4ZN1A

Crystal structure of mjspt4:spt5 complex conformation a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
138
Chain Sequence
MIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTPENIEKGDVVEIIAPFKGERAKVIRVDKHKEEVTLELENAPIPITLPVEGVKIVSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Transcription
molecule keywords Transcription elongation factor Spt5
total genus 25
structure length 138
sequence length 145
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zn1A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 4zn1A01
3CCMA 3G4SA 1VQ4T 5HY6A 1X6OA 3G71T 3LGLA 5FLXE 3LPEA 1UEBA 2CKKA 1N8RC 3J80E 5DLQE 4RG2A 1VQMA 4CRIA 1YHQT 3CD6A 5J3BA 1VQ7A 1VQNT 3CC2A 2KVQG 3CCSA 1YJ9A 3CPWA 2L3RA 1N8RU 2MWPA 3CCLA 1VQ6T 5IAYA 5J26A 3G71A 3CCJA 3CPWS 1VQKT 2JNGA 1VQPT 3J7AF 1Q86C 3CCST 1YJ9T 1KQSS 1S72A 1M1HA 2KDSA 3A5ZB 3CXCA 1NJIU 1VQ6A 2EIFA 2OUGA 3ER0A 3CCQT 3G6EA 3J81E 1VQ5A 1NZ8A 3CCLT 1KC8C 3DB4A 1M1KC 1NPPA 2E70A 3G6ET 3I55T 1NPRA 5A2QE 3PIOA 1YJNA 4QQDA 3CCUA 1YI2T 1QVFS 4ZN3A 1K8AU 1XNIA 2QA4A 1NZ9A 1YHQA 1W2BS 2OTLT 3CC7T 1M1KU 1VQLT 3CC2T 5DM7R 1S72T 1M1GA 4ZN1A 3OW2S 2OTJA 3CCRA 3CC4A 4X34A 2QEXT 1Q86U 2MI6A 3CMAA 1YJNT 1IZ6A 3CCEA 3CCMT 1NJIC 1W2BA 3CCUT 1YBYA 1K9MC 1VQMT 1QVFA 2OTJT 1BKBA 1YITT 1YJWA 5IT9E 1RL2A 3CMAT 1M90C 1QVGS 1KC8U 3I56T 3CXCS 5LL6S 2JVVA 3TREA 1KQSA 2LVMA 3DLLA 3CC4T 3CCRT 1Q7YC 1JJ2S 1YJWT 3LH0A 2DO3A 3I55A 1VQ7T 1SSFA 2LQ8A 3CCJT 1K73U 3I56A 1K8AC 1YI2A 1KD1U 2QA4T 2E6ZA 4YTLA 3JAME 3G4ST 3CMEA 1Q7YU 2XHCA 1YIJA 3DB3A 3CPFA 1VQ9T 1VQ8A 1KHIA 3HKSA 3CCQA 2LCLA 3CCVA 1JJ2A 1Q81C 1VQ5T 3PIPA 3LGFA 1VQOA 1YIJT 3CCET 3OYYA 1K9MU 1VQNA 1VQ9A 1QVGA 1Q82U 2JOYA 1VQ4A 3OW2A 1YITA 1XTDA 2OTLA 1M90U 3QQCD 3CMET 2EXUA 3KBGA 3EWGA 1VQLA 1VQKA 3H7HB 1Q81U 1VQPA 4TVRA 1EIFA 2JUFA 1VQ8T 2MWOA 3P8BB 1Q82C 3CC7A 3CCVT 1K73C 3CD6T 1VQOT 2K06A 2QEXA 2G3RA 1KD1C 2IG0A
chains in the Genus database with same CATH superfamily
2GGRA 5I3PA 3KK3B 5E33A 3ULHA 3Q2TC 3SB2A 3EFOB 1JK9B 3OYFA 1IN0A 1Q5YA 4ZVEA 4ZKAA 2WVDA 3D1OA 4I2PA 3MCMA 3FIFA 3NMAA 4ICLB 2J06A 1RT5A 3CQTA 1PSEA 3MPVA 3NFCA 3HVAA 4NEZA 4PG6A 1NM7A 3J81j 1TKTA 2RHUA 1S1TA 3M32A 1NJIR 2E1RA 4J9PA 1RP5A 3VGVA 4R5PB 3GILA 5ETOA 2KT2A 2HK2A 1RAHB 5KT4A 2KSSA 3EG2A 1IKWA 3PV8A 4ER8A 1I07A 4DX6A 3V8LA 5GMDA 2KG0A 1M90C 3BH7B 2W4CA 3NRBA 2EQMA 1U25A 1RUSA 3TZXA 4BC7A 1UTIA 4KGKA 3UT1A 2VV5A 3M2UB 2V4QA 1B3QA 2DYBA 5KFWA 4NLWA 1JLQA 1TV6B 4WFYA 4OI0A 4F16A 3PIPA 4FYDA 2DGWA 3D68A 3C16A 3VVUA 5FWBA 3GOXA 1XTDA 3MPYA 3V7RA 2XMVA 1K73R 4ZPBA 1CPZA 4YB1P 4RW7A 2W4DA 2QEXS 2KO1A 3QGHA 4C0GA 3JCMe 2VUBA 3CCVS 1UPPA 3N28A 5AXLA 4A4GA 1GXLA 2HQDA 1IGQA 2CXEA 1VIXA 1T05B 1X4BA 2V63A 3QXEB 2MHNA 5KFPA 2EC2A 2K7AA 3GG1A 3MR5A 1MUZA 4M77C 1B7TA 1KQ1A 1U49A 4NXNF 1N9RA 4DEYA 4KFBB 3NGTA 5D4NA 3KLHA 1YJ7A 3J80U 3TO8A 5L39A 1T9YA 3LTOA 1A0NB 4J9GA 5CAIA 3CCMS 4U9RA 1Q5VA 1YJNQ 3PRBA 3W2WA 1V3RA 3G6VA 3BREA 4E7JA 3TA1A 4HHJA 4NLXA 2XDPA 3CC4Q 4OLPA 1HNVA 5AJ3J 2RJFA 3MM7B 3MP1A 3NAHA 4IOAQ 1U0HB 5CYJA 4MZTA 3C94A 2G0IA 3GSIA 2IY5B 3IR5B 1BIBA 5M2PA 3CF5Q 4FU6A 2KDOA 1PJ6A 2R7QA 4VUBA 1FJGJ 1K9MU 1BGXT 5FDLA 3SI8A 4E7ZA 1Y0HA 3PYDA 1SKSA 2LCWA 3M8PB 2OSRA 3DMJB 1YVFA 2CJAA 1SCJB 3EVMA 4M7DF 3PE0A 3ILJA 1R3NA 3PEJA 4A4HA 1F9EB 1WEYA 1LNQA 4CH7A 4A8QA 2AGPA 4P10A 5M2RA 2RH2A 3M1VA 3FFIB 1VRUA 2CT4A 1PRLC 5HN0A 2X3DA 2FGOA 1RXOB 3E01A 3HVWA 3DLEB 2WONA 1Y71A 1HHTP 4ILRA 2BTTA 1MV0B 2KI2A 3CXCA 1N52B 4CWBA 2KYBA 2ZNYA 1PKUA 2BYCA 2FUG9 2PVDB 1FHTA 2P4TA 1BYMA 4HCZA 3I87A 2FRWA 1VISA 1HWJA 1H3HA 3F70A 3T1HF 1M4ZA 1KC8R 1JEGA 2J7IA 5LL6d 3W1YC 2VHGA 2OEJA 3M53A 1OY6A 4YS2A 2XLIA 5EX3A 3BH6B 3QGGA 1M1GA 2AT1B 4CLWA 4TN2A 3H0PA 3HKZD 2AYBA 3MPUB 2VG7B 5BR8J 3OA6A 2GIQA 1PJ7A 1FVSA 3DRSA 2LZ6B 2EPIA 3JQKA 1IGUA 1Q7YC 1S4FA 4I6WA 1SHFA 3PZPA 2VONA 3H2LA 4DXLA 3GV7B 1RHRB 4X4SA 4DR2J 3IRWP 4JI2F 4DUZJ 3H42A 2BKDN 3IG1A 1F1BB 1XR6A 2M70A 2ZM6F 4AD6A 2D0QB 3CC7S 4MMOA 2IA6A 4G1QB 1YZ7A 4YQWA 4GLMA 2AGQA 2JLFA 1H92A 3CC7A 3DDNA 3JSMA 5I42A 3VKIA 4A4KA 4PJMA 3BDLA 1Y7PA 4PXEA 3FQLA 3CCUS 2HKQB 3M2UA 4OGEA 2YNHB 3D1HA 5IC6B 5HQMA 2KVQG 3RTVA 1UHFA 5IV3A 2C1EB 2Z4PA 3IC1A 2Z8QA 4XU1A 1XBWA 2KDSA 1I94F 2VFVA 1WUUA 2DH9A 3FCHA 1GXTA 2NLUA 3MM8B 2MGZB 1CEZA 2DGQA 1ARKA 2EJFA 3BQ2A 3C16B 1RJJA 1VC0A 3CC7T 4O4GB 1OSCA 2Y8WA 1M1KT 5IV4A 2EFOA 3DRPA 3P5BP 4NI2A 2AJ2A 4DOVA 2QA4G 1HR0F 2QC3A 4DV6J 1EETB 2GGPB 2CQ2A 4P73A 2DXBA 2D9PA 1R6VA 3I56T 3CXCS 5IZHA 3RR7A 1UB4A 3H5SA 3C66A 2HURA 1D3WA 1UEUA 5LT5A 2VICA 4DQQA 1T03B 4PUOA 4MFBA 5C6SA 3NXZA 4K4VA 4OB2B 3CD7A 5DETA 2ATCB 1SF9A 2IPOB 1ZTWA 4QVZA 3KMSA 3SDZA 4I64A 3G71S 1XNQF 3KG1A 3KUGA 3QIPB 3PJXA 5HQLA 3UD4P 4ATNA 3VF0B 1FMKA 1WLPB 2PFDA 3S6EA 3GFHA 1TUVA 1F6TA 2LJ1A 1KFZA 4DPUA 4RW9B 2C2OB 4JI3F 1W2IA 3M8SA 1G4CA 2W9CB 3MWBA 4LNPA 1VS3A 1Q78A 3GNGA 2W4PA 4K8RA 1MU2B 4FKXA 5HLFA 1N5YA 3R5GA 3CPWA 3JYTA 3JB9F 3QWXX 2WZ1A 1WGSA 2HIQA 3CCQT 1JLFB 2YNIA 4PJOA 1FT8A 4OYOA 4AFSC 1QVGP 2XQCA 3MAQA 1YI2T 3HRSA 2RQ4A 5GANd 3X24B 2EFNA 4EPCA 1HJDA 1XMOJ 1NJWA 1DQ8A 2AGOA 2IVMA 3MEDA 1NO8A 4DG1B 3HKWA 3K5PA 2WOMA 1JJCB 1VQ7T 4TU9A 1M5PC 4CLSA 3F0NA 3TSZA 4NA2A 1VQ8A 4JRQA 4GKJJ 1UZHA 3CCVA 4DR6J 1DAXA 1I6JA 4OYXA 1Y07A 2V8GA 3Q8SB 4CRJA 1UAWA 3OBWA 1OZ2A 2DJZA 1RI0A 1BLUA 4LRFA 2AEMA 4LDUA 2LQ5A 1PIEA 1N6QA 2YQ1A 2HNIA 1Y5IB 4ZITA 4DFMA 3DHWC 1WG1A 3CB4A 1YHQT 3AXKA 3BBFA 3I35A 2V50A 4KPYA 5A0GA 2Z30B 1LK5A 5HBMA 4LUDA 1GRIA 1VK8A 4LF4J 1HPZA 3I5RA 2B56A 1QM9A 1AEYA 1AW0A 4LF9J 3MMAB 5A2QU 2QGFB 4DV5J 4FYYB 3QWYA 4ZTJA 3U1LA 4C11B 4PG4A 1R8CA 1T9XA 5M2UA 2H48B 4J9CA 5GAGU 3AFGA 1A7GE 1LWFB 1B0VA 2E7XA 3TSWA 4L6V5 3NKYA 1YBYA 5KFOA 2MJUA 3AD9C 1YJWA 4F0KA 1T11A 2UZAA 1FYNA 1VDHA 3PMIA 1MHNA 1CC8A 3CJ3A 4FXDA 5IM0A 1BCOA 2DAQA 2F4VF 1FWKA 2GFAA 3TJ9A 1VQKQ 1UJ4A 5DDRC 2EWHA 4QPXA 2JC1A 3DLGA 1KOOA 3QGPA 1Y3JA 4WK3A 4BWMA 4X2BA 3KFVA 3L7UA 4K4UA 1RTHA 4PAAA 2HNZA 2B6AB 4L3KA 1UGVA 2P5VA 4UTGA 1UE9A 3N79A 4DCJB 2ECZA 2MSTA 3DC2A 5LSRA 1H74A 4Q45A 3RGIA 1VQ9S 3EG0A 1EZZB 3UF4A 2OHDA 1UW4A 3VQSA 4DFKA 1R8AA 2LJ0A 4DL4A 1I51B 3D67A 2KY9A 4IIMA 3SCJE 2DHAA 3HI9A 1R0AA 4L72B 4DU8A 2CNKB 4L5GA 4OJGA 2PMHA 3H90A 1NPPA 4I67A 1OEBA 1SBRA 4LF5F 2HRYA 4M7DB 2KNBB 4NE9C 1TELA 3C4SA 2P6TA 1AYEA 3QUIA 1HW9A 4Y91A 3HZEA 2CPZA 3S7RA 2VKRA 2CKWA 3T41A 4V1Ak 5IN1A 4DV6F 4ECTA 2LDYA 2YWFA 3R5AA 2P9EA 1BD6A 4G1QA 1RABB 1TK0A 1R8HA 2J7KA 3MFIA 3P8HA 1ZBJA 3FBBA 3QDRB 5C42B 4DV7J 1WC4A 4RUHA 3OLAA 1Q82T 4ZPVR 2JOYA 2K3IA 1RADB 3A8HB 4M7AC 1S1VB 5F3TA 4JI7F 5L46A 1VQPS 4B3TF 2D3OR 1I5LA 3FJ5A 2V8HA 2YKNA 4NZ6A 3ENVA 4YY3J 3VQTA 3I5AA 2FPEA 4F3OA 3FRYA 2VBWA 3C6UA 4BB7A 4C8QA 1ABQA 4AYBD 5FRNA 3AOAA 2CP7A 1ZSZB 2OPSB 1ZUKA 2H8HA 2ZEJA 1WD6A 1QE1A 4IUTA 4A47A 4CLYA 3MEUA 2HVZA 2JJ4D 3W9JA 2OI3A 1YJ9T 2ZH1A 3TYTA 5ETPA 1BU1A 1SRLA 3OXLA 1NDPA 5AXNA 1HNXF 3POTA 1U6ZA 2KM8B 2JC0A 5LJ3d 3HK2A 3I9V9 4TYAA 2JFDA 4DPYA 2Q43A 3RU0A 1YBTA 3J7ZT 2VG7A 2D6FA 3RBXA 2R8HA 4B9XA 3G96A 4K5SA 3TEHB 2DBBA 2OIHA 1SI9A 4RO0A 5BR8F 3RMQA 1UFLA 4OLOA 1JLEA 2QGGA 4F7UE 3IAM9 3G8QA 3TWZA 3L2VA 2ZPBB 2LNVA 1RDRA 1IWAA 4U67Q 4LJMA 5D0GA 2FG0A 5DZ7A 2LC4A 1C1CB 2Z2YB 3JCMc 1IKVA 3W65A 2EGEA 3NGSA 1VC6A 2DNQA 4IRDA 1YTYA 1R31A 1RTJA 3M8WA 2EC0A 3NY0A 2E3HA 3H8YA 1IUJA 4OYWA 6AT1B 2P0QA 5FW9A 4C48A 3DOKA 2HQ3A 2XDDA 2ZJPQ 4JI5F 5F8NA 3J81Y 4NXMF 2EYWA 1XR7A 3BO3A 3TVTA 2ZE2A 4JRKA 4M5JA 3OVBA 3CCMQ 1BCMA 4RUGA 1FDAA 4O44A 3L3CA 4NS5A 2MQPA 4A54A 3L42A 4OI6A 4RNOA 5KOXA 1HMVB 1OPLA 2M02A 3BGFA 4XTYA 1KQSS 2VQFF 2VFRA 1RU1A 4PWUA 2J8SA 4OHZA 2YT6A 4OF1A 4IG0A 2AMCB 3WC0A 2QYGA 3EGXB 1OY9A 2I38A 3C8YA 4CYUA 2Y1IA 4M7AF 4HCCA 4JLIA 2B6AA 4ZP8A 1RT5B 4DUYF 3ZTQA 2ZBPA 3GP8A 4KJIA 5GMKe 3DRYA 1VC5A 1RT2B 3H41A 2QK0A 3O3LA 1LW0A 5GAOn 4IH5A 3M9QA 2DGUA 3M4XA 1YJ9S 1VQNQ 2COYA 2H3JA 2FHJD 1ZOTA 2RKIB 1U1SA 5GANg 3EDQB 2RDJA 3VAGA 4ED4A 2VPZB 5HMZA 3W2VA 2C2MB 3MD3A 1NNDA 3TX8A 4ZIWA 3DM2A 3EPIA 1KHWA 1C1BB 2DO4A 3W7BA 3CBOA 1I3OB 4UZCA 2RS2A 4OZJA 4JV1A 4MKAA 1MLAA 2B5JB 2YQ3A 4J9SA 3GFXA 1WHJA 3V6DB 1SC3B 1GCQA 4JP8A 1YJTA 1HQEB 1YLXA 3EGXA 1VBKA 2C3MA 2SRCA 4C3MA 2KT3A 3W8GA 1OPIA 4ZPWR 1XMOF 3AOBA 1JJ4A 2M9KA 2WSCE 4QR1A 3EGWB 4BI4A 4WIQA 3FMBA 1JLCB 3OSPA 3HULA 3V4MA 1L3TA 2O66A 1PC0A 3D5MA 1T05A 4JI1F 1X4GA 3PX4A 2RDDA 4LF6J 4AUKA 3HLUA 2B43A 2ROPA 4ZVTB 3I9QA 2B9EA 2CQPA 2QIFA 1CJTA 4E47A 5L8RC 2VFTA 3M0QA 1QLNA 1NG2A 3FUYA 2RHQB 4P5NA 3V2UC 4PXBA 3VS1A 3DLJA 4UOFA 3CCQQ 2M51A 1T8EA 5D0RA 3BR8A 3CEDA 1S1XB 3Q8YA 1L5UA 4OB1B 5M9OA 1C0UA 5I11A 3VR1A 1GTHA 2YNGB 4OZ2A 3Q24A 3O2IA 3CMQA 1K9MT 2DX1A 3HHLC 4F4AA 4I2PB 3IGVA 3V6DA 2FLNA 4F7VA 5HJXA 3H2VE 1S72A 4KKOA 3L2RA 3KLGA 2XYHB 4GKKJ 4ZNXA 4KSEB 4LDXA 4YDDB 4BWJA 2O4XB 1N8RC 1WJRA 3JXOA 1NH8A 2DD8S 3SWNC 2DRDA 2RB7A 1DZ5A 4ELUA 4JI8F 4F7UF 1M3CA 1PCAA 3DOMB 3NGPA 4KUDK 1CBKA 3IAS9 1QW1A 2MPXC 2LX9A 2XD0A 2MDAA 2NXNA 1XWLA 4C92G 2M2BA 2CUBA 3NS6A 1RAEB 4QWBA 4EMKA 2LXFA 4C9DA 4FT4A 4HCBA 4RW8B 5IXBA 4PR6A 4ED5A 2F5GA 1B0TA 2KJVA 5GJVB 1FJCA 2MIOA 1X5PA 2W7PA 3CC4A 3C6UB 2RN8A 4ZCMA 2DXUA 1BIAA 4ATOA 2FZGB 1TL1A 1P1TA 2IJNA 4BS2A 4HVUA 1SJ1A 3VV2B 1NE8A 1LW2A 4DSIA 1X9SA 4F36A 3T1AA 2KYMA 3M30A 5A0YB 4Y3CA 3QT8A 1X9MA 2QQAA 3RKXA 5F0UA 5J2QA 3R27A 3KLEB 1G3SA 3M0TA 2G2OA 5KG7A 4IKAA 4CQ1A 1GMWD 3MEEA 1Q53A 3BDPA 1SKWA 1IB8A 2VXFA 3SEMA 3EE3A 1W1FA 9RUBA 2ED1A 1Q8KA 5ETRA 3CD0A 2JUFA 3B78A 1YN8A 2QSWA 2VFSA 4H54A 1JLEB 2FZKB 3POTB 5GAMd 5KG0A 5DLGA 2CKKA 1IBMJ 3TZYA 2ZH7A 2DZCA 3CD6A 3RG6A 3G4SQ 3M54A 2Y4YA 1NSKL 3MM5A 4CTAB 4IR9A 4DL3A 1FNMA 3SHWA 1NUEA 2YUQA 2NZCA 4RMOA 4GMKA 3ZZTA 3EXCX 5C25A 5HL7Q 3QNWB 4DBQA 3DI6B 4PFOA 3OFGA 5D6XA 3WZ0A 1QMCA 4C5IA 3PEHA 5A2QE 3M8PA 3R8YA 4I56A 1TL4A 2DGXA 3CJ5A 4FVMA 2YNHA 1HBMB 4WXWA 2HW3A 2J0QD 2MYSA 4E7LA 4FKYA 2M1HA 3K59A 1T0HA 1U06A 3HL8A 3DHXA 2L5QA 4Y2MA 4HH1A 1PCXA 1NZAA 3H4DA 3THPA 1URNA 2DIUA 4P7VA 2LQ8A 2PC6A 4Q44A 2MZTA 4M77F 1RT1A 2H4YB 4DPWA 4NWBA 3IRXB 2RJCA 2FB0A 3I55Q 3NLCA 2XY7A 1NK8A 1UFFA 2UXCJ 4M5NA 1S1WB 3E01B 3VGTA 3P6YC 3A8JA 4ZTFA 1YWXA 3T6BA 2KT1A 2FPDA 3P49B 5A8KB 5LOQA 3HO1A 4K50A 5KFZA 3L1AA 1VQ4T 3KYLA 4Y2CA 2HRTA 4AXIA 4A4FA 4CC3A 3DOKB 1HXDA 3MF5A 4IFYA 2HYIB 1CLFA 3SWNA 1JJ2P 1S49A 2Q1LA 4EWTA 2ZH5A 2E64A 4PXCA 2DEQA 1YDLA 2NYHA 1R27B 1KDNA 3KHRA 5CYQA 3QPHA 2RK1A 1JIHA 2XS5A 1W25A 1GBQA 4PG7A 2OTLT 1LQ9A 2DERA 5C25B 2XBPA 2F40A 4DBHA 1WI8A 1KN6A 4QVDA 1NJIC 2G1DA 4OZ1A 2UV8A 3NGUA 4G65A 4MKVA 1LVKA 2IJRA 2BANA 3OYKA 3C14B 4LDVA 3OL6A 2OTJQ 1UJ0A 1DTTB 3FCVA 2K3XA 1MROA 4F67A 4F4YA 4KRWA 5HQ8A 1ZH5A 5IH2A 4B3SJ 2B7BB 4HT5A 4FPRA 2XZTB 5EC7A 2ZGWA 1D8YA 4B9VA 1IXKA 3CPWP 4ED6A 2L3MA 2L9DA 1GBRA 2VG6A 2DNLA 3T1YJ 2OTLA 3GJSB 1VYUA 4DL5A 3GLJA 3CIZA 1F2GA 4DG1A 4CM2A 2Z0WA 2L9NA 1JB0E 1RWWB 4PJJA 3DLBA 3VTIA 2OJ2A 1C1CA 2OSQA 3M2VB 3G6ES 4WFXA 1WHYA 1SPKA 2AX1A 2BOPA 4YDXA 4X66J 2ADCA 4QR2A 3RNJA 3OTOJ 3VGUA 2C2NA 3Q8UA 4A8XA 1U7LA 3LP1A 2HHQA 3OD2A 2ZH9A 2QO3A 2HHPA 3EGDB 1S0NA 3KG0A 4KRTA 4B9WA 2DE0X 2CZ6B 3BDUA 2R7WA 1XNIA 2HQGA 4K4SA 3RRGA 1SHGA 3VAMA 5HI7A 3CCMT 3RKWA 3IWLA 3L7OA 2DR8A 3SEOA 2B8QA 2QQ9A 2NCKL 2RK2A 1VQ8S 3FEXB 3GYGA 1S6PA 4K7QA 4ZCIA 1G2EA 2ZH4A 1R77A 3ETOA 1VQ9T 1K1QA 3ZZOA 4H4KC 2QL7B 4OP0A 2VDHA 4DV4J 3IWXA 2VUGA 4RBTA 1QAJA 3PXGa 3LAKA 2XS7A 3TQ1A 2CZ7B 1BQNA 2UUWA 1I1JA 5KFIA 1X60A 3UATA 4ZPTR 2YNIB 5HY6A 5IHNA 3SSQA 2EK6A 4B3MJ 4M5IA 1HW8A 3QSUA 1OU9A 1AZSA 2JM9A 4A46A 3HT3A 2COZA 3BSNA 1OQKA 1VQNT 1YCYA 4QWDA 2DRMA 1VBXA 4RCCA 1D3BA 1K1ZA 1GXUA 4LSLB 1TL1B 2BMBA 1TAQA 2IRXA 1FX2A 2FLLA 7AT1B 4TVAB 5KG4A 3DM2B 3VS3A 5GAMf 2MKKA 3MTKA 4YP3A 4HI2A 2RSQA 2DYAA 1EIYB 1JLGB 5A8RB 2MQLA 3J81U 3H25A 2BRLA 4YB5A 5B0CA 5FU7B 1LV5A 3ZZUA 4DQIA 3R7SB 4BY6C 5B0EA 1QSSA 1S9GA 1N32J 4ELVA 1SB6A 3ISNC 3A8LB 4FN5A 1X01A 1H2UX 4XAKA 1CJVA 2MQQA 3JCMJ 4EBEA 4ETZA 2MZQA 5KFMA 1UW9A 5IHIA 2DL4A 1NHVA 1N5SA 5LSLA 4JI0J 1Y96B 3RIRA 3CDUA 3KOAA 4FZVA 4EYHB 4F04B 3WIVA 1T03A 2C0TA 5HO4A 2UXCF 4LBIA 3AODA 1Z4UA 3KLFA 5D0HA 2IRYA 2QLBB 1FWPA 3UE2A 1S1XA 4DL6A 2PDAA 4DX8H 4DV5F 1ZS6A 4WFAQ 3FRZA 3RDVA 4DR3J 1JWWA 2KE9A 2RQWA 2N4CA 3D66A 2H9ZA 2MK5A 1TSFA 1J3TA 1LOUA 2OPRA 1B7YB 5D3GB 4NCAA 1VQ6A 3RZAA 2E5GA 1OX9A 1GTEA 2XIDA 1M5KC 1VJQA 2WBMA 2CDRB 2RS8A 4KO0B 1HL6A 3M9MB 3H2UB 3CCUA 2XSJB 5DQIA 2EW3A 4JZ3A 2XO6A 4WFZA 1NRKA 3PIOQ 1JLFA 2J9DA 4A4EA 4PJOB 4N56A 4B9MA 4HVZA 4WP3A 5J1EA 4M7DD 3KLIB 5H9EJ 3M0RA 4M78D 1JLAA 3KG4A 3GJQB 5DM7Q 2K3KA 2W25A 3SCLE 3LH2S 4O3OA 1TP7A 1JMTA 4IH6A 3V8KA 5ETSA 2HFUA 3VAIA 5K8PA 4OI1A 5A8KA 4D3GA 3EG1A 4C8QD 1B34A 4PJOD 2QFIA 2AD9A 1DQ9A 2ZDPA 3EHRA 4ZLPA 1N36F 4USIA 1Q82C 3TCJA 4DCPB 4QIWD 2MZ1A 3OYIA 2CIMA 3ENAA 5KG3A 1N48A 4CH1A 5K8MA 3D3BJ 3A8OB 1WSVA 4GVBB 4GKJF 1SH3A 2HVHA 1VMBA 2L3PA 1BQXA 4LVNP 3BW1A 4Z2XA 4LF5J 3J7AF 3ULRB 1KQ2A 4R8UB 1FXXA 5K9FA 1P8GA 2XY6A 1JKHA 4OMQA 3I56S 2XDBA 3GG0A 3Q22A 4RKUC 1QD1A 1TVRB 1HQEA 3MR6A 2ZOFA 4M94A 1IBCB 1YG0A 1Q8LA 1UVIA 3KKFA 3E8OA 2NUTA 1WQ7A 2VFUA 4B02A 1JXMA 4X34A 4ZJQA 4I69A 5KYNA 1QTMA 2CP5A 5LJ5j 2WONB 3H40A 3OL9A 1V3SA 3VS0A 5CKEA 2C0OA 3H8ZA 1MWZA 1U48A 3BQ1A 4EMDA 1NBEB 4N41A 2JVRA 1M5SA 1YI2S 3PW2A 5GAEU 4AFUC 3GIIA 2VD3A 5AE3A 5CQXA 4M78C 2BJ9A 1V29B 1Z9QA 4ES3A 4MAKA 1TL7B 3GJRB 2K6DA 1NXIA 4U96A 4NCGA 4C6AA 5HMWA 1GL5A 2GA7A 4ZP7A 1HR0J 4FCYA 3FRNA 1FRJA 4W4MA 1P9YA 4WKYA 2GIRA 3EG3A 2HNDB 4DQPA 1IHWA 2HAFA 4JI3J 4M5GA 2ASJA 2EG1A 2CQ3A 3M4GA 4F2RA 3M57A 4HACB 2YSQA 2VQEF 4DQSA 1S1VA 2FJXA 2C3PA 2OPPA 2RT3A 3NG8A 2XMKA 1M8VA 2BZ2A 4F3MA 2IVWA 5DQHA 3DDKA 2HWTA 2LQJA 2XMMA 4C2MA 3R7NB 3ITHA 2XICA 1S9EA 2FYXA 1WF1A 4A8KA 2LLZA 1NZ9A 1NHKL 2G2YA 4NA3A 1HNVB 2XM3A 1DTTA 2D9OA 4O23A 4PQUA 3JV3A 5D6GA 2KGTA 1HI8A 2H5EA 4X4TA 2HHUA 5ECAA 2DGVA 5MAOA 5KFXA 1RL2A 3GZ7A 1KLMB 1S7HA 4C3LA 2C2EA 1H6KX 1QVFR 2JEIA 3VS2A 2CFXA 1FD2A 1K73U 1VQ6S 2NLWA 3MMBB 4M75G 1FRKA 3MMCA 3PHEA 3JS9A 4GO5X 2FTRA 1IKXA 2KM8C 1F60B 2PSZA 3FSYA 2AJ0A 2GX8A 3EFRA 2PGCA 5CYMB 2JJ9A 3OS5A 3D4JA 3FFIA 2CP0A 1WX6A 3E2UA 2BR0A 1MMDA 2L9WA 1KFDA 3OYMA 2KI7A 4LSNA 4OX6A 2BZXA 4ID8A 1FRIA 1QWEA 3FBCA 1FI4A 2JS0A 5H9EK 1KHVA 3HSBA 2K7KA 1B07A 3MP8A 2R2RA 3M55A 1SKUB 1VUBA 3T1YF 2ZDOA 4X4OA 1SC4B 3AJDA 5EGYA 4NL5A 4HH0A 2LDMA 3NNCA 4EU0A 1BI3A 4DSFA 1K0XA 2ZCFB 1OJ4A 4BE1A 1RWPB 6FD1A 3CE8A 2QXFA 2R58A 4PYAA 4U8YA 2W2QP 1DLOA 2H4WB 8AT1B 5BXIA 2HBZB 1HBMA 2O3DA 3U7JA 3EZ5A 3QWPA 4XK8C 3PDNA 2BX6A 3SQGA 1PC5A 4C7QA 2O5DA 1UWAA 4R8UA 2K1RA 4UF4A 2HK3A 5LXRA 1TL3A 2XSJA 3M9OB 4M4ZA 2HBRB 4YEAA 3OQ2A 3BN7A 4LN2A 1W2BP 3PIPQ 1FKOB 2R3VA 1NB2A 1QSLA 1K47A 2K06A 1HBUB 1XIQA 1D9AA 2NUPB 1RACB 3RB6A 1WC3A 2J6OA 1H3DA 5FLXE 2HFOA 1VBZA 2QLXA 2VU5A 3M6VA 2ZKTA 3HRUA 4ANDA 4AXJA 4WU2A 4DBRA 5DDPC 2F3JA 2E29A 4UUXA 3NTKA 2P2CB 3MEEB 2CG8A 3UN2A 4P52A 4NLOA 3OBYA 4MMKA 5GAMg 3MPWA 3JSBA 5CXTA 1NJZA 3OB9A 3MURP 2QZ8A 5JJBA 3D6HB 1D3BB 2NS1B 5DM6Q 4J7CA 3DGVA 1N56A 3TQ7P 4Y28C 3ZL7C 2W2OP 2VIHA 4U7CA 1TKXA 1OZ3A 1OX8A 4RTYA 2R42A 2HIYA 4OYPA 2UUCF 1MNEA 5E41A 1E6GA 2YKOA 1RYSA 1QCOA 3MCSA 1JX4A 3P8DA 5GANf 1PBUA 5CKBA 4EMHA 3LWLA 4E2FB 1CJTB 2JT4A 4RWXA 2YY3A 1U09A 2HGNA 2ASLA 4UY85 1Y9OA 2QASA 4LF4F 2R7RA 1X9WA 4HA8A 1RHQB 3OL8A 2BQ3A 1UG1A 3JQMA 1VQ8Q 4I7FA 2GCFA 2B9WA 2JOQA 4J9VA 1M9SA 3ZXWA 4EBDA 5KFCA 3G4SA 2VBZA 1JBMA 1RA6A 3C2PA 2BEFA 3RAXA 1TXQA 2PNIA 4RJVA 3FMWA 2ZOGA 3CJKA 1SSHA 5GMKa 4OB0B 3UVJB 1N8RU 4Y6IA 5DGBA 3GIRA 1YCSB 3C6TB 4AFFA 2OUGA 2L89A 2FQQB 5G0RA 1B7FA 3TVKA 2C22A 3LF0A 1HYSB 1AFIA 3W61A 2R7SA 3G6ET 2HD0A 4MK8A 2XO7A 4LDWA 4OHVA 3X25B 2ASDA 3IFEA 3CXCP 2K8GA 2X1FA 2A1BA 2DCUB 4C92C 2C0IA 1REVB 4I2QA 2E41A 1LWCA 1QVGS 3ZC4A 3BM7A 3EHQA 3DLLA 4KQZA 2P0PA 4DV1F 4LRDA 3REAB 1K4US 4USHA 2RNAA 4ECYA 1JJ2A 2E5HA 4Q2LA 1XQHA 1YIJT 2Q6CA 2DXCA 2W2PP 5FU6B 2KTQA 4CNZA 1MROB 3N6MA 3FSXA 4Y65A 1VQ8T 1VQLS 1UA0A 1PD0A 2VPXB 5LJ5d 2QYCA 1VHFA 3HF5A 4B3OB 4MH8A 3LP0B 2DVEA 2HHTA 4D6WA 4M1KA 4XU3A 3ZZ0A 1RWVB 3CCLA 4LF8J 2M8HA 1X31C 4DR1J 1C2PA 1FX7A 1RWOB 1N9SA 4CZCA 2Y1JA 3H0IA 3PVLA 2M52A 2IMWP 4MDWA 5HROA 2ROEA 2WSCC 3V5RA 3RERA 2DO0A 2CZ0B 2D8JA 3EGVA 3AHPA 4XPCA 2H54B 3PIOA 2MJNA 2LTOA 3I0RB 3OPKA 5D7UA 2CPYA 2HHHJ 4NRTA 2DNOA 3G8SA 1GMUA 1AXQA 4DSJA 5GAHI 4DV2J 4A8MP 2PVOB 3QBCA 5KFLA 4LD6A 3I5SA 4PK4A 1SXLA 2FVUA 2OH2A 3FQKA 3MO8A 4NLRA 1XMQF 4M7AD 1L3SA 1OYXA 2NXJA 1VIOA 4PQAA 3DCAA 1H72C 4EFAC 1YI2Q 2MF2A 4RCBA 4K4YA 1G2BA 2V9KA 4QW9A 3HHLB 4MDXA 2CJBA 4UOHA 3GNFB 5F3ZA 4KGXB 3Q23A 2IDLA 4RTWA 2MCNA 3AJ1A 2KHDA 4BD3A 4P75A 2IIHA 4J91A 1YQHA 3X1LB 1VRTA 2W7OA 4NL3A 3BKUA 1WHGA 2LP4A 3WXMB 2GHVC 1WJQA 4DSLA 4IH7A 2YPYA 3N6NA 2HBQB 4ZOSA 3E9FA 4DUZF 2RPNA 3ZTSA 2ERRA 2C3UA 2W01A 3J81E 3C15A 1A9NB 4JI6J 1SJ4P 4AMCA 1IHVA 5KYUB 3BKFA 1TFWA 1OU8A 2DM1A 4LUBA 1U5SA 4PWDA 3NGDA 2I5JA 4TY8A 5J2MA 3A3PB 2C2KB 5CKHA 3PVXA 4F50A 5GAN8 3CBMA 2FVCA 1SV5B 1HWUA 4BCAA 5IOLA 2VDIA 2C42A 1RAIB 3HSDA 3R3TA 1RLQC 4HHUA 4M75A 3RAMA 4LSZB 4J9DA 1B4SA 3VUZA 2LXUA 2V1QA 3A13A 3PNWC 3GCXP 2H3EB 1S1NA 1NK0A 5CQYA 3UW1A 1W7WA 1FNOA 2GMJA 3CULA 1NSQA 3IGNA 3EG9A 3UCZP 4KC5A 2RQCA 3MGJA 4LF6F 1B0PA 4I2QB 2K5FA 2DTJA 1VQOQ 1S48A 4PXDA 4IRCA 1RSCA 5AYFA 4EYIB 3H4BA 5IXFA 5ETTA 3M8ZA 1W26A 4NYOA 1DFDA 3N0VA 2R2SA 3MOZA 4QU7A 4MK9A 1J5EF 4DDFA 1NYGA 5F8HA 3FC3A 1FVQA 2DNYA 1YWPA 2A2DA 2OP5A 3OR1B 2MXYA 3M56A 2RMLA 5F9NA 5K5MA 1KNZA 2GQCA 2YTCA 3CT9A 1PGZA 4RTVA 2QTVA 2I0XA 3AOCA 2O01C 2UXBJ 4RBVA 2OMLA 1RUWA 2BJDA 1JO8A 2BA9A 4ILLA 1M1FA 3M8RA 2R8IA 1OULA 3L95X 2EEYA 5GAOp 1FKAF 1MSWD 1HWIA 5HMXA 1N32F 3B8HA 4ILMA 3LH0A 1SUQB 2NYIA 1KKHA 4OHXA 1FTCA 1YJWQ 2F8MA 3IA0A 2XHCA 1Q7YT 2AYGA 3JB9G 4LF7F 3OFFA 3OS0A 3HHKA 1BC6A 3MEKA 4ICLA 1M3BA 4NOYA 1RI7A 4DV3J 4LE9A 4F4ZA 5EG2A 3CMET 2MLZA 3RR6A 4HTIA 2R8GA 2P6SA 3IXQA 2WVFA 4MZPA 4CRIA 4M5HA 4L3NA 2GF7A 4NLPA 2C06A 1R6YA 1FDBA 4M5DA 4ZJLA 1EQ0A 5EHHA 2DMOA 1NJYA 2YX4A 2RQKA 2XU8A 1ZSGA 3P3DA 1TWBA 3IBCB 4M78E 3KLFB 5HSPA 1N6AA 2DIVA 2FJEB 5IXUA 5IT0A 2EQJA 4KB7A 2CDTA 1NEEA 4JI2J 5CA5A 2IA0A 1YBUA 5D4LA 3OW2S 3CCRA 1IJEB 4L73A 2ASYA 3L09A 2VC0A 5GMEA 1HNWF 1C0UB 1AWWA 3MDFA 1N34J 5A0LA 4KHRA 2R57A 1KFSA 1Y57A 4P2XA 1ZM2A 3AB4B 3CW2C 4F26A 4H4MA 1X4DA 3EZUA 2B4PA 2EGCA 2F2XA 2QA4T 1WZOA 4C8QC 2DZ9A 2GQQA 4ZCKA 2MEWA 3HZGA 1VA7A 4LT6A 1SUQA 1N5YB 3QATA 2NUUG 2XI2A 1X27A 2B5JA 2YH0A 4TVRA 3OS1A 2IAJA 1NAQA 3C12A 3MR3A 3ME9A 5KFRA 1X6OA 5CCMA 2X4JA 1N36J 3V7CA 1G6BA 2W8KA 2JLGA 5DLFA 3I4PA 1RT3A 5HMYA 1Z9ZA 2J0SD 3MUVP 5C2CA 2MQ8A 1NMEB 1JXVA 3UO0A 1C1BA 2FJDB 1S5ZA 4O3QA 3W5XA 3R6GB 4NCBA 1NLOC 4CT9A 1KC8C 4NI2B 2HZVA 3KJQB 4M5DB 2UVUA 4LQ3A 2KN4A 4X66F 5GAOl 3QGIA 2FJVA 1EETA 5KT5A 4DBFA 1NSPA 3G7ZA 1HLWA 4LQ9A 3MM8A 3OL7A 3E3XA 4Y2KA 5I22A 5HP1B 1O0PA 2L3SA 1FXRA 3J7AN 5L9NA 2V26A 2HAXA 2IM0A 5A76A 3TA2A 1U24A 3B4DA 5A8RA 2E1MC 5KT2A 4C8QF 1SKRA 2NR0A 1KD1U 1K73T 2QTWA 4CLZA 3C15B 3M1VB 2VASA 4UY8T 1ZPWX 1RHUB 1Y4ZB 3IP0A 3ICLA 2YPZA 2NUHA 2YUOA 1G3TA 4XTWA 4IKFA 4NOHA 2UUBJ 5GAN2 1X5TA 4J7IA 3R2DJ 4MTPA 3CMAS 2UV8G 4CO1A 3DDIA 2UUAJ 1VBYA 2CH4W 1E6YA 5KFNA 4BHQA 3TAMB 1FKPB 3MMCB 3V81A 2W9BA 2CT3A 2J6TA 2UUBF 4CNYA 2XMAA 2OAWA 2I5JB 1H2TZ 1VQMA 2ZBQA 2DR9A 3DLKA 4M77E 4RLEA 2MQOA 4MIWA 5ETLA 3TNVA 5GMKi 2AIRB 4LRAA 3PKMA 1OSDA 1Q86C 3CCST 3A5ZB 5E3PA 3RBZA 2J0XA 2OMOA 3FNNA 1S77D 4J6YA 3R5JB 1G1XA 3CWJA 7FD1A 2R5AA 2KXHA 4LSNB 3UNYA 3VHQA 3S8SA 4ED8A 1X7VA 4RX6A 2L41A 2AQ4A 2IBKA 1HI1A 3IG1B 2OTJA 1S59A 2JLEA 4A8YA 2B9XA 2NUTB 4ECUA 4NA1A 1KQSA 3CC4T 1JJ2S 2RU9A 5CD4H 3NOCA 5KCHA 1DJ7B 3I55S 3KDOA 2FVSA 5J1EB 4J9EA 3AQPA 4OV1A 4JRIA 5HANA 2EFQA 4YMEA 2J76E 1MMLA 2WB1D 4RNMA 1VQNA 4DN9A 2GHWA 2FJWA 2KT8A 2EXUA 4QOTA 3H7HB 4B3RJ 1T0TV 2ZH3A 3RB3A 2IMOA 3EG9B 2CQGA 1TL7A 2VKZG 1NK7A 4LFAF 5KFUA 1NLKL 1PC4A 3QJLA 2JZ5A 2RHXA 3JCMf 2ZJQQ 3VZHA 1PBAA 1XOVA 2CZVC 3CSKA 5AXKA 1ZTTA 1TR0A 2B4OA 1NJIU 5J2PA 5FLXY 1SRMA 4DR5J 1FJ7A 3GCWP 1WTFA 1XJWB 5HJYA 3DYAA 2V1RA 3X28B 4BDZA 3QPIA 2HFSA 4GVBA 3OVSA 2HCKA 1K8AU 1MW7A 2D9TA 1YHQA 1T02A 1FESA 3CEYA 2FZCB 3IBFB 1S6OA 5GADU 5KYUA 4J37A 2JMCA 2DCLA 3HFNA 1JKHB 4IQXA 2NUZA 2C3YA 2CJ9A 1S9FA 4K59A 1HFEL 3CMES 3BB5A 2CJYB 3DLGB 4X84A 4XDDA 1WHMA 1DRZA 1KHCA 2ZH8A 1TUGB 3BPSP 2BVZA 4OI4A 4Q0BB 4F7UB 4A8FA 1WI6A 5A0YA 1NJXA 1DTQB 4QW2A 4O3PA 4DV0F 1RWUA 2B3TB 1AWJA 2YKMA 3FZ2A 2ZZMA 3U27A 2DGTA 2O67A 2J9CA 1RTDB 3TOQA 4NX9A 1D8ZA 1RTHB 1FWLA 2E44A 1TFYA 2ZUGA 3TI0A 1NEGA 3NS5A 2NXEA 3K2YA 1HWLA 2HLUA 4U7UK 4RUCA 4QWAA 2ZZDA 3BO2A 2JNJA 2MWPA 1H2VZ 2GS8A 4PG5A 4Y92A 1HBNA 1V5VA 3K5MA 1QP3A 4XTTA 3MCOA 1NHUA 1OIAA 3A8GB 2ROGA 3KXDA 2JVOA 1KK7A 2HEKA 3DXBA 3OUYB 1VGYA 4LUEA 1WJ9A 3CC2T 3SMZA 5KG5A 2BDPA 3SIPB 5DZ6A 5B0FA 2B4VA 2QEXT 1TKTB 2DVIA 4TU7A 3C6TA 4KULA 1W2BA 3URGA 4LSLA 2VVKA 1EARA 2DRBA 4AFZC 2B51A 3EXYA 2PFFB 2EJ9A 4OMLA 3DLMA 4L74A 2LX7A 2L2PA 1OPZA 1NK9A 1UVJA 4M7DA 3JB9k 1SIWB 4I4BA 2MLYA 2RD5C 4DFPA 3MMAA 4BUGA 2NSCA 2RILA 4BDPA 1GEHA 2V34A 1UVNA 3KTQA 1PAUB 5B0GA 3OW2R 3PACA 3KLGB 3KK2A 4ZP9A 5DQGA 1QUPA 3LX7A 2XSFA 5KFEA 1UWBB 3V6KA 4HVWA 4V19J 4WCIA 3E51A 5HLFB 5C42A 2DETA 1U2FA 1RT7A 3VV0A 3MM6B 1Q8BA 2LQKA 2F9DA 4MK7A 4XK8E 2W2NP 2CWKA 1B64A 4BDYA 1ZA2B 1GFWB 3BQ0A 3GFYA 1F3FA 1VQ6Q 3CC2A 4L76A 4NPOA 1D1UA 1OO0B 2VG5B 2QL9B 4I0WA 4DU7A 1F0XA 3OMGA 4OMPA 4DA4A 1M8MA 1HA1A 1VQYA 1YGYA 1VQMS 2YXYA 3A8EA 3CGIA 4EIKA 4URSA 3THKA 2HGMA 2UXDF 3OSSC 2DVJA 1G83A 4ZN3A 3RB0A 4G6VB 1OV3A 1FEEA 4DEXA 2YH1A 3EGDA 4PPZA 3SDEB 3MD1A 4NXNJ 1UP1A 1FDNA 1JU5C 2O88A 2KRBA 4Z88A 2PUOB 4RBUA 3G86A 4ZVGA 4WE1A 5SUHA 1MG7A 4JV2A 4IOCQ 4ED0A 2IDEA 2M3DA 1Y00A 3KK1A 2QG9B 4HYKA 4MKBA 4J9HA 2QX0A 4CO2A 2M0YA 2GAGC 4C92A 5AXMA 1M2VA 3G4ST 2DL7A 1VOMA 2LMIA 1IBLJ 1SJFA 3ETMA 4JV0A 2YHTA 2DNMA 1FEHA 3FEOA 1SQEA 4O0IA 4RL1A 1YITA 4QT7A 3PW7A 2GVDA 2RJEA 2BJ1A 2F65A 4ZVQB 2HWIA 1EIFA 1IM6A 4AG1C 1AZSB 2HMIA 2A2CA 4URQU 3VAFA 2A37A 2FY1A 2FPHX 1MMNA 3JCMg 1YFNA 3K58A 3L7PA 2IM2A 4RG2A 3REBB 3NCRA 4M5LA 4FBTA 3IM9A 3M05A 2CYZB 2NPFA 1C1AA 5EWEA 5E3AA 1WNEA 2HQXA 4IG0B 3KUHA 1VQPT 4J9NA 4C8ZA 2EFGA 3MM9A 2DTOA 2DHHA 4OJHA 5GANh 2BW2A 5A8WB 1U02A 4II1A 4IUUA 1OI1A 5FU7C 2FHJA 1N0UA 5EDWA 3M0SA 3M6UA 2AK5A 4JUZA 5GMKh 3TUJC 1ELOA 3CCUQ 3QIPA 3C3LA 4ZVFA 1WOPA 1C4CA 2CRLA 5J39A 4KR0B 3I56Q 2OKQA 3R7BB 3WC2A 4WZQA 1XK8A 2VOPA 1U1KA 2HQEA 1HQUB 4FF4A 3TVZA 4USJC 3IWNC 5E3RA 5K20B 4IUVA 4EMGA 5CCLA 1X0FA 5LJ5Y 2L48A 1YIJA 3IS9B 2E4HA 5I3QA 4HKEA 1SV5A 1P9QC 2NPIA 4F4XA 1J5EJ 3MPDA 5CD4A 1KP6A 4LFBJ 3LA0A 5DO2A 2B86A 3OMCA 1JLBA 1MU2A 1Q81U 3MEWA 2X4XA 2ZH6A 1WOSA 1ZX6A 1CULB 2OTLQ 2CQIA 2U1AA 1V5IB 4USKA 1FMVA 2L0AA 2QV6A 1S79A 2VC1A 2HHSA 3MHXA 1BUXA 5B7WA 1CKBA 4GRSA 4M63A 3A8MB 3P4UB 4KAIA 3G6XA 2IBOA 2IHR1 5E0OA 4HT9A 1SJQA 2QA4Q 4FS1A 3SCKE 5L9XA 1M30A 2L08A 3QSIA 2LNHB 1SC1B 3DLHA 3OBIA 3EFSA 1LFPA 1X4AA 4G1PA 4KUIA 2GGPA 2Z58B 3GBQA 2AZ1A 4F7UA 4XTVA 3CCUT 1XNQJ 1RCOB 2GMLA 1XTZA 1ZA1B 2XKOC 1DTQA 2R7VA 3AT1B 1IBLF 1D1BA 2O31A 2PU9B 2V2VA 2M88A 3D6FB 1G3WA 1PKTA 1T3OA 1T9UA 4NLYA 4K4WA 4DL2A 2KRNA 4DL0C 5B09A 4FXVA 4UOGA 2H1YA 3DN9A 3CCET 4UOCA 1F5AA 5JVGQ 1S1UA 2DD5A 1S0OA 1VQKA 2ZBCA 1EQMA 3LP2B 4M7AG 1IBKF 1Q1KA 3M5AA 2WSEC 4PWWA 3O8WA 1H98A 3M8QA 1QAIA 4FNHA 2CPXA 2ZHBA 1TUWA 2BM0A 2CQ4A 4FS2A 1G5VA 3H5XA 2KU7A 4ECZA 4ZVSB 2WSFE 1D1CA 2VL1A 1FCAA 2C2ZB 4DPXA 5SZTA 1WACA 5IWAJ 2DYIA 2I9SA 1AUDA 3W9IA 4Q7AA 3H6ZA 4P9SA 2VB6A 3U02A 2W8LA 4AQYJ 1YSJA 1A6LA 3QG1A 1UKUA 4QYRA 4V2SA 1G7CB 2GO8A 3T9ZA 2AJ4A 2ZOMA 4TQRA 3TQEA 1FX4A 5RUBA 5EX0A 3IRXA 1WC5A 3ZTRA 2DXTA 3JQJA 2QT7A 2K9GA 1OYEA 1C0MA 3QZ5B 2JVVA 5F8MA 4ZHRB 3I0RA 4JS4A 5BJRA 1LW2B 4CCHA 1U6BA 1UVMA 2FDNA 3DB3A 2A28A 2ZPIB 2WW8A 3UD5A 3CCQA 1LOJA 4QIGA 1FXLA 4E6RA 3UA7A 2UVWA 4EI2A 1YX2A 4IFYB 1GH8A 4K2JA 1NCLA 1M90U 1U0HA 2VA2A 1VRUB 2EJGA 2EQUA 1Q79A 4OL8A 2GAHC 3I31A 1R0AB 4JI5J 4DQRA 3WX4A 2D3O1 2DL5A 2YKPA 4JI7J 5E2QA 4F02A 5GANe 2WRMA 1WA7A 1FK9A 4BI8B 1K9MR 3EVWA 4N4GA 2ED0A 3M32B 1C4AA 5B0DA 4QIFA 1MWQA 3DI6A 4C8QG 4PCQA 2XNRA 4U95A 3ER0A 4JUVA 4N8OA 3TAQA 5ETNA 3RMSA 1CULA 4EZ6A 4K11A 5HBMB 4H4MB 4LR7A 1RHMB 2RUGA 2DXEA 1L3VA 2E1AA 1W2BS 1CJVB 3EPGA 5KTQA 1BK2A 4N76A 4MT1A 2KVIA 1FWZA 1PD1A 2R5MA 4OX8A 2ZUAA 3DFEA 4Q5VA 4EGLA 1KC8U 1R0BG 5IT4A 3DOMA 5FLXU 1KONA 2CA9A 2E1CA 2CPIA 4LR9A 1Q82R 4DX7A 4D8DA 3QFWA 3CCSS 5GAN7 1W4SA 5JVHQ 2MSSA 4P6QA 1GX5A 1B3TA 2LXIA 1UL3A 3D28A 2W9AA 5HP1A 2FVQA 5K8OA 2MHEA 3RBDA 1K8AT 5T7LB 4J5OA 2LEAA 3BSOA 2APOA 1Q8IA 5LJ3h 2FHKA 1RISA 3UR0A 1KEKA 3G8TA 2BE9B 2MWOA 2KXFA 4N77A 3EGNA 2HNYA 1WC6A 3GV8B 3V6JA 2CQBA 1YJRA 5L1KA 2RA2A 4GC6A 2ATLA 4J90A 4QIEA 4UQGA 4Q43A 5KAKA 2FHDA 1RE1B 4BLGA 4XDCA 1X2QA 2GZOA 3E9GA 4USVA 4J9RA 3FGVA 4M77B 3I5CA 2KT5A 4V19X 2UUAF 3AD7C 3QFHA 4FPIA 1LEOA 1WIEA 3KK3A 3RUBL 3W2WB 2ZPHB 2O2OA 3O1LA 3C46A 4RW6B 3W8PA 1DJ0A 5DY9A 3TARA 1X2KA 3QRPA 1QCNA 5IQQA 1SVDA 1YJUA 2YDLA 4WFNQ 1KBRA 2CH4A 1REGX 1RAFB 3MAHA 3BV8A 4C0DB 1Q86U 4M75F 1FMWA 1ZAWA 4F0HA 2AZ3A 2E10A 4LR8A 4Y2IA 1WC1A 2LP5A 2XLJA 4DR3F 1RT6B 1MWYA 3M58A 2G2ZA 5B08A 1SQGA 1WF0A 3GJTB 2VH7A 2E5QA 2RHZA 5T7LA 3N5BA 3LH5A 3Q1JA 1BI0A 2E6ZA 3Q0AA 1FRMA 1X4EA 5AJ3F 1ZETA 1YRXA 1KWMA 1E6VB 4YFUA 4FNIA 3DU6A 2J9EA 1EHWA 3NNHA 2KHCA 3L9ZA 2JL9A 4Z02A 3CDEA 3UDVA 2AF6A 1ULRA 3TA0A 2JW4A 4JV5J 3MFHA 3V6HA 4QR0A 4KH1B 1Z2LA 3J7YI 3CC2Q 2CPDA 4ID5A 2RUSA 3G71Q 5LJ5e 4USTA 1U1RA 5F8IA 4RWWA 3VAKA 1T3LA 1IKXB 4R0EA 2F4FA 1LXNA 3CXCR 2ZE2B 3OVAA 1Y10A 1IQZA 3QO3A 3M2RB 4FXWA 1DQAA 2D69A 1RGVA 2LDIA 3CJ2A 2NWMA 4JJBA 1TUCA 3GF5A 2JEFA 3HFKA 4ES1A 3KJNB 2CYYA 2RE1A 4OX9J 2HQHA 2N4DA 1QY7A 1FNXH 2OTJS 3E1SA 2EW9A 4JYAJ 2K3YA 4TLRA 3PR5B 1RTIA 2HQCA 1ZPVA 2CVIA 3RW7A 2XYPB 4M75C 1S1UB 1TMMA 4LD9K 1UGQB 2G9OA 2LFVA 2B7CB 2WTFA 3EYZA 3M4YA 5CYQB 2ILZA 4B9SA 2YLBA 4RKUE 1IVZA 2GHPA 4X64F 2CUDA 5CVIA 2Z57B 1JJ2R 3QQCD 3CJ0A 4LIWA 4Z8AA 1K76A 5KFVA 1BQMB 2VQFJ 4WP8A 3WQPA 3LYIA 4R25A 4HL9A 4ERDA 2CJQA 2HPUA 1VYAA 1WXBA 1E7OA 1QTNB 3J80E 1HNZJ 2EQIA 4PFPA 2I2YA 2YUPA 3CCSA 4NXMJ 2BRKA 3NEKA 3TP2A 5HAOA 1YP5A 5LJ5f 1HQ2A 3KHLA 2ZH2A 1N5VA 2YWWA 3SFMA 1O75A 4BC9A 4KH0B 2E65A 2UXDJ 3LPYA 4O3NA 5GAN3 3R97A 2QDLA 4ZGEB 4F14A 2IVFB 1FRLA 3WHIA 3TVYA 4PJLA 5GADI 4M7AB 1RAAB 4L59A 4C5EA 3LWMA 4IDKB 1RAJA 2POKA 4Q5WA 2U2FA 1IREB 4F8RA 4ZGJB 4BACA 1UHCA 4JI4F 3H0FA 3A4TA 2XB2D 4QU6A 3QJYA 2X1AA 5LJ3e 4ZVOB 1LWEB 5GAN6 1B34B 2AHJB 2MKIA 3OTCA 4O44B 3PVQA 5CO7A 2KRSA 3CCJS 3MAAB 2HFZA 2ILYA 2OELA 1VQPQ 3A3NB 3AJ2A 4HR2A 4ZLLA 3UPUA 2YX1A 1T95A 5HKCA 3CNQP 2EKYA 4JDSA 4EUVA 3G9CA 4FVCA 2X3WD 1X8DA 2JS2A 4NMLA 2ZPGB 3PTWA 3QLHB 4B9NA 1R8BA 1M90R 3UWTA 2DT9A 3KFWX 3BGLA 5DG7A 1K0TA 3OW2P 3JTOA 2KL8A 4MIAA 2BKPA 2QQRA 2D3ZA 3UR3C 2EBPA 4KO0A 5J26A 5LMUJ 1TOVA 3JSYA 1CJUA 4OX7A 4B3OA 3HD2A 2DB1A 1WKLA 2MKHA 4PFZA 3M8QB 3FBEA 4CM0A 2B8AA 1VR6A 4ZVPB 1ZUUA 2PE8A 2GV1A 4N4HA 2V4JB 1I4K1 1Q7LB 3BZQA 5LMUF 3NPFA 2BJ8A 2V68A 3RRHA 4N0AA 1X4HA 2G0CA 2OFGX 2ZFHA 3EH2A 1G8XA 5LJ5h 2NREA 4KGMA 3DLLQ 1Q86T 1JNRB 3HHDA 5D6WA 2LEPA 3ZTOA 1O6XA 5CKDA 2IIMA 1FE4A 1X6BA 4OYZA 1TH7A 5GAOr 2BM1A 5THWA 1N33J 4E7IA 3KUFA 2KRRA 4RTXA 1HD0A 2QA1A 3M2RA 1CSJA 2XCAA 1Q82U 3L2QA 4URGA 2JTMA 1WHHA 3CCES 3ONQA 4CI0B 4N5SA 4IURA 2O4XA 2FJBB 2KAFA 3OYDA 5F0WA 3SDEA 3JSCA 4HVVA 3GPLA 4P71A 4PABA 1X5SA 1ZLMA 2Y8YA 2YRDA 2AV5A 1U1PA 2VZ9A 2KXDA 4IR1A 4M78G 3L2UA 2DHGA 5A2QY 2XGQA 4N7TA 5KOWA 4WTYA 5ETKA 4AG2C 3KK1B 5BYSA 4HXJA 3TEGA 2CNNB 3A8IA 1KQKA 2HMIB 1R89A 3OV7A 2XLKA 2N7CA 3PX6A 4ZK7M 2E70A 4CTAA 2MKYA 1BB9A 3GIJA 2J0WA 2BUDA 2YLCA 5C24A 2AP6A 1H0HB 3Q2SC 3WX8A 3Q8QB 1RT6A 2HQIA 5IQ6A 4ID5B 1YJNT 5GAMh 3UNGC 4L6V3 3ZZZA 3IMQJ 4DI6A 1NU4A 2W2MP 2HZAA 1XERA 2KBTA 2E9TA 3MM9B 2WK4A 4NLVA 2BQUA 2QMXA 3RUXA 2BOAA 1SSFA 1YI2A 1HK9A 4DR5F 3H20A 4OQJA 1U1TA 3JCMV 5KH6A 3J7YU 2MZJA 1VQ5T 2V5HG 3D7SB 4CO4A 3V8JA 2VQEJ 1VLYA 2OFHX 4EMKB 1QVFP 1NDCA 3I5BA 3PYFA 4GVLA 1PHTA 3OR2B 3VALA 2QLWA 2BJ3A 4HDGA 4B08A 3PRVA 3UWNA 1RI9A 3F44A 1TS9A 3OYCA 2AYMA 3HJVA 2E6NA 1L3UA 5F9LA 1VFJA 1AFJA 1AZGB 3HVTB 1YIJS 4MYTA 1JQQA 5E3QA 2N82B 3RKYA 1VI7A 4OX9F 2GJFA 2MY8A 3H0HA 3MM6A 1EB0A 2RI3A 4NLDA 3KDNA 3N9UC 3CCLQ 2CAJA 2RQMA 4YR3A 4DMZA 1KVKA 2YNFA 5F8JA 1UEKA 3GE9A 2F9JA 5T14A 4MFBB 1YJNA 3VAJA 1XMBA 4M77A 4KV8A 3WVEB 2OEKA 4RW4A 2DNZA 1ICEB 2YBVA 2KXNB 5KFGA 4RU9A 2ZZTA 1C6VX 3TRGA 2AJ1A 1QKWA 3HHLD 4RNNA 4OZNA 2OO4A 2F7VA 2OTJT 3M0PA 3PM9A 2P0KA 2MKJA 2EYZA 3UDLA 4C92B 1UPMB 3CCRQ 2K5LA 2HAIA 2HVEA 5K14A 4C11A 2FVPA 4PKCC 4HTJA 3UA6A 2NQPA 3I9ZA 1KQGB 1H38A 2IRUA 2FRYA 2I1RA 1F9HA 4ZS6A 4LRCA 4ZVRB 3HPOA 1JXOA 1GT8A 1CVJA 3DNCA 4TLQA 3UQSA 2MYFA 5GMKm 4IG3B 2XULA 3IM8A 1M3AA 3SSRA 5KFJA 3I6PA 2AU0A 2GTJA 2Z0GA 1WTBA 1I81A 2LU2A 3SD4A 2GBQA 4LRBA 4DOWA 1UETA 1NPKA 3KK2B 2CQDA 1VQLQ 1XMQJ 2QMWA 2CSQA 2ZAEA 2BZYA 3AAWB 1W70A 5ETMA 1LWFA 2M0OA 4TY8B 5J2MB 4HCKA 3HFVA 1DBDA 3VS6A 4IFVA 4AFQC 1VQ7A 3BGUA 4NRUA 1DY3A 4W98A 3JCMh 3SCIE 5IT9Y 1URRA 4YB7A 2M0GB 4N4IA 3DRPB 3R6LB 3V7SA 3JAMY 2J6KA 2MQMA 3NMRA 2XZDB 4WK1A 1JNZB 2RIJA 2LYVA 1KQSP 2V2KA 5CIUA 1RYRA 3EGUA 2JFKA 3D1QA 1TK5A 3UPFA 5C5JA 2MI6A 2PT0A 2BE2B 2BKNA 1MMAA 1ABOA 3D2WA 3TR5A 1ZYQA 4Y34A 2QFJA 3THVA 3WIUA 2LVMA 1Y5LB 2W7AA 4B3RF 4NL2A 2DY1A 4YR2A 4E0DA 1BHNA 4WWSA 4DR4J 3BKTA 4ECRA 3CC2S 1K1SA 1AD5A 4J6WA 4JPBW 1VQ9Q 3CDAA 4J9LA 1KS2A 4J9FA 1IR1A 3CCLS 5E5NA 4E7SA 4JI4J 1N34F 1FKOA 4ANCA 3LW5C 1HI0P 2AJQA 5CQGA 3HJFA 2XMUA 4DJBA 2VODA 3R9LA 2UU9J 3VWSA 2LECA 2ZC3A 2M8DB 2BKOA 1PWTA 1WHWA 3MUMP 4RZRA 2K4YA 3X20B 3SQGB 1UFKA 1BI2A 3MR7A 2VGMA 4DN0A 3GIBA 1UEBA 3GB0A 4YHHF 5DLQE 3TU4K 2IM3A 1BI1A 2HBWA 2KYZA 2P4RA 4KGVB 1TKZA 1SG5A 5BYQA 2XI9A 5FWCA 1EKRA 4JI8J 1NK4A 3ENWA 1HD1A 1K9AA 3RB4A 4ZHRA 1S99A 2G0JA 1RT4B 2RNEA 1WG4A 3EH1A 3NMZC 4C3KA 2D3UA 1P27B 1KVIA 4A8WA 4WF2A 2YKNB 1S97A 1IXDA 1HBNB 4USUA 2HRUA 3D6TB 4JZ4A 3K57A 2FB7A 5D4PA 2PUKB 2V4JA 2ZNZA 4QJVA 3LGNA 4DS5A 2XYGB 4J8OA 3ILLA 2V0NA 1UEVA 1GQEA 2QQBA 2XK0A 1T9WA 1ZM9A 3OTEA 4J83A 1VIFA 4RR5A 5F8LA 2DO3A 3DYAB 4CO5A 2E1HA 1Y0MA 4KT0C 4IUFA 1KOHA 3PW0A 4LXCA 3HM9A 2HNDA 2BXJA 1KSPA 3ZZRA 3S3NA 1Q81C 2VYTA 5KYWA 3OS2A 4OMMA 1P1LA 3D3CJ 4DF4A 4FF3A 2RJDA 4B3MF 2A10A 2YWHA 3HXMA 2E12A 3T5LA 1TKZB 2CP2A 3P8BB 4X9DA 3QO9A 1J2VA 1U8SA 2X3GA 2I6WA 2AEJA 3QWUA 3MI7X 4JI6F 2IYIA 3MAAA 4R56A 3CCJQ 2RF0A 2LCSA 4DV3F 4DS4A 2FY8A 1H3ZA 1WHVA 2KJWA 1IBKJ 4XU0A 2HEQA 2FYKA 3VS5A 1FKPA 4B17A 2DR5A 2KYXA 5GAOm 3QLHA 1M1HA 4X65F 3I0SA 2XMJA 5LSOA 4EMKC 3EX7B 3FZBA 3G6EA 4X4NA 1N4LA 2HBYB 1VQ7S 2GQ2A 3DRRB 1RAOA 3Q83A 3UVJA 3A8KA 5GAN4 1KRPA 3U1MA 1R8OB 5CZXA 2Z2LA 1YHQS 1AVZC 1U4BA 3UDCA 3S1TA 3G82B 4K4XA 3W3SA 1YITT 4CT8A 2ZBIA 1QE1B 6FDRA 4JBCA 4XU2A 5FU6C 2GTOA 3S3OA 1R0CB 4ZP6A 3T5KA 3KLIA 3EAEA 1OQ6A 4B3TJ 2OD6A 2Y1RI 1U3OA 1UMJA 4RW7B 1S6UA 2E5LJ 4F7UG 3G2XA 1PNJA 2X1BA 4X64J 5KFQA 2O01E 4PJOF 1YRTA 5FIIA 1JLQB 4GKKF 2YVSA 2BACA 4R0JA 4J9MA 4OYMA 1K44A 2PD1A 1S9GB 3LPEA 1PRMC 1RWXB 3OXGA 3QAUA 5HROB 2RMOA 2E1PA 3H9NA 2V8IA 1X69A 5MLCV 3W64A 4J7FA 1NH7A 2EYQA 3I96A 1KTVA 4M8LA 4C8QB 1HKAA 4LFCJ 1NKEA 2W9BB 3LP0A 4FDFA 3FVYA 1ZAXA 3BN4A 4DF8A 3EFOA 4PLLA 5GAOq 1M1KR 1NDKA 4BE0A 2YKAA 4TYBA 4JJCA 4C92D 3OSVA 1TMJA 1M0SA 4EO6A 1P92A 3R5CA 4ED3A 2RD1A 3ZZYA 3OYLA 1LKZA 5BYRA 3CJ4A 2ROTA 3NL0A 2LCCA 3QRRA 2DXDA 5L8RE 3HCXA 4K5RA 1OYDA 3HHEA 1IQTA 3UN5A 4C98A 4C8YA 3K7RA 2YRCA 2O1PA 5CHCB 2DBMA 5J2NA 3K5NA 3PNIA 2KH9A 2NXUA 2ZKUA 5I2MA 2Q3PA 4ENOA 4DQ2A 2CNOB 2JZ2A 4B9TA 2PA3A 4NYZA 2LQNA 3FSIA 2YKMB 3A1PA 3OYGA 2SEMA 1LFWA 2CSIA 3GYNA 3CJKB 3U1NA 1JLAB 1RLDA 1ZHIA 2AKKA 4OJ1A 3NGRA 3PFSA 4OYAA 2BJ7A 4Q0BA 4AL6A 2EQKA 2OGUA 2W1BA 4FBUA 3MEVA 2JEGA 5KYXA 1ZSZC 4C8NA 4PUOB 4R55A 1F5BA 2QAZA 1NLPC 3NHNA 3JTPA 3LLRA 1QJHA 4QWEA 1AB8A 3CDBA 3TJAA 3NBPA 2AYEA 2J7UA 3DKDA 4DV2F 1QQJA 2A7YA 3CD6S 4YOEA 1VJWA 1YJ9Q 5HVHA 2F8HA 2OAUA 1UGRB 2VPYB 3BDEA 3VZIA 1S76D 1NZ8A 2QE5A 4X65J 1T9VA 1NEBA 4FYXB 2G13A 3NCPA 3INZA 3HVTA 4Y2AA 1H73A 4OZLA 4PL6A 4DUYJ 2ZITA 1TZ0A 3PKYA 2VXEA 5G4DA 4M5KA 2YNFB 5D0EA 4WCEQ 4PKDB 3P45B 2M4MA 1IZ6A 3CCEA 1D9FA 1FRXA 4DR1F 3N5BB 3TW0A 2MAMA 3PCOB 3EICA 1HNXJ 3W2VB 1HYOA 2GFUA 3UDEA 4RW4B 5A8WA 2K7JA 4M95A 4LMZA 3BBBA 2QL5B 2DA9A 3FB9A 1QSYA 2GCXA 4YR0A 4FM4B 1CQNA 3HHNB 2F5KA 3W62A 1UDLA 1M5VC 4ZDNA 3EGZA 2PVGB 4EBCA 2EGAA 3VYHB 2DGSA 4BY6B 1KJWA 4CLPA 2BABA 2LQWA 2RVJA 4DEZA 1YJNS 3VYGA 3AA8A 5KFTA 2COWA 2JTEA 4M7AA 1RWMB 1UWBA 3WDOA 3OT9A 1AWOA 4ECSA 1SIZA 2KMTA 2FHMA 4WYWA 5EUHA 2EK1A 1JXEA 2LKZA 2WOMB 3KLVA 1AWXA 1EX4A 2RRBA 4DV0J 3QJJA 3MEGB 3Q8PB 4KE5A 2ZD1B 1M27C 1LK7A 3OYNA 2F63A 2C2DA 2E3IA 4O4GA 2K57A 1GMWA 1S10A 3CCRS 2V94A 3QT6A 1RK8A 2VG5A 1VQ5Q 1ITPA 2V67A 4DR4F 3ZFVA 2MGZA 2DKGA 1S72T 2E9RX 4GY5A 3NAIA 3PG9A 4M78A 4PJOE 1JXLA 1SL1A 3TX0A 5I3UA 4X4PA 4ELTA 2DL3A 2B4UA 3I56A 1CG2A 4CH0S 1N8RT 3E2EA 2MKCA 1ZM3A 3QJ6A 3K0JA 3QYYA 8ATCB 2DIQA 2RH3A 1HBUA 1WFWA 3FC9A 2OPQB 3T19A 2HKNA 2QDYB 4M75D 4UUWA 1YIJQ 1N5TA 2GIFA 3SBMA 4NYPA 4I68A 5LJ5g 2UVRA 1HNZF 1IR0A 3T6JA 2DNPA 4CI0C 1UCNA 3CCMA 4DLGA 2XWXA 4TU8A 3N6LA 1BBZA 3O5TB 4WZMA 2DR6A 2QTXA 1U8RA 4NZ7A 1HHSA 4QZVB 3DRRA 4Q2MA 2A3JA 3QKJA 3RR8A 4DV7F 4QKUA 3KJVA 3QBYA 3HSZA 4PJNA 2K79A 5GAHU 3MMBA 1U45A 3TUPA 1HNIA 5CAAA 1M1KC 2MQNA 1LWEA 1QVFS 2CPEA 3EZOA 3SWNB 4OI3A 2O9VA 2XG8A 5DM7R 3BEGB 2AZVA 5J2QB 1C0TB 4LFBF 3VAHA 4C4WA 2JWNA 1VQMT 2AW0A 4ESRA 4Q8FA 4DUTA 4ZLNA 5HVFA 3T3FA 3CMAT 3J7Z5 1SC6A 1KD1T 3W5YA 2VJVA 2KEAA 4HACA 2EG2A 3JAMU 4BI3A 2M5YA 3R6NA 3RYLA 3TAMA 3E19A 3JSRA 2RM4A 1D0YA 3FDRA 2DRKA 3MM5B 3OYYA 4W92B 4M7AE 2B8PA 4OIXA 1KG1A 2MKSA 3ZEHA 5EWGA 1IR2A 4NASA 4S0MA 2CREA 1N88A 4A8OA 3PO4A 3NWGA 1Q7YR 1UJYA 2RI5A 1CJUB 3A12A 2EFIA 2R2UA 5H9FJ 3KNAA 2YXLA 2P84A 2QEXQ 2AJFE 4ZPDA 1S4EA 1ZUYA 1ZAVA 2GQVA 4JLGA 3DOLB 2X51A 2MB0B 3GIKA 4RPFA 4USMA 4KKOB 1CJKB 2E5IA 2EI5A 4NEYA 5GAEI 2HGLA 3FEYB 3M59A 4IRKA 5CR2A 3GONA 1NK6A 2MZSA 3NGKA 1RA7A 1NKBA 2F2WA 3MTJA 2BZ8A 2PO4A 1N5QA 1IRXA 2HHXA 4C0HA 2ESWA 3HPWA 4ORZA 2HHHF 1RTZA 1TV6A 3VS4A 3RW6A 2ZD1A 1FJGF 1N27A 3F41A 5IM0B 1EJ7L 3BBCA 1RBAA 4QQ6A 3CMAQ 3SFGA 1TK8A 3JB9J 5LM7E 2DHXA 4OMNA 4IDKA 1FERA 2YKQA 2DH8A 4DZDA 4J9IA 1KLNA 4AL5A 1K0VA 5E7OB 4OMOA 1YRUA 5KYXB 3N5FA 4F4WA 4M78B 2JH3A 2KFZA 2HHVA 1Q0NA 3CTRA 1RLCL 3ILIA 2ABYA 3QSYB 1RHKB 3C95A 5IS2A 4HT7A 1WHKA 3M30B 1RQ0A 1TL5A 4Q8EA 3VU3C 1QCFA 1E6VA 1VQOT 1ZM4A 5C2GA 1YITQ 3FBFA 3CJTA 4M7DG 3LGLA 3NS7B 3P96A 1HD3A 4A63B 7FDRA 1PO6A 2AKWB 2LVWA 1GNKA 3T5HA 4RUAA 2E7VA 3UI3A 4I7FB 2GC8A 5GAN5 4XPEA 1IWGA 3BFMA 2CZ1B 4OYIA 1K0SA 1U0SA 2DKOB 4IOBA 1N6QB 1E6HA 1I1GA 2E5LF 1QWFA 5T41A 1JQGA 2QRRA 5KCOA 5A6PA 1OY8A 1SJ3P 2QN6B 1CC7A 3VVTA 4NLTA 1PKSA 4BE2A 1DURA 4OMFB 5E3CA 2ZM6J 3MR2A 1JLCA 2D7SA 2M9UA 1X75C 1H7XA 2V8PA 4TKTA 5FROA 1GX6A 1E6YB 1U47A 1XNRJ 3J7A1 1X5OA 2N3LA 1LPLA 4C8OA 1WG5A 2IFXA 4Y0FA 4KY3A 3OFEA 4N8NA 1QP2A 3CCJT 3LO3A 4F3QA 4FYVB 2B9YA 5LXYA 4LF9F 2CWXA 3G6YA 3T5JA 1APSA 4OVAA 2FHOB 2LQBA 3CC7Q 4A8SA 4K0KF 4QQBA 4JYAF 2R8KA 2WBRA 2HZCA 3X3UA 5F8GA 1VQLA 3GWCA 2IYGA 2CQCA 5I2SA 2DJQA 2E5KA 3PR4A 2ALZA 2F69A 4P2SA 3AD8C 4J9UE 3KHGA 1EFNA 2DIGA 4KBIA 1PAEX 1SPBP 5B0BA 4HEA9 1I5OB 4X62F 3JB9D 2IM1A 4TQSA 2OTLS 3MHYA 4DZ6A 2WVCA 4KV8B 3DXSX 2J6SA 1MN9A 1DARA 2JX2A 1VK3A 2V2ZA 5A0DA 5IAYA 5KFYA 1RT2A 5KE2A 3K5LA 2GO9A 2JM8A 4Y00A 2NXCA 1Y3KA 4RNFA 4KT0E 4WF9Q 4KGZB 2ABLA 4MMLA 2OLWA 3FJPA 3JYTB 3RJMB 3AB2B 3JB9H 2ZHOA 3EDRB 5JMNA 3JB9I 3MEAA 3OLBA 2F1LA 5AE2A 8RUCA 4GC7A 3ET6A 4XTUA 4FIBA 3D54A 3LOUA 5IT9E 5CABA 1YNZA 4WP9A 4YUDA 2LA4A 1NB7A 1O9SA 2DY9A 5DJBA 2X35A 4J9KA 1CKAA 1HBOA 4ED7A 2HNYB 1GMVA 3HTRA 2BV3A 2GJ2A 2NUPA 1WEXA 4CYUB 2Y0BB 4UT4A 4A48A 2DILA 4DX5A 5LJ3j 3HD1A 4TNOA 4ZIVA 2K1RB 3C19A 2K2VA 1SH2A 3VRZA 3TZZA 1WXTA 1LW0B 4YHHJ 2KKHA 3OTOF 1S9EB 3R5DA 5D6YA 4C0BA 3OTBA 1RHJB 4Z37A 3TANA 2N7YA 3O44A 4P7TA 3GQCA 5HATA 1WNLA 3QT5A 4X62J 2QI2A 2LA6A 1UGSB 4LF7J 3R2CJ 2ACMA 4QYZK 3L2ZA 1HMVA 1TQLA 1SQFA 2BBEA 3CCEQ 2VJUA 3QIIA 3M6XA 3BE3A 4B9LA 4QYZJ 2VA3A 3ZFJA 4I6AA 1YHQQ 2RKIA 4ED2A 2ZZNA 1WKKA 4OHYA 1VQKS 1QVFA 3CBPA 3I0SB 2H5JB 2HKEA 3AA9A 2D0NA 3B6BA 3GPAA 4JI0F 3DOLA 1VQOS 4J9OA 1ZBXA 1V6HA 1YJWT 1FA0A 2VBYA 1AA1B 3WVDB 3GSDA 4A4JA 3CCWA 2DITA 3IR7B 4LFAJ 2DBKA 5H9FK 3VCDA 5HCKA 4HI1A 2UP1A 1UA1A 3CMEQ 4OFZA 3JCMb 2AKLA 1S72Q 5LMNF 3ZZPA 2Q66A 5JUMA 1GK8A 4Z7YA 3L2WA 4Y28E 5KT6A 1Q81T 2XMWA 4RTUA 1G3YA 2X4WA 2KK4A 1WEZA 2JDJA 5L23A 1VQ4Q 1ZZNA 3CJ8A 3CIMA 3I32A 4USWA 1FE0A 3MP6A 1S7IA 1M5HA 2LT1A 3GP9A 3LWIA 3UCGA 5I42B 3JSMB 1RBLA 3JCMW 2HSEB 5HK4A 1RTJB 2KG1A 4N0AC 2A6MA 4UC4A 2RU3A 3CPWS 3KMQA 2RRAA 3I4HX 3NNAA 1W6XA 1U1NA 3BR9A 2Z56B 2EBEA 3CCSQ 1IKYA 2X7IA 5ITHA 1C0TA 2C3OA 3PHTA 2IVYA 4ECXA 4ANJA 3SV4A 2OPPB 3UCUP 1U6FA 2COLA 2DISA 1FTRA 1UJ6A 2PMZD 3PX0A 2MZRA 3CCQS 2AX0A 4ZA1A 2ADBA 4MJKA 2A18A 2DJWA 5KYYB 3PT9A 2QQSA 2WSFC 3HHLA 4P72A 5ETVA 4CIOA 2G6FX 5I21A 4JI1J 3OYHA 4FW1A 1S12A 1RWNB 4KIAA 3C14A 2VBXA 1MGQA 1REVA 2V2QA 5LJ3Y 2Y90A 3ASKA 3IO1A 2PMWA 1PYTA 2VPWB 2R9LA 1OOTA 4PQUB 2MMPA 4PWDB 2GQIA 4ZLJA 1VRTB 3OHBA 2MOXA 4ELZC 4HLBA 1YJVA 1TG0A 1BE4A 3MKDA 3CCVQ 2F1FA 1RLPC 2Z2ZA 5KG1A 2HZYA 1S72S 2XY5A 1KSWA 2J7WA 2O9SA 1WC0A 3HDSA 4ECWA 3LANA 3S01A 3QO9B 1HIYA 2BUNA 1QUVA 1Q95G 4RW8A 1CSKA 4K0KJ 2V4RA 1ZQ1A 1WOOA 1MNDA 2FC8A 3F73A 1D0XA 2BW7A 2EYXA 2JN0A 1U1QA 3OYBA 2Q79A 4C8KA 1S57A 3QYHB 3FEZA 5GAMe 4XIUA 1AROP 1IM4A 3GYXB 2GW8A 3ZTPA 1TKXB 1QVPA 1WSRA 3CCLT 1T3SA 2A0FB 3CO9A 2IJFA 3M8YA 3OJUA 3DGPA 1TU0B 3PFOA 4PJOC 1CS4A 4TY9A 1H641 1PG5B 2WAQD 4N47A 1NK5A 3VUBA 3CUNA 4DLEA 2XMFA 3NTIA 5L38A 2RJZA 2X4YA 3PFEA 2DEJA 4QQGA 4DPTA 4Z7CA 1RU2A 4U6PA 1X6GA 1LCKA 2EPDA 2DK2A 4TXSA 3AY0A 4IO9Q 3CCRT 4WTOB 1N0VC 2GFFA 4PNOA 2CPFA 5IFMA 3MEDB 3O6QA 4YTLA 1HSQA 4F17A 3V81B 3EM1A 1NKCA 3BS9A 1W2BR 1M5OC 4OZ5A 1O51A 2R2TA 2ACYA 3EWGA 3D0IE 2I2LA 4CC2A 1XQIA 5IHKA 2VWFA 2EFPA 3CCVT 3PYGA 1JB0C 4EDUA 2FL7A 2DEIA 2CNLB 3QDFA 4PRFA 2JHEA 5DGAA 3QRQA 4FYWB 3CPWR 1HPZB 4JS5A 1BQNB 1PSDA 2IAJB 3CJSA 3BF4A 3JRZA 2GVDB 1JLBB 3META 5CK9A 4ZMMA 4DOZA 1PJ5A 3HFOA 1RAGB 2AHOB 2C2RA 1RWKB 2XWYA 3HX9A 2BIVA 2RQVA 2EVZA 2HFVA 2XNQA 2HWHA 4UQTA 2PEBA 4X9CA 4RTZA 1QDUB 2KRMA 2WACA 1MN7A 2RO0A 3A3OB 1VRQC 1RT3B 4D8KA 2DNHA 2V8VA 3OYAA 3GR0A 2DPIA 4GLKA 3V4IA 5DRKA 1SL2A 1WWHA 2DL8A 5GANj 1BQMA 1S6QA 3LALA 4RW9A 2E9ZA 5LL6S 2DNKA 3ZNUA 2JSXA 2RQRA 4WBFA 2ZPFB 2CQ0A 5CZVA 1WYXA 4LFCF 4DHVA 3LW5E 3KJFB 2HHWA 4CDIA 2K2PA 4KHMA 2HNZB 1FDDA 4U7UD 3FCWA 3HKSA 3LP1B 3KXTA 3M7VA 1WELA 4AQYF 2BJEA 2ROLA 4QWCA 3T1HJ 2L3QA 1VLOA 5AE1A 1HHQA 2A36A 3B4MA 3X26B 2A3LA 1H7WA 3ELHA 2HMAA 1OPKA 1TAUA 4IQMA 1X4CA 3W9HA 3TEEA 3NBPB 1NM2A 2M16A 4L75A 3CVKA 5KT3A 1YK9A 2XEXA 3R5BA 3O5ZA 2W10A 1CQMA 4KYZA 1VQ6T 2B0GA 5HVGA 2QYZA 3THTA 1RZMA 3HT0A 2EIFA 1D0EA 4OV6A 3V4IB 2PA8D 2HL3A 2DTHA 4CLTA 3F56A 3JCMd 1GCPA 2JMAA 5IWAF 5C7PA 3PJ9A 2QJ3A 4MIBA 1N54B 4YY3F 1S6PB 2QA4A 3QT7A 4M7DC 5K14B 3GFZA 2J8AA 4MZMA 1S1TB 3BY7A 4LDYA 1F5CA 1KTQA 1YITS 4KTQA 4XTZA 5A6WA 1HWKA 1UTAA 2NSBA 2FLPA 2V8DA 3U23A 4ZPAA 4FL6A 3D9BA 3HSGA 4CLKA 3MECA 1U2RA 1JLGA 1TL3B 3CDWA 4ED1A 1HYSA 1S0VA 2J6FA 1J5OA 2CS7A 4KHPF 1KIKA 4H4OB 4O6JA 4QBUA 2NYSA 1MMGA 2ALYB 3KUEA 1AOJA 5KFSA 4CLLA 1V76A 2QSFA 2X3XD 1N8RR 4X4UA 3QMQA 2CJXB 1WJSA 1SL0A 2G4BA 1F9FA 1KLMA 2DXFA 1EP4A 5J2NB 1MV3A 3KBGA 3ISND 3BSCA 4EZ9A 4G1IA 3DGPB 4HT8A 2H65B 2YNGA 3HFZB 2G3RA 1ZBTA 2A6OA 2RHYA 1OWXA 4X4RA 3IR6B 2MLXA 3OUYA 2XCPA 4CLUA 2DF6A 2L3RA 1S1WA 3M2VA 3S3MA 3K17A 4C8LA 3JCMQ 3D0HE 5DDOC 2W0ZA 2N3OA 3TUIC 2JNGA 2CJKA 3AQOA 1U1MA 2JEJA 2DPPB 2EYYA 1GFCA 2FPFA 1XN9A 4XAXB 4WFBQ 5CKFA 5HK3A 2Y1LB 2EBGA 3W63A 3CCZA 4ECVA 3VS7A 4DR6F 4FF1A 2DH7A 3PYEA 1DLOB 3HRTA 2ZVIA 1WORA 3TJ8A 3CD5A 4ZN1A 2VOOA 1LXJA 2DEUA 2R7XA 2E66A 1CJKA 2EFVA 3PO5A 1VIEA 1BKBA 2XI3A 3MJXA 3FLGA 3NTHA 1VQNS 3N4WA 2ZWPA 2MMYA 1WHXA 2ZBRA 1WXUA 2R7OA 2MTLA 3HP6A 3B82A 3HVRA 1Q7YU 4ZJOA 2E7WA 3ILOA 3GMGA 1VQ9A 2WW4A 4RU2A 3QZ9B 2DNNA 2Z2MA 2E5JA 4QW8A 2RQTA 2GVZB 2AEFA 2AZSA 2LQ9A 3CD6T 1NSAA 2WSEE 3SSSA 4C8MA 5LJ3f 3OJSA 5FDLB 2VG6B 2DGOA 3FKBA 1O5JA 2JRSA 3AH6A 5KYWB 2RB6A 5EWFA 3H59A 4MKYA 4WIIA 1O8BA 2HL5C 1NYFA 1RTDA 3OSNA 4LF8F 2R7UA 2ZVSA 2PTKA 4OI2A 4XO0A 1FFWB 1FFSB 2YQ0A 2CDQA 2PQWA 3KJVB 5LMNJ 1M5Q1 4KPCA 1N5ZA 4C92F 2BE7D 4CO0A 5JXSA 1YJWS 2Y9HA 4LIRA 3H5UA 3S6WA 1M1KU 1AZEA 1G3OA 1OS5A 1S0MA 4JJNK 1HNIB 3ITHB 4ES2A 3CMAA 3QIDA 2YWKA 1K9MC 5D77A 3HSJA 2K3BA 3W60A 4JB8B 2RAQA 2D1XA 1T0JA 4O0NA 4J9BA 4R0KA 4OYBA 1LWCB 2Q6BA 2J9DE 2PIIA 2BE2A 2HS4A 4E7KA 5EN1A 1AT1B 4M77G 2FO0A 1K8AR 3CMEA 5H1SV 5KFDA 2M7SA 2YWGA 1AUSL 3MUTP 3RBEA 4ZCLA 4PEOA 3DRSB 1TVRA 2P9GA 1I94J 2QLFB 3DLKB 5KG2A 4PJOG 2FLOA 2H5IB 3BYPA 4KFBA 1IKVB 4P2MA 1BMQB 2OPQA 3CD6Q 2QMUB 2J05A 2QA4S 1D9DA 2P9CA 1R7IA 1Q4RA 2KZZA 1VQ5S 3MM7A 1RT4A 5GMKj 2OPRB 4RTTA 5D3GA 4WXOA 5J3BA 1U1OA 2IC3B 4NCGB 3VRYA