5AA4B

Crystal structure of mltf from pseudomonas aeruginosa in complex with cell-wall tetrapeptide
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
417
structure length
417
Chain Sequence
EGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFTQHLQQRLPRYESHFKQSGKQKDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F
publication title Activation by Allostery in Cell-Wall Remodeling by a Modular Membrane-Bound Lytic Transglycosylase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 145
structure length 417
sequence length 417
chains with identical sequence D
ec nomenclature ec 4.2.2.-:
pdb deposition date 2015-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa4B01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa4B02
3QYTA 1Q35A 1JETA 1MY2A 4G4PA 3ZKLA 4KI0E 4F31B 3HSTA 3MPKA 4DXUA 3M3FA 1A54A 3TDJA 2OLBA 3O29A 3IOVA 3VDFA 3V5AA 5AA2A 4OVJA 1JQFA 4OERA 4ELOA 1OQHA 3N5LA 2F78A 1ANFA 4ZS9A 1MM6A 3V83A 1B1HA 2DE2A 1NNTA 4DE8A 3MC2A 3E3KA 5A5XA 1MQJA 3T96B 5CMMA 4R72A 2I4BA 3VVFA 1A99A 3UA8A 3VLUA 4EUOA 3R7XA 3VLVA 4DXCA 4JBZA 2XXXA 5AA2B 2O69A 3KGCA 2ESNA 3E13X 4RPOA 1XVXA 5A5XB 5TU0A 3TYHA 2QL3A 1FQDA 5DVFA 2I4CA 3PPRA 4IY5A 3PPPA 3PMVA 1PBQA 3D4GA 1VR5A 3QK6A 4GIZA 1P1QA 3SEVA 4U22A 1MRPA 2HFBA 2AYSA 3HO7A 3FD3A 4OZ9A 3K1MA 1B4HA 1MQGA 2Q89A 4TLMB 4R6HA 2O6AA 5ITPA 5JTYA 4EXKA 1IIWA 3S4UA 4HS7A 1JW5A 3TTNA 1MPBA 1LGBC 2THIA 3FVKA 1TFDA 4JWOA 3LUYA 1MXYA 5AA4A 4P0IA 3H6TA 4YB5A 4JSOA 4LZ7A 1MH4A 4O3BA 4F29A 4GRKA 3OELA 5B70A 5JTYB 4H8JA 1VFDA 1PC3A 1B3FA 4L17A 2XX9A 5LOMA 3RT8A 2LAOA 3RGYA 2V84A 3PPOA 3M3LA 5AA4B 1P99A 3RLFE 4F1UA 4O3CA 4H1XA 4PE5B 3RN8A 5CMBA 3B7DA 3FATA 1SW1A 2QMWA 2G29A 2R9JA 3OENA 5AE4A 5EHMA 2XXPA 4NEDA 4F2QA 1XOCA 3U93A 1PBPA 4F3BA 1P1UA 2HAVA 1OLAA 2Q8JA 3VV5A 4M4GA 2XXVA 4POXA 1GTKA 4IO7A 1VSOA 1A40A 4LP2B 4F3SA 4ONYA 3MJNA 2HCAA 4ZEKA 4HCYA 1KWHA 2HEUA 5K2YA 2XXIA 3U92A 4E0WA 1FQBA 4H6DA 1O63A 3QSLA 4NMYA 1MPDA 5H8NA 4F18A 4JXIA 4LZ5A 2D3IA 3CFLA 1II5A 3B6TA 2F5XA 1IXGA 2R6GE 2XXUA 3MW0A 4U21A 4G2ZA 3TTRA 1SI0A 1MY0A 1EZPA 4DCXA 2I48A 2F36A 4KHZE 2Z8FA 1B4ZA 3F11A 4DXBA 5H8NB 2RKMA 2DWJA 4BDOA 3RT6B 2I49A 3C35A 2UYFA 2Q9TA 1MQHA 2E0SA 4ZZAA 3CRBA 1B7HA 5DVJA 3W15C 4QSEA 3G3GA 4KCDA 5I2NA 3PU5A 1B2HA 5EHSA 2QSXA 3PMWA 3JZJA 4H5GA 2F7AA 4QSCA 3QIMA 1DTGA 4XTCQ 4WKMA 1N3XA 4Z7EA 2CZLA 4O3AA 2DVZA 3HV1A 3W9WA 1NMUA 4QRZA 2ONRA 5ICQA 4RYAA 1QUKA 5I2NB 3H06B 1Y9UA 3FJ7A 4XIGQ 2OJTA 2AIXA 1B1XA 2GRVA 4OEVA 3DP8A 3EHUA 2F34A 3U94A 1A55A 1SBPA 4ZE8A 4YZZA 5FHOA 3PD9A 4XXUA 3THIA 3U1OA 4FJPA 1R9LA 1SDXA 3MP6A 1B0LA 4KYDA 1NH7A 3CFXA 3IB0A 1B58A 2UVHA 2ZXTA 4AB6A 1JVYA 4NF6A 3K6XA 2Z23A 1R6ZA 4RPNA 2VOZA 1I6AA 2VD2A 5H8FA 3C31A 3FZVA 4ZEFA 3TFLA 1EZOA 1FQFA 3MZBA 2D5WA 3I6VA 1AL3A 4R73A 1GGGA 1HSLA 1NNKA 2XXQA 5FTIA 3E9XA 4WEPA 4NF6B 4F22A 3JYRA 4ZDMA 1SVXB 3GBAA 1H43A 2H9BA 3DLNA 3LBSA 5H8FB 4PETA 2O68A 2XHDA 5I2KB 3HN0A 3PV0E 4Z0IA 1TT1A 3KN7A 4XKQA 3OEKA 3S9MC 1CE2A 1MXXA 1OVBA 3N26A 3H7MA 4EQBA 3B6WA 3C4MA 4YICA 4X48A 2NOOA 2R71A 3FV2A 1FCKA 2RCBA 4YKIA 1PDAA 4C1UA 2XX8A 1LFGA 1TFAA 2UYEA 3SEUA 3TQLA 2VD3A 1S50A 1JEVA 3OO6A 3QAXA 4R9FA 4LONB 2QJEA 1H45A 4QF9A 1AOVA 2XXTA 1FTOA 2F97A 4E0XA 1B5IA 2FYIA 3CSBA 4HCWA 3SESA 5CMKA 1LBCA 1B40A 4RY1A 3KN8A 1DPPA 4YB6A 4NF4A 3EN3A 2AL5A 3K1NA 5DYHA 1MXZA 4OFOA 2RINA 4EF2A 3RQTA 2XXYA 3TMGA 1B3HA 5L9MA 2DSFA 4OTEA 3RTWB 3OSRA 1IZ1A 3H3GA 4U1OA 3RPWA 3OO9A 3VXBA 1YPNA 4H5FA 3MQ9A 2I3VA 2QS3A 4NF4B 1GV8A 3EF7A 3RNNA 1Z7NE 2QPQA 4MLVA 1ZTYA 4X9TA 4QFLA 4G77A 4KQPA 5FHNA 1YTVA 1DMBA 1Y4TA 4GL0A 4NF8A 4RK2A 5CI5A 5FHMA 3KZGA 1AH5A 1ZBMA 3SETA 5AA3A 5I56A 3QUFA 1B3GA 2D21A 4RJZA 2OWTA 4YKPA 2DE3A 3BFUA 5BUUA 4Q8RA 3SKPA 4UA8A 1DSNA 1PB9A 4GLIA 4AQ4A 3VE1B 2F7CA 2ZYMA 4LZ8A 4NF8B 5AA2D 4YB7A 4TQUQ 1RKMA 2H99A 4F3GA 4GFRA 3O9PA 4C0RA 4PFYA 2H98A 2KLFA 5I56B 3C34A 3TTMA 1A8EA 1LFHA 3IB2A 3MP8A 5CM6A 3Q29A 3VLWA 1USYH 3K01A 1B6HA 4FAJA 1FTLA 2V93A 3PUXE 1LCFA 3LR1A 1LAGE 3H03A 5ITOA 1I69A 1JW4A 2P2AA 3TQWA 3BBRA 3WAEA 1NFTA 2DS9A 1ELJA 1TWYA 2ONKE 4JDFA 1ZLQA 4LQ5A 4G68C 4BDNA 5ELVA 3VVEA 3T9UA 3G3JA 1QJMA 5K2XA 5F7VA 4AB5A 4RA1A 3CI8A 1EU8A 5EYFA 3JV9A 1IEJA 4R74A 2V3UA 4QHQA 5FTHA 1UTHA 2HZLA 2V25A 2V3TA 3ONMA 3ECRA 1XVYA 3ZSFA 2M8CA 1Y3PA 1UIUA 1YCJA 1N04A 4OMBA 3KEIA 1OVTA 1IQ7A 4ZZEA 1MQDA 2REGA 3IK6B 3UORA 1ATGA 1XS5A 2ANJA 3PUYE 4DZ1A 4OFJA 4QFKA 3K2DA 4IB2A 4TOZA 1JEUA 2F35A 2Y7KA 4LQ2A 1UTHB 3MP1A 3K4UA 4LUBA 2DYXA 1S7YA 4KD5A 2Q2AA 3ILUB 3HHFA 3CR9A 3FVOA 4N07A 2RCAA 2W7YA 2VP1A 3K00A 1JNFA 4THIA 3KSXA 3Q26A 2DE4A 4NTLA 3N94A 3DM0A 3GBBA 2XD2A 4IO5A 3M3KA 3BFTA 3DELB 2NXOA 2Q88A 1OQGA 2H25A 5CMCA 1MG1A 3K6WA 3EHTA 4LA9A 2OCUA 2DOJA 1MDQA 4JSDA 3SEYA 4FEDA 2YJPA 3ILTB 3OXNA 1LAHE 4IGRA 4ESWA 4IO2A 5B7DA 2O51A 4TLLB 1UQWA 5HM4B 2B65A 3O6HA 4F39A 1IUDA 1BP5A 1VFEA 4G68A 5I59A 4K3FA 3UP9A 4GOTA 1Z7ME 4ISUA 3A3CA 1SYIA 1IITA 4QFNA 5JK4A 3TUSA 3TKDA 3FXRA 3PUVE 5DEXA 3I5OA 3KJTA 5CC2A 2VHAA 2F6PA 2YPNA 2O7UA 3V8XB 2OBGA 4ZEBA 3PGFA 5I59B 4G68B 4GD5A 3FIRA 3P7IA 4GXSB 1WODA 3OSQA 5AA1A 2UVIA 1US4A 4JB7A 4IGTA 4QSDA 3IJXB 4QFPA 2Y7PA 1UIVA 1MPCA 4GXAA 4F1VA 3SEWA 5KDTA 2XD3A 5H8HA 1B7ZA 3KJ7A 4DCYA 3PMXA 3MVWA 3R6UA 1B3LA 2OWSA 4WXJA 3MVYA 4MH5A 4BDQA 4DDDA 3MWBA 5CRYA 1N3WA 2RC8A 3H6UA 1MH3A 3T9XB 2WKYA 1S9TA 4LVQA 2DXRA 4X1BA 3L6GA 1BIYA 4F19A 2REJA 1FW0A 1DTZA 3TTLA 3UN6A 2ZYOA 4Q0CA 3FVGA 3G7WA 4U4XA 2DQVA 1B05A 4OWDA 4Q30B 1PB7A 3G3HA 1IXHA 1XC1A 3HPIA 4KYSA 3EQ1A 1D9VA 1LAXA 3O66A 4G8HA 4JWYA 1HSEA 1P1NA 4OYVA 1O64A 2X7QA 3FASA 4HW8A 1URDA 4YMAA 4YAHX 2PT1A 4PQJA 1P1OA 2HAUA 1Y3QA 4KCCA 4BDMA 3WAFA 1BLFA 5L9OA 1M5EA 3ODBA 2PYYA 3TCFA 1B0HA 3IOWA 4FE8A 1A8FA 3CSGA 3Q25A 4XKPA 3GLBA 5I84A 1N7WA 2QRYA 2QS4A 3G3KA 1ZIUA 2P0SA 4ELQA 1GR2A 2IA4A 4GF8A 3E4RA 4ECFA 2QMXA 3O97A 2XXRA 1Y20A 5TP9A 2GHAA 4YU0A 3CG3A 5ICTA 1NL5A 3MAMA 3MVXA 4OETA 2NVUB 1B32A 3ZS6A 4KR5A 1RYOA 1QKAA 2Y7IA 1MY4A 2I0BA 1P1WA 4GWOA 1POY1 2Y84A 1OIBA 4NE4A 5IAIA 3PD8A 4FEBA 4OESA 3T93B 4KPTA 5TP9B 3C33A 1LB9A 2ZNUA 3H6WA 1WVJA 2F6GA 2ZYKA 4WEDA 3MUQA 1B5HA 1FTJA 1B52A 2PVUA 3LC8A 4RXLA 3T22A 2QS1A 1ZMGA 3LSFB 3IJOB 3O6GA 4F2OA 3T9VA 1RYXA 5I58A 2NWJA 4I8CA 1A7LA 3FJGA 4U23A 2Q2CA 4X1DA 2B3BA 3VXCA 4R9GA 3K02A 1J1NA 2CMOA 3UK4A 3W9VA 3LSLA 3CFZA 3FUZA 2DP8A 2O84X 1QUIA 3MZ9A 1SYHA 5KCJA 2A5TA 5KZTA 3C32A 5J1DA 4I62A 3OOAA 1I6BA 2G93A 3L6HA 4M1VA 5I58B 1QUJA 4LATA 1LFIA 3GZGA 1AIVA 2Z8EA 2X7PA 3LSWA 4MFIA 1LCTA 3FGSA 2DXYA 1MS7A 3CIJA 1IXIA 4FECA 2E1SA 3IO6A 1N7XA 3S2VA 5KCJB 4PP0A 3TEPA 2AL4A 2A5TB 2ONSA 4IO3A 3S9LC 1BTJA 2ZYNA 1SD3A 3Q28A 3HHGA 4GVOA 4KYEA 3H4ZA 2PMSA 1N84A 2GFEA 3G3FA 3LSXA 1QVSA 1MXWA 4BDRA 4JWXA 3K0VA 3S9EA 2IEEA 4GL8A 1MDP1 2I0CA 2ZNSA 1D9YA 3S9NC 3QUJA 1Y1MA 2QS2A 3AXFA 2Y7WA 3TPAA 2I58A 2HQ0A 1MXUA 4IO4A 3IB1A 1ZU0A 1SI1A 2DWAA 3FV1A 1SQYA 3QXMA 3IOUA 2X26A 3K6UA 3IORA 1B9JA 1ZKBA 3MVZA 2V3QA 5DTBA 4F3PA 3VFJA 2F8DA 4OFLA 4U2RA 1PEBA 3DP4A 3D4CA 1DPEA 1B5JA 4I9DA 5F1QA 2DWHA 3T66A 3O2AA 3USDA 3FXUA 5CBRA 2OK2A 1XT8A 2FA7A 1R9QA 3KSJA 1YAEA 4YMBA 1L5TA 3OO7A 4IY6A 4OHNA 5IKBA 3EHSA 1DOTA 3M8UA 1US5A 4EDPA 4R6KA 4R2FA 1QKBA 4KFQA 1H3DA 5L8DA 2XXHA 4YKJA 3SERA 1OLCA 4ELRA 4UACA 3FJMA 4RNSA 3B6QA 2VGQA 3KOTA 4EQ9A 1N76A 3U8QA 3FVNA 4Q5TA 1NNFA 1ZJLA 3UGWA 4ELPA 3SDFA 5M2VA 4H0WA 3UIFA 2H4IA 4OEUA 3RY3A 2ZMBA 4ZE9A 2A5SA 4PFWA 1NKXA 1LBBA 3K6VA 3MZ1A 5L9SA 4ND9A 2I3WA 2FNCA 4MLQA 1EZ9A 3MPLA 4OENA 2PX1A 4BLAA 4H8IA 4H67A 1FQCA 2BJJX 1D3KA 3N6TA 4P11A 1FQAA 5I57A 3MBPA 4C1TA 1F9BA 5ISUA 1M5DA 2P1SA 5H8QA 1UTBA 3I3VA 2YLNA 1LSTA 1QULA 3U72A 1LB8A 1D4NA 3TELA 2DVCA 4MBPA 1URSA 4FORA 2GHBA 3VVDA 1FTMA 3C36A 5I57B 4XKNA 1N0TA 5JEIA 4G8NA 2UVJA 3H6VA 1NNPA 5H8QB 1BKAA 3PPNA 1UTBB 1JW1A 3KFMA 1FQEA 4GQOA 4DIGA 2O7IA 2UVGA 1M5BA 3O6IA 1H44A 2I6EA 2XX7A 2Y7RA 3TCGA 1PB8A 4I1DA 2F7BA 3A09A 1Q1KA 3ZKKA 4U4SA 2O1LA 4R6YA 5DEXB 3TCHA 3DP6A 4FIMA 4ESXA 2XXWA 2DWIA 5CBSA 4FATA 2Z22A 1R1NA 3RTFB 2HXWA 4POWA 5BWJA 3OO8A 1LLSA 2RC9A 4NWDA 3R26A 4XKRA 1B7UA 2B3FA 3KOSA 2UXAA 1JVXA 3PUWE 3TZAA 1QW0A 3TODA 4HTGA 3A3UA 1M5FA 4N13A 2RF1A 4RK9A 5KDTB 1POTA 1SW4A 3C9HA 4U1ZA 5H8SA 4R75A 5H8HB 3V89B 1XHYA 3IL1B 4ZEIA 3CG1A 5TPAA 4DLDA 1TXFA 3IX1A 1M5CA 1HSJA 4EXLA 3IO4A 2O1MA 4NWCA 2H5YA 4N6PA 2Z8DA 1MXVA 1OMPA 2HZKA 1MY1A 4OQOA 4NF5A 4PFTA 4ZEDA 5I2KA 1MQIA 3IR1A 5TPAB 4QFOA 5DVIA 3OMBA 3TAJA 4MF3A 3CVGA 3KG2A 3N6UA 3T9HB 2PT2A 1Y1ZA 1AMFA 3BKIB 3PPQA 1VE4A 4EQ7A 3SEXA 4OXVA 3OEMA 2OZZA 4NF5B 3EPEA 3G3IA 1EH3A 2NUVA 4BDLA 1LAFE 3HCQA 3IOTA 3O28A 3IAZA 1CB6A 5DT6A 3KN3A 3K1PA 1MY3A 2RC7A 1FTKA 2GH9A 3PUZE 1SW2A 1Y4CA 1WDNA 1I6QA 4IO6A 1URGA 2ZNTA 4H65A 3TTKA 3KBRA 1Y3NA 4YKKA 3GXAA 1IXCA 2ALUA 1SW5A 5HPQA 1O7TA 3RUMA 1NH8A 4PFUA 5HBCA 2ABHA 1H76A 1GVCA 4F1YA 2PBWA 4ZECA 1B51A 4G8MA 4R2BA 1USYE 4EF1A 3OD7A 3Q27A 1MM7A 1T0KA 1B3EA 3FXQA 4P0GA 1B46A
chains in the Genus database with same CATH superfamily
3QYTA 2CZIA 1Q35A 1JETA 1MY2A 4G4PA 3ZKLA 4KI0E 2PFYA 4F31B 3HSTA 3MPKA 4DXUA 3KBZA 3M3FA 1A54A 3TDJA 4PC9A 2OLBA 2XWOA 3O29A 3IOVA 3VDFA 3V5AA 5AA2A 5ESYA 4OVJA 1JQFA 4OERA 4ELOA 1OQHA 3N5LA 2F78A 4GWYA 1ANFA 4ZS9A 1MM6A 3V83A 1B1HA 2DE2A 1NNTA 4DE8A 3MC2A 3E3KA 5A5XA 1MQJA 4PF6A 3T96B 5CMMA 4R72A 2I4BA 3VVFA 1A99A 4PFRA 3UA8A 3MYUA 3VLUA 4EUOA 3R7XA 1NUZA 3VLVA 4DXCA 4JBZA 4GWSA 2XXXA 5AA2B 2O69A 3KGCA 2ESNA 3RPLA 3E13X 4RPOA 1XVXA 5A5XB 5TU0A 3TYHA 4QXDA 5A5LA 1IMBA 4PDHA 2QL3A 1FQDA 5DVFA 2I4CA 3PPRA 4IY5A 3PPPA 3PMVA 1PBQA 3RPLB 3D4GA 1VR5A 1DCUA 3QK6A 4GIZA 1YYZA 1P1QA 3SEVA 4U22A 1FBPA 1MRPA 2HFBA 2AYSA 3HO7A 1FPJA 3FD3A 4OZ9A 3K1MA 1B4HA 1MQGA 2Q89A 4TLMB 4R6HA 2O6AA 5ITPA 4NN3A 5JTYA 4EXKA 2XWKA 1IIWA 3S4UA 4HS7A 1JW5A 4XEQA 3TTNA 1MPBA 1LGBC 2THIA 3FVKA 1TFDA 4JWOA 3LUYA 1IMFA 1MXYA 5AA4A 4P0IA 3FBPA 3H6TA 4YB5A 5EYGA 4P47A 4JSOA 3EKIA 4LZ7A 1MH4A 5ET6A 4O3BA 5J16A 4F29A 5IM2A 4GRKA 3OELA 5B70A 5JTYB 4H8JA 1VFDA 4NG7A 1PC3A 1B3FA 4L17A 2XX9A 5I5PA 5LOMA 3RT8A 2LAOA 3RGYA 4N4UA 2V84A 3PPOA 3M3LA 5AA4B 1P99A 5IZ3B 4MJOA 3RLFE 4F1UA 4O3CA 4H1XA 4PE5B 3RN8A 5CMBA 4GWXA 3B7DA 3FATA 1SW1A 2QMWA 2G29A 2R9JA 2WYPA 3OENA 4P1EA 2KQZA 4OA4A 5AE4A 5EHMA 3A29A 2XXPA 4NEDA 4F2QA 1XOCA 3U93A 1PBPA 4F3BA 1P1UA 2HAVA 1OLAA 1D9QA 2FBPA 2Q8JA 3VV5A 4M4GA 2XXVA 4POXA 1GTKA 4IO7A 1FBHA 1VSOA 1A40A 4LP2B 4F3SA 4ONYA 3MJNA 2HCAA 4ZEKA 4HCYA 1KWHA 2HEUA 5FBPA 4MAGA 5K2YA 2XXIA 3U92A 4E0WA 1FQBA 1YXIA 4H6DA 1LBXA 1O63A 3QSLA 4NMYA 1MPDA 5H8NA 4F18A 4JXIA 4LZ5A 2D3IA 3CFLA 1II5A 4MX6A 3E78A 3B6TA 2F5XA 1IXGA 4XFEA 2R6GE 2XXUA 3MW0A 4U21A 4G2ZA 3TTRA 2B4MA 1SI0A 1MY0A 1EZPA 4DCXA 2I48A 1AWBA 2F36A 4KHZE 2Z8FA 1B4ZA 4NX1A 3F11A 4DXBA 5H8NB 2RKMA 2DWJA 3KC0A 4BDOA 3RT6B 2I49A 3C35A 2UYFA 2Q9TA 1MQHA 2E0SA 4ZZAA 3CRBA 1B7HA 5DVJA 3W15C 4QSEA 1K9YA 3G3GA 4KCDA 5I2NA 4AS4A 4MEVA 2P3NA 3PU5A 1B2HA 4QBAA 5EHSA 2QSXA 3PMWA 3JZJA 4H5GA 2F7AA 4QSCA 3QIMA 1DTGA 4XTCQ 4WKMA 1N3XA 4I3EA 3RYDA 4Z7EA 4JVIA 2Q74A 2CZLA 4O3AA 2DVZA 3HV1A 3W9WA 1NMUA 4QRZA 2ONRA 5ICQA 4RYAA 1QUKA 5I2NB 2QVUA 3H06B 1Y9UA 3FJ7A 4XIGQ 2OJTA 2AIXA 1B1XA 3KC1A 2GRVA 1FTAA 4OEVA 3DP8A 3EHUA 2F34A 3U94A 1A55A 2FVZA 1SBPA 1LBYA 4ZE8A 4YZZA 5FHOA 3PD9A 5EQAA 4XXUA 3THIA 4NF0A 3U1OA 4FJPA 1R9LA 1SDXA 3MP6A 1B0LA 4GX3A 4KYDA 1NH7A 3BIGA 1K9ZA 3CFXA 4MNIA 2ZZVA 4MIJA 3IB0A 4P56A 1B58A 2UVHA 2ZXTA 4AB6A 1JVYA 4NF6A 3K6XA 2Z23A 1R6ZA 1NUWA 4RPNA 2VOZA 1FBDA 1I6AA 2VD2A 2BJIA 5H8FA 3C31A 3FZVA 4ZEFA 3TFLA 1EZOA 1FQFA 3MZBA 2D5WA 3I6VA 1AL3A 4R73A 1GGGA 1HSLA 1NNKA 4GBVA 2XXQA 5FTIA 3E9XA 4WEPA 4NF6B 4F22A 3JYRA 4ZDMA 1SVXB 1FJ9A 3GBAA 1H43A 2H9BA 3DLNA 3LBSA 5H8FB 4PETA 2O68A 2XHDA 1FBFA 5I2KB 3HN0A 3PV0E 4Z0IA 1FPFA 1TT1A 3KN7A 4XKQA 2F3DA 3OEKA 4O8MA 3S9MC 1CE2A 4LN5A 1MXXA 4GX4A 1OVBA 5ET5A 3N26A 3H7MA 4EQBA 1JP4A 3B6WA 3C4MA 4YICA 4X48A 2NOOA 2R71A 3FV2A 1FCKA 2RCBA 4YKIA 1PDAA 4C1UA 2XX8A 1LFGA 1TFAA 2UYEA 3MSTA 3SEUA 3TQLA 2VD3A 1S50A 1JEVA 3OO6A 3QAXA 4N6KA 4R9FA 4LONB 3ISPA 2Y5LA 2QJEA 1H45A 4QF9A 1AOVA 2XXTA 1FTOA 2F97A 1KZ8A 4E0XA 1FBCA 1B5IA 2FYIA 3CSBA 4HCWA 3SESA 5CMKA 5I7IA 1LBCA 1B40A 4JVDA 4RY1A 3KN8A 1NUXA 1DPPA 2B4LA 4YB6A 4NF4A 3EN3A 2AL5A 3K1NA 5DYHA 1MXZA 4OFOA 4PF8A 2RINA 4EF2A 3RQTA 4XF5A 1IMDA 2XXYA 1QGXA 1NI9A 3TMGA 1B3HA 5L9MA 1EYJA 3D1RA 2DSFA 4OTEA 3RTWB 3OSRA 1IZ1A 3H3GA 4U1OA 3RPWA 3OO9A 3VXBA 4I40A 3IFAA 1YPNA 3U65A 4H5FA 3MQ9A 2I3VA 2QS3A 4NF4B 1GV8A 3EF7A 3RNNA 1Z7NE 4N15A 2QPQA 4MLVA 1ZTYA 4X9TA 4QFLA 4G77A 4KQPA 5FHNA 1YTVA 1DMBA 1Y4TA 4GL0A 4NF8A 4RK2A 5CI5A 5FHMA 3KZGA 1AH5A 1ZBMA 3SETA 5AA3A 2V4CA 5I56A 3QUFA 1B3GA 2D21A 1FPIA 4RJZA 2OWTA 4YKPA 2DE3A 3BFUA 5BUUA 2XWIA 4Q8RA 3SKPA 4N8YA 4UA8A 1DSNA 1PB9A 4GLIA 4AQ4A 3VE1B 2P3VA 2F7CA 2ZYMA 4LZ8A 4NF8B 5AA2D 4YB7A 4TQUQ 1RKMA 2H99A 4F3GA 4GFRA 4DI4B 3O9PA 4C0RA 4PFYA 2H98A 2KLFA 5I56B 2DDKA 3C34A 3TTMA 1A8EA 1LFHA 2GQ1A 3IB2A 3MP8A 5CM6A 3Q29A 2XA5A 3VLWA 1USYH 4N17A 3K01A 1B6HA 4FAJA 4PGPA 1FTLA 2CZKA 2V93A 3PUXE 1LCFA 3LR1A 1FPLA 1LAGE 3H03A 1IMCA 5ITOA 1I69A 1JW4A 2P2AA 3TQWA 3BBRA 3WAEA 1NFTA 2DS9A 4X04A 1ELJA 1TWYA 2ONKE 4JDFA 1ZLQA 4LQ5A 4G68C 4BDNA 5ELVA 3VVEA 2L5VA 3T9UA 3G3JA 1QJMA 5K2XA 5F7VA 4AB5A 4RA1A 3CI8A 1EU8A 5EYFA 3JV9A 1IEJA 4R74A 2V3UA 4QHQA 5FTHA 1UTHA 4UABA 2VT5A 1LEVA 2FHYA 2HZLA 2V25A 2V3TA 3ONMA 3ECRA 1XVYA 3ZSFA 2M8CA 1Y3PA 1UIUA 1YCJA 4GWUA 1N04A 4OMBA 1DBZA 3KEIA 2KR0A 1OVTA 1IQ7A 4ZZEA 1MQDA 2REGA 1FJ6A 1LBVA 4OVQA 3IK6B 3UORA 1ATGA 1XS5A 2ANJA 3PUYE 4DZ1A 4OFJA 4QFKA 5F24A 4N8GA 3K2DA 4IB2A 4O94A 1JEUA 4TOZA 2F35A 2Y7KA 4LQ2A 1UTHB 3MP1A 3K4UA 4LUBA 2DYXA 1S7YA 4KD5A 1G0IA 2Q2AA 4OVPA 3ILUB 3HHFA 3CR9A 4HE1A 3FVOA 4N07A 4PAKA 2RCAA 2W7YA 2VP1A 3K00A 1JNFA 4THIA 3KSXA 3Q26A 2DE4A 4NTLA 3N94A 3DM0A 3GBBA 2XD2A 4IO5A 3M3KA 4P3LA 3BFTA 3DELB 2NXOA 2Q88A 4P8BA 1OQGA 2H25A 4PBHA 5CMCA 1MG1A 4MNCA 3K6WA 3EHTA 4LA9A 2OCUA 2DOJA 1MDQA 1EYKA 4JSDA 3SEYA 4FEDA 2PFZA 2YJPA 3ILTB 3OXNA 1LAHE 4IGRA 2HHMA 2WEFA 4ESWA 4IO2A 4OANA 5B7DA 2O51A 4TLLB 1UQWA 5HM4B 4GWZA 2B65A 2WBBA 3O6HA 4F39A 1IUDA 3ROJA 3GYYA 3FXBA 1BP5A 1VFEA 4G68A 5EQ8A 5I59A 4K3FA 4NHBA 2HXRA 3UP9A 3PTYA 4GOTA 1Z7ME 4ISUA 3A3CA 1G0HA 4PCDA 1SYIA 1IITA 2HPGA 4QFNA 5JK4A 3TUSA 3TKDA 3FXRA 3PUVE 5ET8A 5DEXA 3I5OA 3KJTA 5CC2A 2VHAA 2F6PA 2YPNA 2O7UA 3V8XB 2OBGA 2PCRA 4ZEBA 3PGFA 5I59B 4G68B 4GD5A 3FIRA 3P7IA 4GXSB 1WODA 3OSQA 5AA1A 1FPEA 2UVIA 1US4A 4JB7A 4IGTA 4QSDA 2FIXA 3IJXB 4QFPA 4PFIA 2Y7PA 1UIVA 1MPCA 4GXAA 1NV2A 2OWZA 1NV6A 4F1VA 3SEWA 5KDTA 2XD3A 4HXVA 5H8HA 1B7ZA 3KJ7A 4DCYA 4G61A 3B50A 3PMXA 1RDZA 4PTKA 1RDXA 3MVWA 3R6UA 1B3LA 2OWSA 4WXJA 3MVYA 4MH5A 1NV1A 4BDQA 4DDDA 3MWBA 5CRYA 1N3WA 2RC8A 3H6UA 1MH3A 3T9XB 2WKYA 1S9TA 4LVQA 2DXRA 4X1BA 3L6GA 1BIYA 4F19A 3IFCA 2REJA 1FW0A 1DTZA 3TTLA 3UN6A 2ZYOA 5IZZA 4Q0CA 3FVGA 3G7WA 4U4XA 4MCOA 2DQVA 1B05A 4OWDA 4Q30B 1PB7A 3G3HA 1IXHA 1XC1A 4PDDA 2Y5KA 3HPIA 4KYSA 3EQ1A 1D9VA 1LAXA 3O66A 4G8HA 4JWYA 1HSEA 1P1NA 4OYVA 1O64A 1NV0A 4PE3A 5EQ9A 1NV3A 2X7QA 3FASA 4HW8A 1URDA 4YMAA 4KXPA 4YAHX 2PT1A 5EQ7A 4PQJA 1P1OA 2HAUA 1Y3QA 4NAPA 4KCCA 4BDMA 3WAFA 1BLFA 5L9OA 1M5EA 3ODBA 2PYYA 1NV7A 3TCFA 1B0HA 3IOWA 4FE8A 1A8FA 3CSGA 3Q25A 4XKPA 3GLBA 5I84A 4PFBA 1N7WA 2QRYA 2QS4A 3G3KA 1ZIUA 2P0SA 1FPDA 4ELQA 1GR2A 2IA4A 4GF8A 3E4RA 4ECFA 2FIEA 5EYHA 2QMXA 2F3BA 3O97A 2XXRA 1Y20A 5TP9A 2GHAA 4YU0A 1NV4A 3CG3A 3T0JA 5ICTA 1NL5A 3MAMA 3MVXA 4OETA 2NVUB 1B32A 3ZS6A 4KR5A 1RYOA 1QKAA 2Y7IA 1MY4A 2I0BA 1P1WA 4GWOA 1POY1 2Y84A 1OIBA 4NE4A 4P9KA 5IAIA 3PD8A 4FEBA 4OVTA 1FBEA 4OESA 2JJKA 3T93B 4PGNA 4KPTA 5LTCA 1BK4A 3C33A 5TP9B 1LB9A 4N6DA 4DI3D 1SPIA 2ZNUA 3H6WA 1WVJA 1CNQA 2F6GA 2ZYKA 4WEDA 3MUQA 1B5HA 1FTJA 1B52A 2PVUA 3LC8A 4RXLA 3T22A 2QS1A 1ZMGA 3LSFB 3IJOB 3O6GA 4F2OA 3T1BA 3T9VA 1RYXA 5I58A 2NWJA 4I8CA 1A7LA 3FJGA 4U23A 2Q2CA 4X1DA 3SZPA 2B3BA 3VXCA 4R9GA 3K02A 1J1NA 2CMOA 3UK4A 3W9VA 3LSLA 3CFZA 4OVSA 3FUZA 2DP8A 2O84X 1QUIA 3MZ9A 1SYHA 4HE2A 5KCJA 2A5TA 5KZTA 3C32A 1RDYA 4PAFA 1XI6A 5J1DA 4I62A 3OOAA 1I6BA 2G93A 3L6HA 4M1VA 5I58B 2QVVA 4MHFA 4JVCA 2CEXA 1QUJA 4LATA 1LFIA 3GZGA 1AIVA 2Z8EA 2X7PA 3LSWA 4MFIA 1LCTA 3FGSA 2DXYA 1MS7A 2MKZA 3CIJA 5T3JA 1IXIA 4FECA 2E1SA 3IO6A 1N7XA 3S2VA 5KCJB 4PP0A 3TEPA 2AL4A 2A5TB 2ONSA 4IO3A 3S9LC 1BTJA 2ZYNA 1SD3A 3Q28A 3HHGA 4GVOA 4KYEA 3H4ZA 3QMFA 2PMSA 1KA0A 1N84A 2GFEA 3G3FA 3LSXA 1QVSA 1MXWA 4BDRA 4JWXA 3K0VA 3S9EA 2IEEA 4GL8A 1FRPA 1MDP1 2I0CA 2ZNSA 1D9YA 1FPGA 3S9NC 3QUJA 1Y1MA 2QS2A 3AXFA 2Y7WA 1DK4A 3TPAA 2I58A 2HQ0A 1MXUA 4IO4A 3IB1A 1ZU0A 4H45A 1YZ0A 1SI1A 2DWAA 3FV1A 1SQYA 3QXMA 3IOUA 2X26A 3K6UA 3IORA 1B9JA 1ZKBA 3MVZA 4OVRA 5IZ3A 2V3QA 5DTBA 4F3PA 3VFJA 2F8DA 4OFLA 4U2RA 1PEBA 4MNPA 3DP4A 3D4CA 1DPEA 1B5JA 4I9DA 5F1QA 2DWHA 3T66A 3O2AA 3USDA 3FXUA 5CBRA 2OK2A 1XT8A 2FA7A 1R9QA 3KSJA 1YAEA 4YMBA 1L5TA 3OO7A 4IY6A 4OHNA 5DW8A 5IKBA 3EHSA 1DOTA 3M8UA 1US5A 4EDPA 4R6KA 4R2FA 1QKBA 4KFQA 5IGAA 1H3DA 5L8DA 2XXHA 4YKJA 3SERA 1OLCA 4ELRA 4UACA 3FJMA 4O7MA 4RNSA 3B6QA 2VGQA 3KOTA 4EQ9A 1N76A 3U8QA 3FVNA 4Q5TA 1NNFA 1ZJLA 2ZZWA 4H46A 2CZHA 4HE0A 3UGWA 3HFUA 3SDFA 5M2VA 4H0WA 3UIFA 4ELPA 2H4IA 4OEUA 3RY3A 2ZMBA 4ZE9A 2A5SA 4PFWA 1NKXA 1LBBA 3K6VA 2XXKA 4FBPA 3MZ1A 5L9SA 4ND9A 2I3WA 2FNCA 4MLQA 2Q8MA 4P1LA 1EZ9A 3MPLA 4OENA 2PX1A 4BLAA 4H8IA 4H67A 1FQCA 2BJJX 2QVRA 1D3KA 3N6TA 4P11A 1FQAA 5I57A 3MBPA 4N81A 4C1TA 1F9BA 5ISUA 1Q9DA 1M5DA 2P1SA 5H8QA 2R8TA 1UTBA 2VPOA 2YLNA 3I3VA 1LSTA 1QULA 1LB8A 3U72A 1D4NA 3TELA 2DVCA 4MBPA 1FSAA 1URSA 4FORA 2GHBA 3VVDA 4X8RA 1FBGA 1FPKA 1FTMA 3C36A 5I57B 4XKNA 1N0TA 2WBDA 2QFLA 5JEIA 4G8NA 2UVJA 3H6VA 1NNPA 5H8QB 1BKAA 3PPNA 1UTBB 1JW1A 3KFMA 1FQEA 4GQOA 2O7IA 4DIGA 1VDWA 2UVGA 4PAIA 1M5BA 1IMEA 3O6IA 1H44A 2I6EA 2XX7A 2Y7RA 3TCGA 1PB8A 4I1DA 2F7BA 3A09A 1Q1KA 3ZKKA 4I3YA 4U4SA 4AS5A 2WYKA 2O1LA 4R6YA 2WX9A 5DEXB 3TCHA 5ET7A 3LUZA 3DP6A 4FIMA 4ESXA 2XXWA 2DWIA 5CBSA 4GWWA 4FATA 2Z22A 1R1NA 3RTFB 2HXWA 4POWA 5BWJA 3OO8A 1LLSA 2RC9A 4NWDA 3E79A 3R26A 4XKRA 1B7UA 2B3FA 3KOSA 2UXAA 1JVXA 5I3SA 3PUWE 3TZAA 1QW0A 3TODA 4HTGA 3A3UA 1M5FA 4N13A 2RF1A 4RK9A 1KA1A 5KDTB 1POTA 1SW4A 3C9HA 4U1ZA 5H8SA 4R75A 5H8HB 3V89B 1XHYA 3IL1B 3CHGA 4ZEIA 1EYIA 3CG1A 5TPAA 4DLDA 1TXFA 3IX1A 1M5CA 1IMAA 1HSJA 4GX6A 4EXLA 3IO4A 2O1MA 4NWCA 2H5YA 4N6PA 4IR8A 2Z8DA 1MXVA 2OX3A 1OMPA 2HZKA 1MY1A 4OQOA 4NF5A 4PFTA 4ZEDA 5I2KA 1MQIA 3IR1A 5TPAB 3B8BA 4QFOA 5DVIA 3OMBA 3LV0A 3TAJA 5IZ1A 4MF3A 3CVGA 3KG2A 3NOHA 3N6UA 4PBQA 2CEYA 3T9HB 2PT2A 4NQ8A 1Y1ZA 1AMFA 3BKIB 3PPQA 1VE4A 4EQ7A 3SEXA 4OXVA 3OEMA 3BIHA 2OZZA 4NF5B 3EPEA 3G3IA 1EH3A 4NGUA 2NUVA 4BDLA 1LAFE 3HCQA 3IOTA 3O28A 3IAZA 1CB6A 5DT6A 3KN3A 1NV5A 3K1PA 1MY3A 2RC7A 1FTKA 2GH9A 3PUZE 1SW2A 1Y4CA 1WDNA 1I6QA 4IO6A 1URGA 2ZNTA 4H65A 2ZZXA 1NUYA 3TTKA 3KBRA 1Y3NA 1INPA 4YKKA 2XWVA 3GXAA 1FPBA 1IXCA 2ALUA 4MMPA 1SW5A 5HPQA 1O7TA 4O7IA 3RUMA 1NH8A 4PFUA 5HBCA 1LBZA 4N91A 2ABHA 1H76A 1GVCA 5LDZA 4F1YA 2PBWA 4ZECA 4G8MA 4R2BA 1B51A 4GBWA 1USYE 2VPNA 4EF1A 1LBWA 3OD7A 3Q27A 1MM7A 1T0KA 1B3EA 3FXQA 4P0GA 1B46A
chains in the Genus database with same CATH topology
3QYTA 1Q35A 1JETA 1MY2A 4G4PA 3ZKLA 4KI0E 4F31B 3HSTA 3MPKA 4DXUA 3M3FA 1A54A 3TDJA 2OLBA 3O29A 3IOVA 3VDFA 3V5AA 5AA2A 4OVJA 1JQFA 4OERA 4ELOA 1OQHA 3N5LA 2F78A 1ANFA 4ZS9A 1MM6A 3V83A 1B1HA 2DE2A 1NNTA 4DE8A 3MC2A 3E3KA 5A5XA 1MQJA 3T96B 5CMMA 4R72A 2I4BA 3VVFA 1A99A 3UA8A 3VLUA 4EUOA 3R7XA 3VLVA 4DXCA 4JBZA 2XXXA 5AA2B 2O69A 3KGCA 2ESNA 3E13X 4RPOA 1XVXA 5A5XB 5TU0A 3TYHA 2QL3A 1FQDA 5DVFA 2I4CA 3PPRA 4IY5A 3PPPA 3PMVA 1PBQA 3D4GA 1VR5A 3QK6A 4GIZA 1P1QA 3SEVA 4U22A 1MRPA 2HFBA 2AYSA 3HO7A 3FD3A 4OZ9A 3K1MA 1B4HA 1MQGA 2Q89A 4TLMB 4R6HA 2O6AA 5ITPA 5JTYA 4EXKA 1IIWA 3S4UA 4HS7A 1JW5A 3TTNA 1MPBA 1LGBC 2THIA 3FVKA 1TFDA 4JWOA 3LUYA 1MXYA 5AA4A 4P0IA 3H6TA 4YB5A 4JSOA 4LZ7A 1MH4A 4O3BA 4F29A 4GRKA 3OELA 5B70A 5JTYB 4H8JA 1VFDA 1PC3A 1B3FA 4L17A 2XX9A 5LOMA 3RT8A 2LAOA 3RGYA 2V84A 3PPOA 3M3LA 5AA4B 1P99A 3RLFE 4F1UA 4O3CA 4H1XA 4PE5B 3RN8A 5CMBA 3B7DA 3FATA 1SW1A 2QMWA 2G29A 2R9JA 3OENA 5AE4A 5EHMA 2XXPA 4NEDA 4F2QA 1XOCA 3U93A 1PBPA 4F3BA 1P1UA 2HAVA 1OLAA 2Q8JA 3VV5A 4M4GA 2XXVA 4POXA 1GTKA 4IO7A 1VSOA 1A40A 4LP2B 4F3SA 4ONYA 3MJNA 2HCAA 4ZEKA 4HCYA 1KWHA 2HEUA 5K2YA 2XXIA 3U92A 4E0WA 1FQBA 4H6DA 1O63A 3QSLA 4NMYA 1MPDA 5H8NA 4F18A 4JXIA 4LZ5A 2D3IA 3CFLA 1II5A 3B6TA 2F5XA 1IXGA 2R6GE 2XXUA 3MW0A 4U21A 4G2ZA 3TTRA 1SI0A 1MY0A 1EZPA 4DCXA 2I48A 2F36A 4KHZE 2Z8FA 1B4ZA 3F11A 4DXBA 5H8NB 2RKMA 2DWJA 4BDOA 3RT6B 2I49A 3C35A 2UYFA 2Q9TA 1MQHA 2E0SA 4ZZAA 3CRBA 1B7HA 5DVJA 3W15C 4QSEA 3G3GA 4KCDA 5I2NA 3PU5A 1B2HA 5EHSA 2QSXA 3PMWA 3JZJA 4H5GA 2F7AA 4QSCA 3QIMA 1DTGA 4XTCQ 4WKMA 1N3XA 4Z7EA 2CZLA 4O3AA 2DVZA 3HV1A 3W9WA 1NMUA 4QRZA 2ONRA 5ICQA 4RYAA 1QUKA 5I2NB 3H06B 1Y9UA 3FJ7A 4XIGQ 2OJTA 2AIXA 1B1XA 2GRVA 4OEVA 3DP8A 3EHUA 2F34A 3U94A 1A55A 1SBPA 4ZE8A 4YZZA 5FHOA 3PD9A 4XXUA 3THIA 3U1OA 4FJPA 1R9LA 1SDXA 3MP6A 1B0LA 4KYDA 1NH7A 3CFXA 3IB0A 1B58A 2UVHA 2ZXTA 4AB6A 1JVYA 4NF6A 3K6XA 2Z23A 1R6ZA 4RPNA 2VOZA 1I6AA 2VD2A 5H8FA 3C31A 3FZVA 4ZEFA 3TFLA 1EZOA 1FQFA 3MZBA 2D5WA 3I6VA 1AL3A 4R73A 1GGGA 1HSLA 1NNKA 2XXQA 5FTIA 3E9XA 4WEPA 4NF6B 4F22A 3JYRA 4ZDMA 1SVXB 3GBAA 1H43A 2H9BA 3DLNA 3LBSA 5H8FB 4PETA 2O68A 2XHDA 5I2KB 3HN0A 3PV0E 4Z0IA 1TT1A 3KN7A 4XKQA 3OEKA 3S9MC 1CE2A 1MXXA 1OVBA 3N26A 3H7MA 4EQBA 3B6WA 3C4MA 4YICA 4X48A 2NOOA 2R71A 3FV2A 1FCKA 2RCBA 4YKIA 1PDAA 4C1UA 2XX8A 1LFGA 1TFAA 2UYEA 3SEUA 3TQLA 2VD3A 1S50A 1JEVA 3OO6A 3QAXA 4R9FA 4LONB 2QJEA 1H45A 4QF9A 1AOVA 2XXTA 1FTOA 2F97A 4E0XA 1B5IA 2FYIA 3CSBA 4HCWA 3SESA 5CMKA 1LBCA 1B40A 4RY1A 3KN8A 1DPPA 4YB6A 4NF4A 3EN3A 2AL5A 3K1NA 5DYHA 1MXZA 4OFOA 2RINA 4EF2A 3RQTA 2XXYA 3TMGA 1B3HA 5L9MA 2DSFA 4OTEA 3RTWB 3OSRA 1IZ1A 3H3GA 4U1OA 3RPWA 3OO9A 3VXBA 1YPNA 4H5FA 3MQ9A 2I3VA 2QS3A 4NF4B 1GV8A 3EF7A 3RNNA 1Z7NE 2QPQA 4MLVA 1ZTYA 4X9TA 4QFLA 4G77A 4KQPA 5FHNA 1YTVA 1DMBA 1Y4TA 4GL0A 4NF8A 4RK2A 5CI5A 5FHMA 3KZGA 1AH5A 1ZBMA 3SETA 5AA3A 5I56A 3QUFA 1B3GA 2D21A 4RJZA 2OWTA 4YKPA 2DE3A 3BFUA 5BUUA 4Q8RA 3SKPA 4UA8A 1DSNA 1PB9A 4GLIA 4AQ4A 3VE1B 2F7CA 2ZYMA 4LZ8A 4NF8B 5AA2D 4YB7A 4TQUQ 1RKMA 2H99A 4F3GA 4GFRA 3O9PA 4C0RA 4PFYA 2H98A 2KLFA 5I56B 3C34A 3TTMA 1A8EA 1LFHA 3IB2A 3MP8A 5CM6A 3Q29A 3VLWA 1USYH 3K01A 1B6HA 4FAJA 1FTLA 2V93A 3PUXE 1LCFA 3LR1A 1LAGE 3H03A 5ITOA 1I69A 1JW4A 2P2AA 3TQWA 3BBRA 3WAEA 1NFTA 2DS9A 1ELJA 1TWYA 2ONKE 4JDFA 1ZLQA 4LQ5A 4G68C 4BDNA 5ELVA 3VVEA 3T9UA 3G3JA 1QJMA 5K2XA 5F7VA 4AB5A 4RA1A 3CI8A 1EU8A 5EYFA 3JV9A 1IEJA 4R74A 2V3UA 4QHQA 5FTHA 1UTHA 2HZLA 2V25A 2V3TA 3ONMA 3ECRA 1XVYA 3ZSFA 2M8CA 1Y3PA 1UIUA 1YCJA 1N04A 4OMBA 3KEIA 1OVTA 1IQ7A 4ZZEA 1MQDA 2REGA 3IK6B 3UORA 1ATGA 1XS5A 2ANJA 3PUYE 4DZ1A 4OFJA 4QFKA 3K2DA 4IB2A 4TOZA 1JEUA 2F35A 2Y7KA 4LQ2A 1UTHB 3MP1A 3K4UA 4LUBA 2DYXA 1S7YA 4KD5A 2Q2AA 3ILUB 3HHFA 3CR9A 3FVOA 4N07A 2RCAA 2W7YA 2VP1A 3K00A 1JNFA 4THIA 3KSXA 3Q26A 2DE4A 4NTLA 3N94A 3DM0A 3GBBA 2XD2A 4IO5A 3M3KA 3BFTA 3DELB 2NXOA 2Q88A 1OQGA 2H25A 5CMCA 1MG1A 3K6WA 3EHTA 4LA9A 2OCUA 2DOJA 1MDQA 4JSDA 3SEYA 4FEDA 2YJPA 3ILTB 3OXNA 1LAHE 4IGRA 4ESWA 4IO2A 5B7DA 2O51A 4TLLB 1UQWA 5HM4B 2B65A 3O6HA 4F39A 1IUDA 1BP5A 1VFEA 4G68A 5I59A 4K3FA 3UP9A 4GOTA 1Z7ME 4ISUA 3A3CA 1SYIA 1IITA 4QFNA 5JK4A 3TUSA 3TKDA 3FXRA 3PUVE 5DEXA 3I5OA 3KJTA 5CC2A 2VHAA 2F6PA 2YPNA 2O7UA 3V8XB 2OBGA 4ZEBA 3PGFA 5I59B 4G68B 4GD5A 3FIRA 3P7IA 4GXSB 1WODA 3OSQA 5AA1A 2UVIA 1US4A 4JB7A 4IGTA 4QSDA 3IJXB 4QFPA 2Y7PA 1UIVA 1MPCA 4GXAA 4F1VA 3SEWA 5KDTA 2XD3A 5H8HA 1B7ZA 3KJ7A 4DCYA 3PMXA 3MVWA 3R6UA 1B3LA 2OWSA 4WXJA 3MVYA 4MH5A 4BDQA 4DDDA 3MWBA 5CRYA 1N3WA 2RC8A 3H6UA 1MH3A 3T9XB 2WKYA 1S9TA 4LVQA 2DXRA 4X1BA 3L6GA 1BIYA 4F19A 2REJA 1FW0A 1DTZA 3TTLA 3UN6A 2ZYOA 4Q0CA 3FVGA 3G7WA 4U4XA 2DQVA 1B05A 4OWDA 4Q30B 1PB7A 3G3HA 1IXHA 1XC1A 3HPIA 4KYSA 3EQ1A 1D9VA 1LAXA 3O66A 4G8HA 4JWYA 1HSEA 1P1NA 4OYVA 1O64A 2X7QA 3FASA 4HW8A 1URDA 4YMAA 4YAHX 2PT1A 4PQJA 1P1OA 2HAUA 1Y3QA 4KCCA 4BDMA 3WAFA 1BLFA 5L9OA 1M5EA 3ODBA 2PYYA 3TCFA 1B0HA 3IOWA 4FE8A 1A8FA 3CSGA 3Q25A 4XKPA 3GLBA 5I84A 1N7WA 2QRYA 2QS4A 3G3KA 1ZIUA 2P0SA 4ELQA 1GR2A 2IA4A 4GF8A 3E4RA 4ECFA 2QMXA 3O97A 2XXRA 1Y20A 5TP9A 2GHAA 4YU0A 3CG3A 5ICTA 1NL5A 3MAMA 3MVXA 4OETA 2NVUB 1B32A 3ZS6A 4KR5A 1RYOA 1QKAA 2Y7IA 1MY4A 2I0BA 1P1WA 4GWOA 1POY1 2Y84A 1OIBA 4NE4A 5IAIA 3PD8A 4FEBA 4OESA 3T93B 4KPTA 5TP9B 3C33A 1LB9A 2ZNUA 3H6WA 1WVJA 2F6GA 2ZYKA 4WEDA 3MUQA 1B5HA 1FTJA 1B52A 2PVUA 3LC8A 4RXLA 3T22A 2QS1A 1ZMGA 3LSFB 3IJOB 3O6GA 4F2OA 3T9VA 1RYXA 5I58A 2NWJA 4I8CA 1A7LA 3FJGA 4U23A 2Q2CA 4X1DA 2B3BA 3VXCA 4R9GA 3K02A 1J1NA 2CMOA 3UK4A 3W9VA 3LSLA 3CFZA 3FUZA 2DP8A 2O84X 1QUIA 3MZ9A 1SYHA 5KCJA 2A5TA 5KZTA 3C32A 5J1DA 4I62A 3OOAA 1I6BA 2G93A 3L6HA 4M1VA 5I58B 1QUJA 4LATA 1LFIA 3GZGA 1AIVA 2Z8EA 2X7PA 3LSWA 4MFIA 1LCTA 3FGSA 2DXYA 1MS7A 3CIJA 1IXIA 4FECA 2E1SA 3IO6A 1N7XA 3S2VA 5KCJB 4PP0A 3TEPA 2AL4A 2A5TB 2ONSA 4IO3A 3S9LC 1BTJA 2ZYNA 1SD3A 3Q28A 3HHGA 4GVOA 4KYEA 3H4ZA 2PMSA 1N84A 2GFEA 3G3FA 3LSXA 1QVSA 1MXWA 4BDRA 4JWXA 3K0VA 3S9EA 2IEEA 4GL8A 1MDP1 2I0CA 2ZNSA 1D9YA 3S9NC 3QUJA 1Y1MA 2QS2A 3AXFA 2Y7WA 3TPAA 2I58A 2HQ0A 1MXUA 4IO4A 3IB1A 1ZU0A 1SI1A 2DWAA 3FV1A 1SQYA 3QXMA 3IOUA 2X26A 3K6UA 3IORA 1B9JA 1ZKBA 3MVZA 2V3QA 5DTBA 4F3PA 3VFJA 2F8DA 4OFLA 4U2RA 1PEBA 3DP4A 3D4CA 1DPEA 1B5JA 4I9DA 5F1QA 2DWHA 3T66A 3O2AA 3USDA 3FXUA 5CBRA 2OK2A 1XT8A 2FA7A 1R9QA 3KSJA 1YAEA 4YMBA 1L5TA 3OO7A 4IY6A 4OHNA 5IKBA 3EHSA 1DOTA 3M8UA 1US5A 4EDPA 4R6KA 4R2FA 1QKBA 4KFQA 1H3DA 5L8DA 2XXHA 4YKJA 3SERA 1OLCA 4ELRA 4UACA 3FJMA 4RNSA 3B6QA 2VGQA 3KOTA 4EQ9A 1N76A 3U8QA 3FVNA 4Q5TA 1NNFA 1ZJLA 3UGWA 4ELPA 3SDFA 5M2VA 4H0WA 3UIFA 2H4IA 4OEUA 3RY3A 2ZMBA 4ZE9A 2A5SA 4PFWA 1NKXA 1LBBA 3K6VA 3MZ1A 5L9SA 4ND9A 2I3WA 2FNCA 4MLQA 1EZ9A 3MPLA 4OENA 2PX1A 4BLAA 4H8IA 4H67A 1FQCA 2BJJX 1D3KA 3N6TA 4P11A 1FQAA 5I57A 3MBPA 4C1TA 1F9BA 5ISUA 1M5DA 2P1SA 5H8QA 1UTBA 3I3VA 2YLNA 1LSTA 1QULA 3U72A 1LB8A 1D4NA 3TELA 2DVCA 4MBPA 1URSA 4FORA 2GHBA 3VVDA 1FTMA 3C36A 5I57B 4XKNA 1N0TA 5JEIA 4G8NA 2UVJA 3H6VA 1NNPA 5H8QB 1BKAA 3PPNA 1UTBB 1JW1A 3KFMA 1FQEA 4GQOA 4DIGA 2O7IA 2UVGA 1M5BA 3O6IA 1H44A 2I6EA 2XX7A 2Y7RA 3TCGA 1PB8A 4I1DA 2F7BA 3A09A 1Q1KA 3ZKKA 4U4SA 2O1LA 4R6YA 5DEXB 3TCHA 3DP6A 4FIMA 4ESXA 2XXWA 2DWIA 5CBSA 4FATA 2Z22A 1R1NA 3RTFB 2HXWA 4POWA 5BWJA 3OO8A 1LLSA 2RC9A 4NWDA 3R26A 4XKRA 1B7UA 2B3FA 3KOSA 2UXAA 1JVXA 3PUWE 3TZAA 1QW0A 3TODA 4HTGA 3A3UA 1M5FA 4N13A 2RF1A 4RK9A 5KDTB 1POTA 1SW4A 3C9HA 4U1ZA 5H8SA 4R75A 5H8HB 3V89B 1XHYA 3IL1B 4ZEIA 3CG1A 5TPAA 4DLDA 1TXFA 3IX1A 1M5CA 1HSJA 4EXLA 3IO4A 2O1MA 4NWCA 2H5YA 4N6PA 2Z8DA 1MXVA 1OMPA 2HZKA 1MY1A 4OQOA 4NF5A 4PFTA 4ZEDA 5I2KA 1MQIA 3IR1A 5TPAB 4QFOA 5DVIA 3OMBA 3TAJA 4MF3A 3CVGA 3KG2A 3N6UA 3T9HB 2PT2A 1Y1ZA 1AMFA 3BKIB 3PPQA 1VE4A 4EQ7A 3SEXA 4OXVA 3OEMA 2OZZA 4NF5B 3EPEA 3G3IA 1EH3A 2NUVA 4BDLA 1LAFE 3HCQA 3IOTA 3O28A 3IAZA 1CB6A 5DT6A 3KN3A 3K1PA 1MY3A 2RC7A 1FTKA 2GH9A 3PUZE 1SW2A 1Y4CA 1WDNA 1I6QA 4IO6A 1URGA 2ZNTA 4H65A 3TTKA 3KBRA 1Y3NA 4YKKA 3GXAA 1IXCA 2ALUA 1SW5A 5HPQA 1O7TA 3RUMA 1NH8A 4PFUA 5HBCA 2ABHA 1H76A 1GVCA 4F1YA 2PBWA 4ZECA 1B51A 4G8MA 4R2BA 1USYE 4EF1A 3OD7A 3Q27A 1MM7A 1T0KA 1B3EA 3FXQA 4P0GA 1B46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYT A;  1Q35 A;  1JET A;  1MY2 A;  4G4P A;  3ZKL A;  4KI0 E;  4F31 B;  3HST A;  3MPK A;  4DXU A;  3M3F A;  1A54 A;  3TDJ A;  2OLB A;  3O29 A;  3IOV A;  3VDF A;  3V5A A;  5AA2 A;  4OVJ A;  1JQF A;  4OER A;  4ELO A;  1OQH A;  3N5L A;  2F78 A;  1ANF A;  4ZS9 A;  1MM6 A;  3V83 A;  1B1H A;  2DE2 A;  1NNT A;  4DE8 A;  3MC2 A;  3E3K A;  5A5X A;  1MQJ A;  3T96 B;  5CMM A;  4R72 A;  2I4B A;  3VVF A;  1A99 A;  3UA8 A;  3VLU A;  4EUO A;  3R7X A;  3VLV A;  4DXC A;  4JBZ A;  2XXX A;  5AA2 B;  2O69 A;  3KGC A;  2ESN A;  3E13 X;  4RPO A;  1XVX A;  5A5X B;  5TU0 A;  3TYH A;  2QL3 A;  1FQD A;  5DVF A;  2I4C A;  3PPR A;  4IY5 A;  3PPP A;  3PMV A;  1PBQ A;  3D4G A;  1VR5 A;  3QK6 A;  4GIZ A;  1P1Q A;  3SEV A;  4U22 A;  1MRP A;  2HFB A;  2AYS A;  3HO7 A;  3FD3 A;  4OZ9 A;  3K1M A;  1B4H A;  1MQG A;  2Q89 A;  4TLM B;  4R6H A;  2O6A A;  5ITP A;  5JTY A;  4EXK A;  1IIW A;  3S4U A;  4HS7 A;  1JW5 A;  3TTN A;  1MPB A;  1LGB C;  2THI A;  3FVK A;  1TFD A;  4JWO A;  3LUY A;  1MXY A;  5AA4 A;  4P0I A;  3H6T A;  4YB5 A;  4JSO A;  4LZ7 A;  1MH4 A;  4O3B A;  4F29 A;  4GRK A;  3OEL A;  5B70 A;  5JTY B;  4H8J A;  1VFD A;  1PC3 A;  1B3F A;  4L17 A;  2XX9 A;  5LOM A;  3RT8 A;  2LAO A;  3RGY A;  2V84 A;  3PPO A;  3M3L A;  5AA4 B;  1P99 A;  3RLF E;  4F1U A;  4O3C A;  4H1X A;  4PE5 B;  3RN8 A;  5CMB A;  3B7D A;  3FAT A;  1SW1 A;  2QMW A;  2G29 A;  2R9J A;  3OEN A;  5AE4 A;  5EHM A;  2XXP A;  4NED A;  4F2Q A;  1XOC A;  3U93 A;  1PBP A;  4F3B A;  1P1U A;  2HAV A;  1OLA A;  2Q8J A;  3VV5 A;  4M4G A;  2XXV A;  4POX A;  1GTK A;  4IO7 A;  1VSO A;  1A40 A;  4LP2 B;  4F3S A;  4ONY A;  3MJN A;  2HCA A;  4ZEK A;  4HCY A;  1KWH A;  2HEU A;  5K2Y A;  2XXI A;  3U92 A;  4E0W A;  1FQB A;  4H6D A;  1O63 A;  3QSL A;  4NMY A;  1MPD A;  5H8N A;  4F18 A;  4JXI A;  4LZ5 A;  2D3I A;  3CFL A;  1II5 A;  3B6T A;  2F5X A;  1IXG A;  2R6G E;  2XXU A;  3MW0 A;  4U21 A;  4G2Z A;  3TTR A;  1SI0 A;  1MY0 A;  1EZP A;  4DCX A;  2I48 A;  2F36 A;  4KHZ E;  2Z8F A;  1B4Z A;  3F11 A;  4DXB A;  5H8N B;  2RKM A;  2DWJ A;  4BDO A;  3RT6 B;  2I49 A;  3C35 A;  2UYF A;  2Q9T A;  1MQH A;  2E0S A;  4ZZA A;  3CRB A;  1B7H A;  5DVJ A;  3W15 C;  4QSE A;  3G3G A;  4KCD A;  5I2N A;  3PU5 A;  1B2H A;  5EHS A;  2QSX A;  3PMW A;  3JZJ A;  4H5G A;  2F7A A;  4QSC A;  3QIM A;  1DTG A;  4XTC Q;  4WKM A;  1N3X A;  4Z7E A;  2CZL A;  4O3A A;  2DVZ A;  3HV1 A;  3W9W A;  1NMU A;  4QRZ A;  2ONR A;  5ICQ A;  4RYA A;  1QUK A;  5I2N B;  3H06 B;  1Y9U A;  3FJ7 A;  4XIG Q;  2OJT A;  2AIX A;  1B1X A;  2GRV A;  4OEV A;  3DP8 A;  3EHU A;  2F34 A;  3U94 A;  1A55 A;  1SBP A;  4ZE8 A;  4YZZ A;  5FHO A;  3PD9 A;  4XXU A;  3THI A;  3U1O A;  4FJP A;  1R9L A;  1SDX A;  3MP6 A;  1B0L A;  4KYD A;  1NH7 A;  3CFX A;  3IB0 A;  1B58 A;  2UVH A;  2ZXT A;  4AB6 A;  1JVY A;  4NF6 A;  3K6X A;  2Z23 A;  1R6Z A;  4RPN A;  2VOZ A;  1I6A A;  2VD2 A;  5H8F A;  3C31 A;  3FZV A;  4ZEF A;  3TFL A;  1EZO A;  1FQF A;  3MZB A;  2D5W A;  3I6V A;  1AL3 A;  4R73 A;  1GGG A;  1HSL A;  1NNK A;  2XXQ A;  5FTI A;  3E9X A;  4WEP A;  4NF6 B;  4F22 A;  3JYR A;  4ZDM A;  1SVX B;  3GBA A;  1H43 A;  2H9B A;  3DLN A;  3LBS A;  5H8F B;  4PET A;  2O68 A;  2XHD A;  5I2K B;  3HN0 A;  3PV0 E;  4Z0I A;  1TT1 A;  3KN7 A;  4XKQ A;  3OEK A;  3S9M C;  1CE2 A;  1MXX A;  1OVB A;  3N26 A;  3H7M A;  4EQB A;  3B6W A;  3C4M A;  4YIC A;  4X48 A;  2NOO A;  2R71 A;  3FV2 A;  1FCK A;  2RCB A;  4YKI A;  1PDA A;  4C1U A;  2XX8 A;  1LFG A;  1TFA A;  2UYE A;  3SEU A;  3TQL A;  2VD3 A;  1S50 A;  1JEV A;  3OO6 A;  3QAX A;  4R9F A;  4LON B;  2QJE A;  1H45 A;  4QF9 A;  1AOV A;  2XXT A;  1FTO A;  2F97 A;  4E0X A;  1B5I A;  2FYI A;  3CSB A;  4HCW A;  3SES A;  5CMK A;  1LBC A;  1B40 A;  4RY1 A;  3KN8 A;  1DPP A;  4YB6 A;  4NF4 A;  3EN3 A;  2AL5 A;  3K1N A;  5DYH A;  1MXZ A;  4OFO A;  2RIN A;  4EF2 A;  3RQT A;  2XXY A;  3TMG A;  1B3H A;  5L9M A;  2DSF A;  4OTE A;  3RTW B;  3OSR A;  1IZ1 A;  3H3G A;  4U1O A;  3RPW A;  3OO9 A;  3VXB A;  1YPN A;  4H5F A;  3MQ9 A;  2I3V A;  2QS3 A;  4NF4 B;  1GV8 A;  3EF7 A;  3RNN A;  1Z7N E;  2QPQ A;  4MLV A;  1ZTY A;  4X9T A;  4QFL A;  4G77 A;  4KQP A;  5FHN A;  1YTV A;  1DMB A;  1Y4T A;  4GL0 A;  4NF8 A;  4RK2 A;  5CI5 A;  5FHM A;  3KZG A;  1AH5 A;  1ZBM A;  3SET A;  5AA3 A;  5I56 A;  3QUF A;  1B3G A;  2D21 A;  4RJZ A;  2OWT A;  4YKP A;  2DE3 A;  3BFU A;  5BUU A;  4Q8R A;  3SKP A;  4UA8 A;  1DSN A;  1PB9 A;  4GLI A;  4AQ4 A;  3VE1 B;  2F7C A;  2ZYM A;  4LZ8 A;  4NF8 B;  5AA2 D;  4YB7 A;  4TQU Q;  1RKM A;  2H99 A;  4F3G A;  4GFR A;  3O9P A;  4C0R A;  4PFY A;  2H98 A;  2KLF A;  5I56 B;  3C34 A;  3TTM A;  1A8E A;  1LFH A;  3IB2 A;  3MP8 A;  5CM6 A;  3Q29 A;  3VLW A;  1USY H;  3K01 A;  1B6H A;  4FAJ A;  1FTL A;  2V93 A;  3PUX E;  1LCF A;  3LR1 A;  1LAG E;  3H03 A;  5ITO A;  1I69 A;  1JW4 A;  2P2A A;  3TQW A;  3BBR A;  3WAE A;  1NFT A;  2DS9 A;  1ELJ A;  1TWY A;  2ONK E;  4JDF A;  1ZLQ A;  4LQ5 A;  4G68 C;  4BDN A;  5ELV A;  3VVE A;  3T9U A;  3G3J A;  1QJM A;  5K2X A;  5F7V A;  4AB5 A;  4RA1 A;  3CI8 A;  1EU8 A;  5EYF A;  3JV9 A;  1IEJ A;  4R74 A;  2V3U A;  4QHQ A;  5FTH A;  1UTH A;  2HZL A;  2V25 A;  2V3T A;  3ONM A;  3ECR A;  1XVY A;  3ZSF A;  2M8C A;  1Y3P A;  1UIU A;  1YCJ A;  1N04 A;  4OMB A;  3KEI A;  1OVT A;  1IQ7 A;  4ZZE A;  1MQD A;  2REG A;  3IK6 B;  3UOR A;  1ATG A;  1XS5 A;  2ANJ A;  3PUY E;  4DZ1 A;  4OFJ A;  4QFK A;  3K2D A;  4IB2 A;  4TOZ A;  1JEU A;  2F35 A;  2Y7K A;  4LQ2 A;  1UTH B;  3MP1 A;  3K4U A;  4LUB A;  2DYX A;  1S7Y A;  4KD5 A;  2Q2A A;  3ILU B;  3HHF A;  3CR9 A;  3FVO A;  4N07 A;  2RCA A;  2W7Y A;  2VP1 A;  3K00 A;  1JNF A;  4THI A;  3KSX A;  3Q26 A;  2DE4 A;  4NTL A;  3N94 A;  3DM0 A;  3GBB A;  2XD2 A;  4IO5 A;  3M3K A;  3BFT A;  3DEL B;  2NXO A;  2Q88 A;  1OQG A;  2H25 A;  5CMC A;  1MG1 A;  3K6W A;  3EHT A;  4LA9 A;  2OCU A;  2DOJ A;  1MDQ A;  4JSD A;  3SEY A;  4FED A;  2YJP A;  3ILT B;  3OXN A;  1LAH E;  4IGR A;  4ESW A;  4IO2 A;  5B7D A;  2O51 A;  4TLL B;  1UQW A;  5HM4 B;  2B65 A;  3O6H A;  4F39 A;  1IUD A;  1BP5 A;  1VFE A;  4G68 A;  5I59 A;  4K3F A;  3UP9 A;  4GOT A;  1Z7M E;  4ISU A;  3A3C A;  1SYI A;  1IIT A;  4QFN A;  5JK4 A;  3TUS A;  3TKD A;  3FXR A;  3PUV E;  5DEX A;  3I5O A;  3KJT A;  5CC2 A;  2VHA A;  2F6P A;  2YPN A;  2O7U A;  3V8X B;  2OBG A;  4ZEB A;  3PGF A;  5I59 B;  4G68 B;  4GD5 A;  3FIR A;  3P7I A;  4GXS B;  1WOD A;  3OSQ A;  5AA1 A;  2UVI A;  1US4 A;  4JB7 A;  4IGT A;  4QSD A;  3IJX B;  4QFP A;  2Y7P A;  1UIV A;  1MPC A;  4GXA A;  4F1V A;  3SEW A;  5KDT A;  2XD3 A;  5H8H A;  1B7Z A;  3KJ7 A;  4DCY A;  3PMX A;  3MVW A;  3R6U A;  1B3L A;  2OWS A;  4WXJ A;  3MVY A;  4MH5 A;  4BDQ A;  4DDD A;  3MWB A;  5CRY A;  1N3W A;  2RC8 A;  3H6U A;  1MH3 A;  3T9X B;  2WKY A;  1S9T A;  4LVQ A;  2DXR A;  4X1B A;  3L6G A;  1BIY A;  4F19 A;  2REJ A;  1FW0 A;  1DTZ A;  3TTL A;  3UN6 A;  2ZYO A;  4Q0C A;  3FVG A;  3G7W A;  4U4X A;  2DQV A;  1B05 A;  4OWD A;  4Q30 B;  1PB7 A;  3G3H A;  1IXH A;  1XC1 A;  3HPI A;  4KYS A;  3EQ1 A;  1D9V A;  1LAX A;  3O66 A;  4G8H A;  4JWY A;  1HSE A;  1P1N A;  4OYV A;  1O64 A;  2X7Q A;  3FAS A;  4HW8 A;  1URD A;  4YMA A;  4YAH X;  2PT1 A;  4PQJ A;  1P1O A;  2HAU A;  1Y3Q A;  4KCC A;  4BDM A;  3WAF A;  1BLF A;  5L9O A;  1M5E A;  3ODB A;  2PYY A;  3TCF A;  1B0H A;  3IOW A;  4FE8 A;  1A8F A;  3CSG A;  3Q25 A;  4XKP A;  3GLB A;  5I84 A;  1N7W A;  2QRY A;  2QS4 A;  3G3K A;  1ZIU A;  2P0S A;  4ELQ A;  1GR2 A;  2IA4 A;  4GF8 A;  3E4R A;  4ECF A;  2QMX A;  3O97 A;  2XXR A;  1Y20 A;  5TP9 A;  2GHA A;  4YU0 A;  3CG3 A;  5ICT A;  1NL5 A;  3MAM A;  3MVX A;  4OET A;  2NVU B;  1B32 A;  3ZS6 A;  4KR5 A;  1RYO A;  1QKA A;  2Y7I A;  1MY4 A;  2I0B A;  1P1W A;  4GWO A;  1POY 1;  2Y84 A;  1OIB A;  4NE4 A;  5IAI A;  3PD8 A;  4FEB A;  4OES A;  3T93 B;  4KPT A;  5TP9 B;  3C33 A;  1LB9 A;  2ZNU A;  3H6W A;  1WVJ A;  2F6G A;  2ZYK A;  4WED A;  3MUQ A;  1B5H A;  1FTJ A;  1B52 A;  2PVU A;  3LC8 A;  4RXL A;  3T22 A;  2QS1 A;  1ZMG A;  3LSF B;  3IJO B;  3O6G A;  4F2O A;  3T9V A;  1RYX A;  5I58 A;  2NWJ A;  4I8C A;  1A7L A;  3FJG A;  4U23 A;  2Q2C A;  4X1D A;  2B3B A;  3VXC A;  4R9G A;  3K02 A;  1J1N A;  2CMO A;  3UK4 A;  3W9V A;  3LSL A;  3CFZ A;  3FUZ A;  2DP8 A;  2O84 X;  1QUI A;  3MZ9 A;  1SYH A;  5KCJ A;  2A5T A;  5KZT A;  3C32 A;  5J1D A;  4I62 A;  3OOA A;  1I6B A;  2G93 A;  3L6H A;  4M1V A;  5I58 B;  1QUJ A;  4LAT A;  1LFI A;  3GZG A;  1AIV A;  2Z8E A;  2X7P A;  3LSW A;  4MFI A;  1LCT A;  3FGS A;  2DXY A;  1MS7 A;  3CIJ A;  1IXI A;  4FEC A;  2E1S A;  3IO6 A;  1N7X A;  3S2V A;  5KCJ B;  4PP0 A;  3TEP A;  2AL4 A;  2A5T B;  2ONS A;  4IO3 A;  3S9L C;  1BTJ A;  2ZYN A;  1SD3 A;  3Q28 A;  3HHG A;  4GVO A;  4KYE A;  3H4Z A;  2PMS A;  1N84 A;  2GFE A;  3G3F A;  3LSX A;  1QVS A;  1MXW A;  4BDR A;  4JWX A;  3K0V A;  3S9E A;  2IEE A;  4GL8 A;  1MDP 1;  2I0C A;  2ZNS A;  1D9Y A;  3S9N C;  3QUJ A;  1Y1M A;  2QS2 A;  3AXF A;  2Y7W A;  3TPA A;  2I58 A;  2HQ0 A;  1MXU A;  4IO4 A;  3IB1 A;  1ZU0 A;  1SI1 A;  2DWA A;  3FV1 A;  1SQY A;  3QXM A;  3IOU A;  2X26 A;  3K6U A;  3IOR A;  1B9J A;  1ZKB A;  3MVZ A;  2V3Q A;  5DTB A;  4F3P A;  3VFJ A;  2F8D A;  4OFL A;  4U2R A;  1PEB A;  3DP4 A;  3D4C A;  1DPE A;  1B5J A;  4I9D A;  5F1Q A;  2DWH A;  3T66 A;  3O2A A;  3USD A;  3FXU A;  5CBR A;  2OK2 A;  1XT8 A;  2FA7 A;  1R9Q A;  3KSJ A;  1YAE A;  4YMB A;  1L5T A;  3OO7 A;  4IY6 A;  4OHN A;  5IKB A;  3EHS A;  1DOT A;  3M8U A;  1US5 A;  4EDP A;  4R6K A;  4R2F A;  1QKB A;  4KFQ A;  1H3D A;  5L8D A;  2XXH A;  4YKJ A;  3SER A;  1OLC A;  4ELR A;  4UAC A;  3FJM A;  4RNS A;  3B6Q A;  2VGQ A;  3KOT A;  4EQ9 A;  1N76 A;  3U8Q A;  3FVN A;  4Q5T A;  1NNF A;  1ZJL A;  3UGW A;  4ELP A;  3SDF A;  5M2V A;  4H0W A;  3UIF A;  2H4I A;  4OEU A;  3RY3 A;  2ZMB A;  4ZE9 A;  2A5S A;  4PFW A;  1NKX A;  1LBB A;  3K6V A;  3MZ1 A;  5L9S A;  4ND9 A;  2I3W A;  2FNC A;  4MLQ A;  1EZ9 A;  3MPL A;  4OEN A;  2PX1 A;  4BLA A;  4H8I A;  4H67 A;  1FQC A;  2BJJ X;  1D3K A;  3N6T A;  4P11 A;  1FQA A;  5I57 A;  3MBP A;  4C1T A;  1F9B A;  5ISU A;  1M5D A;  2P1S A;  5H8Q A;  1UTB A;  3I3V A;  2YLN A;  1LST A;  1QUL A;  3U72 A;  1LB8 A;  1D4N A;  3TEL A;  2DVC A;  4MBP A;  1URS A;  4FOR A;  2GHB A;  3VVD A;  1FTM A;  3C36 A;  5I57 B;  4XKN A;  1N0T A;  5JEI A;  4G8N A;  2UVJ A;  3H6V A;  1NNP A;  5H8Q B;  1BKA A;  3PPN A;  1UTB B;  1JW1 A;  3KFM A;  1FQE A;  4GQO A;  4DIG A;  2O7I A;  2UVG A;  1M5B A;  3O6I A;  1H44 A;  2I6E A;  2XX7 A;  2Y7R A;  3TCG A;  1PB8 A;  4I1D A;  2F7B A;  3A09 A;  1Q1K A;  3ZKK A;  4U4S A;  2O1L A;  4R6Y A;  5DEX B;  3TCH A;  3DP6 A;  4FIM A;  4ESX A;  2XXW A;  2DWI A;  5CBS A;  4FAT A;  2Z22 A;  1R1N A;  3RTF B;  2HXW A;  4POW A;  5BWJ A;  3OO8 A;  1LLS A;  2RC9 A;  4NWD A;  3R26 A;  4XKR A;  1B7U A;  2B3F A;  3KOS A;  2UXA A;  1JVX A;  3PUW E;  3TZA A;  1QW0 A;  3TOD A;  4HTG A;  3A3U A;  1M5F A;  4N13 A;  2RF1 A;  4RK9 A;  5KDT B;  1POT A;  1SW4 A;  3C9H A;  4U1Z A;  5H8S A;  4R75 A;  5H8H B;  3V89 B;  1XHY A;  3IL1 B;  4ZEI A;  3CG1 A;  5TPA A;  4DLD A;  1TXF A;  3IX1 A;  1M5C A;  1HSJ A;  4EXL A;  3IO4 A;  2O1M A;  4NWC A;  2H5Y A;  4N6P A;  2Z8D A;  1MXV A;  1OMP A;  2HZK A;  1MY1 A;  4OQO A;  4NF5 A;  4PFT A;  4ZED A;  5I2K A;  1MQI A;  3IR1 A;  5TPA B;  4QFO A;  5DVI A;  3OMB A;  3TAJ A;  4MF3 A;  3CVG A;  3KG2 A;  3N6U A;  3T9H B;  2PT2 A;  1Y1Z A;  1AMF A;  3BKI B;  3PPQ A;  1VE4 A;  4EQ7 A;  3SEX A;  4OXV A;  3OEM A;  2OZZ A;  4NF5 B;  3EPE A;  3G3I A;  1EH3 A;  2NUV A;  4BDL A;  1LAF E;  3HCQ A;  3IOT A;  3O28 A;  3IAZ A;  1CB6 A;  5DT6 A;  3KN3 A;  3K1P A;  1MY3 A;  2RC7 A;  1FTK A;  2GH9 A;  3PUZ E;  1SW2 A;  1Y4C A;  1WDN A;  1I6Q A;  4IO6 A;  1URG A;  2ZNT A;  4H65 A;  3TTK A;  3KBR A;  1Y3N A;  4YKK A;  3GXA A;  1IXC A;  2ALU A;  1SW5 A;  5HPQ A;  1O7T A;  3RUM A;  1NH8 A;  4PFU A;  5HBC A;  2ABH A;  1H76 A;  1GVC A;  4F1Y A;  2PBW A;  4ZEC A;  1B51 A;  4G8M A;  4R2B A;  1USY E;  4EF1 A;  3OD7 A;  3Q27 A;  1MM7 A;  1T0K A;  1B3E A;  3FXQ A;  4P0G A;  1B46 A; 
#chains in the Genus database with same CATH topology
 3QYT A;  2CZI A;  1Q35 A;  1JET A;  1MY2 A;  4G4P A;  3ZKL A;  4KI0 E;  2PFY A;  4F31 B;  3HST A;  3MPK A;  4DXU A;  3KBZ A;  3M3F A;  1A54 A;  3TDJ A;  4PC9 A;  2OLB A;  2XWO A;  3O29 A;  3IOV A;  3VDF A;  3V5A A;  5AA2 A;  5ESY A;  4OVJ A;  1JQF A;  4OER A;  4ELO A;  1OQH A;  3N5L A;  2F78 A;  4GWY A;  1ANF A;  4ZS9 A;  1MM6 A;  3V83 A;  1B1H A;  2DE2 A;  1NNT A;  4DE8 A;  3MC2 A;  3E3K A;  5A5X A;  1MQJ A;  4PF6 A;  3T96 B;  5CMM A;  4R72 A;  2I4B A;  3VVF A;  1A99 A;  4PFR A;  3UA8 A;  3MYU A;  3VLU A;  4EUO A;  3R7X A;  1NUZ A;  3VLV A;  4DXC A;  4JBZ A;  4GWS A;  2XXX A;  5AA2 B;  2O69 A;  3KGC A;  2ESN A;  3RPL A;  3E13 X;  4RPO A;  1XVX A;  5A5X B;  5TU0 A;  3TYH A;  4QXD A;  5A5L A;  1IMB A;  4PDH A;  2QL3 A;  1FQD A;  5DVF A;  2I4C A;  3PPR A;  4IY5 A;  3PPP A;  3PMV A;  1PBQ A;  3RPL B;  3D4G A;  1VR5 A;  1DCU A;  3QK6 A;  4GIZ A;  1YYZ A;  1P1Q A;  3SEV A;  4U22 A;  1FBP A;  1MRP A;  2HFB A;  2AYS A;  3HO7 A;  1FPJ A;  3FD3 A;  4OZ9 A;  3K1M A;  1B4H A;  1MQG A;  2Q89 A;  4TLM B;  4R6H A;  2O6A A;  5ITP A;  4NN3 A;  5JTY A;  4EXK A;  2XWK A;  1IIW A;  3S4U A;  4HS7 A;  1JW5 A;  4XEQ A;  3TTN A;  1MPB A;  1LGB C;  2THI A;  3FVK A;  1TFD A;  4JWO A;  3LUY A;  1IMF A;  1MXY A;  5AA4 A;  4P0I A;  3FBP A;  3H6T A;  4YB5 A;  5EYG A;  4P47 A;  4JSO A;  3EKI A;  4LZ7 A;  1MH4 A;  5ET6 A;  4O3B A;  5J16 A;  4F29 A;  5IM2 A;  4GRK A;  3OEL A;  5B70 A;  5JTY B;  4H8J A;  1VFD A;  4NG7 A;  1PC3 A;  1B3F A;  4L17 A;  2XX9 A;  5I5P A;  5LOM A;  3RT8 A;  2LAO A;  3RGY A;  4N4U A;  2V84 A;  3PPO A;  3M3L A;  5AA4 B;  1P99 A;  5IZ3 B;  4MJO A;  3RLF E;  4F1U A;  4O3C A;  4H1X A;  4PE5 B;  3RN8 A;  5CMB A;  4GWX A;  3B7D A;  3FAT A;  1SW1 A;  2QMW A;  2G29 A;  2R9J A;  2WYP A;  3OEN A;  4P1E A;  2KQZ A;  4OA4 A;  5AE4 A;  5EHM A;  3A29 A;  2XXP A;  4NED A;  4F2Q A;  1XOC A;  3U93 A;  1PBP A;  4F3B A;  1P1U A;  2HAV A;  1OLA A;  1D9Q A;  2FBP A;  2Q8J A;  3VV5 A;  4M4G A;  2XXV A;  4POX A;  1GTK A;  4IO7 A;  1FBH A;  1VSO A;  1A40 A;  4LP2 B;  4F3S A;  4ONY A;  3MJN A;  2HCA A;  4ZEK A;  4HCY A;  1KWH A;  2HEU A;  5FBP A;  4MAG A;  5K2Y A;  2XXI A;  3U92 A;  4E0W A;  1FQB A;  1YXI A;  4H6D A;  1LBX A;  1O63 A;  3QSL A;  4NMY A;  1MPD A;  5H8N A;  4F18 A;  4JXI A;  4LZ5 A;  2D3I A;  3CFL A;  1II5 A;  4MX6 A;  3E78 A;  3B6T A;  2F5X A;  1IXG A;  4XFE A;  2R6G E;  2XXU A;  3MW0 A;  4U21 A;  4G2Z A;  3TTR A;  2B4M A;  1SI0 A;  1MY0 A;  1EZP A;  4DCX A;  2I48 A;  1AWB A;  2F36 A;  4KHZ E;  2Z8F A;  1B4Z A;  4NX1 A;  3F11 A;  4DXB A;  5H8N B;  2RKM A;  2DWJ A;  3KC0 A;  4BDO A;  3RT6 B;  2I49 A;  3C35 A;  2UYF A;  2Q9T A;  1MQH A;  2E0S A;  4ZZA A;  3CRB A;  1B7H A;  5DVJ A;  3W15 C;  4QSE A;  1K9Y A;  3G3G A;  4KCD A;  5I2N A;  4AS4 A;  4MEV A;  2P3N A;  3PU5 A;  1B2H A;  4QBA A;  5EHS A;  2QSX A;  3PMW A;  3JZJ A;  4H5G A;  2F7A A;  4QSC A;  3QIM A;  1DTG A;  4XTC Q;  4WKM A;  1N3X A;  4I3E A;  3RYD A;  4Z7E A;  4JVI A;  2Q74 A;  2CZL A;  4O3A A;  2DVZ A;  3HV1 A;  3W9W A;  1NMU A;  4QRZ A;  2ONR A;  5ICQ A;  4RYA A;  1QUK A;  5I2N B;  2QVU A;  3H06 B;  1Y9U A;  3FJ7 A;  4XIG Q;  2OJT A;  2AIX A;  1B1X A;  3KC1 A;  2GRV A;  1FTA A;  4OEV A;  3DP8 A;  3EHU A;  2F34 A;  3U94 A;  1A55 A;  2FVZ A;  1SBP A;  1LBY A;  4ZE8 A;  4YZZ A;  5FHO A;  3PD9 A;  5EQA A;  4XXU A;  3THI A;  4NF0 A;  3U1O A;  4FJP A;  1R9L A;  1SDX A;  3MP6 A;  1B0L A;  4GX3 A;  4KYD A;  1NH7 A;  3BIG A;  1K9Z A;  3CFX A;  4MNI A;  2ZZV A;  4MIJ A;  3IB0 A;  4P56 A;  1B58 A;  2UVH A;  2ZXT A;  4AB6 A;  1JVY A;  4NF6 A;  3K6X A;  2Z23 A;  1R6Z A;  1NUW A;  4RPN A;  2VOZ A;  1FBD A;  1I6A A;  2VD2 A;  2BJI A;  5H8F A;  3C31 A;  3FZV A;  4ZEF A;  3TFL A;  1EZO A;  1FQF A;  3MZB A;  2D5W A;  3I6V A;  1AL3 A;  4R73 A;  1GGG A;  1HSL A;  1NNK A;  4GBV A;  2XXQ A;  5FTI A;  3E9X A;  4WEP A;  4NF6 B;  4F22 A;  3JYR A;  4ZDM A;  1SVX B;  1FJ9 A;  3GBA A;  1H43 A;  2H9B A;  3DLN A;  3LBS A;  5H8F B;  4PET A;  2O68 A;  2XHD A;  1FBF A;  5I2K B;  3HN0 A;  3PV0 E;  4Z0I A;  1FPF A;  1TT1 A;  3KN7 A;  4XKQ A;  2F3D A;  3OEK A;  4O8M A;  3S9M C;  1CE2 A;  4LN5 A;  1MXX A;  4GX4 A;  1OVB A;  5ET5 A;  3N26 A;  3H7M A;  4EQB A;  1JP4 A;  3B6W A;  3C4M A;  4YIC A;  4X48 A;  2NOO A;  2R71 A;  3FV2 A;  1FCK A;  2RCB A;  4YKI A;  1PDA A;  4C1U A;  2XX8 A;  1LFG A;  1TFA A;  2UYE A;  3MST A;  3SEU A;  3TQL A;  2VD3 A;  1S50 A;  1JEV A;  3OO6 A;  3QAX A;  4N6K A;  4R9F A;  4LON B;  3ISP A;  2Y5L A;  2QJE A;  1H45 A;  4QF9 A;  1AOV A;  2XXT A;  1FTO A;  2F97 A;  1KZ8 A;  4E0X A;  1FBC A;  1B5I A;  2FYI A;  3CSB A;  4HCW A;  3SES A;  5CMK A;  5I7I A;  1LBC A;  1B40 A;  4JVD A;  4RY1 A;  3KN8 A;  1NUX A;  1DPP A;  2B4L A;  4YB6 A;  4NF4 A;  3EN3 A;  2AL5 A;  3K1N A;  5DYH A;  1MXZ A;  4OFO A;  4PF8 A;  2RIN A;  4EF2 A;  3RQT A;  4XF5 A;  1IMD A;  2XXY A;  1QGX A;  1NI9 A;  3TMG A;  1B3H A;  5L9M A;  1EYJ A;  3D1R A;  2DSF A;  4OTE A;  3RTW B;  3OSR A;  1IZ1 A;  3H3G A;  4U1O A;  3RPW A;  3OO9 A;  3VXB A;  4I40 A;  3IFA A;  1YPN A;  3U65 A;  4H5F A;  3MQ9 A;  2I3V A;  2QS3 A;  4NF4 B;  1GV8 A;  3EF7 A;  3RNN A;  1Z7N E;  4N15 A;  2QPQ A;  4MLV A;  1ZTY A;  4X9T A;  4QFL A;  4G77 A;  4KQP A;  5FHN A;  1YTV A;  1DMB A;  1Y4T A;  4GL0 A;  4NF8 A;  4RK2 A;  5CI5 A;  5FHM A;  3KZG A;  1AH5 A;  1ZBM A;  3SET A;  5AA3 A;  2V4C A;  5I56 A;  3QUF A;  1B3G A;  2D21 A;  1FPI A;  4RJZ A;  2OWT A;  4YKP A;  2DE3 A;  3BFU A;  5BUU A;  2XWI A;  4Q8R A;  3SKP A;  4N8Y A;  4UA8 A;  1DSN A;  1PB9 A;  4GLI A;  4AQ4 A;  3VE1 B;  2P3V A;  2F7C A;  2ZYM A;  4LZ8 A;  4NF8 B;  5AA2 D;  4YB7 A;  4TQU Q;  1RKM A;  2H99 A;  4F3G A;  4GFR A;  4DI4 B;  3O9P A;  4C0R A;  4PFY A;  2H98 A;  2KLF A;  5I56 B;  2DDK A;  3C34 A;  3TTM A;  1A8E A;  1LFH A;  2GQ1 A;  3IB2 A;  3MP8 A;  5CM6 A;  3Q29 A;  2XA5 A;  3VLW A;  1USY H;  4N17 A;  3K01 A;  1B6H A;  4FAJ A;  4PGP A;  1FTL A;  2CZK A;  2V93 A;  3PUX E;  1LCF A;  3LR1 A;  1FPL A;  1LAG E;  3H03 A;  1IMC A;  5ITO A;  1I69 A;  1JW4 A;  2P2A A;  3TQW A;  3BBR A;  3WAE A;  1NFT A;  2DS9 A;  4X04 A;  1ELJ A;  1TWY A;  2ONK E;  4JDF A;  1ZLQ A;  4LQ5 A;  4G68 C;  4BDN A;  5ELV A;  3VVE A;  2L5V A;  3T9U A;  3G3J A;  1QJM A;  5K2X A;  5F7V A;  4AB5 A;  4RA1 A;  3CI8 A;  1EU8 A;  5EYF A;  3JV9 A;  1IEJ A;  4R74 A;  2V3U A;  4QHQ A;  5FTH A;  1UTH A;  4UAB A;  2VT5 A;  1LEV A;  2FHY A;  2HZL A;  2V25 A;  2V3T A;  3ONM A;  3ECR A;  1XVY A;  3ZSF A;  2M8C A;  1Y3P A;  1UIU A;  1YCJ A;  4GWU A;  1N04 A;  4OMB A;  1DBZ A;  3KEI A;  2KR0 A;  1OVT A;  1IQ7 A;  4ZZE A;  1MQD A;  2REG A;  1FJ6 A;  1LBV A;  4OVQ A;  3IK6 B;  3UOR A;  1ATG A;  1XS5 A;  2ANJ A;  3PUY E;  4DZ1 A;  4OFJ A;  4QFK A;  5F24 A;  4N8G A;  3K2D A;  4IB2 A;  4O94 A;  1JEU A;  4TOZ A;  2F35 A;  2Y7K A;  4LQ2 A;  1UTH B;  3MP1 A;  3K4U A;  4LUB A;  2DYX A;  1S7Y A;  4KD5 A;  1G0I A;  2Q2A A;  4OVP A;  3ILU B;  3HHF A;  3CR9 A;  4HE1 A;  3FVO A;  4N07 A;  4PAK A;  2RCA A;  2W7Y A;  2VP1 A;  3K00 A;  1JNF A;  4THI A;  3KSX A;  3Q26 A;  2DE4 A;  4NTL A;  3N94 A;  3DM0 A;  3GBB A;  2XD2 A;  4IO5 A;  3M3K A;  4P3L A;  3BFT A;  3DEL B;  2NXO A;  2Q88 A;  4P8B A;  1OQG A;  2H25 A;  4PBH A;  5CMC A;  1MG1 A;  4MNC A;  3K6W A;  3EHT A;  4LA9 A;  2OCU A;  2DOJ A;  1MDQ A;  1EYK A;  4JSD A;  3SEY A;  4FED A;  2PFZ A;  2YJP A;  3ILT B;  3OXN A;  1LAH E;  4IGR A;  2HHM A;  2WEF A;  4ESW A;  4IO2 A;  4OAN A;  5B7D A;  2O51 A;  4TLL B;  1UQW A;  5HM4 B;  4GWZ A;  2B65 A;  2WBB A;  3O6H A;  4F39 A;  1IUD A;  3ROJ A;  3GYY A;  3FXB A;  1BP5 A;  1VFE A;  4G68 A;  5EQ8 A;  5I59 A;  4K3F A;  4NHB A;  2HXR A;  3UP9 A;  3PTY A;  4GOT A;  1Z7M E;  4ISU A;  3A3C A;  1G0H A;  4PCD A;  1SYI A;  1IIT A;  2HPG A;  4QFN A;  5JK4 A;  3TUS A;  3TKD A;  3FXR A;  3PUV E;  5ET8 A;  5DEX A;  3I5O A;  3KJT A;  5CC2 A;  2VHA A;  2F6P A;  2YPN A;  2O7U A;  3V8X B;  2OBG A;  2PCR A;  4ZEB A;  3PGF A;  5I59 B;  4G68 B;  4GD5 A;  3FIR A;  3P7I A;  4GXS B;  1WOD A;  3OSQ A;  5AA1 A;  1FPE A;  2UVI A;  1US4 A;  4JB7 A;  4IGT A;  4QSD A;  2FIX A;  3IJX B;  4QFP A;  4PFI A;  2Y7P A;  1UIV A;  1MPC A;  4GXA A;  1NV2 A;  2OWZ A;  1NV6 A;  4F1V A;  3SEW A;  5KDT A;  2XD3 A;  4HXV A;  5H8H A;  1B7Z A;  3KJ7 A;  4DCY A;  4G61 A;  3B50 A;  3PMX A;  1RDZ A;  4PTK A;  1RDX A;  3MVW A;  3R6U A;  1B3L A;  2OWS A;  4WXJ A;  3MVY A;  4MH5 A;  1NV1 A;  4BDQ A;  4DDD A;  3MWB A;  5CRY A;  1N3W A;  2RC8 A;  3H6U A;  1MH3 A;  3T9X B;  2WKY A;  1S9T A;  4LVQ A;  2DXR A;  4X1B A;  3L6G A;  1BIY A;  4F19 A;  3IFC A;  2REJ A;  1FW0 A;  1DTZ A;  3TTL A;  3UN6 A;  2ZYO A;  5IZZ A;  4Q0C A;  3FVG A;  3G7W A;  4U4X A;  4MCO A;  2DQV A;  1B05 A;  4OWD A;  4Q30 B;  1PB7 A;  3G3H A;  1IXH A;  1XC1 A;  4PDD A;  2Y5K A;  3HPI A;  4KYS A;  3EQ1 A;  1D9V A;  1LAX A;  3O66 A;  4G8H A;  4JWY A;  1HSE A;  1P1N A;  4OYV A;  1O64 A;  1NV0 A;  4PE3 A;  5EQ9 A;  1NV3 A;  2X7Q A;  3FAS A;  4HW8 A;  1URD A;  4YMA A;  4KXP A;  4YAH X;  2PT1 A;  5EQ7 A;  4PQJ A;  1P1O A;  2HAU A;  1Y3Q A;  4NAP A;  4KCC A;  4BDM A;  3WAF A;  1BLF A;  5L9O A;  1M5E A;  3ODB A;  2PYY A;  1NV7 A;  3TCF A;  1B0H A;  3IOW A;  4FE8 A;  1A8F A;  3CSG A;  3Q25 A;  4XKP A;  3GLB A;  5I84 A;  4PFB A;  1N7W A;  2QRY A;  2QS4 A;  3G3K A;  1ZIU A;  2P0S A;  1FPD A;  4ELQ A;  1GR2 A;  2IA4 A;  4GF8 A;  3E4R A;  4ECF A;  2FIE A;  5EYH A;  2QMX A;  2F3B A;  3O97 A;  2XXR A;  1Y20 A;  5TP9 A;  2GHA A;  4YU0 A;  1NV4 A;  3CG3 A;  3T0J A;  5ICT A;  1NL5 A;  3MAM A;  3MVX A;  4OET A;  2NVU B;  1B32 A;  3ZS6 A;  4KR5 A;  1RYO A;  1QKA A;  2Y7I A;  1MY4 A;  2I0B A;  1P1W A;  4GWO A;  1POY 1;  2Y84 A;  1OIB A;  4NE4 A;  4P9K A;  5IAI A;  3PD8 A;  4FEB A;  4OVT A;  1FBE A;  4OES A;  2JJK A;  3T93 B;  4PGN A;  4KPT A;  5LTC A;  1BK4 A;  3C33 A;  5TP9 B;  1LB9 A;  4N6D A;  4DI3 D;  1SPI A;  2ZNU A;  3H6W A;  1WVJ A;  1CNQ A;  2F6G A;  2ZYK A;  4WED A;  3MUQ A;  1B5H A;  1FTJ A;  1B52 A;  2PVU A;  3LC8 A;  4RXL A;  3T22 A;  2QS1 A;  1ZMG A;  3LSF B;  3IJO B;  3O6G A;  4F2O A;  3T1B A;  3T9V A;  1RYX A;  5I58 A;  2NWJ A;  4I8C A;  1A7L A;  3FJG A;  4U23 A;  2Q2C A;  4X1D A;  3SZP A;  2B3B A;  3VXC A;  4R9G A;  3K02 A;  1J1N A;  2CMO A;  3UK4 A;  3W9V A;  3LSL A;  3CFZ A;  4OVS A;  3FUZ A;  2DP8 A;  2O84 X;  1QUI A;  3MZ9 A;  1SYH A;  4HE2 A;  5KCJ A;  2A5T A;  5KZT A;  3C32 A;  1RDY A;  4PAF A;  1XI6 A;  5J1D A;  4I62 A;  3OOA A;  1I6B A;  2G93 A;  3L6H A;  4M1V A;  5I58 B;  2QVV A;  4MHF A;  4JVC A;  2CEX A;  1QUJ A;  4LAT A;  1LFI A;  3GZG A;  1AIV A;  2Z8E A;  2X7P A;  3LSW A;  4MFI A;  1LCT A;  3FGS A;  2DXY A;  1MS7 A;  2MKZ A;  3CIJ A;  5T3J A;  1IXI A;  4FEC A;  2E1S A;  3IO6 A;  1N7X A;  3S2V A;  5KCJ B;  4PP0 A;  3TEP A;  2AL4 A;  2A5T B;  2ONS A;  4IO3 A;  3S9L C;  1BTJ A;  2ZYN A;  1SD3 A;  3Q28 A;  3HHG A;  4GVO A;  4KYE A;  3H4Z A;  3QMF A;  2PMS A;  1KA0 A;  1N84 A;  2GFE A;  3G3F A;  3LSX A;  1QVS A;  1MXW A;  4BDR A;  4JWX A;  3K0V A;  3S9E A;  2IEE A;  4GL8 A;  1FRP A;  1MDP 1;  2I0C A;  2ZNS A;  1D9Y A;  1FPG A;  3S9N C;  3QUJ A;  1Y1M A;  2QS2 A;  3AXF A;  2Y7W A;  1DK4 A;  3TPA A;  2I58 A;  2HQ0 A;  1MXU A;  4IO4 A;  3IB1 A;  1ZU0 A;  4H45 A;  1YZ0 A;  1SI1 A;  2DWA A;  3FV1 A;  1SQY A;  3QXM A;  3IOU A;  2X26 A;  3K6U A;  3IOR A;  1B9J A;  1ZKB A;  3MVZ A;  4OVR A;  5IZ3 A;  2V3Q A;  5DTB A;  4F3P A;  3VFJ A;  2F8D A;  4OFL A;  4U2R A;  1PEB A;  4MNP A;  3DP4 A;  3D4C A;  1DPE A;  1B5J A;  4I9D A;  5F1Q A;  2DWH A;  3T66 A;  3O2A A;  3USD A;  3FXU A;  5CBR A;  2OK2 A;  1XT8 A;  2FA7 A;  1R9Q A;  3KSJ A;  1YAE A;  4YMB A;  1L5T A;  3OO7 A;  4IY6 A;  4OHN A;  5DW8 A;  5IKB A;  3EHS A;  1DOT A;  3M8U A;  1US5 A;  4EDP A;  4R6K A;  4R2F A;  1QKB A;  4KFQ A;  5IGA A;  1H3D A;  5L8D A;  2XXH A;  4YKJ A;  3SER A;  1OLC A;  4ELR A;  4UAC A;  3FJM A;  4O7M A;  4RNS A;  3B6Q A;  2VGQ A;  3KOT A;  4EQ9 A;  1N76 A;  3U8Q A;  3FVN A;  4Q5T A;  1NNF A;  1ZJL A;  2ZZW A;  4H46 A;  2CZH A;  4HE0 A;  3UGW A;  3HFU A;  3SDF A;  5M2V A;  4H0W A;  3UIF A;  4ELP A;  2H4I A;  4OEU A;  3RY3 A;  2ZMB A;  4ZE9 A;  2A5S A;  4PFW A;  1NKX A;  1LBB A;  3K6V A;  2XXK A;  4FBP A;  3MZ1 A;  5L9S A;  4ND9 A;  2I3W A;  2FNC A;  4MLQ A;  2Q8M A;  4P1L A;  1EZ9 A;  3MPL A;  4OEN A;  2PX1 A;  4BLA A;  4H8I A;  4H67 A;  1FQC A;  2BJJ X;  2QVR A;  1D3K A;  3N6T A;  4P11 A;  1FQA A;  5I57 A;  3MBP A;  4N81 A;  4C1T A;  1F9B A;  5ISU A;  1Q9D A;  1M5D A;  2P1S A;  5H8Q A;  2R8T A;  1UTB A;  2VPO A;  2YLN A;  3I3V A;  1LST A;  1QUL A;  1LB8 A;  3U72 A;  1D4N A;  3TEL A;  2DVC A;  4MBP A;  1FSA A;  1URS A;  4FOR A;  2GHB A;  3VVD A;  4X8R A;  1FBG A;  1FPK A;  1FTM A;  3C36 A;  5I57 B;  4XKN A;  1N0T A;  2WBD A;  2QFL A;  5JEI A;  4G8N A;  2UVJ A;  3H6V A;  1NNP A;  5H8Q B;  1BKA A;  3PPN A;  1UTB B;  1JW1 A;  3KFM A;  1FQE A;  4GQO A;  2O7I A;  4DIG A;  1VDW A;  2UVG A;  4PAI A;  1M5B A;  1IME A;  3O6I A;  1H44 A;  2I6E A;  2XX7 A;  2Y7R A;  3TCG A;  1PB8 A;  4I1D A;  2F7B A;  3A09 A;  1Q1K A;  3ZKK A;  4I3Y A;  4U4S A;  4AS5 A;  2WYK A;  2O1L A;  4R6Y A;  2WX9 A;  5DEX B;  3TCH A;  5ET7 A;  3LUZ A;  3DP6 A;  4FIM A;  4ESX A;  2XXW A;  2DWI A;  5CBS A;  4GWW A;  4FAT A;  2Z22 A;  1R1N A;  3RTF B;  2HXW A;  4POW A;  5BWJ A;  3OO8 A;  1LLS A;  2RC9 A;  4NWD A;  3E79 A;  3R26 A;  4XKR A;  1B7U A;  2B3F A;  3KOS A;  2UXA A;  1JVX A;  5I3S A;  3PUW E;  3TZA A;  1QW0 A;  3TOD A;  4HTG A;  3A3U A;  1M5F A;  4N13 A;  2RF1 A;  4RK9 A;  1KA1 A;  5KDT B;  1POT A;  1SW4 A;  3C9H A;  4U1Z A;  5H8S A;  4R75 A;  5H8H B;  3V89 B;  1XHY A;  3IL1 B;  3CHG A;  4ZEI A;  1EYI A;  3CG1 A;  5TPA A;  4DLD A;  1TXF A;  3IX1 A;  1M5C A;  1IMA A;  1HSJ A;  4GX6 A;  4EXL A;  3IO4 A;  2O1M A;  4NWC A;  2H5Y A;  4N6P A;  4IR8 A;  2Z8D A;  1MXV A;  2OX3 A;  1OMP A;  2HZK A;  1MY1 A;  4OQO A;  4NF5 A;  4PFT A;  4ZED A;  5I2K A;  1MQI A;  3IR1 A;  5TPA B;  3B8B A;  4QFO A;  5DVI A;  3OMB A;  3LV0 A;  3TAJ A;  5IZ1 A;  4MF3 A;  3CVG A;  3KG2 A;  3NOH A;  3N6U A;  4PBQ A;  2CEY A;  3T9H B;  2PT2 A;  4NQ8 A;  1Y1Z A;  1AMF A;  3BKI B;  3PPQ A;  1VE4 A;  4EQ7 A;  3SEX A;  4OXV A;  3OEM A;  3BIH A;  2OZZ A;  4NF5 B;  3EPE A;  3G3I A;  1EH3 A;  4NGU A;  2NUV A;  4BDL A;  1LAF E;  3HCQ A;  3IOT A;  3O28 A;  3IAZ A;  1CB6 A;  5DT6 A;  3KN3 A;  1NV5 A;  3K1P A;  1MY3 A;  2RC7 A;  1FTK A;  2GH9 A;  3PUZ E;  1SW2 A;  1Y4C A;  1WDN A;  1I6Q A;  4IO6 A;  1URG A;  2ZNT A;  4H65 A;  2ZZX A;  1NUY A;  3TTK A;  3KBR A;  1Y3N A;  1INP A;  4YKK A;  2XWV A;  3GXA A;  1FPB A;  1IXC A;  2ALU A;  4MMP A;  1SW5 A;  5HPQ A;  1O7T A;  4O7I A;  3RUM A;  1NH8 A;  4PFU A;  5HBC A;  1LBZ A;  4N91 A;  2ABH A;  1H76 A;  1GVC A;  5LDZ A;  4F1Y A;  2PBW A;  4ZEC A;  4G8M A;  4R2B A;  1B51 A;  4GBW A;  1USY E;  2VPN A;  4EF1 A;  1LBW A;  3OD7 A;  3Q27 A;  1MM7 A;  1T0K A;  1B3E A;  3FXQ A;  4P0G A;  1B46 A; 
#chains in the Genus database with same CATH homology
 3QYT A;  1Q35 A;  1JET A;  1MY2 A;  4G4P A;  3ZKL A;  4KI0 E;  4F31 B;  3HST A;  3MPK A;  4DXU A;  3M3F A;  1A54 A;  3TDJ A;  2OLB A;  3O29 A;  3IOV A;  3VDF A;  3V5A A;  5AA2 A;  4OVJ A;  1JQF A;  4OER A;  4ELO A;  1OQH A;  3N5L A;  2F78 A;  1ANF A;  4ZS9 A;  1MM6 A;  3V83 A;  1B1H A;  2DE2 A;  1NNT A;  4DE8 A;  3MC2 A;  3E3K A;  5A5X A;  1MQJ A;  3T96 B;  5CMM A;  4R72 A;  2I4B A;  3VVF A;  1A99 A;  3UA8 A;  3VLU A;  4EUO A;  3R7X A;  3VLV A;  4DXC A;  4JBZ A;  2XXX A;  5AA2 B;  2O69 A;  3KGC A;  2ESN A;  3E13 X;  4RPO A;  1XVX A;  5A5X B;  5TU0 A;  3TYH A;  2QL3 A;  1FQD A;  5DVF A;  2I4C A;  3PPR A;  4IY5 A;  3PPP A;  3PMV A;  1PBQ A;  3D4G A;  1VR5 A;  3QK6 A;  4GIZ A;  1P1Q A;  3SEV A;  4U22 A;  1MRP A;  2HFB A;  2AYS A;  3HO7 A;  3FD3 A;  4OZ9 A;  3K1M A;  1B4H A;  1MQG A;  2Q89 A;  4TLM B;  4R6H A;  2O6A A;  5ITP A;  5JTY A;  4EXK A;  1IIW A;  3S4U A;  4HS7 A;  1JW5 A;  3TTN A;  1MPB A;  1LGB C;  2THI A;  3FVK A;  1TFD A;  4JWO A;  3LUY A;  1MXY A;  5AA4 A;  4P0I A;  3H6T A;  4YB5 A;  4JSO A;  4LZ7 A;  1MH4 A;  4O3B A;  4F29 A;  4GRK A;  3OEL A;  5B70 A;  5JTY B;  4H8J A;  1VFD A;  1PC3 A;  1B3F A;  4L17 A;  2XX9 A;  5LOM A;  3RT8 A;  2LAO A;  3RGY A;  2V84 A;  3PPO A;  3M3L A;  5AA4 B;  1P99 A;  3RLF E;  4F1U A;  4O3C A;  4H1X A;  4PE5 B;  3RN8 A;  5CMB A;  3B7D A;  3FAT A;  1SW1 A;  2QMW A;  2G29 A;  2R9J A;  3OEN A;  5AE4 A;  5EHM A;  2XXP A;  4NED A;  4F2Q A;  1XOC A;  3U93 A;  1PBP A;  4F3B A;  1P1U A;  2HAV A;  1OLA A;  2Q8J A;  3VV5 A;  4M4G A;  2XXV A;  4POX A;  1GTK A;  4IO7 A;  1VSO A;  1A40 A;  4LP2 B;  4F3S A;  4ONY A;  3MJN A;  2HCA A;  4ZEK A;  4HCY A;  1KWH A;  2HEU A;  5K2Y A;  2XXI A;  3U92 A;  4E0W A;  1FQB A;  4H6D A;  1O63 A;  3QSL A;  4NMY A;  1MPD A;  5H8N A;  4F18 A;  4JXI A;  4LZ5 A;  2D3I A;  3CFL A;  1II5 A;  3B6T A;  2F5X A;  1IXG A;  2R6G E;  2XXU A;  3MW0 A;  4U21 A;  4G2Z A;  3TTR A;  1SI0 A;  1MY0 A;  1EZP A;  4DCX A;  2I48 A;  2F36 A;  4KHZ E;  2Z8F A;  1B4Z A;  3F11 A;  4DXB A;  5H8N B;  2RKM A;  2DWJ A;  4BDO A;  3RT6 B;  2I49 A;  3C35 A;  2UYF A;  2Q9T A;  1MQH A;  2E0S A;  4ZZA A;  3CRB A;  1B7H A;  5DVJ A;  3W15 C;  4QSE A;  3G3G A;  4KCD A;  5I2N A;  3PU5 A;  1B2H A;  5EHS A;  2QSX A;  3PMW A;  3JZJ A;  4H5G A;  2F7A A;  4QSC A;  3QIM A;  1DTG A;  4XTC Q;  4WKM A;  1N3X A;  4Z7E A;  2CZL A;  4O3A A;  2DVZ A;  3HV1 A;  3W9W A;  1NMU A;  4QRZ A;  2ONR A;  5ICQ A;  4RYA A;  1QUK A;  5I2N B;  3H06 B;  1Y9U A;  3FJ7 A;  4XIG Q;  2OJT A;  2AIX A;  1B1X A;  2GRV A;  4OEV A;  3DP8 A;  3EHU A;  2F34 A;  3U94 A;  1A55 A;  1SBP A;  4ZE8 A;  4YZZ A;  5FHO A;  3PD9 A;  4XXU A;  3THI A;  3U1O A;  4FJP A;  1R9L A;  1SDX A;  3MP6 A;  1B0L A;  4KYD A;  1NH7 A;  3CFX A;  3IB0 A;  1B58 A;  2UVH A;  2ZXT A;  4AB6 A;  1JVY A;  4NF6 A;  3K6X A;  2Z23 A;  1R6Z A;  4RPN A;  2VOZ A;  1I6A A;  2VD2 A;  5H8F A;  3C31 A;  3FZV A;  4ZEF A;  3TFL A;  1EZO A;  1FQF A;  3MZB A;  2D5W A;  3I6V A;  1AL3 A;  4R73 A;  1GGG A;  1HSL A;  1NNK A;  2XXQ A;  5FTI A;  3E9X A;  4WEP A;  4NF6 B;  4F22 A;  3JYR A;  4ZDM A;  1SVX B;  3GBA A;  1H43 A;  2H9B A;  3DLN A;  3LBS A;  5H8F B;  4PET A;  2O68 A;  2XHD A;  5I2K B;  3HN0 A;  3PV0 E;  4Z0I A;  1TT1 A;  3KN7 A;  4XKQ A;  3OEK A;  3S9M C;  1CE2 A;  1MXX A;  1OVB A;  3N26 A;  3H7M A;  4EQB A;  3B6W A;  3C4M A;  4YIC A;  4X48 A;  2NOO A;  2R71 A;  3FV2 A;  1FCK A;  2RCB A;  4YKI A;  1PDA A;  4C1U A;  2XX8 A;  1LFG A;  1TFA A;  2UYE A;  3SEU A;  3TQL A;  2VD3 A;  1S50 A;  1JEV A;  3OO6 A;  3QAX A;  4R9F A;  4LON B;  2QJE A;  1H45 A;  4QF9 A;  1AOV A;  2XXT A;  1FTO A;  2F97 A;  4E0X A;  1B5I A;  2FYI A;  3CSB A;  4HCW A;  3SES A;  5CMK A;  1LBC A;  1B40 A;  4RY1 A;  3KN8 A;  1DPP A;  4YB6 A;  4NF4 A;  3EN3 A;  2AL5 A;  3K1N A;  5DYH A;  1MXZ A;  4OFO A;  2RIN A;  4EF2 A;  3RQT A;  2XXY A;  3TMG A;  1B3H A;  5L9M A;  2DSF A;  4OTE A;  3RTW B;  3OSR A;  1IZ1 A;  3H3G A;  4U1O A;  3RPW A;  3OO9 A;  3VXB A;  1YPN A;  4H5F A;  3MQ9 A;  2I3V A;  2QS3 A;  4NF4 B;  1GV8 A;  3EF7 A;  3RNN A;  1Z7N E;  2QPQ A;  4MLV A;  1ZTY A;  4X9T A;  4QFL A;  4G77 A;  4KQP A;  5FHN A;  1YTV A;  1DMB A;  1Y4T A;  4GL0 A;  4NF8 A;  4RK2 A;  5CI5 A;  5FHM A;  3KZG A;  1AH5 A;  1ZBM A;  3SET A;  5AA3 A;  5I56 A;  3QUF A;  1B3G A;  2D21 A;  4RJZ A;  2OWT A;  4YKP A;  2DE3 A;  3BFU A;  5BUU A;  4Q8R A;  3SKP A;  4UA8 A;  1DSN A;  1PB9 A;  4GLI A;  4AQ4 A;  3VE1 B;  2F7C A;  2ZYM A;  4LZ8 A;  4NF8 B;  5AA2 D;  4YB7 A;  4TQU Q;  1RKM A;  2H99 A;  4F3G A;  4GFR A;  3O9P A;  4C0R A;  4PFY A;  2H98 A;  2KLF A;  5I56 B;  3C34 A;  3TTM A;  1A8E A;  1LFH A;  3IB2 A;  3MP8 A;  5CM6 A;  3Q29 A;  3VLW A;  1USY H;  3K01 A;  1B6H A;  4FAJ A;  1FTL A;  2V93 A;  3PUX E;  1LCF A;  3LR1 A;  1LAG E;  3H03 A;  5ITO A;  1I69 A;  1JW4 A;  2P2A A;  3TQW A;  3BBR A;  3WAE A;  1NFT A;  2DS9 A;  1ELJ A;  1TWY A;  2ONK E;  4JDF A;  1ZLQ A;  4LQ5 A;  4G68 C;  4BDN A;  5ELV A;  3VVE A;  3T9U A;  3G3J A;  1QJM A;  5K2X A;  5F7V A;  4AB5 A;  4RA1 A;  3CI8 A;  1EU8 A;  5EYF A;  3JV9 A;  1IEJ A;  4R74 A;  2V3U A;  4QHQ A;  5FTH A;  1UTH A;  2HZL A;  2V25 A;  2V3T A;  3ONM A;  3ECR A;  1XVY A;  3ZSF A;  2M8C A;  1Y3P A;  1UIU A;  1YCJ A;  1N04 A;  4OMB A;  3KEI A;  1OVT A;  1IQ7 A;  4ZZE A;  1MQD A;  2REG A;  3IK6 B;  3UOR A;  1ATG A;  1XS5 A;  2ANJ A;  3PUY E;  4DZ1 A;  4OFJ A;  4QFK A;  3K2D A;  4IB2 A;  4TOZ A;  1JEU A;  2F35 A;  2Y7K A;  4LQ2 A;  1UTH B;  3MP1 A;  3K4U A;  4LUB A;  2DYX A;  1S7Y A;  4KD5 A;  2Q2A A;  3ILU B;  3HHF A;  3CR9 A;  3FVO A;  4N07 A;  2RCA A;  2W7Y A;  2VP1 A;  3K00 A;  1JNF A;  4THI A;  3KSX A;  3Q26 A;  2DE4 A;  4NTL A;  3N94 A;  3DM0 A;  3GBB A;  2XD2 A;  4IO5 A;  3M3K A;  3BFT A;  3DEL B;  2NXO A;  2Q88 A;  1OQG A;  2H25 A;  5CMC A;  1MG1 A;  3K6W A;  3EHT A;  4LA9 A;  2OCU A;  2DOJ A;  1MDQ A;  4JSD A;  3SEY A;  4FED A;  2YJP A;  3ILT B;  3OXN A;  1LAH E;  4IGR A;  4ESW A;  4IO2 A;  5B7D A;  2O51 A;  4TLL B;  1UQW A;  5HM4 B;  2B65 A;  3O6H A;  4F39 A;  1IUD A;  1BP5 A;  1VFE A;  4G68 A;  5I59 A;  4K3F A;  3UP9 A;  4GOT A;  1Z7M E;  4ISU A;  3A3C A;  1SYI A;  1IIT A;  4QFN A;  5JK4 A;  3TUS A;  3TKD A;  3FXR A;  3PUV E;  5DEX A;  3I5O A;  3KJT A;  5CC2 A;  2VHA A;  2F6P A;  2YPN A;  2O7U A;  3V8X B;  2OBG A;  4ZEB A;  3PGF A;  5I59 B;  4G68 B;  4GD5 A;  3FIR A;  3P7I A;  4GXS B;  1WOD A;  3OSQ A;  5AA1 A;  2UVI A;  1US4 A;  4JB7 A;  4IGT A;  4QSD A;  3IJX B;  4QFP A;  2Y7P A;  1UIV A;  1MPC A;  4GXA A;  4F1V A;  3SEW A;  5KDT A;  2XD3 A;  5H8H A;  1B7Z A;  3KJ7 A;  4DCY A;  3PMX A;  3MVW A;  3R6U A;  1B3L A;  2OWS A;  4WXJ A;  3MVY A;  4MH5 A;  4BDQ A;  4DDD A;  3MWB A;  5CRY A;  1N3W A;  2RC8 A;  3H6U A;  1MH3 A;  3T9X B;  2WKY A;  1S9T A;  4LVQ A;  2DXR A;  4X1B A;  3L6G A;  1BIY A;  4F19 A;  2REJ A;  1FW0 A;  1DTZ A;  3TTL A;  3UN6 A;  2ZYO A;  4Q0C A;  3FVG A;  3G7W A;  4U4X A;  2DQV A;  1B05 A;  4OWD A;  4Q30 B;  1PB7 A;  3G3H A;  1IXH A;  1XC1 A;  3HPI A;  4KYS A;  3EQ1 A;  1D9V A;  1LAX A;  3O66 A;  4G8H A;  4JWY A;  1HSE A;  1P1N A;  4OYV A;  1O64 A;  2X7Q A;  3FAS A;  4HW8 A;  1URD A;  4YMA A;  4YAH X;  2PT1 A;  4PQJ A;  1P1O A;  2HAU A;  1Y3Q A;  4KCC A;  4BDM A;  3WAF A;  1BLF A;  5L9O A;  1M5E A;  3ODB A;  2PYY A;  3TCF A;  1B0H A;  3IOW A;  4FE8 A;  1A8F A;  3CSG A;  3Q25 A;  4XKP A;  3GLB A;  5I84 A;  1N7W A;  2QRY A;  2QS4 A;  3G3K A;  1ZIU A;  2P0S A;  4ELQ A;  1GR2 A;  2IA4 A;  4GF8 A;  3E4R A;  4ECF A;  2QMX A;  3O97 A;  2XXR A;  1Y20 A;  5TP9 A;  2GHA A;  4YU0 A;  3CG3 A;  5ICT A;  1NL5 A;  3MAM A;  3MVX A;  4OET A;  2NVU B;  1B32 A;  3ZS6 A;  4KR5 A;  1RYO A;  1QKA A;  2Y7I A;  1MY4 A;  2I0B A;  1P1W A;  4GWO A;  1POY 1;  2Y84 A;  1OIB A;  4NE4 A;  5IAI A;  3PD8 A;  4FEB A;  4OES A;  3T93 B;  4KPT A;  5TP9 B;  3C33 A;  1LB9 A;  2ZNU A;  3H6W A;  1WVJ A;  2F6G A;  2ZYK A;  4WED A;  3MUQ A;  1B5H A;  1FTJ A;  1B52 A;  2PVU A;  3LC8 A;  4RXL A;  3T22 A;  2QS1 A;  1ZMG A;  3LSF B;  3IJO B;  3O6G A;  4F2O A;  3T9V A;  1RYX A;  5I58 A;  2NWJ A;  4I8C A;  1A7L A;  3FJG A;  4U23 A;  2Q2C A;  4X1D A;  2B3B A;  3VXC A;  4R9G A;  3K02 A;  1J1N A;  2CMO A;  3UK4 A;  3W9V A;  3LSL A;  3CFZ A;  3FUZ A;  2DP8 A;  2O84 X;  1QUI A;  3MZ9 A;  1SYH A;  5KCJ A;  2A5T A;  5KZT A;  3C32 A;  5J1D A;  4I62 A;  3OOA A;  1I6B A;  2G93 A;  3L6H A;  4M1V A;  5I58 B;  1QUJ A;  4LAT A;  1LFI A;  3GZG A;  1AIV A;  2Z8E A;  2X7P A;  3LSW A;  4MFI A;  1LCT A;  3FGS A;  2DXY A;  1MS7 A;  3CIJ A;  1IXI A;  4FEC A;  2E1S A;  3IO6 A;  1N7X A;  3S2V A;  5KCJ B;  4PP0 A;  3TEP A;  2AL4 A;  2A5T B;  2ONS A;  4IO3 A;  3S9L C;  1BTJ A;  2ZYN A;  1SD3 A;  3Q28 A;  3HHG A;  4GVO A;  4KYE A;  3H4Z A;  2PMS A;  1N84 A;  2GFE A;  3G3F A;  3LSX A;  1QVS A;  1MXW A;  4BDR A;  4JWX A;  3K0V A;  3S9E A;  2IEE A;  4GL8 A;  1MDP 1;  2I0C A;  2ZNS A;  1D9Y A;  3S9N C;  3QUJ A;  1Y1M A;  2QS2 A;  3AXF A;  2Y7W A;  3TPA A;  2I58 A;  2HQ0 A;  1MXU A;  4IO4 A;  3IB1 A;  1ZU0 A;  1SI1 A;  2DWA A;  3FV1 A;  1SQY A;  3QXM A;  3IOU A;  2X26 A;  3K6U A;  3IOR A;  1B9J A;  1ZKB A;  3MVZ A;  2V3Q A;  5DTB A;  4F3P A;  3VFJ A;  2F8D A;  4OFL A;  4U2R A;  1PEB A;  3DP4 A;  3D4C A;  1DPE A;  1B5J A;  4I9D A;  5F1Q A;  2DWH A;  3T66 A;  3O2A A;  3USD A;  3FXU A;  5CBR A;  2OK2 A;  1XT8 A;  2FA7 A;  1R9Q A;  3KSJ A;  1YAE A;  4YMB A;  1L5T A;  3OO7 A;  4IY6 A;  4OHN A;  5IKB A;  3EHS A;  1DOT A;  3M8U A;  1US5 A;  4EDP A;  4R6K A;  4R2F A;  1QKB A;  4KFQ A;  1H3D A;  5L8D A;  2XXH A;  4YKJ A;  3SER A;  1OLC A;  4ELR A;  4UAC A;  3FJM A;  4RNS A;  3B6Q A;  2VGQ A;  3KOT A;  4EQ9 A;  1N76 A;  3U8Q A;  3FVN A;  4Q5T A;  1NNF A;  1ZJL A;  3UGW A;  4ELP A;  3SDF A;  5M2V A;  4H0W A;  3UIF A;  2H4I A;  4OEU A;  3RY3 A;  2ZMB A;  4ZE9 A;  2A5S A;  4PFW A;  1NKX A;  1LBB A;  3K6V A;  3MZ1 A;  5L9S A;  4ND9 A;  2I3W A;  2FNC A;  4MLQ A;  1EZ9 A;  3MPL A;  4OEN A;  2PX1 A;  4BLA A;  4H8I A;  4H67 A;  1FQC A;  2BJJ X;  1D3K A;  3N6T A;  4P11 A;  1FQA A;  5I57 A;  3MBP A;  4C1T A;  1F9B A;  5ISU A;  1M5D A;  2P1S A;  5H8Q A;  1UTB A;  3I3V A;  2YLN A;  1LST A;  1QUL A;  3U72 A;  1LB8 A;  1D4N A;  3TEL A;  2DVC A;  4MBP A;  1URS A;  4FOR A;  2GHB A;  3VVD A;  1FTM A;  3C36 A;  5I57 B;  4XKN A;  1N0T A;  5JEI A;  4G8N A;  2UVJ A;  3H6V A;  1NNP A;  5H8Q B;  1BKA A;  3PPN A;  1UTB B;  1JW1 A;  3KFM A;  1FQE A;  4GQO A;  4DIG A;  2O7I A;  2UVG A;  1M5B A;  3O6I A;  1H44 A;  2I6E A;  2XX7 A;  2Y7R A;  3TCG A;  1PB8 A;  4I1D A;  2F7B A;  3A09 A;  1Q1K A;  3ZKK A;  4U4S A;  2O1L A;  4R6Y A;  5DEX B;  3TCH A;  3DP6 A;  4FIM A;  4ESX A;  2XXW A;  2DWI A;  5CBS A;  4FAT A;  2Z22 A;  1R1N A;  3RTF B;  2HXW A;  4POW A;  5BWJ A;  3OO8 A;  1LLS A;  2RC9 A;  4NWD A;  3R26 A;  4XKR A;  1B7U A;  2B3F A;  3KOS A;  2UXA A;  1JVX A;  3PUW E;  3TZA A;  1QW0 A;  3TOD A;  4HTG A;  3A3U A;  1M5F A;  4N13 A;  2RF1 A;  4RK9 A;  5KDT B;  1POT A;  1SW4 A;  3C9H A;  4U1Z A;  5H8S A;  4R75 A;  5H8H B;  3V89 B;  1XHY A;  3IL1 B;  4ZEI A;  3CG1 A;  5TPA A;  4DLD A;  1TXF A;  3IX1 A;  1M5C A;  1HSJ A;  4EXL A;  3IO4 A;  2O1M A;  4NWC A;  2H5Y A;  4N6P A;  2Z8D A;  1MXV A;  1OMP A;  2HZK A;  1MY1 A;  4OQO A;  4NF5 A;  4PFT A;  4ZED A;  5I2K A;  1MQI A;  3IR1 A;  5TPA B;  4QFO A;  5DVI A;  3OMB A;  3TAJ A;  4MF3 A;  3CVG A;  3KG2 A;  3N6U A;  3T9H B;  2PT2 A;  1Y1Z A;  1AMF A;  3BKI B;  3PPQ A;  1VE4 A;  4EQ7 A;  3SEX A;  4OXV A;  3OEM A;  2OZZ A;  4NF5 B;  3EPE A;  3G3I A;  1EH3 A;  2NUV A;  4BDL A;  1LAF E;  3HCQ A;  3IOT A;  3O28 A;  3IAZ A;  1CB6 A;  5DT6 A;  3KN3 A;  3K1P A;  1MY3 A;  2RC7 A;  1FTK A;  2GH9 A;  3PUZ E;  1SW2 A;  1Y4C A;  1WDN A;  1I6Q A;  4IO6 A;  1URG A;  2ZNT A;  4H65 A;  3TTK A;  3KBR A;  1Y3N A;  4YKK A;  3GXA A;  1IXC A;  2ALU A;  1SW5 A;  5HPQ A;  1O7T A;  3RUM A;  1NH8 A;  4PFU A;  5HBC A;  2ABH A;  1H76 A;  1GVC A;  4F1Y A;  2PBW A;  4ZEC A;  1B51 A;  4G8M A;  4R2B A;  1USY E;  4EF1 A;  3OD7 A;  3Q27 A;  1MM7 A;  1T0K A;  1B3E A;  3FXQ A;  4P0G A;  1B46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...