2JMCA

Chimer between spc-sh3 and p41
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
77
structure length
77
Chain Sequence
GAMGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQESGDNAPSYSPPPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Spectrin alpha chain, brain and P41 peptide chimera
publication title The high-resolution NMR structure of a single-chain chimeric protein mimicking a SH3-peptide complex
pubmed doi rcsb
source organism Gallus gallus
total genus 7
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jmcA00
1NLPC 1Z9QA 1QKXA 4GLMA 5IH2A 3M0SA 2O88A 1MUZA 1U5SA 2KBTA 1S1NA 1UGVA 3H0HA 3UF4A 3EG2A 4F16A 2DX1A 2D1XA 1WI7A 3IQLA 3VRYA 2DNUA 2JXBA 1W6XA 2RNAA 1B07A 2KEAA 1UTIA 2CSIA 3I5SA 1OEBA 1PKTA 1JQQA 4ORZA 2OI3A 1HJDA 1T3SA 2A36A 5HCKA 1ZX6A 2MOXA 1YCSB 3GBQA 2KNBB 1AWWA 2GNCA 2MCNA 1I07A 2A37A 2YUQA 3SHWA 2KYMA 2JM8A 2LJ0A 2LQNA 3U23A 3TSWA 2JMCA 2ED0A 3VS0A 1PWTA 1WXBA 1QWFA 1UFFA 1NG2A 2DL7A 2AK5A 2DA9A 2HBWA 1GBQA 2SRCA 3NGPA 4LE9A 4J9HA 2OAWA 3TSZA 1AZEA 1JU5C 1I0CA 4Y92A 4LN2A 4J9DA 1BU1A 3VS4A 1VYTA 3EG0A 1U06A 2CT4A 1FYNA 2OJ2A 4J9IA 2B86A 2YUOA 2EW3A 1ZLMA 4HVUA 2F2XA 1GCQC 2DILA 2L2PA 2GTJA 2JTEA 2VWFA 3M0UA 1AWXA 3QWXX 3UATA 5EC7A 2MIOA 4IIMA 2F2WA 3EG1A 2LMJA 2CREA 1NM7A 2K7AA 3M0RA 1RUWA 4Z8AA 2D0NA 2KYBA 1PRLC 1NEBA 1UG1A 2AKLA 2FPFA 1M27C 2GGRA 1OPKA 3LH5A 2J06A 2DL3A 4JZ4A 1T0JA 1EFNA 1ZSGA 5IXBA 4JJCA 2BZ8A 1CKAA 2DM1A 2XMFA 4Z89A 2W0ZA 2PNIA 1N5ZA 1SPKA 3REBB 2J7IA 4HXJA 3EHRA 1YWOA 1ABOA 2DMOA 1G83A 2YDLA 4AFUC 3REAB 4J9CA 1WA7A 1X6BA 2O9VA 2K9GA 2G6FX 1K0SA 2NWMA 4CC7A 5ECAA 2ENMA 3VS6A 1WFWA 2GTOA 2GBQA 1M30A 2K79A 4D8KA 3UA6A 1H8KA 4RTZA 2LCSA 1SHFA 3ULRB 4ESRA 1KFZA 4Z88A 1ABQA 2DL5A 1WX6A 2KXCA 3CQTA 2EYXA 5L23A 2CDTA 3PVQA 3ZL7C 1SRLA 2JS2A 3R6NA 2VKNA 2CUBA 2ECZA 4IIOA 1HSQA 4JPBW 2J05A 2O2OA 1FMKA 2D8JA 4X1VA 1M3AA 1ZUUA 2L0AA 3H0IA 2HDAA 1YN8A 1A0NB 4AFZC 2DYBA 4HCKA 2KRNA 2JW4A 1TUCA 4OMPA 1AWOA 3THKA 2JMAA 1GCPA 4OMQA 1X69A 1KSWA 1H92A 1X2QA 1KJWA 1ZBJA 2DRMA 1TG0A 1ZUYA 2EKHA 3I9QA 5FWBA 2LZ6B 3EG3A 1AEYA 1AZGB 1QWEA 2HCKA 2JT4A 4FSSA 4AG2C 1E6GA 2I0NA 2A28A 1WYXA 2QDLA 1K1ZA 1U3OA 2ROLA 1UJ0A 2IIMA 3NHNA 2YUPA 2EGEA 3M0PA 1JO8A 1K9AA 2K3BA 3VS7A 2CSQA 4LUEA 4EIKA 1WXTA 1K4US 2DJQA 3NMZC 2KR3A 4AG1C 1RLQC 1M3BA 2M51A 4AFQC 5I11A 2L3PA 3VS1A 1SSHA 2FPEA 4DEYA 1AD5A 2RQRA 4GBQA 2P4RA 2RN8A 3NPFA 4F14A 4R0KA 5IXFA 3VS5A 1WIEA 4RTUA 2YSQA 4RTVA 1NLOC 2DVJA 4ZNXA 2EGCA 1NEGA 2SEMA 2F2VA 2DL8A 3KFVA 2KRMA 1H3HA 1RI9A 1Y57A 4QT7A 4OMMA 2A08A 3M0TA 2FG0A 4JJDA 2PZ1A 2YT6A 4OMOA 1WXUA 1K0XA 3TVTA 1E6HA 5GJWB 2EVRA 1YP5A 2LJ3A 4D8DA 3EHQA 3RNJA 4J9BA 1CKBA 4RUGA 2DL4A 4J9FA 5FWCA 2AZVA 2NUZA 3EGUA 1NYGA 1M3CA 1PKSA 1X2KA 4RTTA 1TUDA 1W70A 2FEIA 1X6GA 3H41A 3SEMA 1AOJA 2D8HA 2JS0A 1WDXA 2EQIA 3O5ZA 3PE0A 2C0TA 1QLYA 1UECA 2GQIA 5IHNA 2K2MA 2RQUA 2DBKA 1X43A 2KGTA 3I5RA 1HD3A 1SRMA 2KT1A 2E5KA 4CC3A 1Z9ZA 2DF6A 2KXDA 2FPDA 1PRMC 2ED1A 1LCKA 2EBPA 1Y0MA 4LNPA 2KRSA 3M0QA 1GFDA 1G2BA 1T3LA 2HSPA 2FO0A 1MV3A 4E6RA 2RMOA 1BK2A 2LX7A 3UA7A 2DRKA 2J6FA 1B3QA 2PTKA 4WCIA 2L3SA 1ZUKA 2FRWA 2RQVA 2AKKA 2DE0X 1AVZC 1SEMA 1WLPB 2EYWA 4JJBA 1IO6A 1K76A 1UJYA 2ABLA 1JEGA 2RPNA 5GJVB 2O9SA 2X3XD 2CT3A 5IHIA 1AWJA 1VYVA 1GFCA 3JV3A 4J9GA 2EGAA 2VVKA 1GL5A 1JXMA 4OMNA 3PVLA 1YNZA 1E7OA 1I1JA 2X3WD 2HEQA 1V1CA 1KIKA 1PHTA 2H8HA 1VYUA 2FRYA 4LUDA 2RQWA 1X27A 1JXOA 2O31A 2W10A 1PNJA 1J3TA 4K11A 3H0FA 1T0HA 1GCQA 2KE9A 3RBBB 1QKWA 1RLPC 1QCFA 2L3QA 4HVVA 2KROA 5I22A 1UHFA 1OV3A 1CSKA 1W1FA 2ESWA 1BB9A 3VS3A 2K6DA 2V1QA 1YWPA 2J6KA 2LQWA 2JM9A 4HVWA 1GRIA 2DLPA 2C0IA 4CC4B 1ARKA 5FW9A 4CC2A 2CUDA 1XOVA 1M8MA 2EPDA 2LNHB 1VA7A 3QWYA 2J6OA 1SHGA 2C0OA 3A98A 4AFSC 3I35A 3FJ5A 2CH4W 1NYFA 2KT8A 2RQTA 4F17A 2BZXA 4J9EA 4JZ3A 4OMLA 5IHKA 2BTTA 2ROTA 2DBMA 2RF0A 4RTXA 1UUEA 4M4ZA 2M0YA 1GBRA 1UHCA 1MV0B 2BZYA 2V1RA 4RTYA 2AZSA 4A63B 2LJ1A 2EYZA 3C0CA 1OOTA 2LP5A 2CH4A 3VRZA 3VS2A 1UE9A 1BBZA 2EYYA 4DEXA 1UDLA 1OPLA 2YUNA 4KRTA 4RTWA
chains in the Genus database with same CATH superfamily
1Z9QA 2NUPB 3S3NA 5IH2A 1Q86C 2O88A 1MUZA 4ZTJA 2JUFA 1U5SA 1OZ2A 3JB9I 1B34A 1YI2A 1M90R 1UGVA 4XTYA 5KE2A 4M7DB 3H0HA 1MMGA 3UF4A 1VQ8T 1IGUA 4PJOG 3UWNA 1G5VA 2D1XA 1WI7A 3HRSA 4ZTFA 3IQLA 3OYKA 2JVVA 3QDFA 1LPLA 2DNUA 3G71A 1PD0A 1W6XA 3ASKA 4DOVA 2RNAA 4NL3A 2KEAA 1ZSZC 4M75G 2E41A 5KYYB 4M7AE 4HKEA 2OI3A 3VJPA 1HJDA 1T3SA 2QDYB 3E1SA 2OTLT 2WSEE 3V7CA 2ZZDA 1TOVA 1IZ6A 2KYMA 2YXYA 2LJ0A 2IPOB 2QQ9A 2JZ2A 4BB7A 7AT1B 1GXIE 4UC4A 4F7UF 2RK1A 4ZGDB 2FZCB 2VB6A 4M77C 1PWTA 1WXBA 2HL5C 3HFNA 2DL7A 4M7AB 3P8HA 5GANh 2A0FB 1GBQA 2SRCA 1MHNA 2K5FA 4R56A 4LDXA 2K3XA 5LL6S 5KCOA 1LNXA 1RACB 4J9DA 1BU1A 1U06A 1FYNA 2NYSA 1WZOA 3RIRA 2RB6A 4C8QD 5FLXE 2B86A 1YIJT 4EMGA 3CD6T 1GCQC 3CC7T 1MMDA 3JCMW 3OW2A 1UB4A 5C0MA 4NOYA 1RUWA 3SWNA 3INZA 2F5TX 5I2MA 1ZBXA 2GGRA 3LH5A 2DL3A 1T0JA 1VQPA 3OW2S 5LJ3h 3V7RA 4DOWA 3CCRA 2QQRA 4F7UE 3G6EA 2E4HA 4XAXB 3RUXA 3TEEA 4M78D 2JOYA 1YHQT 3VYGA 5CCAA 4PJLA 3FDRA 1ABOA 1R0CB 2DMOA 1G83A 4XTWA 3DB3A 1N6AA 3Q1JA 2YRVA 4J9CA 2DD4A 1X6BA 2O9VA 2E64A 2G6FX 4C92C 5GAMg 1WFWA 4XTUA 3OW2P 4N4HA 1M30A 2K79A 2F1LA 4D8KA 8AT1B 1BKBA 4JLIA 3UA6A 4DA4A 5GAN6 1UGRB 4B9WA 2LCSA 3ULRB 3M9QA 5IAYA 3OS5A 1D1AA 4RG2A 1WX6A 3CQTA 5L23A 2CDTA 5CO7A 3ZL7C 1SRLA 2CUBA 4LXCA 4RG8A 2F5KA 3OS0A 3H8ZA 3OYAA 1PSFA 4L5GA 3OYBA 2AIRB 2V26A 2O4XB 3LW5E 3GNFB 3H0IA 1RABB 2DYBA 2OX7A 2PQWA 3G4SA 1TUCA 3S3OA 4OMPA 4A4EA 4M77A 2JMAA 4EMHA 2HMAA 1KSWA 3UT1A 1ZBJA 3PMTA 5GAMf 4HA8A 2QEXT 2H3JA 1ZQ1A 2XHCA 3I9QA 1BI2A 2LZ6B 3M57A 3SFMA 2JT4A 4AG2C 3QUIA 1E6GA 2I0NA 1WYXA 4C8QC 5LJ5g 4O6JA 1BI3A 2MWPA 2WSFE 2EGEA 3M0PA 4HCCA 4LUEA 4EIKA 1X75C 4E7HA 4KUIA 4A53A 1VOMA 3BDLA 3L2ZA 1Q7YU 2XD0A 3CCLT 3A1PA 4JRQA 3OYNA 2M51A 4PJOB 1OU9A 4AFQC 2L3PA 3VS1A 1SSHA 3CCUT 2FPEA 1PCXA 1YJWQ 2P4RA 2YRDA 3EGXA 2R57A 4R55A 2FZGB 2YLBA 4M75B 5CQYA 3H6ZA 2DVJA 2EGCA 3PTAA 4XTZA 3JB9D 4II1A 5LJ5f 1BIAA 2HSEB 2A08A 1M1FA 2PZ1A 3MEWA 3BFMA 2B8AA 3CC2Q 2EVRA 2ZPGB 1IXDA 2DL4A 4BI3A 3FLGA 1I81A 1B7TA 1BI0A 1QW1A 2X51A 1M3CA 4A4FA 1M2VB 3G1JA 1W70A 3OY9A 1WPYA 4ELZC 2E70A 3O5ZA 3PE0A 1QLYA 5CVIA 2GQIA 2RQUA 3LWHA 2DK3A 2KGTA 2E5QA 4ATOA 3I5RA 2EIFA 2KT1A 3CXCA 2FL7A 1JJ2S 3MEVA 2KXDA 2E6ZA 3VUZA 5FU7C 1HK9A 2ED1A 3CCJQ 3JRZA 2M0OA 3N5BB 1G2BA 1BI1A 2HSPA 1MV3A 3P8DA 2P0QA 2RMOA 3MHXA 2LX7A 4PL6A 5CAIA 2QTVA 4PJMA 2PTKA 4FYYB 2L3SA 1M8VA 2RQVA 3UPUA 1KG1A 2P0KA 3ZFJA 4BI4A 2YHTA 1JEGA 3QIIA 5AT1B 4M77G 2DERA 1AT1B 2LQKA 1JJ2P 1E7OA 1I1JA 2X3WD 4C8QA 3JCMQ 3PIPA 1PHTA 4OGEA 2H8HA 5DLQE 2W10A 2QGGA 1TSFA 4EPCA 1MNDA 1VIFA 3J80E 4EMKC 2MF2A 3RBBB 1NZ9A 3CXCP 2L3QA 4HVVA 1UHFA 2P84A 1VQNA 2PUOB 3VS3A 3L2VA 1U1TA 1B34B 1YI2Q 4CC2A 2MPXC 3MP8A 5LJ5h 1M8MA 4QQ6A 3CCMQ 1VA7A 4M78A 2LCLA 2MAMA 3VV0A 2CH4W 1PM3A 1NYFA 1PC0A 4E7SA 5IHKA 4RTXA 2DBMA 3CMEQ 3TU4K 3G71T 2CP0A 5M9OA 2BZYA 2LJ1A 3CCQQ 3JB9H 1OOTA 1NJIR 3VS2A 1Q7YR 1Q7YC 3S3MA 2BKDN 1BBZA 2EYYA 3OYFA 2G3RA 3RMQA 3A8GB 3JCMc 3E19A 1EX4A 2RHXA 2Y4XA 1QKXA 2RI2A 1YJWA 2M02A 1QVFA 2QA4Q 2D9TA 4J6YA 1WHHA 3VU3C 4C0DC 4F16A 5AYFA 3X24B 3A5ZB 2L3RA 1VQ9Q 2EJ9A 3VRYA 3X25B 3QPHA 2ZAEA 4DBRA 1KK7A 3M53A 4O5VA 1QVFS 2HNIA 3I5SA 1WHKA 1Q82U 3CC2A 4C0FA 3A8OB 1AWWA 1I07A 2JN0A 2A37A 3FRNA 1FX7A 6AT1B 2A7YA 4LD9K 2RJCA 2QAZA 2DXBA 3FEOA 1VQKT 2LT4A 3SWNB 4XU2A 1W2BA 1UFFA 2R58A 3KXTA 3ZBDA 2HBWA 1VQPQ 1QVFP 4N0AC 4PNOA 1H641 2ZCFB 2COZA 1OYXA 4FSXA 2DIQA 3TSZA 3HP9A 1JU5C 2E65A 3CCJA 3VS4A 3RKWA 2CT4A 4J8OA 3CCRT 1MMAA 3G6ET 4MMKA 2YUOA 2IVWA 3OYGA 1VQ4Q 3UATA 2L2PA 2JTEA 2VWFA 1YJ9Q 4PJJA 3WVEB 3R6OA 4DQ2A 3HHTB 3EG9A 2LMJA 2CREA 3M0RA 1VQOQ 3C95A 2KYBA 1NEBA 2COWA 1KQ2A 2FPFA 2J06A 2X35A 4KBMB 1EFNA 1FMWA 3RR6A 4JJCA 3F70A 4M78G 1Y96A 2VV5A 4Y91A 2ZGWA 1CKAA 2FVUA 2DM1A 2XMFA 2XICA 1SPKA 2J7IA 3LWIA 3EHRA 3QJYA 4M7AD 1ACMB 4IUQA 1G3TA 4QVDA 1Q86R 3G4SQ 5GANj 4A54A 3QJ6A 4M77B 3EFSA 3QG1A 4XU0A 3MEAA 2EWNA 2HQEA 3CCMA 1D1CA 3L42A 2NWMA 4CC7A 1QVPA 2HKQB 1G3SA 2GFUA 4PLIA 4C92D 2GFAA 3OYEA 5CKFA 1M4ZA 5C6SA 2EQKA 4RTZA 1SHFA 1Y71A 4FU6A 5KH6A 3CMEA 1KHCA 3GOXA 1Y07A 2JS2A 5D7UA 3R6NA 3JCMP 2VKNA 2XKOC 3CCQA 1IGQA 4DBQA 2GCXA 2R5AA 3GLXA 1KQSA 2D8JA 3E9GA 4MMLA 1SF9A 4PKCC 2O01E 5KYWA 2LTOA 2DVEA 2QA4A 2FHDA 4OMQA 3EGXB 1D3BA 3BY7A 1H92A 1X2QA 5LJ3j 1BYMA 3E9FA 1ZUYA 1SKUB 3FJPA 3OYMA 4FT2A 2QGFB 2RM4A 4N0AA 2L89A 3EG3A 1AEYA 4MDWA 4MZPA 1VQ9A 2COYA 1QWEA 5CKHA 3H9NA 1I5LA 3M55A 5CK9A 4M7DC 2ROLA 1UJ0A 2RO0A 3NHNA 5GANe 3CMAQ 1G8XA 4WTOB 2NLUA 2QG9B 2LRQA 2HD0A 3VS7A 2CSQA 2MYSA 2RJFA 1WXTA 2C06A 1PG5B 2DJQA 3CPWA 3HRTA 2EQUA 4YTLA 4AG1C 1YIJQ 2CZ0B 4B6MA 1M3BA 4QQDA 1YJNA 3M59A 2DTOA 4ZN1A 2CYZB 3GPLA 2PVGB 1RAFB 2RN8A 4JRIA 4NS5A 3NPFA 4A4KA 5GANd 5KCHA 4F14A 5IXFA 3JB9G 2PU9B 2XDPA 1K8AU 4RTUA 1NLOC 3URGA 1WHGA 2X4JA 1OX9A 2HL3A 3MJXA 5A0DA 4N4GA 2KRMA 2MK5A 5GAOl 4OMMA 2FG0A 4M7AC 1WHJA 4JJDA 4F04B 1YBYA 3UDCA 3TCJA 4OMOA 1WXUA 2RD1A 2DEUA 2EQMA 1E6HA 4LDWA 1M5Q1 2CZ1B 2DTIA 4PJOF 4D8DA 1Q95G 3EHQA 3RNJA 4J9BA 4RUGA 1VQ4A 3JCMX 5LJ3e 5FWCA 2AZVA 1YJ9A 1QMCA 4RTTA 2LVMA 4M75F 2D8HA 1VQOA 2K5IA 2EQIA 4IUUA 1YITQ 2VUBA 3M4GA 2K2MA 4GLKA 1RAEB 2DBKA 1ZSZA 1X43A 5DLOA 5LJ3d 2XK0A 2RH2A 2DEQA 4XTVA 4AMCA 4FCYA 2E5KA 4X9DA 1Z9ZA 3OS2A 4M78E 3HKSA 2QQSA 3M5AA 2EBPA 1Y0MA 2QTXA 4LNPA 2KRSA 3M0QA 1VQNQ 1T3LA 2HQXA 2VGNA 4E6RA 2M1HA 2PVOB 1BK2A 3GP8A 3JSCA 2HQHA 2P4TA 2DRKA 2RHZA 5CKEA 1TWBA 4WCIA 3JAME 1ZUKA 2AKKA 1AVZC 4OF1A 1IRXA 2EYWA 3M4YA 5HK0A 1IO6A 1UJYA 2ABLA 3EGDA 1IB8A 4M78B 2DZ9A 2X3XD 4J9GA 2QEXQ 4BI8B 4PJOE 1OX8A 1JXMA 5L8RE 2CZ6B 1YNZA 3QDRB 3PFSA 1QP2A 3OYLA 2HEQA 2D0QB 1N8RU 1V1CA 3DB4A 1KIKA 2DZCA 1VYUA 1X27A 4QW2A 4M75E 4N4IA 1JXOA 4ZGEB 1PNJA 3O8VA 3OBWA 2K5LA 4J7IA 1TS9A 2LX9A 3H0FA 1GCQA 3V7SA 2KE9A 4BE2A 4AT1B 4CRIA 3DLLA 1RADB 5I22A 1VQLQ 1W1FA 4KH0B 5KYYA 1XQHA 5CQXA 3CBPA 4HVWA 2DLPA 2CZ7B 2C0IA 1ARKA 2CGHA 1VUBA 2LDMA 2EPDA 1V76A 1DJ7B 2RJEA 2VYTA 4PJNA 4KULA 5GMKi 3CCEQ 3EH2A 3I35A 2DJZA 2E10A 2DFUA 4J6WA 5KYXA 2KT8A 2RQTA 4M7AA 4J9EA 4X34A 5J3BA 5GAMj 3CMAA 1R8OB 2M0YA 3BW1A 4OB3B 2V1RA 2AZSA 3V8JA 4PFPA 2HZYA 5D6YA 2OTJQ 2EQJA 2LQ8A 1EZZB 2CH4A 2E3IA 9ATCB 4BUGA 3I56Q 4NL2A 3CC2T 1C6VX 1YIJA 1U1SA 4KRTA 4OP0A 4C92A 5GAN7 4RTWA 1NLPC 3WVDB 3M0SA 1LJOA 1JB0E 1M2OA 5FU6B 1K8AC 1LVKA 5GAOp 2KBTA 1S1NA 1HYOA 2Y4YA 1X01A 4FW1A 1U8RA 2JXBA 5FRNA 5GAN3 1P92A 2KVQG 3META 3C94A 1KD1U 4FYXB 1O75A 4M75C 5GMKj 3JCMg 1JQQA 2A36A 2M16A 2DXUA 2F69A 3GBQA 3CCJT 5LJ5j 4OB1B 3CXCS 1MNEA 2YUQA 3SHWA 4KGZB 2PVDB 3EG9B 3TQ7P 3U23A 2JMCA 1C1AA 3CC4Q 4J5YA 2ED0A 3A8LB 1KC8U 3CEYA 3EFRA 1YITA 4E7KA 2AK5A 5CKBA 5GAMe 2QYZA 2DA9A 3L1AA 4ME7A 4E2FB 2YWWA 4MZTA 1WJSA 3NGPA 5IN1A 1R77A 4F7UA 3RDVA 4J9HA 2ZPEB 2OAWA 2CP2A 3JCMf 4V2SA 1RI0A 1SSFA 5A0GA 3ME9A 5HKCA 4J9IA 2MWOA 5GAOr 3CCST 2NUTA 3SDZA 5GAMd 2DILA 2GTJA 2DO3A 1AWXA 1N27A 1FWZA 2MIOA 3QHSA 5EC7A 4IUTA 4PFOA 4IKFA 1VQ6Q 4E7ZA 3HFOA 3HRUA 3I55Q 4OGCA 3EG1A 3FB9A 4C0DB 1NM7A 2K7AA 4Z8AA 3VKIA 1YI2T 4KGVB 2D0NA 3HPWA 2QEXA 1UEBA 3CCVQ 1UG1A 3CCMT 1N8RC 1N8RR 5GMKe 4BY6B 4DBFA 1OPKA 3S6WA 3V8LA 1SG5A 1ZSGA 1M90U 5IXBA 3OYJA 5LJ5e 3BE3A 1WHMA 2RI5A 5GAOq 2RHUA 3FC3A 4OMFB 3CMET 5I2SA 8ATCB 2RK2A 4Z89A 2W0ZA 1WQWA 2PNIA 4KT0E 4IURA 3REBB 4HXJA 1KHIA 3CCQT 2VC8A 1VQLA 1M1KU 1D1BA 3E2UA 5KYWB 2YDLA 4AFUC 2DETA 1D3BB 3ZEHA 4BACA 4GY5A 2DYIA 3EAEA 3WXMB 5LJ5d 4C92G 2DTHA 5ECAA 2ENMA 4J6XA 3VS6A 2QA4T 4MDXA 2GTOA 2GBQA 3CCEA 2WACA 3ER0A 4QKUA 2E12A 2ZPFB 1S72Q 3MKDA 1C0MA 1KFZA 1UGPB 4Z88A 2KXCA 3OA6A 3NFCA 1VQ9T 4JRKA 3OQ5A 4IIOA 4JPBW 2OTJA 5FRMA 4LDVA 4M77F 2QQBA 3I56A 1FMKA 1F1BB 3SD4A 3L2WA 3NTHA 4X1VA 5FROA 1YJNQ 2L0AA 1H3ZA 2HDAA 1YN8A 2V8JA 4AFZC 2JW4A 4FYWB 1AWOA 2XDDA 3NTKA 1VQKQ 2EKHA 5FWBA 1VQMQ 3MCAB 5KYUA 2X4YA 3JCMh 1AZGB 1QP3A 2HCKA 1KD1C 1VQPT 2A28A 3KUFA 4C0GA 4OVAA 4C8QG 1W2BS 4EMKA 1U3OA 2IIMA 5HK3A 4F7UG 2DPPB 3C12A 3MEUA 4M7DD 2K3BA 3OMGA 3JCMb 2KR3A 4JJNK 4JS5A 3QBYA 5J26A 2V8IA 1RLQC 4QQGA 1VQ4T 1KC8R 1KC8C 3CC4A 1G3WA 4Y28E 1VQ7Q 1YJ9T 4DEYA 4JRPA 4IUPA 2RQRA 3GF5A 2ATCB 2EAYA 1NPRA 2XU8A 5A2QE 4C5GA 3AHUA 1ZA2B 1X6OA 2CP3A 4XU1A 1W2BP 4M77E 1ZSZB 1W4SA 1VQOT 1I5OB 4ZNXA 1NEGA 1OU8A 4RKUE 1OZ3A 4ZN3A 5IT9E 3KFVA 1EIFA 3SWNC 2CP5A 4C5HA 2CKKA 2YT6A 4ELYC 1ZHIA 1K0XA 3TVTA 2LJ3A 3LH0A 4C92F 1CKBA 1V29B 2P0PA 1K9MU 1VQ5Q 4XK8E 2NUZA 3PGGA 2VGMA 1VQ6A 1NYGA 2QQAA 1X2KA 3G4ST 3I55A 3EGDB 2FEIA 1HXDA 1X6GA 1AOJA 3PMIA 5I21A 1WDXA 1VIEA 4E7IA 2E6NA 3CCVA 1VQ8Q 2C0TA 3HSBA 5IHNA 1M90C 3M54A 3VUBA 2E1HA 1HD3A 1SRMA 3PIOA 4C5IA 3OB9A 1D0YA 2OTLQ 1M1KR 1M1KC 2FO0A 1PD1A 2KDSA 4C0ZA 4ANJA 5GMKl 5GAOm 2FZKB 2J6FA 4C8QF 3RMSA 4JJBA 3JB9J 1KQSS 1K76A 5GAN4 4L6V5 1AHJB 4RMOA 5IHIA 1VYVA 1S72A 2DXCA 2EGAA 2RI3A 4C92E 3DKMA 5KYXB 1GL5A 3PVLA 3JCMV 1Q82R 1Q82C 1FXXA 4PFZA 3JCMJ 3EFOA 3RESA 4HCZA 2O31A 1Y7XA 3CBOA 4JUVA 4K11A 3KBGA 1T0HA 3CMAT 3CD6Q 3BDUA 1QKWA 1RLPC 1QCFA 3QKJA 3CC7Q 2KROA 1XNIA 4C92B 1KQSP 4KUDK 4M78F 2BE9B 4BE0A 3L2RA 2K6DA 2V1QA 1YWPA 2EYQA 2J6KA 2JM9A 2XDBA 1GRIA 4Q5WA 1VQKA 5FW9A 3CPWS 2CUDA 1WNLA 1XOVA 2WSCE 5A0LA 1VQMA 2JJ9A 3EH1A 1N9SA 1O9SA 3PT9A 2C0OA 2V8KA 1N9RA 3FJ5A 2M9UA 4C5EA 4X9CA 3OSVA 4F17A 2LC4A 4OMLA 2LCCA 2ROTA 2VXEA 1UUEA 2OAUA 2IG0A 3PNWC 4C8QE 1GBRA 1D0XA 1MV0B 1UHCA 1YHQQ 1OQKA 4RTYA 4A63B 2VXFA 2XI9A 4FM4B 4KGXB 2LP5A 3MP1A 3DLMA 3VRZA 1UE9A 2BUDA 2I2LA 2EFIA 3CPWP 1UDLA 2YUNA 4CI0C 2MMPA 1VQ7A 4GLMA 1WJRA 1R0BG 3P8BB 4C8QB 2DD5A 3C4SA 2K57A 4EDUA 4HT8A 1D09B 3EG2A 4F7UB 2DX1A 2CP7A 1YITT 2K3YA 4JS4A 2XG8D 5D6XA 4PK4A 4PLLA 2QASA 1MMNA 1IREB 1MGQA 4PJOD 1OI1A 2FB7A 1B07A 1UTIA 4FYVB 1Q81U 2CSIA 1OEBA 1PKTA 2L8DA 1K9MR 4ORZA 1K9MC 2NUTB 1BCMA 4M75D 2X9HA 5HCKA 1ZX6A 2MOXA 1YCSB 3J81E 3L2UA 1VQ5A 2KNBB 2GNCA 2MCNA 1VQNT 2JM8A 4RCCA 2LQNA 3MPUB 3TSWA 1K73U 3VS0A 2NUPA 3QYGB 1QWFA 1VQ8A 1NG2A 4HT9A 4MZMA 2XIDA 4M7DA 3QXEB 4BD3A 1YCYA 1QCOA 4FL6A 4LE9A 3OYHA 3LGLA 2K4YA 4L59A 2OTLA 1AZEA 4RCBA 1I0CA 4KH1B 4Y92A 4LN2A 3JB9F 1WHLA 1VYTA 3EG0A 2OJ2A 1FMVA 3CPFA 3CCLQ 4XU3A 2EW3A 1ZLMA 4E7JA 1NPPA 4HVUA 2F2XA 3M0UA 3QWXX 3CCUQ 3SB2A 1VQLT 3LX7A 1NE8A 1NJIU 4IIMA 1YJWT 2F2WA 2QXFA 2LNVA 3VYHB 1RAHB 1BIBA 5HY6A 4BDZA 1PRLC 3AT1B 2LT1A 2AKLA 3HL8A 5FU7B 2E3HA 1M27C 2KMTA 2D6FA 4JZ4A 1D0ZA 3CCET 5EG2A 3J7AF 4M78C 4A4HA 1TH7A 3QYHB 2BZ8A 4XQ3A 2GQVA 2EJFA 3V8KA 3CD6A 1N5ZA 3CC7A 1QCNA 3RKXA 1YWOA 2OTJT 3I56T 3X20B 1K8AR 3REAB 2FYKA 4E7LA 2X4XA 1TXQA 4BE1A 1M1GA 1WA7A 1PSEA 2K9GA 1K0SA 4PJOC 5KYUB 1OULA 4VUBA 3OYDA 1JJ2A 4HCBA 3OBYA 1H8KA 4JLGA 4EMKB 1QVGA 4ESRA 2MI6A 2KK4A 1ABQA 2DL5A 2EYXA 1IHWA 2JTFA 3MP6A 3PVQA 1YHQA 3M58A 2ECZA 1HSQA 1JBMA 2J05A 2QI2A 2O2OA 1M3AA 1I8FA 1QVGS 1ZUUA 3T9NA 2KQWA 1A0NB 1RL2A 4HCKA 2KRNA 2Z0WA 5GAMh 3OYCA 3THKA 1GCPA 1X69A 3GNGA 1KJWA 2DRMA 1TG0A 3CC4T 1NBEB 3HTRA 5D6WA 4E47A 2HBPA 3RERA 1Y96B 3X26B 4B9XA 2RA2A 3A8MB 4FSSA 5FU6C 5DM7R 1Q81R 1Q81C 2QDLA 2YRCA 4FT4A 4M7DG 1K1ZA 1UGSB 3CBMA 2YUPA 2VASA 1JO8A 1K9AA 1QVGP 2KI7A 3QSUA 2ZPBB 2H3EB 4QVZA 1K4US 3NMZC 3QO3A 1LOJA 3CCSQ 1RAAB 3OMCA 1TU0B 1K73R 1K73C 2O4XA 1QQJA 5I11A 5KE3A 1AD5A 4JDSA 1VQ6T 5GMKh 1XJWB 4GBQA 4XTXA 3I55T 1Q86U 2X4WA 4R0KA 3VS5A 4P5NA 1WGSA 1WIEA 3FIFA 2YSQA 4RTVA 3OS1A 3CCVT 4D6WA 2SEMA 4ZGJB 2F2VA 2DL8A 2AT1B 1H3HA 1RI9A 2EJGA 1Y57A 3OYYA 4FW2A 4QT7A 3M0TA 3G71Q 4M7AG 2CS7A 1G3YA 1BCOA 2PUKB 5GJWB 1YP5A 3LLRA 3CCLA 2KY9A 4J9FA 1KQ1A 3CCUA 1NJIC 5GAN2 3EGUA 1PKSA 3MO8A 1TUDA 4FIBA 1TUGB 3H41A 3NTIA 3SEMA 3GIBA 2JS0A 4PJOA 5CIUA 1RAGB 4A4GA 2HAXA 2DAQA 2RHIA 4IUVA 3L2QA 1UECA 2DXTA 2ZPHB 1M9SA 3EFOB 4M75A 1TTHB 1S72T 4CC3A 5GANg 4OB0B 4J7FA 2DF6A 2FPDA 1PRMC 4BY6C 4DBHA 1LCKA 3X28B 3RKYA 1GFDA 5J39A 2DKGA 2L5QA 2GF7A 2K2VA 2ZPIB 3UA7A 2DIGA 3G7ZA 3D7SB 1ZA1B 1YJNT 1B3QA 2HKNA 2FRWA 2DE0X 1WLPB 1SEMA 2Y90A 2A3LA 3M56A 1M2VA 3LGFA 3QZ9B 4M7DF 5CR2A 2RPNA 5GJVB 2O9SA 2JNGA 2CT3A 1AWJA 3JV3A 1GFCA 4J83A 1KD1R 2RHYA 2VVKA 4OMNA 1VQMT 4M77D 3QZ5B 5CKDA 5GANf 1WJQA 2FRYA 4LUDA 2RQWA 5DY9A 2AHJB 5KYNA 3CCRQ 1J3TA 2EKOA 4TVRA 4QVCA 3G6EQ 3JCMe 5LJ3g 4OB2B 4LD6A 1OV3A 1IHVA 1JRIA 1CSKA 2ESWA 4LDYA 4WF2A 1BB9A 1UGQB 2LQWA 4CC4B 2CP6A 2QK0A 1XTDA 4M7AF 1VQ7T 2LNHB 1RAIB 2RJDA 4Z02A 3QWYA 2J6OA 1SHGA 2BE7D 1YFNA 3A98A 3JCMd 5GAN8 4AFSC 1WQ7A 5GMKm 4BDYA 2BZXA 4JZ3A 2BTTA 2RF0A 4M4ZA 2KSSA 4M7DE 4LDUA 2EYZA 2R5MA 3C0CA 2YLCA 3LYIA 5GAN5 5LJ3f 1I4K1 2JTMA 5GAOn 3TREA 3CCSA 4DEXA 3OYIA 2KAFA 1OPLA 3A8HB 3OSSC 2BIVA 1VQ5T
chains in the Genus database with same CATH topology
1NLPC 1Z9QA 1QKXA 4GLMA 5IH2A 3M0SA 2O88A 1MUZA 1U5SA 2KBTA 1S1NA 1UGVA 3H0HA 3UF4A 3EG2A 4F16A 2DX1A 2D1XA 1WI7A 3IQLA 3VRYA 2DNUA 2JXBA 1W6XA 2RNAA 1B07A 2KEAA 1UTIA 2CSIA 3I5SA 1OEBA 1PKTA 1JQQA 4ORZA 2OI3A 1HJDA 1T3SA 2A36A 5HCKA 1ZX6A 2MOXA 1YCSB 3GBQA 2KNBB 1AWWA 2GNCA 2MCNA 1I07A 2A37A 2YUQA 3SHWA 2KYMA 2JM8A 2LJ0A 2LQNA 3U23A 3TSWA 2JMCA 2ED0A 3VS0A 1PWTA 1WXBA 1QWFA 1UFFA 1NG2A 2DL7A 2AK5A 2DA9A 2HBWA 1GBQA 2SRCA 3NGPA 4LE9A 4J9HA 2OAWA 3TSZA 1AZEA 1JU5C 1I0CA 4Y92A 4LN2A 4J9DA 1BU1A 3VS4A 1VYTA 3EG0A 1U06A 2CT4A 1FYNA 2OJ2A 4J9IA 2B86A 2YUOA 2EW3A 1ZLMA 4HVUA 2F2XA 1GCQC 2DILA 2L2PA 2GTJA 2JTEA 2VWFA 3M0UA 1AWXA 3QWXX 3UATA 5EC7A 2MIOA 4IIMA 2F2WA 3EG1A 2LMJA 2CREA 1NM7A 2K7AA 3M0RA 1RUWA 4Z8AA 2D0NA 2KYBA 1PRLC 1NEBA 1UG1A 2AKLA 2FPFA 1M27C 2GGRA 1OPKA 3LH5A 2J06A 2DL3A 4JZ4A 1T0JA 1EFNA 1ZSGA 5IXBA 4JJCA 2BZ8A 1CKAA 2DM1A 2XMFA 4Z89A 2W0ZA 2PNIA 1N5ZA 1SPKA 3REBB 2J7IA 4HXJA 3EHRA 1YWOA 1ABOA 2DMOA 1G83A 2YDLA 4AFUC 3REAB 4J9CA 1WA7A 1X6BA 2O9VA 2K9GA 2G6FX 1K0SA 2NWMA 4CC7A 5ECAA 2ENMA 3VS6A 1WFWA 2GTOA 2GBQA 1M30A 2K79A 4D8KA 3UA6A 1H8KA 4RTZA 2LCSA 1SHFA 3ULRB 4ESRA 1KFZA 4Z88A 1ABQA 2DL5A 1WX6A 2KXCA 3CQTA 2EYXA 5L23A 2CDTA 3PVQA 3ZL7C 1SRLA 2JS2A 3R6NA 2VKNA 2CUBA 2ECZA 4IIOA 1HSQA 4JPBW 2J05A 2O2OA 1FMKA 2D8JA 4X1VA 1M3AA 1ZUUA 2L0AA 3H0IA 2HDAA 1YN8A 1A0NB 4AFZC 2DYBA 4HCKA 2KRNA 2JW4A 1TUCA 4OMPA 1AWOA 3THKA 2JMAA 1GCPA 4OMQA 1X69A 1KSWA 1H92A 1X2QA 1KJWA 1ZBJA 2DRMA 1TG0A 1ZUYA 2EKHA 3I9QA 5FWBA 2LZ6B 3EG3A 1AEYA 1AZGB 1QWEA 2HCKA 2JT4A 4FSSA 4AG2C 1E6GA 2I0NA 2A28A 1WYXA 2QDLA 1K1ZA 1U3OA 2ROLA 1UJ0A 2IIMA 3NHNA 2YUPA 2EGEA 3M0PA 1JO8A 1K9AA 2K3BA 3VS7A 2CSQA 4LUEA 4EIKA 1WXTA 1K4US 2DJQA 3NMZC 2KR3A 4AG1C 1RLQC 1M3BA 2M51A 4AFQC 5I11A 2L3PA 3VS1A 1SSHA 2FPEA 4DEYA 1AD5A 2RQRA 4GBQA 2P4RA 2RN8A 3NPFA 4F14A 4R0KA 5IXFA 3VS5A 1WIEA 4RTUA 2YSQA 4RTVA 1NLOC 2DVJA 4ZNXA 2EGCA 1NEGA 2SEMA 2F2VA 2DL8A 3KFVA 2KRMA 1H3HA 1RI9A 1Y57A 4QT7A 4OMMA 2A08A 3M0TA 2FG0A 4JJDA 2PZ1A 2YT6A 4OMOA 1WXUA 1K0XA 3TVTA 1E6HA 5GJWB 2EVRA 1YP5A 2LJ3A 4D8DA 3EHQA 3RNJA 4J9BA 1CKBA 4RUGA 2DL4A 4J9FA 5FWCA 2AZVA 2NUZA 3EGUA 1NYGA 1M3CA 1PKSA 1X2KA 4RTTA 1TUDA 1W70A 2FEIA 1X6GA 3H41A 3SEMA 1AOJA 2D8HA 2JS0A 1WDXA 2EQIA 3O5ZA 3PE0A 2C0TA 1QLYA 1UECA 2GQIA 5IHNA 2K2MA 2RQUA 2DBKA 1X43A 2KGTA 3I5RA 1HD3A 1SRMA 2KT1A 2E5KA 4CC3A 1Z9ZA 2DF6A 2KXDA 2FPDA 1PRMC 2ED1A 1LCKA 2EBPA 1Y0MA 4LNPA 2KRSA 3M0QA 1GFDA 1G2BA 1T3LA 2HSPA 2FO0A 1MV3A 4E6RA 2RMOA 1BK2A 2LX7A 3UA7A 2DRKA 2J6FA 1B3QA 2PTKA 4WCIA 2L3SA 1ZUKA 2FRWA 2RQVA 2AKKA 2DE0X 1AVZC 1SEMA 1WLPB 2EYWA 4JJBA 1IO6A 1K76A 1UJYA 2ABLA 1JEGA 2RPNA 5GJVB 2O9SA 2X3XD 2CT3A 5IHIA 1AWJA 1VYVA 1GFCA 3JV3A 4J9GA 2EGAA 2VVKA 1GL5A 1JXMA 4OMNA 3PVLA 1YNZA 1E7OA 1I1JA 2X3WD 2HEQA 1V1CA 1KIKA 1PHTA 2H8HA 1VYUA 2FRYA 4LUDA 2RQWA 1X27A 1JXOA 2O31A 2W10A 1PNJA 1J3TA 4K11A 3H0FA 1T0HA 1GCQA 2KE9A 3RBBB 1QKWA 1RLPC 1QCFA 2L3QA 4HVVA 2KROA 5I22A 1UHFA 1OV3A 1CSKA 1W1FA 2ESWA 1BB9A 3VS3A 2K6DA 2V1QA 1YWPA 2J6KA 2LQWA 2JM9A 4HVWA 1GRIA 2DLPA 2C0IA 4CC4B 1ARKA 5FW9A 4CC2A 2CUDA 1XOVA 1M8MA 2EPDA 2LNHB 1VA7A 3QWYA 2J6OA 1SHGA 2C0OA 3A98A 4AFSC 3I35A 3FJ5A 2CH4W 1NYFA 2KT8A 2RQTA 4F17A 2BZXA 4J9EA 4JZ3A 4OMLA 5IHKA 2BTTA 2ROTA 2DBMA 2RF0A 4RTXA 1UUEA 4M4ZA 2M0YA 1GBRA 1UHCA 1MV0B 2BZYA 2V1RA 4RTYA 2AZSA 4A63B 2LJ1A 2EYZA 3C0CA 1OOTA 2LP5A 2CH4A 3VRZA 3VS2A 1UE9A 1BBZA 2EYYA 4DEXA 1UDLA 1OPLA 2YUNA 4KRTA 4RTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLP C;  1Z9Q A;  1QKX A;  4GLM A;  5IH2 A;  3M0S A;  2O88 A;  1MUZ A;  1U5S A;  2KBT A;  1S1N A;  1UGV A;  3H0H A;  3UF4 A;  3EG2 A;  4F16 A;  2DX1 A;  2D1X A;  1WI7 A;  3IQL A;  3VRY A;  2DNU A;  2JXB A;  1W6X A;  2RNA A;  1B07 A;  2KEA A;  1UTI A;  2CSI A;  3I5S A;  1OEB A;  1PKT A;  1JQQ A;  4ORZ A;  2OI3 A;  1HJD A;  1T3S A;  2A36 A;  5HCK A;  1ZX6 A;  2MOX A;  1YCS B;  3GBQ A;  2KNB B;  1AWW A;  2GNC A;  2MCN A;  1I07 A;  2A37 A;  2YUQ A;  3SHW A;  2KYM A;  2JM8 A;  2LJ0 A;  2LQN A;  3U23 A;  3TSW A;  2JMC A;  2ED0 A;  3VS0 A;  1PWT A;  1WXB A;  1QWF A;  1UFF A;  1NG2 A;  2DL7 A;  2AK5 A;  2DA9 A;  2HBW A;  1GBQ A;  2SRC A;  3NGP A;  4LE9 A;  4J9H A;  2OAW A;  3TSZ A;  1AZE A;  1JU5 C;  1I0C A;  4Y92 A;  4LN2 A;  4J9D A;  1BU1 A;  3VS4 A;  1VYT A;  3EG0 A;  1U06 A;  2CT4 A;  1FYN A;  2OJ2 A;  4J9I A;  2B86 A;  2YUO A;  2EW3 A;  1ZLM A;  4HVU A;  2F2X A;  1GCQ C;  2DIL A;  2L2P A;  2GTJ A;  2JTE A;  2VWF A;  3M0U A;  1AWX A;  3QWX X;  3UAT A;  5EC7 A;  2MIO A;  4IIM A;  2F2W A;  3EG1 A;  2LMJ A;  2CRE A;  1NM7 A;  2K7A A;  3M0R A;  1RUW A;  4Z8A A;  2D0N A;  2KYB A;  1PRL C;  1NEB A;  1UG1 A;  2AKL A;  2FPF A;  1M27 C;  2GGR A;  1OPK A;  3LH5 A;  2J06 A;  2DL3 A;  4JZ4 A;  1T0J A;  1EFN A;  1ZSG A;  5IXB A;  4JJC A;  2BZ8 A;  1CKA A;  2DM1 A;  2XMF A;  4Z89 A;  2W0Z A;  2PNI A;  1N5Z A;  1SPK A;  3REB B;  2J7I A;  4HXJ A;  3EHR A;  1YWO A;  1ABO A;  2DMO A;  1G83 A;  2YDL A;  4AFU C;  3REA B;  4J9C A;  1WA7 A;  1X6B A;  2O9V A;  2K9G A;  2G6F X;  1K0S A;  2NWM A;  4CC7 A;  5ECA A;  2ENM A;  3VS6 A;  1WFW A;  2GTO A;  2GBQ A;  1M30 A;  2K79 A;  4D8K A;  3UA6 A;  1H8K A;  4RTZ A;  2LCS A;  1SHF A;  3ULR B;  4ESR A;  1KFZ A;  4Z88 A;  1ABQ A;  2DL5 A;  1WX6 A;  2KXC A;  3CQT A;  2EYX A;  5L23 A;  2CDT A;  3PVQ A;  3ZL7 C;  1SRL A;  2JS2 A;  3R6N A;  2VKN A;  2CUB A;  2ECZ A;  4IIO A;  1HSQ A;  4JPB W;  2J05 A;  2O2O A;  1FMK A;  2D8J A;  4X1V A;  1M3A A;  1ZUU A;  2L0A A;  3H0I A;  2HDA A;  1YN8 A;  1A0N B;  4AFZ C;  2DYB A;  4HCK A;  2KRN A;  2JW4 A;  1TUC A;  4OMP A;  1AWO A;  3THK A;  2JMA A;  1GCP A;  4OMQ A;  1X69 A;  1KSW A;  1H92 A;  1X2Q A;  1KJW A;  1ZBJ A;  2DRM A;  1TG0 A;  1ZUY A;  2EKH A;  3I9Q A;  5FWB A;  2LZ6 B;  3EG3 A;  1AEY A;  1AZG B;  1QWE A;  2HCK A;  2JT4 A;  4FSS A;  4AG2 C;  1E6G A;  2I0N A;  2A28 A;  1WYX A;  2QDL A;  1K1Z A;  1U3O A;  2ROL A;  1UJ0 A;  2IIM A;  3NHN A;  2YUP A;  2EGE A;  3M0P A;  1JO8 A;  1K9A A;  2K3B A;  3VS7 A;  2CSQ A;  4LUE A;  4EIK A;  1WXT A;  1K4U S;  2DJQ A;  3NMZ C;  2KR3 A;  4AG1 C;  1RLQ C;  1M3B A;  2M51 A;  4AFQ C;  5I11 A;  2L3P A;  3VS1 A;  1SSH A;  2FPE A;  4DEY A;  1AD5 A;  2RQR A;  4GBQ A;  2P4R A;  2RN8 A;  3NPF A;  4F14 A;  4R0K A;  5IXF A;  3VS5 A;  1WIE A;  4RTU A;  2YSQ A;  4RTV A;  1NLO C;  2DVJ A;  4ZNX A;  2EGC A;  1NEG A;  2SEM A;  2F2V A;  2DL8 A;  3KFV A;  2KRM A;  1H3H A;  1RI9 A;  1Y57 A;  4QT7 A;  4OMM A;  2A08 A;  3M0T A;  2FG0 A;  4JJD A;  2PZ1 A;  2YT6 A;  4OMO A;  1WXU A;  1K0X A;  3TVT A;  1E6H A;  5GJW B;  2EVR A;  1YP5 A;  2LJ3 A;  4D8D A;  3EHQ A;  3RNJ A;  4J9B A;  1CKB A;  4RUG A;  2DL4 A;  4J9F A;  5FWC A;  2AZV A;  2NUZ A;  3EGU A;  1NYG A;  1M3C A;  1PKS A;  1X2K A;  4RTT A;  1TUD A;  1W70 A;  2FEI A;  1X6G A;  3H41 A;  3SEM A;  1AOJ A;  2D8H A;  2JS0 A;  1WDX A;  2EQI A;  3O5Z A;  3PE0 A;  2C0T A;  1QLY A;  1UEC A;  2GQI A;  5IHN A;  2K2M A;  2RQU A;  2DBK A;  1X43 A;  2KGT A;  3I5R A;  1HD3 A;  1SRM A;  2KT1 A;  2E5K A;  4CC3 A;  1Z9Z A;  2DF6 A;  2KXD A;  2FPD A;  1PRM C;  2ED1 A;  1LCK A;  2EBP A;  1Y0M A;  4LNP A;  2KRS A;  3M0Q A;  1GFD A;  1G2B A;  1T3L A;  2HSP A;  2FO0 A;  1MV3 A;  4E6R A;  2RMO A;  1BK2 A;  2LX7 A;  3UA7 A;  2DRK A;  2J6F A;  1B3Q A;  2PTK A;  4WCI A;  2L3S A;  1ZUK A;  2FRW A;  2RQV A;  2AKK A;  2DE0 X;  1AVZ C;  1SEM A;  1WLP B;  2EYW A;  4JJB A;  1IO6 A;  1K76 A;  1UJY A;  2ABL A;  1JEG A;  2RPN A;  5GJV B;  2O9S A;  2X3X D;  2CT3 A;  5IHI A;  1AWJ A;  1VYV A;  1GFC A;  3JV3 A;  4J9G A;  2EGA A;  2VVK A;  1GL5 A;  1JXM A;  4OMN A;  3PVL A;  1YNZ A;  1E7O A;  1I1J A;  2X3W D;  2HEQ A;  1V1C A;  1KIK A;  1PHT A;  2H8H A;  1VYU A;  2FRY A;  4LUD A;  2RQW A;  1X27 A;  1JXO A;  2O31 A;  2W10 A;  1PNJ A;  1J3T A;  4K11 A;  3H0F A;  1T0H A;  1GCQ A;  2KE9 A;  3RBB B;  1QKW A;  1RLP C;  1QCF A;  2L3Q A;  4HVV A;  2KRO A;  5I22 A;  1UHF A;  1OV3 A;  1CSK A;  1W1F A;  2ESW A;  1BB9 A;  3VS3 A;  2K6D A;  2V1Q A;  1YWP A;  2J6K A;  2LQW A;  2JM9 A;  4HVW A;  1GRI A;  2DLP A;  2C0I A;  4CC4 B;  1ARK A;  5FW9 A;  4CC2 A;  2CUD A;  1XOV A;  1M8M A;  2EPD A;  2LNH B;  1VA7 A;  3QWY A;  2J6O A;  1SHG A;  2C0O A;  3A98 A;  4AFS C;  3I35 A;  3FJ5 A;  2CH4 W;  1NYF A;  2KT8 A;  2RQT A;  4F17 A;  2BZX A;  4J9E A;  4JZ3 A;  4OML A;  5IHK A;  2BTT A;  2ROT A;  2DBM A;  2RF0 A;  4RTX A;  1UUE A;  4M4Z A;  2M0Y A;  1GBR A;  1UHC A;  1MV0 B;  2BZY A;  2V1R A;  4RTY A;  2AZS A;  4A63 B;  2LJ1 A;  2EYZ A;  3C0C A;  1OOT A;  2LP5 A;  2CH4 A;  3VRZ A;  3VS2 A;  1UE9 A;  1BBZ A;  2EYY A;  4DEX A;  1UDL A;  1OPL A;  2YUN A;  4KRT A;  4RTW A; 
#chains in the Genus database with same CATH topology
 1Z9Q A;  2NUP B;  3S3N A;  5IH2 A;  1Q86 C;  2O88 A;  1MUZ A;  4ZTJ A;  2JUF A;  1U5S A;  1OZ2 A;  3JB9 I;  1B34 A;  1YI2 A;  1M90 R;  1UGV A;  4XTY A;  5KE2 A;  4M7D B;  3H0H A;  1MMG A;  3UF4 A;  1VQ8 T;  1IGU A;  4PJO G;  3UWN A;  1G5V A;  2D1X A;  1WI7 A;  3HRS A;  4ZTF A;  3IQL A;  3OYK A;  2JVV A;  3QDF A;  1LPL A;  2DNU A;  3G71 A;  1PD0 A;  1W6X A;  3ASK A;  4DOV A;  2RNA A;  4NL3 A;  2KEA A;  1ZSZ C;  4M75 G;  2E41 A;  5KYY B;  4M7A E;  4HKE A;  2OI3 A;  3VJP A;  1HJD A;  1T3S A;  2QDY B;  3E1S A;  2OTL T;  2WSE E;  3V7C A;  2ZZD A;  1TOV A;  1IZ6 A;  2KYM A;  2YXY A;  2LJ0 A;  2IPO B;  2QQ9 A;  2JZ2 A;  4BB7 A;  7AT1 B;  1GXI E;  4UC4 A;  4F7U F;  2RK1 A;  4ZGD B;  2FZC B;  2VB6 A;  4M77 C;  1PWT A;  1WXB A;  2HL5 C;  3HFN A;  2DL7 A;  4M7A B;  3P8H A;  5GAN h;  2A0F B;  1GBQ A;  2SRC A;  1MHN A;  2K5F A;  4R56 A;  4LDX A;  2K3X A;  5LL6 S;  5KCO A;  1LNX A;  1RAC B;  4J9D A;  1BU1 A;  1U06 A;  1FYN A;  2NYS A;  1WZO A;  3RIR A;  2RB6 A;  4C8Q D;  5FLX E;  2B86 A;  1YIJ T;  4EMG A;  3CD6 T;  1GCQ C;  3CC7 T;  1MMD A;  3JCM W;  3OW2 A;  1UB4 A;  5C0M A;  4NOY A;  1RUW A;  3SWN A;  3INZ A;  2F5T X;  5I2M A;  1ZBX A;  2GGR A;  3LH5 A;  2DL3 A;  1T0J A;  1VQP A;  3OW2 S;  5LJ3 h;  3V7R A;  4DOW A;  3CCR A;  2QQR A;  4F7U E;  3G6E A;  2E4H A;  4XAX B;  3RUX A;  3TEE A;  4M78 D;  2JOY A;  1YHQ T;  3VYG A;  5CCA A;  4PJL A;  3FDR A;  1ABO A;  1R0C B;  2DMO A;  1G83 A;  4XTW A;  3DB3 A;  1N6A A;  3Q1J A;  2YRV A;  4J9C A;  2DD4 A;  1X6B A;  2O9V A;  2E64 A;  2G6F X;  4C92 C;  5GAM g;  1WFW A;  4XTU A;  3OW2 P;  4N4H A;  1M30 A;  2K79 A;  2F1L A;  4D8K A;  8AT1 B;  1BKB A;  4JLI A;  3UA6 A;  4DA4 A;  5GAN 6;  1UGR B;  4B9W A;  2LCS A;  3ULR B;  3M9Q A;  5IAY A;  3OS5 A;  1D1A A;  4RG2 A;  1WX6 A;  3CQT A;  5L23 A;  2CDT A;  5CO7 A;  3ZL7 C;  1SRL A;  2CUB A;  4LXC A;  4RG8 A;  2F5K A;  3OS0 A;  3H8Z A;  3OYA A;  1PSF A;  4L5G A;  3OYB A;  2AIR B;  2V26 A;  2O4X B;  3LW5 E;  3GNF B;  3H0I A;  1RAB B;  2DYB A;  2OX7 A;  2PQW A;  3G4S A;  1TUC A;  3S3O A;  4OMP A;  4A4E A;  4M77 A;  2JMA A;  4EMH A;  2HMA A;  1KSW A;  3UT1 A;  1ZBJ A;  3PMT A;  5GAM f;  4HA8 A;  2QEX T;  2H3J A;  1ZQ1 A;  2XHC A;  3I9Q A;  1BI2 A;  2LZ6 B;  3M57 A;  3SFM A;  2JT4 A;  4AG2 C;  3QUI A;  1E6G A;  2I0N A;  1WYX A;  4C8Q C;  5LJ5 g;  4O6J A;  1BI3 A;  2MWP A;  2WSF E;  2EGE A;  3M0P A;  4HCC A;  4LUE A;  4EIK A;  1X75 C;  4E7H A;  4KUI A;  4A53 A;  1VOM A;  3BDL A;  3L2Z A;  1Q7Y U;  2XD0 A;  3CCL T;  3A1P A;  4JRQ A;  3OYN A;  2M51 A;  4PJO B;  1OU9 A;  4AFQ C;  2L3P A;  3VS1 A;  1SSH A;  3CCU T;  2FPE A;  1PCX A;  1YJW Q;  2P4R A;  2YRD A;  3EGX A;  2R57 A;  4R55 A;  2FZG B;  2YLB A;  4M75 B;  5CQY A;  3H6Z A;  2DVJ A;  2EGC A;  3PTA A;  4XTZ A;  3JB9 D;  4II1 A;  5LJ5 f;  1BIA A;  2HSE B;  2A08 A;  1M1F A;  2PZ1 A;  3MEW A;  3BFM A;  2B8A A;  3CC2 Q;  2EVR A;  2ZPG B;  1IXD A;  2DL4 A;  4BI3 A;  3FLG A;  1I81 A;  1B7T A;  1BI0 A;  1QW1 A;  2X51 A;  1M3C A;  4A4F A;  1M2V B;  3G1J A;  1W70 A;  3OY9 A;  1WPY A;  4ELZ C;  2E70 A;  3O5Z A;  3PE0 A;  1QLY A;  5CVI A;  2GQI A;  2RQU A;  3LWH A;  2DK3 A;  2KGT A;  2E5Q A;  4ATO A;  3I5R A;  2EIF A;  2KT1 A;  3CXC A;  2FL7 A;  1JJ2 S;  3MEV A;  2KXD A;  2E6Z A;  3VUZ A;  5FU7 C;  1HK9 A;  2ED1 A;  3CCJ Q;  3JRZ A;  2M0O A;  3N5B B;  1G2B A;  1BI1 A;  2HSP A;  1MV3 A;  3P8D A;  2P0Q A;  2RMO A;  3MHX A;  2LX7 A;  4PL6 A;  5CAI A;  2QTV A;  4PJM A;  2PTK A;  4FYY B;  2L3S A;  1M8V A;  2RQV A;  3UPU A;  1KG1 A;  2P0K A;  3ZFJ A;  4BI4 A;  2YHT A;  1JEG A;  3QII A;  5AT1 B;  4M77 G;  2DER A;  1AT1 B;  2LQK A;  1JJ2 P;  1E7O A;  1I1J A;  2X3W D;  4C8Q A;  3JCM Q;  3PIP A;  1PHT A;  4OGE A;  2H8H A;  5DLQ E;  2W10 A;  2QGG A;  1TSF A;  4EPC A;  1MND A;  1VIF A;  3J80 E;  4EMK C;  2MF2 A;  3RBB B;  1NZ9 A;  3CXC P;  2L3Q A;  4HVV A;  1UHF A;  2P84 A;  1VQN A;  2PUO B;  3VS3 A;  3L2V A;  1U1T A;  1B34 B;  1YI2 Q;  4CC2 A;  2MPX C;  3MP8 A;  5LJ5 h;  1M8M A;  4QQ6 A;  3CCM Q;  1VA7 A;  4M78 A;  2LCL A;  2MAM A;  3VV0 A;  2CH4 W;  1PM3 A;  1NYF A;  1PC0 A;  4E7S A;  5IHK A;  4RTX A;  2DBM A;  3CME Q;  3TU4 K;  3G71 T;  2CP0 A;  5M9O A;  2BZY A;  2LJ1 A;  3CCQ Q;  3JB9 H;  1OOT A;  1NJI R;  3VS2 A;  1Q7Y R;  1Q7Y C;  3S3M A;  2BKD N;  1BBZ A;  2EYY A;  3OYF A;  2G3R A;  3RMQ A;  3A8G B;  3JCM c;  3E19 A;  1EX4 A;  2RHX A;  2Y4X A;  1QKX A;  2RI2 A;  1YJW A;  2M02 A;  1QVF A;  2QA4 Q;  2D9T A;  4J6Y A;  1WHH A;  3VU3 C;  4C0D C;  4F16 A;  5AYF A;  3X24 B;  3A5Z B;  2L3R A;  1VQ9 Q;  2EJ9 A;  3VRY A;  3X25 B;  3QPH A;  2ZAE A;  4DBR A;  1KK7 A;  3M53 A;  4O5V A;  1QVF S;  2HNI A;  3I5S A;  1WHK A;  1Q82 U;  3CC2 A;  4C0F A;  3A8O B;  1AWW A;  1I07 A;  2JN0 A;  2A37 A;  3FRN A;  1FX7 A;  6AT1 B;  2A7Y A;  4LD9 K;  2RJC A;  2QAZ A;  2DXB A;  3FEO A;  1VQK T;  2LT4 A;  3SWN B;  4XU2 A;  1W2B A;  1UFF A;  2R58 A;  3KXT A;  3ZBD A;  2HBW A;  1VQP Q;  1QVF P;  4N0A C;  4PNO A;  1H64 1;  2ZCF B;  2COZ A;  1OYX A;  4FSX A;  2DIQ A;  3TSZ A;  3HP9 A;  1JU5 C;  2E65 A;  3CCJ A;  3VS4 A;  3RKW A;  2CT4 A;  4J8O A;  3CCR T;  1MMA A;  3G6E T;  4MMK A;  2YUO A;  2IVW A;  3OYG A;  1VQ4 Q;  3UAT A;  2L2P A;  2JTE A;  2VWF A;  1YJ9 Q;  4PJJ A;  3WVE B;  3R6O A;  4DQ2 A;  3HHT B;  3EG9 A;  2LMJ A;  2CRE A;  3M0R A;  1VQO Q;  3C95 A;  2KYB A;  1NEB A;  2COW A;  1KQ2 A;  2FPF A;  2J06 A;  2X35 A;  4KBM B;  1EFN A;  1FMW A;  3RR6 A;  4JJC A;  3F70 A;  4M78 G;  1Y96 A;  2VV5 A;  4Y91 A;  2ZGW A;  1CKA A;  2FVU A;  2DM1 A;  2XMF A;  2XIC A;  1SPK A;  2J7I A;  3LWI A;  3EHR A;  3QJY A;  4M7A D;  1ACM B;  4IUQ A;  1G3T A;  4QVD A;  1Q86 R;  3G4S Q;  5GAN j;  4A54 A;  3QJ6 A;  4M77 B;  3EFS A;  3QG1 A;  4XU0 A;  3MEA A;  2EWN A;  2HQE A;  3CCM A;  1D1C A;  3L42 A;  2NWM A;  4CC7 A;  1QVP A;  2HKQ B;  1G3S A;  2GFU A;  4PLI A;  4C92 D;  2GFA A;  3OYE A;  5CKF A;  1M4Z A;  5C6S A;  2EQK A;  4RTZ A;  1SHF A;  1Y71 A;  4FU6 A;  5KH6 A;  3CME A;  1KHC A;  3GOX A;  1Y07 A;  2JS2 A;  5D7U A;  3R6N A;  3JCM P;  2VKN A;  2XKO C;  3CCQ A;  1IGQ A;  4DBQ A;  2GCX A;  2R5A A;  3GLX A;  1KQS A;  2D8J A;  3E9G A;  4MML A;  1SF9 A;  4PKC C;  2O01 E;  5KYW A;  2LTO A;  2DVE A;  2QA4 A;  2FHD A;  4OMQ A;  3EGX B;  1D3B A;  3BY7 A;  1H92 A;  1X2Q A;  5LJ3 j;  1BYM A;  3E9F A;  1ZUY A;  1SKU B;  3FJP A;  3OYM A;  4FT2 A;  2QGF B;  2RM4 A;  4N0A A;  2L89 A;  3EG3 A;  1AEY A;  4MDW A;  4MZP A;  1VQ9 A;  2COY A;  1QWE A;  5CKH A;  3H9N A;  1I5L A;  3M55 A;  5CK9 A;  4M7D C;  2ROL A;  1UJ0 A;  2RO0 A;  3NHN A;  5GAN e;  3CMA Q;  1G8X A;  4WTO B;  2NLU A;  2QG9 B;  2LRQ A;  2HD0 A;  3VS7 A;  2CSQ A;  2MYS A;  2RJF A;  1WXT A;  2C06 A;  1PG5 B;  2DJQ A;  3CPW A;  3HRT A;  2EQU A;  4YTL A;  4AG1 C;  1YIJ Q;  2CZ0 B;  4B6M A;  1M3B A;  4QQD A;  1YJN A;  3M59 A;  2DTO A;  4ZN1 A;  2CYZ B;  3GPL A;  2PVG B;  1RAF B;  2RN8 A;  4JRI A;  4NS5 A;  3NPF A;  4A4K A;  5GAN d;  5KCH A;  4F14 A;  5IXF A;  3JB9 G;  2PU9 B;  2XDP A;  1K8A U;  4RTU A;  1NLO C;  3URG A;  1WHG A;  2X4J A;  1OX9 A;  2HL3 A;  3MJX A;  5A0D A;  4N4G A;  2KRM A;  2MK5 A;  5GAO l;  4OMM A;  2FG0 A;  4M7A C;  1WHJ A;  4JJD A;  4F04 B;  1YBY A;  3UDC A;  3TCJ A;  4OMO A;  1WXU A;  2RD1 A;  2DEU A;  2EQM A;  1E6H A;  4LDW A;  1M5Q 1;  2CZ1 B;  2DTI A;  4PJO F;  4D8D A;  1Q95 G;  3EHQ A;  3RNJ A;  4J9B A;  4RUG A;  1VQ4 A;  3JCM X;  5LJ3 e;  5FWC A;  2AZV A;  1YJ9 A;  1QMC A;  4RTT A;  2LVM A;  4M75 F;  2D8H A;  1VQO A;  2K5I A;  2EQI A;  4IUU A;  1YIT Q;  2VUB A;  3M4G A;  2K2M A;  4GLK A;  1RAE B;  2DBK A;  1ZSZ A;  1X43 A;  5DLO A;  5LJ3 d;  2XK0 A;  2RH2 A;  2DEQ A;  4XTV A;  4AMC A;  4FCY A;  2E5K A;  4X9D A;  1Z9Z A;  3OS2 A;  4M78 E;  3HKS A;  2QQS A;  3M5A A;  2EBP A;  1Y0M A;  2QTX A;  4LNP A;  2KRS A;  3M0Q A;  1VQN Q;  1T3L A;  2HQX A;  2VGN A;  4E6R A;  2M1H A;  2PVO B;  1BK2 A;  3GP8 A;  3JSC A;  2HQH A;  2P4T A;  2DRK A;  2RHZ A;  5CKE A;  1TWB A;  4WCI A;  3JAM E;  1ZUK A;  2AKK A;  1AVZ C;  4OF1 A;  1IRX A;  2EYW A;  3M4Y A;  5HK0 A;  1IO6 A;  1UJY A;  2ABL A;  3EGD A;  1IB8 A;  4M78 B;  2DZ9 A;  2X3X D;  4J9G A;  2QEX Q;  4BI8 B;  4PJO E;  1OX8 A;  1JXM A;  5L8R E;  2CZ6 B;  1YNZ A;  3QDR B;  3PFS A;  1QP2 A;  3OYL A;  2HEQ A;  2D0Q B;  1N8R U;  1V1C A;  3DB4 A;  1KIK A;  2DZC A;  1VYU A;  1X27 A;  4QW2 A;  4M75 E;  4N4I A;  1JXO A;  4ZGE B;  1PNJ A;  3O8V A;  3OBW A;  2K5L A;  4J7I A;  1TS9 A;  2LX9 A;  3H0F A;  1GCQ A;  3V7S A;  2KE9 A;  4BE2 A;  4AT1 B;  4CRI A;  3DLL A;  1RAD B;  5I22 A;  1VQL Q;  1W1F A;  4KH0 B;  5KYY A;  1XQH A;  5CQX A;  3CBP A;  4HVW A;  2DLP A;  2CZ7 B;  2C0I A;  1ARK A;  2CGH A;  1VUB A;  2LDM A;  2EPD A;  1V76 A;  1DJ7 B;  2RJE A;  2VYT A;  4PJN A;  4KUL A;  5GMK i;  3CCE Q;  3EH2 A;  3I35 A;  2DJZ A;  2E10 A;  2DFU A;  4J6W A;  5KYX A;  2KT8 A;  2RQT A;  4M7A A;  4J9E A;  4X34 A;  5J3B A;  5GAM j;  3CMA A;  1R8O B;  2M0Y A;  3BW1 A;  4OB3 B;  2V1R A;  2AZS A;  3V8J A;  4PFP A;  2HZY A;  5D6Y A;  2OTJ Q;  2EQJ A;  2LQ8 A;  1EZZ B;  2CH4 A;  2E3I A;  9ATC B;  4BUG A;  3I56 Q;  4NL2 A;  3CC2 T;  1C6V X;  1YIJ A;  1U1S A;  4KRT A;  4OP0 A;  4C92 A;  5GAN 7;  4RTW A;  1NLP C;  3WVD B;  3M0S A;  1LJO A;  1JB0 E;  1M2O A;  5FU6 B;  1K8A C;  1LVK A;  5GAO p;  2KBT A;  1S1N A;  1HYO A;  2Y4Y A;  1X01 A;  4FW1 A;  1U8R A;  2JXB A;  5FRN A;  5GAN 3;  1P92 A;  2KVQ G;  3MET A;  3C94 A;  1KD1 U;  4FYX B;  1O75 A;  4M75 C;  5GMK j;  3JCM g;  1JQQ A;  2A36 A;  2M16 A;  2DXU A;  2F69 A;  3GBQ A;  3CCJ T;  5LJ5 j;  4OB1 B;  3CXC S;  1MNE A;  2YUQ A;  3SHW A;  4KGZ B;  2PVD B;  3EG9 B;  3TQ7 P;  3U23 A;  2JMC A;  1C1A A;  3CC4 Q;  4J5Y A;  2ED0 A;  3A8L B;  1KC8 U;  3CEY A;  3EFR A;  1YIT A;  4E7K A;  2AK5 A;  5CKB A;  5GAM e;  2QYZ A;  2DA9 A;  3L1A A;  4ME7 A;  4E2F B;  2YWW A;  4MZT A;  1WJS A;  3NGP A;  5IN1 A;  1R77 A;  4F7U A;  3RDV A;  4J9H A;  2ZPE B;  2OAW A;  2CP2 A;  3JCM f;  4V2S A;  1RI0 A;  1SSF A;  5A0G A;  3ME9 A;  5HKC A;  4J9I A;  2MWO A;  5GAO r;  3CCS T;  2NUT A;  3SDZ A;  5GAM d;  2DIL A;  2GTJ A;  2DO3 A;  1AWX A;  1N27 A;  1FWZ A;  2MIO A;  3QHS A;  5EC7 A;  4IUT A;  4PFO A;  4IKF A;  1VQ6 Q;  4E7Z A;  3HFO A;  3HRU A;  3I55 Q;  4OGC A;  3EG1 A;  3FB9 A;  4C0D B;  1NM7 A;  2K7A A;  4Z8A A;  3VKI A;  1YI2 T;  4KGV B;  2D0N A;  3HPW A;  2QEX A;  1UEB A;  3CCV Q;  1UG1 A;  3CCM T;  1N8R C;  1N8R R;  5GMK e;  4BY6 B;  4DBF A;  1OPK A;  3S6W A;  3V8L A;  1SG5 A;  1ZSG A;  1M90 U;  5IXB A;  3OYJ A;  5LJ5 e;  3BE3 A;  1WHM A;  2RI5 A;  5GAO q;  2RHU A;  3FC3 A;  4OMF B;  3CME T;  5I2S A;  8ATC B;  2RK2 A;  4Z89 A;  2W0Z A;  1WQW A;  2PNI A;  4KT0 E;  4IUR A;  3REB B;  4HXJ A;  1KHI A;  3CCQ T;  2VC8 A;  1VQL A;  1M1K U;  1D1B A;  3E2U A;  5KYW B;  2YDL A;  4AFU C;  2DET A;  1D3B B;  3ZEH A;  4BAC A;  4GY5 A;  2DYI A;  3EAE A;  3WXM B;  5LJ5 d;  4C92 G;  2DTH A;  5ECA A;  2ENM A;  4J6X A;  3VS6 A;  2QA4 T;  4MDX A;  2GTO A;  2GBQ A;  3CCE A;  2WAC A;  3ER0 A;  4QKU A;  2E12 A;  2ZPF B;  1S72 Q;  3MKD A;  1C0M A;  1KFZ A;  1UGP B;  4Z88 A;  2KXC A;  3OA6 A;  3NFC A;  1VQ9 T;  4JRK A;  3OQ5 A;  4IIO A;  4JPB W;  2OTJ A;  5FRM A;  4LDV A;  4M77 F;  2QQB A;  3I56 A;  1FMK A;  1F1B B;  3SD4 A;  3L2W A;  3NTH A;  4X1V A;  5FRO A;  1YJN Q;  2L0A A;  1H3Z A;  2HDA A;  1YN8 A;  2V8J A;  4AFZ C;  2JW4 A;  4FYW B;  1AWO A;  2XDD A;  3NTK A;  1VQK Q;  2EKH A;  5FWB A;  1VQM Q;  3MCA B;  5KYU A;  2X4Y A;  3JCM h;  1AZG B;  1QP3 A;  2HCK A;  1KD1 C;  1VQP T;  2A28 A;  3KUF A;  4C0G A;  4OVA A;  4C8Q G;  1W2B S;  4EMK A;  1U3O A;  2IIM A;  5HK3 A;  4F7U G;  2DPP B;  3C12 A;  3MEU A;  4M7D D;  2K3B A;  3OMG A;  3JCM b;  2KR3 A;  4JJN K;  4JS5 A;  3QBY A;  5J26 A;  2V8I A;  1RLQ C;  4QQG A;  1VQ4 T;  1KC8 R;  1KC8 C;  3CC4 A;  1G3W A;  4Y28 E;  1VQ7 Q;  1YJ9 T;  4DEY A;  4JRP A;  4IUP A;  2RQR A;  3GF5 A;  2ATC B;  2EAY A;  1NPR A;  2XU8 A;  5A2Q E;  4C5G A;  3AHU A;  1ZA2 B;  1X6O A;  2CP3 A;  4XU1 A;  1W2B P;  4M77 E;  1ZSZ B;  1W4S A;  1VQO T;  1I5O B;  4ZNX A;  1NEG A;  1OU8 A;  4RKU E;  1OZ3 A;  4ZN3 A;  5IT9 E;  3KFV A;  1EIF A;  3SWN C;  2CP5 A;  4C5H A;  2CKK A;  2YT6 A;  4ELY C;  1ZHI A;  1K0X A;  3TVT A;  2LJ3 A;  3LH0 A;  4C92 F;  1CKB A;  1V29 B;  2P0P A;  1K9M U;  1VQ5 Q;  4XK8 E;  2NUZ A;  3PGG A;  2VGM A;  1VQ6 A;  1NYG A;  2QQA A;  1X2K A;  3G4S T;  3I55 A;  3EGD B;  2FEI A;  1HXD A;  1X6G A;  1AOJ A;  3PMI A;  5I21 A;  1WDX A;  1VIE A;  4E7I A;  2E6N A;  3CCV A;  1VQ8 Q;  2C0T A;  3HSB A;  5IHN A;  1M90 C;  3M54 A;  3VUB A;  2E1H A;  1HD3 A;  1SRM A;  3PIO A;  4C5I A;  3OB9 A;  1D0Y A;  2OTL Q;  1M1K R;  1M1K C;  2FO0 A;  1PD1 A;  2KDS A;  4C0Z A;  4ANJ A;  5GMK l;  5GAO m;  2FZK B;  2J6F A;  4C8Q F;  3RMS A;  4JJB A;  3JB9 J;  1KQS S;  1K76 A;  5GAN 4;  4L6V 5;  1AHJ B;  4RMO A;  5IHI A;  1VYV A;  1S72 A;  2DXC A;  2EGA A;  2RI3 A;  4C92 E;  3DKM A;  5KYX B;  1GL5 A;  3PVL A;  3JCM V;  1Q82 R;  1Q82 C;  1FXX A;  4PFZ A;  3JCM J;  3EFO A;  3RES A;  4HCZ A;  2O31 A;  1Y7X A;  3CBO A;  4JUV A;  4K11 A;  3KBG A;  1T0H A;  3CMA T;  3CD6 Q;  3BDU A;  1QKW A;  1RLP C;  1QCF A;  3QKJ A;  3CC7 Q;  2KRO A;  1XNI A;  4C92 B;  1KQS P;  4KUD K;  4M78 F;  2BE9 B;  4BE0 A;  3L2R A;  2K6D A;  2V1Q A;  1YWP A;  2EYQ A;  2J6K A;  2JM9 A;  2XDB A;  1GRI A;  4Q5W A;  1VQK A;  5FW9 A;  3CPW S;  2CUD A;  1WNL A;  1XOV A;  2WSC E;  5A0L A;  1VQM A;  2JJ9 A;  3EH1 A;  1N9S A;  1O9S A;  3PT9 A;  2C0O A;  2V8K A;  1N9R A;  3FJ5 A;  2M9U A;  4C5E A;  4X9C A;  3OSV A;  4F17 A;  2LC4 A;  4OML A;  2LCC A;  2ROT A;  2VXE A;  1UUE A;  2OAU A;  2IG0 A;  3PNW C;  4C8Q E;  1GBR A;  1D0X A;  1MV0 B;  1UHC A;  1YHQ Q;  1OQK A;  4RTY A;  4A63 B;  2VXF A;  2XI9 A;  4FM4 B;  4KGX B;  2LP5 A;  3MP1 A;  3DLM A;  3VRZ A;  1UE9 A;  2BUD A;  2I2L A;  2EFI A;  3CPW P;  1UDL A;  2YUN A;  4CI0 C;  2MMP A;  1VQ7 A;  4GLM A;  1WJR A;  1R0B G;  3P8B B;  4C8Q B;  2DD5 A;  3C4S A;  2K57 A;  4EDU A;  4HT8 A;  1D09 B;  3EG2 A;  4F7U B;  2DX1 A;  2CP7 A;  1YIT T;  2K3Y A;  4JS4 A;  2XG8 D;  5D6X A;  4PK4 A;  4PLL A;  2QAS A;  1MMN A;  1IRE B;  1MGQ A;  4PJO D;  1OI1 A;  2FB7 A;  1B07 A;  1UTI A;  4FYV B;  1Q81 U;  2CSI A;  1OEB A;  1PKT A;  2L8D A;  1K9M R;  4ORZ A;  1K9M C;  2NUT B;  1BCM A;  4M75 D;  2X9H A;  5HCK A;  1ZX6 A;  2MOX A;  1YCS B;  3J81 E;  3L2U A;  1VQ5 A;  2KNB B;  2GNC A;  2MCN A;  1VQN T;  2JM8 A;  4RCC A;  2LQN A;  3MPU B;  3TSW A;  1K73 U;  3VS0 A;  2NUP A;  3QYG B;  1QWF A;  1VQ8 A;  1NG2 A;  4HT9 A;  4MZM A;  2XID A;  4M7D A;  3QXE B;  4BD3 A;  1YCY A;  1QCO A;  4FL6 A;  4LE9 A;  3OYH A;  3LGL A;  2K4Y A;  4L59 A;  2OTL A;  1AZE A;  4RCB A;  1I0C A;  4KH1 B;  4Y92 A;  4LN2 A;  3JB9 F;  1WHL A;  1VYT A;  3EG0 A;  2OJ2 A;  1FMV A;  3CPF A;  3CCL Q;  4XU3 A;  2EW3 A;  1ZLM A;  4E7J A;  1NPP A;  4HVU A;  2F2X A;  3M0U A;  3QWX X;  3CCU Q;  3SB2 A;  1VQL T;  3LX7 A;  1NE8 A;  1NJI U;  4IIM A;  1YJW T;  2F2W A;  2QXF A;  2LNV A;  3VYH B;  1RAH B;  1BIB A;  5HY6 A;  4BDZ A;  1PRL C;  3AT1 B;  2LT1 A;  2AKL A;  3HL8 A;  5FU7 B;  2E3H A;  1M27 C;  2KMT A;  2D6F A;  4JZ4 A;  1D0Z A;  3CCE T;  5EG2 A;  3J7A F;  4M78 C;  4A4H A;  1TH7 A;  3QYH B;  2BZ8 A;  4XQ3 A;  2GQV A;  2EJF A;  3V8K A;  3CD6 A;  1N5Z A;  3CC7 A;  1QCN A;  3RKX A;  1YWO A;  2OTJ T;  3I56 T;  3X20 B;  1K8A R;  3REA B;  2FYK A;  4E7L A;  2X4X A;  1TXQ A;  4BE1 A;  1M1G A;  1WA7 A;  1PSE A;  2K9G A;  1K0S A;  4PJO C;  5KYU B;  1OUL A;  4VUB A;  3OYD A;  1JJ2 A;  4HCB A;  3OBY A;  1H8K A;  4JLG A;  4EMK B;  1QVG A;  4ESR A;  2MI6 A;  2KK4 A;  1ABQ A;  2DL5 A;  2EYX A;  1IHW A;  2JTF A;  3MP6 A;  3PVQ A;  1YHQ A;  3M58 A;  2ECZ A;  1HSQ A;  1JBM A;  2J05 A;  2QI2 A;  2O2O A;  1M3A A;  1I8F A;  1QVG S;  1ZUU A;  3T9N A;  2KQW A;  1A0N B;  1RL2 A;  4HCK A;  2KRN A;  2Z0W A;  5GAM h;  3OYC A;  3THK A;  1GCP A;  1X69 A;  3GNG A;  1KJW A;  2DRM A;  1TG0 A;  3CC4 T;  1NBE B;  3HTR A;  5D6W A;  4E47 A;  2HBP A;  3RER A;  1Y96 B;  3X26 B;  4B9X A;  2RA2 A;  3A8M B;  4FSS A;  5FU6 C;  5DM7 R;  1Q81 R;  1Q81 C;  2QDL A;  2YRC A;  4FT4 A;  4M7D G;  1K1Z A;  1UGS B;  3CBM A;  2YUP A;  2VAS A;  1JO8 A;  1K9A A;  1QVG P;  2KI7 A;  3QSU A;  2ZPB B;  2H3E B;  4QVZ A;  1K4U S;  3NMZ C;  3QO3 A;  1LOJ A;  3CCS Q;  1RAA B;  3OMC A;  1TU0 B;  1K73 R;  1K73 C;  2O4X A;  1QQJ A;  5I11 A;  5KE3 A;  1AD5 A;  4JDS A;  1VQ6 T;  5GMK h;  1XJW B;  4GBQ A;  4XTX A;  3I55 T;  1Q86 U;  2X4W A;  4R0K A;  3VS5 A;  4P5N A;  1WGS A;  1WIE A;  3FIF A;  2YSQ A;  4RTV A;  3OS1 A;  3CCV T;  4D6W A;  2SEM A;  4ZGJ B;  2F2V A;  2DL8 A;  2AT1 B;  1H3H A;  1RI9 A;  2EJG A;  1Y57 A;  3OYY A;  4FW2 A;  4QT7 A;  3M0T A;  3G71 Q;  4M7A G;  2CS7 A;  1G3Y A;  1BCO A;  2PUK B;  5GJW B;  1YP5 A;  3LLR A;  3CCL A;  2KY9 A;  4J9F A;  1KQ1 A;  3CCU A;  1NJI C;  5GAN 2;  3EGU A;  1PKS A;  3MO8 A;  1TUD A;  4FIB A;  1TUG B;  3H41 A;  3NTI A;  3SEM A;  3GIB A;  2JS0 A;  4PJO A;  5CIU A;  1RAG B;  4A4G A;  2HAX A;  2DAQ A;  2RHI A;  4IUV A;  3L2Q A;  1UEC A;  2DXT A;  2ZPH B;  1M9S A;  3EFO B;  4M75 A;  1TTH B;  1S72 T;  4CC3 A;  5GAN g;  4OB0 B;  4J7F A;  2DF6 A;  2FPD A;  1PRM C;  4BY6 C;  4DBH A;  1LCK A;  3X28 B;  3RKY A;  1GFD A;  5J39 A;  2DKG A;  2L5Q A;  2GF7 A;  2K2V A;  2ZPI B;  3UA7 A;  2DIG A;  3G7Z A;  3D7S B;  1ZA1 B;  1YJN T;  1B3Q A;  2HKN A;  2FRW A;  2DE0 X;  1WLP B;  1SEM A;  2Y90 A;  2A3L A;  3M56 A;  1M2V A;  3LGF A;  3QZ9 B;  4M7D F;  5CR2 A;  2RPN A;  5GJV B;  2O9S A;  2JNG A;  2CT3 A;  1AWJ A;  3JV3 A;  1GFC A;  4J83 A;  1KD1 R;  2RHY A;  2VVK A;  4OMN A;  1VQM T;  4M77 D;  3QZ5 B;  5CKD A;  5GAN f;  1WJQ A;  2FRY A;  4LUD A;  2RQW A;  5DY9 A;  2AHJ B;  5KYN A;  3CCR Q;  1J3T A;  2EKO A;  4TVR A;  4QVC A;  3G6E Q;  3JCM e;  5LJ3 g;  4OB2 B;  4LD6 A;  1OV3 A;  1IHV A;  1JRI A;  1CSK A;  2ESW A;  4LDY A;  4WF2 A;  1BB9 A;  1UGQ B;  2LQW A;  4CC4 B;  2CP6 A;  2QK0 A;  1XTD A;  4M7A F;  1VQ7 T;  2LNH B;  1RAI B;  2RJD A;  4Z02 A;  3QWY A;  2J6O A;  1SHG A;  2BE7 D;  1YFN A;  3A98 A;  3JCM d;  5GAN 8;  4AFS C;  1WQ7 A;  5GMK m;  4BDY A;  2BZX A;  4JZ3 A;  2BTT A;  2RF0 A;  4M4Z A;  2KSS A;  4M7D E;  4LDU A;  2EYZ A;  2R5M A;  3C0C A;  2YLC A;  3LYI A;  5GAN 5;  5LJ3 f;  1I4K 1;  2JTM A;  5GAO n;  3TRE A;  3CCS A;  4DEX A;  3OYI A;  2KAF A;  1OPL A;  3A8H B;  3OSS C;  2BIV A;  1VQ5 T; 
#chains in the Genus database with same CATH homology
 1NLP C;  1Z9Q A;  1QKX A;  4GLM A;  5IH2 A;  3M0S A;  2O88 A;  1MUZ A;  1U5S A;  2KBT A;  1S1N A;  1UGV A;  3H0H A;  3UF4 A;  3EG2 A;  4F16 A;  2DX1 A;  2D1X A;  1WI7 A;  3IQL A;  3VRY A;  2DNU A;  2JXB A;  1W6X A;  2RNA A;  1B07 A;  2KEA A;  1UTI A;  2CSI A;  3I5S A;  1OEB A;  1PKT A;  1JQQ A;  4ORZ A;  2OI3 A;  1HJD A;  1T3S A;  2A36 A;  5HCK A;  1ZX6 A;  2MOX A;  1YCS B;  3GBQ A;  2KNB B;  1AWW A;  2GNC A;  2MCN A;  1I07 A;  2A37 A;  2YUQ A;  3SHW A;  2KYM A;  2JM8 A;  2LJ0 A;  2LQN A;  3U23 A;  3TSW A;  2JMC A;  2ED0 A;  3VS0 A;  1PWT A;  1WXB A;  1QWF A;  1UFF A;  1NG2 A;  2DL7 A;  2AK5 A;  2DA9 A;  2HBW A;  1GBQ A;  2SRC A;  3NGP A;  4LE9 A;  4J9H A;  2OAW A;  3TSZ A;  1AZE A;  1JU5 C;  1I0C A;  4Y92 A;  4LN2 A;  4J9D A;  1BU1 A;  3VS4 A;  1VYT A;  3EG0 A;  1U06 A;  2CT4 A;  1FYN A;  2OJ2 A;  4J9I A;  2B86 A;  2YUO A;  2EW3 A;  1ZLM A;  4HVU A;  2F2X A;  1GCQ C;  2DIL A;  2L2P A;  2GTJ A;  2JTE A;  2VWF A;  3M0U A;  1AWX A;  3QWX X;  3UAT A;  5EC7 A;  2MIO A;  4IIM A;  2F2W A;  3EG1 A;  2LMJ A;  2CRE A;  1NM7 A;  2K7A A;  3M0R A;  1RUW A;  4Z8A A;  2D0N A;  2KYB A;  1PRL C;  1NEB A;  1UG1 A;  2AKL A;  2FPF A;  1M27 C;  2GGR A;  1OPK A;  3LH5 A;  2J06 A;  2DL3 A;  4JZ4 A;  1T0J A;  1EFN A;  1ZSG A;  5IXB A;  4JJC A;  2BZ8 A;  1CKA A;  2DM1 A;  2XMF A;  4Z89 A;  2W0Z A;  2PNI A;  1N5Z A;  1SPK A;  3REB B;  2J7I A;  4HXJ A;  3EHR A;  1YWO A;  1ABO A;  2DMO A;  1G83 A;  2YDL A;  4AFU C;  3REA B;  4J9C A;  1WA7 A;  1X6B A;  2O9V A;  2K9G A;  2G6F X;  1K0S A;  2NWM A;  4CC7 A;  5ECA A;  2ENM A;  3VS6 A;  1WFW A;  2GTO A;  2GBQ A;  1M30 A;  2K79 A;  4D8K A;  3UA6 A;  1H8K A;  4RTZ A;  2LCS A;  1SHF A;  3ULR B;  4ESR A;  1KFZ A;  4Z88 A;  1ABQ A;  2DL5 A;  1WX6 A;  2KXC A;  3CQT A;  2EYX A;  5L23 A;  2CDT A;  3PVQ A;  3ZL7 C;  1SRL A;  2JS2 A;  3R6N A;  2VKN A;  2CUB A;  2ECZ A;  4IIO A;  1HSQ A;  4JPB W;  2J05 A;  2O2O A;  1FMK A;  2D8J A;  4X1V A;  1M3A A;  1ZUU A;  2L0A A;  3H0I A;  2HDA A;  1YN8 A;  1A0N B;  4AFZ C;  2DYB A;  4HCK A;  2KRN A;  2JW4 A;  1TUC A;  4OMP A;  1AWO A;  3THK A;  2JMA A;  1GCP A;  4OMQ A;  1X69 A;  1KSW A;  1H92 A;  1X2Q A;  1KJW A;  1ZBJ A;  2DRM A;  1TG0 A;  1ZUY A;  2EKH A;  3I9Q A;  5FWB A;  2LZ6 B;  3EG3 A;  1AEY A;  1AZG B;  1QWE A;  2HCK A;  2JT4 A;  4FSS A;  4AG2 C;  1E6G A;  2I0N A;  2A28 A;  1WYX A;  2QDL A;  1K1Z A;  1U3O A;  2ROL A;  1UJ0 A;  2IIM A;  3NHN A;  2YUP A;  2EGE A;  3M0P A;  1JO8 A;  1K9A A;  2K3B A;  3VS7 A;  2CSQ A;  4LUE A;  4EIK A;  1WXT A;  1K4U S;  2DJQ A;  3NMZ C;  2KR3 A;  4AG1 C;  1RLQ C;  1M3B A;  2M51 A;  4AFQ C;  5I11 A;  2L3P A;  3VS1 A;  1SSH A;  2FPE A;  4DEY A;  1AD5 A;  2RQR A;  4GBQ A;  2P4R A;  2RN8 A;  3NPF A;  4F14 A;  4R0K A;  5IXF A;  3VS5 A;  1WIE A;  4RTU A;  2YSQ A;  4RTV A;  1NLO C;  2DVJ A;  4ZNX A;  2EGC A;  1NEG A;  2SEM A;  2F2V A;  2DL8 A;  3KFV A;  2KRM A;  1H3H A;  1RI9 A;  1Y57 A;  4QT7 A;  4OMM A;  2A08 A;  3M0T A;  2FG0 A;  4JJD A;  2PZ1 A;  2YT6 A;  4OMO A;  1WXU A;  1K0X A;  3TVT A;  1E6H A;  5GJW B;  2EVR A;  1YP5 A;  2LJ3 A;  4D8D A;  3EHQ A;  3RNJ A;  4J9B A;  1CKB A;  4RUG A;  2DL4 A;  4J9F A;  5FWC A;  2AZV A;  2NUZ A;  3EGU A;  1NYG A;  1M3C A;  1PKS A;  1X2K A;  4RTT A;  1TUD A;  1W70 A;  2FEI A;  1X6G A;  3H41 A;  3SEM A;  1AOJ A;  2D8H A;  2JS0 A;  1WDX A;  2EQI A;  3O5Z A;  3PE0 A;  2C0T A;  1QLY A;  1UEC A;  2GQI A;  5IHN A;  2K2M A;  2RQU A;  2DBK A;  1X43 A;  2KGT A;  3I5R A;  1HD3 A;  1SRM A;  2KT1 A;  2E5K A;  4CC3 A;  1Z9Z A;  2DF6 A;  2KXD A;  2FPD A;  1PRM C;  2ED1 A;  1LCK A;  2EBP A;  1Y0M A;  4LNP A;  2KRS A;  3M0Q A;  1GFD A;  1G2B A;  1T3L A;  2HSP A;  2FO0 A;  1MV3 A;  4E6R A;  2RMO A;  1BK2 A;  2LX7 A;  3UA7 A;  2DRK A;  2J6F A;  1B3Q A;  2PTK A;  4WCI A;  2L3S A;  1ZUK A;  2FRW A;  2RQV A;  2AKK A;  2DE0 X;  1AVZ C;  1SEM A;  1WLP B;  2EYW A;  4JJB A;  1IO6 A;  1K76 A;  1UJY A;  2ABL A;  1JEG A;  2RPN A;  5GJV B;  2O9S A;  2X3X D;  2CT3 A;  5IHI A;  1AWJ A;  1VYV A;  1GFC A;  3JV3 A;  4J9G A;  2EGA A;  2VVK A;  1GL5 A;  1JXM A;  4OMN A;  3PVL A;  1YNZ A;  1E7O A;  1I1J A;  2X3W D;  2HEQ A;  1V1C A;  1KIK A;  1PHT A;  2H8H A;  1VYU A;  2FRY A;  4LUD A;  2RQW A;  1X27 A;  1JXO A;  2O31 A;  2W10 A;  1PNJ A;  1J3T A;  4K11 A;  3H0F A;  1T0H A;  1GCQ A;  2KE9 A;  3RBB B;  1QKW A;  1RLP C;  1QCF A;  2L3Q A;  4HVV A;  2KRO A;  5I22 A;  1UHF A;  1OV3 A;  1CSK A;  1W1F A;  2ESW A;  1BB9 A;  3VS3 A;  2K6D A;  2V1Q A;  1YWP A;  2J6K A;  2LQW A;  2JM9 A;  4HVW A;  1GRI A;  2DLP A;  2C0I A;  4CC4 B;  1ARK A;  5FW9 A;  4CC2 A;  2CUD A;  1XOV A;  1M8M A;  2EPD A;  2LNH B;  1VA7 A;  3QWY A;  2J6O A;  1SHG A;  2C0O A;  3A98 A;  4AFS C;  3I35 A;  3FJ5 A;  2CH4 W;  1NYF A;  2KT8 A;  2RQT A;  4F17 A;  2BZX A;  4J9E A;  4JZ3 A;  4OML A;  5IHK A;  2BTT A;  2ROT A;  2DBM A;  2RF0 A;  4RTX A;  1UUE A;  4M4Z A;  2M0Y A;  1GBR A;  1UHC A;  1MV0 B;  2BZY A;  2V1R A;  4RTY A;  2AZS A;  4A63 B;  2LJ1 A;  2EYZ A;  3C0C A;  1OOT A;  2LP5 A;  2CH4 A;  3VRZ A;  3VS2 A;  1UE9 A;  1BBZ A;  2EYY A;  4DEX A;  1UDL A;  1OPL A;  2YUN A;  4KRT A;  4RTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...