3SESA

Cu-mediated dimer of maltose-binding protein a216h/k220h by synthetic symmetrization
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
370
structure length
370
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEHAFNHGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Maltose-binding periplasmic protein
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
total genus 124
structure length 370
sequence length 370
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3sesA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3sesA01
5ELVA 5IAIA 4LQ2A 3PUVE 1NH7A 1TWYA 4GXSB 5DTBA 3C34A 4H65A 2HFBA 3O6GA 1B3FA 3VVFA 1M5DA 4IO5A 4ESWA 1NH8A 4LVQA 5CMCA 3K2DA 1EZPA 3KOSA 3B6QA 2XX8A 4FEDA 1A99A 4DLDA 1SW4A 4U22A 1FQFA 4MBPA 5DEXB 3CI8A 3QXMA 1IUDA 4ZEBA 3OMBA 1XC1A 2RCBA 3MVZA 4ZZAA 2HZKA 4NF6B 3IB2A 3LSXA 5I2NB 3TTLA 1Q35A 3UIFA 2UYEA 1I69A 4YU0A 1N7WA 1UTHA 1RKMA 2F7CA 5H8QA 4NF4B 3MC2A 1B5JA 2YJPA 3VDFA 1LB8A 4WEDA 1B0LA 3HHGA 1B3EA 1ZTYA 1J1NA 3K1NA 3CVGA 4GIZA 3K4UA 2PBWA 1VR5A 1MXXA 2OLBA 1LAGE 3Q25A 4YMBA 1MH4A 3FXUA 2Z8DA 3MWBA 3USDA 2H9BA 3RNNA 4QFOA 1MXUA 1DPEA 3QYTA 2O7IA 1Z7ME 1JVXA 1SI0A 4QFKA 3TEPA 3RN8A 2AYSA 3M3KA 3S4UA 4E0WA 1SD3A 2XXIA 3QSLA 4KR5A 2REGA 3UP9A 3K02A 3OO8A 3U8QA 4GQOA 3A09A 2Z8FA 1SI1A 1NKXA 4RK9A 3TTNA 1H44A 3FV1A 4ZEKA 2DWIA 4POWA 3IAZA 4IO2A 2RKMA 1MDQA 2F7AA 3PD9A 4C1UA 4R9FA 5DEXA 4PFUA 3N26A 3VLWA 4R6HA 4NF6A 5H8NB 3S9LC 5I2NA 3H6TA 3LR1A 1FQCA 4YAHX 2V3TA 1D9YA 2QMXA 1USYH 2GH9A 3C32A 4F2QA 2I0CA 1FTOA 3IOVA 4NF4A 5B7DA 3PMXA 2AIXA 1JVYA 4R6KA 4H5FA 3PMVA 4N13A 3H6WA 4IGRA 1B3LA 3UA8A 3RUMA 2DE4A 2OZZA 3VVDA 4H5GA 2DVZA 4HCWA 1OLAA 3Q26A 5CMKA 1LFGA 4F18A 3OELA 4OMBA 1O64A 4LQ5A 2O1MA 3IB1A 3H03A 4QFLA 3RY3A 1FTMA 3O9PA 1DOTA 2XXQA 5L9MA 1EH3A 1H76A 3V5AA 1S50A 1PB7A 3C4MA 4R2BA 2F35A 3A3UA 1Y1ZA 3G3IA 4KD5A 3WAFA 5M2VA 4DZ1A 4TLLB 1MRPA 2I58A 2AL5A 1UQWA 3IR1A 3G3GA 1FQEA 1SW1A 4FECA 2Y7KA 2VOZA 1GR2A 1DMBA 1SBPA 1AH5A 1VFDA 1B2HA 4BDQA 1AMFA 4ISUA 3OENA 2QSXA 3RTFB 2ZYMA 5CI5A 1EZ9A 5H8NA 1CB6A 1SW2A 4KYDA 4JXIA 4IO4A 2FA7A 3OO9A 1MPBA 2YPNA 2ZMBA 3O6HA 3ZSFA 3LSLA 3VVEA 5CM6A 3H6UA 3FVKA 5HPQA 1BLFA 2XXWA 3R26A 2I48A 2HCAA 3CG3A 1SDXA 2VD2A 2DVCA 2ZNTA 4G77A 3ILTB 2ZYNA 4ESXA 1POY1 5DVIA 1B05A 3KEIA 3TKDA 1FQBA 3S9MC 2FNCA 3B7DA 4X1DA 4GXAA 1B4ZA 4R73A 4U1ZA 3PPQA 1QUKA 1MXYA 4FATA 3W15C 4JSDA 4ZECA 5KDTB 2OJTA 4FIMA 2KLFA 2XXVA 3O29A 2V25A 3H4ZA 3VFJA 3UORA 1WODA 4OENA 2NUVA 4FJPA 3IJOB 1LSTA 1QUIA 4G68B 4I62A 2NVUB 1B51A 4GL0A 4Q5TA 2A5TB 5HM4B 1MG1A 3IJXB 3RT8A 4R2FA 3I6VA 1ZJLA 5CBRA 5EYFA 4M1VA 1B7UA 1Y9UA 1Y3PA 3TQLA 5CBSA 5F7VA 1MQHA 4KCDA 1M5FA 5L9SA 1NNFA 4HW8A 1N3XA 3K6VA 1TT1A 4GFRA 5CMMA 3TODA 1OVBA 4H8IA 3FJMA 1CE2A 4JDFA 2VP1A 1VE4A 1IXGA 3FVOA 3ILUB 2G29A 4EF2A 3PUYE 3RQTA 2VD3A 1DSNA 2Q9TA 3GLBA 4ZE9A 1QULA 3GZGA 3MVXA 2XX9A 3CFXA 4M4GA 5L8DA 1US5A 2ALUA 2NWJA 1YAEA 2UVIA 3HSTA 5H8HB 3ODBA 1IITA 3VXCA 2ONSA 2F78A 2RF1A 3O66A 4OERA 2F36A 3TCFA 1PB8A 3T66A 4ZS9A 3G3HA 2P0SA 4G4PA 4XTCQ 3EHSA 2HQ0A 2QS1A 2DE2A 1AL3A 3FZVA 4FE8A 4YMAA 1OMPA 4NF8B 1EU8A 5KDTA 3HPIA 3DELB 1B1XA 4R74A 1YCJA 5FHMA 3ZKKA 3OO6A 4H1XA 1JQFA 2Z22A 3ZS6A 2OBGA 4ONYA 3U93A 1XVYA 3PUXE 4POXA 4K3FA 2O51A 2I4BA 2E1SA 1M5BA 4YZZA 2A5TA 1FTKA 4U21A 5CMBA 1GVCA 1QVSA 2H25A 1NL5A 4F3GA 3E9XA 4F1UA 1HSEA 3T9UA 3LSWA 2O84X 1B46A 2F5XA 3WAEA 2ZYKA 2XXYA 1MQGA 2DP8A 3KGCA 4LA9A 4H6DA 1LGBC 2QL3A 2Y7IA 3VV5A 3TZAA 4YICA 1LBBA 1DTGA 4R72A 3IO4A 3VXBA 2DWHA 3PD8A 2QPQA 3EN3A 2Y7PA 2OWTA 2XXXA 4RXLA 3QIMA 3IORA 3KG2A 5H8HA 1JW1A 1D9VA 1P1NA 1P1OA 5TPAB 1FW0A 4KPTA 1PEBA 2ONKE 4XKRA 3FXQA 4PFWA 3TFLA 5DT6A 4MH5A 3TCHA 3I3VA 1R9QA 4NF8A 4RA1A 3MP6A 2YLNA 3KN7A 4OWDA 3OO7A 3GXAA 4HTGA 3TTKA 1MY1A 4P0GA 2RINA 1I6BA 2QS2A 3FXRA 1Y20A 4H67A 1A54A 3MQ9A 2UXAA 1UIUA 4OZ9A 3ZKLA 1IQ7A 3D4GA 2D3IA 3KSJA 3IK6B 3K01A 1AOVA 4RYAA 3C36A 2DS9A 3QAXA 4G2ZA 3TDJA 5DYHA 4QSDA 1MXVA 1H3DA 3EHTA 3SEYA 3CSGA 2H4IA 3KN3A 4QF9A 3D4CA 4XKPA 2ZNUA 1LLSA 3MP1A 5I57B 2R9JA 1FTJA 4OFLA 1ANFA 3HO7A 3KFMA 1UIVA 4LZ8A 2HAUA 4IO6A 1R9LA 3N6UA 4U1OA 5FHNA 3U72A 3O6IA 4OEVA 1IIWA 3FGSA 1MM7A 2BJJX 1TXFA 3TYHA 5I84A 1EZOA 1M5EA 4PETA 2DE3A 5ICQA 2ZXTA 3MZ1A 4F3SA 3UK4A 1MXZA 3V89B 4JWOA 4OYVA 5I59B 1P99A 3G7WA 4YKPA 1AIVA 3FUZA 1MS7A 4KI0E 1QKAA 4EXKA 3CSBA 5TPAA 5KCJB 3P7IA 4GVOA 5JTYB 3SEUA 3MZBA 3Q27A 2DWAA 4NMYA 4XKNA 3TTRA 2I49A 4JWYA 4GL8A 1IEJA 4LZ7A 4AB5A 3CG1A 4Z0IA 2B65A 3CIJA 4PQJA 3C35A 4TOZA 1XVXA 3DM0A 3SEXA 1B3HA 1A7LA 2X7PA 2G93A 4F39A 3KJ7A 4NWDA 5K2YA 2Y84A 5HBCA 4G8HA 3K1MA 3S9NC 4E0XA 2DQVA 1HSLA 2M8CA 2PT2A 1PBQA 1A40A 1A8EA 3S9EA 2ESNA 5F1QA 5AA3A 3GBAA 4EQ7A 3KOTA 3T9XB 4OETA 4MF3A 1POTA 1N76A 3SKPA 1P1QA 3KZGA 3OEKA 2F97A 4ZE8A 2Y7RA 1UTBB 2FYIA 3LC8A 4DXBA 4G8NA 1MY3A 4F2OA 1QKBA 3QUFA 1MY4A 4NEDA 3OOAA 4YB6A 2Q88A 3THIA 5A5XB 5LOMA 5K2XA 3FATA 2GHAA 3E4RA 5I59A 1N0TA 4TLMB 4AQ4A 5DVFA 3E3KA 1JEVA 2H99A 1B1HA 4OESA 2O7UA 5ITPA 3PUZE 2IA4A 2DXRA 5JTYA 4JBZA 1N7XA 2PX1A 2PMSA 1DTZA 4G68C 3JYRA 4PFTA 5B70A 2F6GA 4IY5A 5FTHA 3MPKA 2F6PA 3BBRA 1Z7NE 4JB7A 4LONB 1LB9A 4LP2B 3CFZA 3EHUA 1D4NA 3K00A 3LBSA 3DLNA 4OHNA 3M3LA 5BWJA 2E0SA 4X48A 1FTLA 3RT6B 4GWOA 1WVJA 4IY6A 5I58B 1O63A 4MLQA 2RCAA 2DSFA 1Y3NA 4I8CA 4ZEFA 4F3PA 5ITOA 3C9HA 3G3JA 1GTKA 1H43A 4JWXA 3SDFA 5AA4B 2B3BA 4EF1A 1JW5A 1KWHA 4NWCA 4F29A 4RPNA 3L6HA 3G3FA 4FORA 3OSQA 2ANJA 1PC3A 1TFDA 1B4HA 1S7YA 1II5A 3IO6A 3IX1A 1UTBA 2F8DA 2VHAA 2AL4A 4Q30B 5AA1A 2HXWA 1JEUA 3M3FA 3OD7A 5A5XA 2O69A 2PT1A 2QRYA 5FHOA 2B3FA 3PU5A 2PVUA 3HV1A 4N6PA 3B6WA 3BFUA 4XKQA 2XXUA 4BLAA 3QUJA 2I3VA 2H5YA 2XX7A 3TQWA 1JNFA 3O97A 1L5TA 3PMWA 1GGGA 3H6VA 4ZDMA 3BKIB 3FJGA 1A55A 3JV9A 1LCFA 4KQPA 4XXUA 2UVHA 1VFEA 5BUUA 4WKMA 4KHZE 2XD2A 5H8FB 3TCGA 4O3AA 3OXNA 4R6YA 1OQHA 1LFHA 1ELJA 3IOTA 4I1DA 3H7MA 1Y3QA 3PPPA 1Y4CA 1NNPA 1MQIA 1S9TA 1LBCA 4HS7A 5JEIA 1MH3A 2QMWA 2V3UA 4G68A 2V84A 4YKJA 2XD3A 4NE4A 5I58A 4RPOA 1Q1KA 5ICTA 1SVXB 1LCTA 2XHDA 2OWSA 4F1VA 4GOTA 5AA4A 3B6TA 4ELQA 1ZIUA 3VE1B 3AXFA 1B40A 4BDNA 5J1DA 4LATA 2GHBA 4Q8RA 1NNTA 2P2AA 1Y1MA 5IKBA 2X26A 4I9DA 2ZNSA 1FQDA 4HCYA 4KYEA 4YKIA 3K6WA 4FEBA 4OXVA 4U23A 2QS3A 2QS4A 3FVNA 3MVWA 2QJEA 4OQOA 2NOOA 3PUWE 4IGTA 3TAJA 4OFJA 3TELA 1LAFE 3N5LA 4H8JA 3UGWA 1BP5A 3HN0A 3MBPA 3EF7A 4N07A 3GBBA 4H0WA 1B5IA 2DWJA 3CFLA 1SYHA 1B9JA 4YB5A 3QK6A 4YB7A 3TMGA 4F3BA 1I6AA 4FAJA 1US4A 4F22A 3MZ9A 1OQGA 5FTIA 3S2VA 4EQBA 4PP0A 2XXHA 4DIGA 1MPDA 5H8FA 1R6ZA 4KFQA 1P1UA 3E13X 3HHFA 1TFAA 3PPNA 1MY0A 1QJMA 2GFEA 2I4CA 4QFPA 1MY2A 4C0RA 2RC7A 3EPEA 3R6UA 1B6HA 3W9VA 3Q29A 4QSEA 1B5HA 3H3GA 1PBPA 3TTMA 3IL1B 4QFNA 1NFTA 4OVJA 4UA8A 3EQ1A 5I56B 1BTJA 3OEMA 5AE4A 4X9TA 3V8XB 1XOCA 3K0VA 3K1PA 3KJTA 2O1LA 2OK2A 3UN6A 4JSOA 2DYXA 3TUSA 4BDLA 3T9VA 1NNKA 1B7ZA 1MQDA 3FASA 3LUYA 5H8SA 5TP9B 3VLUA 2WKYA 4QRZA 2ZYOA 3C31A 1DPPA 4R75A 5I2KB 1NMUA 2X7QA 1LAHE 1N04A 3PPRA 4F1YA 4ELOA 2LAOA 1IXIA 3K6UA 4DCYA 4EXLA 1BIYA 2O6AA 3MP8A 3L6GA 4QHQA 4L17A 2F34A 1LAXA 1P1WA 3KSXA 4ZEDA 1R1NA 1M5CA 1XS5A 4KCCA 1QW0A 2ONRA 4NF5B 1PDAA 1MPCA 4Q0CA 4GF8A 1VSOA 4F19A 1YPNA 4ECFA 4THIA 3KBRA 2UVJA 1ZMGA 3FV2A 2NXOA 3CRBA 3MPLA 3U1OA 4RNSA 4GLIA 3DP8A 2XXPA 2CMOA 4OFOA 1T0KA 5CRYA 1BKAA 1B0HA 3N94A 3ONMA 3ECRA 1OVTA 4RK2A 4NTLA 5ISUA 3A3CA 4IB2A 2R71A 3OSRA 5I56A 3G3KA 1IXHA 2IEEA 1ZLQA 3H06B 4LUBA 4P0IA 1URDA 4G8MA 1O7TA 4O3CA 1HSJA 4C1TA 5I57A 4ZEIA 2UVGA 5JK4A 3BFTA 2OCUA 2UYFA 1D3KA 3R7XA 5CC2A 3K6XA 4X1BA 1ATGA 4U4SA 3I5OA 5TP9A 4OEUA 1XT8A 1OIBA 4EQ9A 3SEVA 5L9OA 3MAMA 5I2KA 3JZJA 3KN8A 3U94A 5KZTA 1RYXA 3VLVA 5TU0A 1FQAA 4OTEA 3PGFA 1I6QA 1PB9A 1URGA 1WDNA 4ND9A 1URSA 1B3GA 3IB0A 3SEWA 1IZ1A 2P1SA 5EHSA 1FCKA 4F31B 3RLFE 1SQYA 2CZLA 1MQJA 4AB6A 3T93B 4ELRA 4NF5A 5KCJA 2O68A 4U4XA 4DXUA 5DVJA 1USYE 4IO7A 3SERA 4P11A 2D21A 1F9BA 2D5WA 2VGQA 4ELPA 1LFIA 3W9WA 5EHMA 1YTVA 3MUQA 2V93A 1JW4A 4WEPA 3IOWA 2W7YA 2RC9A 3M8UA 4MLVA 3HCQA 2HEUA 2Z23A 1N3WA 4QSCA 2I6EA 3RPWA 1RYOA 1Y4TA 3DP6A 5AA2B 2DOJA 2R6GE 4BDOA 4ZZEA 2XXTA 4WXJA 2F7BA 2A5SA 3Q28A 4EDPA 1MXWA 1B58A 4R9GA 3O2AA 1QUJA 4U2RA 2ABHA 1GV8A 3V83A 4O3BA 4RJZA 2HZLA 1N84A 3U92A 3FJ7A 2THIA 4XIGQ 4BDRA 2RC8A 3DP4A 4YKKA 2GRVA 3SETA 1ZBMA 1B32A 4PFYA 3RGYA 4MFIA 1OLCA 1MDP1 2Q8JA 4IO3A 3FVGA 1MM6A 2HAVA 1ZKBA 2V3QA 4GRKA 3MVYA 3PPOA 1SW5A 4Z7EA 3TPAA 1IXCA 3MW0A 1B52A 3LSFB 4KYSA 3T22A 1ZU0A 1H45A 1UTHB 3T9HB 1JETA 3T96B 5H8QB 3O28A 4DE8A 2I0BA 4GD5A 2I3WA 3CR9A 1A8FA 2PYYA 2REJA 4UACA 2Q2CA 4RY1A 1SYIA 4LZ5A 2Z8EA 3SESA 3IOUA 2XXRA 4PE5B 4TQUQ 3PV0E 3FD3A 1B7HA 3FIRA 3F11A 4EUOA 4DDDA 4DXCA 3N6TA 3C33A 2DXYA 2H98A 3RTWB 1XHYA 5AA2D 2Y7WA 5AA2A 4BDMA 4DCXA 3MJNA 2Q89A 2Q2AA
chains in the Genus database with same CATH superfamily
5ELVA 5IAIA 4LQ2A 3PUVE 1NH7A 1TWYA 4GXSB 5DTBA 3C34A 4H65A 2HFBA 4NF0A 4X8RA 1NV5A 3O6GA 1B3FA 3VVFA 1M5DA 4IO5A 4ESWA 3RPLA 1NH8A 4LVQA 5CMCA 1YZ0A 4PGNA 1FPDA 3K2DA 1EZPA 3KOSA 3B6QA 2XX8A 4FEDA 2XWKA 1A99A 4DLDA 1SW4A 1NV3A 4U22A 2Q74A 1FQFA 4MBPA 5DEXB 3CI8A 1LBVA 1NI9A 3QXMA 1KA0A 4P8BA 1IUDA 4ZEBA 5IGAA 3OMBA 1XC1A 2RCBA 3MVZA 4ZZAA 2HZKA 4NF6B 3IB2A 3LSXA 5I2NB 3TTLA 1Q35A 3UIFA 2UYEA 1I69A 4YU0A 4QXDA 1N7WA 1UTHA 1RKMA 1EYIA 2F7CA 4G61A 5H8QA 4NF4B 2P3VA 3MC2A 1B5JA 4H46A 2YJPA 3VDFA 5EYGA 1LB8A 4WEDA 1B0LA 3HHGA 1B3EA 1ZTYA 1J1NA 3K1NA 3CVGA 4GIZA 3K4UA 2PBWA 1VR5A 1MXXA 2OLBA 3ISPA 5F24A 1LAGE 3Q25A 4YMBA 1MH4A 1NV1A 3FXUA 2Z8DA 3MWBA 3USDA 2H9BA 3RNNA 4QFOA 1MXUA 1DPEA 3QYTA 2O7IA 1Z7ME 5FBPA 1JVXA 1SI0A 4QFKA 3TEPA 3RN8A 2AYSA 3M3KA 3S4UA 4E0WA 1SD3A 2XXIA 3QSLA 4KR5A 4N8YA 4PC9A 2REGA 4HE2A 3UP9A 3K02A 3OO8A 3U8QA 4OVTA 4GQOA 3A09A 2Z8FA 1SI1A 1NKXA 4RK9A 3TTNA 1H44A 3FV1A 1FBGA 4ZEKA 2DWIA 4POWA 3IAZA 4IO2A 2RKMA 1MDQA 2F7AA 4O7IA 3PD9A 4C1UA 4R9FA 5DEXA 4PFUA 1NUYA 3N26A 4PAKA 4HE0A 3VLWA 4R6HA 4NF6A 5H8NB 3S9LC 5I2NA 3H6TA 1FJ6A 3LR1A 4GX3A 1FQCA 4MHFA 4YAHX 2V3TA 1D9YA 2QMXA 1USYH 2GH9A 3C32A 4F2QA 2I0CA 4AS5A 1FTOA 4NG7A 2GQ1A 3IOVA 4NF4A 4MMPA 5B7DA 4GBVA 2XXKA 3PMXA 2AIXA 1JVYA 4R6KA 4H5FA 3PMVA 4N13A 3H6WA 2R8TA 4IGRA 1B3LA 3UA8A 3RUMA 3IFAA 2DE4A 2OZZA 4IR8A 3VVDA 4H5GA 2DVZA 1FPFA 4HCWA 1OLAA 3Q26A 5CMKA 1LFGA 4F18A 3OELA 4OMBA 1O64A 2QFLA 4LQ5A 2O1MA 3IB1A 3H03A 4QFLA 3RY3A 4MIJA 4PDDA 1FTMA 3O9PA 4O7MA 1DOTA 2XXQA 1NV0A 5L9MA 1EH3A 1H76A 5I3SA 3V5AA 1S50A 1PB7A 3C4MA 4R2BA 2F35A 3A3UA 1Y1ZA 3G3IA 4KD5A 2WEFA 3WAFA 5M2VA 4DZ1A 4TLLB 1MRPA 2I58A 2AL5A 1UQWA 3IR1A 3G3GA 1FQEA 1SW1A 4FECA 2Y7KA 1KA1A 2VOZA 1GR2A 1DMBA 5ESYA 1SBPA 1IMCA 1AH5A 2PFZA 2XA5A 1VFDA 1B2HA 4BDQA 1AMFA 4ISUA 3OENA 2QSXA 3RTFB 2ZYMA 5CI5A 1EZ9A 5H8NA 1IMFA 1FRPA 5EQ7A 2Q8MA 1CB6A 1SW2A 4KYDA 4JXIA 4P1EA 4IO4A 2FA7A 3OO9A 1MPBA 2YPNA 2ZMBA 3O6HA 3ZSFA 3LSLA 3VVEA 5CM6A 3H6UA 3LV0A 3FVKA 5HPQA 3B50A 1BLFA 2XXWA 3R26A 3SZPA 2I48A 2HCAA 3CG3A 1SDXA 2VD2A 2DVCA 5EQAA 2ZNTA 4G77A 3ILTB 2ZYNA 2ZZXA 2CEYA 4ESXA 1POY1 5DVIA 1B05A 3KEIA 3TKDA 1FQBA 3S9MC 2FNCA 3B7DA 4X1DA 4GXAA 1B4ZA 4R73A 4U1ZA 3PPQA 1QUKA 1MXYA 4FATA 3W15C 4JSDA 4MCOA 5I7IA 4GBWA 4ZECA 5KDTB 2OJTA 4FIMA 2KLFA 2XXVA 3O29A 2V25A 3H4ZA 3VFJA 3UORA 1WODA 4OENA 2NUVA 4FJPA 3IJOB 4XEQA 1LSTA 3GYYA 1QUIA 4G68B 4I62A 1RDYA 5DW8A 2NVUB 1B51A 4GL0A 4Q5TA 2A5TB 5HM4B 1LEVA 1MG1A 3IJXB 3RT8A 4R2FA 3I6VA 1ZJLA 5CBRA 5EYFA 4M1VA 4OA4A 1B7UA 1Y9UA 1Y3PA 3TQLA 5CBSA 5F7VA 1MQHA 4KCDA 1M5FA 5L9SA 1NNFA 4GX6A 5ET7A 2QVVA 4HW8A 1N3XA 3K6VA 1TT1A 4P9KA 4GFRA 5CMMA 3TODA 1OVBA 4P3LA 4H8IA 3FJMA 1FTAA 1CE2A 4JDFA 2VP1A 1VE4A 1IXGA 3FVOA 3ILUB 2G29A 4EF2A 3PUYE 3RQTA 2HHMA 2VD3A 1DSNA 2Q9TA 3GLBA 4ZE9A 1QULA 3GZGA 3MVXA 2XX9A 3CFXA 4M4GA 5L8DA 1US5A 2ALUA 2NWJA 1YAEA 2UVIA 1CNQA 3HSTA 5H8HB 3ODBA 3D1RA 1IITA 3VXCA 2ONSA 4P56A 5T3JA 2F78A 2RF1A 1FPEA 3O66A 4OERA 2F36A 3TCFA 1PB8A 3T66A 4ZS9A 3G3HA 2P0SA 4G4PA 4XTCQ 3EHSA 2HQ0A 4LN5A 2QS1A 2DE2A 4OVSA 1AL3A 3FZVA 4FE8A 4YMAA 1OMPA 4XFEA 4NF8B 1EU8A 5KDTA 3HPIA 3DELB 4NQ8A 1B1XA 4R74A 1YCJA 5FHMA 3ZKKA 3OO6A 1RDZA 4H1XA 1JQFA 2F3BA 2Z22A 3ZS6A 2OBGA 4ONYA 3U93A 1XVYA 3PUXE 4POXA 1IMBA 4K3FA 2O51A 2XWVA 2I4BA 2E1SA 1M5BA 4YZZA 2A5TA 1FTKA 4U21A 5CMBA 1GVCA 1QVSA 2H25A 3ROJA 1NL5A 4F3GA 3E9XA 2L5VA 4F1UA 1HSEA 3T9UA 4GWUA 3LSWA 4GWSA 1FPIA 2O84X 1B46A 2F5XA 2ZZVA 3WAEA 2ZYKA 2XXYA 5LDZA 1MQGA 2DP8A 3KGCA 4LA9A 4H6DA 1LGBC 2QL3A 2Y7IA 3VV5A 4PE3A 3TZAA 2WYKA 4YICA 3T1BA 1LBBA 1DTGA 4R72A 4MNPA 3MSTA 3IO4A 4PF8A 3VXBA 2DWHA 3PD8A 2QPQA 2P3NA 3EN3A 2Y7PA 2OWTA 2XXXA 4RXLA 3QIMA 3IORA 3KG2A 5H8HA 4NHBA 1JW1A 1D9VA 1P1NA 1P1OA 5TPAB 1FW0A 4KPTA 1PEBA 2ONKE 4XKRA 3FXQA 4PFWA 2WYPA 3TFLA 5DT6A 4MH5A 3TCHA 3FXBA 1K9ZA 3I3VA 1R9QA 4NF8A 4RA1A 3MP6A 2YLNA 4OVPA 4FBPA 3KN7A 4NX1A 4OWDA 3OO7A 3GXAA 4HTGA 3TTKA 2Y5KA 1JP4A 1MY1A 1FBPA 4P0GA 2RINA 1I6BA 2QS2A 3FXRA 1Y20A 4H67A 1A54A 3MQ9A 2UXAA 1UIUA 4OZ9A 3ZKLA 1IQ7A 3D4GA 2D3IA 3KSJA 3IK6B 3K01A 1AOVA 4RYAA 3C36A 2DS9A 3QAXA 4G2ZA 3TDJA 4GWYA 1IMDA 5DYHA 4QSDA 1MXVA 1H3DA 3EHTA 2KQZA 3SEYA 3CSGA 2H4IA 3LUZA 3KN3A 4QF9A 3D4CA 4XKPA 2ZNUA 1LLSA 3MP1A 5I57B 2R9JA 1FTJA 4OFLA 1ANFA 3HO7A 1NV4A 1K9YA 3KFMA 1UIVA 4LZ8A 2HAUA 4IO6A 1R9LA 3N6UA 4U1OA 3NOHA 5FHNA 3U72A 3O6IA 4OEVA 1IIWA 3FGSA 1MM7A 2BJJX 1TXFA 3TYHA 5I84A 1EZOA 1M5EA 4PETA 2DE3A 5ICQA 2ZXTA 3MZ1A 4F3SA 3UK4A 1MXZA 3V89B 4JWOA 4OYVA 5I59B 1P99A 4MAGA 4OVQA 3G7WA 4YKPA 1AIVA 3FUZA 3HFUA 1MS7A 4KI0E 1QKAA 4EXKA 3CSBA 5TPAA 5KCJB 3P7IA 4GVOA 5JTYB 3SEUA 3MZBA 3Q27A 2DWAA 4NMYA 4O8MA 4XKNA 2PCRA 3TTRA 2I49A 4JWYA 1FBFA 1SPIA 1NV2A 2XWIA 4GL8A 4PBHA 1IEJA 4LZ7A 3IFCA 4AB5A 3CG1A 1NV6A 4Z0IA 2B65A 1QGXA 3CIJA 4PQJA 3C35A 4GWZA 1XVXA 4TOZA 3DM0A 3SEXA 1B3HA 1A7LA 2X7PA 2G93A 4F39A 3KJ7A 4NWDA 5K2YA 2Y84A 5HBCA 4G8HA 3K1MA 3S9NC 1LBXA 4E0XA 5EYHA 2DQVA 1HSLA 4DI3D 2M8CA 2PT2A 1PBQA 1A40A 1A8EA 1VDWA 1KZ8A 3S9EA 2ESNA 5F1QA 4I3EA 5AA3A 3GBAA 4EQ7A 3KOTA 3T9XB 4OETA 4MF3A 1POTA 1N76A 3SKPA 1P1QA 3KZGA 3OEKA 4PGPA 2F97A 4ZE8A 2Y7RA 1UTBB 2FYIA 2DDKA 3LC8A 4DXBA 4G8NA 1MY3A 4F2OA 1QKBA 3QUFA 1MY4A 4NEDA 3OOAA 1LBWA 2CZKA 4YB6A 5EQ9A 2Q88A 3THIA 5A5XB 5LOMA 5K2XA 3FATA 2GHAA 3E4RA 5I59A 1N0TA 4TLMB 4AQ4A 5DVFA 3KBZA 3E3KA 1JEVA 2H99A 1B1HA 4OESA 2O7UA 5ITPA 3PUZE 2IA4A 2DXRA 5JTYA 4JBZA 4N6KA 1N7XA 2PX1A 4KXPA 2PMSA 4GX4A 5J16A 1DTZA 4AS4A 4G68C 3JYRA 4PFTA 5B70A 2F6GA 4IY5A 4N4UA 5FTHA 4OANA 3MPKA 2F6PA 3BBRA 1Z7NE 4JB7A 2QVRA 4LONB 1LB9A 4LP2B 3CFZA 3EHUA 1D4NA 4PAIA 3K00A 3LBSA 3DLNA 4OHNA 3M3LA 5BWJA 2E0SA 1FBDA 4X48A 1FTLA 4P47A 3RT6B 4GWOA 1WVJA 4IY6A 4NGUA 5I58B 1O63A 4MLQA 2RCAA 2DSFA 1Y3NA 4I8CA 4ZEFA 4F3PA 5ITOA 3C9HA 3G3JA 1GTKA 4NAPA 1H43A 4JWXA 3SDFA 5AA4B 1DK4A 2B3BA 3KC0A 4EF1A 4JVCA 1JW5A 1KWHA 4NWCA 4RPNA 4F29A 3L6HA 3G3FA 4FORA 3OSQA 5ET8A 2ANJA 1PC3A 5A5LA 1TFDA 1B4HA 1S7YA 1II5A 3U65A 3IO6A 1XI6A 3IX1A 1UTBA 2F8DA 2VHAA 2AL4A 4Q30B 5AA1A 1LBYA 4GWXA 2HXWA 1JEUA 3M3FA 3OD7A 5A5XA 2O69A 2PT1A 2FBPA 2QRYA 5FHOA 2B3FA 3PU5A 2PVUA 3HV1A 4N6PA 3B6WA 2F3DA 3BFUA 4XKQA 2XXUA 1G0IA 4BLAA 3QUJA 2I3VA 2H5YA 1FBCA 2XX7A 3TQWA 2BJIA 1JNFA 3O97A 1L5TA 3PMWA 1GGGA 3H6VA 4ZDMA 3BKIB 3FJGA 1A55A 3JV9A 1D9QA 1LCFA 4KQPA 4XXUA 2UVHA 1VFEA 5BUUA 4WKMA 4KHZE 2XD2A 5H8FB 3TCGA 4PFBA 4O3AA 3OXNA 4R6YA 2WBBA 1OQHA 1LFHA 1ELJA 3IOTA 4I1DA 3H7MA 1EYKA 1Y3QA 3PPPA 1Y4CA 1FBHA 1NNPA 1MQIA 1S9TA 1LBCA 4HS7A 5JEIA 4N6DA 1MH3A 2QMWA 2V3UA 4G68A 2V84A 4YKJA 2XD3A 2B4LA 4QBAA 4NE4A 4PFIA 5I58A 4RPOA 1Q1KA 5ICTA 1SVXB 1LCTA 2XHDA 1AWBA 2MKZA 2OWSA 1FPGA 4GOTA 4F1VA 5AA4A 3B6TA 4ELQA 1ZIUA 3VE1B 3AXFA 1B40A 4BDNA 5J1DA 4LATA 2GHBA 4Q8RA 1NNTA 2P2AA 1Y1MA 5IKBA 2X26A 4I9DA 4PDHA 2ZNSA 1FQDA 4HCYA 4KYEA 4YKIA 3K6WA 3MYUA 4FEBA 4OXVA 4U23A 2QS3A 2QS4A 3FVNA 3MVWA 2QJEA 4OQOA 2NOOA 3PUWE 3KC1A 4I3YA 4IGTA 3TAJA 4OFJA 3TELA 1LAFE 3N5LA 4H8JA 3UGWA 1BP5A 3HN0A 3BIGA 3MBPA 3EF7A 4N07A 2VPOA 1INPA 3GBBA 4H0WA 1B5IA 2DWJA 3CFLA 1SYHA 1B9JA 4YB5A 2HPGA 1FJ9A 3QK6A 4YB7A 3TMGA 4F3BA 1I6AA 4FAJA 1US4A 4F22A 3MZ9A 1OQGA 2FVZA 5FTIA 3S2VA 4EQBA 1RDXA 4PP0A 3E78A 2XXHA 4UABA 4DIGA 1MPDA 5H8FA 1R6ZA 4O94A 4KFQA 1P1UA 2CZHA 3E13X 3HHFA 1TFAA 3PPNA 1MY0A 1QJMA 1IMEA 2GFEA 2I4CA 4QFPA 1MY2A 4C0RA 2RC7A 3EPEA 3R6UA 1B6HA 3W9VA 3Q29A 4QSEA 1B5HA 1DCUA 3H3GA 2OWZA 1PBPA 2V4CA 3TTMA 3IL1B 4PAFA 4QFNA 1NFTA 2B4MA 2JJKA 4OVJA 5IZZA 4UA8A 4N81A 3EQ1A 5I56B 1BTJA 1FPJA 3OEMA 5AE4A 4X9TA 3V8XB 1XOCA 1EYJA 3K0VA 4PCDA 3K1PA 1Q9DA 3KJTA 2O1LA 2OK2A 3UN6A 4JSOA 2DYXA 3TUSA 1YYZA 4BDLA 4H45A 3T9VA 1NNKA 1B7ZA 1MQDA 3FASA 1BK4A 3LUYA 5H8SA 5TP9B 2FHYA 2FIEA 2WKYA 3VLUA 2VPNA 4QRZA 2ZYOA 4R75A 3C31A 1DPPA 5I2KB 4HE1A 1NMUA 2X7QA 1LAHE 1N04A 3PPRA 4F1YA 4ELOA 2LAOA 1IXIA 3K6UA 5IM2A 4DCYA 4EXLA 4I40A 1BIYA 1FPKA 4N17A 2O6AA 5IZ3B 2ZZWA 3MP8A 3L6GA 2HXRA 4QHQA 4MJOA 4L17A 4PBQA 2F34A 1LAXA 1P1WA 4OVRA 3KSXA 4ZEDA 1R1NA 1M5CA 1XS5A 4KCCA 1QW0A 2ONRA 4NF5B 1DBZA 1PDAA 1MPCA 4Q0CA 4NN3A 4GF8A 1VSOA 4F19A 1YPNA 4ECFA 4THIA 3KBRA 2UVJA 1FSAA 1ZMGA 1NUXA 3FV2A 2NXOA 3CRBA 3MPLA 3U1OA 4RNSA 4GLIA 3DP8A 2XXPA 2CMOA 5IZ1A 5LTCA 4OFOA 1LBZA 1T0KA 5CRYA 1BKAA 1B0HA 3N94A 3ONMA 3ECRA 1OVTA 4RK2A 4NTLA 5ISUA 1NUWA 4PTKA 3A3CA 1FPLA 2FIXA 4IB2A 2R71A 3OSRA 5I56A 3G3KA 4PF6A 1IXHA 2IEEA 1ZLQA 3H06B 4LUBA 4P0IA 1URDA 4G8MA 1O7TA 4O3CA 2KR0A 1HSJA 4C1TA 5I57A 4ZEIA 2UVGA 5JK4A 3BFTA 2OCUA 2UYFA 1D3KA 3R7XA 5CC2A 3K6XA 4X1BA 1ATGA 4U4SA 3I5OA 5TP9A 4OEUA 1XT8A 1OIBA 4EQ9A 4X04A 3SEVA 5L9OA 2WBDA 3MAMA 5I2KA 3JZJA 4N15A 3E79A 3KN8A 3U94A 3RYDA 5KZTA 1RYXA 3VLVA 2OX3A 5IZ3A 4JVDA 5TU0A 4MNIA 1FQAA 4OTEA 3PGFA 1I6QA 1PB9A 2Y5LA 1URGA 1WDNA 4ND9A 3B8BA 1URSA 1B3GA 3IB0A 3SEWA 1IZ1A 2P1SA 5EHSA 1FCKA 4F31B 3RLFE 1SQYA 2CZLA 1MQJA 2VT5A 4AB6A 3T93B 4JVIA 4ELRA 4NF5A 5KCJA 2O68A 4U4XA 4DXUA 5DVJA 3FBPA 1USYE 4IO7A 3SERA 4P11A 2D21A 1F9BA 2D5WA 2VGQA 4ELPA 4XF5A 1LFIA 3W9WA 5EHMA 1YTVA 3MUQA 2V93A 1JW4A 4WEPA 2CZIA 3IOWA 2W7YA 2RC9A 3M8UA 4MLVA 3HCQA 2HEUA 3CHGA 5I5PA 2Z23A 1N3WA 4QSCA 2I6EA 3RPWA 1RYOA 1Y4TA 3DP6A 5AA2B 2DOJA 4MEVA 2R6GE 3T0JA 4BDOA 3PTYA 4ZZEA 2XXTA 4WXJA 2F7BA 2A5SA 3Q28A 4EDPA 1MXWA 1B58A 4N91A 4R9GA 3O2AA 1QUJA 1NUZA 4U2RA 2XWOA 2ABHA 1GV8A 3V83A 4O3BA 4RJZA 1IMAA 2HZLA 3RPLB 1N84A 3U92A 3FJ7A 2THIA 4DI4B 4XIGQ 1FBEA 4BDRA 2RC8A 3DP4A 4YKKA 2GRVA 3SETA 1ZBMA 1B32A 4PFYA 3RGYA 4MFIA 1OLCA 1MDP1 2Q8JA 4IO3A 3FVGA 1MM6A 2HAVA 1ZKBA 2V3QA 4GRKA 2WX9A 3MVYA 3PPOA 4MX6A 1YXIA 1SW5A 4Z7EA 3TPAA 1IXCA 4GWWA 3MW0A 2CEXA 4P1LA 1B52A 3LSFB 4PFRA 4KYSA 1G0HA 2QVUA 3T22A 1ZU0A 1H45A 1UTHB 3T9HB 1JETA 3T96B 5H8QB 3O28A 4DE8A 2I0BA 4N8GA 4GD5A 2I3WA 3CR9A 1A8FA 2PYYA 2REJA 4UACA 2Q2CA 3EKIA 4RY1A 1SYIA 4LZ5A 1FPBA 2Z8EA 3SESA 3IOUA 2XXRA 4PE5B 4TQUQ 3PV0E 3FD3A 1B7HA 2PFYA 3FIRA 4HXVA 5EQ8A 3F11A 1NV7A 4EUOA 4DDDA 4DXCA 3N6TA 3C33A 5ET6A 2DXYA 2H98A 3RTWB 1XHYA 4MNCA 5AA2D 2Y7WA 3QMFA 5AA2A 3BIHA 4BDMA 5ET5A 4DCXA 3A29A 3MJNA 2Q89A 2Q2AA
chains in the Genus database with same CATH topology
5ELVA 5IAIA 4LQ2A 3PUVE 1NH7A 1TWYA 4GXSB 5DTBA 3C34A 4H65A 2HFBA 3O6GA 1B3FA 3VVFA 1M5DA 4IO5A 4ESWA 1NH8A 4LVQA 5CMCA 3K2DA 1EZPA 3KOSA 3B6QA 2XX8A 4FEDA 1A99A 4DLDA 1SW4A 4U22A 1FQFA 4MBPA 5DEXB 3CI8A 3QXMA 1IUDA 4ZEBA 3OMBA 1XC1A 2RCBA 3MVZA 4ZZAA 2HZKA 4NF6B 3IB2A 3LSXA 5I2NB 3TTLA 1Q35A 3UIFA 2UYEA 1I69A 4YU0A 1N7WA 1UTHA 1RKMA 2F7CA 5H8QA 4NF4B 3MC2A 1B5JA 2YJPA 3VDFA 1LB8A 4WEDA 1B0LA 3HHGA 1B3EA 1ZTYA 1J1NA 3K1NA 3CVGA 4GIZA 3K4UA 2PBWA 1VR5A 1MXXA 2OLBA 1LAGE 3Q25A 4YMBA 1MH4A 3FXUA 2Z8DA 3MWBA 3USDA 2H9BA 3RNNA 4QFOA 1MXUA 1DPEA 3QYTA 2O7IA 1Z7ME 1JVXA 1SI0A 4QFKA 3TEPA 3RN8A 2AYSA 3M3KA 3S4UA 4E0WA 1SD3A 2XXIA 3QSLA 4KR5A 2REGA 3UP9A 3K02A 3OO8A 3U8QA 4GQOA 3A09A 2Z8FA 1SI1A 1NKXA 4RK9A 3TTNA 1H44A 3FV1A 4ZEKA 2DWIA 4POWA 3IAZA 4IO2A 2RKMA 1MDQA 2F7AA 3PD9A 4C1UA 4R9FA 5DEXA 4PFUA 3N26A 3VLWA 4R6HA 4NF6A 5H8NB 3S9LC 5I2NA 3H6TA 3LR1A 1FQCA 4YAHX 2V3TA 1D9YA 2QMXA 1USYH 2GH9A 3C32A 4F2QA 2I0CA 1FTOA 3IOVA 4NF4A 5B7DA 3PMXA 2AIXA 1JVYA 4R6KA 4H5FA 3PMVA 4N13A 3H6WA 4IGRA 1B3LA 3UA8A 3RUMA 2DE4A 2OZZA 3VVDA 4H5GA 2DVZA 4HCWA 1OLAA 3Q26A 5CMKA 1LFGA 4F18A 3OELA 4OMBA 1O64A 4LQ5A 2O1MA 3IB1A 3H03A 4QFLA 3RY3A 1FTMA 3O9PA 1DOTA 2XXQA 5L9MA 1EH3A 1H76A 3V5AA 1S50A 1PB7A 3C4MA 4R2BA 2F35A 3A3UA 1Y1ZA 3G3IA 4KD5A 3WAFA 5M2VA 4DZ1A 4TLLB 1MRPA 2I58A 2AL5A 1UQWA 3IR1A 3G3GA 1FQEA 1SW1A 4FECA 2Y7KA 2VOZA 1GR2A 1DMBA 1SBPA 1AH5A 1VFDA 1B2HA 4BDQA 1AMFA 4ISUA 3OENA 2QSXA 3RTFB 2ZYMA 5CI5A 1EZ9A 5H8NA 1CB6A 1SW2A 4KYDA 4JXIA 4IO4A 2FA7A 3OO9A 1MPBA 2YPNA 2ZMBA 3O6HA 3ZSFA 3LSLA 3VVEA 5CM6A 3H6UA 3FVKA 5HPQA 1BLFA 2XXWA 3R26A 2I48A 2HCAA 3CG3A 1SDXA 2VD2A 2DVCA 2ZNTA 4G77A 3ILTB 2ZYNA 4ESXA 1POY1 5DVIA 1B05A 3KEIA 3TKDA 1FQBA 3S9MC 2FNCA 3B7DA 4X1DA 4GXAA 1B4ZA 4R73A 4U1ZA 3PPQA 1QUKA 1MXYA 4FATA 3W15C 4JSDA 4ZECA 5KDTB 2OJTA 4FIMA 2KLFA 2XXVA 3O29A 2V25A 3H4ZA 3VFJA 3UORA 1WODA 4OENA 2NUVA 4FJPA 3IJOB 1LSTA 1QUIA 4G68B 4I62A 2NVUB 1B51A 4GL0A 4Q5TA 2A5TB 5HM4B 1MG1A 3IJXB 3RT8A 4R2FA 3I6VA 1ZJLA 5CBRA 5EYFA 4M1VA 1B7UA 1Y9UA 1Y3PA 3TQLA 5CBSA 5F7VA 1MQHA 4KCDA 1M5FA 5L9SA 1NNFA 4HW8A 1N3XA 3K6VA 1TT1A 4GFRA 5CMMA 3TODA 1OVBA 4H8IA 3FJMA 1CE2A 4JDFA 2VP1A 1VE4A 1IXGA 3FVOA 3ILUB 2G29A 4EF2A 3PUYE 3RQTA 2VD3A 1DSNA 2Q9TA 3GLBA 4ZE9A 1QULA 3GZGA 3MVXA 2XX9A 3CFXA 4M4GA 5L8DA 1US5A 2ALUA 2NWJA 1YAEA 2UVIA 3HSTA 5H8HB 3ODBA 1IITA 3VXCA 2ONSA 2F78A 2RF1A 3O66A 4OERA 2F36A 3TCFA 1PB8A 3T66A 4ZS9A 3G3HA 2P0SA 4G4PA 4XTCQ 3EHSA 2HQ0A 2QS1A 2DE2A 1AL3A 3FZVA 4FE8A 4YMAA 1OMPA 4NF8B 1EU8A 5KDTA 3HPIA 3DELB 1B1XA 4R74A 1YCJA 5FHMA 3ZKKA 3OO6A 4H1XA 1JQFA 2Z22A 3ZS6A 2OBGA 4ONYA 3U93A 1XVYA 3PUXE 4POXA 4K3FA 2O51A 2I4BA 2E1SA 1M5BA 4YZZA 2A5TA 1FTKA 4U21A 5CMBA 1GVCA 1QVSA 2H25A 1NL5A 4F3GA 3E9XA 4F1UA 1HSEA 3T9UA 3LSWA 2O84X 1B46A 2F5XA 3WAEA 2ZYKA 2XXYA 1MQGA 2DP8A 3KGCA 4LA9A 4H6DA 1LGBC 2QL3A 2Y7IA 3VV5A 3TZAA 4YICA 1LBBA 1DTGA 4R72A 3IO4A 3VXBA 2DWHA 3PD8A 2QPQA 3EN3A 2Y7PA 2OWTA 2XXXA 4RXLA 3QIMA 3IORA 3KG2A 5H8HA 1JW1A 1D9VA 1P1NA 1P1OA 5TPAB 1FW0A 4KPTA 1PEBA 2ONKE 4XKRA 3FXQA 4PFWA 3TFLA 5DT6A 4MH5A 3TCHA 3I3VA 1R9QA 4NF8A 4RA1A 3MP6A 2YLNA 3KN7A 4OWDA 3OO7A 3GXAA 4HTGA 3TTKA 1MY1A 4P0GA 2RINA 1I6BA 2QS2A 3FXRA 1Y20A 4H67A 1A54A 3MQ9A 2UXAA 1UIUA 4OZ9A 3ZKLA 1IQ7A 3D4GA 2D3IA 3KSJA 3IK6B 3K01A 1AOVA 4RYAA 3C36A 2DS9A 3QAXA 4G2ZA 3TDJA 5DYHA 4QSDA 1MXVA 1H3DA 3EHTA 3SEYA 3CSGA 2H4IA 3KN3A 4QF9A 3D4CA 4XKPA 2ZNUA 1LLSA 3MP1A 5I57B 2R9JA 1FTJA 4OFLA 1ANFA 3HO7A 3KFMA 1UIVA 4LZ8A 2HAUA 4IO6A 1R9LA 3N6UA 4U1OA 5FHNA 3U72A 3O6IA 4OEVA 1IIWA 3FGSA 1MM7A 2BJJX 1TXFA 3TYHA 5I84A 1EZOA 1M5EA 4PETA 2DE3A 5ICQA 2ZXTA 3MZ1A 4F3SA 3UK4A 1MXZA 3V89B 4JWOA 4OYVA 5I59B 1P99A 3G7WA 4YKPA 1AIVA 3FUZA 1MS7A 4KI0E 1QKAA 4EXKA 3CSBA 5TPAA 5KCJB 3P7IA 4GVOA 5JTYB 3SEUA 3MZBA 3Q27A 2DWAA 4NMYA 4XKNA 3TTRA 2I49A 4JWYA 4GL8A 1IEJA 4LZ7A 4AB5A 3CG1A 4Z0IA 2B65A 3CIJA 4PQJA 3C35A 4TOZA 1XVXA 3DM0A 3SEXA 1B3HA 1A7LA 2X7PA 2G93A 4F39A 3KJ7A 4NWDA 5K2YA 2Y84A 5HBCA 4G8HA 3K1MA 3S9NC 4E0XA 2DQVA 1HSLA 2M8CA 2PT2A 1PBQA 1A40A 1A8EA 3S9EA 2ESNA 5F1QA 5AA3A 3GBAA 4EQ7A 3KOTA 3T9XB 4OETA 4MF3A 1POTA 1N76A 3SKPA 1P1QA 3KZGA 3OEKA 2F97A 4ZE8A 2Y7RA 1UTBB 2FYIA 3LC8A 4DXBA 4G8NA 1MY3A 4F2OA 1QKBA 3QUFA 1MY4A 4NEDA 3OOAA 4YB6A 2Q88A 3THIA 5A5XB 5LOMA 5K2XA 3FATA 2GHAA 3E4RA 5I59A 1N0TA 4TLMB 4AQ4A 5DVFA 3E3KA 1JEVA 2H99A 1B1HA 4OESA 2O7UA 5ITPA 3PUZE 2IA4A 2DXRA 5JTYA 4JBZA 1N7XA 2PX1A 2PMSA 1DTZA 4G68C 3JYRA 4PFTA 5B70A 2F6GA 4IY5A 5FTHA 3MPKA 2F6PA 3BBRA 1Z7NE 4JB7A 4LONB 1LB9A 4LP2B 3CFZA 3EHUA 1D4NA 3K00A 3LBSA 3DLNA 4OHNA 3M3LA 5BWJA 2E0SA 4X48A 1FTLA 3RT6B 4GWOA 1WVJA 4IY6A 5I58B 1O63A 4MLQA 2RCAA 2DSFA 1Y3NA 4I8CA 4ZEFA 4F3PA 5ITOA 3C9HA 3G3JA 1GTKA 1H43A 4JWXA 3SDFA 5AA4B 2B3BA 4EF1A 1JW5A 1KWHA 4NWCA 4F29A 4RPNA 3L6HA 3G3FA 4FORA 3OSQA 2ANJA 1PC3A 1TFDA 1B4HA 1S7YA 1II5A 3IO6A 3IX1A 1UTBA 2F8DA 2VHAA 2AL4A 4Q30B 5AA1A 2HXWA 1JEUA 3M3FA 3OD7A 5A5XA 2O69A 2PT1A 2QRYA 5FHOA 2B3FA 3PU5A 2PVUA 3HV1A 4N6PA 3B6WA 3BFUA 4XKQA 2XXUA 4BLAA 3QUJA 2I3VA 2H5YA 2XX7A 3TQWA 1JNFA 3O97A 1L5TA 3PMWA 1GGGA 3H6VA 4ZDMA 3BKIB 3FJGA 1A55A 3JV9A 1LCFA 4KQPA 4XXUA 2UVHA 1VFEA 5BUUA 4WKMA 4KHZE 2XD2A 5H8FB 3TCGA 4O3AA 3OXNA 4R6YA 1OQHA 1LFHA 1ELJA 3IOTA 4I1DA 3H7MA 1Y3QA 3PPPA 1Y4CA 1NNPA 1MQIA 1S9TA 1LBCA 4HS7A 5JEIA 1MH3A 2QMWA 2V3UA 4G68A 2V84A 4YKJA 2XD3A 4NE4A 5I58A 4RPOA 1Q1KA 5ICTA 1SVXB 1LCTA 2XHDA 2OWSA 4F1VA 4GOTA 5AA4A 3B6TA 4ELQA 1ZIUA 3VE1B 3AXFA 1B40A 4BDNA 5J1DA 4LATA 2GHBA 4Q8RA 1NNTA 2P2AA 1Y1MA 5IKBA 2X26A 4I9DA 2ZNSA 1FQDA 4HCYA 4KYEA 4YKIA 3K6WA 4FEBA 4OXVA 4U23A 2QS3A 2QS4A 3FVNA 3MVWA 2QJEA 4OQOA 2NOOA 3PUWE 4IGTA 3TAJA 4OFJA 3TELA 1LAFE 3N5LA 4H8JA 3UGWA 1BP5A 3HN0A 3MBPA 3EF7A 4N07A 3GBBA 4H0WA 1B5IA 2DWJA 3CFLA 1SYHA 1B9JA 4YB5A 3QK6A 4YB7A 3TMGA 4F3BA 1I6AA 4FAJA 1US4A 4F22A 3MZ9A 1OQGA 5FTIA 3S2VA 4EQBA 4PP0A 2XXHA 4DIGA 1MPDA 5H8FA 1R6ZA 4KFQA 1P1UA 3E13X 3HHFA 1TFAA 3PPNA 1MY0A 1QJMA 2GFEA 2I4CA 4QFPA 1MY2A 4C0RA 2RC7A 3EPEA 3R6UA 1B6HA 3W9VA 3Q29A 4QSEA 1B5HA 3H3GA 1PBPA 3TTMA 3IL1B 4QFNA 1NFTA 4OVJA 4UA8A 3EQ1A 5I56B 1BTJA 3OEMA 5AE4A 4X9TA 3V8XB 1XOCA 3K0VA 3K1PA 3KJTA 2O1LA 2OK2A 3UN6A 4JSOA 2DYXA 3TUSA 4BDLA 3T9VA 1NNKA 1B7ZA 1MQDA 3FASA 3LUYA 5H8SA 5TP9B 3VLUA 2WKYA 4QRZA 2ZYOA 3C31A 1DPPA 4R75A 5I2KB 1NMUA 2X7QA 1LAHE 1N04A 3PPRA 4F1YA 4ELOA 2LAOA 1IXIA 3K6UA 4DCYA 4EXLA 1BIYA 2O6AA 3MP8A 3L6GA 4QHQA 4L17A 2F34A 1LAXA 1P1WA 3KSXA 4ZEDA 1R1NA 1M5CA 1XS5A 4KCCA 1QW0A 2ONRA 4NF5B 1PDAA 1MPCA 4Q0CA 4GF8A 1VSOA 4F19A 1YPNA 4ECFA 4THIA 3KBRA 2UVJA 1ZMGA 3FV2A 2NXOA 3CRBA 3MPLA 3U1OA 4RNSA 4GLIA 3DP8A 2XXPA 2CMOA 4OFOA 1T0KA 5CRYA 1BKAA 1B0HA 3N94A 3ONMA 3ECRA 1OVTA 4RK2A 4NTLA 5ISUA 3A3CA 4IB2A 2R71A 3OSRA 5I56A 3G3KA 1IXHA 2IEEA 1ZLQA 3H06B 4LUBA 4P0IA 1URDA 4G8MA 1O7TA 4O3CA 1HSJA 4C1TA 5I57A 4ZEIA 2UVGA 5JK4A 3BFTA 2OCUA 2UYFA 1D3KA 3R7XA 5CC2A 3K6XA 4X1BA 1ATGA 4U4SA 3I5OA 5TP9A 4OEUA 1XT8A 1OIBA 4EQ9A 3SEVA 5L9OA 3MAMA 5I2KA 3JZJA 3KN8A 3U94A 5KZTA 1RYXA 3VLVA 5TU0A 1FQAA 4OTEA 3PGFA 1I6QA 1PB9A 1URGA 1WDNA 4ND9A 1URSA 1B3GA 3IB0A 3SEWA 1IZ1A 2P1SA 5EHSA 1FCKA 4F31B 3RLFE 1SQYA 2CZLA 1MQJA 4AB6A 3T93B 4ELRA 4NF5A 5KCJA 2O68A 4U4XA 4DXUA 5DVJA 1USYE 4IO7A 3SERA 4P11A 2D21A 1F9BA 2D5WA 2VGQA 4ELPA 1LFIA 3W9WA 5EHMA 1YTVA 3MUQA 2V93A 1JW4A 4WEPA 3IOWA 2W7YA 2RC9A 3M8UA 4MLVA 3HCQA 2HEUA 2Z23A 1N3WA 4QSCA 2I6EA 3RPWA 1RYOA 1Y4TA 3DP6A 5AA2B 2DOJA 2R6GE 4BDOA 4ZZEA 2XXTA 4WXJA 2F7BA 2A5SA 3Q28A 4EDPA 1MXWA 1B58A 4R9GA 3O2AA 1QUJA 4U2RA 2ABHA 1GV8A 3V83A 4O3BA 4RJZA 2HZLA 1N84A 3U92A 3FJ7A 2THIA 4XIGQ 4BDRA 2RC8A 3DP4A 4YKKA 2GRVA 3SETA 1ZBMA 1B32A 4PFYA 3RGYA 4MFIA 1OLCA 1MDP1 2Q8JA 4IO3A 3FVGA 1MM6A 2HAVA 1ZKBA 2V3QA 4GRKA 3MVYA 3PPOA 1SW5A 4Z7EA 3TPAA 1IXCA 3MW0A 1B52A 3LSFB 4KYSA 3T22A 1ZU0A 1H45A 1UTHB 3T9HB 1JETA 3T96B 5H8QB 3O28A 4DE8A 2I0BA 4GD5A 2I3WA 3CR9A 1A8FA 2PYYA 2REJA 4UACA 2Q2CA 4RY1A 1SYIA 4LZ5A 2Z8EA 3SESA 3IOUA 2XXRA 4PE5B 4TQUQ 3PV0E 3FD3A 1B7HA 3FIRA 3F11A 4EUOA 4DDDA 4DXCA 3N6TA 3C33A 2DXYA 2H98A 3RTWB 1XHYA 5AA2D 2Y7WA 5AA2A 4BDMA 4DCXA 3MJNA 2Q89A 2Q2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELV A;  5IAI A;  4LQ2 A;  3PUV E;  1NH7 A;  1TWY A;  4GXS B;  5DTB A;  3C34 A;  4H65 A;  2HFB A;  3O6G A;  1B3F A;  3VVF A;  1M5D A;  4IO5 A;  4ESW A;  1NH8 A;  4LVQ A;  5CMC A;  3K2D A;  1EZP A;  3KOS A;  3B6Q A;  2XX8 A;  4FED A;  1A99 A;  4DLD A;  1SW4 A;  4U22 A;  1FQF A;  4MBP A;  5DEX B;  3CI8 A;  3QXM A;  1IUD A;  4ZEB A;  3OMB A;  1XC1 A;  2RCB A;  3MVZ A;  4ZZA A;  2HZK A;  4NF6 B;  3IB2 A;  3LSX A;  5I2N B;  3TTL A;  1Q35 A;  3UIF A;  2UYE A;  1I69 A;  4YU0 A;  1N7W A;  1UTH A;  1RKM A;  2F7C A;  5H8Q A;  4NF4 B;  3MC2 A;  1B5J A;  2YJP A;  3VDF A;  1LB8 A;  4WED A;  1B0L A;  3HHG A;  1B3E A;  1ZTY A;  1J1N A;  3K1N A;  3CVG A;  4GIZ A;  3K4U A;  2PBW A;  1VR5 A;  1MXX A;  2OLB A;  1LAG E;  3Q25 A;  4YMB A;  1MH4 A;  3FXU A;  2Z8D A;  3MWB A;  3USD A;  2H9B A;  3RNN A;  4QFO A;  1MXU A;  1DPE A;  3QYT A;  2O7I A;  1Z7M E;  1JVX A;  1SI0 A;  4QFK A;  3TEP A;  3RN8 A;  2AYS A;  3M3K A;  3S4U A;  4E0W A;  1SD3 A;  2XXI A;  3QSL A;  4KR5 A;  2REG A;  3UP9 A;  3K02 A;  3OO8 A;  3U8Q A;  4GQO A;  3A09 A;  2Z8F A;  1SI1 A;  1NKX A;  4RK9 A;  3TTN A;  1H44 A;  3FV1 A;  4ZEK A;  2DWI A;  4POW A;  3IAZ A;  4IO2 A;  2RKM A;  1MDQ A;  2F7A A;  3PD9 A;  4C1U A;  4R9F A;  5DEX A;  4PFU A;  3N26 A;  3VLW A;  4R6H A;  4NF6 A;  5H8N B;  3S9L C;  5I2N A;  3H6T A;  3LR1 A;  1FQC A;  4YAH X;  2V3T A;  1D9Y A;  2QMX A;  1USY H;  2GH9 A;  3C32 A;  4F2Q A;  2I0C A;  1FTO A;  3IOV A;  4NF4 A;  5B7D A;  3PMX A;  2AIX A;  1JVY A;  4R6K A;  4H5F A;  3PMV A;  4N13 A;  3H6W A;  4IGR A;  1B3L A;  3UA8 A;  3RUM A;  2DE4 A;  2OZZ A;  3VVD A;  4H5G A;  2DVZ A;  4HCW A;  1OLA A;  3Q26 A;  5CMK A;  1LFG A;  4F18 A;  3OEL A;  4OMB A;  1O64 A;  4LQ5 A;  2O1M A;  3IB1 A;  3H03 A;  4QFL A;  3RY3 A;  1FTM A;  3O9P A;  1DOT A;  2XXQ A;  5L9M A;  1EH3 A;  1H76 A;  3V5A A;  1S50 A;  1PB7 A;  3C4M A;  4R2B A;  2F35 A;  3A3U A;  1Y1Z A;  3G3I A;  4KD5 A;  3WAF A;  5M2V A;  4DZ1 A;  4TLL B;  1MRP A;  2I58 A;  2AL5 A;  1UQW A;  3IR1 A;  3G3G A;  1FQE A;  1SW1 A;  4FEC A;  2Y7K A;  2VOZ A;  1GR2 A;  1DMB A;  1SBP A;  1AH5 A;  1VFD A;  1B2H A;  4BDQ A;  1AMF A;  4ISU A;  3OEN A;  2QSX A;  3RTF B;  2ZYM A;  5CI5 A;  1EZ9 A;  5H8N A;  1CB6 A;  1SW2 A;  4KYD A;  4JXI A;  4IO4 A;  2FA7 A;  3OO9 A;  1MPB A;  2YPN A;  2ZMB A;  3O6H A;  3ZSF A;  3LSL A;  3VVE A;  5CM6 A;  3H6U A;  3FVK A;  5HPQ A;  1BLF A;  2XXW A;  3R26 A;  2I48 A;  2HCA A;  3CG3 A;  1SDX A;  2VD2 A;  2DVC A;  2ZNT A;  4G77 A;  3ILT B;  2ZYN A;  4ESX A;  1POY 1;  5DVI A;  1B05 A;  3KEI A;  3TKD A;  1FQB A;  3S9M C;  2FNC A;  3B7D A;  4X1D A;  4GXA A;  1B4Z A;  4R73 A;  4U1Z A;  3PPQ A;  1QUK A;  1MXY A;  4FAT A;  3W15 C;  4JSD A;  4ZEC A;  5KDT B;  2OJT A;  4FIM A;  2KLF A;  2XXV A;  3O29 A;  2V25 A;  3H4Z A;  3VFJ A;  3UOR A;  1WOD A;  4OEN A;  2NUV A;  4FJP A;  3IJO B;  1LST A;  1QUI A;  4G68 B;  4I62 A;  2NVU B;  1B51 A;  4GL0 A;  4Q5T A;  2A5T B;  5HM4 B;  1MG1 A;  3IJX B;  3RT8 A;  4R2F A;  3I6V A;  1ZJL A;  5CBR A;  5EYF A;  4M1V A;  1B7U A;  1Y9U A;  1Y3P A;  3TQL A;  5CBS A;  5F7V A;  1MQH A;  4KCD A;  1M5F A;  5L9S A;  1NNF A;  4HW8 A;  1N3X A;  3K6V A;  1TT1 A;  4GFR A;  5CMM A;  3TOD A;  1OVB A;  4H8I A;  3FJM A;  1CE2 A;  4JDF A;  2VP1 A;  1VE4 A;  1IXG A;  3FVO A;  3ILU B;  2G29 A;  4EF2 A;  3PUY E;  3RQT A;  2VD3 A;  1DSN A;  2Q9T A;  3GLB A;  4ZE9 A;  1QUL A;  3GZG A;  3MVX A;  2XX9 A;  3CFX A;  4M4G A;  5L8D A;  1US5 A;  2ALU A;  2NWJ A;  1YAE A;  2UVI A;  3HST A;  5H8H B;  3ODB A;  1IIT A;  3VXC A;  2ONS A;  2F78 A;  2RF1 A;  3O66 A;  4OER A;  2F36 A;  3TCF A;  1PB8 A;  3T66 A;  4ZS9 A;  3G3H A;  2P0S A;  4G4P A;  4XTC Q;  3EHS A;  2HQ0 A;  2QS1 A;  2DE2 A;  1AL3 A;  3FZV A;  4FE8 A;  4YMA A;  1OMP A;  4NF8 B;  1EU8 A;  5KDT A;  3HPI A;  3DEL B;  1B1X A;  4R74 A;  1YCJ A;  5FHM A;  3ZKK A;  3OO6 A;  4H1X A;  1JQF A;  2Z22 A;  3ZS6 A;  2OBG A;  4ONY A;  3U93 A;  1XVY A;  3PUX E;  4POX A;  4K3F A;  2O51 A;  2I4B A;  2E1S A;  1M5B A;  4YZZ A;  2A5T A;  1FTK A;  4U21 A;  5CMB A;  1GVC A;  1QVS A;  2H25 A;  1NL5 A;  4F3G A;  3E9X A;  4F1U A;  1HSE A;  3T9U A;  3LSW A;  2O84 X;  1B46 A;  2F5X A;  3WAE A;  2ZYK A;  2XXY A;  1MQG A;  2DP8 A;  3KGC A;  4LA9 A;  4H6D A;  1LGB C;  2QL3 A;  2Y7I A;  3VV5 A;  3TZA A;  4YIC A;  1LBB A;  1DTG A;  4R72 A;  3IO4 A;  3VXB A;  2DWH A;  3PD8 A;  2QPQ A;  3EN3 A;  2Y7P A;  2OWT A;  2XXX A;  4RXL A;  3QIM A;  3IOR A;  3KG2 A;  5H8H A;  1JW1 A;  1D9V A;  1P1N A;  1P1O A;  5TPA B;  1FW0 A;  4KPT A;  1PEB A;  2ONK E;  4XKR A;  3FXQ A;  4PFW A;  3TFL A;  5DT6 A;  4MH5 A;  3TCH A;  3I3V A;  1R9Q A;  4NF8 A;  4RA1 A;  3MP6 A;  2YLN A;  3KN7 A;  4OWD A;  3OO7 A;  3GXA A;  4HTG A;  3TTK A;  1MY1 A;  4P0G A;  2RIN A;  1I6B A;  2QS2 A;  3FXR A;  1Y20 A;  4H67 A;  1A54 A;  3MQ9 A;  2UXA A;  1UIU A;  4OZ9 A;  3ZKL A;  1IQ7 A;  3D4G A;  2D3I A;  3KSJ A;  3IK6 B;  3K01 A;  1AOV A;  4RYA A;  3C36 A;  2DS9 A;  3QAX A;  4G2Z A;  3TDJ A;  5DYH A;  4QSD A;  1MXV A;  1H3D A;  3EHT A;  3SEY A;  3CSG A;  2H4I A;  3KN3 A;  4QF9 A;  3D4C A;  4XKP A;  2ZNU A;  1LLS A;  3MP1 A;  5I57 B;  2R9J A;  1FTJ A;  4OFL A;  1ANF A;  3HO7 A;  3KFM A;  1UIV A;  4LZ8 A;  2HAU A;  4IO6 A;  1R9L A;  3N6U A;  4U1O A;  5FHN A;  3U72 A;  3O6I A;  4OEV A;  1IIW A;  3FGS A;  1MM7 A;  2BJJ X;  1TXF A;  3TYH A;  5I84 A;  1EZO A;  1M5E A;  4PET A;  2DE3 A;  5ICQ A;  2ZXT A;  3MZ1 A;  4F3S A;  3UK4 A;  1MXZ A;  3V89 B;  4JWO A;  4OYV A;  5I59 B;  1P99 A;  3G7W A;  4YKP A;  1AIV A;  3FUZ A;  1MS7 A;  4KI0 E;  1QKA A;  4EXK A;  3CSB A;  5TPA A;  5KCJ B;  3P7I A;  4GVO A;  5JTY B;  3SEU A;  3MZB A;  3Q27 A;  2DWA A;  4NMY A;  4XKN A;  3TTR A;  2I49 A;  4JWY A;  4GL8 A;  1IEJ A;  4LZ7 A;  4AB5 A;  3CG1 A;  4Z0I A;  2B65 A;  3CIJ A;  4PQJ A;  3C35 A;  4TOZ A;  1XVX A;  3DM0 A;  3SEX A;  1B3H A;  1A7L A;  2X7P A;  2G93 A;  4F39 A;  3KJ7 A;  4NWD A;  5K2Y A;  2Y84 A;  5HBC A;  4G8H A;  3K1M A;  3S9N C;  4E0X A;  2DQV A;  1HSL A;  2M8C A;  2PT2 A;  1PBQ A;  1A40 A;  1A8E A;  3S9E A;  2ESN A;  5F1Q A;  5AA3 A;  3GBA A;  4EQ7 A;  3KOT A;  3T9X B;  4OET A;  4MF3 A;  1POT A;  1N76 A;  3SKP A;  1P1Q A;  3KZG A;  3OEK A;  2F97 A;  4ZE8 A;  2Y7R A;  1UTB B;  2FYI A;  3LC8 A;  4DXB A;  4G8N A;  1MY3 A;  4F2O A;  1QKB A;  3QUF A;  1MY4 A;  4NED A;  3OOA A;  4YB6 A;  2Q88 A;  3THI A;  5A5X B;  5LOM A;  5K2X A;  3FAT A;  2GHA A;  3E4R A;  5I59 A;  1N0T A;  4TLM B;  4AQ4 A;  5DVF A;  3E3K A;  1JEV A;  2H99 A;  1B1H A;  4OES A;  2O7U A;  5ITP A;  3PUZ E;  2IA4 A;  2DXR A;  5JTY A;  4JBZ A;  1N7X A;  2PX1 A;  2PMS A;  1DTZ A;  4G68 C;  3JYR A;  4PFT A;  5B70 A;  2F6G A;  4IY5 A;  5FTH A;  3MPK A;  2F6P A;  3BBR A;  1Z7N E;  4JB7 A;  4LON B;  1LB9 A;  4LP2 B;  3CFZ A;  3EHU A;  1D4N A;  3K00 A;  3LBS A;  3DLN A;  4OHN A;  3M3L A;  5BWJ A;  2E0S A;  4X48 A;  1FTL A;  3RT6 B;  4GWO A;  1WVJ A;  4IY6 A;  5I58 B;  1O63 A;  4MLQ A;  2RCA A;  2DSF A;  1Y3N A;  4I8C A;  4ZEF A;  4F3P A;  5ITO A;  3C9H A;  3G3J A;  1GTK A;  1H43 A;  4JWX A;  3SDF A;  5AA4 B;  2B3B A;  4EF1 A;  1JW5 A;  1KWH A;  4NWC A;  4F29 A;  4RPN A;  3L6H A;  3G3F A;  4FOR A;  3OSQ A;  2ANJ A;  1PC3 A;  1TFD A;  1B4H A;  1S7Y A;  1II5 A;  3IO6 A;  3IX1 A;  1UTB A;  2F8D A;  2VHA A;  2AL4 A;  4Q30 B;  5AA1 A;  2HXW A;  1JEU A;  3M3F A;  3OD7 A;  5A5X A;  2O69 A;  2PT1 A;  2QRY A;  5FHO A;  2B3F A;  3PU5 A;  2PVU A;  3HV1 A;  4N6P A;  3B6W A;  3BFU A;  4XKQ A;  2XXU A;  4BLA A;  3QUJ A;  2I3V A;  2H5Y A;  2XX7 A;  3TQW A;  1JNF A;  3O97 A;  1L5T A;  3PMW A;  1GGG A;  3H6V A;  4ZDM A;  3BKI B;  3FJG A;  1A55 A;  3JV9 A;  1LCF A;  4KQP A;  4XXU A;  2UVH A;  1VFE A;  5BUU A;  4WKM A;  4KHZ E;  2XD2 A;  5H8F B;  3TCG A;  4O3A A;  3OXN A;  4R6Y A;  1OQH A;  1LFH A;  1ELJ A;  3IOT A;  4I1D A;  3H7M A;  1Y3Q A;  3PPP A;  1Y4C A;  1NNP A;  1MQI A;  1S9T A;  1LBC A;  4HS7 A;  5JEI A;  1MH3 A;  2QMW A;  2V3U A;  4G68 A;  2V84 A;  4YKJ A;  2XD3 A;  4NE4 A;  5I58 A;  4RPO A;  1Q1K A;  5ICT A;  1SVX B;  1LCT A;  2XHD A;  2OWS A;  4F1V A;  4GOT A;  5AA4 A;  3B6T A;  4ELQ A;  1ZIU A;  3VE1 B;  3AXF A;  1B40 A;  4BDN A;  5J1D A;  4LAT A;  2GHB A;  4Q8R A;  1NNT A;  2P2A A;  1Y1M A;  5IKB A;  2X26 A;  4I9D A;  2ZNS A;  1FQD A;  4HCY A;  4KYE A;  4YKI A;  3K6W A;  4FEB A;  4OXV A;  4U23 A;  2QS3 A;  2QS4 A;  3FVN A;  3MVW A;  2QJE A;  4OQO A;  2NOO A;  3PUW E;  4IGT A;  3TAJ A;  4OFJ A;  3TEL A;  1LAF E;  3N5L A;  4H8J A;  3UGW A;  1BP5 A;  3HN0 A;  3MBP A;  3EF7 A;  4N07 A;  3GBB A;  4H0W A;  1B5I A;  2DWJ A;  3CFL A;  1SYH A;  1B9J A;  4YB5 A;  3QK6 A;  4YB7 A;  3TMG A;  4F3B A;  1I6A A;  4FAJ A;  1US4 A;  4F22 A;  3MZ9 A;  1OQG A;  5FTI A;  3S2V A;  4EQB A;  4PP0 A;  2XXH A;  4DIG A;  1MPD A;  5H8F A;  1R6Z A;  4KFQ A;  1P1U A;  3E13 X;  3HHF A;  1TFA A;  3PPN A;  1MY0 A;  1QJM A;  2GFE A;  2I4C A;  4QFP A;  1MY2 A;  4C0R A;  2RC7 A;  3EPE A;  3R6U A;  1B6H A;  3W9V A;  3Q29 A;  4QSE A;  1B5H A;  3H3G A;  1PBP A;  3TTM A;  3IL1 B;  4QFN A;  1NFT A;  4OVJ A;  4UA8 A;  3EQ1 A;  5I56 B;  1BTJ A;  3OEM A;  5AE4 A;  4X9T A;  3V8X B;  1XOC A;  3K0V A;  3K1P A;  3KJT A;  2O1L A;  2OK2 A;  3UN6 A;  4JSO A;  2DYX A;  3TUS A;  4BDL A;  3T9V A;  1NNK A;  1B7Z A;  1MQD A;  3FAS A;  3LUY A;  5H8S A;  5TP9 B;  3VLU A;  2WKY A;  4QRZ A;  2ZYO A;  3C31 A;  1DPP A;  4R75 A;  5I2K B;  1NMU A;  2X7Q A;  1LAH E;  1N04 A;  3PPR A;  4F1Y A;  4ELO A;  2LAO A;  1IXI A;  3K6U A;  4DCY A;  4EXL A;  1BIY A;  2O6A A;  3MP8 A;  3L6G A;  4QHQ A;  4L17 A;  2F34 A;  1LAX A;  1P1W A;  3KSX A;  4ZED A;  1R1N A;  1M5C A;  1XS5 A;  4KCC A;  1QW0 A;  2ONR A;  4NF5 B;  1PDA A;  1MPC A;  4Q0C A;  4GF8 A;  1VSO A;  4F19 A;  1YPN A;  4ECF A;  4THI A;  3KBR A;  2UVJ A;  1ZMG A;  3FV2 A;  2NXO A;  3CRB A;  3MPL A;  3U1O A;  4RNS A;  4GLI A;  3DP8 A;  2XXP A;  2CMO A;  4OFO A;  1T0K A;  5CRY A;  1BKA A;  1B0H A;  3N94 A;  3ONM A;  3ECR A;  1OVT A;  4RK2 A;  4NTL A;  5ISU A;  3A3C A;  4IB2 A;  2R71 A;  3OSR A;  5I56 A;  3G3K A;  1IXH A;  2IEE A;  1ZLQ A;  3H06 B;  4LUB A;  4P0I A;  1URD A;  4G8M A;  1O7T A;  4O3C A;  1HSJ A;  4C1T A;  5I57 A;  4ZEI A;  2UVG A;  5JK4 A;  3BFT A;  2OCU A;  2UYF A;  1D3K A;  3R7X A;  5CC2 A;  3K6X A;  4X1B A;  1ATG A;  4U4S A;  3I5O A;  5TP9 A;  4OEU A;  1XT8 A;  1OIB A;  4EQ9 A;  3SEV A;  5L9O A;  3MAM A;  5I2K A;  3JZJ A;  3KN8 A;  3U94 A;  5KZT A;  1RYX A;  3VLV A;  5TU0 A;  1FQA A;  4OTE A;  3PGF A;  1I6Q A;  1PB9 A;  1URG A;  1WDN A;  4ND9 A;  1URS A;  1B3G A;  3IB0 A;  3SEW A;  1IZ1 A;  2P1S A;  5EHS A;  1FCK A;  4F31 B;  3RLF E;  1SQY A;  2CZL A;  1MQJ A;  4AB6 A;  3T93 B;  4ELR A;  4NF5 A;  5KCJ A;  2O68 A;  4U4X A;  4DXU A;  5DVJ A;  1USY E;  4IO7 A;  3SER A;  4P11 A;  2D21 A;  1F9B A;  2D5W A;  2VGQ A;  4ELP A;  1LFI A;  3W9W A;  5EHM A;  1YTV A;  3MUQ A;  2V93 A;  1JW4 A;  4WEP A;  3IOW A;  2W7Y A;  2RC9 A;  3M8U A;  4MLV A;  3HCQ A;  2HEU A;  2Z23 A;  1N3W A;  4QSC A;  2I6E A;  3RPW A;  1RYO A;  1Y4T A;  3DP6 A;  5AA2 B;  2DOJ A;  2R6G E;  4BDO A;  4ZZE A;  2XXT A;  4WXJ A;  2F7B A;  2A5S A;  3Q28 A;  4EDP A;  1MXW A;  1B58 A;  4R9G A;  3O2A A;  1QUJ A;  4U2R A;  2ABH A;  1GV8 A;  3V83 A;  4O3B A;  4RJZ A;  2HZL A;  1N84 A;  3U92 A;  3FJ7 A;  2THI A;  4XIG Q;  4BDR A;  2RC8 A;  3DP4 A;  4YKK A;  2GRV A;  3SET A;  1ZBM A;  1B32 A;  4PFY A;  3RGY A;  4MFI A;  1OLC A;  1MDP 1;  2Q8J A;  4IO3 A;  3FVG A;  1MM6 A;  2HAV A;  1ZKB A;  2V3Q A;  4GRK A;  3MVY A;  3PPO A;  1SW5 A;  4Z7E A;  3TPA A;  1IXC A;  3MW0 A;  1B52 A;  3LSF B;  4KYS A;  3T22 A;  1ZU0 A;  1H45 A;  1UTH B;  3T9H B;  1JET A;  3T96 B;  5H8Q B;  3O28 A;  4DE8 A;  2I0B A;  4GD5 A;  2I3W A;  3CR9 A;  1A8F A;  2PYY A;  2REJ A;  4UAC A;  2Q2C A;  4RY1 A;  1SYI A;  4LZ5 A;  2Z8E A;  3SES A;  3IOU A;  2XXR A;  4PE5 B;  4TQU Q;  3PV0 E;  3FD3 A;  1B7H A;  3FIR A;  3F11 A;  4EUO A;  4DDD A;  4DXC A;  3N6T A;  3C33 A;  2DXY A;  2H98 A;  3RTW B;  1XHY A;  5AA2 D;  2Y7W A;  5AA2 A;  4BDM A;  4DCX A;  3MJN A;  2Q89 A;  2Q2A A; 
#chains in the Genus database with same CATH topology
 5ELV A;  5IAI A;  4LQ2 A;  3PUV E;  1NH7 A;  1TWY A;  4GXS B;  5DTB A;  3C34 A;  4H65 A;  2HFB A;  4NF0 A;  4X8R A;  1NV5 A;  3O6G A;  1B3F A;  3VVF A;  1M5D A;  4IO5 A;  4ESW A;  3RPL A;  1NH8 A;  4LVQ A;  5CMC A;  1YZ0 A;  4PGN A;  1FPD A;  3K2D A;  1EZP A;  3KOS A;  3B6Q A;  2XX8 A;  4FED A;  2XWK A;  1A99 A;  4DLD A;  1SW4 A;  1NV3 A;  4U22 A;  2Q74 A;  1FQF A;  4MBP A;  5DEX B;  3CI8 A;  1LBV A;  1NI9 A;  3QXM A;  1KA0 A;  4P8B A;  1IUD A;  4ZEB A;  5IGA A;  3OMB A;  1XC1 A;  2RCB A;  3MVZ A;  4ZZA A;  2HZK A;  4NF6 B;  3IB2 A;  3LSX A;  5I2N B;  3TTL A;  1Q35 A;  3UIF A;  2UYE A;  1I69 A;  4YU0 A;  4QXD A;  1N7W A;  1UTH A;  1RKM A;  1EYI A;  2F7C A;  4G61 A;  5H8Q A;  4NF4 B;  2P3V A;  3MC2 A;  1B5J A;  4H46 A;  2YJP A;  3VDF A;  5EYG A;  1LB8 A;  4WED A;  1B0L A;  3HHG A;  1B3E A;  1ZTY A;  1J1N A;  3K1N A;  3CVG A;  4GIZ A;  3K4U A;  2PBW A;  1VR5 A;  1MXX A;  2OLB A;  3ISP A;  5F24 A;  1LAG E;  3Q25 A;  4YMB A;  1MH4 A;  1NV1 A;  3FXU A;  2Z8D A;  3MWB A;  3USD A;  2H9B A;  3RNN A;  4QFO A;  1MXU A;  1DPE A;  3QYT A;  2O7I A;  1Z7M E;  5FBP A;  1JVX A;  1SI0 A;  4QFK A;  3TEP A;  3RN8 A;  2AYS A;  3M3K A;  3S4U A;  4E0W A;  1SD3 A;  2XXI A;  3QSL A;  4KR5 A;  4N8Y A;  4PC9 A;  2REG A;  4HE2 A;  3UP9 A;  3K02 A;  3OO8 A;  3U8Q A;  4OVT A;  4GQO A;  3A09 A;  2Z8F A;  1SI1 A;  1NKX A;  4RK9 A;  3TTN A;  1H44 A;  3FV1 A;  1FBG A;  4ZEK A;  2DWI A;  4POW A;  3IAZ A;  4IO2 A;  2RKM A;  1MDQ A;  2F7A A;  4O7I A;  3PD9 A;  4C1U A;  4R9F A;  5DEX A;  4PFU A;  1NUY A;  3N26 A;  4PAK A;  4HE0 A;  3VLW A;  4R6H A;  4NF6 A;  5H8N B;  3S9L C;  5I2N A;  3H6T A;  1FJ6 A;  3LR1 A;  4GX3 A;  1FQC A;  4MHF A;  4YAH X;  2V3T A;  1D9Y A;  2QMX A;  1USY H;  2GH9 A;  3C32 A;  4F2Q A;  2I0C A;  4AS5 A;  1FTO A;  4NG7 A;  2GQ1 A;  3IOV A;  4NF4 A;  4MMP A;  5B7D A;  4GBV A;  2XXK A;  3PMX A;  2AIX A;  1JVY A;  4R6K A;  4H5F A;  3PMV A;  4N13 A;  3H6W A;  2R8T A;  4IGR A;  1B3L A;  3UA8 A;  3RUM A;  3IFA A;  2DE4 A;  2OZZ A;  4IR8 A;  3VVD A;  4H5G A;  2DVZ A;  1FPF A;  4HCW A;  1OLA A;  3Q26 A;  5CMK A;  1LFG A;  4F18 A;  3OEL A;  4OMB A;  1O64 A;  2QFL A;  4LQ5 A;  2O1M A;  3IB1 A;  3H03 A;  4QFL A;  3RY3 A;  4MIJ A;  4PDD A;  1FTM A;  3O9P A;  4O7M A;  1DOT A;  2XXQ A;  1NV0 A;  5L9M A;  1EH3 A;  1H76 A;  5I3S A;  3V5A A;  1S50 A;  1PB7 A;  3C4M A;  4R2B A;  2F35 A;  3A3U A;  1Y1Z A;  3G3I A;  4KD5 A;  2WEF A;  3WAF A;  5M2V A;  4DZ1 A;  4TLL B;  1MRP A;  2I58 A;  2AL5 A;  1UQW A;  3IR1 A;  3G3G A;  1FQE A;  1SW1 A;  4FEC A;  2Y7K A;  1KA1 A;  2VOZ A;  1GR2 A;  1DMB A;  5ESY A;  1SBP A;  1IMC A;  1AH5 A;  2PFZ A;  2XA5 A;  1VFD A;  1B2H A;  4BDQ A;  1AMF A;  4ISU A;  3OEN A;  2QSX A;  3RTF B;  2ZYM A;  5CI5 A;  1EZ9 A;  5H8N A;  1IMF A;  1FRP A;  5EQ7 A;  2Q8M A;  1CB6 A;  1SW2 A;  4KYD A;  4JXI A;  4P1E A;  4IO4 A;  2FA7 A;  3OO9 A;  1MPB A;  2YPN A;  2ZMB A;  3O6H A;  3ZSF A;  3LSL A;  3VVE A;  5CM6 A;  3H6U A;  3LV0 A;  3FVK A;  5HPQ A;  3B50 A;  1BLF A;  2XXW A;  3R26 A;  3SZP A;  2I48 A;  2HCA A;  3CG3 A;  1SDX A;  2VD2 A;  2DVC A;  5EQA A;  2ZNT A;  4G77 A;  3ILT B;  2ZYN A;  2ZZX A;  2CEY A;  4ESX A;  1POY 1;  5DVI A;  1B05 A;  3KEI A;  3TKD A;  1FQB A;  3S9M C;  2FNC A;  3B7D A;  4X1D A;  4GXA A;  1B4Z A;  4R73 A;  4U1Z A;  3PPQ A;  1QUK A;  1MXY A;  4FAT A;  3W15 C;  4JSD A;  4MCO A;  5I7I A;  4GBW A;  4ZEC A;  5KDT B;  2OJT A;  4FIM A;  2KLF A;  2XXV A;  3O29 A;  2V25 A;  3H4Z A;  3VFJ A;  3UOR A;  1WOD A;  4OEN A;  2NUV A;  4FJP A;  3IJO B;  4XEQ A;  1LST A;  3GYY A;  1QUI A;  4G68 B;  4I62 A;  1RDY A;  5DW8 A;  2NVU B;  1B51 A;  4GL0 A;  4Q5T A;  2A5T B;  5HM4 B;  1LEV A;  1MG1 A;  3IJX B;  3RT8 A;  4R2F A;  3I6V A;  1ZJL A;  5CBR A;  5EYF A;  4M1V A;  4OA4 A;  1B7U A;  1Y9U A;  1Y3P A;  3TQL A;  5CBS A;  5F7V A;  1MQH A;  4KCD A;  1M5F A;  5L9S A;  1NNF A;  4GX6 A;  5ET7 A;  2QVV A;  4HW8 A;  1N3X A;  3K6V A;  1TT1 A;  4P9K A;  4GFR A;  5CMM A;  3TOD A;  1OVB A;  4P3L A;  4H8I A;  3FJM A;  1FTA A;  1CE2 A;  4JDF A;  2VP1 A;  1VE4 A;  1IXG A;  3FVO A;  3ILU B;  2G29 A;  4EF2 A;  3PUY E;  3RQT A;  2HHM A;  2VD3 A;  1DSN A;  2Q9T A;  3GLB A;  4ZE9 A;  1QUL A;  3GZG A;  3MVX A;  2XX9 A;  3CFX A;  4M4G A;  5L8D A;  1US5 A;  2ALU A;  2NWJ A;  1YAE A;  2UVI A;  1CNQ A;  3HST A;  5H8H B;  3ODB A;  3D1R A;  1IIT A;  3VXC A;  2ONS A;  4P56 A;  5T3J A;  2F78 A;  2RF1 A;  1FPE A;  3O66 A;  4OER A;  2F36 A;  3TCF A;  1PB8 A;  3T66 A;  4ZS9 A;  3G3H A;  2P0S A;  4G4P A;  4XTC Q;  3EHS A;  2HQ0 A;  4LN5 A;  2QS1 A;  2DE2 A;  4OVS A;  1AL3 A;  3FZV A;  4FE8 A;  4YMA A;  1OMP A;  4XFE A;  4NF8 B;  1EU8 A;  5KDT A;  3HPI A;  3DEL B;  4NQ8 A;  1B1X A;  4R74 A;  1YCJ A;  5FHM A;  3ZKK A;  3OO6 A;  1RDZ A;  4H1X A;  1JQF A;  2F3B A;  2Z22 A;  3ZS6 A;  2OBG A;  4ONY A;  3U93 A;  1XVY A;  3PUX E;  4POX A;  1IMB A;  4K3F A;  2O51 A;  2XWV A;  2I4B A;  2E1S A;  1M5B A;  4YZZ A;  2A5T A;  1FTK A;  4U21 A;  5CMB A;  1GVC A;  1QVS A;  2H25 A;  3ROJ A;  1NL5 A;  4F3G A;  3E9X A;  2L5V A;  4F1U A;  1HSE A;  3T9U A;  4GWU A;  3LSW A;  4GWS A;  1FPI A;  2O84 X;  1B46 A;  2F5X A;  2ZZV A;  3WAE A;  2ZYK A;  2XXY A;  5LDZ A;  1MQG A;  2DP8 A;  3KGC A;  4LA9 A;  4H6D A;  1LGB C;  2QL3 A;  2Y7I A;  3VV5 A;  4PE3 A;  3TZA A;  2WYK A;  4YIC A;  3T1B A;  1LBB A;  1DTG A;  4R72 A;  4MNP A;  3MST A;  3IO4 A;  4PF8 A;  3VXB A;  2DWH A;  3PD8 A;  2QPQ A;  2P3N A;  3EN3 A;  2Y7P A;  2OWT A;  2XXX A;  4RXL A;  3QIM A;  3IOR A;  3KG2 A;  5H8H A;  4NHB A;  1JW1 A;  1D9V A;  1P1N A;  1P1O A;  5TPA B;  1FW0 A;  4KPT A;  1PEB A;  2ONK E;  4XKR A;  3FXQ A;  4PFW A;  2WYP A;  3TFL A;  5DT6 A;  4MH5 A;  3TCH A;  3FXB A;  1K9Z A;  3I3V A;  1R9Q A;  4NF8 A;  4RA1 A;  3MP6 A;  2YLN A;  4OVP A;  4FBP A;  3KN7 A;  4NX1 A;  4OWD A;  3OO7 A;  3GXA A;  4HTG A;  3TTK A;  2Y5K A;  1JP4 A;  1MY1 A;  1FBP A;  4P0G A;  2RIN A;  1I6B A;  2QS2 A;  3FXR A;  1Y20 A;  4H67 A;  1A54 A;  3MQ9 A;  2UXA A;  1UIU A;  4OZ9 A;  3ZKL A;  1IQ7 A;  3D4G A;  2D3I A;  3KSJ A;  3IK6 B;  3K01 A;  1AOV A;  4RYA A;  3C36 A;  2DS9 A;  3QAX A;  4G2Z A;  3TDJ A;  4GWY A;  1IMD A;  5DYH A;  4QSD A;  1MXV A;  1H3D A;  3EHT A;  2KQZ A;  3SEY A;  3CSG A;  2H4I A;  3LUZ A;  3KN3 A;  4QF9 A;  3D4C A;  4XKP A;  2ZNU A;  1LLS A;  3MP1 A;  5I57 B;  2R9J A;  1FTJ A;  4OFL A;  1ANF A;  3HO7 A;  1NV4 A;  1K9Y A;  3KFM A;  1UIV A;  4LZ8 A;  2HAU A;  4IO6 A;  1R9L A;  3N6U A;  4U1O A;  3NOH A;  5FHN A;  3U72 A;  3O6I A;  4OEV A;  1IIW A;  3FGS A;  1MM7 A;  2BJJ X;  1TXF A;  3TYH A;  5I84 A;  1EZO A;  1M5E A;  4PET A;  2DE3 A;  5ICQ A;  2ZXT A;  3MZ1 A;  4F3S A;  3UK4 A;  1MXZ A;  3V89 B;  4JWO A;  4OYV A;  5I59 B;  1P99 A;  4MAG A;  4OVQ A;  3G7W A;  4YKP A;  1AIV A;  3FUZ A;  3HFU A;  1MS7 A;  4KI0 E;  1QKA A;  4EXK A;  3CSB A;  5TPA A;  5KCJ B;  3P7I A;  4GVO A;  5JTY B;  3SEU A;  3MZB A;  3Q27 A;  2DWA A;  4NMY A;  4O8M A;  4XKN A;  2PCR A;  3TTR A;  2I49 A;  4JWY A;  1FBF A;  1SPI A;  1NV2 A;  2XWI A;  4GL8 A;  4PBH A;  1IEJ A;  4LZ7 A;  3IFC A;  4AB5 A;  3CG1 A;  1NV6 A;  4Z0I A;  2B65 A;  1QGX A;  3CIJ A;  4PQJ A;  3C35 A;  4GWZ A;  1XVX A;  4TOZ A;  3DM0 A;  3SEX A;  1B3H A;  1A7L A;  2X7P A;  2G93 A;  4F39 A;  3KJ7 A;  4NWD A;  5K2Y A;  2Y84 A;  5HBC A;  4G8H A;  3K1M A;  3S9N C;  1LBX A;  4E0X A;  5EYH A;  2DQV A;  1HSL A;  4DI3 D;  2M8C A;  2PT2 A;  1PBQ A;  1A40 A;  1A8E A;  1VDW A;  1KZ8 A;  3S9E A;  2ESN A;  5F1Q A;  4I3E A;  5AA3 A;  3GBA A;  4EQ7 A;  3KOT A;  3T9X B;  4OET A;  4MF3 A;  1POT A;  1N76 A;  3SKP A;  1P1Q A;  3KZG A;  3OEK A;  4PGP A;  2F97 A;  4ZE8 A;  2Y7R A;  1UTB B;  2FYI A;  2DDK A;  3LC8 A;  4DXB A;  4G8N A;  1MY3 A;  4F2O A;  1QKB A;  3QUF A;  1MY4 A;  4NED A;  3OOA A;  1LBW A;  2CZK A;  4YB6 A;  5EQ9 A;  2Q88 A;  3THI A;  5A5X B;  5LOM A;  5K2X A;  3FAT A;  2GHA A;  3E4R A;  5I59 A;  1N0T A;  4TLM B;  4AQ4 A;  5DVF A;  3KBZ A;  3E3K A;  1JEV A;  2H99 A;  1B1H A;  4OES A;  2O7U A;  5ITP A;  3PUZ E;  2IA4 A;  2DXR A;  5JTY A;  4JBZ A;  4N6K A;  1N7X A;  2PX1 A;  4KXP A;  2PMS A;  4GX4 A;  5J16 A;  1DTZ A;  4AS4 A;  4G68 C;  3JYR A;  4PFT A;  5B70 A;  2F6G A;  4IY5 A;  4N4U A;  5FTH A;  4OAN A;  3MPK A;  2F6P A;  3BBR A;  1Z7N E;  4JB7 A;  2QVR A;  4LON B;  1LB9 A;  4LP2 B;  3CFZ A;  3EHU A;  1D4N A;  4PAI A;  3K00 A;  3LBS A;  3DLN A;  4OHN A;  3M3L A;  5BWJ A;  2E0S A;  1FBD A;  4X48 A;  1FTL A;  4P47 A;  3RT6 B;  4GWO A;  1WVJ A;  4IY6 A;  4NGU A;  5I58 B;  1O63 A;  4MLQ A;  2RCA A;  2DSF A;  1Y3N A;  4I8C A;  4ZEF A;  4F3P A;  5ITO A;  3C9H A;  3G3J A;  1GTK A;  4NAP A;  1H43 A;  4JWX A;  3SDF A;  5AA4 B;  1DK4 A;  2B3B A;  3KC0 A;  4EF1 A;  4JVC A;  1JW5 A;  1KWH A;  4NWC A;  4RPN A;  4F29 A;  3L6H A;  3G3F A;  4FOR A;  3OSQ A;  5ET8 A;  2ANJ A;  1PC3 A;  5A5L A;  1TFD A;  1B4H A;  1S7Y A;  1II5 A;  3U65 A;  3IO6 A;  1XI6 A;  3IX1 A;  1UTB A;  2F8D A;  2VHA A;  2AL4 A;  4Q30 B;  5AA1 A;  1LBY A;  4GWX A;  2HXW A;  1JEU A;  3M3F A;  3OD7 A;  5A5X A;  2O69 A;  2PT1 A;  2FBP A;  2QRY A;  5FHO A;  2B3F A;  3PU5 A;  2PVU A;  3HV1 A;  4N6P A;  3B6W A;  2F3D A;  3BFU A;  4XKQ A;  2XXU A;  1G0I A;  4BLA A;  3QUJ A;  2I3V A;  2H5Y A;  1FBC A;  2XX7 A;  3TQW A;  2BJI A;  1JNF A;  3O97 A;  1L5T A;  3PMW A;  1GGG A;  3H6V A;  4ZDM A;  3BKI B;  3FJG A;  1A55 A;  3JV9 A;  1D9Q A;  1LCF A;  4KQP A;  4XXU A;  2UVH A;  1VFE A;  5BUU A;  4WKM A;  4KHZ E;  2XD2 A;  5H8F B;  3TCG A;  4PFB A;  4O3A A;  3OXN A;  4R6Y A;  2WBB A;  1OQH A;  1LFH A;  1ELJ A;  3IOT A;  4I1D A;  3H7M A;  1EYK A;  1Y3Q A;  3PPP A;  1Y4C A;  1FBH A;  1NNP A;  1MQI A;  1S9T A;  1LBC A;  4HS7 A;  5JEI A;  4N6D A;  1MH3 A;  2QMW A;  2V3U A;  4G68 A;  2V84 A;  4YKJ A;  2XD3 A;  2B4L A;  4QBA A;  4NE4 A;  4PFI A;  5I58 A;  4RPO A;  1Q1K A;  5ICT A;  1SVX B;  1LCT A;  2XHD A;  1AWB A;  2MKZ A;  2OWS A;  1FPG A;  4GOT A;  4F1V A;  5AA4 A;  3B6T A;  4ELQ A;  1ZIU A;  3VE1 B;  3AXF A;  1B40 A;  4BDN A;  5J1D A;  4LAT A;  2GHB A;  4Q8R A;  1NNT A;  2P2A A;  1Y1M A;  5IKB A;  2X26 A;  4I9D A;  4PDH A;  2ZNS A;  1FQD A;  4HCY A;  4KYE A;  4YKI A;  3K6W A;  3MYU A;  4FEB A;  4OXV A;  4U23 A;  2QS3 A;  2QS4 A;  3FVN A;  3MVW A;  2QJE A;  4OQO A;  2NOO A;  3PUW E;  3KC1 A;  4I3Y A;  4IGT A;  3TAJ A;  4OFJ A;  3TEL A;  1LAF E;  3N5L A;  4H8J A;  3UGW A;  1BP5 A;  3HN0 A;  3BIG A;  3MBP A;  3EF7 A;  4N07 A;  2VPO A;  1INP A;  3GBB A;  4H0W A;  1B5I A;  2DWJ A;  3CFL A;  1SYH A;  1B9J A;  4YB5 A;  2HPG A;  1FJ9 A;  3QK6 A;  4YB7 A;  3TMG A;  4F3B A;  1I6A A;  4FAJ A;  1US4 A;  4F22 A;  3MZ9 A;  1OQG A;  2FVZ A;  5FTI A;  3S2V A;  4EQB A;  1RDX A;  4PP0 A;  3E78 A;  2XXH A;  4UAB A;  4DIG A;  1MPD A;  5H8F A;  1R6Z A;  4O94 A;  4KFQ A;  1P1U A;  2CZH A;  3E13 X;  3HHF A;  1TFA A;  3PPN A;  1MY0 A;  1QJM A;  1IME A;  2GFE A;  2I4C A;  4QFP A;  1MY2 A;  4C0R A;  2RC7 A;  3EPE A;  3R6U A;  1B6H A;  3W9V A;  3Q29 A;  4QSE A;  1B5H A;  1DCU A;  3H3G A;  2OWZ A;  1PBP A;  2V4C A;  3TTM A;  3IL1 B;  4PAF A;  4QFN A;  1NFT A;  2B4M A;  2JJK A;  4OVJ A;  5IZZ A;  4UA8 A;  4N81 A;  3EQ1 A;  5I56 B;  1BTJ A;  1FPJ A;  3OEM A;  5AE4 A;  4X9T A;  3V8X B;  1XOC A;  1EYJ A;  3K0V A;  4PCD A;  3K1P A;  1Q9D A;  3KJT A;  2O1L A;  2OK2 A;  3UN6 A;  4JSO A;  2DYX A;  3TUS A;  1YYZ A;  4BDL A;  4H45 A;  3T9V A;  1NNK A;  1B7Z A;  1MQD A;  3FAS A;  1BK4 A;  3LUY A;  5H8S A;  5TP9 B;  2FHY A;  2FIE A;  2WKY A;  3VLU A;  2VPN A;  4QRZ A;  2ZYO A;  4R75 A;  3C31 A;  1DPP A;  5I2K B;  4HE1 A;  1NMU A;  2X7Q A;  1LAH E;  1N04 A;  3PPR A;  4F1Y A;  4ELO A;  2LAO A;  1IXI A;  3K6U A;  5IM2 A;  4DCY A;  4EXL A;  4I40 A;  1BIY A;  1FPK A;  4N17 A;  2O6A A;  5IZ3 B;  2ZZW A;  3MP8 A;  3L6G A;  2HXR A;  4QHQ A;  4MJO A;  4L17 A;  4PBQ A;  2F34 A;  1LAX A;  1P1W A;  4OVR A;  3KSX A;  4ZED A;  1R1N A;  1M5C A;  1XS5 A;  4KCC A;  1QW0 A;  2ONR A;  4NF5 B;  1DBZ A;  1PDA A;  1MPC A;  4Q0C A;  4NN3 A;  4GF8 A;  1VSO A;  4F19 A;  1YPN A;  4ECF A;  4THI A;  3KBR A;  2UVJ A;  1FSA A;  1ZMG A;  1NUX A;  3FV2 A;  2NXO A;  3CRB A;  3MPL A;  3U1O A;  4RNS A;  4GLI A;  3DP8 A;  2XXP A;  2CMO A;  5IZ1 A;  5LTC A;  4OFO A;  1LBZ A;  1T0K A;  5CRY A;  1BKA A;  1B0H A;  3N94 A;  3ONM A;  3ECR A;  1OVT A;  4RK2 A;  4NTL A;  5ISU A;  1NUW A;  4PTK A;  3A3C A;  1FPL A;  2FIX A;  4IB2 A;  2R71 A;  3OSR A;  5I56 A;  3G3K A;  4PF6 A;  1IXH A;  2IEE A;  1ZLQ A;  3H06 B;  4LUB A;  4P0I A;  1URD A;  4G8M A;  1O7T A;  4O3C A;  2KR0 A;  1HSJ A;  4C1T A;  5I57 A;  4ZEI A;  2UVG A;  5JK4 A;  3BFT A;  2OCU A;  2UYF A;  1D3K A;  3R7X A;  5CC2 A;  3K6X A;  4X1B A;  1ATG A;  4U4S A;  3I5O A;  5TP9 A;  4OEU A;  1XT8 A;  1OIB A;  4EQ9 A;  4X04 A;  3SEV A;  5L9O A;  2WBD A;  3MAM A;  5I2K A;  3JZJ A;  4N15 A;  3E79 A;  3KN8 A;  3U94 A;  3RYD A;  5KZT A;  1RYX A;  3VLV A;  2OX3 A;  5IZ3 A;  4JVD A;  5TU0 A;  4MNI A;  1FQA A;  4OTE A;  3PGF A;  1I6Q A;  1PB9 A;  2Y5L A;  1URG A;  1WDN A;  4ND9 A;  3B8B A;  1URS A;  1B3G A;  3IB0 A;  3SEW A;  1IZ1 A;  2P1S A;  5EHS A;  1FCK A;  4F31 B;  3RLF E;  1SQY A;  2CZL A;  1MQJ A;  2VT5 A;  4AB6 A;  3T93 B;  4JVI A;  4ELR A;  4NF5 A;  5KCJ A;  2O68 A;  4U4X A;  4DXU A;  5DVJ A;  3FBP A;  1USY E;  4IO7 A;  3SER A;  4P11 A;  2D21 A;  1F9B A;  2D5W A;  2VGQ A;  4ELP A;  4XF5 A;  1LFI A;  3W9W A;  5EHM A;  1YTV A;  3MUQ A;  2V93 A;  1JW4 A;  4WEP A;  2CZI A;  3IOW A;  2W7Y A;  2RC9 A;  3M8U A;  4MLV A;  3HCQ A;  2HEU A;  3CHG A;  5I5P A;  2Z23 A;  1N3W A;  4QSC A;  2I6E A;  3RPW A;  1RYO A;  1Y4T A;  3DP6 A;  5AA2 B;  2DOJ A;  4MEV A;  2R6G E;  3T0J A;  4BDO A;  3PTY A;  4ZZE A;  2XXT A;  4WXJ A;  2F7B A;  2A5S A;  3Q28 A;  4EDP A;  1MXW A;  1B58 A;  4N91 A;  4R9G A;  3O2A A;  1QUJ A;  1NUZ A;  4U2R A;  2XWO A;  2ABH A;  1GV8 A;  3V83 A;  4O3B A;  4RJZ A;  1IMA A;  2HZL A;  3RPL B;  1N84 A;  3U92 A;  3FJ7 A;  2THI A;  4DI4 B;  4XIG Q;  1FBE A;  4BDR A;  2RC8 A;  3DP4 A;  4YKK A;  2GRV A;  3SET A;  1ZBM A;  1B32 A;  4PFY A;  3RGY A;  4MFI A;  1OLC A;  1MDP 1;  2Q8J A;  4IO3 A;  3FVG A;  1MM6 A;  2HAV A;  1ZKB A;  2V3Q A;  4GRK A;  2WX9 A;  3MVY A;  3PPO A;  4MX6 A;  1YXI A;  1SW5 A;  4Z7E A;  3TPA A;  1IXC A;  4GWW A;  3MW0 A;  2CEX A;  4P1L A;  1B52 A;  3LSF B;  4PFR A;  4KYS A;  1G0H A;  2QVU A;  3T22 A;  1ZU0 A;  1H45 A;  1UTH B;  3T9H B;  1JET A;  3T96 B;  5H8Q B;  3O28 A;  4DE8 A;  2I0B A;  4N8G A;  4GD5 A;  2I3W A;  3CR9 A;  1A8F A;  2PYY A;  2REJ A;  4UAC A;  2Q2C A;  3EKI A;  4RY1 A;  1SYI A;  4LZ5 A;  1FPB A;  2Z8E A;  3SES A;  3IOU A;  2XXR A;  4PE5 B;  4TQU Q;  3PV0 E;  3FD3 A;  1B7H A;  2PFY A;  3FIR A;  4HXV A;  5EQ8 A;  3F11 A;  1NV7 A;  4EUO A;  4DDD A;  4DXC A;  3N6T A;  3C33 A;  5ET6 A;  2DXY A;  2H98 A;  3RTW B;  1XHY A;  4MNC A;  5AA2 D;  2Y7W A;  3QMF A;  5AA2 A;  3BIH A;  4BDM A;  5ET5 A;  4DCX A;  3A29 A;  3MJN A;  2Q89 A;  2Q2A A; 
#chains in the Genus database with same CATH homology
 5ELV A;  5IAI A;  4LQ2 A;  3PUV E;  1NH7 A;  1TWY A;  4GXS B;  5DTB A;  3C34 A;  4H65 A;  2HFB A;  3O6G A;  1B3F A;  3VVF A;  1M5D A;  4IO5 A;  4ESW A;  1NH8 A;  4LVQ A;  5CMC A;  3K2D A;  1EZP A;  3KOS A;  3B6Q A;  2XX8 A;  4FED A;  1A99 A;  4DLD A;  1SW4 A;  4U22 A;  1FQF A;  4MBP A;  5DEX B;  3CI8 A;  3QXM A;  1IUD A;  4ZEB A;  3OMB A;  1XC1 A;  2RCB A;  3MVZ A;  4ZZA A;  2HZK A;  4NF6 B;  3IB2 A;  3LSX A;  5I2N B;  3TTL A;  1Q35 A;  3UIF A;  2UYE A;  1I69 A;  4YU0 A;  1N7W A;  1UTH A;  1RKM A;  2F7C A;  5H8Q A;  4NF4 B;  3MC2 A;  1B5J A;  2YJP A;  3VDF A;  1LB8 A;  4WED A;  1B0L A;  3HHG A;  1B3E A;  1ZTY A;  1J1N A;  3K1N A;  3CVG A;  4GIZ A;  3K4U A;  2PBW A;  1VR5 A;  1MXX A;  2OLB A;  1LAG E;  3Q25 A;  4YMB A;  1MH4 A;  3FXU A;  2Z8D A;  3MWB A;  3USD A;  2H9B A;  3RNN A;  4QFO A;  1MXU A;  1DPE A;  3QYT A;  2O7I A;  1Z7M E;  1JVX A;  1SI0 A;  4QFK A;  3TEP A;  3RN8 A;  2AYS A;  3M3K A;  3S4U A;  4E0W A;  1SD3 A;  2XXI A;  3QSL A;  4KR5 A;  2REG A;  3UP9 A;  3K02 A;  3OO8 A;  3U8Q A;  4GQO A;  3A09 A;  2Z8F A;  1SI1 A;  1NKX A;  4RK9 A;  3TTN A;  1H44 A;  3FV1 A;  4ZEK A;  2DWI A;  4POW A;  3IAZ A;  4IO2 A;  2RKM A;  1MDQ A;  2F7A A;  3PD9 A;  4C1U A;  4R9F A;  5DEX A;  4PFU A;  3N26 A;  3VLW A;  4R6H A;  4NF6 A;  5H8N B;  3S9L C;  5I2N A;  3H6T A;  3LR1 A;  1FQC A;  4YAH X;  2V3T A;  1D9Y A;  2QMX A;  1USY H;  2GH9 A;  3C32 A;  4F2Q A;  2I0C A;  1FTO A;  3IOV A;  4NF4 A;  5B7D A;  3PMX A;  2AIX A;  1JVY A;  4R6K A;  4H5F A;  3PMV A;  4N13 A;  3H6W A;  4IGR A;  1B3L A;  3UA8 A;  3RUM A;  2DE4 A;  2OZZ A;  3VVD A;  4H5G A;  2DVZ A;  4HCW A;  1OLA A;  3Q26 A;  5CMK A;  1LFG A;  4F18 A;  3OEL A;  4OMB A;  1O64 A;  4LQ5 A;  2O1M A;  3IB1 A;  3H03 A;  4QFL A;  3RY3 A;  1FTM A;  3O9P A;  1DOT A;  2XXQ A;  5L9M A;  1EH3 A;  1H76 A;  3V5A A;  1S50 A;  1PB7 A;  3C4M A;  4R2B A;  2F35 A;  3A3U A;  1Y1Z A;  3G3I A;  4KD5 A;  3WAF A;  5M2V A;  4DZ1 A;  4TLL B;  1MRP A;  2I58 A;  2AL5 A;  1UQW A;  3IR1 A;  3G3G A;  1FQE A;  1SW1 A;  4FEC A;  2Y7K A;  2VOZ A;  1GR2 A;  1DMB A;  1SBP A;  1AH5 A;  1VFD A;  1B2H A;  4BDQ A;  1AMF A;  4ISU A;  3OEN A;  2QSX A;  3RTF B;  2ZYM A;  5CI5 A;  1EZ9 A;  5H8N A;  1CB6 A;  1SW2 A;  4KYD A;  4JXI A;  4IO4 A;  2FA7 A;  3OO9 A;  1MPB A;  2YPN A;  2ZMB A;  3O6H A;  3ZSF A;  3LSL A;  3VVE A;  5CM6 A;  3H6U A;  3FVK A;  5HPQ A;  1BLF A;  2XXW A;  3R26 A;  2I48 A;  2HCA A;  3CG3 A;  1SDX A;  2VD2 A;  2DVC A;  2ZNT A;  4G77 A;  3ILT B;  2ZYN A;  4ESX A;  1POY 1;  5DVI A;  1B05 A;  3KEI A;  3TKD A;  1FQB A;  3S9M C;  2FNC A;  3B7D A;  4X1D A;  4GXA A;  1B4Z A;  4R73 A;  4U1Z A;  3PPQ A;  1QUK A;  1MXY A;  4FAT A;  3W15 C;  4JSD A;  4ZEC A;  5KDT B;  2OJT A;  4FIM A;  2KLF A;  2XXV A;  3O29 A;  2V25 A;  3H4Z A;  3VFJ A;  3UOR A;  1WOD A;  4OEN A;  2NUV A;  4FJP A;  3IJO B;  1LST A;  1QUI A;  4G68 B;  4I62 A;  2NVU B;  1B51 A;  4GL0 A;  4Q5T A;  2A5T B;  5HM4 B;  1MG1 A;  3IJX B;  3RT8 A;  4R2F A;  3I6V A;  1ZJL A;  5CBR A;  5EYF A;  4M1V A;  1B7U A;  1Y9U A;  1Y3P A;  3TQL A;  5CBS A;  5F7V A;  1MQH A;  4KCD A;  1M5F A;  5L9S A;  1NNF A;  4HW8 A;  1N3X A;  3K6V A;  1TT1 A;  4GFR A;  5CMM A;  3TOD A;  1OVB A;  4H8I A;  3FJM A;  1CE2 A;  4JDF A;  2VP1 A;  1VE4 A;  1IXG A;  3FVO A;  3ILU B;  2G29 A;  4EF2 A;  3PUY E;  3RQT A;  2VD3 A;  1DSN A;  2Q9T A;  3GLB A;  4ZE9 A;  1QUL A;  3GZG A;  3MVX A;  2XX9 A;  3CFX A;  4M4G A;  5L8D A;  1US5 A;  2ALU A;  2NWJ A;  1YAE A;  2UVI A;  3HST A;  5H8H B;  3ODB A;  1IIT A;  3VXC A;  2ONS A;  2F78 A;  2RF1 A;  3O66 A;  4OER A;  2F36 A;  3TCF A;  1PB8 A;  3T66 A;  4ZS9 A;  3G3H A;  2P0S A;  4G4P A;  4XTC Q;  3EHS A;  2HQ0 A;  2QS1 A;  2DE2 A;  1AL3 A;  3FZV A;  4FE8 A;  4YMA A;  1OMP A;  4NF8 B;  1EU8 A;  5KDT A;  3HPI A;  3DEL B;  1B1X A;  4R74 A;  1YCJ A;  5FHM A;  3ZKK A;  3OO6 A;  4H1X A;  1JQF A;  2Z22 A;  3ZS6 A;  2OBG A;  4ONY A;  3U93 A;  1XVY A;  3PUX E;  4POX A;  4K3F A;  2O51 A;  2I4B A;  2E1S A;  1M5B A;  4YZZ A;  2A5T A;  1FTK A;  4U21 A;  5CMB A;  1GVC A;  1QVS A;  2H25 A;  1NL5 A;  4F3G A;  3E9X A;  4F1U A;  1HSE A;  3T9U A;  3LSW A;  2O84 X;  1B46 A;  2F5X A;  3WAE A;  2ZYK A;  2XXY A;  1MQG A;  2DP8 A;  3KGC A;  4LA9 A;  4H6D A;  1LGB C;  2QL3 A;  2Y7I A;  3VV5 A;  3TZA A;  4YIC A;  1LBB A;  1DTG A;  4R72 A;  3IO4 A;  3VXB A;  2DWH A;  3PD8 A;  2QPQ A;  3EN3 A;  2Y7P A;  2OWT A;  2XXX A;  4RXL A;  3QIM A;  3IOR A;  3KG2 A;  5H8H A;  1JW1 A;  1D9V A;  1P1N A;  1P1O A;  5TPA B;  1FW0 A;  4KPT A;  1PEB A;  2ONK E;  4XKR A;  3FXQ A;  4PFW A;  3TFL A;  5DT6 A;  4MH5 A;  3TCH A;  3I3V A;  1R9Q A;  4NF8 A;  4RA1 A;  3MP6 A;  2YLN A;  3KN7 A;  4OWD A;  3OO7 A;  3GXA A;  4HTG A;  3TTK A;  1MY1 A;  4P0G A;  2RIN A;  1I6B A;  2QS2 A;  3FXR A;  1Y20 A;  4H67 A;  1A54 A;  3MQ9 A;  2UXA A;  1UIU A;  4OZ9 A;  3ZKL A;  1IQ7 A;  3D4G A;  2D3I A;  3KSJ A;  3IK6 B;  3K01 A;  1AOV A;  4RYA A;  3C36 A;  2DS9 A;  3QAX A;  4G2Z A;  3TDJ A;  5DYH A;  4QSD A;  1MXV A;  1H3D A;  3EHT A;  3SEY A;  3CSG A;  2H4I A;  3KN3 A;  4QF9 A;  3D4C A;  4XKP A;  2ZNU A;  1LLS A;  3MP1 A;  5I57 B;  2R9J A;  1FTJ A;  4OFL A;  1ANF A;  3HO7 A;  3KFM A;  1UIV A;  4LZ8 A;  2HAU A;  4IO6 A;  1R9L A;  3N6U A;  4U1O A;  5FHN A;  3U72 A;  3O6I A;  4OEV A;  1IIW A;  3FGS A;  1MM7 A;  2BJJ X;  1TXF A;  3TYH A;  5I84 A;  1EZO A;  1M5E A;  4PET A;  2DE3 A;  5ICQ A;  2ZXT A;  3MZ1 A;  4F3S A;  3UK4 A;  1MXZ A;  3V89 B;  4JWO A;  4OYV A;  5I59 B;  1P99 A;  3G7W A;  4YKP A;  1AIV A;  3FUZ A;  1MS7 A;  4KI0 E;  1QKA A;  4EXK A;  3CSB A;  5TPA A;  5KCJ B;  3P7I A;  4GVO A;  5JTY B;  3SEU A;  3MZB A;  3Q27 A;  2DWA A;  4NMY A;  4XKN A;  3TTR A;  2I49 A;  4JWY A;  4GL8 A;  1IEJ A;  4LZ7 A;  4AB5 A;  3CG1 A;  4Z0I A;  2B65 A;  3CIJ A;  4PQJ A;  3C35 A;  4TOZ A;  1XVX A;  3DM0 A;  3SEX A;  1B3H A;  1A7L A;  2X7P A;  2G93 A;  4F39 A;  3KJ7 A;  4NWD A;  5K2Y A;  2Y84 A;  5HBC A;  4G8H A;  3K1M A;  3S9N C;  4E0X A;  2DQV A;  1HSL A;  2M8C A;  2PT2 A;  1PBQ A;  1A40 A;  1A8E A;  3S9E A;  2ESN A;  5F1Q A;  5AA3 A;  3GBA A;  4EQ7 A;  3KOT A;  3T9X B;  4OET A;  4MF3 A;  1POT A;  1N76 A;  3SKP A;  1P1Q A;  3KZG A;  3OEK A;  2F97 A;  4ZE8 A;  2Y7R A;  1UTB B;  2FYI A;  3LC8 A;  4DXB A;  4G8N A;  1MY3 A;  4F2O A;  1QKB A;  3QUF A;  1MY4 A;  4NED A;  3OOA A;  4YB6 A;  2Q88 A;  3THI A;  5A5X B;  5LOM A;  5K2X A;  3FAT A;  2GHA A;  3E4R A;  5I59 A;  1N0T A;  4TLM B;  4AQ4 A;  5DVF A;  3E3K A;  1JEV A;  2H99 A;  1B1H A;  4OES A;  2O7U A;  5ITP A;  3PUZ E;  2IA4 A;  2DXR A;  5JTY A;  4JBZ A;  1N7X A;  2PX1 A;  2PMS A;  1DTZ A;  4G68 C;  3JYR A;  4PFT A;  5B70 A;  2F6G A;  4IY5 A;  5FTH A;  3MPK A;  2F6P A;  3BBR A;  1Z7N E;  4JB7 A;  4LON B;  1LB9 A;  4LP2 B;  3CFZ A;  3EHU A;  1D4N A;  3K00 A;  3LBS A;  3DLN A;  4OHN A;  3M3L A;  5BWJ A;  2E0S A;  4X48 A;  1FTL A;  3RT6 B;  4GWO A;  1WVJ A;  4IY6 A;  5I58 B;  1O63 A;  4MLQ A;  2RCA A;  2DSF A;  1Y3N A;  4I8C A;  4ZEF A;  4F3P A;  5ITO A;  3C9H A;  3G3J A;  1GTK A;  1H43 A;  4JWX A;  3SDF A;  5AA4 B;  2B3B A;  4EF1 A;  1JW5 A;  1KWH A;  4NWC A;  4F29 A;  4RPN A;  3L6H A;  3G3F A;  4FOR A;  3OSQ A;  2ANJ A;  1PC3 A;  1TFD A;  1B4H A;  1S7Y A;  1II5 A;  3IO6 A;  3IX1 A;  1UTB A;  2F8D A;  2VHA A;  2AL4 A;  4Q30 B;  5AA1 A;  2HXW A;  1JEU A;  3M3F A;  3OD7 A;  5A5X A;  2O69 A;  2PT1 A;  2QRY A;  5FHO A;  2B3F A;  3PU5 A;  2PVU A;  3HV1 A;  4N6P A;  3B6W A;  3BFU A;  4XKQ A;  2XXU A;  4BLA A;  3QUJ A;  2I3V A;  2H5Y A;  2XX7 A;  3TQW A;  1JNF A;  3O97 A;  1L5T A;  3PMW A;  1GGG A;  3H6V A;  4ZDM A;  3BKI B;  3FJG A;  1A55 A;  3JV9 A;  1LCF A;  4KQP A;  4XXU A;  2UVH A;  1VFE A;  5BUU A;  4WKM A;  4KHZ E;  2XD2 A;  5H8F B;  3TCG A;  4O3A A;  3OXN A;  4R6Y A;  1OQH A;  1LFH A;  1ELJ A;  3IOT A;  4I1D A;  3H7M A;  1Y3Q A;  3PPP A;  1Y4C A;  1NNP A;  1MQI A;  1S9T A;  1LBC A;  4HS7 A;  5JEI A;  1MH3 A;  2QMW A;  2V3U A;  4G68 A;  2V84 A;  4YKJ A;  2XD3 A;  4NE4 A;  5I58 A;  4RPO A;  1Q1K A;  5ICT A;  1SVX B;  1LCT A;  2XHD A;  2OWS A;  4F1V A;  4GOT A;  5AA4 A;  3B6T A;  4ELQ A;  1ZIU A;  3VE1 B;  3AXF A;  1B40 A;  4BDN A;  5J1D A;  4LAT A;  2GHB A;  4Q8R A;  1NNT A;  2P2A A;  1Y1M A;  5IKB A;  2X26 A;  4I9D A;  2ZNS A;  1FQD A;  4HCY A;  4KYE A;  4YKI A;  3K6W A;  4FEB A;  4OXV A;  4U23 A;  2QS3 A;  2QS4 A;  3FVN A;  3MVW A;  2QJE A;  4OQO A;  2NOO A;  3PUW E;  4IGT A;  3TAJ A;  4OFJ A;  3TEL A;  1LAF E;  3N5L A;  4H8J A;  3UGW A;  1BP5 A;  3HN0 A;  3MBP A;  3EF7 A;  4N07 A;  3GBB A;  4H0W A;  1B5I A;  2DWJ A;  3CFL A;  1SYH A;  1B9J A;  4YB5 A;  3QK6 A;  4YB7 A;  3TMG A;  4F3B A;  1I6A A;  4FAJ A;  1US4 A;  4F22 A;  3MZ9 A;  1OQG A;  5FTI A;  3S2V A;  4EQB A;  4PP0 A;  2XXH A;  4DIG A;  1MPD A;  5H8F A;  1R6Z A;  4KFQ A;  1P1U A;  3E13 X;  3HHF A;  1TFA A;  3PPN A;  1MY0 A;  1QJM A;  2GFE A;  2I4C A;  4QFP A;  1MY2 A;  4C0R A;  2RC7 A;  3EPE A;  3R6U A;  1B6H A;  3W9V A;  3Q29 A;  4QSE A;  1B5H A;  3H3G A;  1PBP A;  3TTM A;  3IL1 B;  4QFN A;  1NFT A;  4OVJ A;  4UA8 A;  3EQ1 A;  5I56 B;  1BTJ A;  3OEM A;  5AE4 A;  4X9T A;  3V8X B;  1XOC A;  3K0V A;  3K1P A;  3KJT A;  2O1L A;  2OK2 A;  3UN6 A;  4JSO A;  2DYX A;  3TUS A;  4BDL A;  3T9V A;  1NNK A;  1B7Z A;  1MQD A;  3FAS A;  3LUY A;  5H8S A;  5TP9 B;  3VLU A;  2WKY A;  4QRZ A;  2ZYO A;  3C31 A;  1DPP A;  4R75 A;  5I2K B;  1NMU A;  2X7Q A;  1LAH E;  1N04 A;  3PPR A;  4F1Y A;  4ELO A;  2LAO A;  1IXI A;  3K6U A;  4DCY A;  4EXL A;  1BIY A;  2O6A A;  3MP8 A;  3L6G A;  4QHQ A;  4L17 A;  2F34 A;  1LAX A;  1P1W A;  3KSX A;  4ZED A;  1R1N A;  1M5C A;  1XS5 A;  4KCC A;  1QW0 A;  2ONR A;  4NF5 B;  1PDA A;  1MPC A;  4Q0C A;  4GF8 A;  1VSO A;  4F19 A;  1YPN A;  4ECF A;  4THI A;  3KBR A;  2UVJ A;  1ZMG A;  3FV2 A;  2NXO A;  3CRB A;  3MPL A;  3U1O A;  4RNS A;  4GLI A;  3DP8 A;  2XXP A;  2CMO A;  4OFO A;  1T0K A;  5CRY A;  1BKA A;  1B0H A;  3N94 A;  3ONM A;  3ECR A;  1OVT A;  4RK2 A;  4NTL A;  5ISU A;  3A3C A;  4IB2 A;  2R71 A;  3OSR A;  5I56 A;  3G3K A;  1IXH A;  2IEE A;  1ZLQ A;  3H06 B;  4LUB A;  4P0I A;  1URD A;  4G8M A;  1O7T A;  4O3C A;  1HSJ A;  4C1T A;  5I57 A;  4ZEI A;  2UVG A;  5JK4 A;  3BFT A;  2OCU A;  2UYF A;  1D3K A;  3R7X A;  5CC2 A;  3K6X A;  4X1B A;  1ATG A;  4U4S A;  3I5O A;  5TP9 A;  4OEU A;  1XT8 A;  1OIB A;  4EQ9 A;  3SEV A;  5L9O A;  3MAM A;  5I2K A;  3JZJ A;  3KN8 A;  3U94 A;  5KZT A;  1RYX A;  3VLV A;  5TU0 A;  1FQA A;  4OTE A;  3PGF A;  1I6Q A;  1PB9 A;  1URG A;  1WDN A;  4ND9 A;  1URS A;  1B3G A;  3IB0 A;  3SEW A;  1IZ1 A;  2P1S A;  5EHS A;  1FCK A;  4F31 B;  3RLF E;  1SQY A;  2CZL A;  1MQJ A;  4AB6 A;  3T93 B;  4ELR A;  4NF5 A;  5KCJ A;  2O68 A;  4U4X A;  4DXU A;  5DVJ A;  1USY E;  4IO7 A;  3SER A;  4P11 A;  2D21 A;  1F9B A;  2D5W A;  2VGQ A;  4ELP A;  1LFI A;  3W9W A;  5EHM A;  1YTV A;  3MUQ A;  2V93 A;  1JW4 A;  4WEP A;  3IOW A;  2W7Y A;  2RC9 A;  3M8U A;  4MLV A;  3HCQ A;  2HEU A;  2Z23 A;  1N3W A;  4QSC A;  2I6E A;  3RPW A;  1RYO A;  1Y4T A;  3DP6 A;  5AA2 B;  2DOJ A;  2R6G E;  4BDO A;  4ZZE A;  2XXT A;  4WXJ A;  2F7B A;  2A5S A;  3Q28 A;  4EDP A;  1MXW A;  1B58 A;  4R9G A;  3O2A A;  1QUJ A;  4U2R A;  2ABH A;  1GV8 A;  3V83 A;  4O3B A;  4RJZ A;  2HZL A;  1N84 A;  3U92 A;  3FJ7 A;  2THI A;  4XIG Q;  4BDR A;  2RC8 A;  3DP4 A;  4YKK A;  2GRV A;  3SET A;  1ZBM A;  1B32 A;  4PFY A;  3RGY A;  4MFI A;  1OLC A;  1MDP 1;  2Q8J A;  4IO3 A;  3FVG A;  1MM6 A;  2HAV A;  1ZKB A;  2V3Q A;  4GRK A;  3MVY A;  3PPO A;  1SW5 A;  4Z7E A;  3TPA A;  1IXC A;  3MW0 A;  1B52 A;  3LSF B;  4KYS A;  3T22 A;  1ZU0 A;  1H45 A;  1UTH B;  3T9H B;  1JET A;  3T96 B;  5H8Q B;  3O28 A;  4DE8 A;  2I0B A;  4GD5 A;  2I3W A;  3CR9 A;  1A8F A;  2PYY A;  2REJ A;  4UAC A;  2Q2C A;  4RY1 A;  1SYI A;  4LZ5 A;  2Z8E A;  3SES A;  3IOU A;  2XXR A;  4PE5 B;  4TQU Q;  3PV0 E;  3FD3 A;  1B7H A;  3FIR A;  3F11 A;  4EUO A;  4DDD A;  4DXC A;  3N6T A;  3C33 A;  2DXY A;  2H98 A;  3RTW B;  1XHY A;  5AA2 D;  2Y7W A;  5AA2 A;  4BDM A;  4DCX A;  3MJN A;  2Q89 A;  2Q2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...