2JMCA

Chimer between spc-sh3 and p41
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
77
structure length
77
Chain Sequence
GAMGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQESGDNAPSYSPPPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high-resolution NMR structure of a single-chain chimeric protein mimicking a SH3-peptide complex
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein
molecule keywords Spectrin alpha chain, brain and P41 peptide chimera
total genus 7
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jmcA00
3M0TA 4CC2A 1AOJA 4J9FA 2RQTA 2EGAA 5L23A 1X2KA 1PKTA 1WI7A 2DNUA 1OOTA 4AFUC 2EBPA 2JW4A 1KIKA 1ZUKA 4AFZC 3M0SA 4OMQA 2EQIA 1IO6A 2J6FA 1XOVA 2FO0A 3REBB 1PRLC 4OMOA 2HBWA 4EIKA 1OV3A 1WX6A 2ED1A 3PVLA 1UFFA 2CH4A 4RTWA 1VYUA 3QWYA 1PNJA 1AZGB 2F2VA 1RI9A 1MV0B 2J6OA 1SEMA 4JJBA 1M3BA 1QWEA 1SHFA 1GBRA 5IXBA 2FRYA 4Z89A 4J9EA 2YDLA 1QCFA 1UJ0A 3UA6A 4HCKA 3I5SA 2O9VA 3EG1A 1AD5A 2PZ1A 2EGCA 1K1ZA 2JTEA 2BZYA 1NYFA 2ROLA 3PE0A 3SEMA 2GGRA 2VVKA 2LJ1A 1I1JA 1SHGA 1UGVA 2FRWA 4J9DA 3ZL7C 1NLPC 1BU1A 5ECAA 3UATA 3EGUA 2RNAA 1LCKA 2PTKA 3I9QA 2LMJA 5I22A 1CKAA 2YUOA 4RTXA 1KSWA 4GLMA 2K6DA 2KGTA 1JXMA 2YUPA 2BZ8A 1UDLA 1HSQA 2D8JA 2DBMA 3UF4A 1GCQA 4Y92A 1AVZC 2LJ3A 2DYBA 5FW9A 2E5KA 4D8KA 2EKHA 2JT4A 2CUBA 1PWTA 1SPKA 3TSWA 2J7IA 2RQVA 2A28A 2MCNA 2AZVA 2EGEA 1K0SA 1K0XA 1GL5A 2KXDA 4HVWA 2EW3A 4F16A 4Z88A 4FSSA 1T3LA 2H8HA 3VS4A 1KFZA 3NMZC 4CC4B 1Y57A 2RQUA 3CQTA 4R0KA 3VS1A 2RQRA 2O9SA 2L2PA 2ED0A 3NHNA 2ESWA 2JXBA 3M0QA 2DA9A 5EC7A 2ROTA 2L3SA 2P4RA 4KRTA 3VS7A 2LX7A 4AFSC 4M4ZA 1QKWA 1X6GA 2JS2A 2B86A 2YUNA 3QWXX 1B07A 2J6KA 2VKNA 2JS0A 4WCIA 4IIOA 4RTYA 4OMMA 2EYWA 1UECA 2M0YA 2SRCA 4QT7A 1WIEA 2OAWA 4OMLA 2V1QA 1ZLMA 1X43A 4RTVA 1WA7A 2VWFA 4K11A 4AG1C 3EG0A 2A37A 4A63B 1GCPA 2FG0A 2RMOA 1BB9A 1GCQC 2J05A 2G6FX 2DLPA 1ZUYA 4HXJA 3IQLA 1WXBA 2I0NA 4AFQC 1OEBA 2YSQA 2DRKA 2F2WA 1BK2A 2F2XA 4RTZA 1ZSGA 2K9GA 4F17A 4F14A 1YP5A 2PNIA 2D0NA 2GNCA 4LN2A 2BTTA 2DF6A 3VRZA 1TG0A 2YT6A 2X3WD 3R6NA 2AKKA 2DL8A 2KRSA 2CT4A 2ECZA 2A36A 1VA7A 1M30A 2FPEA 1T0JA 1RLQC 1RLPC 2EPDA 2K7AA 1TUDA 2FEIA 4DEXA 1JXOA 1H92A 2RN8A 2AKLA 3H0IA 1JU5C 1U3OA 1T3SA 1X2QA 1M3AA 2C0TA 1JEGA 1AWOA 1MV3A 1UJYA 3M0UA 2ENMA 4AG2C 1CSKA 2CT3A 3O5ZA 2O31A 1BBZA 2KEAA 3I5RA 1QKXA 1WYXA 3RBBB 5IHNA 2KRMA 2K2MA 2CSIA 2KROA 3EG2A 2DL4A 2CUDA 2EVRA 3VS3A 2XMFA 3U23A 4RUGA 2V1RA 1W1FA 1AWJA 1VYVA 5I11A 4ORZA 1WLPB 1UTIA 2DL5A 2AZSA 2KNBB 3H41A 1VYTA 1QLYA 1NYGA 2CH4W 3UA7A 2AK5A 5IXFA 2KYMA 3EHRA 2K79A 2D1XA 1YWOA 4CC3A 3H0FA 3VS0A 3VS6A 1OPKA 1X6BA 5IHIA 1AEYA 1OPLA 2ABLA 1U5SA 2FPDA 3M0PA 3RNJA 2DILA 3GBQA 4J9GA 2SEMA 4Z8AA 2MOXA 1J3TA 1FMKA 3ULRB 2W0ZA 2CSQA 5GJVB 1TUCA 3H0HA 3C0CA 4OMNA 3VS5A 1FYNA 2HDAA 1PHTA 4JJCA 1NEBA 2KT8A 1JO8A 2NUZA 1WXTA 2EYZA 2DE0X 1A0NB 1UE9A 1M27C 5HCKA 3KFVA 2K3BA 3REAB 4LE9A 1B3QA 2C0IA 1NG2A 2DX1A 1Y0MA 1AWWA 2LNHB 1HJDA 2HEQA 3SHWA 1NEGA 2JMCA 1E7OA 1Z9QA 2DM1A 4RTTA 4CC7A 1X69A 5FWBA 1NLOC 4X1VA 1ARKA 4LNPA 1SRMA 2YUQA 2FPFA 1SSHA 2BZXA 3JV3A 2D8HA 4JJDA 2GTOA 3I35A 2KE9A 3M0RA 1E6HA 1T0HA 2LZ6B 2DJQA 4IIMA 2DRMA 2CREA 1CKBA 1K9AA 1ZBJA 2NWMA 1UUEA 1YN8A 4RTUA 2OJ2A 3NPFA 3LH5A 2CDTA 3PVQA 3A98A 1GRIA 2KYBA 1ZX6A 1WXUA 3TVTA 4J9IA 2LQNA 2W10A 1AWXA 1RUWA 5IH2A 2GQIA 1WDXA 4OMPA 1V1CA 1Z9ZA 2GBQA 1PRMC 2KR3A 1YNZA 1E6GA 2EYXA 1GFCA 4JPBW 1K4US 2A08A 1ABQA 3EHQA 3VRYA 1HD3A 2RPNA 1GBQA 1I0CA 3VS2A 4E6RA 2HSPA 2RQWA 1K76A 1G83A 2IIMA 2LQWA 1QWFA 4J9BA 2GTJA 2HCKA 1GFDA 4JZ4A 2RF0A 2DVJA 2O88A 2C0OA 3EG3A 1MUZA 4HVUA 3THKA 1U06A 2MIOA 4J9HA 3TSZA 1YCSB 4LUEA 1S1NA 1ABOA 2M51A 2KT1A 4GBQA 2J06A 1AZEA 1JQQA 5GJWB 2QDLA 2OI3A 2DL3A 2O2OA 1M3CA 1UHCA 4LUDA 3NGPA 2L3PA 2DBKA 2DMOA 2L0AA 1G2BA 1NM7A 4D8DA 2EYYA 2JM8A 4JZ3A 2KBTA 1UHFA 1WFWA 1N5ZA 3FJ5A 1X27A 4J9CA 5IHKA 1KJWA 2KXCA 4DEYA 4ZNXA 1ZUUA 1H8KA 2X3XD 4ESRA 1H3HA 5FWCA 1EFNA 2LJ0A 2L3QA 2DL7A 1YWPA 1SRLA 4HVVA 1PKSA 2LCSA 1I07A 1W70A 2KRNA 2LP5A 2JM9A 2JMAA 1UG1A 1W6XA 1M8MA
chains in the Genus database with same CATH superfamily
1AOJA 4M78F 5L23A 1PKTA 2CZ7B 3EFRA 3UWNA 2XIDA 6AT1B 3FIFA 2YLBA 3M56A 5D6YA 3MPUB 3GPLA 5KYYB 4OMOA 1SSFA 4M7AD 1OV3A 1WX6A 3INZA 5KYXB 5GMKm 4RTWA 4LD6A 1WZOA 1KC8C 2F2VA 5A2QE 1U1TA 1BI3A 1MV0B 2XD0A 2QEXQ 3EGXB 1YJNQ 4M77F 2FZCB 3P8BB 4PFPA 2FRYA 1M2OA 1HK9A 3QJYA 1QCFA 4V2SA 1UJ0A 1XNIA 1AD5A 3I55T 1M90R 2P0PA 2PZ1A 2RA2A 2JNGA 2JTEA 2BZYA 1RI0A 3JB9G 1K73R 1VUBA 1I1JA 1SHGA 2DVEA 1NLPC 2KI7A 3EGUA 1LCKA 2PTKA 1M1FA 1Q7YC 2YUOA 3M9QA 2KGTA 1TXQA 1HSQA 4M7DA 3QDFA 1AVZC 3QDRB 4M75B 4M75C 3L2QA 3EH2A 1XQHA 2EKHA 2MYSA 2JT4A 4J83A 4BDYA 2CUBA 1FX7A 2A3LA 3TSWA 3WXMB 2A28A 2RJCA 1GL5A 4OVAA 2EW3A 4M77C 3SFMA 1FMWA 1F1BB 3CC7T 4PJOF 4PLIA 4Z88A 4XTVA 2H8HA 3GP8A 4C0FA 3CQTA 3CC4A 2O9SA 2K3YA 3A8GB 1M90C 5LJ5h 1EIFA 2O01E 4ZGDB 3CCEQ 5GAN2 5EC7A 1VQ8Q 3HFOA 5EG2A 3KUFA 3V7CA 4FSXA 5LJ3h 1QKWA 1DJ7B 1X6GA 2JS2A 4RCBA 3V8KA 2YUNA 3PNWC 1R0BG 1Q82R 2JS0A 4IIOA 1Q81U 4KUDK 4PFZA 1R0CB 2COZA 1JBMA 3CD6A 1UECA 1WHGA 4QT7A 1WIEA 4OMLA 2V1QA 1ZLMA 1WA7A 4EMKA 4C92D 4F7UG 4XU2A 2A37A 3J7AF 3EGDB 1U8RA 2ATCB 3LGLA 4J6YA 1UGSB 1VQOT 4M7DC 2RJEA 2G6FX 4C5GA 5A0DA 3QXEB 3CCJA 2DLPA 2HSEB 5L8RE 2I0NA 4OB1B 3HTRA 5HK3A 1YJWT 1OX8A 3MHXA 1VQLQ 4FYVB 3CCRA 3VRZA 3CCUA 1QP3A 3PMTA 2DTHA 1YJNT 3V8JA 2KRSA 2DIQA 4AT1B 4FU6A 1M30A 3E2UA 5I2MA 2XHCA 1RLQC 2K7AA 1TUDA 5GANd 3BFMA 3I55Q 3RIRA 4C8QA 2VASA 1H92A 1YITA 2K4YA 1JU5C 5GANf 1VQNT 1M90U 3LWIA 3CCJT 1AWOA 4JJNK 1CSKA 1QVFA 3L2VA 2O31A 4B9XA 1YJ9T 1BBZA 3A5ZB 1WYXA 4DOWA 3CXCA 2Y90A 2KQWA 1U1SA 2MMPA 2KRMA 4OF1A 4XTWA 2CUDA 5GAOq 2IVWA 1YJNA 3NTKA 3G6EQ 2EYQA 1VQ6Q 5GAOl 2NLUA 2AZSA 2KNBB 1YHQA 3LW5E 4KBMB 2AK5A 5IXFA 2JZ2A 2KYMA 2K79A 3DB3A 3H0FA 3VS0A 1OPKA 3CC7Q 2QAZA 1AEYA 2ABLA 4LDWA 1SKUB 3FLGA 2FPDA 3ME9A 2QEXA 4FCYA 2DILA 1VOMA 3CC2T 4Z8AA 4C92B 1FMKA 2YXYA 2W0ZA 1NPRA 4C8QF 1TUCA 4KH0B 2VXFA 3VS5A 3QPHA 1VQ8T 4JJCA 4VUBA 1YJ9A 1NEBA 2ZCFB 2ZPEB 3C12A 4BUGA 1M27C 3CCEA 2E41A 1JJ2A 1B3QA 1OYXA 2DX1A 3OYNA 1FMVA 2HEQA 2ZAEA 1R77A 2E6NA 1M2VB 5J3BA 3KBGA 3SHWA 4E7IA 1MMDA 2DM1A 4JRQA 3FJPA 1X69A 1NLOC 4X1VA 4ZGJB 4QW2A 3CBPA 2HMAA 3TEEA 2FPFA 1VQ9T 1SSHA 2BZXA 5DLOA 5KYUB 4HT9A 3E1SA 2GTOA 2WSCE 3I35A 3VU3C 1HYOA 2K2VA 1K9MR 2DJQA 2VB6A 4E2FB 3G71Q 1CKBA 3LLRA 4DBRA 2OJ2A 1M1KC 3BDUA 1D1BA 2CDTA 1VQLT 1MGQA 2XICA 5GAMj 5GMKh 2F5KA 1AWXA 2W10A 2L5QA 1N6AA 4OMPA 2YWWA 3PFSA 2GBQA 4IUPA 2KR3A 2QTXA 3M57A 2EYXA 3FB9A 4JPBW 1VQ5T 5GANe 1ABQA 1XJWB 1VQ7T 3JCMP 2CP6A 1I8FA 1GBQA 1D3BA 1I0CA 2HD0A 3P8HA 4E6RA 3OYKA 2RQWA 1TSFA 1K76A 1PM3A 1VQ9A 3MEWA 2QGFB 2QXFA 2HKNA 3G1JA 4Z02A 4LDYA 2JOYA 2PVDB 1W2BS 2QQSA 4Y91A 4M75A 1U06A 2RM4A 3ZBDA 1VQMQ 2MIOA 4RCCA 3TSZA 2ZPIB 2JUFA 4EDUA 2M51A 3CC4T 1VQLA 5LJ3j 1I4K1 2YHTA 3OYYA 1LVKA 4N0AA 2LC4A 2O2OA 2DEQA 2P84A 4PL6A 2K5FA 5CKHA 1M1KR 3OYAA 1YI2Q 1UEBA 3EFSA 4E7LA 1M2VA 1UHFA 3F70A 1N5ZA 5IHKA 3VUBA 4M7AG 2CKKA 3CCLQ 3JSCA 3OYFA 2EKOA 2DL7A 2X4XA 2LVMA 3JAME 3QUIA 1W70A 4PFOA 4XTYA 3CC2Q 4C8QC 2LT1A 3M0TA 1FWZA 3BDLA 4CC2A 1VQOA 2RQTA 4OB3B 1X2KA 1OU9A 1WI7A 2DNUA 3ZFJA 4KGXB 3C94A 1NBEB 1KIKA 2EQIA 2X4WA 3OS5A 5GMKj 2O4XB 2J6FA 1WHMA 1XOVA 2FO0A 4OGCA 3OS2A 1PSFA 3GLXA 4M7DB 5KH6A 4J6WA 2F69A 3EG9A 1LJOA 1AZGB 1D09B 2LNVA 4WF2A 2LQKA 1YCYA 1KK7A 4A53A 3LYIA 2J6OA 2XKOC 4M7AC 3A8MB 3FEOA 1BI2A 2O4XA 4ME7A 1I5LA 1KHIA 2QG9B 4Z89A 4J9EA 2XDBA 3JRZA 2YDLA 3QHSA 2IG0A 3UA6A 3I5SA 2KVQG 1PCXA 2M1HA 2RB6A 9ATCB 1NYFA 1TS9A 2QGGA 3OMGA 1QCNA 2Y4XA 2LJ1A 2FRWA 4PNOA 1N8RU 5GMKl 1OU8A 3I56A 3CCSQ 2LMJA 2EFIA 3WVEB 5I22A 4TVRA 2VYTA 2GCXA 4GLMA 4JS4A 1JXMA 2OAUA 3L2RA 2DBMA 3UF4A 1V29B 2JTFA 4Y92A 1KC8U 4EMKB 2EAYA 5GAMf 2HL3A 2LJ3A 3QSUA 3CMET 1B34B 3QZ9B 4D8KA 2RI3A 3J81E 1YIJT 3OB9A 1SPKA 4ZTFA 2RK1A 4KT0E 3MEUA 3GIBA 1IRXA 1K0SA 3CCMA 5CKDA 2RHXA 3UPUA 2E70A 4F16A 4BE0A 1T3LA 4XTUA 5KYNA 3V8LA 1Y57A 3VS1A 2RQRA 1YJ9Q 2L2PA 2ESWA 1YFNA 1KQSP 2R5MA 3CCQQ 3S3MA 1IREB 1M1KU 4PLLA 1VQKT 3CMAQ 2L3SA 1RAFB 3CBOA 3MP1A 2EJ9A 4EMHA 1VQPA 2DD4A 2LX7A 2C06A 1WJRA 1VQ6T 4NOYA 3CC7A 1IGQA 3CEYA 1RAAB 3TREA 1Y96B 3JCMc 2B86A 1B07A 4F7UF 3SB2A 2VKNA 2EQMA 4X9DA 2FZKB 4RTYA 4FW2A 4M7AB 1PSEA 2MAMA 4E7KA 1SF9A 2QTVA 1WQWA 4AG1C 1WHHA 3EG0A 1WHJA 1BB9A 2E1HA 2J05A 3HFNA 3ZEHA 1ZUYA 4HXJA 3IQLA 4IURA 2DRKA 1N8RR 4QKUA 4M75F 2XDDA 4E7ZA 1IGUA 2PVOB 2GNCA 3AT1B 3CCVT 3OYMA 4QVZA 2FB7A 3HPWA 2X3WD 1HXDA 3EAEA 2DL8A 2QYZA 2ECZA 1M4ZA 3PT9A 5CR2A 4XU0A 4D6WA 4N4HA 5HY6A 2HAXA 2RHYA 1K8AR 1T0JA 1JRIA 2EPDA 3M54A 4NS5A 4F7UA 1PC0A 3G71T 1JXOA 1Q7YU 1QVFP 2RN8A 1ACMB 2E10A 5HKCA 2C0TA 3JCMf 3M0UA 1N27A 1UJYA 2ENMA 1D0ZA 3TCJA 3CCQA 3UDCA 4AMCA 2CT3A 4L6V5 1IB8A 1IXDA 2KEAA 4Q5WA 3M53A 4ANJA 1YI2A 1D1CA 2KY9A 4OGEA 2YRCA 2CSIA 3OYHA 3EG2A 2RH2A 1YITT 3OW2A 3FC3A 2XMFA 2AHJB 2GF7A 4RUGA 2DZCA 1YIJQ 4XU1A 3CMEA 1VYVA 5I11A 1WPYA 1UTIA 2DL5A 4XAXB 1ZA1B 2PQWA 2ZPGB 4ELZC 4N4IA 5IHIA 2KK4A 3X24B 5GAN6 4IUUA 4EMGA 1U5SA 4XQ3A 1BYMA 2VUBA 4J9GA 3G4SA 2SEMA 1J3TA 2MOXA 4HA8A 2XG8D 2M0OA 5KCHA 3CCQT 2LCLA 1ZHIA 1AT1B 2CP3A 1UB4A 3C0CA 3CPWP 1YI2T 2NUZA 1WXTA 1VQKA 2D0QB 5CK9A 2GFUA 1UE9A 3JCMb 3KFVA 1VIFA 2C0IA 1NG2A 1VQ6A 5GAOm 2LNHB 1HJDA 5KYXA 3JCMd 3JCMJ 3A8HB 1WHLA 1MNEA 1RAEB 1E7OA 3OYIA 2YRDA 3T9NA 3L42A 1W4SA 1ARKA 5C0MA 1K9MU 1RAIB 1V76A 1QVFS 2CP7A 2E5QA 4E47A 4BI8B 4M78G 3OS1A 4JJDA 1Y7XA 4OB0B 2KE9A 3M0RA 3OSSC 1T0HA 1D0YA 2ZZDA 3M55A 4PJJA 1ZSZC 2CREA 3WVDB 3VYHB 1K9AA 1YN8A 4RTUA 2K5LA 3HRSA 2DXCA 4LD9K 2DPPB 2FYKA 1ZX6A 1MMAA 2QK0A 3TVTA 2LQNA 5IH2A 2NUPB 3BW1A 3SWNB 4DBHA 3CC2A 1E6GA 1GFCA 2A08A 4M77G 1FXXA 1YIJA 5C6SA 1G83A 4RKUE 1LOJA 2LQWA 2HNIA 2GTJA 2HCKA 4JZ4A 2RF0A 1Q86R 2O88A 4HVUA 4CI0C 1BKBA 3THKA 1P92A 3OA6A 5FRMA 2E65A 1R8OB 2DKGA 1YCSB 4LUEA 2AT1B 1S1NA 1ABOA 3CCST 3A8LB 2PU9B 4BD3A 4HCCA 4FT4A 3JCMW 4A4EA 3QYGB 2CGHA 2EQUA 2MWPA 4M77A 1BCOA 5GAOp 2DMOA 2JTMA 2CZ6B 3CBMA 2RJFA 4C92F 2EYYA 2JM8A 1TUGB 1VQ5A 3QBYA 4J9CA 1EX4A 2KXCA 3RESA 2LRQA 1H641 3V7SA 2X3XD 2RHZA 3LX7A 1H3HA 5LJ5f 2VXEA 2X9HA 1YWPA 4HVVA 1PKSA 2HKQB 2LCSA 1Y96A 4M75D 3I56Q 1I07A 2FL7A 4LDXA 4IUVA 4M7DG 2JMAA 1YBYA 2LX9A 1RACB 3HL8A 4QQ6A 3H9NA 2EGAA 4AFUC 4CRIA 2HQEA 1NJIU 7AT1B 4AFZC 2DIGA 1VQKQ 1IO6A 4PJMA 3REBB 2R57A 2HBWA 1EZZB 4EIKA 1B34A 1C6VX 2RO0A 4A4GA 4BACA 3PVLA 1UFFA 4KGZB 2HZYA 2D9TA 4QVDA 1PG5B 3QJ6A 1VYUA 3QWYA 1RI9A 1LPLA 1WHKA 4JJBA 3S6WA 1QWEA 2DK3A 2BE9B 2KSSA 4M7AE 1W2BA 1VQ5Q 1VQ4A 1VQ7Q 2D6FA 3BE3A 3CCUQ 5FROA 4C0GA 1VIEA 3HKSA 4HCKA 3BY7A 2O9VA 3A1PA 2DXBA 1WJSA 2EGCA 3RKYA 3NTHA 5DLQE 2ROLA 3PE0A 4XTZA 4M7DE 2BUDA 2GGRA 2LT4A 3CCJQ 4J9DA 3ZL7C 1NJIC 5ECAA 3UATA 2XU8A 3I9QA 4M77B 3X25B 5IT9E 4F04B 1Q86C 2XK0A 4FM4B 1KSWA 2K6DA 1UDLA 5I2SA 2FZGB 4YTLA 2RK2A 3J80E 5J26A 5KCOA 3OS0A 2DYBA 1NE8A 1WGSA 4M77D 2KAFA 1PWTA 3NTIA 3MEAA 1KG1A 1KHCA 2RQVA 2MCNA 2AZVA 2EGEA 2KXDA 4HVWA 1N9SA 5FU6C 3VS4A 4KUIA 4NL2A 1N9RA 4CC4B 1VQ4Q 4R0KA 4HCZA 2EWNA 1OQKA 2NUTA 3M58A 1OZ2A 8ATCB 1QCOA 2JXBA 1BIBA 3M0QA 5GMKe 4RMOA 2ROTA 4JDSA 2MI6A 2OTLQ 3OBWA 1G3SA 2EQKA 4AFSC 4M4ZA 1ZA2B 5LJ3e 4MMLA 1KQ1A 2ZGWA 3TU4K 3JB9F 4QVCA 4FT2A 4WCIA 3CPWA 1TU0B 4OP0A 4C5IA 4MMKA 2E3IA 2QI2A 3PIPA 2M0YA 2SRCA 3I56T 4XK8E 1X43A 4J7IA 4RTVA 4J5YA 2VWFA 3CCRT 3MJXA 4K11A 3HP9A 1OI1A 4A63B 2ZPFB 1VQPT 1GCPA 1RABB 5KYUA 3L2ZA 1UGQB 4C92C 3EFOB 4RTZA 1ZSGA 2DAQA 3CD6T 5GAOr 2PNIA 2D0NA 1ZSZA 2VV5A 4LN2A 3CCMT 2RHUA 3RMSA 2EJFA 4ZTJA 2YT6A 4KH1B 3R6NA 2AKKA 4OB2B 1RL2A 4M75E 4BY6C 3C95A 4BI4A 1KD1U 2A36A 1Q95G 1RAGB 1VA7A 2NUPA 3X26B 4PJOE 4M78A 3QKJA 2K5IA 1N8RC 2QQRA 4DEXA 4M77E 1NZ9A 4BI3A 2H3EB 1BI1A 2JVVA 1G3YA 3H0IA 2JJ9A 1U3OA 2DZ9A 1T3SA 1S72T 3LH0A 3OQ5A 5DM7R 2NUTB 3RUXA 4AG2C 1WQ7A 1VQMT 3CCSA 1TH7A 5KE2A 3I5RA 3CC4Q 3RBBB 2V8KA 4UC4A 2OTJT 2GFAA 5IHNA 2K2MA 2KDSA 1RADB 2KROA 4MZTA 2LQ8A 5FRNA 3TQ7P 2V1RA 1W1FA 5CQYA 1M9SA 2L89A 4MDXA 2BIVA 4JRPA 1WLPB 3H41A 1MNDA 4BE2A 1QLYA 1YJWA 5GAN8 3RKWA 3P8DA 1KQSA 3EHRA 2P0QA 3SWNC 4CC3A 3VS6A 1X6BA 2COWA 1OPLA 5FU7B 4FL6A 5DY9A 4A4KA 2PUKB 3M0PA 3RNJA 4B9WA 4QQGA 2IPOB 1H3ZA 5CQXA 3OMCA 5FLXE 2CSQA 5GJVB 3H0HA 4OMNA 1FYNA 2HDAA 1D1AA 1PHTA 1UGRB 4J6XA 4C5HA 1ZSZB 3H6ZA 2OTLT 3VUZA 4L59A 3UT1A 2EYZA 4FW1A 3CPWS 2VGNA 5D6XA 2F5TX 1A0NB 5HCKA 4F7UE 4LE9A 4HKEA 1ZBXA 3CCVQ 2CP2A 3OYCA 2JMCA 2QA4Q 2V26A 4E7HA 5AT1B 2EIFA 4LNPA 1M5Q1 4P5NA 3M4GA 1MMNA 2R5AA 3EGDA 3Q1JA 1VQPQ 3JV3A 5CKEA 3PTAA 2M9UA 4JLIA 2YLCA 5M9OA 2Y4YA 2LTOA 1BCMA 2DTOA 4FIBA 5GMKi 1K9MC 5CVIA 1UUEA 3NPFA 5GAN5 4N4GA 1M1GA 2DO3A 3OW2S 3PVQA 3QYHB 4WTOB 4KULA 2KYBA 4J9IA 1D0XA 1Q82C 2GQIA 1WDXA 1Z9ZA 3X28B 2QEXT 3OSVA 1YNZA 1M8VA 5CCAA 1QQJA 1QVGA 4LXCA 1K4US 3EHQA 1QVGS 3JCMh 1HD3A 2RPNA 1KD1R 5D7UA 2WSFE 3HRUA 4O5VA 3VS2A 4M78E 3CMEQ 3RERA 2L8DA 2X51A 1IHWA 4J9BA 1JJ2P 3H8ZA 3EG3A 1MUZA 2HBPA 2I2LA 4JUVA 2QQAA 1JB0E 1AZEA 1JQQA 3JCMV 3HSBA 2QDLA 2OI3A 2DL3A 3L2WA 2DFUA 2OTJA 1M3CA 3GF5A 3L1AA 4LUDA 4ATOA 2L0AA 1ZQ1A 2R58A 1G2BA 3CMAT 1NM7A 3I55A 4Y28E 4JZ3A 1WFWA 3FJ5A 4GLKA 3OYEA 1KJWA 4R56A 3SDZA 2RI5A 4ZNXA 3OYJA 1RAHB 4QQDA 5GAMe 3D7SB 1H8KA 2RD1A 2X4JA 3MP8A 5FWCA 3CXCP 1EFNA 2LJ0A 1GXIE 4MZPA 1TWBA 2E3HA 2PUOB 1SRLA 1I5OB 1K73C 1BIAA 1UG1A 1W2BP 3MO8A 1NJIR 3JCMQ 4J9FA 1OOTA 2DXUA 3RDVA 5LJ5d 2COYA 5LJ3g 2EBPA 2JW4A 4IUTA 2KMTA 3QIIA 3DLLA 1ZUKA 2DERA 2V8JA 3M0SA 4OMQA 2X35A 1OX9A 1PD1A 3DLMA 1WJQA 4JRKA 3GNGA 2JN0A 4E7JA 4BDZA 4XTXA 1PRLC 4ZN1A 2ED1A 2CH4A 2QASA 3HRTA 3FDRA 2HQXA 3CMAA 5CKFA 1PNJA 2CZ1B 4BB7A 1X6OA 2QA4T 3CCLA 1SEMA 1M3BA 3ASKA 1SHFA 1QP2A 3M4YA 5LJ5j 4C0DB 2L3RA 4X34A 4PJOA 5IXBA 1GBRA 2ZPHB 5AYFA 3JCMX 3OY9A 3OYLA 3CXCS 4DA4A 3VKIA 3DKMA 3EG1A 4ZN3A 1K1ZA 3URGA 3SEMA 2VVKA 3CD6Q 3OW2P 1UGVA 1VQMA 3HHTB 4C5EA 1O9SA 1BU1A 4PJLA 2HQHA 2RNAA 4IKFA 3PIOA 1OULA 1CKAA 1Q82U 4RTXA 2BE7D 2MWOA 5KYYA 3L2UA 2YUPA 2BZ8A 2D8JA 4EPCA 5IN1A 1Q86U 1GCQA 2G3RA 2V8IA 1YITQ 2A0FB 4PJOD 3ER0A 4ELYC 3G6EA 1TOVA 1G3TA 5FW9A 2E5KA 4LDUA 4JLGA 3EH1A 5J39A 2MPXC 3MCAB 2DEUA 4HCBA 2QQBA 3O8VA 3EGXA 2J7IA 4JS5A 1YHQQ 1KD1C 4C8QG 1K0XA 4BY6B 1XTDA 3CCVA 3OYDA 1S72Q 5LJ3f 1KQ2A 1QVGP 3JCMe 4RG8A 4FSSA 1KFZA 3NMZC 1G3WA 4N0AC 1QVPA 1MMGA 3SWNA 2RQUA 4PJNA 2ED0A 3NHNA 4HT8A 3NFCA 2RI2A 2OTJQ 1B7TA 3FRNA 3MKDA 1UGPB 3PGGA 1IZ6A 4PJOG 3JB9I 3R6OA 2DA9A 2EQJA 4JRIA 2P4RA 4KRTA 3VS7A 2QDYB 4M78B 2XDPA 5FU6B 2M16A 3G7ZA 3QWXX 3AHUA 2J6KA 4ZGEB 1TTHB 3G4SQ 1Q81R 4OMMA 2EYWA 4R55A 2OAWA 1LNXA 4C92G 4X9CA 5GAOn 3MP6A 3META 1MHNA 3CCUT 2WSEE 3E19A 3C4SA 5GAN7 2FG0A 2RMOA 3OYBA 1GCQC 1VQNA 1C0MA 4NL3A 4J7FA 2RJDA 5GAMd 1WXBA 4AFQC 1OEBA 2YSQA 2DXTA 2F2WA 1BK2A 2F2XA 4DOVA 4C92E 2E4HA 3PMIA 2K9GA 4F17A 4F14A 3RMQA 1YP5A 3N5BB 2BTTA 5LJ5g 4J8OA 2DF6A 2HL5C 2GQVA 5LL6S 5GANh 1TG0A 2QA4A 1KC8R 5CKBA 2CT4A 1VQ9Q 1PD0A 2FPEA 1SG5A 4RG2A 1VQ8A 4GY5A 3OBYA 1RLPC 2FEIA 2DYIA 3LWHA 1IHVA 1O75A 4PJOC 1OZ3A 2DJZA 3RKXA 4PK4A 2LCCA 1KQSS 2BKDN 2CP5A 2M02A 4DBFA 2AKLA 3MEVA 1X2QA 1M3AA 1JEGA 1C1AA 1MV3A 2MK5A 2VGMA 4C8QD 5A0GA 3O5ZA 2RHIA 1QKXA 3QG1A 3VJPA 4M7AF 2P0KA 3QZ5B 3CCET 3JCMg 2DL4A 2EVRA 4FYYB 3VS3A 2E6ZA 4MDWA 3U23A 1Q81C 2CS7A 5D6WA 1AWJA 3E9FA 4ORZA 1WNLA 4C0ZA 5KYWA 1VYTA 1NYGA 2CH4W 4M75G 3UA7A 2QQ9A 2K57A 2B8AA 2D1XA 1YWOA 2F1LA 3EG9B 1AHJB 4BE1A 1K8AC 3JB9H 3GBQA 4PKCC 1S72A 3ULRB 1VQOQ 3QO3A 3A8OB 2E12A 2KT8A 4L5GA 5CO7A 1JJ2S 1Y07A 1JO8A 5GAN4 2EJGA 3E9GA 3CPFA 2DE0X 3G71A 1YJWQ 2K3BA 3REAB 3CCMQ 1Y0MA 3LGFA 2CZ0B 2WACA 1AWWA 3G4ST 4M7AA 3CCLT 1NEGA 2YRVA 1Z9QA 2ZPBB 4RTTA 4II1A 4CC7A 5FWBA 3GNFB 4LDVA 1SRMA 2YUQA 3X20B 1X01A 1QW1A 4C0DC 4M7DF 2FHDA 4B6MA 2D8HA 4F7UB 2PVGB 1E6HA 2CYZB 4IIMA 2LZ6B 2DRMA 2NWMA 1ZBJA 2A7YA 4DBQA 1K73U 4A54A 1VQ7A 2AIRB 4DQ2A 4MZMA 3DB4A 2LDMA 2NYSA 1VQNQ 3LH5A 5GANg 1BI0A 2X4YA 4C92A 3A98A 1GRIA 1G8XA 1Y71A 1WXUA 5FU7C 1RUWA 4A4HA 1V1CA 1NPPA 3S3NA 1PRMC 2K3XA 3KXTA 4OMFB 4C8QB 1I81A 3VRYA 5KYWB 4IUQA 3G6ET 3VYGA 1G5VA 2HSPA 2OTLA 2DETA 4FYWB 5I21A 3JB9J 2CP0A 3EFOA 1K8AU 2MF2A 2IIMA 4M78C 1QWFA 1GFDA 5HK0A 1Q7YR 1X75C 2DVJA 3M59A 3GOXA 2C0OA 2E64A 3V7RA 4A4FA 5GAMh 4J9HA 4M78D 5LJ3d 2DD5A 3M5AA 3SD4A 1QMCA 5A0LA 2KT1A 4GBQA 2J06A 1VQ4T 2VC8A 5GJWB 4M7DD 2XI9A 3VV0A 1UHCA 5KE3A 8AT1B 3NGPA 2L3PA 2DBKA 4E7SA 5GANj 4D8DA 5IAYA 2P4TA 5GAN3 2KBTA 1X27A 4PJOB 4O6JA 4DEYA 5GAMg 3S3OA 1ZUUA 5CIUA 4XU3A 1YHQT 4FYXB 4ESRA 4EMKC 2DTIA 5LJ5e 2L3QA 2H3JA 1D3BB 4KGVB 3OYGA 4C8QE 5CAIA 2OX7A 2KRNA 2LP5A 2Z0WA 3JB9D 2JM9A 3RR6A 2FVUA 1W6XA 3CCRQ 1M8MA
chains in the Genus database with same CATH topology
3M0TA 4CC2A 1AOJA 4J9FA 2RQTA 2EGAA 5L23A 1X2KA 1PKTA 1WI7A 2DNUA 1OOTA 4AFUC 2EBPA 2JW4A 1KIKA 1ZUKA 4AFZC 3M0SA 4OMQA 2EQIA 1IO6A 2J6FA 1XOVA 2FO0A 3REBB 1PRLC 4OMOA 2HBWA 4EIKA 1OV3A 1WX6A 2ED1A 3PVLA 1UFFA 2CH4A 4RTWA 1VYUA 3QWYA 1PNJA 1AZGB 2F2VA 1RI9A 1MV0B 2J6OA 1SEMA 4JJBA 1M3BA 1QWEA 1SHFA 1GBRA 5IXBA 2FRYA 4Z89A 4J9EA 2YDLA 1QCFA 1UJ0A 3UA6A 4HCKA 3I5SA 2O9VA 3EG1A 1AD5A 2PZ1A 2EGCA 1K1ZA 2JTEA 2BZYA 1NYFA 2ROLA 3PE0A 3SEMA 2GGRA 2VVKA 2LJ1A 1I1JA 1SHGA 1UGVA 2FRWA 4J9DA 3ZL7C 1NLPC 1BU1A 5ECAA 3UATA 3EGUA 2RNAA 1LCKA 2PTKA 3I9QA 2LMJA 5I22A 1CKAA 2YUOA 4RTXA 1KSWA 4GLMA 2K6DA 2KGTA 1JXMA 2YUPA 2BZ8A 1UDLA 1HSQA 2D8JA 2DBMA 3UF4A 1GCQA 4Y92A 1AVZC 2LJ3A 2DYBA 5FW9A 2E5KA 4D8KA 2EKHA 2JT4A 2CUBA 1PWTA 1SPKA 3TSWA 2J7IA 2RQVA 2A28A 2MCNA 2AZVA 2EGEA 1K0SA 1K0XA 1GL5A 2KXDA 4HVWA 2EW3A 4F16A 4Z88A 4FSSA 1T3LA 2H8HA 3VS4A 1KFZA 3NMZC 4CC4B 1Y57A 2RQUA 3CQTA 4R0KA 3VS1A 2RQRA 2O9SA 2L2PA 2ED0A 3NHNA 2ESWA 2JXBA 3M0QA 2DA9A 5EC7A 2ROTA 2L3SA 2P4RA 4KRTA 3VS7A 2LX7A 4AFSC 4M4ZA 1QKWA 1X6GA 2JS2A 2B86A 2YUNA 3QWXX 1B07A 2J6KA 2VKNA 2JS0A 4WCIA 4IIOA 4RTYA 4OMMA 2EYWA 1UECA 2M0YA 2SRCA 4QT7A 1WIEA 2OAWA 4OMLA 2V1QA 1ZLMA 1X43A 4RTVA 1WA7A 2VWFA 4K11A 4AG1C 3EG0A 2A37A 4A63B 1GCPA 2FG0A 2RMOA 1BB9A 1GCQC 2J05A 2G6FX 2DLPA 1ZUYA 4HXJA 3IQLA 1WXBA 2I0NA 4AFQC 1OEBA 2YSQA 2DRKA 2F2WA 1BK2A 2F2XA 4RTZA 1ZSGA 2K9GA 4F17A 4F14A 1YP5A 2PNIA 2D0NA 2GNCA 4LN2A 2BTTA 2DF6A 3VRZA 1TG0A 2YT6A 2X3WD 3R6NA 2AKKA 2DL8A 2KRSA 2CT4A 2ECZA 2A36A 1VA7A 1M30A 2FPEA 1T0JA 1RLQC 1RLPC 2EPDA 2K7AA 1TUDA 2FEIA 4DEXA 1JXOA 1H92A 2RN8A 2AKLA 3H0IA 1JU5C 1U3OA 1T3SA 1X2QA 1M3AA 2C0TA 1JEGA 1AWOA 1MV3A 1UJYA 3M0UA 2ENMA 4AG2C 1CSKA 2CT3A 3O5ZA 2O31A 1BBZA 2KEAA 3I5RA 1QKXA 1WYXA 3RBBB 5IHNA 2KRMA 2K2MA 2CSIA 2KROA 3EG2A 2DL4A 2CUDA 2EVRA 3VS3A 2XMFA 3U23A 4RUGA 2V1RA 1W1FA 1AWJA 1VYVA 5I11A 4ORZA 1WLPB 1UTIA 2DL5A 2AZSA 2KNBB 3H41A 1VYTA 1QLYA 1NYGA 2CH4W 3UA7A 2AK5A 5IXFA 2KYMA 3EHRA 2K79A 2D1XA 1YWOA 4CC3A 3H0FA 3VS0A 3VS6A 1OPKA 1X6BA 5IHIA 1AEYA 1OPLA 2ABLA 1U5SA 2FPDA 3M0PA 3RNJA 2DILA 3GBQA 4J9GA 2SEMA 4Z8AA 2MOXA 1J3TA 1FMKA 3ULRB 2W0ZA 2CSQA 5GJVB 1TUCA 3H0HA 3C0CA 4OMNA 3VS5A 1FYNA 2HDAA 1PHTA 4JJCA 1NEBA 2KT8A 1JO8A 2NUZA 1WXTA 2EYZA 2DE0X 1A0NB 1UE9A 1M27C 5HCKA 3KFVA 2K3BA 3REAB 4LE9A 1B3QA 2C0IA 1NG2A 2DX1A 1Y0MA 1AWWA 2LNHB 1HJDA 2HEQA 3SHWA 1NEGA 2JMCA 1E7OA 1Z9QA 2DM1A 4RTTA 4CC7A 1X69A 5FWBA 1NLOC 4X1VA 1ARKA 4LNPA 1SRMA 2YUQA 2FPFA 1SSHA 2BZXA 3JV3A 2D8HA 4JJDA 2GTOA 3I35A 2KE9A 3M0RA 1E6HA 1T0HA 2LZ6B 2DJQA 4IIMA 2DRMA 2CREA 1CKBA 1K9AA 1ZBJA 2NWMA 1UUEA 1YN8A 4RTUA 2OJ2A 3NPFA 3LH5A 2CDTA 3PVQA 3A98A 1GRIA 2KYBA 1ZX6A 1WXUA 3TVTA 4J9IA 2LQNA 2W10A 1AWXA 1RUWA 5IH2A 2GQIA 1WDXA 4OMPA 1V1CA 1Z9ZA 2GBQA 1PRMC 2KR3A 1YNZA 1E6GA 2EYXA 1GFCA 4JPBW 1K4US 2A08A 1ABQA 3EHQA 3VRYA 1HD3A 2RPNA 1GBQA 1I0CA 3VS2A 4E6RA 2HSPA 2RQWA 1K76A 1G83A 2IIMA 2LQWA 1QWFA 4J9BA 2GTJA 2HCKA 1GFDA 4JZ4A 2RF0A 2DVJA 2O88A 2C0OA 3EG3A 1MUZA 4HVUA 3THKA 1U06A 2MIOA 4J9HA 3TSZA 1YCSB 4LUEA 1S1NA 1ABOA 2M51A 2KT1A 4GBQA 2J06A 1AZEA 1JQQA 5GJWB 2QDLA 2OI3A 2DL3A 2O2OA 1M3CA 1UHCA 4LUDA 3NGPA 2L3PA 2DBKA 2DMOA 2L0AA 1G2BA 1NM7A 4D8DA 2EYYA 2JM8A 4JZ3A 2KBTA 1UHFA 1WFWA 1N5ZA 3FJ5A 1X27A 4J9CA 5IHKA 1KJWA 2KXCA 4DEYA 4ZNXA 1ZUUA 1H8KA 2X3XD 4ESRA 1H3HA 5FWCA 1EFNA 2LJ0A 2L3QA 2DL7A 1YWPA 1SRLA 4HVVA 1PKSA 2LCSA 1I07A 1W70A 2KRNA 2LP5A 2JM9A 2JMAA 1UG1A 1W6XA 1M8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0T A;  4CC2 A;  1AOJ A;  4J9F A;  2RQT A;  2EGA A;  5L23 A;  1X2K A;  1PKT A;  1WI7 A;  2DNU A;  1OOT A;  4AFU C;  2EBP A;  2JW4 A;  1KIK A;  1ZUK A;  4AFZ C;  3M0S A;  4OMQ A;  2EQI A;  1IO6 A;  2J6F A;  1XOV A;  2FO0 A;  3REB B;  1PRL C;  4OMO A;  2HBW A;  4EIK A;  1OV3 A;  1WX6 A;  2ED1 A;  3PVL A;  1UFF A;  2CH4 A;  4RTW A;  1VYU A;  3QWY A;  1PNJ A;  1AZG B;  2F2V A;  1RI9 A;  1MV0 B;  2J6O A;  1SEM A;  4JJB A;  1M3B A;  1QWE A;  1SHF A;  1GBR A;  5IXB A;  2FRY A;  4Z89 A;  4J9E A;  2YDL A;  1QCF A;  1UJ0 A;  3UA6 A;  4HCK A;  3I5S A;  2O9V A;  3EG1 A;  1AD5 A;  2PZ1 A;  2EGC A;  1K1Z A;  2JTE A;  2BZY A;  1NYF A;  2ROL A;  3PE0 A;  3SEM A;  2GGR A;  2VVK A;  2LJ1 A;  1I1J A;  1SHG A;  1UGV A;  2FRW A;  4J9D A;  3ZL7 C;  1NLP C;  1BU1 A;  5ECA A;  3UAT A;  3EGU A;  2RNA A;  1LCK A;  2PTK A;  3I9Q A;  2LMJ A;  5I22 A;  1CKA A;  2YUO A;  4RTX A;  1KSW A;  4GLM A;  2K6D A;  2KGT A;  1JXM A;  2YUP A;  2BZ8 A;  1UDL A;  1HSQ A;  2D8J A;  2DBM A;  3UF4 A;  1GCQ A;  4Y92 A;  1AVZ C;  2LJ3 A;  2DYB A;  5FW9 A;  2E5K A;  4D8K A;  2EKH A;  2JT4 A;  2CUB A;  1PWT A;  1SPK A;  3TSW A;  2J7I A;  2RQV A;  2A28 A;  2MCN A;  2AZV A;  2EGE A;  1K0S A;  1K0X A;  1GL5 A;  2KXD A;  4HVW A;  2EW3 A;  4F16 A;  4Z88 A;  4FSS A;  1T3L A;  2H8H A;  3VS4 A;  1KFZ A;  3NMZ C;  4CC4 B;  1Y57 A;  2RQU A;  3CQT A;  4R0K A;  3VS1 A;  2RQR A;  2O9S A;  2L2P A;  2ED0 A;  3NHN A;  2ESW A;  2JXB A;  3M0Q A;  2DA9 A;  5EC7 A;  2ROT A;  2L3S A;  2P4R A;  4KRT A;  3VS7 A;  2LX7 A;  4AFS C;  4M4Z A;  1QKW A;  1X6G A;  2JS2 A;  2B86 A;  2YUN A;  3QWX X;  1B07 A;  2J6K A;  2VKN A;  2JS0 A;  4WCI A;  4IIO A;  4RTY A;  4OMM A;  2EYW A;  1UEC A;  2M0Y A;  2SRC A;  4QT7 A;  1WIE A;  2OAW A;  4OML A;  2V1Q A;  1ZLM A;  1X43 A;  4RTV A;  1WA7 A;  2VWF A;  4K11 A;  4AG1 C;  3EG0 A;  2A37 A;  4A63 B;  1GCP A;  2FG0 A;  2RMO A;  1BB9 A;  1GCQ C;  2J05 A;  2G6F X;  2DLP A;  1ZUY A;  4HXJ A;  3IQL A;  1WXB A;  2I0N A;  4AFQ C;  1OEB A;  2YSQ A;  2DRK A;  2F2W A;  1BK2 A;  2F2X A;  4RTZ A;  1ZSG A;  2K9G A;  4F17 A;  4F14 A;  1YP5 A;  2PNI A;  2D0N A;  2GNC A;  4LN2 A;  2BTT A;  2DF6 A;  3VRZ A;  1TG0 A;  2YT6 A;  2X3W D;  3R6N A;  2AKK A;  2DL8 A;  2KRS A;  2CT4 A;  2ECZ A;  2A36 A;  1VA7 A;  1M30 A;  2FPE A;  1T0J A;  1RLQ C;  1RLP C;  2EPD A;  2K7A A;  1TUD A;  2FEI A;  4DEX A;  1JXO A;  1H92 A;  2RN8 A;  2AKL A;  3H0I A;  1JU5 C;  1U3O A;  1T3S A;  1X2Q A;  1M3A A;  2C0T A;  1JEG A;  1AWO A;  1MV3 A;  1UJY A;  3M0U A;  2ENM A;  4AG2 C;  1CSK A;  2CT3 A;  3O5Z A;  2O31 A;  1BBZ A;  2KEA A;  3I5R A;  1QKX A;  1WYX A;  3RBB B;  5IHN A;  2KRM A;  2K2M A;  2CSI A;  2KRO A;  3EG2 A;  2DL4 A;  2CUD A;  2EVR A;  3VS3 A;  2XMF A;  3U23 A;  4RUG A;  2V1R A;  1W1F A;  1AWJ A;  1VYV A;  5I11 A;  4ORZ A;  1WLP B;  1UTI A;  2DL5 A;  2AZS A;  2KNB B;  3H41 A;  1VYT A;  1QLY A;  1NYG A;  2CH4 W;  3UA7 A;  2AK5 A;  5IXF A;  2KYM A;  3EHR A;  2K79 A;  2D1X A;  1YWO A;  4CC3 A;  3H0F A;  3VS0 A;  3VS6 A;  1OPK A;  1X6B A;  5IHI A;  1AEY A;  1OPL A;  2ABL A;  1U5S A;  2FPD A;  3M0P A;  3RNJ A;  2DIL A;  3GBQ A;  4J9G A;  2SEM A;  4Z8A A;  2MOX A;  1J3T A;  1FMK A;  3ULR B;  2W0Z A;  2CSQ A;  5GJV B;  1TUC A;  3H0H A;  3C0C A;  4OMN A;  3VS5 A;  1FYN A;  2HDA A;  1PHT A;  4JJC A;  1NEB A;  2KT8 A;  1JO8 A;  2NUZ A;  1WXT A;  2EYZ A;  2DE0 X;  1A0N B;  1UE9 A;  1M27 C;  5HCK A;  3KFV A;  2K3B A;  3REA B;  4LE9 A;  1B3Q A;  2C0I A;  1NG2 A;  2DX1 A;  1Y0M A;  1AWW A;  2LNH B;  1HJD A;  2HEQ A;  3SHW A;  1NEG A;  2JMC A;  1E7O A;  1Z9Q A;  2DM1 A;  4RTT A;  4CC7 A;  1X69 A;  5FWB A;  1NLO C;  4X1V A;  1ARK A;  4LNP A;  1SRM A;  2YUQ A;  2FPF A;  1SSH A;  2BZX A;  3JV3 A;  2D8H A;  4JJD A;  2GTO A;  3I35 A;  2KE9 A;  3M0R A;  1E6H A;  1T0H A;  2LZ6 B;  2DJQ A;  4IIM A;  2DRM A;  2CRE A;  1CKB A;  1K9A A;  1ZBJ A;  2NWM A;  1UUE A;  1YN8 A;  4RTU A;  2OJ2 A;  3NPF A;  3LH5 A;  2CDT A;  3PVQ A;  3A98 A;  1GRI A;  2KYB A;  1ZX6 A;  1WXU A;  3TVT A;  4J9I A;  2LQN A;  2W10 A;  1AWX A;  1RUW A;  5IH2 A;  2GQI A;  1WDX A;  4OMP A;  1V1C A;  1Z9Z A;  2GBQ A;  1PRM C;  2KR3 A;  1YNZ A;  1E6G A;  2EYX A;  1GFC A;  4JPB W;  1K4U S;  2A08 A;  1ABQ A;  3EHQ A;  3VRY A;  1HD3 A;  2RPN A;  1GBQ A;  1I0C A;  3VS2 A;  4E6R A;  2HSP A;  2RQW A;  1K76 A;  1G83 A;  2IIM A;  2LQW A;  1QWF A;  4J9B A;  2GTJ A;  2HCK A;  1GFD A;  4JZ4 A;  2RF0 A;  2DVJ A;  2O88 A;  2C0O A;  3EG3 A;  1MUZ A;  4HVU A;  3THK A;  1U06 A;  2MIO A;  4J9H A;  3TSZ A;  1YCS B;  4LUE A;  1S1N A;  1ABO A;  2M51 A;  2KT1 A;  4GBQ A;  2J06 A;  1AZE A;  1JQQ A;  5GJW B;  2QDL A;  2OI3 A;  2DL3 A;  2O2O A;  1M3C A;  1UHC A;  4LUD A;  3NGP A;  2L3P A;  2DBK A;  2DMO A;  2L0A A;  1G2B A;  1NM7 A;  4D8D A;  2EYY A;  2JM8 A;  4JZ3 A;  2KBT A;  1UHF A;  1WFW A;  1N5Z A;  3FJ5 A;  1X27 A;  4J9C A;  5IHK A;  1KJW A;  2KXC A;  4DEY A;  4ZNX A;  1ZUU A;  1H8K A;  2X3X D;  4ESR A;  1H3H A;  5FWC A;  1EFN A;  2LJ0 A;  2L3Q A;  2DL7 A;  1YWP A;  1SRL A;  4HVV A;  1PKS A;  2LCS A;  1I07 A;  1W70 A;  2KRN A;  2LP5 A;  2JM9 A;  2JMA A;  1UG1 A;  1W6X A;  1M8M A; 
#chains in the Genus database with same CATH topology
 1AOJ A;  4M78 F;  5L23 A;  1PKT A;  2CZ7 B;  3EFR A;  3UWN A;  2XID A;  6AT1 B;  3FIF A;  2YLB A;  3M56 A;  5D6Y A;  3MPU B;  3GPL A;  5KYY B;  4OMO A;  1SSF A;  4M7A D;  1OV3 A;  1WX6 A;  3INZ A;  5KYX B;  5GMK m;  4RTW A;  4LD6 A;  1WZO A;  1KC8 C;  2F2V A;  5A2Q E;  1U1T A;  1BI3 A;  1MV0 B;  2XD0 A;  2QEX Q;  3EGX B;  1YJN Q;  4M77 F;  2FZC B;  3P8B B;  4PFP A;  2FRY A;  1M2O A;  1HK9 A;  3QJY A;  1QCF A;  4V2S A;  1UJ0 A;  1XNI A;  1AD5 A;  3I55 T;  1M90 R;  2P0P A;  2PZ1 A;  2RA2 A;  2JNG A;  2JTE A;  2BZY A;  1RI0 A;  3JB9 G;  1K73 R;  1VUB A;  1I1J A;  1SHG A;  2DVE A;  1NLP C;  2KI7 A;  3EGU A;  1LCK A;  2PTK A;  1M1F A;  1Q7Y C;  2YUO A;  3M9Q A;  2KGT A;  1TXQ A;  1HSQ A;  4M7D A;  3QDF A;  1AVZ C;  3QDR B;  4M75 B;  4M75 C;  3L2Q A;  3EH2 A;  1XQH A;  2EKH A;  2MYS A;  2JT4 A;  4J83 A;  4BDY A;  2CUB A;  1FX7 A;  2A3L A;  3TSW A;  3WXM B;  2A28 A;  2RJC A;  1GL5 A;  4OVA A;  2EW3 A;  4M77 C;  3SFM A;  1FMW A;  1F1B B;  3CC7 T;  4PJO F;  4PLI A;  4Z88 A;  4XTV A;  2H8H A;  3GP8 A;  4C0F A;  3CQT A;  3CC4 A;  2O9S A;  2K3Y A;  3A8G B;  1M90 C;  5LJ5 h;  1EIF A;  2O01 E;  4ZGD B;  3CCE Q;  5GAN 2;  5EC7 A;  1VQ8 Q;  3HFO A;  5EG2 A;  3KUF A;  3V7C A;  4FSX A;  5LJ3 h;  1QKW A;  1DJ7 B;  1X6G A;  2JS2 A;  4RCB A;  3V8K A;  2YUN A;  3PNW C;  1R0B G;  1Q82 R;  2JS0 A;  4IIO A;  1Q81 U;  4KUD K;  4PFZ A;  1R0C B;  2COZ A;  1JBM A;  3CD6 A;  1UEC A;  1WHG A;  4QT7 A;  1WIE A;  4OML A;  2V1Q A;  1ZLM A;  1WA7 A;  4EMK A;  4C92 D;  4F7U G;  4XU2 A;  2A37 A;  3J7A F;  3EGD B;  1U8R A;  2ATC B;  3LGL A;  4J6Y A;  1UGS B;  1VQO T;  4M7D C;  2RJE A;  2G6F X;  4C5G A;  5A0D A;  3QXE B;  3CCJ A;  2DLP A;  2HSE B;  5L8R E;  2I0N A;  4OB1 B;  3HTR A;  5HK3 A;  1YJW T;  1OX8 A;  3MHX A;  1VQL Q;  4FYV B;  3CCR A;  3VRZ A;  3CCU A;  1QP3 A;  3PMT A;  2DTH A;  1YJN T;  3V8J A;  2KRS A;  2DIQ A;  4AT1 B;  4FU6 A;  1M30 A;  3E2U A;  5I2M A;  2XHC A;  1RLQ C;  2K7A A;  1TUD A;  5GAN d;  3BFM A;  3I55 Q;  3RIR A;  4C8Q A;  2VAS A;  1H92 A;  1YIT A;  2K4Y A;  1JU5 C;  5GAN f;  1VQN T;  1M90 U;  3LWI A;  3CCJ T;  1AWO A;  4JJN K;  1CSK A;  1QVF A;  3L2V A;  2O31 A;  4B9X A;  1YJ9 T;  1BBZ A;  3A5Z B;  1WYX A;  4DOW A;  3CXC A;  2Y90 A;  2KQW A;  1U1S A;  2MMP A;  2KRM A;  4OF1 A;  4XTW A;  2CUD A;  5GAO q;  2IVW A;  1YJN A;  3NTK A;  3G6E Q;  2EYQ A;  1VQ6 Q;  5GAO l;  2NLU A;  2AZS A;  2KNB B;  1YHQ A;  3LW5 E;  4KBM B;  2AK5 A;  5IXF A;  2JZ2 A;  2KYM A;  2K79 A;  3DB3 A;  3H0F A;  3VS0 A;  1OPK A;  3CC7 Q;  2QAZ A;  1AEY A;  2ABL A;  4LDW A;  1SKU B;  3FLG A;  2FPD A;  3ME9 A;  2QEX A;  4FCY A;  2DIL A;  1VOM A;  3CC2 T;  4Z8A A;  4C92 B;  1FMK A;  2YXY A;  2W0Z A;  1NPR A;  4C8Q F;  1TUC A;  4KH0 B;  2VXF A;  3VS5 A;  3QPH A;  1VQ8 T;  4JJC A;  4VUB A;  1YJ9 A;  1NEB A;  2ZCF B;  2ZPE B;  3C12 A;  4BUG A;  1M27 C;  3CCE A;  2E41 A;  1JJ2 A;  1B3Q A;  1OYX A;  2DX1 A;  3OYN A;  1FMV A;  2HEQ A;  2ZAE A;  1R77 A;  2E6N A;  1M2V B;  5J3B A;  3KBG A;  3SHW A;  4E7I A;  1MMD A;  2DM1 A;  4JRQ A;  3FJP A;  1X69 A;  1NLO C;  4X1V A;  4ZGJ B;  4QW2 A;  3CBP A;  2HMA A;  3TEE A;  2FPF A;  1VQ9 T;  1SSH A;  2BZX A;  5DLO A;  5KYU B;  4HT9 A;  3E1S A;  2GTO A;  2WSC E;  3I35 A;  3VU3 C;  1HYO A;  2K2V A;  1K9M R;  2DJQ A;  2VB6 A;  4E2F B;  3G71 Q;  1CKB A;  3LLR A;  4DBR A;  2OJ2 A;  1M1K C;  3BDU A;  1D1B A;  2CDT A;  1VQL T;  1MGQ A;  2XIC A;  5GAM j;  5GMK h;  2F5K A;  1AWX A;  2W10 A;  2L5Q A;  1N6A A;  4OMP A;  2YWW A;  3PFS A;  2GBQ A;  4IUP A;  2KR3 A;  2QTX A;  3M57 A;  2EYX A;  3FB9 A;  4JPB W;  1VQ5 T;  5GAN e;  1ABQ A;  1XJW B;  1VQ7 T;  3JCM P;  2CP6 A;  1I8F A;  1GBQ A;  1D3B A;  1I0C A;  2HD0 A;  3P8H A;  4E6R A;  3OYK A;  2RQW A;  1TSF A;  1K76 A;  1PM3 A;  1VQ9 A;  3MEW A;  2QGF B;  2QXF A;  2HKN A;  3G1J A;  4Z02 A;  4LDY A;  2JOY A;  2PVD B;  1W2B S;  2QQS A;  4Y91 A;  4M75 A;  1U06 A;  2RM4 A;  3ZBD A;  1VQM Q;  2MIO A;  4RCC A;  3TSZ A;  2ZPI B;  2JUF A;  4EDU A;  2M51 A;  3CC4 T;  1VQL A;  5LJ3 j;  1I4K 1;  2YHT A;  3OYY A;  1LVK A;  4N0A A;  2LC4 A;  2O2O A;  2DEQ A;  2P84 A;  4PL6 A;  2K5F A;  5CKH A;  1M1K R;  3OYA A;  1YI2 Q;  1UEB A;  3EFS A;  4E7L A;  1M2V A;  1UHF A;  3F70 A;  1N5Z A;  5IHK A;  3VUB A;  4M7A G;  2CKK A;  3CCL Q;  3JSC A;  3OYF A;  2EKO A;  2DL7 A;  2X4X A;  2LVM A;  3JAM E;  3QUI A;  1W70 A;  4PFO A;  4XTY A;  3CC2 Q;  4C8Q C;  2LT1 A;  3M0T A;  1FWZ A;  3BDL A;  4CC2 A;  1VQO A;  2RQT A;  4OB3 B;  1X2K A;  1OU9 A;  1WI7 A;  2DNU A;  3ZFJ A;  4KGX B;  3C94 A;  1NBE B;  1KIK A;  2EQI A;  2X4W A;  3OS5 A;  5GMK j;  2O4X B;  2J6F A;  1WHM A;  1XOV A;  2FO0 A;  4OGC A;  3OS2 A;  1PSF A;  3GLX A;  4M7D B;  5KH6 A;  4J6W A;  2F69 A;  3EG9 A;  1LJO A;  1AZG B;  1D09 B;  2LNV A;  4WF2 A;  2LQK A;  1YCY A;  1KK7 A;  4A53 A;  3LYI A;  2J6O A;  2XKO C;  4M7A C;  3A8M B;  3FEO A;  1BI2 A;  2O4X A;  4ME7 A;  1I5L A;  1KHI A;  2QG9 B;  4Z89 A;  4J9E A;  2XDB A;  3JRZ A;  2YDL A;  3QHS A;  2IG0 A;  3UA6 A;  3I5S A;  2KVQ G;  1PCX A;  2M1H A;  2RB6 A;  9ATC B;  1NYF A;  1TS9 A;  2QGG A;  3OMG A;  1QCN A;  2Y4X A;  2LJ1 A;  2FRW A;  4PNO A;  1N8R U;  5GMK l;  1OU8 A;  3I56 A;  3CCS Q;  2LMJ A;  2EFI A;  3WVE B;  5I22 A;  4TVR A;  2VYT A;  2GCX A;  4GLM A;  4JS4 A;  1JXM A;  2OAU A;  3L2R A;  2DBM A;  3UF4 A;  1V29 B;  2JTF A;  4Y92 A;  1KC8 U;  4EMK B;  2EAY A;  5GAM f;  2HL3 A;  2LJ3 A;  3QSU A;  3CME T;  1B34 B;  3QZ9 B;  4D8K A;  2RI3 A;  3J81 E;  1YIJ T;  3OB9 A;  1SPK A;  4ZTF A;  2RK1 A;  4KT0 E;  3MEU A;  3GIB A;  1IRX A;  1K0S A;  3CCM A;  5CKD A;  2RHX A;  3UPU A;  2E70 A;  4F16 A;  4BE0 A;  1T3L A;  4XTU A;  5KYN A;  3V8L A;  1Y57 A;  3VS1 A;  2RQR A;  1YJ9 Q;  2L2P A;  2ESW A;  1YFN A;  1KQS P;  2R5M A;  3CCQ Q;  3S3M A;  1IRE B;  1M1K U;  4PLL A;  1VQK T;  3CMA Q;  2L3S A;  1RAF B;  3CBO A;  3MP1 A;  2EJ9 A;  4EMH A;  1VQP A;  2DD4 A;  2LX7 A;  2C06 A;  1WJR A;  1VQ6 T;  4NOY A;  3CC7 A;  1IGQ A;  3CEY A;  1RAA B;  3TRE A;  1Y96 B;  3JCM c;  2B86 A;  1B07 A;  4F7U F;  3SB2 A;  2VKN A;  2EQM A;  4X9D A;  2FZK B;  4RTY A;  4FW2 A;  4M7A B;  1PSE A;  2MAM A;  4E7K A;  1SF9 A;  2QTV A;  1WQW A;  4AG1 C;  1WHH A;  3EG0 A;  1WHJ A;  1BB9 A;  2E1H A;  2J05 A;  3HFN A;  3ZEH A;  1ZUY A;  4HXJ A;  3IQL A;  4IUR A;  2DRK A;  1N8R R;  4QKU A;  4M75 F;  2XDD A;  4E7Z A;  1IGU A;  2PVO B;  2GNC A;  3AT1 B;  3CCV T;  3OYM A;  4QVZ A;  2FB7 A;  3HPW A;  2X3W D;  1HXD A;  3EAE A;  2DL8 A;  2QYZ A;  2ECZ A;  1M4Z A;  3PT9 A;  5CR2 A;  4XU0 A;  4D6W A;  4N4H A;  5HY6 A;  2HAX A;  2RHY A;  1K8A R;  1T0J A;  1JRI A;  2EPD A;  3M54 A;  4NS5 A;  4F7U A;  1PC0 A;  3G71 T;  1JXO A;  1Q7Y U;  1QVF P;  2RN8 A;  1ACM B;  2E10 A;  5HKC A;  2C0T A;  3JCM f;  3M0U A;  1N27 A;  1UJY A;  2ENM A;  1D0Z A;  3TCJ A;  3CCQ A;  3UDC A;  4AMC A;  2CT3 A;  4L6V 5;  1IB8 A;  1IXD A;  2KEA A;  4Q5W A;  3M53 A;  4ANJ A;  1YI2 A;  1D1C A;  2KY9 A;  4OGE A;  2YRC A;  2CSI A;  3OYH A;  3EG2 A;  2RH2 A;  1YIT T;  3OW2 A;  3FC3 A;  2XMF A;  2AHJ B;  2GF7 A;  4RUG A;  2DZC A;  1YIJ Q;  4XU1 A;  3CME A;  1VYV A;  5I11 A;  1WPY A;  1UTI A;  2DL5 A;  4XAX B;  1ZA1 B;  2PQW A;  2ZPG B;  4ELZ C;  4N4I A;  5IHI A;  2KK4 A;  3X24 B;  5GAN 6;  4IUU A;  4EMG A;  1U5S A;  4XQ3 A;  1BYM A;  2VUB A;  4J9G A;  3G4S A;  2SEM A;  1J3T A;  2MOX A;  4HA8 A;  2XG8 D;  2M0O A;  5KCH A;  3CCQ T;  2LCL A;  1ZHI A;  1AT1 B;  2CP3 A;  1UB4 A;  3C0C A;  3CPW P;  1YI2 T;  2NUZ A;  1WXT A;  1VQK A;  2D0Q B;  5CK9 A;  2GFU A;  1UE9 A;  3JCM b;  3KFV A;  1VIF A;  2C0I A;  1NG2 A;  1VQ6 A;  5GAO m;  2LNH B;  1HJD A;  5KYX A;  3JCM d;  3JCM J;  3A8H B;  1WHL A;  1MNE A;  1RAE B;  1E7O A;  3OYI A;  2YRD A;  3T9N A;  3L42 A;  1W4S A;  1ARK A;  5C0M A;  1K9M U;  1RAI B;  1V76 A;  1QVF S;  2CP7 A;  2E5Q A;  4E47 A;  4BI8 B;  4M78 G;  3OS1 A;  4JJD A;  1Y7X A;  4OB0 B;  2KE9 A;  3M0R A;  3OSS C;  1T0H A;  1D0Y A;  2ZZD A;  3M55 A;  4PJJ A;  1ZSZ C;  2CRE A;  3WVD B;  3VYH B;  1K9A A;  1YN8 A;  4RTU A;  2K5L A;  3HRS A;  2DXC A;  4LD9 K;  2DPP B;  2FYK A;  1ZX6 A;  1MMA A;  2QK0 A;  3TVT A;  2LQN A;  5IH2 A;  2NUP B;  3BW1 A;  3SWN B;  4DBH A;  3CC2 A;  1E6G A;  1GFC A;  2A08 A;  4M77 G;  1FXX A;  1YIJ A;  5C6S A;  1G83 A;  4RKU E;  1LOJ A;  2LQW A;  2HNI A;  2GTJ A;  2HCK A;  4JZ4 A;  2RF0 A;  1Q86 R;  2O88 A;  4HVU A;  4CI0 C;  1BKB A;  3THK A;  1P92 A;  3OA6 A;  5FRM A;  2E65 A;  1R8O B;  2DKG A;  1YCS B;  4LUE A;  2AT1 B;  1S1N A;  1ABO A;  3CCS T;  3A8L B;  2PU9 B;  4BD3 A;  4HCC A;  4FT4 A;  3JCM W;  4A4E A;  3QYG B;  2CGH A;  2EQU A;  2MWP A;  4M77 A;  1BCO A;  5GAO p;  2DMO A;  2JTM A;  2CZ6 B;  3CBM A;  2RJF A;  4C92 F;  2EYY A;  2JM8 A;  1TUG B;  1VQ5 A;  3QBY A;  4J9C A;  1EX4 A;  2KXC A;  3RES A;  2LRQ A;  1H64 1;  3V7S A;  2X3X D;  2RHZ A;  3LX7 A;  1H3H A;  5LJ5 f;  2VXE A;  2X9H A;  1YWP A;  4HVV A;  1PKS A;  2HKQ B;  2LCS A;  1Y96 A;  4M75 D;  3I56 Q;  1I07 A;  2FL7 A;  4LDX A;  4IUV A;  4M7D G;  2JMA A;  1YBY A;  2LX9 A;  1RAC B;  3HL8 A;  4QQ6 A;  3H9N A;  2EGA A;  4AFU C;  4CRI A;  2HQE A;  1NJI U;  7AT1 B;  4AFZ C;  2DIG A;  1VQK Q;  1IO6 A;  4PJM A;  3REB B;  2R57 A;  2HBW A;  1EZZ B;  4EIK A;  1B34 A;  1C6V X;  2RO0 A;  4A4G A;  4BAC A;  3PVL A;  1UFF A;  4KGZ B;  2HZY A;  2D9T A;  4QVD A;  1PG5 B;  3QJ6 A;  1VYU A;  3QWY A;  1RI9 A;  1LPL A;  1WHK A;  4JJB A;  3S6W A;  1QWE A;  2DK3 A;  2BE9 B;  2KSS A;  4M7A E;  1W2B A;  1VQ5 Q;  1VQ4 A;  1VQ7 Q;  2D6F A;  3BE3 A;  3CCU Q;  5FRO A;  4C0G A;  1VIE A;  3HKS A;  4HCK A;  3BY7 A;  2O9V A;  3A1P A;  2DXB A;  1WJS A;  2EGC A;  3RKY A;  3NTH A;  5DLQ E;  2ROL A;  3PE0 A;  4XTZ A;  4M7D E;  2BUD A;  2GGR A;  2LT4 A;  3CCJ Q;  4J9D A;  3ZL7 C;  1NJI C;  5ECA A;  3UAT A;  2XU8 A;  3I9Q A;  4M77 B;  3X25 B;  5IT9 E;  4F04 B;  1Q86 C;  2XK0 A;  4FM4 B;  1KSW A;  2K6D A;  1UDL A;  5I2S A;  2FZG B;  4YTL A;  2RK2 A;  3J80 E;  5J26 A;  5KCO A;  3OS0 A;  2DYB A;  1NE8 A;  1WGS A;  4M77 D;  2KAF A;  1PWT A;  3NTI A;  3MEA A;  1KG1 A;  1KHC A;  2RQV A;  2MCN A;  2AZV A;  2EGE A;  2KXD A;  4HVW A;  1N9S A;  5FU6 C;  3VS4 A;  4KUI A;  4NL2 A;  1N9R A;  4CC4 B;  1VQ4 Q;  4R0K A;  4HCZ A;  2EWN A;  1OQK A;  2NUT A;  3M58 A;  1OZ2 A;  8ATC B;  1QCO A;  2JXB A;  1BIB A;  3M0Q A;  5GMK e;  4RMO A;  2ROT A;  4JDS A;  2MI6 A;  2OTL Q;  3OBW A;  1G3S A;  2EQK A;  4AFS C;  4M4Z A;  1ZA2 B;  5LJ3 e;  4MML A;  1KQ1 A;  2ZGW A;  3TU4 K;  3JB9 F;  4QVC A;  4FT2 A;  4WCI A;  3CPW A;  1TU0 B;  4OP0 A;  4C5I A;  4MMK A;  2E3I A;  2QI2 A;  3PIP A;  2M0Y A;  2SRC A;  3I56 T;  4XK8 E;  1X43 A;  4J7I A;  4RTV A;  4J5Y A;  2VWF A;  3CCR T;  3MJX A;  4K11 A;  3HP9 A;  1OI1 A;  4A63 B;  2ZPF B;  1VQP T;  1GCP A;  1RAB B;  5KYU A;  3L2Z A;  1UGQ B;  4C92 C;  3EFO B;  4RTZ A;  1ZSG A;  2DAQ A;  3CD6 T;  5GAO r;  2PNI A;  2D0N A;  1ZSZ A;  2VV5 A;  4LN2 A;  3CCM T;  2RHU A;  3RMS A;  2EJF A;  4ZTJ A;  2YT6 A;  4KH1 B;  3R6N A;  2AKK A;  4OB2 B;  1RL2 A;  4M75 E;  4BY6 C;  3C95 A;  4BI4 A;  1KD1 U;  2A36 A;  1Q95 G;  1RAG B;  1VA7 A;  2NUP A;  3X26 B;  4PJO E;  4M78 A;  3QKJ A;  2K5I A;  1N8R C;  2QQR A;  4DEX A;  4M77 E;  1NZ9 A;  4BI3 A;  2H3E B;  1BI1 A;  2JVV A;  1G3Y A;  3H0I A;  2JJ9 A;  1U3O A;  2DZ9 A;  1T3S A;  1S72 T;  3LH0 A;  3OQ5 A;  5DM7 R;  2NUT B;  3RUX A;  4AG2 C;  1WQ7 A;  1VQM T;  3CCS A;  1TH7 A;  5KE2 A;  3I5R A;  3CC4 Q;  3RBB B;  2V8K A;  4UC4 A;  2OTJ T;  2GFA A;  5IHN A;  2K2M A;  2KDS A;  1RAD B;  2KRO A;  4MZT A;  2LQ8 A;  5FRN A;  3TQ7 P;  2V1R A;  1W1F A;  5CQY A;  1M9S A;  2L89 A;  4MDX A;  2BIV A;  4JRP A;  1WLP B;  3H41 A;  1MND A;  4BE2 A;  1QLY A;  1YJW A;  5GAN 8;  3RKW A;  3P8D A;  1KQS A;  3EHR A;  2P0Q A;  3SWN C;  4CC3 A;  3VS6 A;  1X6B A;  2COW A;  1OPL A;  5FU7 B;  4FL6 A;  5DY9 A;  4A4K A;  2PUK B;  3M0P A;  3RNJ A;  4B9W A;  4QQG A;  2IPO B;  1H3Z A;  5CQX A;  3OMC A;  5FLX E;  2CSQ A;  5GJV B;  3H0H A;  4OMN A;  1FYN A;  2HDA A;  1D1A A;  1PHT A;  1UGR B;  4J6X A;  4C5H A;  1ZSZ B;  3H6Z A;  2OTL T;  3VUZ A;  4L59 A;  3UT1 A;  2EYZ A;  4FW1 A;  3CPW S;  2VGN A;  5D6X A;  2F5T X;  1A0N B;  5HCK A;  4F7U E;  4LE9 A;  4HKE A;  1ZBX A;  3CCV Q;  2CP2 A;  3OYC A;  2JMC A;  2QA4 Q;  2V26 A;  4E7H A;  5AT1 B;  2EIF A;  4LNP A;  1M5Q 1;  4P5N A;  3M4G A;  1MMN A;  2R5A A;  3EGD A;  3Q1J A;  1VQP Q;  3JV3 A;  5CKE A;  3PTA A;  2M9U A;  4JLI A;  2YLC A;  5M9O A;  2Y4Y A;  2LTO A;  1BCM A;  2DTO A;  4FIB A;  5GMK i;  1K9M C;  5CVI A;  1UUE A;  3NPF A;  5GAN 5;  4N4G A;  1M1G A;  2DO3 A;  3OW2 S;  3PVQ A;  3QYH B;  4WTO B;  4KUL A;  2KYB A;  4J9I A;  1D0X A;  1Q82 C;  2GQI A;  1WDX A;  1Z9Z A;  3X28 B;  2QEX T;  3OSV A;  1YNZ A;  1M8V A;  5CCA A;  1QQJ A;  1QVG A;  4LXC A;  1K4U S;  3EHQ A;  1QVG S;  3JCM h;  1HD3 A;  2RPN A;  1KD1 R;  5D7U A;  2WSF E;  3HRU A;  4O5V A;  3VS2 A;  4M78 E;  3CME Q;  3RER A;  2L8D A;  2X51 A;  1IHW A;  4J9B A;  1JJ2 P;  3H8Z A;  3EG3 A;  1MUZ A;  2HBP A;  2I2L A;  4JUV A;  2QQA A;  1JB0 E;  1AZE A;  1JQQ A;  3JCM V;  3HSB A;  2QDL A;  2OI3 A;  2DL3 A;  3L2W A;  2DFU A;  2OTJ A;  1M3C A;  3GF5 A;  3L1A A;  4LUD A;  4ATO A;  2L0A A;  1ZQ1 A;  2R58 A;  1G2B A;  3CMA T;  1NM7 A;  3I55 A;  4Y28 E;  4JZ3 A;  1WFW A;  3FJ5 A;  4GLK A;  3OYE A;  1KJW A;  4R56 A;  3SDZ A;  2RI5 A;  4ZNX A;  3OYJ A;  1RAH B;  4QQD A;  5GAM e;  3D7S B;  1H8K A;  2RD1 A;  2X4J A;  3MP8 A;  5FWC A;  3CXC P;  1EFN A;  2LJ0 A;  1GXI E;  4MZP A;  1TWB A;  2E3H A;  2PUO B;  1SRL A;  1I5O B;  1K73 C;  1BIA A;  1UG1 A;  1W2B P;  3MO8 A;  1NJI R;  3JCM Q;  4J9F A;  1OOT A;  2DXU A;  3RDV A;  5LJ5 d;  2COY A;  5LJ3 g;  2EBP A;  2JW4 A;  4IUT A;  2KMT A;  3QII A;  3DLL A;  1ZUK A;  2DER A;  2V8J A;  3M0S A;  4OMQ A;  2X35 A;  1OX9 A;  1PD1 A;  3DLM A;  1WJQ A;  4JRK A;  3GNG A;  2JN0 A;  4E7J A;  4BDZ A;  4XTX A;  1PRL C;  4ZN1 A;  2ED1 A;  2CH4 A;  2QAS A;  3HRT A;  3FDR A;  2HQX A;  3CMA A;  5CKF A;  1PNJ A;  2CZ1 B;  4BB7 A;  1X6O A;  2QA4 T;  3CCL A;  1SEM A;  1M3B A;  3ASK A;  1SHF A;  1QP2 A;  3M4Y A;  5LJ5 j;  4C0D B;  2L3R A;  4X34 A;  4PJO A;  5IXB A;  1GBR A;  2ZPH B;  5AYF A;  3JCM X;  3OY9 A;  3OYL A;  3CXC S;  4DA4 A;  3VKI A;  3DKM A;  3EG1 A;  4ZN3 A;  1K1Z A;  3URG A;  3SEM A;  2VVK A;  3CD6 Q;  3OW2 P;  1UGV A;  1VQM A;  3HHT B;  4C5E A;  1O9S A;  1BU1 A;  4PJL A;  2HQH A;  2RNA A;  4IKF A;  3PIO A;  1OUL A;  1CKA A;  1Q82 U;  4RTX A;  2BE7 D;  2MWO A;  5KYY A;  3L2U A;  2YUP A;  2BZ8 A;  2D8J A;  4EPC A;  5IN1 A;  1Q86 U;  1GCQ A;  2G3R A;  2V8I A;  1YIT Q;  2A0F B;  4PJO D;  3ER0 A;  4ELY C;  3G6E A;  1TOV A;  1G3T A;  5FW9 A;  2E5K A;  4LDU A;  4JLG A;  3EH1 A;  5J39 A;  2MPX C;  3MCA B;  2DEU A;  4HCB A;  2QQB A;  3O8V A;  3EGX A;  2J7I A;  4JS5 A;  1YHQ Q;  1KD1 C;  4C8Q G;  1K0X A;  4BY6 B;  1XTD A;  3CCV A;  3OYD A;  1S72 Q;  5LJ3 f;  1KQ2 A;  1QVG P;  3JCM e;  4RG8 A;  4FSS A;  1KFZ A;  3NMZ C;  1G3W A;  4N0A C;  1QVP A;  1MMG A;  3SWN A;  2RQU A;  4PJN A;  2ED0 A;  3NHN A;  4HT8 A;  3NFC A;  2RI2 A;  2OTJ Q;  1B7T A;  3FRN A;  3MKD A;  1UGP B;  3PGG A;  1IZ6 A;  4PJO G;  3JB9 I;  3R6O A;  2DA9 A;  2EQJ A;  4JRI A;  2P4R A;  4KRT A;  3VS7 A;  2QDY B;  4M78 B;  2XDP A;  5FU6 B;  2M16 A;  3G7Z A;  3QWX X;  3AHU A;  2J6K A;  4ZGE B;  1TTH B;  3G4S Q;  1Q81 R;  4OMM A;  2EYW A;  4R55 A;  2OAW A;  1LNX A;  4C92 G;  4X9C A;  5GAO n;  3MP6 A;  3MET A;  1MHN A;  3CCU T;  2WSE E;  3E19 A;  3C4S A;  5GAN 7;  2FG0 A;  2RMO A;  3OYB A;  1GCQ C;  1VQN A;  1C0M A;  4NL3 A;  4J7F A;  2RJD A;  5GAM d;  1WXB A;  4AFQ C;  1OEB A;  2YSQ A;  2DXT A;  2F2W A;  1BK2 A;  2F2X A;  4DOV A;  4C92 E;  2E4H A;  3PMI A;  2K9G A;  4F17 A;  4F14 A;  3RMQ A;  1YP5 A;  3N5B B;  2BTT A;  5LJ5 g;  4J8O A;  2DF6 A;  2HL5 C;  2GQV A;  5LL6 S;  5GAN h;  1TG0 A;  2QA4 A;  1KC8 R;  5CKB A;  2CT4 A;  1VQ9 Q;  1PD0 A;  2FPE A;  1SG5 A;  4RG2 A;  1VQ8 A;  4GY5 A;  3OBY A;  1RLP C;  2FEI A;  2DYI A;  3LWH A;  1IHV A;  1O75 A;  4PJO C;  1OZ3 A;  2DJZ A;  3RKX A;  4PK4 A;  2LCC A;  1KQS S;  2BKD N;  2CP5 A;  2M02 A;  4DBF A;  2AKL A;  3MEV A;  1X2Q A;  1M3A A;  1JEG A;  1C1A A;  1MV3 A;  2MK5 A;  2VGM A;  4C8Q D;  5A0G A;  3O5Z A;  2RHI A;  1QKX A;  3QG1 A;  3VJP A;  4M7A F;  2P0K A;  3QZ5 B;  3CCE T;  3JCM g;  2DL4 A;  2EVR A;  4FYY B;  3VS3 A;  2E6Z A;  4MDW A;  3U23 A;  1Q81 C;  2CS7 A;  5D6W A;  1AWJ A;  3E9F A;  4ORZ A;  1WNL A;  4C0Z A;  5KYW A;  1VYT A;  1NYG A;  2CH4 W;  4M75 G;  3UA7 A;  2QQ9 A;  2K57 A;  2B8A A;  2D1X A;  1YWO A;  2F1L A;  3EG9 B;  1AHJ B;  4BE1 A;  1K8A C;  3JB9 H;  3GBQ A;  4PKC C;  1S72 A;  3ULR B;  1VQO Q;  3QO3 A;  3A8O B;  2E12 A;  2KT8 A;  4L5G A;  5CO7 A;  1JJ2 S;  1Y07 A;  1JO8 A;  5GAN 4;  2EJG A;  3E9G A;  3CPF A;  2DE0 X;  3G71 A;  1YJW Q;  2K3B A;  3REA B;  3CCM Q;  1Y0M A;  3LGF A;  2CZ0 B;  2WAC A;  1AWW A;  3G4S T;  4M7A A;  3CCL T;  1NEG A;  2YRV A;  1Z9Q A;  2ZPB B;  4RTT A;  4II1 A;  4CC7 A;  5FWB A;  3GNF B;  4LDV A;  1SRM A;  2YUQ A;  3X20 B;  1X01 A;  1QW1 A;  4C0D C;  4M7D F;  2FHD A;  4B6M A;  2D8H A;  4F7U B;  2PVG B;  1E6H A;  2CYZ B;  4IIM A;  2LZ6 B;  2DRM A;  2NWM A;  1ZBJ A;  2A7Y A;  4DBQ A;  1K73 U;  4A54 A;  1VQ7 A;  2AIR B;  4DQ2 A;  4MZM A;  3DB4 A;  2LDM A;  2NYS A;  1VQN Q;  3LH5 A;  5GAN g;  1BI0 A;  2X4Y A;  4C92 A;  3A98 A;  1GRI A;  1G8X A;  1Y71 A;  1WXU A;  5FU7 C;  1RUW A;  4A4H A;  1V1C A;  1NPP A;  3S3N A;  1PRM C;  2K3X A;  3KXT A;  4OMF B;  4C8Q B;  1I81 A;  3VRY A;  5KYW B;  4IUQ A;  3G6E T;  3VYG A;  1G5V A;  2HSP A;  2OTL A;  2DET A;  4FYW B;  5I21 A;  3JB9 J;  2CP0 A;  3EFO A;  1K8A U;  2MF2 A;  2IIM A;  4M78 C;  1QWF A;  1GFD A;  5HK0 A;  1Q7Y R;  1X75 C;  2DVJ A;  3M59 A;  3GOX A;  2C0O A;  2E64 A;  3V7R A;  4A4F A;  5GAM h;  4J9H A;  4M78 D;  5LJ3 d;  2DD5 A;  3M5A A;  3SD4 A;  1QMC A;  5A0L A;  2KT1 A;  4GBQ A;  2J06 A;  1VQ4 T;  2VC8 A;  5GJW B;  4M7D D;  2XI9 A;  3VV0 A;  1UHC A;  5KE3 A;  8AT1 B;  3NGP A;  2L3P A;  2DBK A;  4E7S A;  5GAN j;  4D8D A;  5IAY A;  2P4T A;  5GAN 3;  2KBT A;  1X27 A;  4PJO B;  4O6J A;  4DEY A;  5GAM g;  3S3O A;  1ZUU A;  5CIU A;  4XU3 A;  1YHQ T;  4FYX B;  4ESR A;  4EMK C;  2DTI A;  5LJ5 e;  2L3Q A;  2H3J A;  1D3B B;  4KGV B;  3OYG A;  4C8Q E;  5CAI A;  2OX7 A;  2KRN A;  2LP5 A;  2Z0W A;  3JB9 D;  2JM9 A;  3RR6 A;  2FVU A;  1W6X A;  3CCR Q;  1M8M A; 
#chains in the Genus database with same CATH homology
 3M0T A;  4CC2 A;  1AOJ A;  4J9F A;  2RQT A;  2EGA A;  5L23 A;  1X2K A;  1PKT A;  1WI7 A;  2DNU A;  1OOT A;  4AFU C;  2EBP A;  2JW4 A;  1KIK A;  1ZUK A;  4AFZ C;  3M0S A;  4OMQ A;  2EQI A;  1IO6 A;  2J6F A;  1XOV A;  2FO0 A;  3REB B;  1PRL C;  4OMO A;  2HBW A;  4EIK A;  1OV3 A;  1WX6 A;  2ED1 A;  3PVL A;  1UFF A;  2CH4 A;  4RTW A;  1VYU A;  3QWY A;  1PNJ A;  1AZG B;  2F2V A;  1RI9 A;  1MV0 B;  2J6O A;  1SEM A;  4JJB A;  1M3B A;  1QWE A;  1SHF A;  1GBR A;  5IXB A;  2FRY A;  4Z89 A;  4J9E A;  2YDL A;  1QCF A;  1UJ0 A;  3UA6 A;  4HCK A;  3I5S A;  2O9V A;  3EG1 A;  1AD5 A;  2PZ1 A;  2EGC A;  1K1Z A;  2JTE A;  2BZY A;  1NYF A;  2ROL A;  3PE0 A;  3SEM A;  2GGR A;  2VVK A;  2LJ1 A;  1I1J A;  1SHG A;  1UGV A;  2FRW A;  4J9D A;  3ZL7 C;  1NLP C;  1BU1 A;  5ECA A;  3UAT A;  3EGU A;  2RNA A;  1LCK A;  2PTK A;  3I9Q A;  2LMJ A;  5I22 A;  1CKA A;  2YUO A;  4RTX A;  1KSW A;  4GLM A;  2K6D A;  2KGT A;  1JXM A;  2YUP A;  2BZ8 A;  1UDL A;  1HSQ A;  2D8J A;  2DBM A;  3UF4 A;  1GCQ A;  4Y92 A;  1AVZ C;  2LJ3 A;  2DYB A;  5FW9 A;  2E5K A;  4D8K A;  2EKH A;  2JT4 A;  2CUB A;  1PWT A;  1SPK A;  3TSW A;  2J7I A;  2RQV A;  2A28 A;  2MCN A;  2AZV A;  2EGE A;  1K0S A;  1K0X A;  1GL5 A;  2KXD A;  4HVW A;  2EW3 A;  4F16 A;  4Z88 A;  4FSS A;  1T3L A;  2H8H A;  3VS4 A;  1KFZ A;  3NMZ C;  4CC4 B;  1Y57 A;  2RQU A;  3CQT A;  4R0K A;  3VS1 A;  2RQR A;  2O9S A;  2L2P A;  2ED0 A;  3NHN A;  2ESW A;  2JXB A;  3M0Q A;  2DA9 A;  5EC7 A;  2ROT A;  2L3S A;  2P4R A;  4KRT A;  3VS7 A;  2LX7 A;  4AFS C;  4M4Z A;  1QKW A;  1X6G A;  2JS2 A;  2B86 A;  2YUN A;  3QWX X;  1B07 A;  2J6K A;  2VKN A;  2JS0 A;  4WCI A;  4IIO A;  4RTY A;  4OMM A;  2EYW A;  1UEC A;  2M0Y A;  2SRC A;  4QT7 A;  1WIE A;  2OAW A;  4OML A;  2V1Q A;  1ZLM A;  1X43 A;  4RTV A;  1WA7 A;  2VWF A;  4K11 A;  4AG1 C;  3EG0 A;  2A37 A;  4A63 B;  1GCP A;  2FG0 A;  2RMO A;  1BB9 A;  1GCQ C;  2J05 A;  2G6F X;  2DLP A;  1ZUY A;  4HXJ A;  3IQL A;  1WXB A;  2I0N A;  4AFQ C;  1OEB A;  2YSQ A;  2DRK A;  2F2W A;  1BK2 A;  2F2X A;  4RTZ A;  1ZSG A;  2K9G A;  4F17 A;  4F14 A;  1YP5 A;  2PNI A;  2D0N A;  2GNC A;  4LN2 A;  2BTT A;  2DF6 A;  3VRZ A;  1TG0 A;  2YT6 A;  2X3W D;  3R6N A;  2AKK A;  2DL8 A;  2KRS A;  2CT4 A;  2ECZ A;  2A36 A;  1VA7 A;  1M30 A;  2FPE A;  1T0J A;  1RLQ C;  1RLP C;  2EPD A;  2K7A A;  1TUD A;  2FEI A;  4DEX A;  1JXO A;  1H92 A;  2RN8 A;  2AKL A;  3H0I A;  1JU5 C;  1U3O A;  1T3S A;  1X2Q A;  1M3A A;  2C0T A;  1JEG A;  1AWO A;  1MV3 A;  1UJY A;  3M0U A;  2ENM A;  4AG2 C;  1CSK A;  2CT3 A;  3O5Z A;  2O31 A;  1BBZ A;  2KEA A;  3I5R A;  1QKX A;  1WYX A;  3RBB B;  5IHN A;  2KRM A;  2K2M A;  2CSI A;  2KRO A;  3EG2 A;  2DL4 A;  2CUD A;  2EVR A;  3VS3 A;  2XMF A;  3U23 A;  4RUG A;  2V1R A;  1W1F A;  1AWJ A;  1VYV A;  5I11 A;  4ORZ A;  1WLP B;  1UTI A;  2DL5 A;  2AZS A;  2KNB B;  3H41 A;  1VYT A;  1QLY A;  1NYG A;  2CH4 W;  3UA7 A;  2AK5 A;  5IXF A;  2KYM A;  3EHR A;  2K79 A;  2D1X A;  1YWO A;  4CC3 A;  3H0F A;  3VS0 A;  3VS6 A;  1OPK A;  1X6B A;  5IHI A;  1AEY A;  1OPL A;  2ABL A;  1U5S A;  2FPD A;  3M0P A;  3RNJ A;  2DIL A;  3GBQ A;  4J9G A;  2SEM A;  4Z8A A;  2MOX A;  1J3T A;  1FMK A;  3ULR B;  2W0Z A;  2CSQ A;  5GJV B;  1TUC A;  3H0H A;  3C0C A;  4OMN A;  3VS5 A;  1FYN A;  2HDA A;  1PHT A;  4JJC A;  1NEB A;  2KT8 A;  1JO8 A;  2NUZ A;  1WXT A;  2EYZ A;  2DE0 X;  1A0N B;  1UE9 A;  1M27 C;  5HCK A;  3KFV A;  2K3B A;  3REA B;  4LE9 A;  1B3Q A;  2C0I A;  1NG2 A;  2DX1 A;  1Y0M A;  1AWW A;  2LNH B;  1HJD A;  2HEQ A;  3SHW A;  1NEG A;  2JMC A;  1E7O A;  1Z9Q A;  2DM1 A;  4RTT A;  4CC7 A;  1X69 A;  5FWB A;  1NLO C;  4X1V A;  1ARK A;  4LNP A;  1SRM A;  2YUQ A;  2FPF A;  1SSH A;  2BZX A;  3JV3 A;  2D8H A;  4JJD A;  2GTO A;  3I35 A;  2KE9 A;  3M0R A;  1E6H A;  1T0H A;  2LZ6 B;  2DJQ A;  4IIM A;  2DRM A;  2CRE A;  1CKB A;  1K9A A;  1ZBJ A;  2NWM A;  1UUE A;  1YN8 A;  4RTU A;  2OJ2 A;  3NPF A;  3LH5 A;  2CDT A;  3PVQ A;  3A98 A;  1GRI A;  2KYB A;  1ZX6 A;  1WXU A;  3TVT A;  4J9I A;  2LQN A;  2W10 A;  1AWX A;  1RUW A;  5IH2 A;  2GQI A;  1WDX A;  4OMP A;  1V1C A;  1Z9Z A;  2GBQ A;  1PRM C;  2KR3 A;  1YNZ A;  1E6G A;  2EYX A;  1GFC A;  4JPB W;  1K4U S;  2A08 A;  1ABQ A;  3EHQ A;  3VRY A;  1HD3 A;  2RPN A;  1GBQ A;  1I0C A;  3VS2 A;  4E6R A;  2HSP A;  2RQW A;  1K76 A;  1G83 A;  2IIM A;  2LQW A;  1QWF A;  4J9B A;  2GTJ A;  2HCK A;  1GFD A;  4JZ4 A;  2RF0 A;  2DVJ A;  2O88 A;  2C0O A;  3EG3 A;  1MUZ A;  4HVU A;  3THK A;  1U06 A;  2MIO A;  4J9H A;  3TSZ A;  1YCS B;  4LUE A;  1S1N A;  1ABO A;  2M51 A;  2KT1 A;  4GBQ A;  2J06 A;  1AZE A;  1JQQ A;  5GJW B;  2QDL A;  2OI3 A;  2DL3 A;  2O2O A;  1M3C A;  1UHC A;  4LUD A;  3NGP A;  2L3P A;  2DBK A;  2DMO A;  2L0A A;  1G2B A;  1NM7 A;  4D8D A;  2EYY A;  2JM8 A;  4JZ3 A;  2KBT A;  1UHF A;  1WFW A;  1N5Z A;  3FJ5 A;  1X27 A;  4J9C A;  5IHK A;  1KJW A;  2KXC A;  4DEY A;  4ZNX A;  1ZUU A;  1H8K A;  2X3X D;  4ESR A;  1H3H A;  5FWC A;  1EFN A;  2LJ0 A;  2L3Q A;  2DL7 A;  1YWP A;  1SRL A;  4HVV A;  1PKS A;  2LCS A;  1I07 A;  1W70 A;  2KRN A;  2LP5 A;  2JM9 A;  2JMA A;  1UG1 A;  1W6X A;  1M8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...