2JMCA

Chimer between spc-sh3 and p41
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
77
structure length
77
Chain Sequence
GAMGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQESGDNAPSYSPPPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain and P41 peptide chimera
publication title The high-resolution NMR structure of a single-chain chimeric protein mimicking a SH3-peptide complex
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 7
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jmcA00
3NHNA 2AZVA 3NGPA 2RNAA 3QWYA 4JPBW 3UATA 4GLMA 1NLOC 1UTIA 2LMJA 2LQNA 3FJ5A 2L0AA 4KRTA 3H0FA 1OV3A 5FWCA 3R6NA 1UHCA 3O5ZA 4X1VA 2K7AA 2V1RA 2LP5A 1LCKA 2KYMA 2W10A 2KRMA 1AWWA 2LJ1A 4RUGA 1ZUYA 4IIOA 1ZSGA 3PE0A 3PVLA 2YUPA 3VS6A 1RLPC 1UECA 2CSIA 2V1QA 2EPDA 2O31A 4HVUA 2FPEA 1U3OA 2DM1A 2L2PA 4ORZA 2K6DA 2MOXA 4J9CA 5HCKA 3UF4A 3KFVA 1E6GA 2AK5A 1E7OA 1W70A 2BZXA 5GJVB 2HBWA 1WI7A 1Z9QA 2F2XA 4WCIA 2L3SA 1VYUA 4M4ZA 4Y92A 4Z8AA 4DEYA 2IIMA 4J9DA 2MIOA 3M0QA 1KJWA 4CC7A 1OPLA 4F16A 2I0NA 1UUEA 2KXCA 3EHRA 2BTTA 1NEBA 3U23A 2VKNA 4QT7A 4Z88A 2CH4W 1CSKA 1EFNA 1HSQA 1HD3A 2EGAA 1W6XA 2L3QA 1K9AA 2EGEA 1AWXA 3REAB 1CKAA 2FPFA 1YP5A 4AG2C 1SRMA 2FRYA 1BU1A 2GQIA 1JXOA 1M8MA 2JW4A 4HXJA 2DL7A 3M0SA 3NMZC 4RTWA 2DLPA 2DE0X 1M3BA 2RQUA 2AKLA 3C0CA 4Z89A 1G2BA 1H8KA 2D8JA 2RQWA 1NEGA 1V1CA 2DYBA 2QDLA 2CSQA 2RQTA 1NLPC 2DNUA 2KROA 2A28A 2G6FX 3RBBB 3VS5A 2FO0A 4ESRA 1JO8A 4F17A 4HVVA 4OMPA 2BZYA 1T3LA 2E5KA 4J9IA 2J06A 2LCSA 4RTVA 1GBRA 2YUQA 4JZ4A 1IO6A 1RUWA 3M0UA 2YT6A 1SEMA 1YNZA 4EIKA 1J3TA 2NWMA 1UJYA 2J6OA 4RTXA 1UFFA 1X69A 2ESWA 2DRKA 1WDXA 3GBQA 1GCPA 1S1NA 2DILA 2LQWA 2YUOA 2J6KA 5IXBA 1ZUKA 1ZBJA 3H0HA 4CC2A 2DA9A 2O2OA 1ZUUA 1H3HA 3RNJA 3I9QA 4DEXA 4F14A 2ROTA 1M27C 2LJ0A 5IHNA 2X3WD 3THKA 2DL8A 2KT8A 1B3QA 1ARKA 1SHFA 4LUDA 4D8KA 3EGUA 3ZL7C 2O88A 1UE9A 2JM9A 1GBQA 2KBTA 3M0RA 2W0ZA 1FYNA 2FPDA 4OMQA 3I5SA 2A36A 2PTKA 1K76A 1UGVA 1ZX6A 1TUDA 1M30A 2J7IA 1H92A 1PRLC 2KYBA 2ROLA 4CC3A 2A37A 2RQVA 2FRWA 1CKBA 1AWJA 1TG0A 2GTJA 2OAWA 3EG1A 2FEIA 3JV3A 1NG2A 2KXDA 2PZ1A 1GFDA 3QWXX 4AFQC 3EG0A 1QCFA 2CUDA 1K1ZA 5ECAA 2JM8A 1MV0B 2C0IA 1T0HA 1WXUA 2MCNA 4JJBA 2DL5A 2JMAA 1I07A 1QWFA 3I35A 1AVZC 1GRIA 2ED1A 1NM7A 1JEGA 2DL3A 2KEAA 2SRCA 4HVWA 4AFSC 1K4US 5I22A 5FW9A 3NPFA 1PHTA 2ED0A 2H8HA 2RPNA 2YDLA 2EYXA 1NYFA 1X6GA 3SHWA 2CUBA 2EYYA 4A63B 1T0JA 4LN2A 4IIMA 2LJ3A 5FWBA 1WX6A 1AZEA 1K0SA 4J9FA 2GGRA 3TSZA 2C0OA 4OMNA 1XOVA 1Z9ZA 3EHQA 2EYZA 1X2KA 2VVKA 3PVQA 2J6FA 2EKHA 2J05A 5IHKA 2D8HA 2KRSA 4LUEA 2DJQA 1AZGB 1OEBA 2DF6A 2M0YA 4GBQA 5EC7A 1A0NB 1WXBA 4AFZC 2YUNA 3TSWA 1QKWA 4D8DA 1X27A 2LNHB 2OI3A 2F2WA 2JS2A 2PNIA 3VS3A 1GL5A 3REBB 2EGCA 2GBQA 3M0TA 1X43A 3VS0A 1BBZA 1SSHA 2D1XA 2OJ2A 1JU5C 3M0PA 1VA7A 2DBMA 2M51A 2JMCA 2D0NA 1Y0MA 3SEMA 1UG1A 1KSWA 1W1FA 2BZ8A 2DBKA 3VS1A 2JT4A 1JXMA 1PRMC 1AEYA 4ZNXA 2P4RA 4AFUC 1BK2A 4OMMA 1VYVA 2C0TA 3H41A 1YN8A 4RTTA 1RLQC 2GTOA 3VRYA 2CT4A 1SHGA 2VWFA 2DMOA 1M3CA 1BB9A 1QWEA 1E6HA 2K9GA 2HDAA 1WLPB 2RF0A 2JS0A 4J9EA 2LZ6B 1G83A 1KIKA 2EW3A 2CH4A 2O9SA 1PKSA 2CDTA 2GNCA 1ABQA 2L3PA 2HSPA 4CC4B 1FMKA 1VYTA 1GCQA 2HCKA 1AWOA 1X2QA 1GFCA 2DVJA 1AD5A 1JQQA 2EBPA 4OMOA 5IXFA 1I1JA 1SRLA 2ENMA 1I0CA 1PKTA 1PNJA 2KE9A 4R0KA 2XMFA 2A08A 3I5RA 1YWPA 5IH2A 1N5ZA 1GCQC 1B07A 3EG2A 2EYWA 1WFWA 1NYGA 3TVTA 4RTZA 1Y57A 4AG1C 4HCKA 1M3AA 1PWTA 4J9HA 1KFZA 4JJCA 2AZSA 2RN8A 4LE9A 2FG0A 2KR3A 4JJDA 2HEQA 2AKKA 1U06A 1RI9A 1WXTA 2RMOA 1UHFA 2ABLA 2EVRA 5L23A 3IQLA 5IHIA 4RTYA 1WA7A 4J9GA 4FSSA 1ABOA 1TUCA 1YWOA 3ULRB 3LH5A 2CREA 1T3SA 1UDLA 2K2MA 3VRZA 1OOTA 3H0IA 1K0XA 2KGTA 3A98A 2DRMA 1MUZA 1UJ0A 2K79A 3UA6A 2DL4A 2DX1A 2F2VA 1WIEA 4LNPA 1OPKA 2B86A 1AOJA 2JXBA 2NUZA 2X3XD 1YCSB 5GJWB 2KNBB 4K11A 1MV3A 2K3BA 2O9VA 2JTEA 2RQRA 4JZ3A 2KT1A 2LX7A 1U5SA 2CT3A 4J9BA 2SEMA 3VS4A 2YSQA 3EG3A 3VS7A 3CQTA 2KRNA 4OMLA 3VS2A 4E6RA 1SPKA 5I11A 1WYXA 1HJDA 1X6BA 3UA7A 2ECZA 4RTUA 1ZLMA 1QKXA 1QLYA 2EQIA
chains in the Genus database with same CATH superfamily
3NGPA 2RNAA 3L1AA 5DY9A 1VQ8Q 1UTIA 2LMJA 1BIBA 4EMHA 1KHIA 4C8QE 4E7IA 3H0FA 1M2VB 4M7DA 5FWCA 2K5IA 2K7AA 2V1RA 2LP5A 3G71Q 4AT1B 1MMAA 2IG0A 2ZCFB 3I55Q 2P4TA 8AT1B 4PNOA 3QKJA 2RA2A 3P8DA 1S72Q 1Q7YC 1YITT 4RUGA 3PVLA 2JTMA 3CCRQ 2YUPA 3NTIA 1LVKA 1UECA 2G3RA 2A3LA 3M53A 4HVUA 3VYGA 2OTLA 2DM1A 4HCZA 1I4K1 4QQDA 2X4WA 5D7UA 1TU0B 3UF4A 1WJRA 2AK5A 3HP9A 2O4XB 1VUBA 1IB8A 2JN0A 3CCST 1VQOA 3G6EQ 2VV5A 1VYUA 2I2LA 1AHJB 4DEYA 3CXCA 3JCMP 4IUPA 3EAEA 4LDVA 3RDVA 1QQJA 5A0LA 2A7YA 1M4ZA 3OYFA 3EHRA 1WHGA 2CP3A 3MEAA 1NEBA 3QDFA 2P0PA 1X75C 3A8LB 1YHQT 2EGAA 1BI0A 3OS5A 1AWXA 3REAB 4AG2C 3HFOA 5A2QE 1BU1A 2COWA 2GQIA 1ZA1B 2GQVA 1HYOA 1RACB 3CCET 4HXJA 1QP2A 3M0SA 3CCLT 4M78G 4C0ZA 2DPPB 3EGDB 4Z89A 1PCXA 1H8KA 3RKXA 4M75D 2DEQA 5KCOA 2CP7A 1VQ4Q 2RQWA 3RKYA 2DXTA 3EFOA 2DYBA 1K73R 2FVUA 4E7LA 4FW1A 1KD1C 2RI5A 4NOYA 1YIJT 5IT9E 2F69A 4HVVA 4M7DE 1SF9A 2A0FB 2LVMA 2OTJA 1T3LA 3A8GB 1VQKT 1YI2A 2YUQA 3P8BB 3X24B 1IO6A 2D6FA 3M0UA 3CCUQ 4XAXB 1VQPQ 4EIKA 2QA4Q 5CO7A 1YJWQ 3VU3C 5M9OA 1UFFA 1X69A 2ESWA 5GMKm 3OW2P 1Q7YU 4M75B 2KMTA 4M7AA 2FHDA 2HSEB 3CCJA 1ZBJA 2DA9A 2RD1A 2O2OA 4VUBA 1NJIR 4ELYC 2PUOB 3RNJA 1I5LA 2YRDA 4C5GA 2DXUA 1QMCA 5I2MA 3R6OA 1KG1A 2PU9B 2CZ1B 2DIGA 1ARKA 4LUDA 1NZ9A 2QG9B 1PC0A 4HCCA 5KYUB 4E7KA 5IAYA 3E9FA 3I5SA 1R77A 2A36A 4ME7A 1ZX6A 5I21A 4N4GA 1VQ8T 1ACMB 2RQVA 4V2SA 1IHWA 2GFAA 1ZBXA 2GTJA 2OAWA 3EG1A 5CAIA 3CC4Q 2VYTA 1RABB 3G71T 1VQ9A 4LDWA 1NG2A 2KXDA 1VIFA 1YJ9Q 3HSBA 5ECAA 4B6MA 4LDXA 1XNIA 2C0IA 1WXUA 1RAFB 2DXCA 4JJBA 3CCRT 3RUXA 1G3YA 4FU6A 1QWFA 4F7UA 4N0AA 1N6AA 2QQSA 4D6WA 4MMLA 1AVZC 1EZZB 3N5BB 1JEGA 3TU4K 1MGQA 2SRCA 4HVWA 4AFSC 1AT1B 4XTYA 5FW9A 3CCMQ 1K4US 5CQYA 2ED0A 1NYFA 3UPUA 2EYYA 1T0JA 2RO0A 4E47A 2DERA 3G6ET 1WX6A 2GGRA 2C0OA 1KD1U 3JB9F 1XQHA 5GMKh 4RG8A 4QW2A 4XK8E 3CMAA 4HA8A 1OEBA 2DF6A 4ATOA 1Q95G 1TWBA 4M7AE 2EFIA 5GAN4 2LNHB 3PMTA 1XTDA 2JS2A 2JOYA 2EGCA 4OP0A 1X43A 1G8XA 2XD0A 1OI1A 4DBFA 3VS0A 4BACA 2D1XA 1SSHA 4JRPA 2CGHA 1C6VX 1VQMQ 2EAYA 1Q81C 2BZ8A 1O9SA 1KC8R 2JT4A 3OSSC 4WF2A 2F5KA 4AFUC 1VQ4T 1OX8A 2KSSA 2C0TA 3QZ5B 2VGMA 2CT4A 2QI2A 1QWEA 3CC7Q 2EQKA 3JB9J 2HDAA 2RF0A 2JZ2A 2EW3A 1B7TA 2CH4A 1WPYA 4LD6A 1W2BS 4KUDK 3ER0A 5CQXA 2L3PA 3CCUT 1VYTA 4OVAA 2QA4T 4MDXA 2HCKA 4Q5WA 1YJWT 3CCQQ 1AWOA 1GFCA 1JJ2S 4R55A 1JQQA 4OMOA 2KI7A 3GOXA 3HRTA 1PNJA 4M77E 1G3SA 2BE9B 4ZN3A 2XMFA 4PJOB 2WACA 5CR2A 3CC2Q 2ZPEB 4BUGA 1Q7YR 1W4SA 3EG2A 2EYWA 3RMSA 3T9NA 3TVTA 2Y4YA 3ME9A 2QXFA 2CP0A 1M3AA 2XKOC 3OYYA 2HL3A 4M78F 4OB1B 4RG2A 3M9QA 1W2BA 2RN8A 2DD5A 4OB2B 3JSCA 4C92E 1I8FA 1VQ7T 2DZ9A 2KR3A 4JJDA 2HEQA 2AKKA 1U06A 4B9XA 4QVDA 3JCMV 5L23A 5IHIA 4IURA 4ELZC 1JJ2A 4FSSA 1WHMA 1ABOA 1TUCA 4XTUA 3FLGA 5GAMg 2CREA 1V29B 3WXMB 3FDRA 3CC4T 1UJ0A 2K79A 2ZGWA 2RHIA 2DX1A 3ZBDA 3JAME 2NYSA 2QEXA 1Y07A 3JB9I 4F7UB 2KNBB 4K11A 1YITQ 2DJZA 2K3BA 3OYLA 1RAEB 4C8QG 4C0GA 2KT1A 3M5AA 1M90C 4NL2A 1N27A 2CT3A 3VS4A 2Z0WA 3EG3A 4JS5A 3MPUB 1ZSZA 3X26B 1Q81U 3GLXA 4OMLA 2H3JA 2XDDA 1WYXA 3UA7A 4M77F 2EQIA 7AT1B 2AZVA 2QTVA 2O4XA 5GAOl 1NLOC 2LQNA 3CCVT 2L0AA 1RAIB 1UGPB 1UEBA 3R6NA 5GAN8 1KD1R 1LCKA 2HNIA 4C92F 4KGVB 3V8LA 1GXIE 2E4HA 4DOVA 1OU9A 2OTJQ 2LJ1A 1AWWA 2LNVA 4UC4A 1YHQQ 1YI2Q 4PK4A 1D3BB 1RLPC 2V1QA 2EPDA 1D0XA 5GANg 4Y28E 1U3OA 4M78C 2K6DA 2COZA 1K9MC 4A53A 3CCLQ 1E7OA 1IGQA 1VQLA 3CPWS 4M75G 1K73U 4WCIA 2L3SA 2XG8D 4M4ZA 4Z8AA 3INZA 3QZ9B 2EQMA 3M0QA 1MHNA 4FSXA 5LJ3g 4KULA 3U23A 4QT7A 4Z88A 2CH4W 4JDSA 3JCMg 1FWZA 4PL6A 1VQKQ 5GANh 2LQKA 1K9AA 2RHZA 4B9WA 1B34A 4GY5A 2FRYA 2K5LA 1RAAB 2MK5A 2JW4A 3CPWA 4M7DG 5KYNA 3FRNA 1BCOA 3M57A 1RAGB 2DE0X 2VXEA 1YBYA 2R5MA 1VQ5A 2RQUA 2PVDB 2AKLA 3C0CA 2DXBA 2DFUA 1VQ9Q 2DTOA 1M90U 2JJ9A 1KC8C 2D8JA 2HL5C 4M77C 2RH2A 2HAXA 5FU7C 1NEGA 4Y91A 3AHUA 2CSQA 2RQTA 3P8HA 5LJ3h 1NLPC 2PVOB 3SFMA 1Y71A 4ZTJA 2OTLT 3JCMh 3VS5A 1H3ZA 2FO0A 5KH6A 1JO8A 4KH1B 3JB9G 1M5Q1 4XTZA 4C92C 2E64A 1KHCA 1VQOT 4JZ4A 1JB0E 5FLXE 2YT6A 2CP5A 1SEMA 5LJ5g 1Q86R 1J3TA 4ANJA 4KUIA 1UJYA 4DQ2A 2XK0A 3L2RA 1GCPA 4DBHA 3C12A 2K4YA 1KQSS 2DILA 3MEWA 2J6KA 5IXBA 4IUVA 2FL7A 4BY6C 2GF7A 4CC2A 5DLOA 2EYQA 2QQAA 2EJ9A 3L2ZA 4F14A 2ROTA 3GPLA 1M27C 4J5YA 2O01E 5IHNA 1ZSZB 3ZFJA 1K9MU 2PUKB 1UGRB 3SB2A 1SHFA 3EG9A 3OYNA 9ATCB 3C95A 3FB9A 2E5QA 3C4SA 1OULA 1QVPA 4C5HA 3M0RA 1QVGS 3OBWA 4LDYA 2FPDA 1Q81R 2R5AA 2L5QA 5LJ5h 1KQSA 1UGVA 1TUDA 1RL2A 1PRLC 2ROLA 5GAMd 2PVGB 1UB4A 1AWJA 4FT2A 2FEIA 4QQGA 2PZ1A 3WVEB 4LDUA 4OMFB 1QCFA 1QP3A 1K1ZA 1PG5B 4A4GA 2ZPIB 2OTJT 1MV0B 4PFZA 2CYZB 1T0HA 2K5FA 1YI2T 2MCNA 3OY9A 3A8OB 2JMAA 1QVGA 3LW5E 5FU6B 4M75E 4L5GA 1ZHIA 2DL3A 2LQ8A 3EGXA 4P5NA 2R57A 2H8HA 3KUFA 2RPNA 1PM3A 3E19A 4C8QF 1KC8U 4EMKA 4M7AG 3HFNA 4A63B 3SWNC 2K3XA 3CCJT 2LDMA 4LXCA 3ZEHA 2YLCA 3NTKA 1K0SA 2CZ0B 4J9FA 1N8RC 1M1KR 3OYBA 2YRVA 3TSZA 3M4YA 1XJWB 2MWPA 4OMNA 5KYXA 4DBRA 3NFCA 3EHQA 1IGUA 5FRMA 2J05A 1HXDA 4RCCA 1HK9A 2C06A 1BYMA 1AZGB 4GBQA 2M0YA 2QQRA 1Y7XA 1B34B 5GAOq 4AFZC 4XU0A 2YUNA 3TSWA 1YFNA 2F5TX 2EQJA 2XU8A 5CKHA 1GL5A 4N4IA 2OAUA 8ATCB 3LH0A 5HY6A 2MF2A 1X6OA 3DLMA 5GANd 2OJ2A 1JU5C 2XDPA 1WQ7A 5GMKj 1VQ9T 6AT1B 1KSWA 2DBKA 3VS1A 3I56Q 2AHJB 1JXMA 1PRMC 2L3RA 4PJOA 3FC3A 3RERA 1M90R 3H41A 1YN8A 3FJPA 1SHGA 1F1BB 1M3CA 2RHYA 4M77G 1G3WA 2CZ6B 1SSFA 3QXEB 1MNEA 1D0YA 4M75F 2LZ6B 1G83A 1RAHB 1VQ7Q 1LJOA 4A4FA 1PKSA 3QG1A 5GAN7 2GNCA 1MNDA 1ABQA 2P0QA 1FMKA 1GCQA 3RKWA 4C92G 4KH0B 1LPLA 5IXFA 3OYHA 1PKTA 2K2VA 1JBMA 2NLUA 4C8QC 3CMAT 4BD3A 1VOMA 1YWPA 4PFOA 4M7DF 4CI0C 3EG9B 4RTZA 1IZ6A 2V8IA 1TH7A 4C0DB 1KFZA 2XIDA 2E3HA 2FG0A 1K9MR 1WXTA 1UHFA 2XICA 3IQLA 1N8RU 1WA7A 2B8AA 5CCAA 4NL3A 1M1GA 3G7ZA 1FMVA 3CCVQ 1Q86C 4EMGA 3VRZA 1D09B 2KGTA 5HKCA 2DKGA 1WJQA 1FX7A 4XTVA 1YJNA 1MUZA 2RHXA 1OZ2A 4FYXB 3O8VA 5LL6S 5GAMf 2X9HA 4LNPA 1WQWA 4E7HA 2X3XD 1YCSB 4JZ3A 5D6WA 4BE1A 1U5SA 3BY7A 3EGXB 4PJOE 4J9BA 1D3BA 4EMKB 3VS7A 5CVIA 3I55A 2IVWA 3CQTA 4E6RA 1SPKA 1WZOA 4HKEA 2CZ7B 1U1SA 1S72A 4M75C 1VQ5Q 3TCJA 1D1CA 1PSFA 5KYXB 1QLYA 3HPWA 3NHNA 4PJOD 2EKOA 3QWYA 4JPBW 3UATA 3FJ5A 3LGLA 4KRTA 1NBEB 2AT1B 2LRQA 3UWNA 2CP2A 3VKIA 5HK0A 4R56A 2LT4A 1UHCA 1PD1A 3O5ZA 1QVFP 4X1VA 4DA4A 4J6XA 5KYYA 4M78D 4AMCA 3OW2S 2DTIA 1M8VA 4PJMA 3FIFA 2HKNA 2V26A 5D6XA 2RI2A 4PJLA 1ZUYA 4IIOA 1ZSGA 3PE0A 5GAMj 3CBOA 3VS6A 4M7DC 2HBPA 1DJ7B 3OYEA 4WTOB 4DBQA 4ORZA 1G3TA 2MOXA 5GAOp 4F7UE 2HQHA 2VUBA 5KE3A 1W70A 2E41A 1TTHB 3I56T 2BZXA 2RJFA 3OYAA 1WI7A 1Z9QA 4IUUA 5GANf 2Y90A 5HK3A 2QEXT 3OW2A 2QAZA 1M1KC 2D0QB 4Y92A 1TS9A 2ZPHB 1OYXA 3V8JA 1V76A 1U1TA 2R58A 2MIOA 4M78B 1KJWA 3MHXA 4M7AF 4CC7A 1OPLA 1K8AC 4F16A 2I0NA 1UUEA 2OTLQ 2BTTA 3SD4A 1LOJA 1CSKA 2HKQB 1HSQA 1Q86U 2ATCB 1VQOQ 1YP5A 4KBMB 3V7SA 1D1BA 5LJ3f 1JXOA 4PFPA 2DL7A 3QDRB 3JCMf 1G5VA 1RADB 1M3BA 1TSFA 5GMKl 5GMKe 4BDZA 4EPCA 4C5IA 3LGFA 4FYWB 3CD6A 1VQPA 4PLIA 1YJWA 2HQEA 1V1CA 3QO3A 1H641 5GANj 2DNUA 3J80E 1MMNA 2A28A 2M02A 2G6FX 3RBBB 4ESRA 4O5VA 4FW2A 4IUTA 5KYWB 5CK9A 2QQBA 3GP8A 2DD4A 4X34A 4F7UF 2BZYA 4OB0B 4RTVA 1GBRA 1FXXA 4PJNA 1VQLT 3TEEA 1N8RR 4F04B 3CBMA 2DVEA 4BE2A 2XHCA 5A0GA 3LYIA 4RTXA 1X01A 4PKCC 2DRKA 1UGSB 3GBQA 4LD9K 5LJ3j 3L42A 3CXCP 3JCMW 3UDCA 1ZUKA 3H0HA 2KK4A 1H3HA 3I9QA 1ZA2B 2BE7D 2LJ0A 5GAN6 2X3WD 4J83A 3THKA 2KT8A 3OBYA 1B3QA 1NE8A 3CMEA 1VQNA 4FYVB 2QASA 1R8OB 3MEUA 2HZYA 4M7AC 1YJ9A 3S3NA 2LCCA 3X25B 3ZL7C 2IPOB 2O88A 5J26A 1GBQA 2X4XA 4RCBA 3PTAA 1WJSA 4JJNK 1FYNA 1VQ5T 2EJGA 2LC4A 4BY6B 1M1KU 2DAQA 2M9UA 3NTHA 2KY9A 5GAOr 2PTKA 4TVRA 3CCJQ 1K76A 4FIBA 1M30A 2J7IA 1K8AU 2KYBA 2EJFA 4CC3A 3CCMA 5KYYB 2JUFA 5C0MA 3EFRA 5DM7R 1BI1A 4N4HA 3M56A 2FRWA 3OYCA 1CKBA 3CBPA 2RJDA 3JCMc 4XU1A 3QWXX 1N9SA 5CKBA 3EG0A 2CUDA 3L2UA 4MZPA 3SDZA 2DL5A 2OX7A 3M59A 2ZPFB 4II1A 1Q82R 1WNLA 2LTOA 1NM7A 2LX9A 1QCOA 3G4SA 1X6GA 3SHWA 1WHHA 2CUBA 4LN2A 3QPHA 5FWBA 1AZEA 4N0AC 1IRXA 1XOVA 3DKMA 2EYZA 4FYYB 2ZZDA 2VVKA 3MCAB 2J6FA 3E2UA 5IHKA 1VQMA 4LUEA 2QYZA 3MEVA 2LT1A 3G1JA 2DK3A 5EC7A 1U8RA 5GAMe 1WHLA 4D8DA 2V8KA 2L89A 3LWHA 2P0KA 2L8DA 2OI3A 4JLGA 1VQ6A 2F2WA 4Z02A 3CC7A 2GBQA 4HCBA 4PJJA 1BI3A 1OZ3A 1BBZA 1M9SA 3M0PA 2QQ9A 2DBMA 1RI0A 3C94A 2M51A 2JMCA 2QGFB 3OMGA 2HMAA 3CMAQ 1W1FA 3L2VA 3RESA 2X51A 1SKUB 4J7IA 3CCQA 3BDLA 2WSCE 3OYJA 1RLQC 2GTOA 3RMQA 2M16A 2FZGB 1MMDA 2DMOA 5AYFA 1BB9A 1E6HA 3S6WA 4QQ6A 2ZAEA 2DEUA 1WLPB 1IREB 4J9EA 2JS0A 2JVVA 5J3BA 3CXCS 3CC2A 1KIKA 3FEOA 2RJCA 1UGQB 5D6YA 4C8QD 4E2FB 2MYSA 2FB7A 2HSPA 4C5EA 1KQ2A 3META 1X2QA 2DVJA 1AD5A 2EBPA 5GAN2 4YTLA 1I81A 1SRLA 2KE9A 2YHTA 4XTWA 3HRUA 2A08A 3I5RA 5J39A 3OS0A 3MP1A 5IH2A 2DETA 4E7SA 1B07A 3OSVA 3KXTA 1NYGA 4AG1C 3HHTB 4HCKA 5GANe 1PWTA 4J9HA 4E7ZA 2RK2A 4JJCA 2AZSA 3M55A 3KBGA 1D0ZA 4XU3A 2EVRA 4ZGDB 4C8QB 3URGA 3S3OA 1YITA 5A0DA 4J9GA 3HKSA 4BB7A 2NUPB 4KGZB 1BIAA 3LX7A 4IUQA 4OB3B 2MPXC 4PJOG 3LH5A 3PGGA 3QBYA 1T3SA 1UDLA 2DO3A 1OOTA 2VC8A 3A98A 2DZCA 5LJ3e 1K8AR 3QJ6A 2DTHA 2DL4A 1WIEA 1QCNA 1OPKA 2B86A 3JCMe 3CCSA 4JRIA 2DYIA 5GJWB 3V7RA 1MV3A 2O9VA 2RQRA 4OF1A 1SG5A 4NS5A 1QW1A 2VASA 1WHJA 2EIFA 1IHVA 2YSQA 4FT4A 5I11A 2HD0A 1TUGB 4CRIA 2CKKA 3VUBA 1YHQA 3Q1JA 4OGCA 3VUZA 4FCYA 4JUVA 2QEXQ 4JRKA 3CD6Q 4GLMA 2E12A 2MAMA 4PLLA 4F7UG 3CCEA 3PFSA 3QJYA 1ZSZC 5FRNA 4M7DD 1D1AA 2V8JA 3CPFA 1OV3A 3CCLA 2X35A 3OMCA 4A4HA 4M78A 4JRQA 2KYMA 2W10A 2KRMA 3GIBA 5LJ3d 1W2BP 2XDBA 1BCMA 2AIRB 5LJ5e 3JCMd 2CSIA 2Y4XA 2E70A 2GFUA 1Q82C 3DB4A 2O31A 3LLRA 2FPEA 1JJ2P 3QUIA 3M58A 2L2PA 1YIJA 3HRSA 2XI9A 4J9CA 5HCKA 4KGXB 3X28B 2E3IA 4E7JA 1YJNT 2EWNA 3JB9D 3KFVA 1E6GA 3OS1A 2EQUA 5DLQE 1VQKA 4BI3A 2RM4A 3BW1A 5GJVB 1BI2A 2HBWA 3QIIA 3OYGA 2F2XA 1TOVA 2CS7A 5GAOm 4M7DB 3VJPA 1EIFA 5FU6C 2IIMA 4J9DA 2VGNA 3OYMA 1M2OA 4MDWA 3CMEQ 1VQNQ 5C6SA 2KXCA 3I55T 4BI8B 3A5ZB 3OB9A 1S72T 2VKNA 3CEYA 2E10A 5KYWA 1EFNA 3AT1B 1HD3A 4QKUA 1W6XA 2L3QA 3WVDB 2EGEA 1VQLQ 2VB6A 4QVZA 1CKAA 1P92A 2FPFA 1SRMA 4DOWA 4M77A 3MJXA 1M8MA 3D7SB 3L2QA 5LJ5d 3NMZC 4RTWA 2DLPA 4HT9A 3UT1A 2YWWA 4L6V5 1G2BA 2MI6A 2NUTA 1VQ8A 5IN1A 4X9DA 3M54A 3HL8A 4C92A 3X20B 2QDLA 1YCYA 2KROA 3OYKA 4FM4B 1I5OB 3G71A 1KK7A 1KQ1A 2DIQA 3OS2A 4F17A 4A54A 3RR6A 2RB6A 3JCMb 4OMPA 2E6ZA 3G4SQ 2FYKA 2E5KA 4J9IA 2J06A 2LCSA 4M78E 5CKEA 4OGEA 2FZCB 3CCRA 4HT8A 4L59A 1RUWA 2E65A 3A1PA 3E9GA 1YNZA 1Y96A 5CKDA 2NWMA 2J6OA 3EH1A 1WDXA 1S1NA 2JNGA 2LQWA 2P84A 4M7AD 2YUOA 3G6EA 2RJEA 3EFOB 1ZUUA 1Q82U 4DEXA 5I2SA 2DL8A 1VQ6Q 2ZPGB 3E1SA 2BUDA 4D8KA 5AT1B 3EGUA 4RMOA 1UE9A 2JM9A 2KBTA 4GLKA 1O75A 3GNGA 2W0ZA 4A4KA 5L8RE 4OMQA 4J7FA 3CPWP 3A8HB 3MO8A 3TQ7P 3QYHB 3CD6T 1VQPT 4XQ3A 4JLIA 1H92A 4C0DC 5KCHA 2A37A 3HTRA 3V8KA 2YRCA 5EG2A 4M7AB 1TG0A 5GAN3 2YLBA 4J6WA 2QTXA 3JV3A 2RHUA 4PJOF 3JCMX 1GFDA 3S3MA 4AFQC 4J8OA 3BDUA 2JM8A 1PSEA 3PIPA 1VQ4A 2YXYA 3OQ5A 1I07A 1OX9A 3SWNA 1K73C 1C0MA 3I35A 2KQWA 4M77D 1GRIA 2ED1A 2KEAA 3BE3A 5I22A 3NPFA 1PHTA 2YDLA 2EYXA 5GAOn 3PIOA 4MZMA 1OU8A 3H6ZA 3GNFB 4IIMA 2LJ3A 2D9TA 3MP8A 3CCUA 2QA4A 3ASKA 2LCLA 1TXQA 2BIVA 4C92D 4EDUA 1Z9ZA 2VXFA 3TREA 1X2KA 3PVQA 2E6NA 4EMKC 3CMET 1VQNT 2EKHA 1C1AA 2D8HA 2KRSA 1M2VA 1YJ9T 2DJQA 1IXDA 3I56A 4IKFA 1NPPA 2M1HA 1VIEA 1A0NB 1WXBA 1NJIC 1QKWA 5CKFA 2QK0A 4BE0A 4M77B 1X27A 1NPRA 5FU7B 2PNIA 3VS3A 3REBB 3PNWC 3MP6A 3M0TA 3CCMT 4FL6A 1VQ7A 5GMKi 4QVCA 3L2WA 1KQSP 5GAMh 1VA7A 1WGSA 2NUTB 2D0NA 1Y0MA 3SEMA 1UG1A 3CCSQ 3RIRA 2WSFE 4C92B 5LJ5f 1AEYA 4ZNXA 2P4RA 1BK2A 4OMMA 1VYVA 4MMKA 4C0FA 4RTTA 3VRYA 2KVQG 3OA6A 2VWFA 4A4EA 3CC4A 2COYA 2K9GA 3DB3A 3QSUA 1QVFS 3VV0A 4ZTFA 3BFMA 2QDYB 1LNXA 2H3EB 1QVGP 3G4ST 1R0BG 4PJOC 3PMIA 2O9SA 2PQWA 1ZQ1A 2KDSA 1Y96B 2CDTA 2QGGA 4C8QA 4XTXA 3F70A 4CC4B 3QYGB 5CIUA 4ZGEB 5GAN5 2NUPA 3JRZA 3H8ZA 3A8MB 3CCEQ 1I1JA 2ENMA 1WHKA 1I0CA 1MMGA 2E1HA 3EH2A 3PT9A 4R0KA 3DLLA 1VQMT 3J81E 2FZKB 1JRIA 1N5ZA 4J6YA 2RK1A 1GCQC 1QVFA 3EGDA 3CCVA 1WFWA 1Y57A 3JB9H 5FROA 5LJ5j 1VQ6T 2MWOA 1OQKA 3CC7T 3JCMJ 2K3YA 4LE9A 5KE2A 1YIJQ 3J7AF 1BKBA 1M1FA 1RI9A 2F1LA 2RMOA 2ABLA 4RTYA 4X9CA 4MZTA 1PD0A 1EX4A 3MKDA 4BI4A 2MMPA 4XU2A 3V7CA 1YWOA 4ZGJB 3LWIA 2KAFA 3OYDA 3GF5A 3QHSA 3ULRB 1R0CB 3CCQT 2CP6A 2K2MA 2ZPBB 3H0IA 1K0XA 3EFSA 1N9RA 2BKDN 2DRMA 3UA6A 2F2VA 2HQXA 1NJIU 4ZN1A 3CC2T 1AOJA 4BDYA 2WSEE 2JXBA 2X4YA 2M0OA 3SWNB 2NUZA 3VYHB 4M75A 3M4GA 4O6JA 2JTEA 2X4JA 3H9NA 2LX7A 3OYIA 1FMWA 2GCXA 2SEMA 2RI3A 2KRNA 3VS2A 4RKUE 4JS4A 2JTFA 1HJDA 1X6BA 1YJNQ 2ECZA 4RTUA 2K57A 3JCMQ 4KT0E 1ZLMA 1QKXA 5KYUA
chains in the Genus database with same CATH topology
3NHNA 2AZVA 3NGPA 2RNAA 3QWYA 4JPBW 3UATA 4GLMA 1NLOC 1UTIA 2LMJA 2LQNA 3FJ5A 2L0AA 4KRTA 3H0FA 1OV3A 5FWCA 3R6NA 1UHCA 3O5ZA 4X1VA 2K7AA 2V1RA 2LP5A 1LCKA 2KYMA 2W10A 2KRMA 1AWWA 2LJ1A 4RUGA 1ZUYA 4IIOA 1ZSGA 3PE0A 3PVLA 2YUPA 3VS6A 1RLPC 1UECA 2CSIA 2V1QA 2EPDA 2O31A 4HVUA 2FPEA 1U3OA 2DM1A 2L2PA 4ORZA 2K6DA 2MOXA 4J9CA 5HCKA 3UF4A 3KFVA 1E6GA 2AK5A 1E7OA 1W70A 2BZXA 5GJVB 2HBWA 1WI7A 1Z9QA 2F2XA 4WCIA 2L3SA 1VYUA 4M4ZA 4Y92A 4Z8AA 4DEYA 2IIMA 4J9DA 2MIOA 3M0QA 1KJWA 4CC7A 1OPLA 4F16A 2I0NA 1UUEA 2KXCA 3EHRA 2BTTA 1NEBA 3U23A 2VKNA 4QT7A 4Z88A 2CH4W 1CSKA 1EFNA 1HSQA 1HD3A 2EGAA 1W6XA 2L3QA 1K9AA 2EGEA 1AWXA 3REAB 1CKAA 2FPFA 1YP5A 4AG2C 1SRMA 2FRYA 1BU1A 2GQIA 1JXOA 1M8MA 2JW4A 4HXJA 2DL7A 3M0SA 3NMZC 4RTWA 2DLPA 2DE0X 1M3BA 2RQUA 2AKLA 3C0CA 4Z89A 1G2BA 1H8KA 2D8JA 2RQWA 1NEGA 1V1CA 2DYBA 2QDLA 2CSQA 2RQTA 1NLPC 2DNUA 2KROA 2A28A 2G6FX 3RBBB 3VS5A 2FO0A 4ESRA 1JO8A 4F17A 4HVVA 4OMPA 2BZYA 1T3LA 2E5KA 4J9IA 2J06A 2LCSA 4RTVA 1GBRA 2YUQA 4JZ4A 1IO6A 1RUWA 3M0UA 2YT6A 1SEMA 1YNZA 4EIKA 1J3TA 2NWMA 1UJYA 2J6OA 4RTXA 1UFFA 1X69A 2ESWA 2DRKA 1WDXA 3GBQA 1GCPA 1S1NA 2DILA 2LQWA 2YUOA 2J6KA 5IXBA 1ZUKA 1ZBJA 3H0HA 4CC2A 2DA9A 2O2OA 1ZUUA 1H3HA 3RNJA 3I9QA 4DEXA 4F14A 2ROTA 1M27C 2LJ0A 5IHNA 2X3WD 3THKA 2DL8A 2KT8A 1B3QA 1ARKA 1SHFA 4LUDA 4D8KA 3EGUA 3ZL7C 2O88A 1UE9A 2JM9A 1GBQA 2KBTA 3M0RA 2W0ZA 1FYNA 2FPDA 4OMQA 3I5SA 2A36A 2PTKA 1K76A 1UGVA 1ZX6A 1TUDA 1M30A 2J7IA 1H92A 1PRLC 2KYBA 2ROLA 4CC3A 2A37A 2RQVA 2FRWA 1CKBA 1AWJA 1TG0A 2GTJA 2OAWA 3EG1A 2FEIA 3JV3A 1NG2A 2KXDA 2PZ1A 1GFDA 3QWXX 4AFQC 3EG0A 1QCFA 2CUDA 1K1ZA 5ECAA 2JM8A 1MV0B 2C0IA 1T0HA 1WXUA 2MCNA 4JJBA 2DL5A 2JMAA 1I07A 1QWFA 3I35A 1AVZC 1GRIA 2ED1A 1NM7A 1JEGA 2DL3A 2KEAA 2SRCA 4HVWA 4AFSC 1K4US 5I22A 5FW9A 3NPFA 1PHTA 2ED0A 2H8HA 2RPNA 2YDLA 2EYXA 1NYFA 1X6GA 3SHWA 2CUBA 2EYYA 4A63B 1T0JA 4LN2A 4IIMA 2LJ3A 5FWBA 1WX6A 1AZEA 1K0SA 4J9FA 2GGRA 3TSZA 2C0OA 4OMNA 1XOVA 1Z9ZA 3EHQA 2EYZA 1X2KA 2VVKA 3PVQA 2J6FA 2EKHA 2J05A 5IHKA 2D8HA 2KRSA 4LUEA 2DJQA 1AZGB 1OEBA 2DF6A 2M0YA 4GBQA 5EC7A 1A0NB 1WXBA 4AFZC 2YUNA 3TSWA 1QKWA 4D8DA 1X27A 2LNHB 2OI3A 2F2WA 2JS2A 2PNIA 3VS3A 1GL5A 3REBB 2EGCA 2GBQA 3M0TA 1X43A 3VS0A 1BBZA 1SSHA 2D1XA 2OJ2A 1JU5C 3M0PA 1VA7A 2DBMA 2M51A 2JMCA 2D0NA 1Y0MA 3SEMA 1UG1A 1KSWA 1W1FA 2BZ8A 2DBKA 3VS1A 2JT4A 1JXMA 1PRMC 1AEYA 4ZNXA 2P4RA 4AFUC 1BK2A 4OMMA 1VYVA 2C0TA 3H41A 1YN8A 4RTTA 1RLQC 2GTOA 3VRYA 2CT4A 1SHGA 2VWFA 2DMOA 1M3CA 1BB9A 1QWEA 1E6HA 2K9GA 2HDAA 1WLPB 2RF0A 2JS0A 4J9EA 2LZ6B 1G83A 1KIKA 2EW3A 2CH4A 2O9SA 1PKSA 2CDTA 2GNCA 1ABQA 2L3PA 2HSPA 4CC4B 1FMKA 1VYTA 1GCQA 2HCKA 1AWOA 1X2QA 1GFCA 2DVJA 1AD5A 1JQQA 2EBPA 4OMOA 5IXFA 1I1JA 1SRLA 2ENMA 1I0CA 1PKTA 1PNJA 2KE9A 4R0KA 2XMFA 2A08A 3I5RA 1YWPA 5IH2A 1N5ZA 1GCQC 1B07A 3EG2A 2EYWA 1WFWA 1NYGA 3TVTA 4RTZA 1Y57A 4AG1C 4HCKA 1M3AA 1PWTA 4J9HA 1KFZA 4JJCA 2AZSA 2RN8A 4LE9A 2FG0A 2KR3A 4JJDA 2HEQA 2AKKA 1U06A 1RI9A 1WXTA 2RMOA 1UHFA 2ABLA 2EVRA 5L23A 3IQLA 5IHIA 4RTYA 1WA7A 4J9GA 4FSSA 1ABOA 1TUCA 1YWOA 3ULRB 3LH5A 2CREA 1T3SA 1UDLA 2K2MA 3VRZA 1OOTA 3H0IA 1K0XA 2KGTA 3A98A 2DRMA 1MUZA 1UJ0A 2K79A 3UA6A 2DL4A 2DX1A 2F2VA 1WIEA 4LNPA 1OPKA 2B86A 1AOJA 2JXBA 2NUZA 2X3XD 1YCSB 5GJWB 2KNBB 4K11A 1MV3A 2K3BA 2O9VA 2JTEA 2RQRA 4JZ3A 2KT1A 2LX7A 1U5SA 2CT3A 4J9BA 2SEMA 3VS4A 2YSQA 3EG3A 3VS7A 3CQTA 2KRNA 4OMLA 3VS2A 4E6RA 1SPKA 5I11A 1WYXA 1HJDA 1X6BA 3UA7A 2ECZA 4RTUA 1ZLMA 1QKXA 1QLYA 2EQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHN A;  2AZV A;  3NGP A;  2RNA A;  3QWY A;  4JPB W;  3UAT A;  4GLM A;  1NLO C;  1UTI A;  2LMJ A;  2LQN A;  3FJ5 A;  2L0A A;  4KRT A;  3H0F A;  1OV3 A;  5FWC A;  3R6N A;  1UHC A;  3O5Z A;  4X1V A;  2K7A A;  2V1R A;  2LP5 A;  1LCK A;  2KYM A;  2W10 A;  2KRM A;  1AWW A;  2LJ1 A;  4RUG A;  1ZUY A;  4IIO A;  1ZSG A;  3PE0 A;  3PVL A;  2YUP A;  3VS6 A;  1RLP C;  1UEC A;  2CSI A;  2V1Q A;  2EPD A;  2O31 A;  4HVU A;  2FPE A;  1U3O A;  2DM1 A;  2L2P A;  4ORZ A;  2K6D A;  2MOX A;  4J9C A;  5HCK A;  3UF4 A;  3KFV A;  1E6G A;  2AK5 A;  1E7O A;  1W70 A;  2BZX A;  5GJV B;  2HBW A;  1WI7 A;  1Z9Q A;  2F2X A;  4WCI A;  2L3S A;  1VYU A;  4M4Z A;  4Y92 A;  4Z8A A;  4DEY A;  2IIM A;  4J9D A;  2MIO A;  3M0Q A;  1KJW A;  4CC7 A;  1OPL A;  4F16 A;  2I0N A;  1UUE A;  2KXC A;  3EHR A;  2BTT A;  1NEB A;  3U23 A;  2VKN A;  4QT7 A;  4Z88 A;  2CH4 W;  1CSK A;  1EFN A;  1HSQ A;  1HD3 A;  2EGA A;  1W6X A;  2L3Q A;  1K9A A;  2EGE A;  1AWX A;  3REA B;  1CKA A;  2FPF A;  1YP5 A;  4AG2 C;  1SRM A;  2FRY A;  1BU1 A;  2GQI A;  1JXO A;  1M8M A;  2JW4 A;  4HXJ A;  2DL7 A;  3M0S A;  3NMZ C;  4RTW A;  2DLP A;  2DE0 X;  1M3B A;  2RQU A;  2AKL A;  3C0C A;  4Z89 A;  1G2B A;  1H8K A;  2D8J A;  2RQW A;  1NEG A;  1V1C A;  2DYB A;  2QDL A;  2CSQ A;  2RQT A;  1NLP C;  2DNU A;  2KRO A;  2A28 A;  2G6F X;  3RBB B;  3VS5 A;  2FO0 A;  4ESR A;  1JO8 A;  4F17 A;  4HVV A;  4OMP A;  2BZY A;  1T3L A;  2E5K A;  4J9I A;  2J06 A;  2LCS A;  4RTV A;  1GBR A;  2YUQ A;  4JZ4 A;  1IO6 A;  1RUW A;  3M0U A;  2YT6 A;  1SEM A;  1YNZ A;  4EIK A;  1J3T A;  2NWM A;  1UJY A;  2J6O A;  4RTX A;  1UFF A;  1X69 A;  2ESW A;  2DRK A;  1WDX A;  3GBQ A;  1GCP A;  1S1N A;  2DIL A;  2LQW A;  2YUO A;  2J6K A;  5IXB A;  1ZUK A;  1ZBJ A;  3H0H A;  4CC2 A;  2DA9 A;  2O2O A;  1ZUU A;  1H3H A;  3RNJ A;  3I9Q A;  4DEX A;  4F14 A;  2ROT A;  1M27 C;  2LJ0 A;  5IHN A;  2X3W D;  3THK A;  2DL8 A;  2KT8 A;  1B3Q A;  1ARK A;  1SHF A;  4LUD A;  4D8K A;  3EGU A;  3ZL7 C;  2O88 A;  1UE9 A;  2JM9 A;  1GBQ A;  2KBT A;  3M0R A;  2W0Z A;  1FYN A;  2FPD A;  4OMQ A;  3I5S A;  2A36 A;  2PTK A;  1K76 A;  1UGV A;  1ZX6 A;  1TUD A;  1M30 A;  2J7I A;  1H92 A;  1PRL C;  2KYB A;  2ROL A;  4CC3 A;  2A37 A;  2RQV A;  2FRW A;  1CKB A;  1AWJ A;  1TG0 A;  2GTJ A;  2OAW A;  3EG1 A;  2FEI A;  3JV3 A;  1NG2 A;  2KXD A;  2PZ1 A;  1GFD A;  3QWX X;  4AFQ C;  3EG0 A;  1QCF A;  2CUD A;  1K1Z A;  5ECA A;  2JM8 A;  1MV0 B;  2C0I A;  1T0H A;  1WXU A;  2MCN A;  4JJB A;  2DL5 A;  2JMA A;  1I07 A;  1QWF A;  3I35 A;  1AVZ C;  1GRI A;  2ED1 A;  1NM7 A;  1JEG A;  2DL3 A;  2KEA A;  2SRC A;  4HVW A;  4AFS C;  1K4U S;  5I22 A;  5FW9 A;  3NPF A;  1PHT A;  2ED0 A;  2H8H A;  2RPN A;  2YDL A;  2EYX A;  1NYF A;  1X6G A;  3SHW A;  2CUB A;  2EYY A;  4A63 B;  1T0J A;  4LN2 A;  4IIM A;  2LJ3 A;  5FWB A;  1WX6 A;  1AZE A;  1K0S A;  4J9F A;  2GGR A;  3TSZ A;  2C0O A;  4OMN A;  1XOV A;  1Z9Z A;  3EHQ A;  2EYZ A;  1X2K A;  2VVK A;  3PVQ A;  2J6F A;  2EKH A;  2J05 A;  5IHK A;  2D8H A;  2KRS A;  4LUE A;  2DJQ A;  1AZG B;  1OEB A;  2DF6 A;  2M0Y A;  4GBQ A;  5EC7 A;  1A0N B;  1WXB A;  4AFZ C;  2YUN A;  3TSW A;  1QKW A;  4D8D A;  1X27 A;  2LNH B;  2OI3 A;  2F2W A;  2JS2 A;  2PNI A;  3VS3 A;  1GL5 A;  3REB B;  2EGC A;  2GBQ A;  3M0T A;  1X43 A;  3VS0 A;  1BBZ A;  1SSH A;  2D1X A;  2OJ2 A;  1JU5 C;  3M0P A;  1VA7 A;  2DBM A;  2M51 A;  2JMC A;  2D0N A;  1Y0M A;  3SEM A;  1UG1 A;  1KSW A;  1W1F A;  2BZ8 A;  2DBK A;  3VS1 A;  2JT4 A;  1JXM A;  1PRM C;  1AEY A;  4ZNX A;  2P4R A;  4AFU C;  1BK2 A;  4OMM A;  1VYV A;  2C0T A;  3H41 A;  1YN8 A;  4RTT A;  1RLQ C;  2GTO A;  3VRY A;  2CT4 A;  1SHG A;  2VWF A;  2DMO A;  1M3C A;  1BB9 A;  1QWE A;  1E6H A;  2K9G A;  2HDA A;  1WLP B;  2RF0 A;  2JS0 A;  4J9E A;  2LZ6 B;  1G83 A;  1KIK A;  2EW3 A;  2CH4 A;  2O9S A;  1PKS A;  2CDT A;  2GNC A;  1ABQ A;  2L3P A;  2HSP A;  4CC4 B;  1FMK A;  1VYT A;  1GCQ A;  2HCK A;  1AWO A;  1X2Q A;  1GFC A;  2DVJ A;  1AD5 A;  1JQQ A;  2EBP A;  4OMO A;  5IXF A;  1I1J A;  1SRL A;  2ENM A;  1I0C A;  1PKT A;  1PNJ A;  2KE9 A;  4R0K A;  2XMF A;  2A08 A;  3I5R A;  1YWP A;  5IH2 A;  1N5Z A;  1GCQ C;  1B07 A;  3EG2 A;  2EYW A;  1WFW A;  1NYG A;  3TVT A;  4RTZ A;  1Y57 A;  4AG1 C;  4HCK A;  1M3A A;  1PWT A;  4J9H A;  1KFZ A;  4JJC A;  2AZS A;  2RN8 A;  4LE9 A;  2FG0 A;  2KR3 A;  4JJD A;  2HEQ A;  2AKK A;  1U06 A;  1RI9 A;  1WXT A;  2RMO A;  1UHF A;  2ABL A;  2EVR A;  5L23 A;  3IQL A;  5IHI A;  4RTY A;  1WA7 A;  4J9G A;  4FSS A;  1ABO A;  1TUC A;  1YWO A;  3ULR B;  3LH5 A;  2CRE A;  1T3S A;  1UDL A;  2K2M A;  3VRZ A;  1OOT A;  3H0I A;  1K0X A;  2KGT A;  3A98 A;  2DRM A;  1MUZ A;  1UJ0 A;  2K79 A;  3UA6 A;  2DL4 A;  2DX1 A;  2F2V A;  1WIE A;  4LNP A;  1OPK A;  2B86 A;  1AOJ A;  2JXB A;  2NUZ A;  2X3X D;  1YCS B;  5GJW B;  2KNB B;  4K11 A;  1MV3 A;  2K3B A;  2O9V A;  2JTE A;  2RQR A;  4JZ3 A;  2KT1 A;  2LX7 A;  1U5S A;  2CT3 A;  4J9B A;  2SEM A;  3VS4 A;  2YSQ A;  3EG3 A;  3VS7 A;  3CQT A;  2KRN A;  4OML A;  3VS2 A;  4E6R A;  1SPK A;  5I11 A;  1WYX A;  1HJD A;  1X6B A;  3UA7 A;  2ECZ A;  4RTU A;  1ZLM A;  1QKX A;  1QLY A;  2EQI A; 
#chains in the Genus database with same CATH topology
 3NGP A;  2RNA A;  3L1A A;  5DY9 A;  1VQ8 Q;  1UTI A;  2LMJ A;  1BIB A;  4EMH A;  1KHI A;  4C8Q E;  4E7I A;  3H0F A;  1M2V B;  4M7D A;  5FWC A;  2K5I A;  2K7A A;  2V1R A;  2LP5 A;  3G71 Q;  4AT1 B;  1MMA A;  2IG0 A;  2ZCF B;  3I55 Q;  2P4T A;  8AT1 B;  4PNO A;  3QKJ A;  2RA2 A;  3P8D A;  1S72 Q;  1Q7Y C;  1YIT T;  4RUG A;  3PVL A;  2JTM A;  3CCR Q;  2YUP A;  3NTI A;  1LVK A;  1UEC A;  2G3R A;  2A3L A;  3M53 A;  4HVU A;  3VYG A;  2OTL A;  2DM1 A;  4HCZ A;  1I4K 1;  4QQD A;  2X4W A;  5D7U A;  1TU0 B;  3UF4 A;  1WJR A;  2AK5 A;  3HP9 A;  2O4X B;  1VUB A;  1IB8 A;  2JN0 A;  3CCS T;  1VQO A;  3G6E Q;  2VV5 A;  1VYU A;  2I2L A;  1AHJ B;  4DEY A;  3CXC A;  3JCM P;  4IUP A;  3EAE A;  4LDV A;  3RDV A;  1QQJ A;  5A0L A;  2A7Y A;  1M4Z A;  3OYF A;  3EHR A;  1WHG A;  2CP3 A;  3MEA A;  1NEB A;  3QDF A;  2P0P A;  1X75 C;  3A8L B;  1YHQ T;  2EGA A;  1BI0 A;  3OS5 A;  1AWX A;  3REA B;  4AG2 C;  3HFO A;  5A2Q E;  1BU1 A;  2COW A;  2GQI A;  1ZA1 B;  2GQV A;  1HYO A;  1RAC B;  3CCE T;  4HXJ A;  1QP2 A;  3M0S A;  3CCL T;  4M78 G;  4C0Z A;  2DPP B;  3EGD B;  4Z89 A;  1PCX A;  1H8K A;  3RKX A;  4M75 D;  2DEQ A;  5KCO A;  2CP7 A;  1VQ4 Q;  2RQW A;  3RKY A;  2DXT A;  3EFO A;  2DYB A;  1K73 R;  2FVU A;  4E7L A;  4FW1 A;  1KD1 C;  2RI5 A;  4NOY A;  1YIJ T;  5IT9 E;  2F69 A;  4HVV A;  4M7D E;  1SF9 A;  2A0F B;  2LVM A;  2OTJ A;  1T3L A;  3A8G B;  1VQK T;  1YI2 A;  2YUQ A;  3P8B B;  3X24 B;  1IO6 A;  2D6F A;  3M0U A;  3CCU Q;  4XAX B;  1VQP Q;  4EIK A;  2QA4 Q;  5CO7 A;  1YJW Q;  3VU3 C;  5M9O A;  1UFF A;  1X69 A;  2ESW A;  5GMK m;  3OW2 P;  1Q7Y U;  4M75 B;  2KMT A;  4M7A A;  2FHD A;  2HSE B;  3CCJ A;  1ZBJ A;  2DA9 A;  2RD1 A;  2O2O A;  4VUB A;  1NJI R;  4ELY C;  2PUO B;  3RNJ A;  1I5L A;  2YRD A;  4C5G A;  2DXU A;  1QMC A;  5I2M A;  3R6O A;  1KG1 A;  2PU9 B;  2CZ1 B;  2DIG A;  1ARK A;  4LUD A;  1NZ9 A;  2QG9 B;  1PC0 A;  4HCC A;  5KYU B;  4E7K A;  5IAY A;  3E9F A;  3I5S A;  1R77 A;  2A36 A;  4ME7 A;  1ZX6 A;  5I21 A;  4N4G A;  1VQ8 T;  1ACM B;  2RQV A;  4V2S A;  1IHW A;  2GFA A;  1ZBX A;  2GTJ A;  2OAW A;  3EG1 A;  5CAI A;  3CC4 Q;  2VYT A;  1RAB B;  3G71 T;  1VQ9 A;  4LDW A;  1NG2 A;  2KXD A;  1VIF A;  1YJ9 Q;  3HSB A;  5ECA A;  4B6M A;  4LDX A;  1XNI A;  2C0I A;  1WXU A;  1RAF B;  2DXC A;  4JJB A;  3CCR T;  3RUX A;  1G3Y A;  4FU6 A;  1QWF A;  4F7U A;  4N0A A;  1N6A A;  2QQS A;  4D6W A;  4MML A;  1AVZ C;  1EZZ B;  3N5B B;  1JEG A;  3TU4 K;  1MGQ A;  2SRC A;  4HVW A;  4AFS C;  1AT1 B;  4XTY A;  5FW9 A;  3CCM Q;  1K4U S;  5CQY A;  2ED0 A;  1NYF A;  3UPU A;  2EYY A;  1T0J A;  2RO0 A;  4E47 A;  2DER A;  3G6E T;  1WX6 A;  2GGR A;  2C0O A;  1KD1 U;  3JB9 F;  1XQH A;  5GMK h;  4RG8 A;  4QW2 A;  4XK8 E;  3CMA A;  4HA8 A;  1OEB A;  2DF6 A;  4ATO A;  1Q95 G;  1TWB A;  4M7A E;  2EFI A;  5GAN 4;  2LNH B;  3PMT A;  1XTD A;  2JS2 A;  2JOY A;  2EGC A;  4OP0 A;  1X43 A;  1G8X A;  2XD0 A;  1OI1 A;  4DBF A;  3VS0 A;  4BAC A;  2D1X A;  1SSH A;  4JRP A;  2CGH A;  1C6V X;  1VQM Q;  2EAY A;  1Q81 C;  2BZ8 A;  1O9S A;  1KC8 R;  2JT4 A;  3OSS C;  4WF2 A;  2F5K A;  4AFU C;  1VQ4 T;  1OX8 A;  2KSS A;  2C0T A;  3QZ5 B;  2VGM A;  2CT4 A;  2QI2 A;  1QWE A;  3CC7 Q;  2EQK A;  3JB9 J;  2HDA A;  2RF0 A;  2JZ2 A;  2EW3 A;  1B7T A;  2CH4 A;  1WPY A;  4LD6 A;  1W2B S;  4KUD K;  3ER0 A;  5CQX A;  2L3P A;  3CCU T;  1VYT A;  4OVA A;  2QA4 T;  4MDX A;  2HCK A;  4Q5W A;  1YJW T;  3CCQ Q;  1AWO A;  1GFC A;  1JJ2 S;  4R55 A;  1JQQ A;  4OMO A;  2KI7 A;  3GOX A;  3HRT A;  1PNJ A;  4M77 E;  1G3S A;  2BE9 B;  4ZN3 A;  2XMF A;  4PJO B;  2WAC A;  5CR2 A;  3CC2 Q;  2ZPE B;  4BUG A;  1Q7Y R;  1W4S A;  3EG2 A;  2EYW A;  3RMS A;  3T9N A;  3TVT A;  2Y4Y A;  3ME9 A;  2QXF A;  2CP0 A;  1M3A A;  2XKO C;  3OYY A;  2HL3 A;  4M78 F;  4OB1 B;  4RG2 A;  3M9Q A;  1W2B A;  2RN8 A;  2DD5 A;  4OB2 B;  3JSC A;  4C92 E;  1I8F A;  1VQ7 T;  2DZ9 A;  2KR3 A;  4JJD A;  2HEQ A;  2AKK A;  1U06 A;  4B9X A;  4QVD A;  3JCM V;  5L23 A;  5IHI A;  4IUR A;  4ELZ C;  1JJ2 A;  4FSS A;  1WHM A;  1ABO A;  1TUC A;  4XTU A;  3FLG A;  5GAM g;  2CRE A;  1V29 B;  3WXM B;  3FDR A;  3CC4 T;  1UJ0 A;  2K79 A;  2ZGW A;  2RHI A;  2DX1 A;  3ZBD A;  3JAM E;  2NYS A;  2QEX A;  1Y07 A;  3JB9 I;  4F7U B;  2KNB B;  4K11 A;  1YIT Q;  2DJZ A;  2K3B A;  3OYL A;  1RAE B;  4C8Q G;  4C0G A;  2KT1 A;  3M5A A;  1M90 C;  4NL2 A;  1N27 A;  2CT3 A;  3VS4 A;  2Z0W A;  3EG3 A;  4JS5 A;  3MPU B;  1ZSZ A;  3X26 B;  1Q81 U;  3GLX A;  4OML A;  2H3J A;  2XDD A;  1WYX A;  3UA7 A;  4M77 F;  2EQI A;  7AT1 B;  2AZV A;  2QTV A;  2O4X A;  5GAO l;  1NLO C;  2LQN A;  3CCV T;  2L0A A;  1RAI B;  1UGP B;  1UEB A;  3R6N A;  5GAN 8;  1KD1 R;  1LCK A;  2HNI A;  4C92 F;  4KGV B;  3V8L A;  1GXI E;  2E4H A;  4DOV A;  1OU9 A;  2OTJ Q;  2LJ1 A;  1AWW A;  2LNV A;  4UC4 A;  1YHQ Q;  1YI2 Q;  4PK4 A;  1D3B B;  1RLP C;  2V1Q A;  2EPD A;  1D0X A;  5GAN g;  4Y28 E;  1U3O A;  4M78 C;  2K6D A;  2COZ A;  1K9M C;  4A53 A;  3CCL Q;  1E7O A;  1IGQ A;  1VQL A;  3CPW S;  4M75 G;  1K73 U;  4WCI A;  2L3S A;  2XG8 D;  4M4Z A;  4Z8A A;  3INZ A;  3QZ9 B;  2EQM A;  3M0Q A;  1MHN A;  4FSX A;  5LJ3 g;  4KUL A;  3U23 A;  4QT7 A;  4Z88 A;  2CH4 W;  4JDS A;  3JCM g;  1FWZ A;  4PL6 A;  1VQK Q;  5GAN h;  2LQK A;  1K9A A;  2RHZ A;  4B9W A;  1B34 A;  4GY5 A;  2FRY A;  2K5L A;  1RAA B;  2MK5 A;  2JW4 A;  3CPW A;  4M7D G;  5KYN A;  3FRN A;  1BCO A;  3M57 A;  1RAG B;  2DE0 X;  2VXE A;  1YBY A;  2R5M A;  1VQ5 A;  2RQU A;  2PVD B;  2AKL A;  3C0C A;  2DXB A;  2DFU A;  1VQ9 Q;  2DTO A;  1M90 U;  2JJ9 A;  1KC8 C;  2D8J A;  2HL5 C;  4M77 C;  2RH2 A;  2HAX A;  5FU7 C;  1NEG A;  4Y91 A;  3AHU A;  2CSQ A;  2RQT A;  3P8H A;  5LJ3 h;  1NLP C;  2PVO B;  3SFM A;  1Y71 A;  4ZTJ A;  2OTL T;  3JCM h;  3VS5 A;  1H3Z A;  2FO0 A;  5KH6 A;  1JO8 A;  4KH1 B;  3JB9 G;  1M5Q 1;  4XTZ A;  4C92 C;  2E64 A;  1KHC A;  1VQO T;  4JZ4 A;  1JB0 E;  5FLX E;  2YT6 A;  2CP5 A;  1SEM A;  5LJ5 g;  1Q86 R;  1J3T A;  4ANJ A;  4KUI A;  1UJY A;  4DQ2 A;  2XK0 A;  3L2R A;  1GCP A;  4DBH A;  3C12 A;  2K4Y A;  1KQS S;  2DIL A;  3MEW A;  2J6K A;  5IXB A;  4IUV A;  2FL7 A;  4BY6 C;  2GF7 A;  4CC2 A;  5DLO A;  2EYQ A;  2QQA A;  2EJ9 A;  3L2Z A;  4F14 A;  2ROT A;  3GPL A;  1M27 C;  4J5Y A;  2O01 E;  5IHN A;  1ZSZ B;  3ZFJ A;  1K9M U;  2PUK B;  1UGR B;  3SB2 A;  1SHF A;  3EG9 A;  3OYN A;  9ATC B;  3C95 A;  3FB9 A;  2E5Q A;  3C4S A;  1OUL A;  1QVP A;  4C5H A;  3M0R A;  1QVG S;  3OBW A;  4LDY A;  2FPD A;  1Q81 R;  2R5A A;  2L5Q A;  5LJ5 h;  1KQS A;  1UGV A;  1TUD A;  1RL2 A;  1PRL C;  2ROL A;  5GAM d;  2PVG B;  1UB4 A;  1AWJ A;  4FT2 A;  2FEI A;  4QQG A;  2PZ1 A;  3WVE B;  4LDU A;  4OMF B;  1QCF A;  1QP3 A;  1K1Z A;  1PG5 B;  4A4G A;  2ZPI B;  2OTJ T;  1MV0 B;  4PFZ A;  2CYZ B;  1T0H A;  2K5F A;  1YI2 T;  2MCN A;  3OY9 A;  3A8O B;  2JMA A;  1QVG A;  3LW5 E;  5FU6 B;  4M75 E;  4L5G A;  1ZHI A;  2DL3 A;  2LQ8 A;  3EGX A;  4P5N A;  2R57 A;  2H8H A;  3KUF A;  2RPN A;  1PM3 A;  3E19 A;  4C8Q F;  1KC8 U;  4EMK A;  4M7A G;  3HFN A;  4A63 B;  3SWN C;  2K3X A;  3CCJ T;  2LDM A;  4LXC A;  3ZEH A;  2YLC A;  3NTK A;  1K0S A;  2CZ0 B;  4J9F A;  1N8R C;  1M1K R;  3OYB A;  2YRV A;  3TSZ A;  3M4Y A;  1XJW B;  2MWP A;  4OMN A;  5KYX A;  4DBR A;  3NFC A;  3EHQ A;  1IGU A;  5FRM A;  2J05 A;  1HXD A;  4RCC A;  1HK9 A;  2C06 A;  1BYM A;  1AZG B;  4GBQ A;  2M0Y A;  2QQR A;  1Y7X A;  1B34 B;  5GAO q;  4AFZ C;  4XU0 A;  2YUN A;  3TSW A;  1YFN A;  2F5T X;  2EQJ A;  2XU8 A;  5CKH A;  1GL5 A;  4N4I A;  2OAU A;  8ATC B;  3LH0 A;  5HY6 A;  2MF2 A;  1X6O A;  3DLM A;  5GAN d;  2OJ2 A;  1JU5 C;  2XDP A;  1WQ7 A;  5GMK j;  1VQ9 T;  6AT1 B;  1KSW A;  2DBK A;  3VS1 A;  3I56 Q;  2AHJ B;  1JXM A;  1PRM C;  2L3R A;  4PJO A;  3FC3 A;  3RER A;  1M90 R;  3H41 A;  1YN8 A;  3FJP A;  1SHG A;  1F1B B;  1M3C A;  2RHY A;  4M77 G;  1G3W A;  2CZ6 B;  1SSF A;  3QXE B;  1MNE A;  1D0Y A;  4M75 F;  2LZ6 B;  1G83 A;  1RAH B;  1VQ7 Q;  1LJO A;  4A4F A;  1PKS A;  3QG1 A;  5GAN 7;  2GNC A;  1MND A;  1ABQ A;  2P0Q A;  1FMK A;  1GCQ A;  3RKW A;  4C92 G;  4KH0 B;  1LPL A;  5IXF A;  3OYH A;  1PKT A;  2K2V A;  1JBM A;  2NLU A;  4C8Q C;  3CMA T;  4BD3 A;  1VOM A;  1YWP A;  4PFO A;  4M7D F;  4CI0 C;  3EG9 B;  4RTZ A;  1IZ6 A;  2V8I A;  1TH7 A;  4C0D B;  1KFZ A;  2XID A;  2E3H A;  2FG0 A;  1K9M R;  1WXT A;  1UHF A;  2XIC A;  3IQL A;  1N8R U;  1WA7 A;  2B8A A;  5CCA A;  4NL3 A;  1M1G A;  3G7Z A;  1FMV A;  3CCV Q;  1Q86 C;  4EMG A;  3VRZ A;  1D09 B;  2KGT A;  5HKC A;  2DKG A;  1WJQ A;  1FX7 A;  4XTV A;  1YJN A;  1MUZ A;  2RHX A;  1OZ2 A;  4FYX B;  3O8V A;  5LL6 S;  5GAM f;  2X9H A;  4LNP A;  1WQW A;  4E7H A;  2X3X D;  1YCS B;  4JZ3 A;  5D6W A;  4BE1 A;  1U5S A;  3BY7 A;  3EGX B;  4PJO E;  4J9B A;  1D3B A;  4EMK B;  3VS7 A;  5CVI A;  3I55 A;  2IVW A;  3CQT A;  4E6R A;  1SPK A;  1WZO A;  4HKE A;  2CZ7 B;  1U1S A;  1S72 A;  4M75 C;  1VQ5 Q;  3TCJ A;  1D1C A;  1PSF A;  5KYX B;  1QLY A;  3HPW A;  3NHN A;  4PJO D;  2EKO A;  3QWY A;  4JPB W;  3UAT A;  3FJ5 A;  3LGL A;  4KRT A;  1NBE B;  2AT1 B;  2LRQ A;  3UWN A;  2CP2 A;  3VKI A;  5HK0 A;  4R56 A;  2LT4 A;  1UHC A;  1PD1 A;  3O5Z A;  1QVF P;  4X1V A;  4DA4 A;  4J6X A;  5KYY A;  4M78 D;  4AMC A;  3OW2 S;  2DTI A;  1M8V A;  4PJM A;  3FIF A;  2HKN A;  2V26 A;  5D6X A;  2RI2 A;  4PJL A;  1ZUY A;  4IIO A;  1ZSG A;  3PE0 A;  5GAM j;  3CBO A;  3VS6 A;  4M7D C;  2HBP A;  1DJ7 B;  3OYE A;  4WTO B;  4DBQ A;  4ORZ A;  1G3T A;  2MOX A;  5GAO p;  4F7U E;  2HQH A;  2VUB A;  5KE3 A;  1W70 A;  2E41 A;  1TTH B;  3I56 T;  2BZX A;  2RJF A;  3OYA A;  1WI7 A;  1Z9Q A;  4IUU A;  5GAN f;  2Y90 A;  5HK3 A;  2QEX T;  3OW2 A;  2QAZ A;  1M1K C;  2D0Q B;  4Y92 A;  1TS9 A;  2ZPH B;  1OYX A;  3V8J A;  1V76 A;  1U1T A;  2R58 A;  2MIO A;  4M78 B;  1KJW A;  3MHX A;  4M7A F;  4CC7 A;  1OPL A;  1K8A C;  4F16 A;  2I0N A;  1UUE A;  2OTL Q;  2BTT A;  3SD4 A;  1LOJ A;  1CSK A;  2HKQ B;  1HSQ A;  1Q86 U;  2ATC B;  1VQO Q;  1YP5 A;  4KBM B;  3V7S A;  1D1B A;  5LJ3 f;  1JXO A;  4PFP A;  2DL7 A;  3QDR B;  3JCM f;  1G5V A;  1RAD B;  1M3B A;  1TSF A;  5GMK l;  5GMK e;  4BDZ A;  4EPC A;  4C5I A;  3LGF A;  4FYW B;  3CD6 A;  1VQP A;  4PLI A;  1YJW A;  2HQE A;  1V1C A;  3QO3 A;  1H64 1;  5GAN j;  2DNU A;  3J80 E;  1MMN A;  2A28 A;  2M02 A;  2G6F X;  3RBB B;  4ESR A;  4O5V A;  4FW2 A;  4IUT A;  5KYW B;  5CK9 A;  2QQB A;  3GP8 A;  2DD4 A;  4X34 A;  4F7U F;  2BZY A;  4OB0 B;  4RTV A;  1GBR A;  1FXX A;  4PJN A;  1VQL T;  3TEE A;  1N8R R;  4F04 B;  3CBM A;  2DVE A;  4BE2 A;  2XHC A;  5A0G A;  3LYI A;  4RTX A;  1X01 A;  4PKC C;  2DRK A;  1UGS B;  3GBQ A;  4LD9 K;  5LJ3 j;  3L42 A;  3CXC P;  3JCM W;  3UDC A;  1ZUK A;  3H0H A;  2KK4 A;  1H3H A;  3I9Q A;  1ZA2 B;  2BE7 D;  2LJ0 A;  5GAN 6;  2X3W D;  4J83 A;  3THK A;  2KT8 A;  3OBY A;  1B3Q A;  1NE8 A;  3CME A;  1VQN A;  4FYV B;  2QAS A;  1R8O B;  3MEU A;  2HZY A;  4M7A C;  1YJ9 A;  3S3N A;  2LCC A;  3X25 B;  3ZL7 C;  2IPO B;  2O88 A;  5J26 A;  1GBQ A;  2X4X A;  4RCB A;  3PTA A;  1WJS A;  4JJN K;  1FYN A;  1VQ5 T;  2EJG A;  2LC4 A;  4BY6 B;  1M1K U;  2DAQ A;  2M9U A;  3NTH A;  2KY9 A;  5GAO r;  2PTK A;  4TVR A;  3CCJ Q;  1K76 A;  4FIB A;  1M30 A;  2J7I A;  1K8A U;  2KYB A;  2EJF A;  4CC3 A;  3CCM A;  5KYY B;  2JUF A;  5C0M A;  3EFR A;  5DM7 R;  1BI1 A;  4N4H A;  3M56 A;  2FRW A;  3OYC A;  1CKB A;  3CBP A;  2RJD A;  3JCM c;  4XU1 A;  3QWX X;  1N9S A;  5CKB A;  3EG0 A;  2CUD A;  3L2U A;  4MZP A;  3SDZ A;  2DL5 A;  2OX7 A;  3M59 A;  2ZPF B;  4II1 A;  1Q82 R;  1WNL A;  2LTO A;  1NM7 A;  2LX9 A;  1QCO A;  3G4S A;  1X6G A;  3SHW A;  1WHH A;  2CUB A;  4LN2 A;  3QPH A;  5FWB A;  1AZE A;  4N0A C;  1IRX A;  1XOV A;  3DKM A;  2EYZ A;  4FYY B;  2ZZD A;  2VVK A;  3MCA B;  2J6F A;  3E2U A;  5IHK A;  1VQM A;  4LUE A;  2QYZ A;  3MEV A;  2LT1 A;  3G1J A;  2DK3 A;  5EC7 A;  1U8R A;  5GAM e;  1WHL A;  4D8D A;  2V8K A;  2L89 A;  3LWH A;  2P0K A;  2L8D A;  2OI3 A;  4JLG A;  1VQ6 A;  2F2W A;  4Z02 A;  3CC7 A;  2GBQ A;  4HCB A;  4PJJ A;  1BI3 A;  1OZ3 A;  1BBZ A;  1M9S A;  3M0P A;  2QQ9 A;  2DBM A;  1RI0 A;  3C94 A;  2M51 A;  2JMC A;  2QGF B;  3OMG A;  2HMA A;  3CMA Q;  1W1F A;  3L2V A;  3RES A;  2X51 A;  1SKU B;  4J7I A;  3CCQ A;  3BDL A;  2WSC E;  3OYJ A;  1RLQ C;  2GTO A;  3RMQ A;  2M16 A;  2FZG B;  1MMD A;  2DMO A;  5AYF A;  1BB9 A;  1E6H A;  3S6W A;  4QQ6 A;  2ZAE A;  2DEU A;  1WLP B;  1IRE B;  4J9E A;  2JS0 A;  2JVV A;  5J3B A;  3CXC S;  3CC2 A;  1KIK A;  3FEO A;  2RJC A;  1UGQ B;  5D6Y A;  4C8Q D;  4E2F B;  2MYS A;  2FB7 A;  2HSP A;  4C5E A;  1KQ2 A;  3MET A;  1X2Q A;  2DVJ A;  1AD5 A;  2EBP A;  5GAN 2;  4YTL A;  1I81 A;  1SRL A;  2KE9 A;  2YHT A;  4XTW A;  3HRU A;  2A08 A;  3I5R A;  5J39 A;  3OS0 A;  3MP1 A;  5IH2 A;  2DET A;  4E7S A;  1B07 A;  3OSV A;  3KXT A;  1NYG A;  4AG1 C;  3HHT B;  4HCK A;  5GAN e;  1PWT A;  4J9H A;  4E7Z A;  2RK2 A;  4JJC A;  2AZS A;  3M55 A;  3KBG A;  1D0Z A;  4XU3 A;  2EVR A;  4ZGD B;  4C8Q B;  3URG A;  3S3O A;  1YIT A;  5A0D A;  4J9G A;  3HKS A;  4BB7 A;  2NUP B;  4KGZ B;  1BIA A;  3LX7 A;  4IUQ A;  4OB3 B;  2MPX C;  4PJO G;  3LH5 A;  3PGG A;  3QBY A;  1T3S A;  1UDL A;  2DO3 A;  1OOT A;  2VC8 A;  3A98 A;  2DZC A;  5LJ3 e;  1K8A R;  3QJ6 A;  2DTH A;  2DL4 A;  1WIE A;  1QCN A;  1OPK A;  2B86 A;  3JCM e;  3CCS A;  4JRI A;  2DYI A;  5GJW B;  3V7R A;  1MV3 A;  2O9V A;  2RQR A;  4OF1 A;  1SG5 A;  4NS5 A;  1QW1 A;  2VAS A;  1WHJ A;  2EIF A;  1IHV A;  2YSQ A;  4FT4 A;  5I11 A;  2HD0 A;  1TUG B;  4CRI A;  2CKK A;  3VUB A;  1YHQ A;  3Q1J A;  4OGC A;  3VUZ A;  4FCY A;  4JUV A;  2QEX Q;  4JRK A;  3CD6 Q;  4GLM A;  2E12 A;  2MAM A;  4PLL A;  4F7U G;  3CCE A;  3PFS A;  3QJY A;  1ZSZ C;  5FRN A;  4M7D D;  1D1A A;  2V8J A;  3CPF A;  1OV3 A;  3CCL A;  2X35 A;  3OMC A;  4A4H A;  4M78 A;  4JRQ A;  2KYM A;  2W10 A;  2KRM A;  3GIB A;  5LJ3 d;  1W2B P;  2XDB A;  1BCM A;  2AIR B;  5LJ5 e;  3JCM d;  2CSI A;  2Y4X A;  2E70 A;  2GFU A;  1Q82 C;  3DB4 A;  2O31 A;  3LLR A;  2FPE A;  1JJ2 P;  3QUI A;  3M58 A;  2L2P A;  1YIJ A;  3HRS A;  2XI9 A;  4J9C A;  5HCK A;  4KGX B;  3X28 B;  2E3I A;  4E7J A;  1YJN T;  2EWN A;  3JB9 D;  3KFV A;  1E6G A;  3OS1 A;  2EQU A;  5DLQ E;  1VQK A;  4BI3 A;  2RM4 A;  3BW1 A;  5GJV B;  1BI2 A;  2HBW A;  3QII A;  3OYG A;  2F2X A;  1TOV A;  2CS7 A;  5GAO m;  4M7D B;  3VJP A;  1EIF A;  5FU6 C;  2IIM A;  4J9D A;  2VGN A;  3OYM A;  1M2O A;  4MDW A;  3CME Q;  1VQN Q;  5C6S A;  2KXC A;  3I55 T;  4BI8 B;  3A5Z B;  3OB9 A;  1S72 T;  2VKN A;  3CEY A;  2E10 A;  5KYW A;  1EFN A;  3AT1 B;  1HD3 A;  4QKU A;  1W6X A;  2L3Q A;  3WVD B;  2EGE A;  1VQL Q;  2VB6 A;  4QVZ A;  1CKA A;  1P92 A;  2FPF A;  1SRM A;  4DOW A;  4M77 A;  3MJX A;  1M8M A;  3D7S B;  3L2Q A;  5LJ5 d;  3NMZ C;  4RTW A;  2DLP A;  4HT9 A;  3UT1 A;  2YWW A;  4L6V 5;  1G2B A;  2MI6 A;  2NUT A;  1VQ8 A;  5IN1 A;  4X9D A;  3M54 A;  3HL8 A;  4C92 A;  3X20 B;  2QDL A;  1YCY A;  2KRO A;  3OYK A;  4FM4 B;  1I5O B;  3G71 A;  1KK7 A;  1KQ1 A;  2DIQ A;  3OS2 A;  4F17 A;  4A54 A;  3RR6 A;  2RB6 A;  3JCM b;  4OMP A;  2E6Z A;  3G4S Q;  2FYK A;  2E5K A;  4J9I A;  2J06 A;  2LCS A;  4M78 E;  5CKE A;  4OGE A;  2FZC B;  3CCR A;  4HT8 A;  4L59 A;  1RUW A;  2E65 A;  3A1P A;  3E9G A;  1YNZ A;  1Y96 A;  5CKD A;  2NWM A;  2J6O A;  3EH1 A;  1WDX A;  1S1N A;  2JNG A;  2LQW A;  2P84 A;  4M7A D;  2YUO A;  3G6E A;  2RJE A;  3EFO B;  1ZUU A;  1Q82 U;  4DEX A;  5I2S A;  2DL8 A;  1VQ6 Q;  2ZPG B;  3E1S A;  2BUD A;  4D8K A;  5AT1 B;  3EGU A;  4RMO A;  1UE9 A;  2JM9 A;  2KBT A;  4GLK A;  1O75 A;  3GNG A;  2W0Z A;  4A4K A;  5L8R E;  4OMQ A;  4J7F A;  3CPW P;  3A8H B;  3MO8 A;  3TQ7 P;  3QYH B;  3CD6 T;  1VQP T;  4XQ3 A;  4JLI A;  1H92 A;  4C0D C;  5KCH A;  2A37 A;  3HTR A;  3V8K A;  2YRC A;  5EG2 A;  4M7A B;  1TG0 A;  5GAN 3;  2YLB A;  4J6W A;  2QTX A;  3JV3 A;  2RHU A;  4PJO F;  3JCM X;  1GFD A;  3S3M A;  4AFQ C;  4J8O A;  3BDU A;  2JM8 A;  1PSE A;  3PIP A;  1VQ4 A;  2YXY A;  3OQ5 A;  1I07 A;  1OX9 A;  3SWN A;  1K73 C;  1C0M A;  3I35 A;  2KQW A;  4M77 D;  1GRI A;  2ED1 A;  2KEA A;  3BE3 A;  5I22 A;  3NPF A;  1PHT A;  2YDL A;  2EYX A;  5GAO n;  3PIO A;  4MZM A;  1OU8 A;  3H6Z A;  3GNF B;  4IIM A;  2LJ3 A;  2D9T A;  3MP8 A;  3CCU A;  2QA4 A;  3ASK A;  2LCL A;  1TXQ A;  2BIV A;  4C92 D;  4EDU A;  1Z9Z A;  2VXF A;  3TRE A;  1X2K A;  3PVQ A;  2E6N A;  4EMK C;  3CME T;  1VQN T;  2EKH A;  1C1A A;  2D8H A;  2KRS A;  1M2V A;  1YJ9 T;  2DJQ A;  1IXD A;  3I56 A;  4IKF A;  1NPP A;  2M1H A;  1VIE A;  1A0N B;  1WXB A;  1NJI C;  1QKW A;  5CKF A;  2QK0 A;  4BE0 A;  4M77 B;  1X27 A;  1NPR A;  5FU7 B;  2PNI A;  3VS3 A;  3REB B;  3PNW C;  3MP6 A;  3M0T A;  3CCM T;  4FL6 A;  1VQ7 A;  5GMK i;  4QVC A;  3L2W A;  1KQS P;  5GAM h;  1VA7 A;  1WGS A;  2NUT B;  2D0N A;  1Y0M A;  3SEM A;  1UG1 A;  3CCS Q;  3RIR A;  2WSF E;  4C92 B;  5LJ5 f;  1AEY A;  4ZNX A;  2P4R A;  1BK2 A;  4OMM A;  1VYV A;  4MMK A;  4C0F A;  4RTT A;  3VRY A;  2KVQ G;  3OA6 A;  2VWF A;  4A4E A;  3CC4 A;  2COY A;  2K9G A;  3DB3 A;  3QSU A;  1QVF S;  3VV0 A;  4ZTF A;  3BFM A;  2QDY B;  1LNX A;  2H3E B;  1QVG P;  3G4S T;  1R0B G;  4PJO C;  3PMI A;  2O9S A;  2PQW A;  1ZQ1 A;  2KDS A;  1Y96 B;  2CDT A;  2QGG A;  4C8Q A;  4XTX A;  3F70 A;  4CC4 B;  3QYG B;  5CIU A;  4ZGE B;  5GAN 5;  2NUP A;  3JRZ A;  3H8Z A;  3A8M B;  3CCE Q;  1I1J A;  2ENM A;  1WHK A;  1I0C A;  1MMG A;  2E1H A;  3EH2 A;  3PT9 A;  4R0K A;  3DLL A;  1VQM T;  3J81 E;  2FZK B;  1JRI A;  1N5Z A;  4J6Y A;  2RK1 A;  1GCQ C;  1QVF A;  3EGD A;  3CCV A;  1WFW A;  1Y57 A;  3JB9 H;  5FRO A;  5LJ5 j;  1VQ6 T;  2MWO A;  1OQK A;  3CC7 T;  3JCM J;  2K3Y A;  4LE9 A;  5KE2 A;  1YIJ Q;  3J7A F;  1BKB A;  1M1F A;  1RI9 A;  2F1L A;  2RMO A;  2ABL A;  4RTY A;  4X9C A;  4MZT A;  1PD0 A;  1EX4 A;  3MKD A;  4BI4 A;  2MMP A;  4XU2 A;  3V7C A;  1YWO A;  4ZGJ B;  3LWI A;  2KAF A;  3OYD A;  3GF5 A;  3QHS A;  3ULR B;  1R0C B;  3CCQ T;  2CP6 A;  2K2M A;  2ZPB B;  3H0I A;  1K0X A;  3EFS A;  1N9R A;  2BKD N;  2DRM A;  3UA6 A;  2F2V A;  2HQX A;  1NJI U;  4ZN1 A;  3CC2 T;  1AOJ A;  4BDY A;  2WSE E;  2JXB A;  2X4Y A;  2M0O A;  3SWN B;  2NUZ A;  3VYH B;  4M75 A;  3M4G A;  4O6J A;  2JTE A;  2X4J A;  3H9N A;  2LX7 A;  3OYI A;  1FMW A;  2GCX A;  2SEM A;  2RI3 A;  2KRN A;  3VS2 A;  4RKU E;  4JS4 A;  2JTF A;  1HJD A;  1X6B A;  1YJN Q;  2ECZ A;  4RTU A;  2K57 A;  3JCM Q;  4KT0 E;  1ZLM A;  1QKX A;  5KYU A; 
#chains in the Genus database with same CATH homology
 3NHN A;  2AZV A;  3NGP A;  2RNA A;  3QWY A;  4JPB W;  3UAT A;  4GLM A;  1NLO C;  1UTI A;  2LMJ A;  2LQN A;  3FJ5 A;  2L0A A;  4KRT A;  3H0F A;  1OV3 A;  5FWC A;  3R6N A;  1UHC A;  3O5Z A;  4X1V A;  2K7A A;  2V1R A;  2LP5 A;  1LCK A;  2KYM A;  2W10 A;  2KRM A;  1AWW A;  2LJ1 A;  4RUG A;  1ZUY A;  4IIO A;  1ZSG A;  3PE0 A;  3PVL A;  2YUP A;  3VS6 A;  1RLP C;  1UEC A;  2CSI A;  2V1Q A;  2EPD A;  2O31 A;  4HVU A;  2FPE A;  1U3O A;  2DM1 A;  2L2P A;  4ORZ A;  2K6D A;  2MOX A;  4J9C A;  5HCK A;  3UF4 A;  3KFV A;  1E6G A;  2AK5 A;  1E7O A;  1W70 A;  2BZX A;  5GJV B;  2HBW A;  1WI7 A;  1Z9Q A;  2F2X A;  4WCI A;  2L3S A;  1VYU A;  4M4Z A;  4Y92 A;  4Z8A A;  4DEY A;  2IIM A;  4J9D A;  2MIO A;  3M0Q A;  1KJW A;  4CC7 A;  1OPL A;  4F16 A;  2I0N A;  1UUE A;  2KXC A;  3EHR A;  2BTT A;  1NEB A;  3U23 A;  2VKN A;  4QT7 A;  4Z88 A;  2CH4 W;  1CSK A;  1EFN A;  1HSQ A;  1HD3 A;  2EGA A;  1W6X A;  2L3Q A;  1K9A A;  2EGE A;  1AWX A;  3REA B;  1CKA A;  2FPF A;  1YP5 A;  4AG2 C;  1SRM A;  2FRY A;  1BU1 A;  2GQI A;  1JXO A;  1M8M A;  2JW4 A;  4HXJ A;  2DL7 A;  3M0S A;  3NMZ C;  4RTW A;  2DLP A;  2DE0 X;  1M3B A;  2RQU A;  2AKL A;  3C0C A;  4Z89 A;  1G2B A;  1H8K A;  2D8J A;  2RQW A;  1NEG A;  1V1C A;  2DYB A;  2QDL A;  2CSQ A;  2RQT A;  1NLP C;  2DNU A;  2KRO A;  2A28 A;  2G6F X;  3RBB B;  3VS5 A;  2FO0 A;  4ESR A;  1JO8 A;  4F17 A;  4HVV A;  4OMP A;  2BZY A;  1T3L A;  2E5K A;  4J9I A;  2J06 A;  2LCS A;  4RTV A;  1GBR A;  2YUQ A;  4JZ4 A;  1IO6 A;  1RUW A;  3M0U A;  2YT6 A;  1SEM A;  1YNZ A;  4EIK A;  1J3T A;  2NWM A;  1UJY A;  2J6O A;  4RTX A;  1UFF A;  1X69 A;  2ESW A;  2DRK A;  1WDX A;  3GBQ A;  1GCP A;  1S1N A;  2DIL A;  2LQW A;  2YUO A;  2J6K A;  5IXB A;  1ZUK A;  1ZBJ A;  3H0H A;  4CC2 A;  2DA9 A;  2O2O A;  1ZUU A;  1H3H A;  3RNJ A;  3I9Q A;  4DEX A;  4F14 A;  2ROT A;  1M27 C;  2LJ0 A;  5IHN A;  2X3W D;  3THK A;  2DL8 A;  2KT8 A;  1B3Q A;  1ARK A;  1SHF A;  4LUD A;  4D8K A;  3EGU A;  3ZL7 C;  2O88 A;  1UE9 A;  2JM9 A;  1GBQ A;  2KBT A;  3M0R A;  2W0Z A;  1FYN A;  2FPD A;  4OMQ A;  3I5S A;  2A36 A;  2PTK A;  1K76 A;  1UGV A;  1ZX6 A;  1TUD A;  1M30 A;  2J7I A;  1H92 A;  1PRL C;  2KYB A;  2ROL A;  4CC3 A;  2A37 A;  2RQV A;  2FRW A;  1CKB A;  1AWJ A;  1TG0 A;  2GTJ A;  2OAW A;  3EG1 A;  2FEI A;  3JV3 A;  1NG2 A;  2KXD A;  2PZ1 A;  1GFD A;  3QWX X;  4AFQ C;  3EG0 A;  1QCF A;  2CUD A;  1K1Z A;  5ECA A;  2JM8 A;  1MV0 B;  2C0I A;  1T0H A;  1WXU A;  2MCN A;  4JJB A;  2DL5 A;  2JMA A;  1I07 A;  1QWF A;  3I35 A;  1AVZ C;  1GRI A;  2ED1 A;  1NM7 A;  1JEG A;  2DL3 A;  2KEA A;  2SRC A;  4HVW A;  4AFS C;  1K4U S;  5I22 A;  5FW9 A;  3NPF A;  1PHT A;  2ED0 A;  2H8H A;  2RPN A;  2YDL A;  2EYX A;  1NYF A;  1X6G A;  3SHW A;  2CUB A;  2EYY A;  4A63 B;  1T0J A;  4LN2 A;  4IIM A;  2LJ3 A;  5FWB A;  1WX6 A;  1AZE A;  1K0S A;  4J9F A;  2GGR A;  3TSZ A;  2C0O A;  4OMN A;  1XOV A;  1Z9Z A;  3EHQ A;  2EYZ A;  1X2K A;  2VVK A;  3PVQ A;  2J6F A;  2EKH A;  2J05 A;  5IHK A;  2D8H A;  2KRS A;  4LUE A;  2DJQ A;  1AZG B;  1OEB A;  2DF6 A;  2M0Y A;  4GBQ A;  5EC7 A;  1A0N B;  1WXB A;  4AFZ C;  2YUN A;  3TSW A;  1QKW A;  4D8D A;  1X27 A;  2LNH B;  2OI3 A;  2F2W A;  2JS2 A;  2PNI A;  3VS3 A;  1GL5 A;  3REB B;  2EGC A;  2GBQ A;  3M0T A;  1X43 A;  3VS0 A;  1BBZ A;  1SSH A;  2D1X A;  2OJ2 A;  1JU5 C;  3M0P A;  1VA7 A;  2DBM A;  2M51 A;  2JMC A;  2D0N A;  1Y0M A;  3SEM A;  1UG1 A;  1KSW A;  1W1F A;  2BZ8 A;  2DBK A;  3VS1 A;  2JT4 A;  1JXM A;  1PRM C;  1AEY A;  4ZNX A;  2P4R A;  4AFU C;  1BK2 A;  4OMM A;  1VYV A;  2C0T A;  3H41 A;  1YN8 A;  4RTT A;  1RLQ C;  2GTO A;  3VRY A;  2CT4 A;  1SHG A;  2VWF A;  2DMO A;  1M3C A;  1BB9 A;  1QWE A;  1E6H A;  2K9G A;  2HDA A;  1WLP B;  2RF0 A;  2JS0 A;  4J9E A;  2LZ6 B;  1G83 A;  1KIK A;  2EW3 A;  2CH4 A;  2O9S A;  1PKS A;  2CDT A;  2GNC A;  1ABQ A;  2L3P A;  2HSP A;  4CC4 B;  1FMK A;  1VYT A;  1GCQ A;  2HCK A;  1AWO A;  1X2Q A;  1GFC A;  2DVJ A;  1AD5 A;  1JQQ A;  2EBP A;  4OMO A;  5IXF A;  1I1J A;  1SRL A;  2ENM A;  1I0C A;  1PKT A;  1PNJ A;  2KE9 A;  4R0K A;  2XMF A;  2A08 A;  3I5R A;  1YWP A;  5IH2 A;  1N5Z A;  1GCQ C;  1B07 A;  3EG2 A;  2EYW A;  1WFW A;  1NYG A;  3TVT A;  4RTZ A;  1Y57 A;  4AG1 C;  4HCK A;  1M3A A;  1PWT A;  4J9H A;  1KFZ A;  4JJC A;  2AZS A;  2RN8 A;  4LE9 A;  2FG0 A;  2KR3 A;  4JJD A;  2HEQ A;  2AKK A;  1U06 A;  1RI9 A;  1WXT A;  2RMO A;  1UHF A;  2ABL A;  2EVR A;  5L23 A;  3IQL A;  5IHI A;  4RTY A;  1WA7 A;  4J9G A;  4FSS A;  1ABO A;  1TUC A;  1YWO A;  3ULR B;  3LH5 A;  2CRE A;  1T3S A;  1UDL A;  2K2M A;  3VRZ A;  1OOT A;  3H0I A;  1K0X A;  2KGT A;  3A98 A;  2DRM A;  1MUZ A;  1UJ0 A;  2K79 A;  3UA6 A;  2DL4 A;  2DX1 A;  2F2V A;  1WIE A;  4LNP A;  1OPK A;  2B86 A;  1AOJ A;  2JXB A;  2NUZ A;  2X3X D;  1YCS B;  5GJW B;  2KNB B;  4K11 A;  1MV3 A;  2K3B A;  2O9V A;  2JTE A;  2RQR A;  4JZ3 A;  2KT1 A;  2LX7 A;  1U5S A;  2CT3 A;  4J9B A;  2SEM A;  3VS4 A;  2YSQ A;  3EG3 A;  3VS7 A;  3CQT A;  2KRN A;  4OML A;  3VS2 A;  4E6R A;  1SPK A;  5I11 A;  1WYX A;  1HJD A;  1X6B A;  3UA7 A;  2ECZ A;  4RTU A;  1ZLM A;  1QKX A;  1QLY A;  2EQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...