;  3H6U A;  1N3X A;  4GX3 A;  3HPI A;  5EQA A;  2JJK A;  3TAJ A;  1MY2 A;  3H6T A;  4NHB A;  4ZEB A;  4ELO A;  1MM7 A;  2NWJ A;  5DVJ A;  4XF5 A;  4YIC A;  4PE5 B;  3FIR A;  3TTN A;  3PUV E;  1OIB A;  3B6W A;  1LBX A;  4U4S A;  5AA3 A;  4R72 A;  1SYH A;  2I3V A;  5ESY A;  4PAK A;  1AWB A;  4OES A;  4P8B A;  4PF6 A;  1P1U A;  3CHG A;  3TEL A;  1MQH A;  3KN8 A;  1FPF A;  4QFO A;  1B3F A;  5AA2 D;  3QXM A;  4R73 A;  5F1Q A;  3CI8 A;  4XXU A;  4G68 B;  3UIF A;  2YLN A;  5EYH A;  4HTG A;  1MQD A;  1I6B A;  3T96 B;  4N13 A;  1Q35 A;  4GL8 A;  1NUW A;  4UAC A;  3DP8 A;  1NV6 A;  4MNI A;  5L9M A;  1B5J A;  3CFL A;  5FHN A;  3PMW A;  3FUZ A;  2F78 A;  2IEE A;  4BDR A;  3ISP A;  3N26 A;  3IB1 A;  3S9M C;  1YXI A;  3GLB A;  3LSW A;  1LFI A;  4FBP A;  5J16 A;  1DMB A;  4EQ9 A;  2DOJ A;  4O3C A;  2ONK E;  1HSE A;  1RYO A;  4P56 A;  1FW0 A;  2ZNT A;  3IR1 A;  3TTL A;  3TTM A;  1OQH A;  4G8H A;  3TTK A;  3PUX E;  3B8B A;  1UTB B;  4EQ7 A;  2VOZ A;  4Q8R A;  1YYZ A;  3ILU B;  1N0T A;  3TOD A;  2XWV A;  1PBP A;  1FRP A;  3GYY A;  3ZKL A;  1OLA A;  3VXC A;  3CSB A;  5IM2 A;  4YB5 A;  4ZE8 A;  4OFO A;  2A5T A;  1DOT A;  1TFD A;  2CZK A;  1KZ8 A;  2FBP A;  2RC8 A;  2FIE A;  3RYD A;  5I58 B;  1NI9 A;  1AH5 A;  3MAM A;  4FEB A;  3CG1 A;  5CRY A;  3T66 A;  5KCJ A;  3FV2 A;  4GFR A;  5I57 A;  3T93 B;  4KHZ E;  4ZZE A;  3TKD A;  1H44 A;  4HXV A;  1O7T A;  1EU8 A;  4NF5 B;  1MY4 A;  1SW1 A;  1IXC A;  5FBP A;  4PAI A;  1MQJ A;  3U65 A;  4YU0 A;  1HSL A;  2F7A A;  3MC2 A;  3CSG A;  1FTJ A;  2V3T A;  2RCA A;  2P0S A;  4H5G A;  3FXQ A;  3UA8 A;  1OVT A;  3B6T A;  3PD9 A;  4NED A;  1FQB A;  2WBD A;  2OX3 A;  4FAJ A;  4ND9 A;  4KCC A;  4ELR A;  1YZ0 A;  2V3U A;  4F1V A;  2I49 A;  1ZLQ A;  5HBC A;  3THI A;  2H9B A;  2M8C A;  4U1Z A;  1LFH A;  2Q88 A;  1MRP A;  2G29 A;  1MG1 A;  2WYK A;  5ISU A;  3I5O A;  4OWD A;  5H8H A;  4G77 A;  4GWZ A;  3U8Q A;  3FXB A;  2X7Q A;  1IXH A;  1LST A;  2I48 A;  1QJM A;  3MP8 A;  4Q0C A;  1IMF A;  4LON B;  2NOO A;  5AA2 B;  4ZDM A;  1G0H A;  3JYR A;  1NV5 A;  1SW4 A;  3SEW A;  1SQY A;  5JEI A;  3CRB A;  2Q8J A;  4I9D A;  5EHS A;  3G3F A;  1KWH A;  1UQW A;  1RDY A;  1XHY A;  3L6G A;  1FTK A;  2YPN A;  2DXR A;  3IO6 A;  4E0W A;  3MVX A;  5TPA B;  1K9Y A;  2BJI A;  1FTM A;  5I2K A;  3TCG A;  1DCU A;  2E1S A;  5I57 B;  4GD5 A;  4MMP A;  2XXT A;  1LAG E;  3CR9 A;  5A5L A;  2OCU A;  2H25 A;  4GF8 A;  1EYJ A;  4IY5 A;  2B65 A;  4HCW A;  5H8Q B;  1B52 A;  2ZZV A;  2VD3 A;  4PFU A;  1MY1 A;  2DWJ A;  2FHY A;  2QMX A;  4RK2 A;  4K3F A;  4I8C A;  4I3Y A;  3VLV A;  3MZ9 A;  2WEF A;  4IO5 A;  1FPB A;  1ZJL A;  4GVO A;  4H46 A;  3TCH A;  4PQJ A;  4N6D A;  4NQ8 A;  3BBR A;  3VE1 B;  3I6V A;  2RCB A;  5J1D A;  4NGU A;  5CMC A;  3FVK A;  3MYU A;  3Q28 A;  4WKM A;  3Q26 A;  1FPG A;  5CMM A;  5IAI A;  3VFJ A;  3USD A;  3LUY A;  3DP6 A;  1MDQ A;  5H8S A;  4P0I A;  2DE2 A;  4LZ5 A;  1RYX A;  3VVF A;  3TDJ A;  4TLM B;  1J1N A;  2ZZX A;  3A3U A;  5TPA A;  4ESW A;  4KYD A;  4U2R A;  1A54 A;  4PFI A;  2ANJ A;  2I4C A;  3O9P A;  4NF6 B;  4YKP A;  3I3V A;  4H67 A;  5DVI A;  4P47 A;  1M5B A;  1VSO A;  3FJM A;  4MH5 A;  4LQ5 A;  4F1Y A;  4ZEI A;  4C0R A;  1POY 1;  4GXA A;  4JWO A;  3RGY A;  1QVS A;  3IK6 B;  4POW A;  3VDF A;  2REJ A;  1SW2 A;  2DQV A;  2XXK A;  5F24 A;  3KC1 A;  3PUY E;  1IEJ A;  2VD2 A;  5DEX B;  2XXY A;  1RKM A;  4R6H A;  4XIG Q;  4RPO A;  2PBW A;  2F6P A;  2P1S A;  3H6V A;  5I2K B;  4BDQ A;  4NTL A;  4YKJ A;  4JBZ A;  3CVG A;  3FZV A;  4X1D A;  4EF1 A;  1MH4 A;  1LBV A;  4DCY A;  1ANF A;  1SBP A;  4OXV A;  2VPO A;  3OO6 A;  4PTK A;  5CBR A;  3R7X A;  1UTH A;  3T1B A;  3G3I A;  4IB2 A;  1LAF E;  2XD2 A;  1GTK A;  1I6Q A;  2KLF A;  3AXF A;  4MIJ A;  1NMU A;  1B0L A;  4F18 A;  1USY E;  1LB9 A;  3Q25 A;  2OJT A;  3IJO B;  5ITO A;  4NWD A;  1FQA A;  4LAT A;  1ZIU A;  5CC2 A;  1QUK A;  2R6G E;  4YKI A;  3ILT B;  1DSN A;  3N6U A;  2F5X A;  4MCO A;  4NF4 B;  5AA4 B;  5CMB A;  4F19 A;  1SVX B;  2O1M A;  2RIN A;  1P1N A;  4RJZ A;  4EUO A;  4ESX A;  1WDN A;  3KSX A;  3VLU A;  3OEM A;  2X26 A;  4OMB A;  5LOM A;  1UTB A;  2HXW A;  1JNF A;  4NF0 A;  4ECF A;  4MJO A;  4GIZ A;  5H8F A;  3ZKK A;  3JZJ A;  5JTY A;  1NFT A;  2D21 A;  2F3B A;  4IR8 A;  4YKK A;  3KBZ A;  4XKR A;  1R9L A;  5K2Y A;  4C1U A;  4PP0 A;  4E0X A;  5L8D A;  2PX1 A;  2Q2C A;  1EZP A;  4TLL B;  2ZZW A;  2OWS A;  2ESN A;  1N76 A;  3OXN A;  2Y7I A;  2HQ0 A;  3CFZ A;  1NH8 A;  3T9V A;  3E79 A;  2QFL A;  1NNP A;  2QMW A;  3S2V A;  2CZI A;  1Q9D A;  4O94 A;  2DWA A;  3KEI A;  3GBA A;  3SET A;  3RPL A;  4ZED A;  4F2Q A;  1G0I A;  2I0B A;  3WAF A;  3K01 A;  2UVH A;  1FJ6 A;  3QIM A;  1YTV A;  4GX6 A;  3E13 X;  1D9V A;  4F1U A;  2DYX A;  1WVJ A;  2IA4 A;  1LEV A;  1URS A;  1OVB A;  3UP9 A;  4NF4 A;  3UGW A;  4GWO A;  1LBY A;  5FTH A;  1F9B A;  2P2A A;  1B40 A;  4F3P A;  1B58 A;  3VVE A;  1FCK A;  2OWT A;  1JVY A;  1FSA A;  4FE8 A;  4PBH A;  3BIG A;  1I69 A;  5FTI A;  4JSD A;  3N94 A;  4TQU Q;  1ZTY A;  2REG A;  2Y7P A;  1B0H A;  2Y5L A;  1RDX A;  4G8N A;  4LA9 A;  4GOT A;  1MY0 A;  2Y7W A;  4GL0 A;  1NNK A;  4DDD A;  3KOT A;  5CM6 A;  4H8J A;  1P1O A;  4FEC A;  1B51 A;  5JTY B;  4KI0 E;  4P3L A;  4R2F A;  3TFL A;  1A7L A;  4N4U A;  4R9F A;  2RC7 A;  1ATG A;  4DZ1 A;  4OFL A;  1XS5 A;  5AA4 A;  3FV1 A;  4JSO A;  2NVU B;  1XOC A;  4PFT A;  1XI6 A;  1B2H A;  1MXU A;  4DLD A;  2O84 X;  4NE4 A;  5I2N B;  2H5Y A;  3RTF B;  2G93 A;  4PE3 A;  2HEU A;  4UA8 A;  1FPD A;  1B7Z A;  1P1Q A;  4PFB A;  3MQ9 A;  1KA1 A;  3D4C A;  3B7D A;  4YB7 A;  5H8Q A;  3LC8 A;  4R9G A;  1URD A;  5AE4 A;  1EZ9 A;  2R9J A;  2ZNS A;  4OHN A;  5KDT A;  1B1H A;  2OZZ A;  3QMF A;  4N8G A;  3SEU A;  3VLW A;  5LTC A;  3VVD A;  3O97 A;  3MP6 A;  4KYE A;  5ELV A;  1FPE A;  4QFN A;  3PUW E;  1JW1 A;  4HE2 A;  2DE3 A;  4U21 A;  3O2A A;  4ZEK A;  2O69 A;  2H4I A;  3KOS A;  1Y9U A;  4RA1 A;  2O7U A;  2PMS A;  2OBG A;  4MNC A;  1ZBM A;  1YPN A;  5DVF A;  3RTW B;  2F34 A;  4GBW A;  3QUJ A;  2F7C A;  1A55 A;  4RPN A;  4N91 A;  2XX9 A;  3U94 A;  1NUZ A;  1XVY A;  3RPL B;  2PCR A;  4R6Y A;  3RY3 A;  1Y3N A;  4P11 A;  2DSF A;  5ITP A;  2H99 A;  3RLF E;  4I40 A;  4OVR A;  1BK4 A;  4N6P A;  2V4C A;  3S4U A;  4P1E A;  1VR5 A;  2RKM A;  4H5F A;  1LLS A;  3LR1 A;  4H0W A;  1FBD A;  3O28 A;  4BDN A;  3MP1 A;  5DTB A;  1O64 A;  2I58 A;  3O29 A;  3E3K A;  3BKI B;  1CNQ A;  3EPE A;  1N7X A;  4F31 B;  3IB2 A;  2OLB A;  3UK4 A;  1TT1 A;  4BDL A;  1OMP A;  1MDP 1;  4QFK A;  2WYP A;  4MHF A;  1D4N A;  4MFI A;  1B3L A;  4HCY A;  4IGT A;  4F3S A;  1Y3Q A;  5I3S A;  3K1P A;  3QYT A;  3RNN A;  1MXV A;  1R1N A;  3HFU A;  4HE0 A;  1XC1 A;  2UVI A;  4N81 A;  5AA2 A;  4GWX A;  1AIV A;  2V84 A;  4XKP A;  3PU5 A;  4XEQ A;  4R74 A;  2KR0 A;  4H6D A;  3PMX A;  3M8U A;  4JVC A;  5I5P A;  1FTL A;  4HW8 A;  2QS1 A;  4ELQ A;  1BKA A;  1QW0 A;  3IB0 A;  3PPP A;  2DS9 A;  2ONS A;  2DVZ A;  2F8D A;  3TQW A;  4XTC Q;  3KC0 A;  4F22 A;  3K6V A;  3SEX A;  3DP4 A;  1FQC A;  1N04 A;  4H45 A;  1MXY A;  2F7B A;  2F36 A;  3A3C A;  3K1N A;  2Z8F A;  3FAT A;  2R71 A;  3FGS A;  3S9E A;  2RC9 A;  4L17 A;  1Y20 A;  2PYY A;  3OEK A;  1QUL A;  2WX9 A;  2Q89 A;  2O7I A;  1K9Z A;  1OLC A;  1O63 A;  1IIW A;  3OO7 A;  3JV9 A;  3K4U A;  3G3K A;  4OYV A;  3FXU A;  2OK2 A;  1PB9 A;  4QSE A;  2H98 A;  3EF7 A;  4GQO A;  2QVV A;  3T0J A;  4IO7 A;  3C32 A;  4QRZ A;  3QSL A;  1TWY A;  3C34 A;  2Y5K A;  3FJG A;  4DXC A;  3U92 A;  2I0C A;  4R75 A;  4JWX A;  5IZZ A;  5I59 B;  1ZKB A;  3W15 C;  4X9T A;  4X1B A;  3OO8 A;  1YAE A;  1DTZ A;  1Y4T A;  2NUV A;  3HHF A;  2R8T A;  5L9S A;  4YZZ A;  1FPJ A;  2UXA A;  1MS7 A;  2Z8D A;  1FQE A;  3PD8 A;  2HAV A;  3O6I A;  3HV1 A;  1PC3 A;  3D4G A;  4OAN A;  3PTY A;  2XXU A;  4QBA A;  1SD3 A;  4NX1 A;  1FPI A;  1QKA A;  5I2N A;  2AIX A;  4NAP A;  3N5L A;  4LN5 A;  1LBZ A;  4F2O A;  5DYH A;  2WKY A;  4H1X A;  4QSD A;  1LCF A;  3KBR A;  4YMB A;  1UTH B;  3V83 A;  4LQ2 A;  1DBZ A;  1A40 A;  4F39 A;  1IQ7 A;  3MVY A;  1B7H A;  2O51 A;  4OVP A;  1JEV A;  3R26 A;  5CBS A;  3OEN A;  3K6X A;  4KYS A;  1Z7N E;  5H8N B;  5EYF A;  1GV8 A;  4NWC A;  4NF6 A;  1Y1Z A;  1Z7M E;  1PBQ A;  2DDK A;  3KFM A;  4LP2 B;  3ROJ A;  2DXY A;  4EXL A;  1B3G A;  5JK4 A;  3KZG A;  4GWW A;  5IZ3 A;  3MZB A;  3H7M A;  2QS2 A;  2XXH A;  4OVT A;  2Y84 A;  1MQG A;  1GGG A;  3HHG A;  1B9J A;  3U1O A;  4RNS A;  1NV2 A;  3BFU A;  4THI A;  1US4 A;  1NV4 A;  3B6Q A;  4ONY A;  3SER A;  4FJP A;  3IL1 B;  2XWK A;  4I1D A;  3EHT A;  3S9N C;  4Q5T A;  1IZ1 A;  5IKB A;  5DEX A;  2O1L A;  2HCA A;  5FHM A;  1SI1 A;  3RT8 A;  3VV5 A;  4IO3 A;  3O6H A;  5EQ8 A;  4U1O A;  2UYF A;  2UVG A;  5A5X A;  3DLN A;  5ICT A;  3R6U A;  1USY H;  3PUZ E;  4OEV A;  4IY6 A;  2I4B A;  4O3B A;  3O66 A;  4PC9 A;  2GHA A;  4QF9 A;  4C1T A;  4PFR A;  1NV0 A;  1R9Q A;  1CB6 A;  1D3K A;  1NNF A;  2Z22 A;  1NV7 A;  4XFE A;  1LCT A;  2ZXT A;  1IMD A;  1LBB A;  1MM6 A;  3FVG A;  4RK9 A;  5FHO A;  2HPG A;  1JP4 A;  4MF3 A;  1LGB C;  4KQP A;  3VXB A;  3PV0 E;  3E9X A;  3TZA A;  1D9Y A;  1QKB A;  3S9L C;  1FBE A;  5BUU A;  1B4H A;  2QJE A;  2VGQ A;  4F3B A;  3PPR A;  2AL4 A;  4NF5 A;  3FD3 A;  3TYH A;  2B4L A;  2XWI A;  1M5F A;  2CZH A;  4NG7 A;  3SZP A;  2NXO A;  2PT1 A;  4NF8 A;  3EHS A;  4BLA A;  1BIY A;  2B3B A;  3GXA A;  4PDD A;  4FAT A;  4JVD A;  1FQF A;  4XKN A;  1NH7 A;  3KJT A;  3FVN A;  3IFA A;  3ECR A;  4GLI A;  5CI5 A;  2F6G A;  4M1V A;  4QFP A;  1JEU A;  2O6A A;  4ZEC A;  2ZYM A;  4HS7 A;  3FJ7 A;  3N6T A;  5EQ7 A;  4KFQ A;  4NN3 A;  1S50 A;  4EQB A;  4PBQ A;  1SDX A;  4QXD A;  3C35 A;  4WED A;  1B1X A;  4DI4 B;  1ZMG A;  1NV3 A;  1B3H A;  3FBP A;  4OFJ A;  3O6G A;  3H6W A;  3IOV A;  1PB7 A;  2XXQ A;  1FTA A;  3IAZ A;  4XKQ A;  2VT5 A;  4OET A;  1A99 A;  2Q9T A;  3LUZ A;  5A5X B;  3K6U A;  5EYG A;  1IMA A;  3Q27 A;  3PPQ A;  2ALU A;  5I84 A;  4G8M A;  2HHM A;  2F97 A;  4GRK A;  1D9Q A;  2XXI A; 
#chains in the Genus database with same CATH homology
 2I6E A;  2RCB A;  3RLF E;  3SEY A;  4QHQ A;  5J1D A;  3FAS A;  1N7W A;  1PB8 A;  5AA1 A;  4AQ4 A;  2DE4 A;  2E0S A;  5HM4 B;  2F35 A;  5CMC A;  2FYI A;  3K02 A;  3K1M A;  1B4Z A;  2QSX A;  4N6P A;  3FVK A;  4X48 A;  2V93 A;  3Q28 A;  4WKM A;  3S4U A;  1VR5 A;  2RKM A;  4ZZA A;  4H5F A;  3Q26 A;  1LLS A;  5TP9 A;  5ICQ A;  2ZYK A;  1BP5 A;  5B70 A;  1FQD A;  3LR1 A;  3TEP A;  3H03 A;  4H0W A;  3FXR A;  5CMM A;  5IAI A;  1NL5 A;  3EHU A;  4IO6 A;  3O28 A;  4FIM A;  4BDN A;  3MP1 A;  5DTB A;  3VFJ A;  1O64 A;  2I58 A;  3USD A;  4H65 A;  3O29 A;  3E3K A;  3BKI B;  3EPE A;  1N7X A;  2LAO A;  3IB2 A;  1JW4 A;  1WOD A;  2CMO A;  2OLB A;  4F31 B;  1I6A A;  3LUY A;  3UK4 A;  1TT1 A;  4BDL A;  5I58 A;  1B5H A;  3DP6 A;  1OMP A;  3U72 A;  3M3K A;  1MDP 1;  1XT8 A;  1MDQ A;  3W9V A;  4QFK A;  1JW5 A;  5H8S A;  3TPA A;  1QUJ A;  1H76 A;  4P0I A;  1D4N A;  2DE2 A;  4LZ5 A;  4TOZ A;  3OO9 A;  4MFI A;  4Z0I A;  1B3L A;  1RYX A;  4HCY A;  3MUQ A;  4IGT A;  3VVF A;  1ELJ A;  3IOW A;  3H3G A;  4F3S A;  1Y3Q A;  1DPE A;  1UIU A;  3P7I A;  1LFG A;  4H8I A;  3KJ7 A;  3K2D A;  3K1P A;  3QYT A;  3TDJ A;  4TLM B;  1J1N A;  3RNN A;  3DEL B;  4MLQ A;  1P99 A;  1MXV A;  1R1N A;  2XHD A;  3OMB A;  3OSQ A;  3LSF B;  1VFE A;  4PFY A;  4YAH X;  3A3U A;  5TPA A;  4DE8 A;  4ESW A;  4KYD A;  2I3W A;  4P0G A;  5K2X A;  5KDT B;  1XC1 A;  4U2R A;  1A54 A;  2UVI A;  1IIT A;  5AA2 A;  1AIV A;  1H43 A;  1R6Z A;  2ANJ A;  1SW5 A;  2V84 A;  4QFL A;  2I4C A;  4KR5 A;  3O9P A;  4NF6 B;  4YKP A;  4XKP A;  1Y4C A;  3I3V A;  4H67 A;  4ISU A;  5DVI A;  4YMA A;  3IO4 A;  1ZU0 A;  3MPL A;  4O3A A;  3PU5 A;  1M5B A;  4DIG A;  1UIV A;  1VSO A;  3FJM A;  3MWB A;  4NMY A;  4R74 A;  3RQT A;  4H6D A;  3PMX A;  3M8U A;  4MH5 A;  2PT2 A;  3W9W A;  4LQ5 A;  1FTL A;  2HFB A;  2QS1 A;  3QK6 A;  1POT A;  4HW8 A;  4F1Y A;  1H3D A;  4ZEI A;  4C0R A;  4ELQ A;  3WAE A;  4NF8 B;  1BKA A;  3MBP A;  1QW0 A;  4U23 A;  4ELP A;  1BTJ A;  1POY 1;  1URG A;  3OD7 A;  1N3W A;  3IB0 A;  4GXS B;  2A5T B;  3PPP A;  4GXA A;  2HZK A;  4JWO A;  4AB5 A;  2DS9 A;  3G7W A;  2ONS A;  4LZ8 A;  5BWJ A;  3RGY A;  2DVZ A;  1QVS A;  3K00 A;  2F8D A;  3A09 A;  3IK6 B;  1AOV A;  3KN7 A;  3TQW A;  4XTC Q;  4POW A;  3CG3 A;  3VDF A;  2REJ A;  4EDP A;  1B05 A;  4F22 A;  1SW2 A;  1A8F A;  1EH3 A;  2DQV A;  1M5E A;  2XD3 A;  3K6V A;  3SEX A;  2ZNU A;  3DP4 A;  3PUY E;  1FQC A;  1IEJ A;  1N04 A;  4G4P A;  1TXF A;  2VD2 A;  1MXY A;  3C4M A;  2XXY A;  4R6K A;  5DEX B;  2F7B A;  1LBC A;  2F36 A;  3T22 A;  3A3C A;  1RKM A;  3K1N A;  3C36 A;  3MJN A;  4JDF A;  4R6H A;  3S9E A;  2ZMB A;  1EZO A;  1MXW A;  4XIG Q;  3CFX A;  2Z8F A;  3FAT A;  4RPO A;  1JET A;  3V89 B;  2R71 A;  4QSC A;  5AA2 D;  1A8E A;  1B7U A;  2F6P A;  2P1S A;  2PBW A;  2RC9 A;  2GRV A;  3FGS A;  3H6V A;  3HN0 A;  1Y20 A;  4JBZ A;  4NTL A;  4PFW A;  2PYY A;  4R2B A;  2QPQ A;  1FTO A;  3CVG A;  3FZV A;  3OEK A;  1QUL A;  3QUF A;  2Y7K A;  3K6W A;  4X1D A;  4EF1 A;  4OEN A;  4JB7 A;  1MH4 A;  5M2V A;  2Q89 A;  3G3J A;  3IJX B;  3LSL A;  1P1W A;  4DCY A;  2XX8 A;  2O7I A;  3C33 A;  3KGC A;  1ANF A;  1LB8 A;  1SBP A;  1OLC A;  3H06 B;  1O63 A;  1IIW A;  1DPP A;  4OXV A;  3V5A A;  3VE1 B;  3OO7 A;  3JV9 A;  3OO6 A;  4OTE A;  5H8F B;  1IUD A;  1NKX A;  4F29 A;  5CBR A;  3R7X A;  3K4U A;  1JQF A;  3G3K A;  1UTH A;  3RT6 B;  4OYV A;  3FXU A;  3T9X B;  3G3I A;  2OK2 A;  1PB9 A;  2THI A;  4IB2 A;  5F7V A;  1LAF E;  2XD2 A;  3PPO A;  1GTK A;  4QSE A;  1I6Q A;  2H98 A;  4OEU A;  2KLF A;  4F3G A;  3AXF A;  3EF7 A;  3MW0 A;  1NMU A;  3C31 A;  4LZ7 A;  3SKP A;  3V8X B;  4EXK A;  4GQO A;  1B0L A;  2B3F A;  4G2Z A;  2ABH A;  4F18 A;  1USY E;  1LB9 A;  4IO7 A;  3C32 A;  1TFA A;  3L6H A;  3Q25 A;  2HZL A;  4QRZ A;  3H6U A;  3ZSF A;  2OJT A;  1N3X A;  3IJO B;  3QSL A;  1TWY A;  5ITO A;  4BDQ A;  1CE2 A;  3HPI A;  3UN6 A;  3C34 A;  4NWD A;  1FQA A;  3FJG A;  4LAT A;  5H8H B;  5L9O A;  4ZS9 A;  3TAJ A;  4DXC A;  1MY2 A;  4YKJ A;  1ZIU A;  3U92 A;  1NNT A;  2I0C A;  4R75 A;  4JWX A;  5CC2 A;  3H6T A;  1QUK A;  5I59 B;  1ZKB A;  2R6G E;  4ZEB A;  1XVX A;  3ILT B;  4X9T A;  4YKI A;  3W15 C;  1MM7 A;  1SYI A;  1L5T A;  5TU0 A;  4X1B A;  1MPB A;  5DVJ A;  2NWJ A;  1DSN A;  4YIC A;  3N6U A;  3OO8 A;  4PE5 B;  1YAE A;  2F5X A;  1YCJ A;  3FIR A;  1DTZ A;  1Y4T A;  2NUV A;  2V25 A;  3HHF A;  3IOT A;  4WEP A;  3PUV E;  1OIB A;  3VVE A;  4DCX A;  4NF4 B;  4YZZ A;  5L9S A;  3B6W A;  5AA4 B;  4U4S A;  5AA3 A;  3E4R A;  3M3F A;  4R72 A;  1SYH A;  1PEB A;  5CMB A;  4F19 A;  2XX7 A;  2I3V A;  2UXA A;  1MS7 A;  1T0K A;  3LSX A;  4OES A;  5DT6 A;  1SVX B;  2Z8D A;  1FQE A;  3PD8 A;  2O1M A;  2HAV A;  3O6I A;  1P1U A;  3TEL A;  3HV1 A;  1MQH A;  3KN8 A;  1PC3 A;  2RIN A;  4QFO A;  1B3F A;  1LAH E;  3D4G A;  3TCF A;  1P1N A;  3QXM A;  4R73 A;  3U93 A;  4ZE9 A;  3ONM A;  3GZG A;  5F1Q A;  2O68 A;  5I56 B;  2XXU A;  3CI8 A;  4XXU A;  4RJZ A;  1SD3 A;  4G68 B;  3UIF A;  1B32 A;  2YLN A;  3TTR A;  3G3G A;  4HTG A;  4EUO A;  1MQD A;  1QKA A;  5I2N A;  4ESX A;  2AIX A;  1I6B A;  3T96 B;  3N5L A;  1N84 A;  1WDN A;  3SES A;  4N13 A;  1Q35 A;  4JXI A;  4XKQ A;  3KSX A;  4GL8 A;  3VLU A;  3OEM A;  5DYH A;  4UAC A;  4F2O A;  2WKY A;  3DP8 A;  2X26 A;  2D3I A;  5L9M A;  4H1X A;  4OMB A;  3DM0 A;  4QSD A;  1S7Y A;  1LCF A;  1UTB A;  1VFD A;  1B5J A;  1JNF A;  2HXW A;  3KBR A;  4ECF A;  4YMB A;  4Z7E A;  4GIZ A;  2QS3 A;  3CFL A;  3PMW A;  5FHN A;  5H8F A;  2W7Y A;  3Q29 A;  3FUZ A;  2F78 A;  1UTH B;  2IEE A;  4BDR A;  3V83 A;  3ZKK A;  3JZJ A;  4LQ2 A;  5JTY A;  1NFT A;  1MXX A;  2D21 A;  2QL3 A;  3MVZ A;  3N26 A;  1MY3 A;  2V3Q A;  3IB1 A;  3S9M C;  1A40 A;  1S9T A;  4YKK A;  1B3E A;  3GLB A;  4ELO A;  3LSW A;  4XKR A;  4F39 A;  1IQ7 A;  3MVY A;  1B7H A;  1R9L A;  1LFI A;  2O51 A;  1DMB A;  4ZEF A;  5K2Y A;  4C1U A;  4EQ9 A;  2VP1 A;  2DOJ A;  4O3C A;  1JEV A;  2ONK E;  4PP0 A;  2DWH A;  3R26 A;  4E0X A;  5CBS A;  3OEN A;  3RPW A;  4RA1 A;  3K6X A;  5L8D A;  2PX1 A;  1HSE A;  2Q2C A;  1RYO A;  4KYS A;  4DDD A;  1EZP A;  1Z7N E;  5H8N B;  5EYF A;  3ODB A;  1FW0 A;  3LBS A;  2ZNT A;  3IR1 A;  4NWC A;  4TLL B;  1GV8 A;  3TTL A;  3TTM A;  1OQH A;  2OWS A;  4G8H A;  4NF6 A;  3TTK A;  1Y1Z A;  1Z7M E;  3IX1 A;  2ESN A;  1PBQ A;  3PUX E;  1N76 A;  3OXN A;  1UTB B;  3KFM A;  4LP2 B;  2VOZ A;  2A5S A;  4EQ7 A;  2Y7I A;  3ILU B;  5EHM A;  4Q8R A;  2ZYN A;  2HQ0 A;  1N0T A;  3CFZ A;  4MLV A;  3TOD A;  1NH8 A;  3TTN A;  4RY1 A;  3T9V A;  2DXY A;  5TP9 B;  4EXL A;  1NNP A;  3OOA A;  2QMW A;  3S2V A;  1PBP A;  3ZKL A;  1B3G A;  2DWA A;  1OLA A;  3KEI A;  3CSB A;  4I62 A;  4RXL A;  3VXC A;  3GBA A;  5JK4 A;  4YB5 A;  3SET A;  4ZE8 A;  3KZG A;  2A5T A;  1DOT A;  1TFD A;  4OFO A;  2RC8 A;  3H7M A;  2QS2 A;  3MZB A;  1H45 A;  2XXH A;  4ZED A;  4KCD A;  4F2Q A;  2Y84 A;  2I0B A;  3WAF A;  1MQG A;  5I58 B;  3K01 A;  2YJP A;  2UVH A;  1AH5 A;  1GGG A;  3QIM A;  3MAM A;  2XXV A;  4FEB A;  1YTV A;  2UVJ A;  3CG1 A;  3HHG A;  5CRY A;  3RUM A;  3T66 A;  1B9J A;  3FV2 A;  4GFR A;  5KCJ A;  1DTG A;  5I57 A;  3T93 B;  3E13 X;  3U1O A;  4KHZ E;  4RNS A;  1D9V A;  3BFU A;  2XXR A;  1GVC A;  4F1U A;  4L17 A;  4THI A;  1US4 A;  2DVC A;  4ZZE A;  3TKD A;  3B6Q A;  2DYX A;  4ONY A;  1Y1M A;  4FJP A;  1H44 A;  4JWY A;  4LVQ A;  3SER A;  4DXB A;  3HCQ A;  3IL1 B;  1O7T A;  3C9H A;  1EU8 A;  2CZL A;  4NF5 B;  4I1D A;  5CMK A;  1B5I A;  3EHT A;  3S9N C;  1Q1K A;  1WVJ A;  2IA4 A;  4Q5T A;  3TMG A;  2XXP A;  1AMF A;  1IZ1 A;  1MY4 A;  1URS A;  1OVB A;  3UP9 A;  4NF4 A;  5IKB A;  5DEX A;  3EN3 A;  3TQL A;  1SW1 A;  3UGW A;  2O1L A;  2Y7R A;  1IXC A;  2HCA A;  4GWO A;  5FTH A;  5FHM A;  1SI1 A;  3RT8 A;  3VV5 A;  1MQJ A;  4IO3 A;  4YU0 A;  1HSL A;  2F7A A;  3MC2 A;  3O6H A;  3CSG A;  1F9B A;  2GHB A;  2P2A A;  3M3L A;  4OVJ A;  5KZT A;  1FTJ A;  4U1O A;  3OEL A;  1B40 A;  2V3T A;  2UYF A;  4G68 C;  4F3P A;  1B58 A;  2RCA A;  2VHA A;  1FCK A;  2OWT A;  2PVU A;  1JVY A;  2P0S A;  4PET A;  4H5G A;  2UVG A;  4M4G A;  5A5X A;  4FE8 A;  3FXQ A;  3UA8 A;  1OVT A;  3B6T A;  1I69 A;  3DLN A;  3PD9 A;  4OZ9 A;  5FTI A;  5ICT A;  4JSD A;  4NED A;  3R6U A;  3N94 A;  1USY H;  4TQU Q;  1ZTY A;  3PUZ E;  2REG A;  2Y7P A;  1FQB A;  4OEV A;  5I56 A;  1LAX A;  4IY6 A;  4FAJ A;  1B0H A;  2I4B A;  4ND9 A;  1SI0 A;  4G8N A;  2AL5 A;  4KCC A;  4LA9 A;  3O66 A;  4O3B A;  4ELR A;  4GOT A;  2GHA A;  3FVO A;  4QF9 A;  2V3U A;  4C1T A;  4F1V A;  1MY0 A;  2X7P A;  2DWI A;  2I49 A;  1B46 A;  1R9Q A;  3MPK A;  4EF2 A;  2QS4 A;  2Y7W A;  1NNK A;  4GL0 A;  1ZLQ A;  1II5 A;  1CB6 A;  2FNC A;  2UYE A;  3KOT A;  1D3K A;  4PFU A;  5HBC A;  3THI A;  1NNF A;  1PDA A;  2H9B A;  2Z22 A;  2M8C A;  1P1O A;  4FEC A;  1B51 A;  4H8J A;  4U1Z A;  1LCT A;  5JTY B;  2ZXT A;  1LFH A;  1LBB A;  2Q88 A;  1MM6 A;  3FVG A;  4RK9 A;  4KI0 E;  4OQO A;  1MRP A;  2G29 A;  1MG1 A;  1Y3P A;  5FHO A;  4R2F A;  4U22 A;  3TFL A;  1A7L A;  3QAX A;  5ISU A;  4R9F A;  3I5O A;  2RC7 A;  1M5C A;  1ATG A;  2ONR A;  4OWD A;  4OFL A;  1XS5 A;  2GH9 A;  5H8H A;  4DZ1 A;  5AA4 A;  3FV1 A;  4JSO A;  4G77 A;  4MF3 A;  2NVU B;  1LGB C;  1OQG A;  4KQP A;  4LUB A;  1XOC A;  3VXB A;  3PV0 E;  4PFT A;  1B2H A;  3U8Q A;  1MXU A;  4DLD A;  5I59 A;  2O84 X;  2X7Q A;  3PMV A;  4NE4 A;  1IXH A;  3BFT A;  1LST A;  1IXG A;  2I48 A;  1QJM A;  3E9X A;  3OSR A;  2GFE A;  3KN3 A;  3TZA A;  4BDO A;  1D9Y A;  4IO4 A;  2H5Y A;  5I2N B;  3MP8 A;  1MPC A;  4IGR A;  3RTF B;  3TUS A;  4Q0C A;  1QKB A;  2G93 A;  3T9U A;  3S9L C;  2HEU A;  2BJJ X;  4LON B;  5BUU A;  1B4H A;  2NOO A;  4UA8 A;  5AA2 B;  1B7Z A;  2QJE A;  2VGQ A;  3PPR A;  4POX A;  2AL4 A;  4ZDM A;  4F3B A;  4NF5 A;  3FD3 A;  3TYH A;  3JYR A;  1P1Q A;  1M5F A;  2NXO A;  2RF1 A;  2PT1 A;  4NF8 A;  1SW4 A;  3EHS A;  3MQ9 A;  4Q30 B;  3SEW A;  1SQY A;  3IOU A;  4BLA A;  1BIY A;  3D4C A;  2FA7 A;  2B3B A;  5JEI A;  3CRB A;  4WXJ A;  2Q8J A;  2Q2A A;  3B7D A;  3GXA A;  4I9D A;  5EHS A;  4YB7 A;  4FAT A;  5H8Q A;  3SEV A;  3LC8 A;  5I2K B;  1MPD A;  3G3F A;  1HSJ A;  1KWH A;  1UQW A;  4U4X A;  3F11 A;  1VE4 A;  1FQF A;  1URD A;  1XHY A;  4R9G A;  4XKN A;  1NH7 A;  3L6G A;  5AE4 A;  1EZ9 A;  1FTK A;  2R9J A;  5HPQ A;  2YPN A;  3FVN A;  2DXR A;  3KJT A;  3HO7 A;  1GR2 A;  3IO6 A;  3MVX A;  1AL3 A;  2ZNS A;  3PPN A;  3ECR A;  4OHN A;  5H8N A;  4GLI A;  5TPA B;  5CI5 A;  1FTM A;  5KDT A;  1B1H A;  2F6G A;  2OZZ A;  5I2K A;  3TCG A;  2AYS A;  4M1V A;  4QFP A;  4DXU A;  1JEU A;  2O6A A;  3RN8 A;  4ZEC A;  2ZYM A;  4HS7 A;  2E1S A;  3FJ7 A;  3SEU A;  3VLW A;  3N6T A;  4BDM A;  4GD5 A;  5I57 B;  3VVD A;  2XXT A;  3O97 A;  3MP6 A;  1LAG E;  3CR9 A;  3H4Z A;  3KSJ A;  4KFQ A;  2OCU A;  5LOM A;  2H25 A;  1S50 A;  4EQB A;  4GF8 A;  4KYE A;  1SDX A;  4IY5 A;  3C35 A;  5ELV A;  2B65 A;  3PGF A;  4MBP A;  2XXW A;  1B1X A;  4QFN A;  4KD5 A;  4WED A;  4FOR A;  3CIJ A;  3MVW A;  4G68 A;  3PUW E;  4HCW A;  1ZMG A;  1B3H A;  3G3H A;  1JW1 A;  3UOR A;  4OFJ A;  3T9H B;  3O6G A;  3H6W A;  2DP8 A;  3IOV A;  3ZS6 A;  5H8Q B;  1B52 A;  1PB7 A;  5B7D A;  2DE3 A;  2XXQ A;  3EQ1 A;  3O2A A;  4U21 A;  4ZEK A;  5CM6 A;  2O69 A;  2H4I A;  3KOS A;  2VD3 A;  2QRY A;  1MY1 A;  1Y9U A;  2DWJ A;  2O7U A;  3KG2 A;  4FED A;  3IAZ A;  4OER A;  2PMS A;  1B6H A;  2QMX A;  2OBG A;  4K3F A;  1M5D A;  4OET A;  4I8C A;  1ZBM A;  1A99 A;  1YPN A;  4RK2 A;  4KPT A;  1QUI A;  1MH3 A;  2F34 A;  3HST A;  3GBB A;  3IOR A;  4YB6 A;  5DVF A;  3RTW B;  3SDF A;  2Q9T A;  3VLV A;  3QUJ A;  4RYA A;  2F7C A;  1A55 A;  1BLF A;  1MXZ A;  2HAU A;  3MZ9 A;  4RPN A;  5A5X B;  2XX9 A;  3K6U A;  3U94 A;  4IO5 A;  3Q27 A;  3PPQ A;  5KCJ B;  1ZJL A;  3K0V A;  1US5 A;  2ZYO A;  1XVY A;  1IXI A;  2ALU A;  2D5W A;  5I84 A;  4R6Y A;  4GVO A;  4E0W A;  1MQI A;  2Z23 A;  3TCH A;  4PQJ A;  3RY3 A;  1Y3N A;  4IO2 A;  4G8M A;  3MZ1 A;  1JVX A;  4P11 A;  2F97 A;  2DSF A;  2XXX A;  2Z8E A;  3BBR A;  4GRK A;  5ITP A;  2H99 A;  2XXI A;  4N07 A;  4AB6 A;  3I6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...