2Q2CA

Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
231
structure length
231
Chain Sequence
KKVVVGTDAAFAPFEYMQKGKIVGFDVDLLDAVMKAAGLDYELKNIGWDPLFASLQSKEVDMGISGITITDERKQSYDFSDPYFEATQVILVKQGSPVKNALDLKGKTIGVQNATTGQEAAEKLFGKGPHIKKFETTVVAIMELLNGGVDAVITDNAVANEYVKNNPNKKLQVIEDPKNFASEYYGMIFPKNSELKAKVDEALKNVINSGKYTEIYKKWFGKEPKLDRLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ArtJ
publication title Crystal structures and mutational analysis of the arginine-, lysine-, histidine-binding protein ArtJ from Geobacillus stearothermophilus. Implications for interactions of ArtJ with its cognate ATP-binding cassette transporter, Art(MP)2
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 74
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2q2cA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2q2cA02
1OMPA 4ZEDA 4GRKA 4IO5A 4OYVA 2I58A 1P99A 1RYXA 3QUFA 1VE4A 2D3IA 3G3HA 1M5DA 4NF6A 4LQ2A 3FASA 2H4IA 1VR5A 1M5EA 1M5BA 1FQCA 3RPWA 3SEYA 1URGA 1IEJA 5H8QA 4BDLA 1B7UA 3LSFB 2D5WA 3VDFA 3MPLA 4N13A 3GZGA 2Y7IA 1URDA 4GFRA 3EHTA 3MZ1A 1JEUA 1N76A 1MXXA 2D21A 2HXWA 2QL3A 5CBSA 4GF8A 1PDAA 3IOWA 1OLCA 2XD3A 3WAEA 3OSRA 4RPNA 3G3GA 4OMBA 3ECRA 2O6AA 1DTZA 4NF5B 4TLLB 1O63A 3MZBA 4WEPA 4QFPA 4QSCA 2DWJA 3OEKA 1FQAA 2XXQA 5AA2B 5TP9B 1PEBA 1YTVA 4R75A 5AA3A 4OERA 2UYFA 3MC2A 4IY6A 1A99A 2A5TA 3I5OA 1BTJA 3DLNA 2R9JA 4IO7A 2XXXA 1PBPA 1UTHA 1Z7NE 5I57A 3HPIA 4R72A 3SKPA 5FTIA 4DDDA 4DXBA 3G3IA 4F3GA 5CM6A 3QSLA 4DZ1A 4H5FA 4JWXA 4KFQA 3LSWA 3PD8A 2DSFA 1OLAA 4FORA 4R74A 3O2AA 4JBZA 4OHNA 3G3JA 3KJTA 2ZXTA 1FQBA 2QJEA 1MQGA 4F1YA 1B3HA 1MPBA 1OVBA 3UK4A 1S7YA 1IXIA 1M5CA 3O6GA 1R9LA 4ZDMA 1Y4TA 3O97A 4H65A 2Z8EA 3IX1A 4NWDA 3FVKA 2GRVA 5ITPA 1SI1A 1I6QA 2ZYOA 3KOSA 3MP8A 3U72A 2F5XA 3QK6A 4MF3A 4QRZA 1FCKA 2ONKE 3F11A 4R2BA 2BJJX 5DVIA 3CFZA 3EN3A 4K3FA 4EQ7A 4ZEKA 2G93A 1UQWA 1CE2A 3ZSFA 4ISUA 5LOMA 4LUBA 3VLWA 4NF8B 1SW2A 2F7BA 4PFUA 1URSA 3FJGA 2O84X 1QKBA 1PBQA 1ZKBA 2FYIA 2O51A 2O7IA 4H8IA 5F1QA 3BFTA 1POTA 1LBCA 2Q8JA 2AL5A 1LFHA 4GXSB 1N84A 5TPAB 5AA2A 4LATA 3V5AA 3MBPA 4XKRA 3DP8A 3VLUA 2Q2AA 5IKBA 3U1OA 4P0IA 3HCQA 3L6GA 3MP1A 4X1BA 2F6GA 3S9MC 3T22A 1OQGA 5A5XA 3RTWB 3CRBA 4C0RA 1GGGA 2V84A 3B6QA 3E9XA 4ZZAA 1MPDA 1IXCA 2O1LA 1FQDA 4RPOA 4U1OA 1FTOA 1MXUA 3U93A 1B51A 4F2OA 1B3GA 4G68C 2ONRA 3QIMA 3RLFE 3IOTA 4KYDA 4RNSA 3FXUA 2QRYA 4YB6A 1H3DA 4ZEIA 3OELA 3TEPA 1NFTA 5AE4A 3S9EA 3Q29A 4N6PA 3OMBA 2I48A 3E3KA 3N94A 2H9BA 5DTBA 3DP6A 3TFLA 2HQ0A 3TUSA 1IIWA 3JV9A 3PMVA 3VLVA 2ZNSA 2V3UA 5I56A 1TXFA 1TFDA 3EHSA 1FTKA 4G4PA 2CZLA 1H45A 5DT6A 4QSDA 1YPNA 3C33A 1SW5A 4JXIA 3PUZE 1FTJA 1QVSA 4FAJA 2ONSA 4F1UA 5ICQA 3M3LA 4NE4A 5ICTA 3K6XA 3O29A 1NNFA 2H98A 1GR2A 4KPTA 3FGSA 1B58A 5H8SA 5I2NB 4F18A 3RUMA 4U4SA 2VHAA 3LC8A 1QJMA 3PUWE 2XXVA 4R73A 1USYH 1SDXA 4FE8A 4R6HA 2H5YA 3TMGA 3EF7A 4ZEFA 4F1VA 2O69A 3LUYA 4THIA 3R6UA 4WXJA 3FVGA 1LFGA 3IB0A 2OJTA 4EDPA 3O6HA 1JEVA 3GLBA 1Y3NA 4DCYA 1XT8A 3CVGA 2F97A 3FVNA 4QFOA 3CR9A 2V3QA 3IOUA 4ZE9A 3ONMA 2V25A 4Z7EA 1P1UA 1PB9A 4MLQA 4XXUA 1B05A 3BBRA 3GXAA 5J1DA 1QUKA 1MY3A 1Y9UA 4OZ9A 4RXLA 2ESNA 4YMBA 3V83A 3N6TA 4X48A 3C4MA 2THIA 3UN6A 1N3XA 1I6BA 1ZBMA 3VFJA 2G29A 3KG2A 5CMCA 5KCJB 5HM4B 3PGFA 5CBRA 4QSEA 5JK4A 3K1MA 4KYSA 2YPNA 3CI8A 4O3CA 2UVHA 1MQHA 4ONYA 4R9FA 4R6KA 4DE8A 4ELQA 3TTKA 1PC3A 1B3LA 1O64A 1US4A 2Y7RA 3Q27A 1NL5A 1P1WA 2F6PA 5B70A 4E0WA 1Z7ME 2AYSA 2NUVA 3K6WA 5H8FB 3H3GA 1LSTA 1DSNA 1P1NA 1POY1 1AIVA 4OENA 1QUIA 1B0LA 2DE2A 4KHZE 4JB7A 3KZGA 4TQUQ 1VFDA 3E4RA 5I2NA 3CIJA 4GIZA 5L9SA 4PE5B 1PB8A 5BUUA 3FV1A 1T0KA 1MXWA 4R9GA 3MP6A 1TT1A 4G8MA 1XHYA 5I2KB 5BWJA 4PP0A 3OO7A 4ECFA 3TCGA 4KI0E 1S9TA 1MXYA 2RCAA 4G8NA 4LVQA 1UTBB 4IO3A 2UVIA 2Y7KA 1M5FA 1AOVA 5M2VA 4FECA 3MAMA 4UACA 4POWA 4BDOA 4YKKA 1MY2A 3TYHA 4ZECA 3S2VA 4OFLA 3FD3A 4AQ4A 3K0VA 4TLMB 2M8CA 3UP9A 4ND9A 5F7VA 2XX7A 3B6TA 5CRYA 3W9WA 3G3FA 1XVYA 1D3KA 1NH7A 2PBWA 1KWHA 4ESXA 1DPPA 5CI5A 5FTHA 4MH5A 1H44A 3OEMA 2QS2A 4GD5A 2ZMBA 3LSXA 3QYTA 4PFYA 5AA4A 1LB9A 3IL1B 1SI0A 3MVYA 3PMXA 5CMMA 1L5TA 1B5IA 2DWIA 3FUZA 1FTMA 4P0GA 3D4GA 4GXAA 2NWJA 2W7YA 5DYHA 1O7TA 3FJMA 1VSOA 4Q0CA 3HSTA 3MQ9A 2ZYNA 5EHMA 2OWTA 4AB6A 4FATA 3PPQA 4I62A 3TAJA 1B0HA 4HS7A 5HBCA 1RYOA 4R2FA 2AIXA 4ELRA 4RA1A 2XHDA 4ZZEA 2F7AA 2YJPA 4QFKA 5ISUA 2Z8DA 4NWCA 3FJ7A 4HTGA 4U21A 1BP5A 3PU5A 3BFUA 1Y3PA 2UYEA 4FEDA 1F9BA 2XX9A 2R6GE 2F8DA 3ZKKA 4JSDA 2XXYA 4WEDA 4EF1A 4U23A 3JYRA 4YAHX 5CMKA 2VGQA 4GVOA 1WDNA 4IB2A 4XKPA 1MY0A 1ZTYA 1SBPA 3MVZA 4MBPA 4NF5A 4OESA 5IAIA 1FW0A 3KN3A 4EXKA 3QXMA 1TFAA 3Q28A 1LLSA 2I3VA 3MZ9A 1MH4A 1D9VA 4G77A 5H8NB 1A55A 3FXQA 5TP9A 3DELB 5FHOA 1CB6A 1PB7A 4RYAA 1B1HA 4YKJA 3IOVA 3H6UA 2OCUA 2R71A 3C32A 2PT2A 4F19A 2ZYMA 4Q5TA 3ILTB 3CFLA 4H5GA 4YU0A 1J1NA 1SYHA 5FHMA 3OD7A 1GV8A 3MUQA 4X9TA 1JW5A 4PFWA 4DLDA 1FQEA 3K00A 2DS9A 3EHUA 4X1DA 4LONB 3K2DA 3TKDA 3H7MA 3K1PA 4F29A 3PMWA 2DP8A 4H6DA 3HN0A 5K2YA 2DE3A 1LBBA 4YB7A 1IZ1A 3O6IA 4YMAA 1RKMA 1NMUA 2PX1A 5JEIA 1MPCA 1XC1A 1B9JA 1A8FA 4GOTA 3I6VA 1JQFA 3SETA 2ZNUA 3UGWA 4ZEBA 3MPKA 3N5LA 5TU0A 4IGTA 1A40A 2QS3A 5L9MA 2PVUA 1ZLQA 1MM7A 4IGRA 3PPPA 3RY3A 2I4BA 4LP2B 3OO8A 3O28A 3VVEA 3K4UA 4F3BA 4O3AA 3WAFA 3FXRA 2GFEA 3PPOA 1DOTA 4P11A 1IUDA 2OZZA 3TTLA 3TZAA 1LAFE 3H6VA 4NTLA 4RJZA 5DEXB 3USDA 2E1SA 1B40A 2F35A 1B6HA 4F3PA 1JVXA 4NF8A 4I8CA 5K2XA 3VV5A 2Y7PA 3U94A 2O68A 2F34A 4F3SA 4KCDA 4RK2A 2Q9TA 3SERA 2H99A 1MXVA 4NMYA 4NF6B 3TTRA 3RT6B 2VP1A 3OO6A 1N3WA 4OETA 3RGYA 3U8QA 3HO7A 3I3VA 2A5SA 4LQ5A 2O7UA 3OENA 4YB5A 1H43A 2DWAA 4OXVA 3IB2A 1B5HA 2HZKA 3TCFA 5TPAA 1ZU0A 1R1NA 1MY1A 4DXUA 3IO4A 1FQFA 2Z23A 4GL8A 3FVOA 1NNKA 3K02A 4OQOA 1NNPA 1B7ZA 2REJA 2XXHA 4G2ZA 2I49A 3A09A 3C36A 3PD9A 2LAOA 3MVWA 1II5A 4DIGA 2OK2A 2Q88A 4NF4B 4KD5A 5JTYB 2GHBA 1ATGA 1ZJLA 2V93A 3N6UA 5DVJA 3P7IA 3OOAA 2XD2A 3AXFA 2ANJA 2XX8A 2X7QA 3CG1A 1P1OA 3R26A 3SEWA 2QS4A 3T9UA 1EZ9A 2Q89A 3VXCA 1DMBA 2OLBA 5HPQA 3O66A 1EU8A 4OTEA 3IK6B 4I1DA 3ODBA 3G3KA 3KSXA 4F22A 4ELPA 1ZIUA 2UVGA 2I0BA 5ITOA 1ANFA 3VE1B 4F2QA 1I6AA 5AA1A 1B7HA 3SEXA 4ELOA 4BDMA 3QUJA 4GQOA 1UTHB 2PMSA 3MWBA 4LZ7A 3PPRA 2RF1A 1B5JA 2DQVA 2DWHA 2H25A 4OWDA 3IJXB 4F39A 2P1SA 1IXGA 3B7DA 4JDFA 1HSLA 2OBGA 4H67A 4XKQA 5DEXA 3BKIB 3HV1A 3T66A 2Y84A 1VFEA 4OFJA 4MLVA 1UIVA 3KSJA 2VD2A 3H4ZA 1JVYA 2RC9A 4C1UA 1IITA 2KLFA 2X26A 4EXLA 1MDP1 1USYE 1LAGE 3A3UA 4OVJA 1B2HA 3D4CA 1Q35A 2ABHA 2I0CA 4U4XA 1JW4A 1HSEA 3PV0E 3TPAA 3LBSA 4R6YA 1NNTA 1NKXA 3O9PA 3N26A 2CMOA 4OEVA 4QHQA 4LZ5A 3SEUA 4EQ9A 4MFIA 1EZOA 2ALUA 4NF4A 5JTYA 3UORA 3LSLA 1R9QA 2B3BA 3DP4A 4H0WA 1B46A 1B3EA 5H8HB 5EHSA 5I84A 1XS5A 2YLNA 3C34A 2QMWA 5EYFA 2OWSA 3FATA 3UA8A 3TDJA 1LAHE 2V3TA 4U1ZA 1LB8A 1UIUA 4XIGQ 2DYXA 4DCXA 2ZNTA 3KBRA 2X7PA 1B52A 3GBBA 3K6UA 4F31B 1B4HA 1S50A 1SVXB 5KDTB 2RC7A 4U2RA 3H6TA 1R6ZA 4N07A 4IY5A 1MQDA 3EPEA 1H76A 1AMFA 3TQWA 4ZE8A 5A5XB 1ZMGA 2B3FA 3CFXA 3PPNA 3CSGA 5KCJA 3HHFA 3E13X 3U92A 4EQBA 1MG1A 2NOOA 2DOJA 3T9XB 3B6WA 4RY1A 2HZLA 4ZS9A 5KZTA 1MQIA 2P2AA 1XVXA 1IXHA 2WKYA 4ESWA 3PUVE 1HSJA 3H06B 1BLFA 3SEVA 3TCHA 3K1NA 4PETA 3C35A 3W15C 3KFMA 3K01A 1N7XA 2XXWA 3CG3A 1B3FA 1N04A 3T9HB 1LCFA 3UIFA 5H8FA 3S4UA 4PQJA 4IO4A 1OIBA 1OQHA 1EH3A 3ILUB 4QF9A 5DVFA 3IAZA 2GHAA 4H8JA 2F7CA 3RT8A 5I59B 1WVJA 1MH3A 3OSQA 1MXZA 2QSXA 4OFOA 1LFIA 4I9DA 2HAUA 5I2KA 5I56B 1AL3A 2UVJA 1GTKA 4U22A 2HFBA 5AA2D 3G7WA 3KOTA 2AL4A 1UTBA 3T96B 4KR5A 4JWOA 4G8HA 4IO2A 1YAEA 2XXIA 2E0SA 5H8HA 2FA7A 1MDQA 3JZJA 1JETA 3Q26A 3T93B 5CMBA 1Y1ZA 1Y4CA 3FZVA 3LR1A 4GLIA 4WKMA 3MVXA 2XXPA 4PFTA 3V8XB 1SYIA 4QFNA 4EF2A 3KN8A 3TELA 1XOCA 1BKAA 4C1TA 1Y1MA 2FNCA 2I6EA 4HCWA 1QUJA 5KDTA 3IORA 1D4NA 3VVDA 1QW0A 2VD3A 1LAXA 1OVTA 5I58B 3KN7A 3MJNA 3PUXE 4TOZA 4UA8A 4Q8RA 2UXAA 5B7DA 2B65A 2REGA 1N7WA 3K6VA 1IQ7A 4JWYA 3OXNA 4M4GA 4H1XA 1ELJA 3W9VA 3KJ7A 1YCJA 1GVCA 3RNNA 3M3FA 2I4CA 4FEBA 2DE4A 1Y20A 1FTLA 1P1QA 1JNFA 1A7LA 4QFLA 1B32A 4YICA 1QKAA 4G68B 1Y3QA 3THIA 1MY4A 4OEUA 1D9YA 2NXOA 3ZS6A 1LGBC 3M8UA 3SDFA 3CSBA 2DXYA 1I69A 4M1VA 5L8DA 1DPEA 1MS7A 3L6HA 3RN8A 5I59A 3C9HA 1US5A 2HEUA 2DXRA 4RK9A 1SW4A 1SW1A 3A3CA 2PT1A 3IJOB 4L17A 4DXCA 3M3KA 4IO6A 3IB1A 2PYYA 1NH8A 3HHGA 2QS1A 2VOZA 3TTNA 1MM6A 2RCBA 2I3WA 2RINA 1WODA 3TQLA 3FIRA 3ZKLA 3H6WA 4LZ8A 4Q30B 1DTGA 3R7XA 3C31A 2XXTA 4BDRA 4KCCA 4KYEA 4BLAA 5CC2A 2NVUB 5H8NA 2XXUA 1A54A 4BDNA 2P0SA 1MRPA 5H8QB 2Q2CA 1BIYA 4GWOA 1QULA 4XKNA 3Q25A 2F36A 2QMXA 4YKPA 3VVFA 3DM0A 3TODA 3H03A 4LA9A 3QAXA 5I58A 2RKMA 2IA4A 1N0TA 2HAVA 2XXRA 3S9NC 3IO6A 1B4ZA 3MW0A 3T9VA 4AB5A 4FIMA 1TWYA 2Y7WA 1B1XA 3S9LC 1EZPA 3EQ1A 3RTFB 1Q1KA 4JSOA 2Z22A 4EUOA 3V89B 5ELVA 4BDQA 1AH5A 3KEIA 4NEDA 4POXA 4YZZA 3IR1A 4O3BA 4HCYA 3PUYE 2O1MA 2HCAA 2ZYKA 1SQYA 1A8EA 3TTMA 2IEEA 4GL0A 2GH9A 4G68A 3RQTA 2A5TB 3SESA 5L9OA 2DVCA 1MQJA 5I57B 4FJPA 3KGCA 2F78A 1SD3A 5AA4B 3VXBA 3OO9A 4HW8A 5FHNA 4XTCQ 4YKIA 3FV2A 2RC8A 4KQPA 4Z0IA 3GBAA 1JW1A 2QPQA 1LCTA 2DVZA 4E0XA 2Z8FA
chains in the Genus database with same CATH superfamily
1OMPA 4ZEDA 3QMFA 4GRKA 4IO5A 4OYVA 2I58A 1P99A 1RYXA 3QUFA 1KA0A 1VE4A 2D3IA 3G3HA 1M5DA 4P56A 4NF6A 4LQ2A 1KZ8A 3FASA 2H4IA 1VR5A 1M5EA 1M5BA 1FQCA 3RPWA 3SEYA 5IZ3A 1URGA 4GWUA 1IEJA 5H8QA 4BDLA 1B7UA 3LSFB 2D5WA 3VDFA 3MPLA 4HXVA 4N13A 3GZGA 2Y7IA 1URDA 4GFRA 3EHTA 4MJOA 2VPOA 3MZ1A 1JEUA 1N76A 2XA5A 4PF6A 1MXXA 2D21A 2HXWA 5EYHA 2QL3A 2R8TA 5CBSA 4GF8A 1PDAA 4N91A 3IOWA 2B4MA 1OLCA 2XD3A 2F3BA 3WAEA 3OSRA 4RPNA 3G3GA 4OMBA 4PBQA 3ECRA 2O6AA 1DTZA 4NF5B 4TLLB 1O63A 3MZBA 3T1BA 4WEPA 4PDHA 4QFPA 4QSCA 2DWJA 3OEKA 1FQAA 2XXQA 5AA2B 4FBPA 5TP9B 1PEBA 2ZZWA 1RDYA 1YTVA 4R75A 5AA3A 2CZKA 4OERA 2UYFA 3MC2A 4IY6A 1LBVA 1A99A 2A5TA 3I5OA 1BTJA 3DLNA 2R9JA 4IO7A 2XXXA 1PBPA 4OVSA 1UTHA 1Z7NE 5I57A 1FBHA 3HPIA 4OA4A 2XXKA 4R72A 5FTIA 3SKPA 4DDDA 4DXBA 2XWVA 3G3IA 4F3GA 5CM6A 3QSLA 4DZ1A 4H5FA 4JWXA 4KFQA 3LSWA 3PD8A 2DSFA 1OLAA 1FPDA 4FORA 1FTAA 4R74A 3O2AA 4JBZA 5IZ1A 4NHBA 4OHNA 3G3JA 3KJTA 2ZXTA 1FQBA 2QJEA 1LBZA 1MQGA 1FBGA 4F1YA 1B3HA 1MPBA 4PFRA 1OVBA 3UK4A 1S7YA 1IXIA 4I40A 1M5CA 4PTKA 4GWYA 3O6GA 1R9LA 4ZDMA 1Y4TA 3O97A 4H65A 2Z8EA 3IX1A 4NWDA 3FVKA 2GRVA 5ITPA 4DI3D 1SI1A 1I6QA 3T0JA 1NV1A 2ZYOA 3KOSA 3MP8A 3U72A 2F5XA 2HPGA 3QK6A 4MF3A 4QRZA 1FCKA 2ONKE 3F11A 4R2BA 2BJJX 5DVIA 3CFZA 3EN3A 4K3FA 4EQ7A 4ZEKA 2G93A 1UQWA 1CE2A 4PC9A 3ZSFA 4ISUA 5LOMA 4LUBA 3VLWA 4NF8B 1SW2A 2F7BA 4GX4A 4PFUA 1URSA 1LBWA 3FJGA 2O84X 2WBDA 4PGNA 1QKBA 1PBQA 1ZKBA 1EYKA 4OVPA 2FYIA 3KC1A 4MHFA 2O51A 2O7IA 1DK4A 4H8IA 5F1QA 3BFTA 1D9QA 1POTA 1LBCA 2Q8JA 2AL5A 1LFHA 4GXSB 1N84A 5TPAB 5AA2A 4LATA 3V5AA 3MBPA 4XKRA 4MNIA 3DP8A 3VLUA 2Q2AA 4N4UA 5IKBA 3LV0A 3U1OA 4P0IA 3HCQA 4GBWA 3L6GA 1KA1A 3MP1A 4X1BA 2F6GA 3S9MC 5I5PA 3T22A 1OQGA 4PBHA 5A5XA 3RTWB 3CRBA 4C0RA 1GGGA 4PFBA 2V84A 3B6QA 2V4CA 3E9XA 4ZZAA 3SZPA 1MPDA 1IXCA 2O1LA 1FQDA 4RPOA 4U1OA 1FJ9A 1FTOA 2HXRA 5EQ7A 4OANA 1MXUA 3U93A 4NF0A 2MKZA 1B51A 4GX3A 4F2OA 1B3GA 1DCUA 5EYGA 4G68C 2QVUA 2ONRA 3QIMA 3RLFE 2ZZXA 3IOTA 2XWOA 4KYDA 4RNSA 3FXUA 2QRYA 4YB6A 1H3DA 4ZEIA 3OELA 3TEPA 1NFTA 5AE4A 3S9EA 3Q29A 4N6PA 3OMBA 2I48A 2WYKA 1IMDA 3E3KA 3N94A 2H9BA 4GWSA 5DTBA 3DP6A 3TFLA 2HQ0A 3TUSA 1IIWA 3JV9A 3PMVA 3VLVA 2ZNSA 2V3UA 3A29A 5I56A 2OX3A 1TXFA 1TFDA 3EHSA 1FTKA 4N17A 4G4PA 2CZLA 1H45A 4N81A 5DT6A 1NV6A 2QVRA 4QSDA 1YPNA 4O7MA 3C33A 1SW5A 4JXIA 1IMBA 3PUZE 4N6DA 1FTJA 1QVSA 4FAJA 2ONSA 5FBPA 3GYYA 4F1UA 5ICQA 3M3LA 4NE4A 3IFCA 5ICTA 3K6XA 3O29A 1LEVA 1NNFA 2H98A 1GR2A 4KPTA 3FGSA 1B58A 5H8SA 5I2NB 4F18A 3RUMA 4U4SA 2VHAA 3LC8A 5I7IA 1QJMA 3PUWE 2XXVA 4R73A 1USYH 1SDXA 4FE8A 4R6HA 1RDXA 2H5YA 3TMGA 3EF7A 2CEYA 4ZEFA 4F1VA 1FBPA 2O69A 3LUYA 4THIA 3R6UA 5EQ8A 4WXJA 3FVGA 1LFGA 1EYJA 3IB0A 2OJTA 4EDPA 3O6HA 4MNPA 1JEVA 3GLBA 1LBXA 4PE3A 1Y3NA 4DCYA 1XT8A 3CVGA 2F97A 3FVNA 4QFOA 4PDDA 3CR9A 2V3QA 3IOUA 4ZE9A 3ONMA 1LBYA 2V25A 4Z7EA 1P1UA 1PB9A 4MLQA 4XXUA 1B05A 3BBRA 3GXAA 5J1DA 1QUKA 1MY3A 1Y9UA 4OZ9A 4RXLA 1FPJA 2ESNA 4YMBA 3V83A 4DI4B 3N6TA 4X48A 3C4MA 2THIA 2OWZA 3UN6A 1N3XA 1I6BA 1ZBMA 3KC0A 3VFJA 2G29A 3KG2A 5CMCA 5KCJB 4JVDA 5HM4B 3PGFA 5CBRA 1NV3A 4QSEA 3RYDA 5JK4A 3K1MA 4KYSA 2YPNA 3CI8A 4O3CA 2UVHA 1FBEA 1MQHA 4ONYA 4R9FA 4R6KA 4MEVA 2BJIA 2PFZA 4DE8A 1RDZA 2KR0A 4ELQA 3TTKA 1PC3A 1B3LA 3E79A 1O64A 1US4A 2Y7RA 3Q27A 1NL5A 1P1WA 5IM2A 2F6PA 5B70A 1AWBA 4E0WA 1Z7ME 2AYSA 2NUVA 3K6WA 5H8FB 3H3GA 1LSTA 2CZHA 1DSNA 1P1NA 4QXDA 1POY1 1AIVA 4OENA 1QUIA 1B0LA 2DE2A 3B8BA 4KHZE 4X04A 4JB7A 3KZGA 4TQUQ 1VFDA 3LUZA 3E4RA 5I2NA 5IZZA 3CIJA 4GIZA 5L9SA 4XF5A 4PE5B 1PB8A 3D1RA 5BUUA 3FV1A 1T0KA 1MXWA 4R9GA 3MP6A 1TT1A 4G8MA 1XHYA 5I2KB 5BWJA 4PP0A 3OO7A 4HE1A 4KXPA 1YXIA 3TCGA 4ECFA 4KI0E 1S9TA 1MXYA 2RCAA 1VDWA 4MMPA 4G8NA 4LVQA 1UTBB 4IO3A 2UVIA 1NV5A 2Y7KA 1M5FA 1AOVA 4GWXA 5M2VA 4FECA 3MAMA 4UACA 4POWA 4BDOA 4YKKA 1MY2A 3TYHA 4ZECA 4MIJA 1IMAA 3S2VA 4OFLA 1FPKA 3FD3A 4AQ4A 3K0VA 4TLMB 2M8CA 3UP9A 2Y5KA 4ND9A 5F7VA 2XX7A 3B6TA 5CRYA 3NOHA 3W9WA 3G3FA 1D3KA 1NH7A 1XVYA 2PBWA 1KWHA 4ESXA 1DPPA 5CI5A 5FTHA 4MH5A 1H44A 3OEMA 1K9YA 2QS2A 4GD5A 2ZMBA 3LSXA 3MYUA 3QYTA 4PFYA 5AA4A 1LB9A 3IL1B 2QFLA 1SI0A 3MVYA 3PMXA 5CMMA 1L5TA 1FPIA 1B5IA 2DWIA 3FUZA 1FTMA 4P0GA 3D4GA 4GXAA 2NWJA 2W7YA 5DYHA 4GWWA 1FPBA 1O7TA 3FJMA 1IMFA 1VSOA 4Q0CA 3HSTA 4OVTA 3MQ9A 2ZYNA 4XEQA 4PF8A 2L5VA 5EHMA 2OWTA 4AB6A 4FATA 3PPQA 4I62A 3TAJA 1B0HA 4HS7A 5HBCA 1RYOA 4R2FA 2AIXA 5LDZA 4ELRA 4RA1A 2XHDA 2F3DA 4ZZEA 3BIGA 2F7AA 2YJPA 4QFKA 4GX6A 2Z8DA 5ISUA 4GWZA 4NWCA 4P1EA 3FJ7A 4HTGA 4U21A 1BP5A 2GQ1A 3PU5A 3BFUA 1Y3PA 2UYEA 4FEDA 1IMCA 1F9BA 2XX9A 1FPGA 2R6GE 2F8DA 3ZKKA 2XWIA 4JSDA 2XXYA 4WEDA 4U23A 4EF1A 3JYRA 4YAHX 2P3NA 5CMKA 2VGQA 4GVOA 1WDNA 4IB2A 4XKPA 1MY0A 1ZTYA 3ISPA 1SBPA 3MVZA 1NUXA 4MBPA 4NF5A 4OESA 5IAIA 1FW0A 3KN3A 4EXKA 5DW8A 3QXMA 1TFAA 3Q28A 4MAGA 1LLSA 2I3VA 3MZ9A 1MH4A 1D9VA 1EYIA 4G77A 5H8NB 1A55A 3FXQA 5TP9A 3DELB 5FHOA 1CB6A 1PB7A 4RYAA 4H45A 1B1HA 4YKJA 3IOVA 3H6UA 2OCUA 2R71A 3RPLB 3C32A 2PT2A 4F19A 2ZYMA 1XI6A 3HFUA 4Q5TA 1NI9A 3ILTB 3CFLA 4H5GA 4YU0A 1J1NA 1SYHA 5FHMA 3OD7A 1GV8A 5T3JA 3MUQA 4X9TA 1NUZA 1JW5A 4PFWA 4DLDA 1FQEA 3K00A 2DS9A 3EHUA 4X1DA 4LONB 2CZIA 4O8MA 3K2DA 2FBPA 3TKDA 3H7MA 3K1PA 4F29A 3PMWA 2DP8A 4H6DA 3HN0A 3MSTA 5K2YA 4N6KA 1FJ6A 2DE3A 1LBBA 4YB7A 1IZ1A 3O6IA 4YMAA 1RKMA 4QBAA 1NMUA 2PX1A 5JEIA 1MPCA 1B9JA 1A8FA 1XC1A 4GOTA 3I6VA 1JQFA 3SETA 2ZNUA 3UGWA 4ZEBA 4XFEA 3IFAA 3MPKA 4HE2A 3N5LA 5TU0A 4IGTA 1A40A 2QS3A 2ZZVA 5L9MA 2PVUA 1ZLQA 1DBZA 1MM7A 4IGRA 3PPPA 3RY3A 2KQZA 1BK4A 2I4BA 4LP2B 3OO8A 3O28A 3VVEA 3K4UA 4F3BA 4O3AA 3WAFA 3FXRA 2GFEA 3PPOA 1DOTA 4P11A 1IUDA 2OZZA 3TTLA 3TZAA 1LAFE 3H6VA 4NTLA 4RJZA 5DEXB 3USDA 2E1SA 1B40A 2F35A 1B6HA 4F3PA 1JVXA 4NF8A 4I8CA 5K2XA 1G0HA 3VV5A 5EQ9A 2Y7PA 3U94A 2O68A 2F34A 4F3SA 4KCDA 4RK2A 2Q9TA 3SERA 2H99A 4X8RA 1MXVA 4NMYA 2CEXA 4NF6B 3TTRA 3RT6B 5A5LA 2VP1A 3OO6A 1N3WA 4OETA 2B4LA 3RGYA 5LTCA 3U8QA 2FIXA 3HO7A 3I3VA 2A5SA 4LQ5A 2O7UA 3OENA 4YB5A 1H43A 2DWAA 4OXVA 3IB2A 1B5HA 2HZKA 3TCFA 5TPAA 1ZU0A 5IZ3B 1R1NA 1MY1A 3ROJA 4DXUA 3IO4A 1FQFA 1QGXA 2Z23A 4GL8A 3FVOA 1NNKA 3K02A 4OQOA 1NNPA 1B7ZA 2REJA 2XXHA 3RPLA 4G2ZA 2I49A 3A09A 3C36A 3PD9A 2LAOA 3MVWA 1II5A 4DIGA 2OK2A 4JVIA 1FBFA 2Q88A 4NF4B 4KD5A 5JTYB 4NN3A 2GHBA 1ATGA 1ZJLA 2V93A 3N6UA 5DVJA 3P7IA 3OOAA 2XD2A 3AXFA 2ANJA 2XX8A 2X7QA 3CG1A 1P1OA 3R26A 3SEWA 2QS4A 4NG7A 3T9UA 1EZ9A 2Q89A 3VXCA 1DMBA 3FBPA 4O94A 2OLBA 5HPQA 3O66A 1EU8A 4OTEA 3IK6B 4I1DA 1IMEA 1FPFA 3ODBA 3G3KA 3KSXA 4F22A 2WEFA 4ELPA 1ZIUA 2UVGA 2I0BA 5ITOA 1SPIA 1ANFA 4P47A 3VE1B 4NAPA 5ET5A 5ESYA 4F2QA 1I6AA 5AA1A 4P3LA 1B7HA 3SEXA 1JP4A 4ELOA 4BDMA 3QUJA 1NV0A 4GQOA 1UTHB 2PMSA 3MWBA 4LZ7A 3PPRA 2RF1A 1B5JA 2DQVA 2DWHA 2H25A 4OWDA 3IJXB 4P1LA 4F39A 2P1SA 1IXGA 3B7DA 4G61A 3KBZA 4NQ8A 4JDFA 1HSLA 4I3EA 2OBGA 4AS5A 1K9ZA 4H67A 4XKQA 5DEXA 3BKIB 3HV1A 3T66A 2Y84A 1VFEA 4OFJA 2HHMA 2Q74A 4MLVA 1UIVA 3KSJA 2VD2A 3H4ZA 1JVYA 2RC9A 4C1UA 1IITA 2KLFA 3BIHA 2X26A 4EXLA 1MDP1 1USYE 1LAGE 3A3UA 4LN5A 4PFIA 4N15A 4N8YA 2WYPA 4OVJA 1B2HA 3D4CA 2WX9A 1Q35A 2ABHA 2I0CA 4U4XA 1JW4A 1HSEA 3PV0E 3TPAA 3LBSA 4R6YA 1NNTA 1NKXA 5I3SA 3FXBA 3O9PA 4PAKA 5F24A 4IR8A 3N26A 2Q8MA 4JVCA 2CMOA 4OEVA 4QHQA 4LZ5A 2QVVA 3SEUA 4EQ9A 4MFIA 1EZOA 2ALUA 4NF4A 5JTYA 3UORA 3LSLA 1R9QA 2B3BA 3DP4A 4H0WA 1B46A 1B3EA 5H8HB 1FBCA 5EHSA 5I84A 1XS5A 2YLNA 2VPNA 3C34A 2QMWA 5EYFA 2OWSA 3FATA 3UA8A 3TDJA 1LAHE 2V3TA 4U1ZA 1LB8A 4N8GA 1UIUA 4XIGQ 2DYXA 4DCXA 2ZNTA 3KBRA 2X7PA 1B52A 3GBBA 3K6UA 4F31B 1B4HA 1S50A 1SVXB 5KDTB 2RC7A 4U2RA 3H6TA 1R6ZA 4N07A 5ET7A 4IY5A 1MQDA 3EPEA 1H76A 1AMFA 3TQWA 4OVRA 4ZE8A 5A5XB 1CNQA 1ZMGA 2B3FA 3CFXA 3PPNA 3CSGA 5KCJA 3HHFA 4PAIA 3E13X 2PCRA 3U92A 4EQBA 1MG1A 2NOOA 2DOJA 3T9XB 3B6WA 4RY1A 2HZLA 4ZS9A 1FRPA 5KZTA 1MQIA 2P2AA 1XVXA 1IXHA 2WKYA 4ESWA 3PUVE 1HSJA 3H06B 1BLFA 5ET8A 4HE0A 4PCDA 3SEVA 3TCHA 3K1NA 4PETA 3C35A 3W15C 3KFMA 3K01A 1N7XA 2XXWA 2DDKA 3CG3A 1B3FA 1N04A 3T9HB 1LCFA 3UIFA 5H8FA 3S4UA 4PQJA 4IO4A 1OIBA 1OQHA 1EH3A 3ILUB 4QF9A 5DVFA 3IAZA 2GHAA 4H8JA 2F7CA 3E78A 3RT8A 1G0IA 5I59B 1NUYA 1WVJA 5ET6A 1MH3A 3OSQA 1FPEA 1MXZA 2QSXA 4OFOA 1LFIA 4I9DA 3U65A 2HAUA 5I2KA 5I56B 1AL3A 2UVJA 1GTKA 4U22A 2HFBA 5AA2D 1FSAA 3G7WA 3KOTA 1UTBA 2AL4A 3T96B 4KR5A 4JWOA 4G8HA 4IO2A 1YAEA 2XXIA 2E0SA 5H8HA 2FA7A 1MDQA 1Q9DA 3JZJA 1JETA 3Q26A 3T93B 5CMBA 1Y1ZA 1Y4CA 3FZVA 1NUWA 3LR1A 4GLIA 1NV2A 4WKMA 3MVXA 2XXPA 4PFTA 3V8XB 2VT5A 1SYIA 4QFNA 4EF2A 3KN8A 3TELA 1XOCA 1BKAA 4C1TA 1Y1MA 2FNCA 2I6EA 4HCWA 1QUJA 5KDTA 3IORA 1D4NA 3VVDA 1QW0A 2VD3A 1LAXA 1OVTA 5I58B 3KN7A 3MJNA 3PUXE 4TOZA 4MNCA 4UA8A 4Q8RA 2FIEA 2UXAA 2Y5LA 5B7DA 2B65A 2REGA 4I3YA 1N7WA 3K6VA 4PAFA 1IQ7A 4JWYA 3OXNA 4MX6A 4M4GA 4H1XA 4UABA 1ELJA 3W9VA 3KJ7A 1YCJA 4PGPA 1GVCA 3RNNA 3M3FA 2I4CA 4FEBA 2DE4A 1Y20A 1FTLA 3EKIA 1P1QA 1JNFA 1A7LA 4QFLA 1B32A 1NV7A 4YICA 1QKAA 4G68B 1Y3QA 4H46A 3THIA 1MY4A 1NV4A 4OEUA 5EQAA 1FPLA 1D9YA 2NXOA 3ZS6A 1LGBC 4P8BA 3CHGA 3M8UA 3SDFA 3CSBA 2DXYA 1I69A 4M1VA 5L8DA 1DPEA 1MS7A 2JJKA 3PTYA 3L6HA 2XWKA 3RN8A 5I59A 3C9HA 1US5A 2HEUA 2DXRA 4RK9A 1SW4A 1SW1A 3A3CA 2PT1A 3IJOB 4L17A 4DXCA 3M3KA 4IO6A 3IB1A 2PYYA 1NH8A 3HHGA 2QS1A 2VOZA 3TTNA 2FHYA 1MM6A 2RCBA 2I3WA 2RINA 1WODA 3TQLA 5IGAA 3FIRA 3ZKLA 3H6WA 4LZ8A 4Q30B 1DTGA 3R7XA 3C31A 2XXTA 4BDRA 4KCCA 4KYEA 4BLAA 2PFYA 5CC2A 2NVUB 5H8NA 2XXUA 1A54A 1YZ0A 2P0SA 4BDNA 4MCOA 1MRPA 5H8QB 2Q2CA 1BIYA 4O7IA 4GWOA 1QULA 4XKNA 2P3VA 3Q25A 2F36A 4GBVA 2QMXA 4YKPA 3VVFA 4NGUA 3DM0A 3TODA 3H03A 4LA9A 3QAXA 5I58A 2RKMA 4P9KA 2IA4A 1N0TA 2FVZA 2HAVA 2XXRA 3S9NC 3IO6A 1B4ZA 3MW0A 3T9VA 4AB5A 4FIMA 1TWYA 2Y7WA 1B1XA 3S9LC 1EZPA 1YYZA 3B50A 3EQ1A 1FBDA 3RTFB 1Q1KA 4JSOA 2Z22A 4EUOA 3V89B 5J16A 5ELVA 4BDQA 1AH5A 3KEIA 4NEDA 4POXA 4YZZA 3IR1A 4O3BA 4HCYA 3PUYE 2O1MA 2HCAA 2ZYKA 1SQYA 1A8EA 3TTMA 1INPA 2IEEA 4GL0A 2GH9A 2WBBA 4G68A 3RQTA 2A5TB 3SESA 5L9OA 2DVCA 1MQJA 5I57B 4FJPA 3KGCA 4AS4A 2F78A 1SD3A 4NX1A 5AA4B 3VXBA 3OO9A 4HW8A 5FHNA 4XTCQ 4YKIA 3FV2A 2RC8A 4KQPA 4Z0IA 4OVQA 3GBAA 1JW1A 2QPQA 1LCTA 2DVZA 4E0XA 2Z8FA
chains in the Genus database with same CATH topology
1OMPA 4ZEDA 4GRKA 4IO5A 4OYVA 2I58A 1P99A 1RYXA 3QUFA 1VE4A 2D3IA 3G3HA 1M5DA 4NF6A 4LQ2A 3FASA 2H4IA 1VR5A 1M5EA 1M5BA 1FQCA 3RPWA 3SEYA 1URGA 1IEJA 5H8QA 4BDLA 1B7UA 3LSFB 2D5WA 3VDFA 3MPLA 4N13A 3GZGA 2Y7IA 1URDA 4GFRA 3EHTA 3MZ1A 1JEUA 1N76A 1MXXA 2D21A 2HXWA 2QL3A 5CBSA 4GF8A 1PDAA 3IOWA 1OLCA 2XD3A 3WAEA 3OSRA 4RPNA 3G3GA 4OMBA 3ECRA 2O6AA 1DTZA 4NF5B 4TLLB 1O63A 3MZBA 4WEPA 4QFPA 4QSCA 2DWJA 3OEKA 1FQAA 2XXQA 5AA2B 5TP9B 1PEBA 1YTVA 4R75A 5AA3A 4OERA 2UYFA 3MC2A 4IY6A 1A99A 2A5TA 3I5OA 1BTJA 3DLNA 2R9JA 4IO7A 2XXXA 1PBPA 1UTHA 1Z7NE 5I57A 3HPIA 4R72A 3SKPA 5FTIA 4DDDA 4DXBA 3G3IA 4F3GA 5CM6A 3QSLA 4DZ1A 4H5FA 4JWXA 4KFQA 3LSWA 3PD8A 2DSFA 1OLAA 4FORA 4R74A 3O2AA 4JBZA 4OHNA 3G3JA 3KJTA 2ZXTA 1FQBA 2QJEA 1MQGA 4F1YA 1B3HA 1MPBA 1OVBA 3UK4A 1S7YA 1IXIA 1M5CA 3O6GA 1R9LA 4ZDMA 1Y4TA 3O97A 4H65A 2Z8EA 3IX1A 4NWDA 3FVKA 2GRVA 5ITPA 1SI1A 1I6QA 2ZYOA 3KOSA 3MP8A 3U72A 2F5XA 3QK6A 4MF3A 4QRZA 1FCKA 2ONKE 3F11A 4R2BA 2BJJX 5DVIA 3CFZA 3EN3A 4K3FA 4EQ7A 4ZEKA 2G93A 1UQWA 1CE2A 3ZSFA 4ISUA 5LOMA 4LUBA 3VLWA 4NF8B 1SW2A 2F7BA 4PFUA 1URSA 3FJGA 2O84X 1QKBA 1PBQA 1ZKBA 2FYIA 2O51A 2O7IA 4H8IA 5F1QA 3BFTA 1POTA 1LBCA 2Q8JA 2AL5A 1LFHA 4GXSB 1N84A 5TPAB 5AA2A 4LATA 3V5AA 3MBPA 4XKRA 3DP8A 3VLUA 2Q2AA 5IKBA 3U1OA 4P0IA 3HCQA 3L6GA 3MP1A 4X1BA 2F6GA 3S9MC 3T22A 1OQGA 5A5XA 3RTWB 3CRBA 4C0RA 1GGGA 2V84A 3B6QA 3E9XA 4ZZAA 1MPDA 1IXCA 2O1LA 1FQDA 4RPOA 4U1OA 1FTOA 1MXUA 3U93A 1B51A 4F2OA 1B3GA 4G68C 2ONRA 3QIMA 3RLFE 3IOTA 4KYDA 4RNSA 3FXUA 2QRYA 4YB6A 1H3DA 4ZEIA 3OELA 3TEPA 1NFTA 5AE4A 3S9EA 3Q29A 4N6PA 3OMBA 2I48A 3E3KA 3N94A 2H9BA 5DTBA 3DP6A 3TFLA 2HQ0A 3TUSA 1IIWA 3JV9A 3PMVA 3VLVA 2ZNSA 2V3UA 5I56A 1TXFA 1TFDA 3EHSA 1FTKA 4G4PA 2CZLA 1H45A 5DT6A 4QSDA 1YPNA 3C33A 1SW5A 4JXIA 3PUZE 1FTJA 1QVSA 4FAJA 2ONSA 4F1UA 5ICQA 3M3LA 4NE4A 5ICTA 3K6XA 3O29A 1NNFA 2H98A 1GR2A 4KPTA 3FGSA 1B58A 5H8SA 5I2NB 4F18A 3RUMA 4U4SA 2VHAA 3LC8A 1QJMA 3PUWE 2XXVA 4R73A 1USYH 1SDXA 4FE8A 4R6HA 2H5YA 3TMGA 3EF7A 4ZEFA 4F1VA 2O69A 3LUYA 4THIA 3R6UA 4WXJA 3FVGA 1LFGA 3IB0A 2OJTA 4EDPA 3O6HA 1JEVA 3GLBA 1Y3NA 4DCYA 1XT8A 3CVGA 2F97A 3FVNA 4QFOA 3CR9A 2V3QA 3IOUA 4ZE9A 3ONMA 2V25A 4Z7EA 1P1UA 1PB9A 4MLQA 4XXUA 1B05A 3BBRA 3GXAA 5J1DA 1QUKA 1MY3A 1Y9UA 4OZ9A 4RXLA 2ESNA 4YMBA 3V83A 3N6TA 4X48A 3C4MA 2THIA 3UN6A 1N3XA 1I6BA 1ZBMA 3VFJA 2G29A 3KG2A 5CMCA 5KCJB 5HM4B 3PGFA 5CBRA 4QSEA 5JK4A 3K1MA 4KYSA 2YPNA 3CI8A 4O3CA 2UVHA 1MQHA 4ONYA 4R9FA 4R6KA 4DE8A 4ELQA 3TTKA 1PC3A 1B3LA 1O64A 1US4A 2Y7RA 3Q27A 1NL5A 1P1WA 2F6PA 5B70A 4E0WA 1Z7ME 2AYSA 2NUVA 3K6WA 5H8FB 3H3GA 1LSTA 1DSNA 1P1NA 1POY1 1AIVA 4OENA 1QUIA 1B0LA 2DE2A 4KHZE 4JB7A 3KZGA 4TQUQ 1VFDA 3E4RA 5I2NA 3CIJA 4GIZA 5L9SA 4PE5B 1PB8A 5BUUA 3FV1A 1T0KA 1MXWA 4R9GA 3MP6A 1TT1A 4G8MA 1XHYA 5I2KB 5BWJA 4PP0A 3OO7A 4ECFA 3TCGA 4KI0E 1S9TA 1MXYA 2RCAA 4G8NA 4LVQA 1UTBB 4IO3A 2UVIA 2Y7KA 1M5FA 1AOVA 5M2VA 4FECA 3MAMA 4UACA 4POWA 4BDOA 4YKKA 1MY2A 3TYHA 4ZECA 3S2VA 4OFLA 3FD3A 4AQ4A 3K0VA 4TLMB 2M8CA 3UP9A 4ND9A 5F7VA 2XX7A 3B6TA 5CRYA 3W9WA 3G3FA 1XVYA 1D3KA 1NH7A 2PBWA 1KWHA 4ESXA 1DPPA 5CI5A 5FTHA 4MH5A 1H44A 3OEMA 2QS2A 4GD5A 2ZMBA 3LSXA 3QYTA 4PFYA 5AA4A 1LB9A 3IL1B 1SI0A 3MVYA 3PMXA 5CMMA 1L5TA 1B5IA 2DWIA 3FUZA 1FTMA 4P0GA 3D4GA 4GXAA 2NWJA 2W7YA 5DYHA 1O7TA 3FJMA 1VSOA 4Q0CA 3HSTA 3MQ9A 2ZYNA 5EHMA 2OWTA 4AB6A 4FATA 3PPQA 4I62A 3TAJA 1B0HA 4HS7A 5HBCA 1RYOA 4R2FA 2AIXA 4ELRA 4RA1A 2XHDA 4ZZEA 2F7AA 2YJPA 4QFKA 5ISUA 2Z8DA 4NWCA 3FJ7A 4HTGA 4U21A 1BP5A 3PU5A 3BFUA 1Y3PA 2UYEA 4FEDA 1F9BA 2XX9A 2R6GE 2F8DA 3ZKKA 4JSDA 2XXYA 4WEDA 4EF1A 4U23A 3JYRA 4YAHX 5CMKA 2VGQA 4GVOA 1WDNA 4IB2A 4XKPA 1MY0A 1ZTYA 1SBPA 3MVZA 4MBPA 4NF5A 4OESA 5IAIA 1FW0A 3KN3A 4EXKA 3QXMA 1TFAA 3Q28A 1LLSA 2I3VA 3MZ9A 1MH4A 1D9VA 4G77A 5H8NB 1A55A 3FXQA 5TP9A 3DELB 5FHOA 1CB6A 1PB7A 4RYAA 1B1HA 4YKJA 3IOVA 3H6UA 2OCUA 2R71A 3C32A 2PT2A 4F19A 2ZYMA 4Q5TA 3ILTB 3CFLA 4H5GA 4YU0A 1J1NA 1SYHA 5FHMA 3OD7A 1GV8A 3MUQA 4X9TA 1JW5A 4PFWA 4DLDA 1FQEA 3K00A 2DS9A 3EHUA 4X1DA 4LONB 3K2DA 3TKDA 3H7MA 3K1PA 4F29A 3PMWA 2DP8A 4H6DA 3HN0A 5K2YA 2DE3A 1LBBA 4YB7A 1IZ1A 3O6IA 4YMAA 1RKMA 1NMUA 2PX1A 5JEIA 1MPCA 1XC1A 1B9JA 1A8FA 4GOTA 3I6VA 1JQFA 3SETA 2ZNUA 3UGWA 4ZEBA 3MPKA 3N5LA 5TU0A 4IGTA 1A40A 2QS3A 5L9MA 2PVUA 1ZLQA 1MM7A 4IGRA 3PPPA 3RY3A 2I4BA 4LP2B 3OO8A 3O28A 3VVEA 3K4UA 4F3BA 4O3AA 3WAFA 3FXRA 2GFEA 3PPOA 1DOTA 4P11A 1IUDA 2OZZA 3TTLA 3TZAA 1LAFE 3H6VA 4NTLA 4RJZA 5DEXB 3USDA 2E1SA 1B40A 2F35A 1B6HA 4F3PA 1JVXA 4NF8A 4I8CA 5K2XA 3VV5A 2Y7PA 3U94A 2O68A 2F34A 4F3SA 4KCDA 4RK2A 2Q9TA 3SERA 2H99A 1MXVA 4NMYA 4NF6B 3TTRA 3RT6B 2VP1A 3OO6A 1N3WA 4OETA 3RGYA 3U8QA 3HO7A 3I3VA 2A5SA 4LQ5A 2O7UA 3OENA 4YB5A 1H43A 2DWAA 4OXVA 3IB2A 1B5HA 2HZKA 3TCFA 5TPAA 1ZU0A 1R1NA 1MY1A 4DXUA 3IO4A 1FQFA 2Z23A 4GL8A 3FVOA 1NNKA 3K02A 4OQOA 1NNPA 1B7ZA 2REJA 2XXHA 4G2ZA 2I49A 3A09A 3C36A 3PD9A 2LAOA 3MVWA 1II5A 4DIGA 2OK2A 2Q88A 4NF4B 4KD5A 5JTYB 2GHBA 1ATGA 1ZJLA 2V93A 3N6UA 5DVJA 3P7IA 3OOAA 2XD2A 3AXFA 2ANJA 2XX8A 2X7QA 3CG1A 1P1OA 3R26A 3SEWA 2QS4A 3T9UA 1EZ9A 2Q89A 3VXCA 1DMBA 2OLBA 5HPQA 3O66A 1EU8A 4OTEA 3IK6B 4I1DA 3ODBA 3G3KA 3KSXA 4F22A 4ELPA 1ZIUA 2UVGA 2I0BA 5ITOA 1ANFA 3VE1B 4F2QA 1I6AA 5AA1A 1B7HA 3SEXA 4ELOA 4BDMA 3QUJA 4GQOA 1UTHB 2PMSA 3MWBA 4LZ7A 3PPRA 2RF1A 1B5JA 2DQVA 2DWHA 2H25A 4OWDA 3IJXB 4F39A 2P1SA 1IXGA 3B7DA 4JDFA 1HSLA 2OBGA 4H67A 4XKQA 5DEXA 3BKIB 3HV1A 3T66A 2Y84A 1VFEA 4OFJA 4MLVA 1UIVA 3KSJA 2VD2A 3H4ZA 1JVYA 2RC9A 4C1UA 1IITA 2KLFA 2X26A 4EXLA 1MDP1 1USYE 1LAGE 3A3UA 4OVJA 1B2HA 3D4CA 1Q35A 2ABHA 2I0CA 4U4XA 1JW4A 1HSEA 3PV0E 3TPAA 3LBSA 4R6YA 1NNTA 1NKXA 3O9PA 3N26A 2CMOA 4OEVA 4QHQA 4LZ5A 3SEUA 4EQ9A 4MFIA 1EZOA 2ALUA 4NF4A 5JTYA 3UORA 3LSLA 1R9QA 2B3BA 3DP4A 4H0WA 1B46A 1B3EA 5H8HB 5EHSA 5I84A 1XS5A 2YLNA 3C34A 2QMWA 5EYFA 2OWSA 3FATA 3UA8A 3TDJA 1LAHE 2V3TA 4U1ZA 1LB8A 1UIUA 4XIGQ 2DYXA 4DCXA 2ZNTA 3KBRA 2X7PA 1B52A 3GBBA 3K6UA 4F31B 1B4HA 1S50A 1SVXB 5KDTB 2RC7A 4U2RA 3H6TA 1R6ZA 4N07A 4IY5A 1MQDA 3EPEA 1H76A 1AMFA 3TQWA 4ZE8A 5A5XB 1ZMGA 2B3FA 3CFXA 3PPNA 3CSGA 5KCJA 3HHFA 3E13X 3U92A 4EQBA 1MG1A 2NOOA 2DOJA 3T9XB 3B6WA 4RY1A 2HZLA 4ZS9A 5KZTA 1MQIA 2P2AA 1XVXA 1IXHA 2WKYA 4ESWA 3PUVE 1HSJA 3H06B 1BLFA 3SEVA 3TCHA 3K1NA 4PETA 3C35A 3W15C 3KFMA 3K01A 1N7XA 2XXWA 3CG3A 1B3FA 1N04A 3T9HB 1LCFA 3UIFA 5H8FA 3S4UA 4PQJA 4IO4A 1OIBA 1OQHA 1EH3A 3ILUB 4QF9A 5DVFA 3IAZA 2GHAA 4H8JA 2F7CA 3RT8A 5I59B 1WVJA 1MH3A 3OSQA 1MXZA 2QSXA 4OFOA 1LFIA 4I9DA 2HAUA 5I2KA 5I56B 1AL3A 2UVJA 1GTKA 4U22A 2HFBA 5AA2D 3G7WA 3KOTA 2AL4A 1UTBA 3T96B 4KR5A 4JWOA 4G8HA 4IO2A 1YAEA 2XXIA 2E0SA 5H8HA 2FA7A 1MDQA 3JZJA 1JETA 3Q26A 3T93B 5CMBA 1Y1ZA 1Y4CA 3FZVA 3LR1A 4GLIA 4WKMA 3MVXA 2XXPA 4PFTA 3V8XB 1SYIA 4QFNA 4EF2A 3KN8A 3TELA 1XOCA 1BKAA 4C1TA 1Y1MA 2FNCA 2I6EA 4HCWA 1QUJA 5KDTA 3IORA 1D4NA 3VVDA 1QW0A 2VD3A 1LAXA 1OVTA 5I58B 3KN7A 3MJNA 3PUXE 4TOZA 4UA8A 4Q8RA 2UXAA 5B7DA 2B65A 2REGA 1N7WA 3K6VA 1IQ7A 4JWYA 3OXNA 4M4GA 4H1XA 1ELJA 3W9VA 3KJ7A 1YCJA 1GVCA 3RNNA 3M3FA 2I4CA 4FEBA 2DE4A 1Y20A 1FTLA 1P1QA 1JNFA 1A7LA 4QFLA 1B32A 4YICA 1QKAA 4G68B 1Y3QA 3THIA 1MY4A 4OEUA 1D9YA 2NXOA 3ZS6A 1LGBC 3M8UA 3SDFA 3CSBA 2DXYA 1I69A 4M1VA 5L8DA 1DPEA 1MS7A 3L6HA 3RN8A 5I59A 3C9HA 1US5A 2HEUA 2DXRA 4RK9A 1SW4A 1SW1A 3A3CA 2PT1A 3IJOB 4L17A 4DXCA 3M3KA 4IO6A 3IB1A 2PYYA 1NH8A 3HHGA 2QS1A 2VOZA 3TTNA 1MM6A 2RCBA 2I3WA 2RINA 1WODA 3TQLA 3FIRA 3ZKLA 3H6WA 4LZ8A 4Q30B 1DTGA 3R7XA 3C31A 2XXTA 4BDRA 4KCCA 4KYEA 4BLAA 5CC2A 2NVUB 5H8NA 2XXUA 1A54A 4BDNA 2P0SA 1MRPA 5H8QB 2Q2CA 1BIYA 4GWOA 1QULA 4XKNA 3Q25A 2F36A 2QMXA 4YKPA 3VVFA 3DM0A 3TODA 3H03A 4LA9A 3QAXA 5I58A 2RKMA 2IA4A 1N0TA 2HAVA 2XXRA 3S9NC 3IO6A 1B4ZA 3MW0A 3T9VA 4AB5A 4FIMA 1TWYA 2Y7WA 1B1XA 3S9LC 1EZPA 3EQ1A 3RTFB 1Q1KA 4JSOA 2Z22A 4EUOA 3V89B 5ELVA 4BDQA 1AH5A 3KEIA 4NEDA 4POXA 4YZZA 3IR1A 4O3BA 4HCYA 3PUYE 2O1MA 2HCAA 2ZYKA 1SQYA 1A8EA 3TTMA 2IEEA 4GL0A 2GH9A 4G68A 3RQTA 2A5TB 3SESA 5L9OA 2DVCA 1MQJA 5I57B 4FJPA 3KGCA 2F78A 1SD3A 5AA4B 3VXBA 3OO9A 4HW8A 5FHNA 4XTCQ 4YKIA 3FV2A 2RC8A 4KQPA 4Z0IA 3GBAA 1JW1A 2QPQA 1LCTA 2DVZA 4E0XA 2Z8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMP A;  4ZED A;  4GRK A;  4IO5 A;  4OYV A;  2I58 A;  1P99 A;  1RYX A;  3QUF A;  1VE4 A;  2D3I A;  3G3H A;  1M5D A;  4NF6 A;  4LQ2 A;  3FAS A;  2H4I A;  1VR5 A;  1M5E A;  1M5B A;  1FQC A;  3RPW A;  3SEY A;  1URG A;  1IEJ A;  5H8Q A;  4BDL A;  1B7U A;  3LSF B;  2D5W A;  3VDF A;  3MPL A;  4N13 A;  3GZG A;  2Y7I A;  1URD A;  4GFR A;  3EHT A;  3MZ1 A;  1JEU A;  1N76 A;  1MXX A;  2D21 A;  2HXW A;  2QL3 A;  5CBS A;  4GF8 A;  1PDA A;  3IOW A;  1OLC A;  2XD3 A;  3WAE A;  3OSR A;  4RPN A;  3G3G A;  4OMB A;  3ECR A;  2O6A A;  1DTZ A;  4NF5 B;  4TLL B;  1O63 A;  3MZB A;  4WEP A;  4QFP A;  4QSC A;  2DWJ A;  3OEK A;  1FQA A;  2XXQ A;  5AA2 B;  5TP9 B;  1PEB A;  1YTV A;  4R75 A;  5AA3 A;  4OER A;  2UYF A;  3MC2 A;  4IY6 A;  1A99 A;  2A5T A;  3I5O A;  1BTJ A;  3DLN A;  2R9J A;  4IO7 A;  2XXX A;  1PBP A;  1UTH A;  1Z7N E;  5I57 A;  3HPI A;  4R72 A;  3SKP A;  5FTI A;  4DDD A;  4DXB A;  3G3I A;  4F3G A;  5CM6 A;  3QSL A;  4DZ1 A;  4H5F A;  4JWX A;  4KFQ A;  3LSW A;  3PD8 A;  2DSF A;  1OLA A;  4FOR A;  4R74 A;  3O2A A;  4JBZ A;  4OHN A;  3G3J A;  3KJT A;  2ZXT A;  1FQB A;  2QJE A;  1MQG A;  4F1Y A;  1B3H A;  1MPB A;  1OVB A;  3UK4 A;  1S7Y A;  1IXI A;  1M5C A;  3O6G A;  1R9L A;  4ZDM A;  1Y4T A;  3O97 A;  4H65 A;  2Z8E A;  3IX1 A;  4NWD A;  3FVK A;  2GRV A;  5ITP A;  1SI1 A;  1I6Q A;  2ZYO A;  3KOS A;  3MP8 A;  3U72 A;  2F5X A;  3QK6 A;  4MF3 A;  4QRZ A;  1FCK A;  2ONK E;  3F11 A;  4R2B A;  2BJJ X;  5DVI A;  3CFZ A;  3EN3 A;  4K3F A;  4EQ7 A;  4ZEK A;  2G93 A;  1UQW A;  1CE2 A;  3ZSF A;  4ISU A;  5LOM A;  4LUB A;  3VLW A;  4NF8 B;  1SW2 A;  2F7B A;  4PFU A;  1URS A;  3FJG A;  2O84 X;  1QKB A;  1PBQ A;  1ZKB A;  2FYI A;  2O51 A;  2O7I A;  4H8I A;  5F1Q A;  3BFT A;  1POT A;  1LBC A;  2Q8J A;  2AL5 A;  1LFH A;  4GXS B;  1N84 A;  5TPA B;  5AA2 A;  4LAT A;  3V5A A;  3MBP A;  4XKR A;  3DP8 A;  3VLU A;  2Q2A A;  5IKB A;  3U1O A;  4P0I A;  3HCQ A;  3L6G A;  3MP1 A;  4X1B A;  2F6G A;  3S9M C;  3T22 A;  1OQG A;  5A5X A;  3RTW B;  3CRB A;  4C0R A;  1GGG A;  2V84 A;  3B6Q A;  3E9X A;  4ZZA A;  1MPD A;  1IXC A;  2O1L A;  1FQD A;  4RPO A;  4U1O A;  1FTO A;  1MXU A;  3U93 A;  1B51 A;  4F2O A;  1B3G A;  4G68 C;  2ONR A;  3QIM A;  3RLF E;  3IOT A;  4KYD A;  4RNS A;  3FXU A;  2QRY A;  4YB6 A;  1H3D A;  4ZEI A;  3OEL A;  3TEP A;  1NFT A;  5AE4 A;  3S9E A;  3Q29 A;  4N6P A;  3OMB A;  2I48 A;  3E3K A;  3N94 A;  2H9B A;  5DTB A;  3DP6 A;  3TFL A;  2HQ0 A;  3TUS A;  1IIW A;  3JV9 A;  3PMV A;  3VLV A;  2ZNS A;  2V3U A;  5I56 A;  1TXF A;  1TFD A;  3EHS A;  1FTK A;  4G4P A;  2CZL A;  1H45 A;  5DT6 A;  4QSD A;  1YPN A;  3C33 A;  1SW5 A;  4JXI A;  3PUZ E;  1FTJ A;  1QVS A;  4FAJ A;  2ONS A;  4F1U A;  5ICQ A;  3M3L A;  4NE4 A;  5ICT A;  3K6X A;  3O29 A;  1NNF A;  2H98 A;  1GR2 A;  4KPT A;  3FGS A;  1B58 A;  5H8S A;  5I2N B;  4F18 A;  3RUM A;  4U4S A;  2VHA A;  3LC8 A;  1QJM A;  3PUW E;  2XXV A;  4R73 A;  1USY H;  1SDX A;  4FE8 A;  4R6H A;  2H5Y A;  3TMG A;  3EF7 A;  4ZEF A;  4F1V A;  2O69 A;  3LUY A;  4THI A;  3R6U A;  4WXJ A;  3FVG A;  1LFG A;  3IB0 A;  2OJT A;  4EDP A;  3O6H A;  1JEV A;  3GLB A;  1Y3N A;  4DCY A;  1XT8 A;  3CVG A;  2F97 A;  3FVN A;  4QFO A;  3CR9 A;  2V3Q A;  3IOU A;  4ZE9 A;  3ONM A;  2V25 A;  4Z7E A;  1P1U A;  1PB9 A;  4MLQ A;  4XXU A;  1B05 A;  3BBR A;  3GXA A;  5J1D A;  1QUK A;  1MY3 A;  1Y9U A;  4OZ9 A;  4RXL A;  2ESN A;  4YMB A;  3V83 A;  3N6T A;  4X48 A;  3C4M A;  2THI A;  3UN6 A;  1N3X A;  1I6B A;  1ZBM A;  3VFJ A;  2G29 A;  3KG2 A;  5CMC A;  5KCJ B;  5HM4 B;  3PGF A;  5CBR A;  4QSE A;  5JK4 A;  3K1M A;  4KYS A;  2YPN A;  3CI8 A;  4O3C A;  2UVH A;  1MQH A;  4ONY A;  4R9F A;  4R6K A;  4DE8 A;  4ELQ A;  3TTK A;  1PC3 A;  1B3L A;  1O64 A;  1US4 A;  2Y7R A;  3Q27 A;  1NL5 A;  1P1W A;  2F6P A;  5B70 A;  4E0W A;  1Z7M E;  2AYS A;  2NUV A;  3K6W A;  5H8F B;  3H3G A;  1LST A;  1DSN A;  1P1N A;  1POY 1;  1AIV A;  4OEN A;  1QUI A;  1B0L A;  2DE2 A;  4KHZ E;  4JB7 A;  3KZG A;  4TQU Q;  1VFD A;  3E4R A;  5I2N A;  3CIJ A;  4GIZ A;  5L9S A;  4PE5 B;  1PB8 A;  5BUU A;  3FV1 A;  1T0K A;  1MXW A;  4R9G A;  3MP6 A;  1TT1 A;  4G8M A;  1XHY A;  5I2K B;  5BWJ A;  4PP0 A;  3OO7 A;  4ECF A;  3TCG A;  4KI0 E;  1S9T A;  1MXY A;  2RCA A;  4G8N A;  4LVQ A;  1UTB B;  4IO3 A;  2UVI A;  2Y7K A;  1M5F A;  1AOV A;  5M2V A;  4FEC A;  3MAM A;  4UAC A;  4POW A;  4BDO A;  4YKK A;  1MY2 A;  3TYH A;  4ZEC A;  3S2V A;  4OFL A;  3FD3 A;  4AQ4 A;  3K0V A;  4TLM B;  2M8C A;  3UP9 A;  4ND9 A;  5F7V A;  2XX7 A;  3B6T A;  5CRY A;  3W9W A;  3G3F A;  1XVY A;  1D3K A;  1NH7 A;  2PBW A;  1KWH A;  4ESX A;  1DPP A;  5CI5 A;  5FTH A;  4MH5 A;  1H44 A;  3OEM A;  2QS2 A;  4GD5 A;  2ZMB A;  3LSX A;  3QYT A;  4PFY A;  5AA4 A;  1LB9 A;  3IL1 B;  1SI0 A;  3MVY A;  3PMX A;  5CMM A;  1L5T A;  1B5I A;  2DWI A;  3FUZ A;  1FTM A;  4P0G A;  3D4G A;  4GXA A;  2NWJ A;  2W7Y A;  5DYH A;  1O7T A;  3FJM A;  1VSO A;  4Q0C A;  3HST A;  3MQ9 A;  2ZYN A;  5EHM A;  2OWT A;  4AB6 A;  4FAT A;  3PPQ A;  4I62 A;  3TAJ A;  1B0H A;  4HS7 A;  5HBC A;  1RYO A;  4R2F A;  2AIX A;  4ELR A;  4RA1 A;  2XHD A;  4ZZE A;  2F7A A;  2YJP A;  4QFK A;  5ISU A;  2Z8D A;  4NWC A;  3FJ7 A;  4HTG A;  4U21 A;  1BP5 A;  3PU5 A;  3BFU A;  1Y3P A;  2UYE A;  4FED A;  1F9B A;  2XX9 A;  2R6G E;  2F8D A;  3ZKK A;  4JSD A;  2XXY A;  4WED A;  4EF1 A;  4U23 A;  3JYR A;  4YAH X;  5CMK A;  2VGQ A;  4GVO A;  1WDN A;  4IB2 A;  4XKP A;  1MY0 A;  1ZTY A;  1SBP A;  3MVZ A;  4MBP A;  4NF5 A;  4OES A;  5IAI A;  1FW0 A;  3KN3 A;  4EXK A;  3QXM A;  1TFA A;  3Q28 A;  1LLS A;  2I3V A;  3MZ9 A;  1MH4 A;  1D9V A;  4G77 A;  5H8N B;  1A55 A;  3FXQ A;  5TP9 A;  3DEL B;  5FHO A;  1CB6 A;  1PB7 A;  4RYA A;  1B1H A;  4YKJ A;  3IOV A;  3H6U A;  2OCU A;  2R71 A;  3C32 A;  2PT2 A;  4F19 A;  2ZYM A;  4Q5T A;  3ILT B;  3CFL A;  4H5G A;  4YU0 A;  1J1N A;  1SYH A;  5FHM A;  3OD7 A;  1GV8 A;  3MUQ A;  4X9T A;  1JW5 A;  4PFW A;  4DLD A;  1FQE A;  3K00 A;  2DS9 A;  3EHU A;  4X1D A;  4LON B;  3K2D A;  3TKD A;  3H7M A;  3K1P A;  4F29 A;  3PMW A;  2DP8 A;  4H6D A;  3HN0 A;  5K2Y A;  2DE3 A;  1LBB A;  4YB7 A;  1IZ1 A;  3O6I A;  4YMA A;  1RKM A;  1NMU A;  2PX1 A;  5JEI A;  1MPC A;  1XC1 A;  1B9J A;  1A8F A;  4GOT A;  3I6V A;  1JQF A;  3SET A;  2ZNU A;  3UGW A;  4ZEB A;  3MPK A;  3N5L A;  5TU0 A;  4IGT A;  1A40 A;  2QS3 A;  5L9M A;  2PVU A;  1ZLQ A;  1MM7 A;  4IGR A;  3PPP A;  3RY3 A;  2I4B A;  4LP2 B;  3OO8 A;  3O28 A;  3VVE A;  3K4U A;  4F3B A;  4O3A A;  3WAF A;  3FXR A;  2GFE A;  3PPO A;  1DOT A;  4P11 A;  1IUD A;  2OZZ A;  3TTL A;  3TZA A;  1LAF E;  3H6V A;  4NTL A;  4RJZ A;  5DEX B;  3USD A;  2E1S A;  1B40 A;  2F35 A;  1B6H A;  4F3P A;  1JVX A;  4NF8 A;  4I8C A;  5K2X A;  3VV5 A;  2Y7P A;  3U94 A;  2O68 A;  2F34 A;  4F3S A;  4KCD A;  4RK2 A;  2Q9T A;  3SER A;  2H99 A;  1MXV A;  4NMY A;  4NF6 B;  3TTR A;  3RT6 B;  2VP1 A;  3OO6 A;  1N3W A;  4OET A;  3RGY A;  3U8Q A;  3HO7 A;  3I3V A;  2A5S A;  4LQ5 A;  2O7U A;  3OEN A;  4YB5 A;  1H43 A;  2DWA A;  4OXV A;  3IB2 A;  1B5H A;  2HZK A;  3TCF A;  5TPA A;  1ZU0 A;  1R1N A;  1MY1 A;  4DXU A;  3IO4 A;  1FQF A;  2Z23 A;  4GL8 A;  3FVO A;  1NNK A;  3K02 A;  4OQO A;  1NNP A;  1B7Z A;  2REJ A;  2XXH A;  4G2Z A;  2I49 A;  3A09 A;  3C36 A;  3PD9 A;  2LAO A;  3MVW A;  1II5 A;  4DIG A;  2OK2 A;  2Q88 A;  4NF4 B;  4KD5 A;  5JTY B;  2GHB A;  1ATG A;  1ZJL A;  2V93 A;  3N6U A;  5DVJ A;  3P7I A;  3OOA A;  2XD2 A;  3AXF A;  2ANJ A;  2XX8 A;  2X7Q A;  3CG1 A;  1P1O A;  3R26 A;  3SEW A;  2QS4 A;  3T9U A;  1EZ9 A;  2Q89 A;  3VXC A;  1DMB A;  2OLB A;  5HPQ A;  3O66 A;  1EU8 A;  4OTE A;  3IK6 B;  4I1D A;  3ODB A;  3G3K A;  3KSX A;  4F22 A;  4ELP A;  1ZIU A;  2UVG A;  2I0B A;  5ITO A;  1ANF A;  3VE1 B;  4F2Q A;  1I6A A;  5AA1 A;  1B7H A;  3SEX A;  4ELO A;  4BDM A;  3QUJ A;  4GQO A;  1UTH B;  2PMS A;  3MWB A;  4LZ7 A;  3PPR A;  2RF1 A;  1B5J A;  2DQV A;  2DWH A;  2H25 A;  4OWD A;  3IJX B;  4F39 A;  2P1S A;  1IXG A;  3B7D A;  4JDF A;  1HSL A;  2OBG A;  4H67 A;  4XKQ A;  5DEX A;  3BKI B;  3HV1 A;  3T66 A;  2Y84 A;  1VFE A;  4OFJ A;  4MLV A;  1UIV A;  3KSJ A;  2VD2 A;  3H4Z A;  1JVY A;  2RC9 A;  4C1U A;  1IIT A;  2KLF A;  2X26 A;  4EXL A;  1MDP 1;  1USY E;  1LAG E;  3A3U A;  4OVJ A;  1B2H A;  3D4C A;  1Q35 A;  2ABH A;  2I0C A;  4U4X A;  1JW4 A;  1HSE A;  3PV0 E;  3TPA A;  3LBS A;  4R6Y A;  1NNT A;  1NKX A;  3O9P A;  3N26 A;  2CMO A;  4OEV A;  4QHQ A;  4LZ5 A;  3SEU A;  4EQ9 A;  4MFI A;  1EZO A;  2ALU A;  4NF4 A;  5JTY A;  3UOR A;  3LSL A;  1R9Q A;  2B3B A;  3DP4 A;  4H0W A;  1B46 A;  1B3E A;  5H8H B;  5EHS A;  5I84 A;  1XS5 A;  2YLN A;  3C34 A;  2QMW A;  5EYF A;  2OWS A;  3FAT A;  3UA8 A;  3TDJ A;  1LAH E;  2V3T A;  4U1Z A;  1LB8 A;  1UIU A;  4XIG Q;  2DYX A;  4DCX A;  2ZNT A;  3KBR A;  2X7P A;  1B52 A;  3GBB A;  3K6U A;  4F31 B;  1B4H A;  1S50 A;  1SVX B;  5KDT B;  2RC7 A;  4U2R A;  3H6T A;  1R6Z A;  4N07 A;  4IY5 A;  1MQD A;  3EPE A;  1H76 A;  1AMF A;  3TQW A;  4ZE8 A;  5A5X B;  1ZMG A;  2B3F A;  3CFX A;  3PPN A;  3CSG A;  5KCJ A;  3HHF A;  3E13 X;  3U92 A;  4EQB A;  1MG1 A;  2NOO A;  2DOJ A;  3T9X B;  3B6W A;  4RY1 A;  2HZL A;  4ZS9 A;  5KZT A;  1MQI A;  2P2A A;  1XVX A;  1IXH A;  2WKY A;  4ESW A;  3PUV E;  1HSJ A;  3H06 B;  1BLF A;  3SEV A;  3TCH A;  3K1N A;  4PET A;  3C35 A;  3W15 C;  3KFM A;  3K01 A;  1N7X A;  2XXW A;  3CG3 A;  1B3F A;  1N04 A;  3T9H B;  1LCF A;  3UIF A;  5H8F A;  3S4U A;  4PQJ A;  4IO4 A;  1OIB A;  1OQH A;  1EH3 A;  3ILU B;  4QF9 A;  5DVF A;  3IAZ A;  2GHA A;  4H8J A;  2F7C A;  3RT8 A;  5I59 B;  1WVJ A;  1MH3 A;  3OSQ A;  1MXZ A;  2QSX A;  4OFO A;  1LFI A;  4I9D A;  2HAU A;  5I2K A;  5I56 B;  1AL3 A;  2UVJ A;  1GTK A;  4U22 A;  2HFB A;  5AA2 D;  3G7W A;  3KOT A;  2AL4 A;  1UTB A;  3T96 B;  4KR5 A;  4JWO A;  4G8H A;  4IO2 A;  1YAE A;  2XXI A;  2E0S A;  5H8H A;  2FA7 A;  1MDQ A;  3JZJ A;  1JET A;  3Q26 A;  3T93 B;  5CMB A;  1Y1Z A;  1Y4C A;  3FZV A;  3LR1 A;  4GLI A;  4WKM A;  3MVX A;  2XXP A;  4PFT A;  3V8X B;  1SYI A;  4QFN A;  4EF2 A;  3KN8 A;  3TEL A;  1XOC A;  1BKA A;  4C1T A;  1Y1M A;  2FNC A;  2I6E A;  4HCW A;  1QUJ A;  5KDT A;  3IOR A;  1D4N A;  3VVD A;  1QW0 A;  2VD3 A;  1LAX A;  1OVT A;  5I58 B;  3KN7 A;  3MJN A;  3PUX E;  4TOZ A;  4UA8 A;  4Q8R A;  2UXA A;  5B7D A;  2B65 A;  2REG A;  1N7W A;  3K6V A;  1IQ7 A;  4JWY A;  3OXN A;  4M4G A;  4H1X A;  1ELJ A;  3W9V A;  3KJ7 A;  1YCJ A;  1GVC A;  3RNN A;  3M3F A;  2I4C A;  4FEB A;  2DE4 A;  1Y20 A;  1FTL A;  1P1Q A;  1JNF A;  1A7L A;  4QFL A;  1B32 A;  4YIC A;  1QKA A;  4G68 B;  1Y3Q A;  3THI A;  1MY4 A;  4OEU A;  1D9Y A;  2NXO A;  3ZS6 A;  1LGB C;  3M8U A;  3SDF A;  3CSB A;  2DXY A;  1I69 A;  4M1V A;  5L8D A;  1DPE A;  1MS7 A;  3L6H A;  3RN8 A;  5I59 A;  3C9H A;  1US5 A;  2HEU A;  2DXR A;  4RK9 A;  1SW4 A;  1SW1 A;  3A3C A;  2PT1 A;  3IJO B;  4L17 A;  4DXC A;  3M3K A;  4IO6 A;  3IB1 A;  2PYY A;  1NH8 A;  3HHG A;  2QS1 A;  2VOZ A;  3TTN A;  1MM6 A;  2RCB A;  2I3W A;  2RIN A;  1WOD A;  3TQL A;  3FIR A;  3ZKL A;  3H6W A;  4LZ8 A;  4Q30 B;  1DTG A;  3R7X A;  3C31 A;  2XXT A;  4BDR A;  4KCC A;  4KYE A;  4BLA A;  5CC2 A;  2NVU B;  5H8N A;  2XXU A;  1A54 A;  4BDN A;  2P0S A;  1MRP A;  5H8Q B;  2Q2C A;  1BIY A;  4GWO A;  1QUL A;  4XKN A;  3Q25 A;  2F36 A;  2QMX A;  4YKP A;  3VVF A;  3DM0 A;  3TOD A;  3H03 A;  4LA9 A;  3QAX A;  5I58 A;  2RKM A;  2IA4 A;  1N0T A;  2HAV A;  2XXR A;  3S9N C;  3IO6 A;  1B4Z A;  3MW0 A;  3T9V A;  4AB5 A;  4FIM A;  1TWY A;  2Y7W A;  1B1X A;  3S9L C;  1EZP A;  3EQ1 A;  3RTF B;  1Q1K A;  4JSO A;  2Z22 A;  4EUO A;  3V89 B;  5ELV A;  4BDQ A;  1AH5 A;  3KEI A;  4NED A;  4POX A;  4YZZ A;  3IR1 A;  4O3B A;  4HCY A;  3PUY E;  2O1M A;  2HCA A;  2ZYK A;  1SQY A;  1A8E A;  3TTM A;  2IEE A;  4GL0 A;  2GH9 A;  4G68 A;  3RQT A;  2A5T B;  3SES A;  5L9O A;  2DVC A;  1MQJ A;  5I57 B;  4FJP A;  3KGC A;  2F78 A;  1SD3 A;  5AA4 B;  3VXB A;  3OO9 A;  4HW8 A;  5FHN A;  4XTC Q;  4YKI A;  3FV2 A;  2RC8 A;  4KQP A;  4Z0I A;  3GBA A;  1JW1 A;  2QPQ A;  1LCT A;  2DVZ A;  4E0X A;  2Z8F A; 
#chains in the Genus database with same CATH topology
 1OMP A;  4ZED A;  3QMF A;  4GRK A;  4IO5 A;  4OYV A;  2I58 A;  1P99 A;  1RYX A;  3QUF A;  1KA0 A;  1VE4 A;  2D3I A;  3G3H A;  1M5D A;  4P56 A;  4NF6 A;  4LQ2 A;  1KZ8 A;  3FAS A;  2H4I A;  1VR5 A;  1M5E A;  1M5B A;  1FQC A;  3RPW A;  3SEY A;  5IZ3 A;  1URG A;  4GWU A;  1IEJ A;  5H8Q A;  4BDL A;  1B7U A;  3LSF B;  2D5W A;  3VDF A;  3MPL A;  4HXV A;  4N13 A;  3GZG A;  2Y7I A;  1URD A;  4GFR A;  3EHT A;  4MJO A;  2VPO A;  3MZ1 A;  1JEU A;  1N76 A;  2XA5 A;  4PF6 A;  1MXX A;  2D21 A;  2HXW A;  5EYH A;  2QL3 A;  2R8T A;  5CBS A;  4GF8 A;  1PDA A;  4N91 A;  3IOW A;  2B4M A;  1OLC A;  2XD3 A;  2F3B A;  3WAE A;  3OSR A;  4RPN A;  3G3G A;  4OMB A;  4PBQ A;  3ECR A;  2O6A A;  1DTZ A;  4NF5 B;  4TLL B;  1O63 A;  3MZB A;  3T1B A;  4WEP A;  4PDH A;  4QFP A;  4QSC A;  2DWJ A;  3OEK A;  1FQA A;  2XXQ A;  5AA2 B;  4FBP A;  5TP9 B;  1PEB A;  2ZZW A;  1RDY A;  1YTV A;  4R75 A;  5AA3 A;  2CZK A;  4OER A;  2UYF A;  3MC2 A;  4IY6 A;  1LBV A;  1A99 A;  2A5T A;  3I5O A;  1BTJ A;  3DLN A;  2R9J A;  4IO7 A;  2XXX A;  1PBP A;  4OVS A;  1UTH A;  1Z7N E;  5I57 A;  1FBH A;  3HPI A;  4OA4 A;  2XXK A;  4R72 A;  5FTI A;  3SKP A;  4DDD A;  4DXB A;  2XWV A;  3G3I A;  4F3G A;  5CM6 A;  3QSL A;  4DZ1 A;  4H5F A;  4JWX A;  4KFQ A;  3LSW A;  3PD8 A;  2DSF A;  1OLA A;  1FPD A;  4FOR A;  1FTA A;  4R74 A;  3O2A A;  4JBZ A;  5IZ1 A;  4NHB A;  4OHN A;  3G3J A;  3KJT A;  2ZXT A;  1FQB A;  2QJE A;  1LBZ A;  1MQG A;  1FBG A;  4F1Y A;  1B3H A;  1MPB A;  4PFR A;  1OVB A;  3UK4 A;  1S7Y A;  1IXI A;  4I40 A;  1M5C A;  4PTK A;  4GWY A;  3O6G A;  1R9L A;  4ZDM A;  1Y4T A;  3O97 A;  4H65 A;  2Z8E A;  3IX1 A;  4NWD A;  3FVK A;  2GRV A;  5ITP A;  4DI3 D;  1SI1 A;  1I6Q A;  3T0J A;  1NV1 A;  2ZYO A;  3KOS A;  3MP8 A;  3U72 A;  2F5X A;  2HPG A;  3QK6 A;  4MF3 A;  4QRZ A;  1FCK A;  2ONK E;  3F11 A;  4R2B A;  2BJJ X;  5DVI A;  3CFZ A;  3EN3 A;  4K3F A;  4EQ7 A;  4ZEK A;  2G93 A;  1UQW A;  1CE2 A;  4PC9 A;  3ZSF A;  4ISU A;  5LOM A;  4LUB A;  3VLW A;  4NF8 B;  1SW2 A;  2F7B A;  4GX4 A;  4PFU A;  1URS A;  1LBW A;  3FJG A;  2O84 X;  2WBD A;  4PGN A;  1QKB A;  1PBQ A;  1ZKB A;  1EYK A;  4OVP A;  2FYI A;  3KC1 A;  4MHF A;  2O51 A;  2O7I A;  1DK4 A;  4H8I A;  5F1Q A;  3BFT A;  1D9Q A;  1POT A;  1LBC A;  2Q8J A;  2AL5 A;  1LFH A;  4GXS B;  1N84 A;  5TPA B;  5AA2 A;  4LAT A;  3V5A A;  3MBP A;  4XKR A;  4MNI A;  3DP8 A;  3VLU A;  2Q2A A;  4N4U A;  5IKB A;  3LV0 A;  3U1O A;  4P0I A;  3HCQ A;  4GBW A;  3L6G A;  1KA1 A;  3MP1 A;  4X1B A;  2F6G A;  3S9M C;  5I5P A;  3T22 A;  1OQG A;  4PBH A;  5A5X A;  3RTW B;  3CRB A;  4C0R A;  1GGG A;  4PFB A;  2V84 A;  3B6Q A;  2V4C A;  3E9X A;  4ZZA A;  3SZP A;  1MPD A;  1IXC A;  2O1L A;  1FQD A;  4RPO A;  4U1O A;  1FJ9 A;  1FTO A;  2HXR A;  5EQ7 A;  4OAN A;  1MXU A;  3U93 A;  4NF0 A;  2MKZ A;  1B51 A;  4GX3 A;  4F2O A;  1B3G A;  1DCU A;  5EYG A;  4G68 C;  2QVU A;  2ONR A;  3QIM A;  3RLF E;  2ZZX A;  3IOT A;  2XWO A;  4KYD A;  4RNS A;  3FXU A;  2QRY A;  4YB6 A;  1H3D A;  4ZEI A;  3OEL A;  3TEP A;  1NFT A;  5AE4 A;  3S9E A;  3Q29 A;  4N6P A;  3OMB A;  2I48 A;  2WYK A;  1IMD A;  3E3K A;  3N94 A;  2H9B A;  4GWS A;  5DTB A;  3DP6 A;  3TFL A;  2HQ0 A;  3TUS A;  1IIW A;  3JV9 A;  3PMV A;  3VLV A;  2ZNS A;  2V3U A;  3A29 A;  5I56 A;  2OX3 A;  1TXF A;  1TFD A;  3EHS A;  1FTK A;  4N17 A;  4G4P A;  2CZL A;  1H45 A;  4N81 A;  5DT6 A;  1NV6 A;  2QVR A;  4QSD A;  1YPN A;  4O7M A;  3C33 A;  1SW5 A;  4JXI A;  1IMB A;  3PUZ E;  4N6D A;  1FTJ A;  1QVS A;  4FAJ A;  2ONS A;  5FBP A;  3GYY A;  4F1U A;  5ICQ A;  3M3L A;  4NE4 A;  3IFC A;  5ICT A;  3K6X A;  3O29 A;  1LEV A;  1NNF A;  2H98 A;  1GR2 A;  4KPT A;  3FGS A;  1B58 A;  5H8S A;  5I2N B;  4F18 A;  3RUM A;  4U4S A;  2VHA A;  3LC8 A;  5I7I A;  1QJM A;  3PUW E;  2XXV A;  4R73 A;  1USY H;  1SDX A;  4FE8 A;  4R6H A;  1RDX A;  2H5Y A;  3TMG A;  3EF7 A;  2CEY A;  4ZEF A;  4F1V A;  1FBP A;  2O69 A;  3LUY A;  4THI A;  3R6U A;  5EQ8 A;  4WXJ A;  3FVG A;  1LFG A;  1EYJ A;  3IB0 A;  2OJT A;  4EDP A;  3O6H A;  4MNP A;  1JEV A;  3GLB A;  1LBX A;  4PE3 A;  1Y3N A;  4DCY A;  1XT8 A;  3CVG A;  2F97 A;  3FVN A;  4QFO A;  4PDD A;  3CR9 A;  2V3Q A;  3IOU A;  4ZE9 A;  3ONM A;  1LBY A;  2V25 A;  4Z7E A;  1P1U A;  1PB9 A;  4MLQ A;  4XXU A;  1B05 A;  3BBR A;  3GXA A;  5J1D A;  1QUK A;  1MY3 A;  1Y9U A;  4OZ9 A;  4RXL A;  1FPJ A;  2ESN A;  4YMB A;  3V83 A;  4DI4 B;  3N6T A;  4X48 A;  3C4M A;  2THI A;  2OWZ A;  3UN6 A;  1N3X A;  1I6B A;  1ZBM A;  3KC0 A;  3VFJ A;  2G29 A;  3KG2 A;  5CMC A;  5KCJ B;  4JVD A;  5HM4 B;  3PGF A;  5CBR A;  1NV3 A;  4QSE A;  3RYD A;  5JK4 A;  3K1M A;  4KYS A;  2YPN A;  3CI8 A;  4O3C A;  2UVH A;  1FBE A;  1MQH A;  4ONY A;  4R9F A;  4R6K A;  4MEV A;  2BJI A;  2PFZ A;  4DE8 A;  1RDZ A;  2KR0 A;  4ELQ A;  3TTK A;  1PC3 A;  1B3L A;  3E79 A;  1O64 A;  1US4 A;  2Y7R A;  3Q27 A;  1NL5 A;  1P1W A;  5IM2 A;  2F6P A;  5B70 A;  1AWB A;  4E0W A;  1Z7M E;  2AYS A;  2NUV A;  3K6W A;  5H8F B;  3H3G A;  1LST A;  2CZH A;  1DSN A;  1P1N A;  4QXD A;  1POY 1;  1AIV A;  4OEN A;  1QUI A;  1B0L A;  2DE2 A;  3B8B A;  4KHZ E;  4X04 A;  4JB7 A;  3KZG A;  4TQU Q;  1VFD A;  3LUZ A;  3E4R A;  5I2N A;  5IZZ A;  3CIJ A;  4GIZ A;  5L9S A;  4XF5 A;  4PE5 B;  1PB8 A;  3D1R A;  5BUU A;  3FV1 A;  1T0K A;  1MXW A;  4R9G A;  3MP6 A;  1TT1 A;  4G8M A;  1XHY A;  5I2K B;  5BWJ A;  4PP0 A;  3OO7 A;  4HE1 A;  4KXP A;  1YXI A;  3TCG A;  4ECF A;  4KI0 E;  1S9T A;  1MXY A;  2RCA A;  1VDW A;  4MMP A;  4G8N A;  4LVQ A;  1UTB B;  4IO3 A;  2UVI A;  1NV5 A;  2Y7K A;  1M5F A;  1AOV A;  4GWX A;  5M2V A;  4FEC A;  3MAM A;  4UAC A;  4POW A;  4BDO A;  4YKK A;  1MY2 A;  3TYH A;  4ZEC A;  4MIJ A;  1IMA A;  3S2V A;  4OFL A;  1FPK A;  3FD3 A;  4AQ4 A;  3K0V A;  4TLM B;  2M8C A;  3UP9 A;  2Y5K A;  4ND9 A;  5F7V A;  2XX7 A;  3B6T A;  5CRY A;  3NOH A;  3W9W A;  3G3F A;  1D3K A;  1NH7 A;  1XVY A;  2PBW A;  1KWH A;  4ESX A;  1DPP A;  5CI5 A;  5FTH A;  4MH5 A;  1H44 A;  3OEM A;  1K9Y A;  2QS2 A;  4GD5 A;  2ZMB A;  3LSX A;  3MYU A;  3QYT A;  4PFY A;  5AA4 A;  1LB9 A;  3IL1 B;  2QFL A;  1SI0 A;  3MVY A;  3PMX A;  5CMM A;  1L5T A;  1FPI A;  1B5I A;  2DWI A;  3FUZ A;  1FTM A;  4P0G A;  3D4G A;  4GXA A;  2NWJ A;  2W7Y A;  5DYH A;  4GWW A;  1FPB A;  1O7T A;  3FJM A;  1IMF A;  1VSO A;  4Q0C A;  3HST A;  4OVT A;  3MQ9 A;  2ZYN A;  4XEQ A;  4PF8 A;  2L5V A;  5EHM A;  2OWT A;  4AB6 A;  4FAT A;  3PPQ A;  4I62 A;  3TAJ A;  1B0H A;  4HS7 A;  5HBC A;  1RYO A;  4R2F A;  2AIX A;  5LDZ A;  4ELR A;  4RA1 A;  2XHD A;  2F3D A;  4ZZE A;  3BIG A;  2F7A A;  2YJP A;  4QFK A;  4GX6 A;  2Z8D A;  5ISU A;  4GWZ A;  4NWC A;  4P1E A;  3FJ7 A;  4HTG A;  4U21 A;  1BP5 A;  2GQ1 A;  3PU5 A;  3BFU A;  1Y3P A;  2UYE A;  4FED A;  1IMC A;  1F9B A;  2XX9 A;  1FPG A;  2R6G E;  2F8D A;  3ZKK A;  2XWI A;  4JSD A;  2XXY A;  4WED A;  4U23 A;  4EF1 A;  3JYR A;  4YAH X;  2P3N A;  5CMK A;  2VGQ A;  4GVO A;  1WDN A;  4IB2 A;  4XKP A;  1MY0 A;  1ZTY A;  3ISP A;  1SBP A;  3MVZ A;  1NUX A;  4MBP A;  4NF5 A;  4OES A;  5IAI A;  1FW0 A;  3KN3 A;  4EXK A;  5DW8 A;  3QXM A;  1TFA A;  3Q28 A;  4MAG A;  1LLS A;  2I3V A;  3MZ9 A;  1MH4 A;  1D9V A;  1EYI A;  4G77 A;  5H8N B;  1A55 A;  3FXQ A;  5TP9 A;  3DEL B;  5FHO A;  1CB6 A;  1PB7 A;  4RYA A;  4H45 A;  1B1H A;  4YKJ A;  3IOV A;  3H6U A;  2OCU A;  2R71 A;  3RPL B;  3C32 A;  2PT2 A;  4F19 A;  2ZYM A;  1XI6 A;  3HFU A;  4Q5T A;  1NI9 A;  3ILT B;  3CFL A;  4H5G A;  4YU0 A;  1J1N A;  1SYH A;  5FHM A;  3OD7 A;  1GV8 A;  5T3J A;  3MUQ A;  4X9T A;  1NUZ A;  1JW5 A;  4PFW A;  4DLD A;  1FQE A;  3K00 A;  2DS9 A;  3EHU A;  4X1D A;  4LON B;  2CZI A;  4O8M A;  3K2D A;  2FBP A;  3TKD A;  3H7M A;  3K1P A;  4F29 A;  3PMW A;  2DP8 A;  4H6D A;  3HN0 A;  3MST A;  5K2Y A;  4N6K A;  1FJ6 A;  2DE3 A;  1LBB A;  4YB7 A;  1IZ1 A;  3O6I A;  4YMA A;  1RKM A;  4QBA A;  1NMU A;  2PX1 A;  5JEI A;  1MPC A;  1B9J A;  1A8F A;  1XC1 A;  4GOT A;  3I6V A;  1JQF A;  3SET A;  2ZNU A;  3UGW A;  4ZEB A;  4XFE A;  3IFA A;  3MPK A;  4HE2 A;  3N5L A;  5TU0 A;  4IGT A;  1A40 A;  2QS3 A;  2ZZV A;  5L9M A;  2PVU A;  1ZLQ A;  1DBZ A;  1MM7 A;  4IGR A;  3PPP A;  3RY3 A;  2KQZ A;  1BK4 A;  2I4B A;  4LP2 B;  3OO8 A;  3O28 A;  3VVE A;  3K4U A;  4F3B A;  4O3A A;  3WAF A;  3FXR A;  2GFE A;  3PPO A;  1DOT A;  4P11 A;  1IUD A;  2OZZ A;  3TTL A;  3TZA A;  1LAF E;  3H6V A;  4NTL A;  4RJZ A;  5DEX B;  3USD A;  2E1S A;  1B40 A;  2F35 A;  1B6H A;  4F3P A;  1JVX A;  4NF8 A;  4I8C A;  5K2X A;  1G0H A;  3VV5 A;  5EQ9 A;  2Y7P A;  3U94 A;  2O68 A;  2F34 A;  4F3S A;  4KCD A;  4RK2 A;  2Q9T A;  3SER A;  2H99 A;  4X8R A;  1MXV A;  4NMY A;  2CEX A;  4NF6 B;  3TTR A;  3RT6 B;  5A5L A;  2VP1 A;  3OO6 A;  1N3W A;  4OET A;  2B4L A;  3RGY A;  5LTC A;  3U8Q A;  2FIX A;  3HO7 A;  3I3V A;  2A5S A;  4LQ5 A;  2O7U A;  3OEN A;  4YB5 A;  1H43 A;  2DWA A;  4OXV A;  3IB2 A;  1B5H A;  2HZK A;  3TCF A;  5TPA A;  1ZU0 A;  5IZ3 B;  1R1N A;  1MY1 A;  3ROJ A;  4DXU A;  3IO4 A;  1FQF A;  1QGX A;  2Z23 A;  4GL8 A;  3FVO A;  1NNK A;  3K02 A;  4OQO A;  1NNP A;  1B7Z A;  2REJ A;  2XXH A;  3RPL A;  4G2Z A;  2I49 A;  3A09 A;  3C36 A;  3PD9 A;  2LAO A;  3MVW A;  1II5 A;  4DIG A;  2OK2 A;  4JVI A;  1FBF A;  2Q88 A;  4NF4 B;  4KD5 A;  5JTY B;  4NN3 A;  2GHB A;  1ATG A;  1ZJL A;  2V93 A;  3N6U A;  5DVJ A;  3P7I A;  3OOA A;  2XD2 A;  3AXF A;  2ANJ A;  2XX8 A;  2X7Q A;  3CG1 A;  1P1O A;  3R26 A;  3SEW A;  2QS4 A;  4NG7 A;  3T9U A;  1EZ9 A;  2Q89 A;  3VXC A;  1DMB A;  3FBP A;  4O94 A;  2OLB A;  5HPQ A;  3O66 A;  1EU8 A;  4OTE A;  3IK6 B;  4I1D A;  1IME A;  1FPF A;  3ODB A;  3G3K A;  3KSX A;  4F22 A;  2WEF A;  4ELP A;  1ZIU A;  2UVG A;  2I0B A;  5ITO A;  1SPI A;  1ANF A;  4P47 A;  3VE1 B;  4NAP A;  5ET5 A;  5ESY A;  4F2Q A;  1I6A A;  5AA1 A;  4P3L A;  1B7H A;  3SEX A;  1JP4 A;  4ELO A;  4BDM A;  3QUJ A;  1NV0 A;  4GQO A;  1UTH B;  2PMS A;  3MWB A;  4LZ7 A;  3PPR A;  2RF1 A;  1B5J A;  2DQV A;  2DWH A;  2H25 A;  4OWD A;  3IJX B;  4P1L A;  4F39 A;  2P1S A;  1IXG A;  3B7D A;  4G61 A;  3KBZ A;  4NQ8 A;  4JDF A;  1HSL A;  4I3E A;  2OBG A;  4AS5 A;  1K9Z A;  4H67 A;  4XKQ A;  5DEX A;  3BKI B;  3HV1 A;  3T66 A;  2Y84 A;  1VFE A;  4OFJ A;  2HHM A;  2Q74 A;  4MLV A;  1UIV A;  3KSJ A;  2VD2 A;  3H4Z A;  1JVY A;  2RC9 A;  4C1U A;  1IIT A;  2KLF A;  3BIH A;  2X26 A;  4EXL A;  1MDP 1;  1USY E;  1LAG E;  3A3U A;  4LN5 A;  4PFI A;  4N15 A;  4N8Y A;  2WYP A;  4OVJ A;  1B2H A;  3D4C A;  2WX9 A;  1Q35 A;  2ABH A;  2I0C A;  4U4X A;  1JW4 A;  1HSE A;  3PV0 E;  3TPA A;  3LBS A;  4R6Y A;  1NNT A;  1NKX A;  5I3S A;  3FXB A;  3O9P A;  4PAK A;  5F24 A;  4IR8 A;  3N26 A;  2Q8M A;  4JVC A;  2CMO A;  4OEV A;  4QHQ A;  4LZ5 A;  2QVV A;  3SEU A;  4EQ9 A;  4MFI A;  1EZO A;  2ALU A;  4NF4 A;  5JTY A;  3UOR A;  3LSL A;  1R9Q A;  2B3B A;  3DP4 A;  4H0W A;  1B46 A;  1B3E A;  5H8H B;  1FBC A;  5EHS A;  5I84 A;  1XS5 A;  2YLN A;  2VPN A;  3C34 A;  2QMW A;  5EYF A;  2OWS A;  3FAT A;  3UA8 A;  3TDJ A;  1LAH E;  2V3T A;  4U1Z A;  1LB8 A;  4N8G A;  1UIU A;  4XIG Q;  2DYX A;  4DCX A;  2ZNT A;  3KBR A;  2X7P A;  1B52 A;  3GBB A;  3K6U A;  4F31 B;  1B4H A;  1S50 A;  1SVX B;  5KDT B;  2RC7 A;  4U2R A;  3H6T A;  1R6Z A;  4N07 A;  5ET7 A;  4IY5 A;  1MQD A;  3EPE A;  1H76 A;  1AMF A;  3TQW A;  4OVR A;  4ZE8 A;  5A5X B;  1CNQ A;  1ZMG A;  2B3F A;  3CFX A;  3PPN A;  3CSG A;  5KCJ A;  3HHF A;  4PAI A;  3E13 X;  2PCR A;  3U92 A;  4EQB A;  1MG1 A;  2NOO A;  2DOJ A;  3T9X B;  3B6W A;  4RY1 A;  2HZL A;  4ZS9 A;  1FRP A;  5KZT A;  1MQI A;  2P2A A;  1XVX A;  1IXH A;  2WKY A;  4ESW A;  3PUV E;  1HSJ A;  3H06 B;  1BLF A;  5ET8 A;  4HE0 A;  4PCD A;  3SEV A;  3TCH A;  3K1N A;  4PET A;  3C35 A;  3W15 C;  3KFM A;  3K01 A;  1N7X A;  2XXW A;  2DDK A;  3CG3 A;  1B3F A;  1N04 A;  3T9H B;  1LCF A;  3UIF A;  5H8F A;  3S4U A;  4PQJ A;  4IO4 A;  1OIB A;  1OQH A;  1EH3 A;  3ILU B;  4QF9 A;  5DVF A;  3IAZ A;  2GHA A;  4H8J A;  2F7C A;  3E78 A;  3RT8 A;  1G0I A;  5I59 B;  1NUY A;  1WVJ A;  5ET6 A;  1MH3 A;  3OSQ A;  1FPE A;  1MXZ A;  2QSX A;  4OFO A;  1LFI A;  4I9D A;  3U65 A;  2HAU A;  5I2K A;  5I56 B;  1AL3 A;  2UVJ A;  1GTK A;  4U22 A;  2HFB A;  5AA2 D;  1FSA A;  3G7W A;  3KOT A;  1UTB A;  2AL4 A;  3T96 B;  4KR5 A;  4JWO A;  4G8H A;  4IO2 A;  1YAE A;  2XXI A;  2E0S A;  5H8H A;  2FA7 A;  1MDQ A;  1Q9D A;  3JZJ A;  1JET A;  3Q26 A;  3T93 B;  5CMB A;  1Y1Z A;  1Y4C A;  3FZV A;  1NUW A;  3LR1 A;  4GLI A;  1NV2 A;  4WKM A;  3MVX A;  2XXP A;  4PFT A;  3V8X B;  2VT5 A;  1SYI A;  4QFN A;  4EF2 A;  3KN8 A;  3TEL A;  1XOC A;  1BKA A;  4C1T A;  1Y1M A;  2FNC A;  2I6E A;  4HCW A;  1QUJ A;  5KDT A;  3IOR A;  1D4N A;  3VVD A;  1QW0 A;  2VD3 A;  1LAX A;  1OVT A;  5I58 B;  3KN7 A;  3MJN A;  3PUX E;  4TOZ A;  4MNC A;  4UA8 A;  4Q8R A;  2FIE A;  2UXA A;  2Y5L A;  5B7D A;  2B65 A;  2REG A;  4I3Y A;  1N7W A;  3K6V A;  4PAF A;  1IQ7 A;  4JWY A;  3OXN A;  4MX6 A;  4M4G A;  4H1X A;  4UAB A;  1ELJ A;  3W9V A;  3KJ7 A;  1YCJ A;  4PGP A;  1GVC A;  3RNN A;  3M3F A;  2I4C A;  4FEB A;  2DE4 A;  1Y20 A;  1FTL A;  3EKI A;  1P1Q A;  1JNF A;  1A7L A;  4QFL A;  1B32 A;  1NV7 A;  4YIC A;  1QKA A;  4G68 B;  1Y3Q A;  4H46 A;  3THI A;  1MY4 A;  1NV4 A;  4OEU A;  5EQA A;  1FPL A;  1D9Y A;  2NXO A;  3ZS6 A;  1LGB C;  4P8B A;  3CHG A;  3M8U A;  3SDF A;  3CSB A;  2DXY A;  1I69 A;  4M1V A;  5L8D A;  1DPE A;  1MS7 A;  2JJK A;  3PTY A;  3L6H A;  2XWK A;  3RN8 A;  5I59 A;  3C9H A;  1US5 A;  2HEU A;  2DXR A;  4RK9 A;  1SW4 A;  1SW1 A;  3A3C A;  2PT1 A;  3IJO B;  4L17 A;  4DXC A;  3M3K A;  4IO6 A;  3IB1 A;  2PYY A;  1NH8 A;  3HHG A;  2QS1 A;  2VOZ A;  3TTN A;  2FHY A;  1MM6 A;  2RCB A;  2I3W A;  2RIN A;  1WOD A;  3TQL A;  5IGA A;  3FIR A;  3ZKL A;  3H6W A;  4LZ8 A;  4Q30 B;  1DTG A;  3R7X A;  3C31 A;  2XXT A;  4BDR A;  4KCC A;  4KYE A;  4BLA A;  2PFY A;  5CC2 A;  2NVU B;  5H8N A;  2XXU A;  1A54 A;  1YZ0 A;  2P0S A;  4BDN A;  4MCO A;  1MRP A;  5H8Q B;  2Q2C A;  1BIY A;  4O7I A;  4GWO A;  1QUL A;  4XKN A;  2P3V A;  3Q25 A;  2F36 A;  4GBV A;  2QMX A;  4YKP A;  3VVF A;  4NGU A;  3DM0 A;  3TOD A;  3H03 A;  4LA9 A;  3QAX A;  5I58 A;  2RKM A;  4P9K A;  2IA4 A;  1N0T A;  2FVZ A;  2HAV A;  2XXR A;  3S9N C;  3IO6 A;  1B4Z A;  3MW0 A;  3T9V A;  4AB5 A;  4FIM A;  1TWY A;  2Y7W A;  1B1X A;  3S9L C;  1EZP A;  1YYZ A;  3B50 A;  3EQ1 A;  1FBD A;  3RTF B;  1Q1K A;  4JSO A;  2Z22 A;  4EUO A;  3V89 B;  5J16 A;  5ELV A;  4BDQ A;  1AH5 A;  3KEI A;  4NED A;  4POX A;  4YZZ A;  3IR1 A;  4O3B A;  4HCY A;  3PUY E;  2O1M A;  2HCA A;  2ZYK A;  1SQY A;  1A8E A;  3TTM A;  1INP A;  2IEE A;  4GL0 A;  2GH9 A;  2WBB A;  4G68 A;  3RQT A;  2A5T B;  3SES A;  5L9O A;  2DVC A;  1MQJ A;  5I57 B;  4FJP A;  3KGC A;  4AS4 A;  2F78 A;  1SD3 A;  4NX1 A;  5AA4 B;  3VXB A;  3OO9 A;  4HW8 A;  5FHN A;  4XTC Q;  4YKI A;  3FV2 A;  2RC8 A;  4KQP A;  4Z0I A;  4OVQ A;  3GBA A;  1JW1 A;  2QPQ A;  1LCT A;  2DVZ A;  4E0X A;  2Z8F A; 
#chains in the Genus database with same CATH homology
 1OMP A;  4ZED A;  4GRK A;  4IO5 A;  4OYV A;  2I58 A;  1P99 A;  1RYX A;  3QUF A;  1VE4 A;  2D3I A;  3G3H A;  1M5D A;  4NF6 A;  4LQ2 A;  3FAS A;  2H4I A;  1VR5 A;  1M5E A;  1M5B A;  1FQC A;  3RPW A;  3SEY A;  1URG A;  1IEJ A;  5H8Q A;  4BDL A;  1B7U A;  3LSF B;  2D5W A;  3VDF A;  3MPL A;  4N13 A;  3GZG A;  2Y7I A;  1URD A;  4GFR A;  3EHT A;  3MZ1 A;  1JEU A;  1N76 A;  1MXX A;  2D21 A;  2HXW A;  2QL3 A;  5CBS A;  4GF8 A;  1PDA A;  3IOW A;  1OLC A;  2XD3 A;  3WAE A;  3OSR A;  4RPN A;  3G3G A;  4OMB A;  3ECR A;  2O6A A;  1DTZ A;  4NF5 B;  4TLL B;  1O63 A;  3MZB A;  4WEP A;  4QFP A;  4QSC A;  2DWJ A;  3OEK A;  1FQA A;  2XXQ A;  5AA2 B;  5TP9 B;  1PEB A;  1YTV A;  4R75 A;  5AA3 A;  4OER A;  2UYF A;  3MC2 A;  4IY6 A;  1A99 A;  2A5T A;  3I5O A;  1BTJ A;  3DLN A;  2R9J A;  4IO7 A;  2XXX A;  1PBP A;  1UTH A;  1Z7N E;  5I57 A;  3HPI A;  4R72 A;  3SKP A;  5FTI A;  4DDD A;  4DXB A;  3G3I A;  4F3G A;  5CM6 A;  3QSL A;  4DZ1 A;  4H5F A;  4JWX A;  4KFQ A;  3LSW A;  3PD8 A;  2DSF A;  1OLA A;  4FOR A;  4R74 A;  3O2A A;  4JBZ A;  4OHN A;  3G3J A;  3KJT A;  2ZXT A;  1FQB A;  2QJE A;  1MQG A;  4F1Y A;  1B3H A;  1MPB A;  1OVB A;  3UK4 A;  1S7Y A;  1IXI A;  1M5C A;  3O6G A;  1R9L A;  4ZDM A;  1Y4T A;  3O97 A;  4H65 A;  2Z8E A;  3IX1 A;  4NWD A;  3FVK A;  2GRV A;  5ITP A;  1SI1 A;  1I6Q A;  2ZYO A;  3KOS A;  3MP8 A;  3U72 A;  2F5X A;  3QK6 A;  4MF3 A;  4QRZ A;  1FCK A;  2ONK E;  3F11 A;  4R2B A;  2BJJ X;  5DVI A;  3CFZ A;  3EN3 A;  4K3F A;  4EQ7 A;  4ZEK A;  2G93 A;  1UQW A;  1CE2 A;  3ZSF A;  4ISU A;  5LOM A;  4LUB A;  3VLW A;  4NF8 B;  1SW2 A;  2F7B A;  4PFU A;  1URS A;  3FJG A;  2O84 X;  1QKB A;  1PBQ A;  1ZKB A;  2FYI A;  2O51 A;  2O7I A;  4H8I A;  5F1Q A;  3BFT A;  1POT A;  1LBC A;  2Q8J A;  2AL5 A;  1LFH A;  4GXS B;  1N84 A;  5TPA B;  5AA2 A;  4LAT A;  3V5A A;  3MBP A;  4XKR A;  3DP8 A;  3VLU A;  2Q2A A;  5IKB A;  3U1O A;  4P0I A;  3HCQ A;  3L6G A;  3MP1 A;  4X1B A;  2F6G A;  3S9M C;  3T22 A;  1OQG A;  5A5X A;  3RTW B;  3CRB A;  4C0R A;  1GGG A;  2V84 A;  3B6Q A;  3E9X A;  4ZZA A;  1MPD A;  1IXC A;  2O1L A;  1FQD A;  4RPO A;  4U1O A;  1FTO A;  1MXU A;  3U93 A;  1B51 A;  4F2O A;  1B3G A;  4G68 C;  2ONR A;  3QIM A;  3RLF E;  3IOT A;  4KYD A;  4RNS A;  3FXU A;  2QRY A;  4YB6 A;  1H3D A;  4ZEI A;  3OEL A;  3TEP A;  1NFT A;  5AE4 A;  3S9E A;  3Q29 A;  4N6P A;  3OMB A;  2I48 A;  3E3K A;  3N94 A;  2H9B A;  5DTB A;  3DP6 A;  3TFL A;  2HQ0 A;  3TUS A;  1IIW A;  3JV9 A;  3PMV A;  3VLV A;  2ZNS A;  2V3U A;  5I56 A;  1TXF A;  1TFD A;  3EHS A;  1FTK A;  4G4P A;  2CZL A;  1H45 A;  5DT6 A;  4QSD A;  1YPN A;  3C33 A;  1SW5 A;  4JXI A;  3PUZ E;  1FTJ A;  1QVS A;  4FAJ A;  2ONS A;  4F1U A;  5ICQ A;  3M3L A;  4NE4 A;  5ICT A;  3K6X A;  3O29 A;  1NNF A;  2H98 A;  1GR2 A;  4KPT A;  3FGS A;  1B58 A;  5H8S A;  5I2N B;  4F18 A;  3RUM A;  4U4S A;  2VHA A;  3LC8 A;  1QJM A;  3PUW E;  2XXV A;  4R73 A;  1USY H;  1SDX A;  4FE8 A;  4R6H A;  2H5Y A;  3TMG A;  3EF7 A;  4ZEF A;  4F1V A;  2O69 A;  3LUY A;  4THI A;  3R6U A;  4WXJ A;  3FVG A;  1LFG A;  3IB0 A;  2OJT A;  4EDP A;  3O6H A;  1JEV A;  3GLB A;  1Y3N A;  4DCY A;  1XT8 A;  3CVG A;  2F97 A;  3FVN A;  4QFO A;  3CR9 A;  2V3Q A;  3IOU A;  4ZE9 A;  3ONM A;  2V25 A;  4Z7E A;  1P1U A;  1PB9 A;  4MLQ A;  4XXU A;  1B05 A;  3BBR A;  3GXA A;  5J1D A;  1QUK A;  1MY3 A;  1Y9U A;  4OZ9 A;  4RXL A;  2ESN A;  4YMB A;  3V83 A;  3N6T A;  4X48 A;  3C4M A;  2THI A;  3UN6 A;  1N3X A;  1I6B A;  1ZBM A;  3VFJ A;  2G29 A;  3KG2 A;  5CMC A;  5KCJ B;  5HM4 B;  3PGF A;  5CBR A;  4QSE A;  5JK4 A;  3K1M A;  4KYS A;  2YPN A;  3CI8 A;  4O3C A;  2UVH A;  1MQH A;  4ONY A;  4R9F A;  4R6K A;  4DE8 A;  4ELQ A;  3TTK A;  1PC3 A;  1B3L A;  1O64 A;  1US4 A;  2Y7R A;  3Q27 A;  1NL5 A;  1P1W A;  2F6P A;  5B70 A;  4E0W A;  1Z7M E;  2AYS A;  2NUV A;  3K6W A;  5H8F B;  3H3G A;  1LST A;  1DSN A;  1P1N A;  1POY 1;  1AIV A;  4OEN A;  1QUI A;  1B0L A;  2DE2 A;  4KHZ E;  4JB7 A;  3KZG A;  4TQU Q;  1VFD A;  3E4R A;  5I2N A;  3CIJ A;  4GIZ A;  5L9S A;  4PE5 B;  1PB8 A;  5BUU A;  3FV1 A;  1T0K A;  1MXW A;  4R9G A;  3MP6 A;  1TT1 A;  4G8M A;  1XHY A;  5I2K B;  5BWJ A;  4PP0 A;  3OO7 A;  4ECF A;  3TCG A;  4KI0 E;  1S9T A;  1MXY A;  2RCA A;  4G8N A;  4LVQ A;  1UTB B;  4IO3 A;  2UVI A;  2Y7K A;  1M5F A;  1AOV A;  5M2V A;  4FEC A;  3MAM A;  4UAC A;  4POW A;  4BDO A;  4YKK A;  1MY2 A;  3TYH A;  4ZEC A;  3S2V A;  4OFL A;  3FD3 A;  4AQ4 A;  3K0V A;  4TLM B;  2M8C A;  3UP9 A;  4ND9 A;  5F7V A;  2XX7 A;  3B6T A;  5CRY A;  3W9W A;  3G3F A;  1XVY A;  1D3K A;  1NH7 A;  2PBW A;  1KWH A;  4ESX A;  1DPP A;  5CI5 A;  5FTH A;  4MH5 A;  1H44 A;  3OEM A;  2QS2 A;  4GD5 A;  2ZMB A;  3LSX A;  3QYT A;  4PFY A;  5AA4 A;  1LB9 A;  3IL1 B;  1SI0 A;  3MVY A;  3PMX A;  5CMM A;  1L5T A;  1B5I A;  2DWI A;  3FUZ A;  1FTM A;  4P0G A;  3D4G A;  4GXA A;  2NWJ A;  2W7Y A;  5DYH A;  1O7T A;  3FJM A;  1VSO A;  4Q0C A;  3HST A;  3MQ9 A;  2ZYN A;  5EHM A;  2OWT A;  4AB6 A;  4FAT A;  3PPQ A;  4I62 A;  3TAJ A;  1B0H A;  4HS7 A;  5HBC A;  1RYO A;  4R2F A;  2AIX A;  4ELR A;  4RA1 A;  2XHD A;  4ZZE A;  2F7A A;  2YJP A;  4QFK A;  5ISU A;  2Z8D A;  4NWC A;  3FJ7 A;  4HTG A;  4U21 A;  1BP5 A;  3PU5 A;  3BFU A;  1Y3P A;  2UYE A;  4FED A;  1F9B A;  2XX9 A;  2R6G E;  2F8D A;  3ZKK A;  4JSD A;  2XXY A;  4WED A;  4EF1 A;  4U23 A;  3JYR A;  4YAH X;  5CMK A;  2VGQ A;  4GVO A;  1WDN A;  4IB2 A;  4XKP A;  1MY0 A;  1ZTY A;  1SBP A;  3MVZ A;  4MBP A;  4NF5 A;  4OES A;  5IAI A;  1FW0 A;  3KN3 A;  4EXK A;  3QXM A;  1TFA A;  3Q28 A;  1LLS A;  2I3V A;  3MZ9 A;  1MH4 A;  1D9V A;  4G77 A;  5H8N B;  1A55 A;  3FXQ A;  5TP9 A;  3DEL B;  5FHO A;  1CB6 A;  1PB7 A;  4RYA A;  1B1H A;  4YKJ A;  3IOV A;  3H6U A;  2OCU A;  2R71 A;  3C32 A;  2PT2 A;  4F19 A;  2ZYM A;  4Q5T A;  3ILT B;  3CFL A;  4H5G A;  4YU0 A;  1J1N A;  1SYH A;  5FHM A;  3OD7 A;  1GV8 A;  3MUQ A;  4X9T A;  1JW5 A;  4PFW A;  4DLD A;  1FQE A;  3K00 A;  2DS9 A;  3EHU A;  4X1D A;  4LON B;  3K2D A;  3TKD A;  3H7M A;  3K1P A;  4F29 A;  3PMW A;  2DP8 A;  4H6D A;  3HN0 A;  5K2Y A;  2DE3 A;  1LBB A;  4YB7 A;  1IZ1 A;  3O6I A;  4YMA A;  1RKM A;  1NMU A;  2PX1 A;  5JEI A;  1MPC A;  1XC1 A;  1B9J A;  1A8F A;  4GOT A;  3I6V A;  1JQF A;  3SET A;  2ZNU A;  3UGW A;  4ZEB A;  3MPK A;  3N5L A;  5TU0 A;  4IGT A;  1A40 A;  2QS3 A;  5L9M A;  2PVU A;  1ZLQ A;  1MM7 A;  4IGR A;  3PPP A;  3RY3 A;  2I4B A;  4LP2 B;  3OO8 A;  3O28 A;  3VVE A;  3K4U A;  4F3B A;  4O3A A;  3WAF A;  3FXR A;  2GFE A;  3PPO A;  1DOT A;  4P11 A;  1IUD A;  2OZZ A;  3TTL A;  3TZA A;  1LAF E;  3H6V A;  4NTL A;  4RJZ A;  5DEX B;  3USD A;  2E1S A;  1B40 A;  2F35 A;  1B6H A;  4F3P A;  1JVX A;  4NF8 A;  4I8C A;  5K2X A;  3VV5 A;  2Y7P A;  3U94 A;  2O68 A;  2F34 A;  4F3S A;  4KCD A;  4RK2 A;  2Q9T A;  3SER A;  2H99 A;  1MXV A;  4NMY A;  4NF6 B;  3TTR A;  3RT6 B;  2VP1 A;  3OO6 A;  1N3W A;  4OET A;  3RGY A;  3U8Q A;  3HO7 A;  3I3V A;  2A5S A;  4LQ5 A;  2O7U A;  3OEN A;  4YB5 A;  1H43 A;  2DWA A;  4OXV A;  3IB2 A;  1B5H A;  2HZK A;  3TCF A;  5TPA A;  1ZU0 A;  1R1N A;  1MY1 A;  4DXU A;  3IO4 A;  1FQF A;  2Z23 A;  4GL8 A;  3FVO A;  1NNK A;  3K02 A;  4OQO A;  1NNP A;  1B7Z A;  2REJ A;  2XXH A;  4G2Z A;  2I49 A;  3A09 A;  3C36 A;  3PD9 A;  2LAO A;  3MVW A;  1II5 A;  4DIG A;  2OK2 A;  2Q88 A;  4NF4 B;  4KD5 A;  5JTY B;  2GHB A;  1ATG A;  1ZJL A;  2V93 A;  3N6U A;  5DVJ A;  3P7I A;  3OOA A;  2XD2 A;  3AXF A;  2ANJ A;  2XX8 A;  2X7Q A;  3CG1 A;  1P1O A;  3R26 A;  3SEW A;  2QS4 A;  3T9U A;  1EZ9 A;  2Q89 A;  3VXC A;  1DMB A;  2OLB A;  5HPQ A;  3O66 A;  1EU8 A;  4OTE A;  3IK6 B;  4I1D A;  3ODB A;  3G3K A;  3KSX A;  4F22 A;  4ELP A;  1ZIU A;  2UVG A;  2I0B A;  5ITO A;  1ANF A;  3VE1 B;  4F2Q A;  1I6A A;  5AA1 A;  1B7H A;  3SEX A;  4ELO A;  4BDM A;  3QUJ A;  4GQO A;  1UTH B;  2PMS A;  3MWB A;  4LZ7 A;  3PPR A;  2RF1 A;  1B5J A;  2DQV A;  2DWH A;  2H25 A;  4OWD A;  3IJX B;  4F39 A;  2P1S A;  1IXG A;  3B7D A;  4JDF A;  1HSL A;  2OBG A;  4H67 A;  4XKQ A;  5DEX A;  3BKI B;  3HV1 A;  3T66 A;  2Y84 A;  1VFE A;  4OFJ A;  4MLV A;  1UIV A;  3KSJ A;  2VD2 A;  3H4Z A;  1JVY A;  2RC9 A;  4C1U A;  1IIT A;  2KLF A;  2X26 A;  4EXL A;  1MDP 1;  1USY E;  1LAG E;  3A3U A;  4OVJ A;  1B2H A;  3D4C A;  1Q35 A;  2ABH A;  2I0C A;  4U4X A;  1JW4 A;  1HSE A;  3PV0 E;  3TPA A;  3LBS A;  4R6Y A;  1NNT A;  1NKX A;  3O9P A;  3N26 A;  2CMO A;  4OEV A;  4QHQ A;  4LZ5 A;  3SEU A;  4EQ9 A;  4MFI A;  1EZO A;  2ALU A;  4NF4 A;  5JTY A;  3UOR A;  3LSL A;  1R9Q A;  2B3B A;  3DP4 A;  4H0W A;  1B46 A;  1B3E A;  5H8H B;  5EHS A;  5I84 A;  1XS5 A;  2YLN A;  3C34 A;  2QMW A;  5EYF A;  2OWS A;  3FAT A;  3UA8 A;  3TDJ A;  1LAH E;  2V3T A;  4U1Z A;  1LB8 A;  1UIU A;  4XIG Q;  2DYX A;  4DCX A;  2ZNT A;  3KBR A;  2X7P A;  1B52 A;  3GBB A;  3K6U A;  4F31 B;  1B4H A;  1S50 A;  1SVX B;  5KDT B;  2RC7 A;  4U2R A;  3H6T A;  1R6Z A;  4N07 A;  4IY5 A;  1MQD A;  3EPE A;  1H76 A;  1AMF A;  3TQW A;  4ZE8 A;  5A5X B;  1ZMG A;  2B3F A;  3CFX A;  3PPN A;  3CSG A;  5KCJ A;  3HHF A;  3E13 X;  3U92 A;  4EQB A;  1MG1 A;  2NOO A;  2DOJ A;  3T9X B;  3B6W A;  4RY1 A;  2HZL A;  4ZS9 A;  5KZT A;  1MQI A;  2P2A A;  1XVX A;  1IXH A;  2WKY A;  4ESW A;  3PUV E;  1HSJ A;  3H06 B;  1BLF A;  3SEV A;  3TCH A;  3K1N A;  4PET A;  3C35 A;  3W15 C;  3KFM A;  3K01 A;  1N7X A;  2XXW A;  3CG3 A;  1B3F A;  1N04 A;  3T9H B;  1LCF A;  3UIF A;  5H8F A;  3S4U A;  4PQJ A;  4IO4 A;  1OIB A;  1OQH A;  1EH3 A;  3ILU B;  4QF9 A;  5DVF A;  3IAZ A;  2GHA A;  4H8J A;  2F7C A;  3RT8 A;  5I59 B;  1WVJ A;  1MH3 A;  3OSQ A;  1MXZ A;  2QSX A;  4OFO A;  1LFI A;  4I9D A;  2HAU A;  5I2K A;  5I56 B;  1AL3 A;  2UVJ A;  1GTK A;  4U22 A;  2HFB A;  5AA2 D;  3G7W A;  3KOT A;  2AL4 A;  1UTB A;  3T96 B;  4KR5 A;  4JWO A;  4G8H A;  4IO2 A;  1YAE A;  2XXI A;  2E0S A;  5H8H A;  2FA7 A;  1MDQ A;  3JZJ A;  1JET A;  3Q26 A;  3T93 B;  5CMB A;  1Y1Z A;  1Y4C A;  3FZV A;  3LR1 A;  4GLI A;  4WKM A;  3MVX A;  2XXP A;  4PFT A;  3V8X B;  1SYI A;  4QFN A;  4EF2 A;  3KN8 A;  3TEL A;  1XOC A;  1BKA A;  4C1T A;  1Y1M A;  2FNC A;  2I6E A;  4HCW A;  1QUJ A;  5KDT A;  3IOR A;  1D4N A;  3VVD A;  1QW0 A;  2VD3 A;  1LAX A;  1OVT A;  5I58 B;  3KN7 A;  3MJN A;  3PUX E;  4TOZ A;  4UA8 A;  4Q8R A;  2UXA A;  5B7D A;  2B65 A;  2REG A;  1N7W A;  3K6V A;  1IQ7 A;  4JWY A;  3OXN A;  4M4G A;  4H1X A;  1ELJ A;  3W9V A;  3KJ7 A;  1YCJ A;  1GVC A;  3RNN A;  3M3F A;  2I4C A;  4FEB A;  2DE4 A;  1Y20 A;  1FTL A;  1P1Q A;  1JNF A;  1A7L A;  4QFL A;  1B32 A;  4YIC A;  1QKA A;  4G68 B;  1Y3Q A;  3THI A;  1MY4 A;  4OEU A;  1D9Y A;  2NXO A;  3ZS6 A;  1LGB C;  3M8U A;  3SDF A;  3CSB A;  2DXY A;  1I69 A;  4M1V A;  5L8D A;  1DPE A;  1MS7 A;  3L6H A;  3RN8 A;  5I59 A;  3C9H A;  1US5 A;  2HEU A;  2DXR A;  4RK9 A;  1SW4 A;  1SW1 A;  3A3C A;  2PT1 A;  3IJO B;  4L17 A;  4DXC A;  3M3K A;  4IO6 A;  3IB1 A;  2PYY A;  1NH8 A;  3HHG A;  2QS1 A;  2VOZ A;  3TTN A;  1MM6 A;  2RCB A;  2I3W A;  2RIN A;  1WOD A;  3TQL A;  3FIR A;  3ZKL A;  3H6W A;  4LZ8 A;  4Q30 B;  1DTG A;  3R7X A;  3C31 A;  2XXT A;  4BDR A;  4KCC A;  4KYE A;  4BLA A;  5CC2 A;  2NVU B;  5H8N A;  2XXU A;  1A54 A;  4BDN A;  2P0S A;  1MRP A;  5H8Q B;  2Q2C A;  1BIY A;  4GWO A;  1QUL A;  4XKN A;  3Q25 A;  2F36 A;  2QMX A;  4YKP A;  3VVF A;  3DM0 A;  3TOD A;  3H03 A;  4LA9 A;  3QAX A;  5I58 A;  2RKM A;  2IA4 A;  1N0T A;  2HAV A;  2XXR A;  3S9N C;  3IO6 A;  1B4Z A;  3MW0 A;  3T9V A;  4AB5 A;  4FIM A;  1TWY A;  2Y7W A;  1B1X A;  3S9L C;  1EZP A;  3EQ1 A;  3RTF B;  1Q1K A;  4JSO A;  2Z22 A;  4EUO A;  3V89 B;  5ELV A;  4BDQ A;  1AH5 A;  3KEI A;  4NED A;  4POX A;  4YZZ A;  3IR1 A;  4O3B A;  4HCY A;  3PUY E;  2O1M A;  2HCA A;  2ZYK A;  1SQY A;  1A8E A;  3TTM A;  2IEE A;  4GL0 A;  2GH9 A;  4G68 A;  3RQT A;  2A5T B;  3SES A;  5L9O A;  2DVC A;  1MQJ A;  5I57 B;  4FJP A;  3KGC A;  2F78 A;  1SD3 A;  5AA4 B;  3VXB A;  3OO9 A;  4HW8 A;  5FHN A;  4XTC Q;  4YKI A;  3FV2 A;  2RC8 A;  4KQP A;  4Z0I A;  3GBA A;  1JW1 A;  2QPQ A;  1LCT A;  2DVZ A;  4E0X A;  2Z8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...