4ZN1A

Crystal structure of mjspt4:spt5 complex conformation a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
138
Chain Sequence
MIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTPENIEKGDVVEIIAPFKGERAKVIRVDKHKEEVTLELENAPIPITLPVEGVKIVSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor Spt5
publication title Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Transcription
total genus 25
structure length 138
sequence length 145
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zn1A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 4zn1A01
3I56A 1VQ8T 1NPPA 3J81E 1VQOT 1VQ9T 2CKKA 1YIJT 1N8RU 1VQ6A 1QVGA 1K73C 2OTLA 2EIFA 1YHQT 5IAYA 3CMEA 1VQLA 1IZ6A 3CCLA 3PIOA 1KD1U 5J26A 3CCMA 3CC7T 3CCUA 1YJ9T 1M1KC 1NZ9A 3LGLA 3HKSA 2OTJA 4QQDA 1S72T 4TVRA 1UEBA 3CC2A 1RL2A 3DLLA 1YI2T 3DB4A 1K73U 1N8RC 4YTLA 1VQOA 1VQ9A 3CXCA 2QA4A 5DM7R 2G3RA 1KC8C 1YHQA 1M1KU 3CD6A 2LVMA 4ZN1A 3LH0A 2DO3A 1XTDA 4X34A 3CPWA 3LPEA 1Q86C 4CRIA 1KQSS 1JJ2A 3CMAT 1VQMT 1VQ4T 3CCVA 2JNGA 1S72A 3CPFA 3CCQA 2E6ZA 1VQKA 3G71T 1VQ7T 5HY6A 3PIPA 1KC8U 1K9MC 2JVVA 1VQNT 3CCJT 3CCET 1VQ5T 3I55A 1Q86U 2E70A 3DB3A 1QVGS 1VQ8A 2L3RA 1YIJA 3CCRT 5J3BA 1BKBA 2LQ8A 1K9MU 2MWOA 1Q7YC 2JOYA 1QVFS 1YITT 3CC4T 1VQPT 1Q82U 3CC7A 1YJNT 3ER0A 3G4ST 2KVQG 1YJ9A 1NZ8A 3CCEA 3J7AF 3OW2S 1VQ5A 1M90C 1VQ6T 3TREA 4ZN3A 1YI2A 2OTLT 1Q7YU 1NJIC 5IT9E 1W2BS 3CCUT 1Q82C 2K06A 3CCST 3CPWS 1M1HA 1M90U 2OTJT 2JUFA 1YJNA 3G4SA 3CC2T 3CMAA 1NJIU 3KBGA 2KDSA 1VQMA 1VQ4A 4RG2A 1K8AC 2QEXT 2QA4T 1Q81C 5LL6S 3G71A 1YJWT 1VQ7A 3OYYA 1SSFA 3G6ET 3CD6T 3P8BB 2MI6A 1VQNA 5DLQE 1XNIA 3EWGA 3JAME 3CCJA 3LGFA 1NPRA 3I56T 1QVFA 2OUGA 3A5ZB 5FLXE 3QQCD 3CCSA 1M1GA 3CXCS 1KHIA 1K8AU 1YBYA 3CCVT 1VQLT 1X6OA 3CMET 3CCQT 3CCLT 1Q81U 5A2QE 3OW2A 1KQSA 1VQKT 2LCLA 2XHCA 3H7HB 3CCRA 3J80E 2QEXA 3CCMT 2MWPA 1YITA 3CC4A 1YJWA 1VQPA 3I55T 3G6EA 1EIFA 2IG0A 1KD1C 1JJ2S 1W2BA 2EXUA
chains in the Genus database with same CATH superfamily
2DMOA 1XBWA 5CK9A 2JMAA 1BUXA 5FJ4A 2VBXA 2BE2B 1YVFA 4ILLA 4BD3A 4NLPA 3B78A 5DM7Q 1GCQA 1MUZA 1PYOB 2ZM6J 2E1MC 3M59A 1T05A 4ID5B 2DJZA 3FZ2A 2KAFA 1TL7A 5DZ6A 3WX8A 2ZOMA 2ZH9A 2OD4A 1WOPA 1HLWA 4FNIA 1PCAA 4FPIA 2EFQA 3PIPA 1PNJA 4DBRA 1D8YA 4J9FA 4Q8FA 4NCGB 4J9VA 5F8HA 5LL6d 2OLWA 1SJRA 3M8QB 3EG0A 4M5GA 2QQAA 1MN9A 5D0GA 2FVQA 2QYGA 4USHA 2AYBA 2P84A 4QW2A 5D4PA 1K8AR 2BJEA 1J5EJ 2MKHA 1L3VA 4KGMA 2CPHA 1URNA 3C6UA 1R8AA 3ET6A 3HLUA 3ZTSA 4DX7A 2W2QP 2EGAA 4FKYA 2QEXT 4IKAA 4LBPA 5GAMd 2XMTA 3T5KA 2JDJA 2PDAA 5CXTA 2R9LA 4DQIA 4B3MJ 3OYJA 2FPDA 2XGPA 2GMJA 1HI8A 1S0NA 2VWFA 3KXDA 1SKUB 4F7UA 4I6WA 2DGVA 5I4MA 2QXFA 3TA2A 2WB4A 2SXLA 2DBBA 2HS4A 1QKWA 3QMQA 3H41A 3I4PA 4OB1B 1WUUA 4L5GA 4DOWA 3M58A 3X20B 3HXMA 2EFNA 3RRGA 1GRIA 5LJ5h 4MFBB 1KFZA 5DM6Q 3C15B 1FNXH 2VB6A 3L2QA 5E7OB 4CTAB 3VAMA 2UXCF 3HVAA 2ZKUA 4TN2A 1WNEA 2YLBA 2K3KA 4ED5A 2DT9A 5SZTA 2P9GA 5GAN2 2E44A 3OSVA 1WOOA 3NTKA 3FCWA 2FHJD 1YCSB 3C16A 1XR6A 2F63A 2VA2A 5D4OA 3R2DJ 5D6WA 2QDLA 1Q7YU 2R5AA 3WZ0A 1VQPQ 3N9UC 1CJKB 1RAJA 4LRAA 3LUYA 4AFQC 1UAWA 5T41A 4P2MA 2KYMA 4DV4F 3DXSX 2RQRA 3TWZA 3J80U 2IM1A 5K9FA 3HSJA 3META 1RABB 2XZDB 1LW2B 2FLNA 3D54A 4UC4A 3CD7A 1HMVA 4X4QA 1OSDA 1KR4A 4KH0B 3U1NA 2OJ2A 3DLKA 3CC4A 2K2MA 5JXSA 4TYAA 2CT3A 4K5RA 1SL0A 4C4WA 4FKXA 3HHLA 1RADB 2WVCA 3Q23A 1MMAA 2G2OA 3FEOA 3RAMA 2VPYB 5CD4H 1N5TA 2B5JB 3J7YU 3QT7A 3CC2A 2RQMA 1DHMA 5AJ3F 3NCQA 3DM2A 2MY8A 1G5VA 5LJ3g 2WW4A 4RNHA 2BQ3A 3I0SB 4J37A 1FMVA 2O67A 1U4BA 4KO0B 4M7DA 2MGZA 1Y10A 2HPUA 4ZTFA 3CJ0A 2AEJA 2HHWA 2APOA 4C7QA 2IAJB 2CH4W 1Y3KA 3LALA 2BRLA 3FZBA 2UV8G 2C28A 1G3TA 3QYYA 2H5EA 1TP7A 3KK3B 4D3HA 1VA7A 2XCPA 1RT6B 2O88A 2QL5B 1KP6A 3I9QA 2XK0A 1SF9A 4ECRA 4UT4A 4LF6F 3CWJA 3CMES 3CCLS 2HVEA 3CCUS 3BGRB 3BYPA 1O0PA 4IH5A 4B3OA 2XMUA 5AT1B 1U1KA 1R3NA 2EKHA 2JM8A 5HQLA 1R89A 2LP4A 2EC0A 1U0HB 4LUDA 4X4TA 2XLJA 2C0TA 3LPYA 3MPWA 2EIFA 4MYUA 1EP4B 1WDTA 1WC1A 3R7NB 1M30A 4MTPA 2FY8A 4M75C 1X6GA 2L48A 4LDVA 2PVDB 4LSLB 2MQMA 3SCKE 3MMAA 2W1BA 3AODA 2JRSA 2AYMA 5F0UA 2KRBA 3M0SA 3U7JA 1U26A 2ROPA 2JNGA 2JVVA 3OS0A 3CXCP 3LGHA 1NK6A 3CJRA 4QWBA 3BEGB 3TZWA 3ZNJ1 2EGEA 3OYNA 3CCRT 3KJVA 2WRMA 1X4AA 2DH7A 2GFFA 3I6PA 1VISA 2HIYA 2CQIA 4NRTA 2R7TA 2M0YA 2W4CA 2V4JB 4OYBA 1NBEB 1WXBA 5A8WA 2OTLT 2AMCB 5AXLA 3KYLA 4N4GA 2ZZMA 5GMKm 4M75G 2XICA 2RRBA 2OTJT 3DRSB 3A3NB 2FVRA 3AQOA 1YX2A 2LCCA 4I69A 3NNAA 3UWNA 2DNUA 2C2NA 1CULB 3QT6A 4PYDA 1OULA 4E7SA 1RHMB 3W8GA 1PJ5A 1ABOA 2JEIA 4WYWA 2H8HA 2BIVA 1XEZA 2UUAF 1F9EB 1TKXB 2ZCFB 5GMDA 2HVIA 4DV7F 2COLA 2VKZG 2KM8B 1NJZA 2VPZB 4Y65A 3PIOA 2RF2A 2G0IA 4KHRA 2RNEA 1TQLA 3PR5B 2XZWA 3TAMB 2HQXA 3G8TA 1CJUA 1JLEA 1KONA 4BUGA 5B0DA 1XMQJ 2G1HA 2CP5A 1OS5A 3CJKA 2YH1A 3GFZA 1K9MR 3FDSA 2VKNA 3TANA 1LW0A 4DEXA 2YBVA 3CJ4A 4CNZA 2YDLA 2H3JA 2ERRA 1X8DA 2HGNA 1B7FA 3RR6A 2VASA 2OIHA 1UE9A 2M5YA 4CNYA 2MWOA 5D0RA 1YZ7A 1XN9A 4K59A 1VQ5Q 1V6HA 4M4ZA 3C0CA 3J7AF 3GBQA 2Y1RI 3E3XA 3FQLA 2ZZNA 2QEXQ 3GFXA 4DUYF 2JLFA 4J7FA 2ZHBA 4DUZJ 3DKDA 2LQ9A 2DE0X 5IXBA 2DKGA 1RKIA 5HCKA 2DXFA 4FYXB 3CVKA 4LF9F 3KFWX 1ZZNA 3IR7B 4CRJA 1TK8A 3G71A 4OZNA 3OJUA 2WSEE 3LWHA 4AQYF 2QA1A 2NUTA 5IT4A 1SRLA 3JSCA 4FW1A 5KT3A 2AJQA 5KT6A 3CMET 4WP8A 3CCLT 2NZCA 2XHCA 4JJDA 1WORA 4IFYB 3LQVA 1RWMB 1UEKA 3PJWA 2CZ6B 1ZH5A 2LMJA 1JJHA 1H6KX 3KNAA 2JWNA 1U1NA 4FVCA 1B64A 2XMWA 2FJVA 3SSSA 1KKHA 4I7FA 1V3SA 5HLFB 5IC6B 2KBTA 3T5LA 3CSKA 3UDVA 2IFXA 4KGVB 4ZJOA 3M9OB 5CR2A 2LVMA 4C92A 1IO6A 2MSSA 3CPWA 4K4TA 2EQMA 1Q86C 1LOUA 3GE9A 4P73A 1WD6A 3Q83A 2MTLA 4ECZA 5A2QY 4HTJA 4PKCC 1NK8A 2CWKA 4CLYA 5ETOA 1HBUB 2HBYB 3A13A 4QVCA 1KOHA 4LF7F 3PO5A 4M77F 5M2RA 4OYPA 1R8OB 4M5MA 3BH6B 2CSQA 2XSJB 3V4IB 1Q53A 3VRZA 3RAQA 1K1ZA 3K7RA 3F70A 1GBQA 4WE1B 2L08A 4HHJA 2LNVA 3ZEHA 5KT4A 2Y8WA 2FC9A 2OMOA 2PEBA 3M57A 2WZ1A 3QSUA 3FC9A 3RB4A 4A8XA 2XHWA 1PHTA 2XM3A 4ECSA 1M1GA 3TA1A 2V8DA 3J81U 1KQSA 5ETSA 3A1PA 1KQFB 3K5NA 3JCMd 3OBYA 1YJWA 1X9MA 2IG0A 3US5A 4OMPA 1KTQA 4GLKA 1JX4A 2K4YA 3I32A 1YJVA 5E41A 3V5RA 3BPDA 5RUBA 5KFBA 4DLGA 1RT2B 3N28A 4DPTA 1NZ9A 4QQDA 2MDAA 1TL3B 1RA7A 5LXRA 2DXEA 1MLAA 3H98A 4M5DA 2J8AA 3MM5A 1VOMA 1T8EA 2F4VF 3BZQA 2N4DA 1FWKA 2DNHA 2R58A 1N0VC 3RGIA 5KFRA 4EYHB 3HVWA 1TOVA 4OZ5A 3JQJA 1HNZJ 3M0TA 4DQRA 3ILJA 4OP0A 4FVMA 2KZMA 4JI6F 1F3VA 3DDKA 1WEXA 3GV5B 3HPWA 1FXLA 1PKUA 4HYKA 2VF3A 1SJQA 4M7AF 2YWKA 1YJ9A 1VQ5A 3AFGA 1KHWA 1N5YA 1Q8BA 2QA4S 4N41A 1ULRA 4H4OA 1M1FA 3M9MB 4NXNF 4A4GA 2RK1A 2MJNA 2DGSA 5IC4B 3M5AA 4ECUA 3M32A 1LXJA 2GJFA 2KJWA 3E01A 1YWPA 3A8HB 1AEYA 3CD6S 1RISA 4E98A 2DGWA 3WC0A 3VGTA 3OYBA 2J8SA 3C14B 4PWDB 1S72S 2L3MA 3EVWA 3GOXA 4YB1P 3INZA 1XR7A 1K0TA 5D0EA 3O2IA 3OD2A 4LF5J 3V6KA 4ZPTR 6FD1A 3JB9D 3QLHA 4B9UA 3QJ6A 2KMTA 3DLHA 2E4HA 3UATA 2DERA 1FD2A 2DCUB 2PT0A 4FPRA 2YKMB 2O2OA 1IR0A 2EI5A 4J90A 2EFPA 4DL2A 3MFIA 5GANf 5E3AA 1I94J 4U7CA 4UZBA 1WXTA 1WG1A 2VQEF 1TFYA 1M27C 3IBFB 1VQ6S 4X65J 3QAUA 3M55A 5HROA 4M5HA 4M5JA 5L8RE 4YR3A 2ROLA 3QZ5B 5KFDA 2GS8A 1CJVB 4L6V3 4RTYA 3ULHA 3M2VB 3DYAA 2VYTA 1RAOA 3CT9A 2GCFA 2UVWA 3PYFA 5J2NA 5GMKh 3V81A 1S6UA 3TI0A 3JCMb 4IOBA 2R8IA 2EFVA 3MXHP 2DHGA 5EUHA 5A0YA 1MU2B 4W4MA 3PFOA 1SJ1A 4ZP9A 2GNCA 3LGFA 2LXUA 1MMDA 3WVEB 2MLZA 3TUIC 2QE5A 4LDXA 3UQSA 1UVNA 1S79A 3JB9J 5HK3A 5DLFA 1W1FA 2VG5A 4OI2A 1NDCA 2X7IA 1NPPA 5GAEI 2EKNA 2MHEA 2GIFA 4K4SA 3UD5A 3H5YA 4P75A 2RU3A 4M78C 1LWXA 4E0DA 3LGLA 4BI8B 1UPMB 3FVYA 3CO9A 1R6VA 2K6DA 2MOXA 4HR2A 3UR3C 2RQKA 3EXCX 3CCJS 3FGVA 4JB8B 1QVFP 1VIXA 2KHDA 5FLXY 1XTDA 2W2MP 2CGHA 2V8JA 3QFWA 3HRTA 4NA2A 1IKYA 2CQ0A 4YQWA 4E7HA 4K4UA 2LCSA 1S9FA 5I2MA 1CJTA 2W2PP 1LEOA 1LWFB 2QDYB 1QVPA 1SJ3P 1QVFS 5HJYA 1GQEA 3NGPA 3D4JA 4LR9A 4EWTA 1RB0A 3RB3A 1H7XA 3TQEA 1VC5A 4M78G 4DPOA 5GAOr 1KSWA 1VLYA 2DF6A 3M4GA 1S1VA 2XBPA 2VBZA 1QP2A 3IGVA 1X4FA 2ZDOA 1BBZA 2OPQB 3I82A 4PG6A 1GFWB 1C2PA 3FDRA 2ZNZA 3GJSB 3CCLQ 2RMLA 2QA4T 1HSQA 3CCUQ 1W7WA 2V8VA 4PRFA 3Q86A 1TV6A 1RWOB 1SEMA 1VLOA 2DAQA 1JXEA 1NSPA 4J9UE 4JV5J 4N8NA 5F8MA 5I3UB 2FHOB 1FNOA 1M5KC 2IBKA 1SUQA 3A8KA 1T02A 3K0JA 3VS2A 2NQPA 5K20B 1WG5A 2CQDA 2HMIA 2KRSA 5IHNA 1I81A 3V8LA 4OZ2A 1S72T 3QO9A 1XNRJ 3HO1A 1NPKA 5HQ8A 2DY1A 1KLMA 3D6MB 2HQFA 1K0VA 1VHIA 1JMTA 5E3PA 4KUDK 4RX6A 3VTIA 2GAGC 4ICLB 1VQKA 1PKTA 3EGDB 5IM0B 4RTTA 1YJTA 4GMKA 3B8HA 4F04B 1PC5A 1SI9A 2CG4A 5KOWA 3Q8SB 2E70A 4FNHA 1TSFA 3FJ5A 2F9DA 3R5AA 2C3YA 2EYZA 1R8PA 2IMOA 2PSZA 2WB1D 1JLBA 3QIIA 5KYYA 4X4SA 3L7PA 1VQ6T 3U23A 2UUCF 4AE5A 3VV0A 2Z30B 4P74A 4EBCA 3EFOA 3T6BA 2IHR1 4J5YA 1RLPC 1UHFA 3O8WA 1MV3A 4J9DA 1M90T 1XNIA 2K57A 2XNQA 4U95A 4O4GB 4IUVA 3MR5A 1R0AB 2E29A 1M4ZA 2DGQA 4JI7F 2VOPA 2C2RA 3FK4A 5K8MA 4O3RA 2QMUB 3EDQB 1S6PB 3H2LA 2GGRA 3BDUA 4DV3F 2HW3A 2VG7A 3FUYA 2ZH8A 4B3RF 2HZYA 5C42A 3PHEA 3LGNA 4DSEA 1OY8A 3CNQP 3U1LA 1HI0P 2PUOB 4LF8F 2NXJA 4MZPA 1CQMA 2B7CB 3DB4A 1K4US 1LWEB 2DNGA 3VAKA 2XIDA 4B6MA 2NUPA 2BKOA 5LJ3Y 4USUA 4DF4A 3QPHA 5LJ3f 3BR9A 2BEFA 2DH8A 4NLTA 1X9SA 4Y00A 4J9LA 4QKUA 1FX2A 1U8RA 3CCJT 1CKBA 1X2QA 2YTCA 4DV0F 1N34J 2RQCA 4Q5WA 4N56A 1T3LA 3I96A 1RTDA 1YRXA 3HHLD 1UECA 3ISZA 2QRRA 2BV3A 3N0VA 2M9KA 4DL6A 2R8HA 1Q16B 1F5AA 4UY8T 3TVTA 5IXUA 1FRMA 1OYXA 3OYGA 5HBMB 2HLUA 2VG6B 2MZQA 1Y3JA 3GFYA 1TUGB 4ELTA 4HL9A 3JCMP 2O01E 3M8PA 1AFIA 3NS7B 1KQ1A 4LN2A 1UP1A 4M7DD 1VQ7A 4IUQA 4B9XA 1RAEB 1VK3A 2L9NA 4IUTA 4QVDA 3M05A 4A8OA 1K73R 3DU6A 4L3KA 3IG1B 1XMBA 1T3NA 3NAHA 1HR0J 3TSWA 2XLKA 3R97A 2DGXA 2PMZD 1X4HA 5IQQA 2F8MA 5J2MA 5CKBA 4BDZA 3NRBA 1C1BB 1OX9A 4AL6A 3ZNUA 2I38A 4BBYA 6FDRA 4ZLJA 1EZZB 1B0TA 2V5HG 4TLRA 1N56A 3DOLB 3SFGA 1RHRB 1WC5A 2EGCA 3NAIA 4ESRA 3D67A 1YITS 4C5IA 3AA8A 2R7QA 3OXGA 1YFNA 1X5SA 4A8YA 2RRAA 1S48A 2DXCA 2C2MB 3GLXA 1PWTA 5CD4A 2DIVA 2PO4A 4N5SA 1R27B 3G8SA 4HI2A 1P9QC 2WSEC 2C3PA 4LRBA 5FDLA 1FXXA 2DILA 2MQLA 4IFVB 1TTHB 4J7IA 1TKTB 2GFAA 2KNBB 1H3DA 4IYQA 4V19J 1R77A 5A2QU 3LA0A 2K2VA 3KKFA 1GFCA 4I64A 1JLAB 3GILA 5DLGA 2QQ9A 1KD1R 3PRVA 2RM4A 5DJBA 2AHJB 3LANA 1RT5A 3MCAB 4UQGA 3UA7A 3HJVA 2R2UA 3CJ5A 4Z02A 1Y7PA 4LR8A 5CQGA 4NYZA 5J1EB 3KLFB 1S0MA 1WF2A 2BM1A 5F8LA 3ZTPA 1WHYA 4ANJA 2XMVA 1HNVB 1MMLA 4IO9Q 4PJOF 2EK6A 1RKJA 2XYGB 5HVFA 2J76E 5B08A 4ZMMA 1A0OB 1PILA 3G6XA 3ENAA 3TAPA 1UA0A 2ZH4A 3SMZA 3KUHA 2E9ZA 2YKNB 2QYZA 2MKKA 5C24A 4PABA 4NYOA 1Y96B 2UV8A 2E66A 1ZSZC 2HNZA 1FK9A 1S7HA 4N7TA 3BDPA 4MAKA 3FSIA 4XTVA 4PPZA 2V8IA 2OAUA 2BMBA 5CA5A 3QZ8A 4HKEA 1NJIR 5GMEA 3V6DB 3PRBA 4DR2J 4ORZA 1E6GA 2RD5C 2ZD1B 2BW7A 1UUEA 4ZN3A 3QIDA 1QAJA 4ZLNA 3MOZA 4J9BA 4HA8A 3W9JA 1ZAVA 5EGYA 3JCMc 1FCAA 3I9V9 2B4UA 2OPPB 3R7SB 1X01A 4C2MA 3GU0A 5KFEA 3MPUB 2SRCA 2V8PA 4IG3B 1LKZA 5B0GA 2OD6A 3DLLQ 2YKOA 3C19A 4LSNA 3WVDB 1T9XA 1JO8A 3CD6Q 3E19A 3J80E 1PSEA 4ID5A 4WKYA 1U1LA 5KYXB 2XYHB 4DPWA 3AHPA 1SVDA 3OTCA 2HQCA 2FB7A 1Q8LA 1P8GA 5HI7A 4WCIA 1WI6A 2MK5A 1I5OB 2EKYA 2LQKA 1ZTTA 4B08A 5LMNF 4AUKA 5HL7Q 2UVVA 2AJ0A 1M1KU 1M5Q1 3J7YI 1YI2S 2YWEA 2F2WA 2MZJA 3M8QA 4C0HA 1WLPB 1B3TA 2MLXA 1ICEB 2HKNA 2B4VA 4MDXA 1AD5A 1MROB 5GAN3 3NY0A 2OPRB 4P72A 1AZSB 1KLNA 4F0HA 2JTMA 4C3KA 1WPYA 1Q7YT 3M1VA 3DGPA 2FVPA 2QTVA 4C6AA 2P2CB 1YITT 3CCEQ 3OYEA 3FJ2A 5H9FJ 3RYLA 1MWYA 3NGUA 4J9PA 2FZKB 1IKVA 4N8OA 4OI4A 4C92D 3EG1A 5GAHI 1C1CB 2N3LA 2JUFA 5MLCV 3D28A 1VQ4A 5ECAA 4Q44A 4JI2J 3JSMB 4RBTA 2OUGA 3NG8A 3A5ZB 1T9WA 4AFFA 2KRRA 4RUAA 3LOUA 3ITHB 2DNQA 3NGSA 4JI8J 4NLGA 2FVUA 1VS3A 3FJPA 4X1VA 3DRXA 5THWA 2HBZB 2VC0A 1NEGA 3OYMA 4CC7A 3LP2A 3PY8A 2HAXA 3KMQA 4GC6A 3H8YA 4CTAA 1T05B 4ANCA 4Z8AA 3OL7A 1VQ8S 2M1HA 3ENVA 4RUHA 2MKCA 4WFBQ 4C8QF 3QBCA 1Q79A 2MSTA 3QFHA 1S10A 2B8QA 5IWAJ 4B9LA 1U8WA 2DIQA 1MWQA 2RE1A 3HSBA 4UQTA 2VGNA 3AJ2A 3QRRA 4HCZA 2GFUA 1FJGF 1EARA 2F8EX 1ZM4A 4BCAA 9ATCB 2D3O1 1Y4ZB 3KG1A 2PQWA 3GNFB 3P5TL 1NH8A 1LW2A 2EWHA 3C6UB 3ET6B 4LIRA 3I56S 4DZDA 1YLXA 3QT8A 5FLXU 2CP3A 2AT1B 3QGGA 4P7TA 4ED6A 3PNIA 3MR7A 4CLTA 2ZGWA 3L42A 3W5YA 4PFPA 2D0QB 3L2UA 1REVA 1NEBA 4LF7J 1CQNA 4HTIA 4GY5A 1WHXA 4F7UB 3GV8B 3IO1A 5DG7A 4EZ9A 4AL5A 1R8CA 3DOMA 1SC1B 1QAIA 2I0XA 2L3SA 3D0GE 3S01A 5DDQC 1HFEL 2DXBA 3UD3P 1QVGA 1FMWA 1N8RR 3OW2P 3I0SA 3FFIA 1TK0A 5B0BA 4KO0A 2F7VA 4IKFA 1D0EA 4PJJA 4HCBA 5KFKA 3D0HE 4GKJJ 2IAJA 2G0JA 4ECTA 2HHUA 2ZEJA 4ZCIA 3Q8VA 1BHNA 1YDLA 3FMBA 2CZ9A 4ED8A 2AHOB 4AYBD 2K3BA 2E6ZA 4ER8A 1TS9A 2QA4G 1D1UA 2HSEB 4P5NA 3W7BA 4HT8A 1Q8IA 4DR6J 4UOFA 1FF2A 4OI3A 4WZQA 2HHVA 2PI4A 4F50A 3C16B 3QYGB 4WU3A 1XOVA 1CLFA 2FZCB 3PKYA 2QMXA 3CCEA 4C0DB 3IR6B 3R5BA 2N7YA 2KH9A 4OGCA 2GQCA 2BJ3A 1BI0A 2V67A 1W2BS 3HHTB 2MCNA 4NXMJ 1YBTA 2VL1A 5C2CA 2VIHA 2WBRA 1HHSA 2EBEA 4CM2A 2HRTA 3RBDA 3L2WA 1XC9A 2C3MA 4KBMB 2AV5A 1HMVB 2EAYA 1RCOB 3MUMP 3DLKB 3CCVT 1HK9A 3T1HJ 3NFCA 4KGZB 1S1UA 4FBTA 5CCLA 5GANj 4C0FA 2W9CA 4CLSA 3K59A 3UDLA 1RHKB 3UVJA 3EG2A 1OO0B 2QSWA 3HHLB 2CJQA 3KG0A 1C4CA 4C9DA 1LK7A 5EWEA 1XNQF 5GAN7 3RUBL 3LWMA 3KHRA 4CI0B 2QT7A 4UTGA 2QA2A 4PL6A 4XU3A 3B82A 4DHVA 3PGGA 1SQFA 4QIWD 3JCMh 5EWGA 1HPZB 2K3IA 2ZPFB 2YKQA 3ISNC 4LREA 5C2GA 3TQ7P 3CMAT 3HFKA 3HKWA 3PNWC 4M7DB 3K89A 2MGZB 3MFHA 2V4JA 1WQ7A 1B07A 2ILYA 3MAHA 1ZOTA 1WHLA 4F0KA 2NYHA 1D0ZA 3KDNA 5L38A 1X4CA 4I6YA 4DN0A 1W2BR 1LJOA 4F36A 3OJSA 3R8YA 4XK8E 1ZM3A 4CC3A 1NZ8A 4Q45A 2FLLA 1CULA 3TVKA 4BE0A 2VD3A 2CZ0B 2BXJA 3G6ES 2WVDA 2LNHB 3EJMA 3LLRA 2PMWA 3H0FA 2QASA 1A0NB 3SIPB 1E6YA 1FO1A 4B3OB 2D3OR 1WKJA 2ROEA 3SQGA 2JXBA 5DDRC 3I56T 4EDUA 3K58A 1YIJS 1K8AU 2DNPA 3BKUA 5HSPA 4C8ZA 3OV7A 1J2VA 4UUWA 3OBIA 1JJ2S 2V26A 3MMBA 2E1AA 4WP3A 1HD1A 3GG1A 5JVGQ 3J81E 2YWHA 2I2LA 2KG1A 2PC6A 1BQNA 3M8WA 3OUYB 1VQMS 3HRUA 2E5GA 3QWYA 1P92A 4DPUA 5CKEA 1IHVA 5LM7E 5A76A 3CDUA 4X4RA 1RAFB 2GQIA 3QYHB 2BM0A 3T1YF 5KE2A 4KIAA 3PDNA 5K5MA 2F5GA 3KLEA 1N36J 4ZGEB 2A6OA 2C42A 3HVTB 2W8LA 3KJVB 1JIHA 3PVXA 3WX4A 2O01C 2UU9F 2DTHA 2V1QA 3QATA 2KY9A 1M5VC 2Y8YA 3D6FB 3ZL7C 3JAMY 2HHHJ 4JI0F 3S3OA 4NE9C 2FZGB 1U49A 3KK1B 4LRDA 3CJ2A 2DEJA 3MUVP 1MNEA 4CO2A 1V5IB 2B8PA 5A0DA 5ETNA 5LJ5d 3I5AA 4X62F 2KDSA 2XMMA 3PCOB 1D9DA 4KRWA 3CJSA 3O3LA 2CQ2A 4HDHA 3NL0A 4IQMA 2B8AA 1VQ9S 3LWIA 1X5PA 1KK7A 2KI7A 5HLFA 2C2ZB 1UVLA 4F2SA 3MECB 3QIPA 4K4YA 2R8JA 2X3XD 4R0JA 4AG1C 3CJTA 2VBWA 4C11B 2LQ5A 1VCTA 2VBYA 1CJUB 1JLEB 1FNMA 1MNDA 4WF2A 3HZEA 3VS5A 5L39A 3CJKB 2PMHA 4ENOA 3CC7S 3TRGA 1LW0B 2DXDA 2BACA 4IG0A 4PXBA 3GSDA 1WJ9A 4OYZA 2XSJA 2HFSA 3V4IA 5D15A 5HY6A 3OXLA 3HM9A 4ZA1A 1PRMC 1Q4RA 4WE1A 1XQIA 4M78A 2CXEA 2YLCA 4H54A 2R5MA 5ETTA 4ETZA 4FM4B 3OYFA 4B3TF 2DO4A 4J9HA 2VUBA 3GG0A 2AGOA 1M8VA 1H3HA 1UG1A 1GCPA 3QRQA 2NWMA 4MK9A 2ZH1A 1QLNA 2WHOA 4KAIA 3OQ5A 1UCNA 2P6TA 1U7LA 1P6TA 3DC2A 2DCLA 5ETRA 3BSOA 2RUGA 2AU0A 3BKTA 1BB9A 5J2QA 2NUTB 3G6ET 1NK7A 3KLGA 1T9YA 4QW8A 3PYDA 3NHNA 1UGRB 5C5JA 1H8KA 3QSIA 2OSQA 3GTYX 3H25A 5LJ3j 4P2SA 1CSKA 3MEEA 1Q81T 4BY6B 3CBOA 4ZVSB 4LDWA 5GAMg 2AX1A 2R7XA 1YIJT 2C06A 4I7FB 4JRPA 1WHVA 2HVZA 5GMKa 3I87A 2BZ2A 4DR7F 1NM7A 1KJWA 4C8KA 1FTRA 2LXFA 4OYIA 4RG8A 3G96A 4DFJA 2J05A 4LFCF 4C92B 1VQNS 3MM9A 4RW7A 2IJRA 4ED2A 1YI2Q 2OP5A 1VQMT 3SSQA 2LT4A 1CS4B 3GIMA 4Z2XA 2RB7A 2RDIA 4D6WA 3IRXB 1IJEB 2KQWA 2W7AA 3KHGA 3DLEA 4EPCA 1Q7YC 3I9ZA 1UJ0A 1GBRA 2K5LA 1P9YA 3RESA 1SH2A 2BA9A 4QIFA 4ZPBA 1Q82T 3HRSA 3GWCA 4PJLA 2W9BB 4P71A 1RQ0A 2G9OA 1FRKA 2IVMA 2QZ8A 2EPIA 1S9EA 1MN7A 4QU6A 3ASKA 1TUWA 3X3UA 3DI6B 3ZZUA 3CEYA 1KHIA 2W0ZA 2DO0A 4XU2A 4DV6J 3CCRA 2CNNB 4OX9J 4PCQA 1X6BA 1R8BA 4PJNA 2OFHX 4M5NA 4X64F 3FCHA 1VQ9T 4K4XA 2OTLA 1MV0B 4ZP7A 4E7IA 3I55Q 2RDJA 1MGQA 1ZSGA 3LX7A 2OTJA 5BYSA 3KG4A 1VQ8Q 2GJIA 2ZHOA 1RL2A 2CJAA 3BN4A 1VQOA 2FTRA 3THTA 5GAOp 2XCAA 4IO1A 1D3WA 4XTWA 2ZJPQ 3H20A 2UUTA 2A2DA 2K5FA 3IR5B 1Z2LA 2LDIA 1K9MU 3WQPA 3C46A 1FT8A 1BI3A 1N5YB 1OI1A 3N5FA 5G0RA 4CO5A 1XMOF 4U7UK 4X2BA 4H4OB 1H92A 2R7UA 1ZS6A 1FVQA 5D4NA 2UUBJ 3MEKA 2HHXA 3CC4S 4R8UB 2MLYA 2VFVA 1FFGB 1SH0A 1AUDA 1X4DA 2GTOA 3NGKA 2Z2LA 3I56Q 2VODA 2PVOB 4F67A 2J7WA 1YJUA 3ZZTA 3NKYA 3FKBA 3E01B 2JLGA 1LOJA 3MPVA 3CC2S 4ECYA 2FVCA 4X4PA 4DV2J 1GX6A 4URSA 5M2PA 1M5HA 4TY9A 4HVWA 1YJRA 2NS1B 3DRPA 1RBAA 2ESWA 2CUBA 2W01A 4J8OA 1Z9ZA 3EDRB 4DR4F 1GX5A 2HAFA 2YRVA 4KHPJ 1HNXJ 3QLHB 2DD8S 3V6HA 3VJPA 4I2PA 3CMQA 1YQHA 1FWZA 2GNKA 4OHXA 5FU7B 4ID8A 3W9IA 1OY6A 3VKIA 3K5PA 1UJ6A 9RUBA 2ASJA 4FF1A 2KFNA 1VQNT 2JM9A 5HROB 1UFWA 1S12A 5L1JA 2FL7A 5HJXA 1X4EA 4P2FA 1NXIA 4L3NA 1E7OA 4ZK7M 2OPQA 5IT9U 1TVRA 1WKLA 1NSKL 2JC0A 2DPPB 2E5QA 5KFLA 2H5JB 2MQPA 3C12A 3TREA 4DQSA 2E5IA 3ZZRA 3GB0A 3VALA 3DMJA 2FGCA 3V81B 3ENWA 3VGUA 1JLCA 1TL5A 1MHNA 3BDLA 3JYTA 2LCWA 1SSFA 3MJXA 1GMUA 3PXGa 5HATA 1FXDA 4DS5A 2V0NA 1U48A 3MO8A 1QDUB 2V94A 2VG5B 4M75D 3SCLE 4PJOE 1V3RA 1D3BA 3QJPA 1VQLQ 3CCQQ 1WIEA 1T0HA 4M77C 1B7TA 1SC3B 3NWRA 3GLJA 2R2RA 1FKOA 4ICLA 2Y0SD 1KFDA 3HKSA 3EMTA 5C6SA 2LVWA 3VF0B 1IXKA 2G0CA 2UXBF 5B0FA 4TQRA 5KTQA 3PZPA 3CXCA 3AHUA 1M2OA 1TFWA 4LFAF 2FIUA 2GAHC 1TMMA 4ELZC 3CTRA 2H48B 1CJTB 1VQPS 2M88A 4OX7A 4XQ3A 4FCYA 2AKWB 2KRMA 3IAS9 2OX7A 4F14A 3VUZA 1F2GA 3RKWA 1T9UA 3NOCA 2KVQG 5L23A 1UVIA 4M77G 4R55A 1S1VB 4A8WA 4F3OA 1FDAA 3FC3A 3VS0A 4LF2A 2YPYA 3QUIA 1YJNQ 1R0AA 1JB0C 2AP6A 4K0KJ 4Y6IA 1ZSZA 3JV3A 2BUNA 4RG2A 4BI4A 2VOOA 1UZDA 1X4GA 1ZBJA 1ZX6A 5DLOA 5DLQE 3NEKA 2XLIA 2UVRA 3AD8C 5BYRA 2FG0A 5A2QE 4A4HA 4FT4A 4GVBA 1OOTA 1SUQB 3AH6A 4OJHA 1RU2A 3U1MA 1DQAA 3AOBA 1PM3A 1TK5A 5A8RA 2PEHA 2DISA 3Q22A 1YSJA 4GKKF 4JI3F 1OY9A 4HT9A 3G87A 2FPHX 4UOCA 3MR3A 4QIEA 2YXLA 1TAQA 3QO9B 4M7AC 2IRXA 2CJYB 2EW3A 3KJQB 3GF5A 4M75E 4D8KA 4J9GA 1KLMB 3FEYB 1J5OB 2CFXA 4V1Ak 1QMCA 2CJ9A 1K44A 1RLCL 1TL4A 2HZCA 1OJ4A 4PQUB 2YNHB 1G83A 2MEWA 1S9GA 3MEWA 4N77A 1S0OA 4CO0A 5K8PA 4WCEQ 3GONA 4RW4A 3B4MA 5HBMA 3G71S 1ZPWX 3TW0A 5J3BA 3KJFB 1JLBB 5KYYB 1B0VA 2LTOA 2HWIA 1EKRA 3RERA 5DQGA 3EFOB 3QKJA 3ZXWA 4M7AG 3H4DA 1Y57A 4LDUA 2EQIA 2WACA 2Y90A 4I56A 3ETOA 4I68A 4QR2A 4E8UA 2KXDA 1AB8A 4NA1A 3M54A 2JVOA 3QPIA 1UETA 2GV1A 2KXNB 2LYVA 2MZTA 4ZPDA 1VQ9Q 2Z4PA 1HNWF 3TEHB 4DDFA 2Q3PA 1QCFA 4WWSA 5C42B 3FBFA 5A6PA 5A0GA 1C1BA 1C6VX 3BV8A 2EK1A 1K1QA 1SC4B 2J6SA 1VQLA 2HL3A 3MP8A 4LUEA 3ZTRA 4B02A 1EFNA 1KHCA 4KV8B 2NYSA 2BE9B 3HHKA 1SBRA 1X0PA 3G9CA 4JJNK 4L75A 2AK5A 3CC7Q 4WTOB 4DBQA 2BUDA 2QFJA 4A4FA 1NSAA 3BGOP 2GO9A 3OTOF 1DY3A 4X66F 5KFSA 4ZVUB 4IFVA 1RTDB 1AVZC 3GP8A 5HO4A 4QWCA 3TP2A 4HACB 4EUVA 4MK8A 1EQMA 2P9CA 3VV2B 1ZZFA 1VQPT 3D66A 4DSLA 1RWXB 1N33F 2MQ8A 1ZBTA 1N4LA 4ILRA 4YB7A 4C5EA 1JLAA 2P8IA 2ZH3A 1YJWS 2FLPA 4LDYA 4S0MA 1UKUA 3THKA 2UXDF 3M8PB 1M90U 2RJEA 3O5ZA 4P7VA 1YJNA 4ES1A 1AHJB 5KFTA 4RW6A 3KBGA 2CT4A 2KKHA 2IRUA 2Y1JA 3CPWR 1WTFA 4KR0B 4U8VA 1OYDA 3FB9A 4Z37A 1BMQB 2DTOA 1HNIB 1UGVA 4G1QA 3BBCA 1F6TA 2MQNA 5GADI 3MWBA 1S1NA 1HWUA 2OI2A 5J2MB 3L95X 2EKOA 3S1TA 4FF2A 5GAN8 4DXLA 2CH4A 1R0BG 3B6BA 3TO8A 3NGTA 2QA4A 1NU4A 5FRNA 1WG4A 1YJ9S 1DURA 1YHQA 1VQ5S 2JEFA 2LRQA 4F2RA 3JTOA 3IP0A 4X4UA 1RZMA 3M56A 2CZ1B 2E5JA 3IQLA 5L9NA 2ZD1A 3L09A 3PTAA 3CCWA 4ILMA 1IR1A 2XS7A 2CQGA 4JS4A 1KQSR 2R42A 3FCVA 4KFBB 2RSQA 3RRKA 3HFOA 2OI3A 4EMKB 1RJJA 1U1SA 4E47A 1S6OA 3RB6A 4C8YA 5FDLB 4F4WA 1E6HA 1BQMA 3F44A 5GAOl 2MYFA 1BI1A 3E9GA 4M8LA 1ZA1B 3GCXP 1Q82C 2BQUA 2ATCB 3DN9A 2XQCA 1WJRA 1WZOA 4RUGA 1IKXA 5CVIA 1UHCA 3V7RA 4FSXA 2WW8A 1VYAA 2OSRA 1NJXA 1HYOA 3LAMA 2LDYA 2AQ4A 5FLXE 1W2IA 5GAMe 3G7ZA 4PG8A 1RT5B 4XPCA 2E5LJ 1OEBA 3RMQA 4PK4A 2JS2A 3M0UA 1RYRA 1KBRA 1PCXA 1PSDA 4KULA 1VQ6A 1KS2A 2XMJA 3RZAA 1R8HA 4PR6A 3C4SA 1KC8R 3OL9A 2L9DA 3PT9A 1MROA 3EGUA 3IS9A 3QDRB 3OYAA 3F41A 3MZIA 3CW2C 2J06A 3MMCA 1T0TV 5IXFA 4PKDB 1Q78A 4RNMA 3W2WA 1X69A 5C24B 4OHWA 3RW7A 4QIVA 4PJOB 4ANDA 3VYGA 3CPFA 1H98A 2PA3A 4USMA 1Y0HA 3Q8RB 4DL7A 5AE3A 4ED7A 1GXUA 4LIWA 2HZAA 1CKAA 4MJKA 3F56A 4JRIA 4ZKAA 1SKRA 3AJDA 2JOYA 1QM9A 4OB2B 1KHVA 3MR2A 3P49B 2ZUGA 2KZZA 1UA1A 3A8OB 3JTPA 2J5AA 1N9SA 3CC4Q 1U06A 5HANA 2K79A 4DG1B 3Q8YA 5L1KA 2GHPA 2EVRA 1G4CA 2QO3A 3T1YJ 2KK4A 1RWWB 1YJWT 2DKOB 3P8BB 4PZVA 3CCSQ 2BBEA 3H90A 4XO0A 3CCJA 3N5BA 2MPUA 2YX4A 3M0RA 1N9RA 3CC2Q 4LSNB 5FU6C 4M78D 5FD1A 1VDHA 3LAKA 2MKJA 4JV2A 2RO0A 2D1CA 2UU9J 2X4XA 4CLFA 4F8RA 4YY3J 2P4RA 4DS4A 2ZC3A 2HVDA 3VAFA 1QE1B 3JXOA 1S59A 1GCQC 5GAMf 4UZCA 4NWBA 4PQAA 3LP1A 3TZZA 3AD7C 3TA0A 3OBWA 5LSLA 4JV1A 3CCMA 2CQCA 4WK3A 3CBPA 4ZGDB 1LNQA 1NZAA 1S1XA 4OMMA 1K73U 2HBRB 2BW2A 2ZWOA 3SQOP 2KJVA 3BGFA 3W5XA 2ZE2A 1B99A 4HDGA 4CRIA 5HMWA 1KRPA 3OT9A 5GVQA 1CC8A 4TU9A 2FHDA 1NAQA 3GYGA 3OFGA 3M1VB 1VQ5T 2YNFA 3QAEA 3DGPB 4NA3A 4NLUA 3MEVA 2IM0A 4Y28C 3HP9A 2OFGX 4NOHA 2VQFF 3ZZ0A 4M75B 4BE1A 5KG2A 4RBVA 3LP0A 2AYGA 1WHMA 2PD1A 4WTYA 1IKVB 5GAOn 1G2EA 2CRLA 1YJ7A 3R5GA 1TAUA 4B3SJ 4RWWA 2DETA 4QIGA 1AOJA 2CJXB 1OX8A 2VHGA 5JMNA 1KQGB 1W4SA 4FSSA 2CVEA 2IMWP 1WHGA 2J0QD 3GQCA 2GQ2A 2A08A 3PW0A 3CJQA 1VMBA 1WC3A 4EMKC 1YBYA 1YTYA 5DS7A 4QT7A 1ZTWA 1PBUA 4LFBF 2ZM6F 3LP2B 1S1TB 2DNNA 2W25A 1VQKS 4R0KA 4RL1A 3NOGA 1ZQ1A 1DJ7B 4M78E 1Q5YA 4ZGJB 3KHLA 1KD1U 3CCZA 3OFFA 3R5DA 2A18A 2FRWA 3GIJA 5LMUF 4KRTA 3D6TB 5DZ7A 1QUPA 4DR3J 2A7YA 2X1AA 5EX3A 1D1AA 3QHSA 3TUPA 1URRA 4CC2A 5KFNA 5KFUA 4HVUA 1W26A 2DBMA 3AD9C 2V63A 4DPYA 4DBFA 2L41A 5GAN4 2UZAA 1OU8A 1QJHA 4N0AA 1J5EF 2JJ9A 1SCJB 2NYIA 1IKWA 1SC6A 2V2ZA 2FY1A 1W25A 1S49A 5ADZA 3GIIA 5GANh 4FP9A 2HRUA 2IA0A 1N5VA 1N88A 3G4SQ 4B3MF 2FVSA 4MIAA 1K8AT 4M63A 3ZTOA 4PJOC 3BSNA 5A0LA 3O5TB 1NJIU 2NXNA 3M2RA 3PIOQ 2FUG9 2EFIA 1REVB 1RAHB 4BE2A 3GYNA 3EUNA 4R5PA 3CCSA 1JQGA 3DU5A 1OPLA 4L6V5 3DOMB 3MEGA 2CG8A 4DR5F 2CP6A 4IUPA 4RW9B 4QW9A 4PUOA 3ZO7A 3ZZPA 1HPZA 4C8NA 3THVA 1AWWA 4OZ0A 1HARA 3FFIB 4ZHRA 1YCYA 1KDNA 3M53A 3EGNA 2FLOA 1S6QB 2BVZA 5EG2A 1QTMA 1BI2A 4PJOG 2RU9A 2IBOA 1I4K1 3X25B 1NDKA 2HS0A 3T1AA 1LFPA 5HAOA 1ZA2B 1GMVA 3A1YG 2ASYA 1U0SA 4Q2LA 2J6KA 2CQ1A 2VV5A 1VQ7S 3HHEA 4YB5A 3G71Q 2R8KA 1KIKA 4C3LA 3JQMA 2YQ1A 5BR8F 3NMAA 1VIFA 2E10A 1TU0B 1MMNA 2IJFA 3QT5A 2EFOA 2W8KA 2VJUA 3PTWA 4M95A 2EYWA 4M1KA 4CLWA 3T3FA 1MMGA 2D3UA 2IC3A 5CKFA 4E7KA 1S76D 2I1RA 4JI5J 4Y91A 3MD3A 4AXJA 3H2VE 4RUBA 2EWNA 1UGSB 4MZMA 1K9AA 1FDDA 3TSZA 1S1UB 1FJCA 4F7VA 3S3NA 1R31A 2QX0A 3VVTA 2IM3A 3CUNA 2W9CB 5KYWB 3UVJB 3OUYA 1PKSA 4Q8EA 1YITA 2M4MA 2PE8A 4G6VB 3C66A 3RTVA 1X7VA 2GVZA 1WC0A 2GX8A 2ZZDA 4F16A 3CD5A 4X4VA 2HFVA 1ABQA 1WHJA 2EJ9A 3TVZA 4C0BA 1NDPA 4IH7A 3HVTA 2MAMA 3N6NA 1JNRB 2XY5A 3THPA 1SV5B 2VDIA 4O44A 2FJEB 1ZPVA 2G3RA 2CJKA 4P10A 2EBGA 2HFOA 1NUEA 2DHHA 4NLXA 3DLBA 2XYPB 1KSPA 1I1GA 3KK1A 3IM8A 5JJBA 4DQQA 1NYFA 4OZ1A 1RI9A 4WXWA 2H3EB 4LJMA 1KG1A 2ROGA 5I2SA 1KQ2A 1UL3A 2O1PA 2FPFA 2LXIA 3ILOA 4OZ3A 4MH8A 2HKEA 2CQPA 3LGMA 3KXTA 1UGQB 2XMAA 2ENMA 2COYA 2Y9HA 1YJWQ 4ME7A 4X9CA 2FPEA 4WFYA 1E6YB 3G4SA 3HVRA 3MAQA 4C8QC 3SQGB 1OSCA 1M9SA 2DHXA 3MECA 1WDXA 1UW9A 1FRLA 2B9XA 3EWGA 1U2RA 4C11A 4JYAF 1WQWA 3D9BA 5HMYA 2C22A 1BIBA 2B86A 3MMBB 4B9NA 2ASDA 3KLHB 5KYNA 1AW0A 3JCMe 2Q6CA 2ZZTA 2CNOB 3OLAA 1BQNB 5HVGA 1M1KC 2CKWA 3EH2A 4OYOA 4BDYA 2O9SA 1YJ9Q 2EPDA 3PW4A 4C8QG 1HBMB 2E6NA 3LH0A 5E0OA 3KLEB 2QLWA 4ZS6A 2DVIA 5GJVB 5DG9A 4CT8A 2O66A 2OEJA 3TUJC 2DNLA 1C0UA 3EVOA 1VRUA 1KOOA 4DFKA 1X75C 4MK7A 4HHHA 4HH0A 4NEZA 4AL7A 1EAYC 3HSZA 2HS3A 4YR2A 2N3OA 1YRUA 2RJFA 1Q5VA 1RHJB 3P4UB 5LJ3h 2DLPA 2Q66A 1R7IA 3KTQA 3CDBA 3CCUT 4BWJA 1OIAA 5F9NA 1PD1A 4LFAJ 5KFXA 1U6FA 1IM4A 5IS2A 3WHIA 1WC6A 5B09A 3QJLA 1NPRA 2BJDA 3HFNA 2V2QA 1FRJA 3H7HB 4ZNXA 5KE3A 1RWKB 3QIPB 2XO6A 4IDKB 1XMQF 4TLQA 2LEBA 1FKPA 2HNDA 4A4JA 1CS4A 2HBQB 1UDLA 4XTXA 2E9RX 3JCMf 3BO3A 3IRXA 2JJ4D 1SKSA 1H2TZ 4IG0B 5DM7R 4ZCLA 3F73A 4G1PA 2U2FA 2HGLA 3RBZA 3RR8A 3QO3A 1RAIB 2YX1A 2Z8QA 5CYJA 1K9MT 3CCVA 1IGUA 2GCXA 4EI2A 4HH1A 3NLCA 1R0CB 4DLEA 1EQ0A 3O8VA 5C25A 4KSEB 4YB6A 4M78B 1VQ4S 3M8SA 4M77A 1TG0A 5F0WA 3PRDA 3W2VA 4J5OA 2W9BA 2YUNA 2Z0GA 4DUZF 5CYMB 3K5OA 2H9ZA 3LO3A 2Z2YB 1VBZA 4TXSA 3G86A 4USIA 2FEIA 1IBKJ 2XTJP 3OSPA 1XQHA 1F2HA 1SQGA 4ZJLA 5IT9E 3DI6A 1U1TA 3CCTA 5J2QB 3CMAA 3PG9A 1ROFA 3KLGB 2CNLB 4HEA9 5FROA 4KPYA 3MURP 1O9SA 2LLZA 2R7OA 2PNIA 4RNNA 3QG1A 5J1PA 2CIMA 2UUWA 3MEEB 2L2PA 4MIWA 1RWUA 3VYHB 3H4BA 5I21A 4FU6A 1UTIA 4FS1A 4ZPCA 2RPNA 1JXVA 2WTFA 3NCRA 1WYXA 5T7LB 3SDZA 4F4XA 1G3SA 2QFIA 4A8MP 5IT0A 2KYBA 2DYAA 2AW0A 3MM9B 2V4RA 4RW7B 2ZVIA 5DETA 2O4XA 2YQ0A 1EB0A 5ITHA 2BKDN 1JLQA 2HDAA 3DLEB 1JRIA 4J6XA 2HFNA 2HQIA 4R8UA 3M4YA 1RE1B 2VONA 1NLPC 2YKAA 4C3MA 3KOAA 2OMLA 4K8RA 3ER0A 2NSCA 2VXFA 2EW9A 4AMCA 2WCXA 1SHFA 4MMLA 3PW5A 3E2EA 1WWHA 5GMKi 2XO7A 1EHWA 3M0PA 4OMOA 2PFFB 3P96A 3E51A 3MM7A 4QWAA 1S9EB 4OF1A 3G6VA 4AFUC 1W6XA 3A8IA 4JOUA 1S5ZA 1G3WA 3OYKA 1IBLJ 1G8XA 1HXDA 1FX7A 2HAIA 3TJ9A 3QJJA 2PFDA 4YFUA 1Q81U 3T9NA 3OW2A 1DJ0A 5J39A 2X4WA 3OL6A 1DTTA 1JJ4A 2C2KB 2DRAA 2FJAB 3LH5A 3PHTA 3PX6A 1VQKQ 2RF0A 2XDDA 1S7IA 4LBIA 2HL5C 4Y2KA 3JCMV 3TZXA 2N82B 3H40A 4KGKA 5CCMA 3UWTA 1BU1A 4C8MA 1HNZF 2BANA 2DNMA 3CCES 4EO6A 3NMZC 3TU4K 1RDRA 2OELA 1M1KR 1UFKA 2L5QA 1WGSA 3I0RA 3AB2B 2Y3YA 3BF4A 3MCNA 3M7VA 4BI3A 2OH2A 2HMAA 4K2XA 4KHMA 2C2DA 3I35A 4ITSA 2QK0A 2QL7B 4IIOA 5CHCB 3EYZA 2FHKA 4OHVA 2OJ3A 2RT3A 5G0RB 1Q0NA 3M30A 3N6LA 1U09A 1Q82U 3NXZA 2HBWA 2ZBPA 3UFCX 4QQGA 1QVGR 1TL1A 1SB6A 3GIRA 3EGWB 4DSJA 1RTIA 4DR1J 3OPKA 3OTDA 5DDPC 2BQRA 3SWNC 3SB2A 5T14A 5A6WA 5MAOA 5GAN5 4YDXA 2ACMA 2B6AA 1K8AC 3NNHA 2DBKA 2M3DA 4B9SA 4ZVGA 1K47A 2RHZA 1M0SA 1HQUB 2BJ1A 2QGGA 4JRQA 1EX4A 5KG3A 2F9JA 1X6OA 3DRPB 1IXDA 4LF5F 2ZBQA 4NOYA 4B9VA 2F69A 2O5DA 2K1RB 2Q79A 1B34A 3A3PB 3P6YC 3KLIA 4LF4F 4YR0A 2M0GB 2DRKA 3ISND 4EU0A 2RQVA 4RU2A 1N48A 4CH1A 3BJYA 1I94F 4BC7A 4I2PB 5KFAA 3TEEA 4YTLA 1Q86R 3PR4A 4X65F 2DZ9A 1X31C 2IIHA 2HNYA 4DX6A 1ZAXA 2VFSA 2H54B 4O3PA 1IVZA 2DR5A 1H72C 3K8VA 4RTUA 3TAQA 4USJC 3HL8A 5C7PA 2J6FA 2FDNA 3GNGA 3R9LA 1WJQA 1TVRB 1YIJA 1VQ7Q 3CBMA 2X3GA 4E7LA 2EQUA 2D74B 1JBMA 1RT1A 4KB7A 5LSRA 3N79A 5EHHA 3BQ0A 4PXDA 1APSA 3UPUA 3OR1B 3ILIA 3FMWA 3DMJB 4KTQA 2W2NP 4JI1J 2BOPA 5GAMj 4K11A 4BC9A 1FRIA 1JLCB 4DV1J 4EO8A 1AROP 1DRZA 3JYTB 3VGVA 4DOVA 1VQMA 3JB9F 1Y07A 3JTNA 2HLTA 4OMFB 3CD6T 1Z2ZA 2CS7A 5D3GA 1B0PA 3S8SA 3SHWA 5LJ5g 2GW8A 2LU1A 3GP9A 4Y0FA 4CIOA 5I11A 2CREA 5J1NA 2E41A 2CPDA 4OYXA 1D3BB 2WSCC 5KFJA 5C0MA 1J5OA 4NZ0A 2VA3A 1FKOB 4PQUA 1EETB 1HWJA 2YNHA 5B0EA 2XG8A 3SXLA 3A4TA 3MTJA 1M8MA 5F9LA 3H8ZA 2RVJA 4ES2A 2K7AA 2K7KA 4YS2A 2X3WD 1UWAA 1ZHIA 3I5BA 3SI8A 4BWMA 1HQEB 2ZH7A 2HSPA 4JUZA 3M8ZA 1BE4A 1TMJA 1NHVA 2LJ1A 4EMHA 3CCET 1JQQA 4A63B 2JL9A 2AIRB 1JK9B 2EC2A 3TARA 5CO7A 2DRDA 2ED1A 2ZH6A 1RLDA 4H4KC 1N5QA 3FSXA 5M9OA 2J0XA 2DJQA 1H641 2ZKTA 4U7UD 2VXEA 4OJ3A 1U8SA 2BX6A 2J7KA 3V2UC 2AZVA 2FJWA 1Q95G 2PUKB 4FYDA 1ZSZB 3ICLA 4P6QA 3J81Y 4JV5F 1ELOA 2DZCA 4HCKA 3DOKA 3OMGA 3BGLA 2QI2A 2RUSA 5L9XA 2GGPA 5CCAA 4GVBB 5H9EK 4KV8A 1UEUA 3GPAA 4RTZA 1NM2A 2JFKA 5A8RB 2XI9A 4OGEA 2B0GA 2XD0A 3QZ9B 1XNRF 2NUZA 3HCXA 1BYMA 2M51A 1HWKA 4OYMA 4P52A 1I1JA 1DFDA 1AT1B 4EBDA 1AXQA 1U1QA 3IA0A 1SL2A 2OPSA 2ABLA 5AXKA 4DU7A 1X9WA 4OHZA 2RHYA 1G6BA 4HACA 1S9GB 4NLSA 5BJRA 4JZ4A 1ZUKA 3ME9A 1TKZB 3W5ZA 2B9YA 3LW5C 2YUOA 3L2VA 4RW4B 1LCKA 5HP1A 1ZUYA 4LFBJ 1OQ3A 2GVDA 4HVVA 1G7CB 3VS4A 1FJEB 4QVZA 2UXCJ 4GBQA 1Y9OA 3MPDA 2JHEA 1CG2A 1OYEA 4PFOA 3QWPA 3MHYA 2V8GA 2YWWA 3H0IA 5LMUJ 1OZ2A 2X1BA 2EQKA 1EX8A 4DA4A 4USKA 3EHQA 1HNIA 4WJBA 4LT6A 2MKIA 2CQ4A 2DYBA 1NO8A 1RHQB 3UN5A 1VQNA 2M9UA 5FWBA 1T3OA 3H0PA 5CZXA 3N01A 4DSIA 3PM9A 5K14B 4DV4J 1RT7A 3CIZA 4F7UF 2L3QA 1BQXA 4VUBA 3CDWA 4J9KA 1AWOA 2LJ0A 1WHHA 5J26A 4OZJA 2WONA 4WPAA 4ELUA 4WFAQ 1DQ9A 4PG7A 1N34F 2ZH2A 4FF3A 4KFBA 4JP8A 2EVZA 4J6YA 4EMKA 1BLUA 4EGLA 4FXWA 4DEZA 3OS5A 3P8DA 3BKFA 1FEHA 3CULA 1YKWA 1K9MC 3PV8A 5AJ3J 1WDDA 4AFSC 4DR5J 2BJ7A 3MMJA 1FERA 1VQ4Q 4TNOA 1GEHA 4A8SA 3OVAA 2V4QA 4O3QA 2I2YA 3UW1A 2QQSA 2WOMA 4HT5A 3OFEA 3H5UA 3JQKA 1K0XA 1L3TA 2K7JA 3CCRS 2DK2A 2W7PA 1QUVA 1RYSA 1S57A 4NPOA 1CBKA 1NH7A 2WVEA 3UA6A 1Q1KA 1XTZA 3S7RA 4RW6B 2WBMA 4OMFG 3R6GB 2OTLS 3OY9A 1VGYA 3JCMJ 1LWCA 1JNZB 2X51A 2OTJS 4IH6A 5GAN6 2AEFA 1HR0F 2AJ2A 3J7ZT 2O9VA 3HDSA 3HMJG 3MEAA 3NGRA 1VQOS 3M6XA 4G1QB 4JBCA 2JMCA 4LF6J 2XI3A 1S97A 1NMEB 3MD1A 3X26B 4BS2A 1K73T 5BR8J 3HKZD 3PACA 4QJVA 4PJOA 2H65B 2P0QA 3HK2A 2K3YA 1YK9A 3RW6A 3QZ7A 2D69A 3GPLA 1SQEA 1WSVA 3BDEA 1VBXA 2CPIA 5AE2A 2DNKA 2RI5A 2IVFB 1U2FA 2V9KA 5EWFA 3HD2A 4QCLA 1QCNA 2MYSA 4M7DF 3R6LB 3MM8B 3PYEA 5IHKA 3VAGA 4K4WA 3FQKA 4DG1A 2ATLA 4CLPA 2F8HA 3W8PA 5F3ZA 1BQMB 4ECWA 1H38A 4WIIA 2I6WA 5SUHA 4DMZA 4NI2A 1F0XA 1G2BA 2IA6A 3UD4P 2NZ4A 2ED0A 1IKXB 2R7RA 4F25A 4DL4A 5DGBA 2I0NA 4JS5A 3NNCA 4DL0C 2DYIA 3MCSA 5GAHU 1QE1A 2KTQA 2C2EA 1RT3A 1JKHA 4ZP6A 5HK4A 2RN8A 3OMCA 3UT1A 4RZRA 2HQDA 1NKBA 1KD1T 1WX6A 3A12A 2AWZA 3URGA 1EIFA 2J7IA 2HWTA 1UVKA 3W62A 2MXYA 3C2PA 3OHBA 1XK8A 4A47A 3BBFA 5M2UA 1HQ2A 4MZTA 4U6PA 2B9EA 1GXLA 3GJTB 1RHUB 3I5CA 2RMOA 3BGUA 2NUHA 3IS9B 1XJWB 4NX9A 1U3OA 3MEDB 1LFWA 2NUUG 3MMCB 2UUAJ 3OTBA 3AA9A 2DEIA 4DV7J 1S99A 4PLLA 3W2WB 2HHQA 1WHKA 3GYXB 5KG1A 4ZN1A 3R3TA 4XAXB 4M75A 4RTWA 3C6TA 5KFWA 4URQU 2PA8D 5KFIA 4JI4F 4JYAJ 2DL7A 2KI2A 3OYHA 4DR2F 2V68A 4TU8A 1KVJA 3VQTA 3W65A 2DD5A 2EFGA 4J9SA 2IRYA 3VZHA 3K8WA 1U24A 3W66A 7FDRA 2M02A 2Q43A 2DPIA 1NLOC 2EJGA 4Q0BB 3ZC4A 1TUVA 4J9EA 5D6YA 1XWLA 2Y1IA 2EYYA 5I42B 1NJIT 5FIIA 2XY6A 2KXHA 2V8HA 1ZM2A 2XNRA 4MMKA 2G13A 2DHSA 1I07A 1N5ZA 3HTRA 3TEGA 2ZVSA 1S1TA 3G82A 4V2SA 3OSNA 3N5BB 1E6VB 3X28B 3I55S 4JDSA 4DUYJ 4XTYA 4J9QA 4EIKA 4M77D 1P1LA 4XTUA 3CXCS 2R8GA 1FHTA 4X84A 2QTWA 4Y2IA 2COZA 1WHWA 2MZSA 4LF9J 4CO3A 1VQPA 4AQYJ 3LP1B 4I0WA 1RT4A 1VQOT 1RBLA 2AJ4A 2V8KA 1S1XB 4DUTA 2CPYA 5BYQA 2KL8A 4F26A 4C0ZA 1NK4A 4C8QA 3VR1A 2JNJA 4RU9A 2J6OA 5HQMA 2JH3A 5CKHA 4PPDA 3OA6A 1UFFA 3MM6A 2I5JA 2ZE2B 1MWZA 4QYZJ 3EGXA 1H3ZA 3BE3A 3KWMA 2HCKA 2GIRA 3D6HB 3RBEA 3EZUA 1X60A 4Y2AA 2YNFB 1QWEA 1V5VA 1PAUB 4NCAA 2R4FA 4RMOA 1RBOB 2RKIA 3IXQA 4DN9A 3P3DA 5HK0A 2LC4A 3LP0B 2PN6A 4EMDA 3PO4A 1YWXA 4MKBA 4QBUA 1M2VA 5CH7B 2KU7A 3L1AA 3OQ2A 4A46A 4CDIA 1LVKA 1RU1A 4JI2F 1JLFB 5H1SV 2QV6A 1VQSA 1RI0A 4E7JA 1NLKL 4OL8A 3CXCR 1N0UA 2WVFA 4RW9A 4JI8F 4QWEA 1XERA 4RR5A 3MTKA 4MKAA 2GBQA 1IB8A 2DL3A 1BWVA 2W10A 4O5VA 3PKMA 2W4DA 1FX4A 2LKZA 4DCJB 1O6XA 3KK2A 5U47A 2RQUA 2XGQA 2AZ1A 4M7AD 1S6QA 3M9QA 1QTNB 2FYKA 2KVQE 3MPYA 4M77E 3FRNA 2H5IB 2ACYA 1T11A 5KG6A 5IWAF 3UI3A 1W2BP 1BK2A 2XDBA 4R25A 1YI2T 2V34A 5FW9A 1UFLA 3I31A 3OVBA 3N4WA 3LH2S 3EG3A 2YNGA 4C92F 3TX0A 2MQQA 4AG2C 1IM6A 3VZIA 1KC8U 1X43A 1SG5A 2QAZA 5JVHQ 1GNKA 4EYIB 3UPFA 1JLGA 5E2QA 2F4VJ 3KJNB 3OHAA 1IKWB 2QC3A 3PX4A 5LSOA 2NXUA 3R5JB 1UWBA 1M90C 2ALYB 1U2CA 3DDNA 2KT3A 3GCWP 1D8ZA 4JI6J 3OTEA 2M70A 1JB0E 5KYWA 4PWUA 5LJ5e 5D77A 3M2RB 1QCOA 3CCQS 1VQLS 2AX0A 2CYYA 4J9MA 3AOCA 3REBB 5LL6S 2WSFC 1WELA 4R5PB 5KFMA 2ZHAA 5GMKl 3MEGB 4NXNJ 4EK2A 2OKQA 1HW9A 1WJSA 3I5SA 3ZFVA 4PUOB 1U6BA 2NREA 2IYGA 3LYIA 3MP6A 3I55T 4YMEA 4WKRA 1S4FA 1RA6A 1X5OA 4YOEA 1SV5A 1VQ8T 1Z9QA 2D1XA 4GKJF 2FC8A 2P5VA 4ZHRB 4OMQA 3SV4A 1N8RT 4M7AE 3VUBA 3OVSA 1T03B 5A8KA 1NKCA 1RTHA 1PSFA 4DR6F 4OMLA 2DRBA 4RTXA 4IR1A 2DXUA 4KC5A 4M5LA 2IY5B 4F02A 2W7OA 1U45A 4CO4A 1NJYA 1YJNS 5F8JA 5GANe 1F5BA 1TZ0A 2A2CA 2JT4A 5KH6A 4NXMF 1JJ2P 1ZETA 3A8LB 3O44A 3E9FA 2HGMA 4ZPWR 3DLGA 2QGFB 5IFMA 2VQEJ 3UCUP 5B7WA 4GO5X 3R2CJ 2BJ9A 1ZYQA 2HG4A 3M4XA 4FZVA 2IC3B 4L72B 3RJMB 3A8MB 3T1HF 2F2VA 2KM8C 4PXEA 1PC0A 1NHKL 2K9GA 1LQ9A 2HD0A 2AD9A 3KLHA 5D0HA 4LE9A 3L2RA 4ZVPB 1F9HA 1O75A 3EG9A 3TOQA 2NPFA 5LJ5Y 5CQXA 4TKTA 3TNVA 1MW7A 4L74A 3BQ2A 5LJ5f 1ACMB 1RI7A 1GMWA 1YHQS 2LFVA 1QSSA 5IZHA 2QEXA 3W9HA 2YY3A 3PFSA 5HKCA 2GVZB 2F4FA 2XZTB 1HBMA 1IZ6A 2GHWA 4ALZA 3OSSC 1VRTB 2KSSA 3JCMW 2KFZA 2LEAA 3MF5A 4O44B 2FJBB 3KLVA 5DQHA 2GC8A 2R3VA 2ABYA 3HT3A 2LQJA 3EAEA 1L3UA 2NCKL 3QGIA 4M5IA 1IRXA 4Y92A 1HI1A 2AJFE 4FYVB 4ZVFA 3GZ7A 5IHIA 2ZPIB 1PRLC 3I4HX 4D3GA 2A0FB 4LF4J 4XU0A 2XG8D 5DQIA 3MGJA 2YH0A 1SIZA 1OWXA 5HMXA 4O0IA 1H73A 3VVUA 1D09B 1HWIA 1Y5LB 2XWYA 1K76A 5EX0A 3CCRQ 1SH3A 1QAXA 1F9FA 4KKOA 2KROA 4WYLA 5I3QA 5KFPA 3OR2A 2AYEA 2OTLQ 4ED3A 2GMLA 3N6MA 4IDKA 4RPFA 1KQKA 3V8KA 4FT2A 1HL6A 1DLOB 2OTJQ 1L3SA 2DXTA 4MIBA 1VQOQ 1VQLT 3CCQT 2J6UA 4OFZA 4ZTJA 4NL2A 2MQOA 2C0IA 2Z2MA 3FNNA 3SWNA 5KFGA 1K73C 2H1YA 4C0OC 3B54A 5GANd 2JEJA 4B17A 3IC1A 3EXYA 3G1JA 1N36F 2M7SA 1VBKA 3RG6A 1YG0A 1WC4A 2QL9B 2B51A 3REAB 2DPJA 2ADBA 5CYMA 2DO3A 3KNGA 4NLYA 1C0UB 1SPBP 4JPBW 4O0NA 2HHHF 1VRUB 2IVYA 1HHQA 8AT1B 3J81j 2ADCA 3VAIA 1I3OB 1UPPA 2LX7A 1FI4A 1NDLA 2QIFA 3TJ8A 3DGVA 5GJWB 3A3OB 1X4BA 4EFAC 1QY7A 3NP5A 1WEYA 1YJNT 2LX9A 3NPFA 1LNXA 4DL5A 3PJXA 3OYCA 5DDOC 1SSHA 2GZOA 4GO7X 3JB9I 1VRQC 5FWCA 3X24B 2MY7A 4W92B 2OGUA 1M90R 2LQNA 1DARA 3CCMS 2RIJA 4PWWA 2E3HA 4NLOA 3HSGA 3CJ8A 3PJ9A 2UUCJ 2Z0WA 3CDAA 1M3CA 4XTTA 2PU9B 1I8FA 2X1FA 3FIFA 4IR9A 5T7LA 5KOXA 2D0NA 4QR1A 1YWOA 4PEOA 4KYZA 2E7XA 1NCLA 4JZ3A 1KD1C 1OPIA 3IM9A 3SSRA 1IWGA 1HA1A 4USVA 3DHXA 3CMEQ 1FKPB 2QLJB 1PAEX 2HNDB 2J9DE 2ZJRQ 1Y7XA 2XU8A 4I1TA 3CDEA 1YHQT 5AYFA 1T7PA 2LP5A 2QTXA 4L59A 4IRDA 3W1YC 4JI7J 3VAJA 1CVJA 3BW1A 1HBNA 4DV3J 4TY8B 1T95A 2HHSA 5E33A 4B3RJ 4UOHA 4QYRA 3CQTA 1VUBA 1B7YB 2PVGB 2F1FA 2L9WA 4PG5A 5ETMA 2XC9A 2RDDA 5BXIA 1NNDA 3K17A 4LF8J 1N6QA 2JTEA 5C25B 4A4KA 5LJ3e 4M77B 2GQVA 2DHAA 3W2VB 2ZPBB 4FIBA 3RKXA 4WIQA 2YRDA 1V76A 3AJ1A 5KCHA 1OU9A 1VIEA 2KEAA 4C5HA 2VFRA 3SYZA 2CJBA 5J2PB 1S1WB 5KT2A 2PIIA 3EZ5A 4DV0J 1QVFR 4JRKA 1NJIC 1C0TA 2V6AA 3T41A 4U67Q 4DSKA 3R1LA 4Q2MA 2CAJA 3D7SB 4J83A 5AXMA 1QSYA 1S4EA 2DVJA 1UJ5A 4MT1A 3VU3C 5KFCA 4ATNA 4BLGA 3PW7A 1D1CA 1R43A 3G6YA 2WK4A 4J91A 4H4KA 1V9OA 2C0OA 4CQ1A 4RCBA 2F1LA 4ED1A 3EM1A 3VS3A 3EZOA 2AGQA 1FFWB 4AD6A 4P9SA 3KDOA 3CC7T 2QN6B 2N7CA 2ZH5A 3QWXX 4WZMA 4DJBA 3VCDA 4WFNQ 4CLLA 2GO8A 2O4XB 4J9IA 1REGX 1BY9A 2HK3A 4IURA 2YNIA 1UB4A 3U02A 4EBEA 4DCPB 1JLQB 1RP5A 4DL3A 4IUFA 4HKQA 2CP7A 1TELA 3BQ1A 2XMKA 3SDEA 2E12A 4CCHA 1HYSB 2AEMA 3UF4A 1Z1ZA 2LMIA 4LMZA 4Y28E 3SV3A 4M7AB 4NCBA 3SCJE 4CYUA 4RNOA 4PJOD 5LOQA 3POTB 4KH1B 4U96A 3CCSS 2DGOA 2DNRA 1IR2A 4DZ6A 2D3ZA 3HP6A 2AZ3A 2HKQB 1NEEA 1HQUA 3MM7B 1AZEA 4QPXA 3V7SA 3BSCA 2ZITA 3QGPA 4Y3CA 3JSBA 4DOZA 5KT5A 1H7WA 4DV6F 4OX9F 3FEZA 1NK0A 3OYIA 2K1RA 3T19A 4USTA 3MEUA 5CABA 2MKSA 4F4AA 2MI6A 5EC7A 1D9AA 4OLOA 3L7UA 4F7UE 3ELHA 3OYLA 2E7VA 1WI7A 3BSAA 2PGCA 1DTTB 2LQBA 4E2FB 3CCMT 2JC1A 3R5CA 2GF7A 1OQ6A 3J7Z5 2MIOA 1QW1A 2A37A 2M8DB 5LJ3d 3CMEA 3CCLA 1C4AA 2J7UA 3MKDA 3AXKA 4GC7A 4I2QB 4J9RA 2RS2A 4Q5VA 3CCUA 1IQZA 4U9RA 3VHQA 2HQHA 2BANB 4RCCA 2KXFA 2JW4A 1H0HB 1HWLA 2IDLA 4C97A 2A28A 2Z57B 4NMLA 3I0RB 1RWPB 1ZLMA 4B9TA 2RH3A 1QWFA 1WNLA 2V50A 5GAMh 3DNCA 3OR1A 2IDEA 3VS6A 3WDOA 1U02A 2UUBF 2SEMA 2B3TB 1RLQC 1DZ5A 3M30B 1M5OC 1FVSA 3S6EA 1DTQA 2QSFA 3C95A 1TL1B 3H0HA 4RNFA 3D5MA 5HN0A 1H2UX 3EH1A 1RTIB 2W24A 1PO6A 1I0CA 3NMRA 4DX5A 1IGQA 1FYNA 3KMSA 3TCJA 2LEPA 3OFHA 5KYUA 4A8KA 1RTJA 2B6AB 2R2TA 3VRYA 4DV2F 1NK9A 2FB0A 3J7A1 1GXIE 3Q8QB 3M6VA 5B0CA 2CQ3A 3T9ZA 3QGHA 3AT1B 3V8JA 2F2XA 1EETA 1A9NB 2YVSA 2MF2A 1J3TA 3UO0A 1WF1A 4AXIA 4KHPF 1HNXF 1B34B 1YGYA 1SXLA 3KLIB 3R6OA 2VPXB 5CYQA 2GQQA 3OXFA 2RJCA 4E6RA 2RD1A 2B4PA 3M2UA 1HQEA 2CKKA 4DQ2A 4CLZA 1FE0A 4HXJA 2Z2ZA 1D1BA 2V1RA 2QLXA 4FL6A 1Y5NB 3NS6A 3KUEA 1X5TA 2DR8A 4TYBA 5F8NA 1N8RC 2KXCA 3DRRA 3NBPA 3RKYA 3BR8A 1SL1A 2HNYB 4M7DE 5GMKe 3H6ZA 4ZPAA 1U1MA 2D8JA 2E64A 1DAXA 1Z4UA 2RI3A 3J7AN 1Q7YR 3G4SS 5LMNJ 2PZ1A 1VR6A 4NS5A 4H4MB 2BJ8A 4ZCMA 3Q24A 5GAGU 3MAAA 1RCXB 3IWLA 3SZ2A 2ZJQQ 2DTIA 1RT1B 4C5GA 3CC4T 4RW8B 2DFUA 1T9TA 4UF4A 2YHTA 4C8QD 2Q6BA 1HBOA 4M94A 4OJGA 2MB0B 3IWNC 2JVRA 1FJ7A 4LRCA 1GXTA 2YQ3A 3CCST 1RAAB 2VUGA 2RHUA 2RJDA 2KHCA 4ZVRB 3CC2T 2L3PA 3EHRA 1V3ZA 1RACB 2OEKA 2MHNA 4OYWA 4JI4J 1X2KA 5D3GB 1AUSL 2L89A 4I4BA 2QYCA 3JB9k 2RILA 4IOAQ 4Z7YA 1F3FA 2QA4Q 3A8GB 3HFVA 1YHQQ 4QPTA 2Z56B 1A6LA 1SJ4P 4GVLA 4EEYA 2Y1LB 2EXUA 4YP3A 1UMJA 4BB7A 1WFWA 2B7BB 4O6JA 4R56A 3GJRB 2C3OA 3D1QA 1TKZA 2EBPA 2XY7A 4L76A 4K4VA 2K3XA 2C3UA 3R1HA 2NLUA 2BE2A 1N27A 1F60B 3TZYA 4HHUA 1VHFA 1VJWA 1V1CA 3HD1A 4J9CA 3L9ZA 3SFUA 1S72Q 3GMGA 3SEOA 4X34A 5JUMA 3HX9A 4DFMA 3M6UA 2VZ9A 5CIUA 3MCMA 4NLQA 4D8DA 3Q0AA 3V7CA 4NMXA 5GAOm 4K2JA 1U47A 1RK8A 3CPWP 2P9EA 4OV6A 2EEYA 4XTZA 3W63A 4EMGA 4ED4A 4K7QA 4NCGA 4K0KF 5HMZA 2O31A 1RGVA 4PYAA 4M75F 5CQYA 4LQ9A 4ATOA 2E65A 1FJGJ 2HWHA 3PMIA 1YBUA 4J6WA 2DB1A 3JAMU 3CPWS 1M1HA 4O3NA 1VQ6Q 5K14A 3A8JA 3DFEA 3JSRA 5DO2A 4C8QE 3DOKB 4ERDA 3M9NB 1N54B 5IV4A 2A3JA 2GGPB 4HCCA 4X4OA 1TXQA 1BIAA 3JCMg 2DTJA 3NTHA 4KT0E 2DY9A 4E7ZA 2A3LA 4USWA 3CCVS 1UZHA 2LJ3A 4ZVEA 2FGOA 2HQGA 2J9EA 2V2KA 2ZPGB 1RUWA 4QZVB 5EDWA 1FRHA 1KQSP 1VYTA 1EKSA 1YBAA 1F1BB 2OPSB 1GT8A 2HQEA 2CSIA 4DWIA 5GADU 2CPXA 4C0GA 2FQQB 2DH9A 4XDDA 4V19X 1HW8A 1VQYA 5FU6B 2GHVC 1QKXA 4MFBA 2NR0A 4HT7A 3C15A 2VC1A 2DR9A 4OVAA 1KQSS 4ES3A 2YUPA 1KTVA 2CZ4A 5HP1B 2BKPA 1OMSA 4BHQA 4CH0S 3D0IE 3L2ZA 2LQWA 2GVDB 2ECZA 3QRPA 2CYZB 5CKDA 1PYSB 3CMAS 1Q86U 4PNOA 4TU7A 4DBHA 1TL7B 3R7BB 2L3RA 2DM1A 2KGTA 1FXRA 2RHQB 4N4HA 3D1HA 2ROTA 5L8RC 3CCJQ 3PMTA 3JCMX 1RSCA 4L73A 3G4ST 2QQRA 5ETVA 4XDCA 1G3YA 2C1EB 1NE8A 2RQTA 5IN1A 2E1PA 2HRYA 3IBCB 1VC6A 4A4EA 2K06A 2XI2A 3K5MA 2DNZA 1CJKA 1XIQA 2BRKA 3GR1A 3H2UB 2RNAA 2VICA 1I6JA 1Q81C 1PJ6A 4JUVA 3CCMQ 3PVLA 1GTHA 1L5UA 1S77D 1TKDA 2RQWA 1BWEA 5L1IA 1RT7B 2AKLA 4WU2A 2HEKA 3S3MA 3L4BC 2AJ1A 4NLWA 3CGIA 2YKPA 3RAXA 1T0JA 2MMPA 2JTFA 3VQSA 2MZRA 1M3BA 3EE3A 3NTIA 2WONB 4CLUA 3M0QA 2YUQA 3HT0A 1TH7A 2V2VA 2YSQA 1U1OA 3RBXA 4C92E 1FTCA 3HULA 2A6MA 1UEBA 3H5XA 4WP9A 3DLLA 2B5JA 2X4YA 4ELYC 3MM8A 3SD4A 3BB5A 5F41A 3CB4A 1IQTA 2DK3A 3CD6A 3IRWP 2HYIB 3PX0A 3V4MA 1XNQJ 1K0SA 1OV3A 4RKUE 5CAAA 1GMWD 5KCOA 2CUDA 3RNJA 3Q89A 1S72A 3BY7A 3TUZC 4Z88A 5IT9Y 3G71T 5FRMA 2DRMA 4WF9Q 2R7VA 5IOLA 1VIOA 4YHHF 1WSRA 4MDWA 2WOMB 1BKBA 3MOJB 1GK8A 3U27A 3GV7B 5LJ5j 1L3KA 1FA0A 4ZLPA 3ILLA 3OW2S 1O5JA 4KGXB 3VAHA 2BZXA 4CLKA 3KK3A 4GRSA 3H42A 4IIMA 1RT6A 2AF6A 3LF0A 4ZCKA 1D0YA 1LK5A 3Q2SC 4J7CA 2CADA 1N32F 1LWCB 4ZOSA 2CDTA 4UUXA 3EGVA 2KT1A 3BGRA 2D6FA 3HI9A 3ZTQA 4RBUA 3L7OA 3JB9G 3X1LB 2DA9A 1YN8A 2DD4A 4JV0A 3MEDA 1XR5A 4K4ZA 3MDFA 3PFEA 3UN2A 1ZAWA 4KY3A 3ULRB 1AWJA 5EN1A 4LD9K 1U0HA 1YRTA 2KT8A 1UW4A 2YXYA 3H5SA 3TQ1A 2KE9A 2DL8A 1N5SA 1EP4A 1IBCB 5DG8A 4RO0A 3CD0A 2KG0A 4LSLA 4P2XA 2DL5A 4Q0BA 3QNWB 1JXOA 3UDCA 4CZCA 5I42A 3C94A 3JB9H 3AB4B 4DV5F 5K8OA 1RAGB 3OW2R 2JS0A 3DM2B 2W2OP 4I6AA 2X1GA 2KO1A 1Y0MA 2CQBA 5LXYA 3QXEB 2BDPA 1FDNA 3IFEA 3ZZZA 2W9AA 1MG7A 2XWXA 4LQ3A 4JLIA 2CPFA 4NI2B 1E6VA 2FD2A 1GH8A 1OPZA 2VGMA 5L1LA 2DJWA 4WFZA 2UVUA 1WKKA 4Z89A 2ILZA 2EYXA 4OHYA 1SHGA 2M52A 4FF4A 2E5LF 4ANEA 3D68A 5H9EJ 2ZPHB 1AA1B 4JI0J 1IREB 1RWNB 3DRSA 4K5SA 3EPGA 3A8EA 1RT3B 3PW2A 1JKHB 4NLRA 3WIVA 3GSIA 4QQBA 1QVFA 3UE2A 2NLWA 4OI1A 1IBMF 4F4YA 1OQKA 3PEHA 2HEQA 4N4IA 1SJFA 4X62J 3Q2TC 3TR5A 2NPIA 3PE0A 1NB2A 2AKKA 2JZ2A 3EVMA 5HVHA 2M8HA 1TKXA 2H51B 1FD8A 2B56A 4KPCA 1YJ9T 1AFJA 2X4JA 4ELVA 1KC8T 1N52B 2DVEA 3TAMA 3JCMQ 3C6TB 4CT9A 3DKMA 1D0XA 4OYAA 5KAKA 1WXUA 1JLFA 3TYTA 3EPIA 3OB9A 1RXOB 3BPSP 3S6WA 1LV5A 4OMNA 3AOAA 3MMAB 2ZUAA 2FJDB 4ECQA 5KFVA 4DSFA 2CQHA 4FYWB 3AQPA 1JXMA 4HI1A 2DR6A 2ZBIA 2H4YB 2KB2A 2M0OA 2BE7D 4CO1A 2OO4A 4IRCA 3CO0P 1JU5C 1VYUA 1YITQ 4OX6A 1HJDA 4A54A 1U25A 4LR7A 3IWXA 3ZFJA 3G82B 4B3TJ 2IYIA 5B0AA 2AGPA 3MUTP 4YY3F 1B4SA 1FMKA 1G1XA 1T3SA 5A8WB 1H74A 3P8HA 4ZLLA 2GJ2A 3DHWC 3BBBA 1WF0A 2RQ4A 4F4ZA 1Q81R 3OL8A 2MWPA 2XSFA 1RT4B 2FHMA 4IFYA 4U8YA 2YWFA 4XIUA 3QJYA 4B9MA 1TWBA 1JJ2R 1UEVA 4CP5A 2ZWPA 4C8QB 3V6JA 1V29B 4F7UG 2IPOB 2JOQA 4G65A 4Y34A 2IJNA 2HZVA 1Y11A 1SIWB 3MM6B 2I5JB 4F4KA 4OB0B 3EGXB 1FEEA 3ZZOA 4C0DC 3BN7A 1JWWA 5KFHA 3I5RA 1CPZA 4J9NA 3T5JA 4DR7J 2BOAA 3VS7A 2RF2B 3EGZA 2VPWB 4XPEA 2LECA 4N0AC 2RKIB 5E3CA 5G4DA 4PAAA 4XU1A 4LFCJ 1P1TA 3DB3A 2XEXA 2XMFA 1HBUA 1ZUUA 1M2VB 4KE5A 1BGXT 1VJQA 4M78F 4NL5A 4B3SF 2E5KA 3D2WA 3DXBA 3RBBB 2CP0A 1Q82R 1Q7LB 2R7SA 2EJFA 3W3SA 4Z7CA 4Q43A 3HFZB 3HHLC 3GIBA 5I22A 2EQJA 2JFDA 2CDQA 2QLFB 4OI0A 4IRKA 4CI0C 1JEGA 3RR7A 1M3AA 1X27A 2OHDA 1D9FA 3ETMA 2NXCA 3KK2B 2R2SA 4DEYA 1GTEA 1CC7A 2I9SA 4FS2A 2WSCE 3RB0A 1T03A 4M7DC 1GAOA 4QWDA 4PJMA 2JX2A 4FDFA 1GFDA 4DR3F 1U1PA 2P6SA 4F17A 2RB6A 7AT1B 1Q8KA 3HHNB 4RUCA 1RT2A 3MCOA 2HHTA 4TVRA 5E5NA 3WBZA 2IM2A 2G1DA 1TL3A 4X64J 3UCGA 2YNGB 1FWLA 2LA4A 1U5SA 1AYEA 1NB7A 1O8BA 4Y2MA 2G6FX 2GMHA 2COWA 1JLGB 2N4CA 4J9OA 4ZVHA 2P0KA 4LNPA 2E1HA 4OZLA 1W70A 4DF8A 1UWBB 1ARKA 2Y0BB 2KYXA 4M7DG 1YZ6A 1WACA 2KN4A 2XDPA 2K8GA 2CWXA 4UW2A 3RUXA 2W4PA 4W98A 5GAOq 5KFFA 4ZP8A 2CPZA 8RUCA 2YPZA 2A10A 1OZ3A 2PTKA 4ECXA 3LTOA 3WC2A 5K8NA 1LXNA 4CC4B 1XMOJ 1EJ7L 4WFXA 5AXNA 1QD1A 5ETKA 2G2YA 2CVIA 5F8GA 4OJ1A 3T6JA 2ZNYA 1VRTA 5E3QA 1VQKT 1TR0A 2X35A 1YP5A 2KYZA 5LT5A 3CCVQ 3C14A 1KVIA 4PWDA 4UY85 1WA7A 5DRKA 2VFUA 2CPEA 2CUYA 1WTBA 2FHJA 1BCOA 5A8KB 1DQ8A 1RTHB 3GJQB 1PJ7A 1VI7A 5KT7A 2CZ7B 3LWLA 2D9OA 3KUFA 2CNKB 4DR4J 2YKMA 3CEDA 5D6GA 4JLGA 4NLVA 1SKWA 3LW5E 1UVMA 2DEUA 4KJIA 2YT6A 2ZBRA