4ZN1A

Crystal structure of mjspt4:spt5 complex conformation a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
138
Chain Sequence
b'MIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTPENIEKGDVVEIIAPFKGERAKVIRVDKHKEEVTLELENAPIPITLPVEGVKIVSKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor Spt5
publication title Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Transcription
total genus 25
structure length 138
sequence length 145
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zn1A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 4zn1A01
1UEBA 1QVFS 1YJ9A 2JOYA 1K8AC 1IZ6A 3J81E 1VQLT 2OTJT 1NZ8A 5DLQE 3PIOA 3CPWA 3CC4A 2E6ZA 1YITT 3OW2S 3EWGA 2MI6A 2QA4T 3HKSA 1VQ7A 1VQ8A 1RL2A 2KDSA 5LL6S 3CCQT 1VQKA 1YIJT 3J80E 1VQ5A 1XTDA 3CXCA 1VQPA 2QEXA 1Q86U 1NJIU 3CCLT 1SSFA 1K9MU 1QVGS 3G6EA 3CC2T 2G3RA 1VQNA 1YJNA 2OTLT 4ZN3A 3I56A 2DO3A 3G71A 1M1GA 2KVQG 1VQ9A 5HY6A 1M1HA 4X34A 1KC8U 1Q7YC 2E70A 1VQ6T 1NPPA 3CMAA 1M1KU 4TVRA 2JVVA 2QA4A 1YJWT 3DB3A 3CCSA 2LVMA 3CPWS 1XNIA 2XHCA 1M90U 4ZN1A 3PIPA 1Q81U 3CCJT 3CCMT 2IG0A 3CCUT 1VQMT 1VQOT 1W2BS 2MWPA 3G4ST 1VQ4T 3CPFA 1KQSA 3CMEA 3CD6A 1KD1U 1JJ2A 1NJIC 1QVFA 1K8AU 2OTLA 3CCET 2K06A 3OYYA 1YHQT 3DB4A 3CCVT 5A2QE 5FLXE 3OW2A 3QQCD 1YI2T 3CCJA 3CC7T 2LCLA 1YJ9T 2OUGA 4CRIA 1BKBA 1JJ2S 1VQLA 2OTJA 1Q82C 3CC4T 1N8RC 1YITA 1KD1C 3H7HB 4RG2A 2MWOA 1VQ7T 1NPRA 1KC8C 5J26A 2EXUA 3CCRT 1S72T 1VQKT 3P8BB 1KHIA 3CCQA 1YIJA 3CCMA 1VQ5T 1M1KC 3A5ZB 3G4SA 1NZ9A 3CCLA 3DLLA 2LQ8A 1K73U 3I55T 3G6ET 1EIFA 3CC2A 3CCEA 1YJNT 3CXCS 5J3BA 1Q86C 3I56T 1Q7YU 3CCVA 5IAYA 1KQSS 1K9MC 1VQ9T 3J7AF 3KBGA 3CC7A 2JNGA 3LGFA 3LGLA 2CKKA 5DM7R 1YBYA 3CMAT 1VQ6A 1W2BA 3TREA 1YJWA 3CCST 1X6OA 3CCRA 1S72A 1VQ8T 2JUFA 1QVGA 4YTLA 3LH0A 1VQPT 2QEXT 3CCUA 2EIFA 1VQOA 1VQMA 3JAME 3I55A 1VQ4A 3CMET 3CD6T 3ER0A 1M90C 1Q81C 5IT9E 1VQNT 1Q82U 1YHQA 1K73C 1N8RU 3G71T 3LPEA 4QQDA 2L3RA 1YI2A
chains in the Genus database with same CATH superfamily
5DLFA 3M8WA 4DSIA 3PIOA 4BHQA 3R8YA 2FPFA 1OY6A 2AEJA 2HAFA 5L39A 1VQ8A 1H3DA 3N4WA 3A1YG 1S0VA 2RHZA 1OX8A 2HHXA 3GOXA 5RUBA 3V4MA 1U1LA 3BS9A 3RMSA 4WP8A 4F4XA 4F8RA 1GRIA 2D8JA 1PD0A 4TU9A 3KFVA 2RNAA 1VIOA 1T95A 5GMDA 2LRQA 3R5DA 3CT9A 1MV0B 4LD6A 3DXSX 2XG8A 1YK9A 4ECQA 3UF4A 3MP8A 2RQVA 3FUYA 3OL9A 2PEHA 4CO5A 1Q86R 3L2RA 4BB7A 1AFJA 1J5OB 4FVCA 3OSVA 2RQKA 3DRPB 1WEXA 4C8NA 2QAZA 3WVEB 4N5SA 1RT1B 2XO7A 2FG0A 1Q7YU 1SI9A 2R7RA 2OX7A 4ECYA 3FBFA 2DCUB 2PQWA 2GAGC 3JSMA 2OPPA 4DCPB 1VHIA 2W7AA 4C0DC 3Q8PB 2H65B 4E7HA 2E7XA 1UE9A 2B51A 2M8DB 5D6YA 4ZP8A 3RBXA 4OYXA 1RTZA 2ROTA 3TUJC 4LUDA 3JCMJ 2FL7A 1VK8A 4CLLA 1Q8IA 2NLUA 1NNDA 3KHHA 4C8KA 4FW2A 2KDSA 4AQYJ 3Q83A 1JK9B 2L9WA 5ETOA 3A3PB 3H0FA 3CDBA 4PR6A 5GAN2 3M0RA 3QIDA 3EVMA 2WSEC 5M2PA 3CCES 4JPBW 4P71A 2P0PA 1C0TB 2RHUA 2ZE2A 2Y1IA 1QSLA 4DUZF 1M5OC 2YX7A 2MWPA 3SDZA 3AD7C 2V9WA 3GIJA 1RDRA 2DIVA 1BQNA 2JZ5A 1VQ4S 4AL5A 3L4BC 2CQHA 4DV4F 4K4YA 3RB0A 2FHMA 2C2RA 3R5BA 1RE1B 3AODA 4C9DA 2CPXA 3GSIA 1SIZA 1GXTA 4M7DB 2YUQA 2AJ2A 2CQGA 3OW2R 1H2VZ 1S7IA 5DLGA 4ZNXA 2C1EB 2F4VJ 4NLTA 3U27A 4L75A 4XTYA 4KY3A 3RAMA 4CNYA 1S9FA 4RTVA 4HCCA 4E6RA 3KLGA 3M55A 1TVRA 2LZ6B 4C97A 2O3DA 1ZSZC 4A46A 1RA7A 1B34A 3M6WA 5T7LA 4NLPA 5LMUJ 3MCMA 2NZCA 2HQHA 4F14A 3CTRA 4NPOA 4FT4A 2Z2ZA 1VUBA 4ECSA 1Y0MA 4ME7A 1YQHA 3PW5A 1DTTB 5MLCV 1RBOB 4OMNA 4ELTA 3MEDA 1R8PA 2DJWA 1Q86U 2G2YA 2KXHA 2A28A 2CJBA 5KFPA 1TL4A 1VQOS 1EZZB 3CMEQ 3PO5A 1CLFA 1HA1A 2IMWP 4F4KA 3MM5A 1WHXA 3DCAA 4DV2F 3DB3A 3HPWA 3EX7B 3TVTA 1TMMA 1VQ6S 4FPRA 2LC4A 2ZPEB 3RYLA 4CT9A 2YKAA 2X7IA 1X9SA 1WG1A 4QIWD 4ED2A 4F04B 2V6AA 2UUCF 4ZPDA 2RE1A 2HGMA 3DLEA 1ZOTA 7AT1B 1JJ2P 4F4AA 1K9MR 2H8HA 3MFHA 3JAMY 2D1XA 1D3BA 5GMKa 3WDOA 4ZPBA 5KG7A 1IKWB 3P96A 4R55A 4YUDA 4JS4A 5KE2A 2Q66A 2F9JA 5AJ3F 3PFEA 5GAGI 3KBGA 2QLBB 3N0VA 3I32A 1KD1R 3NMZC 4E7JA 4WIIA 1K8AR 2DYAA 3FNNA 1UDLA 4I56A 1CJKA 1LVKA 4IIOA 1D9AA 1GNKA 1X43A 1QAYA 3G6XA 1OYEA 1UGSB 2MCNA 1RWKB 4ZVGA 4EMHA 2I1RA 2GQIA 4B3MF 1YHQA 2ZH9A 4ED3A 4Z8AA 1YLXA 2CPZA 2YNGB 3J81E 3BYRA 5D3GB 2EBEA 2IC3B 1HNVA 3ONQA 1Q5VA 4PJOG 3EXYA 1JRIA 2QSFA 2FJXA 5IM0A 4A54A 2RU9A 2VD3A 3X20B 2KO1A 3U02A 3T6BA 4LF7J 2FZGB 1EETB 2GNCA 1NSPA 1PKUA 4ICLB 3IC1A 3HZEA 1N36J 4NYZA 3IMQJ 1XNRJ 1HNZF 3C15B 5L1IA 2XMAA 5KT5A 1K73T 4DQPA 2IBOA 1BUXA 5B0BA 3H9NA 4YR3A 2ACYA 4NLDA 1QUVA 4LFAF 5DQGA 5HAOA 5IZHA 3VAGA 2MWOA 2A18A 4JYAJ 1UGPB 4DS5A 3UD5A 2HVHA 1B3QA 7FD1A 3OYAA 2ABYA 3OQ5A 1U06A 1ZA1B 1F1BB 5A8WB 5C24B 2MIOA 1P1LA 5D6XA 3HVAA 3I55Q 4PKCC 4M7DG 3MI7X 2GW8A 1KTVA 2IVYA 3O6QA 1RI0A 3OYFA 3GNGA 2ZH6A 4ZJOA 5JMNA 4QQ6A 4U7CA 4XDDA 1OYDA 4J9UE 1PKSA 1VQ8T 5LJ5h 2D74B 2KVIA 3KDNA 1W2BP 1QAJA 2LP4A 2DNOA 2BV3A 3BKTA 3MZIA 2MLZA 3KTQA 2QO3A 2I8EA 2PI4A 1J5OA 3CE8A 2XCAA 3DRPA 3VYHB 3BF4A 3WHIA 4F3QA 4W92B 1U1OA 3K5LA 5DY9A 3NL0A 1RT1A 2AZ3A 4QOTA 2Y0BB 1HNIB 1K9MU 4ILMA 4O3OA 3QHSA 2DIUA 3VZIA 1RWNB 3BB5A 1N48A 4DV0J 4A4KA 2A0FB 2Y9HA 1M2VB 1M1HA 2JVOA 2GO8A 5L46A 2WW8A 1FA0A 1T02A 1U6FA 1UVKA 4LQ9A 1Q8KA 1WXBA 1MNDA 1K47A 3BE3A 5I2SA 1KD1U 3GONA 1K8AU 3KHGA 1FE0A 3RKWA 5DDQC 4OMOA 3OW2A 2ROGA 2MXYA 1Y5IB 2A3JA 4M7AF 1M8MA 3KG4A 1FRLA 3HHTB 1BWVA 3BDEA 1RAGB 2N4DA 3G6ET 3Q8SB 2W7OA 2A1BA 1RUSA 2XGPA 2VPYB 1OU9A 3GV8B 1C0TA 1QVGR 2EFQA 3CNQP 3IBFB 3D6MB 3CMAT 2DFUA 2DVEA 3PTAA 3FIFA 4W4MA 2UUBJ 2KYMA 1FRXA 3R6OA 1M5VC 1T03B 4DBHA 1DRZA 3R27A 4X66J 1T0JA 4C3MA 2RHYA 3B4DA 2PE8A 5KFNA 4KRWA 2JM9A 2OIHA 4M7DA 3FJ2A 1WHMA 1K4US 2YUPA 3M4YA 1PYSB 5AE3A 3BBBA 3A8MB 2RK2A 3MM8B 2R8IA 2AEFA 4FXVA 4OX9F 1IBLF 2OJ2A 5LJ3e 4LF5J 2PU9B 3GFHA 3CD6Q 3DHWC 2B8QA 3FSYA 2I6WA 3OD2A 2I38A 1HFEL 3AJDA 2B3TB 4P2XA 5KFMA 2QLJB 2KXNB 4RU2A 2VPXB 1N0UA 1PCAA 5F9LA 2HCKA 2HVDA 2DNZA 5KG2A 4AG2C 2BR0A 3PY8A 3IN5A 1DTTA 5LJ3f 3W61A 1M9SA 1MMNA 2K6DA 4ZIWA 1Y5LB 2I0XA 4DR5F 3GYNA 4FDFA 2ZAEA 2KT5A 2GS8A 2HBQB 3ZXWA 4HVVA 2WSCE 5HMZA 2C2NA 3K7RA 1M0SA 2VC8A 5FLXU 4QJVA 2OI3A 2VVKA 3X25B 3CC2A 1Q7YT 2J0SD 5GJVB 5KT2A 2QA2A 1XR5A 4DF4A 3CC7A 4ENOA 4DN9A 3MM6B 2ROEA 1TAQA 1OQ6A 4YFUA 3GJQB 2XKOC 3IR6B 1VQ9S 4K4VA 2YPZA 4C92E 4M5JA 4JI1J 3J7AN 3C3LA 3EGWB 2V50A 2B9WA 3MO8A 3FEOA 3FSXA 4FF4A 1WC3A 5CABA 2OD4A 3EG9B 4KJIA 1FMVA 3A8LB 2DGUA 3PKYA 3VVUA 3A8EA 1T11A 4YB7A 1FF2A 3R1LA 4DV3J 2KG1A 3HKSA 1IKWA 5GMKl 1RHRB 3SSSA 4L3NA 2HMIB 1HR0F 4EBCA 1JXMA 2QYCA 1P92A 2D7SA 5F8MA 2BIVA 1R8HA 4F7UF 1OIAA 3DRXA 2JVVA 5L9XA 2MQLA 3EFOB 2H4YB 5B0FA 2VWFA 1TH7A 3KLFB 2E1CA 2NWMA 3M6XA 1GT8A 2JTEA 1EAYC 2YNGA 5D3GA 2IC3A 4DXLA 3QFWA 2UV8G 3VAJA 1EKRA 4M75C 4LFCF 2JH3A 1OPIA 1SHGA 2EYWA 3QZ8A 1N8RC 4XO0A 2NUHA 5L38A 3CC4S 4C8QF 3CCRQ 2J7WA 2QLWA 1H2UX 3R5AA 1EETA 3CJ3A 1R6VA 4DZ6A 2QFJA 1NBEB 4ICLA 1M5KC 1NDCA 2VUGA 1YDLA 3C15A 2JJ4D 5LSLA 3KUGA 1FKPB 1VBXA 2DO4A 1QUPA 2KNBB 1NEBA 2ZPHB 5LJ5Y 3I0RB 4ZHRB 4OGEA 2RMLA 3MCAB 1XMQF 3MWBA 3CCSS 1YP5A 2HQXA 2VFTA 1OPKA 1Z2LA 2KT1A 2KT3A 3TA2A 3FQKA 2VQFJ 2BZYA 1W6XA 1VA7A 1HXDA 1LOJA 3ZZYA 1P8GA 3MEAA 5A8WA 5DQHA 1WDTA 3A8HB 1YJRA 5C24A 1Q86T 2PDAA 1K76A 3R6LB 2IHR1 2KM8B 2AKWB 4RU9A 2OPRB 3AOAA 3CCLS 4BI8B 3EPIA 4DPOA 4EMKC 2PA8D 2LYVA 3EGVA 1URRA 4DU8A 2CNOB 2VFVA 4BC7A 3T1HF 2BZXA 3MMJA 3FQLA 1S72S 3QZ5B 4QWDA 4KH0B 2IJRA 4BY6B 3V6KA 3QPIA 1WZOA 4Q45A 3IGNA 1JLCB 9RUBA 3RNJA 1HNIA 4J9EA 3LP1B 1HQ2A 1QVFR 4JDSA 3R2CJ 1R43A 1AXQA 3QYYA 1YJNT 4CLSA 1WOPA 2VG6B 2WZ1A 4ALZA 2J0QD 4ETXA 1YI2Q 2CQCA 2UV8A 2HSPA 1LV5A 2WSFE 3UNGC 1J5EJ 2GIFA 4J9CA 3MPYA 5KFJA 2AGOA 3NGUA 4K4UA 4F67A 3QG1A 3AXMA 4RNMA 1UGVA 2ZPBB 1TKZB 1NM7A 2C3UA 3UDLA 2ZBCA 2WCXA 3DLJA 4EEYA 5GANh 2NR0A 3VAKA 2X1BA 4FP9A 1IQZA 3O5ZA 4DR6F 4O5VA 4FIBA 2AV5A 3H0PA 3JQMA 1MMLA 1PJ6A 4A4FA 2DHSA 4C0ZA 4X62F 4JI5F 3VRYA 3HHKA 2Z0WA 1VQNQ 1AEYA 5HVHA 1OU8A 4M78D 3CCJQ 3P5TL 4QR2A 3G6VA 2Y4XA 1T03A 3PTWA 2UXDF 3TOQA 3E9FA 3CIZA 1YJWS 1U2RA 5E33A 3CMEA 3MHYA 2BZ2A 3DOMB 4I2PB 4O3NA 2VKRA 4ZCIA 2I9SA 3OTBA 4ATNA 2XULA 3A3OB 2JM8A 1R8BA 3NCPA 1FO1A 1XEZA 5B0CA 3MM8A 2E64A 1X8DA 4RTYA 2AWZA 2GHVC 3CCMA 4A8FA 2ZCFB 2YBVA 3FCVA 1D1CA 1NSQA 3ZTPA 3I9ZA 5CIUA 2HL3A 5KFDA 2WW4A 5GAMj 3AJ1A 1F5CA 3J80Y 2KRRA 2HBYB 1WKLA 3DC2A 3P8DA 1X69A 2XMFA 5E7OB 4P72A 4JRKA 4L72B 3NOCA 2V1RA 1SKRA 3BQ1A 3CDWA 1NK7A 1O9SA 4PRFA 3SD4A 3I0SB 1KC8T 1MWQA 3CPWA 1OS5A 4KGMA 7FDRA 4RTUA 2OI2A 5L1LA 3NG8A 1RK8A 4MTPA 1K9MT 4J9VA 4NYPA 4DOVA 3CCQS 1D8ZA 4OHVA 2CQ4A 2E5QA 3MM6A 1D0YA 2W24A 3TQ7P 3CW2C 1B3TA 4TQSA 4MK7A 3N01A 1Q79A 4MIAA 1BXNA 3EG9A 3P4UB 5J2NB 1KONA 3QYHB 1K8AT 3BQ0A 2X35A 1GAOA 2JRSA 3CC7T 4HT8A 5IHNA 2KT8A 4ETZA 2HMIA 2JS0A 3E3XA 4B08A 3A5ZB 3AXKA 4YDXA 1FXDA 1RAHB 2IVWA 2ZBPA 5M2UA 4DR4J 4WK1A 2QQAA 3QYGB 3TZXA 2COLA 4OV6A 3EFOA 4LF9J 4A4HA 5DJBA 4KB7A 3KLFA 2B4UA 2QV6A 1VQ7Q 2BTTA 2IA6A 2HBRB 4MZPA 3I55A 5CH7B 2CZ0B 2MSTA 4I7FB 4MMKA 1U6ZA 2XI2A 1HW8A 1T3LA 4AG1C 2JLGA 3GNFB 4WFYA 4GKKJ 1RTJB 3RERA 4JLIA 2DJQA 5HK4A 5K9FA 2CG4A 3OBIA 1U2FA 2A2DA 2X4WA 1TK8A 4USKA 1SPKA 1AT1B 4LRBA 1PJ7A 2CGHA 1U0SA 1SL2A 2HVZA 5IQQA 4QVDA 5IV3A 4R0JA 2L89A 4GKJJ 3I0RA 4ZHRA 1BB9A 3CMQA 1UECA 4DSKA 1RXOB 2DPJA 2NXJA 3FRZA 2X1GA 1JLAB 3NFCA 4PXEA 1QVFA 3MCOA 3QBYA 2GV1A 2K3IA 1XQIA 4YHHJ 4PG4A 3L9ZA 2Z2LA 4OYAA 5GAN3 4HDHA 1JB0C 1KHIA 2OPRA 3GV7B 5IAYA 2D1CA 1Y0HA 2Y4YA 3JCMh 2CJ9A 2BKDN 1KFZA 3C95A 2J9DE 3WXMB 1VISA 4AL6A 2E10A 1E7OA 4C5GA 5DS7A 3QO9B 5K20B 2KN4A 3CD7A 3I87A 2E44A 1MMAA 4ECRA 1JLCA 2APOA 1TSFA 3D66A 2AEMA 4OVAA 2LQWA 3KUFA 4UTGA 3ENVA 5CD4A 3LP1A 4LSNB 4DL6A 1T8EA 3RBZA 1N5QA 3E9GA 4M77B 1F0XA 3JAMU 2D3OR 2ASJA 5I22A 4D8KA 3NGDA 4JJDA 4MKVA 1RP5A 1GXUA 5MAOA 1HNXJ 2VG6A 2HEKA 2B7CB 4M5DB 3PFOA 2GIRA 4KPYA 1TKDA 1Y7XA 2JT4A 1KIKA 4G65A 5CR2A 3OXGA 3WC2A 3VGSA 3A12A 2RM4A 2DEIA 2P9CA 3EGZA 5DZ7A 4CH1A 2HFOA 3V8JA 2CZ9A 1UFWA 1TS9A 4DX7A 3CCZA 1TKZA 2E9ZA 3CD6A 2CH4A 1G6BA 1S1NA 2DEQA 3V6DB 1CS4B 3TYTA 2A6MA 3AQPA 1FEEA 3C66A 4PJOC 3M2UB 2VHGA 4NWBA 3DKDA 4KAIA 3RB4A 2QGFB 2RMOA 2E5KA 3HKZD 1VQKT 1WELA 3CULA 2EFGA 1B4SA 4HEA9 2DAQA 3D0HE 1RCXB 5H1SV 2RD1A 2JL9A 5IS2A 1L3VA 3GYXB 3H2LA 2L8DA 3FMBA 2WONB 2P6SA 4ZP7A 3DOMA 4RKUE 4I2PA 1VJQA 1S9EB 1VQPQ 2QEXQ 2X3GA 4TLQA 2KB2A 1R0CB 4PNOA 2MAMA 2O66A 3H5SA 3WIVA 2KRSA 5IXBA 4WJBA 3DRYA 2YWHA 4NCAA 2F65A 3MR6A 3DLGB 4M7DC 4JI8F 1TK5A 2CYYA 1PGZA 5EX3A 3VS2A 3EG1A 1S6UA 1KFSA 3POTB 4PG8A 3Q23A 5KFBA 1H641 4X64J 3OA6A 3PYEA 2MZSA 1RKIA 5B0AA 1AHJB 4ZCKA 1REVB 2BQUA 2JOQA 2QXFA 1IM4A 3CCMT 3HSGA 1UVNA 2E5GA 1S77D 3CJSA 3I0SA 4G1PA 5EC7A 3BKFA 2R7SA 3DOKB 4OYBA 3PVXA 3PMTA 4K5SA 3UPFA 1PO6A 4Q5WA 4OB2B 4QQGA 2K3KA 4KULA 1BI1A 2DNLA 2X3XD 4A4JA 2RI5A 5GAN5 2CQ1A 2VQEJ 1ZETA 4CT8A 3QT8A 4IG0B 2DTJA 1KG1A 3MTKA 5E3QA 2DXTA 3AH6A 3NAIA 3OFHA 3I5SA 2VG5B 2V94A 1KBRA 5D4OA 4Y0FA 1U3OA 3CCUQ 4RW9B 2ADCA 3CCVA 3CMES 4GLKA 2CZ6B 4CZCA 4ZIVA 2PGCA 3VV0A 4RG8A 3CJ8A 2DHGA 3DLMA 4CLUA 2R2SA 4LQ3A 5J2NA 2CNKB 3CCRA 2PZ1A 3H8YA 2JUFA 3OYIA 4HHHA 3MECB 2FHJA 2MB0B 1X01A 3L95X 3JB9G 2DTIA 1SVDA 1D0XA 2RQMA 4WFZA 1TUGB 2SEMA 1X5PA 3SCKE 5K8MA 4QQDA 2DT9A 2MKHA 4M63A 2XBPA 3VVTA 3UWTA 2Y90A 2IAJB 1YIJT 1O51A 3AA9A 1QLYA 3PIPQ 3VALA 4M77G 2RH2A 5EWEA 3L7UA 3D1OA 4DEYA 2H1YA 3HHDA 2FY8A 1N32J 1R89A 2DR6A 3JCMP 4I7FA 3CPWS 2EGAA 2BYCA 1VQMT 2LCCA 2VG7B 1J3TA 2EQMA 5GAHI 5L1KA 1RTJA 4JI6F 2R42A 4G1QA 1HBOB 3WIUA 5DETA 4DUYJ 5K8PA 4RMOA 4IR1A 1WKKA 1G8XA 4YR2A 2Q79A 3S6WA 3I55T 3HRSA 1HKAA 3DRSB 1G3WA 3QIPB 5JUMA 3OS1A 4C8ZA 1L3SA 3RGIA 3DLHA 4IUVA 4ED8A 2CQ0A 2M51A 3D7SB 3RUXA 1M90C 2YUNA 3T5HA 3ZZUA 5BYSA 1HHSA 3HX9A 5GAN7 3FK4A 2L3RA 1YI2A 1UEBA 5CO7A 2RJZA 4KV8B 3EFRA 5C6SA 4USWA 1UVJA 1HL6A 3V7CA 4L74A 3I9QA 2DNPA 4IRDA 1VLOA 3S3MA 1RJJA 1SC1B 3OVBA 3MD1A 3FLGA 1SL0A 4XU0A 2FJVA 3OTOJ 4P75A 4Q8EA 4L59A 2HFNA 2UXCF 2ILYA 2CDRB 2E1PA 3M0SA 4DS4A 4XTTA 3W9HA 4NOHA 2H3JA 3KLIB 3QO9A 1RT3B 3QRQA 1YWXA 2R9LA 3RRGA 2K1RB 3OY9A 2AT1B 2HIQA 2VBYA 1RZMA 1KQSA 1FRIA 1FFGB 5KT7A 4LSNA 4KFBB 4K59A 4HACB 2ROPA 1WC4A 4C4WA 3QQCD 5KFYA 2NUTB 3CCJA 4M77A 3M2VA 1DAXA 1U6BA 2Z58B 2ZC4A 4II1A 1PC5A 4JI2F 3CJ2A 5CCLA 5IWAF 1YRXA 4M5DA 3REAB 1H3ZA 4K2JA 2ZZMA 3GIBA 3JXOA 1S5ZA 2CRLA 4UZBA 3DU6A 2RDDA 3HP6A 1NK9A 3GP8A 2HL5C 2FGOA 3C6TB 1E6VB 2QC3A 4TY9A 5D0GA 5CCAA 5LJ3j 1OX9A 3BFMA 1N4LA 3V6DA 4IQXA 5IT9Y 1CS4A 2OFHX 5KFSA 4JV5J 3KNAA 2GC8A 2R5AA 4GC7A 3M2UA 2HZCA 1HPZB 4B3SF 3FCWA 3GE9A 1TAUA 3JCMf 4LDVA 3Q89A 2FC8A 1RAEB 4ED6A 2C2EA 1V1CA 5B08A 4JZ3A 3VV2B 4L6V3 2OELA 3HKWA 3MEKA 3K0JA 2NYIA 2WONA 2HDAA 4NE9C 4ESRA 1WSVA 1HBMB 2RILA 5ETMA 1RT6B 3EE3A 1NPPA 3MEEA 1JKHA 5HCKA 2VXEA 1S9EA 3QT7A 1J2VA 4F02A 3FVYA 4HKQA 4J8OA 3ZC4A 1MWZA 1HD3A 1NDLA 1TFYA 4C5HA 1MU2B 2G9OA 5HO4A 3ZZPA 1OSCA 2RVJA 4GC6A 2KBTA 3DLGA 3QGPA 1OMSA 1WACA 3KK1B 1NRKA 1S1TB 2MMYA 3SXLA 3POTA 2HQGA 2HLTA 2KL8A 4ZTFA 3OSSC 5FRNA 1REVA 1C2PA 3MMBB 1OZ2A 2FO0A 2VJVA 1S57A 3QATA 2QYGA 3TEHB 2IRYA 3ZZOA 3VUZA 1LFPA 3BGFA 3VWSA 4JJNK 2J0WA 1AZSB 2RQUA 3KK3B 2XICA 4EDUA 2AHOB 3DOKA 3CMAS 4P7TA 5KFZA 3DRRB 2CG8A 3JCMW 1N5ZA 4Y00A 2ZOFA 3HMJG 4M78F 4O4GB 1CC7A 5BYRA 3M4GA 2V9KA 1G3YA 4HVWA 2LEAA 4YB6A 2CADA 4IG0A 4NA3A 2VG5A 3ZTSA 3HT0A 1KN6A 2K5LA 1VQ7A 4U8VA 3O2IA 1T9VA 4RW9A 1S1XA 1AFIA 1IKYB 2W10A 3MURP 4DV7F 5KOXA 1SJ4P 2C42A 3VQSA 3UWNA 2YH0A 4KT0E 2HAXA 1D8YA 4OX8A 5CYQB 4XK8C 3MECA 2HWTA 1U4BA 4LRCA 3UA6A 1HLWA 3B8HA 2MQOA 4F4WA 2HK3A 4DX6A 2NZ4A 3E1SA 5GMKm 1VC5A 3EM1A 2V2VA 3FMWA 4C8QE 3CCVT 3CBMA 4F0HA 2YUOA 4ZVHA 2P8IA 4MK8A 2IAJA 2RHXA 3MKDA 4CM0A 1CQMA 4K0KF 1PJ5A 3EPGA 4M8LA 4CC7A 3CCRT 4J91A 2HHHF 4EPCA 2VOOA 2EFIA 2H4WB 3EDRB 1BI3A 2CS7A 4U96A 5KAKA 2CP6A 2DGTA 1RTDB 2UUWA 2VKZG 4M5NA 4FKXA 4Q5VA 2VG7A 1X0PA 1VYUA 1I6JA 3M9OB 4NLQA 4Y28E 1S59A 4ED5A 3HSBA 3GLJA 4WYLA 1ICEB 2PMHA 1B07A 1UCNA 1HBOA 3I82A 1UZHA 3SCJE 5CKEA 1JJ2S 1YCYA 1KQFB 2V8VA 1E6YB 2MEWA 1UJ5A 1WJ9A 2OPQB 2Y8WA 2CJQA 1W25A 2M7SA 4L6V5 4C7QA 3DRSA 3R9LA 3QIPA 4WWSA 1CBKA 2DPIA 1VRUB 4DR3F 2IVMA 3OXLA 3CXCP 2XM3A 2K5IA 4QIFA 4LF6J 4ECUA 1TWBA 3BKUA 4DMZA 1XR6A 4C48A 2PEBA 4F2SA 4DQRA 4DL7A 4U8YA 1Z9ZA 1IQTA 2L5QA 2WVBA 2XCPA 3EZOA 3GTYX 2AYGA 2XZTB 3CCEQ 4KV8A 2YTCA 4WF9Q 1L5UA 4USTA 2BMBA 5D8HB 1B7FA 2MQNA 4RW4B 4WF2A 1NLKL 4F3OA 2Y1LB 2ZH8A 4M7AB 1I94F 2WVDA 1AROP 3HHNB 1M1KR 2EAYA 1VQ4Q 3KJNB 2KH9A 3KLIA 4UY85 1RT3A 1NJZA 2K1RA 2C28A 2K4YA 3MM9B 1X6OA 3BBCA 3CJ0A 3P8HA 4DR2F 4KFBA 3WZ0A 5FWBA 4HACA 2CP7A 9ATCB 2D9TA 2VA3A 2NUTA 3AD9C 1WI7A 5IT9E 3ET6B 4BY6C 2DISA 2VPZB 1U0HB 1SRLA 2R8HA 2W9CA 3P3DA 2L3SA 1SC6A 5DLQE 4XDCA 2R2RA 2P84A 3D9BA 1ZSZB 3Q2SC 1D1UA 2LT4A 1NDKA 1NJIU 1VQPA 1FMWA 2QEXA 2ZH2A 2YXLA 3DKMA 1UFFA 5KG6A 3C6TA 1E6VA 1KVJA 4N41A 3CJKB 2OEKA 2HRYA 4NXMJ 2VB6A 1UTAA 3EGNA 2E3IA 2KR3A 5KG3A 4N8NA 4YY3F 1W2BS 4LD9K 5B0DA 5F8GA 1HPZA 4NLRA 2RUGA 5E3RA 2P2CB 2RDJA 2XMWA 4IFVB 1AZEA 4J6XA 4IDKB 4HTIA 4MDWA 1Q82C 3M58A 1KVKA 1UVLA 1VQ6Q 1U1MA 3EG2A 3MPVA 3AA8A 3TUPA 3AT1B 4LF4F 4RPFA 1HBMA 1C0UB 3JQJA 3KNGA 4Z7CA 1KQSS 1RT6A 2OFGX 4KQZA 4DLEA 4DG1B 1LWCB 1VQNS 1YJNS 3EZUA 1I5OB 2UU9F 3JCMb 2GO9A 4OZNA 4OI2A 1W4SA 3IAM9 3UATA 4ANDA 3BPSP 2AIRB 2BKPA 2CPDA 3LH0A 1HNWF 1Q95G 3CCUA 2FVPA 1MU2A 3EICA 3LP0B 1YBUA 3TA0A 2EBPA 4YR0A 3Q8QB 3KK1A 2JS2A 1S1TA 3WX8A 4E98A 1BI2A 2CIMA 3SFMA 2HQFA 2IM3A 3OR2B 1EQMA 2HG4A 4OF1A 1BI0A 4EBDA 3MMBA 3BGLA 5AE1A 4DZDA 2ZNZA 5ETQA 4UY8T 2K79A 3A3NB 1KWMA 1AZSA 3ME9A 3KK3A 3RESA 4Q7AA 1M1KU 1LPLA 3DRRA 2V4QA 2PA3A 3PIPA 4O4GA 1WPYA 4F7UB 4IH5A 1NO8A 2PVOB 3MUVP 2QA4Q 3H20A 3HRUA 1UKUA 3BH6B 1SJRA 4DFMA 3R7NB 2XLIA 2W1BA 5KFCA 3TI0A 5H9EK 2A36A 3A8OB 1KQ2A 2EC2A 3FKBA 2XLKA 4LRFA 1HBNB 1MMGA 4C92C 2E4HA 5H9EJ 1VQ5T 1IKYA 2XZWA 5D0EA 2CXEA 4Z88A 4CWBA 1RT5B 4MKAA 1RBAA 4J90A 3ZZTA 3M2RB 4M7AG 1JJCB 4ELVA 1PRMC 2AU0A 1GL5A 2J6TA 3KUEA 2EG2A 1UFLA 5AE2A 1CEZA 1RI9A 1I51B 3PM9A 3MHXA 2HMAA 5I3UB 4B9SA 4WKYA 3VUBA 1B99A 1U8SA 4LDWA 1RT7B 2FLPA 3M30B 1U1TA 3JRZA 1WG5A 3AJ2A 2CSIA 5IT0A 1YX2A 3I56Q 3OL8A 3M8PB 3PVQA 1M5Q1 1TOVA 3E19A 4WE1B 1IHVA 4OZ2A 3H59A 4MYTA 3R5CA 1RTDA 3CJQA 1R0AB 4UZCA 2N7YA 2MDAA 2DY9A 3WBZA 2V63A 2R4FA 1NM2A 3JYTB 2KSSA 4RNHA 4MT1A 2U1AA 3ELHA 4NS5A 3H6ZA 1NCLA 3M6VA 1E6YA 2OPQA 2RQCA 2ZUGA 1YJ9T 2DIGA 2NCKL 2VC0A 1OY9A 1VRUA 1Z1ZA 3MJXA 3RUBL 4MJKA 3QPHA 5DLOA 4IOCQ 2DNGA 1IR2A 1KJWA 5CXTA 3PJWA 4DQQA 1JLFB 3OFGA 2ZWPA 2ZVIA 1IGUA 3UCUP 2LLZA 1N27A 2KHDA 2ZM6J 4BE0A 3GILA 1YTYA 3C19A 2CQIA 3ZZ0A 2FVSA 2RT3A 2V2KA 3S6EA 3HM9A 1NK4A 4BDYA 3X26B 4DR7F 2R7WA 4RW4A 2HQCA 2YNHB 3HSZA 2MK5A 3Q86A 2YKOA 4M7AA 2KJWA 2WTFA 2FVUA 3THVA 2AYBA 1F9FA 2C2MB 3S3OA 3MM9A 3L09A 1WI6A 1QWEA 2F7VA 1RISA 1RAAB 3QUIA 1WEYA 4XIUA 4M5HA 2GAHC 2VGNA 1P27B 3ET6A 4A8MP 4ECTA 4A8KA 5DDOC 1T9WA 1U0HA 4H4KC 1YWOA 5ITHA 2YQ0A 4QT7A 4UOCA 4F7UG 2JWNA 1UWBB 1SIWB 3IG1B 3UR0A 1ZSZA 2LCLA 2XB2D 5B7WA 1GTHA 3ZNUA 2BRLA 2IYGA 3IA0A 2CFXA 2E6NA 3OYCA 2MQQA 2QMUB 2MKCA 2EFPA 4PPDA 1FNMA 4DPWA 3BDLA 1GMWD 4L76A 3EVOA 3CJKA 2IJNA 4Z02A 1YZ6A 3AHPA 2YRCA 2CZVC 1WC5A 1AA1B 3HT3A 1U8WA 2DNHA 2M5YA 3LGFA 4C8QG 3PFSA 3N5BB 5GAMh 1RWPB 2BZ8A 3D6HB 2AKLA 1VQPT 2QEXT 4F26A 2ZWOA 4HKEA 2CZ7B 2FUG9 4IDKA 3NS5A 3TO8A 4MK9A 5KG5A 2XNRA 2R57A 1KOHA 3KUHA 5K8NA 4BE2A 3IFEA 5DQIA 4ZPCA 5LJ5d 1VQ9Q 3M0UA 4HR2A 1YITT 1T05B 3OS0A 1Q0NA 1NPKA 1H38A 4MDXA 3PACA 2HGNA 5C25B 1C0UA 3SSQA 5B0EA 2EKHA 4ILRA 4DG1A 1LWCA 5E3PA 3VRZA 2EW9A 4B3OB 4NCBA 4PFPA 4ORZA 4CTAB 3V5RA 4IUQA 1KDNA 2QSWA 2CREA 4YN3B 4PL6A 4JLGA 4Y2MA 2CPEA 2JLEA 3CDEA 2ZZTA 3LP0A 4OZLA 5AXKA 1RAIB 5KFAA 2P9EA 5LMNF 4DQIA 1VOMA 2K2PA 1HD1A 1UUEA 4KBMB 3LWMA 1JU5C 3H25A 4F0KA 4QW9A 3OL7A 3ZL7C 1LK5A 2R5MA 3TSWA 3OR2A 3EYZA 1FE4A 4DV5F 3M53A 2DKGA 1BQXA 4Q43A 3PNIA 3M8QB 1VQKS 2GVDB 2V68A 3JSRA 4ECVA 2M0GB 5H9FK 3ULHA 3G2XA 5H9FJ 4F7UA 2WOMB 3G71S 4URGA 3TR5A 3HTRA 1QDUB 3CC4Q 4CO1A 3K5MA 4ES3A 1TG0A 3U1MA 1NHVA 3HSDA 3P45B 4FM4B 2BJ8A 1EIYB 1JMTA 5GAOr 1WXUA 2VV5A 1REGX 1HBNA 3GPAA 1N56A 4DV1J 1CKAA 1IBMJ 4MMOA 3FBBA 3FC9A 4PFOA 3BO3A 3G7ZA 3U1NA 3CCSQ 1RT5A 4P74A 1NG2A 2MQMA 2YT6A 3TW0A 1KTQA 3M2RA 1ZAWA 3ETOA 5HY6A 1M3BA 3LF0A 1FJ7A 1R3NA 3R6NA 2M3DA 1UG1A 2UU9J 5I3UA 2GA7A 1N8RR 4GO5X 1RT7A 3ISNC 3M30A 4K4WA 1KHCA 3CCLQ 2DO0A 1GXIE 1GX6A 4F17A 3RR6A 3M8PA 2EK1A 2EGEA 4HA8A 3M9MB 4WE1A 2RU3A 4DFJA 3NGTA 2JSXA 4N76A 1EP4B 1SJQA 4OI0A 1R0AA 2ZPIB 4HHJA 3GIRA 3RKYA 3W66A 1M1FA 3A1PA 3CCEA 3KKFA 4KC5A 2KXFA 3FB9A 1N5SA 2B86A 1X5SA 3U1LA 5HP1B 4GO7X 2KY9A 3DN9A 1G4CA 3JYTA 1EHWA 4NXNF 5CAIA 5DM7R 4HTJA 4B3RJ 3B6BA 2HVEA 2DHAA 1XMOJ 1XN9A 4B02A 3I5BA 1VQ4A 3OUYB 3W9IA 3TJ9A 1OEBA 1NK0A 3PCOB 4I4BA 5KFHA 4U95A 1L3TA 2X4YA 3UDEA 3MPDA 4LFBJ 5E3CA 4JRIA 4QBUA 4WFNQ 2KZZA 4FF3A 2A3LA 1GEHA 3BO2A 4KPCA 1JLFA 2ZUAA 1H98A 1RHJB 1Z2ZA 3US5A 2AJ1A 2QA4G 1FDNA 5KG1A 3QWYA 2FZCB 2AKKA 1KNZA 2CZ1B 2ATLA 5BR8J 3MAHA 3CDAA 4CLKA 1XNIA 3B82A 4OL8A 4EBEA 2MZRA 2G6FX 4K8RA 3OVSA 5KYUB 2UUAF 2KDOA 4M1KA 4J9RA 1VQMS 2DL8A 2EWHA 1RACB 2YNHA 3K58A 4JI0J 4ZTJA 1OPLA 4CO0A 2ZNYA 1GQEA 4IH6A 5F3TA 3K57A 1R8AA 1YJWQ 1WORA 4BLGA 2CQ3A 1TU0B 2JMCA 5A2QU 1H74A 2ZH1A 2VIHA 2GFUA 4LVNP 4EZ6A 1WC6A 3A8KA 3TA1A 2MJNA 2DX1A 1WKJA 2LNHB 1R31A 2KE9A 2CKWA 3NTHA 1GCPA 2F2XA 2QMWA 3PX0A 2G4BA 3TQEA 1VQ6A 3PV8A 1QCOA 4KGZB 3J7A1 3JCMc 2E3HA 1UWBA 4BI3A 3IG1A 2JJ9A 2V8DA 2LU1A 4EMGA 2HRTA 1N8RU 3SEOA 2LMIA 2X9HA 2V8HA 4AXJA 2QX0A 2E6ZA 2E1MC 1ZX6A 2BRKA 4OZJA 3CGIA 5F8IA 3P49B 2FIUA 5HBMB 3NTKA 2ZH4A 4FNHA 1X4CA 3K2YA 1YBAA 3VJPA 4H4MB 5DDPC 3L1AA 3N5BA 4B9TA 4IUUA 3OFFA 1HK9A 1AUSL 4PYDA 3G87A 1RTIB 2HKNA 1ZZNA 3FC3A 4DOWA 1Q1KA 2GQQA 3CCQQ 3QSYB 5EDWA 3B54A 1S1WB 1T05A 4FF1A 1RHQB 2IA0A 5BYQA 1RLPC 5C25A 1TP7A 5CA5A 1MWYA 4P2FA 3T9NA 1HI8A 2VJUA 3THPA 4B3OA 2C0TA 1V3SA 4RKUC 4CTAA 2DNRA 3JV3A 1OV3A 5IC4B 2C06A 1YKWA 2XGQA 2FVCA 3KG1A 4R25A 4M78E 4B3TJ 1UL3A 2DR9A 3W1YC 2ALZA 1N33F 1WQ7A 2QQ9A 3H0IA 5A76A 1QMCA 4A4EA 1BE4A 3OHAA 4HXJA 1B64A 5F9NA 3UN3A 2J7UA 4DV6F 2V5HG 4E2FB 3NNHA 2FHJD 1VQLT 1ZTTA 5GAOm 3G8QA 3M8QA 2EG1A 4LT6A 2GVDA 5HI7A 1KSWA 4BUGA 2RUSA 2RDIA 3H2UB 1S97A 1KR4A 3EHQA 4JV0A 2EYYA 2EGCA 4OMFG 1U2CA 3I56A 2QT7A 2WOMA 3KDOA 3PEJA 5CHCB 5GANd 2MPUA 2YPYA 1URNA 2X1AA 2O9SA 3TAPA 3Q8RB 3CB4A 2X3WD 2LQ5A 2FJAB 1NJIC 5HMYA 3EGDB 2RJEA 4KIAA 4FSSA 3JCMX 1V5VA 4M94A 1DY3A 4LRAA 3ILOA 4HVZA 3EVWA 5GMKe 3R2DJ 1K1ZA 2F40A 2W9BB 3J81Y 1N34F 1ZLMA 1SF9A 4CM2A 2J06A 2E5LF 3C6UB 2LA4A 4B9UA 1Q4RA 2EJ9A 2Q43A 4K4TA 3GP9A 2W8KA 4PABA 2EC0A 4EMKA 3M7VA 1OULA 2CQDA 2CVEA 1OY8A 1W70A 5FD1A 3KJVB 4LDUA 4KTQA 4AUKA 1HWIA 2EKYA 2G1DA 4E7ZA 1EP4A 3TZZA 2F9DA 5JXSA 4L5GA 4HT7A 1JLQB 2QTWA 3HZGA 3U23A 1IR1A 2XIDA 4QIGA 5HP1A 3KMQA 1DURA 2DO3A 1ZZFA 3AY0A 4R0EA 4X1VA 1UA1A 4ID8A 1AVZC 2O5DA 2DNUA 3OUYA 2DXEA 3OXFA 3DFEA 1QWFA 4FF2A 2KTQA 1NH7A 4TNOA 2K7KA 2B0GA 4RTWA 5GANg 3I35A 1WC0A 3CCET 2K7AA 4QVCA 5DRKA 4HVUA 1AWOA 1HW9A 3HVRA 3FRNA 1UJ6A 3SHWA 1SQGA 1M1KC 4M77D 4WXOA 2MGZB 4J5OA 3GQCA 4TYBA 2V34A 1G5VA 2CWXA 2FYXA 2OGUA 4PJOB 4JV2A 3FEXB 4RBUA 3HJVA 4UW2A 1RWUA 5KYUA 5D4PA 1WX6A 2B9EA 3NAHA 4PXDA 4J9FA 3ASKA 5LJ3h 3R97A 4IURA 3MM7B 2ZHOA 1SKWA 3NNCA 3BR8A 1CSKA 2OTJT 2DBBA 3TARA 3U7JA 1JLEB 1ZM3A 5E3AA 4ER8A 4MKYA 3RKXA 4FT2A 4WP9A 4KHPJ 2AMCB 2L3PA 2DA9A 4LF8F 4M7AC 3M1VA 2L41A 3SQOP 4ZN3A 3M9QA 1M5PC 1ZA2B 1VQ9A 4JB8B 2G2OA 2KZMA 1WOSA 3K89A 2AF6A 3ZTOA 5CKHA 2OPSB 2GNKA 1VQOT 2ZVSA 2F3JA 4IUPA 3T1YJ 1ZM2A 2BX6A 3GLXA 1S4EA 5J2PB 1TV6B 5JJBA 1RHUB 2BUDA 2QQBA 1FJEB 2JLFA 3WC0A 1R0BG 1H2TZ 5HBMA 1TXQA 2ADBA 4J7IA 2WB4A 3C94A 2CUDA 4RW6B 2DRKA 4AL7A 4H4MA 1BGXT 3HO1A 1KK7A 3MR7A 3B4MA 2LDYA 2BUNA 4BS2A 4P10A 3ULRB 1RTIA 3I96A 2F8EX 2E12A 2DILA 2VOPA 4LN2A 5BXIA 5AT1B 2CT4A 1KKHA 2EFOA 1S1WA 3JCMd 1FJGJ 4EWTA 2DIQA 4NRTA 2L2PA 4J9HA 5IXUA 2X1FA 4C0FA 5F8LA 1TUDA 3JB9J 1Y71A 3CC4A 3NKYA 1N52B 2K9GA 2LFVA 2ZEJA 4C3LA 4Y34A 4R0KA 3SSRA 1WJSA 4DR1F 4PAAA 1J27A 4J9MA 3NY0A 3O8VA 5I21A 2RRBA 3OYBA 4DPYA 1X9WA 1GCQC 1TUCA 4RCBA 2FVRA 2ZJQQ 3LWHA 1JQGA 3L3CA 2EJFA 2LP5A 2AJQA 3T3FA 3CCSA 4LBHA 4NYOA 2KFYA 2ZPGB 3W65A 2CNNB 3JB9I 4PJNA 3GYGA 4RBVA 4LUBA 1UW4A 2FDNA 3H4BA 1WEZA 2UXBF 2PN6A 3X24B 2ZOGA 3MCSA 3VS3A 4ED4A 4UOFA 2DITA 3DGVA 5FU7B 4CH0S 3TVKA 1SSHA 1UGRB 3CCLA 3QXEB 1S9GB 2DVJA 3CJTA 2XMJA 2GMLA 3NWRA 4JRQA 4P73A 3UN5A 1WOOA 1DQ8A 4RTXA 3JS9A 3GPLA 2FEIA 4DX8H 1S72A 2RQ4A 1E6GA 2LJ0A 1F2HA 1EX8A 3V2UC 3EGDA 2QA4S 3FRYA 3GU0A 1SJFA 4CC3A 3M56A 1VYTA 4QZVB 2RI3A 2AZ1A 4M75E 2FGCA 4DHVA 2D41A 1IBKF 4CNZA 2MI6A 2IPOB 2Z4PA 2W9BA 3K59A 3D6TB 4AE5A 1K0TA 1PD1A 4B9XA 5K14B 1AYEA 1XNQJ 3GR0A 4CLFA 3H41A 3R3TA 1PSDA 3C6UA 1U45A 3G4SS 4JI4J 4C8QC 4C8LA 2U2FA 1AUDA 4C8YA 1LWEB 4HDGA 2DJZA 2KFZA 2JX2A 2A37A 4ED1A 4EO8A 2K3XA 3KJVA 1EB0A 3BZQA 2K06A 4FXWA 4BWMA 3I56S 1JLQA 4JI3J 5KYYB 4RW8B 5GAOn 1GMUA 2QK0A 3IAS9 1XQHA 2YWGA 3K8WA 4Y28C 4B9LA 1DQ9A 3S7RA 1VQ5S 5GAN4 2JTMA 2NXCA 1M90R 1M5SA 4D3GA 1YJWA 2YNIB 3OT9A 2UVUA 4ZLLA 2JN0A 4X9CA 4LBIA 3UT1A 5LJ3Y 3NNAA 1T9TA 3BSNA 3LWIA 1G3OA 1TK0A 3PT9A 1K0SA 1T94A 3A4TA 4JI7F 1PBUA 3T6JA 2DRDA 1XIQA 2BJ3A 2ECZA 2MGZA 2EWNA 3TVZA 3MCNA 4OV1A 2FD2A 4R8UB 1OOTA 4M78G 3NRBA 4FN5A 4PG6A 1GFCA 1VQ8Q 3KK2B 1Z4UA 4NLGA 1F2GA 4PJOA 1V5IB 4O6JA 1QD1A 4Z89A 3QWXX 1FDAA 2PSZA 2Z2MA 1LOUA 5ETLA 4YMEA 3FJ5A 2VFUA 4X65J 4OX7A 3PX4A 3RRHA 1U48A 1YJTA 3PYGA 4ILLA 5LXYA 3CSKA 1N9SA 4GY5A 5L23A 2LXUA 1X2QA 1Q53A 2VBWA 4RUGA 4BE1A 3MM7A 3BSAA 2HD0A 4DBRA 4U6PA 1U09A 3SFUA 3VAHA 4EK2A 1JLEA 1S49A 3IRXB 2GJFA 3C14B 5CVIA 1NUEA 3H7HB 1WHJA 2DK2A 1NPRA 1YJ9S 3OW2P 3MUMP 1KSPA 3CCQA 4JV1A 4AFQC 2I2LA 2WBRA 3LH2S 4E7IA 1LXJA 2FLOA 3CXCS 3UFCX 4WU3A 1FWPA 2F8HA 2QL9B 1YGYA 2KAFA 5D0HA 5KCOA 1EX4A 1LK7A 2OPSA 5G4DA 3D1QA 2BACA 4IKAA 2BJEA 2PD1A 4PQUB 2XDDA 5M9OA 1LWFB 4USIA 1LQ9A 5J2PA 1TV6A 3K8VA 4ZVPB 1Q81C 2HGLA 1CULB 2E7WA 3G6EQ 4J7CA 2OTLS 2RO0A 4NL5A 1RLCL 4M5MA 3EWGA 3BBFA 4RW6A 1S76D 4A8YA 1P9YA 4DN0A 4RNNA 3CMAQ 4HI1A 2VU5A 2LXIA 5HANA 1HWKA 1OPZA 5K5MA 2G3RA 4TKTA 1UEKA 4DCJB 1NB2A 3RMQA 5C0MA 1FKAF 1FK9B 1IXKA 4LNPA 1S1VB 2HPUA 1F3FA 3OFEA 1M90U 2DH9A 1YSJA 3L2UA 1SJ1A 3L2QA 3VAMA 2Z30B 3F41A 5GMKi 3TANA 4F3MA 2XI3A 2IIMA 2NUPB 3KFWX 2XQCA 4B9MA 2EW3A 3DB4A 2DNQA 5KFUA 1N6QB 3HHLD 3IBCB 2QASA 3NP5A 1R6YA 4LBPA 2RQRA 1SG5A 4KHRA 3H5XA 3K5PA 2VKNA 1V6HA 4DUZJ 3QGHA 4DUTA 1BBZA 5J3BA 2CWKA 4H4OB 4C8MA 1TL3B 5I3QA 4DV4J 2ZJPQ 3OJUA 2CJYB 3SIPB 3UD4P 4G3IA 1BD6A 4NA1A 5L8RC 2XLJA 2CDQA 1TUVA 4K4XA 2EIFA 3B78A 3ETMA 2A08A 1HJDA 3WX4A 3CPWR 2VONA 1C6VX 3QJ6A 5EX0A 2CDTA 2HEQA 1PG5B 1V76A 8RUCA 6AT1B 5E5NA 4RTTA 2HHUA 4GRSA 3RU0A 1S9GA 1YITS 4CDIA 3PRVA 5KFTA 2NSBA 4D8DA 3W62A 3D2WA 2E7VA 4HH0A 3BM7A 3IBWA 4PG5A 5FU6C 2BW2A 4AFSC 5A0GA 2V1QA 1JLBB 4X4SA 3RBEA 1FT8A 5LT5A 4NLXA 3NCQA 3JTOA 1OSDA 2YDLA 1QKXA 1UB4A 4PQAA 3UPUA 2LEBA 2MYSA 3M0TA 2RI2A 1RCOB 1YHQT 3CJRA 2ZHBA 2H54B 3H5UA 4KBIA 3QAUA 4X2BA 2XS2A 3HPOA 4DV2J 1QP3A 2HFUA 2NLWA 5K14A 1S72T 3OMGA 2GMJA 2W8LA 4HH1A 4O44B 4USHA 1QTMA 1R77A 5ECAA 3LOUA 4OX6A 4OJ1A 1LWEA 2V8PA 2MHNA 1S99A 3MEUA 2XY6A 2RHQB 2C2ZB 4FPIA 2UUCJ 1X75C 1PSEA 1UGQB 4AQYF 4EZ9A 3QRRA 4BD3A 2F63A 2ZD1B 2C0OA 1FWLA 2XNQA 4F4ZA 4J9GA 5LM7E 1DHMA 3X28B 2WVFA 4P2MA 5KYYA 2LQKA 5HVGA 5AJ3J 2X4JA 4FCYA 2B5JB 2G2ZA 1K73R 1KHVA 5LSOA 3TJAA 2HZAA 4WFAQ 4DEZA 1VFJA 3NWGA 1HHQA 4WFBQ 1S6OA 1HHTP 1SH2A 3UE2A 4A47A 3EFSA 4B3MJ 2YNIA 2EPIA 4X34A 3KMSA 2DPPB 4ZVQB 2R8KA 3D6FB 2HNZB 4A8QA 4EYIB 2YNFB 1A9NB 4YEAA 1YVFA 3GJTB 1HD0A 4CO4A 1NEGA 2G1HA 2HRUA 1M2VA 2F4VF 4C0GA 5FLXY 2ZOMA 1WXTA 2MKJA 4JJBA 2KRBA 3E01B 1NYGA 1ZYQA 4R8UA 1BC6A 2QLXA 2ZDOA 1NB7A 4RG2A 3KK2A 1HNZJ 5CYMB 5LMUF 3J7Z5 3PO4A 4HYKA 5KFXA 3LO3A 1EKSA 1FEHA 1QVGP 3JTPA 1IBCB 2J8SA 1AB8A 2Z8QA 4ZVUB 4LFAJ 3KJFB 4OZ5A 4HHUA 4OHZA 3G82B 4ANJA 1IJFB 1RYSA 1SRMA 3AB2B 3SCIE 3MR5A 3CBOA 4GVLA 3PW4A 3LANA 3IRXA 2FPDA 1QSYA 4J9PA 1YJNQ 4PPZA 2EQJA 1S6PB 4ED0A 3LP2B 4YB5A 1VJWA 1UFKA 2OJ3A 5J2QB 3TP2A 2EK6A 2HQ3A 1FTRA 1NDPA 2V26A 2BBEA 2PTKA 1O0PA 3QJLA 2DERA 4M77F 1UVMA 4PQUA 1VBYA 1LWFA 1TZ0A 1Q82R 2XS5A 1CJTB 4W98A 2GTOA 1RSCA 1CULA 2VDIA 2LEPA 4S0MA 2HQIA 3BW1A 1GH8A 3D5MA 1NK6A 2F8MA 2OAWA 2ASLA 2Y0SD 2AJ4A 3M32B 4IIMA 3FBEA 3FEYB 1RABB 1X6BA 3HULA 2A2CA 4RX6A 1UPPA 3LX7A 1XBWA 3DXBA 4M7DE 2L08A 1K73U 3W5ZA 2PUOB 3ZEHA 3TEGA 4A4GA 1FK9A 2J9EA 4XAKA 5M2RA 1S1VA 2V4JB 3NS6A 2XO6A 2DRAA 3HL8A 1ZBJA 3OTDA 1U25A 4C92B 1JNRB 3TREA 3VS0A 3RAQA 1C4CA 2DM1A 5KFOA 1U8RA 2NUPA 2J6SA 4C0HA 3M8YA 3TUIC 1XERA 5DDRC 2CPJA 1N6QA 5CKDA 4LF7F 3EG0A 3VCDA 3MP1A 2PIIA 2OEJA 1N36F 3AOBA 1XNRF 2K57A 2I0NA 3I6PA 4OI4A 5LL6S 4Q2MA 4KGKA 1I0CA 2J6FA 3J7ZT 1NMEB 4H4OA 4RJVA 3OVAA 1KD1T 1TL3A 2XZDB 2AP6A 3CC2T 1PNJA 2HHVA 4PCQA 1UTIA 1DZ5A 2OLWA 3H98A 2PFFB 3THKA 3MOZA 3LWLA 1FVSA 1UHFA 3UVJB 2DVIA 4AFUC 4JYAF 5GMKj 2FQQB 4U67Q 4QIVA 3PDNA 1X5TA 2X51A 3GWCA 1D3BB 4HL9A 2BE7D 3PR5B 3D28A 5ETPA 1IBLJ 4OX9J 2NS1B 2VH7A 4WU2A 4LF1A 5IHIA 4LRDA 3NGRA 2OSRA 4OB0B 1MHNA 2D6FA 2M70A 1JJ2R 1QE1B 2FVQA 2ASYA 4X4NA 3CO0P 1EIFA 3BJYA 1APSA 3H0HA 2GHPA 1JLBA 3BO4A 2ED1A 1A6LA 2N4CA 1HQEB 2PVDB 3ILLA 3CC7Q 1ROFA 2J0XA 1N88A 4X84A 4NLUA 4DR5J 1S48A 3PXGa 5GMEA 1CJVB 1AWXA 2R7XA 4DV0F 4BCAA 2Y1JA 1Q82U 1FKPA 4QU6A 2PMWA 4I0WA 2IDEA 2RS8A 4C0OC 3CF5Q 2JOYA 4RL1A 3SCLE 5I4MA 2KYBA 1X4HA 4O44A 1VQLS 3O44A 3VGTA 1A0NB 1L3KA 1MG7A 2F5KA 4CIOA 4J7FA 1NSKL 2B4VA 3K5NA 3M05A 4W90B 5LL6d 2HWIA 3SV4A 4O0IA 1UJ0A 1YJ7A 1BY9A 4K4SA 1JEGA 4WZQA 2ZD1A 3QSIA 1M90T 2CJXB 1X5OA 3V7RA 2CJAA 3L2WA 3TNVA 3D4JA 2KFNA 4WK3A 1LWXA 1QVPA 3RR7A 2HBZB 5FROA 1HR0J 3HFNA 2B5JA 3MEVA 5FLXE 3L7PA 4FYVB 1X7VA 1QVFP 2DH8A 2POKA 3OPKA 3CEYA 5F8NA 2UUBF 5CQGA 1G2BA 2D0NA 1LNXA 2ALYB 4BC9A 4X66F 3RJMB 3G1JA 3TUZC 2BXJA 2QYZA 5JVHQ 3KLHB 3UCZP 2DNMA 2XI9A 2HNZA 2R2TA 2YNFA 3M4XA 4LFCJ 5DO2A 1MW7A 3D54A 5CCMA 2M0YA 2BKNA 4CO3A 2YLBA 1NJYA 4LUEA 5KT6A 1VCTA 3E01A 4LF5F 1XWLA 3INZA 4C92G 5KE3A 4IOAQ 1B0PA 1W2BR 2MKIA 3OMCA 1PHTA 3TQ1A 2FPEA 5CYMA 2C2DA 2GCXA 4FYXB 2J9CA 4N56A 1MN9A 1VBZA 1S12A 4RW7B 3RBDA 2AZSA 4ZA1A 2DZ9A 3HI9A 3BGOP 2OKQA 1XMQJ 3UQSA 3G6EA 2AW0A 2N3OA 1FRKA 3T5JA 2NPFA 2FJDB 2B8AA 3G82A 1LW0B 3BH7B 3W5YA 2Z57B 1Y3JA 4QR1A 5GAN8 3CMAA 4OZ3A 4P2SA 1KQSR 1DLOB 5GJWB 4B6MA 2ZZDA 4ELUA 4C6AA 1ZQ1A 5CQXA 3SDEB 1WWHA 4C8OA 1YNZA 4FYYB 1S6PA 4RO0A 3LP2A 5KFVA 2EQIA 1LEOA 1VYVA 1SBRA 2JXBA 1KQ1A 4XPCA 3Q8YA 4XTWA 5J2QA 3R7SB 2VFRA 4JI1F 1PSFA 2QE5A 2AD9A 2C3PA 3T1HJ 3UDVA 4AD6A 4H54A 1FCAA 2DE0X 1R8OB 2EI5A 5FIIA 2HVIA 1FDBA 4A8WA 4PK4A 4AT1B 2BM1A 2B43A 2VFSA 4DV3F 1CJTA 1QW1A 1Y57A 1ZSGA 2GJ2A 2K7JA 4ECWA 5GAEU 2DR8A 1VQKQ 5FRMA 3CMET 4Y65A 3NPFA 3M32A 3MGJA 2KI2A 1RHKB 1A7GE 2NYHA 3Q8VA 5SUHA 1I5LA 2W2MP 3ISZA 2JW4A 3PR4A 1IUJA 3LPEA 1D1AA 2CAJA 2YX4A 3G71Q 2F4FA 4R56A 2GF7A 2F2VA 5CKBA 2JDJA 4JUZA 1QCFA 3I4HX 1RU1A 4QWBA 2OTJS 5SZTA 1EQ0A 2HHSA 1CPZA 2EJGA 4J9LA 4LSLB 1NKBA 2C22A 1U49A 2V4JA 3M5AA 2HQEA 4PEOA 4C92A 4M75D 2D0QB 1SXLA 3TX8A 5F3ZA 3EXCX 1GK8A 2FHDA 5I3PA 1OWXA 2YRVA 2KYXA 1H7XA 2J5AA 2ZDPA 3VS5A 1GFDA 1JJ2A 4OYIA 4DR6J 3RBBB 1XK8A 3DLKB 4ZGEB 4J37A 3UI3A 4J9IA 1B0TA 2HZYA 5KTQA 4X62J 4JI5J 4M78C 2CQBA 1XMBA 2AX1A 2E5HA 2ROLA 3GIKA 4Z7YA 3KJQB 2UXDJ 2E5JA 2B6AB 1KC8R 3CCMQ 4LXCA 1RBLA 4QYRA 1C0MA 3UVJA 1YJVA 4C5IA 2VQFF 2OSQA 3GIMA 3MTJA 1H3HA 4NL2A 3D0IE 3IWXA 2JNGA 5IC6B 4XK8E 4IUTA 4OZ0A 2XK0A 3NGSA 2M88A 4WCIA 1QAXA 3T1AA 4XTXA 3PMIA 2LCWA 5ADZA 1AZGB 3MDFA 4JRPA 5ETRA 1XJWB 1IN0A 5GAMd 3W9JA 1QE1A 2V8KA 5AXMA 3KOAA 4MZTA 2YKMB 1JXVA 1OJ4A 4HT5A 1RQ0A 2R7TA 2FHOB 1TTHB 5FU7C 1ZM4A 1KQGB 2LCSA 3BSCA 4NASA 1HQEA 1PM3A 2J05A 4Y91A 3H4DA 3ZBDA 1S79A 2XG8D 3H2VE 2FYKA 3A98A 1CJVA 3REBB 5ETTA 3TWZA 4CC2A 1JXEA 2L3MA 1HSQA 4RR5A 5U47A 5GADU 3BREA 1QKWA 2CYZB 1FD2A 1HQUB 4HI2A 1Z9QA 1YIJQ 5HL7Q 3EDQB 2QA1A 1BYMA 2LXFA 2QL5B 4X4QA 2CP3A 4HCKA 3KYLA 5D4NA 3MOJB 4NEYA 3CIMA 3I31A 2BW7A 1JLAA 1J5EF 4X9DA 2BJDA 3VS7A 2NUUG 3V7SA 1KRPA 4KKOB 3R5GA 1WHVA 1VQMQ 4USJC 2COWA 2DD5A 3SMZA 2BVZA 1FERA 1X6GA 2MPXC 3BN4A 3AD8C 5CYJA 1I81A 2PFDA 1S0MA 1W2BA 1MGQA 2DD4A 2E1HA 1UPMB 5DGAA 1QQJA 4DF8A 2K2MA 3PE0A 4ZDNA 1IHWA 2KU7A 5C42B 3E8OA 1XR7A 3AOCA 3QBCA 3N6MA 4MFBB 4GVBB 2ZITA 3M0PA 1QTNB 3DNCA 1GXLA 3PRDA 4YQWA 2DK3A 4K2XA 1OQKA 2DH7A 4H4KA 2ZGWA 2VPWB 2UVRA 2JC1A 2XTJP 2CH4W 1WHGA 3DDNA 1V9OA 4KUIA 4EGLA 2A6OA 3PYFA 2OO4A 3W2WB 4HT9A 4XTUA 4Y2AA 2BDPA 3KLHA 4RWXA 5GAMg 1VQNA 1YJNA 2BE2B 1WD6A 3HVWA 3UR3C 3D67A 3OS2A 2GZOA 4EMDA 1G3TA 1KC8U 1X2KA 1WNLA 1ZBXA 3LW5E 4ZVOB 5F8JA 5J1NA 1WHHA 1UW9A 3RB3A 4D3HA 2GTJA 2LX9A 3L2VA 2DXFA 2EYQA 3W7BA 2ZH5A 4MIWA 3MXHP 3TRGA 2QG9B 1K0VA 1LW2B 3BPDA 1KQSP 3OYLA 4RW7A 2GGPB 1QAIA 1U1RA 3EGXB 3W60A 3QJJA 2QI2A 3IO1A 5HK3A 2E9TA 2N3LA 3EH1A 1VQ8S 5IN1A 2XEXA 3AB4B 1LW0A 3HFVA 3MEWA 2L9NA 2RSQA 1DLOA 1VYAA 4FZVA 5IHKA 1D1BA 3MMCB 4DWIA 4V1Ak 3QLHB 3SDEA 2DNNA 1M2OA 1ZM9A 1UEUA 3CD6T 1KFDA 5CZXA 1Q82T 3HSJA 3MF5A 3D3CJ 5E0OA 4OB3B 3PEHA 4G6VB 1ZUUA 1ZPWX 3GIIA 2Y8YA 2OEMA 2NXNA 3QZ9B 2Y1RI 2CT3A 2ZBRA 2J7KA 2ZHAA 2DHXA 4ECZA 3GFYA 1K1SA 1SL1A 2QTXA 2QIFA 2XWYA 2I5JB 4A8OA 1VIEA 4QPXA 1U1PA 4QPTA 2ILZA 2XWXA 1FRJA 2MZJA 3IR7B 1DJ7B 5CQYA 5I42B 2XHCA 4E7KA 4PYAA 4DR4F 4DL2A 5AYFA 4CLWA 3NBPB 5KT3A 3QGGA 4X4RA 3DLLQ 2RJFA 3G6ES 3D1HA 4LF9F 2G0JA 4EIKA 2DXDA 4USVA 2B9XA 4I1TA 1ITPA 4LSLA 3NMAA 2XD0A 5HATA 4OYPA 3UO0A 2FTRA 2GX8A 1M27C 1HBUB 3HVTB 4ES2A 3LQVA 3RW7A 1OQ3A 2EQUA 3W63A 4GKKF 4OMMA 4M5LA 5CK9A 3MMAB 2P4TA 2FPHX 4OYOA 1PRLC 1FI4A 3GB0A 3DLKA 2OMOA 3QRPA 4N4GA 4WZMA 3JAME 2R58A 3META 1M4ZA 4ZPWR 2P5VA 4DBQA 1GFWB 4OMLA 4WBFA 4UC4A 1D0EA 4GKJF 2ZC3A 3GMGA 2VICA 3VAIA 1P1TA 2B4OA 2B6AA 2XU8A 3VTIA 3EZ5A 4Q44A 2V69A 3ILIA 2V67A 1MLAA 1HYSB 4F4YA 1W2IA 4QW2A 4NLVA 1TUWA 2UZAA 1I1JA 1X27A 4YHHF 1SH0A 3SWNB 3OLAA 1NJIR 1ZAVA 2HLUA 1IGQA 1PYOB 1NK5A 4X4OA 4YB1P 2LU2A 2BM0A 1D3WA 2AQ4A 1U1SA 3RZAA 4FSXA 1UEVA 2VL1A 1FFSB 4ZLPA 4NLYA 3IS9B 2JEJA 4JI8J 1UP1A 1RT2B 2YKMA 3KXDA 1YRTA 4NLSA 2DYIA 4V2SA 2F5GA 4ZJLA 1KQKA 2EBGA 2H5EA 4DX5A 2DL7A 4JBCA 3BR9A 1F5BA 4DOZA 5ETSA 4F16A 3QWPA 3CCVQ 4BDZA 2RJCA 2MHEA 4AMCA 5KFKA 1HQUA 3TCJA 1PBAA 2EFVA 4FKYA 1QLNA 1HNXF 3OHBA 3FJPA 1Y5NB 2JEIA 1W7WA 5LOQA 1N9RA 2GGRA 1K73C 4QKUA 3OR1B 3JCMQ 5A6WA 3J80U 4KKOA 2CPFA 4Z2XA 1MV3A 1RL2A 2D9PA 1RAOA 1Q7LB 3HFZB 1SSFA 4PLLA 4A8XA 3EGUA 2J9DA 1JIHA 2RPNA 4LIRA 4F2RA 5F0UA 4AFFA 1U5SA 2W01A 4PJOD 3M0QA 4I6AA 5C42A 1FXXA 3QNWB 3V8KA 4MFBA 4GVBA 5G0RB 2F2WA 4RWWA 1NKCA 2G0IA 2G0CA 1YWPA 1TMJA 1RWXB 3T41A 1YI2T 4MZMA 1RKJA 2OUGA 2Q1LA 2W2NP 4ZITA 1YHQS 4DSEA 1ULRA 3W2WA 4TN2A 2F5TX 3QGIA 3JSCA 4TYAA 2BE2A 1MROB 1NLOC 5A0YB 1B7YB 1AWWA 3OYNA 3NCRA 4CYUB 2RJDA 4JI6J 1WFWA 3ZFVA 1QVGA 2CQ2A 2K3BA 2DLPA 4M7DD 1D09B 3BDUA 5KYWB 3OYHA 1F5AA 3QT5A 1B7TA 4X64F 1LW2A 4WPAA 3N6NA 3OQ2A 1VQNT 1JWWA 4OHYA 1AW0A 2GGPA 3CCJT 2CSQA 3J7YI 3EGXA 1W26A 2J6OA 3OYJA 4USUA 1D9DA 1SQEA 4DQSA 2H5JB 2FC9A 5DG7A 4V19X 5LJ5e 2ED0A 4M77E 1VQKA 1JLGB 1C1CB 3ZFJA 4LDXA 3G71A 2IFXA 3RB6A 1FWKA 3NLCA 3MMCA 5BJRA 3VYGA 4O23A 1K1QA 3QLHA 2VQEF 4CRJA 3OYDA 1DJ0A 2FRYA 2KGTA 2LDMA 1VC0A 3S3NA 2RF0A 3LALA 5LJ5f 2MY8A 3IGVA 1RADB 4O3QA 2UXCJ 2HNIA 1Q8LA 1FHTA 2I5JA 4YOEA 5DM6Q 2DKOB 5HN0A 3CEDA 4ANEA 3ITHB 5I42A 5KYXB 2NYSA 3D3BJ 3OSPA 1FKOB 2OH2A 2CKKA 1GMWA 3IR5B 2NXUA 5KFIA 4JI2J 3NBPA 5IWAJ 3D0GE 1KVIA 4OMQA 1LKZA 3ILJA 3SYZA 2P0KA 5J1PA 3T9ZA 2PNIA 4J9BA 3W2VB 3GCXP 2DEJA 1N5VA 1N32F 1IZ6A 2M8HA 2QGGA 2IJFA 3OW2S 2CA9A 1BIBA 1K0XA 2WSCC 1HBUA 3HVTA 5LJ3d 3BGRB 1RWOB 3ZTRA 2XMTA 1LXNA 3MMAA 8AT1B 3EG3A 4DJBA 1M3CA 4DUYF 4NLOA 1Q7YC 4B3SJ 1HIYA 3PW2A 3VU3C 2DXUA 5IFMA 2DGWA 2KT2A 2RN8A 3X1LB 1O6XA 2XC9A 2XSJB 2DGOA 2JFDA 2M4MA 3A13A 1JJHA 3G4SQ 2RF2B 5CYQA 4C8QB 1NE8A 3PHEA 4LIWA 2QQRA 1X9MA 1HWUA 2W0ZA 5LXRA 2O01E 1HYSA 4KH1B 1H0HB 5IT4A 1WQWA 3T5LA 1VQ7T 2NSCA 3MD3A 2EXUA 2DNYA 1YIJA 1O75A 1NEEA 1NZ9A 3OS5A 3SWNA 3F73A 4TVAB 2HZVA 4NZ0A 2QLFB 1G2EA 4LJMA 1VS3A 2XYPB 2HS3A 3Q8UA 1ZS6A 4CQ1A 3ENWA 1TL7B 3UDCA 4CLZA 1YBYA 3IS9A 1XOVA 1I4K1 2YKQA 5A0LA 1WHYA 4B9VA 4M75F 4KRTA 1VQMA 4TY8B 3OTOF 1RT2A 1VQ5Q 4I6WA 4C3KA 3LYIA 1RWMB 4P7VA 4USMA 1IWAA 3MEGB 1X4EA 1PIEA 3FSIA 4OFZA 2B56A 4GMKA 3QJPA 3SEMA 1YJUA 2MZ1A 1G3SA 2YLCA 4DSLA 4LE9A 2DR5A 3PHTA 4FBUA 1XC9A 4N77A 3CC2S 1VIXA 2AJ0A 4PUOB 1WYXA 5LJ3g 4ZKAA 3NTIA 3CC7S 4E7SA 1M5HA 4G1QB 2NPIA 3WVDB 3OR1A 5LSRA 1JO8A 1Q8BA 1RT4B 1F60B 1R8CA 3W8PA 3N79A 3VR1A 4DPUA 4DV7J 1T9XA 2EKNA 3CCWA 3OBYA 3OBWA 2MQPA 4ZLJA 5T14A 1MNEA 2KKHA 2MY7A 3QIIA 2H3EB 1VQYA 4JV5F 4J5YA 2JHEA 2DTOA 2DCLA 2WVCA 3OB9A 1Q86C 5A8KB 2XSFA 3VHQA 3CDUA 1N54B 5HVFA 3PJ9A 1YJ9Q 4AFZC 2GQ2A 2Q6CA 4K0KJ 5G0RA 1L3UA 1G1XA 1FX7A 3J81j 2GCFA 4DBFA 1Y00A 2HHHJ 1IKXB 2UUTA 2DGSA 5B09A 4J9KA 2VXFA 3KLEB 5HQ8A 4FU6A 1RLDA 2DR7A 1N0VC 1FX2A 1MROA 2BABA 2OHDA 1WDDA 3UCGA 5A0YA 1XTDA 4BI4A 2W7PA 3NS7B 2R8JA 1JQQA 4EUVA 4M95A 4CYUA 1QCNA 5JVGQ 3TAQA 2OTLQ 1WUUA 3QZ7A 4RNOA 4QR0A 1ABOA 4KGXB 1IRXA 2WSFC 5ETNA 5KYWA 2LVMA 5J39A 3M2VB 1WG4A 3LPYA 2DD8S 1ZH5A 4HLBA 1C1BB 2HSEB 4PXBA 4DR3J 1WLPB 3G8SA 4CO2A 4URSA 3AFGA 1JLGA 1C1CA 2YWFA 3OTEA 2E9RX 2LQNA 1RI7A 5HROB 4DSFA 3EH2A 4K50A 4RZRA 3OYKA 4IFVA 2MYFA 3DLLA 4IQMA 5KFFA 2PO4A 5GAN6 1Q81R 1ZBTA 1U7LA 4BACA 4OHXA 2LA6A 4DPXA 1T0TV 1OYXA 4J9SA 4EYHB 1CKBA 3K17A 5KG4A 4BDPA 2AYEA 1GCQA 4ELZC 2D3ZA 2WACA 1HYOA 1YZ7A 2LX7A 3QMQA 3ER0A 3FEZA 1AD5A 2W4DA 1HWJA 1I94J 3BDPA 1K44A 3TSZA 3G71T 4OI3A 4K11A 3RIRA 2NXEA 2W2QP 3VKIA 1FMKA 3RAXA 3DMJB 5E41A 3J80E 4Y2IA 5KFLA 3ITHA 2KHCA 2G13A 5KYXA 1QVGS 2L48A 3MEEB 1JKHB 5I11A 4DR2J 2ESWA 4I64A 1IM6A 1ZPVA 3V8LA 4CI0B 1TFWA 1FKOA 2MKKA 2YHTA 4P52A 4J9OA 5GANe 1WA7A 4IRKA 2KG0A 3RR8A 1YITQ 1WHWA 1OO0B 3CCUT 1WIEA 3W2VA 4XAXB 5GMKh 4AXIA 3VZHA 1CSJA 2VDHA 5FU6B 3DLBA 5KFGA 1S4FA 4TXSA 3FCHA 3SB2A 3FZ2A 2GBQA 1S10A 1HWLA 4ZVFA 3BGRA 2LTOA 3G9CA 3VF0B 1KC8C 2GQCA 2KEAA 3WQPA 3NXZA 5C2GA 1GTEA 1FESA 3CVKA 5GANf 1NH8A 4CC4B 3N28A 2DEUA 2FB7A 4YY3J 5D6GA 3VS4A 1RGVA 4LREA 2BANB 2PVGB 1IXDA 1K9MC 1H73A 3O5TB 4WCEQ 1RUWA 4Q2LA 2NQPA 1TL1B 2DY1A 2VUBA 2JZ2A 2HBPA 2E5IA 2XSJA 1NJIT 3C46A 3E51A 1VLYA 2RF2A 1YRUA 4C8QA 4DCOB 1VK3A 4Z37A 4LF4J 1IKVB 5LJ5g 3BYPA 5KT4A 4LF6F 2DYBA 1S1XB 1KD1C 2C3YA 1K8AC 2EVRA 4A63B 2E1RA 3GFZA 5GAOq 5IT9U 3L7OA 4E0DA 1HNWJ 3CCMS 1TL7A 4QVZA 4CLYA 1M1GA 1S6QB 1NYFA 4NOYA 2ZZNA 2DBKA 2MZQA 3GCWP 2VBZA 3H8ZA 2OMLA 4TY8A 3A8JA 3F44A 1Q81U 3UW1A 3S01A 3V4IB 5GAGU 4PJMA 2SXLA 5KFEA 4KUDK 1PILA 2R8GA 2ZKUA 3MEGA 2D9OA 1V29B 3OYYA 3QKJA 1GMVA 4B17A 4ZPVR 4WTOB 2DB1A 1FXRA 2IMOA 5HSPA 2HFVA 3URGA 1U1KA 3SZ2A 3LAMA 3I4PA 1H8KA 2ZBQA 5IQ6A 2UP1A 5KG0A 3CQTA 4JJCA 4DSJA 4PKDB 4PUOA 3MPUB 2WHOA 1BQMB 5D7UA 4OI6A 4OIXA 4OMPA 4A48A 3OTCA 1RLQC 4OB1B 4OMFB 2V8GA 4OYWA 1RWVB 1RT4A 3Q1JA 2XY5A 1VR6A 1YIJS 3O1LA 3UN2A 2D3UA 4NXMF 5HMWA 4WYWA 4PWWA 4IO1A 4MAKA 1M1KT 3SBMA 2AZVA 4OYMA 3N6LA 4DFKA 3ENQA 2BEFA 5A8KA 4XQ3A 3ZTQA 1T3NA 1Y10A 3GF5A 3BV8A 4QIEA 4DEXA 1U1QA 4N4HA 3CXCR 2JTFA 3M8SA 1IKXA 4IFYB 1H72C 4O0NA 1WHKA 2M2BA 4K4ZA 2DXCA 2E66A 2NUZA 1V3ZA 1EARA 4RCCA 3KLEA 5HQMA 5C7PA 2UVWA 2HHQA 3GG0A 3CD0A 3I55S 1QY7A 2WSEE 2RB7A 2HWHA 5CKFA 1GBQA 4EO6A 2DGVA 3N9UC 3AAWB 3QSUA 1M8VA 4FS1A 1I3OB 3HFOA 2DTHA 1Y7PA 4M7AE 4OI1A 1BU1A 4N8OA 3PW7A 2ENMA 4C11B 5ETVA 3L42A 2L9DA 4O3PA 2CNLB 1C1BA 1IJEB 2W9CB 4YTLA 4G1IA 2ABLA 4JUVA 4F7VA 1WJQA 4C2MA 1BHNA 3IWLA 4PJOF 2VBXA 3JSBA 1IB8A 4BWJA 4DL0C 2FLNA 3C4SA 3JCMe 2EYZA 1QVFS 5HROA 1O8BA 4CLPA 2XYHB 3GSDA 1QJHA 2VGMA 1RU2A 3V6HA 4NLWA 4LDYA 2BJ7A 1CG2A 2XMVA 4NRUA 1UA0A 1SPBP 1QSSA 4LVOP 2OP5A 1CJUB 3JCMV 4EFAC 2MKSA 4QQBA 4Q0BB 1LFWA 2LDIA 1UJYA 4ATOA 2B9YA 1S0OA 4ZPAA 4DA4A 3LGHA 1WGSA 2J7IA 4DR7J 1FWZA 2QA4A 3HP9A 2YY3A 4C92D 4IG3B 3EUNA 1FNXH 2EVZA 2KK4A 2O9VA 1E6HA 1SV5B 4GLMA 4Q8FA 2W25A 3VGUA 4X4VA 3H42A 4A8SA 2KQWA 4M7DF 3DMJA 4O3SA 4UQGA 4R5PB 2GHWA 5HK0A 4J9QA 3ENAA 4WIQA 4OP0A 2J76E 4ZPTR 3G4SA 3IQLA 3I5AA 4NZ6A 4DU7A 3UNYA 2YKNB 3I9V9 3NMRA 4AYBD 4QWEA 1YN8A 3W3SA 5KCHA 2F1FA 4WKRA 4UUXA 4ZMMA 5EHHA 4MYUA 4UOGA 3VS1A 3CJ4A 3HFKA 1Q16B 1M30A 1NU4A 2QRRA 2ACMA 1XTZA 3DDKA 3CD6S 2YWKA 3MR2A 5GAOl 1ZHIA 5D6WA 2DHHA 2LQJA 3GR1A 3VGVA 4BBYA 2HW3A 4ID5B 1YFNA 1WSRA 1VQ5A 4DI6A 2P0QA 2Z2YB 4E7LA 2BANA 5F41A 1N5TA 1WNEA 2KROA 1TL1A 3E2EA 2XDPA 1KLNA 1H92A 4TLRA 2ZPFB 3HHLB 5DG8A 2C2KB 3VQTA 3LGMA 4TVRA 1VQLQ 2PUKB 2DF6A 2HS0A 3SFGA 4IOBA 3S8SA 1IKVA 2KRMA 3KWMA 2H5IB 4F7UE 1VQSA 5A2QY 2FB0A 1TELA 1SKSA 4PJLA 1O5JA 5FWCA 1VC6A 4I68A 2D8HA 4RUAA 2J8AA 4ITSA 4DDFA 4N7TA 2ZM6F 1VGYA 2AGPA 3QO3A 3HRTA 2LQ8A 2H48B 1S6QA 1NSAA 1BMQB 1BIAA 3PGGA 3HDSA 3V6JA 2HHTA 5LMNJ 2K2VA 1RAJA 2EPDA 3SWNC 3CJ5A 2L0AA 3V4IA 5CZVA 3DOLB 1SJ3P 4QW8A 2JEGA 4DV5J 1T0HA 2R7QA 5KFRA 2R7OA 2JFKA 2QFIA 4X65F 3PW0A 1ZUYA 2ZFHA 1BCOA 1YJ9A 2HKEA 3OL6A 2WVEA 3I5CA 2BQRA 2E1AA 2VF3A 3JB9D 3H5YA 3CXCA 1DTQB 2M1HA 3ICLA 3TEEA 2YKPA 3FGVA 1BQMA 2YXYA 3MAAB 4Y6IA 5AXLA 2RRNA 1A0OB 1PAUB 5DGBA 3D68A 2CP5A 2YRDA 2MZTA 1IVZA 1P6TA 2K3YA 3TAMB 3F0NA 2AGQA 1YG0A 1T3SA 3CCVS 4IYQA 2P4RA 4I6YA 5C2CA 4C0DB 1Q78A 1W1FA 3E2UA 4URQU 3PKMA 2B7BB 3CCRS 1VQ4T 1I07A 2OTLA 4QWAA 4L73A 3S1TA 5F0WA 5KYNA 2I2YA 2KXCA 1KP6A 5DZ6A 2YH1A 5J26A 4F0MA 3P8BB 2GQVA 2HFSA 2HK2A 4CLTA 1OZ3A 2LKZA 1Y4ZB 3TJ8A 3N5FA 3V81B 2DGXA 5LJ5j 2CZ4A 4IFYA 3Q0AA 4LR7A 4OJ3A 3M8RA 2AJFE 2QZ8A 2VYTA 4FBTA 1UAWA 1Y96B 2RK1A 4VUBA 4NA2A 3LA0A 2KM8C 2CPYA 5HLFB 3BSOA 4UT4A 4C5EA 4X4PA 2MMPA 3KG0A 2QDYB 1PKTA 1N6AA 3M54A 2PC6A 3LW5C 2ASDA 4NXNJ 3DGPB 1UETA 1JJ4A 1OI1A 5HJYA 3L2ZA 1UMJA 2HIYA 2RQWA 2XMUA 3OYEA 4C11A 3KXTA 3FDRA 2ATCB 1GBRA 5GAEI 4FXDA 3GBQA 1FRHA 3P6YC 1VQ6T 4J9NA 4ED7A 2CP0A 2OTJQ 1Q81T 1HI0P 1LNQA 2FHKA 4MMLA 1TKXB 2JC0A 2K8GA 4RUBA 3J7YU 2X3DA 2GJIA 1FX4A 2KI7A 4YDDB 4FYWB 4OJGA 2GMHA 1VMBA 3IRWP 2CUYA 4N0AA 2CUBA 1IREB 1YITA 3TVYA 1YI2S 2N82B 4M4ZA 3DDIA 2JVRA 2LT1A 1CJUA 2KRNA 2YSQA 1PAEX 4U7UD 2B8PA 4Q0BA 2WK4A 1VQOQ 2IY5B 2HHPA 4KGVB 4FS2A 2UUAJ 1KLMB 3JTNA 3DU5A 4M78B 4DV1F 1ZAXA 2C3OA 4F50A 3EAEA 2WAQD 1IBMF 4FL6A 3C2PA 4IG3A 5KFQA 2HFZA 4L3KA 5KH6A 2EEYA 1FVQA 1SV5A 1GX5A 1UHCA 3LLRA 1WI8A 1C4AA 4F36A 2JNJA 2W2PP 3R7BB 2KVQE 3QJYA 1IO6A 2DNKA 2HAIA 2HKQB 4R5PA 1U26A 4IUFA 4O3RA 2V2QA 2AYMA 5D78A 3KLVA 2IVFB 3DYAB 3LGNA 4QU7A 3CCJS 2QA4T 1DQAA 4XTVA 2MKYA 4TU7A 3AHUA 1AOJA 2YKNA 4PFZA 4M5KA 4DL5A 3GJSB 5ETKA 2ZJRQ 1D9FA 3ISND 2YX1A 3TX0A 2HNYB 1QM9A 4LF2A 4ZP9A 4B9NA 4Y3CA 4ECXA 1FFWB 1F6TA 2E41A 4J9DA 2X4XA 5FW9A 1SQFA 2COYA 4PJJA 2O4XB 1AWJA 5L8RE 2E29A 3G4ST 5EWGA 3OLBA 3CPFA 3C12A 6FD1A 5CD4H 1T3OA 2QDLA 2FJWA 5A2QE 1CC8A 1RAFB 4ZVTB 4UOHA 1BKBA 2YQ3A 4ID5A 4B3RF 5K8OA 2BQ3A 3AQOA 3C16B 3RW6A 5GVQA 3W5XA 2MLYA 1XMOF 4F25A 2PT0A 3GFXA 3HHLA 1N8RT 5GADI 3I56T 5EWFA 2WBMA 3HK2A 4KT0C 2ZH7A 4LFBF 1SC3B 2GFFA 4MH8A 4PWDB 1T9UA 4V19J 2IDLA 3JCMg 4LR8A 2DL4A 1IR0A 1Y3KA 4MIBA 1B0VA 4UUWA 2BA9A 1K9AA 4TU8A 3CBPA 3A8GB 2QMXA 1WDXA 1YCSB 2B4PA 2FZKB 4CCHA 1FYNA 5BR8F 2A10A 2V0NA 3EHRA 5L1JA 1X4AA 1N33J 3M59A 4PXCA 4X4TA 2O88A 4RNFA 1X4DA 1X0FA 3MP6A