2JMCA

Chimer between spc-sh3 and p41
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
77
structure length
77
Chain Sequence
b'GAMGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQESGDNAPSYSPPPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain and P41 peptide chimera
publication title The high-resolution NMR structure of a single-chain chimeric protein mimicking a SH3-peptide complex
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 7
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jmcA00
1PRLC 2KYMA 5I11A 1H92A 1WLPB 1UG1A 3PVQA 1U06A 2MOXA 4R0KA 1RUWA 2DJQA 4LE9A 1GFCA 5L23A 1GL5A 2OI3A 1CKAA 2CT4A 2DL8A 2FPFA 4HCKA 2DM1A 1BU1A 3VS7A 2O2OA 1WIEA 1AWWA 1OV3A 3NPFA 4RTZA 4RTTA 1H3HA 2L3SA 1RLPC 1W6XA 2DMOA 1GBQA 2HBWA 1ABQA 2DRKA 2YUQA 2W10A 1YWPA 2LJ0A 3H41A 2QDLA 3VS2A 5EC7A 5IXFA 2BTTA 2O9VA 1HD3A 1FYNA 4RTUA 2LZ6B 2CUBA 2V1RA 2BZYA 2CDTA 1MUZA 4OMNA 2LP5A 2M0YA 2RQVA 1YN8A 2LQWA 3I5RA 2AZSA 2J6OA 3PVLA 2DL3A 4FSSA 3UF4A 4Y92A 2GTJA 4RUGA 2BZXA 2ABLA 4QT7A 1Y57A 4D8DA 1V1CA 1RI9A 1ZUKA 2ROLA 2DA9A 2DF6A 4KRTA 3C0CA 3THKA 2K3BA 3VS5A 1X2KA 2JT4A 3QWYA 3A98A 1VA7A 2K7AA 4LUEA 1B07A 1VYTA 4RTWA 1UHCA 2ED1A 3RBBB 2KRNA 4DEYA 2L3QA 1Y0MA 2JM8A 1X6BA 1OPLA 2KXDA 1N5ZA 2D8JA 4J9IA 4JPBW 4K11A 3SHWA 1PKSA 4HVVA 2OJ2A 1ZUUA 3U23A 1VYUA 1AD5A 1EFNA 2JS0A 1MV3A 2CSQA 2NWMA 4CC7A 1BK2A 3VS3A 1ZSGA 2EGCA 2DNUA 1K0SA 2GNCA 1Z9QA 1B3QA 1WX6A 2EBPA 2YDLA 2KT1A 3M0RA 2CH4W 2DE0X 1W70A 5I22A 2CREA 1NEGA 2MCNA 4WCIA 4E6RA 4Z89A 2EGAA 2HCKA 3UA7A 1HJDA 4J9GA 3M0TA 1ARKA 2ED0A 2KEAA 2KRSA 3LH5A 2YUNA 1ZUYA 2EYZA 3O5ZA 2NUZA 2CSIA 3ULRB 2GGRA 1QWFA 2KT8A 1SHGA 1JO8A 1WFWA 2ESWA 2YUPA 1QKXA 2SEMA 3H0IA 1QKWA 2LCSA 2RPNA 4ORZA 1CKBA 1AOJA 1X43A 1M30A 3EG1A 2H8HA 1WI7A 3I5SA 2D1XA 1GRIA 1E7OA 1NG2A 4GBQA 4AFZC 1JQQA 4OMPA 1YCSB 3H0HA 2DILA 1KSWA 2O9SA 2LJ3A 2GTOA 2J6KA 2RQTA 2YUOA 2AZVA 3M0SA 4JJBA 2KE9A 1M3CA 1NM7A 4JZ4A 2GQIA 2DL7A 2F2XA 5ECAA 1JEGA 1UDLA 2L0AA 3NHNA 2FPEA 1NEBA 2D8HA 2KRMA 2A28A 1FMKA 4EIKA 3VS6A 4D8KA 2ECZA 2RQWA 1UFFA 1IO6A 1VYVA 2C0OA 2E5KA 4RTXA 1E6HA 1PWTA 4CC3A 3PE0A 4HVUA 1T3SA 3EG0A 4JZ3A 3EG3A 1TUCA 2LNHB 4AFQC 1AWXA 3RNJA 2KROA 3SEMA 4LNPA 1BBZA 1X2QA 2O88A 4ESRA 2A08A 1T3LA 2KYBA 2HDAA 2B86A 2JM9A 1MV0B 1XOVA 3UA6A 5IH2A 4IIMA 2JXBA 3I35A 2L3PA 2JS2A 5IXBA 3NMZC 2AK5A 2V1QA 5IHKA 1AWOA 5IHIA 1QLYA 2JTEA 2DLPA 3M0QA 1OPKA 3JV3A 1NYGA 2JMCA 1PKTA 1KJWA 1E6GA 1ZX6A 2JMAA 2EYXA 1S1NA 1TUDA 4GLMA 2K2MA 1KIKA 2XMFA 1I0CA 5IHNA 3VS0A 3TSWA 1HSQA 1UGVA 4J9EA 4HXJA 2DL4A 2G6FX 2PZ1A 1UHFA 3ZL7C 2KNBB 4J9HA 3VS1A 3QWXX 1YP5A 2CT3A 1RLQC 2J7IA 2PNIA 4RTYA 2RQRA 2AKKA 3KFVA 4M4ZA 1QCFA 2DL5A 3EG2A 2DYBA 2KR3A 4JJDA 2EQIA 2K6DA 4AG1C 3UATA 2ROTA 1AZEA 3VRYA 2J05A 4HVWA 2JW4A 1ABOA 4F17A 3I9QA 2VKNA 2P4RA 4J9DA 2VVKA 1UJYA 2J06A 1TG0A 4X1VA 4Z88A 1X69A 1NYFA 1UECA 1M3BA 1U3OA 1UJ0A 2LX7A 2VWFA 4RTVA 1GCQA 2SRCA 1WDXA 4A63B 1X27A 1G2BA 1JU5C 3IQLA 1ZBJA 2X3WD 1KFZA 5FWCA 1K0XA 2CH4A 2FG0A 1JXMA 1PNJA 5FW9A 1UE9A 2K79A 2A37A 2M51A 1AEYA 2LQNA 1GCPA 2C0TA 1QWEA 1H8KA 3H0FA 2HSPA 4OMOA 3VRZA 3GBQA 3TVTA 2KGTA 1YNZA 2HEQA 2RF0A 2L2PA 2PTKA 2RNAA 4J9FA 2X3XD 3M0PA 2LMJA 2KXCA 1J3TA 2LJ1A 1A0NB 1WA7A 1OOTA 3REBB 2DVJA 3CQTA 4J9BA 1K9AA 1UUEA 1SRMA 5FWBA 1M3AA 4DEXA 2OAWA 4J9CA 4IIOA 1NLPC 2DX1A 1W1FA 2O31A 2AKLA 4AG2C 1K1ZA 2F2VA 4LN2A 1SSHA 1OEBA 1Z9ZA 1CSKA 2DBKA 1GFDA 2F2WA 1WXUA 2C0IA 2YSQA 2EVRA 1T0JA 3TSZA 4F16A 2FEIA 2RN8A 4ZNXA 2FRWA 2BZ8A 1WXBA 2YT6A 2EYWA 5HCKA 1K76A 2A36A 2K9GA 2RQUA 2DRMA 1SEMA 1PHTA 2CUDA 3EHRA 2GBQA 1AWJA 1K4US 1AVZC 1NLOC 4OMLA 1BB9A 1SHFA 1JXOA 2W0ZA 2FO0A 3FJ5A 1AZGB 1WYXA 1M8MA 4AFUC 2EW3A 1X6GA 2DBMA 2I0NA 1I1JA 3REAB 2KBTA 2FPDA 4JJCA 5GJWB 2EKHA 4CC4B 1ZLMA 3NGPA 1LCKA 1PRMC 2IIMA 1U5SA 2J6FA 4CC2A 1I07A 1WXTA 1UTIA 1GBRA 2FRYA 1SRLA 3EGUA 4Z8AA 5GJVB 2RMOA 1T0HA 2ENMA 4OMQA 1SPKA 1YWOA 1M27C 4AFSC 4F14A 3VS4A 4OMMA 3M0UA 2MIOA 3EHQA 2D0NA 2EYYA 3R6NA 1G83A 1GCQC 2EGEA 4LUDA 2EPDA
chains in the Genus database with same CATH superfamily
1PRLC 5GAN2 1U06A 5GAN8 3C12A 3I56Q 3EAEA 5GAOq 1GFCA 1GL5A 2OI3A 5GAOp 5A0LA 2EKOA 3QIIA 1TTHB 4HCKA 2HKNA 1IHWA 2O2OA 1D1BA 1VQ4T 2HMAA 4RTZA 1YJNA 1PSFA 4R56A 2L3SA 3JB9H 2HBWA 4C92G 4E7ZA 1ABQA 2W10A 1YJ9Q 3H41A 2KSSA 2BTTA 4KT0E 1OYXA 2LT4A 4GY5A 3G4SQ 1K73U 3JCMg 1C6VX 1WZOA 3JCMb 2I2LA 2E41A 2V1RA 3GLXA 2CDTA 3X26B 5CKDA 4OMNA 1OI1A 1NJIC 2QGFB 3JCMh 3CC7T 5L8RE 2J6OA 4M7AF 3CCJQ 2YXYA 3S3MA 4N4HA 1PCXA 1ACMB 1KQ2A 1RI9A 4J7IA 2ROLA 2DA9A 4KRTA 5GAOn 3C0CA 1WHGA 2E65A 2K3BA 2RHZA 3THKA 3VS5A 4E47A 3QWYA 1RAHB 1VA7A 1ZA1B 2K7AA 4LUEA 1VYTA 2H3EB 2LX9A 5EG2A 4PJNA 1X6BA 2XIDA 1N5ZA 4K11A 3A8GB 3JAME 2CZ6B 4HT8A 3CCMA 1RAEB 3U23A 4ZGDB 2HQHA 4OGEA 1S72A 3OYIA 4C5EA 1ZQ1A 5KYNA 1M1KU 2E3HA 4CC7A 4ZN1A 3VS3A 2RK2A 4HA8A 2EGCA 1N8RC 3L2RA 3LX7A 2DETA 2RB6A 1BI0A 1Q7YC 2YDLA 1Y7XA 3M0RA 2JJ9A 3QPHA 5GANf 4M78B 3SD4A 4WCIA 2WACA 1W4SA 2M1HA 3UA7A 2KRSA 1IREB 4MMLA 4DBFA 3INZA 1VQ6Q 2CSIA 3ULRB 2D9TA 3OS2A 3RIRA 4WTOB 1VQMT 5I2SA 2XI9A 1QKXA 4RCCA 2QQBA 1CKBA 1X43A 3A1PA 3C95A 1MMGA 3M54A 1GRIA 3RKXA 5LJ3g 3HFOA 4JS4A 1SG5A 2RHXA 2HKQB 2LJ3A 5KYXB 1KHIA 3BE3A 2RQTA 2C06A 3L2QA 4PNOA 3MJXA 2XG8D 2OTJA 2P0PA 4JZ4A 2JVVA 1W2BS 1KQSP 3ZFJA 4OP0A 1JEGA 2F69A 1UDLA 2L0AA 5LJ5g 3UPUA 3NHNA 3QUIA 1NEBA 4BY6B 1FMKA 1VQKQ 4EIKA 4D8KA 3OA6A 1UFFA 4FYXB 5IAYA 4O6JA 3ZBDA 2E5KA 4F7UA 5D7UA 1E6HA 3PE0A 1MGQA 4FL6A 1TU0B 2QQ9A 1WHLA 2BUDA 2X4WA 2LNHB 4MDXA 2KROA 3CMAT 4XU2A 4LNPA 1X2QA 4A53A 2O88A 1WHHA 4LD6A 1T3LA 2JM9A 3UA6A 2EQUA 3I56A 2JXBA 4C8QB 3NMZC 2DD4A 4B6MA 4JRIA 2L89A 5I2MA 1QVGP 2DLPA 2QAZA 2DD5A 3JV3A 2LCCA 3BW1A 1PKTA 3JCMV 1HYOA 3CD6T 3FDRA 3JSCA 4WF2A 1VQOT 2K2MA 1YJ9A 3META 1JRIA 3TSWA 1NPPA 1UGVA 3TU4K 1W2BA 1TUGB 1FWZA 1OU9A 3PNWC 2G6FX 2PZ1A 1UHFA 2ZPHB 2HQXA 1K73C 2R5AA 4ANJA 1JJ2P 5GMKh 4F7UE 5IN1A 2J7IA 2VC8A 3MEVA 1M1GA 1OZ2A 2RI2A 1VQ5Q 1IGQA 3L1AA 4X34A 2K6DA 3HHTB 1VQ8T 5KCHA 1RABB 2QGGA 2J05A 3OS5A 4HVWA 3CCUA 2JW4A 1ABOA 1ZSZB 5LJ5j 1VQPQ 2VVKA 1UJYA 2J06A 1M90U 4X1VA 4Z88A 3G6EA 4XAXB 2CZ0B 1AHJB 1UJ0A 5HY6A 3OYBA 3JRZA 4NOYA 3LGLA 3M58A 2QEXA 2E1HA 2LQKA 2NUTA 3IQLA 3CCQQ 3CCJT 1Y07A 3HFNA 2X3WD 1YHQT 4DA4A 3EG9A 5I21A 2WSEE 4LDWA 4PLLA 1K0XA 5CQYA 1PNJA 2M51A 4EPCA 1M1KC 4M7DC 2C0TA 2DIGA 1GXIE 2HSPA 4B9XA 1RL2A 4M7DD 3S3NA 2K2VA 2OTLA 1G8XA 2HEQA 2X4JA 4J9FA 2RNAA 4M7DA 4MZTA 5AT1B 1G3YA 1OOTA 3REBB 2DVJA 2DTOA 2K5FA 3D7SB 5FWBA 1SRMA 1M3AA 1M5Q1 2EYQA 4J9CA 2QK0A 2XDDA 4M77F 2DX1A 1W1FA 2WSCE 1Y96A 2AKLA 2MMPA 2NYSA 1K9MR 4BDYA 1VQ6A 1VIFA 1VQNA 1Z9ZA 2COWA 3J81E 2CP0A 2DBKA 3T9NA 1GFDA 1Q95G 4MDWA 2C0IA 3RKYA 2L3RA 3H6ZA 1T0JA 3TSZA 4F16A 2FEIA 2VUBA 4PJOF 2BZ8A 3JCMQ 2EYWA 3OW2S 5HCKA 3ASKA 4JS5A 1VQ9T 1MMAA 3O8VA 1VIEA 2GF7A 3CC7Q 1M9SA 3E1SA 4JLGA 2DPPB 2XK0A 1JXOA 2W0ZA 1V76A 1AZGB 4M7AD 3OYJA 2KBTA 4C5HA 4M7DE 5GJWB 4PLIA 4M7AA 4CC4B 4OB2B 1YJWA 3NGPA 1LCKA 1PRMC 2IIMA 2J6FA 1VUBA 1UTIA 1XTDA 4Z8AA 4BI4A 2LCLA 1LOJA 3ER0A 3L2WA 4C0GA 4AFSC 2K5LA 2QI2A 3EHQA 4BB7A 4LUDA 3G1JA 1M8VA 2KYMA 3OYCA 2MPXC 2XDBA 1UG1A 1I5LA 3VV0A 2CP3A 4M78C 4R0KA 2DEUA 3EFRA 4LE9A 5L23A 1VQKT 1RI0A 4C5IA 1CKAA 3OW2A 4OVAA 2DM1A 3M59A 4EMHA 4F7UB 1PD0A 2WSFE 3RMSA 1TH7A 1WIEA 1QP2A 4A4FA 1OV3A 3NPFA 4RTTA 1U1SA 2HL5C 1ZBXA 1RLPC 1W6XA 2DMOA 4ELYC 2LT1A 4M7AE 2DRKA 3TQ7P 3VS2A 2X51A 1VQMQ 1H641 3EH1A 4RTUA 3OYYA 5GAN3 2DIQA 5KYWB 3LH0A 1I4K1 4RCBA 2BZYA 2VASA 3FRNA 2LP5A 2YLCA 2VXEA 1VQ5A 4IUTA 1SF9A 4M75B 3UF4A 4KUIA 4QT7A 1M2OA 2EIFA 1WNLA 3HL8A 1RAGB 4BI3A 1R77A 2DEQA 3QDRB 2DF6A 5CO7A 1WHMA 4BY6C 4QVDA 1VQPA 1X2KA 3L2UA 3A98A 3OBYA 3M4YA 1WGSA 3EGXB 1M90C 4XTZA 1UHCA 2JTFA 4XTVA 1Y0MA 2RD1A 1QCNA 4QKUA 4ZTFA 1QVFS 4J9IA 4JPBW 5FU7B 3QXEB 2OJ2A 4E7LA 2IG0A 3JCMW 3LW5E 4QW2A 5KE3A 4FYYB 3CMAQ 4LDXA 1EFNA 4C8QC 2NUPA 4C8QD 3NTIA 1FXXA 2Z0WA 1K0SA 4FU6A 3X20B 5D6XA 1MNEA 3HPWA 4C8QA 2E6NA 2ZAEA 5GAN4 3CCLT 4C0DB 2EBPA 1WQWA 3DB4A 2NUTB 1W70A 1VQ4A 5I22A 3FEOA 3CCQT 1NEGA 1D0ZA 1XQHA 3EG9B 4Z89A 3MP6A 2EGAA 3CD6Q 1YI2Q 2HCKA 1VQ7T 1HJDA 3FIFA 3M0TA 3TREA 2KEAA 3OQ5A 2A3LA 3TCJA 3NTKA 2GGRA 2M16A 2LNVA 3CC4T 1JO8A 4M7DB 2ESWA 4X9DA 2SEMA 4HT9A 4ORZA 3MKDA 3EG1A 2ZPBB 2GCXA 3CC2T 1WI7A 4R55A 3OS0A 1D09B 1QVFA 1NG2A 4AFZC 3CC7A 1N27A 1SSFA 1ZSZC 2OAUA 1YCSB 3CMEQ 3FC3A 2O9SA 4DBQA 4JUVA 1Y96B 5FU6B 3VUBA 1VQ8Q 3LWIA 2J6KA 5GANg 2KQWA 4DBHA 4ATOA 4JJBA 1ZSZA 1LNXA 1M2VB 4E7SA 5A0GA 4C8QE 1NM7A 2LDMA 5GMKm 4B9WA 1Q86R 1PM3A 2E3IA 3M9QA 5ECAA 1WHJA 2FPEA 3KBGA 2D8HA 2KRMA 4C92F 4OF1A 4RG2A 4RMOA 1R8OB 3OYLA 1WHKA 3DKMA 2ECZA 1D0XA 1IO6A 4FW1A 1VYVA 1QP3A 2MF2A 2RJFA 1YHQQ 3QYHB 1PWTA 2BE7D 1OX9A 1NPRA 1T3SA 1KD1R 4XK8E 1TUCA 4AFQC 3RMQA 3CCRQ 1AWXA 4M7AB 2PVDB 4FSXA 3SEMA 4LXCA 3H9NA 3OYAA 5J26A 4LDYA 2KYBA 2HDAA 2B86A 1XOVA 1IB8A 4IIMA 4A4GA 2ZCFB 3I35A 2DTHA 1AWOA 2ZPGB 2XHCA 2P4TA 2CP7A 3L2ZA 1VOMA 1OPKA 2ZZDA 1TWBA 2JMCA 1KJWA 3M56A 3X28B 2JMAA 1KG1A 4M78G 1Q81U 4ZN3A 2KDSA 4KBMB 2BE9B 2XMFA 3KXTA 4M77D 1SKUB 1VQMA 2CZ7B 2V8JA 3OYFA 4M77A 1VQ9Q 3I55A 4J9HA 1YP5A 2CT3A 4E7HA 1RLQC 4PJOD 2RQRA 3BY7A 3M53A 5GANj 1IGUA 5GAMd 4JJDA 4PJOA 1X6OA 1BI1A 1YITQ 4AG1C 2RJDA 2XDPA 9ATCB 2LC4A 3X25B 1O9SA 3I9QA 3TEEA 3CCMT 2VKNA 3CCET 5FLXE 2E70A 3CBOA 1M4ZA 1UGSB 3CXCP 4NS5A 4HKEA 1YIJA 1X69A 2CGHA 1NYFA 1UECA 2MK5A 3PIOA 3X24B 3HRTA 5KYUA 3MHXA 2KAFA 4IURA 1FX7A 1P92A 1X27A 5LJ3h 1ZBJA 2OX7A 4J7FA 3PMTA 5FWCA 1NJIR 4GLKA 1UE9A 3RR6A 3CMAA 2NLUA 2ZPFB 2KY9A 2LQNA 1KC8C 1QWEA 1H8KA 2QA4Q 5AYFA 5GMKl 1YBYA 4V2SA 2RF0A 1ZA2B 2L2PA 2HD0A 5GAN6 2ZGWA 5LJ5h 3JCMd 3R6OA 3JB9D 2LJ1A 1A0NB 2DKGA 1WA7A 2M02A 4C8QG 3CQTA 2L8DA 1B34B 4FYWB 4J9BA 4ZGJB 3G71T 6AT1B 1B7TA 3OS1A 2X4XA 1JJ2S 1VQOA 2OAWA 2K3YA 2YLBA 5J39A 5GAOm 2NUPB 4AG2C 1K1ZA 1X01A 4LN2A 3FJPA 2RI5A 1KQ1A 1N9RA 1RACB 4FCYA 2F2WA 1WXUA 3J7AF 5KYWA 4M75C 1WXBA 4DBRA 1LVKA 4M75D 5D6WA 2DERA 3A5ZB 3C4SA 4BUGA 3OBWA 2DFUA 1BI2A 4M75A 1YI2T 3EHRA 2GBQA 1AVZC 1NLOC 4OMLA 1SHFA 1HK9A 3JCMX 2YRDA 1VQ8A 3P8HA 2FO0A 3MEWA 1WYXA 4J6WA 2QTXA 4AFUC 2EW3A 2DBMA 2I0NA 3G4SA 2LVMA 3H8ZA 3EGXA 2FPDA 4JJCA 4Q5WA 4J6XA 5FU7C 4CC2A 3E9FA 1OX8A 3HSBA 2O01E 5CIUA 1WPYA 3CMET 4PJJA 4FW2A 3CCJA 2HL3A 1YHQA 1U8RA 5FRNA 1JJ2A 2QG9B 3SWNB 5GANe 3M0UA 3R6NA 5A2QE 1Q86U 2EGEA 4C0DC 1WJQA 2EPDA 5I11A 1H92A 3OB9A 2MOXA 3CCLQ 4FM4B 3VU3C 4M75E 2G3RA 2CT4A 3CCSQ 2F5KA 3CPWP 4QQDA 1BU1A 4OB1B 2DO3A 3M57A 3QYGB 1VQ7Q 2EQJA 5LJ3d 4NL2A 1R0BG 2FZGB 4Y28E 2EAYA 3CCRT 1GBQA 4KGZB 1Q81C 3SFMA 4ELZC 4BDZA 5IXFA 1K8AR 3CC4Q 2O9VA 1HD3A 3PFSA 2P84A 2LZ6B 2PVGB 1QMCA 3OYKA 3CC2Q 3CEYA 1VQ9A 1HXDA 5FU6C 4BACA 5LJ5d 2FYKA 3VKIA 3PGGA 2LQWA 2AZSA 4FSSA 2GTJA 2BZXA 2ABLA 1Q82R 1UGPB 3QKJA 1Y57A 3WXMB 1M2VA 5CKEA 2E5QA 4QQ6A 1BYMA 1X75C 4XU1A 2R57A 5GAOl 2JT4A 4M77B 3DLLA 5GMKj 1B07A 2CYZB 2ED1A 3MP1A 2KRNA 3RBBB 4DEYA 3M4GA 3LLRA 4QVCA 2JM8A 2CZ1B 2QASA 2V8KA 4QVZA 2DZCA 4PJOB 1YCYA 5CAIA 1K73R 3SHWA 1QCOA 1YITT 4M7AC 4HVVA 1TXQA 3ZEHA 2YRCA 3OSSC 1ZUUA 4EMKB 1EX4A 1YJNQ 4J6YA 2LQ8A 1I8FA 1AD5A 2JS0A 2CP2A 3OYHA 3DB3A 1MV3A 4HCZA 4PK4A 2NWMA 1NBEB 2K57A 3CBMA 1ZSGA 1VQKA 2GNCA 1Z9QA 1B3QA 5KYUB 4CRIA 2KT1A 3GNFB 2HSEB 2O4XA 2CH4W 4D6WA 2AT1B 3NFCA 4N0AA 2MCNA 4KGVB 1KHCA 3CCVT 4E6RA 4NL3A 2RHYA 5KE2A 4F7UG 4J9GA 2ED0A 3LH5A 2EYZA 3JB9G 5GAN5 5M9OA 2QA4T 4XTYA 5DLOA 1BKBA 3RDVA 3OW2P 2RM4A 1N6AA 1WFWA 3EGDA 3UT1A 3H0IA 2RJEA 2RPNA 2H8HA 4XQ3A 3QZ5B 4F7UF 2D1XA 3Q1JA 4OMPA 3H0HA 1KK7A 4JRKA 2GTOA 1FMWA 2YUOA 1WJRA 3M0SA 4M75G 3CCMQ 3CCEQ 2KE9A 1D1CA 4A4KA 1MMNA 3QDFA 4FYVB 1I81A 4BD3A 2DJZA 2F2XA 2PUKB 3BFMA 5CK9A 2LTOA 2JZ2A 2CP6A 1G5VA 3VS6A 3QBYA 3QHSA 2RQWA 2V26A 2DXUA 3CBPA 4CC3A 4HVUA 4L59A 3EG0A 2JN0A 3EG3A 2JTMA 3JB9I 5CVIA 1VQLT 3RNJA 2A0FB 2BIVA 1Q86C 3V8JA 1BBZA 2A08A 2Y4YA 2F5TX 5IH2A 3HRUA 3CCLA 2L3PA 5IXBA 5GMKe 3OYEA 2V1QA 5IHKA 5IHIA 3JB9J 3CCQA 1PSEA 3V7CA 3G71Q 4QQGA 1B34A 1QLYA 2RK1A 3M0QA 5KH6A 1VQ7A 3P8DA 2RHUA 2QXFA 1NYGA 1E6GA 1ZX6A 3E19A 4EMGA 2ZPEB 1G3WA 1OQKA 5IT9E 2X35A 3VS0A 1HSQA 4J9EA 2OTJQ 3FB9A 1D3BB 3CC4A 2DL4A 4KULA 3VYHB 4BE2A 3CCST 1NE8A 5J3BA 2KNBB 4JRPA 3EFSA 2K4YA 3QWXX 3VS1A 3CC2A 2PNIA 4RTYA 4M7DG 2RI3A 4LDUA 3KFVA 4M4ZA 5CCAA 1QCFA 2DL5A 3EG2A 2KR3A 4VUBA 2KI7A 3UATA 2ROTA 1K8AU 2FVUA 4ZTJA 2D0QB 3BDLA 3JCMP 1YFNA 4M7DF 2VGNA 4KUDK 2QYZA 2E10A 1QVFP 1XJWB 4PFPA 4J83A 1U3OA 4E2FB 4BE0A 4Y91A 3SWNC 2LX7A 2VWFA 1GCQA 4HCBA 2A7YA 2SRCA 3RERA 1Q82U 1K9MU 4UC4A 4A63B 3OYNA 3G7ZA 3FLGA 4FT2A 3SWNA 2X9HA 1KFZA 2B8AA 2AHJB 5DM7R 4EDUA 2K79A 1MNDA 5GANh 3UDCA 1JB0E 1GCPA 3H0FA 5HK3A 1D1AA 2MYSA 4OMOA 3VRZA 5C0MA 3GBQA 3MEAA 4M7AG 1F1BB 4XU0A 2X3XD 3M0PA 2KXCA 3WVEB 2HNIA 4LD9K 3JCMc 1J3TA 1M1FA 1M90R 3A8HB 2FL7A 3VYGA 4C92B 1WJSA 2E64A 4DEXA 1YJNT 2DVEA 3SDZA 2O31A 4A4HA 1RAAB 2Y4XA 3LYIA 2F2VA 3RESA 7AT1B 1OEBA 2XKOC 3CCUQ 2EVRA 5GAMf 1QVPA 4TVRA 4ZNXA 2FZCB 1BI3A 3GOXA 2O4XB 5GAMj 3G6EQ 4MMKA 2K9GA 2LRQA 2RQUA 1OULA 1SEMA 1PHTA 3CXCS 2CUDA 3OMCA 4L5GA 1LJOA 4M77C 2YRVA 2DXBA 4XTWA 5GMKi 3OYMA 2R5MA 2QEXQ 1OU8A 3CCEA 1M8MA 1MHNA 1X6GA 1I1JA 3HRSA 3MCAB 4OB3B 3EGDB 4PJOC 2EKHA 4YTLA 1KQSS 5GAOr 5A0DA 4M78F 1I07A 4DQ2A 3M55A 4IUPA 2OTLQ 1GBRA 2FRYA 4PJMA 4XU3A 4EMKC 1SRLA 2FB7A 2PUOB 2JUFA 1JBMA 2RMOA 1T0HA 4F04B 2KK4A 5CQXA 2DXTA 4OMQA 5FROA 1SPKA 1M27C 3PTAA 4EMKA 4RG8A 2QTVA 2YWWA 3AHUA 2MIOA 1S72T 2D0NA 4OGCA 3JCMf 4DOVA 2DAQA 1Y71A 1WLPB 3PVQA 1RUWA 1VQNQ 4AMCA 2DJQA 3URGA 4IUQA 2DL8A 2V8IA 2FPFA 2VB6A 4PFOA 2RH2A 1D0YA 2JNGA 3VS7A 3CCVQ 3GF5A 3CXCA 3G71A 3I55T 1AWWA 2X4YA 1WQ7A 4M77E 1H3HA 4RKUE 1QVGS 5FRMA 2YUQA 2PVOB 1YWPA 2LJ0A 2QDLA 5EC7A 5GANd 3V7RA 3A8MB 4KH0B 1FYNA 5CKBA 4PJOE 4PFZA 2CUBA 1KQSA 4FT4A 2QQRA 4JLIA 1H3ZA 4L6V5 4OMFB 1YJWQ 1MUZA 1YIJT 2M0YA 4XTXA 5D6YA 2RQVA 3CD6A 1YN8A 1YI2A 3I5RA 2ATCB 3QO3A 3PVLA 2DL3A 4Y92A 4RUGA 4A54A 3OMGA 4D8DA 1V1CA 1ZUKA 1DJ7B 1K8AC 2E6ZA 2OTJT 1C0MA 3V7SA 4C8QF 1BCOA 2IVWA 3DLMA 3EFOB 4IUVA 4RTWA 1N8RR 4P5NA 2H3JA 1PG5B 8ATCB 2L3QA 4JRQA 3KUFA 2XICA 2HAXA 1OPLA 2KXDA 4J8OA 2D8JA 5CKFA 1Q7YR 3CMEA 2DZ9A 1N9SA 1PKSA 1Q82C 2VV5A 3N5BB 1W2BP 1K9MC 5GAMe 2CKKA 3OYGA 1VYUA 1QVGA 3CPWS 1VQLQ 4II1A 2CSQA 4PKCC 1BK2A 3A8LB 1PC0A 1UB4A 2ZPIB 3EH2A 2DNUA 4CI0C 5LJ3f 1BCMA 3I56T 1WX6A 1MMDA 2EJGA 2DYIA 5LJ3j 2RA2A 2DE0X 3SB2A 2CREA 3QJ6A 1UGRB 3L2VA 1R0CB 2EQKA 5KYYA 3CCRA 1ARKA 3S6WA 2VYTA 2YUNA 1ZUYA 4E7IA 3O5ZA 1PD1A 5LJ5f 2NUZA 4MZMA 4JDSA 4BI8B 1D3BA 1YJ9T 2E4HA 2BKDN 1QWFA 2KT8A 3E2UA 1SHGA 3A8OB 2DK3A 2YUPA 2LCSA 1QKWA 3G4ST 2R58A 1AOJA 3QSUA 1M30A 1ZHIA 1KC8R 4ME7A 3JCMe 3I5SA 1KD1U 1E7OA 1RADB 4GBQA 4BE1A 1JQQA 3MEUA 3CPFA 1TS9A 2DILA 2XU8A 1KSWA 2K3XA 4E7JA 4IUUA 3ME9A 2M9UA 2AZVA 3CPWA 4N4GA 1M3CA 3CCUT 3JCMJ 1QQJA 2MWPA 2GQIA 2DL7A 4E7KA 3OSVA 4HCCA 4M77G 3G6ET 2A28A 2HZYA 4O5VA 1LPLA 2C0OA 1YITA 3OYDA 2EFIA 4AT1B 4XTUA 4RTXA 3L42A 2QEXT 1VQ4Q 3J80E 4PJOG 3PIPA 4JZ3A 3GPLA 2M0OA 3OY9A 1IZ6A 1O75A 5HKCA 4ESRA 4J5YA 1MV0B 4C92C 2MAMA 2OTLT 2IPOB 2MWOA 4C92D 2JS2A 3AT1B 2AK5A 2JOYA 4OB0B 2QQSA 2COZA 2Y90A 4C92A 3CCVA 2JTEA 2RJCA 1RAFB 1U1TA 1XNIA 2RHIA 2EYXA 1S1NA 1TUDA 4GLMA 1TOVA 2EQMA 2GFUA 1KIKA 2QA4A 3E9GA 1I0CA 5IHNA 3QJYA 4N0AC 1G3TA 1EIFA 2CP5A 1VQ6T 1VQNT 4HXJA 3ZL7C 1C1AA 3NTHA 3M5AA 2D6FA 4C0FA 3PMIA 4X9CA 4ZGEB 1NJIU 2AKKA 2VXFA 2DYBA 3S3OA 2EQIA 2K5IA 1RAIB 5LJ3e 1AZEA 1NZ9A 3VRYA 2XD0A 5C6SA 2P0QA 4F17A 2L5QA 1QW1A 4PL6A 2P4RA 4J9DA 2MI6A 1TG0A 1M1KR 2DXCA 5CKHA 1Q81R 2VGMA 4C92E 1YJWT 1BIBA 1M3BA 3VUZA 3JB9F 1OZ3A 4RTVA 5LJ5e 4N4IA 4KGXB 4M78D 2COYA 1WDXA 4LDVA 5DY9A 2EJ9A 1G2BA 1JU5C 4MZPA 2P0KA 4M78A 1S72Q 3F70A 3GIBA 2RO0A 3MO8A 3HKSA 3RKWA 1V29B 2CH4A 1VQLA 2FG0A 1JXMA 5CR2A 4A4EA 5FW9A 2DTIA 2A37A 2PQWA 1AEYA 1N8RU 2GFAA 5DLQE 8AT1B 3HTRA 2KGTA 3TVTA 1YNZA 3RUXA 2PTKA 1Q7YU 2LMJA 4M75F 2KVQG 3I55Q 1I5OB 1K9AA 1UGQB 1UUEA 1AT1B 2GQVA 4IIOA 1NLPC 5KYXA 4Z02A 2F1LA 1SSHA 3GNGA 3QZ9B 1CSKA 2CS7A 4FIBA 2FHDA 2YSQA 3CCSA 2RN8A 2FRWA 4C0ZA 2YT6A 3HP9A 1YIJQ 2KMTA 1K76A 2A36A 5LL6S 4M78E 1G3SA 2DRMA 1IRXA 1IXDA 1KD1C 2HQEA 2PU9B 5KYYB 4C5GA 1AWJA 5HK0A 1K4US 3V8KA 1VQ5T 1BB9A 3PT9A 3LGFA 4IKFA 2EJFA 2QQAA 3FJ5A 3REAB 3MP8A 3GP8A 2YHTA 3P8BB 1BIAA 1VQPT 2AIRB 3EFOA 3MPUB 1EZZB 1ZLMA 1KC8U 2HBPA 4KH1B 1U5SA 3QG1A 3LWHA 5GAN7 3WVDB 1UEBA 1WXTA 1TSFA 5GAMg 3C94A 3EGUA 5GJVB 5KCOA 3V8LA 2FZKB 2ENMA 3VJPA 4JJNK 2E12A 2EWNA 1IHVA 1YWOA 4F14A 3UWNA 3VS4A 5GAMh 4OMMA 1FMVA 4DOWA 2EYYA 2QDYB 1G83A 1GCQC 1VQOQ 3BDUA 4PJLA
chains in the Genus database with same CATH topology
1PRLC 2KYMA 5I11A 1H92A 1WLPB 1UG1A 3PVQA 1U06A 2MOXA 4R0KA 1RUWA 2DJQA 4LE9A 1GFCA 5L23A 1GL5A 2OI3A 1CKAA 2CT4A 2DL8A 2FPFA 4HCKA 2DM1A 1BU1A 3VS7A 2O2OA 1WIEA 1AWWA 1OV3A 3NPFA 4RTZA 4RTTA 1H3HA 2L3SA 1RLPC 1W6XA 2DMOA 1GBQA 2HBWA 1ABQA 2DRKA 2YUQA 2W10A 1YWPA 2LJ0A 3H41A 2QDLA 3VS2A 5EC7A 5IXFA 2BTTA 2O9VA 1HD3A 1FYNA 4RTUA 2LZ6B 2CUBA 2V1RA 2BZYA 2CDTA 1MUZA 4OMNA 2LP5A 2M0YA 2RQVA 1YN8A 2LQWA 3I5RA 2AZSA 2J6OA 3PVLA 2DL3A 4FSSA 3UF4A 4Y92A 2GTJA 4RUGA 2BZXA 2ABLA 4QT7A 1Y57A 4D8DA 1V1CA 1RI9A 1ZUKA 2ROLA 2DA9A 2DF6A 4KRTA 3C0CA 3THKA 2K3BA 3VS5A 1X2KA 2JT4A 3QWYA 3A98A 1VA7A 2K7AA 4LUEA 1B07A 1VYTA 4RTWA 1UHCA 2ED1A 3RBBB 2KRNA 4DEYA 2L3QA 1Y0MA 2JM8A 1X6BA 1OPLA 2KXDA 1N5ZA 2D8JA 4J9IA 4JPBW 4K11A 3SHWA 1PKSA 4HVVA 2OJ2A 1ZUUA 3U23A 1VYUA 1AD5A 1EFNA 2JS0A 1MV3A 2CSQA 2NWMA 4CC7A 1BK2A 3VS3A 1ZSGA 2EGCA 2DNUA 1K0SA 2GNCA 1Z9QA 1B3QA 1WX6A 2EBPA 2YDLA 2KT1A 3M0RA 2CH4W 2DE0X 1W70A 5I22A 2CREA 1NEGA 2MCNA 4WCIA 4E6RA 4Z89A 2EGAA 2HCKA 3UA7A 1HJDA 4J9GA 3M0TA 1ARKA 2ED0A 2KEAA 2KRSA 3LH5A 2YUNA 1ZUYA 2EYZA 3O5ZA 2NUZA 2CSIA 3ULRB 2GGRA 1QWFA 2KT8A 1SHGA 1JO8A 1WFWA 2ESWA 2YUPA 1QKXA 2SEMA 3H0IA 1QKWA 2LCSA 2RPNA 4ORZA 1CKBA 1AOJA 1X43A 1M30A 3EG1A 2H8HA 1WI7A 3I5SA 2D1XA 1GRIA 1E7OA 1NG2A 4GBQA 4AFZC 1JQQA 4OMPA 1YCSB 3H0HA 2DILA 1KSWA 2O9SA 2LJ3A 2GTOA 2J6KA 2RQTA 2YUOA 2AZVA 3M0SA 4JJBA 2KE9A 1M3CA 1NM7A 4JZ4A 2GQIA 2DL7A 2F2XA 5ECAA 1JEGA 1UDLA 2L0AA 3NHNA 2FPEA 1NEBA 2D8HA 2KRMA 2A28A 1FMKA 4EIKA 3VS6A 4D8KA 2ECZA 2RQWA 1UFFA 1IO6A 1VYVA 2C0OA 2E5KA 4RTXA 1E6HA 1PWTA 4CC3A 3PE0A 4HVUA 1T3SA 3EG0A 4JZ3A 3EG3A 1TUCA 2LNHB 4AFQC 1AWXA 3RNJA 2KROA 3SEMA 4LNPA 1BBZA 1X2QA 2O88A 4ESRA 2A08A 1T3LA 2KYBA 2HDAA 2B86A 2JM9A 1MV0B 1XOVA 3UA6A 5IH2A 4IIMA 2JXBA 3I35A 2L3PA 2JS2A 5IXBA 3NMZC 2AK5A 2V1QA 5IHKA 1AWOA 5IHIA 1QLYA 2JTEA 2DLPA 3M0QA 1OPKA 3JV3A 1NYGA 2JMCA 1PKTA 1KJWA 1E6GA 1ZX6A 2JMAA 2EYXA 1S1NA 1TUDA 4GLMA 2K2MA 1KIKA 2XMFA 1I0CA 5IHNA 3VS0A 3TSWA 1HSQA 1UGVA 4J9EA 4HXJA 2DL4A 2G6FX 2PZ1A 1UHFA 3ZL7C 2KNBB 4J9HA 3VS1A 3QWXX 1YP5A 2CT3A 1RLQC 2J7IA 2PNIA 4RTYA 2RQRA 2AKKA 3KFVA 4M4ZA 1QCFA 2DL5A 3EG2A 2DYBA 2KR3A 4JJDA 2EQIA 2K6DA 4AG1C 3UATA 2ROTA 1AZEA 3VRYA 2J05A 4HVWA 2JW4A 1ABOA 4F17A 3I9QA 2VKNA 2P4RA 4J9DA 2VVKA 1UJYA 2J06A 1TG0A 4X1VA 4Z88A 1X69A 1NYFA 1UECA 1M3BA 1U3OA 1UJ0A 2LX7A 2VWFA 4RTVA 1GCQA 2SRCA 1WDXA 4A63B 1X27A 1G2BA 1JU5C 3IQLA 1ZBJA 2X3WD 1KFZA 5FWCA 1K0XA 2CH4A 2FG0A 1JXMA 1PNJA 5FW9A 1UE9A 2K79A 2A37A 2M51A 1AEYA 2LQNA 1GCPA 2C0TA 1QWEA 1H8KA 3H0FA 2HSPA 4OMOA 3VRZA 3GBQA 3TVTA 2KGTA 1YNZA 2HEQA 2RF0A 2L2PA 2PTKA 2RNAA 4J9FA 2X3XD 3M0PA 2LMJA 2KXCA 1J3TA 2LJ1A 1A0NB 1WA7A 1OOTA 3REBB 2DVJA 3CQTA 4J9BA 1K9AA 1UUEA 1SRMA 5FWBA 1M3AA 4DEXA 2OAWA 4J9CA 4IIOA 1NLPC 2DX1A 1W1FA 2O31A 2AKLA 4AG2C 1K1ZA 2F2VA 4LN2A 1SSHA 1OEBA 1Z9ZA 1CSKA 2DBKA 1GFDA 2F2WA 1WXUA 2C0IA 2YSQA 2EVRA 1T0JA 3TSZA 4F16A 2FEIA 2RN8A 4ZNXA 2FRWA 2BZ8A 1WXBA 2YT6A 2EYWA 5HCKA 1K76A 2A36A 2K9GA 2RQUA 2DRMA 1SEMA 1PHTA 2CUDA 3EHRA 2GBQA 1AWJA 1K4US 1AVZC 1NLOC 4OMLA 1BB9A 1SHFA 1JXOA 2W0ZA 2FO0A 3FJ5A 1AZGB 1WYXA 1M8MA 4AFUC 2EW3A 1X6GA 2DBMA 2I0NA 1I1JA 3REAB 2KBTA 2FPDA 4JJCA 5GJWB 2EKHA 4CC4B 1ZLMA 3NGPA 1LCKA 1PRMC 2IIMA 1U5SA 2J6FA 4CC2A 1I07A 1WXTA 1UTIA 1GBRA 2FRYA 1SRLA 3EGUA 4Z8AA 5GJVB 2RMOA 1T0HA 2ENMA 4OMQA 1SPKA 1YWOA 1M27C 4AFSC 4F14A 3VS4A 4OMMA 3M0UA 2MIOA 3EHQA 2D0NA 2EYYA 3R6NA 1G83A 1GCQC 2EGEA 4LUDA 2EPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRL C;  2KYM A;  5I11 A;  1H92 A;  1WLP B;  1UG1 A;  3PVQ A;  1U06 A;  2MOX A;  4R0K A;  1RUW A;  2DJQ A;  4LE9 A;  1GFC A;  5L23 A;  1GL5 A;  2OI3 A;  1CKA A;  2CT4 A;  2DL8 A;  2FPF A;  4HCK A;  2DM1 A;  1BU1 A;  3VS7 A;  2O2O A;  1WIE A;  1AWW A;  1OV3 A;  3NPF A;  4RTZ A;  4RTT A;  1H3H A;  2L3S A;  1RLP C;  1W6X A;  2DMO A;  1GBQ A;  2HBW A;  1ABQ A;  2DRK A;  2YUQ A;  2W10 A;  1YWP A;  2LJ0 A;  3H41 A;  2QDL A;  3VS2 A;  5EC7 A;  5IXF A;  2BTT A;  2O9V A;  1HD3 A;  1FYN A;  4RTU A;  2LZ6 B;  2CUB A;  2V1R A;  2BZY A;  2CDT A;  1MUZ A;  4OMN A;  2LP5 A;  2M0Y A;  2RQV A;  1YN8 A;  2LQW A;  3I5R A;  2AZS A;  2J6O A;  3PVL A;  2DL3 A;  4FSS A;  3UF4 A;  4Y92 A;  2GTJ A;  4RUG A;  2BZX A;  2ABL A;  4QT7 A;  1Y57 A;  4D8D A;  1V1C A;  1RI9 A;  1ZUK A;  2ROL A;  2DA9 A;  2DF6 A;  4KRT A;  3C0C A;  3THK A;  2K3B A;  3VS5 A;  1X2K A;  2JT4 A;  3QWY A;  3A98 A;  1VA7 A;  2K7A A;  4LUE A;  1B07 A;  1VYT A;  4RTW A;  1UHC A;  2ED1 A;  3RBB B;  2KRN A;  4DEY A;  2L3Q A;  1Y0M A;  2JM8 A;  1X6B A;  1OPL A;  2KXD A;  1N5Z A;  2D8J A;  4J9I A;  4JPB W;  4K11 A;  3SHW A;  1PKS A;  4HVV A;  2OJ2 A;  1ZUU A;  3U23 A;  1VYU A;  1AD5 A;  1EFN A;  2JS0 A;  1MV3 A;  2CSQ A;  2NWM A;  4CC7 A;  1BK2 A;  3VS3 A;  1ZSG A;  2EGC A;  2DNU A;  1K0S A;  2GNC A;  1Z9Q A;  1B3Q A;  1WX6 A;  2EBP A;  2YDL A;  2KT1 A;  3M0R A;  2CH4 W;  2DE0 X;  1W70 A;  5I22 A;  2CRE A;  1NEG A;  2MCN A;  4WCI A;  4E6R A;  4Z89 A;  2EGA A;  2HCK A;  3UA7 A;  1HJD A;  4J9G A;  3M0T A;  1ARK A;  2ED0 A;  2KEA A;  2KRS A;  3LH5 A;  2YUN A;  1ZUY A;  2EYZ A;  3O5Z A;  2NUZ A;  2CSI A;  3ULR B;  2GGR A;  1QWF A;  2KT8 A;  1SHG A;  1JO8 A;  1WFW A;  2ESW A;  2YUP A;  1QKX A;  2SEM A;  3H0I A;  1QKW A;  2LCS A;  2RPN A;  4ORZ A;  1CKB A;  1AOJ A;  1X43 A;  1M30 A;  3EG1 A;  2H8H A;  1WI7 A;  3I5S A;  2D1X A;  1GRI A;  1E7O A;  1NG2 A;  4GBQ A;  4AFZ C;  1JQQ A;  4OMP A;  1YCS B;  3H0H A;  2DIL A;  1KSW A;  2O9S A;  2LJ3 A;  2GTO A;  2J6K A;  2RQT A;  2YUO A;  2AZV A;  3M0S A;  4JJB A;  2KE9 A;  1M3C A;  1NM7 A;  4JZ4 A;  2GQI A;  2DL7 A;  2F2X A;  5ECA A;  1JEG A;  1UDL A;  2L0A A;  3NHN A;  2FPE A;  1NEB A;  2D8H A;  2KRM A;  2A28 A;  1FMK A;  4EIK A;  3VS6 A;  4D8K A;  2ECZ A;  2RQW A;  1UFF A;  1IO6 A;  1VYV A;  2C0O A;  2E5K A;  4RTX A;  1E6H A;  1PWT A;  4CC3 A;  3PE0 A;  4HVU A;  1T3S A;  3EG0 A;  4JZ3 A;  3EG3 A;  1TUC A;  2LNH B;  4AFQ C;  1AWX A;  3RNJ A;  2KRO A;  3SEM A;  4LNP A;  1BBZ A;  1X2Q A;  2O88 A;  4ESR A;  2A08 A;  1T3L A;  2KYB A;  2HDA A;  2B86 A;  2JM9 A;  1MV0 B;  1XOV A;  3UA6 A;  5IH2 A;  4IIM A;  2JXB A;  3I35 A;  2L3P A;  2JS2 A;  5IXB A;  3NMZ C;  2AK5 A;  2V1Q A;  5IHK A;  1AWO A;  5IHI A;  1QLY A;  2JTE A;  2DLP A;  3M0Q A;  1OPK A;  3JV3 A;  1NYG A;  2JMC A;  1PKT A;  1KJW A;  1E6G A;  1ZX6 A;  2JMA A;  2EYX A;  1S1N A;  1TUD A;  4GLM A;  2K2M A;  1KIK A;  2XMF A;  1I0C A;  5IHN A;  3VS0 A;  3TSW A;  1HSQ A;  1UGV A;  4J9E A;  4HXJ A;  2DL4 A;  2G6F X;  2PZ1 A;  1UHF A;  3ZL7 C;  2KNB B;  4J9H A;  3VS1 A;  3QWX X;  1YP5 A;  2CT3 A;  1RLQ C;  2J7I A;  2PNI A;  4RTY A;  2RQR A;  2AKK A;  3KFV A;  4M4Z A;  1QCF A;  2DL5 A;  3EG2 A;  2DYB A;  2KR3 A;  4JJD A;  2EQI A;  2K6D A;  4AG1 C;  3UAT A;  2ROT A;  1AZE A;  3VRY A;  2J05 A;  4HVW A;  2JW4 A;  1ABO A;  4F17 A;  3I9Q A;  2VKN A;  2P4R A;  4J9D A;  2VVK A;  1UJY A;  2J06 A;  1TG0 A;  4X1V A;  4Z88 A;  1X69 A;  1NYF A;  1UEC A;  1M3B A;  1U3O A;  1UJ0 A;  2LX7 A;  2VWF A;  4RTV A;  1GCQ A;  2SRC A;  1WDX A;  4A63 B;  1X27 A;  1G2B A;  1JU5 C;  3IQL A;  1ZBJ A;  2X3W D;  1KFZ A;  5FWC A;  1K0X A;  2CH4 A;  2FG0 A;  1JXM A;  1PNJ A;  5FW9 A;  1UE9 A;  2K79 A;  2A37 A;  2M51 A;  1AEY A;  2LQN A;  1GCP A;  2C0T A;  1QWE A;  1H8K A;  3H0F A;  2HSP A;  4OMO A;  3VRZ A;  3GBQ A;  3TVT A;  2KGT A;  1YNZ A;  2HEQ A;  2RF0 A;  2L2P A;  2PTK A;  2RNA A;  4J9F A;  2X3X D;  3M0P A;  2LMJ A;  2KXC A;  1J3T A;  2LJ1 A;  1A0N B;  1WA7 A;  1OOT A;  3REB B;  2DVJ A;  3CQT A;  4J9B A;  1K9A A;  1UUE A;  1SRM A;  5FWB A;  1M3A A;  4DEX A;  2OAW A;  4J9C A;  4IIO A;  1NLP C;  2DX1 A;  1W1F A;  2O31 A;  2AKL A;  4AG2 C;  1K1Z A;  2F2V A;  4LN2 A;  1SSH A;  1OEB A;  1Z9Z A;  1CSK A;  2DBK A;  1GFD A;  2F2W A;  1WXU A;  2C0I A;  2YSQ A;  2EVR A;  1T0J A;  3TSZ A;  4F16 A;  2FEI A;  2RN8 A;  4ZNX A;  2FRW A;  2BZ8 A;  1WXB A;  2YT6 A;  2EYW A;  5HCK A;  1K76 A;  2A36 A;  2K9G A;  2RQU A;  2DRM A;  1SEM A;  1PHT A;  2CUD A;  3EHR A;  2GBQ A;  1AWJ A;  1K4U S;  1AVZ C;  1NLO C;  4OML A;  1BB9 A;  1SHF A;  1JXO A;  2W0Z A;  2FO0 A;  3FJ5 A;  1AZG B;  1WYX A;  1M8M A;  4AFU C;  2EW3 A;  1X6G A;  2DBM A;  2I0N A;  1I1J A;  3REA B;  2KBT A;  2FPD A;  4JJC A;  5GJW B;  2EKH A;  4CC4 B;  1ZLM A;  3NGP A;  1LCK A;  1PRM C;  2IIM A;  1U5S A;  2J6F A;  4CC2 A;  1I07 A;  1WXT A;  1UTI A;  1GBR A;  2FRY A;  1SRL A;  3EGU A;  4Z8A A;  5GJV B;  2RMO A;  1T0H A;  2ENM A;  4OMQ A;  1SPK A;  1YWO A;  1M27 C;  4AFS C;  4F14 A;  3VS4 A;  4OMM A;  3M0U A;  2MIO A;  3EHQ A;  2D0N A;  2EYY A;  3R6N A;  1G83 A;  1GCQ C;  2EGE A;  4LUD A;  2EPD A; 
#chains in the Genus database with same CATH topology
 1PRL C;  5GAN 2;  1U06 A;  5GAN 8;  3C12 A;  3I56 Q;  3EAE A;  5GAO q;  1GFC A;  1GL5 A;  2OI3 A;  5GAO p;  5A0L A;  2EKO A;  3QII A;  1TTH B;  4HCK A;  2HKN A;  1IHW A;  2O2O A;  1D1B A;  1VQ4 T;  2HMA A;  4RTZ A;  1YJN A;  1PSF A;  4R56 A;  2L3S A;  3JB9 H;  2HBW A;  4C92 G;  4E7Z A;  1ABQ A;  2W10 A;  1YJ9 Q;  3H41 A;  2KSS A;  2BTT A;  4KT0 E;  1OYX A;  2LT4 A;  4GY5 A;  3G4S Q;  1K73 U;  3JCM g;  1C6V X;  1WZO A;  3JCM b;  2I2L A;  2E41 A;  2V1R A;  3GLX A;  2CDT A;  3X26 B;  5CKD A;  4OMN A;  1OI1 A;  1NJI C;  2QGF B;  3JCM h;  3CC7 T;  5L8R E;  2J6O A;  4M7A F;  3CCJ Q;  2YXY A;  3S3M A;  4N4H A;  1PCX A;  1ACM B;  1KQ2 A;  1RI9 A;  4J7I A;  2ROL A;  2DA9 A;  4KRT A;  5GAO n;  3C0C A;  1WHG A;  2E65 A;  2K3B A;  2RHZ A;  3THK A;  3VS5 A;  4E47 A;  3QWY A;  1RAH B;  1VA7 A;  1ZA1 B;  2K7A A;  4LUE A;  1VYT A;  2H3E B;  2LX9 A;  5EG2 A;  4PJN A;  1X6B A;  2XID A;  1N5Z A;  4K11 A;  3A8G B;  3JAM E;  2CZ6 B;  4HT8 A;  3CCM A;  1RAE B;  3U23 A;  4ZGD B;  2HQH A;  4OGE A;  1S72 A;  3OYI A;  4C5E A;  1ZQ1 A;  5KYN A;  1M1K U;  2E3H A;  4CC7 A;  4ZN1 A;  3VS3 A;  2RK2 A;  4HA8 A;  2EGC A;  1N8R C;  3L2R A;  3LX7 A;  2DET A;  2RB6 A;  1BI0 A;  1Q7Y C;  2YDL A;  1Y7X A;  3M0R A;  2JJ9 A;  3QPH A;  5GAN f;  4M78 B;  3SD4 A;  4WCI A;  2WAC A;  1W4S A;  2M1H A;  3UA7 A;  2KRS A;  1IRE B;  4MML A;  4DBF A;  3INZ A;  1VQ6 Q;  2CSI A;  3ULR B;  2D9T A;  3OS2 A;  3RIR A;  4WTO B;  1VQM T;  5I2S A;  2XI9 A;  1QKX A;  4RCC A;  2QQB A;  1CKB A;  1X43 A;  3A1P A;  3C95 A;  1MMG A;  3M54 A;  1GRI A;  3RKX A;  5LJ3 g;  3HFO A;  4JS4 A;  1SG5 A;  2RHX A;  2HKQ B;  2LJ3 A;  5KYX B;  1KHI A;  3BE3 A;  2RQT A;  2C06 A;  3L2Q A;  4PNO A;  3MJX A;  2XG8 D;  2OTJ A;  2P0P A;  4JZ4 A;  2JVV A;  1W2B S;  1KQS P;  3ZFJ A;  4OP0 A;  1JEG A;  2F69 A;  1UDL A;  2L0A A;  5LJ5 g;  3UPU A;  3NHN A;  3QUI A;  1NEB A;  4BY6 B;  1FMK A;  1VQK Q;  4EIK A;  4D8K A;  3OA6 A;  1UFF A;  4FYX B;  5IAY A;  4O6J A;  3ZBD A;  2E5K A;  4F7U A;  5D7U A;  1E6H A;  3PE0 A;  1MGQ A;  4FL6 A;  1TU0 B;  2QQ9 A;  1WHL A;  2BUD A;  2X4W A;  2LNH B;  4MDX A;  2KRO A;  3CMA T;  4XU2 A;  4LNP A;  1X2Q A;  4A53 A;  2O88 A;  1WHH A;  4LD6 A;  1T3L A;  2JM9 A;  3UA6 A;  2EQU A;  3I56 A;  2JXB A;  4C8Q B;  3NMZ C;  2DD4 A;  4B6M A;  4JRI A;  2L89 A;  5I2M A;  1QVG P;  2DLP A;  2QAZ A;  2DD5 A;  3JV3 A;  2LCC A;  3BW1 A;  1PKT A;  3JCM V;  1HYO A;  3CD6 T;  3FDR A;  3JSC A;  4WF2 A;  1VQO T;  2K2M A;  1YJ9 A;  3MET A;  1JRI A;  3TSW A;  1NPP A;  1UGV A;  3TU4 K;  1W2B A;  1TUG B;  1FWZ A;  1OU9 A;  3PNW C;  2G6F X;  2PZ1 A;  1UHF A;  2ZPH B;  2HQX A;  1K73 C;  2R5A A;  4ANJ A;  1JJ2 P;  5GMK h;  4F7U E;  5IN1 A;  2J7I A;  2VC8 A;  3MEV A;  1M1G A;  1OZ2 A;  2RI2 A;  1VQ5 Q;  1IGQ A;  3L1A A;  4X34 A;  2K6D A;  3HHT B;  1VQ8 T;  5KCH A;  1RAB B;  2QGG A;  2J05 A;  3OS5 A;  4HVW A;  3CCU A;  2JW4 A;  1ABO A;  1ZSZ B;  5LJ5 j;  1VQP Q;  2VVK A;  1UJY A;  2J06 A;  1M90 U;  4X1V A;  4Z88 A;  3G6E A;  4XAX B;  2CZ0 B;  1AHJ B;  1UJ0 A;  5HY6 A;  3OYB A;  3JRZ A;  4NOY A;  3LGL A;  3M58 A;  2QEX A;  2E1H A;  2LQK A;  2NUT A;  3IQL A;  3CCQ Q;  3CCJ T;  1Y07 A;  3HFN A;  2X3W D;  1YHQ T;  4DA4 A;  3EG9 A;  5I21 A;  2WSE E;  4LDW A;  4PLL A;  1K0X A;  5CQY A;  1PNJ A;  2M51 A;  4EPC A;  1M1K C;  4M7D C;  2C0T A;  2DIG A;  1GXI E;  2HSP A;  4B9X A;  1RL2 A;  4M7D D;  3S3N A;  2K2V A;  2OTL A;  1G8X A;  2HEQ A;  2X4J A;  4J9F A;  2RNA A;  4M7D A;  4MZT A;  5AT1 B;  1G3Y A;  1OOT A;  3REB B;  2DVJ A;  2DTO A;  2K5F A;  3D7S B;  5FWB A;  1SRM A;  1M3A A;  1M5Q 1;  2EYQ A;  4J9C A;  2QK0 A;  2XDD A;  4M77 F;  2DX1 A;  1W1F A;  2WSC E;  1Y96 A;  2AKL A;  2MMP A;  2NYS A;  1K9M R;  4BDY A;  1VQ6 A;  1VIF A;  1VQN A;  1Z9Z A;  2COW A;  3J81 E;  2CP0 A;  2DBK A;  3T9N A;  1GFD A;  1Q95 G;  4MDW A;  2C0I A;  3RKY A;  2L3R A;  3H6Z A;  1T0J A;  3TSZ A;  4F16 A;  2FEI A;  2VUB A;  4PJO F;  2BZ8 A;  3JCM Q;  2EYW A;  3OW2 S;  5HCK A;  3ASK A;  4JS5 A;  1VQ9 T;  1MMA A;  3O8V A;  1VIE A;  2GF7 A;  3CC7 Q;  1M9S A;  3E1S A;  4JLG A;  2DPP B;  2XK0 A;  1JXO A;  2W0Z A;  1V76 A;  1AZG B;  4M7A D;  3OYJ A;  2KBT A;  4C5H A;  4M7D E;  5GJW B;  4PLI A;  4M7A A;  4CC4 B;  4OB2 B;  1YJW A;  3NGP A;  1LCK A;  1PRM C;  2IIM A;  2J6F A;  1VUB A;  1UTI A;  1XTD A;  4Z8A A;  4BI4 A;  2LCL A;  1LOJ A;  3ER0 A;  3L2W A;  4C0G A;  4AFS C;  2K5L A;  2QI2 A;  3EHQ A;  4BB7 A;  4LUD A;  3G1J A;  1M8V A;  2KYM A;  3OYC A;  2MPX C;  2XDB A;  1UG1 A;  1I5L A;  3VV0 A;  2CP3 A;  4M78 C;  4R0K A;  2DEU A;  3EFR A;  4LE9 A;  5L23 A;  1VQK T;  1RI0 A;  4C5I A;  1CKA A;  3OW2 A;  4OVA A;  2DM1 A;  3M59 A;  4EMH A;  4F7U B;  1PD0 A;  2WSF E;  3RMS A;  1TH7 A;  1WIE A;  1QP2 A;  4A4F A;  1OV3 A;  3NPF A;  4RTT A;  1U1S A;  2HL5 C;  1ZBX A;  1RLP C;  1W6X A;  2DMO A;  4ELY C;  2LT1 A;  4M7A E;  2DRK A;  3TQ7 P;  3VS2 A;  2X51 A;  1VQM Q;  1H64 1;  3EH1 A;  4RTU A;  3OYY A;  5GAN 3;  2DIQ A;  5KYW B;  3LH0 A;  1I4K 1;  4RCB A;  2BZY A;  2VAS A;  3FRN A;  2LP5 A;  2YLC A;  2VXE A;  1VQ5 A;  4IUT A;  1SF9 A;  4M75 B;  3UF4 A;  4KUI A;  4QT7 A;  1M2O A;  2EIF A;  1WNL A;  3HL8 A;  1RAG B;  4BI3 A;  1R77 A;  2DEQ A;  3QDR B;  2DF6 A;  5CO7 A;  1WHM A;  4BY6 C;  4QVD A;  1VQP A;  1X2K A;  3L2U A;  3A98 A;  3OBY A;  3M4Y A;  1WGS A;  3EGX B;  1M90 C;  4XTZ A;  1UHC A;  2JTF A;  4XTV A;  1Y0M A;  2RD1 A;  1QCN A;  4QKU A;  4ZTF A;  1QVF S;  4J9I A;  4JPB W;  5FU7 B;  3QXE B;  2OJ2 A;  4E7L A;  2IG0 A;  3JCM W;  3LW5 E;  4QW2 A;  5KE3 A;  4FYY B;  3CMA Q;  4LDX A;  1EFN A;  4C8Q C;  2NUP A;  4C8Q D;  3NTI A;  1FXX A;  2Z0W A;  1K0S A;  4FU6 A;  3X20 B;  5D6X A;  1MNE A;  3HPW A;  4C8Q A;  2E6N A;  2ZAE A;  5GAN 4;  3CCL T;  4C0D B;  2EBP A;  1WQW A;  3DB4 A;  2NUT B;  1W70 A;  1VQ4 A;  5I22 A;  3FEO A;  3CCQ T;  1NEG A;  1D0Z A;  1XQH A;  3EG9 B;  4Z89 A;  3MP6 A;  2EGA A;  3CD6 Q;  1YI2 Q;  2HCK A;  1VQ7 T;  1HJD A;  3FIF A;  3M0T A;  3TRE A;  2KEA A;  3OQ5 A;  2A3L A;  3TCJ A;  3NTK A;  2GGR A;  2M16 A;  2LNV A;  3CC4 T;  1JO8 A;  4M7D B;  2ESW A;  4X9D A;  2SEM A;  4HT9 A;  4ORZ A;  3MKD A;  3EG1 A;  2ZPB B;  2GCX A;  3CC2 T;  1WI7 A;  4R55 A;  3OS0 A;  1D09 B;  1QVF A;  1NG2 A;  4AFZ C;  3CC7 A;  1N27 A;  1SSF A;  1ZSZ C;  2OAU A;  1YCS B;  3CME Q;  3FC3 A;  2O9S A;  4DBQ A;  4JUV A;  1Y96 B;  5FU6 B;  3VUB A;  1VQ8 Q;  3LWI A;  2J6K A;  5GAN g;  2KQW A;  4DBH A;  4ATO A;  4JJB A;  1ZSZ A;  1LNX A;  1M2V B;  4E7S A;  5A0G A;  4C8Q E;  1NM7 A;  2LDM A;  5GMK m;  4B9W A;  1Q86 R;  1PM3 A;  2E3I A;  3M9Q A;  5ECA A;  1WHJ A;  2FPE A;  3KBG A;  2D8H A;  2KRM A;  4C92 F;  4OF1 A;  4RG2 A;  4RMO A;  1R8O B;  3OYL A;  1WHK A;  3DKM A;  2ECZ A;  1D0X A;  1IO6 A;  4FW1 A;  1VYV A;  1QP3 A;  2MF2 A;  2RJF A;  1YHQ Q;  3QYH B;  1PWT A;  2BE7 D;  1OX9 A;  1NPR A;  1T3S A;  1KD1 R;  4XK8 E;  1TUC A;  4AFQ C;  3RMQ A;  3CCR Q;  1AWX A;  4M7A B;  2PVD B;  4FSX A;  3SEM A;  4LXC A;  3H9N A;  3OYA A;  5J26 A;  4LDY A;  2KYB A;  2HDA A;  2B86 A;  1XOV A;  1IB8 A;  4IIM A;  4A4G A;  2ZCF B;  3I35 A;  2DTH A;  1AWO A;  2ZPG B;  2XHC A;  2P4T A;  2CP7 A;  3L2Z A;  1VOM A;  1OPK A;  2ZZD A;  1TWB A;  2JMC A;  1KJW A;  3M56 A;  3X28 B;  2JMA A;  1KG1 A;  4M78 G;  1Q81 U;  4ZN3 A;  2KDS A;  4KBM B;  2BE9 B;  2XMF A;  3KXT A;  4M77 D;  1SKU B;  1VQM A;  2CZ7 B;  2V8J A;  3OYF A;  4M77 A;  1VQ9 Q;  3I55 A;  4J9H A;  1YP5 A;  2CT3 A;  4E7H A;  1RLQ C;  4PJO D;  2RQR A;  3BY7 A;  3M53 A;  5GAN j;  1IGU A;  5GAM d;  4JJD A;  4PJO A;  1X6O A;  1BI1 A;  1YIT Q;  4AG1 C;  2RJD A;  2XDP A;  9ATC B;  2LC4 A;  3X25 B;  1O9S A;  3I9Q A;  3TEE A;  3CCM T;  2VKN A;  3CCE T;  5FLX E;  2E70 A;  3CBO A;  1M4Z A;  1UGS B;  3CXC P;  4NS5 A;  4HKE A;  1YIJ A;  1X69 A;  2CGH A;  1NYF A;  1UEC A;  2MK5 A;  3PIO A;  3X24 B;  3HRT A;  5KYU A;  3MHX A;  2KAF A;  4IUR A;  1FX7 A;  1P92 A;  1X27 A;  5LJ3 h;  1ZBJ A;  2OX7 A;  4J7F A;  3PMT A;  5FWC A;  1NJI R;  4GLK A;  1UE9 A;  3RR6 A;  3CMA A;  2NLU A;  2ZPF B;  2KY9 A;  2LQN A;  1KC8 C;  1QWE A;  1H8K A;  2QA4 Q;  5AYF A;  5GMK l;  1YBY A;  4V2S A;  2RF0 A;  1ZA2 B;  2L2P A;  2HD0 A;  5GAN 6;  2ZGW A;  5LJ5 h;  3JCM d;  3R6O A;  3JB9 D;  2LJ1 A;  1A0N B;  2DKG A;  1WA7 A;  2M02 A;  4C8Q G;  3CQT A;  2L8D A;  1B34 B;  4FYW B;  4J9B A;  4ZGJ B;  3G71 T;  6AT1 B;  1B7T A;  3OS1 A;  2X4X A;  1JJ2 S;  1VQO A;  2OAW A;  2K3Y A;  2YLB A;  5J39 A;  5GAO m;  2NUP B;  4AG2 C;  1K1Z A;  1X01 A;  4LN2 A;  3FJP A;  2RI5 A;  1KQ1 A;  1N9R A;  1RAC B;  4FCY A;  2F2W A;  1WXU A;  3J7A F;  5KYW A;  4M75 C;  1WXB A;  4DBR A;  1LVK A;  4M75 D;  5D6W A;  2DER A;  3A5Z B;  3C4S A;  4BUG A;  3OBW A;  2DFU A;  1BI2 A;  4M75 A;  1YI2 T;  3EHR A;  2GBQ A;  1AVZ C;  1NLO C;  4OML A;  1SHF A;  1HK9 A;  3JCM X;  2YRD A;  1VQ8 A;  3P8H A;  2FO0 A;  3MEW A;  1WYX A;  4J6W A;  2QTX A;  4AFU C;  2EW3 A;  2DBM A;  2I0N A;  3G4S A;  2LVM A;  3H8Z A;  3EGX A;  2FPD A;  4JJC A;  4Q5W A;  4J6X A;  5FU7 C;  4CC2 A;  3E9F A;  1OX8 A;  3HSB A;  2O01 E;  5CIU A;  1WPY A;  3CME T;  4PJJ A;  4FW2 A;  3CCJ A;  2HL3 A;  1YHQ A;  1U8R A;  5FRN A;  1JJ2 A;  2QG9 B;  3SWN B;  5GAN e;  3M0U A;  3R6N A;  5A2Q E;  1Q86 U;  2EGE A;  4C0D C;  1WJQ A;  2EPD A;  5I11 A;  1H92 A;  3OB9 A;  2MOX A;  3CCL Q;  4FM4 B;  3VU3 C;  4M75 E;  2G3R A;  2CT4 A;  3CCS Q;  2F5K A;  3CPW P;  4QQD A;  1BU1 A;  4OB1 B;  2DO3 A;  3M57 A;  3QYG B;  1VQ7 Q;  2EQJ A;  5LJ3 d;  4NL2 A;  1R0B G;  2FZG B;  4Y28 E;  2EAY A;  3CCR T;  1GBQ A;  4KGZ B;  1Q81 C;  3SFM A;  4ELZ C;  4BDZ A;  5IXF A;  1K8A R;  3CC4 Q;  2O9V A;  1HD3 A;  3PFS A;  2P84 A;  2LZ6 B;  2PVG B;  1QMC A;  3OYK A;  3CC2 Q;  3CEY A;  1VQ9 A;  1HXD A;  5FU6 C;  4BAC A;  5LJ5 d;  2FYK A;  3VKI A;  3PGG A;  2LQW A;  2AZS A;  4FSS A;  2GTJ A;  2BZX A;  2ABL A;  1Q82 R;  1UGP B;  3QKJ A;  1Y57 A;  3WXM B;  1M2V A;  5CKE A;  2E5Q A;  4QQ6 A;  1BYM A;  1X75 C;  4XU1 A;  2R57 A;  5GAO l;  2JT4 A;  4M77 B;  3DLL A;  5GMK j;  1B07 A;  2CYZ B;  2ED1 A;  3MP1 A;  2KRN A;  3RBB B;  4DEY A;  3M4G A;  3LLR A;  4QVC A;  2JM8 A;  2CZ1 B;  2QAS A;  2V8K A;  4QVZ A;  2DZC A;  4PJO B;  1YCY A;  5CAI A;  1K73 R;  3SHW A;  1QCO A;  1YIT T;  4M7A C;  4HVV A;  1TXQ A;  3ZEH A;  2YRC A;  3OSS C;  1ZUU A;  4EMK B;  1EX4 A;  1YJN Q;  4J6Y A;  2LQ8 A;  1I8F A;  1AD5 A;  2JS0 A;  2CP2 A;  3OYH A;  3DB3 A;  1MV3 A;  4HCZ A;  4PK4 A;  2NWM A;  1NBE B;  2K57 A;  3CBM A;  1ZSG A;  1VQK A;  2GNC A;  1Z9Q A;  1B3Q A;  5KYU B;  4CRI A;  2KT1 A;  3GNF B;  2HSE B;  2O4X A;  2CH4 W;  4D6W A;  2AT1 B;  3NFC A;  4N0A A;  2MCN A;  4KGV B;  1KHC A;  3CCV T;  4E6R A;  4NL3 A;  2RHY A;  5KE2 A;  4F7U G;  4J9G A;  2ED0 A;  3LH5 A;  2EYZ A;  3JB9 G;  5GAN 5;  5M9O A;  2QA4 T;  4XTY A;  5DLO A;  1BKB A;  3RDV A;  3OW2 P;  2RM4 A;  1N6A A;  1WFW A;  3EGD A;  3UT1 A;  3H0I A;  2RJE A;  2RPN A;  2H8H A;  4XQ3 A;  3QZ5 B;  4F7U F;  2D1X A;  3Q1J A;  4OMP A;  3H0H A;  1KK7 A;  4JRK A;  2GTO A;  1FMW A;  2YUO A;  1WJR A;  3M0S A;  4M75 G;  3CCM Q;  3CCE Q;  2KE9 A;  1D1C A;  4A4K A;  1MMN A;  3QDF A;  4FYV B;  1I81 A;  4BD3 A;  2DJZ A;  2F2X A;  2PUK B;  3BFM A;  5CK9 A;  2LTO A;  2JZ2 A;  2CP6 A;  1G5V A;  3VS6 A;  3QBY A;  3QHS A;  2RQW A;  2V26 A;  2DXU A;  3CBP A;  4CC3 A;  4HVU A;  4L59 A;  3EG0 A;  2JN0 A;  3EG3 A;  2JTM A;  3JB9 I;  5CVI A;  1VQL T;  3RNJ A;  2A0F B;  2BIV A;  1Q86 C;  3V8J A;  1BBZ A;  2A08 A;  2Y4Y A;  2F5T X;  5IH2 A;  3HRU A;  3CCL A;  2L3P A;  5IXB A;  5GMK e;  3OYE A;  2V1Q A;  5IHK A;  5IHI A;  3JB9 J;  3CCQ A;  1PSE A;  3V7C A;  3G71 Q;  4QQG A;  1B34 A;  1QLY A;  2RK1 A;  3M0Q A;  5KH6 A;  1VQ7 A;  3P8D A;  2RHU A;  2QXF A;  1NYG A;  1E6G A;  1ZX6 A;  3E19 A;  4EMG A;  2ZPE B;  1G3W A;  1OQK A;  5IT9 E;  2X35 A;  3VS0 A;  1HSQ A;  4J9E A;  2OTJ Q;  3FB9 A;  1D3B B;  3CC4 A;  2DL4 A;  4KUL A;  3VYH B;  4BE2 A;  3CCS T;  1NE8 A;  5J3B A;  2KNB B;  4JRP A;  3EFS A;  2K4Y A;  3QWX X;  3VS1 A;  3CC2 A;  2PNI A;  4RTY A;  4M7D G;  2RI3 A;  4LDU A;  3KFV A;  4M4Z A;  5CCA A;  1QCF A;  2DL5 A;  3EG2 A;  2KR3 A;  4VUB A;  2KI7 A;  3UAT A;  2ROT A;  1K8A U;  2FVU A;  4ZTJ A;  2D0Q B;  3BDL A;  3JCM P;  1YFN A;  4M7D F;  2VGN A;  4KUD K;  2QYZ A;  2E10 A;  1QVF P;  1XJW B;  4PFP A;  4J83 A;  1U3O A;  4E2F B;  4BE0 A;  4Y91 A;  3SWN C;  2LX7 A;  2VWF A;  1GCQ A;  4HCB A;  2A7Y A;  2SRC A;  3RER A;  1Q82 U;  1K9M U;  4UC4 A;  4A63 B;  3OYN A;  3G7Z A;  3FLG A;  4FT2 A;  3SWN A;  2X9H A;  1KFZ A;  2B8A A;  2AHJ B;  5DM7 R;  4EDU A;  2K79 A;  1MND A;  5GAN h;  3UDC A;  1JB0 E;  1GCP A;  3H0F A;  5HK3 A;  1D1A A;  2MYS A;  4OMO A;  3VRZ A;  5C0M A;  3GBQ A;  3MEA A;  4M7A G;  1F1B B;  4XU0 A;  2X3X D;  3M0P A;  2KXC A;  3WVE B;  2HNI A;  4LD9 K;  3JCM c;  1J3T A;  1M1F A;  1M90 R;  3A8H B;  2FL7 A;  3VYG A;  4C92 B;  1WJS A;  2E64 A;  4DEX A;  1YJN T;  2DVE A;  3SDZ A;  2O31 A;  4A4H A;  1RAA B;  2Y4X A;  3LYI A;  2F2V A;  3RES A;  7AT1 B;  1OEB A;  2XKO C;  3CCU Q;  2EVR A;  5GAM f;  1QVP A;  4TVR A;  4ZNX A;  2FZC B;  1BI3 A;  3GOX A;  2O4X B;  5GAM j;  3G6E Q;  4MMK A;  2K9G A;  2LRQ A;  2RQU A;  1OUL A;  1SEM A;  1PHT A;  3CXC S;  2CUD A;  3OMC A;  4L5G A;  1LJO A;  4M77 C;  2YRV A;  2DXB A;  4XTW A;  5GMK i;  3OYM A;  2R5M A;  2QEX Q;  1OU8 A;  3CCE A;  1M8M A;  1MHN A;  1X6G A;  1I1J A;  3HRS A;  3MCA B;  4OB3 B;  3EGD B;  4PJO C;  2EKH A;  4YTL A;  1KQS S;  5GAO r;  5A0D A;  4M78 F;  1I07 A;  4DQ2 A;  3M55 A;  4IUP A;  2OTL Q;  1GBR A;  2FRY A;  4PJM A;  4XU3 A;  4EMK C;  1SRL A;  2FB7 A;  2PUO B;  2JUF A;  1JBM A;  2RMO A;  1T0H A;  4F04 B;  2KK4 A;  5CQX A;  2DXT A;  4OMQ A;  5FRO A;  1SPK A;  1M27 C;  3PTA A;  4EMK A;  4RG8 A;  2QTV A;  2YWW A;  3AHU A;  2MIO A;  1S72 T;  2D0N A;  4OGC A;  3JCM f;  4DOV A;  2DAQ A;  1Y71 A;  1WLP B;  3PVQ A;  1RUW A;  1VQN Q;  4AMC A;  2DJQ A;  3URG A;  4IUQ A;  2DL8 A;  2V8I A;  2FPF A;  2VB6 A;  4PFO A;  2RH2 A;  1D0Y A;  2JNG A;  3VS7 A;  3CCV Q;  3GF5 A;  3CXC A;  3G71 A;  3I55 T;  1AWW A;  2X4Y A;  1WQ7 A;  4M77 E;  1H3H A;  4RKU E;  1QVG S;  5FRM A;  2YUQ A;  2PVO B;  1YWP A;  2LJ0 A;  2QDL A;  5EC7 A;  5GAN d;  3V7R A;  3A8M B;  4KH0 B;  1FYN A;  5CKB A;  4PJO E;  4PFZ A;  2CUB A;  1KQS A;  4FT4 A;  2QQR A;  4JLI A;  1H3Z A;  4L6V 5;  4OMF B;  1YJW Q;  1MUZ A;  1YIJ T;  2M0Y A;  4XTX A;  5D6Y A;  2RQV A;  3CD6 A;  1YN8 A;  1YI2 A;  3I5R A;  2ATC B;  3QO3 A;  3PVL A;  2DL3 A;  4Y92 A;  4RUG A;  4A54 A;  3OMG A;  4D8D A;  1V1C A;  1ZUK A;  1DJ7 B;  1K8A C;  2E6Z A;  2OTJ T;  1C0M A;  3V7S A;  4C8Q F;  1BCO A;  2IVW A;  3DLM A;  3EFO B;  4IUV A;  4RTW A;  1N8R R;  4P5N A;  2H3J A;  1PG5 B;  8ATC B;  2L3Q A;  4JRQ A;  3KUF A;  2XIC A;  2HAX A;  1OPL A;  2KXD A;  4J8O A;  2D8J A;  5CKF A;  1Q7Y R;  3CME A;  2DZ9 A;  1N9S A;  1PKS A;  1Q82 C;  2VV5 A;  3N5B B;  1W2B P;  1K9M C;  5GAM e;  2CKK A;  3OYG A;  1VYU A;  1QVG A;  3CPW S;  1VQL Q;  4II1 A;  2CSQ A;  4PKC C;  1BK2 A;  3A8L B;  1PC0 A;  1UB4 A;  2ZPI B;  3EH2 A;  2DNU A;  4CI0 C;  5LJ3 f;  1BCM A;  3I56 T;  1WX6 A;  1MMD A;  2EJG A;  2DYI A;  5LJ3 j;  2RA2 A;  2DE0 X;  3SB2 A;  2CRE A;  3QJ6 A;  1UGR B;  3L2V A;  1R0C B;  2EQK A;  5KYY A;  3CCR A;  1ARK A;  3S6W A;  2VYT A;  2YUN A;  1ZUY A;  4E7I A;  3O5Z A;  1PD1 A;  5LJ5 f;  2NUZ A;  4MZM A;  4JDS A;  4BI8 B;  1D3B A;  1YJ9 T;  2E4H A;  2BKD N;  1QWF A;  2KT8 A;  3E2U A;  1SHG A;  3A8O B;  2DK3 A;  2YUP A;  2LCS A;  1QKW A;  3G4S T;  2R58 A;  1AOJ A;  3QSU A;  1M30 A;  1ZHI A;  1KC8 R;  4ME7 A;  3JCM e;  3I5S A;  1KD1 U;  1E7O A;  1RAD B;  4GBQ A;  4BE1 A;  1JQQ A;  3MEU A;  3CPF A;  1TS9 A;  2DIL A;  2XU8 A;  1KSW A;  2K3X A;  4E7J A;  4IUU A;  3ME9 A;  2M9U A;  2AZV A;  3CPW A;  4N4G A;  1M3C A;  3CCU T;  3JCM J;  1QQJ A;  2MWP A;  2GQI A;  2DL7 A;  4E7K A;  3OSV A;  4HCC A;  4M77 G;  3G6E T;  2A28 A;  2HZY A;  4O5V A;  1LPL A;  2C0O A;  1YIT A;  3OYD A;  2EFI A;  4AT1 B;  4XTU A;  4RTX A;  3L42 A;  2QEX T;  1VQ4 Q;  3J80 E;  4PJO G;  3PIP A;  4JZ3 A;  3GPL A;  2M0O A;  3OY9 A;  1IZ6 A;  1O75 A;  5HKC A;  4ESR A;  4J5Y A;  1MV0 B;  4C92 C;  2MAM A;  2OTL T;  2IPO B;  2MWO A;  4C92 D;  2JS2 A;  3AT1 B;  2AK5 A;  2JOY A;  4OB0 B;  2QQS A;  2COZ A;  2Y90 A;  4C92 A;  3CCV A;  2JTE A;  2RJC A;  1RAF B;  1U1T A;  1XNI A;  2RHI A;  2EYX A;  1S1N A;  1TUD A;  4GLM A;  1TOV A;  2EQM A;  2GFU A;  1KIK A;  2QA4 A;  3E9G A;  1I0C A;  5IHN A;  3QJY A;  4N0A C;  1G3T A;  1EIF A;  2CP5 A;  1VQ6 T;  1VQN T;  4HXJ A;  3ZL7 C;  1C1A A;  3NTH A;  3M5A A;  2D6F A;  4C0F A;  3PMI A;  4X9C A;  4ZGE B;  1NJI U;  2AKK A;  2VXF A;  2DYB A;  3S3O A;  2EQI A;  2K5I A;  1RAI B;  5LJ3 e;  1AZE A;  1NZ9 A;  3VRY A;  2XD0 A;  5C6S A;  2P0Q A;  4F17 A;  2L5Q A;  1QW1 A;  4PL6 A;  2P4R A;  4J9D A;  2MI6 A;  1TG0 A;  1M1K R;  2DXC A;  5CKH A;  1Q81 R;  2VGM A;  4C92 E;  1YJW T;  1BIB A;  1M3B A;  3VUZ A;  3JB9 F;  1OZ3 A;  4RTV A;  5LJ5 e;  4N4I A;  4KGX B;  4M78 D;  2COY A;  1WDX A;  4LDV A;  5DY9 A;  2EJ9 A;  1G2B A;  1JU5 C;  4MZP A;  2P0K A;  4M78 A;  1S72 Q;  3F70 A;  3GIB A;  2RO0 A;  3MO8 A;  3HKS A;  3RKW A;  1V29 B;  2CH4 A;  1VQL A;  2FG0 A;  1JXM A;  5CR2 A;  4A4E A;  5FW9 A;  2DTI A;  2A37 A;  2PQW A;  1AEY A;  1N8R U;  2GFA A;  5DLQ E;  8AT1 B;  3HTR A;  2KGT A;  3TVT A;  1YNZ A;  3RUX A;  2PTK A;  1Q7Y U;  2LMJ A;  4M75 F;  2KVQ G;  3I55 Q;  1I5O B;  1K9A A;  1UGQ B;  1UUE A;  1AT1 B;  2GQV A;  4IIO A;  1NLP C;  5KYX A;  4Z02 A;  2F1L A;  1SSH A;  3GNG A;  3QZ9 B;  1CSK A;  2CS7 A;  4FIB A;  2FHD A;  2YSQ A;  3CCS A;  2RN8 A;  2FRW A;  4C0Z A;  2YT6 A;  3HP9 A;  1YIJ Q;  2KMT A;  1K76 A;  2A36 A;  5LL6 S;  4M78 E;  1G3S A;  2DRM A;  1IRX A;  1IXD A;  1KD1 C;  2HQE A;  2PU9 B;  5KYY B;  4C5G A;  1AWJ A;  5HK0 A;  1K4U S;  3V8K A;  1VQ5 T;  1BB9 A;  3PT9 A;  3LGF A;  4IKF A;  2EJF A;  2QQA A;  3FJ5 A;  3REA B;  3MP8 A;  3GP8 A;  2YHT A;  3P8B B;  1BIA A;  1VQP T;  2AIR B;  3EFO A;  3MPU B;  1EZZ B;  1ZLM A;  1KC8 U;  2HBP A;  4KH1 B;  1U5S A;  3QG1 A;  3LWH A;  5GAN 7;  3WVD B;  1UEB A;  1WXT A;  1TSF A;  5GAM g;  3C94 A;  3EGU A;  5GJV B;  5KCO A;  3V8L A;  2FZK B;  2ENM A;  3VJP A;  4JJN K;  2E12 A;  2EWN A;  1IHV A;  1YWO A;  4F14 A;  3UWN A;  3VS4 A;  5GAM h;  4OMM A;  1FMV A;  4DOW A;  2EYY A;  2QDY B;  1G83 A;  1GCQ C;  1VQO Q;  3BDU A;  4PJL A; 
#chains in the Genus database with same CATH homology
 1PRL C;  2KYM A;  5I11 A;  1H92 A;  1WLP B;  1UG1 A;  3PVQ A;  1U06 A;  2MOX A;  4R0K A;  1RUW A;  2DJQ A;  4LE9 A;  1GFC A;  5L23 A;  1GL5 A;  2OI3 A;  1CKA A;  2CT4 A;  2DL8 A;  2FPF A;  4HCK A;  2DM1 A;  1BU1 A;  3VS7 A;  2O2O A;  1WIE A;  1AWW A;  1OV3 A;  3NPF A;  4RTZ A;  4RTT A;  1H3H A;  2L3S A;  1RLP C;  1W6X A;  2DMO A;  1GBQ A;  2HBW A;  1ABQ A;  2DRK A;  2YUQ A;  2W10 A;  1YWP A;  2LJ0 A;  3H41 A;  2QDL A;  3VS2 A;  5EC7 A;  5IXF A;  2BTT A;  2O9V A;  1HD3 A;  1FYN A;  4RTU A;  2LZ6 B;  2CUB A;  2V1R A;  2BZY A;  2CDT A;  1MUZ A;  4OMN A;  2LP5 A;  2M0Y A;  2RQV A;  1YN8 A;  2LQW A;  3I5R A;  2AZS A;  2J6O A;  3PVL A;  2DL3 A;  4FSS A;  3UF4 A;  4Y92 A;  2GTJ A;  4RUG A;  2BZX A;  2ABL A;  4QT7 A;  1Y57 A;  4D8D A;  1V1C A;  1RI9 A;  1ZUK A;  2ROL A;  2DA9 A;  2DF6 A;  4KRT A;  3C0C A;  3THK A;  2K3B A;  3VS5 A;  1X2K A;  2JT4 A;  3QWY A;  3A98 A;  1VA7 A;  2K7A A;  4LUE A;  1B07 A;  1VYT A;  4RTW A;  1UHC A;  2ED1 A;  3RBB B;  2KRN A;  4DEY A;  2L3Q A;  1Y0M A;  2JM8 A;  1X6B A;  1OPL A;  2KXD A;  1N5Z A;  2D8J A;  4J9I A;  4JPB W;  4K11 A;  3SHW A;  1PKS A;  4HVV A;  2OJ2 A;  1ZUU A;  3U23 A;  1VYU A;  1AD5 A;  1EFN A;  2JS0 A;  1MV3 A;  2CSQ A;  2NWM A;  4CC7 A;  1BK2 A;  3VS3 A;  1ZSG A;  2EGC A;  2DNU A;  1K0S A;  2GNC A;  1Z9Q A;  1B3Q A;  1WX6 A;  2EBP A;  2YDL A;  2KT1 A;  3M0R A;  2CH4 W;  2DE0 X;  1W70 A;  5I22 A;  2CRE A;  1NEG A;  2MCN A;  4WCI A;  4E6R A;  4Z89 A;  2EGA A;  2HCK A;  3UA7 A;  1HJD A;  4J9G A;  3M0T A;  1ARK A;  2ED0 A;  2KEA A;  2KRS A;  3LH5 A;  2YUN A;  1ZUY A;  2EYZ A;  3O5Z A;  2NUZ A;  2CSI A;  3ULR B;  2GGR A;  1QWF A;  2KT8 A;  1SHG A;  1JO8 A;  1WFW A;  2ESW A;  2YUP A;  1QKX A;  2SEM A;  3H0I A;  1QKW A;  2LCS A;  2RPN A;  4ORZ A;  1CKB A;  1AOJ A;  1X43 A;  1M30 A;  3EG1 A;  2H8H A;  1WI7 A;  3I5S A;  2D1X A;  1GRI A;  1E7O A;  1NG2 A;  4GBQ A;  4AFZ C;  1JQQ A;  4OMP A;  1YCS B;  3H0H A;  2DIL A;  1KSW A;  2O9S A;  2LJ3 A;  2GTO A;  2J6K A;  2RQT A;  2YUO A;  2AZV A;  3M0S A;  4JJB A;  2KE9 A;  1M3C A;  1NM7 A;  4JZ4 A;  2GQI A;  2DL7 A;  2F2X A;  5ECA A;  1JEG A;  1UDL A;  2L0A A;  3NHN A;  2FPE A;  1NEB A;  2D8H A;  2KRM A;  2A28 A;  1FMK A;  4EIK A;  3VS6 A;  4D8K A;  2ECZ A;  2RQW A;  1UFF A;  1IO6 A;  1VYV A;  2C0O A;  2E5K A;  4RTX A;  1E6H A;  1PWT A;  4CC3 A;  3PE0 A;  4HVU A;  1T3S A;  3EG0 A;  4JZ3 A;  3EG3 A;  1TUC A;  2LNH B;  4AFQ C;  1AWX A;  3RNJ A;  2KRO A;  3SEM A;  4LNP A;  1BBZ A;  1X2Q A;  2O88 A;  4ESR A;  2A08 A;  1T3L A;  2KYB A;  2HDA A;  2B86 A;  2JM9 A;  1MV0 B;  1XOV A;  3UA6 A;  5IH2 A;  4IIM A;  2JXB A;  3I35 A;  2L3P A;  2JS2 A;  5IXB A;  3NMZ C;  2AK5 A;  2V1Q A;  5IHK A;  1AWO A;  5IHI A;  1QLY A;  2JTE A;  2DLP A;  3M0Q A;  1OPK A;  3JV3 A;  1NYG A;  2JMC A;  1PKT A;  1KJW A;  1E6G A;  1ZX6 A;  2JMA A;  2EYX A;  1S1N A;  1TUD A;  4GLM A;  2K2M A;  1KIK A;  2XMF A;  1I0C A;  5IHN A;  3VS0 A;  3TSW A;  1HSQ A;  1UGV A;  4J9E A;  4HXJ A;  2DL4 A;  2G6F X;  2PZ1 A;  1UHF A;  3ZL7 C;  2KNB B;  4J9H A;  3VS1 A;  3QWX X;  1YP5 A;  2CT3 A;  1RLQ C;  2J7I A;  2PNI A;  4RTY A;  2RQR A;  2AKK A;  3KFV A;  4M4Z A;  1QCF A;  2DL5 A;  3EG2 A;  2DYB A;  2KR3 A;  4JJD A;  2EQI A;  2K6D A;  4AG1 C;  3UAT A;  2ROT A;  1AZE A;  3VRY A;  2J05 A;  4HVW A;  2JW4 A;  1ABO A;  4F17 A;  3I9Q A;  2VKN A;  2P4R A;  4J9D A;  2VVK A;  1UJY A;  2J06 A;  1TG0 A;  4X1V A;  4Z88 A;  1X69 A;  1NYF A;  1UEC A;  1M3B A;  1U3O A;  1UJ0 A;  2LX7 A;  2VWF A;  4RTV A;  1GCQ A;  2SRC A;  1WDX A;  4A63 B;  1X27 A;  1G2B A;  1JU5 C;  3IQL A;  1ZBJ A;  2X3W D;  1KFZ A;  5FWC A;  1K0X A;  2CH4 A;  2FG0 A;  1JXM A;  1PNJ A;  5FW9 A;  1UE9 A;  2K79 A;  2A37 A;  2M51 A;  1AEY A;  2LQN A;  1GCP A;  2C0T A;  1QWE A;  1H8K A;  3H0F A;  2HSP A;  4OMO A;  3VRZ A;  3GBQ A;  3TVT A;  2KGT A;  1YNZ A;  2HEQ A;  2RF0 A;  2L2P A;  2PTK A;  2RNA A;  4J9F A;  2X3X D;  3M0P A;  2LMJ A;  2KXC A;  1J3T A;  2LJ1 A;  1A0N B;  1WA7 A;  1OOT A;  3REB B;  2DVJ A;  3CQT A;  4J9B A;  1K9A A;  1UUE A;  1SRM A;  5FWB A;  1M3A A;  4DEX A;  2OAW A;  4J9C A;  4IIO A;  1NLP C;  2DX1 A;  1W1F A;  2O31 A;  2AKL A;  4AG2 C;  1K1Z A;  2F2V A;  4LN2 A;  1SSH A;  1OEB A;  1Z9Z A;  1CSK A;  2DBK A;  1GFD A;  2F2W A;  1WXU A;  2C0I A;  2YSQ A;  2EVR A;  1T0J A;  3TSZ A;  4F16 A;  2FEI A;  2RN8 A;  4ZNX A;  2FRW A;  2BZ8 A;  1WXB A;  2YT6 A;  2EYW A;  5HCK A;  1K76 A;  2A36 A;  2K9G A;  2RQU A;  2DRM A;  1SEM A;  1PHT A;  2CUD A;  3EHR A;  2GBQ A;  1AWJ A;  1K4U S;  1AVZ C;  1NLO C;  4OML A;  1BB9 A;  1SHF A;  1JXO A;  2W0Z A;  2FO0 A;  3FJ5 A;  1AZG B;  1WYX A;  1M8M A;  4AFU C;  2EW3 A;  1X6G A;  2DBM A;  2I0N A;  1I1J A;  3REA B;  2KBT A;  2FPD A;  4JJC A;  5GJW B;  2EKH A;  4CC4 B;  1ZLM A;  3NGP A;  1LCK A;  1PRM C;  2IIM A;  1U5S A;  2J6F A;  4CC2 A;  1I07 A;  1WXT A;  1UTI A;  1GBR A;  2FRY A;  1SRL A;  3EGU A;  4Z8A A;  5GJV B;  2RMO A;  1T0H A;  2ENM A;  4OMQ A;  1SPK A;  1YWO A;  1M27 C;  4AFS C;  4F14 A;  3VS4 A;  4OMM A;  3M0U A;  2MIO A;  3EHQ A;  2D0N A;  2EYY A;  3R6N A;  1G83 A;  1GCQ C;  2EGE A;  4LUD A;  2EPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...