1ABQA

Crystal structure of the unliganded abl tyrosine kinase sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
LFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ABL TYROSINE KINASE SRC-HOMOLOGY 3 (SH3) DOMAIN
publication title High-resolution crystal structures of tyrosine kinase SH3 domains complexed with proline-rich peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Kinase
total genus 10
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1abqA00
5I11A 2A28A 3NHNA 2AZSA 2NWMA 1CKAA 1H92A 1K1ZA 4LUEA 2DNUA 1WYXA 2C0TA 1UJYA 2EKHA 2KEAA 1QWFA 2MCNA 2VVKA 3A98A 1UHFA 2QDLA 4RTWA 1VYUA 3U23A 2K6DA 1A0NB 3VS0A 2ESWA 2YT6A 3C0CA 5I22A 2K2MA 2DBKA 3M0QA 2CH4A 1GFDA 1MV0B 5L23A 4DEYA 4E6RA 2KE9A 2D8JA 2LP5A 2F2VA 5EC7A 2DRMA 3I5RA 5IHNA 1YP5A 2RNAA 2KNBB 1M3CA 4K11A 2HEQA 1ZUUA 1JO8A 1UG1A 3O5ZA 4OMOA 3UATA 3I5SA 1Z9ZA 1N5ZA 2OJ2A 3H41A 1BB9A 3UF4A 2DLPA 1BBZA 2GNCA 1YN8A 2HCKA 4JJBA 2EYWA 1W1FA 2KRMA 4J9CA 1OPLA 1UDLA 1X2KA 2FPFA 2KT8A 4HVUA 1FYNA 2J6KA 1WX6A 1CKBA 3PE0A 3EG2A 3EG1A 2LCSA 1ZLMA 2FEIA 2DILA 4RTZA 2M0YA 1AD5A 5GJWB 3M0RA 2K79A 1AZEA 1JEGA 2DL7A 2GQIA 2X3WD 2O2OA 3H0IA 2OAWA 2MIOA 2LQWA 2BTTA 3M0TA 1NEGA 4JZ4A 1X6BA 2ENMA 4HXJA 1S1NA 2J6OA 2KRSA 4F14A 1SRLA 4AFZC 4OMPA 3VS3A 3REBB 2JXBA 4Z89A 1U5SA 2DL4A 1UJ0A 3TVTA 5IH2A 4RTVA 1AWOA 1YWPA 2RQVA 1SPKA 2D1XA 1VYVA 2HSPA 1M3AA 2NUZA 2CT3A 5IXBA 2EPDA 2L3QA 1AWWA 1OEBA 1VA7A 1UFFA 2EVRA 1JQQA 1NG2A 5GJVB 2RF0A 4Y92A 1X6GA 1Z9QA 4J9EA 1PKSA 1AOJA 3VS6A 4CC4B 3TSWA 2KYBA 5IXFA 4FSSA 1PWTA 2DBMA 1OPKA 1VYTA 2J7IA 2JM9A 2EGCA 2YSQA 1E6GA 2FPEA 1PRLC 1NM7A 2FO0A 2RMOA 1X27A 3EHQA 2RQUA 3NPFA 2DM1A 2KXCA 2V1QA 4KRTA 2MOXA 1AVZC 2A36A 1I07A 1QWEA 2W10A 4IIMA 2ECZA 1WXTA 1X43A 1ZUKA 4AFQC 2JW4A 2HBWA 2RPNA 1UHCA 2DX1A 2AK5A 1GFCA 2JMAA 2PNIA 2CSQA 4J9IA 2EYXA 2DJQA 4JZ3A 1EFNA 1JU5C 1PRMC 4OMQA 4AFUC 1TUDA 4JJDA 2K7AA 1J3TA 2K3BA 2EW3A 4J9BA 4Z8AA 1G83A 1KJWA 3NMZC 3RNJA 3H0HA 4ORZA 2RN8A 1B3QA 2JT4A 1GRIA 2BZXA 2VWFA 3VS1A 5FW9A 2L2PA 1W6XA 2DVJA 1KIKA 4AG2C 3GBQA 1ZX6A 1NEBA 1SHGA 2KXDA 2GGRA 2KGTA 2JMCA 3UA7A 4RTUA 2CSIA 1IO6A 4D8DA 1NYGA 2AKKA 2YUNA 1GCQA 2EQIA 3KFVA 2VKNA 2H8HA 4AG1C 2FG0A 2ED0A 2KBTA 2EGEA 1BK2A 2LMJA 2A37A 2AZVA 1X69A 4CC3A 2BZ8A 1YNZA 2L3PA 3I9QA 1PHTA 1Y0MA 2DF6A 1WI7A 2K9GA 2JTEA 1ZUYA 4JJCA 1U3OA 1WIEA 3PVQA 3THKA 1ZSGA 5HCKA 1H3HA 1SEMA 1SHFA 1E6HA 4EIKA 3ZL7C 1T0HA 4CC2A 4OMMA 2X3XD 2CH4W 1GBQA 1QLYA 2RQRA 2GTJA 1E7OA 1NLPC 1X2QA 1AWXA 1QKWA 2L0AA 4RTXA 3UA6A 1UECA 1WXUA 2YUOA 3PVLA 1HD3A 1KFZA 1UUEA 2V1RA 2GTOA 5FWBA 1SRMA 1SSHA 1ARKA 2DE0X 2DL5A 4ESRA 3JV3A 4HVVA 1AEYA 1GBRA 1K4US 2DMOA 2DYBA 2YDLA 4DEXA 2M51A 2ROLA 1TUCA 1PKTA 5IHIA 2ED1A 1AWJA 3VRZA 2CT4A 2SEMA 3M0SA 1BU1A 1JXOA 1UE9A 4RUGA 1T3SA 1QKXA 3R6NA 1WLPB 4LNPA 2O31A 1NYFA 2I0NA 2RQWA 1GCPA 2FRYA 1FMKA 4GBQA 5FWCA 1ABOA 2O9VA 1MV3A 2L3SA 2DRKA 4J9DA 4JPBW 2CUDA 4RTTA 4AFSC 1HSQA 4F17A 2EYYA 3ULRB 1GL5A 1NLOC 2LJ0A 2JS0A 3VS7A 1M3BA 1K9AA 1H8KA 4QT7A 1G2BA 1I1JA 1MUZA 2O88A 1XOVA 2EGAA 2KYMA 1OV3A 2J06A 2OI3A 3QWYA 2D8HA 3FJ5A 2D0NA 1T0JA 1RLPC 1K76A 2O9SA 1GCQC 3EG0A 3EG3A 2KT1A 1TG0A 1JXMA 2KROA 2DL8A 2EYZA 4CC7A 4ZNXA 2LJ1A 2AKLA 4GLMA 3TSZA 4LE9A 3H0FA 2A08A 2KRNA 3REAB 2BZYA 2KR3A 2LZ6B 4WCIA 3QWXX 1UTIA 3SEMA 1QCFA 4OMLA 3EGUA 2DA9A 3VS5A 3CQTA 2LQNA 2CUBA 2XMFA 3VRYA 4IIOA 2YUQA 4M4ZA 1HJDA 1ABQA 3NGPA 2G6FX 1U06A 1WDXA 1ZBJA 1M27C 1WA7A 2PZ1A 1W70A 1RUWA 2LJ3A 2JS2A 3I35A 1K0XA 4A63B 1B07A 4LUDA 1V1CA 3EHRA 3SHWA 1RI9A 2W0ZA 2E5KA 2EBPA 2FPDA 1OOTA 4R0KA 1K0SA 4J9FA 1YWOA 5IHKA 2ROTA 3RBBB 3VS2A 1CSKA 2PTKA 1M8MA 1RLQC 4HCKA 3IQLA 2JM8A 4Z88A 2F2XA 2GBQA 2ABLA 2J6FA 3M0PA 2B86A 4LN2A 3VS4A 1LCKA 1Y57A 1PNJA 4OMNA 2IIMA 2LNHB 1WFWA 3M0UA 4J9GA 1YCSB 4J9HA 2LX7A 4RTYA 2CDTA 2RQTA 4HVWA 4F16A 2C0IA 2HDAA 1M30A 2F2WA 1AZGB 2CREA 1KSWA 2J05A 4D8KA 2P4RA 2SRCA 5ECAA 1T3LA 3LH5A 2FRWA 1UGVA 2DL3A 4X1VA 1WXBA 2YUPA 1I0CA 2C0OA
chains in the Genus database with same CATH superfamily
2M0OA 2A28A 3NHNA 2AZSA 2GFUA 3CCVT 1K73R 2DYIA 2NWMA 1K1ZA 1ZHIA 5IT9E 4O6JA 1WYXA 2C0TA 2VUBA 3A98A 4PFOA 1KC8C 2XD0A 2HZYA 2ESWA 4CI0C 3C0CA 5C0MA 3G7ZA 4A4EA 1R0CB 5D6YA 1TXQA 2E3HA 1WNLA 3O8VA 1HK9A 5A0GA 2V8JA 4M7DG 4E47A 4N4HA 3OYGA 1PG5B 4IUTA 3JRZA 3RKYA 1MMGA 5LJ3g 4E2FB 4PJOB 1KHCA 1WQ7A 1UB4A 1N5ZA 2XI9A 4QQDA 3UF4A 2DLPA 1KQSS 1LVKA 2KRMA 2F5KA 2KT8A 1IHWA 1BKBA 4HA8A 4C8QC 1CKBA 3PE0A 4AT1B 6AT1B 2LCSA 5IN1A 2H3JA 2M0YA 3FEOA 2X3WD 2HBPA 1D0ZA 4C92C 4JZ4A 2ENMA 4HXJA 2J6OA 3RKXA 4F14A 5IAYA 4F7UB 3FDRA 3CC7Q 2GCXA 1YJ9Q 4Z89A 3CCVQ 1MMAA 4M7DF 5KYXA 5IH2A 1YJNA 4RTVA 1VQLA 3CCST 1TSFA 3Q1JA 2HSPA 5HK0A 2NUZA 5AYFA 3CMAA 2L3QA 1BIAA 3RESA 3L2QA 1AWWA 1YCYA 4GLKA 1W2BS 1N6AA 1FWZA 3SWNC 1OX9A 2LCCA 1UFFA 4NL3A 4PJLA 4Y92A 1U8RA 2KYBA 5IXFA 4FSSA 5FU7C 3RUXA 5HY6A 2J7IA 4MDWA 3X28B 1XJWB 1TUGB 1NM7A 3HFOA 3OSSC 3A8OB 5KYWA 2FO0A 3OS0A 4M7DE 3CCJT 3NPFA 1VQ6A 1WJSA 1OX8A 3ZEHA 3MEAA 2A7YA 1AVZC 2A36A 2VV5A 1OQKA 1VQKT 4FYWB 3CMEA 3NTKA 2ECZA 1QCOA 4M75G 3JCMX 1ZUKA 4C8QB 5LJ3e 2JMAA 1RL2A 4FSXA 1NJIU 4EMHA 2DTOA 5GAN5 3ER0A 2QA4T 2WSEE 4M7DD 3L1AA 1D3BB 1I81A 4OB2B 1PRMC 2DD5A 1MMNA 3A1PA 2DKGA 5FRMA 4Z8AA 4BE0A 3RKWA 5I2SA 2EJFA 3H0HA 1DJ7B 4ORZA 3CCSQ 3ZFJA 2BZXA 1VQ8T 2L2PA 4KUIA 1KIKA 3JSCA 1VQPA 1K9MU 4LDUA 2KXDA 2QEXT 2KGTA 2Y4XA 4HCZA 3JCMf 2WSCE 2E12A 3UDCA 1PD1A 5GMKm 4RTUA 2L89A 2CSIA 3EAEA 3R6OA 5GAN4 1BIBA 1QVFP 4BI4A 1FXXA 4D8DA 1NYGA 2YUNA 2E5QA 2H8HA 3X24B 2A0FB 2YWWA 5FU7B 2GF7A 2E6ZA 3V7RA 2A37A 4CC3A 4M7AG 1PSFA 2ZPHB 4OP0A 1TH7A 2XIDA 2X4WA 2K9GA 3CCJQ 2DEUA 5GAN2 2DPPB 3THKA 1ZSGA 1VQKQ 1H3HA 1C6VX 1D0XA 1SEMA 2RI5A 3ZL7C 3L42A 2LC4A 4CC2A 4OMMA 3FLGA 1BI1A 4M75B 3JCMd 2X3XD 2CH4W 2YLCA 1N8RU 3OYHA 2GTJA 2QA4Q 2YLBA 1P92A 3I56Q 3NTHA 2DIGA 3CCRT 2QGGA 2QEXA 3OYMA 4Z02A 2PVGB 1UECA 3OS5A 4C92A 1YIJA 2YUOA 3AT1B 3PVLA 1KFZA 4ATOA 2NUTA 1UUEA 2GTOA 3L2UA 5LJ5f 2LT1A 3HRTA 1ZBXA 1VQ8Q 2DXBA 4M7AF 1D1BA 3E1SA 2QQAA 2M16A 4DEXA 1TUCA 2ATCB 3G6EQ 3G4SA 2QDYB 1PM3A 3SWNA 2YRDA 2SEMA 1BU1A 3P8DA 1Q86U 3CBOA 2O31A 3RR6A 1VQ5Q 3VUZA 4B9XA 1MV3A 1RABB 3DLMA 2DRKA 3OS2A 1B7TA 2HQEA 5LJ5d 1Q81R 1HSQA 2LDMA 2FB7A 1RAGB 4BE2A 4M7AE 5LJ5j 1GL5A 2KK4A 3VS7A 1Q95G 1KHIA 3OYJA 2A3LA 1MUZA 3OS1A 2DD4A 1M1KU 2C06A 2DK3A 1BYMA 5GANg 2JJ9A 2OI3A 3CCLQ 3A8GB 2D8HA 1T0JA 3CCRQ 1RLPC 2ZCFB 3OYEA 1KG1A 4M78F 4M7AD 4JRKA 2KROA 2P0KA 3M59A 4ZNXA 2AKLA 1M90R 1ZSZB 1KQSA 3H0FA 1VQOA 2A08A 2LT4A 5KYYB 2KR3A 4WCIA 2X51A 3C95A 4HKEA 3CCEA 1QCFA 3PIPA 1IXDA 3GF5A 4N4GA 3EGDA 3BDLA 5FLXE 4N0AA 3TQ7P 4PKCC 4QW2A 1O9SA 3VV0A 2AHJB 1FX7A 3VRYA 1QVFS 1K8AU 2DZ9A 1HJDA 3NGPA 1M2VB 3PGGA 4C0ZA 2JUFA 1M27C 5GMKj 4M78E 5LJ5h 2FZKB 2PZ1A 4PNOA 1RUWA 1K73U 2JS2A 4QQ6A 2ZPIB 1JB0E 5KE2A 3TREA 5DY9A 3QZ9B 1V1CA 3PIOA 1K9MR 1W2BA 1Q82U 1OOTA 1K0SA 1N9SA 2OTJT 3BDUA 4M78D 2JM8A 2L3RA 3QYHB 2J6FA 3HTRA 3V8LA 1S72T 4XQ3A 3CCUT 1Y57A 4PJNA 3QO3A 2LNHB 1WFWA 4KGVB 3S3MA 1YCSB 1GXIE 2RQTA 1VQMQ 1M30A 1YHQA 3CD6T 2F2WA 3QUIA 4D8KA 2P4RA 5GANe 1T3LA 4M78A 4MZMA 1WXBA 4ZGJB 5KH6A 1AT1B 3EGXA 5A2QE 5I11A 2PUOB 3HSBA 5HKCA 3QJYA 3OYAA 4M77C 1RACB 4C0DB 1CKAA 1H92A 3LH0A 4CRIA 2DXTA 2EKHA 3LX7A 4EMKA 2MCNA 2VVKA 3VUBA 1EIFA 1ZQ1A 2CP6A 3CPWP 4PL6A 5AT1B 1MV0B 4DEYA 2LP5A 2D8JA 3H6ZA 2KNBB 1M3CA 1VUBA 4DBFA 1F1BB 1N8RC 2NUPA 3QHSA 1B34A 1ZUUA 1JO8A 1PC0A 1UG1A 3ZBDA 3UATA 4MDXA 2OJ2A 1QCNA 1Q86R 2LVMA 1S72Q 2BKDN 5FROA 1NBEB 2EYWA 2CP5A 3CBMA 4J9CA 4DBRA 4HVUA 1TOVA 3SDZA 3EG1A 3CD6Q 1ZLMA 1IB8A 2RH2A 2EQMA 4RTZA 1VQ7T 1AD5A 3M0RA 2VXEA 2DL7A 3RIRA 2GQIA 2MWPA 3H0IA 1PD0A 3QSUA 1UEBA 2KY9A 1RAAB 1X6BA 1M1KR 4AFZC 4OMPA 5CVIA 2JXBA 2QI2A 4WTOB 1YWPA 4PJMA 1VYVA 4PJOC 1Q7YR 5GMKe 1OEBA 4FYVB 2EYQA 4BDZA 2EVRA 1JQQA 1W4SA 4NL2A 1NG2A 2RF0A 4OB0B 1X6GA 4J9EA 3OBWA 2CZ7B 4CC4B 4JRPA 2E1HA 5DLOA 3CCQA 2XKOC 3CC2A 2QTVA 1OPKA 3HHTB 2BE7D 5GMKl 2HL5C 1E6GA 1PRLC 2K5FA 3C12A 2HQXA 4C5HA 4C5EA 1X01A 2V1QA 5LJ3d 3CCMA 1QWEA 2W10A 4OMFB 2HBWA 4XTVA 1VQ7Q 1KD1C 4J9IA 1YJWT 2EYXA 2DJQA 4JZ3A 1YBYA 1Q82R 3EFRA 4ZGEB 1VQ4T 1G3SA 5GAOq 2HAXA 4OMQA 1Y7XA 3J81E 1AHJB 4RCBA 1J3TA 5D7UA 5GAMg 2EW3A 4J9BA 2QXFA 1G83A 3NMZC 1YJNT 1VQLT 4X9DA 3VYGA 1Y07A 2HSEB 2OTLQ 4XTXA 1GRIA 4RG2A 4FYXB 3OYKA 2DVJA 3CMAT 5DLQE 1M8VA 4PFZA 1SHGA 3AHUA 3LLRA 1TWBA 3UA7A 2DO3A 2DAQA 1IZ6A 2L5QA 2RD1A 1IGQA 3CPWS 3JCMQ 5GAN6 3EFOB 1OZ2A 2CGHA 1UGQB 2Y90A 1GCQA 1PSEA 2DVEA 3M4YA 2RJCA 2FG0A 2ED0A 2KBTA 5KYWB 3EG9A 2LMJA 2AZVA 2BZ8A 1YJWA 1PHTA 5LJ3h 3EH1A 1WI7A 1VQ6T 1IHVA 3MP8A 1VQ4A 1U3OA 2V8KA 3CC7A 2KSSA 1YJ9A 1SF9A 5HCKA 3CMET 2HQHA 3URGA 1SHFA 5D6XA 4X34A 5L8RE 4DBQA 4J83A 2E3IA 3WVEB 2RHIA 2CP7A 2PU9B 1R8OB 1QLYA 1E7OA 4C92G 1Q81U 2XG8D 5CIUA 1AWXA 1KQ1A 2L0AA 3M54A 1WQWA 3S3OA 3OY9A 3ME9A 1RAFB 1HD3A 4ZGDB 3HP9A 1M9SA 1YJNQ 1VQLQ 5CKHA 3A8LB 4EDUA 1ARKA 1WHHA 1N9RA 3N5BB 4ESRA 4M7DB 3JV3A 2E10A 4HVVA 4Q5WA 1VQPT 1K4US 2ZZDA 3L2VA 1QVGP 2HNIA 2ROLA 2CP3A 2VGNA 1PKTA 2EJ9A 4BB7A 1M90U 4C8QF 2CT4A 2XHCA 5GAMe 3CBPA 3M0SA 2HD0A 2HL3A 1UE9A 3PMTA 2EWNA 4M75C 3QXEB 1WLPB 2FZGB 2KQWA 1NYFA 2B8AA 2I0NA 4C92F 5CK9A 4GBQA 4IUVA 5FWCA 2O9VA 4BI3A 2G3RA 4J9DA 1VQ6Q 2CUDA 4AFSC 1Y71A 4F17A 2CS7A 3OW2P 3CMEQ 3ULRB 4F7UA 1M3BA 4QT7A 2MYSA 1G2BA 3G1JA 1I1JA 1XOVA 2JZ2A 4C8QE 1WJRA 4KULA 2J06A 2R57A 1K76A 4XU3A 4O5VA 1YIJT 2KT1A 5EG2A 1PCXA 2DL8A 2EYZA 4C92E 2LJ1A 3CXCP 4IKFA 4C8QD 2O4XB 1M5Q1 3REAB 4KH0B 1WHGA 4LDWA 1OULA 1VQPQ 1WHJA 3TEEA 3QWXX 4FIBA 3SEMA 3M55A 3OYIA 2DTHA 4WF2A 3EGUA 4ZN1A 3G4ST 4E7KA 1H641 1NZ9A 4C92D 4RMOA 2CP2A 3H8ZA 2XMFA 4PJJA 4J6YA 2DJZA 2QASA 4IIOA 1YITA 3MCAB 5FRNA 1ABQA 2K57A 4C8QA 4JRQA 1U06A 1UGRB 4OB1B 5KCOA 1WA7A 3I56A 1OU8A 4A4KA 1Y96B 4RKUE 1B07A 4C0GA 1D3BA 1KK7A 4LUDA 3OYNA 3EHRA 3SHWA 1QMCA 4DQ2A 5HK3A 3KUFA 2E5KA 4A4HA 4B6MA 2EBPA 4J6WA 2FPDA 4NS5A 4R0KA 4OVAA 1I5OB 1ZSZC 5IHKA 1EZZB 2PTKA 1RLQC 1MHNA 3UWNA 4FW1A 4XK8E 1JJ2P 2B86A 3QZ5B 3VS4A 2X4JA 2LQ8A 3G6EA 1FMVA 4OMNA 4F04B 2QEXQ 1IGUA 3M0UA 4J9GA 2L8DA 2XDPA 4M78G 5GANd 3OSVA 2HDAA 2M1HA 2EQUA 1VQOT 9ATCB 1SG5A 1VQ9A 1VQ5A 2H3EB 3LH5A 2FRWA 4ELYC 1UGVA 1SSFA 3CCET 1WPYA 1OZ3A 3JCMg 3J7AF 4MMLA 2C0OA 4M7AB 1QVGS 2E65A 1C1AA 4AMCA 4LUEA 2DNUA 2LX9A 2ZAEA 3L2ZA 1UJYA 3X20B 2MF2A 2RM4A 3A8MB 4IURA 1UHFA 2P84A 4HCCA 2QDLA 4RTWA 1NPRA 2DERA 3LWIA 2K6DA 3CCLA 4M75A 3VS0A 2HKNA 2YT6A 5J26A 5I22A 3M0QA 2DBKA 4OF1A 2CH4A 4JUVA 3RMSA 3BE3A 4HT8A 3S6WA 3LW5E 5CAIA 3RERA 3MEVA 2KE9A 4HCBA 4J8OA 1Q7YU 2E41A 3I5RA 3OW2S 2RNAA 4K11A 2RHZA 3MHXA 3O5ZA 3CPWA 2YRVA 2XDDA 2IVWA 2WACA 3H41A 1MGQA 5GANh 3HRUA 4JJBA 4PLIA 3VKIA 1OPLA 1X2KA 4C0DC 3QPHA 4FM4B 1JRIA 2PVDB 2J6KA 2AIRB 1YHQT 2DXUA 5LJ5g 2FEIA 2DILA 1VQOQ 2MI6A 3CXCS 1JEGA 1KC8U 2O2OA 2OAWA 1M90C 2MIOA 3CCEQ 2VYTA 2LQWA 2BTTA 3M0TA 2FZCB 1S1NA 1MMDA 3VS3A 3REBB 2YXYA 3I55A 3GOXA 2DL4A 1YI2A 3OMCA 2P4TA 1SPKA 2D1XA 1BCOA 3QDFA 2Z0WA 1NJIC 1RI0A 5IXBA 2EPDA 3INZA 4TVRA 3OB9A 1VA7A 3JCMe 3X26B 3JCMJ 3CC4A 1O75A 2QYZA 3VS6A 1C0MA 8ATCB 1HYOA 5KYUB 1OYXA 1PWTA 2VASA 2DBMA 4LD9K 3NFCA 1YFNA 2KDSA 2GFAA 1K9MC 2YSQA 2DEQA 4DBHA 1WHMA 3FC3A 4C0FA 2FVUA 3EHQA 1VQNA 2RQUA 5KYYA 1JJ2S 2DM1A 2ZPEB 2JNGA 4L5GA 2K3YA 4IIMA 2MK5A 3SFMA 1WXTA 2BUDA 4AFQC 2JW4A 4E7SA 1YHQQ 2RPNA 2DX1A 2AK5A 3LWHA 2PNIA 3QBYA 3GNGA 5GAN3 1JU5C 3BY7A 4EPCA 3GIBA 2IG0A 2K3BA 1KJWA 4VUBA 4ZN3A 4JLIA 3QDRB 5KYNA 5J39A 2RN8A 5LJ5e 4J5YA 2JT4A 5DM7R 2VWFA 2X9HA 5KCHA 2OTJQ 5FW9A 3L2WA 4NOYA 3G71A 2D9TA 1ZX6A 2GGRA 3JCMb 3CCUQ 3A5ZB 2K4YA 1G3WA 2EQIA 3SD4A 3CCQT 2X35A 3CC2T 1M1GA 2RK1A 5D6WA 2RJEA 1IRXA 2EGEA 1BK2A 3A8HB 1MNEA 3M56A 1X69A 1G3YA 2QGFB 1Y0MA 2DF6A 3OA6A 2X4XA 1NE8A 1I5LA 4M77F 1ZUYA 2JTEA 2V8IA 4JJCA 3F70A 2RJDA 3CCMT 1XQHA 1I8FA 2AT1B 1Q86C 1IREB 1TS9A 2QQRA 4KGXB 5LJ3f 1R77A 3LGFA 4BI8B 1GBQA 2RQRA 1M1FA 2PQWA 4FL6A 1NLPC 3HPWA 3JCMW 4RTXA 2P0QA 3FIFA 2CP0A 3VJPA 2R5AA 1LNXA 2RJFA 1WXUA 4PLLA 2JOYA 2ZPBB 1V76A 1WZOA 3QG1A 1SRMA 4MZPA 2DE0X 2DL5A 1M1KC 2K5LA 4M77E 1GBRA 2DMOA 2DYBA 2M51A 3PT9A 5A0LA 5IHIA 2K2VA 1UGSB 3VRZA 4BY6C 2IPOB 3P8HA 2ZPFB 1Q7YC 1KC8R 4QVZA 3M53A 4ELZC 1JXOA 4M77D 5LJ3j 1T3SA 3R6NA 4LNPA 1QVGA 5KE3A 2QQBA 1UGPB 1GCPA 2FRYA 3GNFB 2CKKA 2VC8A 1ABOA 4E7ZA 4IUPA 4F7UG 2L3SA 4DOWA 4XTWA 4JPBW 2RHYA 4RTTA 1OI1A 3CC7T 4GY5A 5KYXB 1OU9A 1YJ9T 2MMPA 4LDVA 3CCMQ 5CKFA 3SB2A 1K8AC 4PJOF 1NLOC 2OTLA 2JS0A 1K9AA 3MPUB 1H8KA 4M77A 1XNIA 4M7DC 3MEWA 1BCMA 2EQJA 2RI3A 4A53A 3JB9F 2KYMA 4XU0A 1K73C 3JB9H 4J7FA 3VYHB 1U1SA 3FJ5A 4MMKA 3OW2A 4FT2A 2D0QB 2O9SA 3LGLA 3TCJA 3EG3A 1JXMA 2DIQA 4CC7A 3M4GA 1Q82C 1NPPA 2CYZB 3TSZA 5GAMh 4LE9A 2CZ1B 3V7CA 5CQXA 1RADB 2KRNA 3QKJA 3NTIA 2LZ6B 4F7UF 4ZTFA 3MEUA 1QVFA 4PJOE 3VS5A 4BDYA 3PTAA 4BY6B 3CQTA 3CXCA 2LQNA 4C8QG 4JRIA 3CCVA 4MZTA 2MWOA 2YUQA 2BE9B 4DOVA 2G6FX 1WDXA 2RA2A 4E7LA 5FU6C 2NYSA 1YJWQ 5GAOr 4PJOD 5CQYA 1QW1A 2CZ0B 2LJ3A 4A63B 1VQ4Q 2V26A 2JTFA 3BFMA 3JB9D 3WVDB 1QP3A 2W0ZA 2RB6A 1LJOA 4Y91A 3OQ5A 2MAMA 2LTOA 4F7UE 1YWOA 3D7SB 3RBBB 3VS2A 4LXCA 1CSKA 3LYIA 1M8MA 4HCKA 3E9FA 2ABLA 2KAFA 4LN2A 3CMAQ 5CR2A 4PJOA 1PNJA 2DETA 2IIMA 3MJXA 3MO8A 2JTMA 4RTYA 3T9NA 2CDTA 4A4FA 3CEYA 4XU2A 2HMAA 2M9UA 3EFOA 2CREA 2O01E 1JJ2A 4X9CA 4IUQA 4E7HA 2Y4YA 3OMGA 3CPFA 2SRCA 3QYGB 5GAOm 3P8BB 4L6V5 3ASKA 2DL3A 1FMWA 2YUPA 1I0CA 2VB6A 3KXTA 4FT4A 4YTLA 1G3TA 3HL8A 1YITT 3CCSA 3JCMP 2QK0A 3M57A 2KEAA 1QWFA 2FL7A 1TU0B 5GAN7 1VYUA 1ZA2B 3U23A 3JAME 3I56T 1A0NB 5FU6B 2K2MA 4OB3B 3PNWC 4C92B 3V7SA 1GFDA 4JDSA 1VIEA 1D09B 2NUTB 4P5NA 2XU8A 4R55A 4XU1A 5CKEA 5L23A 4E6RA 5EC7A 3FRNA 3V8JA 2F2VA 5A0DA 2DRMA 5IHNA 1YP5A 2HEQA 1D1CA 1X6OA 4FU6A 4UC4A 4OMOA 3I5SA 4BUGA 1Z9ZA 1KQ2A 4M7DA 1BI0A 3E2UA 4N0AC 1BB9A 3SWNB 3G6ET 1BBZA 3EH2A 2GNCA 4M7AC 1YN8A 3CCJA 2HCKA 3OBYA 2DZCA 1W1FA 4RG8A 2R5MA 4A4GA 1UDLA 2FPFA 4QVDA 1BI3A 2I2LA 4M75F 1VQKA 1FYNA 1WX6A 4J7IA 3EG2A 2EQKA 1QP2A 4XTZA 3QIIA 1VQ9T 1VQ5T 5GJWB 4QKUA 2K79A 1AZEA 1MNDA 5GANf 4PK4A 2QA4A 1M2OA 2E4HA 4RCCA 4XTYA 1X75C 5GAOp 1NEGA 1WHLA 2KRSA 1SRLA 4OGCA 2F1LA 1U5SA 2RI2A 1UJ0A 3TVTA 4LDXA 1AWOA 2RQVA 1YITQ 2JVVA 2D6FA 2EAYA 1M3AA 3RMQA 2DXCA 1VQ8A 2CT3A 2EJGA 3CCLT 2BIVA 4KBMB 4M75E 4ANJA 1G5VA 2COWA 3GLXA 5GJVB 5I2MA 1TTHB 5GAN8 1Z9QA 1PKSA 4A54A 3S3NA 1AOJA 3TSWA 2WSFE 1YIJQ 4XAXB 4M78C 2F69A 1VYTA 2OAUA 5GANj 2JM9A 3OYLA 2YHTA 4M75D 2EGCA 3GPLA 2O4XA 2FPEA 3OYCA 2HKQB 3EGDB 3C4SA 2RMOA 3J80E 1X27A 2M02A 4Y28E 1JBMA 2KXCA 3MP6A 4KRTA 3G4SQ 2MOXA 1I07A 4EMKC 2ZGWA 1X43A 3OYBA 1UHCA 1VIFA 1GFCA 4JJNK 1VQ9Q 3FJPA 2CSQA 8AT1B 3PFSA 2KI7A 3JCMV 1EFNA 2FYKA 3EFSA 3CCRA 1ACMB 3HFNA 4AFUC 1N27A 1TUDA 1HXDA 4JJDA 2K7AA 3OYDA 1Y96A 3V8KA 3JCMh 5LL6S 3I55T 4FW2A 3RNJA 1YI2T 2F5TX 2XDBA 4OGEA 1B3QA 3HRSA 4E7IA 1SKUB 3VS1A 1Q81C 1W6XA 4XTUA 4AG2C 2K5IA 3GBQA 1NEBA 3CC4T 2E64A 2JMCA 2KMTA 1IO6A 1VQMT 2AKKA 1I4K1 4R56A 3KFVA 1LOJA 2VKNA 4AG1C 1WJQA 4M78B 2E70A 3FB9A 2XICA 1KD1U 1YNZA 2L3PA 2QG9B 3EGXB 3I9QA 2YRCA 1VQNT 4JS5A 5CKDA 1NJIR 1WIEA 3PVQA 1BI2A 3M58A 4M7AA 2PUKB 1QQJA 2P0PA 2JN0A 2QQ9A 1E6HA 4EIKA 1EX4A 4EMKB 2LRQA 3HKSA 1T0HA 2DFUA 4C5GA 1H3ZA 2MPXC 2LQKA 3UT1A 4L59A 1X2QA 1QKWA 4FYYB 2RK2A 2RO0A 4B9WA 3E19A 3UA6A 3DLLA 2LCLA 2RHUA 3MP1A 1XTDA 3I55Q 5CCAA 2QQSA 2COYA 2V1RA 2EFIA 1WHKA 2NUPB 5FWBA 1YI2Q 1VQMA 1B34B 2QAZA 1D0YA 1SSHA 2FHDA 2XK0A 1G8XA 2X4YA 4BD3A 2E6NA 1QVPA 2LNVA 3DB4A 1AEYA 3G71T 1ZSZA 2KVQG 2YDLA 3CC4Q 5J3BA 2ED1A 1AWJA 4KUDK 3VU3C 4ME7A 3MKDA 2OX7A 4BACA 4RUGA 1QKXA 5M9OA 3JB9I 1RAEB 4LD6A 2RQWA 3BW1A 1FMKA 3JCMc 3QJ6A 1M2VA 1VQNQ 4JS4A 4M77G 1N8RR 5GMKh 2EYYA 2EIFA 4J6XA 5I21A 2NLUA 2LJ0A 2VXFA 1R0BG 4KH1B 4QQGA 1V29B 2OTJA 2O88A 2PVOB 4II1A 2EGAA 4EMGA 1OV3A 1KQSP 3QWYA 3M9QA 2D0NA 1S72A 3CCUA 1GCQC 3EG0A 3TU4K 1VOMA 2QTXA 3GP8A 1TG0A 1RAIB 2R58A 4GLMA 3CD6A 4FCYA 5KYUA 1ZA1B 4DA4A 2BZYA 3DKMA 3G71Q 3META 3L2RA 1UTIA 2DTIA 2GQVA 3M5AA 4LDYA 4OMLA 3JB9J 2RHXA 2DA9A 3C94A 4V2SA 2ZPGB 4N4IA 2CUBA 5GAMf 5GAOl 3PMIA 3X25B 4M4ZA 1D1AA 1W2BP 5CKBA 3H9NA 1U1TA 1ZBJA 5C6SA 3UPUA 1W70A 7AT1B 3I35A 1K0XA 2COZA 2EKOA 5CO7A 2CZ6B 4IUUA 3E9GA 4M77B 1RI9A 4E7JA 2OTLT 4JLGA 4PJOG 4J9FA 2ROTA 4PFPA 3IQLA 4Z88A 2F2XA 2GBQA 3WXMB 3DB3A 3M0PA 3JB9G 1M4ZA 5GAMd 2VGMA 1LPLA 4C5IA 2K3XA 1LCKA 4D6WA 3OYFA 4KT0E 5GAMj 3OYYA 1KD1R 4J9HA 2LX7A 4BE1A 1WGSA 4QVCA 4HVWA 4KGZB 4F16A 2C0IA 3EG9B 4HT9A 3CCQQ 5GAOn 3CC2Q 3KBGA 1AZGB 1KSWA 2J05A 5GMKi 1VQ7A 1RAHB 5ECAA 4ZTJA 3RDVA 4X1VA 1K8AR
chains in the Genus database with same CATH topology
5I11A 2A28A 3NHNA 2AZSA 2NWMA 1CKAA 1H92A 1K1ZA 4LUEA 2DNUA 1WYXA 2C0TA 1UJYA 2EKHA 2KEAA 1QWFA 2MCNA 2VVKA 3A98A 1UHFA 2QDLA 4RTWA 1VYUA 3U23A 2K6DA 1A0NB 3VS0A 2ESWA 2YT6A 3C0CA 5I22A 2K2MA 2DBKA 3M0QA 2CH4A 1GFDA 1MV0B 5L23A 4DEYA 4E6RA 2KE9A 2D8JA 2LP5A 2F2VA 5EC7A 2DRMA 3I5RA 5IHNA 1YP5A 2RNAA 2KNBB 1M3CA 4K11A 2HEQA 1ZUUA 1JO8A 1UG1A 3O5ZA 4OMOA 3UATA 3I5SA 1Z9ZA 1N5ZA 2OJ2A 3H41A 1BB9A 3UF4A 2DLPA 1BBZA 2GNCA 1YN8A 2HCKA 4JJBA 2EYWA 1W1FA 2KRMA 4J9CA 1OPLA 1UDLA 1X2KA 2FPFA 2KT8A 4HVUA 1FYNA 2J6KA 1WX6A 1CKBA 3PE0A 3EG2A 3EG1A 2LCSA 1ZLMA 2FEIA 2DILA 4RTZA 2M0YA 1AD5A 5GJWB 3M0RA 2K79A 1AZEA 1JEGA 2DL7A 2GQIA 2X3WD 2O2OA 3H0IA 2OAWA 2MIOA 2LQWA 2BTTA 3M0TA 1NEGA 4JZ4A 1X6BA 2ENMA 4HXJA 1S1NA 2J6OA 2KRSA 4F14A 1SRLA 4AFZC 4OMPA 3VS3A 3REBB 2JXBA 4Z89A 1U5SA 2DL4A 1UJ0A 3TVTA 5IH2A 4RTVA 1AWOA 1YWPA 2RQVA 1SPKA 2D1XA 1VYVA 2HSPA 1M3AA 2NUZA 2CT3A 5IXBA 2EPDA 2L3QA 1AWWA 1OEBA 1VA7A 1UFFA 2EVRA 1JQQA 1NG2A 5GJVB 2RF0A 4Y92A 1X6GA 1Z9QA 4J9EA 1PKSA 1AOJA 3VS6A 4CC4B 3TSWA 2KYBA 5IXFA 4FSSA 1PWTA 2DBMA 1OPKA 1VYTA 2J7IA 2JM9A 2EGCA 2YSQA 1E6GA 2FPEA 1PRLC 1NM7A 2FO0A 2RMOA 1X27A 3EHQA 2RQUA 3NPFA 2DM1A 2KXCA 2V1QA 4KRTA 2MOXA 1AVZC 2A36A 1I07A 1QWEA 2W10A 4IIMA 2ECZA 1WXTA 1X43A 1ZUKA 4AFQC 2JW4A 2HBWA 2RPNA 1UHCA 2DX1A 2AK5A 1GFCA 2JMAA 2PNIA 2CSQA 4J9IA 2EYXA 2DJQA 4JZ3A 1EFNA 1JU5C 1PRMC 4OMQA 4AFUC 1TUDA 4JJDA 2K7AA 1J3TA 2K3BA 2EW3A 4J9BA 4Z8AA 1G83A 1KJWA 3NMZC 3RNJA 3H0HA 4ORZA 2RN8A 1B3QA 2JT4A 1GRIA 2BZXA 2VWFA 3VS1A 5FW9A 2L2PA 1W6XA 2DVJA 1KIKA 4AG2C 3GBQA 1ZX6A 1NEBA 1SHGA 2KXDA 2GGRA 2KGTA 2JMCA 3UA7A 4RTUA 2CSIA 1IO6A 4D8DA 1NYGA 2AKKA 2YUNA 1GCQA 2EQIA 3KFVA 2VKNA 2H8HA 4AG1C 2FG0A 2ED0A 2KBTA 2EGEA 1BK2A 2LMJA 2A37A 2AZVA 1X69A 4CC3A 2BZ8A 1YNZA 2L3PA 3I9QA 1PHTA 1Y0MA 2DF6A 1WI7A 2K9GA 2JTEA 1ZUYA 4JJCA 1U3OA 1WIEA 3PVQA 3THKA 1ZSGA 5HCKA 1H3HA 1SEMA 1SHFA 1E6HA 4EIKA 3ZL7C 1T0HA 4CC2A 4OMMA 2X3XD 2CH4W 1GBQA 1QLYA 2RQRA 2GTJA 1E7OA 1NLPC 1X2QA 1AWXA 1QKWA 2L0AA 4RTXA 3UA6A 1UECA 1WXUA 2YUOA 3PVLA 1HD3A 1KFZA 1UUEA 2V1RA 2GTOA 5FWBA 1SRMA 1SSHA 1ARKA 2DE0X 2DL5A 4ESRA 3JV3A 4HVVA 1AEYA 1GBRA 1K4US 2DMOA 2DYBA 2YDLA 4DEXA 2M51A 2ROLA 1TUCA 1PKTA 5IHIA 2ED1A 1AWJA 3VRZA 2CT4A 2SEMA 3M0SA 1BU1A 1JXOA 1UE9A 4RUGA 1T3SA 1QKXA 3R6NA 1WLPB 4LNPA 2O31A 1NYFA 2I0NA 2RQWA 1GCPA 2FRYA 1FMKA 4GBQA 5FWCA 1ABOA 2O9VA 1MV3A 2L3SA 2DRKA 4J9DA 4JPBW 2CUDA 4RTTA 4AFSC 1HSQA 4F17A 2EYYA 3ULRB 1GL5A 1NLOC 2LJ0A 2JS0A 3VS7A 1M3BA 1K9AA 1H8KA 4QT7A 1G2BA 1I1JA 1MUZA 2O88A 1XOVA 2EGAA 2KYMA 1OV3A 2J06A 2OI3A 3QWYA 2D8HA 3FJ5A 2D0NA 1T0JA 1RLPC 1K76A 2O9SA 1GCQC 3EG0A 3EG3A 2KT1A 1TG0A 1JXMA 2KROA 2DL8A 2EYZA 4CC7A 4ZNXA 2LJ1A 2AKLA 4GLMA 3TSZA 4LE9A 3H0FA 2A08A 2KRNA 3REAB 2BZYA 2KR3A 2LZ6B 4WCIA 3QWXX 1UTIA 3SEMA 1QCFA 4OMLA 3EGUA 2DA9A 3VS5A 3CQTA 2LQNA 2CUBA 2XMFA 3VRYA 4IIOA 2YUQA 4M4ZA 1HJDA 1ABQA 3NGPA 2G6FX 1U06A 1WDXA 1ZBJA 1M27C 1WA7A 2PZ1A 1W70A 1RUWA 2LJ3A 2JS2A 3I35A 1K0XA 4A63B 1B07A 4LUDA 1V1CA 3EHRA 3SHWA 1RI9A 2W0ZA 2E5KA 2EBPA 2FPDA 1OOTA 4R0KA 1K0SA 4J9FA 1YWOA 5IHKA 2ROTA 3RBBB 3VS2A 1CSKA 2PTKA 1M8MA 1RLQC 4HCKA 3IQLA 2JM8A 4Z88A 2F2XA 2GBQA 2ABLA 2J6FA 3M0PA 2B86A 4LN2A 3VS4A 1LCKA 1Y57A 1PNJA 4OMNA 2IIMA 2LNHB 1WFWA 3M0UA 4J9GA 1YCSB 4J9HA 2LX7A 4RTYA 2CDTA 2RQTA 4HVWA 4F16A 2C0IA 2HDAA 1M30A 2F2WA 1AZGB 2CREA 1KSWA 2J05A 4D8KA 2P4RA 2SRCA 5ECAA 1T3LA 3LH5A 2FRWA 1UGVA 2DL3A 4X1VA 1WXBA 2YUPA 1I0CA 2C0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I11 A;  2A28 A;  3NHN A;  2AZS A;  2NWM A;  1CKA A;  1H92 A;  1K1Z A;  4LUE A;  2DNU A;  1WYX A;  2C0T A;  1UJY A;  2EKH A;  2KEA A;  1QWF A;  2MCN A;  2VVK A;  3A98 A;  1UHF A;  2QDL A;  4RTW A;  1VYU A;  3U23 A;  2K6D A;  1A0N B;  3VS0 A;  2ESW A;  2YT6 A;  3C0C A;  5I22 A;  2K2M A;  2DBK A;  3M0Q A;  2CH4 A;  1GFD A;  1MV0 B;  5L23 A;  4DEY A;  4E6R A;  2KE9 A;  2D8J A;  2LP5 A;  2F2V A;  5EC7 A;  2DRM A;  3I5R A;  5IHN A;  1YP5 A;  2RNA A;  2KNB B;  1M3C A;  4K11 A;  2HEQ A;  1ZUU A;  1JO8 A;  1UG1 A;  3O5Z A;  4OMO A;  3UAT A;  3I5S A;  1Z9Z A;  1N5Z A;  2OJ2 A;  3H41 A;  1BB9 A;  3UF4 A;  2DLP A;  1BBZ A;  2GNC A;  1YN8 A;  2HCK A;  4JJB A;  2EYW A;  1W1F A;  2KRM A;  4J9C A;  1OPL A;  1UDL A;  1X2K A;  2FPF A;  2KT8 A;  4HVU A;  1FYN A;  2J6K A;  1WX6 A;  1CKB A;  3PE0 A;  3EG2 A;  3EG1 A;  2LCS A;  1ZLM A;  2FEI A;  2DIL A;  4RTZ A;  2M0Y A;  1AD5 A;  5GJW B;  3M0R A;  2K79 A;  1AZE A;  1JEG A;  2DL7 A;  2GQI A;  2X3W D;  2O2O A;  3H0I A;  2OAW A;  2MIO A;  2LQW A;  2BTT A;  3M0T A;  1NEG A;  4JZ4 A;  1X6B A;  2ENM A;  4HXJ A;  1S1N A;  2J6O A;  2KRS A;  4F14 A;  1SRL A;  4AFZ C;  4OMP A;  3VS3 A;  3REB B;  2JXB A;  4Z89 A;  1U5S A;  2DL4 A;  1UJ0 A;  3TVT A;  5IH2 A;  4RTV A;  1AWO A;  1YWP A;  2RQV A;  1SPK A;  2D1X A;  1VYV A;  2HSP A;  1M3A A;  2NUZ A;  2CT3 A;  5IXB A;  2EPD A;  2L3Q A;  1AWW A;  1OEB A;  1VA7 A;  1UFF A;  2EVR A;  1JQQ A;  1NG2 A;  5GJV B;  2RF0 A;  4Y92 A;  1X6G A;  1Z9Q A;  4J9E A;  1PKS A;  1AOJ A;  3VS6 A;  4CC4 B;  3TSW A;  2KYB A;  5IXF A;  4FSS A;  1PWT A;  2DBM A;  1OPK A;  1VYT A;  2J7I A;  2JM9 A;  2EGC A;  2YSQ A;  1E6G A;  2FPE A;  1PRL C;  1NM7 A;  2FO0 A;  2RMO A;  1X27 A;  3EHQ A;  2RQU A;  3NPF A;  2DM1 A;  2KXC A;  2V1Q A;  4KRT A;  2MOX A;  1AVZ C;  2A36 A;  1I07 A;  1QWE A;  2W10 A;  4IIM A;  2ECZ A;  1WXT A;  1X43 A;  1ZUK A;  4AFQ C;  2JW4 A;  2HBW A;  2RPN A;  1UHC A;  2DX1 A;  2AK5 A;  1GFC A;  2JMA A;  2PNI A;  2CSQ A;  4J9I A;  2EYX A;  2DJQ A;  4JZ3 A;  1EFN A;  1JU5 C;  1PRM C;  4OMQ A;  4AFU C;  1TUD A;  4JJD A;  2K7A A;  1J3T A;  2K3B A;  2EW3 A;  4J9B A;  4Z8A A;  1G83 A;  1KJW A;  3NMZ C;  3RNJ A;  3H0H A;  4ORZ A;  2RN8 A;  1B3Q A;  2JT4 A;  1GRI A;  2BZX A;  2VWF A;  3VS1 A;  5FW9 A;  2L2P A;  1W6X A;  2DVJ A;  1KIK A;  4AG2 C;  3GBQ A;  1ZX6 A;  1NEB A;  1SHG A;  2KXD A;  2GGR A;  2KGT A;  2JMC A;  3UA7 A;  4RTU A;  2CSI A;  1IO6 A;  4D8D A;  1NYG A;  2AKK A;  2YUN A;  1GCQ A;  2EQI A;  3KFV A;  2VKN A;  2H8H A;  4AG1 C;  2FG0 A;  2ED0 A;  2KBT A;  2EGE A;  1BK2 A;  2LMJ A;  2A37 A;  2AZV A;  1X69 A;  4CC3 A;  2BZ8 A;  1YNZ A;  2L3P A;  3I9Q A;  1PHT A;  1Y0M A;  2DF6 A;  1WI7 A;  2K9G A;  2JTE A;  1ZUY A;  4JJC A;  1U3O A;  1WIE A;  3PVQ A;  3THK A;  1ZSG A;  5HCK A;  1H3H A;  1SEM A;  1SHF A;  1E6H A;  4EIK A;  3ZL7 C;  1T0H A;  4CC2 A;  4OMM A;  2X3X D;  2CH4 W;  1GBQ A;  1QLY A;  2RQR A;  2GTJ A;  1E7O A;  1NLP C;  1X2Q A;  1AWX A;  1QKW A;  2L0A A;  4RTX A;  3UA6 A;  1UEC A;  1WXU A;  2YUO A;  3PVL A;  1HD3 A;  1KFZ A;  1UUE A;  2V1R A;  2GTO A;  5FWB A;  1SRM A;  1SSH A;  1ARK A;  2DE0 X;  2DL5 A;  4ESR A;  3JV3 A;  4HVV A;  1AEY A;  1GBR A;  1K4U S;  2DMO A;  2DYB A;  2YDL A;  4DEX A;  2M51 A;  2ROL A;  1TUC A;  1PKT A;  5IHI A;  2ED1 A;  1AWJ A;  3VRZ A;  2CT4 A;  2SEM A;  3M0S A;  1BU1 A;  1JXO A;  1UE9 A;  4RUG A;  1T3S A;  1QKX A;  3R6N A;  1WLP B;  4LNP A;  2O31 A;  1NYF A;  2I0N A;  2RQW A;  1GCP A;  2FRY A;  1FMK A;  4GBQ A;  5FWC A;  1ABO A;  2O9V A;  1MV3 A;  2L3S A;  2DRK A;  4J9D A;  4JPB W;  2CUD A;  4RTT A;  4AFS C;  1HSQ A;  4F17 A;  2EYY A;  3ULR B;  1GL5 A;  1NLO C;  2LJ0 A;  2JS0 A;  3VS7 A;  1M3B A;  1K9A A;  1H8K A;  4QT7 A;  1G2B A;  1I1J A;  1MUZ A;  2O88 A;  1XOV A;  2EGA A;  2KYM A;  1OV3 A;  2J06 A;  2OI3 A;  3QWY A;  2D8H A;  3FJ5 A;  2D0N A;  1T0J A;  1RLP C;  1K76 A;  2O9S A;  1GCQ C;  3EG0 A;  3EG3 A;  2KT1 A;  1TG0 A;  1JXM A;  2KRO A;  2DL8 A;  2EYZ A;  4CC7 A;  4ZNX A;  2LJ1 A;  2AKL A;  4GLM A;  3TSZ A;  4LE9 A;  3H0F A;  2A08 A;  2KRN A;  3REA B;  2BZY A;  2KR3 A;  2LZ6 B;  4WCI A;  3QWX X;  1UTI A;  3SEM A;  1QCF A;  4OML A;  3EGU A;  2DA9 A;  3VS5 A;  3CQT A;  2LQN A;  2CUB A;  2XMF A;  3VRY A;  4IIO A;  2YUQ A;  4M4Z A;  1HJD A;  1ABQ A;  3NGP A;  2G6F X;  1U06 A;  1WDX A;  1ZBJ A;  1M27 C;  1WA7 A;  2PZ1 A;  1W70 A;  1RUW A;  2LJ3 A;  2JS2 A;  3I35 A;  1K0X A;  4A63 B;  1B07 A;  4LUD A;  1V1C A;  3EHR A;  3SHW A;  1RI9 A;  2W0Z A;  2E5K A;  2EBP A;  2FPD A;  1OOT A;  4R0K A;  1K0S A;  4J9F A;  1YWO A;  5IHK A;  2ROT A;  3RBB B;  3VS2 A;  1CSK A;  2PTK A;  1M8M A;  1RLQ C;  4HCK A;  3IQL A;  2JM8 A;  4Z88 A;  2F2X A;  2GBQ A;  2ABL A;  2J6F A;  3M0P A;  2B86 A;  4LN2 A;  3VS4 A;  1LCK A;  1Y57 A;  1PNJ A;  4OMN A;  2IIM A;  2LNH B;  1WFW A;  3M0U A;  4J9G A;  1YCS B;  4J9H A;  2LX7 A;  4RTY A;  2CDT A;  2RQT A;  4HVW A;  4F16 A;  2C0I A;  2HDA A;  1M30 A;  2F2W A;  1AZG B;  2CRE A;  1KSW A;  2J05 A;  4D8K A;  2P4R A;  2SRC A;  5ECA A;  1T3L A;  3LH5 A;  2FRW A;  1UGV A;  2DL3 A;  4X1V A;  1WXB A;  2YUP A;  1I0C A;  2C0O A; 
#chains in the Genus database with same CATH topology
 2M0O A;  2A28 A;  3NHN A;  2AZS A;  2GFU A;  3CCV T;  1K73 R;  2DYI A;  2NWM A;  1K1Z A;  1ZHI A;  5IT9 E;  4O6J A;  1WYX A;  2C0T A;  2VUB A;  3A98 A;  4PFO A;  1KC8 C;  2XD0 A;  2HZY A;  2ESW A;  4CI0 C;  3C0C A;  5C0M A;  3G7Z A;  4A4E A;  1R0C B;  5D6Y A;  1TXQ A;  2E3H A;  1WNL A;  3O8V A;  1HK9 A;  5A0G A;  2V8J A;  4M7D G;  4E47 A;  4N4H A;  3OYG A;  1PG5 B;  4IUT A;  3JRZ A;  3RKY A;  1MMG A;  5LJ3 g;  4E2F B;  4PJO B;  1KHC A;  1WQ7 A;  1UB4 A;  1N5Z A;  2XI9 A;  4QQD A;  3UF4 A;  2DLP A;  1KQS S;  1LVK A;  2KRM A;  2F5K A;  2KT8 A;  1IHW A;  1BKB A;  4HA8 A;  4C8Q C;  1CKB A;  3PE0 A;  4AT1 B;  6AT1 B;  2LCS A;  5IN1 A;  2H3J A;  2M0Y A;  3FEO A;  2X3W D;  2HBP A;  1D0Z A;  4C92 C;  4JZ4 A;  2ENM A;  4HXJ A;  2J6O A;  3RKX A;  4F14 A;  5IAY A;  4F7U B;  3FDR A;  3CC7 Q;  2GCX A;  1YJ9 Q;  4Z89 A;  3CCV Q;  1MMA A;  4M7D F;  5KYX A;  5IH2 A;  1YJN A;  4RTV A;  1VQL A;  3CCS T;  1TSF A;  3Q1J A;  2HSP A;  5HK0 A;  2NUZ A;  5AYF A;  3CMA A;  2L3Q A;  1BIA A;  3RES A;  3L2Q A;  1AWW A;  1YCY A;  4GLK A;  1W2B S;  1N6A A;  1FWZ A;  3SWN C;  1OX9 A;  2LCC A;  1UFF A;  4NL3 A;  4PJL A;  4Y92 A;  1U8R A;  2KYB A;  5IXF A;  4FSS A;  5FU7 C;  3RUX A;  5HY6 A;  2J7I A;  4MDW A;  3X28 B;  1XJW B;  1TUG B;  1NM7 A;  3HFO A;  3OSS C;  3A8O B;  5KYW A;  2FO0 A;  3OS0 A;  4M7D E;  3CCJ T;  3NPF A;  1VQ6 A;  1WJS A;  1OX8 A;  3ZEH A;  3MEA A;  2A7Y A;  1AVZ C;  2A36 A;  2VV5 A;  1OQK A;  1VQK T;  4FYW B;  3CME A;  3NTK A;  2ECZ A;  1QCO A;  4M75 G;  3JCM X;  1ZUK A;  4C8Q B;  5LJ3 e;  2JMA A;  1RL2 A;  4FSX A;  1NJI U;  4EMH A;  2DTO A;  5GAN 5;  3ER0 A;  2QA4 T;  2WSE E;  4M7D D;  3L1A A;  1D3B B;  1I81 A;  4OB2 B;  1PRM C;  2DD5 A;  1MMN A;  3A1P A;  2DKG A;  5FRM A;  4Z8A A;  4BE0 A;  3RKW A;  5I2S A;  2EJF A;  3H0H A;  1DJ7 B;  4ORZ A;  3CCS Q;  3ZFJ A;  2BZX A;  1VQ8 T;  2L2P A;  4KUI A;  1KIK A;  3JSC A;  1VQP A;  1K9M U;  4LDU A;  2KXD A;  2QEX T;  2KGT A;  2Y4X A;  4HCZ A;  3JCM f;  2WSC E;  2E12 A;  3UDC A;  1PD1 A;  5GMK m;  4RTU A;  2L89 A;  2CSI A;  3EAE A;  3R6O A;  5GAN 4;  1BIB A;  1QVF P;  4BI4 A;  1FXX A;  4D8D A;  1NYG A;  2YUN A;  2E5Q A;  2H8H A;  3X24 B;  2A0F B;  2YWW A;  5FU7 B;  2GF7 A;  2E6Z A;  3V7R A;  2A37 A;  4CC3 A;  4M7A G;  1PSF A;  2ZPH B;  4OP0 A;  1TH7 A;  2XID A;  2X4W A;  2K9G A;  3CCJ Q;  2DEU A;  5GAN 2;  2DPP B;  3THK A;  1ZSG A;  1VQK Q;  1H3H A;  1C6V X;  1D0X A;  1SEM A;  2RI5 A;  3ZL7 C;  3L42 A;  2LC4 A;  4CC2 A;  4OMM A;  3FLG A;  1BI1 A;  4M75 B;  3JCM d;  2X3X D;  2CH4 W;  2YLC A;  1N8R U;  3OYH A;  2GTJ A;  2QA4 Q;  2YLB A;  1P92 A;  3I56 Q;  3NTH A;  2DIG A;  3CCR T;  2QGG A;  2QEX A;  3OYM A;  4Z02 A;  2PVG B;  1UEC A;  3OS5 A;  4C92 A;  1YIJ A;  2YUO A;  3AT1 B;  3PVL A;  1KFZ A;  4ATO A;  2NUT A;  1UUE A;  2GTO A;  3L2U A;  5LJ5 f;  2LT1 A;  3HRT A;  1ZBX A;  1VQ8 Q;  2DXB A;  4M7A F;  1D1B A;  3E1S A;  2QQA A;  2M16 A;  4DEX A;  1TUC A;  2ATC B;  3G6E Q;  3G4S A;  2QDY B;  1PM3 A;  3SWN A;  2YRD A;  2SEM A;  1BU1 A;  3P8D A;  1Q86 U;  3CBO A;  2O31 A;  3RR6 A;  1VQ5 Q;  3VUZ A;  4B9X A;  1MV3 A;  1RAB B;  3DLM A;  2DRK A;  3OS2 A;  1B7T A;  2HQE A;  5LJ5 d;  1Q81 R;  1HSQ A;  2LDM A;  2FB7 A;  1RAG B;  4BE2 A;  4M7A E;  5LJ5 j;  1GL5 A;  2KK4 A;  3VS7 A;  1Q95 G;  1KHI A;  3OYJ A;  2A3L A;  1MUZ A;  3OS1 A;  2DD4 A;  1M1K U;  2C06 A;  2DK3 A;  1BYM A;  5GAN g;  2JJ9 A;  2OI3 A;  3CCL Q;  3A8G B;  2D8H A;  1T0J A;  3CCR Q;  1RLP C;  2ZCF B;  3OYE A;  1KG1 A;  4M78 F;  4M7A D;  4JRK A;  2KRO A;  2P0K A;  3M59 A;  4ZNX A;  2AKL A;  1M90 R;  1ZSZ B;  1KQS A;  3H0F A;  1VQO A;  2A08 A;  2LT4 A;  5KYY B;  2KR3 A;  4WCI A;  2X51 A;  3C95 A;  4HKE A;  3CCE A;  1QCF A;  3PIP A;  1IXD A;  3GF5 A;  4N4G A;  3EGD A;  3BDL A;  5FLX E;  4N0A A;  3TQ7 P;  4PKC C;  4QW2 A;  1O9S A;  3VV0 A;  2AHJ B;  1FX7 A;  3VRY A;  1QVF S;  1K8A U;  2DZ9 A;  1HJD A;  3NGP A;  1M2V B;  3PGG A;  4C0Z A;  2JUF A;  1M27 C;  5GMK j;  4M78 E;  5LJ5 h;  2FZK B;  2PZ1 A;  4PNO A;  1RUW A;  1K73 U;  2JS2 A;  4QQ6 A;  2ZPI B;  1JB0 E;  5KE2 A;  3TRE A;  5DY9 A;  3QZ9 B;  1V1C A;  3PIO A;  1K9M R;  1W2B A;  1Q82 U;  1OOT A;  1K0S A;  1N9S A;  2OTJ T;  3BDU A;  4M78 D;  2JM8 A;  2L3R A;  3QYH B;  2J6F A;  3HTR A;  3V8L A;  1S72 T;  4XQ3 A;  3CCU T;  1Y57 A;  4PJN A;  3QO3 A;  2LNH B;  1WFW A;  4KGV B;  3S3M A;  1YCS B;  1GXI E;  2RQT A;  1VQM Q;  1M30 A;  1YHQ A;  3CD6 T;  2F2W A;  3QUI A;  4D8K A;  2P4R A;  5GAN e;  1T3L A;  4M78 A;  4MZM A;  1WXB A;  4ZGJ B;  5KH6 A;  1AT1 B;  3EGX A;  5A2Q E;  5I11 A;  2PUO B;  3HSB A;  5HKC A;  3QJY A;  3OYA A;  4M77 C;  1RAC B;  4C0D B;  1CKA A;  1H92 A;  3LH0 A;  4CRI A;  2DXT A;  2EKH A;  3LX7 A;  4EMK A;  2MCN A;  2VVK A;  3VUB A;  1EIF A;  1ZQ1 A;  2CP6 A;  3CPW P;  4PL6 A;  5AT1 B;  1MV0 B;  4DEY A;  2LP5 A;  2D8J A;  3H6Z A;  2KNB B;  1M3C A;  1VUB A;  4DBF A;  1F1B B;  1N8R C;  2NUP A;  3QHS A;  1B34 A;  1ZUU A;  1JO8 A;  1PC0 A;  1UG1 A;  3ZBD A;  3UAT A;  4MDX A;  2OJ2 A;  1QCN A;  1Q86 R;  2LVM A;  1S72 Q;  2BKD N;  5FRO A;  1NBE B;  2EYW A;  2CP5 A;  3CBM A;  4J9C A;  4DBR A;  4HVU A;  1TOV A;  3SDZ A;  3EG1 A;  3CD6 Q;  1ZLM A;  1IB8 A;  2RH2 A;  2EQM A;  4RTZ A;  1VQ7 T;  1AD5 A;  3M0R A;  2VXE A;  2DL7 A;  3RIR A;  2GQI A;  2MWP A;  3H0I A;  1PD0 A;  3QSU A;  1UEB A;  2KY9 A;  1RAA B;  1X6B A;  1M1K R;  4AFZ C;  4OMP A;  5CVI A;  2JXB A;  2QI2 A;  4WTO B;  1YWP A;  4PJM A;  1VYV A;  4PJO C;  1Q7Y R;  5GMK e;  1OEB A;  4FYV B;  2EYQ A;  4BDZ A;  2EVR A;  1JQQ A;  1W4S A;  4NL2 A;  1NG2 A;  2RF0 A;  4OB0 B;  1X6G A;  4J9E A;  3OBW A;  2CZ7 B;  4CC4 B;  4JRP A;  2E1H A;  5DLO A;  3CCQ A;  2XKO C;  3CC2 A;  2QTV A;  1OPK A;  3HHT B;  2BE7 D;  5GMK l;  2HL5 C;  1E6G A;  1PRL C;  2K5F A;  3C12 A;  2HQX A;  4C5H A;  4C5E A;  1X01 A;  2V1Q A;  5LJ3 d;  3CCM A;  1QWE A;  2W10 A;  4OMF B;  2HBW A;  4XTV A;  1VQ7 Q;  1KD1 C;  4J9I A;  1YJW T;  2EYX A;  2DJQ A;  4JZ3 A;  1YBY A;  1Q82 R;  3EFR A;  4ZGE B;  1VQ4 T;  1G3S A;  5GAO q;  2HAX A;  4OMQ A;  1Y7X A;  3J81 E;  1AHJ B;  4RCB A;  1J3T A;  5D7U A;  5GAM g;  2EW3 A;  4J9B A;  2QXF A;  1G83 A;  3NMZ C;  1YJN T;  1VQL T;  4X9D A;  3VYG A;  1Y07 A;  2HSE B;  2OTL Q;  4XTX A;  1GRI A;  4RG2 A;  4FYX B;  3OYK A;  2DVJ A;  3CMA T;  5DLQ E;  1M8V A;  4PFZ A;  1SHG A;  3AHU A;  3LLR A;  1TWB A;  3UA7 A;  2DO3 A;  2DAQ A;  1IZ6 A;  2L5Q A;  2RD1 A;  1IGQ A;  3CPW S;  3JCM Q;  5GAN 6;  3EFO B;  1OZ2 A;  2CGH A;  1UGQ B;  2Y90 A;  1GCQ A;  1PSE A;  2DVE A;  3M4Y A;  2RJC A;  2FG0 A;  2ED0 A;  2KBT A;  5KYW B;  3EG9 A;  2LMJ A;  2AZV A;  2BZ8 A;  1YJW A;  1PHT A;  5LJ3 h;  3EH1 A;  1WI7 A;  1VQ6 T;  1IHV A;  3MP8 A;  1VQ4 A;  1U3O A;  2V8K A;  3CC7 A;  2KSS A;  1YJ9 A;  1SF9 A;  5HCK A;  3CME T;  2HQH A;  3URG A;  1SHF A;  5D6X A;  4X34 A;  5L8R E;  4DBQ A;  4J83 A;  2E3I A;  3WVE B;  2RHI A;  2CP7 A;  2PU9 B;  1R8O B;  1QLY A;  1E7O A;  4C92 G;  1Q81 U;  2XG8 D;  5CIU A;  1AWX A;  1KQ1 A;  2L0A A;  3M54 A;  1WQW A;  3S3O A;  3OY9 A;  3ME9 A;  1RAF B;  1HD3 A;  4ZGD B;  3HP9 A;  1M9S A;  1YJN Q;  1VQL Q;  5CKH A;  3A8L B;  4EDU A;  1ARK A;  1WHH A;  1N9R A;  3N5B B;  4ESR A;  4M7D B;  3JV3 A;  2E10 A;  4HVV A;  4Q5W A;  1VQP T;  1K4U S;  2ZZD A;  3L2V A;  1QVG P;  2HNI A;  2ROL A;  2CP3 A;  2VGN A;  1PKT A;  2EJ9 A;  4BB7 A;  1M90 U;  4C8Q F;  2CT4 A;  2XHC A;  5GAM e;  3CBP A;  3M0S A;  2HD0 A;  2HL3 A;  1UE9 A;  3PMT A;  2EWN A;  4M75 C;  3QXE B;  1WLP B;  2FZG B;  2KQW A;  1NYF A;  2B8A A;  2I0N A;  4C92 F;  5CK9 A;  4GBQ A;  4IUV A;  5FWC A;  2O9V A;  4BI3 A;  2G3R A;  4J9D A;  1VQ6 Q;  2CUD A;  4AFS C;  1Y71 A;  4F17 A;  2CS7 A;  3OW2 P;  3CME Q;  3ULR B;  4F7U A;  1M3B A;  4QT7 A;  2MYS A;  1G2B A;  3G1J A;  1I1J A;  1XOV A;  2JZ2 A;  4C8Q E;  1WJR A;  4KUL A;  2J06 A;  2R57 A;  1K76 A;  4XU3 A;  4O5V A;  1YIJ T;  2KT1 A;  5EG2 A;  1PCX A;  2DL8 A;  2EYZ A;  4C92 E;  2LJ1 A;  3CXC P;  4IKF A;  4C8Q D;  2O4X B;  1M5Q 1;  3REA B;  4KH0 B;  1WHG A;  4LDW A;  1OUL A;  1VQP Q;  1WHJ A;  3TEE A;  3QWX X;  4FIB A;  3SEM A;  3M55 A;  3OYI A;  2DTH A;  4WF2 A;  3EGU A;  4ZN1 A;  3G4S T;  4E7K A;  1H64 1;  1NZ9 A;  4C92 D;  4RMO A;  2CP2 A;  3H8Z A;  2XMF A;  4PJJ A;  4J6Y A;  2DJZ A;  2QAS A;  4IIO A;  1YIT A;  3MCA B;  5FRN A;  1ABQ A;  2K57 A;  4C8Q A;  4JRQ A;  1U06 A;  1UGR B;  4OB1 B;  5KCO A;  1WA7 A;  3I56 A;  1OU8 A;  4A4K A;  1Y96 B;  4RKU E;  1B07 A;  4C0G A;  1D3B A;  1KK7 A;  4LUD A;  3OYN A;  3EHR A;  3SHW A;  1QMC A;  4DQ2 A;  5HK3 A;  3KUF A;  2E5K A;  4A4H A;  4B6M A;  2EBP A;  4J6W A;  2FPD A;  4NS5 A;  4R0K A;  4OVA A;  1I5O B;  1ZSZ C;  5IHK A;  1EZZ B;  2PTK A;  1RLQ C;  1MHN A;  3UWN A;  4FW1 A;  4XK8 E;  1JJ2 P;  2B86 A;  3QZ5 B;  3VS4 A;  2X4J A;  2LQ8 A;  3G6E A;  1FMV A;  4OMN A;  4F04 B;  2QEX Q;  1IGU A;  3M0U A;  4J9G A;  2L8D A;  2XDP A;  4M78 G;  5GAN d;  3OSV A;  2HDA A;  2M1H A;  2EQU A;  1VQO T;  9ATC B;  1SG5 A;  1VQ9 A;  1VQ5 A;  2H3E B;  3LH5 A;  2FRW A;  4ELY C;  1UGV A;  1SSF A;  3CCE T;  1WPY A;  1OZ3 A;  3JCM g;  3J7A F;  4MML A;  2C0O A;  4M7A B;  1QVG S;  2E65 A;  1C1A A;  4AMC A;  4LUE A;  2DNU A;  2LX9 A;  2ZAE A;  3L2Z A;  1UJY A;  3X20 B;  2MF2 A;  2RM4 A;  3A8M B;  4IUR A;  1UHF A;  2P84 A;  4HCC A;  2QDL A;  4RTW A;  1NPR A;  2DER A;  3LWI A;  2K6D A;  3CCL A;  4M75 A;  3VS0 A;  2HKN A;  2YT6 A;  5J26 A;  5I22 A;  3M0Q A;  2DBK A;  4OF1 A;  2CH4 A;  4JUV A;  3RMS A;  3BE3 A;  4HT8 A;  3S6W A;  3LW5 E;  5CAI A;  3RER A;  3MEV A;  2KE9 A;  4HCB A;  4J8O A;  1Q7Y U;  2E41 A;  3I5R A;  3OW2 S;  2RNA A;  4K11 A;  2RHZ A;  3MHX A;  3O5Z A;  3CPW A;  2YRV A;  2XDD A;  2IVW A;  2WAC A;  3H41 A;  1MGQ A;  5GAN h;  3HRU A;  4JJB A;  4PLI A;  3VKI A;  1OPL A;  1X2K A;  4C0D C;  3QPH A;  4FM4 B;  1JRI A;  2PVD B;  2J6K A;  2AIR B;  1YHQ T;  2DXU A;  5LJ5 g;  2FEI A;  2DIL A;  1VQO Q;  2MI6 A;  3CXC S;  1JEG A;  1KC8 U;  2O2O A;  2OAW A;  1M90 C;  2MIO A;  3CCE Q;  2VYT A;  2LQW A;  2BTT A;  3M0T A;  2FZC B;  1S1N A;  1MMD A;  3VS3 A;  3REB B;  2YXY A;  3I55 A;  3GOX A;  2DL4 A;  1YI2 A;  3OMC A;  2P4T A;  1SPK A;  2D1X A;  1BCO A;  3QDF A;  2Z0W A;  1NJI C;  1RI0 A;  5IXB A;  2EPD A;  3INZ A;  4TVR A;  3OB9 A;  1VA7 A;  3JCM e;  3X26 B;  3JCM J;  3CC4 A;  1O75 A;  2QYZ A;  3VS6 A;  1C0M A;  8ATC B;  1HYO A;  5KYU B;  1OYX A;  1PWT A;  2VAS A;  2DBM A;  4LD9 K;  3NFC A;  1YFN A;  2KDS A;  2GFA A;  1K9M C;  2YSQ A;  2DEQ A;  4DBH A;  1WHM A;  3FC3 A;  4C0F A;  2FVU A;  3EHQ A;  1VQN A;  2RQU A;  5KYY A;  1JJ2 S;  2DM1 A;  2ZPE B;  2JNG A;  4L5G A;  2K3Y A;  4IIM A;  2MK5 A;  3SFM A;  1WXT A;  2BUD A;  4AFQ C;  2JW4 A;  4E7S A;  1YHQ Q;  2RPN A;  2DX1 A;  2AK5 A;  3LWH A;  2PNI A;  3QBY A;  3GNG A;  5GAN 3;  1JU5 C;  3BY7 A;  4EPC A;  3GIB A;  2IG0 A;  2K3B A;  1KJW A;  4VUB A;  4ZN3 A;  4JLI A;  3QDR B;  5KYN A;  5J39 A;  2RN8 A;  5LJ5 e;  4J5Y A;  2JT4 A;  5DM7 R;  2VWF A;  2X9H A;  5KCH A;  2OTJ Q;  5FW9 A;  3L2W A;  4NOY A;  3G71 A;  2D9T A;  1ZX6 A;  2GGR A;  3JCM b;  3CCU Q;  3A5Z B;  2K4Y A;  1G3W A;  2EQI A;  3SD4 A;  3CCQ T;  2X35 A;  3CC2 T;  1M1G A;  2RK1 A;  5D6W A;  2RJE A;  1IRX A;  2EGE A;  1BK2 A;  3A8H B;  1MNE A;  3M56 A;  1X69 A;  1G3Y A;  2QGF B;  1Y0M A;  2DF6 A;  3OA6 A;  2X4X A;  1NE8 A;  1I5L A;  4M77 F;  1ZUY A;  2JTE A;  2V8I A;  4JJC A;  3F70 A;  2RJD A;  3CCM T;  1XQH A;  1I8F A;  2AT1 B;  1Q86 C;  1IRE B;  1TS9 A;  2QQR A;  4KGX B;  5LJ3 f;  1R77 A;  3LGF A;  4BI8 B;  1GBQ A;  2RQR A;  1M1F A;  2PQW A;  4FL6 A;  1NLP C;  3HPW A;  3JCM W;  4RTX A;  2P0Q A;  3FIF A;  2CP0 A;  3VJP A;  2R5A A;  1LNX A;  2RJF A;  1WXU A;  4PLL A;  2JOY A;  2ZPB B;  1V76 A;  1WZO A;  3QG1 A;  1SRM A;  4MZP A;  2DE0 X;  2DL5 A;  1M1K C;  2K5L A;  4M77 E;  1GBR A;  2DMO A;  2DYB A;  2M51 A;  3PT9 A;  5A0L A;  5IHI A;  2K2V A;  1UGS B;  3VRZ A;  4BY6 C;  2IPO B;  3P8H A;  2ZPF B;  1Q7Y C;  1KC8 R;  4QVZ A;  3M53 A;  4ELZ C;  1JXO A;  4M77 D;  5LJ3 j;  1T3S A;  3R6N A;  4LNP A;  1QVG A;  5KE3 A;  2QQB A;  1UGP B;  1GCP A;  2FRY A;  3GNF B;  2CKK A;  2VC8 A;  1ABO A;  4E7Z A;  4IUP A;  4F7U G;  2L3S A;  4DOW A;  4XTW A;  4JPB W;  2RHY A;  4RTT A;  1OI1 A;  3CC7 T;  4GY5 A;  5KYX B;  1OU9 A;  1YJ9 T;  2MMP A;  4LDV A;  3CCM Q;  5CKF A;  3SB2 A;  1K8A C;  4PJO F;  1NLO C;  2OTL A;  2JS0 A;  1K9A A;  3MPU B;  1H8K A;  4M77 A;  1XNI A;  4M7D C;  3MEW A;  1BCM A;  2EQJ A;  2RI3 A;  4A53 A;  3JB9 F;  2KYM A;  4XU0 A;  1K73 C;  3JB9 H;  4J7F A;  3VYH B;  1U1S A;  3FJ5 A;  4MMK A;  3OW2 A;  4FT2 A;  2D0Q B;  2O9S A;  3LGL A;  3TCJ A;  3EG3 A;  1JXM A;  2DIQ A;  4CC7 A;  3M4G A;  1Q82 C;  1NPP A;  2CYZ B;  3TSZ A;  5GAM h;  4LE9 A;  2CZ1 B;  3V7C A;  5CQX A;  1RAD B;  2KRN A;  3QKJ A;  3NTI A;  2LZ6 B;  4F7U F;  4ZTF A;  3MEU A;  1QVF A;  4PJO E;  3VS5 A;  4BDY A;  3PTA A;  4BY6 B;  3CQT A;  3CXC A;  2LQN A;  4C8Q G;  4JRI A;  3CCV A;  4MZT A;  2MWO A;  2YUQ A;  2BE9 B;  4DOV A;  2G6F X;  1WDX A;  2RA2 A;  4E7L A;  5FU6 C;  2NYS A;  1YJW Q;  5GAO r;  4PJO D;  5CQY A;  1QW1 A;  2CZ0 B;  2LJ3 A;  4A63 B;  1VQ4 Q;  2V26 A;  2JTF A;  3BFM A;  3JB9 D;  3WVD B;  1QP3 A;  2W0Z A;  2RB6 A;  1LJO A;  4Y91 A;  3OQ5 A;  2MAM A;  2LTO A;  4F7U E;  1YWO A;  3D7S B;  3RBB B;  3VS2 A;  4LXC A;  1CSK A;  3LYI A;  1M8M A;  4HCK A;  3E9F A;  2ABL A;  2KAF A;  4LN2 A;  3CMA Q;  5CR2 A;  4PJO A;  1PNJ A;  2DET A;  2IIM A;  3MJX A;  3MO8 A;  2JTM A;  4RTY A;  3T9N A;  2CDT A;  4A4F A;  3CEY A;  4XU2 A;  2HMA A;  2M9U A;  3EFO A;  2CRE A;  2O01 E;  1JJ2 A;  4X9C A;  4IUQ A;  4E7H A;  2Y4Y A;  3OMG A;  3CPF A;  2SRC A;  3QYG B;  5GAO m;  3P8B B;  4L6V 5;  3ASK A;  2DL3 A;  1FMW A;  2YUP A;  1I0C A;  2VB6 A;  3KXT A;  4FT4 A;  4YTL A;  1G3T A;  3HL8 A;  1YIT T;  3CCS A;  3JCM P;  2QK0 A;  3M57 A;  2KEA A;  1QWF A;  2FL7 A;  1TU0 B;  5GAN 7;  1VYU A;  1ZA2 B;  3U23 A;  3JAM E;  3I56 T;  1A0N B;  5FU6 B;  2K2M A;  4OB3 B;  3PNW C;  4C92 B;  3V7S A;  1GFD A;  4JDS A;  1VIE A;  1D09 B;  2NUT B;  4P5N A;  2XU8 A;  4R55 A;  4XU1 A;  5CKE A;  5L23 A;  4E6R A;  5EC7 A;  3FRN A;  3V8J A;  2F2V A;  5A0D A;  2DRM A;  5IHN A;  1YP5 A;  2HEQ A;  1D1C A;  1X6O A;  4FU6 A;  4UC4 A;  4OMO A;  3I5S A;  4BUG A;  1Z9Z A;  1KQ2 A;  4M7D A;  1BI0 A;  3E2U A;  4N0A C;  1BB9 A;  3SWN B;  3G6E T;  1BBZ A;  3EH2 A;  2GNC A;  4M7A C;  1YN8 A;  3CCJ A;  2HCK A;  3OBY A;  2DZC A;  1W1F A;  4RG8 A;  2R5M A;  4A4G A;  1UDL A;  2FPF A;  4QVD A;  1BI3 A;  2I2L A;  4M75 F;  1VQK A;  1FYN A;  1WX6 A;  4J7I A;  3EG2 A;  2EQK A;  1QP2 A;  4XTZ A;  3QII A;  1VQ9 T;  1VQ5 T;  5GJW B;  4QKU A;  2K79 A;  1AZE A;  1MND A;  5GAN f;  4PK4 A;  2QA4 A;  1M2O A;  2E4H A;  4RCC A;  4XTY A;  1X75 C;  5GAO p;  1NEG A;  1WHL A;  2KRS A;  1SRL A;  4OGC A;  2F1L A;  1U5S A;  2RI2 A;  1UJ0 A;  3TVT A;  4LDX A;  1AWO A;  2RQV A;  1YIT Q;  2JVV A;  2D6F A;  2EAY A;  1M3A A;  3RMQ A;  2DXC A;  1VQ8 A;  2CT3 A;  2EJG A;  3CCL T;  2BIV A;  4KBM B;  4M75 E;  4ANJ A;  1G5V A;  2COW A;  3GLX A;  5GJV B;  5I2M A;  1TTH B;  5GAN 8;  1Z9Q A;  1PKS A;  4A54 A;  3S3N A;  1AOJ A;  3TSW A;  2WSF E;  1YIJ Q;  4XAX B;  4M78 C;  2F69 A;  1VYT A;  2OAU A;  5GAN j;  2JM9 A;  3OYL A;  2YHT A;  4M75 D;  2EGC A;  3GPL A;  2O4X A;  2FPE A;  3OYC A;  2HKQ B;  3EGD B;  3C4S A;  2RMO A;  3J80 E;  1X27 A;  2M02 A;  4Y28 E;  1JBM A;  2KXC A;  3MP6 A;  4KRT A;  3G4S Q;  2MOX A;  1I07 A;  4EMK C;  2ZGW A;  1X43 A;  3OYB A;  1UHC A;  1VIF A;  1GFC A;  4JJN K;  1VQ9 Q;  3FJP A;  2CSQ A;  8AT1 B;  3PFS A;  2KI7 A;  3JCM V;  1EFN A;  2FYK A;  3EFS A;  3CCR A;  1ACM B;  3HFN A;  4AFU C;  1N27 A;  1TUD A;  1HXD A;  4JJD A;  2K7A A;  3OYD A;  1Y96 A;  3V8K A;  3JCM h;  5LL6 S;  3I55 T;  4FW2 A;  3RNJ A;  1YI2 T;  2F5T X;  2XDB A;  4OGE A;  1B3Q A;  3HRS A;  4E7I A;  1SKU B;  3VS1 A;  1Q81 C;  1W6X A;  4XTU A;  4AG2 C;  2K5I A;  3GBQ A;  1NEB A;  3CC4 T;  2E64 A;  2JMC A;  2KMT A;  1IO6 A;  1VQM T;  2AKK A;  1I4K 1;  4R56 A;  3KFV A;  1LOJ A;  2VKN A;  4AG1 C;  1WJQ A;  4M78 B;  2E70 A;  3FB9 A;  2XIC A;  1KD1 U;  1YNZ A;  2L3P A;  2QG9 B;  3EGX B;  3I9Q A;  2YRC A;  1VQN T;  4JS5 A;  5CKD A;  1NJI R;  1WIE A;  3PVQ A;  1BI2 A;  3M58 A;  4M7A A;  2PUK B;  1QQJ A;  2P0P A;  2JN0 A;  2QQ9 A;  1E6H A;  4EIK A;  1EX4 A;  4EMK B;  2LRQ A;  3HKS A;  1T0H A;  2DFU A;  4C5G A;  1H3Z A;  2MPX C;  2LQK A;  3UT1 A;  4L59 A;  1X2Q A;  1QKW A;  4FYY B;  2RK2 A;  2RO0 A;  4B9W A;  3E19 A;  3UA6 A;  3DLL A;  2LCL A;  2RHU A;  3MP1 A;  1XTD A;  3I55 Q;  5CCA A;  2QQS A;  2COY A;  2V1R A;  2EFI A;  1WHK A;  2NUP B;  5FWB A;  1YI2 Q;  1VQM A;  1B34 B;  2QAZ A;  1D0Y A;  1SSH A;  2FHD A;  2XK0 A;  1G8X A;  2X4Y A;  4BD3 A;  2E6N A;  1QVP A;  2LNV A;  3DB4 A;  1AEY A;  3G71 T;  1ZSZ A;  2KVQ G;  2YDL A;  3CC4 Q;  5J3B A;  2ED1 A;  1AWJ A;  4KUD K;  3VU3 C;  4ME7 A;  3MKD A;  2OX7 A;  4BAC A;  4RUG A;  1QKX A;  5M9O A;  3JB9 I;  1RAE B;  4LD6 A;  2RQW A;  3BW1 A;  1FMK A;  3JCM c;  3QJ6 A;  1M2V A;  1VQN Q;  4JS4 A;  4M77 G;  1N8R R;  5GMK h;  2EYY A;  2EIF A;  4J6X A;  5I21 A;  2NLU A;  2LJ0 A;  2VXF A;  1R0B G;  4KH1 B;  4QQG A;  1V29 B;  2OTJ A;  2O88 A;  2PVO B;  4II1 A;  2EGA A;  4EMG A;  1OV3 A;  1KQS P;  3QWY A;  3M9Q A;  2D0N A;  1S72 A;  3CCU A;  1GCQ C;  3EG0 A;  3TU4 K;  1VOM A;  2QTX A;  3GP8 A;  1TG0 A;  1RAI B;  2R58 A;  4GLM A;  3CD6 A;  4FCY A;  5KYU A;  1ZA1 B;  4DA4 A;  2BZY A;  3DKM A;  3G71 Q;  3MET A;  3L2R A;  1UTI A;  2DTI A;  2GQV A;  3M5A A;  4LDY A;  4OML A;  3JB9 J;  2RHX A;  2DA9 A;  3C94 A;  4V2S A;  2ZPG B;  4N4I A;  2CUB A;  5GAM f;  5GAO l;  3PMI A;  3X25 B;  4M4Z A;  1D1A A;  1W2B P;  5CKB A;  3H9N A;  1U1T A;  1ZBJ A;  5C6S A;  3UPU A;  1W70 A;  7AT1 B;  3I35 A;  1K0X A;  2COZ A;  2EKO A;  5CO7 A;  2CZ6 B;  4IUU A;  3E9G A;  4M77 B;  1RI9 A;  4E7J A;  2OTL T;  4JLG A;  4PJO G;  4J9F A;  2ROT A;  4PFP A;  3IQL A;  4Z88 A;  2F2X A;  2GBQ A;  3WXM B;  3DB3 A;  3M0P A;  3JB9 G;  1M4Z A;  5GAM d;  2VGM A;  1LPL A;  4C5I A;  2K3X A;  1LCK A;  4D6W A;  3OYF A;  4KT0 E;  5GAM j;  3OYY A;  1KD1 R;  4J9H A;  2LX7 A;  4BE1 A;  1WGS A;  4QVC A;  4HVW A;  4KGZ B;  4F16 A;  2C0I A;  3EG9 B;  4HT9 A;  3CCQ Q;  5GAO n;  3CC2 Q;  3KBG A;  1AZG B;  1KSW A;  2J05 A;  5GMK i;  1VQ7 A;  1RAH B;  5ECA A;  4ZTJ A;  3RDV A;  4X1V A;  1K8A R; 
#chains in the Genus database with same CATH homology
 5I11 A;  2A28 A;  3NHN A;  2AZS A;  2NWM A;  1CKA A;  1H92 A;  1K1Z A;  4LUE A;  2DNU A;  1WYX A;  2C0T A;  1UJY A;  2EKH A;  2KEA A;  1QWF A;  2MCN A;  2VVK A;  3A98 A;  1UHF A;  2QDL A;  4RTW A;  1VYU A;  3U23 A;  2K6D A;  1A0N B;  3VS0 A;  2ESW A;  2YT6 A;  3C0C A;  5I22 A;  2K2M A;  2DBK A;  3M0Q A;  2CH4 A;  1GFD A;  1MV0 B;  5L23 A;  4DEY A;  4E6R A;  2KE9 A;  2D8J A;  2LP5 A;  2F2V A;  5EC7 A;  2DRM A;  3I5R A;  5IHN A;  1YP5 A;  2RNA A;  2KNB B;  1M3C A;  4K11 A;  2HEQ A;  1ZUU A;  1JO8 A;  1UG1 A;  3O5Z A;  4OMO A;  3UAT A;  3I5S A;  1Z9Z A;  1N5Z A;  2OJ2 A;  3H41 A;  1BB9 A;  3UF4 A;  2DLP A;  1BBZ A;  2GNC A;  1YN8 A;  2HCK A;  4JJB A;  2EYW A;  1W1F A;  2KRM A;  4J9C A;  1OPL A;  1UDL A;  1X2K A;  2FPF A;  2KT8 A;  4HVU A;  1FYN A;  2J6K A;  1WX6 A;  1CKB A;  3PE0 A;  3EG2 A;  3EG1 A;  2LCS A;  1ZLM A;  2FEI A;  2DIL A;  4RTZ A;  2M0Y A;  1AD5 A;  5GJW B;  3M0R A;  2K79 A;  1AZE A;  1JEG A;  2DL7 A;  2GQI A;  2X3W D;  2O2O A;  3H0I A;  2OAW A;  2MIO A;  2LQW A;  2BTT A;  3M0T A;  1NEG A;  4JZ4 A;  1X6B A;  2ENM A;  4HXJ A;  1S1N A;  2J6O A;  2KRS A;  4F14 A;  1SRL A;  4AFZ C;  4OMP A;  3VS3 A;  3REB B;  2JXB A;  4Z89 A;  1U5S A;  2DL4 A;  1UJ0 A;  3TVT A;  5IH2 A;  4RTV A;  1AWO A;  1YWP A;  2RQV A;  1SPK A;  2D1X A;  1VYV A;  2HSP A;  1M3A A;  2NUZ A;  2CT3 A;  5IXB A;  2EPD A;  2L3Q A;  1AWW A;  1OEB A;  1VA7 A;  1UFF A;  2EVR A;  1JQQ A;  1NG2 A;  5GJV B;  2RF0 A;  4Y92 A;  1X6G A;  1Z9Q A;  4J9E A;  1PKS A;  1AOJ A;  3VS6 A;  4CC4 B;  3TSW A;  2KYB A;  5IXF A;  4FSS A;  1PWT A;  2DBM A;  1OPK A;  1VYT A;  2J7I A;  2JM9 A;  2EGC A;  2YSQ A;  1E6G A;  2FPE A;  1PRL C;  1NM7 A;  2FO0 A;  2RMO A;  1X27 A;  3EHQ A;  2RQU A;  3NPF A;  2DM1 A;  2KXC A;  2V1Q A;  4KRT A;  2MOX A;  1AVZ C;  2A36 A;  1I07 A;  1QWE A;  2W10 A;  4IIM A;  2ECZ A;  1WXT A;  1X43 A;  1ZUK A;  4AFQ C;  2JW4 A;  2HBW A;  2RPN A;  1UHC A;  2DX1 A;  2AK5 A;  1GFC A;  2JMA A;  2PNI A;  2CSQ A;  4J9I A;  2EYX A;  2DJQ A;  4JZ3 A;  1EFN A;  1JU5 C;  1PRM C;  4OMQ A;  4AFU C;  1TUD A;  4JJD A;  2K7A A;  1J3T A;  2K3B A;  2EW3 A;  4J9B A;  4Z8A A;  1G83 A;  1KJW A;  3NMZ C;  3RNJ A;  3H0H A;  4ORZ A;  2RN8 A;  1B3Q A;  2JT4 A;  1GRI A;  2BZX A;  2VWF A;  3VS1 A;  5FW9 A;  2L2P A;  1W6X A;  2DVJ A;  1KIK A;  4AG2 C;  3GBQ A;  1ZX6 A;  1NEB A;  1SHG A;  2KXD A;  2GGR A;  2KGT A;  2JMC A;  3UA7 A;  4RTU A;  2CSI A;  1IO6 A;  4D8D A;  1NYG A;  2AKK A;  2YUN A;  1GCQ A;  2EQI A;  3KFV A;  2VKN A;  2H8H A;  4AG1 C;  2FG0 A;  2ED0 A;  2KBT A;  2EGE A;  1BK2 A;  2LMJ A;  2A37 A;  2AZV A;  1X69 A;  4CC3 A;  2BZ8 A;  1YNZ A;  2L3P A;  3I9Q A;  1PHT A;  1Y0M A;  2DF6 A;  1WI7 A;  2K9G A;  2JTE A;  1ZUY A;  4JJC A;  1U3O A;  1WIE A;  3PVQ A;  3THK A;  1ZSG A;  5HCK A;  1H3H A;  1SEM A;  1SHF A;  1E6H A;  4EIK A;  3ZL7 C;  1T0H A;  4CC2 A;  4OMM A;  2X3X D;  2CH4 W;  1GBQ A;  1QLY A;  2RQR A;  2GTJ A;  1E7O A;  1NLP C;  1X2Q A;  1AWX A;  1QKW A;  2L0A A;  4RTX A;  3UA6 A;  1UEC A;  1WXU A;  2YUO A;  3PVL A;  1HD3 A;  1KFZ A;  1UUE A;  2V1R A;  2GTO A;  5FWB A;  1SRM A;  1SSH A;  1ARK A;  2DE0 X;  2DL5 A;  4ESR A;  3JV3 A;  4HVV A;  1AEY A;  1GBR A;  1K4U S;  2DMO A;  2DYB A;  2YDL A;  4DEX A;  2M51 A;  2ROL A;  1TUC A;  1PKT A;  5IHI A;  2ED1 A;  1AWJ A;  3VRZ A;  2CT4 A;  2SEM A;  3M0S A;  1BU1 A;  1JXO A;  1UE9 A;  4RUG A;  1T3S A;  1QKX A;  3R6N A;  1WLP B;  4LNP A;  2O31 A;  1NYF A;  2I0N A;  2RQW A;  1GCP A;  2FRY A;  1FMK A;  4GBQ A;  5FWC A;  1ABO A;  2O9V A;  1MV3 A;  2L3S A;  2DRK A;  4J9D A;  4JPB W;  2CUD A;  4RTT A;  4AFS C;  1HSQ A;  4F17 A;  2EYY A;  3ULR B;  1GL5 A;  1NLO C;  2LJ0 A;  2JS0 A;  3VS7 A;  1M3B A;  1K9A A;  1H8K A;  4QT7 A;  1G2B A;  1I1J A;  1MUZ A;  2O88 A;  1XOV A;  2EGA A;  2KYM A;  1OV3 A;  2J06 A;  2OI3 A;  3QWY A;  2D8H A;  3FJ5 A;  2D0N A;  1T0J A;  1RLP C;  1K76 A;  2O9S A;  1GCQ C;  3EG0 A;  3EG3 A;  2KT1 A;  1TG0 A;  1JXM A;  2KRO A;  2DL8 A;  2EYZ A;  4CC7 A;  4ZNX A;  2LJ1 A;  2AKL A;  4GLM A;  3TSZ A;  4LE9 A;  3H0F A;  2A08 A;  2KRN A;  3REA B;  2BZY A;  2KR3 A;  2LZ6 B;  4WCI A;  3QWX X;  1UTI A;  3SEM A;  1QCF A;  4OML A;  3EGU A;  2DA9 A;  3VS5 A;  3CQT A;  2LQN A;  2CUB A;  2XMF A;  3VRY A;  4IIO A;  2YUQ A;  4M4Z A;  1HJD A;  1ABQ A;  3NGP A;  2G6F X;  1U06 A;  1WDX A;  1ZBJ A;  1M27 C;  1WA7 A;  2PZ1 A;  1W70 A;  1RUW A;  2LJ3 A;  2JS2 A;  3I35 A;  1K0X A;  4A63 B;  1B07 A;  4LUD A;  1V1C A;  3EHR A;  3SHW A;  1RI9 A;  2W0Z A;  2E5K A;  2EBP A;  2FPD A;  1OOT A;  4R0K A;  1K0S A;  4J9F A;  1YWO A;  5IHK A;  2ROT A;  3RBB B;  3VS2 A;  1CSK A;  2PTK A;  1M8M A;  1RLQ C;  4HCK A;  3IQL A;  2JM8 A;  4Z88 A;  2F2X A;  2GBQ A;  2ABL A;  2J6F A;  3M0P A;  2B86 A;  4LN2 A;  3VS4 A;  1LCK A;  1Y57 A;  1PNJ A;  4OMN A;  2IIM A;  2LNH B;  1WFW A;  3M0U A;  4J9G A;  1YCS B;  4J9H A;  2LX7 A;  4RTY A;  2CDT A;  2RQT A;  4HVW A;  4F16 A;  2C0I A;  2HDA A;  1M30 A;  2F2W A;  1AZG B;  2CRE A;  1KSW A;  2J05 A;  4D8K A;  2P4R A;  2SRC A;  5ECA A;  1T3L A;  3LH5 A;  2FRW A;  1UGV A;  2DL3 A;  4X1V A;  1WXB A;  2YUP A;  1I0C A;  2C0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...