4ZN1A

Crystal structure of mjspt4:spt5 complex conformation a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
138
Chain Sequence
MIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTPENIEKGDVVEIIAPFKGERAKVIRVDKHKEEVTLELENAPIPITLPVEGVKIVSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Transcription
molecule keywords Transcription elongation factor Spt5
total genus 25
structure length 138
sequence length 145
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zn1A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 4zn1A01
3CC4T 1KHIA 5DM7R 3CC7A 3CMAT 2CKKA 2G3RA 2IG0A 3CCRA 3PIOA 3CCET 3J7AF 3CCUT 5IAYA 3G71T 3CMAA 2QA4A 1YI2T 2L3RA 2XHCA 3LGLA 1VQ6A 1NPRA 3EWGA 2LQ8A 3CCJT 3CCMA 1Q81U 4QQDA 1YBYA 3OW2A 3JAME 2JOYA 1N8RU 1VQLT 3LPEA 1NZ8A 3G71A 1JJ2S 3DLLA 3I55T 1VQ6T 3DB3A 3CCQA 1K9MC 2K06A 3CCEA 1KC8C 3LH0A 1M1KC 1QVFS 3CCUA 1Q7YC 2KVQG 1M90U 1YITT 1QVGS 1BKBA 1X6OA 4TVRA 3CXCA 3CCRT 1EIFA 1YHQT 1K8AC 3QQCD 5IT9E 3CC7T 3OYYA 1UEBA 2E6ZA 1VQNT 1XNIA 5J26A 3CCSA 1NJIC 1Q86C 3P8BB 1Q82C 1RL2A 2EIFA 2QEXT 1VQ5T 3CPFA 1VQLA 3J80E 5A2QE 3CC2A 3G4ST 4ZN1A 2MWPA 2OUGA 1W2BA 2KDSA 3CPWS 1KD1U 1VQ9A 5J3BA 2MI6A 3G6ET 4X34A 3ER0A 3CCLA 1VQOA 1VQKA 3CCLT 1VQ9T 3CD6T 3CCQT 3I55A 1KQSS 3CXCS 1S72A 3G4SA 3HKSA 5LL6S 2E70A 1K73U 1IZ6A 2MWOA 3DB4A 1JJ2A 1YJ9A 3CC2T 2OTLT 2OTJT 3CMET 3A5ZB 4YTLA 1VQMA 1VQ4T 1K73C 5HY6A 1VQNA 3OW2S 3G6EA 3I56T 2DO3A 3KBGA 1YIJA 1YHQA 5DLQE 2EXUA 1YITA 3TREA 1KD1C 1YJWT 3I56A 1VQKT 1XTDA 1VQ7A 3LGFA 2LVMA 3PIPA 1VQ8T 1QVGA 3CC4A 4CRIA 1NPPA 1VQMT 1YJNT 2OTJA 1Q82U 2OTLA 4ZN3A 3CMEA 3CCMT 3CPWA 1YJ9T 1Q86U 1YI2A 2QEXA 1NJIU 1VQ5A 1S72T 3H7HB 1VQOT 1VQPA 1VQ8A 1NZ9A 3CD6A 2JUFA 3CCST 1K8AU 1KQSA 1VQPT 1VQ7T 1YJWA 4RG2A 1QVFA 1M90C 1Q7YU 3J81E 1M1HA 1YIJT 5FLXE 1W2BS 1M1GA 1KC8U 1M1KU 1K9MU 2JNGA 2LCLA 2JVVA 3CCJA 1YJNA 3CCVT 1N8RC 2QA4T 1Q81C 1SSFA 1VQ4A 3CCVA
chains in the Genus database with same CATH superfamily
4TYAA 1CG2A 2QL5B 2ZJQQ 2QEXS 2FYXA 1Q79A 3PW5A 3RBXA 3NS7B 3A4TA 4CLFA 3OXGA 2V2ZA 5M2PA 4NI2A 3EXCX 1TP7A 2VOPA 2EFVA 3KJNB 2R58A 4L3KA 1VQ8S 3H2UB 3D6TB 1VQPS 1IREB 1WHHA 3A8IA 4EGLA 2QE5A 5KFFA 5C25A 1YRTA 1I5LA 1KOHA 4M5IA 3EG1A 4OZ1A 4E7ZA 1M2VA 3RNJA 5AT1B 3L1AA 1UCNA 3H59A 4OLOA 5KFXA 1HWKA 2QRRA 3RW7A 4Y0FA 1B7TA 4EEYA 5GAOm 1BQMB 3BV8A 2NQPA 1IKVA 1I4K1 2XHWA 4HXJA 2K2PA 4F4KA 1T02A 1X5TA 1Q82U 4LDWA 2EQKA 2LDMA 2Z2ZA 5AE1A 3VZHA 2V4RA 1P27B 4PL6A 5KYWB 4FNIA 2C3MA 1N48A 4II1A 4RG2A 2RHXA 4M7DC 2DBBA 2XEXA 2VXFA 2ZPGB 2WSFC 5KFQA 4DS4A 3BKFA 2JVVA 3OFEA 1FHTA 3DM2A 5D0GA 4DR1J 2XLJA 1H2TZ 3IR6B 2RHYA 4DV1J 4PUOA 1B3TA 4OLPA 2VWFA 3T3FA 3JSMA 2JW4A 3RTVA 4J9PA 3CMAQ 5J1EB 2BW2A 4DXLA 1D0EA 1F9HA 3JAME 3OUYA 1YNZA 2AYGA 1K9MC 2RU9A 1NCLA 4ITSA 2NLWA 4OYPA 3ZTRA 3KLHA 2QO3A 1U8WA 1UFWA 3TP2A 2RA2A 2L9WA 5B0CA 1Q86C 3MP8A 2VXEA 1KTQA 4OGCA 2CT3A 2IAJA 3BSNA 5KFOA 4EYIB 1TAQA 2KT1A 4A63B 3MOJB 3MPVA 1IBCB 2C2DA 1YJRA 3J7Z5 4RNNA 3VAKA 1W7WA 4BY6B 3TAMB 1KQSS 2FLLA 1TOVA 2DNRA 2XMKA 2PIIA 3Q24A 4DR6F 1XR5A 4F17A 2HFSA 3TEGA 1N36F 4M75G 1TSFA 1ZM3A 1WXUA 3H0FA 1C1CB 5M9OA 4KPYA 1YJWT 4ZHRB 1YN8A 4P2XA 4CRIA 1RI0A 1NPPA 4X66J 2JS2A 1WXBA 5LJ3Y 1WEXA 2L3QA 1N0VC 4IUFA 5B09A 2P4RA 2JM8A 1YSJA 2C06A 3QAUA 4DSJA 3US5A 5L23A 4JV5F 4YQWA 2Q1LA 2A0FB 1M30A 3KK3A 2W7OA 2EPDA 1RHJB 2LCCA 4DR6J 1X4FA 4EI2A 3UPUA 4BHQA 2KXFA 3L09A 1NK4A 4PQAA 2R7WA 3R6LB 1T3NA 3THVA 4N0AA 4DU7A 1IKVB 4KBIA 2EJ9A 2E3HA 4ANCA 2MMPA 3IP0A 1KD1T 3ITHB 4O4GA 3QIDA 4C8YA 4QWEA 3QRQA 3AD8C 2DL5A 1FDNA 2ZBCA 4DU8A 2EIFA 2QA4Q 1W2BP 1V76A 1IGUA 2LQ9A 3I87A 4ZS6A 2XLIA 3TAMA 3AA9A 1VS3A 1M5VC 2L5QA 4BI4A 3HKSA 1YI2S 2E70A 2MWOA 4QR0A 3CC2T 4UC4A 2OO4A 3QGGA 1M4ZA 1H92A 2B86A 1M5OC 4IO1A 4DEXA 1JJHA 1VQ7A 2KQWA 5EGYA 4ZPCA 2GNCA 2P9GA 2C3YA 2MY7A 4I69A 3V81B 3DLLQ 3VYGA 4HCZA 3FIFA 2J6SA 3MM8A 5FRNA 4NLDA 2ZAEA 4FYVB 3GU0A 2J6UA 2YX7A 4RUAA 2ZUGA 3H5UA 2VBYA 3WC0A 1G6BA 2V4JB 2DRAA 2JEIA 1XQHA 5B0EA 2D69A 1FESA 4OHXA 4Z7CA 3AY0A 1FXDA 2XWYA 4MIBA 3HHLA 1SL0A 1MMGA 4QKUA 4IKFA 2EG2A 4Q5VA 1BD6A 4NEZA 3OW2P 5DLGA 2YNGB 4PFOA 4OX6A 5KYUA 5MLCV 2NYSA 1RE1B 3FDRA 4JI6J 3CC7T 3GJSB 1U8SA 5FU6C 1XR7A 1VK8A 2K3XA 3UPFA 4Y92A 4OX8A 1E6HA 3TR5A 3M0QA 1NAQA 1X4HA 3U27A 1IBLJ 4NRUA 4NYZA 4JI7J 5CCAA 5A2QE 2KN4A 1NLKL 2JM9A 4Z7YA 3MUTP 5IM0A 3CJRA 4CYUB 5F9NA 3T6JA 2F7VA 2RD5C 5B08A 2E5JA 2GFAA 1V1CA 4LF4J 4RNHA 3W2VB 3SIPB 3OB9A 3VS4A 2ZUAA 1J5EJ 5LJ5d 3PNWC 3GIMA 1KR4A 4LRDA 2K9GA 5IHKA 4OJ3A 5FDLB 3KJVB 1I07A 2RJZA 3R3TA 4MJKA 3E19A 5GVQA 2QV6A 5A8RB 1R8AA 1CC8A 4QWAA 1Y0MA 2RN8A 4B9WA 3HFKA 2FZKB 4ZVOB 1SKRA 2AEFA 2XULA 1FYNA 4EZ6A 2DVEA 2JX2A 1VQNS 2HAIA 2MGZA 2XZWA 1W2BR 1VA7A 5LJ5j 1T95A 3CCET 5L1IA 4FW1A 1FKPB 1RLCL 1RBAA 1HNVB 5HQMA 2QDLA 3BGLA 1AOJA 2C3OA 3CCEA 4L6V3 1KVKA 4NA1A 2G4BA 5DY9A 1BI3A 1KN6A 3CW2C 3R1HA 5HAOA 4J9MA 3GV7B 4A4KA 5CO7A 3IG1A 3RRHA 1OPLA 4EPCA 2YX1A 3SDEB 1RTJB 2LT1A 3PVXA 1OI1A 2GGRA 4PR6A 1LCKA 4J5YA 3ULHA 3G4ST 3Q2SC 4PUOB 3PACA 3JCMJ 3OBWA 3CBOA 4ZVHA 4CYUA 1JJ2P 1UAWA 3M4YA 3G4SA 2NXNA 1MV3A 2JSXA 5KFBA 3DMJA 2I1RA 4DMZA 3M6VA 2HVEA 4AQYJ 5D4PA 4LMZA 2AEJA 2V8HA 2HWTA 3FK4A 5J2MA 2VFRA 2D3O1 3M7VA 2YNHB 1WEZA 4XDCA 3DLHA 1VQOQ 1S49A 4L72B 3TREA 4HHHA 2KB2A 5HK0A 2KJVA 2PMHA 4RWXA 3CJ8A 1YJ7A 1NK5A 1GXIE 3CCQQ 3GJTB 2DCUB 3FGVA 1YHQQ 3CJTA 1YX2A 2M8DB 3CC4Q 2LLZA 4RLEA 3V6KA 2R8JA 5LSLA 1H8KA 3BZQA 4NCAA 4FKXA 1U5SA 2IC3A 3EXYA 3TUPA 5GAOn 4PYDA 4TLQA 4AG1C 3MHYA 2OI2A 1WHLA 3KJFB 2X9HA 3X25B 1GFDA 5LSOA 5CCMA 4Q8FA 4O6JA 2VJVA 1UZHA 4P9SA 3GSDA 1X5PA 2GQVA 2DNOA 1FX7A 2A37A 2JJ9A 1XR6A 1RZMA 5DGAA 1S9FA 2Q6BA 2IRXA 2DXCA 3O1LA 2EWNA 3GYXB 2ABYA 4ATNA 4KHPJ 4I2PA 1WOPA 2DD4A 5L1JA 2I2LA 2A6OA 3WC2A 3M59A 1H641 4CO1A 4Q43A 4NLGA 1Y3KA 1S1XB 2DR7A 2E5GA 1HQUB 1TL1B 1DTTB 1AZSB 1Y3JA 4LQ9A 4F7UE 1REVB 1NK6A 2QYCA 3PIPA 5DM7Q 4Y2CA 1TKXA 1MNDA 5CYMA 1PILA 2E41A 3TX0A 1K73R 4RCBA 2HBYB 1VQOT 5CAAA 3M1VA 2AWZA 4M95A 2Y1IA 1LNQA 1I94F 1HKAA 1YIJT 1D8ZA 3UFCX 1GMWD 3DRXA 4EO8A 4UQGA 1U1PA 3VVTA 3MGJA 3M30A 3NGDA 3MMJA 2W25A 4EMKA 2R8GA 4E7SA 2LXUA 4F3MA 4C8KA 2W2QP 3CCUT 1QQJA 4PG8A 2H4WB 3N6LA 3I5BA 3B4MA 3DDIA 1HHTP 1PYOB 3BGFA 4UUXA 1GK8A 2C0IA 5HKCA 2YNFB 4E47A 3DRRA 1N34F 4LIRA 3FDSA 3THTA 1E6YB 1KFSA 1SSHA 1I94J 2RO0A 4HYKA 2C2MB 4OI4A 3EDQB 1X31C 1BE4A 4ZVFA 3F44A 4ED5A 2FVSA 4MKVA 3TJAA 4DQIA 1FWPA 3JB9D 4JI2F 2LQKA 2CPHA 2RKIA 3M54A 1S7IA 3PTWA 3JCMV 3SYZA 3MXHP 4DPWA 1HYSB 3QO3A 3IN5A 2ECZA 1Q78A 1OY9A 5LJ3e 2D1CA 2KZZA 1BQXA 3FEXB 4A48A 1TKXB 1QCNA 5D0EA 2X3XD 1L5UA 2JLEA 2G2OA 4QR1A 5GAN2 3CCQS 4DR3F 3DRPB 1L3TA 2JLGA 2H4YB 2KL8A 3RUBL 2D0NA 1RT5B 4F3QA 2FYKA 2FC9A 3CCUS 2HKNA 5HN0A 4OI0A 3R5JB 1FJCA 3UR3C 2IY5B 1CKAA 3MD1A 3H6ZA 3W2VA 1GMUA 1PCXA 2X3WD 4Z2XA 5HLFA 4PG7A 2RQTA 3BN4A 3JQJA 2KG1A 2B4VA 4JDSA 3IRXB 3LGLA 2AEMA 4G6VB 2LU2A 3H4BA 5GAMe 2B4PA 4J9NA 1Y96A 1VQLT 2H3EB 3KLEA 5IHNA 1FRKA 1S1UA 2X3DA 4O3QA 2MZQA 4F36A 1LWFA 2L89A 1TUCA 3MKDA 4LSNB 2XMAA 4MMLA 3BFMA 4DZDA 1R27B 2H5JB 1TH7A 2FGCA 1H98A 2VQFJ 1VQ9A 3OSNA 2IIMA 3FEOA 1RAFB 2GHPA 3KYLA 4HVUA 3OYKA 1RTHA 5AE2A 1UFLA 1MU2B 1MROA 2FQQB 3J7A1 2CDTA 4OZNA 4X4NA 1L3VA 2RQMA 1AWXA 1HNZF 2V1RA 4OHVA 1NKBA 4RTVA 5FLXY 3LA0A 2F8HA 4ICLA 4URGA 1HA1A 1K1QA 5A8KA 3BKUA 1Y5NB 4R56A 1EARA 1DURA 1WOSA 1WSRA 3GPAA 2FUG9 2V8VA 2M4MA 4JJCA 4YOEA 4LSLA 2HZYA 4J9SA 3CIMA 3PO5A 5HMWA 4X4TA 3BJYA 4QYZK 1VIOA 5SZTA 3JCMQ 2LQNA 3MEEB 3M9NB 2ZH6A 1WC0A 4DZ6A 2ZVSA 3L4BC 1SV5B 5J2MB 3WIUA 4OYMA 2F1FA 3LAMA 3AXMA 3M6UA 2ASLA 1JQQA 1G3TA 4QBUA 2RB7A 1IXKA 4KRWA 2ZPFB 3MPWA 3TA2A 1T8EA 3Q8YA 4QPXA 3OQ2A 2K2MA 5HMZA 2R2TA 1N54B 3CCRT 2XI9A 5D6GA 1QAXA 2EW9A 1SUQA 3HHEA 1GCPA 1QY7A 1FNOA 4CC7A 5HL7Q 1WDDA 3PEHA 3A3OB 2IRYA 1FNXH 4GBQA 2RDDA 5HBMA 4RW7B 4J9QA 1CJVA 4YS2A 1FWKA 3C6TB 4PG4A 3EG2A 2XO7A 2HNIA 2ASYA 4FSSA 2WVCA 3OMGA 5DDRC 4C92G 3JB9F 3RU0A 5U47A 1TL7A 2N3LA 2G9OA 3MR7A 1N8RT 2CNNB 2HNDA 1D1AA 2OSQA 2ROLA 2EYXA 3DI6B 2Y1JA 4CLUA 4N0AC 1VQ8T 3QKJA 2RHUA 1YGYA 1GCQA 2CP3A 3NTHA 2G2YA 4LFAF 1VRTB 3MWBA 3HVWA 5C5JA 4A8SA 3QJ6A 3OHBA 2M0OA 2EVZA 4B3TJ 1EZZB 4OMPA 3OSVA 3FB9A 2UVUA 3UA6A 1WHKA 4FYYB 3KHLA 3CC2S 2CQ0A 2DO0A 5J2NA 4G1QB 3NMZC 2F2VA 1TL3A 4RNFA 5HMXA 1I81A 3P49B 2GFUA 2LEBA 2AKWB 4URSA 4HT5A 3SMZA 1C0UA 5B0AA 1UGRB 1H72C 3E2EA 2J7IA 2VODA 3UCUP 3U1MA 1P6TA 1HNVA 5ITHA 2RM4A 1NRKA 4IUUA 1NZ8A 3ZZYA 1X4EA 1IM6A 1M1KC 3DOMB 1M0SA 5L1KA 1WI6A 3A1YG 4WE1A 2EGCA 1J3TA 4NXMJ 4XPEA 1TK5A 3V4MA 1YRUA 5GANh 2KYXA 5GMKj 1AFIA 2QLFB 4M5MA 3CCRQ 3QT5A 1WGSA 1PD1A 3GIJA 4DUZJ 4WFYA 3CCSQ 3FVYA 1M27C 3ET6B 1JXOA 1CPZA 3OL6A 1JKHB 2UU9F 2LDIA 2ZOGA 1VQNA 4PRFA 2IIHA 1RLPC 1A0NB 2MQLA 1YHQA 4M7DB 1SCJB 3JTOA 5IXUA 1XTDA 2UXBF 4YY3F 5GANf 1RDRA 2OEMA 3IWNC 1E6GA 5HCKA 2R5AA 3TQ7P 3TZZA 3OJUA 1IHWA 5J2PA 1NK8A 2JNJA 3O8VA 1HFEL 3CD6A 2ZH2A 1SXLA 5CVIA 3MM5A 2CQ4A 4OB0B 1Q7YU 2AQ4A 2KRBA 3OLBA 4P2FA 4RNOA 5CIUA 2FIUA 3Q1JA 2VU5A 2GVZA 3O3LA 2DD8S 2PFDA 4DL2A 2C2ZB 1MU2A 1TK8A 1M3AA 1VC6A 2CVIA 4TNOA 3W5XA 2X4YA 4EMGA 2PD1A 2PVOB 3DXSX 2KRSA 2DRDA 5IWAF 2MZ1A 2Q6CA 4L5GA 2YNIB 4DSEA 3PKYA 1XEZA 3MCAB 2LEPA 4ZJOA 2N3OA 4M75B 3L2QA 2LXIA 1UETA 3MPYA 2XSFA 2B5JA 1I6JA 2LZ6B 1EIYB 4CC2A 2VGNA 3GIBA 3JCMX 1JLFA 3TUJC 2WONA 4CLYA 2YWKA 3PR4A 2YY3A 2R7SA 1N6QB 5F3TA 1ABOA 2I0XA 2J7KA 4ID8A 2UV8A 2WAQD 5KG5A 4ZA1A 5D78A 4DV5J 1JLEA 3GLJA 4QYRA 4CCHA 3EGDA 3JRZA 1RTIA 6FD1A 5C42A 1X4GA 4H4KA 3MMBB 4Y28C 1SC6A 5CQYA 3ZFJA 2B9YA 2WOMB 3KKFA 1VBZA 3OTDA 1HHSA 1F1BB 2P9EA 2DXBA 2APOA 4MMOA 3DOKB 4PJOA 3Q8SB 2B6AA 5FU7B 4USTA 4OMMA 4U7CA 2Z0GA 3OD2A 1ZM4A 2DHAA 1C0MA 1Q8LA 2G6FX 4J83A 1G83A 3PVQA 4M5JA 3A8JA 3GJRB 1D3BA 4MZMA 3OYBA 4CZCA 2XYPB 2AJ4A 4RTZA 3DI6A 2I6WA 4B9LA 3D28A 2EGEA 3H90A 3TEHB 1RK8A 1IKXB 1FXLA 3UWNA 2L8DA 5IFMA 3K5OA 2QGFB 3L7OA 4JI4J 2KXHA 4HI2A 1AW0A 4Z02A 2DL4A 2XIDA 4F7UF 2PI4A 1QM9A 4CI0C 1QTNB 4B08A 2YKPA 2CH4A 1Y57A 3IC1A 3ADAC 4R55A 2W4PA 5KFUA 2GO8A 4NOHA 1U7LA 2Y1RI 2ZE2A 2HHTA 1WG4A 2MAMA 4MKAA 2W2NP 2GTOA 5JVGQ 3QGIA 4CRJA 4B3RF 1X4DA 2BE7D 1HBMB 3S3OA 3P45B 3EPGA 1R6YA 2B9WA 1H3DA 4F04B 3GG1A 3I6PA 3JB9k 2QTVA 2BVZA 4R0EA 4U96A 1VQSA 4IFYB 2M0GB 4C11B 5KFNA 1FKOB 3OVSA 4Q0BA 2GMJA 2FY1A 5EUHA 4JUVA 1SC4B 1VLOA 2DIGA 3GILA 5LMNJ 1BXNA 2DEJA 1AZEA 1W2BS 2O1PA 4KYZA 2HHXA 2P9CA 2R2UA 2V9WA 1Q0NA 3MEVA 1KHCA 2BACA 5E5NA 3RW6A 1XMQF 2X1AA 2KT8A 1HD1A 1FK9B 1FMWA 2FEIA 2RF2B 2XS2A 4WFAQ 2FHJA 1WC6A 2BA9A 9RUBA 3H2LA 1H7WA 2EGAA 3ZZTA 2OEJA 3M6WA 4OZ5A 2YWGA 2ILYA 2DPIA 2EPIA 4YY3J 2C22A 2MKKA 3CO0P 2VF3A 4KH1B 2V8DA 3CCMQ 2D9TA 4ZCIA 3B54A 3M8YA 3IM9A 5ETTA 2VG6B 1ROFA 2OPSB 3TUZC 5KG4A 1ZBTA 2DZCA 2RF0A 1WHJA 4NPOA 1IZ6A 2QA2A 3VRYA 1LXNA 4HTJA 1S9GB 4TY9A 1VHIA 4PG5A 5L38A 3S6WA 4WZMA 2DILA 1Q8IA 2VB6A 1JEGA 2O5DA 3I5AA 2LX7A 2YUOA 1VQMT 4ZHRA 4ID5B 1SJ4P 1LW2B 2B56A 1RT2B 2A10A 1AVZC 3KUFA 2WW4A 5KT2A 3NRBA 3OXFA 4R25A 2QL7B 3LP0A 4PLIA 3M0TA 3PW4A 4V19J 3QJJA 2V4QA 1YI2Q 1FVQA 4LFAJ 1TKDA 3CCVA 2N82B 2CQ3A 2GQCA 3BN7A 2CPZA 1HWIA 4FF3A 4YR2A 5LSRA 2VUBA 1K8AR 4G1PA 3IM8A 2KM8B 4CT8A 3RIRA 3T6BA 1IM4A 3KNAA 2JZ2A 4QW8A 1R8PA 5KT3A 1C4AA 4B3OA 4JPBW 1FCAA 2DPPB 4A54A 5CZVA 2VHGA 1VQNQ 5DQGA 2RK1A 4CIOA 2B4OA 1OJ4A 3PYGA 3AODA 4ZOSA 4WPAA 3I0SA 4ILRA 1AEYA 4DV6F 3H42A 2AZVA 3SEMA 5GAN8 3O6QA 3QNWB 1KD1U 3E9GA 4OMLA 1JLGB 4PABA 4OZ2A 1KQKA 4WXOA 2KSSA 2DXFA 3K8VA 4LF8J 4GO5X 5FD1A 2FZCB 3G8QA 4B9UA 3MM6A 1ACMB 1JB0E 4J9IA 5BJRA 2KROA 1TUWA 1CQMA 2AKKA 4MT1A 4X84A 4YP3A 4XTXA 5CKHA 4X4SA 2H54B 1PM3A 2ROGA 1FRJA 1TAUA 2MKCA 2DGVA 3KK1B 2LNHB 4FT2A 4LNPA 1HR0J 3A12A 2QGGA 2KI2A 1FDAA 1HBMA 3JSMB 2DEQA 3VS7A 3UD5A 2FVPA 1S12A 3EVMA 3EGXA 5EX0A 2NUHA 4WIIA 2UUAF 4OB1B 1AYEA 1VQ6Q 1YI2T 1U2RA 2LU1A 2AJQA 1Q1KA 4ZVSB 5DLFA 1WHYA 2EQIA 1FI4A 3M2RB 1U1QA 4DR4J 1QVGS 1U06A 4GVBA 3NCPA 3CXCA 2MPUA 4L76A 4KRTA 3L2UA 3HF5A 2DH9A 2A28A 4DBRA 2W1BA 3HHKA 4O3PA 4IQXA 3WQPA 1YCSB 5IXBA 2V34A 5I2SA 4YB1P 4I2QB 1ZTWA 3DLKB 5I3UB 5DGBA 2HQDA 5CAIA 1X43A 5LJ3h 3MEWA 5GAEU 1MV0B 3FQLA 2EFIA 3NY0A 4Y2KA 2WACA 4M7DA 4RG8A 3HZGA 2BEFA 1FEEA 1PC0A 1KD1C 3CEDA 4LBIA 5J1EA 2JLFA 1M3CA 1RAOA 3QUIA 3CCMS 2GJ2A 2KVIA 3MEDA 3QYGB 2AV5A 2E29A 3KXDA 4IG3B 4PK4A 1CVJA 4KT0C 2LMJA 3VS3A 1C0TA 2X35A 3FSIA 1YITS 2VFVA 3BDLA 2CSIA 1JLQB 1K9AA 3Q89A 4QWBA 2HQIA 4LBPA 3CJ4A 1HI8A 2R2RA 4F16A 3WVEB 4YDDB 2BMBA 4DL3A 3GR1A 3NKYA 3PW7A 4C3LA 1LWCB 2J7WA 5DDQC 4HT8A 4TQSA 3IR5B 2QZ8A 4QU6A 3PDNA 2HZVA 4X9DA 2DFUA 2DY9A 4HDHA 2B8PA 4H4MB 1NDPA 3PX4A 3VR1A 2R7VA 4KKOA 1Q7YC 2PA3A 4DN9A 1YHQS 5I11A 3P8DA 3K5PA 5AXMA 3OQ5A 4IH6A 2JWNA 5F8NA 3HKWA 5EWEA 1OPZA 3IG1B 2HLTA 1G5VA 2MK5A 4YFUA 1S0NA 4ZVPB 5IV4A 1UVIA 3OL7A 4O3NA 2PTKA 2MXYA 5I3PA 1F3VA 1S9EA 1JJ2A 2E5KA 1FFWB 4OMOA 1QWFA 1LW0A 4F7UA 2UUCJ 1AWOA 2HAFA 2DO3A 4HA8A 4PNOA 2XDDA 3OTBA 3CC7S 4OX7A 3GF5A 2XSJA 1WZOA 1GX5A 2OHDA 1JWWA 2AGQA 4P74A 4IFVA 1CS4B 4NMXA 1UTAA 5EC7A 3OA6A 2RU3A 1RBLA 2UUBF 1APSA 1KBRA 1Z2ZA 5HI7A 5KFMA 3MOZA 1M1KU 1JLGA 2ALZA 1S6PA 4NRTA 2VZ9A 5F8JA 4OYAA 1RT4A 4X66F 2F4FA 2AGPA 3N5FA 4KUIA 1KC8R 1IR2A 1IR0A 4CLPA 4U8VA 1ZM9A 1N8RU 1HARA 3IR7B 3ENQA 2HZAA 5KFEA 2FJVA 4E98A 4N5SA 1PRLC 4JI1F 3E3XA 2JTMA 3MEDB 1B07A 1MMAA 4IUPA 2JH3A 3I0SB 2W9AA 2F1LA 2GQ2A 4C92D 1QAIA 2A6MA 4FF1A 3OR2B 2B51A 2PZ1A 2IAJB 4GO7X 3DOLB 2MSTA 1KLNA 8AT1B 1OYXA 4D8KA 5F3ZA 2DK3A 1Q81R 1SJQA 1ZOTA 3RB6A 4I6WA 1VQ4T 2HD0A 3FBFA 5D7UA 5CZXA 1C1CA 3M0UA 3K8WA 1SEMA 3LGFA 4IDKB 5D8HB 4DL0C 1JQGA 1REGX 3MCNA 3K2YA 4DF8A 1NDLA 1X7VA 4QJVA 2XNQA 1RWOB 4ENOA 3UDVA 2EC0A 1RT4B 2F3JA 4BLGA 4LVOP 4USUA 2HQHA 2Y0BB 3M2VA 1FNMA 5GAN6 2MQNA 1VBYA 4EBCA 1W70A 3PJWA 1IRXA 5GAOq 4ZTJA 3M30B 4AFFA 2CP7A 4NXNF 4CI0B 4RPFA 1U2FA 3W64A 4LFCF 1NMEB 3MFHA 3IMQJ 5H9FJ 3GG0A 4M77B 1CJUA 3BGOP 3AB4B 2R7RA 4RW9B 1URNA 4FYWB 2XY6A 1RWXB 1PWTA 3G87A 2OLWA 5LJ5e 3JB9H 4TVRA 1K1SA 4JS5A 3LWHA 2PU9B 4JI0F 1RTJA 5J26A 3W9HA 2FJEB 3UR0A 3J80E 3D0IE 3M2UA 4TY8A 1D1BA 1UE9A 5GANe 4J7CA 3GV8B 2JT4A 5KFRA 1M1FA 4YUDA 3G9CA 4DSLA 4C8NA 4OYOA 3TQ1A 2DTHA 4MTPA 3RBZA 3SFUA 4DFKA 2W8LA 2D9OA 3G71S 4TKTA 3T5JA 2MZRA 3W5YA 4O4RA 1ITPA 1RKIA 2PEBA 2IBKA 2YSQA 2DHHA 1D0YA 4OI6A 1TS9A 3LYIA 2J6FA 1M90C 1HBOA 2VH7A 3M2VB 4ECVA 4Y2AA 3A8MB 1ZA1B 4N77A 4P7TA 1NE8A 3CD7A 2C2KB 4X62F 2HS3A 4A8MP 5GMEA 2CKKA 2HRYA 2HVZA 1BCMA 4RUCA 4B6MA 3QMQA 2BJ7A 4ELTA 2YKMA 2DHXA 4K0KF 3TUIC 4DL6A 4C8QG 2ROEA 2EK6A 2DE0X 5HROA 1RAJA 4LDUA 3RB4A 2HGMA 5F0WA 3IQLA 5GAMd 2UVRA 1C1BB 2CYYA 2K4YA 2DVIA 4DV0F 4JI7F 3GNFB 4M7AC 3PRBA 4DL4A 3GP8A 1E6VB 4I67A 2ZDOA 5M2RA 4MYUA 2O4XB 4AL7A 3CXCS 1N33J 4PJOE 4WWSA 4KHRA 4F50A 4PXCA 4QOTA 2LA6A 1LW0B 4MK7A 4ZCMA 4F67A 1S1TB 1WG5A 2F69A 3OUYB 2GS8A 3FSXA 5T14A 3FBEA 2Y90A 1Y00A 3P5BP 1Y07A 3OBIA 5LJ3d 1YJ9T 2ZNYA 1SVDA 1WIEA 2JZ5A 5D4LA 4CH7A 2IM2A 1WHWA 1FDDA 2D8JA 2PMWA 4YEAA 1EQMA 3VAFA 3M9OB 1XOVA 2XB2D 3JSYA 1R8OB 1W25A 4QIVA 3H8ZA 1TXQA 1ZZFA 4R5PA 2IFXA 3EJMA 2ROTA 3PGGA 2DRBA 1FRMA 1HL6A 3T19A 4PJOC 2GZOA 2DISA 4MKYA 1XQIA 3K5LA 1B64A 3T1YJ 3EVOA 3NGUA 5IN1A 2XSJB 1HQUA 1TL1A 2DYAA 5HROB 2QA1A 3G6YA 1QCFA 3WX4A 3ZZUA 3D2WA 3WIVA 1FWZA 2BQ3A 4LF6J 1Q86R 1V6HA 3P4UB 1TTHB 3AB2B 5KFDA 4JI3F 4NZ6A 3A13A 5EG2A 1UW4A 5LMNF 1R0AB 3PTAA 1EQ0A 3RMSA 5K8OA 1IXDA 2D6FA 4R0JA 4RTTA 8RUCA 1RYRA 2KU7A 5GADI 3QXEB 3BM7A 4I7FA 3EGXB 1YJ9A 4M77G 4MDWA 2GO9A 1S1TA 2C0TA 3JSCA 2CWKA 1H3HA 4C8ZA 3ETMA 1L3KA 5F0UA 4J9BA 1WC4A 3M8QA 2J9DE 3ZEHA 2J0SD 2V8KA 1HD3A 4NCGA 4Q2MA 4WCEQ 4DUYJ 2WCXA 2J6TA 2R57A 4CWBA 4QQ6A 3CDUA 2KTQA 3PFEA 4ICLB 2L9DA 4WFNQ 3J80Y 3X3UA 1VYTA 4PEOA 1E6YA 1S0VA 4R0KA 1YJUA 3PIPQ 3JB9I 2IDEA 1IVZA 1ZZNA 4M77D 3VKIA 5F8LA 1F0XA 2YKOA 1AB8A 2O31A 2VG5B 2CSQA 1N5YB 4J91A 2COYA 2DTJA 3Q8PB 3FBCA 3ZZRA 4TLRA 2RQKA 3OHAA 3SSQA 1DJ7B 1CKBA 2QJ3A 3JQKA 1QUVA 2O01E 5HP1B 4DX7A 1HNIB 2R8KA 3ZNUA 5CKDA 1LK7A 4NI2B 3M9QA 4OYXA 5KFKA 4XIUA 2I5JA 4CO5A 4CO3A 2BJ3A 2BXJA 5L8RC 5BR8F 4A8QA 2AMCB 2DGUA 2VBWA 3N9UC 3OBYA 3HSGA 2CZ1B 2UUBJ 2HVDA 2MIOA 1EKSA 3GB0A 3PX0A 4ZPVR 2ZH9A 2V69A 1JLQA 3SWNC 2EYYA 1JLAA 4AMCA 3MP1A 4XK8E 1UA1A 2UP1A 4I7FB 4HCBA 4D3HA 3RG6A 3QYHB 1I8FA 4BWJA 2E65A 3V7SA 3Q8VA 1AZGB 1EFNA 1WQWA 2RRBA 4KAIA 5LJ5Y 5HLFB 1RTDA 4WK3A 1GT8A 2PSZA 1ULRA 2D1XA 1X4AA 4F25A 1SRLA 5LJ3j 3C0CA 2OH2A 2W9CA 3G8TA 1NUEA 1IB8A 2KYZA 5FW9A 1CJTB 1TKTA 1YJTA 2OPPA 3QDFA 2PFFB 1XN9A 3QSYB 5GMKl 1JRIA 2RK2A 1D1UA 1B0VA 2CZ0B 3DDNA 2E12A 3PXGa 4P2SA 1IBKJ 2KZMA 4WTYA 3SBMA 2AK5A 1ZTTA 5IC6B 1SSFA 1NO8A 4PLLA 1UG1A 2Z2LA 2RUGA 2X1GA 4DR1F 2JTEA 2MTLA 1Q5VA 2HEKA 1O8BA 4K8RA 2YPZA 2XGQA 2E5IA 4ED6A 3GONA 3POTB 1M5SA 4C92E 4CLKA 3QWPA 3LOUA 3FRZA 4K4ZA 2KNBB 4HTIA 4IUVA 2CQ1A 2Z8QA 1Q7LB 2FLPA 3S3NA 2EFNA 1YITT 1TL5A 4DSKA 5JVHQ 3KJVA 4F14A 3TAPA 4F4WA 5LOQA 1NJXA 4ZIWA 2JS0A 3NNAA 2VPYB 1FXXA 2DIVA 3ZTQA 5CD4H 1BI0A 5LMUJ 2GAGC 4RUHA 3ZXWA 1Z9ZA 3O44A 4GC6A 4QIGA 2WONB 3Q0AA 1F5BA 4BCAA 4RKUC 3KG0A 3HULA 1SV5A 1UTIA 1VJQA 4C0HA 1C1AA 2VOOA 1JB0C 1XNQF 2CQ2A 4ZVQB 2JXBA 4ZJLA 3CDEA 3N79A 7AT1B 2DX1A 2B9XA 4KUDK 4C6AA 2ZHOA 2J0QD 3EGZA 2KI7A 4RX6A 4QVDA 2X4JA 4I56A 1YZ6A 1VQPA 4JJBA 5DQIA 3TVKA 4C3KA 3QRPA 5J2NB 3HSJA 2KVQE 1LWXA 4ECUA 2DYIA 3I82A 4M5DB 3MR3A 2WB1D 1CULB 3JTNA 3RBBB 4J9LA 2V6AA 1UJYA 2BE9B 1M2OA 1N32F 2DJWA 3W66A 3MPUB 3NGKA 2VA3A 1D9AA 5GANg 1WI8A 1U8RA 2CP2A 1ICEB 4M77C 4BDYA 3MHXA 2JC0A 1VQ6A 5IQQA 2F9DA 1SIWB 2W0ZA 2XGPA 4M7AD 3FUYA 3KHHA 4HVZA 5KOWA 4C8MA 1T3OA 3GCWP 4OX9J 2YWWA 1ZX6A 1OS5A 1GAOA 2DRKA 4JB8B 5K5MA 3CJ0A 2HMIB 1RUWA 3LGMA 1RGVA 3MPDA 2HDAA 1QKXA 1K0SA 5SUHA 4DWIA 1RHMB 1VQ7Q 2HHPA 2B5JB 3NAHA 1U1NA 3K5NA 2FPDA 3LP0B 4GKJF 1TL3B 1DTTA 5E0OA 3X24B 2V2KA 2QMUB 3AXKA 5GMKi 4CNZA 1RB0A 3G6VA 2RVJA 4IOAQ 1Y5LB 2FPFA 3ZZZA 1FJ7A 5D6XA 3V81A 3FRNA 3LALA 1ELOA 3NMAA 2DXUA 1XNRF 2WSCE 1KOOA 2GCXA 3CCST 2OAWA 3MMBA 3DU6A 3VS5A 2ZKUA 3A8EA 4PXDA 4J9KA 1VQKS 4RL1A 4KSEB 2EEYA 1NSAA 3KK2A 4CLTA 3U7JA 5EWFA 2OD4A 5DM7R 3MEEA 2XD0A 3CWJA 3CJ3A 5IHIA 4CO4A 1M90T 1NXIA 2K3KA 1U24A 1R8HA 4DX8H 3IRXA 1TUGB 2VGMA 4BI3A 4ZP9A 4ERDA 1RHRB 5K14A 3I55T 5KFSA 2K06A 4IOBA 3LH0A 2HWHA 5CYMB 5L1LA 5AE3A 2MKHA 1U1OA 4ZLLA 2CREA 5HJYA 4KE5A 3KDNA 3CD6S 4BWMA 3QZ7A 3MEAA 4GY5A 4OHZA 4M78C 3TX8A 3SV4A 4Q2LA 4JI8J 3JSBA 2RH2A 3PVLA 2DB1A 2GVDA 2P2CB 1RT3B 3MM7B 2IVMA 4NLWA 2F2XA 4Z37A 2NREA 4F4YA 3PMIA 3RAMA 2B4UA 2L0AA 4WP3A 2FB7A 1HHQA 1S77D 3TU4K 2CUDA 3DLMA 4WCIA 2BE2B 4FBUA 2CPYA 3JSRA 3OS2A 1VQKT 1T11A 2KAFA 4JI0J 1Q86U 2IDLA 1PC5A 1H3ZA 2BV3A 3VQTA 4WK1A 5KT5A 4PJNA 5FWCA 4JI3J 2KKHA 1K9MU 2B6AB 4JI1J 2GIQA 1WOOA 3BPSP 5THWA 2FJWA 2UUWA 4UOCA 1VIEA 4M5GA 2NPIA 2C28A 2RUSA 3CCTA 3BYRA 1N6QA 1LWEA 1MWYA 2YVSA 1FKPA 4QIEA 2CT4A 3JCMb 2HKQB 2L3RA 4DCJB 2LFVA 3HXMA 2KFNA 3CTRA 3WXMB 4BE1A 4DQQA 2HYIB 2K3YA 4ZVGA 5C24B 5I42A 2HHQA 5LXYA 1VQPQ 1Y10A 4X2BA 4RUBA 2E5QA 1BK2A 3KTQA 4A4JA 1UFKA 2FG0A 3PV8A 3OYGA 3W61A 1T05A 1Y71A 1OYEA 3MM7A 1D9FA 3HHLD 3L3CA 4NLVA 1EHWA 1CJVB 4TU8A 1AROP 2DGQA 3GZ7A 2QASA 3RESA 1FE4A 2LRQA 4DN0A 2MJNA 2NS1B 1RKJA 2C1EB 2V0NA 4DV3F 3EAEA 1UUEA 2RB6A 2CFXA 3HRTA 4NLPA 1NEBA 3AJDA 1RLDA 1DAXA 5A2QU 4JRPA 4O0IA 2VFUA 1TG0A 2H51B 4E7JA 2DGXA 2XQCA 1HBUB 1IBLF 3SQGB 1VQKQ 1LWFB 2DNHA 2FJDB 2XK0A 2CPJA 1Q82T 1NU4A 2MPXC 3GNGA 4JJDA 2QLJB 2MB0B 4ES1A 3TVZA 2QQ9A 4FN5A 4EDUA 3T5HA 2HGNA 4ZKAA 5E7OB 2KYMA 1AD5A 2ZC4A 4TYBA 1YJ9S 3IXQA 3CMAA 1WORA 4CC4B 1S57A 5GJVB 1FRXA 4X9CA 1YJWQ 1RCOB 1BKBA 2AJ1A 4XTWA 3MURP 1VI7A 3C95A 3VVUA 4NWBA 1BY9A 1Q4RA 4J37A 2PQWA 5DETA 4DSFA 5GAN5 2O88A 2BOAA 2DIQA 1T0JA 3CVKA 4DUTA 3VS0A 1PGZA 1KHVA 1WHVA 4QVZA 1ZPVA 2YHTA 2QIFA 1S6PB 4Y2MA 3TVTA 1IWGA 3QIPA 5KYNA 2AX1A 2MZJA 2PVGB 4BUGA 1YIJA 1GMVA 2YKNA 3PM9A 3OVBA 4C0ZA 2YLBA 1VMBA 3CBMA 3KWMA 3A8HB 5CABA 1XC9A 1PSEA 1AUSL 3LWLA 5C7PA 2XMJA 2IJFA 2LQ5A 1S6QA 1ZAXA 1KIKA 3KLGA 3REBB 1UVKA 5K8NA 2EQJA 2XMUA 3MEKA 3SDZA 3PR5B 5CCLA 2DGOA 2QA4T 2E1RA 3D1HA 4DUYF 2BX6A 2M3DA 2VONA 4RTYA 2MF2A 1FFSB 1B0TA 3N0VA 3PRDA 3NGRA 4Y2IA 1DZ5A 4M4ZA 2QLBB 5C42B 4P10A 2D0QB 5J2QA 1KHWA 3I56S 2XU8A 1U47A 3UCZP 4DR5J 3OYMA 4C0GA 4HT7A 4LR8A 4XTZA 1U0HB 1UECA 2HFUA 1RT2A 4IIOA 1RCXB 4N41A 1FDBA 3ELHA 2J0WA 1KQSP 4DQRA 4J9VA 3ET6A 1WWHA 1BGXT 2NXUA 2B43A 1NJIR 4P52A 3QATA 3CCJQ 3K0JA 2YH1A 2BJ1A 3IGVA 2IYIA 5H9EJ 4FBTA 1CJKB 3DLJA 2QXFA 2DL7A 1AFJA 3I5RA 3BBBA 1ZBXA 4HKQA 3IWLA 4IH7A 3CSKA 2YWHA 2QAZA 4WE1B 3OXLA 2OI3A 2KFYA 4D8DA 2QT7A 1H0HB 3FCVA 3QFWA 1MW7A 2QYGA 4ZGEB 1S48A 4M7DE 1KEKA 3RKXA 2OP5A 2C3UA 3JB9J 1M5Q1 2XG8A 1SPKA 4XTTA 4NL3A 4I1TA 2HZCA 1NG2A 1RTHB 2YTCA 5FU6B 5FROA 2Q79A 3NS5A 3CMAT 4KPCA 2LEAA 1V5VA 2DBKA 2X7IA 3PFSA 3LTOA 5E33A 3F56A 2OSRA 2N7CA 1RWKB 3M2RA 3MM6B 5B0DA 2BJEA 5GMKm 2DGTA 1WA7A 1U0HA 3GFHA 3MAAA 2M1HA 4KT0E 3OMCA 4C0BA 1Q82C 4A4GA 2RQUA 2IHR1 3OFHA 3ULRB 4IRKA 3UN5A 1RWNB 2OUGA 1M5KC 2XYGB 3HVTA 2YKAA 3BREA 4XK8C 5DJBA 3NEKA 2ZD1A 3RKWA 3MMCA 4IR1A 1YFNA 1VQMA 2ZBRA 2R2SA 2J0XA 4M75E 4C8QC 2A2DA 5F8HA 2CADA 3CCES 4OZ3A 4F7UB 2YKQA 2OEKA 1K1ZA 2M88A 2P0QA 4OL8A 2ZPHB 4C5EA 2FHJD 4FXVA 2E1MC 3L9ZA 1K0XA 3FC9A 1NZ9A 2YWEA 1QVFP 1N88A 2CS7A 2EBGA 1Q95G 4BC9A 1LJOA 1U25A 2P5VA 2L3MA 3G4SS 4WF9Q 3EHRA 1JXEA 1OULA 2MGZB 1ZUKA 2DH7A 2ZCFB 1U49A 1TL7B 5I21A 2W9BB 1OO0B 3M58A 3PIOA 2EJGA 2OTLS 3EZUA 3VYHB 2M16A 1QWEA 2VC0A 1JLCB 4MMKA 2VBXA 4Y00A 2XG8D 3DLLA 1T9XA 2DR9A 1BQNA 2VG7A 3EICA 1JXLA 2HVHA 2AJ2A 1OY6A 2Y1LB 2PEHA 2H65B 3MAAB 3TA1A 3EYZA 2YBVA 3M8PA 1PAUB 3G82A 4DPTA 3HVTB 2X51A 3DXBA 5B7WA 5F8GA 3RRGA 1VQKA 2NUTB 4P73A 2VQEJ 4IURA 3R1LA 2XBPA 2VFSA 1G3SA 4FS1A 4Y91A 4NMLA 1T9YA 1IR1A 3D68A 5KFVA 3CCWA 2JVRA 5KG6A 1H6KX 1UJ6A 3DRYA 2YQ0A 2WVBA 4ZGJB 4ER8A 4TQRA 3RR6A 1RTZA 2K3IA 4LXCA 4ECYA 4J7IA 3MFIA 5KYUB 1T9UA 4AE5A 3NBPA 1KKHA 1WX6A 3MCMA 3M57A 2E9RX 1JNRB 3THPA 3LUYA 3K58A 1SHFA 5GAOl 2L3SA 3P3DA 1ZAVA 2L3PA 4HHJA 5FRMA 1EX4A 1S0OA 3F73A 5HK3A 2BM0A 1C0UB 1QJHA 4O0NA 1BIBA 2YRCA 4N4GA 4KC5A 4LRFA 4A8FA 1UW9A 5KFCA 4YR3A 4DQSA 4I0WA 1PHTA 3DHWC 5DS7A 2J5AA 1B3QA 1M5HA 4K4TA 3M8PB 5KG0A 2QTWA 4NCGB 3H25A 1U6FA 3MEGA 1XIQA 2FO0A 3KK1A 5DG8A 2G0JA 2K5LA 1C2PA 4I2PB 3W2WB 2XS7A 3ER0A 2KEAA 4ZP7A 1BI1A 3QRRA 3FMWA 4D3GA 3UN3A 3R7SB 4CDIA 1P1TA 2HKEA 2NYHA 4NL2A 3BEGB 3OFFA 2CVEA 2HNYA 3CULA 2YXLA 3TYTA 1DBDA 4LF1A 4CLLA 4OZJA 2HRUA 2Y8YA 2H5IB 2G0CA 2HBWA 3HM9A 1YJNS 3DLEB 2K5FA 1WJSA 3BB5A 4JI5F 5JJBA 4DPOA 1PRMC 1UPPA 2BDPA 2ZBPA 2P84A 1FTRA 2J9EA 3OLAA 4QPTA 4RW7A 4O3OA 1DTQA 1S72Q 2C0OA 4UZCA 4O44B 4K4UA 3BDUA 4LF8F 1HBOB 2V67A 3FFIA 3CCEQ 2QLXA 2RI2A 4J9DA 2KXCA 2YUQA 2CQIA 4USHA 1S9GA 1G4CA 3GMGA 3D4JA 2CWXA 2X4WA 3GOXA 3SFMA 3O8WA 3G71T 4A4EA 4WYLA 5KG2A 2WRMA 2J7UA 2MKYA 3OYDA 2ZZNA 4ZJQA 5IQ6A 3SWNA 3CCQA 1NKCA 2YKMB 2ZFHA 2JFDA 3CBPA 4DV1F 2HHSA 3GIIA 2O2OA 3E51A 4HI1A 3MEGB 3A3PB 2E6ZA 3NS6A 4EUVA 1C0TB 3G4SQ 1JBMA 1QW1A 3HJFA 2FVUA 1KRPA 3CPFA 1DHMA 4WYWA 4C8QF 3CC2A 4ANDA 4V1Ak 4LIWA 1W2IA 1PNJA 3NCQA 4K5RA 2OELA 3RZAA 1IKWA 4NXNJ 2CKWA 3VWSA 2L9NA 2RRNA 3GQCA 3MR6A 2J8SA 1QE1B 3PEJA 2RNAA 2BZ8A 3M05A 3A5ZB 3C94A 3OJSA 4DEZA 2VKZG 3OW2S 3G6EA 3BDPA 1S1NA 4M75D 3QBYA 1RP5A 1OPIA 4C8OA 2PUOB 3CC4A 2FLOA 3M8QB 2OTJA 1VQLQ 3G8SA 4CM2A 4DL7A 1NPKA 5KYYB 2AKLA 1OV3A 4H4OB 1KG1A 4DR7F 3TQEA 4ZVTB 2E7WA 4RUGA 3CCJA 4K2JA 5KH6A 1U45A 4QZVB 2KDOA 3D67A 1BWVA 1F2GA 3TRGA 1UPMB 2QFIA 2DM1A 4VUBA 2KXNB 1H2VZ 1AHJB 2GCFA 4ZPDA 2DKOB 5DM6Q 4K4XA 2FLNA 1WELA 1Q8BA 4FSXA 2ZWOA 4DR7J 3OYCA 2H48B 2QLWA 4CO0A 2XHCA 1UEUA 3PW2A 2RJEA 1KC8T 1Z9QA 4IIMA 4X1VA 2KHCA 4GVBB 3J81U 2DNYA 5IT0A 2HGLA 3BO2A 3J81Y 3NWRA 4XQ3A 4ED8A 3P8HA 2Z4PA 2J6OA 2NZ4A 3DLKA 4B3TF 1H2UX 2K79A 3M1VB 2NZCA 1TFWA 2NLUA 1PO6A 1F2HA 1Q5YA 3M8RA 1NK9A 2ZM6F 1VRUB 4OJHA 5FWBA 2XICA 3E2UA 2QMXA 3KOAA 2FDNA 4DV7F 2ROPA 1TZ0A 2ZZTA 4ZIVA 2GMLA 2AJFE 4UF4A 4J9OA 3JXOA 4HR2A 4C0DB 2HL5C 2D3ZA 4LDVA 1LNXA 1GH8A 2F5KA 4IFYA 4N8NA 1U1MA 3UF4A 2U1AA 2VBZA 4CLWA 4RTWA 1BI2A 2OTLA 1H73A 2IVFB 1QMCA 1GQEA 3ICLA 5CH7B 1VBXA 2NWMA 5ETKA 1WYXA 5GMDA 4K0KJ 2DR6A 4PWWA 3FJ2A 4MZPA 5I4MA 1KLMB 3T1AA 3R6OA 5E3RA 5KAKA 5KG3A 1QCOA 1GFCA 1VUBA 4NLQA 2FVQA 1N36J 1A0OB 4X4VA 2QN6B 4UQTA 2AIRB 1M90R 2HQFA 3QZ9B 4USJC 3EGDB 1RTIB 5EDWA 3FRYA 2XLKA 2EQMA 3TI0A 1GNKA 1HI0P 5KYWA 1GXLA 4DX6A 4EBEA 1S72S 2JVOA 2VA2A 2CQPA 3CDWA 3F0NA 3OTEA 3HP9A 1TWBA 2R7OA 1UKUA 4BE2A 1TVRB 5AXNA 2AX0A 2F2WA 4NCBA 1YRXA 1KD1R 3OYAA 5KFAA 1SH2A 1NHUA 2F5TX 1HIYA 5CA5A 4I68A 1ZSZC 1TUDA 3HDSA 3AOBA 2DMOA 3U1NA 2R9LA 1KFDA 5GAHI 3K7RA 3TCJA 2CP6A 1Q7YR 4ORZA 2HNYB 5A2QY 4KFBA 1J27A 5H1SV 1YCYA 4C92B 1UGVA 1S0MA 1SQGA 1BWEA 1X2KA 2Y3YA 1TV6B 2CH4W 5KCHA 2ZM6J 4GLKA 2BZYA 3SXLA 2OJ3A 1ZSZB 3N28A 4M5LA 1KQSA 5GAN7 5F8IA 3JYTB 2MKIA 1KNZA 1YLXA 1U3OA 4DV2F 2AU0A 5CKFA 4LJMA 4W92B 4OI2A 3M8WA 4MH8A 2CDQA 1OZ2A 2CXEA 5EX3A 3QO9B 4ECZA 1WHGA 1UP1A 2LECA 4M5DA 5F41A 2HBZB 3I9ZA 2CQCA 5HP1A 3R5DA 5A6PA 3T1HJ 1VQMS 4HLBA 4ANEA 4AG2C 3MCSA 2M7SA 1KC8C 2E66A 5KYYA 3HVRA 3I96A 4XTUA 3AJ2A 3G82B 2V8GA 3PO4A 1MWQA 1VQ4S 2V8PA 2KT5A 2OIHA 1QKWA 2UVWA 2XMWA 1OQ6A 1WDXA 1S6OA 3DOLA 5KE2A 1W2BA 4DR2F 2JC1A 3I31A 1KJWA 4JYAF 3CCLT 7FDRA 2RQVA 2HFOA 1HD0A 2HLUA 3DB4A 2KR3A 3WVDB 3CMET 3UDLA 3DYAA 4YTLA 1K73C 1KSPA 5IC4B 3A98A 1X0FA 2OPQB 3TANA 4OYBA 1ZA2B 2JHEA 2LVMA 4J90A 3UATA 2DZ9A 2BRKA 4ZPAA 4MDXA 4M7AB 1BYMA 3N6MA 1OWXA 3AHPA 5FLXE 3T1YF 4OJGA 3MTJA 2OPRB 1T3LA 1YJNA 3FMBA 5HBMB 4C5IA 2RD1A 4JV1A 3HL8A 1SRMA 1FMVA 1VQ7S 3VF0B 4DUZF 1YBTA 4J7FA 3I5SA 1RAAB 3W9IA 1EETA 5CKBA 4MIAA 2M52A 4OMFB 4LN2A 1FJEB 2VD3A 4KFBB 2R3VA 4OMNA 4N4HA 2FJBB 4KULA 2W10A 4KGXB 4A8YA 2M02A 2PA8D 2D3UA 4H54A 2DRMA 1U2CA 4J5OA 3HPOA 2B8QA 5KOXA 2AF6A 4MZTA 4PQUB 4MAKA 2YUPA 2HCKA 5A0YA 4PKCC 3THKA 2W2OP 1QD1A 1QP2A 4KHMA 2NUUG 2UUCF 5ETLA 3G2XA 4L73A 5J3BA 3G6ET 3EGVA 3CD6T 4D6WA 3I55A 3GYNA 4KB7A 3B8HA 3JCMc 2A08A 4OGEA 1YJNQ 4PJLA 3CCJS 3HHLC 5KFGA 2O3DA 2VKNA 3DFEA 1U4BA 1TQLA 1T9TA 3W9JA 2N7YA 4RW9A 1FKAF 3CCLQ 1FT8A 1IJEB 3SFGA 2HFZA 2CPDA 4FS2A 4IH5A 1HWJA 1S5ZA 2HNZA 3V8JA 2ZOMA 3VAGA 4AUKA 2W2MP 3N5BA 4DV6J 4USVA 1PAEX 2Y4XA 1LPLA 1MMNA 3UN2A 1TL4A 1IQZA 1JXVA 4PKDB 1L3SA 4F0HA 1P8GA 4PPDA 2KE9A 4DLEA 1YBUA 2MQQA 1N5YA 1F9EB 2V4JA 5G0RB 5A76A 1RU2A 2CQGA 2DK2A 2G2ZA 3RBDA 3HSBA 1N56A 4JS4A 2WSEE 4QW9A 1G1XA 2AGOA 4IUQA 1Y11A 4EIKA 3UA7A 4K4WA 3N6NA 3M53A 2YQ1A 1W1FA 4RBTA 1NDCA 4L75A 5HANA 4GVLA 4M8LA 4FVMA 5B0GA 3NXZA 3CCSA 2OTLQ 4IG0A 2CJYB 2ABLA 4E2FB 3AOAA 2IJNA 2ILZA 1F6TA 5KG1A 4EK2A 1ZS6A 3W1YC 4DBHA 4NLTA 4LT6A 3G7ZA 3LWIA 5HY6A 1X9MA 5GMKa 1HNXF 1RTDB 4DV4J 3CD6Q 2E5LJ 2VKRA 2V50A 4TN2A 3LO3A 4LSZB 2ENMA 1YJNT 4DG1B 2JN0A 1VRQC 1N0UA 3OYFA 2CQBA 5EWGA 1EP4A 1PBUA 3HK2A 2ZPEB 4L59A 1HNXJ 1Y7XA 1IWAA 4DFMA 4FCYA 2UUAJ 4AFQC 4NYPA 2POKA 4YB6A 2V2QA 3NMRA 4C5GA 3UDEA 1VHFA 9ATCB 1KVIA 1YK9A 2ASDA 1FRLA 1GBRA 2ZHBA 2IVYA 4OHWA 3SZ2A 2HHHF 5KYXA 3OW2A 1XMQJ 1KONA 1P92A 3MUMP 4H4KC 4RJVA 1KQ2A 2IM3A 5K8MA 4ED0A 4JYAJ 1BU1A 4UOGA 2YRDA 1EIFA 4V2SA 5FJ4A 3TAQA 4L6V5 3FC3A 1VC5A 1VQMQ 1GBQA 3R5CA 1KQSR 3S1TA 1U09A 1LXJA 4WP8A 2NSBA 5J39A 4TU7A 4J9RA 1P9QC 1EB0A 3W3SA 5DZ6A 1S72A 5LL6S 2W4DA 1RU1A 4B02A 4AD6A 2OTLT 3CJ5A 3UCGA 3D1OA 3VHQA 2H9ZA 2QSWA 5KCOA 2HRTA 2YNHA 3L7PA 1SKUB 2RI3A 1RWWB 4ECQA 4JZ3A 4JRQA 4LFBF 5HK4A 2DNGA 2HURA 1RSCA 3HI9A 1WC5A 3P96A 4NZ7A 4DPYA 5LT5A 1SJFA 3SCIE 3H0HA 3JCMf 4M7AA 4QT7A 2JNGA 2FRYA 3G86A 4HDGA 4EO6A 1VQ4A 2F5GA 3HJVA 2YDLA 1JK9B 4LFBJ 1NHVA 1ZAWA 3HFVA 2VC1A 2EW3A 1SIZA 1N33F 1WF2A 5HSPA 2O01C 4BDZA 3FCHA 4WU2A 3H0PA 1K73T 1NSPA 4QQDA 2JOYA 3NGTA 3NOCA 3RAXA 5HQ8A 1K8AT 3ZFVA 2JEGA 1M8VA 1NH8A 2EKOA 1WACA 1LOJA 3AQOA 4JRKA 4R8UB 2IRUA 3P8BB 1YQHA 1PCAA 1RT1A 3BQ2A 5B0BA 2K6DA 5A0YB 3BGRB 2J8AA 4K4VA 3PNIA 2KK4A 3NWGA 1WFWA 1BMQB 1VOMA 1UHFA 5IZHA 1WLPB 3V2UC 2XNRA 2FGOA 4ZP6A 2HMAA 2KM8C 2R8HA 2M5YA 2AJ0A 1OIAA 2F8EX 1HQEB 2CAJA 2W9BA 5H9FK 4ZLPA 2VFTA 2V2VA 4C8QE 3MMAB 2BJ9A 3W63A 2GBQA 2DCLA 5KYXB 4YHHF 2E1PA 3VAHA 4B3MJ 2WVFA 2V9KA 4B9NA 3VGTA 1UWBB 4J8OA 4DBFA 1NJIU 3J7AN 2DNQA 2PI5A 3ILLA 2QG9B 2GW8A 3O2IA 3BR9A 4AFZC 2ADBA 1JX4A 2ATLA 2UVVA 1M1HA 2MQPA 4IQMA 4O5VA 3JTPA 1D3WA 1SF9A 2EKYA 3OYLA 1PKTA 3M5AA 4OF1A 2ALYB 4C7QA 3KHRA 1YJVA 4ELVA 2NCKL 1RT6B 4KGKA 3HP6A 2BYCA 2DAQA 3CCMA 4QR2A 4LE9A 1AZSA 3CCUA 2PN6A 3IA0A 3SQOP 3C46A 2JTFA 3CF5Q 3IFEA 3R2DJ 1N9RA 4OHYA 4F4AA 2LQBA 3NL0A 3D1QA 4B17A 3JYTA 1XTZA 4RW4B 2O9VA 4M78G 4PPZA 1GX6A 3K59A 3RR7A 5T7LB 2GGPA 2WBMA 4OZ0A 4YB7A 4Q7AA 2RILA 3OV7A 2F63A 2UXBJ 2OMLA 3X28B 1U1TA 3S8SA 3BSOA 3RB0A 1XWLA 1OX8A 4ME7A 1NEGA 4LRCA 3KLIB 3I56T 3HPWA 4F4ZA 5D4NA 3HTRA 2J9CA 4GLMA 4WIQA 5HJXA 3W5ZA 4NLOA 2E9ZA 4YR0A 1BBZA 5D3GB 5C2CA 1NEEA 1LOUA 2OKQA 2FHOB 2KRRA 4RW8A 5DZ7A 1D9DA 4B9TA 3BGUA 3W7BA 2DNUA 3BGRA 1N52B 1S1WB 3ILOA 2QK0A 1B7YB 4U9RA 2QA4G 3KMQA 2EFQA 3T5KA 4Y34A 2EYZA 4PJMA 2YNGA 2LP5A 1LEOA 4IRDA 1Q81U 3EPIA 1T9WA 2HNDB 4LDYA 3W60A 2G13A 2RT3A 1U0SA 1M90U 2ASJA 3KNGA 3GWCA 2GX8A 4H4MA 3ZO7A 2ESWA 4KV8A 2CQDA 1WJQA 4CP5A 3JQMA 4BB7A 4B9XA 3D54A 1SJ1A 2GGPB 3SCJE 1UGQB 5CYJA 3M4XA 3D3CJ 4MKBA 4BS2A 3SI8A 2G1HA 3HLUA 4O44A 2RS2A 2AZSA 2BKNA 2DY1A 1OEBA 3Q83A 4W90B 3TA0A 3CCSS 2E9TA 2XCPA 1HJDA 2IA0A 4WKYA 1XBWA 3QT7A 2KY9A 3LANA 3CEYA 4M7AF 3I56A 3ISZA 5FLXU 4K59A 1PJ5A 3O5ZA 1SUQB 4JRIA 4UOFA 4DPXA 1OU8A 5L8RE 3TWZA 3OT9A 5L9NA 1S1UB 3PIOQ 1AT1B 3ENAA 1K8AU 1MWZA 3L42A 4WTOB 2AHOB 5LJ5h 4RWWA 3QWYA 3X20B 2L41A 2NSCA 3HHDA 1HLWA 4CT9A 4JI6F 3BBFA 5I3QA 5I3UA 3UD4P 2RE1A 3QZ5B 1SL2A 3MR2A 2NYIA 2RRAA 2VDHA 2ZGWA 1NJIT 4KJIA 4HACB 2RAQA 1RISA 2AYMA 3EX7B 1VQ4Q 1VR6A 3KUHA 1R89A 5D0RA 4P7VA 3NAIA 2N4CA 2I38A 4XTVA 1HWLA 2EFGA 1VRTA 1K76A 1HBUA 1PKUA 5GMKh 1VK3A 2J6KA 3GBQA 1T03A 1F9FA 3A1PA 2XMVA 2ACYA 2EYQA 4J9UE 3CPWR 1IQTA 1PD0A 2BJ8A 2V8IA 1GL5A 2GAHC 1UJ4A 5IV3A 3I35A 1BUXA 2RQWA 4U8YA 4PAAA 2MQ8A 3EZOA 5AJ3J 2YWFA 2F8MA 4J9HA 4RU2A 5IXFA 4DBQA 4KBMB 1S4FA 4ANJA 1SQEA 4LR9A 1LK5A 2GFFA 4FT4A 1VQ8A 4A47A 2V63A 4OYZA 3H2VE 2LCWA 2D41A 4ILMA 3H20A 1N8RC 3MECA 4RBUA 4DEYA 1LWEB 2IC3B 2ZWPA 5GAOr 3FZ2A 2ZVIA 4BY6C 3EFOB 1S1VA 4AFUC 3MMCB 5J1PA 1X01A 2YUNA 5A0GA 4KY3A 2ZD1B 2ZHAA 4HACA 3CIZA 1Q81T 3D6MB 3LPEA 4Z89A 2RSQA 5CR2A 3HT3A 3KMSA 4HVVA 4DOZA 4HT9A 2IM0A 1FWLA 3HKZD 2CRLA 1QSYA 1YKWA 2LJ0A 1QUPA 3GV5B 2WBRA 2JMAA 4ZCKA 4K7QA 5EHHA 1MGQA 4NLXA 2VVKA 3GFXA 2FPEA 2CNOB 4FL6A 5BR8J 1SJRA 3DOKA 2E1CA 1VQ9T 1KLMA 2K7KA 4OYWA 4EWTA 3HD2A 2COLA 3QDRB 3OR1B 1CC7A 2VUGA 1RAGB 1YWPA 1YWXA 1Y7PA 1QDUB 5HATA 4UY8T 2KFZA 1RUSA 1S79A 4JUZA 1WC1A 5DLQE 4PJOD 5GAEI 2Z2YB 1SPBP 2K3BA 4LD9K 4FYDA 1G8XA 2ADCA 2W8KA 1ZLMA 4ZPTR 3ZZOA 2B7BB 1BQNB 4Y28E 3E1SA 4RNMA 3QPHA 1WHXA 1EJ7L 2RMLA 2WSCC 4DI6A 4E0DA 3RJMB 1HI1A 4M78E 2P6SA 4YHHJ 4USWA 3TSZA 3GE9A 3C6TA 3CCLS 2LCLA 3L2RA 4DJBA 2DXTA 2R7XA 2VG6A 3QT6A 1FD8A 1Y5IB 5A8WA 3KUEA 2KHDA 4L3NA 4N8OA 1FTCA 2XS5A 2YLCA 3CCRA 1WSVA 3C4SA 1UEVA 1X2QA 4N76A 2FY8A 3D5MA 1RYSA 1O75A 3OYEA 5LXRA 3ITHA 4ZITA 1UWAA 2EAYA 2MMYA 1OSDA 2OPPB 1IJFB 2JEFA 2Z57B 1X5SA 4BI8B 2RDJA 1VIFA 3EM1A 4P6QA 4M7DF 3AD9C 1SJ3P 1Y4ZB 4DLGA 1YJ9Q 1RL2A 5J2PB 1VQLA 3W2WA 4C5HA 3K5MA 2LCSA 2QQBA 1B0PA 2HIQA 4Z88A 5E3AA 4X34A 1MSWD 1S99A 2D7SA 2Z2MA 2Z56B 1S97A 3KFVA 5A6WA 4JP8A 2FD2A 2I0NA 1RA6A 4USMA 1RT7B 5KFLA 4F3OA 1N27A 1T94A 2CZ9A 3UW1A 2IM1A 1VQ9Q 1FRIA 1HMVB 2HS0A 5DDPC 3NP5A 2V8JA 4M7DG 1QVPA 3QFHA 3IS9A 2XZDB 4LUDA 4CTAA 5KT6A 3R6NA 2BOPA 1MG7A 4CQ1A 1KTVA 3KG4A 2YPYA 4A4FA 4P2MA 1HSQA 3C16B 5C6SA 2FZGB 3LW5E 5GAN4 1TMMA 3CC4T 1ZUUA 3MTKA 4KO0A 3FCWA 1FVSA 1RQ0A 4RKUE 1EAYC 3T41A 1MMLA 2RJDA 1LWCA 2QA4A 1CQNA 1VJWA 2O66A 3TJ9A 4Q0BB 2D9PA 3MUVP 4JBCA 1VISA 1R6VA 2ZNZA 1Y0HA 3LWMA 1UWBA 5ETOA 3QQCD 3CUNA 4LSNA 2BR0A 5F9LA 1NK0A 5KE3A 3HMJG 3S3MA 1RHUB 3C2PA 2GC8A 1CSKA 4J6XA 3G71Q 4B3SF 3GTYX 1I1GA 4ALZA 3Q23A 1WNLA 4PJOB 2RF2A 4F0MA 1S9EB 1CJKA 1FFGB 3OW2R 2MHNA 3PCOB 4QWDA 6FDRA 2PUKB 4DR2J 1N9SA 3U23A 1Q86T 3PE0A 1FE0A 2RHIA 4F7UG 3IS9B 1UA0A 1JJ2R 5GAMg 4DOWA 3F41A 2KO1A 4HHUA 3ENWA 3LLRA 3B6BA 2XY5A 4DL5A 3PY8A 2LVWA 4CH1A 1R31A 2M9UA 1DY3A 3KHGA 3AHUA 2KRNA 4KQZA 2CDRB 4I6YA 3EGUA 4A8XA 2MLZA 1X4BA 2V5HG 2SRCA 3TZXA 2A3LA 1B34A 1O0PA 2BABA 2C3PA 5HQLA 3J7AF 1OSCA 4OIXA 4RBVA 1IBKF 2GV1A 3R9LA 3KLFB 2KVQG 3AT1B 2BUDA 3J80U 1FEHA 4WKRA 3DLGA 4ELZC 5ETRA 3JCMh 2LTOA 2P0KA 2RDIA 1RJJA 1T3SA 3IBWA 3VV2B 1JLAB 1UJ0A 3M0SA 3UQSA 3GYGA 4LUBA 2H5EA 3HZEA 3G1JA 1X6GA 5A8WB 2UUTA 2ACMA 1U1SA 2DTIA 1O6XA 4IUTA 2MHEA 3W8PA 1Q53A 2CPIA 5LM7E 4LDXA 4M75C 4CLSA 2E3IA 1LQ9A 1CJTA 1TKTB 3QJLA 3CJKB 2P4TA 4J6YA 3J7YU 2XI2A 3GP9A 3PYDA 2GNKA 4AL5A 1AWJA 1VQ5A 1IN0A 3OSPA 1X9SA 2G1DA 1S59A 4BBYA 4PJJA 4JV2A 3TVYA 4G1QA 1X0PA 1U48A 3URGA 1Q8KA 1KP6A 2OD6A 3RAQA 1VRUA 1E7OA 2XDBA 3S7RA 1R7IA 4HCKA 1YDLA 3MAQA 2YX4A 1QLNA 2CYZB 2WVEA 3POTA 4GKJJ 2Z30B 5IWAJ 1SH3A 5AYFA 1Q82R 3VAIA 1L3UA 3L2WA 1IKYB 2VYTA 3M4GA 1ZETA 2VQEF 3DGPA 4LF7J 4DQ2A 1N32J 1MN7A 3VALA 4PYAA 5DRKA 1YHQT 3DLGB 2AZ1A 5IT9E 2DF6A 1KFZA 3CXCP 1SKWA 3CCZA 1W4SA 3QPIA 4M94A 3BW1A 1YVFA 1JO8A 1QLYA 2MZTA 3B82A 2E10A 1G7CB 2H8HA 4WU3A 2KDSA 2R7TA 2DR5A 1XMBA 1KQFB 3PJXA 3HFOA 2FVCA 4U7UD 2MKJA 4DS5A 2JMCA 3NNHA 4DPUA 3WDOA 2V1QA 4X65J 5J1NA 4UZBA 1B4SA 1DJ0A 1YITA 1PYSB 4PCQA 4C98A 1V29B 1SI9A 2DPJA 5I42B 2A3JA 2CA9A 4KKOB 5HO4A 5AXKA 1U6ZA 2ZJPQ 4NEYA 3CPWA 2I5JB 1D0XA 2ATCB 3LP1B 4NLSA 2E7VA 2JEJA 1M1GA 2GVZB 3PYFA 3GPLA 1MHNA 1QTMA 3LW5C 4ZLJA 3JS9A 5GAMf 4NXMF 4ETXA 2DA9A 3V8KA 3FFIB 3PHTA 1X75C 4ECXA 5CYQB 4FU6A 1K44A 4OMQA 1QVGR 2DXDA 1UB4A 1TK0A 4A8WA 4XPCA 3VUBA 4XU3A 2RJFA 3OYIA 4CTAB 3L2ZA 4DCPB 3GLXA 4QW2A 2DNNA 1WF0A 5DDOC 3U02A 4M5HA 4IR9A 3B4DA 3KJQB 1TUVA 4LSLB 4JI8F 1GFWB 1DQAA 3FJPA 3L7UA 4BE0A 2QEXT 5D4OA 4ELYC 4HCCA 1ZHIA 2CUYA 1JU5C 1VYUA 2ED1A 3C14B 3FKBA 3R5AA 2YXYA 1DARA 3BDEA 2ZJRQ 3LP2B 1OX9A 3TOQA 1DLOA 2ZOFA 3BQ1A 4FKYA 5JXSA 1JNZB 4E8UA 3ASKA 1X5OA 3CMAS 2W01A 3M0RA 5HVGA 4RW6A 4G65A 3D66A 4F02A 4W4MA 5GAGU 2OGUA 2A2CA 3MZIA 4RR5A 4FDFA 3CCVQ 3D0HE 4LBHA 2QA4S 5ETVA 4P71A 4IG3A 5C25B 4M1KA 1EP4B 2V26A 2R8IA 5GAOp 1RACB 2ZH1A 2HHWA 2W4CA 4CH0S 1VQYA 4WJBA 5E3CA 3M32B 3HVAA 4R5PB 4C8QD 1Z2LA 3CC7A 1WC3A 3KK2B 3JCMg 2G3RA 3K17A 4X62J 3VGSA 1IO6A 1FJGJ 1JIHA 3OTCA 1O5JA 3NPFA 1F5AA 1SBRA 5KFTA 1CLFA 2GIRA 5KT4A 3PYEA 3BH6B 5K9FA 1ZSGA 2XM3A 3VS2A 3EMTA 4NX9A 3INZA 3AAWB 2GVDB 2XTJP 3HX9A 2XCAA 1KQ1A 1WF1A 4NA3A 2MQOA 5DG7A 1FMKA 4MFBB 2UXCF 4X65F 3QBCA 2ZH8A 4Y65A 2MI6A 3WBZA 5GANj 3C15B 2ZBQA 4E7LA 1YTYA 2EG1A 2AYBA 2QEXQ 4RW6B 3TZWA 2CPFA 3A3NB 3KUGA 4M77A 1CJUB 1SL1A 1GTHA 4C11A 3PKMA 2HQXA 2C2RA 3OS1A 2WHOA 4DR5F 3H40A 1AWWA 2FPHX 1M5PC 4DQPA 3G6EQ 5L9XA 5GJWB 2KMTA 4RTUA 1U1RA 1H7XA 3EG9A 4FF2A 4M78B 1VQPT 5IT9U 5B0FA 3I4HX 5CK9A 2NXJA 2HMIA 3CCVT 3BO4A 3I55S 2VL1A 2NPFA 4AT1B 3RUXA 2IYGA 3EH2A 2DGSA 2B7CB 3QO9A 2E1HA 1NSKL 2HHVA 2PVDB 1K9MR 2CP0A 1SH0A 2Q3PA 1H74A 2MLYA 4QQGA 2AT1B 2UXDF 2KJWA 3VGVA 5GMKe 3BF4A 2EBEA 4PJOF 1JJ2S 3IRWP 3N01A 2GHWA 1UHCA 4QVCA 2ZZMA 1TR0A 1ZUYA 2DO4A 1OYDA 3MM5B 3M9MB 4FXDA 2HNZB 2HVIA 1W6XA 3BS9A 3TEEA 4WBFA 5E2QA 5FDLA 4OI1A 4EBDA 3IGNA 5KFIA 1U26A 3MEUA 3OR2A 2OPSA 5D3GA 4M5NA 5A0LA 1T05B 1RHQB 2EFOA 3FEYB 2VIHA 4ED2A 3OS0A 3RMQA 5GAMh 2UZAA 5G0RA 4F8RA 4DV5F 3E8OA 3OYHA 3JCMd 4NE9C 3FSYA 4N4IA 1GCQC 1U6BA 1GXUA 4ILLA 4UTGA 2BKPA 1QVGP 3IAM9 2OFHX 2VC8A 1YWOA 2W9CB 4IDKA 3V6DB 1G3YA 2DL3A 5ADZA 1BC6A 3EDRB 4PXBA 1HPZA 4DCOB 3HHTB 1PIEA 1QAJA 1UEKA 4Q8EA 3QAEA 3SDEA 3WZ0A 2FHKA 4OP0A 5MAOA 1LVKA 1WQ7A 3QHSA 3VU3C 4UUWA 4XAKA 1XJWB 5KTQA 3FLGA 1JLBB 1VQOS 3H5XA 4ZVRB 1UVNA 1VQ5S 3VS1A 4O3SA 1YIJS 1CBKA 1ZM2A 1HNWF 4B3OB 3I55Q 3V7RA 1EKRA 3T5LA 1U1KA 2VJUA 3OYJA 3UNGC 5C0MA 4LF2A 1TKZB 2BKOA 1VLYA 3ZTPA 3R6GB 1Q16B 2DXEA 3ISNC 4E7HA 1K8AC 1DQ9A 3OYYA 1G3WA 4XDDA 3PHEA 1QAYA 2BM1A 2C2OB 3FQKA 4BC7A 2ZDPA 1LFPA 3H8YA 3GIKA 4DV3J 2CG8A 3TO8A 2AZ3A 4ZN1A 4K4SA 2DHGA 3CPWS 3R97A 3D6HB 1RI9A 3Q2TC 2MY8A 2X1BA 4BDPA 2PNIA 4P5NA 2GJIA 1B34B 4OI3A 3R5BA 1WHMA 2HQEA 2M51A 4QQBA 2UXDJ 4PFPA 4WP9A 2DJQA 3NLCA 1HQEA 3KLIA 3PJ9A 4NLRA 1V3ZA 2NXCA 4X4UA 4MK8A 2VPZB 2QQRA 1E6VA 5CHCB 2HHHJ 4C8LA 2PO4A 4ZVEA 3DU5A 1HBNA 4U67Q 4QWCA 4FW2A 1A9NB 4ZGDB 1ZYQA 3OFGA 1VQ9S 2FJAB 4Q44A 2D8HA 1Q81C 1KHIA 4EFAC 4KGMA 4O3RA 3A8KA 2JL9A 2LXFA 4Y3CA 1LKZA 4KIAA 2FRWA 2RHSB 5LJ3f 3R8YA 1RAHB 3PT9A 3CCJT 3EGWB 3MI7X 3SWNB 3EGNA 4ECRA 4AL6A 1BCOA 4O4GB 3G96A 2NXEA 4A8KA 2L08A 4UT4A 5AXLA 3DRSB 2MKSA 2N4DA 1UEBA 2QI2A 1XNIA 5A8RA 1WKKA 3T1HF 5IOLA 5CQGA 1YJWS 4CC3A 2LQJA 4IG0B 2DR8A 4Z8AA 3DN9A 4FZVA 4JI4F 4HVWA 3DDKA 4DDFA 2KT2A 3C15A 2WTFA 2KXDA 1HWUA 1UZDA 1MLAA 5EN1A 1T7PA 2QYZA 2RQ4A 4M78F 1TELA 3MM9B 2QC3A 4C0DC 1KK7A 3VRZA 3X26B 3VV0A 1M9SA 3SD4A 2D74B 3C12A 1JLEB 4DV0J 3CJ2A 1FX4A 1EX8A 3DRPA 1IBMF 2QX0A 4DA4A 5KFWA 1P1LA 4ZP8A 1ZQ1A 3UDCA 5AJ3F 2UV8G 2KRMA 3DKDA 3J81E 2DH8A 3QLHB 2D3OR 5KG7A 3PW0A 5D0HA 4B9SA 1V5IB 4EU0A 2CZVC 2DT9A 2ZZDA 1N4LA 2CUBA 1NK7A 2RHQB 3DMJB 3OPKA 4IO9Q 1NB7A 4YMEA 2M70A 2SXLA 3OS5A 4USIA 3NTKA 2BANA 1KSWA 4U95A 3R7BB 1RHKB 4LREA 2XZTB 1PJ7A 1QVFS 3BSCA 2MDAA 2W2PP 4XU1A 4GC7A 1RI7A 2MZSA 2DKGA 4HH1A 5D6WA 1SB6A 1VQNT 1NJIC 3RR8A 3CO9A 2RJCA 2KGTA 1R0CB 2YH0A 4FPRA 2MWPA 3ZZ0A 2EBPA 1N34J 4OX9F 3QWUA 5FIIA 3FZBA 4FNHA 3GR0A 3V7CA 4FIBA 2E44A 3DGVA 4DF4A 2RHZA 4WFZA 3PFOA 2C42A 3BSAA 4BACA 3R27A 3MDFA 1RT6A 3KLHB 1C1BA 2XI3A 4ZN3A 2E7XA 5HVHA 5A8KB 2DTOA 2LQWA 2JUFA 2HQCA 3QLHA 2DL8A 5LJ5g 3QT8A 1WKLA 4M77F 2OMOA 1UGSB 4CNYA 3I56Q 2ZC3A 2AP6A 3I9QA 2DNKA 4I4BA 2RQRA 3I9V9 2WSEC 3VGUA 1XNQJ 3FJ5A 3PMTA 3VAJA 4OJ1A 2VPWB 5D77A 3MP6A 2F40A 3PX6A 1XMOJ 4GKKF 1ZBJA 1VQ6T 4YB5A 3ZTSA 1ZSZA 2BQRA 1U02A 5BYQA 2OTJS 1NB2A 3BE3A 3GSIA 1HBNB 3MF5A 3EFSA 1QSLA 4F0KA 4PWUA 2X4XA 2HQGA 1UFFA 2WW8A 4DHVA 1AUDA 2Q43A 3M32A 4DR3J 4C48A 2PMZD 2DD5A 2XWXA 3BQ0A 1B70B 2A7YA 2XMTA 2DERA 5E3PA 4B3RJ 3HSZA 2Z0WA 5GADU 1HNIA 4J9GA 1NJYA 3V5RA 1SQFA 5JMNA 1REVA 3Q22A 1I0CA 3UO0A 2KT3A 4AXJA 3CMEA 3CCMT 3QZ8A 2F4VF 3RB3A 5IH2A 1PG5B 4LRBA 4K11A 1NH7A 2XY7A 1T0HA 4KV8B 3BBCA 3LGHA 4O23A 4B9VA 3UWTA 1HW9A 3TZYA 3VTIA 4GMKA 2W7PA 2LT4A 3P6YC 4J9FA 2BBEA 1MUZA 1F5CA 1SKSA 1NBEB 2H1YA 5D6YA 1JXMA 2EI5A 2HAXA 3E9FA 1S7HA 3D6FB 4LD6A 2QSFA 1YZ7A 4FXWA 1AA1B 2P6TA 3ME9A 1LFWA 1RWMB 5CXTA 1I3OB 3CC2Q 2R5MA 4NZ0A 1B7FA 3MO8A 3QG1A 4RMOA 3TJ8A 4DG1A 2OJ2A 1SC1B 4JJNK 4JV5J 3ZZPA 5HMYA 4X4PA 3M2UB 4TY8B 4X4RA 3K57A 1RT5A 2ZH4A 1IBMJ 4M75F 1UVLA 1YP5A 1RBOB 3VUZA 2V94A 4AQYF 4U7UK 2MSSA 2VG5A 1WTFA 3EHQA 1GXTA 1J2VA 1EETB 2QTXA 4KGZB 4OB2B 1GMWA 4OV1A 3QWXX 2HL3A 1JMTA 3HHLB 1R8BA 1HYSA 3LGNA 2BZXA 1RT7A 3SCKE 3V8LA 3AH6A 1JLCA 5ETMA 2M8HA 3WX8A 1WJRA 1G2EA 3CGIA 3R7NB 2HEQA 5ETQA 2F65A 2RI5A 1N5QA 4LF9J 2PE8A 4A4HA 2ZH3A 3S01A 4ECTA 1VGYA 2GQIA 4ZNXA 4PFZA 4QCLA 2ERRA 2OPRA 1WXTA 4NYOA 3KLGB 2WSFE 4ZPWR 4JLGA 3CC7Q 3ISND 3CJQA 2P8IA 2BUNA 2DIUA 4KHPF 1BHNA 3QGPA 3RERA 1A7GE 5G4DA 1PSDA 2KG0A 1J5EF 2R42A 3UD3P 3QIIA 2CZ7B 1W26A 1TU0B 2CJAA 2K1RA 3NCRA 4IFVB 3Q8RB 2B0GA 2BIVA 2COWA 2IPOB 1TV6A 2COZA 1KS2A 3N5BB 2M9KA 4LF7F 4URQU 4G1IA 4FVCA 1D8YA 1C6VX 3NFCA 2K7JA 3NTIA 3CPWP 1KVJA 1VIXA 2O4XA 4LF6F 1URRA 1CEZA 4N7TA 2RKIB 1NDKA 1N5TA 5KFYA 2JOQA 5GAHU 1IKWB 2DGWA 2IMWP 4USKA 1FERA 4DSIA 1FK9A 3EFOA 2BJDA 2C2EA 3MMAA 5M2UA 4NOYA 2Y8WA 2NUZA 2XC9A 3D9BA 3PG9A 4F4XA 3EE3A 2EC2A 1NNDA 2OX7A 1VYVA 3EFRA 5GAMj 4P75A 2VASA 2O67A 2FL7A 1IHVA 3CNQP 5IS2A 4CLZA 2HS4A 2WOMA 3X1LB 2G0IA 2FHMA 3EUNA 4A46A 4R8UA 1QVFA 4F7VA 4XU2A 3OL9A 2EVRA 3M8SA 1FJGF 2XYHB 4H4OA 3NHNA 2GTJA 4F26A 4C3MA 3KXTA 1S1WA 3DCAA 2RH3A 2V68A 4EZ9A 3ETOA 2JDJA 1O9SA 3CDBA 2QQSA 3AA8A 1M1KT 2E6NA 4DFPA 3R5GA 4J6WA 4M78D 2PDAA 3J81j 4LRAA 2LYVA 1SC3B 3D3BJ 2L2PA 1F3FA 1FO1A 4A8OA 2VDIA 2EQUA 4WF2A 2K57A 1WEYA 1I1JA 1VQ6S 1VQ5T 2CJ9A 3OSSC 5GANd 2LP4A 1S4EA 3IBFB 5KFJA 3NGSA 3SCLE 2C2NA 5CD4A 5KT7A 3V6JA 2UU9J 3CCQT 1XK8A 8ATCB 4KGVB 4JI2J 3CCRS 3AFGA 1TMJA 5LL6d 4ZK7M 2EFPA 2PC6A 1WKJA 3M56A 1K47A 3DLBA 2DHSA 1R43A 3T9ZA 1FX2A 2I9SA 3CXCR 1NJZA 3W62A 2FJXA 4K50A 3MJXA 2LNVA 3NGPA 2HBPA 3Q8UA 2IBOA 1JJ4A 3DRSA 2KH9A 3PZPA 4OB3B 1VCTA 2WB4A 3V6HA 3AJ1A 2JRSA 1PSFA 1T0TV 1S72T 1WNEA 4C97A 3QJPA 1YG0A 4RW4A 4WFXA 4RW8B 3Q8QB 2CIMA 2E5LF 2BTTA 5DO2A 5C2GA 5K8PA 3EG3A 1KC8U 4PXEA 4U6PA 2LJ1A 2ZKTA 1S10A 4EMKC 4ZLNA 2NR0A 2U2FA 2ZITA 2K7AA 5GAGI 1M1KR 2DEUA 1FD2A 4C0OC 3LH5A 4X64F 2CJBA 1JKHA 3GJQB 4RCCA 4UOHA 4RU9A 2LMIA 4DV2J 4ESRA 2DITA 3ILJA 2YKNB 4Y6IA 1IKYA 2CJKA 4L74A 3FNNA 1TFYA 2HBRB 4DFJA 1PYTA 2GIFA 1RWVB 2FHDA 1OU9A 4HL9A 3CD0A 4F2RA 3EH1A 1JJCB 5JUMA 3C16A 2XMMA 1R3NA 1VDHA 1VQ5Q 3CD5A 3JV3A 3HT0A 2NUTA 2DYBA 1RXOB 2QL9B 1YIJQ 2DLPA 5ETPA 1S1XA 4ZDNA 2CNKB 4LFCJ 3C19A 5K20B 4EYHB 1X4CA 5K14B 2EXUA 2YNIA 3HFZB 1IGQA 5T41A 1J5OB 1QVGA 2CP5A 3TSWA 3DRRB 3CJKA 3CCUQ 1RA7A 2E4HA 4M7AG 1F60B 3E01B 1WUUA 2BW7A 2YRVA 2BKDN 3I4PA 1XERA 4ES2A 4ES3A 2PGCA 3UE2A 2YT6A 4EMKB 5IT9Y 5F8MA 4PWDA 3RKYA 1WD6A