5AA4B

Crystal structure of mltf from pseudomonas aeruginosa in complex with cell-wall tetrapeptide
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
417
structure length
417
Chain Sequence
EGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFTQHLQQRLPRYESHFKQSGKQKDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F
publication title Activation by Allostery in Cell-Wall Remodeling by a Modular Membrane-Bound Lytic Transglycosylase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 145
structure length 417
sequence length 417
chains with identical sequence D
ec nomenclature ec 4.2.2.-:
pdb deposition date 2015-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa4B01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa4B02
5FHNA 4RA1A 1OQGA 3MPLA 1YCJA 2YPNA 5JTYB 3BBRA 3ZS6A 2PX1A 1LGBC 3PMWA 2IA4A 1N0TA 1Y1ZA 1Y3QA 4Q30B 1MXYA 3FJMA 4RK2A 1GTKA 2F7CA 1IITA 3O6HA 1XVXA 5H8HA 1WODA 4IGTA 1D9YA 1FTKA 4IO7A 3TZAA 1UTBB 4F18A 4GXSB 4ZEKA 2DXRA 3N6TA 4LONB 2A5TA 4JBZA 1MM7A 3R6UA 5KCJA 2RF1A 4LUBA 4OFLA 2O69A 2PYYA 3S9LC 2DS9A 3H6TA 3GBBA 3O6IA 1MXXA 1Q1KA 1Y20A 1B1XA 3K1PA 1NNFA 1PBPA 3KJTA 1NNTA 4Z0IA 1POY1 3DLNA 2HAVA 1Y9UA 1LBBA 4NWCA 2RC7A 1XOCA 3SETA 2FNCA 1DOTA 3LUYA 1XVYA 2UXAA 3TDJA 1VSOA 3LC8A 2V84A 2AIXA 4FE8A 3OEKA 4RY1A 2R9JA 1TXFA 3PUWE 2Z8DA 2XXIA 1A55A 2ZYNA 5L9MA 3CI8A 4OESA 4LZ8A 3T9UA 4NF6B 5HM4B 3K1MA 4ZE8A 4C1UA 1H45A 3KSJA 2QL3A 1NH8A 4N07A 3S9NC 1JW1A 3FIRA 1RYXA 4NF4A 4KD5A 4NTLA 1LCFA 3Q26A 3H6VA 1MG1A 4FECA 3MP1A 4GL0A 5I56B 1VR5A 3T9HB 3RT8A 3IJOB 4ESXA 1POTA 2ZNUA 2I3WA 4RXLA 4K3FA 4YMAA 4PFYA 1FQEA 1Z7NE 2D5WA 5HPQA 2ONSA 4R9FA 4I62A 1LAFE 3G3FA 1YPNA 1B0LA 2AYSA 2NVUB 3FJGA 5CBSA 3TMGA 1LAXA 2REJA 1ZLQA 3FVGA 2Y7PA 3TELA 3UIFA 4RNSA 1LBCA 2RKMA 1GR2A 1FQAA 5I59B 3OO6A 3MJNA 3E3KA 1SD3A 4QFNA 2F8DA 3K4UA 1RKMA 1ZKBA 4H6DA 2B3BA 3L6GA 4YB7A 4OHNA 1NFTA 1M5EA 5AA4A 1JETA 1A99A 4UA8A 1A40A 3N26A 3IOTA 3ZKKA 3OD7A 4P0GA 5DEXA 1USYH 3VV5A 1MH4A 4EXLA 3R26A 3TKDA 2XXHA 4U4SA 5CMMA 1IXCA 4ZEBA 1UIUA 4F3GA 4P0IA 5BUUA 5AA1A 1NNPA 4YU0A 1Y4CA 4LZ7A 5F7VA 4H67A 1R9QA 4NE4A 3EHTA 3VVFA 1FTJA 2QS3A 2R6GE 2Y7RA 2Y7IA 3D4CA 1I6AA 4H1XA 3RY3A 1P1UA 1B7UA 3ODBA 5KDTB 1M5DA 5CMKA 5FHOA 1SDXA 2NWJA 3Q27A 3CVGA 1LFIA 5ELVA 1D9VA 4F39A 5DVIA 4FJPA 1N3XA 2OWTA 4E0WA 5I58B 3FV1A 4ONYA 4G4PA 3Q25A 2DVCA 2DSFA 3FASA 2XXPA 4M1VA 1QW0A 4IGRA 1XC1A 1B0HA 1UTHA 1FTMA 3HO7A 3USDA 2VOZA 1P1QA 1DTGA 3SDFA 3A3CA 3Q28A 4EF1A 3TQLA 3FVOA 4TLLB 2Y7KA 1S7YA 1B2HA 3RUMA 1XHYA 4YMBA 4ZEFA 4U22A 4PQJA 3HN0A 4PFWA 2THIA 3ILUB 1LCTA 4I8CA 4AB6A 1PB7A 3TFLA 4N6PA 2UVIA 4KCDA 4WXJA 3OO8A 1Y3PA 3TUSA 3CG1A 3G3HA 4U21A 3AXFA 4YB6A 3VE1B 4KI0E 3HHFA 4YKKA 4RK9A 4HW8A 3IB0A 3HCQA 2YLNA 3KG2A 1A7LA 5EYFA 4XXUA 4H8JA 3HV1A 3U1OA 3Q29A 3HSTA 4FATA 1MY4A 3TTRA 2DXYA 4G68A 2GH9A 4IO4A 1LB8A 4R6YA 3CFZA 1MH3A 1N7WA 4E0XA 3PU5A 3MVYA 2P1SA 5ITOA 4POXA 2F5XA 5H8SA 1MQHA 2HQ0A 1B3GA 3DP8A 3SEYA 3S4UA 3MBPA 2H5YA 4POWA 2X26A 1FW0A 5TPAB 2O84X 1FCKA 4GLIA 4QSCA 4JWYA 1QKBA 4KYSA 1VE4A 2Q2CA 4QSEA 4TOZA 1NMUA 5TU0A 4NF8B 1AL3A 1P1WA 1MDQA 2I3VA 1OVBA 3FATA 4RJZA 2AL5A 3U94A 1KWHA 3TEPA 5AA2B 4WEPA 1IZ1A 3G3IA 4OENA 4KHZE 2M8CA 1JW4A 2O51A 4OYVA 3DELB 1N04A 2XX8A 1Y1MA 4GL8A 1QUKA 2O1MA 5I2NA 1US4A 2XXRA 1GGGA 3K02A 1B5IA 3RNNA 3G3GA 3K6WA 4ZS9A 3UA8A 2X7QA 5DT6A 3EN3A 3C36A 3FXRA 4X48A 5KCJB 3MZBA 2Y7WA 1FQFA 1EZ9A 3RGYA 3PV0E 3DP4A 5I57A 2HEUA 4GRKA 2O1LA 4G2ZA 4LVQA 4ZEDA 3OMBA 4IY6A 3VVEA 5H8NA 2RCBA 4H8IA 2DQVA 4YICA 4HCWA 3FXUA 5IKBA 3K2DA 3OENA 1MY3A 2B65A 3O9PA 2GHAA 2NUVA 3F11A 2OCUA 3G3KA 3RN8A 1SVXB 1MPBA 3C4MA 2REGA 2DWJA 3H03A 2QSXA 2UVGA 4IB2A 1I6BA 2ZYMA 3FV2A 3OO9A 1URGA 1DPPA 3FGSA 2FYIA 2QS4A 2OLBA 3IJXB 3EHUA 4QFKA 4DCYA 3EQ1A 4ELRA 2DE4A 1II5A 3KBRA 4UACA 2HZKA 1USYE 2P0SA 3SESA 4OWDA 3MWBA 4YKPA 2PVUA 4TLMB 2ANJA 3KOTA 2RCAA 4KYDA 3IX1A 4R6KA 5BWJA 4JWOA 3ZSFA 4X1DA 3BFTA 1JQFA 4NF5B 1GVCA 3UGWA 4NWDA 3QAXA 4C1TA 1JEVA 3H6UA 3KN3A 2WKYA 4DE8A 4EDPA 4KYEA 2Z22A 3MP8A 1ZMGA 4MLVA 4U23A 4DXBA 5CI5A 5EHMA 2XXUA 2OJTA 2RC8A 2RINA 4RPNA 5I2KB 2VP1A 4H0WA 1URSA 3CR9A 4R72A 5JTYA 4DXCA 1MQIA 3LR1A 3U72A 3OELA 4R74A 3CSGA 1A8EA 3TPAA 4DDDA 3OXNA 4GFRA 2DE2A 3IK6B 4FORA 1US5A 4PFUA 4OVJA 4U2RA 4O3BA 3OEMA 1F9BA 2HFBA 3VFJA 4ND9A 5DVFA 1UTBA 2H99A 5JK4A 1LB9A 1SI1A 1MDP1 4BDOA 4F3PA 4LQ5A 2Q2AA 3TTKA 1OIBA 5CBRA 4YKIA 3IOVA 1UIVA 4WKMA 3O66A 3PMXA 4NEDA 5K2XA 2ESNA 3VVDA 1ANFA 3KOSA 3TAJA 3HPIA 4JSDA 3O97A 3TTLA 1SW5A 1BP5A 2HCAA 4KFQA 4QFOA 4LATA 1IXGA 1ZTYA 1PB9A 4H65A 3C9HA 4RPOA 2OZZA 3SKPA 4AQ4A 4MF3A 3OOAA 2G29A 3TODA 4NMYA 3O2AA 3I6VA 3RTFB 3PMVA 4DXUA 4PP0A 1MY0A 3MVXA 4R75A 3I3VA 2QRYA 3UP9A 3VLUA 4JSOA 1MXWA 1PDAA 3TTNA 2H4IA 3SEVA 3E4RA 4YKJA 5DVJA 2UVHA 4NF6A 2R71A 3PUZE 1IXHA 3W15C 3W9VA 1MPDA 3TYHA 2V25A 4GOTA 1CB6A 1NH7A 2O6AA 3BKIB 4YZZA 2Z23A 3VXCA 3B6WA 5I56A 1O7TA 2AL4A 3DM0A 3GXAA 4C0RA 1HSJA 1O64A 5EHSA 1XT8A 2Y84A 2IEEA 3GLBA 4BDRA 1D4NA 1N3WA 1R6ZA 4GIZA 2BJJX 4G8MA 2RC9A 3PPOA 1H44A 4KQPA 4QFPA 2Q9TA 5A5XB 1S50A 1B40A 3V5AA 5TP9B 2F34A 1TT1A 2PT1A 1P99A 3S9EA 3ZKLA 3KJ7A 4I1DA 1PC3A 3FD3A 2HZLA 3MPKA 1WDNA 3CRBA 3WAFA 3SEUA 1TWYA 4P11A 3OO7A 4IO5A 1A54A 2PT2A 4PFTA 3GBAA 5H8QB 4H5FA 3S9MC 1QJMA 5JEIA 2I49A 2V93A 5FTIA 3O28A 1WVJA 3VDFA 2W7YA 1AOVA 4MLQA 5ICTA 1OLAA 3OSQA 2DOJA 1B58A 1N76A 4DIGA 4BDNA 3UK4A 1B52A 1ZIUA 5CC2A 3U8QA 3V89B 2O7UA 3QYTA 4R2BA 1AMFA 1IUDA 3K6VA 1SYHA 4JXIA 2V3UA 3FXQA 4R6HA 3T22A 2OBGA 3C34A 3U92A 1B1HA 1N84A 2O68A 5KDTA 2DWAA 1L5TA 3LSWA 1B32A 4EUOA 3IOWA 3C33A 4GD5A 2XXVA 1JVYA 1JVXA 1IQ7A 3I5OA 5F1QA 1B46A 3EPEA 4ZEIA 2I48A 4DZ1A 5I58A 1A8FA 3PPQA 2G93A 3FJ7A 1Y3NA 3N6UA 4FEBA 1NL5A 2CZLA 5H8NB 1SW4A 3IOUA 5AA2D 4OERA 3U93A 1B05A 1FQCA 4DCXA 4OEUA 4L17A 1B5JA 4Q8RA 5H8FA 3UN6A 4U1ZA 1MM6A 1JNFA 1T0KA 2F35A 3V8XB 5ISUA 3E9XA 5CMBA 4Q5TA 4G8HA 4MBPA 2XD3A 1MXUA 3E13X 4GWOA 4HCYA 3K0VA 5H8HB 1VFEA 3M3KA 1YTVA 1FQBA 1OLCA 1TFDA 3O6GA 3P7IA 3PUYE 2QMWA 2A5TB 1O63A 2DYXA 1B9JA 3N94A 3IB2A 4XKRA 4Z7EA 3QIMA 3GZGA 2DWHA 1QULA 3MVZA 3FVKA 4EXKA 1B3HA 3W9WA 4ZZAA 1LAHE 3CFXA 2A5SA 3IB1A 1Z7ME 1ELJA 1HSLA 3H7MA 1LFHA 4KR5A 3C32A 4XKNA 5IAIA 3KSXA 2F7AA 2DP8A 3KGCA 4OMBA 1LFGA 2QPQA 1LSTA 4BLAA 1MQJA 3KN8A 1PEBA 2PMSA 1M5FA 1MQDA 1HSEA 4KCCA 4RYAA 1B3LA 4MH5A 4F1YA 4EQBA 3TCFA 3D4GA 2D21A 1DMBA 3LBSA 4HTGA 4NF8A 5KZTA 4O3AA 1SBPA 4OTEA 3K6XA 1SI0A 2ONRA 3B7DA 3BFUA 4F3SA 2XD2A 3TCHA 2KLFA 5AA2A 3LSLA 3QUJA 4OFOA 1MXZA 4NF4B 4ESWA 2GRVA 4XIGQ 4QRZA 1B51A 3H3GA 2DE3A 3MZ1A 5J1DA 4IO2A 5B7DA 4F1UA 4QHQA 2XX7A 4MFIA 4ZECA 3V83A 2I6EA 3T9XB 3A3UA 4GF8A 1D3KA 3MP6A 4OEVA 3H4ZA 1B6HA 4IO3A 3PPRA 4BDMA 4LA9A 1M5BA 2V3TA 1MPCA 3G7WA 4LP2B 3M8UA 3PD9A 4QF9A 5ICQA 1OVTA 1QUIA 1FTLA 1BKAA 2ZMBA 4EQ7A 2OK2A 3L6HA 4FIMA 4U4XA 5LOMA 2QMXA 1UQWA 3MW0A 1ZJLA 2GHBA 3PPNA 2ZNTA 1Y4TA 3S2VA 2F78A 5DTBA 3ILTB 4GQOA 5AA4B 1P1OA 3VLWA 3IAZA 5DEXB 4QFLA 5AE4A 2B3FA 2ONKE 2F7BA 2F6GA 5FHMA 3B6TA 2F6PA 3WAEA 3IL1B 3LSFB 4M4GA 1JEUA 3T93B 3IORA 3TQWA 1BTJA 1SW1A 3JYRA 2NOOA 3KEIA 1B3FA 4XKPA 3DP6A 5FTHA 2NXOA 1URDA 4JDFA 1ZBMA 3CFLA 1EH3A 4NF5A 4N13A 2VGQA 1SYIA 4G8NA 3IO4A 2XXYA 1CE2A 4Q0CA 4ZE9A 1XS5A 5L9SA 4G68C 2X7PA 3T9VA 2I58A 3PUXE 4X1BA 4YAHX 2Q89A 2HXWA 1DTZA 2UVJA 2Z8EA 4R73A 3C31A 2F36A 5HBCA 5I2KA 1MRPA 3T96B 1B4HA 3PD8A 4F31B 3B6QA 3LSXA 1UTHB 2XXTA 2I0CA 4FEDA 1N7XA 1J1NA 1R9LA 1H3DA 1B5HA 4OFJA 2OWSA 1B7HA 1EU8A 1ATGA 1I69A 2E0SA 4U1OA 4F19A 2YJPA 3KFMA 2VD3A 4OZ9A 4ELPA 3PUVE 3CG3A 4G77A 3JV9A 4PE5B 1YAEA 4R2FA 2CMOA 3FZVA 5AA3A 2HAUA 4X9TA 1B3EA 2H98A 2QS1A 1SQYA 3N5LA 4AB5A 1PBQA 1S9TA 3RTWB 1MXVA 3R7XA 2XX9A 3TTMA 1B4ZA 3PPPA 1OQHA 1LLSA 3MAMA 3M3FA 3SEXA 3MQ9A 2DVZA 5CM6A 1P1NA 5I59A 4ISUA 4ZDMA 3EF7A 4G68B 3K6UA 4F2OA 3SEWA 3K1NA 1DSNA 2DWIA 5CRYA 4BDQA 1PB8A 3JZJA 1H43A 4DLDA 1QUJA 1SW2A 5M2VA 2D3IA 2XXQA 4LQ2A 1FQDA 2PBWA 1IIWA 1MY2A 4JWXA 1BIYA 2FA7A 4OQOA 2ZNSA 3HHGA 4H5GA 2UYEA 1MQGA 4HS7A 5H8FB 3QXMA 5ITPA 3C35A 1IEJA 3VXBA 3MC2A 4JB7A 1MY1A 4KPTA 2ZYOA 4ECFA 1NNKA 1ZU0A 4XKQA 4LZ5A 4IY5A 4R9GA 1AH5A 3T66A 4BDLA 5DYHA 2I4CA 2XXWA 5I2NB 2P2AA 4I9DA 4OETA 3H06B 4PETA 3MUQA 2Q8JA 1OMPA 4FAJA 4F3BA 5A5XA 4QSDA 5TP9A 4ZZEA 1JW5A 1VFDA 5I57B 3OSRA 5L9OA 3RLFE 1MS7A 3QK6A 1BLFA 3FUZA 2V3QA 2QJEA 2I0BA 1B7ZA 5L8DA 4THIA 4GXAA 1AIVA 1H76A 2Q88A 3FVNA 5CMCA 3TCGA 5H8QA 3IO6A 1EZPA 4GVOA 3IR1A 1IXIA 1RYOA 1I6QA 3QUFA 3THIA 3M3LA 4F29A 2E1SA 2ALUA 3RT6B 2Z8FA 4EF2A 2H25A 4TQUQ 1DPEA 3UORA 4ELQA 3RQTA 5K2YA 3G3JA 3KZGA 2VHAA 4O3CA 3KN7A 4XTCQ 3MVWA 3RPWA 4WEDA 2LAOA 1LAGE 3ONMA 2ZXTA 3K00A 4OXVA 1QKAA 2VD2A 1GV8A 2I4BA 3K01A 3ECRA 3SERA 3A09A 3H6WA 2UYFA 3O29A 3CIJA 1EZOA 3QSLA 3MZ9A 1NKXA 2O7IA 1QVSA 3EHSA 3CSBA 5I84A 2H9BA 2ZYKA 1R1NA 5B70A 4IO6A 1FTOA 3PGFA 4F22A 2ABHA 1TFAA 4YB5A 2XXXA 1Q35A 2F97A 1M5CA 4ELOA 4EQ9A 2GFEA 3VLVA 2XHDA 4F2QA 4F1VA 2QS2A 5TPAA
chains in the Genus database with same CATH superfamily
5FHNA 4RA1A 5F24A 1OQGA 3MPLA 1YCJA 2CZKA 4GWUA 5EQAA 2YPNA 5JTYB 3BBRA 3ZS6A 2PX1A 4NF0A 1LGBC 3PMWA 2IA4A 1N0TA 1Y1ZA 1Y3QA 4Q30B 1MXYA 3FJMA 4RK2A 1GTKA 2F7CA 1IITA 3O6HA 4AS4A 1XVXA 5H8HA 1WODA 4IGTA 1D9YA 1FTKA 4O8MA 1SPIA 4MCOA 4IO7A 3TZAA 1UTBB 4F18A 4GXSB 4ZEKA 1LEVA 2DXRA 3N6TA 4LONB 2A5TA 4JBZA 5IZ3A 2WYKA 1MM7A 3HFUA 3R6UA 5KCJA 2L5VA 2RF1A 4LUBA 4NGUA 4OFLA 2O69A 2PYYA 3S9LC 2DS9A 3H6TA 1EYKA 1FTAA 1KA0A 3GBBA 3O6IA 1MXXA 1Q1KA 1Y20A 3CHGA 1B1XA 3K1PA 1NNFA 1PBPA 3KJTA 1NNTA 1K9ZA 1POY1 3DLNA 4Z0IA 4NX1A 2HAVA 1Y9UA 1LBBA 4NWCA 2RC7A 1XOCA 3SETA 1IMAA 2FNCA 1DOTA 3LUYA 4MNPA 1XVYA 2UXAA 3TDJA 1VSOA 3LC8A 4GX6A 4MHFA 2V84A 2AIXA 4FE8A 3OEKA 4NAPA 4RY1A 2R9JA 1TXFA 3PUWE 2Z8DA 2XXIA 1A55A 4MMPA 2ZYNA 5L9MA 1IMFA 3CI8A 2Y5LA 4OESA 5IZ1A 4LZ8A 3T9UA 2XWKA 4NF6B 5HM4B 3K1MA 1FPBA 4ZE8A 4C1UA 1H45A 3KSJA 4I3EA 2QL3A 2WBBA 1NH8A 4MNIA 4N07A 3S9NC 1JW1A 3FIRA 1RYXA 4O7IA 4NF4A 4KD5A 4NTLA 1LCFA 3Q26A 3H6VA 1MG1A 4FECA 3MP1A 4GL0A 5I56B 1VR5A 3T9HB 3RT8A 4PE3A 3IJOB 4ESXA 2ZZVA 1POTA 2ZNUA 2I3WA 4RXLA 4K3FA 4YMAA 4PFYA 1FQEA 1Z7NE 2D5WA 2CEYA 5HPQA 2ONSA 4R9FA 4I62A 1LAFE 3G3FA 1YPNA 1B0LA 2AYSA 2NVUB 2BJIA 3FJGA 5CBSA 3TMGA 1LAXA 2REJA 1ZLQA 3FVGA 2Y7PA 3TELA 5ET7A 3UIFA 4RNSA 1LBCA 1FBHA 2RKMA 1GR2A 4P56A 1FQAA 5I59B 3OO6A 2WEFA 4N8YA 3MJNA 3D1RA 3E3KA 1SD3A 4QFNA 2F8DA 3K4UA 1RKMA 1ZKBA 4H6DA 1YXIA 3U65A 2B3BA 3L6GA 4YB7A 4GX3A 4OHNA 1NFTA 1M5EA 4FBPA 5AA4A 1JETA 1A99A 4UA8A 1RDXA 2XWOA 1A40A 3N26A 3IOTA 3ZKKA 3OD7A 4P0GA 5DEXA 1USYH 3VV5A 1MH4A 4EXLA 3R26A 3TKDA 1FPIA 2XXHA 4U4SA 5CMMA 1IXCA 4ZEBA 1YYZA 2XWVA 1UIUA 4F3GA 4P0IA 5BUUA 5AA1A 1NNPA 4YU0A 1Y4CA 4LZ7A 5F7VA 4H67A 1R9QA 4N17A 4NE4A 3EHTA 3VVFA 1FTJA 2QS3A 2R6GE 2Y7RA 2Y7IA 4GWXA 3D4CA 1I6AA 4H1XA 3RY3A 1P1UA 1B7UA 3ODBA 5KDTB 1M5DA 5CMKA 5FHOA 1SDXA 2NWJA 3Q27A 3CVGA 1LFIA 5ELVA 1D9VA 4F39A 5DVIA 1NUXA 4FJPA 4PDDA 1N3XA 2OWTA 1FPDA 4E0WA 5I58B 3FV1A 4ONYA 4G4PA 3Q25A 2DVCA 1NV6A 2DSFA 3FASA 2HPGA 2XXPA 4M1VA 1QW0A 1G0HA 4IGRA 1XC1A 1B0HA 1UTHA 1FTMA 3HO7A 3USDA 2VOZA 1P1QA 1DTGA 3SDFA 3A3CA 1FPEA 3Q28A 4EF1A 3ISPA 3TQLA 3FVOA 2GQ1A 1VDWA 4TLLB 4N6DA 2Y7KA 1S7YA 1B2HA 3RUMA 1XHYA 1AWBA 3SZPA 4PF6A 4YMBA 4ZEFA 4U22A 4PQJA 3HN0A 4PFWA 1D9QA 2THIA 3ILUB 1LCTA 4I8CA 4AB6A 1PB7A 4XF5A 3TFLA 4N6PA 2UVIA 2Q74A 4KCDA 4WXJA 3OO8A 1Y3PA 3TUSA 3CG1A 3G3HA 4U21A 3AXFA 4YB6A 3VE1B 4KI0E 3HHFA 4YKKA 4RK9A 4HW8A 3IB0A 2F3DA 3HCQA 2V4CA 1LBWA 1Q9DA 2YLNA 4PFRA 3KG2A 1A7LA 5EYFA 4XXUA 4H8JA 3HV1A 3U1OA 3Q29A 3HSTA 4FATA 1MY4A 2FIXA 3TTRA 1FPJA 2DXYA 4G68A 2GH9A 4IO4A 1LB8A 4R6YA 3CFZA 3RPLA 1MH3A 1N7WA 4E0XA 3PU5A 3MVYA 2P1SA 5ITOA 4POXA 2F5XA 5H8SA 4P1EA 1MQHA 2HQ0A 1B3GA 3DP8A 3SEYA 3LUZA 3S4UA 3MBPA 2H5YA 4POWA 2X26A 1FW0A 5TPAB 2O84X 1FCKA 4GLIA 4QSCA 4QXDA 4JWYA 1QKBA 3BIHA 1VE4A 2Q2CA 3A29A 4KYSA 1NMUA 4QSEA 4TOZA 5TU0A 4NF8B 1AL3A 1P1WA 4GX4A 1MDQA 2I3VA 4O7MA 1OVBA 3FATA 4RJZA 2AL5A 3PTYA 3U94A 1KWHA 3TEPA 5AA2B 3T1BA 4WEPA 1IZ1A 3G3IA 4OENA 4NG7A 4KHZE 2M8CA 1JW4A 2O51A 4OYVA 1FBEA 3DELB 1N04A 2XX8A 5LDZA 1Y1MA 4GL8A 1QUKA 4JVDA 2O1MA 5I2NA 1US4A 2XXRA 1GGGA 3K02A 1B5IA 3RNNA 3G3GA 3K6WA 4ZS9A 3UA8A 2X7QA 5DT6A 3EN3A 3C36A 3FXRA 4X48A 5KCJB 3MZBA 2Y7WA 1FQFA 1EZ9A 3RGYA 1LBZA 3PV0E 3DP4A 5I57A 2HEUA 2PFYA 4GRKA 2O1LA 4G2ZA 4LVQA 5T3JA 4ZEDA 3OMBA 4IY6A 1NV0A 3VVEA 5H8NA 2RCBA 4H8IA 2DQVA 5I5PA 4PAKA 1FPGA 4YICA 2KR0A 4HCWA 4G61A 3FXUA 5IKBA 3K2DA 3OENA 1MY3A 2B65A 3O9PA 1RDYA 2GHAA 2NUVA 3BIGA 3F11A 2OCUA 3G3KA 5IZZA 3RN8A 1SVXB 1MPBA 3C4MA 2REGA 2DWJA 3H03A 2QSXA 2CEXA 2UVGA 4IB2A 1I6BA 2ZYMA 3FV2A 3OO9A 1URGA 1DPPA 3FGSA 2FYIA 2QS4A 4HE0A 2OLBA 3IJXB 3B8BA 3EHUA 4QFKA 4DCYA 3EQ1A 4ELRA 2DE4A 2FHYA 1II5A 3KBRA 4UACA 2HZKA 1USYE 2KQZA 2P0SA 3SESA 2WX9A 4OWDA 3MWBA 2PVUA 4TLMB 4YKPA 2ANJA 3KOTA 2RCAA 4KYDA 3IX1A 4PGPA 4R6KA 5BWJA 4JWOA 3ZSFA 4X1DA 3BFTA 4MEVA 1JQFA 4NF5B 1GVCA 3UGWA 4NWDA 4N4UA 3QAXA 4C1TA 1JEVA 3H6UA 3KN3A 2WKYA 4DE8A 4EDPA 4KYEA 2Z22A 3MP8A 4OVPA 1ZMGA 3IFAA 4MLVA 4U23A 4DXBA 1DCUA 5CI5A 2Q8MA 1KZ8A 5EHMA 2XXUA 2OJTA 2RC8A 2RINA 4RPNA 5I2KB 2VP1A 4H0WA 1URSA 1QGXA 3CR9A 4R72A 5JTYA 3E79A 5EYHA 4DXCA 1MQIA 2CZIA 3LR1A 3U72A 3OELA 4R74A 3CSGA 1A8EA 3TPAA 4DDDA 3OXNA 4GFRA 2DE2A 3IK6B 4FORA 1US5A 4PFUA 4OVJA 4U2RA 4O3BA 3OEMA 1F9BA 2HFBA 3VFJA 4ND9A 5DVFA 1UTBA 2VT5A 2H99A 5JK4A 1LB9A 1EYIA 1SI1A 1MDP1 4BDOA 2B4LA 4F3PA 4LQ5A 2Q2AA 3TTKA 1OIBA 5CBRA 4OVTA 4YKIA 3IOVA 1UIVA 4JVIA 4WKMA 3O66A 3PMXA 4NEDA 5K2XA 2ESNA 3VVDA 1NUYA 1ANFA 3KOSA 3TAJA 3HPIA 4JSDA 5FBPA 3O97A 3TTLA 5EQ7A 1SW5A 2ZZWA 1BP5A 2HCAA 4KFQA 4QFOA 4LATA 1IXGA 1ZTYA 3KC0A 1PB9A 4H65A 3C9HA 1DK4A 4RPOA 2OZZA 3SKPA 4AQ4A 4MF3A 3OOAA 2G29A 3TODA 4NMYA 3O2AA 3I6VA 3RTFB 3PMVA 4DXUA 4PP0A 5ESYA 1MY0A 3MVXA 4R75A 4HXVA 3I3VA 2QRYA 3UP9A 3VLUA 4JSOA 4P8BA 2WBDA 1MXWA 1PDAA 3TTNA 2H4IA 3SEVA 3E4RA 4YKJA 5DVJA 2UVHA 4PF8A 4NF6A 2R71A 4GBWA 3PUZE 4IR8A 1IXHA 3W15C 3W9VA 1MPDA 3TYHA 2V25A 4GOTA 1CB6A 1NH7A 2O6AA 3BKIB 4PBHA 4YZZA 3KC1A 2Z23A 3VXCA 3B6WA 5I56A 1O7TA 2AL4A 3DM0A 4KXPA 4LN5A 3GXAA 4C0RA 1HSJA 1O64A 5EHSA 1XT8A 2Y84A 2IEEA 4MJOA 3GLBA 4BDRA 1D4NA 1N3WA 1R6ZA 4GIZA 1BK4A 2BJJX 2QFLA 4G8MA 2RC9A 3PPOA 1H44A 4KQPA 4QFPA 2Q9TA 1IMDA 5A5XB 1G0IA 1S50A 1B40A 4GBVA 3V5AA 5TP9B 2F34A 1TT1A 2PT1A 1P99A 3S9EA 3ZKLA 3KJ7A 1FJ9A 4I1DA 1PC3A 3FD3A 2HZLA 3MPKA 1WDNA 3CRBA 3WAFA 4GWWA 3SEUA 1TWYA 4P11A 3OO7A 5EQ9A 4IO5A 1A54A 2PT2A 4PFTA 2F3BA 3GBAA 5H8QB 4H5FA 3S9MC 1QJMA 5JEIA 2I49A 2V93A 5FTIA 3O28A 1WVJA 3VDFA 5EQ8A 2Y5KA 2PCRA 2XA5A 2W7YA 1AOVA 4MLQA 4HE2A 5ICTA 1OLAA 3OSQA 2DOJA 1B58A 1N76A 4DI3D 4DIGA 4BDNA 3UK4A 1B52A 1ZIUA 5CC2A 3U8QA 1NUZA 3V89B 2O7UA 3QYTA 4R2BA 1AMFA 1IUDA 4N6KA 3K6VA 1SYHA 5A5LA 4PAIA 4OVSA 4AS5A 4JXIA 4X04A 2V3UA 3FXQA 4R6HA 3T22A 2OBGA 3C34A 4MIJA 3U92A 1B1HA 1N84A 1NI9A 2O68A 5KDTA 2DWAA 1L5TA 4NN3A 3LSWA 1B32A 4EUOA 3IOWA 3C33A 4GD5A 2XXVA 1JVYA 1FPLA 1JVXA 1IQ7A 3I5OA 5F1QA 1B46A 3EPEA 4ZEIA 2I48A 4DZ1A 5I58A 1A8FA 3PPQA 2G93A 3FJ7A 1Y3NA 3N6UA 4FEBA 1NL5A 2CZLA 5H8NB 1SW4A 2ZZXA 3IOUA 5AA2D 4OERA 3U93A 1B05A 1FQCA 5IGAA 4DCXA 4OEUA 4L17A 1B5JA 4Q8RA 5H8FA 2QVVA 3UN6A 5J16A 1KA1A 4U1ZA 4I3YA 1MM6A 1JNFA 1T0KA 2F35A 1FBCA 3V8XB 5ISUA 3E9XA 5CMBA 4Q5TA 4G8HA 4MBPA 2XD3A 1MXUA 3E13X 4GWOA 4HCYA 3K0VA 5H8HB 1VFEA 3M3KA 1YTVA 1NV3A 5EYGA 1FQBA 1OLCA 1TFDA 3O6GA 3B50A 3P7IA 3PUYE 2QMWA 2A5TB 4DI4B 1O63A 2DYXA 1B9JA 3N94A 5IZ3B 3IB2A 4XKRA 4Z7EA 3QIMA 3GZGA 2DWHA 2XWIA 1QULA 3MVZA 3FVKA 1EYJA 4EXKA 1B3HA 3W9WA 4ZZAA 1LAHE 4P3LA 3CFXA 2A5SA 3IB1A 1Z7ME 1ELJA 1HSLA 3H7MA 1LFHA 4KR5A 3RYDA 3C32A 4OANA 4XKNA 5IAIA 1LBYA 3KSXA 2F7AA 2DP8A 3KGCA 4OMBA 1LFGA 2QPQA 1INPA 1LSTA 1MQJA 4BLAA 3KN8A 1PEBA 2PMSA 1M5FA 1MQDA 4PCDA 4N91A 1HSEA 4KCCA 4RYAA 1B3LA 4MH5A 4F1YA 4EQBA 2MKZA 3TCFA 3D4GA 2D21A 1DMBA 3LBSA 4HTGA 4NF8A 5KZTA 1LBVA 4O3AA 1SBPA 4OTEA 4MNCA 1JP4A 4GWSA 3K6XA 1SI0A 2ONRA 3B7DA 3BFUA 4F3SA 1K9YA 2XD2A 3TCHA 2KLFA 5AA2A 4N15A 3LSLA 3QUJA 4OFOA 1MXZA 4NF4B 4ESWA 2GRVA 4XIGQ 4QRZA 1B51A 3H3GA 2DE3A 3MZ1A 5J1DA 4IO2A 5B7DA 2FBPA 4F1UA 4QHQA 2XX7A 4P47A 4HE1A 4MFIA 4ZECA 3V83A 2HHMA 2DDKA 2I6EA 3T9XB 3A3UA 4GF8A 1D3KA 4XFEA 3MP6A 4OEVA 3H4ZA 1B6HA 3FBPA 4IO3A 3PPRA 4BDMA 4LA9A 1M5BA 2V3TA 1MPCA 2JJKA 4PAFA 3G7WA 4LP2B 3M8UA 2WYPA 3PD9A 4QF9A 5ICQA 1OVTA 1QUIA 1NV7A 1FTLA 1FBGA 1BKAA 2ZMBA 1YZ0A 4EQ7A 2OK2A 3L6HA 4FIMA 4U4XA 5LOMA 2QMXA 3QMFA 1UQWA 3MW0A 5IM2A 4GWZA 1ZJLA 2GHBA 3PPNA 2ZNTA 1Y4TA 3S2VA 2F78A 5DTBA 4XEQA 4OVQA 1RDZA 3ILTB 4GQOA 5AA4B 2XXKA 1P1OA 3VLWA 3IAZA 5DEXB 4QFLA 5AE4A 2B3FA 2ONKE 2F7BA 5ET8A 2F6GA 5FHMA 3B6TA 2FVZA 2F6PA 3WAEA 3IL1B 3LSFB 4M4GA 1IMEA 1JEUA 3T93B 3MSTA 3IORA 3TQWA 1BTJA 1SW1A 3JYRA 2NOOA 3KEIA 4OA4A 1B3FA 4XKPA 3DP6A 5FTHA 2VPNA 2NXOA 1URDA 4JDFA 1ZBMA 3CFLA 1EH3A 4NF5A 3ROJA 1FPFA 4N13A 2VGQA 1SYIA 4G8NA 3IO4A 2XXYA 1CE2A 4Q0CA 4ZE9A 1XS5A 5L9SA 1DBZA 4G68C 3NOHA 4O94A 2X7PA 3T9VA 2I58A 3PUXE 4X1BA 4YAHX 2QVRA 2R8TA 2QVUA 2Q89A 2HXWA 1DTZA 2UVJA 4P9KA 2Z8EA 4R73A 5LTCA 3C31A 2F36A 5HBCA 4PFBA 1MRPA 5I2KA 3T96B 4GWYA 1B4HA 3PD8A 4F31B 4PTKA 3B6QA 3LSXA 1UTHB 2XXTA 3LV0A 2I0CA 4FEDA 3FXBA 1N7XA 1J1NA 1R9LA 1H3DA 1B5HA 4OFJA 2OWSA 1B7HA 1EU8A 1ATGA 1I69A 2E0SA 4U1OA 1NV2A 5I7IA 4F19A 2YJPA 1XI6A 3KFMA 2VD3A 2OX3A 4OZ9A 2P3NA 1LBXA 2HXRA 4ELPA 3PUVE 3CG3A 4G77A 3JV9A 1NV4A 4PE5B 1YAEA 4R2FA 1NUWA 2CMOA 3FZVA 5AA3A 2HAUA 5ET6A 4UABA 2PFZA 4X9TA 1B3EA 2H98A 2QS1A 1SQYA 4PFIA 3N5LA 4AB5A 1PBQA 1S9TA 3RTWB 3MYUA 1MXVA 3R7XA 2XX9A 3TTMA 4I40A 4MX6A 1B4ZA 3PPPA 1OQHA 1LLSA 3MAMA 4PC9A 3KBZA 3M3FA 3SEXA 3MQ9A 2DVZA 5CM6A 1P1NA 5I59A 4ISUA 4ZDMA 4NQ8A 4PBQA 3EF7A 4G68B 3E78A 3K6UA 4F2OA 3SEWA 3K1NA 3RPLB 1DSNA 2DWIA 5CRYA 4BDQA 1PB8A 3JZJA 1H43A 4DLDA 2FIEA 1QUJA 1SW2A 5M2VA 2D3IA 2XXQA 4LQ2A 1FBPA 1FQDA 1NV5A 2PBWA 1IIWA 1MY2A 4JWXA 1BIYA 2FA7A 4OQOA 2ZNSA 3T0JA 1IMCA 4PGNA 3HHGA 4H5GA 2UYEA 2OWZA 1MQGA 4HS7A 5H8FB 4N8GA 3QXMA 4X8RA 5ITPA 3C35A 1FJ6A 1IEJA 3VXBA 4NHBA 4PDHA 1IMBA 3MC2A 4JB7A 1MY1A 4QBAA 4KPTA 2ZYOA 4ECFA 1NNKA 1ZU0A 4XKQA 4LZ5A 4IY5A 4R9GA 1AH5A 3T66A 4BDLA 5DYHA 2I4CA 2XXWA 5I2NB 2P2AA 4I9DA 4OETA 3H06B 4PETA 3MUQA 2Q8JA 1OMPA 4FAJA 4F3BA 5A5XA 4QSDA 5TP9A 4ZZEA 5I3SA 4H46A 1FBFA 1JW5A 1VFDA 5I57B 3OSRA 5L9OA 4N81A 3RLFE 4OVRA 1FBDA 1MS7A 3QK6A 1BLFA 5DW8A 1FSAA 3FUZA 2V3QA 2QJEA 2I0BA 3GYYA 1B7ZA 5L8DA 4THIA 4GXAA 1AIVA 1H76A 2Q88A 1FRPA 3FVNA 5CMCA 3TCGA 5H8QA 3IO6A 1EZPA 4GVOA 3IR1A 1IXIA 1RYOA 1I6QA 3QUFA 5ET5A 3THIA 3M3LA 4F29A 1NV1A 2E1SA 2ALUA 3RT6B 2Z8FA 4EF2A 2H25A 4TQUQ 4JVCA 1DPEA 4MAGA 3UORA 4ELQA 3RQTA 5K2YA 1CNQA 3G3JA 3KZGA 2VHAA 4O3CA 3KN7A 2B4MA 4XTCQ 3MVWA 3RPWA 4WEDA 2LAOA 1LAGE 3ONMA 2ZXTA 3K00A 4P1LA 4OXVA 1QKAA 2VD2A 1GV8A 2I4BA 3K01A 3ECRA 3SERA 3A09A 3H6WA 2UYFA 3O29A 3CIJA 1FPKA 1EZOA 3QSLA 3MZ9A 2P3VA 1NKXA 2O7IA 1QVSA 3EHSA 4H45A 3CSBA 5I84A 2H9BA 2ZYKA 1R1NA 5B70A 4IO6A 2VPOA 1FTOA 2CZHA 3PGFA 3EKIA 4F22A 3IFCA 2ABHA 1TFAA 4YB5A 2XXXA 1Q35A 2F97A 1M5CA 4ELOA 4EQ9A 2GFEA 3VLVA 2XHDA 4F2QA 4F1VA 2QS2A 5TPAA
chains in the Genus database with same CATH topology
5FHNA 4RA1A 1OQGA 3MPLA 1YCJA 2YPNA 5JTYB 3BBRA 3ZS6A 2PX1A 1LGBC 3PMWA 2IA4A 1N0TA 1Y1ZA 1Y3QA 4Q30B 1MXYA 3FJMA 4RK2A 1GTKA 2F7CA 1IITA 3O6HA 1XVXA 5H8HA 1WODA 4IGTA 1D9YA 1FTKA 4IO7A 3TZAA 1UTBB 4F18A 4GXSB 4ZEKA 2DXRA 3N6TA 4LONB 2A5TA 4JBZA 1MM7A 3R6UA 5KCJA 2RF1A 4LUBA 4OFLA 2O69A 2PYYA 3S9LC 2DS9A 3H6TA 3GBBA 3O6IA 1MXXA 1Q1KA 1Y20A 1B1XA 3K1PA 1NNFA 1PBPA 3KJTA 1NNTA 4Z0IA 1POY1 3DLNA 2HAVA 1Y9UA 1LBBA 4NWCA 2RC7A 1XOCA 3SETA 2FNCA 1DOTA 3LUYA 1XVYA 2UXAA 3TDJA 1VSOA 3LC8A 2V84A 2AIXA 4FE8A 3OEKA 4RY1A 2R9JA 1TXFA 3PUWE 2Z8DA 2XXIA 1A55A 2ZYNA 5L9MA 3CI8A 4OESA 4LZ8A 3T9UA 4NF6B 5HM4B 3K1MA 4ZE8A 4C1UA 1H45A 3KSJA 2QL3A 1NH8A 4N07A 3S9NC 1JW1A 3FIRA 1RYXA 4NF4A 4KD5A 4NTLA 1LCFA 3Q26A 3H6VA 1MG1A 4FECA 3MP1A 4GL0A 5I56B 1VR5A 3T9HB 3RT8A 3IJOB 4ESXA 1POTA 2ZNUA 2I3WA 4RXLA 4K3FA 4YMAA 4PFYA 1FQEA 1Z7NE 2D5WA 5HPQA 2ONSA 4R9FA 4I62A 1LAFE 3G3FA 1YPNA 1B0LA 2AYSA 2NVUB 3FJGA 5CBSA 3TMGA 1LAXA 2REJA 1ZLQA 3FVGA 2Y7PA 3TELA 3UIFA 4RNSA 1LBCA 2RKMA 1GR2A 1FQAA 5I59B 3OO6A 3MJNA 3E3KA 1SD3A 4QFNA 2F8DA 3K4UA 1RKMA 1ZKBA 4H6DA 2B3BA 3L6GA 4YB7A 4OHNA 1NFTA 1M5EA 5AA4A 1JETA 1A99A 4UA8A 1A40A 3N26A 3IOTA 3ZKKA 3OD7A 4P0GA 5DEXA 1USYH 3VV5A 1MH4A 4EXLA 3R26A 3TKDA 2XXHA 4U4SA 5CMMA 1IXCA 4ZEBA 1UIUA 4F3GA 4P0IA 5BUUA 5AA1A 1NNPA 4YU0A 1Y4CA 4LZ7A 5F7VA 4H67A 1R9QA 4NE4A 3EHTA 3VVFA 1FTJA 2QS3A 2R6GE 2Y7RA 2Y7IA 3D4CA 1I6AA 4H1XA 3RY3A 1P1UA 1B7UA 3ODBA 5KDTB 1M5DA 5CMKA 5FHOA 1SDXA 2NWJA 3Q27A 3CVGA 1LFIA 5ELVA 1D9VA 4F39A 5DVIA 4FJPA 1N3XA 2OWTA 4E0WA 5I58B 3FV1A 4ONYA 4G4PA 3Q25A 2DVCA 2DSFA 3FASA 2XXPA 4M1VA 1QW0A 4IGRA 1XC1A 1B0HA 1UTHA 1FTMA 3HO7A 3USDA 2VOZA 1P1QA 1DTGA 3SDFA 3A3CA 3Q28A 4EF1A 3TQLA 3FVOA 4TLLB 2Y7KA 1S7YA 1B2HA 3RUMA 1XHYA 4YMBA 4ZEFA 4U22A 4PQJA 3HN0A 4PFWA 2THIA 3ILUB 1LCTA 4I8CA 4AB6A 1PB7A 3TFLA 4N6PA 2UVIA 4KCDA 4WXJA 3OO8A 1Y3PA 3TUSA 3CG1A 3G3HA 4U21A 3AXFA 4YB6A 3VE1B 4KI0E 3HHFA 4YKKA 4RK9A 4HW8A 3IB0A 3HCQA 2YLNA 3KG2A 1A7LA 5EYFA 4XXUA 4H8JA 3HV1A 3U1OA 3Q29A 3HSTA 4FATA 1MY4A 3TTRA 2DXYA 4G68A 2GH9A 4IO4A 1LB8A 4R6YA 3CFZA 1MH3A 1N7WA 4E0XA 3PU5A 3MVYA 2P1SA 5ITOA 4POXA 2F5XA 5H8SA 1MQHA 2HQ0A 1B3GA 3DP8A 3SEYA 3S4UA 3MBPA 2H5YA 4POWA 2X26A 1FW0A 5TPAB 2O84X 1FCKA 4GLIA 4QSCA 4JWYA 1QKBA 4KYSA 1VE4A 2Q2CA 4QSEA 4TOZA 1NMUA 5TU0A 4NF8B 1AL3A 1P1WA 1MDQA 2I3VA 1OVBA 3FATA 4RJZA 2AL5A 3U94A 1KWHA 3TEPA 5AA2B 4WEPA 1IZ1A 3G3IA 4OENA 4KHZE 2M8CA 1JW4A 2O51A 4OYVA 3DELB 1N04A 2XX8A 1Y1MA 4GL8A 1QUKA 2O1MA 5I2NA 1US4A 2XXRA 1GGGA 3K02A 1B5IA 3RNNA 3G3GA 3K6WA 4ZS9A 3UA8A 2X7QA 5DT6A 3EN3A 3C36A 3FXRA 4X48A 5KCJB 3MZBA 2Y7WA 1FQFA 1EZ9A 3RGYA 3PV0E 3DP4A 5I57A 2HEUA 4GRKA 2O1LA 4G2ZA 4LVQA 4ZEDA 3OMBA 4IY6A 3VVEA 5H8NA 2RCBA 4H8IA 2DQVA 4YICA 4HCWA 3FXUA 5IKBA 3K2DA 3OENA 1MY3A 2B65A 3O9PA 2GHAA 2NUVA 3F11A 2OCUA 3G3KA 3RN8A 1SVXB 1MPBA 3C4MA 2REGA 2DWJA 3H03A 2QSXA 2UVGA 4IB2A 1I6BA 2ZYMA 3FV2A 3OO9A 1URGA 1DPPA 3FGSA 2FYIA 2QS4A 2OLBA 3IJXB 3EHUA 4QFKA 4DCYA 3EQ1A 4ELRA 2DE4A 1II5A 3KBRA 4UACA 2HZKA 1USYE 2P0SA 3SESA 4OWDA 3MWBA 4YKPA 2PVUA 4TLMB 2ANJA 3KOTA 2RCAA 4KYDA 3IX1A 4R6KA 5BWJA 4JWOA 3ZSFA 4X1DA 3BFTA 1JQFA 4NF5B 1GVCA 3UGWA 4NWDA 3QAXA 4C1TA 1JEVA 3H6UA 3KN3A 2WKYA 4DE8A 4EDPA 4KYEA 2Z22A 3MP8A 1ZMGA 4MLVA 4U23A 4DXBA 5CI5A 5EHMA 2XXUA 2OJTA 2RC8A 2RINA 4RPNA 5I2KB 2VP1A 4H0WA 1URSA 3CR9A 4R72A 5JTYA 4DXCA 1MQIA 3LR1A 3U72A 3OELA 4R74A 3CSGA 1A8EA 3TPAA 4DDDA 3OXNA 4GFRA 2DE2A 3IK6B 4FORA 1US5A 4PFUA 4OVJA 4U2RA 4O3BA 3OEMA 1F9BA 2HFBA 3VFJA 4ND9A 5DVFA 1UTBA 2H99A 5JK4A 1LB9A 1SI1A 1MDP1 4BDOA 4F3PA 4LQ5A 2Q2AA 3TTKA 1OIBA 5CBRA 4YKIA 3IOVA 1UIVA 4WKMA 3O66A 3PMXA 4NEDA 5K2XA 2ESNA 3VVDA 1ANFA 3KOSA 3TAJA 3HPIA 4JSDA 3O97A 3TTLA 1SW5A 1BP5A 2HCAA 4KFQA 4QFOA 4LATA 1IXGA 1ZTYA 1PB9A 4H65A 3C9HA 4RPOA 2OZZA 3SKPA 4AQ4A 4MF3A 3OOAA 2G29A 3TODA 4NMYA 3O2AA 3I6VA 3RTFB 3PMVA 4DXUA 4PP0A 1MY0A 3MVXA 4R75A 3I3VA 2QRYA 3UP9A 3VLUA 4JSOA 1MXWA 1PDAA 3TTNA 2H4IA 3SEVA 3E4RA 4YKJA 5DVJA 2UVHA 4NF6A 2R71A 3PUZE 1IXHA 3W15C 3W9VA 1MPDA 3TYHA 2V25A 4GOTA 1CB6A 1NH7A 2O6AA 3BKIB 4YZZA 2Z23A 3VXCA 3B6WA 5I56A 1O7TA 2AL4A 3DM0A 3GXAA 4C0RA 1HSJA 1O64A 5EHSA 1XT8A 2Y84A 2IEEA 3GLBA 4BDRA 1D4NA 1N3WA 1R6ZA 4GIZA 2BJJX 4G8MA 2RC9A 3PPOA 1H44A 4KQPA 4QFPA 2Q9TA 5A5XB 1S50A 1B40A 3V5AA 5TP9B 2F34A 1TT1A 2PT1A 1P99A 3S9EA 3ZKLA 3KJ7A 4I1DA 1PC3A 3FD3A 2HZLA 3MPKA 1WDNA 3CRBA 3WAFA 3SEUA 1TWYA 4P11A 3OO7A 4IO5A 1A54A 2PT2A 4PFTA 3GBAA 5H8QB 4H5FA 3S9MC 1QJMA 5JEIA 2I49A 2V93A 5FTIA 3O28A 1WVJA 3VDFA 2W7YA 1AOVA 4MLQA 5ICTA 1OLAA 3OSQA 2DOJA 1B58A 1N76A 4DIGA 4BDNA 3UK4A 1B52A 1ZIUA 5CC2A 3U8QA 3V89B 2O7UA 3QYTA 4R2BA 1AMFA 1IUDA 3K6VA 1SYHA 4JXIA 2V3UA 3FXQA 4R6HA 3T22A 2OBGA 3C34A 3U92A 1B1HA 1N84A 2O68A 5KDTA 2DWAA 1L5TA 3LSWA 1B32A 4EUOA 3IOWA 3C33A 4GD5A 2XXVA 1JVYA 1JVXA 1IQ7A 3I5OA 5F1QA 1B46A 3EPEA 4ZEIA 2I48A 4DZ1A 5I58A 1A8FA 3PPQA 2G93A 3FJ7A 1Y3NA 3N6UA 4FEBA 1NL5A 2CZLA 5H8NB 1SW4A 3IOUA 5AA2D 4OERA 3U93A 1B05A 1FQCA 4DCXA 4OEUA 4L17A 1B5JA 4Q8RA 5H8FA 3UN6A 4U1ZA 1MM6A 1JNFA 1T0KA 2F35A 3V8XB 5ISUA 3E9XA 5CMBA 4Q5TA 4G8HA 4MBPA 2XD3A 1MXUA 3E13X 4GWOA 4HCYA 3K0VA 5H8HB 1VFEA 3M3KA 1YTVA 1FQBA 1OLCA 1TFDA 3O6GA 3P7IA 3PUYE 2QMWA 2A5TB 1O63A 2DYXA 1B9JA 3N94A 3IB2A 4XKRA 4Z7EA 3QIMA 3GZGA 2DWHA 1QULA 3MVZA 3FVKA 4EXKA 1B3HA 3W9WA 4ZZAA 1LAHE 3CFXA 2A5SA 3IB1A 1Z7ME 1ELJA 1HSLA 3H7MA 1LFHA 4KR5A 3C32A 4XKNA 5IAIA 3KSXA 2F7AA 2DP8A 3KGCA 4OMBA 1LFGA 2QPQA 1LSTA 4BLAA 1MQJA 3KN8A 1PEBA 2PMSA 1M5FA 1MQDA 1HSEA 4KCCA 4RYAA 1B3LA 4MH5A 4F1YA 4EQBA 3TCFA 3D4GA 2D21A 1DMBA 3LBSA 4HTGA 4NF8A 5KZTA 4O3AA 1SBPA 4OTEA 3K6XA 1SI0A 2ONRA 3B7DA 3BFUA 4F3SA 2XD2A 3TCHA 2KLFA 5AA2A 3LSLA 3QUJA 4OFOA 1MXZA 4NF4B 4ESWA 2GRVA 4XIGQ 4QRZA 1B51A 3H3GA 2DE3A 3MZ1A 5J1DA 4IO2A 5B7DA 4F1UA 4QHQA 2XX7A 4MFIA 4ZECA 3V83A 2I6EA 3T9XB 3A3UA 4GF8A 1D3KA 3MP6A 4OEVA 3H4ZA 1B6HA 4IO3A 3PPRA 4BDMA 4LA9A 1M5BA 2V3TA 1MPCA 3G7WA 4LP2B 3M8UA 3PD9A 4QF9A 5ICQA 1OVTA 1QUIA 1FTLA 1BKAA 2ZMBA 4EQ7A 2OK2A 3L6HA 4FIMA 4U4XA 5LOMA 2QMXA 1UQWA 3MW0A 1ZJLA 2GHBA 3PPNA 2ZNTA 1Y4TA 3S2VA 2F78A 5DTBA 3ILTB 4GQOA 5AA4B 1P1OA 3VLWA 3IAZA 5DEXB 4QFLA 5AE4A 2B3FA 2ONKE 2F7BA 2F6GA 5FHMA 3B6TA 2F6PA 3WAEA 3IL1B 3LSFB 4M4GA 1JEUA 3T93B 3IORA 3TQWA 1BTJA 1SW1A 3JYRA 2NOOA 3KEIA 1B3FA 4XKPA 3DP6A 5FTHA 2NXOA 1URDA 4JDFA 1ZBMA 3CFLA 1EH3A 4NF5A 4N13A 2VGQA 1SYIA 4G8NA 3IO4A 2XXYA 1CE2A 4Q0CA 4ZE9A 1XS5A 5L9SA 4G68C 2X7PA 3T9VA 2I58A 3PUXE 4X1BA 4YAHX 2Q89A 2HXWA 1DTZA 2UVJA 2Z8EA 4R73A 3C31A 2F36A 5HBCA 5I2KA 1MRPA 3T96B 1B4HA 3PD8A 4F31B 3B6QA 3LSXA 1UTHB 2XXTA 2I0CA 4FEDA 1N7XA 1J1NA 1R9LA 1H3DA 1B5HA 4OFJA 2OWSA 1B7HA 1EU8A 1ATGA 1I69A 2E0SA 4U1OA 4F19A 2YJPA 3KFMA 2VD3A 4OZ9A 4ELPA 3PUVE 3CG3A 4G77A 3JV9A 4PE5B 1YAEA 4R2FA 2CMOA 3FZVA 5AA3A 2HAUA 4X9TA 1B3EA 2H98A 2QS1A 1SQYA 3N5LA 4AB5A 1PBQA 1S9TA 3RTWB 1MXVA 3R7XA 2XX9A 3TTMA 1B4ZA 3PPPA 1OQHA 1LLSA 3MAMA 3M3FA 3SEXA 3MQ9A 2DVZA 5CM6A 1P1NA 5I59A 4ISUA 4ZDMA 3EF7A 4G68B 3K6UA 4F2OA 3SEWA 3K1NA 1DSNA 2DWIA 5CRYA 4BDQA 1PB8A 3JZJA 1H43A 4DLDA 1QUJA 1SW2A 5M2VA 2D3IA 2XXQA 4LQ2A 1FQDA 2PBWA 1IIWA 1MY2A 4JWXA 1BIYA 2FA7A 4OQOA 2ZNSA 3HHGA 4H5GA 2UYEA 1MQGA 4HS7A 5H8FB 3QXMA 5ITPA 3C35A 1IEJA 3VXBA 3MC2A 4JB7A 1MY1A 4KPTA 2ZYOA 4ECFA 1NNKA 1ZU0A 4XKQA 4LZ5A 4IY5A 4R9GA 1AH5A 3T66A 4BDLA 5DYHA 2I4CA 2XXWA 5I2NB 2P2AA 4I9DA 4OETA 3H06B 4PETA 3MUQA 2Q8JA 1OMPA 4FAJA 4F3BA 5A5XA 4QSDA 5TP9A 4ZZEA 1JW5A 1VFDA 5I57B 3OSRA 5L9OA 3RLFE 1MS7A 3QK6A 1BLFA 3FUZA 2V3QA 2QJEA 2I0BA 1B7ZA 5L8DA 4THIA 4GXAA 1AIVA 1H76A 2Q88A 3FVNA 5CMCA 3TCGA 5H8QA 3IO6A 1EZPA 4GVOA 3IR1A 1IXIA 1RYOA 1I6QA 3QUFA 3THIA 3M3LA 4F29A 2E1SA 2ALUA 3RT6B 2Z8FA 4EF2A 2H25A 4TQUQ 1DPEA 3UORA 4ELQA 3RQTA 5K2YA 3G3JA 3KZGA 2VHAA 4O3CA 3KN7A 4XTCQ 3MVWA 3RPWA 4WEDA 2LAOA 1LAGE 3ONMA 2ZXTA 3K00A 4OXVA 1QKAA 2VD2A 1GV8A 2I4BA 3K01A 3ECRA 3SERA 3A09A 3H6WA 2UYFA 3O29A 3CIJA 1EZOA 3QSLA 3MZ9A 1NKXA 2O7IA 1QVSA 3EHSA 3CSBA 5I84A 2H9BA 2ZYKA 1R1NA 5B70A 4IO6A 1FTOA 3PGFA 4F22A 2ABHA 1TFAA 4YB5A 2XXXA 1Q35A 2F97A 1M5CA 4ELOA 4EQ9A 2GFEA 3VLVA 2XHDA 4F2QA 4F1VA 2QS2A 5TPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FHN A;  4RA1 A;  1OQG A;  3MPL A;  1YCJ A;  2YPN A;  5JTY B;  3BBR A;  3ZS6 A;  2PX1 A;  1LGB C;  3PMW A;  2IA4 A;  1N0T A;  1Y1Z A;  1Y3Q A;  4Q30 B;  1MXY A;  3FJM A;  4RK2 A;  1GTK A;  2F7C A;  1IIT A;  3O6H A;  1XVX A;  5H8H A;  1WOD A;  4IGT A;  1D9Y A;  1FTK A;  4IO7 A;  3TZA A;  1UTB B;  4F18 A;  4GXS B;  4ZEK A;  2DXR A;  3N6T A;  4LON B;  2A5T A;  4JBZ A;  1MM7 A;  3R6U A;  5KCJ A;  2RF1 A;  4LUB A;  4OFL A;  2O69 A;  2PYY A;  3S9L C;  2DS9 A;  3H6T A;  3GBB A;  3O6I A;  1MXX A;  1Q1K A;  1Y20 A;  1B1X A;  3K1P A;  1NNF A;  1PBP A;  3KJT A;  1NNT A;  4Z0I A;  1POY 1;  3DLN A;  2HAV A;  1Y9U A;  1LBB A;  4NWC A;  2RC7 A;  1XOC A;  3SET A;  2FNC A;  1DOT A;  3LUY A;  1XVY A;  2UXA A;  3TDJ A;  1VSO A;  3LC8 A;  2V84 A;  2AIX A;  4FE8 A;  3OEK A;  4RY1 A;  2R9J A;  1TXF A;  3PUW E;  2Z8D A;  2XXI A;  1A55 A;  2ZYN A;  5L9M A;  3CI8 A;  4OES A;  4LZ8 A;  3T9U A;  4NF6 B;  5HM4 B;  3K1M A;  4ZE8 A;  4C1U A;  1H45 A;  3KSJ A;  2QL3 A;  1NH8 A;  4N07 A;  3S9N C;  1JW1 A;  3FIR A;  1RYX A;  4NF4 A;  4KD5 A;  4NTL A;  1LCF A;  3Q26 A;  3H6V A;  1MG1 A;  4FEC A;  3MP1 A;  4GL0 A;  5I56 B;  1VR5 A;  3T9H B;  3RT8 A;  3IJO B;  4ESX A;  1POT A;  2ZNU A;  2I3W A;  4RXL A;  4K3F A;  4YMA A;  4PFY A;  1FQE A;  1Z7N E;  2D5W A;  5HPQ A;  2ONS A;  4R9F A;  4I62 A;  1LAF E;  3G3F A;  1YPN A;  1B0L A;  2AYS A;  2NVU B;  3FJG A;  5CBS A;  3TMG A;  1LAX A;  2REJ A;  1ZLQ A;  3FVG A;  2Y7P A;  3TEL A;  3UIF A;  4RNS A;  1LBC A;  2RKM A;  1GR2 A;  1FQA A;  5I59 B;  3OO6 A;  3MJN A;  3E3K A;  1SD3 A;  4QFN A;  2F8D A;  3K4U A;  1RKM A;  1ZKB A;  4H6D A;  2B3B A;  3L6G A;  4YB7 A;  4OHN A;  1NFT A;  1M5E A;  5AA4 A;  1JET A;  1A99 A;  4UA8 A;  1A40 A;  3N26 A;  3IOT A;  3ZKK A;  3OD7 A;  4P0G A;  5DEX A;  1USY H;  3VV5 A;  1MH4 A;  4EXL A;  3R26 A;  3TKD A;  2XXH A;  4U4S A;  5CMM A;  1IXC A;  4ZEB A;  1UIU A;  4F3G A;  4P0I A;  5BUU A;  5AA1 A;  1NNP A;  4YU0 A;  1Y4C A;  4LZ7 A;  5F7V A;  4H67 A;  1R9Q A;  4NE4 A;  3EHT A;  3VVF A;  1FTJ A;  2QS3 A;  2R6G E;  2Y7R A;  2Y7I A;  3D4C A;  1I6A A;  4H1X A;  3RY3 A;  1P1U A;  1B7U A;  3ODB A;  5KDT B;  1M5D A;  5CMK A;  5FHO A;  1SDX A;  2NWJ A;  3Q27 A;  3CVG A;  1LFI A;  5ELV A;  1D9V A;  4F39 A;  5DVI A;  4FJP A;  1N3X A;  2OWT A;  4E0W A;  5I58 B;  3FV1 A;  4ONY A;  4G4P A;  3Q25 A;  2DVC A;  2DSF A;  3FAS A;  2XXP A;  4M1V A;  1QW0 A;  4IGR A;  1XC1 A;  1B0H A;  1UTH A;  1FTM A;  3HO7 A;  3USD A;  2VOZ A;  1P1Q A;  1DTG A;  3SDF A;  3A3C A;  3Q28 A;  4EF1 A;  3TQL A;  3FVO A;  4TLL B;  2Y7K A;  1S7Y A;  1B2H A;  3RUM A;  1XHY A;  4YMB A;  4ZEF A;  4U22 A;  4PQJ A;  3HN0 A;  4PFW A;  2THI A;  3ILU B;  1LCT A;  4I8C A;  4AB6 A;  1PB7 A;  3TFL A;  4N6P A;  2UVI A;  4KCD A;  4WXJ A;  3OO8 A;  1Y3P A;  3TUS A;  3CG1 A;  3G3H A;  4U21 A;  3AXF A;  4YB6 A;  3VE1 B;  4KI0 E;  3HHF A;  4YKK A;  4RK9 A;  4HW8 A;  3IB0 A;  3HCQ A;  2YLN A;  3KG2 A;  1A7L A;  5EYF A;  4XXU A;  4H8J A;  3HV1 A;  3U1O A;  3Q29 A;  3HST A;  4FAT A;  1MY4 A;  3TTR A;  2DXY A;  4G68 A;  2GH9 A;  4IO4 A;  1LB8 A;  4R6Y A;  3CFZ A;  1MH3 A;  1N7W A;  4E0X A;  3PU5 A;  3MVY A;  2P1S A;  5ITO A;  4POX A;  2F5X A;  5H8S A;  1MQH A;  2HQ0 A;  1B3G A;  3DP8 A;  3SEY A;  3S4U A;  3MBP A;  2H5Y A;  4POW A;  2X26 A;  1FW0 A;  5TPA B;  2O84 X;  1FCK A;  4GLI A;  4QSC A;  4JWY A;  1QKB A;  4KYS A;  1VE4 A;  2Q2C A;  4QSE A;  4TOZ A;  1NMU A;  5TU0 A;  4NF8 B;  1AL3 A;  1P1W A;  1MDQ A;  2I3V A;  1OVB A;  3FAT A;  4RJZ A;  2AL5 A;  3U94 A;  1KWH A;  3TEP A;  5AA2 B;  4WEP A;  1IZ1 A;  3G3I A;  4OEN A;  4KHZ E;  2M8C A;  1JW4 A;  2O51 A;  4OYV A;  3DEL B;  1N04 A;  2XX8 A;  1Y1M A;  4GL8 A;  1QUK A;  2O1M A;  5I2N A;  1US4 A;  2XXR A;  1GGG A;  3K02 A;  1B5I A;  3RNN A;  3G3G A;  3K6W A;  4ZS9 A;  3UA8 A;  2X7Q A;  5DT6 A;  3EN3 A;  3C36 A;  3FXR A;  4X48 A;  5KCJ B;  3MZB A;  2Y7W A;  1FQF A;  1EZ9 A;  3RGY A;  3PV0 E;  3DP4 A;  5I57 A;  2HEU A;  4GRK A;  2O1L A;  4G2Z A;  4LVQ A;  4ZED A;  3OMB A;  4IY6 A;  3VVE A;  5H8N A;  2RCB A;  4H8I A;  2DQV A;  4YIC A;  4HCW A;  3FXU A;  5IKB A;  3K2D A;  3OEN A;  1MY3 A;  2B65 A;  3O9P A;  2GHA A;  2NUV A;  3F11 A;  2OCU A;  3G3K A;  3RN8 A;  1SVX B;  1MPB A;  3C4M A;  2REG A;  2DWJ A;  3H03 A;  2QSX A;  2UVG A;  4IB2 A;  1I6B A;  2ZYM A;  3FV2 A;  3OO9 A;  1URG A;  1DPP A;  3FGS A;  2FYI A;  2QS4 A;  2OLB A;  3IJX B;  3EHU A;  4QFK A;  4DCY A;  3EQ1 A;  4ELR A;  2DE4 A;  1II5 A;  3KBR A;  4UAC A;  2HZK A;  1USY E;  2P0S A;  3SES A;  4OWD A;  3MWB A;  4YKP A;  2PVU A;  4TLM B;  2ANJ A;  3KOT A;  2RCA A;  4KYD A;  3IX1 A;  4R6K A;  5BWJ A;  4JWO A;  3ZSF A;  4X1D A;  3BFT A;  1JQF A;  4NF5 B;  1GVC A;  3UGW A;  4NWD A;  3QAX A;  4C1T A;  1JEV A;  3H6U A;  3KN3 A;  2WKY A;  4DE8 A;  4EDP A;  4KYE A;  2Z22 A;  3MP8 A;  1ZMG A;  4MLV A;  4U23 A;  4DXB A;  5CI5 A;  5EHM A;  2XXU A;  2OJT A;  2RC8 A;  2RIN A;  4RPN A;  5I2K B;  2VP1 A;  4H0W A;  1URS A;  3CR9 A;  4R72 A;  5JTY A;  4DXC A;  1MQI A;  3LR1 A;  3U72 A;  3OEL A;  4R74 A;  3CSG A;  1A8E A;  3TPA A;  4DDD A;  3OXN A;  4GFR A;  2DE2 A;  3IK6 B;  4FOR A;  1US5 A;  4PFU A;  4OVJ A;  4U2R A;  4O3B A;  3OEM A;  1F9B A;  2HFB A;  3VFJ A;  4ND9 A;  5DVF A;  1UTB A;  2H99 A;  5JK4 A;  1LB9 A;  1SI1 A;  1MDP 1;  4BDO A;  4F3P A;  4LQ5 A;  2Q2A A;  3TTK A;  1OIB A;  5CBR A;  4YKI A;  3IOV A;  1UIV A;  4WKM A;  3O66 A;  3PMX A;  4NED A;  5K2X A;  2ESN A;  3VVD A;  1ANF A;  3KOS A;  3TAJ A;  3HPI A;  4JSD A;  3O97 A;  3TTL A;  1SW5 A;  1BP5 A;  2HCA A;  4KFQ A;  4QFO A;  4LAT A;  1IXG A;  1ZTY A;  1PB9 A;  4H65 A;  3C9H A;  4RPO A;  2OZZ A;  3SKP A;  4AQ4 A;  4MF3 A;  3OOA A;  2G29 A;  3TOD A;  4NMY A;  3O2A A;  3I6V A;  3RTF B;  3PMV A;  4DXU A;  4PP0 A;  1MY0 A;  3MVX A;  4R75 A;  3I3V A;  2QRY A;  3UP9 A;  3VLU A;  4JSO A;  1MXW A;  1PDA A;  3TTN A;  2H4I A;  3SEV A;  3E4R A;  4YKJ A;  5DVJ A;  2UVH A;  4NF6 A;  2R71 A;  3PUZ E;  1IXH A;  3W15 C;  3W9V A;  1MPD A;  3TYH A;  2V25 A;  4GOT A;  1CB6 A;  1NH7 A;  2O6A A;  3BKI B;  4YZZ A;  2Z23 A;  3VXC A;  3B6W A;  5I56 A;  1O7T A;  2AL4 A;  3DM0 A;  3GXA A;  4C0R A;  1HSJ A;  1O64 A;  5EHS A;  1XT8 A;  2Y84 A;  2IEE A;  3GLB A;  4BDR A;  1D4N A;  1N3W A;  1R6Z A;  4GIZ A;  2BJJ X;  4G8M A;  2RC9 A;  3PPO A;  1H44 A;  4KQP A;  4QFP A;  2Q9T A;  5A5X B;  1S50 A;  1B40 A;  3V5A A;  5TP9 B;  2F34 A;  1TT1 A;  2PT1 A;  1P99 A;  3S9E A;  3ZKL A;  3KJ7 A;  4I1D A;  1PC3 A;  3FD3 A;  2HZL A;  3MPK A;  1WDN A;  3CRB A;  3WAF A;  3SEU A;  1TWY A;  4P11 A;  3OO7 A;  4IO5 A;  1A54 A;  2PT2 A;  4PFT A;  3GBA A;  5H8Q B;  4H5F A;  3S9M C;  1QJM A;  5JEI A;  2I49 A;  2V93 A;  5FTI A;  3O28 A;  1WVJ A;  3VDF A;  2W7Y A;  1AOV A;  4MLQ A;  5ICT A;  1OLA A;  3OSQ A;  2DOJ A;  1B58 A;  1N76 A;  4DIG A;  4BDN A;  3UK4 A;  1B52 A;  1ZIU A;  5CC2 A;  3U8Q A;  3V89 B;  2O7U A;  3QYT A;  4R2B A;  1AMF A;  1IUD A;  3K6V A;  1SYH A;  4JXI A;  2V3U A;  3FXQ A;  4R6H A;  3T22 A;  2OBG A;  3C34 A;  3U92 A;  1B1H A;  1N84 A;  2O68 A;  5KDT A;  2DWA A;  1L5T A;  3LSW A;  1B32 A;  4EUO A;  3IOW A;  3C33 A;  4GD5 A;  2XXV A;  1JVY A;  1JVX A;  1IQ7 A;  3I5O A;  5F1Q A;  1B46 A;  3EPE A;  4ZEI A;  2I48 A;  4DZ1 A;  5I58 A;  1A8F A;  3PPQ A;  2G93 A;  3FJ7 A;  1Y3N A;  3N6U A;  4FEB A;  1NL5 A;  2CZL A;  5H8N B;  1SW4 A;  3IOU A;  5AA2 D;  4OER A;  3U93 A;  1B05 A;  1FQC A;  4DCX A;  4OEU A;  4L17 A;  1B5J A;  4Q8R A;  5H8F A;  3UN6 A;  4U1Z A;  1MM6 A;  1JNF A;  1T0K A;  2F35 A;  3V8X B;  5ISU A;  3E9X A;  5CMB A;  4Q5T A;  4G8H A;  4MBP A;  2XD3 A;  1MXU A;  3E13 X;  4GWO A;  4HCY A;  3K0V A;  5H8H B;  1VFE A;  3M3K A;  1YTV A;  1FQB A;  1OLC A;  1TFD A;  3O6G A;  3P7I A;  3PUY E;  2QMW A;  2A5T B;  1O63 A;  2DYX A;  1B9J A;  3N94 A;  3IB2 A;  4XKR A;  4Z7E A;  3QIM A;  3GZG A;  2DWH A;  1QUL A;  3MVZ A;  3FVK A;  4EXK A;  1B3H A;  3W9W A;  4ZZA A;  1LAH E;  3CFX A;  2A5S A;  3IB1 A;  1Z7M E;  1ELJ A;  1HSL A;  3H7M A;  1LFH A;  4KR5 A;  3C32 A;  4XKN A;  5IAI A;  3KSX A;  2F7A A;  2DP8 A;  3KGC A;  4OMB A;  1LFG A;  2QPQ A;  1LST A;  4BLA A;  1MQJ A;  3KN8 A;  1PEB A;  2PMS A;  1M5F A;  1MQD A;  1HSE A;  4KCC A;  4RYA A;  1B3L A;  4MH5 A;  4F1Y A;  4EQB A;  3TCF A;  3D4G A;  2D21 A;  1DMB A;  3LBS A;  4HTG A;  4NF8 A;  5KZT A;  4O3A A;  1SBP A;  4OTE A;  3K6X A;  1SI0 A;  2ONR A;  3B7D A;  3BFU A;  4F3S A;  2XD2 A;  3TCH A;  2KLF A;  5AA2 A;  3LSL A;  3QUJ A;  4OFO A;  1MXZ A;  4NF4 B;  4ESW A;  2GRV A;  4XIG Q;  4QRZ A;  1B51 A;  3H3G A;  2DE3 A;  3MZ1 A;  5J1D A;  4IO2 A;  5B7D A;  4F1U A;  4QHQ A;  2XX7 A;  4MFI A;  4ZEC A;  3V83 A;  2I6E A;  3T9X B;  3A3U A;  4GF8 A;  1D3K A;  3MP6 A;  4OEV A;  3H4Z A;  1B6H A;  4IO3 A;  3PPR A;  4BDM A;  4LA9 A;  1M5B A;  2V3T A;  1MPC A;  3G7W A;  4LP2 B;  3M8U A;  3PD9 A;  4QF9 A;  5ICQ A;  1OVT A;  1QUI A;  1FTL A;  1BKA A;  2ZMB A;  4EQ7 A;  2OK2 A;  3L6H A;  4FIM A;  4U4X A;  5LOM A;  2QMX A;  1UQW A;  3MW0 A;  1ZJL A;  2GHB A;  3PPN A;  2ZNT A;  1Y4T A;  3S2V A;  2F78 A;  5DTB A;  3ILT B;  4GQO A;  5AA4 B;  1P1O A;  3VLW A;  3IAZ A;  5DEX B;  4QFL A;  5AE4 A;  2B3F A;  2ONK E;  2F7B A;  2F6G A;  5FHM A;  3B6T A;  2F6P A;  3WAE A;  3IL1 B;  3LSF B;  4M4G A;  1JEU A;  3T93 B;  3IOR A;  3TQW A;  1BTJ A;  1SW1 A;  3JYR A;  2NOO A;  3KEI A;  1B3F A;  4XKP A;  3DP6 A;  5FTH A;  2NXO A;  1URD A;  4JDF A;  1ZBM A;  3CFL A;  1EH3 A;  4NF5 A;  4N13 A;  2VGQ A;  1SYI A;  4G8N A;  3IO4 A;  2XXY A;  1CE2 A;  4Q0C A;  4ZE9 A;  1XS5 A;  5L9S A;  4G68 C;  2X7P A;  3T9V A;  2I58 A;  3PUX E;  4X1B A;  4YAH X;  2Q89 A;  2HXW A;  1DTZ A;  2UVJ A;  2Z8E A;  4R73 A;  3C31 A;  2F36 A;  5HBC A;  5I2K A;  1MRP A;  3T96 B;  1B4H A;  3PD8 A;  4F31 B;  3B6Q A;  3LSX A;  1UTH B;  2XXT A;  2I0C A;  4FED A;  1N7X A;  1J1N A;  1R9L A;  1H3D A;  1B5H A;  4OFJ A;  2OWS A;  1B7H A;  1EU8 A;  1ATG A;  1I69 A;  2E0S A;  4U1O A;  4F19 A;  2YJP A;  3KFM A;  2VD3 A;  4OZ9 A;  4ELP A;  3PUV E;  3CG3 A;  4G77 A;  3JV9 A;  4PE5 B;  1YAE A;  4R2F A;  2CMO A;  3FZV A;  5AA3 A;  2HAU A;  4X9T A;  1B3E A;  2H98 A;  2QS1 A;  1SQY A;  3N5L A;  4AB5 A;  1PBQ A;  1S9T A;  3RTW B;  1MXV A;  3R7X A;  2XX9 A;  3TTM A;  1B4Z A;  3PPP A;  1OQH A;  1LLS A;  3MAM A;  3M3F A;  3SEX A;  3MQ9 A;  2DVZ A;  5CM6 A;  1P1N A;  5I59 A;  4ISU A;  4ZDM A;  3EF7 A;  4G68 B;  3K6U A;  4F2O A;  3SEW A;  3K1N A;  1DSN A;  2DWI A;  5CRY A;  4BDQ A;  1PB8 A;  3JZJ A;  1H43 A;  4DLD A;  1QUJ A;  1SW2 A;  5M2V A;  2D3I A;  2XXQ A;  4LQ2 A;  1FQD A;  2PBW A;  1IIW A;  1MY2 A;  4JWX A;  1BIY A;  2FA7 A;  4OQO A;  2ZNS A;  3HHG A;  4H5G A;  2UYE A;  1MQG A;  4HS7 A;  5H8F B;  3QXM A;  5ITP A;  3C35 A;  1IEJ A;  3VXB A;  3MC2 A;  4JB7 A;  1MY1 A;  4KPT A;  2ZYO A;  4ECF A;  1NNK A;  1ZU0 A;  4XKQ A;  4LZ5 A;  4IY5 A;  4R9G A;  1AH5 A;  3T66 A;  4BDL A;  5DYH A;  2I4C A;  2XXW A;  5I2N B;  2P2A A;  4I9D A;  4OET A;  3H06 B;  4PET A;  3MUQ A;  2Q8J A;  1OMP A;  4FAJ A;  4F3B A;  5A5X A;  4QSD A;  5TP9 A;  4ZZE A;  1JW5 A;  1VFD A;  5I57 B;  3OSR A;  5L9O A;  3RLF E;  1MS7 A;  3QK6 A;  1BLF A;  3FUZ A;  2V3Q A;  2QJE A;  2I0B A;  1B7Z A;  5L8D A;  4THI A;  4GXA A;  1AIV A;  1H76 A;  2Q88 A;  3FVN A;  5CMC A;  3TCG A;  5H8Q A;  3IO6 A;  1EZP A;  4GVO A;  3IR1 A;  1IXI A;  1RYO A;  1I6Q A;  3QUF A;  3THI A;  3M3L A;  4F29 A;  2E1S A;  2ALU A;  3RT6 B;  2Z8F A;  4EF2 A;  2H25 A;  4TQU Q;  1DPE A;  3UOR A;  4ELQ A;  3RQT A;  5K2Y A;  3G3J A;  3KZG A;  2VHA A;  4O3C A;  3KN7 A;  4XTC Q;  3MVW A;  3RPW A;  4WED A;  2LAO A;  1LAG E;  3ONM A;  2ZXT A;  3K00 A;  4OXV A;  1QKA A;  2VD2 A;  1GV8 A;  2I4B A;  3K01 A;  3ECR A;  3SER A;  3A09 A;  3H6W A;  2UYF A;  3O29 A;  3CIJ A;  1EZO A;  3QSL A;  3MZ9 A;  1NKX A;  2O7I A;  1QVS A;  3EHS A;  3CSB A;  5I84 A;  2H9B A;  2ZYK A;  1R1N A;  5B70 A;  4IO6 A;  1FTO A;  3PGF A;  4F22 A;  2ABH A;  1TFA A;  4YB5 A;  2XXX A;  1Q35 A;  2F97 A;  1M5C A;  4ELO A;  4EQ9 A;  2GFE A;  3VLV A;  2XHD A;  4F2Q A;  4F1V A;  2QS2 A;  5TPA A; 
#chains in the Genus database with same CATH topology
 5FHN A;  4RA1 A;  5F24 A;  1OQG A;  3MPL A;  1YCJ A;  2CZK A;  4GWU A;  5EQA A;  2YPN A;  5JTY B;  3BBR A;  3ZS6 A;  2PX1 A;  4NF0 A;  1LGB C;  3PMW A;  2IA4 A;  1N0T A;  1Y1Z A;  1Y3Q A;  4Q30 B;  1MXY A;  3FJM A;  4RK2 A;  1GTK A;  2F7C A;  1IIT A;  3O6H A;  4AS4 A;  1XVX A;  5H8H A;  1WOD A;  4IGT A;  1D9Y A;  1FTK A;  4O8M A;  1SPI A;  4MCO A;  4IO7 A;  3TZA A;  1UTB B;  4F18 A;  4GXS B;  4ZEK A;  1LEV A;  2DXR A;  3N6T A;  4LON B;  2A5T A;  4JBZ A;  5IZ3 A;  2WYK A;  1MM7 A;  3HFU A;  3R6U A;  5KCJ A;  2L5V A;  2RF1 A;  4LUB A;  4NGU A;  4OFL A;  2O69 A;  2PYY A;  3S9L C;  2DS9 A;  3H6T A;  1EYK A;  1FTA A;  1KA0 A;  3GBB A;  3O6I A;  1MXX A;  1Q1K A;  1Y20 A;  3CHG A;  1B1X A;  3K1P A;  1NNF A;  1PBP A;  3KJT A;  1NNT A;  1K9Z A;  1POY 1;  3DLN A;  4Z0I A;  4NX1 A;  2HAV A;  1Y9U A;  1LBB A;  4NWC A;  2RC7 A;  1XOC A;  3SET A;  1IMA A;  2FNC A;  1DOT A;  3LUY A;  4MNP A;  1XVY A;  2UXA A;  3TDJ A;  1VSO A;  3LC8 A;  4GX6 A;  4MHF A;  2V84 A;  2AIX A;  4FE8 A;  3OEK A;  4NAP A;  4RY1 A;  2R9J A;  1TXF A;  3PUW E;  2Z8D A;  2XXI A;  1A55 A;  4MMP A;  2ZYN A;  5L9M A;  1IMF A;  3CI8 A;  2Y5L A;  4OES A;  5IZ1 A;  4LZ8 A;  3T9U A;  2XWK A;  4NF6 B;  5HM4 B;  3K1M A;  1FPB A;  4ZE8 A;  4C1U A;  1H45 A;  3KSJ A;  4I3E A;  2QL3 A;  2WBB A;  1NH8 A;  4MNI A;  4N07 A;  3S9N C;  1JW1 A;  3FIR A;  1RYX A;  4O7I A;  4NF4 A;  4KD5 A;  4NTL A;  1LCF A;  3Q26 A;  3H6V A;  1MG1 A;  4FEC A;  3MP1 A;  4GL0 A;  5I56 B;  1VR5 A;  3T9H B;  3RT8 A;  4PE3 A;  3IJO B;  4ESX A;  2ZZV A;  1POT A;  2ZNU A;  2I3W A;  4RXL A;  4K3F A;  4YMA A;  4PFY A;  1FQE A;  1Z7N E;  2D5W A;  2CEY A;  5HPQ A;  2ONS A;  4R9F A;  4I62 A;  1LAF E;  3G3F A;  1YPN A;  1B0L A;  2AYS A;  2NVU B;  2BJI A;  3FJG A;  5CBS A;  3TMG A;  1LAX A;  2REJ A;  1ZLQ A;  3FVG A;  2Y7P A;  3TEL A;  5ET7 A;  3UIF A;  4RNS A;  1LBC A;  1FBH A;  2RKM A;  1GR2 A;  4P56 A;  1FQA A;  5I59 B;  3OO6 A;  2WEF A;  4N8Y A;  3MJN A;  3D1R A;  3E3K A;  1SD3 A;  4QFN A;  2F8D A;  3K4U A;  1RKM A;  1ZKB A;  4H6D A;  1YXI A;  3U65 A;  2B3B A;  3L6G A;  4YB7 A;  4GX3 A;  4OHN A;  1NFT A;  1M5E A;  4FBP A;  5AA4 A;  1JET A;  1A99 A;  4UA8 A;  1RDX A;  2XWO A;  1A40 A;  3N26 A;  3IOT A;  3ZKK A;  3OD7 A;  4P0G A;  5DEX A;  1USY H;  3VV5 A;  1MH4 A;  4EXL A;  3R26 A;  3TKD A;  1FPI A;  2XXH A;  4U4S A;  5CMM A;  1IXC A;  4ZEB A;  1YYZ A;  2XWV A;  1UIU A;  4F3G A;  4P0I A;  5BUU A;  5AA1 A;  1NNP A;  4YU0 A;  1Y4C A;  4LZ7 A;  5F7V A;  4H67 A;  1R9Q A;  4N17 A;  4NE4 A;  3EHT A;  3VVF A;  1FTJ A;  2QS3 A;  2R6G E;  2Y7R A;  2Y7I A;  4GWX A;  3D4C A;  1I6A A;  4H1X A;  3RY3 A;  1P1U A;  1B7U A;  3ODB A;  5KDT B;  1M5D A;  5CMK A;  5FHO A;  1SDX A;  2NWJ A;  3Q27 A;  3CVG A;  1LFI A;  5ELV A;  1D9V A;  4F39 A;  5DVI A;  1NUX A;  4FJP A;  4PDD A;  1N3X A;  2OWT A;  1FPD A;  4E0W A;  5I58 B;  3FV1 A;  4ONY A;  4G4P A;  3Q25 A;  2DVC A;  1NV6 A;  2DSF A;  3FAS A;  2HPG A;  2XXP A;  4M1V A;  1QW0 A;  1G0H A;  4IGR A;  1XC1 A;  1B0H A;  1UTH A;  1FTM A;  3HO7 A;  3USD A;  2VOZ A;  1P1Q A;  1DTG A;  3SDF A;  3A3C A;  1FPE A;  3Q28 A;  4EF1 A;  3ISP A;  3TQL A;  3FVO A;  2GQ1 A;  1VDW A;  4TLL B;  4N6D A;  2Y7K A;  1S7Y A;  1B2H A;  3RUM A;  1XHY A;  1AWB A;  3SZP A;  4PF6 A;  4YMB A;  4ZEF A;  4U22 A;  4PQJ A;  3HN0 A;  4PFW A;  1D9Q A;  2THI A;  3ILU B;  1LCT A;  4I8C A;  4AB6 A;  1PB7 A;  4XF5 A;  3TFL A;  4N6P A;  2UVI A;  2Q74 A;  4KCD A;  4WXJ A;  3OO8 A;  1Y3P A;  3TUS A;  3CG1 A;  3G3H A;  4U21 A;  3AXF A;  4YB6 A;  3VE1 B;  4KI0 E;  3HHF A;  4YKK A;  4RK9 A;  4HW8 A;  3IB0 A;  2F3D A;  3HCQ A;  2V4C A;  1LBW A;  1Q9D A;  2YLN A;  4PFR A;  3KG2 A;  1A7L A;  5EYF A;  4XXU A;  4H8J A;  3HV1 A;  3U1O A;  3Q29 A;  3HST A;  4FAT A;  1MY4 A;  2FIX A;  3TTR A;  1FPJ A;  2DXY A;  4G68 A;  2GH9 A;  4IO4 A;  1LB8 A;  4R6Y A;  3CFZ A;  3RPL A;  1MH3 A;  1N7W A;  4E0X A;  3PU5 A;  3MVY A;  2P1S A;  5ITO A;  4POX A;  2F5X A;  5H8S A;  4P1E A;  1MQH A;  2HQ0 A;  1B3G A;  3DP8 A;  3SEY A;  3LUZ A;  3S4U A;  3MBP A;  2H5Y A;  4POW A;  2X26 A;  1FW0 A;  5TPA B;  2O84 X;  1FCK A;  4GLI A;  4QSC A;  4QXD A;  4JWY A;  1QKB A;  3BIH A;  1VE4 A;  2Q2C A;  3A29 A;  4KYS A;  1NMU A;  4QSE A;  4TOZ A;  5TU0 A;  4NF8 B;  1AL3 A;  1P1W A;  4GX4 A;  1MDQ A;  2I3V A;  4O7M A;  1OVB A;  3FAT A;  4RJZ A;  2AL5 A;  3PTY A;  3U94 A;  1KWH A;  3TEP A;  5AA2 B;  3T1B A;  4WEP A;  1IZ1 A;  3G3I A;  4OEN A;  4NG7 A;  4KHZ E;  2M8C A;  1JW4 A;  2O51 A;  4OYV A;  1FBE A;  3DEL B;  1N04 A;  2XX8 A;  5LDZ A;  1Y1M A;  4GL8 A;  1QUK A;  4JVD A;  2O1M A;  5I2N A;  1US4 A;  2XXR A;  1GGG A;  3K02 A;  1B5I A;  3RNN A;  3G3G A;  3K6W A;  4ZS9 A;  3UA8 A;  2X7Q A;  5DT6 A;  3EN3 A;  3C36 A;  3FXR A;  4X48 A;  5KCJ B;  3MZB A;  2Y7W A;  1FQF A;  1EZ9 A;  3RGY A;  1LBZ A;  3PV0 E;  3DP4 A;  5I57 A;  2HEU A;  2PFY A;  4GRK A;  2O1L A;  4G2Z A;  4LVQ A;  5T3J A;  4ZED A;  3OMB A;  4IY6 A;  1NV0 A;  3VVE A;  5H8N A;  2RCB A;  4H8I A;  2DQV A;  5I5P A;  4PAK A;  1FPG A;  4YIC A;  2KR0 A;  4HCW A;  4G61 A;  3FXU A;  5IKB A;  3K2D A;  3OEN A;  1MY3 A;  2B65 A;  3O9P A;  1RDY A;  2GHA A;  2NUV A;  3BIG A;  3F11 A;  2OCU A;  3G3K A;  5IZZ A;  3RN8 A;  1SVX B;  1MPB A;  3C4M A;  2REG A;  2DWJ A;  3H03 A;  2QSX A;  2CEX A;  2UVG A;  4IB2 A;  1I6B A;  2ZYM A;  3FV2 A;  3OO9 A;  1URG A;  1DPP A;  3FGS A;  2FYI A;  2QS4 A;  4HE0 A;  2OLB A;  3IJX B;  3B8B A;  3EHU A;  4QFK A;  4DCY A;  3EQ1 A;  4ELR A;  2DE4 A;  2FHY A;  1II5 A;  3KBR A;  4UAC A;  2HZK A;  1USY E;  2KQZ A;  2P0S A;  3SES A;  2WX9 A;  4OWD A;  3MWB A;  2PVU A;  4TLM B;  4YKP A;  2ANJ A;  3KOT A;  2RCA A;  4KYD A;  3IX1 A;  4PGP A;  4R6K A;  5BWJ A;  4JWO A;  3ZSF A;  4X1D A;  3BFT A;  4MEV A;  1JQF A;  4NF5 B;  1GVC A;  3UGW A;  4NWD A;  4N4U A;  3QAX A;  4C1T A;  1JEV A;  3H6U A;  3KN3 A;  2WKY A;  4DE8 A;  4EDP A;  4KYE A;  2Z22 A;  3MP8 A;  4OVP A;  1ZMG A;  3IFA A;  4MLV A;  4U23 A;  4DXB A;  1DCU A;  5CI5 A;  2Q8M A;  1KZ8 A;  5EHM A;  2XXU A;  2OJT A;  2RC8 A;  2RIN A;  4RPN A;  5I2K B;  2VP1 A;  4H0W A;  1URS A;  1QGX A;  3CR9 A;  4R72 A;  5JTY A;  3E79 A;  5EYH A;  4DXC A;  1MQI A;  2CZI A;  3LR1 A;  3U72 A;  3OEL A;  4R74 A;  3CSG A;  1A8E A;  3TPA A;  4DDD A;  3OXN A;  4GFR A;  2DE2 A;  3IK6 B;  4FOR A;  1US5 A;  4PFU A;  4OVJ A;  4U2R A;  4O3B A;  3OEM A;  1F9B A;  2HFB A;  3VFJ A;  4ND9 A;  5DVF A;  1UTB A;  2VT5 A;  2H99 A;  5JK4 A;  1LB9 A;  1EYI A;  1SI1 A;  1MDP 1;  4BDO A;  2B4L A;  4F3P A;  4LQ5 A;  2Q2A A;  3TTK A;  1OIB A;  5CBR A;  4OVT A;  4YKI A;  3IOV A;  1UIV A;  4JVI A;  4WKM A;  3O66 A;  3PMX A;  4NED A;  5K2X A;  2ESN A;  3VVD A;  1NUY A;  1ANF A;  3KOS A;  3TAJ A;  3HPI A;  4JSD A;  5FBP A;  3O97 A;  3TTL A;  5EQ7 A;  1SW5 A;  2ZZW A;  1BP5 A;  2HCA A;  4KFQ A;  4QFO A;  4LAT A;  1IXG A;  1ZTY A;  3KC0 A;  1PB9 A;  4H65 A;  3C9H A;  1DK4 A;  4RPO A;  2OZZ A;  3SKP A;  4AQ4 A;  4MF3 A;  3OOA A;  2G29 A;  3TOD A;  4NMY A;  3O2A A;  3I6V A;  3RTF B;  3PMV A;  4DXU A;  4PP0 A;  5ESY A;  1MY0 A;  3MVX A;  4R75 A;  4HXV A;  3I3V A;  2QRY A;  3UP9 A;  3VLU A;  4JSO A;  4P8B A;  2WBD A;  1MXW A;  1PDA A;  3TTN A;  2H4I A;  3SEV A;  3E4R A;  4YKJ A;  5DVJ A;  2UVH A;  4PF8 A;  4NF6 A;  2R71 A;  4GBW A;  3PUZ E;  4IR8 A;  1IXH A;  3W15 C;  3W9V A;  1MPD A;  3TYH A;  2V25 A;  4GOT A;  1CB6 A;  1NH7 A;  2O6A A;  3BKI B;  4PBH A;  4YZZ A;  3KC1 A;  2Z23 A;  3VXC A;  3B6W A;  5I56 A;  1O7T A;  2AL4 A;  3DM0 A;  4KXP A;  4LN5 A;  3GXA A;  4C0R A;  1HSJ A;  1O64 A;  5EHS A;  1XT8 A;  2Y84 A;  2IEE A;  4MJO A;  3GLB A;  4BDR A;  1D4N A;  1N3W A;  1R6Z A;  4GIZ A;  1BK4 A;  2BJJ X;  2QFL A;  4G8M A;  2RC9 A;  3PPO A;  1H44 A;  4KQP A;  4QFP A;  2Q9T A;  1IMD A;  5A5X B;  1G0I A;  1S50 A;  1B40 A;  4GBV A;  3V5A A;  5TP9 B;  2F34 A;  1TT1 A;  2PT1 A;  1P99 A;  3S9E A;  3ZKL A;  3KJ7 A;  1FJ9 A;  4I1D A;  1PC3 A;  3FD3 A;  2HZL A;  3MPK A;  1WDN A;  3CRB A;  3WAF A;  4GWW A;  3SEU A;  1TWY A;  4P11 A;  3OO7 A;  5EQ9 A;  4IO5 A;  1A54 A;  2PT2 A;  4PFT A;  2F3B A;  3GBA A;  5H8Q B;  4H5F A;  3S9M C;  1QJM A;  5JEI A;  2I49 A;  2V93 A;  5FTI A;  3O28 A;  1WVJ A;  3VDF A;  5EQ8 A;  2Y5K A;  2PCR A;  2XA5 A;  2W7Y A;  1AOV A;  4MLQ A;  4HE2 A;  5ICT A;  1OLA A;  3OSQ A;  2DOJ A;  1B58 A;  1N76 A;  4DI3 D;  4DIG A;  4BDN A;  3UK4 A;  1B52 A;  1ZIU A;  5CC2 A;  3U8Q A;  1NUZ A;  3V89 B;  2O7U A;  3QYT A;  4R2B A;  1AMF A;  1IUD A;  4N6K A;  3K6V A;  1SYH A;  5A5L A;  4PAI A;  4OVS A;  4AS5 A;  4JXI A;  4X04 A;  2V3U A;  3FXQ A;  4R6H A;  3T22 A;  2OBG A;  3C34 A;  4MIJ A;  3U92 A;  1B1H A;  1N84 A;  1NI9 A;  2O68 A;  5KDT A;  2DWA A;  1L5T A;  4NN3 A;  3LSW A;  1B32 A;  4EUO A;  3IOW A;  3C33 A;  4GD5 A;  2XXV A;  1JVY A;  1FPL A;  1JVX A;  1IQ7 A;  3I5O A;  5F1Q A;  1B46 A;  3EPE A;  4ZEI A;  2I48 A;  4DZ1 A;  5I58 A;  1A8F A;  3PPQ A;  2G93 A;  3FJ7 A;  1Y3N A;  3N6U A;  4FEB A;  1NL5 A;  2CZL A;  5H8N B;  1SW4 A;  2ZZX A;  3IOU A;  5AA2 D;  4OER A;  3U93 A;  1B05 A;  1FQC A;  5IGA A;  4DCX A;  4OEU A;  4L17 A;  1B5J A;  4Q8R A;  5H8F A;  2QVV A;  3UN6 A;  5J16 A;  1KA1 A;  4U1Z A;  4I3Y A;  1MM6 A;  1JNF A;  1T0K A;  2F35 A;  1FBC A;  3V8X B;  5ISU A;  3E9X A;  5CMB A;  4Q5T A;  4G8H A;  4MBP A;  2XD3 A;  1MXU A;  3E13 X;  4GWO A;  4HCY A;  3K0V A;  5H8H B;  1VFE A;  3M3K A;  1YTV A;  1NV3 A;  5EYG A;  1FQB A;  1OLC A;  1TFD A;  3O6G A;  3B50 A;  3P7I A;  3PUY E;  2QMW A;  2A5T B;  4DI4 B;  1O63 A;  2DYX A;  1B9J A;  3N94 A;  5IZ3 B;  3IB2 A;  4XKR A;  4Z7E A;  3QIM A;  3GZG A;  2DWH A;  2XWI A;  1QUL A;  3MVZ A;  3FVK A;  1EYJ A;  4EXK A;  1B3H A;  3W9W A;  4ZZA A;  1LAH E;  4P3L A;  3CFX A;  2A5S A;  3IB1 A;  1Z7M E;  1ELJ A;  1HSL A;  3H7M A;  1LFH A;  4KR5 A;  3RYD A;  3C32 A;  4OAN A;  4XKN A;  5IAI A;  1LBY A;  3KSX A;  2F7A A;  2DP8 A;  3KGC A;  4OMB A;  1LFG A;  2QPQ A;  1INP A;  1LST A;  1MQJ A;  4BLA A;  3KN8 A;  1PEB A;  2PMS A;  1M5F A;  1MQD A;  4PCD A;  4N91 A;  1HSE A;  4KCC A;  4RYA A;  1B3L A;  4MH5 A;  4F1Y A;  4EQB A;  2MKZ A;  3TCF A;  3D4G A;  2D21 A;  1DMB A;  3LBS A;  4HTG A;  4NF8 A;  5KZT A;  1LBV A;  4O3A A;  1SBP A;  4OTE A;  4MNC A;  1JP4 A;  4GWS A;  3K6X A;  1SI0 A;  2ONR A;  3B7D A;  3BFU A;  4F3S A;  1K9Y A;  2XD2 A;  3TCH A;  2KLF A;  5AA2 A;  4N15 A;  3LSL A;  3QUJ A;  4OFO A;  1MXZ A;  4NF4 B;  4ESW A;  2GRV A;  4XIG Q;  4QRZ A;  1B51 A;  3H3G A;  2DE3 A;  3MZ1 A;  5J1D A;  4IO2 A;  5B7D A;  2FBP A;  4F1U A;  4QHQ A;  2XX7 A;  4P47 A;  4HE1 A;  4MFI A;  4ZEC A;  3V83 A;  2HHM A;  2DDK A;  2I6E A;  3T9X B;  3A3U A;  4GF8 A;  1D3K A;  4XFE A;  3MP6 A;  4OEV A;  3H4Z A;  1B6H A;  3FBP A;  4IO3 A;  3PPR A;  4BDM A;  4LA9 A;  1M5B A;  2V3T A;  1MPC A;  2JJK A;  4PAF A;  3G7W A;  4LP2 B;  3M8U A;  2WYP A;  3PD9 A;  4QF9 A;  5ICQ A;  1OVT A;  1QUI A;  1NV7 A;  1FTL A;  1FBG A;  1BKA A;  2ZMB A;  1YZ0 A;  4EQ7 A;  2OK2 A;  3L6H A;  4FIM A;  4U4X A;  5LOM A;  2QMX A;  3QMF A;  1UQW A;  3MW0 A;  5IM2 A;  4GWZ A;  1ZJL A;  2GHB A;  3PPN A;  2ZNT A;  1Y4T A;  3S2V A;  2F78 A;  5DTB A;  4XEQ A;  4OVQ A;  1RDZ A;  3ILT B;  4GQO A;  5AA4 B;  2XXK A;  1P1O A;  3VLW A;  3IAZ A;  5DEX B;  4QFL A;  5AE4 A;  2B3F A;  2ONK E;  2F7B A;  5ET8 A;  2F6G A;  5FHM A;  3B6T A;  2FVZ A;  2F6P A;  3WAE A;  3IL1 B;  3LSF B;  4M4G A;  1IME A;  1JEU A;  3T93 B;  3MST A;  3IOR A;  3TQW A;  1BTJ A;  1SW1 A;  3JYR A;  2NOO A;  3KEI A;  4OA4 A;  1B3F A;  4XKP A;  3DP6 A;  5FTH A;  2VPN A;  2NXO A;  1URD A;  4JDF A;  1ZBM A;  3CFL A;  1EH3 A;  4NF5 A;  3ROJ A;  1FPF A;  4N13 A;  2VGQ A;  1SYI A;  4G8N A;  3IO4 A;  2XXY A;  1CE2 A;  4Q0C A;  4ZE9 A;  1XS5 A;  5L9S A;  1DBZ A;  4G68 C;  3NOH A;  4O94 A;  2X7P A;  3T9V A;  2I58 A;  3PUX E;  4X1B A;  4YAH X;  2QVR A;  2R8T A;  2QVU A;  2Q89 A;  2HXW A;  1DTZ A;  2UVJ A;  4P9K A;  2Z8E A;  4R73 A;  5LTC A;  3C31 A;  2F36 A;  5HBC A;  4PFB A;  1MRP A;  5I2K A;  3T96 B;  4GWY A;  1B4H A;  3PD8 A;  4F31 B;  4PTK A;  3B6Q A;  3LSX A;  1UTH B;  2XXT A;  3LV0 A;  2I0C A;  4FED A;  3FXB A;  1N7X A;  1J1N A;  1R9L A;  1H3D A;  1B5H A;  4OFJ A;  2OWS A;  1B7H A;  1EU8 A;  1ATG A;  1I69 A;  2E0S A;  4U1O A;  1NV2 A;  5I7I A;  4F19 A;  2YJP A;  1XI6 A;  3KFM A;  2VD3 A;  2OX3 A;  4OZ9 A;  2P3N A;  1LBX A;  2HXR A;  4ELP A;  3PUV E;  3CG3 A;  4G77 A;  3JV9 A;  1NV4 A;  4PE5 B;  1YAE A;  4R2F A;  1NUW A;  2CMO A;  3FZV A;  5AA3 A;  2HAU A;  5ET6 A;  4UAB A;  2PFZ A;  4X9T A;  1B3E A;  2H98 A;  2QS1 A;  1SQY A;  4PFI A;  3N5L A;  4AB5 A;  1PBQ A;  1S9T A;  3RTW B;  3MYU A;  1MXV A;  3R7X A;  2XX9 A;  3TTM A;  4I40 A;  4MX6 A;  1B4Z A;  3PPP A;  1OQH A;  1LLS A;  3MAM A;  4PC9 A;  3KBZ A;  3M3F A;  3SEX A;  3MQ9 A;  2DVZ A;  5CM6 A;  1P1N A;  5I59 A;  4ISU A;  4ZDM A;  4NQ8 A;  4PBQ A;  3EF7 A;  4G68 B;  3E78 A;  3K6U A;  4F2O A;  3SEW A;  3K1N A;  3RPL B;  1DSN A;  2DWI A;  5CRY A;  4BDQ A;  1PB8 A;  3JZJ A;  1H43 A;  4DLD A;  2FIE A;  1QUJ A;  1SW2 A;  5M2V A;  2D3I A;  2XXQ A;  4LQ2 A;  1FBP A;  1FQD A;  1NV5 A;  2PBW A;  1IIW A;  1MY2 A;  4JWX A;  1BIY A;  2FA7 A;  4OQO A;  2ZNS A;  3T0J A;  1IMC A;  4PGN A;  3HHG A;  4H5G A;  2UYE A;  2OWZ A;  1MQG A;  4HS7 A;  5H8F B;  4N8G A;  3QXM A;  4X8R A;  5ITP A;  3C35 A;  1FJ6 A;  1IEJ A;  3VXB A;  4NHB A;  4PDH A;  1IMB A;  3MC2 A;  4JB7 A;  1MY1 A;  4QBA A;  4KPT A;  2ZYO A;  4ECF A;  1NNK A;  1ZU0 A;  4XKQ A;  4LZ5 A;  4IY5 A;  4R9G A;  1AH5 A;  3T66 A;  4BDL A;  5DYH A;  2I4C A;  2XXW A;  5I2N B;  2P2A A;  4I9D A;  4OET A;  3H06 B;  4PET A;  3MUQ A;  2Q8J A;  1OMP A;  4FAJ A;  4F3B A;  5A5X A;  4QSD A;  5TP9 A;  4ZZE A;  5I3S A;  4H46 A;  1FBF A;  1JW5 A;  1VFD A;  5I57 B;  3OSR A;  5L9O A;  4N81 A;  3RLF E;  4OVR A;  1FBD A;  1MS7 A;  3QK6 A;  1BLF A;  5DW8 A;  1FSA A;  3FUZ A;  2V3Q A;  2QJE A;  2I0B A;  3GYY A;  1B7Z A;  5L8D A;  4THI A;  4GXA A;  1AIV A;  1H76 A;  2Q88 A;  1FRP A;  3FVN A;  5CMC A;  3TCG A;  5H8Q A;  3IO6 A;  1EZP A;  4GVO A;  3IR1 A;  1IXI A;  1RYO A;  1I6Q A;  3QUF A;  5ET5 A;  3THI A;  3M3L A;  4F29 A;  1NV1 A;  2E1S A;  2ALU A;  3RT6 B;  2Z8F A;  4EF2 A;  2H25 A;  4TQU Q;  4JVC A;  1DPE A;  4MAG A;  3UOR A;  4ELQ A;  3RQT A;  5K2Y A;  1CNQ A;  3G3J A;  3KZG A;  2VHA A;  4O3C A;  3KN7 A;  2B4M A;  4XTC Q;  3MVW A;  3RPW A;  4WED A;  2LAO A;  1LAG E;  3ONM A;  2ZXT A;  3K00 A;  4P1L A;  4OXV A;  1QKA A;  2VD2 A;  1GV8 A;  2I4B A;  3K01 A;  3ECR A;  3SER A;  3A09 A;  3H6W A;  2UYF A;  3O29 A;  3CIJ A;  1FPK A;  1EZO A;  3QSL A;  3MZ9 A;  2P3V A;  1NKX A;  2O7I A;  1QVS A;  3EHS A;  4H45 A;  3CSB A;  5I84 A;  2H9B A;  2ZYK A;  1R1N A;  5B70 A;  4IO6 A;  2VPO A;  1FTO A;  2CZH A;  3PGF A;  3EKI A;  4F22 A;  3IFC A;  2ABH A;  1TFA A;  4YB5 A;  2XXX A;  1Q35 A;  2F97 A;  1M5C A;  4ELO A;  4EQ9 A;  2GFE A;  3VLV A;  2XHD A;  4F2Q A;  4F1V A;  2QS2 A;  5TPA A; 
#chains in the Genus database with same CATH homology
 5FHN A;  4RA1 A;  1OQG A;  3MPL A;  1YCJ A;  2YPN A;  5JTY B;  3BBR A;  3ZS6 A;  2PX1 A;  1LGB C;  3PMW A;  2IA4 A;  1N0T A;  1Y1Z A;  1Y3Q A;  4Q30 B;  1MXY A;  3FJM A;  4RK2 A;  1GTK A;  2F7C A;  1IIT A;  3O6H A;  1XVX A;  5H8H A;  1WOD A;  4IGT A;  1D9Y A;  1FTK A;  4IO7 A;  3TZA A;  1UTB B;  4F18 A;  4GXS B;  4ZEK A;  2DXR A;  3N6T A;  4LON B;  2A5T A;  4JBZ A;  1MM7 A;  3R6U A;  5KCJ A;  2RF1 A;  4LUB A;  4OFL A;  2O69 A;  2PYY A;  3S9L C;  2DS9 A;  3H6T A;  3GBB A;  3O6I A;  1MXX A;  1Q1K A;  1Y20 A;  1B1X A;  3K1P A;  1NNF A;  1PBP A;  3KJT A;  1NNT A;  4Z0I A;  1POY 1;  3DLN A;  2HAV A;  1Y9U A;  1LBB A;  4NWC A;  2RC7 A;  1XOC A;  3SET A;  2FNC A;  1DOT A;  3LUY A;  1XVY A;  2UXA A;  3TDJ A;  1VSO A;  3LC8 A;  2V84 A;  2AIX A;  4FE8 A;  3OEK A;  4RY1 A;  2R9J A;  1TXF A;  3PUW E;  2Z8D A;  2XXI A;  1A55 A;  2ZYN A;  5L9M A;  3CI8 A;  4OES A;  4LZ8 A;  3T9U A;  4NF6 B;  5HM4 B;  3K1M A;  4ZE8 A;  4C1U A;  1H45 A;  3KSJ A;  2QL3 A;  1NH8 A;  4N07 A;  3S9N C;  1JW1 A;  3FIR A;  1RYX A;  4NF4 A;  4KD5 A;  4NTL A;  1LCF A;  3Q26 A;  3H6V A;  1MG1 A;  4FEC A;  3MP1 A;  4GL0 A;  5I56 B;  1VR5 A;  3T9H B;  3RT8 A;  3IJO B;  4ESX A;  1POT A;  2ZNU A;  2I3W A;  4RXL A;  4K3F A;  4YMA A;  4PFY A;  1FQE A;  1Z7N E;  2D5W A;  5HPQ A;  2ONS A;  4R9F A;  4I62 A;  1LAF E;  3G3F A;  1YPN A;  1B0L A;  2AYS A;  2NVU B;  3FJG A;  5CBS A;  3TMG A;  1LAX A;  2REJ A;  1ZLQ A;  3FVG A;  2Y7P A;  3TEL A;  3UIF A;  4RNS A;  1LBC A;  2RKM A;  1GR2 A;  1FQA A;  5I59 B;  3OO6 A;  3MJN A;  3E3K A;  1SD3 A;  4QFN A;  2F8D A;  3K4U A;  1RKM A;  1ZKB A;  4H6D A;  2B3B A;  3L6G A;  4YB7 A;  4OHN A;  1NFT A;  1M5E A;  5AA4 A;  1JET A;  1A99 A;  4UA8 A;  1A40 A;  3N26 A;  3IOT A;  3ZKK A;  3OD7 A;  4P0G A;  5DEX A;  1USY H;  3VV5 A;  1MH4 A;  4EXL A;  3R26 A;  3TKD A;  2XXH A;  4U4S A;  5CMM A;  1IXC A;  4ZEB A;  1UIU A;  4F3G A;  4P0I A;  5BUU A;  5AA1 A;  1NNP A;  4YU0 A;  1Y4C A;  4LZ7 A;  5F7V A;  4H67 A;  1R9Q A;  4NE4 A;  3EHT A;  3VVF A;  1FTJ A;  2QS3 A;  2R6G E;  2Y7R A;  2Y7I A;  3D4C A;  1I6A A;  4H1X A;  3RY3 A;  1P1U A;  1B7U A;  3ODB A;  5KDT B;  1M5D A;  5CMK A;  5FHO A;  1SDX A;  2NWJ A;  3Q27 A;  3CVG A;  1LFI A;  5ELV A;  1D9V A;  4F39 A;  5DVI A;  4FJP A;  1N3X A;  2OWT A;  4E0W A;  5I58 B;  3FV1 A;  4ONY A;  4G4P A;  3Q25 A;  2DVC A;  2DSF A;  3FAS A;  2XXP A;  4M1V A;  1QW0 A;  4IGR A;  1XC1 A;  1B0H A;  1UTH A;  1FTM A;  3HO7 A;  3USD A;  2VOZ A;  1P1Q A;  1DTG A;  3SDF A;  3A3C A;  3Q28 A;  4EF1 A;  3TQL A;  3FVO A;  4TLL B;  2Y7K A;  1S7Y A;  1B2H A;  3RUM A;  1XHY A;  4YMB A;  4ZEF A;  4U22 A;  4PQJ A;  3HN0 A;  4PFW A;  2THI A;  3ILU B;  1LCT A;  4I8C A;  4AB6 A;  1PB7 A;  3TFL A;  4N6P A;  2UVI A;  4KCD A;  4WXJ A;  3OO8 A;  1Y3P A;  3TUS A;  3CG1 A;  3G3H A;  4U21 A;  3AXF A;  4YB6 A;  3VE1 B;  4KI0 E;  3HHF A;  4YKK A;  4RK9 A;  4HW8 A;  3IB0 A;  3HCQ A;  2YLN A;  3KG2 A;  1A7L A;  5EYF A;  4XXU A;  4H8J A;  3HV1 A;  3U1O A;  3Q29 A;  3HST A;  4FAT A;  1MY4 A;  3TTR A;  2DXY A;  4G68 A;  2GH9 A;  4IO4 A;  1LB8 A;  4R6Y A;  3CFZ A;  1MH3 A;  1N7W A;  4E0X A;  3PU5 A;  3MVY A;  2P1S A;  5ITO A;  4POX A;  2F5X A;  5H8S A;  1MQH A;  2HQ0 A;  1B3G A;  3DP8 A;  3SEY A;  3S4U A;  3MBP A;  2H5Y A;  4POW A;  2X26 A;  1FW0 A;  5TPA B;  2O84 X;  1FCK A;  4GLI A;  4QSC A;  4JWY A;  1QKB A;  4KYS A;  1VE4 A;  2Q2C A;  4QSE A;  4TOZ A;  1NMU A;  5TU0 A;  4NF8 B;  1AL3 A;  1P1W A;  1MDQ A;  2I3V A;  1OVB A;  3FAT A;  4RJZ A;  2AL5 A;  3U94 A;  1KWH A;  3TEP A;  5AA2 B;  4WEP A;  1IZ1 A;  3G3I A;  4OEN A;  4KHZ E;  2M8C A;  1JW4 A;  2O51 A;  4OYV A;  3DEL B;  1N04 A;  2XX8 A;  1Y1M A;  4GL8 A;  1QUK A;  2O1M A;  5I2N A;  1US4 A;  2XXR A;  1GGG A;  3K02 A;  1B5I A;  3RNN A;  3G3G A;  3K6W A;  4ZS9 A;  3UA8 A;  2X7Q A;  5DT6 A;  3EN3 A;  3C36 A;  3FXR A;  4X48 A;  5KCJ B;  3MZB A;  2Y7W A;  1FQF A;  1EZ9 A;  3RGY A;  3PV0 E;  3DP4 A;  5I57 A;  2HEU A;  4GRK A;  2O1L A;  4G2Z A;  4LVQ A;  4ZED A;  3OMB A;  4IY6 A;  3VVE A;  5H8N A;  2RCB A;  4H8I A;  2DQV A;  4YIC A;  4HCW A;  3FXU A;  5IKB A;  3K2D A;  3OEN A;  1MY3 A;  2B65 A;  3O9P A;  2GHA A;  2NUV A;  3F11 A;  2OCU A;  3G3K A;  3RN8 A;  1SVX B;  1MPB A;  3C4M A;  2REG A;  2DWJ A;  3H03 A;  2QSX A;  2UVG A;  4IB2 A;  1I6B A;  2ZYM A;  3FV2 A;  3OO9 A;  1URG A;  1DPP A;  3FGS A;  2FYI A;  2QS4 A;  2OLB A;  3IJX B;  3EHU A;  4QFK A;  4DCY A;  3EQ1 A;  4ELR A;  2DE4 A;  1II5 A;  3KBR A;  4UAC A;  2HZK A;  1USY E;  2P0S A;  3SES A;  4OWD A;  3MWB A;  4YKP A;  2PVU A;  4TLM B;  2ANJ A;  3KOT A;  2RCA A;  4KYD A;  3IX1 A;  4R6K A;  5BWJ A;  4JWO A;  3ZSF A;  4X1D A;  3BFT A;  1JQF A;  4NF5 B;  1GVC A;  3UGW A;  4NWD A;  3QAX A;  4C1T A;  1JEV A;  3H6U A;  3KN3 A;  2WKY A;  4DE8 A;  4EDP A;  4KYE A;  2Z22 A;  3MP8 A;  1ZMG A;  4MLV A;  4U23 A;  4DXB A;  5CI5 A;  5EHM A;  2XXU A;  2OJT A;  2RC8 A;  2RIN A;  4RPN A;  5I2K B;  2VP1 A;  4H0W A;  1URS A;  3CR9 A;  4R72 A;  5JTY A;  4DXC A;  1MQI A;  3LR1 A;  3U72 A;  3OEL A;  4R74 A;  3CSG A;  1A8E A;  3TPA A;  4DDD A;  3OXN A;  4GFR A;  2DE2 A;  3IK6 B;  4FOR A;  1US5 A;  4PFU A;  4OVJ A;  4U2R A;  4O3B A;  3OEM A;  1F9B A;  2HFB A;  3VFJ A;  4ND9 A;  5DVF A;  1UTB A;  2H99 A;  5JK4 A;  1LB9 A;  1SI1 A;  1MDP 1;  4BDO A;  4F3P A;  4LQ5 A;  2Q2A A;  3TTK A;  1OIB A;  5CBR A;  4YKI A;  3IOV A;  1UIV A;  4WKM A;  3O66 A;  3PMX A;  4NED A;  5K2X A;  2ESN A;  3VVD A;  1ANF A;  3KOS A;  3TAJ A;  3HPI A;  4JSD A;  3O97 A;  3TTL A;  1SW5 A;  1BP5 A;  2HCA A;  4KFQ A;  4QFO A;  4LAT A;  1IXG A;  1ZTY A;  1PB9 A;  4H65 A;  3C9H A;  4RPO A;  2OZZ A;  3SKP A;  4AQ4 A;  4MF3 A;  3OOA A;  2G29 A;  3TOD A;  4NMY A;  3O2A A;  3I6V A;  3RTF B;  3PMV A;  4DXU A;  4PP0 A;  1MY0 A;  3MVX A;  4R75 A;  3I3V A;  2QRY A;  3UP9 A;  3VLU A;  4JSO A;  1MXW A;  1PDA A;  3TTN A;  2H4I A;  3SEV A;  3E4R A;  4YKJ A;  5DVJ A;  2UVH A;  4NF6 A;  2R71 A;  3PUZ E;  1IXH A;  3W15 C;  3W9V A;  1MPD A;  3TYH A;  2V25 A;  4GOT A;  1CB6 A;  1NH7 A;  2O6A A;  3BKI B;  4YZZ A;  2Z23 A;  3VXC A;  3B6W A;  5I56 A;  1O7T A;  2AL4 A;  3DM0 A;  3GXA A;  4C0R A;  1HSJ A;  1O64 A;  5EHS A;  1XT8 A;  2Y84 A;  2IEE A;  3GLB A;  4BDR A;  1D4N A;  1N3W A;  1R6Z A;  4GIZ A;  2BJJ X;  4G8M A;  2RC9 A;  3PPO A;  1H44 A;  4KQP A;  4QFP A;  2Q9T A;  5A5X B;  1S50 A;  1B40 A;  3V5A A;  5TP9 B;  2F34 A;  1TT1 A;  2PT1 A;  1P99 A;  3S9E A;  3ZKL A;  3KJ7 A;  4I1D A;  1PC3 A;  3FD3 A;  2HZL A;  3MPK A;  1WDN A;  3CRB A;  3WAF A;  3SEU A;  1TWY A;  4P11 A;  3OO7 A;  4IO5 A;  1A54 A;  2PT2 A;  4PFT A;  3GBA A;  5H8Q B;  4H5F A;  3S9M C;  1QJM A;  5JEI A;  2I49 A;  2V93 A;  5FTI A;  3O28 A;  1WVJ A;  3VDF A;  2W7Y A;  1AOV A;  4MLQ A;  5ICT A;  1OLA A;  3OSQ A;  2DOJ A;  1B58 A;  1N76 A;  4DIG A;  4BDN A;  3UK4 A;  1B52 A;  1ZIU A;  5CC2 A;  3U8Q A;  3V89 B;  2O7U A;  3QYT A;  4R2B A;  1AMF A;  1IUD A;  3K6V A;  1SYH A;  4JXI A;  2V3U A;  3FXQ A;  4R6H A;  3T22 A;  2OBG A;  3C34 A;  3U92 A;  1B1H A;  1N84 A;  2O68 A;  5KDT A;  2DWA A;  1L5T A;  3LSW A;  1B32 A;  4EUO A;  3IOW A;  3C33 A;  4GD5 A;  2XXV A;  1JVY A;  1JVX A;  1IQ7 A;  3I5O A;  5F1Q A;  1B46 A;  3EPE A;  4ZEI A;  2I48 A;  4DZ1 A;  5I58 A;  1A8F A;  3PPQ A;  2G93 A;  3FJ7 A;  1Y3N A;  3N6U A;  4FEB A;  1NL5 A;  2CZL A;  5H8N B;  1SW4 A;  3IOU A;  5AA2 D;  4OER A;  3U93 A;  1B05 A;  1FQC A;  4DCX A;  4OEU A;  4L17 A;  1B5J A;  4Q8R A;  5H8F A;  3UN6 A;  4U1Z A;  1MM6 A;  1JNF A;  1T0K A;  2F35 A;  3V8X B;  5ISU A;  3E9X A;  5CMB A;  4Q5T A;  4G8H A;  4MBP A;  2XD3 A;  1MXU A;  3E13 X;  4GWO A;  4HCY A;  3K0V A;  5H8H B;  1VFE A;  3M3K A;  1YTV A;  1FQB A;  1OLC A;  1TFD A;  3O6G A;  3P7I A;  3PUY E;  2QMW A;  2A5T B;  1O63 A;  2DYX A;  1B9J A;  3N94 A;  3IB2 A;  4XKR A;  4Z7E A;  3QIM A;  3GZG A;  2DWH A;  1QUL A;  3MVZ A;  3FVK A;  4EXK A;  1B3H A;  3W9W A;  4ZZA A;  1LAH E;  3CFX A;  2A5S A;  3IB1 A;  1Z7M E;  1ELJ A;  1HSL A;  3H7M A;  1LFH A;  4KR5 A;  3C32 A;  4XKN A;  5IAI A;  3KSX A;  2F7A A;  2DP8 A;  3KGC A;  4OMB A;  1LFG A;  2QPQ A;  1LST A;  4BLA A;  1MQJ A;  3KN8 A;  1PEB A;  2PMS A;  1M5F A;  1MQD A;  1HSE A;  4KCC A;  4RYA A;  1B3L A;  4MH5 A;  4F1Y A;  4EQB A;  3TCF A;  3D4G A;  2D21 A;  1DMB A;  3LBS A;  4HTG A;  4NF8 A;  5KZT A;  4O3A A;  1SBP A;  4OTE A;  3K6X A;  1SI0 A;  2ONR A;  3B7D A;  3BFU A;  4F3S A;  2XD2 A;  3TCH A;  2KLF A;  5AA2 A;  3LSL A;  3QUJ A;  4OFO A;  1MXZ A;  4NF4 B;  4ESW A;  2GRV A;  4XIG Q;  4QRZ A;  1B51 A;  3H3G A;  2DE3 A;  3MZ1 A;  5J1D A;  4IO2 A;  5B7D A;  4F1U A;  4QHQ A;  2XX7 A;  4MFI A;  4ZEC A;  3V83 A;  2I6E A;  3T9X B;  3A3U A;  4GF8 A;  1D3K A;  3MP6 A;  4OEV A;  3H4Z A;  1B6H A;  4IO3 A;  3PPR A;  4BDM A;  4LA9 A;  1M5B A;  2V3T A;  1MPC A;  3G7W A;  4LP2 B;  3M8U A;  3PD9 A;  4QF9 A;  5ICQ A;  1OVT A;  1QUI A;  1FTL A;  1BKA A;  2ZMB A;  4EQ7 A;  2OK2 A;  3L6H A;  4FIM A;  4U4X A;  5LOM A;  2QMX A;  1UQW A;  3MW0 A;  1ZJL A;  2GHB A;  3PPN A;  2ZNT A;  1Y4T A;  3S2V A;  2F78 A;  5DTB A;  3ILT B;  4GQO A;  5AA4 B;  1P1O A;  3VLW A;  3IAZ A;  5DEX B;  4QFL A;  5AE4 A;  2B3F A;  2ONK E;  2F7B A;  2F6G A;  5FHM A;  3B6T A;  2F6P A;  3WAE A;  3IL1 B;  3LSF B;  4M4G A;  1JEU A;  3T93 B;  3IOR A;  3TQW A;  1BTJ A;  1SW1 A;  3JYR A;  2NOO A;  3KEI A;  1B3F A;  4XKP A;  3DP6 A;  5FTH A;  2NXO A;  1URD A;  4JDF A;  1ZBM A;  3CFL A;  1EH3 A;  4NF5 A;  4N13 A;  2VGQ A;  1SYI A;  4G8N A;  3IO4 A;  2XXY A;  1CE2 A;  4Q0C A;  4ZE9 A;  1XS5 A;  5L9S A;  4G68 C;  2X7P A;  3T9V A;  2I58 A;  3PUX E;  4X1B A;  4YAH X;  2Q89 A;  2HXW A;  1DTZ A;  2UVJ A;  2Z8E A;  4R73 A;  3C31 A;  2F36 A;  5HBC A;  5I2K A;  1MRP A;  3T96 B;  1B4H A;  3PD8 A;  4F31 B;  3B6Q A;  3LSX A;  1UTH B;  2XXT A;  2I0C A;  4FED A;  1N7X A;  1J1N A;  1R9L A;  1H3D A;  1B5H A;  4OFJ A;  2OWS A;  1B7H A;  1EU8 A;  1ATG A;  1I69 A;  2E0S A;  4U1O A;  4F19 A;  2YJP A;  3KFM A;  2VD3 A;  4OZ9 A;  4ELP A;  3PUV E;  3CG3 A;  4G77 A;  3JV9 A;  4PE5 B;  1YAE A;  4R2F A;  2CMO A;  3FZV A;  5AA3 A;  2HAU A;  4X9T A;  1B3E A;  2H98 A;  2QS1 A;  1SQY A;  3N5L A;  4AB5 A;  1PBQ A;  1S9T A;  3RTW B;  1MXV A;  3R7X A;  2XX9 A;  3TTM A;  1B4Z A;  3PPP A;  1OQH A;  1LLS A;  3MAM A;  3M3F A;  3SEX A;  3MQ9 A;  2DVZ A;  5CM6 A;  1P1N A;  5I59 A;  4ISU A;  4ZDM A;  3EF7 A;  4G68 B;  3K6U A;  4F2O A;  3SEW A;  3K1N A;  1DSN A;  2DWI A;  5CRY A;  4BDQ A;  1PB8 A;  3JZJ A;  1H43 A;  4DLD A;  1QUJ A;  1SW2 A;  5M2V A;  2D3I A;  2XXQ A;  4LQ2 A;  1FQD A;  2PBW A;  1IIW A;  1MY2 A;  4JWX A;  1BIY A;  2FA7 A;  4OQO A;  2ZNS A;  3HHG A;  4H5G A;  2UYE A;  1MQG A;  4HS7 A;  5H8F B;  3QXM A;  5ITP A;  3C35 A;  1IEJ A;  3VXB A;  3MC2 A;  4JB7 A;  1MY1 A;  4KPT A;  2ZYO A;  4ECF A;  1NNK A;  1ZU0 A;  4XKQ A;  4LZ5 A;  4IY5 A;  4R9G A;  1AH5 A;  3T66 A;  4BDL A;  5DYH A;  2I4C A;  2XXW A;  5I2N B;  2P2A A;  4I9D A;  4OET A;  3H06 B;  4PET A;  3MUQ A;  2Q8J A;  1OMP A;  4FAJ A;  4F3B A;  5A5X A;  4QSD A;  5TP9 A;  4ZZE A;  1JW5 A;  1VFD A;  5I57 B;  3OSR A;  5L9O A;  3RLF E;  1MS7 A;  3QK6 A;  1BLF A;  3FUZ A;  2V3Q A;  2QJE A;  2I0B A;  1B7Z A;  5L8D A;  4THI A;  4GXA A;  1AIV A;  1H76 A;  2Q88 A;  3FVN A;  5CMC A;  3TCG A;  5H8Q A;  3IO6 A;  1EZP A;  4GVO A;  3IR1 A;  1IXI A;  1RYO A;  1I6Q A;  3QUF A;  3THI A;  3M3L A;  4F29 A;  2E1S A;  2ALU A;  3RT6 B;  2Z8F A;  4EF2 A;  2H25 A;  4TQU Q;  1DPE A;  3UOR A;  4ELQ A;  3RQT A;  5K2Y A;  3G3J A;  3KZG A;  2VHA A;  4O3C A;  3KN7 A;  4XTC Q;  3MVW A;  3RPW A;  4WED A;  2LAO A;  1LAG E;  3ONM A;  2ZXT A;  3K00 A;  4OXV A;  1QKA A;  2VD2 A;  1GV8 A;  2I4B A;  3K01 A;  3ECR A;  3SER A;  3A09 A;  3H6W A;  2UYF A;  3O29 A;  3CIJ A;  1EZO A;  3QSL A;  3MZ9 A;  1NKX A;  2O7I A;  1QVS A;  3EHS A;  3CSB A;  5I84 A;  2H9B A;  2ZYK A;  1R1N A;  5B70 A;  4IO6 A;  1FTO A;  3PGF A;  4F22 A;  2ABH A;  1TFA A;  4YB5 A;  2XXX A;  1Q35 A;  2F97 A;  1M5C A;  4ELO A;  4EQ9 A;  2GFE A;  3VLV A;  2XHD A;  4F2Q A;  4F1V A;  2QS2 A;  5TPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...