1ABQA

Crystal structure of the unliganded abl tyrosine kinase sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
LFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Kinase
molecule keywords ABL TYROSINE KINASE SRC-HOMOLOGY 3 (SH3) DOMAIN
publication title High-resolution crystal structures of tyrosine kinase SH3 domains complexed with proline-rich peptides.
pubmed doi rcsb
source organism Mus musculus
total genus 10
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1abqA00
3GBQA 1K0SA 2DRKA 2KE9A 1GL5A 2VKNA 3H0FA 2LJ3A 2DYBA 1K76A 1YP5A 3EG1A 1AEYA 2W0ZA 3IQLA 4AFZC 2F2WA 2RMOA 4RTXA 2DX1A 2LJ0A 4CC4B 2LCSA 2FPEA 1IO6A 1UHCA 2B86A 4A63B 3CQTA 3LH5A 2IIMA 1UFFA 1H3HA 4AFQC 1QWEA 3H41A 3ZL7C 1G2BA 1YN8A 4OMNA 4JZ3A 2FRWA 1YWOA 1OOTA 1AWJA 3TSWA 5IHKA 1SRLA 2LQNA 4F17A 3O5ZA 2LMJA 1KIKA 4E6RA 4RTTA 4Z8AA 1HJDA 1ZX6A 2KXCA 1T0JA 2QDLA 3RNJA 2K9GA 2DNUA 5ECAA 2CUBA 1JXOA 1A0NB 1AWXA 2LP5A 1X43A 2SRCA 5L23A 4IIMA 4ESRA 3M0RA 3I9QA 1YNZA 4QT7A 1J3TA 5HCKA 1VYVA 3VS6A 2J7IA 2JMCA 4FSSA 2OJ2A 1NG2A 2EBPA 2O31A 4GBQA 2CH4A 1ZUUA 4R0KA 1KJWA 2A28A 4K11A 2DL7A 4WCIA 2OAWA 3UATA 2CUDA 3REBB 2J6KA 2DJQA 4Z89A 1W1FA 3KFVA 3NPFA 1UGVA 1K0XA 1M3AA 1B07A 2BTTA 1UG1A 1RLQC 4J9IA 4CC7A 1UJ0A 1CKAA 2GTOA 1YWPA 2CSIA 4EIKA 2C0IA 2LZ6B 1MV0B 4J9CA 3M0TA 3EG3A 2CREA 2VWFA 1T0HA 1WLPB 1WFWA 1GCPA 2X3XD 4OMLA 4JJDA 2EQIA 3UA6A 2XMFA 1UUEA 2CSQA 3VS0A 2EGAA 1N5ZA 1T3SA 3QWXX 1UJYA 1ARKA 3TSZA 1ZUYA 1SRMA 2AZSA 2EGEA 1GBQA 4Y92A 3NGPA 1GCQA 2RPNA 1KSWA 1JO8A 4M4ZA 1OEBA 4ORZA 2ROTA 2RQRA 4RTUA 2RNAA 2D1XA 2DMOA 2X3WD 4GLMA 2W10A 2JT4A 5IXFA 2ESWA 1Y0MA 2KGTA 3QWYA 2DVJA 3U23A 1M3CA 2YT6A 1U06A 1PRMC 2DL4A 1M30A 5IHNA 1UECA 2AKKA 2KRSA 1K4US 2JMAA 2KRMA 5I11A 2ECZA 1WIEA 1W6XA 3PVQA 2C0TA 2V1QA 4RTWA 2HCKA 2DL8A 4OMPA 4J9GA 2L3QA 2RN8A 2H8HA 2D8HA 1X2KA 2MOXA 1UDLA 2F2VA 2CT4A 2E5KA 1NLOC 4J9DA 4RTVA 2LNHB 2J6FA 3VS5A 2O2OA 3H0HA 2YDLA 1UTIA 1GRIA 1AWWA 2K3BA 1AZEA 1CSKA 3VS1A 2JM8A 1B3QA 1MV3A 1KFZA 1ABQA 2RQVA 1PKSA 2DBMA 2D8JA 2FEIA 2M0YA 4LE9A 1E6GA 1OV3A 2JTEA 4HXJA 4F16A 4HCKA 2K2MA 1NM7A 1GCQC 1TUCA 2PZ1A 3RBBB 1PNJA 1WXUA 4LN2A 3ULRB 4JPBW 1K9AA 1GBRA 5EC7A 2MCNA 2DBKA 5IXBA 2SEMA 4RTZA 2L3PA 3VS3A 1JXMA 2D0NA 3EG2A 4LUEA 1SHGA 2FG0A 2HSPA 2DA9A 5FW9A 3FJ5A 1X6GA 3SEMA 2K6DA 4CC3A 2FPFA 1S1NA 2YSQA 3I35A 1Z9ZA 2ED1A 1ZLMA 2EVRA 1ABOA 3A98A 1X2QA 2LX7A 2RQTA 2JM9A 4RUGA 3I5RA 1Z9QA 2EGCA 3PVLA 4J9HA 1HSQA 1SHFA 2RQUA 1RUWA 3SHWA 2K79A 1FMKA 1HD3A 1M27C 2GQIA 2YUPA 3EHQA 5GJWB 2KT8A 1SPKA 1E7OA 1ZUKA 1X27A 4J9BA 2EYXA 1OPLA 1QKWA 1W70A 1H92A 2J05A 2ROLA 2I0NA 2DL3A 1QWFA 3EG0A 4D8KA 2GGRA 2KEAA 2KYBA 2FRYA 2G6FX 1MUZA 2ABLA 2BZYA 4KRTA 2ED0A 4X1VA 1T3LA 4JJBA 3VS4A 2LQWA 3M0UA 1PWTA 2DILA 1SSHA 2KROA 4DEYA 3VS2A 2RQWA 3H0IA 3M0PA 1BK2A 4HVUA 1JQQA 3UF4A 1TUDA 3THKA 1LCKA 4LNPA 1E6HA 2DLPA 2JW4A 1OPKA 1UE9A 1K1ZA 2CT3A 1SEMA 5FWCA 1AZGB 2NUZA 1WDXA 1CKBA 2DRMA 2L2PA 3JV3A 4CC2A 2KR3A 1BBZA 1I07A 2CDTA 3EHRA 4AG1C 1TG0A 1GFDA 3EGUA 2BZ8A 3R6NA 1PRLC 1U5SA 2DM1A 4ZNXA 2EW3A 2LJ1A 2J06A 1QKXA 1WA7A 1I1JA 2EYZA 3UA7A 4RTYA 2JS2A 5IH2A 1VYTA 1AD5A 2HDAA 2FO0A 2A37A 1PKTA 5IHIA 2DE0X 1H8KA 1Y57A 4JJCA 2GBQA 4AG2C 2V1RA 2FPDA 2JXBA 2A36A 2JS0A 2CH4W 4HVVA 1RI9A 2KT1A 1RLPC 4F14A 1U3OA 2EYWA 3REAB 2EKHA 2L3SA 3I5SA 2F2XA 1BU1A 1AVZC 1V1CA 2AZVA 3VS7A 2AK5A 2PNIA 4JZ4A 1EFNA 4Z88A 2KBTA 4HVWA 2KNBB 1UHFA 1AWOA 2GTJA 1AOJA 4OMQA 2L0AA 5I22A 1VA7A 4DEXA 2O88A 4J9FA 1FYNA 2KXDA 2DF6A 1ZSGA 1WI7A 1X6BA 1WXTA 3C0CA 2KYMA 2C0OA 1I0CA 1ZBJA 1M3BA 2OI3A 2J6OA 4LUDA 2GNCA 1WX6A 4AFUC 2P4RA 2KRNA 4J9EA 2HBWA 1QLYA 2O9VA 1GFCA 2RF0A 4IIOA 3TVTA 1NEBA 3NMZC 3M0SA 4OMMA 2EPDA 3NHNA 2M51A 2NWMA 2O9SA 2MIOA 1NEGA 2HEQA 4OMOA 2A08A 3VRYA 5GJVB 2EYYA 1NLPC 2BZXA 1JU5C 5FWBA 1WYXA 1BB9A 4AFSC 2VVKA 1QCFA 2YUQA 2DL5A 4D8DA 1NYGA 2K7AA 1PHTA 2ENMA 1NYFA 1M8MA 2YUOA 3VRZA 1G83A 1WXBA 2YUNA 1X69A 3PE0A 2AKLA 1XOVA 1VYUA 3M0QA 1YCSB 2PTKA 1JEGA
chains in the Genus database with same CATH superfamily
4NS5A 4BY6B 3S3OA 4FYVB 5KYWB 2VB6A 4HA8A 2K5FA 9ATCB 1K8AR 1AEYA 3CC7A 1VQ5T 4IUPA 2RMOA 1VQPA 3WVDB 1Q86U 1WHJA 5FROA 3AT1B 4M7AA 1KK7A 1IO6A 4MDWA 4XTUA 3LH5A 3VJPA 2IIMA 1NZ9A 3RESA 1H3HA 3QUIA 1TH7A 1X01A 2FRWA 1YI2Q 1OOTA 5LJ3g 1RAGB 4PJOF 3TSWA 1YHQA 1VQ6A 3CCLQ 3O5ZA 4C5EA 3MCAB 4C5HA 4FCYA 1YITT 4B9XA 2KXCA 4J5YA 1VOMA 3I55T 3S3NA 3PNWC 4LD9K 1M9SA 2DNUA 4J6YA 2RHUA 2LT4A 3QZ9B 1PD0A 4FW2A 1F1BB 2EQMA 1RL2A 2P0QA 4PL6A 2X4WA 1TOVA 5KH6A 3VUBA 5GAN2 1OU9A 1WGSA 1X6OA 2WSFE 5CKHA 3PMIA 2QASA 1D09B 2A0FB 2CZ6B 4IUTA 1NPPA 3HTRA 4C0DB 1RADB 2H3JA 2V8JA 2DL7A 1WHLA 3UT1A 1W1FA 2OTJA 4HCBA 1XQHA 5LJ5d 3CD6Q 2VXEA 1K8AC 1M3AA 3UWNA 1QVFA 3C94A 2D0QB 2CSIA 4EIKA 1OYXA 2COWA 3M0TA 3EG3A 4OB1B 4M7AC 2VWFA 3QDFA 3PIPA 3EFOB 3MJXA 2ATCB 1WFWA 3G71A 2XICA 3UA6A 1BCMA 2XMFA 2EGAA 4JJNK 1QCOA 2QEXQ 1ARKA 4NL2A 2MWOA 5KCOA 2AZSA 3NGPA 3OS0A 3OQ5A 4PJOA 4CRIA 4LDUA 1IHWA 4BDZA 1JO8A 2M1HA 3META 4LD6A 3RMQA 1OEBA 2ZPEB 4IURA 2RQRA 2D1XA 2DMOA 3GNGA 2M02A 2DKGA 2W10A 2RO0A 3T9NA 4HCZA 4M7DE 1Y0MA 2KGTA 3QWYA 4L5GA 2RJEA 5CO7A 4N4IA 3QDRB 5FLXE 2AKKA 1K4US 3I56T 2CP5A 1D0YA 5CKFA 2C0TA 2HCKA 1WHKA 2O4XB 2QGFB 3FEOA 3JCMX 3EFRA 2H3EB 2DPPB 3HRUA 1PC0A 1YITQ 2DL8A 4OMPA 1AHJB 4J9GA 2DEQA 1X2KA 1ZSZB 3KUFA 2MOXA 4XQ3A 2HQHA 2E5KA 2VGMA 2OAUA 1Q95G 3HKSA 3KXTA 2WSCE 2J6FA 3H9NA 2QYZA 4A4HA 3P8HA 2KDSA 4OF1A 4KUIA 4XTWA 4EDUA 3VU3C 3CMAT 1KFZA 5IAYA 1PKSA 2D8JA 3A1PA 3SDZA 1YJNT 4FIBA 2JTEA 4HXJA 4F16A 1YCYA 4HCKA 4NL3A 2EYQA 4C92D 1G3SA 3M58A 2K2VA 1TUCA 2PZ1A 2VASA 1PNJA 4M7DF 1Y96A 1OI1A 2OX7A 4BB7A 1TUGB 4RTZA 5KCHA 2YRCA 1VQ9A 2CP6A 1V29B 3FJ5A 1NJIC 2CGHA 4CC3A 2CP2A 2C06A 3I35A 1Z9ZA 1ZLMA 3QG1A 3HPWA 4FT4A 3L2QA 3A98A 4A4FA 2LX7A 2DYIA 4OP0A 2D6FA 4QKUA 5GAOq 1H641 1Z9QA 5GAMe 1YI2A 2RI3A 3PT9A 1SHFA 1RUWA 3SHWA 2K79A 1WHGA 4KGXB 5GJWB 2KT8A 3OYJA 1SPKA 4C8QF 1X27A 2NUPB 5CQYA 2R58A 1QKWA 2JUFA 2YLBA 1H92A 2D9TA 2HL3A 1MNEA 3JCMP 2DL3A 4D8KA 1VQPT 3VYHB 2JNGA 2P4TA 3JCMe 3J7AF 2KYBA 1VQ8T 3BE3A 2QQAA 2ED0A 4X1VA 3VS4A 1PWTA 2RK1A 4RKUE 2DILA 1UB4A 1SSHA 3P8DA 1HYOA 2RHZA 1YIJT 3M0PA 3I56Q 3CXCP 5GAN7 4HVUA 1JQQA 3UF4A 4B6MA 1K73U 5GAN5 4F7UG 2LQ8A 1Q7YR 2JW4A 4ZGEB 1OZ2A 1OPKA 1UE9A 1K1ZA 4XTZA 3TEEA 1CKBA 2L2PA 4CC2A 4JRPA 4M7DA 2V8IA 2B8AA 1BI0A 1GFDA 3EGUA 3V8LA 1UEBA 2BZ8A 2CP0A 5HK3A 2YRVA 2RM4A 2E6ZA 4BD3A 1TWBA 2IPOB 1VQNA 2E41A 4MMLA 3CMAQ 4DOVA 2NUTA 3UA7A 3OYFA 2LDMA 3G6ET 4BUGA 4F7UB 2DEUA 1D3BB 1VYTA 1O9SA 2MMPA 2OTJT 2FO0A 5FU7C 3CC2T 3DLMA 3ZBDA 1IZ6A 3EGXA 2JXBA 2EQJA 2PQWA 2JS0A 4XU3A 3MP8A 1RI9A 4F14A 1U3OA 2EKHA 2L3SA 2WSEE 3A8MB 1BU1A 1VIEA 4F04B 1AVZC 3G1JA 2ZGWA 2A7YA 2KBTA 3EH2A 1Q7YC 2EKOA 5I2MA 4N4GA 2L0AA 1VA7A 2CP3A 2O88A 4M7DC 4E2FB 2DF6A 1ZSGA 4X34A 4M78C 3SB2A 2CKKA 5LJ5f 4LUDA 2GNCA 5KE2A 2QA4A 3QZ5B 1QLYA 2O9VA 3LW5E 3TVTA 1Y7XA 1NEBA 3CCVQ 1OX9A 3JCMh 4OMMA 1VQ8Q 2O9SA 1NEGA 2HEQA 4FYXB 5GAN6 2CZ7B 5FU6C 1Y07A 4BE1A 2KI7A 1JJ2S 1WYXA 2HQEA 1BB9A 4AFSC 2VVKA 1YIJQ 3MEVA 1QCFA 1QVPA 2HQXA 4D8DA 3FIFA 2DVEA 2QI2A 1QMCA 1R0CB 2CP7A 3CEYA 1M8MA 3CCQA 3OYLA 2YUNA 1X69A 3OBYA 4PJLA 1D0ZA 1VQKA 1D1AA 5GANe 1FMVA 3OW2P 1KQSS 5CK9A 4M75E 4P5NA 4C0GA 2DRKA 5I21A 1M90U 3L1AA 1M2OA 3RKXA 2VKNA 2FB7A 4C92G 2LJ3A 2EJGA 3CCJA 3CCMT 4JLIA 4AFZC 4KUDK 1M4ZA 3CCRT 3G6EQ 2NLUA 2LJ0A 3OY9A 4CC4B 2LCSA 3JB9I 2B86A 4A63B 3CQTA 4M78G 1UFFA 4MZMA 3CC2Q 4AFQC 1QWEA 1YN8A 3G4SA 3EAEA 3LYIA 4M77C 5CQXA 5GMKi 1EIFA 4C92B 1SG5A 2XIDA 2LQNA 1VQOT 4KH1B 4Y28E 1Q82R 4Z8AA 1HJDA 3RNJA 1A0NB 1VQ7A 1AWXA 1N9SA 3FDRA 5KYYA 3X26B 1I5OB 3M0RA 1YNZA 3KBGA 2RJDA 1M1FA 3J80E 5GANj 5HCKA 3JB9F 3LWHA 2L5QA 1VQLA 2KSSA 2OJ2A 4QVCA 4R0KA 2KY9A 4M7AD 1YJWA 1KJWA 4K11A 3UATA 4PNOA 3REBB 3M59A 3EFOA 4N4HA 2A3LA 3KFVA 2MPXC 2F5KA 3CMET 1N27A 2BTTA 1D0XA 1HXDA 1UG1A 1RLQC 4LDXA 3M4YA 2JZ2A 3OA6A 1CKAA 2C0IA 2YLCA 5GMKl 3MEUA 2E64A 4BDYA 4L6V5 3QYGB 1GCPA 2X3XD 3M55A 4JJDA 4M77G 2EQKA 4RCBA 3CCSA 3QWXX 2HSEB 1Q82C 3C4SA 3CCEQ 2EGEA 1VQMA 2QQ9A 5GANh 5LJ5g 5CIUA 4FYYB 2CS7A 3CCMQ 1VQNT 2ROTA 6AT1B 1W2BP 2RHYA 1UGRB 2RNAA 1WHMA 3X25B 2PU9B 2QK0A 2X3WD 3CC4A 1I81A 2JT4A 3HFOA 4F7UE 3U23A 1M3CA 2L89A 4M75A 3VYGA 1ZSZA 1M30A 5IHNA 1N8RR 2KRSA 2ZZDA 1IHVA 1RI0A 3J81E 2ECZA 2E3IA 2DETA 4XAXB 1M1GA 1VQOQ 2L3QA 1RAFB 2H8HA 2D8HA 1QVGS 1U1SA 3CPWP 3A8GB 3QBYA 1NLOC 1JB0E 1BIBA 1I8FA 2CZ0B 2DIQA 2YDLA 2AT1B 3CCUA 2K3BA 3V7RA 3VS1A 3AHUA 2RJFA 4PFZA 2RQVA 3JCMb 1PCXA 2M0YA 1E6GA 4BE2A 3CXCA 3ME9A 5HKCA 2K2MA 2VV5A 2DERA 1NE8A 2F5TX 1PSEA 1YJ9A 1WXUA 4F7UF 1K9AA 1JRIA 5AYFA 3CMEQ 2MCNA 5KYUB 4PK4A 4BACA 3E9FA 3OYYA 3OYAA 3FRNA 1PD1A 4LUEA 1RAIB 2DA9A 4EMKA 4M75C 8AT1B 2DXTA 1Q81R 3EFSA 3SEMA 1N8RC 1G8XA 2LQKA 4DQ2A 1UGPB 2X35A 5HY6A 3TQ7P 5A2QE 5A0LA 2XDDA 1ABOA 1UGSB 2DTHA 4E7IA 1B34A 4PJMA 4KT0E 1TU0B 2CZ1B 4A4KA 2K3YA 4FT2A 3FJPA 2YWWA 2L8DA 3E2UA 5LJ3e 2Y90A 3TCJA 3L2UA 2DXUA 2GQIA 1E7OA 4OGEA 1X75C 3QIIA 4RG2A 3BW1A 3CCJT 4ELYC 1BI2A 3P8BB 1KQ1A 4ZTJA 2LRQA 2ROLA 5DLQE 1FXXA 2JJ9A 3EG0A 3EG9A 3OS5A 2MI6A 2GGRA 4KH0B 1M2VA 3QJ6A 5D7UA 3DB3A 2QGGA 1MUZA 2BZYA 3JSCA 2PVGB 1VQ5Q 5IN1A 3RMSA 4DBRA 5HK0A 1LPLA 3G4ST 2RQWA 5DY9A 3HFNA 2LX9A 1TUDA 5J26A 4JLGA 4LNPA 5A0GA 3JB9J 4C5GA 2O01E 4OB2B 3JV3A 4F7UA 4EMKC 2R57A 1VQ4A 1Q81C 4M7AG 1M1KR 3I55Q 2XU8A 5KYXB 1TG0A 3R6NA 1PRLC 1I5LA 2EW3A 5LJ3j 4DA4A 2LJ1A 2OTLA 3OYGA 3JCMJ 1FWZA 4RTYA 4QQGA 2DFUA 1AD5A 2X4XA 2RI2A 4C8QE 1PKTA 3ZEHA 1WQWA 1H8KA 1Y57A 1R8OB 1B7TA 5I2SA 4PJOC 4A53A 1SKUB 1S72T 4M7AB 4VUBA 3OW2A 2COZA 2FHDA 4C92F 3NTHA 2Y4XA 4M7DD 2ZPIB 1RLPC 1RACB 4LXCA 3I5SA 4M78D 2AZVA 2ZPBB 4O5VA 4JZ4A 4Z88A 2ZPGB 4HVWA 2Y4YA 2MAMA 4BE0A 1K9MR 4WF2A 2GTJA 4PKCC 5C0MA 1AOJA 2F69A 4OMQA 5I22A 1QVGP 4A4EA 2YRDA 3JRZA 4J9FA 5LJ3h 1EX4A 3JCMc 2BE7D 1WI7A 1WQ7A 3BDUA 2VGNA 4FM4B 1M1KC 2KYMA 1M3BA 4EMHA 4AFUC 4GY5A 3X24B 2EJ9A 3CCLA 1MMDA 4J9EA 1PM3A 2P0KA 2HBWA 2E10A 3FC3A 1G5VA 3M56A 4IIOA 5FRMA 2P0PA 2QQRA 3NMZC 1OU8A 3A8LB 3CC7T 2EPDA 2M51A 4PFPA 2NWMA 1KD1R 3CBOA 3FLGA 4OMOA 2MK5A 1MMGA 2E12A 1NLPC 1JU5C 4ZN1A 5FWBA 1G3YA 4PJOG 3OYKA 1PHTA 2ENMA 4XTVA 1WHHA 2YUOA 3VRZA 2COYA 1R0BG 3M54A 4E7HA 1YHQT 2KQWA 1VQ6T 3HL8A 3LH0A 2PTKA 3FB9A 1K0SA 2VXFA 2DO3A 2V8KA 3CD6A 4C0FA 2DYBA 5CAIA 1YP5A 3CCUT 3EG1A 3JCMd 4M77D 4ELZC 2EJFA 1Q86R 1K8AU 1K9MC 3OS2A 5CKDA 1RAAB 4XTYA 5GAMj 2DX1A 3NFCA 3SFMA 3E9GA 2DK3A 3PGGA 1YJ9T 3V8JA 1YJNQ 3H41A 4II1A 3SWNA 3JCMW 1G2BA 4OMNA 3GIBA 4JZ3A 3QXEB 1AWJA 2QEXA 4V2SA 1S72Q 4ZGJB 5IHKA 5KYNA 4PFOA 2QQBA 4F17A 4E6RA 1KG1A 1ZX6A 1KD1C 2K9GA 2CUBA 2LP5A 2SRCA 4HKEA 1PSFA 4RCCA 4C8QA 1W2BA 4QT7A 3C12A 2PUKB 3F70A 3PFSA 1R77A 1VYVA 3G71T 2J7IA 2JMCA 2MYSA 3N5BB 3M9QA 4E7KA 4FSSA 1NG2A 2EBPA 2DD5A 2CH4A 1ZUUA 2A28A 4WCIA 4E7LA 5GAMh 2IG0A 1UGVA 2DZCA 2E3HA 4MZPA 1B07A 4RMOA 1YITA 3WXMB 4KGVB 4Q5WA 1Q86C 4J9IA 3CC7Q 1UJ0A 5AT1B 3CPWA 1YWPA 5J39A 2LZ6B 4J9CA 1RAHB 1VQPQ 2GFUA 2CREA 1T0HA 1WLPB 3OYHA 1QCNA 3JAME 5GAOl 4OMLA 5D6WA 4E7SA 3SWNC 3OYNA 3L2WA 3PMTA 3VS0A 1N5ZA 4HT9A 1KQSA 3JCMV 5KYWA 3TSZA 1YHQQ 4JS5A 1VQ6Q 3WVEB 1IRXA 5CR2A 4IUUA 4HCCA 4E47A 5GMKm 5FRNA 1M8VA 1Y71A 4C8QC 5KE3A 2E70A 2OTLT 1TXQA 3MEAA 4FU6A 4RTUA 4A54A 3M53A 2FZCB 4LDVA 3OYBA 2JVVA 4GLMA 3OMGA 5FU7B 5IXFA 2E5QA 2KAFA 2DVJA 4JRIA 2YT6A 1U06A 2DL4A 4OMFB 4M7DG 1NJIU 4J83A 2JMAA 5I11A 1XTDA 4GLKA 1WIEA 1W6XA 2LCCA 2OTJQ 2V1QA 4RTWA 4X9CA 3S6WA 5GANd 1N6AA 4J8OA 2RN8A 2ZCFB 3LX7A 1VQ9T 4OGCA 4XK8E 4LDWA 4J9DA 2LNHB 3VS5A 3OSVA 3G71Q 5GMKe 4M7DB 1GRIA 1XNIA 2X4JA 4FW1A 1AWWA 3JB9H 2JM8A 1B3QA 2LCLA 1ABQA 4M78B 2DBMA 2FEIA 3GOXA 3EGDB 1IXDA 1OV3A 1YI2T 4M75D 3I56A 3DKMA 2RA2A 1BIAA 1ZA2B 2XK0A 3RBBB 4JPBW 3JB9D 1YFNA 1BKBA 2K5IA 1GBRA 5EC7A 5GAOp 1ZBXA 3OYMA 5FU6B 2SEMA 2L3PA 3VS3A 1JXMA 2JOYA 2D0NA 3V7CA 2FG0A 4M7AF 2HSPA 4PLIA 1JBMA 5FW9A 4KULA 3QSUA 2K6DA 2FPFA 3EGXB 2V26A 2JTMA 2EVRA 3HRTA 3CMAA 1X2QA 2JTFA 7AT1B 2JM9A 4RUGA 4CI0C 3I5RA 2EGCA 4TVRA 3PVLA 1ZA1B 3D7SB 2G3RA 3RDVA 3X28B 2YUPA 5GMKj 1QP3A 1ZUKA 1SSFA 2HMAA 4HT8A 4J9BA 2EYXA 2HZYA 4C0DC 1W70A 4N0AA 2EAYA 4ZGDB 2ZPFB 2J05A 5M9OA 1QWFA 4ATOA 2KEAA 4LDYA 2FRYA 4J7FA 1MHNA 1OULA 4KRTA 1QQJA 2O4XA 4JJBA 3CCRQ 4M77B 1BCOA 4DEYA 1K73R 3H0IA 4NOYA 1BK2A 3ZFJA 5CCAA 3THKA 3Q1JA 1E6HA 5GAMf 1OQKA 2DLPA 3H6ZA 1MNDA 1ZQ1A 3RUXA 1QVGA 1Q7YU 1AZGB 2DRMA 2QXFA 2GFAA 4BI8B 2PUOB 1BBZA 1VQ9Q 5D6XA 3EHRA 1U5SA 5D6YA 4AMCA 1JJ2P 2RD1A 4IUVA 3JCMf 2DM1A 3X20B 2QQSA 4ZNXA 3QPHA 4AT1B 4PJOD 3CCVA 1P92A 3GLXA 4QW2A 3OMCA 5GMKh 3A5ZB 4C0ZA 1VQ8A 2QG9B 1QKXA 1WA7A 2EYZA 2FL7A 5CKBA 2I2LA 4MZTA 1W4SA 4C5IA 1YIJA 1M5Q1 2WACA 2GQVA 2HDAA 2RHIA 1U8RA 2LNVA 1KQSP 3NTIA 3OYIA 1HK9A 4JJCA 2GBQA 4N0AC 2M0OA 2PVOB 5LJ5e 2A36A 5GAN4 5GAN8 2QA4T 3MP6A 2HKQB 2DXBA 3V7SA 2CH4W 2QAZA 2M9UA 3OSSC 1TS9A 4Y91A 2EYWA 3REAB 5L8RE 2DAQA 2DTOA 2RHXA 1K73C 3G7ZA 2DJZA 3RR6A 1V1CA 2XD0A 3VS7A 4JS4A 1WZOA 2AK5A 1ZSZC 2XHCA 2NUPA 3G6EA 2KVQG 1UHFA 5KYYB 1AWOA 3CCQT 4DEXA 1KC8U 1FYNA 3CC2A 3CXCS 1VQKT 3M5AA 3GPLA 1WXTA 3C0CA 2C0OA 2XKOC 2J6OA 4IUQA 1WX6A 2AIRB 2R5AA 3GP8A 1WJQA 1GFCA 2RF0A 3M0SA 4IKFA 1VQNQ 3NHNA 2MIOA 1QVFS 1QW1A 2A08A 3VRYA 2BIVA 4XU1A 5GJVB 4MDXA 3BDLA 2BZXA 5LJ5j 3PTAA 2YUQA 2DL5A 4YTLA 2DD4A 3LLRA 2K7AA 2E6NA 1WXBA 4E7JA 1IREB 3OBWA 3PE0A 2AKLA 2EQUA 5LJ3d 1VYUA 3ASKA 1YCSB 3UDCA 2RI5A 1EZZB 4C92E 3GBQA 1M90R 3A8OB 1GXIE 2KE9A 2DIGA 4M75G 3OYCA 2BE9B 3H0FA 1VQ7T 1GL5A 2VYTA 4JRKA 5J3BA 1D3BA 1K76A 2HD0A 1NPRA 3JB9G 2W0ZA 5GAOr 1NJIR 3DLLA 2BKDN 3IQLA 2F2WA 4M78E 4RTXA 2FZKB 2VUBA 2FPEA 1UHCA 4XU2A 1VQLT 4RG8A 2KK4A 5GAMg 1YJWT 3ZL7C 2E4HA 3RKYA 3NTKA 1YWOA 1LVKA 4R55A 2IVWA 5LJ5h 4FYWB 4M75B 1SRLA 5GANf 2QA4Q 3CCEA 2LMJA 1KIKA 3MO8A 4RTTA 4Z02A 1T0JA 2QDLA 1Q82U 4E7ZA 5ECAA 1JXOA 1X43A 2VC8A 3JCMg 5L23A 4IIMA 3CCMA 4ESRA 3I9QA 3S3MA 8ATCB 1J3TA 1NBEB 3CCRA 3VS6A 4XTXA 3GNFB 3CCST 3OYEA 3CCQQ 2O31A 4GBQA 4FSXA 1G3WA 1M90C 3L2ZA 1VQKQ 2OAWA 1C1AA 2CUDA 1VQMT 2J6KA 2DJQA 2K4YA 4M78F 4Z89A 2NYSA 3LGLA 3NPFA 2JN0A 4DOWA 1K0XA 2HKNA 1VQOA 3CCJQ 3INZA 1UGQB 3OW2S 3O8VA 2QTXA 4CC7A 2GTOA 1MV0B 3CC4T 2P84A 1IGUA 4WTOB 4M77E 2XG8D 3A8HB 1YBYA 2K5LA 2DXCA 3CPFA 4C8QD 2EQIA 1UUEA 2CSQA 2HBPA 1T3SA 3G4SQ 1UJYA 4EMKB 1MGQA 1LNXA 2Z0WA 1ZUYA 1XJWB 1SRMA 2X51A 4Y92A 1GBQA 3DB4A 3RKWA 3UPUA 5GAMd 1WJSA 3QYHB 2CYZB 1B34B 1GCQA 5DLOA 1H3ZA 2RPNA 1VQ7Q 1KSWA 2DTIA 2LVMA 2RK2A 3CMEA 3HHTB 3QHSA 4M4ZA 5GAOm 3CCVT 4ORZA 1SF9A 4ZN3A 1ZHIA 4D6WA 2E1HA 2RH2A 4DBFA 2ESWA 2MWPA 1VQLQ 1PRMC 4C92A 4EMGA 1IB8A 4PJOB 1UECA 4PJNA 1YJWQ 2R5MA 3EG9B 2KRMA 1N8RU 3E19A 1M2VB 4EPCA 3PVQA 4M77F 1RAEB 1OX8A 4A4GA 1FMWA 2BUDA 2FYKA 2EWNA 3SD4A 1QVFP 4M78A 2MF2A 3EGDA 3QKJA 1BI1A 2XI9A 1UDLA 2F2VA 2XDBA 2CT4A 3QO3A 2K3XA 3OB9A 4RTVA 2O2OA 3H0HA 1UTIA 2HNIA 5EG2A 2FVUA 1AZEA 5DM7R 1CSKA 3CCSQ 3BY7A 1MV3A 1VQ5A 1VIFA 4LE9A 2QTVA 4DBHA 3M4GA 1VQMQ 1NM7A 1GCQC 4ZTFA 4LN2A 3ULRB 3C95A 4BI3A 5GANg 1BI3A 2RB6A 2DBKA 5IXBA 3L2VA 3HSBA 4OVAA 3EG2A 1SHGA 3ER0A 3CC4Q 4QQ6A 3I55A 1X6GA 4C92C 2M16A 2EIFA 1JJ2A 1W2BS 1S1NA 2YSQA 1Q81U 1Y96B 2ED1A 1KC8R 3L2RA 1KHIA 2KMTA 2RQTA 4B9WA 4UC4A 1C0MA 4J6XA 3EH1A 4J9HA 3VKIA 2EFIA 4ANJA 1HSQA 2RQUA 1FMKA 1HD3A 1M27C 3EHQA 1KQ2A 2LC4A 3LGFA 4M77A 3MEWA 1VQ4T 1OPLA 4QVDA 3TU4K 3GF5A 3JCMQ 1TTHB 2X9HA 2I0NA 4PJJA 3CPWS 2GF7A 4XU0A 1TSFA 2G6FX 3CCUQ 2ABLA 3MKDA 4DBQA 4J7IA 4PLLA 2HL5C 5LL6S 1T3LA 2LQWA 3M0UA 3E1SA 4O6JA 2KROA 3VS2A 3OS1A 2XDPA 1YJ9Q 2LT1A 1LCKA 1QP2A 3CCET 3M57A 4MMKA 2CT3A 5LJ3f 4KGZB 1SEMA 5FWCA 2NUZA 3OYDA 1WDXA 3QJYA 4M7AE 3TREA 1I4K1 2KR3A 2K57A 1I07A 2CDTA 4AG1C 3CBPA 3RIRA 1M1KU 1KC8C 3R6OA 2J06A 2ZPHB 2X4YA 1I1JA 4JRQA 2JS2A 4BY6C 5KYUA 5IH2A 2LTOA 2AHJB 1LOJA 2A37A 5IHIA 4OB3B 2DE0X 1ACMB 4L59A 4QQDA 4QVZA 3VUZA 3HRSA 4C8QG 4AG2C 4OB0B 2V1RA 2FPDA 4JDSA 3CCLT 5GAOn 2NUTB 5A0DA 3SWNB 2ZAEA 4HVVA 4M75F 2KT1A 3H8ZA 4JUVA 2E65A 2F2XA 4KBMB 2PNIA 2QDYB 1EFNA 2L3RA 2RJCA 4ME7A 2KNBB 2HAXA 1IGQA 2YXYA 1WNLA 1V76A 1KHCA 2YHTA 1K9MU 1MMNA 5C6SA 4C8QB 5CVIA 3BFMA 1YJNA 2KXDA 4X9DA 1X6BA 1I0CA 1VQ4Q 1ZBJA 2OI3A 1S72A 3LWIA 1AT1B 1O75A 1PG5B 2FZGB 2P4RA 3VV0A 2KRNA 1OZ3A 1FX7A 3CD6T 4BI4A 4R56A 1C6VX 3CBMA 2DZ9A 1WJRA 3RERA 4J6WA 1MMAA 1U1TA 1WPYA 5IT9E 5GAN3 2OTLQ 1D1CA 3V8KA 5CKEA 3PIOA 1KD1U 4PJOE 4FL6A 2EYYA 3L42A 1N9RA 3MP1A 1RABB 1NYGA 3URGA 2GCXA 1NYFA 1VUBA 2PVDB 5KYXA 1G83A 3HP9A 2QEXT 3MHXA 1DJ7B 1G3TA 1BYMA 1XOVA 2F1LA 3M0QA 3MPUB 1LJOA 1D1BA 1JEGA
chains in the Genus database with same CATH topology
3GBQA 1K0SA 2DRKA 2KE9A 1GL5A 2VKNA 3H0FA 2LJ3A 2DYBA 1K76A 1YP5A 3EG1A 1AEYA 2W0ZA 3IQLA 4AFZC 2F2WA 2RMOA 4RTXA 2DX1A 2LJ0A 4CC4B 2LCSA 2FPEA 1IO6A 1UHCA 2B86A 4A63B 3CQTA 3LH5A 2IIMA 1UFFA 1H3HA 4AFQC 1QWEA 3H41A 3ZL7C 1G2BA 1YN8A 4OMNA 4JZ3A 2FRWA 1YWOA 1OOTA 1AWJA 3TSWA 5IHKA 1SRLA 2LQNA 4F17A 3O5ZA 2LMJA 1KIKA 4E6RA 4RTTA 4Z8AA 1HJDA 1ZX6A 2KXCA 1T0JA 2QDLA 3RNJA 2K9GA 2DNUA 5ECAA 2CUBA 1JXOA 1A0NB 1AWXA 2LP5A 1X43A 2SRCA 5L23A 4IIMA 4ESRA 3M0RA 3I9QA 1YNZA 4QT7A 1J3TA 5HCKA 1VYVA 3VS6A 2J7IA 2JMCA 4FSSA 2OJ2A 1NG2A 2EBPA 2O31A 4GBQA 2CH4A 1ZUUA 4R0KA 1KJWA 2A28A 4K11A 2DL7A 4WCIA 2OAWA 3UATA 2CUDA 3REBB 2J6KA 2DJQA 4Z89A 1W1FA 3KFVA 3NPFA 1UGVA 1K0XA 1M3AA 1B07A 2BTTA 1UG1A 1RLQC 4J9IA 4CC7A 1UJ0A 1CKAA 2GTOA 1YWPA 2CSIA 4EIKA 2C0IA 2LZ6B 1MV0B 4J9CA 3M0TA 3EG3A 2CREA 2VWFA 1T0HA 1WLPB 1WFWA 1GCPA 2X3XD 4OMLA 4JJDA 2EQIA 3UA6A 2XMFA 1UUEA 2CSQA 3VS0A 2EGAA 1N5ZA 1T3SA 3QWXX 1UJYA 1ARKA 3TSZA 1ZUYA 1SRMA 2AZSA 2EGEA 1GBQA 4Y92A 3NGPA 1GCQA 2RPNA 1KSWA 1JO8A 4M4ZA 1OEBA 4ORZA 2ROTA 2RQRA 4RTUA 2RNAA 2D1XA 2DMOA 2X3WD 4GLMA 2W10A 2JT4A 5IXFA 2ESWA 1Y0MA 2KGTA 3QWYA 2DVJA 3U23A 1M3CA 2YT6A 1U06A 1PRMC 2DL4A 1M30A 5IHNA 1UECA 2AKKA 2KRSA 1K4US 2JMAA 2KRMA 5I11A 2ECZA 1WIEA 1W6XA 3PVQA 2C0TA 2V1QA 4RTWA 2HCKA 2DL8A 4OMPA 4J9GA 2L3QA 2RN8A 2H8HA 2D8HA 1X2KA 2MOXA 1UDLA 2F2VA 2CT4A 2E5KA 1NLOC 4J9DA 4RTVA 2LNHB 2J6FA 3VS5A 2O2OA 3H0HA 2YDLA 1UTIA 1GRIA 1AWWA 2K3BA 1AZEA 1CSKA 3VS1A 2JM8A 1B3QA 1MV3A 1KFZA 1ABQA 2RQVA 1PKSA 2DBMA 2D8JA 2FEIA 2M0YA 4LE9A 1E6GA 1OV3A 2JTEA 4HXJA 4F16A 4HCKA 2K2MA 1NM7A 1GCQC 1TUCA 2PZ1A 3RBBB 1PNJA 1WXUA 4LN2A 3ULRB 4JPBW 1K9AA 1GBRA 5EC7A 2MCNA 2DBKA 5IXBA 2SEMA 4RTZA 2L3PA 3VS3A 1JXMA 2D0NA 3EG2A 4LUEA 1SHGA 2FG0A 2HSPA 2DA9A 5FW9A 3FJ5A 1X6GA 3SEMA 2K6DA 4CC3A 2FPFA 1S1NA 2YSQA 3I35A 1Z9ZA 2ED1A 1ZLMA 2EVRA 1ABOA 3A98A 1X2QA 2LX7A 2RQTA 2JM9A 4RUGA 3I5RA 1Z9QA 2EGCA 3PVLA 4J9HA 1HSQA 1SHFA 2RQUA 1RUWA 3SHWA 2K79A 1FMKA 1HD3A 1M27C 2GQIA 2YUPA 3EHQA 5GJWB 2KT8A 1SPKA 1E7OA 1ZUKA 1X27A 4J9BA 2EYXA 1OPLA 1QKWA 1W70A 1H92A 2J05A 2ROLA 2I0NA 2DL3A 1QWFA 3EG0A 4D8KA 2GGRA 2KEAA 2KYBA 2FRYA 2G6FX 1MUZA 2ABLA 2BZYA 4KRTA 2ED0A 4X1VA 1T3LA 4JJBA 3VS4A 2LQWA 3M0UA 1PWTA 2DILA 1SSHA 2KROA 4DEYA 3VS2A 2RQWA 3H0IA 3M0PA 1BK2A 4HVUA 1JQQA 3UF4A 1TUDA 3THKA 1LCKA 4LNPA 1E6HA 2DLPA 2JW4A 1OPKA 1UE9A 1K1ZA 2CT3A 1SEMA 5FWCA 1AZGB 2NUZA 1WDXA 1CKBA 2DRMA 2L2PA 3JV3A 4CC2A 2KR3A 1BBZA 1I07A 2CDTA 3EHRA 4AG1C 1TG0A 1GFDA 3EGUA 2BZ8A 3R6NA 1PRLC 1U5SA 2DM1A 4ZNXA 2EW3A 2LJ1A 2J06A 1QKXA 1WA7A 1I1JA 2EYZA 3UA7A 4RTYA 2JS2A 5IH2A 1VYTA 1AD5A 2HDAA 2FO0A 2A37A 1PKTA 5IHIA 2DE0X 1H8KA 1Y57A 4JJCA 2GBQA 4AG2C 2V1RA 2FPDA 2JXBA 2A36A 2JS0A 2CH4W 4HVVA 1RI9A 2KT1A 1RLPC 4F14A 1U3OA 2EYWA 3REAB 2EKHA 2L3SA 3I5SA 2F2XA 1BU1A 1AVZC 1V1CA 2AZVA 3VS7A 2AK5A 2PNIA 4JZ4A 1EFNA 4Z88A 2KBTA 4HVWA 2KNBB 1UHFA 1AWOA 2GTJA 1AOJA 4OMQA 2L0AA 5I22A 1VA7A 4DEXA 2O88A 4J9FA 1FYNA 2KXDA 2DF6A 1ZSGA 1WI7A 1X6BA 1WXTA 3C0CA 2KYMA 2C0OA 1I0CA 1ZBJA 1M3BA 2OI3A 2J6OA 4LUDA 2GNCA 1WX6A 4AFUC 2P4RA 2KRNA 4J9EA 2HBWA 1QLYA 2O9VA 1GFCA 2RF0A 4IIOA 3TVTA 1NEBA 3NMZC 3M0SA 4OMMA 2EPDA 3NHNA 2M51A 2NWMA 2O9SA 2MIOA 1NEGA 2HEQA 4OMOA 2A08A 3VRYA 5GJVB 2EYYA 1NLPC 2BZXA 1JU5C 5FWBA 1WYXA 1BB9A 4AFSC 2VVKA 1QCFA 2YUQA 2DL5A 4D8DA 1NYGA 2K7AA 1PHTA 2ENMA 1NYFA 1M8MA 2YUOA 3VRZA 1G83A 1WXBA 2YUNA 1X69A 3PE0A 2AKLA 1XOVA 1VYUA 3M0QA 1YCSB 2PTKA 1JEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GBQ A;  1K0S A;  2DRK A;  2KE9 A;  1GL5 A;  2VKN A;  3H0F A;  2LJ3 A;  2DYB A;  1K76 A;  1YP5 A;  3EG1 A;  1AEY A;  2W0Z A;  3IQL A;  4AFZ C;  2F2W A;  2RMO A;  4RTX A;  2DX1 A;  2LJ0 A;  4CC4 B;  2LCS A;  2FPE A;  1IO6 A;  1UHC A;  2B86 A;  4A63 B;  3CQT A;  3LH5 A;  2IIM A;  1UFF A;  1H3H A;  4AFQ C;  1QWE A;  3H41 A;  3ZL7 C;  1G2B A;  1YN8 A;  4OMN A;  4JZ3 A;  2FRW A;  1YWO A;  1OOT A;  1AWJ A;  3TSW A;  5IHK A;  1SRL A;  2LQN A;  4F17 A;  3O5Z A;  2LMJ A;  1KIK A;  4E6R A;  4RTT A;  4Z8A A;  1HJD A;  1ZX6 A;  2KXC A;  1T0J A;  2QDL A;  3RNJ A;  2K9G A;  2DNU A;  5ECA A;  2CUB A;  1JXO A;  1A0N B;  1AWX A;  2LP5 A;  1X43 A;  2SRC A;  5L23 A;  4IIM A;  4ESR A;  3M0R A;  3I9Q A;  1YNZ A;  4QT7 A;  1J3T A;  5HCK A;  1VYV A;  3VS6 A;  2J7I A;  2JMC A;  4FSS A;  2OJ2 A;  1NG2 A;  2EBP A;  2O31 A;  4GBQ A;  2CH4 A;  1ZUU A;  4R0K A;  1KJW A;  2A28 A;  4K11 A;  2DL7 A;  4WCI A;  2OAW A;  3UAT A;  2CUD A;  3REB B;  2J6K A;  2DJQ A;  4Z89 A;  1W1F A;  3KFV A;  3NPF A;  1UGV A;  1K0X A;  1M3A A;  1B07 A;  2BTT A;  1UG1 A;  1RLQ C;  4J9I A;  4CC7 A;  1UJ0 A;  1CKA A;  2GTO A;  1YWP A;  2CSI A;  4EIK A;  2C0I A;  2LZ6 B;  1MV0 B;  4J9C A;  3M0T A;  3EG3 A;  2CRE A;  2VWF A;  1T0H A;  1WLP B;  1WFW A;  1GCP A;  2X3X D;  4OML A;  4JJD A;  2EQI A;  3UA6 A;  2XMF A;  1UUE A;  2CSQ A;  3VS0 A;  2EGA A;  1N5Z A;  1T3S A;  3QWX X;  1UJY A;  1ARK A;  3TSZ A;  1ZUY A;  1SRM A;  2AZS A;  2EGE A;  1GBQ A;  4Y92 A;  3NGP A;  1GCQ A;  2RPN A;  1KSW A;  1JO8 A;  4M4Z A;  1OEB A;  4ORZ A;  2ROT A;  2RQR A;  4RTU A;  2RNA A;  2D1X A;  2DMO A;  2X3W D;  4GLM A;  2W10 A;  2JT4 A;  5IXF A;  2ESW A;  1Y0M A;  2KGT A;  3QWY A;  2DVJ A;  3U23 A;  1M3C A;  2YT6 A;  1U06 A;  1PRM C;  2DL4 A;  1M30 A;  5IHN A;  1UEC A;  2AKK A;  2KRS A;  1K4U S;  2JMA A;  2KRM A;  5I11 A;  2ECZ A;  1WIE A;  1W6X A;  3PVQ A;  2C0T A;  2V1Q A;  4RTW A;  2HCK A;  2DL8 A;  4OMP A;  4J9G A;  2L3Q A;  2RN8 A;  2H8H A;  2D8H A;  1X2K A;  2MOX A;  1UDL A;  2F2V A;  2CT4 A;  2E5K A;  1NLO C;  4J9D A;  4RTV A;  2LNH B;  2J6F A;  3VS5 A;  2O2O A;  3H0H A;  2YDL A;  1UTI A;  1GRI A;  1AWW A;  2K3B A;  1AZE A;  1CSK A;  3VS1 A;  2JM8 A;  1B3Q A;  1MV3 A;  1KFZ A;  1ABQ A;  2RQV A;  1PKS A;  2DBM A;  2D8J A;  2FEI A;  2M0Y A;  4LE9 A;  1E6G A;  1OV3 A;  2JTE A;  4HXJ A;  4F16 A;  4HCK A;  2K2M A;  1NM7 A;  1GCQ C;  1TUC A;  2PZ1 A;  3RBB B;  1PNJ A;  1WXU A;  4LN2 A;  3ULR B;  4JPB W;  1K9A A;  1GBR A;  5EC7 A;  2MCN A;  2DBK A;  5IXB A;  2SEM A;  4RTZ A;  2L3P A;  3VS3 A;  1JXM A;  2D0N A;  3EG2 A;  4LUE A;  1SHG A;  2FG0 A;  2HSP A;  2DA9 A;  5FW9 A;  3FJ5 A;  1X6G A;  3SEM A;  2K6D A;  4CC3 A;  2FPF A;  1S1N A;  2YSQ A;  3I35 A;  1Z9Z A;  2ED1 A;  1ZLM A;  2EVR A;  1ABO A;  3A98 A;  1X2Q A;  2LX7 A;  2RQT A;  2JM9 A;  4RUG A;  3I5R A;  1Z9Q A;  2EGC A;  3PVL A;  4J9H A;  1HSQ A;  1SHF A;  2RQU A;  1RUW A;  3SHW A;  2K79 A;  1FMK A;  1HD3 A;  1M27 C;  2GQI A;  2YUP A;  3EHQ A;  5GJW B;  2KT8 A;  1SPK A;  1E7O A;  1ZUK A;  1X27 A;  4J9B A;  2EYX A;  1OPL A;  1QKW A;  1W70 A;  1H92 A;  2J05 A;  2ROL A;  2I0N A;  2DL3 A;  1QWF A;  3EG0 A;  4D8K A;  2GGR A;  2KEA A;  2KYB A;  2FRY A;  2G6F X;  1MUZ A;  2ABL A;  2BZY A;  4KRT A;  2ED0 A;  4X1V A;  1T3L A;  4JJB A;  3VS4 A;  2LQW A;  3M0U A;  1PWT A;  2DIL A;  1SSH A;  2KRO A;  4DEY A;  3VS2 A;  2RQW A;  3H0I A;  3M0P A;  1BK2 A;  4HVU A;  1JQQ A;  3UF4 A;  1TUD A;  3THK A;  1LCK A;  4LNP A;  1E6H A;  2DLP A;  2JW4 A;  1OPK A;  1UE9 A;  1K1Z A;  2CT3 A;  1SEM A;  5FWC A;  1AZG B;  2NUZ A;  1WDX A;  1CKB A;  2DRM A;  2L2P A;  3JV3 A;  4CC2 A;  2KR3 A;  1BBZ A;  1I07 A;  2CDT A;  3EHR A;  4AG1 C;  1TG0 A;  1GFD A;  3EGU A;  2BZ8 A;  3R6N A;  1PRL C;  1U5S A;  2DM1 A;  4ZNX A;  2EW3 A;  2LJ1 A;  2J06 A;  1QKX A;  1WA7 A;  1I1J A;  2EYZ A;  3UA7 A;  4RTY A;  2JS2 A;  5IH2 A;  1VYT A;  1AD5 A;  2HDA A;  2FO0 A;  2A37 A;  1PKT A;  5IHI A;  2DE0 X;  1H8K A;  1Y57 A;  4JJC A;  2GBQ A;  4AG2 C;  2V1R A;  2FPD A;  2JXB A;  2A36 A;  2JS0 A;  2CH4 W;  4HVV A;  1RI9 A;  2KT1 A;  1RLP C;  4F14 A;  1U3O A;  2EYW A;  3REA B;  2EKH A;  2L3S A;  3I5S A;  2F2X A;  1BU1 A;  1AVZ C;  1V1C A;  2AZV A;  3VS7 A;  2AK5 A;  2PNI A;  4JZ4 A;  1EFN A;  4Z88 A;  2KBT A;  4HVW A;  2KNB B;  1UHF A;  1AWO A;  2GTJ A;  1AOJ A;  4OMQ A;  2L0A A;  5I22 A;  1VA7 A;  4DEX A;  2O88 A;  4J9F A;  1FYN A;  2KXD A;  2DF6 A;  1ZSG A;  1WI7 A;  1X6B A;  1WXT A;  3C0C A;  2KYM A;  2C0O A;  1I0C A;  1ZBJ A;  1M3B A;  2OI3 A;  2J6O A;  4LUD A;  2GNC A;  1WX6 A;  4AFU C;  2P4R A;  2KRN A;  4J9E A;  2HBW A;  1QLY A;  2O9V A;  1GFC A;  2RF0 A;  4IIO A;  3TVT A;  1NEB A;  3NMZ C;  3M0S A;  4OMM A;  2EPD A;  3NHN A;  2M51 A;  2NWM A;  2O9S A;  2MIO A;  1NEG A;  2HEQ A;  4OMO A;  2A08 A;  3VRY A;  5GJV B;  2EYY A;  1NLP C;  2BZX A;  1JU5 C;  5FWB A;  1WYX A;  1BB9 A;  4AFS C;  2VVK A;  1QCF A;  2YUQ A;  2DL5 A;  4D8D A;  1NYG A;  2K7A A;  1PHT A;  2ENM A;  1NYF A;  1M8M A;  2YUO A;  3VRZ A;  1G83 A;  1WXB A;  2YUN A;  1X69 A;  3PE0 A;  2AKL A;  1XOV A;  1VYU A;  3M0Q A;  1YCS B;  2PTK A;  1JEG A; 
#chains in the Genus database with same CATH topology
 4NS5 A;  4BY6 B;  3S3O A;  4FYV B;  5KYW B;  2VB6 A;  4HA8 A;  2K5F A;  9ATC B;  1K8A R;  1AEY A;  3CC7 A;  1VQ5 T;  4IUP A;  2RMO A;  1VQP A;  3WVD B;  1Q86 U;  1WHJ A;  5FRO A;  3AT1 B;  4M7A A;  1KK7 A;  1IO6 A;  4MDW A;  4XTU A;  3LH5 A;  3VJP A;  2IIM A;  1NZ9 A;  3RES A;  1H3H A;  3QUI A;  1TH7 A;  1X01 A;  2FRW A;  1YI2 Q;  1OOT A;  5LJ3 g;  1RAG B;  4PJO F;  3TSW A;  1YHQ A;  1VQ6 A;  3CCL Q;  3O5Z A;  4C5E A;  3MCA B;  4C5H A;  4FCY A;  1YIT T;  4B9X A;  2KXC A;  4J5Y A;  1VOM A;  3I55 T;  3S3N A;  3PNW C;  4LD9 K;  1M9S A;  2DNU A;  4J6Y A;  2RHU A;  2LT4 A;  3QZ9 B;  1PD0 A;  4FW2 A;  1F1B B;  2EQM A;  1RL2 A;  2P0Q A;  4PL6 A;  2X4W A;  1TOV A;  5KH6 A;  3VUB A;  5GAN 2;  1OU9 A;  1WGS A;  1X6O A;  2WSF E;  5CKH A;  3PMI A;  2QAS A;  1D09 B;  2A0F B;  2CZ6 B;  4IUT A;  1NPP A;  3HTR A;  4C0D B;  1RAD B;  2H3J A;  2V8J A;  2DL7 A;  1WHL A;  3UT1 A;  1W1F A;  2OTJ A;  4HCB A;  1XQH A;  5LJ5 d;  3CD6 Q;  2VXE A;  1K8A C;  1M3A A;  3UWN A;  1QVF A;  3C94 A;  2D0Q B;  2CSI A;  4EIK A;  1OYX A;  2COW A;  3M0T A;  3EG3 A;  4OB1 B;  4M7A C;  2VWF A;  3QDF A;  3PIP A;  3EFO B;  3MJX A;  2ATC B;  1WFW A;  3G71 A;  2XIC A;  3UA6 A;  1BCM A;  2XMF A;  2EGA A;  4JJN K;  1QCO A;  2QEX Q;  1ARK A;  4NL2 A;  2MWO A;  5KCO A;  2AZS A;  3NGP A;  3OS0 A;  3OQ5 A;  4PJO A;  4CRI A;  4LDU A;  1IHW A;  4BDZ A;  1JO8 A;  2M1H A;  3MET A;  4LD6 A;  3RMQ A;  1OEB A;  2ZPE B;  4IUR A;  2RQR A;  2D1X A;  2DMO A;  3GNG A;  2M02 A;  2DKG A;  2W10 A;  2RO0 A;  3T9N A;  4HCZ A;  4M7D E;  1Y0M A;  2KGT A;  3QWY A;  4L5G A;  2RJE A;  5CO7 A;  4N4I A;  3QDR B;  5FLX E;  2AKK A;  1K4U S;  3I56 T;  2CP5 A;  1D0Y A;  5CKF A;  2C0T A;  2HCK A;  1WHK A;  2O4X B;  2QGF B;  3FEO A;  3JCM X;  3EFR A;  2H3E B;  2DPP B;  3HRU A;  1PC0 A;  1YIT Q;  2DL8 A;  4OMP A;  1AHJ B;  4J9G A;  2DEQ A;  1X2K A;  1ZSZ B;  3KUF A;  2MOX A;  4XQ3 A;  2HQH A;  2E5K A;  2VGM A;  2OAU A;  1Q95 G;  3HKS A;  3KXT A;  2WSC E;  2J6F A;  3H9N A;  2QYZ A;  4A4H A;  3P8H A;  2KDS A;  4OF1 A;  4KUI A;  4XTW A;  4EDU A;  3VU3 C;  3CMA T;  1KFZ A;  5IAY A;  1PKS A;  2D8J A;  3A1P A;  3SDZ A;  1YJN T;  4FIB A;  2JTE A;  4HXJ A;  4F16 A;  1YCY A;  4HCK A;  4NL3 A;  2EYQ A;  4C92 D;  1G3S A;  3M58 A;  2K2V A;  1TUC A;  2PZ1 A;  2VAS A;  1PNJ A;  4M7D F;  1Y96 A;  1OI1 A;  2OX7 A;  4BB7 A;  1TUG B;  4RTZ A;  5KCH A;  2YRC A;  1VQ9 A;  2CP6 A;  1V29 B;  3FJ5 A;  1NJI C;  2CGH A;  4CC3 A;  2CP2 A;  2C06 A;  3I35 A;  1Z9Z A;  1ZLM A;  3QG1 A;  3HPW A;  4FT4 A;  3L2Q A;  3A98 A;  4A4F A;  2LX7 A;  2DYI A;  4OP0 A;  2D6F A;  4QKU A;  5GAO q;  1H64 1;  1Z9Q A;  5GAM e;  1YI2 A;  2RI3 A;  3PT9 A;  1SHF A;  1RUW A;  3SHW A;  2K79 A;  1WHG A;  4KGX B;  5GJW B;  2KT8 A;  3OYJ A;  1SPK A;  4C8Q F;  1X27 A;  2NUP B;  5CQY A;  2R58 A;  1QKW A;  2JUF A;  2YLB A;  1H92 A;  2D9T A;  2HL3 A;  1MNE A;  3JCM P;  2DL3 A;  4D8K A;  1VQP T;  3VYH B;  2JNG A;  2P4T A;  3JCM e;  3J7A F;  2KYB A;  1VQ8 T;  3BE3 A;  2QQA A;  2ED0 A;  4X1V A;  3VS4 A;  1PWT A;  2RK1 A;  4RKU E;  2DIL A;  1UB4 A;  1SSH A;  3P8D A;  1HYO A;  2RHZ A;  1YIJ T;  3M0P A;  3I56 Q;  3CXC P;  5GAN 7;  4HVU A;  1JQQ A;  3UF4 A;  4B6M A;  1K73 U;  5GAN 5;  4F7U G;  2LQ8 A;  1Q7Y R;  2JW4 A;  4ZGE B;  1OZ2 A;  1OPK A;  1UE9 A;  1K1Z A;  4XTZ A;  3TEE A;  1CKB A;  2L2P A;  4CC2 A;  4JRP A;  4M7D A;  2V8I A;  2B8A A;  1BI0 A;  1GFD A;  3EGU A;  3V8L A;  1UEB A;  2BZ8 A;  2CP0 A;  5HK3 A;  2YRV A;  2RM4 A;  2E6Z A;  4BD3 A;  1TWB A;  2IPO B;  1VQN A;  2E41 A;  4MML A;  3CMA Q;  4DOV A;  2NUT A;  3UA7 A;  3OYF A;  2LDM A;  3G6E T;  4BUG A;  4F7U B;  2DEU A;  1D3B B;  1VYT A;  1O9S A;  2MMP A;  2OTJ T;  2FO0 A;  5FU7 C;  3CC2 T;  3DLM A;  3ZBD A;  1IZ6 A;  3EGX A;  2JXB A;  2EQJ A;  2PQW A;  2JS0 A;  4XU3 A;  3MP8 A;  1RI9 A;  4F14 A;  1U3O A;  2EKH A;  2L3S A;  2WSE E;  3A8M B;  1BU1 A;  1VIE A;  4F04 B;  1AVZ C;  3G1J A;  2ZGW A;  2A7Y A;  2KBT A;  3EH2 A;  1Q7Y C;  2EKO A;  5I2M A;  4N4G A;  2L0A A;  1VA7 A;  2CP3 A;  2O88 A;  4M7D C;  4E2F B;  2DF6 A;  1ZSG A;  4X34 A;  4M78 C;  3SB2 A;  2CKK A;  5LJ5 f;  4LUD A;  2GNC A;  5KE2 A;  2QA4 A;  3QZ5 B;  1QLY A;  2O9V A;  3LW5 E;  3TVT A;  1Y7X A;  1NEB A;  3CCV Q;  1OX9 A;  3JCM h;  4OMM A;  1VQ8 Q;  2O9S A;  1NEG A;  2HEQ A;  4FYX B;  5GAN 6;  2CZ7 B;  5FU6 C;  1Y07 A;  4BE1 A;  2KI7 A;  1JJ2 S;  1WYX A;  2HQE A;  1BB9 A;  4AFS C;  2VVK A;  1YIJ Q;  3MEV A;  1QCF A;  1QVP A;  2HQX A;  4D8D A;  3FIF A;  2DVE A;  2QI2 A;  1QMC A;  1R0C B;  2CP7 A;  3CEY A;  1M8M A;  3CCQ A;  3OYL A;  2YUN A;  1X69 A;  3OBY A;  4PJL A;  1D0Z A;  1VQK A;  1D1A A;  5GAN e;  1FMV A;  3OW2 P;  1KQS S;  5CK9 A;  4M75 E;  4P5N A;  4C0G A;  2DRK A;  5I21 A;  1M90 U;  3L1A A;  1M2O A;  3RKX A;  2VKN A;  2FB7 A;  4C92 G;  2LJ3 A;  2EJG A;  3CCJ A;  3CCM T;  4JLI A;  4AFZ C;  4KUD K;  1M4Z A;  3CCR T;  3G6E Q;  2NLU A;  2LJ0 A;  3OY9 A;  4CC4 B;  2LCS A;  3JB9 I;  2B86 A;  4A63 B;  3CQT A;  4M78 G;  1UFF A;  4MZM A;  3CC2 Q;  4AFQ C;  1QWE A;  1YN8 A;  3G4S A;  3EAE A;  3LYI A;  4M77 C;  5CQX A;  5GMK i;  1EIF A;  4C92 B;  1SG5 A;  2XID A;  2LQN A;  1VQO T;  4KH1 B;  4Y28 E;  1Q82 R;  4Z8A A;  1HJD A;  3RNJ A;  1A0N B;  1VQ7 A;  1AWX A;  1N9S A;  3FDR A;  5KYY A;  3X26 B;  1I5O B;  3M0R A;  1YNZ A;  3KBG A;  2RJD A;  1M1F A;  3J80 E;  5GAN j;  5HCK A;  3JB9 F;  3LWH A;  2L5Q A;  1VQL A;  2KSS A;  2OJ2 A;  4QVC A;  4R0K A;  2KY9 A;  4M7A D;  1YJW A;  1KJW A;  4K11 A;  3UAT A;  4PNO A;  3REB B;  3M59 A;  3EFO A;  4N4H A;  2A3L A;  3KFV A;  2MPX C;  2F5K A;  3CME T;  1N27 A;  2BTT A;  1D0X A;  1HXD A;  1UG1 A;  1RLQ C;  4LDX A;  3M4Y A;  2JZ2 A;  3OA6 A;  1CKA A;  2C0I A;  2YLC A;  5GMK l;  3MEU A;  2E64 A;  4BDY A;  4L6V 5;  3QYG B;  1GCP A;  2X3X D;  3M55 A;  4JJD A;  4M77 G;  2EQK A;  4RCB A;  3CCS A;  3QWX X;  2HSE B;  1Q82 C;  3C4S A;  3CCE Q;  2EGE A;  1VQM A;  2QQ9 A;  5GAN h;  5LJ5 g;  5CIU A;  4FYY B;  2CS7 A;  3CCM Q;  1VQN T;  2ROT A;  6AT1 B;  1W2B P;  2RHY A;  1UGR B;  2RNA A;  1WHM A;  3X25 B;  2PU9 B;  2QK0 A;  2X3W D;  3CC4 A;  1I81 A;  2JT4 A;  3HFO A;  4F7U E;  3U23 A;  1M3C A;  2L89 A;  4M75 A;  3VYG A;  1ZSZ A;  1M30 A;  5IHN A;  1N8R R;  2KRS A;  2ZZD A;  1IHV A;  1RI0 A;  3J81 E;  2ECZ A;  2E3I A;  2DET A;  4XAX B;  1M1G A;  1VQO Q;  2L3Q A;  1RAF B;  2H8H A;  2D8H A;  1QVG S;  1U1S A;  3CPW P;  3A8G B;  3QBY A;  1NLO C;  1JB0 E;  1BIB A;  1I8F A;  2CZ0 B;  2DIQ A;  2YDL A;  2AT1 B;  3CCU A;  2K3B A;  3V7R A;  3VS1 A;  3AHU A;  2RJF A;  4PFZ A;  2RQV A;  3JCM b;  1PCX A;  2M0Y A;  1E6G A;  4BE2 A;  3CXC A;  3ME9 A;  5HKC A;  2K2M A;  2VV5 A;  2DER A;  1NE8 A;  2F5T X;  1PSE A;  1YJ9 A;  1WXU A;  4F7U F;  1K9A A;  1JRI A;  5AYF A;  3CME Q;  2MCN A;  5KYU B;  4PK4 A;  4BAC A;  3E9F A;  3OYY A;  3OYA A;  3FRN A;  1PD1 A;  4LUE A;  1RAI B;  2DA9 A;  4EMK A;  4M75 C;  8AT1 B;  2DXT A;  1Q81 R;  3EFS A;  3SEM A;  1N8R C;  1G8X A;  2LQK A;  4DQ2 A;  1UGP B;  2X35 A;  5HY6 A;  3TQ7 P;  5A2Q E;  5A0L A;  2XDD A;  1ABO A;  1UGS B;  2DTH A;  4E7I A;  1B34 A;  4PJM A;  4KT0 E;  1TU0 B;  2CZ1 B;  4A4K A;  2K3Y A;  4FT2 A;  3FJP A;  2YWW A;  2L8D A;  3E2U A;  5LJ3 e;  2Y90 A;  3TCJ A;  3L2U A;  2DXU A;  2GQI A;  1E7O A;  4OGE A;  1X75 C;  3QII A;  4RG2 A;  3BW1 A;  3CCJ T;  4ELY C;  1BI2 A;  3P8B B;  1KQ1 A;  4ZTJ A;  2LRQ A;  2ROL A;  5DLQ E;  1FXX A;  2JJ9 A;  3EG0 A;  3EG9 A;  3OS5 A;  2MI6 A;  2GGR A;  4KH0 B;  1M2V A;  3QJ6 A;  5D7U A;  3DB3 A;  2QGG A;  1MUZ A;  2BZY A;  3JSC A;  2PVG B;  1VQ5 Q;  5IN1 A;  3RMS A;  4DBR A;  5HK0 A;  1LPL A;  3G4S T;  2RQW A;  5DY9 A;  3HFN A;  2LX9 A;  1TUD A;  5J26 A;  4JLG A;  4LNP A;  5A0G A;  3JB9 J;  4C5G A;  2O01 E;  4OB2 B;  3JV3 A;  4F7U A;  4EMK C;  2R57 A;  1VQ4 A;  1Q81 C;  4M7A G;  1M1K R;  3I55 Q;  2XU8 A;  5KYX B;  1TG0 A;  3R6N A;  1PRL C;  1I5L A;  2EW3 A;  5LJ3 j;  4DA4 A;  2LJ1 A;  2OTL A;  3OYG A;  3JCM J;  1FWZ A;  4RTY A;  4QQG A;  2DFU A;  1AD5 A;  2X4X A;  2RI2 A;  4C8Q E;  1PKT A;  3ZEH A;  1WQW A;  1H8K A;  1Y57 A;  1R8O B;  1B7T A;  5I2S A;  4PJO C;  4A53 A;  1SKU B;  1S72 T;  4M7A B;  4VUB A;  3OW2 A;  2COZ A;  2FHD A;  4C92 F;  3NTH A;  2Y4X A;  4M7D D;  2ZPI B;  1RLP C;  1RAC B;  4LXC A;  3I5S A;  4M78 D;  2AZV A;  2ZPB B;  4O5V A;  4JZ4 A;  4Z88 A;  2ZPG B;  4HVW A;  2Y4Y A;  2MAM A;  4BE0 A;  1K9M R;  4WF2 A;  2GTJ A;  4PKC C;  5C0M A;  1AOJ A;  2F69 A;  4OMQ A;  5I22 A;  1QVG P;  4A4E A;  2YRD A;  3JRZ A;  4J9F A;  5LJ3 h;  1EX4 A;  3JCM c;  2BE7 D;  1WI7 A;  1WQ7 A;  3BDU A;  2VGN A;  4FM4 B;  1M1K C;  2KYM A;  1M3B A;  4EMH A;  4AFU C;  4GY5 A;  3X24 B;  2EJ9 A;  3CCL A;  1MMD A;  4J9E A;  1PM3 A;  2P0K A;  2HBW A;  2E10 A;  3FC3 A;  1G5V A;  3M56 A;  4IIO A;  5FRM A;  2P0P A;  2QQR A;  3NMZ C;  1OU8 A;  3A8L B;  3CC7 T;  2EPD A;  2M51 A;  4PFP A;  2NWM A;  1KD1 R;  3CBO A;  3FLG A;  4OMO A;  2MK5 A;  1MMG A;  2E12 A;  1NLP C;  1JU5 C;  4ZN1 A;  5FWB A;  1G3Y A;  4PJO G;  3OYK A;  1PHT A;  2ENM A;  4XTV A;  1WHH A;  2YUO A;  3VRZ A;  2COY A;  1R0B G;  3M54 A;  4E7H A;  1YHQ T;  2KQW A;  1VQ6 T;  3HL8 A;  3LH0 A;  2PTK A;  3FB9 A;  1K0S A;  2VXF A;  2DO3 A;  2V8K A;  3CD6 A;  4C0F A;  2DYB A;  5CAI A;  1YP5 A;  3CCU T;  3EG1 A;  3JCM d;  4M77 D;  4ELZ C;  2EJF A;  1Q86 R;  1K8A U;  1K9M C;  3OS2 A;  5CKD A;  1RAA B;  4XTY A;  5GAM j;  2DX1 A;  3NFC A;  3SFM A;  3E9G A;  2DK3 A;  3PGG A;  1YJ9 T;  3V8J A;  1YJN Q;  3H41 A;  4II1 A;  3SWN A;  3JCM W;  1G2B A;  4OMN A;  3GIB A;  4JZ3 A;  3QXE B;  1AWJ A;  2QEX A;  4V2S A;  1S72 Q;  4ZGJ B;  5IHK A;  5KYN A;  4PFO A;  2QQB A;  4F17 A;  4E6R A;  1KG1 A;  1ZX6 A;  1KD1 C;  2K9G A;  2CUB A;  2LP5 A;  2SRC A;  4HKE A;  1PSF A;  4RCC A;  4C8Q A;  1W2B A;  4QT7 A;  3C12 A;  2PUK B;  3F70 A;  3PFS A;  1R77 A;  1VYV A;  3G71 T;  2J7I A;  2JMC A;  2MYS A;  3N5B B;  3M9Q A;  4E7K A;  4FSS A;  1NG2 A;  2EBP A;  2DD5 A;  2CH4 A;  1ZUU A;  2A28 A;  4WCI A;  4E7L A;  5GAM h;  2IG0 A;  1UGV A;  2DZC A;  2E3H A;  4MZP A;  1B07 A;  4RMO A;  1YIT A;  3WXM B;  4KGV B;  4Q5W A;  1Q86 C;  4J9I A;  3CC7 Q;  1UJ0 A;  5AT1 B;  3CPW A;  1YWP A;  5J39 A;  2LZ6 B;  4J9C A;  1RAH B;  1VQP Q;  2GFU A;  2CRE A;  1T0H A;  1WLP B;  3OYH A;  1QCN A;  3JAM E;  5GAO l;  4OML A;  5D6W A;  4E7S A;  3SWN C;  3OYN A;  3L2W A;  3PMT A;  3VS0 A;  1N5Z A;  4HT9 A;  1KQS A;  3JCM V;  5KYW A;  3TSZ A;  1YHQ Q;  4JS5 A;  1VQ6 Q;  3WVE B;  1IRX A;  5CR2 A;  4IUU A;  4HCC A;  4E47 A;  5GMK m;  5FRN A;  1M8V A;  1Y71 A;  4C8Q C;  5KE3 A;  2E70 A;  2OTL T;  1TXQ A;  3MEA A;  4FU6 A;  4RTU A;  4A54 A;  3M53 A;  2FZC B;  4LDV A;  3OYB A;  2JVV A;  4GLM A;  3OMG A;  5FU7 B;  5IXF A;  2E5Q A;  2KAF A;  2DVJ A;  4JRI A;  2YT6 A;  1U06 A;  2DL4 A;  4OMF B;  4M7D G;  1NJI U;  4J83 A;  2JMA A;  5I11 A;  1XTD A;  4GLK A;  1WIE A;  1W6X A;  2LCC A;  2OTJ Q;  2V1Q A;  4RTW A;  4X9C A;  3S6W A;  5GAN d;  1N6A A;  4J8O A;  2RN8 A;  2ZCF B;  3LX7 A;  1VQ9 T;  4OGC A;  4XK8 E;  4LDW A;  4J9D A;  2LNH B;  3VS5 A;  3OSV A;  3G71 Q;  5GMK e;  4M7D B;  1GRI A;  1XNI A;  2X4J A;  4FW1 A;  1AWW A;  3JB9 H;  2JM8 A;  1B3Q A;  2LCL A;  1ABQ A;  4M78 B;  2DBM A;  2FEI A;  3GOX A;  3EGD B;  1IXD A;  1OV3 A;  1YI2 T;  4M75 D;  3I56 A;  3DKM A;  2RA2 A;  1BIA A;  1ZA2 B;  2XK0 A;  3RBB B;  4JPB W;  3JB9 D;  1YFN A;  1BKB A;  2K5I A;  1GBR A;  5EC7 A;  5GAO p;  1ZBX A;  3OYM A;  5FU6 B;  2SEM A;  2L3P A;  3VS3 A;  1JXM A;  2JOY A;  2D0N A;  3V7C A;  2FG0 A;  4M7A F;  2HSP A;  4PLI A;  1JBM A;  5FW9 A;  4KUL A;  3QSU A;  2K6D A;  2FPF A;  3EGX B;  2V26 A;  2JTM A;  2EVR A;  3HRT A;  3CMA A;  1X2Q A;  2JTF A;  7AT1 B;  2JM9 A;  4RUG A;  4CI0 C;  3I5R A;  2EGC A;  4TVR A;  3PVL A;  1ZA1 B;  3D7S B;  2G3R A;  3RDV A;  3X28 B;  2YUP A;  5GMK j;  1QP3 A;  1ZUK A;  1SSF A;  2HMA A;  4HT8 A;  4J9B A;  2EYX A;  2HZY A;  4C0D C;  1W70 A;  4N0A A;  2EAY A;  4ZGD B;  2ZPF B;  2J05 A;  5M9O A;  1QWF A;  4ATO A;  2KEA A;  4LDY A;  2FRY A;  4J7F A;  1MHN A;  1OUL A;  4KRT A;  1QQJ A;  2O4X A;  4JJB A;  3CCR Q;  4M77 B;  1BCO A;  4DEY A;  1K73 R;  3H0I A;  4NOY A;  1BK2 A;  3ZFJ A;  5CCA A;  3THK A;  3Q1J A;  1E6H A;  5GAM f;  1OQK A;  2DLP A;  3H6Z A;  1MND A;  1ZQ1 A;  3RUX A;  1QVG A;  1Q7Y U;  1AZG B;  2DRM A;  2QXF A;  2GFA A;  4BI8 B;  2PUO B;  1BBZ A;  1VQ9 Q;  5D6X A;  3EHR A;  1U5S A;  5D6Y A;  4AMC A;  1JJ2 P;  2RD1 A;  4IUV A;  3JCM f;  2DM1 A;  3X20 B;  2QQS A;  4ZNX A;  3QPH A;  4AT1 B;  4PJO D;  3CCV A;  1P92 A;  3GLX A;  4QW2 A;  3OMC A;  5GMK h;  3A5Z B;  4C0Z A;  1VQ8 A;  2QG9 B;  1QKX A;  1WA7 A;  2EYZ A;  2FL7 A;  5CKB A;  2I2L A;  4MZT A;  1W4S A;  4C5I A;  1YIJ A;  1M5Q 1;  2WAC A;  2GQV A;  2HDA A;  2RHI A;  1U8R A;  2LNV A;  1KQS P;  3NTI A;  3OYI A;  1HK9 A;  4JJC A;  2GBQ A;  4N0A C;  2M0O A;  2PVO B;  5LJ5 e;  2A36 A;  5GAN 4;  5GAN 8;  2QA4 T;  3MP6 A;  2HKQ B;  2DXB A;  3V7S A;  2CH4 W;  2QAZ A;  2M9U A;  3OSS C;  1TS9 A;  4Y91 A;  2EYW A;  3REA B;  5L8R E;  2DAQ A;  2DTO A;  2RHX A;  1K73 C;  3G7Z A;  2DJZ A;  3RR6 A;  1V1C A;  2XD0 A;  3VS7 A;  4JS4 A;  1WZO A;  2AK5 A;  1ZSZ C;  2XHC A;  2NUP A;  3G6E A;  2KVQ G;  1UHF A;  5KYY B;  1AWO A;  3CCQ T;  4DEX A;  1KC8 U;  1FYN A;  3CC2 A;  3CXC S;  1VQK T;  3M5A A;  3GPL A;  1WXT A;  3C0C A;  2C0O A;  2XKO C;  2J6O A;  4IUQ A;  1WX6 A;  2AIR B;  2R5A A;  3GP8 A;  1WJQ A;  1GFC A;  2RF0 A;  3M0S A;  4IKF A;  1VQN Q;  3NHN A;  2MIO A;  1QVF S;  1QW1 A;  2A08 A;  3VRY A;  2BIV A;  4XU1 A;  5GJV B;  4MDX A;  3BDL A;  2BZX A;  5LJ5 j;  3PTA A;  2YUQ A;  2DL5 A;  4YTL A;  2DD4 A;  3LLR A;  2K7A A;  2E6N A;  1WXB A;  4E7J A;  1IRE B;  3OBW A;  3PE0 A;  2AKL A;  2EQU A;  5LJ3 d;  1VYU A;  3ASK A;  1YCS B;  3UDC A;  2RI5 A;  1EZZ B;  4C92 E;  3GBQ A;  1M90 R;  3A8O B;  1GXI E;  2KE9 A;  2DIG A;  4M75 G;  3OYC A;  2BE9 B;  3H0F A;  1VQ7 T;  1GL5 A;  2VYT A;  4JRK A;  5J3B A;  1D3B A;  1K76 A;  2HD0 A;  1NPR A;  3JB9 G;  2W0Z A;  5GAO r;  1NJI R;  3DLL A;  2BKD N;  3IQL A;  2F2W A;  4M78 E;  4RTX A;  2FZK B;  2VUB A;  2FPE A;  1UHC A;  4XU2 A;  1VQL T;  4RG8 A;  2KK4 A;  5GAM g;  1YJW T;  3ZL7 C;  2E4H A;  3RKY A;  3NTK A;  1YWO A;  1LVK A;  4R55 A;  2IVW A;  5LJ5 h;  4FYW B;  4M75 B;  1SRL A;  5GAN f;  2QA4 Q;  3CCE A;  2LMJ A;  1KIK A;  3MO8 A;  4RTT A;  4Z02 A;  1T0J A;  2QDL A;  1Q82 U;  4E7Z A;  5ECA A;  1JXO A;  1X43 A;  2VC8 A;  3JCM g;  5L23 A;  4IIM A;  3CCM A;  4ESR A;  3I9Q A;  3S3M A;  8ATC B;  1J3T A;  1NBE B;  3CCR A;  3VS6 A;  4XTX A;  3GNF B;  3CCS T;  3OYE A;  3CCQ Q;  2O31 A;  4GBQ A;  4FSX A;  1G3W A;  1M90 C;  3L2Z A;  1VQK Q;  2OAW A;  1C1A A;  2CUD A;  1VQM T;  2J6K A;  2DJQ A;  2K4Y A;  4M78 F;  4Z89 A;  2NYS A;  3LGL A;  3NPF A;  2JN0 A;  4DOW A;  1K0X A;  2HKN A;  1VQO A;  3CCJ Q;  3INZ A;  1UGQ B;  3OW2 S;  3O8V A;  2QTX A;  4CC7 A;  2GTO A;  1MV0 B;  3CC4 T;  2P84 A;  1IGU A;  4WTO B;  4M77 E;  2XG8 D;  3A8H B;  1YBY A;  2K5L A;  2DXC A;  3CPF A;  4C8Q D;  2EQI A;  1UUE A;  2CSQ A;  2HBP A;  1T3S A;  3G4S Q;  1UJY A;  4EMK B;  1MGQ A;  1LNX A;  2Z0W A;  1ZUY A;  1XJW B;  1SRM A;  2X51 A;  4Y92 A;  1GBQ A;  3DB4 A;  3RKW A;  3UPU A;  5GAM d;  1WJS A;  3QYH B;  2CYZ B;  1B34 B;  1GCQ A;  5DLO A;  1H3Z A;  2RPN A;  1VQ7 Q;  1KSW A;  2DTI A;  2LVM A;  2RK2 A;  3CME A;  3HHT B;  3QHS A;  4M4Z A;  5GAO m;  3CCV T;  4ORZ A;  1SF9 A;  4ZN3 A;  1ZHI A;  4D6W A;  2E1H A;  2RH2 A;  4DBF A;  2ESW A;  2MWP A;  1VQL Q;  1PRM C;  4C92 A;  4EMG A;  1IB8 A;  4PJO B;  1UEC A;  4PJN A;  1YJW Q;  2R5M A;  3EG9 B;  2KRM A;  1N8R U;  3E19 A;  1M2V B;  4EPC A;  3PVQ A;  4M77 F;  1RAE B;  1OX8 A;  4A4G A;  1FMW A;  2BUD A;  2FYK A;  2EWN A;  3SD4 A;  1QVF P;  4M78 A;  2MF2 A;  3EGD A;  3QKJ A;  1BI1 A;  2XI9 A;  1UDL A;  2F2V A;  2XDB A;  2CT4 A;  3QO3 A;  2K3X A;  3OB9 A;  4RTV A;  2O2O A;  3H0H A;  1UTI A;  2HNI A;  5EG2 A;  2FVU A;  1AZE A;  5DM7 R;  1CSK A;  3CCS Q;  3BY7 A;  1MV3 A;  1VQ5 A;  1VIF A;  4LE9 A;  2QTV A;  4DBH A;  3M4G A;  1VQM Q;  1NM7 A;  1GCQ C;  4ZTF A;  4LN2 A;  3ULR B;  3C95 A;  4BI3 A;  5GAN g;  1BI3 A;  2RB6 A;  2DBK A;  5IXB A;  3L2V A;  3HSB A;  4OVA A;  3EG2 A;  1SHG A;  3ER0 A;  3CC4 Q;  4QQ6 A;  3I55 A;  1X6G A;  4C92 C;  2M16 A;  2EIF A;  1JJ2 A;  1W2B S;  1S1N A;  2YSQ A;  1Q81 U;  1Y96 B;  2ED1 A;  1KC8 R;  3L2R A;  1KHI A;  2KMT A;  2RQT A;  4B9W A;  4UC4 A;  1C0M A;  4J6X A;  3EH1 A;  4J9H A;  3VKI A;  2EFI A;  4ANJ A;  1HSQ A;  2RQU A;  1FMK A;  1HD3 A;  1M27 C;  3EHQ A;  1KQ2 A;  2LC4 A;  3LGF A;  4M77 A;  3MEW A;  1VQ4 T;  1OPL A;  4QVD A;  3TU4 K;  3GF5 A;  3JCM Q;  1TTH B;  2X9H A;  2I0N A;  4PJJ A;  3CPW S;  2GF7 A;  4XU0 A;  1TSF A;  2G6F X;  3CCU Q;  2ABL A;  3MKD A;  4DBQ A;  4J7I A;  4PLL A;  2HL5 C;  5LL6 S;  1T3L A;  2LQW A;  3M0U A;  3E1S A;  4O6J A;  2KRO A;  3VS2 A;  3OS1 A;  2XDP A;  1YJ9 Q;  2LT1 A;  1LCK A;  1QP2 A;  3CCE T;  3M57 A;  4MMK A;  2CT3 A;  5LJ3 f;  4KGZ B;  1SEM A;  5FWC A;  2NUZ A;  3OYD A;  1WDX A;  3QJY A;  4M7A E;  3TRE A;  1I4K 1;  2KR3 A;  2K57 A;  1I07 A;  2CDT A;  4AG1 C;  3CBP A;  3RIR A;  1M1K U;  1KC8 C;  3R6O A;  2J06 A;  2ZPH B;  2X4Y A;  1I1J A;  4JRQ A;  2JS2 A;  4BY6 C;  5KYU A;  5IH2 A;  2LTO A;  2AHJ B;  1LOJ A;  2A37 A;  5IHI A;  4OB3 B;  2DE0 X;  1ACM B;  4L59 A;  4QQD A;  4QVZ A;  3VUZ A;  3HRS A;  4C8Q G;  4AG2 C;  4OB0 B;  2V1R A;  2FPD A;  4JDS A;  3CCL T;  5GAO n;  2NUT B;  5A0D A;  3SWN B;  2ZAE A;  4HVV A;  4M75 F;  2KT1 A;  3H8Z A;  4JUV A;  2E65 A;  2F2X A;  4KBM B;  2PNI A;  2QDY B;  1EFN A;  2L3R A;  2RJC A;  4ME7 A;  2KNB B;  2HAX A;  1IGQ A;  2YXY A;  1WNL A;  1V76 A;  1KHC A;  2YHT A;  1K9M U;  1MMN A;  5C6S A;  4C8Q B;  5CVI A;  3BFM A;  1YJN A;  2KXD A;  4X9D A;  1X6B A;  1I0C A;  1VQ4 Q;  1ZBJ A;  2OI3 A;  1S72 A;  3LWI A;  1AT1 B;  1O75 A;  1PG5 B;  2FZG B;  2P4R A;  3VV0 A;  2KRN A;  1OZ3 A;  1FX7 A;  3CD6 T;  4BI4 A;  4R56 A;  1C6V X;  3CBM A;  2DZ9 A;  1WJR A;  3RER A;  4J6W A;  1MMA A;  1U1T A;  1WPY A;  5IT9 E;  5GAN 3;  2OTL Q;  1D1C A;  3V8K A;  5CKE A;  3PIO A;  1KD1 U;  4PJO E;  4FL6 A;  2EYY A;  3L42 A;  1N9R A;  3MP1 A;  1RAB B;  1NYG A;  3URG A;  2GCX A;  1NYF A;  1VUB A;  2PVD B;  5KYX A;  1G83 A;  3HP9 A;  2QEX T;  3MHX A;  1DJ7 B;  1G3T A;  1BYM A;  1XOV A;  2F1L A;  3M0Q A;  3MPU B;  1LJO A;  1D1B A;  1JEG A; 
#chains in the Genus database with same CATH homology
 3GBQ A;  1K0S A;  2DRK A;  2KE9 A;  1GL5 A;  2VKN A;  3H0F A;  2LJ3 A;  2DYB A;  1K76 A;  1YP5 A;  3EG1 A;  1AEY A;  2W0Z A;  3IQL A;  4AFZ C;  2F2W A;  2RMO A;  4RTX A;  2DX1 A;  2LJ0 A;  4CC4 B;  2LCS A;  2FPE A;  1IO6 A;  1UHC A;  2B86 A;  4A63 B;  3CQT A;  3LH5 A;  2IIM A;  1UFF A;  1H3H A;  4AFQ C;  1QWE A;  3H41 A;  3ZL7 C;  1G2B A;  1YN8 A;  4OMN A;  4JZ3 A;  2FRW A;  1YWO A;  1OOT A;  1AWJ A;  3TSW A;  5IHK A;  1SRL A;  2LQN A;  4F17 A;  3O5Z A;  2LMJ A;  1KIK A;  4E6R A;  4RTT A;  4Z8A A;  1HJD A;  1ZX6 A;  2KXC A;  1T0J A;  2QDL A;  3RNJ A;  2K9G A;  2DNU A;  5ECA A;  2CUB A;  1JXO A;  1A0N B;  1AWX A;  2LP5 A;  1X43 A;  2SRC A;  5L23 A;  4IIM A;  4ESR A;  3M0R A;  3I9Q A;  1YNZ A;  4QT7 A;  1J3T A;  5HCK A;  1VYV A;  3VS6 A;  2J7I A;  2JMC A;  4FSS A;  2OJ2 A;  1NG2 A;  2EBP A;  2O31 A;  4GBQ A;  2CH4 A;  1ZUU A;  4R0K A;  1KJW A;  2A28 A;  4K11 A;  2DL7 A;  4WCI A;  2OAW A;  3UAT A;  2CUD A;  3REB B;  2J6K A;  2DJQ A;  4Z89 A;  1W1F A;  3KFV A;  3NPF A;  1UGV A;  1K0X A;  1M3A A;  1B07 A;  2BTT A;  1UG1 A;  1RLQ C;  4J9I A;  4CC7 A;  1UJ0 A;  1CKA A;  2GTO A;  1YWP A;  2CSI A;  4EIK A;  2C0I A;  2LZ6 B;  1MV0 B;  4J9C A;  3M0T A;  3EG3 A;  2CRE A;  2VWF A;  1T0H A;  1WLP B;  1WFW A;  1GCP A;  2X3X D;  4OML A;  4JJD A;  2EQI A;  3UA6 A;  2XMF A;  1UUE A;  2CSQ A;  3VS0 A;  2EGA A;  1N5Z A;  1T3S A;  3QWX X;  1UJY A;  1ARK A;  3TSZ A;  1ZUY A;  1SRM A;  2AZS A;  2EGE A;  1GBQ A;  4Y92 A;  3NGP A;  1GCQ A;  2RPN A;  1KSW A;  1JO8 A;  4M4Z A;  1OEB A;  4ORZ A;  2ROT A;  2RQR A;  4RTU A;  2RNA A;  2D1X A;  2DMO A;  2X3W D;  4GLM A;  2W10 A;  2JT4 A;  5IXF A;  2ESW A;  1Y0M A;  2KGT A;  3QWY A;  2DVJ A;  3U23 A;  1M3C A;  2YT6 A;  1U06 A;  1PRM C;  2DL4 A;  1M30 A;  5IHN A;  1UEC A;  2AKK A;  2KRS A;  1K4U S;  2JMA A;  2KRM A;  5I11 A;  2ECZ A;  1WIE A;  1W6X A;  3PVQ A;  2C0T A;  2V1Q A;  4RTW A;  2HCK A;  2DL8 A;  4OMP A;  4J9G A;  2L3Q A;  2RN8 A;  2H8H A;  2D8H A;  1X2K A;  2MOX A;  1UDL A;  2F2V A;  2CT4 A;  2E5K A;  1NLO C;  4J9D A;  4RTV A;  2LNH B;  2J6F A;  3VS5 A;  2O2O A;  3H0H A;  2YDL A;  1UTI A;  1GRI A;  1AWW A;  2K3B A;  1AZE A;  1CSK A;  3VS1 A;  2JM8 A;  1B3Q A;  1MV3 A;  1KFZ A;  1ABQ A;  2RQV A;  1PKS A;  2DBM A;  2D8J A;  2FEI A;  2M0Y A;  4LE9 A;  1E6G A;  1OV3 A;  2JTE A;  4HXJ A;  4F16 A;  4HCK A;  2K2M A;  1NM7 A;  1GCQ C;  1TUC A;  2PZ1 A;  3RBB B;  1PNJ A;  1WXU A;  4LN2 A;  3ULR B;  4JPB W;  1K9A A;  1GBR A;  5EC7 A;  2MCN A;  2DBK A;  5IXB A;  2SEM A;  4RTZ A;  2L3P A;  3VS3 A;  1JXM A;  2D0N A;  3EG2 A;  4LUE A;  1SHG A;  2FG0 A;  2HSP A;  2DA9 A;  5FW9 A;  3FJ5 A;  1X6G A;  3SEM A;  2K6D A;  4CC3 A;  2FPF A;  1S1N A;  2YSQ A;  3I35 A;  1Z9Z A;  2ED1 A;  1ZLM A;  2EVR A;  1ABO A;  3A98 A;  1X2Q A;  2LX7 A;  2RQT A;  2JM9 A;  4RUG A;  3I5R A;  1Z9Q A;  2EGC A;  3PVL A;  4J9H A;  1HSQ A;  1SHF A;  2RQU A;  1RUW A;  3SHW A;  2K79 A;  1FMK A;  1HD3 A;  1M27 C;  2GQI A;  2YUP A;  3EHQ A;  5GJW B;  2KT8 A;  1SPK A;  1E7O A;  1ZUK A;  1X27 A;  4J9B A;  2EYX A;  1OPL A;  1QKW A;  1W70 A;  1H92 A;  2J05 A;  2ROL A;  2I0N A;  2DL3 A;  1QWF A;  3EG0 A;  4D8K A;  2GGR A;  2KEA A;  2KYB A;  2FRY A;  2G6F X;  1MUZ A;  2ABL A;  2BZY A;  4KRT A;  2ED0 A;  4X1V A;  1T3L A;  4JJB A;  3VS4 A;  2LQW A;  3M0U A;  1PWT A;  2DIL A;  1SSH A;  2KRO A;  4DEY A;  3VS2 A;  2RQW A;  3H0I A;  3M0P A;  1BK2 A;  4HVU A;  1JQQ A;  3UF4 A;  1TUD A;  3THK A;  1LCK A;  4LNP A;  1E6H A;  2DLP A;  2JW4 A;  1OPK A;  1UE9 A;  1K1Z A;  2CT3 A;  1SEM A;  5FWC A;  1AZG B;  2NUZ A;  1WDX A;  1CKB A;  2DRM A;  2L2P A;  3JV3 A;  4CC2 A;  2KR3 A;  1BBZ A;  1I07 A;  2CDT A;  3EHR A;  4AG1 C;  1TG0 A;  1GFD A;  3EGU A;  2BZ8 A;  3R6N A;  1PRL C;  1U5S A;  2DM1 A;  4ZNX A;  2EW3 A;  2LJ1 A;  2J06 A;  1QKX A;  1WA7 A;  1I1J A;  2EYZ A;  3UA7 A;  4RTY A;  2JS2 A;  5IH2 A;  1VYT A;  1AD5 A;  2HDA A;  2FO0 A;  2A37 A;  1PKT A;  5IHI A;  2DE0 X;  1H8K A;  1Y57 A;  4JJC A;  2GBQ A;  4AG2 C;  2V1R A;  2FPD A;  2JXB A;  2A36 A;  2JS0 A;  2CH4 W;  4HVV A;  1RI9 A;  2KT1 A;  1RLP C;  4F14 A;  1U3O A;  2EYW A;  3REA B;  2EKH A;  2L3S A;  3I5S A;  2F2X A;  1BU1 A;  1AVZ C;  1V1C A;  2AZV A;  3VS7 A;  2AK5 A;  2PNI A;  4JZ4 A;  1EFN A;  4Z88 A;  2KBT A;  4HVW A;  2KNB B;  1UHF A;  1AWO A;  2GTJ A;  1AOJ A;  4OMQ A;  2L0A A;  5I22 A;  1VA7 A;  4DEX A;  2O88 A;  4J9F A;  1FYN A;  2KXD A;  2DF6 A;  1ZSG A;  1WI7 A;  1X6B A;  1WXT A;  3C0C A;  2KYM A;  2C0O A;  1I0C A;  1ZBJ A;  1M3B A;  2OI3 A;  2J6O A;  4LUD A;  2GNC A;  1WX6 A;  4AFU C;  2P4R A;  2KRN A;  4J9E A;  2HBW A;  1QLY A;  2O9V A;  1GFC A;  2RF0 A;  4IIO A;  3TVT A;  1NEB A;  3NMZ C;  3M0S A;  4OMM A;  2EPD A;  3NHN A;  2M51 A;  2NWM A;  2O9S A;  2MIO A;  1NEG A;  2HEQ A;  4OMO A;  2A08 A;  3VRY A;  5GJV B;  2EYY A;  1NLP C;  2BZX A;  1JU5 C;  5FWB A;  1WYX A;  1BB9 A;  4AFS C;  2VVK A;  1QCF A;  2YUQ A;  2DL5 A;  4D8D A;  1NYG A;  2K7A A;  1PHT A;  2ENM A;  1NYF A;  1M8M A;  2YUO A;  3VRZ A;  1G83 A;  1WXB A;  2YUN A;  1X69 A;  3PE0 A;  2AKL A;  1XOV A;  1VYU A;  3M0Q A;  1YCS B;  2PTK A;  1JEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...