4ZN1A

Crystal structure of mjspt4:spt5 complex conformation a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
138
Chain Sequence
MIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTPENIEKGDVVEIIAPFKGERAKVIRVDKHKEEVTLELENAPIPITLPVEGVKIVSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription elongation factor Spt5
publication title Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
total genus 25
structure length 138
sequence length 145
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zn1A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 4zn1A01
3DB3A 1YJWT 3I55T 1YJWA 2KDSA 3PIOA 2JNGA 3I55A 2MWPA 5FLXE 1XTDA 5DM7R 1Q7YC 1JJ2A 2LVMA 3G4SA 5J3BA 3ER0A 1KHIA 2LCLA 1YITT 3QQCD 1YHQA 1K8AC 4ZN3A 1Q86C 1YITA 3CPFA 3OYYA 1Q81C 1Q7YU 1BKBA 1VQMT 1VQ6T 1QVFS 3CCRA 1VQMA 1VQ6A 1X6OA 1K73C 1KD1C 1K8AU 3H7HB 1Q86U 3PIPA 1UEBA 1VQNT 1Q81U 3DB4A 2CKKA 1VQNA 2G3RA 1NJIC 1M1GA 2JOYA 1JJ2S 1K73U 1VQKT 2E70A 2LQ8A 1KD1U 2KVQG 2JUFA 3G71T 1VQ8T 3CCQT 1VQKA 3G71A 1NZ9A 3CCQA 3CCLT 1NJIU 3CCUT 4QQDA 3CC4T 3CCLA 3CCVT 1VQLT 2MWOA 3CCUA 3CC4A 5J26A 3JAME 3CCVA 1VQLA 4RG2A 3G6ET 3CD6T 1EIFA 5LL6S 1N8RC 3CD6A 3KBGA 5HY6A 2OUGA 3I56T 1VQOT 3CC7T 3OW2A 4ZN1A 1VQ7T 3I56A 3CMET 1VQOA 3CC7A 3CMEA 2QA4T 1RL2A 1QVGS 3EWGA 1QVGA 2QA4A 3CXCA 4CRIA 1N8RU 3LGLA 1VQ9T 3HKSA 3CCET 1VQ4T 3LGFA 1S72T 1M90C 1VQ9A 3CCEA 1VQ4A 1VQ8A 1YIJT 1S72A 2DO3A 1YIJA 1NPRA 3CCMT 3A5ZB 3J80E 2EXUA 3CPWS 3TREA 3CPWA 5IT9E 3J7AF 4TVRA 1YJNT 3CMAT 5DLQE 3J81E 2L3RA 1YJNA 1W2BS 1M90U 2OTJT 3G6EA 1NZ8A 3CMAA 1W2BA 1M1HA 3CCST 1NPPA 2OTJA 3OW2S 2OTLT 1YBYA 3LPEA 3CCSA 1Q82C 1M1KC 2OTLA 3G4ST 3P8BB 1KC8C 1K9MC 1VQ7A 3CCJT 4X34A 1YI2T 2XHCA 3CXCS 3CCJA 1YHQT 1KQSS 2E6ZA 2MI6A 1YI2A 1KQSA 1YJ9T 4YTLA 1XNIA 1YJ9A 1IZ6A 1VQ5T 3CC2T 3DLLA 2K06A 5A2QE 1VQ5A 3CC2A 1SSFA 3LH0A 1Q82U 1M1KU 1KC8U 5IAYA 1K9MU 3CCRT 2IG0A 2QEXT 1QVFA 3CCMA 2QEXA 2JVVA 1VQPT 2EIFA 1VQPA
chains in the Genus database with same CATH superfamily
3QYYA 1J27A 2Q1LA 1U45A 1BWVA 3HLUA 3CD7A 1UPMB 2QLFB 4QWAA 3URGA 4EPCA 2BIVA 3PO4A 5EN1A 5KFIA 2CS7A 4X4NA 1L3TA 1PWTA 3DOMB 3DRRB 3NTKA 5RUBA 2IHR1 2HKQB 1NXIA 2KR3A 1TU0B 2DPJA 4BBYA 4DWIA 3QT8A 5HVGA 2FZCB 2P9EA 2P0QA 2A3JA 4PNOA 2CT4A 2AZSA 3S7RA 3TVYA 2PN6A 4OV6A 2D7SA 2OX7A 5D7UA 3W9IA 1B7YB 1XERA 3WC2A 4FS2A 2QI2A 2ZUGA 1REVB 4AT1B 4LQ9A 3CMET 3GG1A 4LF5J 2EQUA 4AFSC 2CPJA 1ZHIA 1S0OA 1B7FA 1FRKA 3MM9B 2DBKA 2V8HA 5D0GA 3TARA 4DBQA 2DGOA 1YDLA 2VVKA 4M5LA 2RO0A 4FN5A 2F63A 8RUCA 2ZAEA 2OTLA 1FRMA 2WCXA 3H5SA 1B34B 3FCHA 3TX0A 2LU1A 4J9KA 3A3OB 3S6EA 1NPKA 4K4SA 2C3YA 3MO8A 2VWFA 3OL7A 3KK2B 3O2IA 6FDRA 1TXQA 3VRYA 1VBXA 3MEGA 2P6SA 1NHUA 4PJOD 4WP8A 3WXMB 3DKDA 2QYGA 3MECB 2R58A 3M8YA 4M5NA 5F8LA 2K5IA 1CJVA 4Q8FA 2DTOA 2NYSA 5KFDA 2KRMA 1PBAA 2AZVA 1JJ2A 5F8HA 2GJIA 4LD6A 1UW9A 3I82A 1C4CA 3BGOP 3KUEA 4YEAA 1VQMA 1N33F 1FTRA 3PJWA 1SV5A 4AQYJ 1LOJA 2CVIA 2ROGA 4LDXA 1YBAA 1WEYA 2WVEA 1ZPWX 1S77D 2LRQA 4CLYA 1JXVA 2F5KA 2YNHA 1OZ3A 2B9WA 3JYTB 2QMUB 4B6MA 2HNIA 2WSEC 3PYEA 1G3OA 1KKHA 3RAQA 3R6OA 3OW2A 1B07A 4NI2A 3WZ0A 2EYWA 4MK9A 2RDDA 5GADU 3KMQA 1V9OA 3J81j 2HNZA 2R2RA 3PX6A 2YLCA 1S72A 4HT5A 4R8UA 3QJLA 3DOLB 2YPZA 4CO0A 4F7VA 2MLYA 5IV4A 2YXLA 1DQ9A 2HMIB 2D9TA 1ZBTA 2HVDA 3ILJA 4FW2A 5EG2A 2OTJA 2AYBA 4HTJA 1XNQJ 4MMLA 1N0VC 4RTYA 1DRZA 4R0EA 1IZ6A 4F36A 2VPYB 2FC8A 3ZNJ1 3MEAA 1ZM3A 4II1A 3TRGA 3C46A 5KFHA 1FDNA 5IZHA 4NOHA 3L95X 4F8RA 3SSSA 5LXYA 1XTDA 2ZC4A 2HZCA 2F5GA 4OYPA 2IVFB 2WSFC 3WQPA 3EVOA 2ZD1B 3FC9A 3SCIE 1OQKA 4WFBQ 2MZTA 4YHHJ 3GFHA 1S1VA 4KKOB 1WTBA 4DPUA 4O4RA 3SWNC 1RTJA 3AJDA 5JVGQ 4C0GA 1H6KX 4B9VA 1FFWB 1SJFA 3FMBA 1M8MA 5SUHA 2M3DA 2LTOA 2VUGA 1VQ8T 1YLXA 2WZ1A 4NCGA 4OGCA 2XY6A 4RBVA 1IKXA 4DF8A 5I4MA 4KULA 3NGTA 3DGVA 1KTQA 3BGLA 2F65A 4JI4F 1VQ7T 3K7RA 4RPFA 3R9LA 2BMBA 2DRAA 2B5JA 1Y9OA 2IYIA 2MPXC 3EZOA 3BKFA 2HRUA 2EJGA 1WKLA 3CPWS 3AFGA 4W4MA 3ZZ0A 3G6XA 1P9QC 1AHJB 1ZSZC 3OYLA 4Y92A 1ARKA 4ZS6A 1SKUB 2QA4Q 3M8RA 4RNHA 3ZO7A 3R7SB 4K59A 3GE9A 3VF0B 2PFDA 2UXCJ 2D1XA 3C6TB 1N5VA 2KGTA 1Q82U 1Y0HA 2C2MB 3RGIA 1S99A 3H6ZA 2ABYA 1UG1A 2RUGA 1KG1A 2Z4PA 2NPFA 4JI0J 1N0UA 5A8KA 5KG3A 5KYYA 4HTIA 3L7PA 1ITPA 3I0SA 3EGUA 1TMMA 2HGMA 1QVGR 1RT1B 2K7JA 4LMZA 3EFOB 2LQWA 3H25A 1U1SA 2NUPB 2YH0A 1DLOA 1IBCB 5BR8F 2IDLA 1RAOA 1JLAB 3V6HA 1JJHA 1MROB 3TQEA 5HQ8A 3M59A 1CJKA 5LMNF 1B0VA 4O4GA 4IRCA 5I3UA 2XULA 1QVPA 4OZ3A 2B4PA 2PI5A 1KC8R 1RU2A 2KQWA 2LT4A 4LR7A 4NCGB 3MURP 5BJRA 4WF9Q 1IKXB 2P6TA 2VKNA 3GCXP 3MCAB 3QZ9B 2F5TX 1WOOA 1VRUB 2VFRA 1YTYA 4IUFA 4CO1A 2YBVA 2HPUA 3SCJE 2V1RA 2DCLA 4BDPA 3NOGA 1U8RA 3V5RA 1S6OA 2YX7A 3OTDA 4ER8A 4M7AA 3JCMb 4L6V3 1LWFB 3HP9A 3C15A 5C42A 1M1KT 3MMCA 3NBPB 3SI8A 1YI2A 2CIMA 5KH6A 3EYZA 1YWPA 4FL6A 2A08A 5J2PB 1JRIA 1XC9A 4RBTA 1XN9A 1F5BA 4XO0A 3IC1A 2UUCJ 3IBCB 4JI8F 3PEJA 2GGPA 1MGQA 2M52A 4DFPA 4OX7A 1VRQC 5A8KB 3BSCA 3GU0A 1SQEA 4PJOE 5HROB 1PAEX 2P0KA 4AYBD 3P96A 1U5SA 4NS5A 5J2NA 2GIRA 2LJ3A 4HKQA 3I35A 1E6GA 3KUFA 1IBKF 3PM9A 4AG1C 1IGUA 3ZZYA 2LDYA 1Q0NA 4OB2B 5HJXA 4KSEB 4ESRA 4P7VA 4J7IA 3VAKA 3QZ8A 2LX9A 2KT2A 1CJKB 5KFLA 2HBZB 4DEYA 4LSZB 4P72A 3CC4T 1WNEA 1S6UA 2L5QA 1MWQA 3OUYA 3SSRA 2FLPA 4WBFA 4WIIA 2QX0A 1UVMA 4DI6A 2HGNA 1U49A 1PYSB 3H2UB 1T9UA 3H4BA 2XNRA 2XY7A 4RW6A 1VQLQ 4F0MA 4LRBA 4LFCJ 3DCAA 1HNZF 2BW7A 4Q2LA 1W26A 4CH1A 1EQ0A 2HQGA 2VQEF 3NG8A 2J7KA 4ZPBA 1FYNA 2K7KA 2AKKA 4GVBB 3OYGA 3QJJA 3CC2S 1S6PA 2C2ZB 2COZA 1WQ7A 4ZIVA 1RU1A 1ZX6A 2RHZA 4FYYB 1R27B 2KRNA 3H0HA 2FHJA 1VQYA 3FEOA 2F2VA 5CKFA 5B0CA 3CPFA 4M94A 2YKMB 3NNAA 1WHGA 4DFKA 3SZ2A 3D7SB 1C4AA 3V81B 2SXLA 3JCMd 5A0DA 4ICLB 5D15A 2NS1B 4XU3A 5HMXA 1X8DA 3BYPA 1AD5A 3U27A 2LZ6B 1VQKA 4ZVGA 4IH7A 2LLZA 4B9XA 3S3MA 2QASA 4RG8A 2YX4A 1RA7A 4A8MP 3KXDA 3PZPA 4USKA 5L1KA 4PJOC 3FJ5A 1S49A 4NLVA 3Q8PB 1QVFR 1GX6A 3KTQA 5GAN4 1Q4RA 2DTJA 4LNPA 4FPRA 1UGSB 4K4WA 1VQ9A 1S57A 4C0OC 3KFVA 2R2UA 3MPDA 2X4JA 3C6UA 4DR7J 3HCXA 4J9RA 3CMAT 2AT1B 4QIFA 4RUGA 2QV6A 4B3SJ 1RT7B 4C11B 2EFIA 3RUBL 3OTCA 5HP1B 3LP0B 1NDKA 4OMQA 1YRUA 1JXOA 5IAYA 4O3PA 3G96A 2D9PA 3RTVA 3RNJA 1HMVA 3GLJA 4KHMA 1IUJA 3M2RA 3MEDA 2R2TA 3PIOA 5KFYA 2F2XA 2BJ7A 4LREA 2VB6A 1OPZA 3M6XA 2KYMA 1FERA 4ZVEA 2HL5C 1VQ6A 4ZNXA 2ZBCA 3ZL7C 4G1QA 3IXQA 4IFVA 3QUIA 3D28A 3OYCA 4CLSA 1SC4B 2VGMA 4YB6A 3GFZA 3CPWP 2XI3A 4AL6A 4X4RA 2HSPA 2DBBA 3OL8A 4L75A 3HK2A 5KG2A 3L2ZA 1R8BA 1T9WA 1LFWA 4Q5WA 1BQMA 4DR1J 2F4VF 3CJ0A 1WXTA 2HK3A 3I56T 2N82B 1K1SA 4L3NA 1NDCA 3QSIA 4J9IA 1QKXA 2B8AA 1K1QA 4NPOA 3OJSA 1M90C 1T02A 4JI6J 4IQXA 3F44A 3NY0A 2BKNA 5DS7A 1NM7A 1WI8A 4AFZC 4XU1A 4NLSA 1GFWB 3K17A 3H8YA 4DOWA 4WXOA 1FX4A 2CQ3A 1V76A 1RWNB 3IP0A 3QJ6A 1HK9A 2LCSA 4IDKA 3SDEA 2HVHA 3V8JA 3JXOA 4RR5A 3C94A 4M7AD 1SC3B 1XNRJ 1BB9A 1MV0B 4OLOA 3G6EQ 1EB0A 5KE2A 1T0TV 1XBWA 4Z88A 3THVA 1BXNA 1HMVB 2KG0A 5FLXE 3M2RB 2MQ8A 2ZFHA 3V6DB 3VYGA 4NE9C 4B9LA 1WDXA 2PVGB 2HHUA 4D8DA 5D0EA 2GVDA 4AL5A 1MV3A 1HYOA 4LDYA 3RR6A 1PYOB 4F4YA 4HA8A 3BR8A 2O9SA 2FHDA 2L8DA 2JOYA 2LQ8A 5KFOA 4OX9J 5HMYA 4JI1F 3MAAB 5DRKA 1F1BB 4PYDA 3KJQB 4QQDA 3VYHB 3CBPA 2BDPA 2DNLA 3OSSC 2RHYA 1U2FA 2GMHA 3PCOB 2VXFA 1OQ6A 3ENVA 1W2IA 1K76A 1WLPB 3UE2A 3HSBA 4MKVA 5K20B 3JSCA 4M7AF 5D8HB 1X43A 1DQ8A 4K0KJ 4XU0A 1DURA 4PUOA 1PSFA 3HHLB 2HW3A 3CCUQ 2E1CA 3VV2B 3CCMT 4NXNF 2MIOA 3QT5A 1X5OA 2CP7A 2P2CB 1PYTA 1OS5A 3A13A 1VBKA 3TAMA 2XI2A 3UVJB 3WHIA 3ZTSA 4GKJJ 1FJ7A 2UV8A 2BKOA 2KXDA 1PC0A 2J9DA 4WXWA 2EGAA 2CH4W 3MMAA 2E29A 3OYNA 2R42A 4B9MA 3VS5A 3SDEB 2HBRB 1REGX 2HIQA 4PG6A 2AK5A 2V68A 3Q8UA 1OYXA 3TEGA 2MWPA 4RX6A 2IPOB 3G4SS 2QMXA 4J9BA 4ZLJA 3PEHA 1FFSB 3MM6B 3J80U 1S0NA 1K44A 3QT7A 3H42A 4HCCA 2EPIA 9RUBA 2IAJB 2QEXQ 2DGQA 5GAMf 4WE1B 2YKOA 3GF5A 4ED8A 1RTIB 1BI0A 1X7VA 1ZYQA 2FHJD 2EGCA 1NJXA 2J0WA 1QSLA 4LRFA 2WHOA 4PAAA 1P9YA 1NZ9A 5L23A 2XIDA 5KFXA 2ACYA 1WIEA 5DGBA 1YJ7A 1FRHA 5KFBA 2HHWA 3FZBA 2XY5A 2RQTA 1NK7A 3H0FA 3G71Q 1AUDA 3LGFA 4FNHA 2CPFA 3X20B 2DHSA 1YJNT 1NK0A 3BM7A 1S9EA 3Q2SC 5FWCA 1N4LA 1KSWA 4LF8J 2XBPA 3CMES 4NYZA 3VS2A 5KFMA 2LQ9A 5F41A 2RJDA 3RW7A 2FY1A 1NEBA 2AX0A 1OV3A 5HKCA 4Z2XA 3MMAB 2PIIA 1URRA 4RTXA 1TUWA 3Q8VA 2WW8A 3KOAA 2DH7A 4LR8A 1Q7YC 2ZVSA 3EG9B 1PKUA 1Y5LB 2HYIB 3CUNA 1KHIA 1PCAA 2VPZB 4R5PA 3VWSA 1AA1B 2XMKA 3B82A 4XK8E 1IRXA 3J81Y 4HEA9 3RDVA 1G3WA 1X6OA 3M05A 3S01A 1GX5A 2DXFA 4DUZF 2HQCA 1M1GA 1U8WA 1X4AA 4IG0A 3DLLQ 2D41A 2K8GA 2HNDB 3V4IA 2ESWA 1Q82R 1G3SA 1QP3A 3T5HA 2W4CA 3RAXA 1S12A 4K4YA 1BMQB 2YWFA 5ETQA 3NS7B 3D3BJ 2IIHA 1SHGA 4ETXA 2BA9A 2MDAA 5LM7E 1RWVB 5IXBA 5KG7A 4DG1A 3UWNA 1W70A 3SDZA 4J9VA 3UN3A 2EQIA 1U6BA 1GMWA 3BFMA 3FUYA 4TYBA 3RRKA 4RNFA 2C1EB 5GANj 4H4MB 1S4EA 2O01C 5K8PA 3PE0A 3ZBDA 2GAHC 2Y9HA 3H41A 4CLWA 3RIRA 3IS9A 2GW8A 3CW2C 3I4PA 3VAIA 1JJ4A 2UXBF 3NMAA 1X4EA 5KTQA 2ZM6J 3ER0A 4M7AE 3QGHA 2E1MC 5B08A 1W1FA 1WXUA 3HVAA 2EFGA 2R8KA 1YITA 3MHYA 5LJ3j 2HRTA 3CQTA 2KRBA 3AXMA 2HGLA 2D69A 4M75G 8AT1B 4N8OA 2DAQA 3UDLA 2KAFA 1E6VA 2M9KA 2GO8A 1FX2A 5B09A 2B86A 2R2SA 3L3CA 5C25A 4KGMA 2GTOA 1UEKA 5E3QA 3VZIA 3P5TL 2KYBA 2DL8A 4M7DA 3VAMA 4WTYA 4ZOSA 1ZAVA 4URQU 1RHMB 3PTWA 1NJIU 4IG0B 2YNFA 3J7A1 3N01A 4OMNA 4N41A 4RG2A 1C0TB 5LL6S 1N8RC 5HCKA 4L73A 3MKDA 5KG5A 2OUGA 2W2MP 2F69A 1PO6A 4L72B 3WDOA 4FIBA 3GTYX 2L3PA 2DM1A 4J9FA 2VQFF 3NXZA 2V63A 2FEIA 1VQ8S 1P92A 1VQ4A 1IKVA 1FTCA 5E5NA 3J7AF 4ZLNA 4IG3B 2HKEA 1FXRA 4K2JA 4KHRA 2E7VA 2HS0A 5ADZA 2OTLT 1NH7A 4NA3A 3RR8A 2LNHB 1VQ7S 4EMKA 1VA7A 1KQ2A 4K11A 3LWHA 4OI6A 4OGEA 2IVWA 4ZVUB 4PJJA 4IUVA 1ZH5A 2JN0A 1VQ5S 1U1OA 1YNZA 3SV4A 4DSLA 4C0DB 3TWZA 3T41A 1W25A 4WYLA 3TA2A 5L8RE 2YUPA 3A1PA 2DGXA 4DUYJ 4ECWA 2Q79A 5A8RB 1YVFA 3T6BA 3R5DA 2NXEA 4X62F 5I21A 3FKBA 4ZPDA 1VQMT 1V3ZA 2KRRA 3PY8A 2QDYB 3MM5A 1QLNA 5HLFB 2AGOA 2W4PA 1X01A 1SVDA 1MMAA 1Z4UA 4F67A 4HACA 4DV1F 1QW1A 1D3WA 4E7SA 4DHVA 4Y34A 1Q7YT 5B0FA 4DR5F 3RJMB 4NXMJ 4K7QA 1JXEA 1X0PA 2FJAB 4M7AC 4R55A 2YNFB 2PMHA 4IUUA 3M57A 4HH0A 4G1PA 2GVZA 1S6QA 2DA9A 1Z9QA 4C8QG 4YY3J 4HCZA 2JFDA 2J7UA 3LGLA 5A2QU 1TS9A 4BACA 1S72T 1H3ZA 4PQUA 4IYQA 4NLXA 1K9MR 1FD2A 4FZVA 3EFRA 2DD8S 2WONA 4N56A 2AGQA 1IXKA 2HBPA 2OTJT 4LXCA 3Q83A 2WSCE 2VG6A 2COWA 1F0XA 1S4FA 2AGPA 1NYFA 3FBCA 4ZLLA 4FKXA 3QLHB 2I6WA 1VQSA 2RI2A 2PC6A 4H4KA 4JI7J 1ZBJA 2J6TA 3ZEHA 4USHA 2P5VA 1RLCL 5FU7C 3FEYB 2DRDA 2GMLA 3M0SA 3BW1A 2YQ0A 2G1DA 2DIGA 3OYYA 2DILA 1JIHA 5I42B 4KO0A 2GNKA 3AB2B 1K73C 1HBOB 2WAQD 4KFBB 2WOMA 2HQIA 2AJ1A 1FK9A 3L1AA 4JLGA 3AODA 1C1BA 5L8RC 3UD4P 1RAFB 4NZ7A 5GMKm 2Y90A 1WQWA 4ID5A 5I3QA 3VALA 2CJAA 5I11A 2FVQA 3ASKA 1UJ6A 2W2QP 3IR7B 3ZC4A 2ZNYA 1JLEB 5M2PA 4ALZA 1S6QB 3PFOA 4XTTA 3RKWA 4OZLA 2EYYA 3DLEA 4PG8A 2MXYA 3CJQA 1ZM4A 1UGRB 1U47A 4PQUB 3CC4S 5DLFA 1OIAA 2WONB 2HMAA 3M6WA 4WFZA 4LBHA 2GIFA 1RT5A 2VJUA 2BV3A 1D1BA 4X4SA 1EJ7L 4J9NA 1IKYA 3UNGC 4YFUA 5CIUA 4QWBA 2YWWA 4EK2A 2XK0A 2IMWP 4Z7YA 2X35A 2G2OA 1GMWD 2BJ8A 2GJFA 3RMSA 4A4JA 5LOQA 2ASJA 2K1RA 2QSFA 4FBTA 5E41A 1RZMA 1PBUA 3META 2KEAA 2JNJA 5CKBA 3CC2Q 1N27A 5LSOA 3HX9A 3LALA 5J1NA 4JLIA 4ES3A 2DGVA 1BC6A 1OU9A 1T9TA 2EI5A 4DQPA 1I94F 5FJ4A 1KD1C 1HR0J 2WOMB 3GJRB 3QBYA 2MK5A 3A1YG 2HK2A 1HNIA 2FRWA 4LRDA 4ZTFA 4FF3A 2MKSA 2H48B 2CZ6B 4QWEA 3HHEA 3V8LA 1MN9A 2RF0A 2BANA 3TZYA 5T7LB 3IWXA 1WHKA 5A8WB 2NXJA 4X66F 5LJ3g 2QN6B 1N33J 5D6XA 5CH7B 1CQNA 2MGZA 3E2UA 3QMQA 2KSSA 4YS2A 3EVWA 3RW6A 1Y57A 4CZCA 5ETNA 2WTFA 3TJ9A 4M7DD 2R8HA 2QA4A 1L3UA 3TEEA 1AT1B 4CO3A 4CLZA 4X4OA 5CYJA 1H38A 3VAGA 2MQLA 2JS0A 4ZVRB 1WHJA 4OB0B 3D1OA 3PV8A 2VC1A 3DLEB 2E9TA 2KHDA 2HHHJ 1OYDA 2DKGA 1U1RA 2EBPA 1YI2T 3CXCS 2DXDA 1NB2A 3T3FA 4MYTA 4ZJOA 1IREB 3DXSX 4ED5A 1VGYA 1M9SA 3ZTQA 4Q44A 1JNRB 3ET6A 1U2RA 3UPFA 5GMKe 3PMIA 1K8AR 5JXSA 2QTVA 3CMAS 1IBLJ 2ENMA 4UQGA 5H9EK 1Y0MA 3IRXB 1XQHA 2NZ4A 3CGIA 2VBYA 4DDFA 2Z56B 3CO0P 3D5MA 1XR7A 1M27C 4U95A 1OI1A 1BHNA 2HZAA 3PRBA 4CC3A 4RTZA 4U67Q 1ZA1B 2J9DE 4OYWA 5FRNA 4P75A 4ECYA 2DEQA 1HI0P 3C14A 1M5Q1 1R77A 2W1BA 2Y4YA 3M55A 4C0ZA 1IGQA 4QVCA 1Z2ZA 2DRKA 7FDRA 1K73T 4I67A 4J6WA 2CH4A 2YRVA 1T9YA 4K8RA 1D9DA 4CRIA 2UP1A 1APSA 4C6AA 3OSPA 3M4GA 1D0ZA 3M4XA 4DL2A 4DL4A 3T1HJ 2X4YA 3W65A 2O67A 3IWNC 4KTQA 4B9TA 3KLEB 2YRDA 3KLHA 3EPIA 1HD1A 3TSWA 3I56S 3JB9D 1GXLA 4QOTA 2HQXA 1TL1A 2UU9F 4C0HA 2J6FA 5GMKh 2VG7B 1H98A 2ZKUA 2IDEA 1T7PA 3UDCA 4RW8B 1M1KU 3W62A 3W2WB 4FF4A 3E8OA 4LBPA 5GAOm 1W6XA 4RUCA 3NTHA 2P84A 2JOQA 1K47A 3RUXA 4IRKA 2A2DA 2OAUA 1IKWB 1PC5A 2OPRA 5I3PA 3NNHA 3J80Y 1KQKA 2OEJA 1ZETA 3MP8A 1U24A 4UT4A 1B0TA 2QTXA 2EFNA 2EKNA 4OYMA 4KT0C 2HNYA 2FYKA 3NGPA 1VJQA 4RTTA 3OR2B 5G0RA 2MLXA 1VQKT 1VK8A 1BQXA 1M3BA 4EZ6A 2OMLA 3JB9F 1WJQA 2HWTA 1SSHA 2NZCA 3OYKA 3K0JA 1VQLA 1LK7A 2RK1A 4DLEA 1DFDA 4LF7F 5BR8J 3KBGA 1QLYA 2KB2A 4C8KA 2MZSA 3RZAA 4HDGA 4P73A 3O5TB 1TL4A 3OYMA 4ES1A 3AAWB 2AP6A 5LMNJ 1VQ9T 2E65A 4I2PA 1BQNA 5D3GA 3QZ5B 3M8SA 4PG4A 4QW8A 3KLGA 2BJ3A 4KV8A 2HEKA 3PFEA 3F0NA 1UAWA 1WD6A 1F5AA 3B4MA 4AD6A 2MKKA 3EMTA 5BXIA 4AQYF 2L89A 1N5YA 1WORA 3C4SA 1NUEA 1FRLA 1WI6A 1IQTA 4C8ZA 4OIXA 1WELA 3CCEQ 1LVKA 5HAOA 1PG5B 2E12A 3LH0A 1RTHA 5C7PA 4MIAA 2PMZD 3CCMS 2ROEA 4Z37A 3VR1A 5HK3A 4UUWA 2HHTA 1SL1A 4X4TA 2L2PA 1E7OA 3MR7A 1U1QA 2ZNZA 4NX9A 2E1HA 4DZDA 3DRPA 2X1FA 1M5OC 4BDZA 2DGWA 3LH5A 4NMXA 2BOAA 4NLDA 4ECTA 3D1QA 2H5EA 3OVBA 2VG5B 3UCZP 2DPIA 1VQ6T 3OT9A 4OI1A 1NKCA 2FVSA 4PFOA 4HXJA 2E5LF 2EPDA 2BX6A 5BYSA 2G3RA 3G4SQ 1JXMA 3SD4A 2B9XA 1LNXA 4MZTA 2LDIA 2HHSA 4LRCA 1JLQB 4LSNA 1VHFA 2LQ5A 3BGFA 3PX0A 4RUAA 3BV8A 1QQJA 2QJ3A 2F8EX 3G82A 3KK1A 4NLQA 4TN2A 3O6QA 4J37A 1B7TA 4ECRA 4ZVHA 3ETMA 2CNNB 2UUAF 4YHHF 2MAMA 1KS2A 2XMTA 4M7DE 1G6BA 3HFKA 4KV8B 2NUUG 4JI3J 4X34A 2IM2A 3HT3A 1N5YB 1YJ9S 4X4QA 1NJIR 2PO4A 3A8LB 3A98A 3LGNA 3QIPB 2PGCA 1NE8A 1N6AA 2VL1A 4QCLA 1PKSA 1HNZJ 1YJNS 3NS6A 1WPYA 2YNGB 3RU0A 2AEJA 1TH7A 5KCHA 4NLTA 2VQEJ 2VU5A 4WU2A 3D2WA 5KFAA 3BO3A 3BN7A 4NLYA 4QR0A 3LUYA 2QGGA 4KRTA 1T3LA 2ZHAA 2OD4A 4Q5VA 1N9RA 4LF1A 3N4WA 4HKEA 3R7BB 4WF2A 3TJ8A 3I55Q 3HVTA 1RE1B 1GCQA 4U8YA 1SI9A 3R3TA 4DCJB 4AL7A 5IC4B 2UXCF 2Y0SD 2F9DA 2X3XD 3RB4A 2KI2A 5IM0A 3W8GA 2RN8A 2OSQA 3C16A 3KHGA 4DR3F 1UJ5A 4DQQA 1CPZA 3CXCP 3MR2A 2A37A 3DXBA 3EVMA 1HL6A 1T05B 4JI0F 1RKIA 4H54A 3E01B 1RLPC 3CMQA 3M8PB 3NLCA 3QO9A 1U8SA 3KK1B 4FM4B 2BYCA 1KQGB 2ADBA 2KZZA 4BUGA 2JXBA 3OYAA 1WOSA 2YUQA 2B4OA 3G6EA 2XMWA 1MWZA 5LJ3Y 4M5MA 4RU2A 3P49B 3GWCA 1Y07A 3Q89A 3AD8C 2ASDA 4CLPA 1I8FA 3L2QA 4WFXA 1VR6A 1SIZA 3JAMU 1Q16B 3MFHA 2DTHA 2QQBA 5GAN8 4BY6B 3KJFB 3LGMA 4DL5A 5L38A 3ZXWA 2ED1A 2OI3A 1HQEB 4XAKA 4M7DC 1PJ6A 5A6PA 2CQ1A 3LH2S 1JLCB 5HMZA 1WEXA 3TX8A 5CQGA 1T03A 1VYUA 5E0OA 3D67A 4M78C 4W92B 3I96A 1YJRA 4DV7F 3UD5A 4EYHB 4WKRA 2VFVA 1XOVA 1PCXA 4G1IA 5KYWA 2UVUA 3I5SA 3DGPA 4ZCIA 2CQCA 1S1UA 3HVTB 3HFNA 4C92G 1DTQA 1ZUKA 1LW2A 2GFUA 1VHIA 5LT5A 1VIEA 3CCUA 3FVYA 5CYMA 5C0MA 2HKNA 1DHMA 2UUCF 2ATCB 2O5DA 4EMKC 4DPWA 3DFEA 3ZZTA 1UZHA 3GYNA 1EX8A 4Y91A 2M0YA 4URGA 4DR4J 3SQGA 1R8PA 1WWHA 2E64A 4C7QA 4TVRA 3NCPA 1TL7B 3LP1A 4LUDA 2MLZA 1R31A 1O6XA 3U1LA 3EG3A 2J0XA 1NSKL 2YRCA 4C5HA 4QIGA 2E41A 3HRSA 5C5JA 3T9NA 3UF4A 1VQ8Q 1BBZA 1N56A 3QWYA 1SCJB 1AVZC 3GSIA 5DQIA 1T9VA 4WCIA 2EW3A 2NXUA 3C66A 2QEXA 2CZ1B 5THWA 1SUQA 1U7LA 1T8EA 4F3OA 1VQ7Q 1KIKA 1JEGA 2OTLS 2GMJA 1PIEA 4RNOA 4CI0B 1VQ5Q 2KM8C 3FFIB 3U1MA 1JXLA 4M77A 1VIXA 1T03B 5GAOp 1KOOA 3TZXA 2ZHBA 3BSOA 3UATA 3HRTA 1CS4A 3IBFB 1JJ2S 1V3RA 2MMYA 1Z9ZA 4UY8T 3G71A 1S1UB 1H8KA 1DTQB 1H3DA 2RMOA 3THKA 3FQLA 3G87A 2VODA 3L7OA 3PX4A 4TQRA 2E7XA 2V5HG 3K5MA 1S59A 3CC7A 3OLBA 1X4GA 2VFSA 1RBAA 3HKSA 1NK9A 5ITHA 1BCMA 1E6YB 4H4KC 4M1KA 5HMWA 4IURA 1D3BB 2W0ZA 2MY8A 3SXLA 1TZ0A 3FBBA 1UFLA 2XHWA 3Q2TC 5D77A 3OW2S 4QIVA 3LW5E 1F2GA 2K2MA 1IBMJ 1FCAA 1YHQT 4UQTA 3B4DA 3SSQA 2DEUA 1S72S 1RAAB 4RW9B 2EG1A 1M2OA 2RF2A 4NXNJ 3FSXA 1RK8A 3PW7A 4C0BA 2CPDA 4C8NA 5HBMA 2I38A 5GAMe 3TP2A 1PRMC 2JX2A 1YITT 3KLIA 3CT9A 4JV2A 1UZDA 4DR7F 4BWJA 4X64J 2B6AB 4GRSA 2C3UA 5CCAA 2H9ZA 3UCGA 2Y3YA 1P6TA 1O9SA 4PK4A 3OQ2A 1CS4B 2O1PA 1B99A 4B3OB 4DPTA 4G6VB 3D6FB 1SC6A 1GK8A 3BY7A 3N5BB 2HAIA 1P8GA 2BVZA 4KBMB 3OFGA 1K0XA 2ED0A 4LVNP 4EMGA 2JTFA 1QVGS 2EYQA 2ZDPA 5KFWA 3MCNA 1XTZA 4USUA 3LQVA 1VQ4T 2UUBJ 4Y6IA 4JRIA 4HVZA 4IUTA 4ECVA 1WYXA 1SKRA 3DC2A 4AXIA 3QGPA 4CWBA 1RCXB 5KFPA 3J7YI 5DGAA 2W9BB 1YBYA 3G1JA 1KC8C 1UHCA 3X1LB 4QW9A 2VFTA 4RUBA 2ZBRA 3QNWB 1JKHB 2EWNA 1SL0A 2K06A 3UWTA 4DR1F 5GAMh 2CQBA 4DV0J 4I2QB 2FJVA 2DNNA 4UUXA 2V8IA 1CJTB 2EFVA 2QK0A 4RBUA 2E3HA 1WEZA 3DI6A 1HD3A 2N4CA 5DQHA 3ISND 1KWMA 5HBMB 2DR5A 6AT1B 2PSZA 3GIBA 1IHWA 2QE5A 1TSFA 4JI6F 3DM2B 5CZVA 3BDEA 4QYRA 3NHNA 5LJ5f 2QQSA 1M0SA 3RG6A 2L08A 1VQNS 5KYXB 3M9NB 2J9CA 2Y1RI 2BUDA 3ETOA 4EO8A 4U7UD 4K4TA 2MPUA 4J91A 2YT6A 4J9SA 3GIMA 2FJWA 1M1KR 2JSXA 2M8HA 4USWA 2E1AA 1NSAA 3CCVS 3DMJB 4GC6A 1PD1A 4PJOG 1YP5A 5GANf 2AEMA 1QSYA 2FY8A 1RWOB 1XMQJ 1G3TA 1Q5VA 3QZ7A 4F4ZA 5AJ3F 3CPWA 5K8OA 3NCQA 1ZSGA 1W2BS 2BZXA 5FLXU 3DN9A 1PJ5A 4LFAF 2ERRA 2AYEA 3TOQA 5LJ3f 2BE7D 5L9XA 2V2QA 5T41A 4A4HA 2HL3A 2XU8A 2XICA 2KVQE 5AXNA 1CJUA 3CEDA 3VTIA 1YJWS 4J6XA 2KU7A 2I0NA 4Y65A 3DI6B 1RTZA 1KFSA 3F56A 4EMDA 2CDRB 4A8WA 1R43A 4NA2A 3OBYA 4QR2A 3MDFA 1BK2A 5KE3A 3G6VA 1UWAA 3HULA 3QGIA 3IRWP 5DDPC 2RSQA 2DIUA 2JVRA 4GKJF 4A54A 3QKJA 4O44B 2UXBJ 5IOLA 4DX8H 3SWNB 4CT9A 5KFRA 3QYGB 2RHXA 4M77D 2B3TB 5IT4A 3C2PA 2WB4A 3TVTA 3EM1A 3Q22A 3JCMQ 2RRAA 4JZ4A 1ZAWA 1YX2A 1B70B 1LWCB 4KJIA 1LCKA 2LFVA 5KYUA 4KYZA 4E7ZA 1M1FA 3LWMA 2KXFA 3EHRA 2RA2A 3MEVA 3A8HB 3V7SA 3IMQJ 3H40A 1OX9A 3DDNA 2E3IA 3CCSS 4IH5A 1ZSZB 4ZTJA 2VQFJ 5K9FA 3GOXA 5GAN5 3CD5A 3M9OB 4ECZA 2QO3A 3CCRT 1TFYA 1J5OB 4F4KA 1JJ2P 3FEZA 4DN9A 2A2CA 2AHOB 1CC7A 3IAS9 1RAEB 1RHKB 1CJUB 2DHHA 4CRJA 2V26A 2GIQA 4WKYA 4E2FB 2R7RA 4FT2A 4L76A 3CXCR 1N5QA 1UECA 4FXWA 2F8MA 2FJEB 4MIBA 4NZ6A 3WVEB 3EUNA 2CT3A 3R2DJ 4LF8F 1BIAA 5H9EJ 1YZ6A 1BYMA 2DISA 2Z58B 2JZ2A 3CJKA 4ELYC 1AFJA 4ECSA 2O4XB 2DNRA 4K4UA 4KR0B 1I3OB 1CEZA 3OW2P 1QM9A 2MWOA 4Q43A 3D54A 1GXIE 2MJUA 1N9SA 3GCWP 1E6HA 1UB4A 3BGRA 3CIZA 1T9XA 4XQ3A 2QA4T 2HQEA 4PL6A 3HSZA 4ZK7M 4CCHA 5KYUB 5CQXA 2PE8A 2XZTB 4QT7A 4DR5J 4QYZJ 4M63A 3TNVA 5D6YA 5F8MA 2XGPA 4IIMA 4ZGEB 2FD2A 1ZQ1A 3HHDA 4A53A 2X1BA 1K0VA 4HL9A 2UUWA 4AFUC 3HKWA 5K14A 4MMOA 1JWWA 5D0HA 4JRKA 2AF6A 3M30A 3QPHA 3CC2A 2BEFA 3CJ5A 4D8KA 2XSFA 3HKZD 1WX6A 3JS9A 2SRCA 2M70A 4RW7A 2FPEA 2A28A 3D1HA 2JFKA 4FCYA 2GA7A 2HFVA 3LX7A 2RU9A 2M1HA 2COYA 2Z57B 5HN0A 4AXJA 2IMOA 1LK5A 1PD0A 1AEYA 3CCZA 3VS7A 1YZ7A 3DOKA 2BJ1A 3CCMQ 1QVGP 2COLA 3SQOP 2CPZA 2DFUA 2EQKA 1FWLA 1HIYA 2JH3A 3E19A 3I5RA 1Y00A 4LRAA 3PW4A 1TKXB 2NLUA 1N32F 2RHQB 1BI2A 2XB2D 4N4IA 2M02A 3QWXX 1KONA 2HWIA 3DU6A 5DJBA 2CNLB 3JTPA 3LP2B 4DQRA 1VQ6S 3X25B 1RABB 1MSWD 1FWZA 1VYVA 5CZXA 4HH1A 3M8WA 1TUDA 1QWFA 3LOUA 3BGRB 3MF5A 4O3NA 2ZM6F 3VS4A 1KTVA 2CQDA 3VGVA 3D0HE 3T9ZA 3D66A 2VBXA 2KYXA 2FZKB 1WG1A 4IH6A 1N6QA 4LDVA 1LWEA 2JMAA 3AY0A 7FD1A 1EAYC 3MM7A 1HFEL 3J81E 2K57A 2G0JA 1LNQA 1YWXA 2EJ9A 3RRGA 2B9YA 2GCFA 1XNIA 2QQ9A 1SJ4P 1EP4A 3JAMY 5K14B 4DEXA 2UXDJ 4XTXA 4U7UK 2EK1A 2BQUA 4JRQA 2BRLA 2F1FA 4DU8A 5LSRA 1AWOA 3BN4A 5LJ5d 4C8QA 2DNOA 1YJ9Q 4B02A 2JM8A 4UF4A 4HVWA 5GAHI 5IS2A 2HZVA 2ZUAA 5IQQA 4AG2C 1Q86T 3L42A 4PXDA 2HBWA 1R7IA 3HPOA 2VKZG 3UO0A 1NU4A 1TV6A 4K2XA 5GANd 4PXCA 1W2BP 2VD3A 2DL5A 2EKOA 4LUEA 1VQLT 1H7WA 2B9EA 1G2BA 1RKJA 1HPZB 4DUYF 1J5EF 2V8VA 3I5AA 4M77E 1TP7A 4ZN1A 2CXEA 1VRTB 2DYAA 1RYRA 1G8XA 4PJOB 4ENOA 1M8VA 2J5AA 2NQPA 1FFGB 2JTMA 2FPFA 4WP9A 2RB6A 4ATOA 1X2QA 2WVDA 1RT6B 4ME7A 4QW2A 4DX6A 1PNJA 3OD2A 2C3MA 2C2RA 4DXLA 3OL6A 1KQ1A 3B78A 4RLEA 4ZMMA 1PJ7A 1Y5IB 3PG9A 4DS4A 2BQ3A 2LCCA 3GNFB 4M5DA 2RB7A 3FZ2A 4F02A 3FRNA 5FU6C 1EP4B 4FW1A 5FROA 4LDWA 1YSJA 4PWDB 3LPEA 4LF4F 3H90A 3GZ7A 1QWEA 2ASLA 3EG0A 1BIBA 4UOFA 3R5JB 4QWDA 3QQCD 4WK1A 2I5JA 2J76E 1NH8A 1WG5A 1Q81T 4DZ6A 5CABA 2V8JA 4C9DA 3S6WA 3VS3A 5GAGI 3TU4K 3HFVA 2F40A 4A46A 3MEUA 2DNMA 3E1SA 1OWXA 4JI7F 2CPEA 4R0KA 5FDLA 3HRUA 2HFNA 4HLBA 3VAFA 2EAYA 2U2FA 3ZTRA 1RL2A 3EWGA 2Q66A 1DZ5A 1TAUA 3MCSA 4NYOA 2LQNA 2QQRA 1FKPA 2ZJQQ 3HSDA 3CCEA 1F5CA 2DEJA 5GAN2 4GLMA 4M5HA 1HNWF 2B4VA 2MZRA 1B3QA 3EGDA 2X1GA 3HO1A 1GMUA 3RKYA 1U0HB 1Q82C 2AZ3A 1DTTB 1LQ9A 5IHNA 4DL6A 4JV5F 4IFYA 2G2ZA 2QLBB 3SBMA 4M77C 2CQHA 1V3SA 4DUTA 3KK3A 1ACMB 2WSEE 2YH1A 1MMGA 2LNVA 4CO4A 2CUYA 4ZP6A 4ZVFA 3OYDA 2R7WA 2V67A 4CYUA 1M2VB 1WSVA 2W7AA 5DDRC 4ZHRA 2OPQA 1RSCA 2UU9J 1Y7XA 4YB5A 3G4SA 3EXCX 2EFPA 4ZPVR 4ZN3A 4ILLA 1RT2B 5IT9Y 2RS8A 2H54B 1MWYA 4WWSA 1VQPQ 3W5ZA 1M5SA 3M1VA 1S0VA 1C0UA 2EVZA 4WP3A 3M5AA 2CUDA 4P71A 4C3MA 5E3AA 2BUNA 4N0AC 4C3LA 1RYSA 2M2BA 2YLBA 2BJ9A 2IRUA 4LF9J 2Y1IA 2ECZA 1WGSA 3X26B 4V1Ak 3MEWA 3CD6S 3HHKA 4M7AG 2OJ2A 2XMUA 2WSFE 4F7UB 1VQOS 1JNZB 1VUBA 1G7CB 1LPLA 5JUMA 4DV6J 2FQQB 4CH0S 4O3SA 2CYZB 4NMLA 2VPWB 3CCQQ 4N4HA 4XAXB 4EBCA 4O5VA 1HBUB 3JB9J 1F2HA 4FP9A 1HR0F 4LF7J 3UA7A 3UA6A 1RT4A 3CJ2A 2DRMA 4ZJQA 1KVKA 2ZKTA 3EGDB 2D6FA 1S1TA 1WC0A 1HQUA 1RTDA 3MAQA 1ZZNA 2CJQA 2KI7A 4IFYB 5A0YA 5EWGA 3WIVA 2RQCA 5D4OA 2POKA 4Y2KA 3IG1A 3K59A 1NK6A 4CYUB 1N5TA 4OMFG 1NZAA 1UWBA 3I55A 3UDEA 4OJGA 2MZJA 4ZHRB 4WFYA 2VGNA 1YHQS 3D0IE 2PA3A 1UFFA 1NLKL 2J6KA 3IM8A 5CCLA 3TYTA 3JCMf 1QUPA 5KFCA 3NMZC 4EO6A 2DERA 5LL6d 4G65A 4GC7A 1Y71A 3OSVA 1X0FA 3AH6A 2HHHF 3W60A 3I9QA 1MMNA 1S9GA 1X6BA 4C8QD 4MZMA 2HQFA 4N47A 2GNCA 3UQSA 4F26A 4OZ1A 3R6LB 3J7Z5 3QFHA 1D8ZA 1EKSA 3CCWA 1SJRA 4PJOF 3RESA 3QRPA 2YQ1A 4ZCMA 1QSSA 3CCUT 1QAYA 5CKHA 4B3RF 1C1AA 1RAJA 4DEZA 3KUGA 4OP0A 1BUXA 1SJ1A 1F9FA 4CLKA 2OKQA 1IBLF 1EZZB 4OYBA 2E5LJ 4RTVA 1FEHA 1MHNA 4YDDB 2H51B 1I5OB 3R5GA 1R0AA 2LA6A 2CJKA 1OY9A 5E2QA 1Q8LA 2DRBA 2I1RA 1JJ2R 3AJ2A 2A3LA 4HDHA 2YKPA 2IVYA 3HVWA 3MP1A 4F4WA 5B0DA 4KGVB 2HFZA 3B8HA 5CCMA 2OFHX 1UVJA 5IHKA 3MEGB 3BKUA 5A0LA 3BO2A 4Q7AA 1YWOA 1U26A 3W9HA 1CJVB 1EX4A 3W1YC 4FF1A 2AV5A 3PXGa 3JCMc 4I68A 3NS5A 5J1EA 1VQ4S 1RTDB 4KAIA 3DLGA 3ZZRA 1Q7YR 2UUAJ 1FRIA 2QEXT 3H98A 5A0YB 1KLMA 2R5MA 4CC4B 5HK4A 1U1LA 2GQVA 1F60B 4GO5X 4PZVA 4J83A 1SV5B 3A4TA 3EGVA 3OW2R 1OPKA 1QMCA 4RMOA 2ZZDA 5LSLA 2IA0A 2YQ3A 1UETA 3W2VA 3T1HF 2MZ1A 4FBUA 5CAIA 3GSDA 2MYFA 1NO8A 2FLLA 3TQ1A 2BKDN 2YNHB 1UVIA 2RT3A 2KY9A 3NAIA 4HHJA 1CSJA 5GMDA 4OMPA 3P4UB 2DK2A 4NI2B 4OL8A 2H3JA 3KG4A 3G71T 4JPBW 5GJVB 2HHPA 1EETA 2HNZB 1T0JA 2FVUA 2HQHA 2PVOB 4R8UB 1YBUA 2JHEA 3POTA 1H2TZ 4TVAB 5HY6A 1VQNQ 2DO4A 2WW4A 1FD8A 2EC2A 3CC7T 1HWLA 1PM3A 3E2EA 1AWWA 2FGCA 2Q43A 1JLGA 3CJTA 4ED2A 2W24A 2YHTA 1VQ8A 1NJYA 3OYBA 5A0GA 4R25A 3CCVQ 4DR3J 4E8UA 2GFAA 3CNQP 1WC1A 1S1WA 4A8QA 3PT9A 2OIHA 3SFMA 5M2RA 1D0YA 1HW9A 1VQ7A 2KXHA 1CKAA 1IM6A 1RBLA 2LA4A 2YWEA 2DLPA 1VQ5A 4KB7A 2DETA 5J1EB 2ZWPA 3BYRA 4ED3A 4EYIB 1R8OB 1ZA2B 1S1VB 3FK4A 1RTJB 2VASA 1RLDA 3GFXA 2JNGA 4PR6A 1P1TA 5DZ7A 2K2VA 3GV8B 1WC4A 4YP3A 2D3O1 3A8GB 3ITHA 3CF5Q 3FRYA 3KG0A 4E7HA 5CAAA 4OHWA 3T5JA 4TNOA 1C2PA 2ILZA 5B0AA 3G8QA 1YJWQ 5IH2A 3IGNA 4ETZA 2XLJA 4F7UF 1MU2A 4CLFA 1UMJA 2BM1A 3OBIA 2B5JB 2V4JA 2GFFA 4DV7J 4TU7A 2DJQA 1I1GA 3B6BA 2LMIA 1FA0A 2BRKA 3H5XA 1SBRA 2ASYA 1NB7A 4ANJA 3T1AA 4QWCA 1RHQB 3J80E 2CQ4A 2XYPB 3MJXA 3IN5A 5KAKA 3NGKA 4U8VA 1KQSS 4B08A 5KYYB 2O2OA 4PXEA 1VISA 2HFUA 4J9QA 1A7GE 2V8GA 2KYZA 3I0SB 2ZH4A 1JLFA 1M5PC 4E7LA 2XZWA 5D6GA 3QJYA 1DLOB 2E9ZA 1AW0A 1WSRA 3H59A 3CCSQ 2K3XA 4QU7A 1CG2A 5EC7A 3MMJA 1W2BR 5AXLA 4JP8A 1Z1ZA 3ILOA 2F8HA 3DKMA 1RWPB 5D4NA 4ES2A 5EGYA 2DE0X 4ZPCA 4U9RA 4H4OA 4O4GB 5E7OB 5I3UB 3R5BA 3GQCA 1KVIA 3UNYA 3CCRS 3IR6B 2NXNA 3AQPA 2DNHA 1D8YA 2M16A 1FXXA 4JI3F 4F17A 3QBCA 3BZQA 3NEKA 5AYFA 1RWWB 2VKRA 3HHTB 3GPAA 1J3TA 2MTLA 2LP5A 4M75C 3V7RA 5HVHA 2V4JB 3E3XA 4DQSA 1R0BG 3QT6A 3V2UC 1N36F 4M7AB 4DPXA 5F0WA 2WK4A 2UV8G 3KHHA 2KFYA 4MFBA 3C15B 5C42B 3GBQA 3MMCB 5F8JA 3KMSA 2B8QA 1G3YA 2BW2A 1A6LA 1NSPA 1RACB 2VJVA 2BJEA 2DK3A 3X3UA 4C8LA 2E5IA 2YY3A 1KHCA 4MKYA 3OYFA 2GGPB 1TUCA 1TFWA 2XZDB 4C92A 1VC0A 2ZBIA 1K9MU 4OX6A 2W8LA 2DXCA 5J2NB 3JSMA 4N76A 2KDSA 3CCJQ 1LXNA 2C28A 4OMFB 3KWMA 3J7AN 4VUBA 1K73R 5FU7B 3PVLA 3DYAA 2ZITA 2E1PA 2LT1A 3P45B 2LECA 3RR7A 1TVRA 3E9GA 3FCWA 4ANCA 3KJVA 1OX8A 2XYGB 3OUYB 4BHQA 1B3TA 4CIOA 5KG1A 1JQGA 2XGQA 2KG1A 2EVRA 3BBFA 2W4DA 1OSCA 2I8EA 4UY85 3E51A 4OZ5A 5IC6B 4P2FA 4I6WA 5J26A 4RW6B 4DV3J 5EWFA 1GAOA 3I4HX 2AJ2A 3O5ZA 3OTBA 1Y3KA 1OJ4A 5KOWA 3HD1A 4A8OA 1HA1A 1TL3A 2C3OA 2GQ2A 1FMVA 1YIJA 4FKYA 1S6PB 1OZ2A 1RHRB 2XCPA 4Y28C 1XMOF 3SYZA 1X9SA 2J8SA 2BKPA 4C8QC 1IJFB 2OMOA 5J39A 2JJ4D 4F7UE 4AUKA 4KGXB 3MXHP 2MI6A 3QGGA 1XWLA 5IXFA 5GAEU 3O44A 4AMCA 3MWBA 2ABLA 1R89A 2RQWA 4C8YA 2DVJA 3QWPA 2UZAA 3IGVA 4J9UE 2QL7B 3RBBB 1RWUA 1JQQA 4DR4F 1QD1A 3KYLA 2ATLA 2A36A 3FBEA 4I6YA 3H2VE 4KRWA 4OZJA 3VVTA 1D0EA 4JRPA 5HJYA 1TVRB 3OTEA 2Q6CA 3EE3A 2BBEA 1SC1B 3CJ4A 4ZDNA 2DTIA 1HQ2A 1AZSA 3CCLA 2DVIA 1HI1A 3DRSA 3M54A 1K0TA 4IIOA 1BY9A 3C6UB 2J06A 1U25A 2D74B 4DSEA 2DR6A 4OB1B 4EWTA 3OPKA 2CGHA 1A0NB 4B17A 4KGKA 3BH7B 2MKCA 2EFOA 2RJZA 1ICEB 2E44A 2HS3A 1QKWA 3DLJA 4PPZA 5LJ3e 1ZLMA 3RKXA 1RHUB 4ZJLA 3MEDB 4GKKJ 2DR9A 2A0FB 2E5QA 2GV1A 2QXFA 4NLRA 2H5IB 2XC9A 4J9GA 3CC2T 3CIMA 2K79A 5CYQA 4Q0BA 4U96A 3CBOA 1D1UA 2NWMA 4J8OA 5AJ3J 4QU6A 4N7TA 3QXEB 5AE3A 2KT5A 1HBMA 2IBOA 3P8HA 1YCYA 4G1QB 4IFVB 4I0WA 4X84A 2QSWA 4LF6J 4LFAJ 1H74A 4M7DG 4CT8A 2FJXA 4A4GA 1BGXT 4E98A 2WB1D 2L41A 1I07A 1RISA 1BQMB 3EX7B 3O1LA 1K8AU 3S8SA 2M5YA 4PWWA 2G2YA 3VS1A 4I69A 3T19A 1NJIC 1IBMF 4JV1A 5LXRA 4OYIA 4OHVA 4ERDA 2YUOA 1VBZA 1BU1A 4B9SA 1LFPA 3TAPA 3R97A 1KQSP 5CHCB 3U1NA 5DG9A 1GCPA 2ROLA 2PDAA 3DRSB 4LSLA 2YX1A 2DHGA 1RI9A 5LJ3h 2FIUA 1MLAA 3NGRA 4X64F 1JB0C 1IR1A 2ZJPQ 3A5ZB 1YN8A 4IDKB 2ZOGA 1FWPA 1R8HA 1AUSL 4F3QA 3EICA 2DHXA 1SG5A 2VYTA 3BJYA 3N79A 2X9HA 5KFQA 1TWBA 1GXTA 3WBZA 3L2UA 3LAKA 3M2VA 3EPGA 2AKWB 3N6NA 5CYQB 5C2CA 2ZPEB 1JK9B 3CCMA 1HHQA 3R7NB 4ELVA 2GVDB 3L2WA 3ZTOA 1HSQA 5DZ6A 1RWXB 4C92D 3AOBA 4TY8A 2XDPA 2UUBF 5DDQC 2NUHA 4ZVTB 5CVIA 3LWIA 5IN1A 4M5GA 4PLIA 2V69A 3I9V9 2O01E 2X4XA 2DEIA 5H1SV 2NSCA 1KNZA 4LUBA 2JTEA 2FB0A 4I1TA 3JB9G 3IFEA 5F8IA 4O23A 5AE2A 2X3GA 1K9AA 4DV0F 2O66A 1FXDA 4Q8EA 1SRLA 2KDOA 2PNIA 3GV5B 4PUOB 1UE9A 1FRJA 1L3VA 4RNMA 4O3OA 1T0HA 3DLHA 2C2DA 3RB0A 3TAMB 2BE2A 3NTIA 3B54A 2GHPA 4JJCA 1SH2A 5L9NA 1M90T 5F8NA 2E7WA 1NPRA 2DXEA 2Z2LA 2EXUA 5HK0A 3CD6Q 4QPTA 1ZS6A 2VXEA 2VBWA 3Q86A 1VQOQ 3N5FA 4MH8A 2DNKA 5IFMA 2LEAA 3K5NA 2YWKA 1YJ9A 3M0QA 1D0XA 2RMLA 2HD0A 3MR5A 3F41A 3IO1A 3VGTA 5KFZA 5C24A 2OEKA 3NWGA 3I0RA 2R7XA 4ZITA 4PCQA 4JI5F 3TAQA 2F7VA 4WYWA 1UEVA 3GYGA 3QATA 5CR2A 2IYGA 1XMQF 5MLCV 4WJBA 2DVEA 4K4ZA 5ETSA 2EG2A 3H7HB 1Q86U 2QL9B 2AJFE 5LJ5j 3AD7C 1O5JA 3TUZC 4LFBJ 1X5TA 3DOMA 3OMCA 8ATCB 1FNOA 1HXDA 4ZIWA 5HL7Q 1YHQQ 1L3KA 3DRRA 3LLRA 2D0QB 2MYSA 3GB0A 3TVKA 4M5KA 2MCNA 2MKHA 2GZOA 1SKSA 4CDIA 3PJXA 5KFEA 1H0HB 1EARA 4J9EA 4DV4J 2RHSB 1S9EB 1N32J 1FHTA 5CXTA 3CCET 3DDIA 3V6KA 4EZ9A 4MDXA 3PR5B 4F0HA 2DKOB 2JLEA 1AB8A 1N88A 3CWJA 2ROTA 2RQUA 4EIKA 2XTJP 3EGNA 4TKTA 2P9GA 3MM9A 3GJTB 4R0JA 1EHWA 4PKDB 1MNDA 2D9OA 2AX1A 4D3GA 5GVQA 4R5PB 5EWEA 4FSSA 3UR3C 2IG0A 3OR1A 2JVVA 1IB8A 1H2VZ 1U09A 2UVVA 1L5UA 3AHUA 4RWWA 3EZ5A 3BSNA 2QLWA 2WACA 2R7SA 3VU3C 2ZOMA 1WZOA 2LMJA 3I6PA 3FDSA 3ZFVA 2XS2A 3KK2A 3KNGA 2W2NP 1RUSA 2CSIA 3V4IB 4M78A 1KDNA 3TVZA 2QEXS 2XSJA 1ZOTA 3MECA 1H72C 3OBWA 4DBFA 2C2KB 1Q81U 3I5CA 3D9BA 3GNGA 3BQ1A 4DBHA 1WOPA 2QA4G 2FUG9 4WCEQ 3TI0A 2CNKB 3HZGA 3IBWA 1UTIA 1RI7A 1UDLA 5GJWB 4KBIA 3WX4A 2UVRA 1NNDA 2RIJA 4NLGA 3U23A 3K2YA 3CJRA 5HQMA 4DG1B 2DZCA 3EDQB 4YQWA 1YJUA 5GMKi 4OLPA 1U0SA 3CE8A 4TU8A 1FDDA 4ZVQB 3G71S 1I81A 3A12A 4CLUA 2CDQA 3JYTA 2P8IA 3BDUA 3VHQA 3ONQA 3QIDA 5L1JA 2JVOA 4ELTA 1QY7A 3GJQB 1J5EJ 1IR2A 4K5RA 3GIIA 3HDSA 4A4KA 2KE9A 4PPDA 3IS9B 3CC7S 4PG5A 1X4FA 2V2KA 3FCVA 1KHVA 3HFOA 3DOLA 5A6WA 1SH0A 4JBCA 4UOCA 4XPCA 2HMIA 5EDWA 3SCLE 1V5VA 1RUWA 1VQPA 2VOPA 1PGZA 3OR1B 2QA2A 1R8CA 2BXJA 3I55T 2D1CA 1UGQB 1E6VB 5FRMA 4OX8A 2VONA 2K3IA 4DV2J 5C25B 3O8WA 4M7DB 5CD4H 2LJ0A 2ALZA 4C92E 3KLFA 3H0IA 3LF0A 4M78B 4ED0A 3MCMA 1O8BA 2Y8WA 3CVKA 4LF4J 1VS3A 2XSJB 1PRLC 3BH6B 5L39A 1JLBA 2ZD1A 2ZH3A 4CNYA 3CCQA 5BYRA 4IKFA 1S0MA 1JMTA 4KKOA 2ZCFB 5U47A 1IKVB 1XR6A 2HLTA 2FTRA 2CZ9A 5C2GA 1X75C 5GMKl 3MPWA 1V6HA 3AXKA 4FVCA 2IJFA 3VVUA 2BZ8A 2XD0A 2VA2A 4BDYA 1WF2A 2AYMA 3BEGB 4EMKB 5CA5A 2ZHOA 3BO4A 1F9HA 1ZZFA 4Y2CA 2ZH5A 3PVQA 5JVHQ 2IY5B 2P0PA 4JJNK 4YUDA 2F9JA 2B51A 3NGDA 2LC4A 2OO4A 3QDFA 1M1KC 1D09B 1SEMA 3CCTA 3BKTA 3HFZB 3C19A 1U06A 4Y00A 3GIKA 1UW4A 2ZPHB 1AYEA 3JRZA 1B64A 2CKWA 1HNWJ 4O0IA 5CO7A 4FS1A 1ZUUA 4E0DA 2KKHA 4NCAA 3MM5B 2Y8YA 2XLIA 3TUPA 1V5IB 1LWXA 4V19J 4JV5J 1UFKA 1CULA 3C6TA 4HACB 2LKZA 4LIWA 2C0OA 3TUIC 4X9DA 2AJ0A 3VQSA 3M2UA 4QJVA 4DOZA 2KH9A 2XNQA 1T3OA 2KM8B 1Y11A 4FSXA 1DAXA 2GTJA 3Q8QB 3KLFB 3ENAA 2GVZB 1RT1A 3EFOA 3RBXA 1UA0A 2KVQG 2W8KA 2NUPA 2QDLA 2VICA 2ZJRQ 2NUZA 3ULRB 5D6WA 1JLBB 2UXDF 3CCRQ 1NDPA 3J81U 4FNIA 1JLAA 2G6FX 3QAUA 1NG2A 5C6SA 1N8RT 3AB4B 1MROA 1DQAA 4HVUA 5KFTA 3JB9I 3DLMA 3GLXA 4C92C 5LJ5g 4EFAC 1QVGA 4XTZA 3EGWB 4J9HA 4DCPB 2OI2A 2VG6B 2V6AA 2QIFA 4ECXA 2OD6A 5H9FK 5KFGA 4RUHA 3F70A 2BR0A 1WC6A 3RYLA 4W98A 2MKJA 1WTFA 4DCOB 4F2SA 1G83A 1QCOA 1VRUA 5GAEI 2QFJA 3M56A 1LEOA 4RNNA 5M9OA 5GANg 1RDRA 4GY5A 1VQ5T 3K8VA 2LX7A 4O6JA 3WX8A 1FJGF 4E7KA 4KO0B 1T95A 1LWFA 2DIVA 3W5YA 2OHDA 3K89A 3NGUA 3JCMe 2MQNA 3NBPA 1FK9B 4LIRA 3JB9H 2HAFA 3REAB 5J3BA 1O51A 3BREA 5J2PA 3N6MA 1UVKA 3BF4A 1C1BB 3AQOA 2BOPA 1KQSR 1CULB 4NZ0A 2H5JB 2V4QA 2YXYA 3THTA 2OAWA 4HT9A 1ROFA 2R8JA 3EGXA 4ID5B 2L9DA 3M2UB 3H9NA 2LU2A 2OJ3A 4FXDA 1S97A 3M53A 3OQ5A 5GAN7 4IKAA 1VQNA 2O3DA 3W5XA 1WKJA 3SEMA 2MHNA 4TXSA 5HROA 4FYVB 2ZWOA 4M78D 2XKOC 4IQMA 5CQYA 1NLOC 3JAME 2QT7A 3CCVA 4ECQA 2RJCA 3GONA 5IWAF 2MJNA 4QR1A 4HVVA 3KDOA 4JV0A 4P74A 1RT5B 4MKAA 2L3SA 1IKYB 1K4US 4DR2F 3J7YU 4NYPA 2YVSA 3RBDA 2RDIA 4KT0E 1FO1A 1WNLA 4B3RJ 3TREA 3GFYA 4KGZB 4Y2IA 4YN3B 2K6DA 1NZ8A 3SFGA 1W2BA 2I0XA 5MAOA 3AHPA 3IWLA 2K1RB 2CP0A 4F3MA 2IM1A 3K5PA 3ZZPA 3PGGA 1YFNA 3JCMh 4HT8A 2RH2A 4M7DF 2NYIA 3H5UA 2NXCA 2EIFA 1GMVA 2DNPA 2Z0GA 2XI9A 4M78F 1YJWA 2RQKA 2M0OA 3FDRA 4C5EA 4GVBA 5GAOl 4PYAA 1HNIB 4KUIA 2K4YA 4QYZK 3HJFA 2BANB 4DFJA 1N34F 3EGXB 2MGZB 2CZ7B 2RVJA 3FQKA 4NOYA 2HAXA 3G8SA 2Z30B 2YKMA 2CQPA 1GBRA 2EC0A 1T3NA 2IM3A 1U4BA 3LWLA 5ETOA 3V81A 1UJYA 2VDIA 4ICLA 1NMEB 4JDSA 1I1JA 4I6AA 2EK6A 1I51B 2M0GB 6FD1A 4XPEA 2F4FA 5KT5A 1Y5NB 2FVPA 2DZ9A 2C06A 1NK5A 3C0CA 2B7CB 2IJNA 4YB1P 3ET6B 1NK4A 4OF1A 4ZVOB 2FHOB 1R8AA 3CCSA 5ETRA 4N4GA 3VKIA 4NASA 4NL3A 4KQZA 2EQJA 4LF9F 5M2UA 1GFDA 1HNXF 2PU9B 1QVFA 2RAQA 2HVIA 2K9GA 3MD3A 5KT7A 1RT7A 4C11A 3J7ZT 3V4MA 4YR2A 5HP1A 3LP0A 4DV6F 1U02A 2BM0A 4PLLA 5GAN6 3C14B 4RU9A 2RKIA 4Q45A 4RL1A 2PFFB 1X4BA 1KD1T 1RAIB 3D0GE 3OHBA 2EFQA 1IVZA 1C1CA 1FJEB 5F0UA 1KK7A 2QC3A 3ZZOA 2NSBA 4Y3CA 2B7BB 2DGSA 4ZVSB 1RQ0A 2EJFA 2DNGA 2V50A 1RADB 1X27A 1FT8A 4AFQC 2G4BA 1XJWB 1M30A 4EGLA 3KLHB 3TW0A 1WHHA 4IR9A 1TL1B 4DMZA 2QYZA 1PAUB 2APOA 5DM6Q 1YIJT 2CVEA 3CDUA 5LMUF 4J9DA 1HWJA 4UOGA 5IT9E 1SH3A 2CJXB 3OY9A 4ZCKA 1Q86R 2EBGA 2AMCB 2DXTA 1X31C 1NEEA 4WIQA 2H3EB 4CLTA 3CCJA 3JSRA 1SQFA 4EBEA 1S5ZA 2M9UA 3HSJA 5L1LA 2OPRB 4M77G 4PJLA 2EEYA 4LJMA 4JUZA 1I5LA 2K2PA 3CJ3A 4C5GA 2JEJA 2ZZNA 1NM2A 5D0RA 3DDKA 4OZ0A 2R9LA 1KHWA 5B0GA 3PTAA 4OFZA 2HNYB 1CC8A 2N7YA 5G0RB 5SZTA 2B56A 1Y7PA 3W66A 2J9EA 4DS5A 3TZWA 4J5YA 1FMKA 2RKIB 4QQBA 2QA1A 3ILLA 3QJPA 4LT6A 1TG0A 2GF7A 1AZEA 3TA0A 1ZTWA 5KFUA 3V6DA 3L7UA 3FMWA 3HT0A 4L59A 5ETTA 1C1CB 2JUFA 3IA0A 4DX5A 4A8YA 2DYIA 1JBMA 4C0FA 4I2PB 1BQNB 3CCLT 3LO3A 1Q1KA 5D3GB 5KCOA 2CPXA 1HD0A 4LE9A 3KLGB 1KSPA 3W8PA 1FKAF 3OV7A 4QQ6A 3MAHA 1X4CA 3NMRA 2KHCA 4M78E 2DJWA 4OJ1A 2XMMA 4GO7X 4BLGA 4FXVA 3MAAA 1K1ZA 4UC4A 2D3UA 2CPIA 1HWKA 1WUUA 4C2MA 4J7FA 1UL3A 4U7CA 4E47A 3KDNA 4F4XA 4AFFA 1RTHB 2DR8A 1YJTA 2G13A 3PRVA 4F4AA 1Q81R 4IOBA 2CPHA 4BC9A 1N36J 3CMEQ 3MPUB 2PEBA 3MD1A 4JYAJ 3DRPB 4YTLA 3HHLA 2RD1A 2JZ5A 1PHTA 7AT1B 2K3YA 1L3SA 1ZPVA 5LJ5Y 3S3OA 5F3TA 4MAKA 4NLUA 3KLVA 1U1KA 3M6UA 4X65F 3QDRB 3UVJA 1Q5YA 1WC3A 2LDMA 1NHKL 2I2YA 4PKCC 1TUVA 3ZZZA 1SJQA 1BWEA 1TK5A 2HSEB 3BSAA 2QRRA 2LXIA 3M0PA 2V0NA 4ZP9A 1OPLA 1T11A 3LA0A 5ETLA 2DCUB 4WFAQ 1BKBA 4LSNB 4LD9K 1Y10A 5ETVA 2F2WA 2YKQA 3D4JA 1AWXA 2HZYA 2HQDA 2V2VA 3NAHA 3G82B 1FVSA 3MM6A 3TUJC 2V2ZA 2CADA 2C2OB 3MUMP 2IAJA 2IM0A 4JUVA 1WHYA 3LTOA 4WE1A 1UUEA 3OYJA 2ZBQA 4ANEA 4J9CA 4A47A 4J90A 4WZMA 1RTIA 4TYAA 4HCBA 1KFDA 1S48A 2C42A 4IO9Q 4RWXA 4HHUA 3W64A 2KZMA 5E3RA 1VMBA 2B4UA 4OB3B 2I2LA 2PUOB 2FHKA 5EX3A 2KXCA 3QWUA 1HW8A 4PG7A 5F9LA 2GJ2A 2RNAA 3CSKA 4USVA 3BGUA 2CWXA 4IOAQ 1KFZA 3CCES 1O0PA 2MEWA 4ZCLA 4A8FA 4ZLPA 4YR3A 2RQ4A 2P9CA 5GAOq 1XMOJ 1D1CA 4BWMA 5GAHU 2YWHA 2ZPFB 4DSIA 4RW4A 2XMJA 5I22A 1FEEA 2HRYA 1WHLA 2QTWA 3FRZA 4NRUA 4CNZA 1Q79A 2AU0A 1IR0A 1WF1A 2V1QA 5IXUA 5IM0B 3DLBA 5D4PA 3C16B 4OJ3A 4OI4A 2H8HA 1N5SA 5CK9A 2CA9A 5D4LA 5JMNA 3EG9A 2VC8A 2DXBA 3PKYA 4NRTA 5A2QY 3QO9B 4CM2A 2ACMA 1XQIA 4RO0A 1HARA 1I0CA 2FRYA 2CREA 1H2UX 3A3NB 4BB7A 1PKTA 2FG0A 1EQMA 1U48A 1IM4A 4KHPF 5IHIA 1GBQA 1SHFA 5J2QA 1DJ0A 2O88A 2K5LA 2HNDA 1GT8A 4F50A 1RB0A 1GH8A 2R8GA 2DNYA 5GADI 1NAQA 3EFSA 4F25A 3HMJG 3M0RA 1NHVA 1HJDA 1ULRA 1TMJA 4QIWD 4ED7A 3EG1A 2RK2A 2XM3A 5DLOA 1NKBA 3UI3A 1N48A 3PYFA 1YJ9T 2V34A 3FB9A 2PVDB 1QDUB 1SSFA 1CKBA 2QYCA 1MG7A 3HZEA 4F14A 4IUPA 2E5GA 3REBB 1S1XA 1RXOB 3UN2A 3CC7Q 1BD6A 5FU6B 3A8JA 5KYWB 1YJVA 4H4MA 2JEGA 3OS5A 3DGPB 4JJBA 4RW4B 1ZAXA 1WA7A 2DIQA 2OLWA 4ZA1A 2IC3A 1LW2B 2KN4A 1QUVA 1VQMS 5GAGU 4KY3A 1WHVA 4OMLA 2JT4A 2MZQA 3A8IA 5CYMB 3ICLA 3CDEA 2AD9A 3I55S 4OZ2A 1NLPC 4N0AA 2RHUA 3QSYB 2XEXA 5GAOn 3LAMA 4QQGA 1NBEB 3SQGB 3PIPQ 3CD6A 3JCMg 3FJ2A 2H1YA 2L0AA 2HVZA 1DJ7B 3LP1B 3PW0A 1VQOA 5ETKA 1HKAA 2MQMA 1KBRA 1X60A 4KE5A 2E4HA 2W7PA 4TQSA 4YMEA 5J2QB 4UZCA 4OV1A 2ZZMA 3A8MB 4C5IA 1TKTA 2W2OP 1C0TA 3INZA 2LEBA 3RAMA 2P4RA 2DF6A 4M5IA 4K4XA 1M90U 2OTJS 1SUQB 2HDAA 1VLOA 4DSKA 1RCOB 5F8GA 1P27B 3DLLA 3PR4A 1SPBP 5CD4A 4DV3F 5HANA 3P3DA 4IG3A 4M77B 3US5A 2OGUA 1G4CA 2KNBB 4CM0A 3OYEA 2BJDA 2R5AA 2KJWA 1AWJA 2ZVIA 4U6PA 3PFSA 1FXLA 1S1XB 3HHLD 2Z8QA 4DN0A 2E66A 1DBDA 4P5NA 1YHQA 2CQIA 3Q8YA 5KFNA 1PSEA 1HHSA 4OYOA 2HCKA 3MP6A 4OHXA 2WVFA 3Q0AA 1RAGB 2IC3B 2AIRB 1LJOA 5A8RA 2MY7A 4KH0B 3MFIA 2DJZA 4P7TA 5DO2A 2JWNA 1BE4A 1RWKB 4Y2MA 2XMFA 2GHWA 2DX1A 2R7OA 3DRXA 3T6JA 2RS2A 1Q53A 5HLFA 1HWIA 2YKNA 2KL8A 2L9NA 5L46A 3PW5A 3PNWC 2M88A 3MHXA 3R1LA 1TKZA 3SIPB 3CC4Q 4CO2A 4JI2F 3HXMA 3OFFA 2FGOA 5KYNA 2RF2B 1TKTB 2F3JA 4BI3A 3JQMA 4M5JA 4DQ2A 2W25A 2FDNA 4XK8C 3PYGA 3H0PA 1NEGA 4BI4A 2DBMA 1YRTA 3MUTP 3KLIB 4O0NA 3K57A 4BD3A 1F3VA 2MQOA 1VQPT 1D1AA 1TKDA 1D9AA 2LVWA 1YRXA 3QAEA 2NPIA 1MNEA 1GTHA 4DR6F 1FX7A 1FRXA 4DV5J 2X1AA 1SQGA 2B8PA 2DNQA 3QLHA 1UEUA 2MKIA 1S1NA 4OHYA 1DY3A 2CZVC 1NKEA 2MSSA 3OVSA 3RBEA 3M58A 1Q7LB 3C8YA 3M7VA 3QO3A 2OPPA 2CKKA 4GKKF 3A8KA 4JI5J 2G0IA 4C8OA 2LQJA 1UJ4A 3N6LA 3CCQT 2QGFB 1AZGB 5I42A 1PSDA 4B3TJ 1JJCB 1SXLA 1QAIA 2KT3A 1HBOA 4KFBA 3M4YA 5AE1A 3ZFJA 3AOCA 4DF4A 3FC3A 2AJ4A 2YKNB 1NDLA 3L09A 3MEEA 2CFXA 4LF6F 4PJNA 4Z02A 1UCNA 2EGEA 4ZPTR 1WHWA 4E6RA 1RJJA 4DQIA 2EWHA 4F2RA 2IRXA 4OVAA 1TKZB 1JU5C 3ILIA 1WXBA 3HVRA 2XCAA 1JLEA 4BI8B 2PUKB 3X28B 3D6TB 3BQ0A 1YI2S 3GYXB 2FZGB 4A48A 5H9FJ 1WC5A 2XMVA 3CMAQ 3I5BA 4XTVA 3OTOJ 4B9WA 2HVEA 3TA1A 3C12A 2O9VA 2I9SA 4DPOA 3VGSA 2QL5B 4D6WA 2KFNA 4B3MJ 2HIYA 1Q7YU 1X4DA 3H4DA 2G9OA 3CPWR 5GAMd 5IT0A 3DHXA 2E5KA 2JL9A 2OPPB 2IA6A 2QFIA 2V9KA 3JCMJ 3EXYA 5IQ6A 3RMQA 4OYXA 5KG0A 4RJVA 2OFGX 2GCXA 1UFWA 2CP6A 4CTAA 1U3OA 2KROA 1UTAA 3KFWX 1VDHA 2R7UA 3MEEB 3HM9A 3KUHA 4V19X 4J9PA 2DO0A 1S7IA 5T7LA 5A8WA 3W61A 2A6OA 1X69A 2FYXA 1TELA 1TOVA 4M77F 1U1PA 3I56Q 3OS2A 2NREA 1DARA 3PACA 3JB9k 4XIUA 3CDWA 1KC8T 1FKOA 1AXQA 2VPXB 1KQSA 4LBIA 3ADAC 2GHVC 2CNOB 2YPYA 5FIIA 1KJWA 5K8MA 2HBQB 1WI7A 4USJC 3VS0A 4YB7A 4RKUE 4BS2A 4Z7CA 1UP1A 2A18A 2JDJA 1MMDA 2ZH6A 2RPNA 3W7BA 1FNXH 2JM9A 3TR5A 1GXUA 1SB6A 2CYYA 4F7UG 3AJ1A 3CCRA 4QBUA 2RHIA 5F3ZA 3NGSA 3KKFA 3K8WA 1VQNT 2C22A 3IRXA 1WACA 3V6JA 5KG6A 5HQLA 2ZH2A 1VQKS 3T1YF 1SKWA 2WSCC 3C95A 3CCVT 4M75A 1M4ZA 1GNKA 4ZP8A 4YR0A 5B0BA 2RQVA 2LJ1A 1GL5A 2MHEA 3CDBA 4CTAB 3BDPA 3NOCA 4GVLA 1N8RU 4NLWA 3A8OB 1B4SA 4DL0C 3PVXA 1VQ9S 1R0CB 3IQLA 1KLNA 1QP2A 3GILA 3TEHB 2BZYA 4CP5A 5E3CA 4DSJA 4PFZA 1QAJA 4LFBF 2SEMA 3P8BB 4WU3A 3FJPA 4LVOP 3OA6A 2ZPIB 2LQKA 2EBEA 2GBQA 1FKOB 4RZRA 2ZBPA 2BQRA 1YIJS 2A7YA 2FVRA 3TANA 3EGZA 3KLEA 2DY1A 3FEXB 2E5JA 4HCKA 4OJHA 2DL3A 1X5SA 4PWUA 1YJWT 5A76A 4DOVA 2MQQA 4C8MA 4DV4F 2EYXA 2VG7A 3EG2A 1OSDA 4BE1A 2GS8A 3RRHA 2AQ4A 1MW7A 1VC5A 2YKAA 4MYUA 2DL4A 2LCLA 1OMSA 4RW8A 4P2XA 2XMAA 3CJKB 3ZZUA 1U6FA 3W2WA 2LXUA 3JTOA 1KQFB 2RNEA 2YUNA 1WJRA 2MSTA 1G1XA 3SMZA 4LDUA 2CG4A 3D6MB 1Q8KA 1PC4A 1IKWA 1WG4A 2QG9B 4RKUC 4OYZA 2VA3A 2R7TA 3OFEA 1F3FA 4QIEA 3I87A 3UPUA 2H4YB 2CUBA 2RE1A 3R5CA 2E9RX 3MPVA 1EIFA 4J9OA 3OR2A 4M75B 1OYEA 3QG1A 3C3LA 3EZUA 3HHLC 4KIAA 2W10A 4P6QA 3M0TA 4W90B 2MF2A 4OI0A 5KOXA 4MMKA 2A1BA 3M30B 3CCLS 2YDLA 3KHLA 4MK7A 4KPYA 1UGPB 1WJ9A 1SRMA 3CULA 4GLKA 4EUVA 3O3LA 3CCST 4RW7B 4Z8AA 2KT8A 1TTHB 2D3ZA 3CO9A 2ADCA 4D3HA 1SIWB 1YK9A 1I6JA 2FLNA 1JX4A 4PRFA 3S1TA 1T94A 1VJWA 5AXMA 2U1AA 1UGVA 4HI1A 5EUHA 3M8ZA 4RTUA 2DNZA 1WF0A 2RI5A 3DOKB 1YJNQ 4FT4A 5EHHA 4DBRA 3VRZA 1VC6A 1P1LA 4JI4J 3G2XA 1TK8A 4ORZA 2CAJA 2C2EA 2V94A 3NNCA 4CC7A 5GAOr 3SCKE 2HFOA 1ZM9A 2RRBA 2BABA 4MDWA 4USIA 1FJGJ 1FE4A 4RTWA 3Q23A 3MR3A 3RBZA 5KFJA 3RB6A 2VV5A 3WC0A 3PYDA 1RAHB 2AYGA 4LF5F 3QPIA 5K5MA 1K73U 4FYXB 2HFSA 1FMWA 1SL2A 4X1VA 4JJDA 2VG5A 4IR1A 2N3LA 4P10A 1X9MA 2IJRA 3Q1JA 4KC5A 3TZZA 3QFWA 3NCRA 2XWYA 2F1LA 3I31A 1N6QB 4L5GA 1LWEB 5CKEA 3LGHA 3MM7B 3BQ2A 3NFCA 2XG8A 3FSIA 2Y0BB 1VK3A 4DV2F 2CZ0B 3P8DA 3E9FA 1N5ZA 1OOTA 4X2BA 3FIFA 1IWAA 1JLQA 1LXJA 1NCLA 2WRMA 3F73A 1A0OB 5IWAJ 2ZEJA 4URSA 1KEKA 2NLWA 1CBKA 3BDLA 3CCJT 2GQIA 3MZIA 2QZ8A 4C8QB 2RM4A 1Q8BA 4DR2J 2J7WA 3GJSB 2IRYA 5KFSA 2X51A 3VJPA 5B0EA 2P4TA 4ELZC 2RU3A 3SHWA 3OSNA 2IVMA 5KT6A 2OH2A 4KH1B 1IXDA 2J0QD 4CQ1A 3D6HB 1SF9A 2HURA 1TV6B 2DMOA 3QIPA 2XDDA 4WK3A 1KP6A 2CP3A 1BCOA 1M90R 2YNGA 3VS6A 3EAEA 2DR7A 1GFCA 3W63A 1GRIA 2D8HA 1CQMA 3CD0A 3K5LA 1KR4A 1KD1U 2RUSA 1U1MA 4OHZA 3GIJA 3R6GB 4J9MA 1V29B 3CTRA 2X7IA 1OPIA 1N34J 3EJMA 2CQGA 3BS9A 2J6SA 4JI8J 1XNQF 2VIHA 4I64A 1VCTA 1VI7A 1VYTA 3Q24A 2OP5A 3PRDA 2AWZA 2Z2MA 1NRKA 4M75D 1MN7A 3NRBA 4M5DB 3KJNB 1X5PA 3OMGA 1T05A 3E01A 4ATNA 2CZ4A 3M8PA 4DLGA 3S3NA 2CSQA 1IBKJ 4EBDA 3HHNB 1R6VA 2ZH7A 4PABA 1M3AA 4OYAA 2DYBA 1BLUA 1TL5A 2XO6A 2N3OA 1UHFA 5DQGA 4F04B 3RB3A 2LYVA 1AROP 3LPYA 3KHRA 3NKYA 1X2KA 3HP6A 2I5JB 1FDAA 1H92A 4CC2A 2A6MA 4OI2A 2OTLQ 1BI3A 2EW9A 2CDTA 4A8XA 2J05A 2D3OR 1AFIA 4UOHA 2PT0A 2BACA 3LYIA 2XS5A 3CBMA 4QKUA 2XDBA 2GC8A 1HNXJ 2FPDA 5I2SA 4DPYA 4LN2A 1UKUA 5FDLB 1HQEA 2CP2A 5E3PA 1G2EA 3L9ZA 1GQEA 1JLCA 4M75F 4UTGA 2KJVA 3ISZA 3TCJA 1OO0B 3GPLA 1CLFA 2C3PA 3M0UA 5KFKA 1FKPB 5GMKj 3KNAA 2ZC3A 1VQMQ 2FO0A 4NEYA 3AD9C 2C0IA 3G6ET 4DX7A 2AZ1A 1H7XA 1F9EB 5GMKa 4TU9A 5FD1A 3CMEA 2DH8A 1NYGA 1XIQA 4NLPA 2VDHA 3TO8A 3V8KA 3KK3B 4BE0A 3HL8A 5KG4A 5DLQE 1EIYB 4A63B 3L2VA 3OFHA 1LW0A 2OPQB 4IO1A 1YCSB 1S72Q 4C0DC 4Y2AA 4AE5A 4XTWA 1TQLA 4EDUA 5LMUJ 2Y1LB 2DT9A 1FE0A 1TL7A 3DLKA 1RI0A 3QSUA 3R8YA 2OTJQ 2QAZA 3NPFA 3VAHA 3WVDB 3M1VB 1C0UB 2V8PA 2C2NA 2UUTA 4F16A 1C6VX 3EDRB 4ID8A 4MK8A 4DU7A 1YITS 3JCMP 3MPYA 2CQ0A 4IUQA 3M9MB 4EU0A 4FVMA 4L74A 3BPDA 4UW2A 2DL7A 1N52B 2DITA 3GG0A 2KFZA 1VIFA 3PO5A 4EEYA 3L4BC 1Z2LA 1CVJA 4CH7A 1XK8A 3FFIA 3G8TA 2CPYA 4DL7A 5DG7A 2ALYB 3BB5A 2FVCA 4NL2A 4QVZA 2VOOA 3OXGA 2LP4A 2HBYB 4ELUA 3M32A 2G1HA 5FLXY 2CJBA 1VYAA 1AOJA 1NJZA 1FJCA 1RT4B 1KN6A 4MTPA 2A10A 3HD2A 1U6ZA 1S1TB 1FNMA 1HQUB 4C8QF 1OULA 4X4VA 4JS4A 2R7VA 1OY8A 2XG8D 2DGUA 3IG1B 2VBZA 5GAN3 2VH7A 3OXLA 3SEOA 2K7AA 1HHTP 1H73A 4XDCA 5DY9A 1K9MC 1Q82T 4K50A 1TR0A 1UWBB 2RH3A 1E6YA 4ZPAA 3TQ7P 1LW0B 2HLUA 1N54B 3D3CJ 3VQTA 1D3BA 2AJQA 4N8NA 3H8ZA 1KRPA 2F4VJ 2KVIA 5HSPA 1QCNA 2MOXA 2Z0WA 3DLKB 2GX8A 5KT4A 2MKYA 1S9GB 4G3IA 2RQRA 3HSGA 1WHXA 3UW1A 2LVMA 4X9CA 4QPXA 1U1TA 4RW9A 5EX0A 5ETPA 3HF5A 1Q8IA 1RP5A 4Y0FA 4X65J 1VQPS 1M5HA 4ECUA 4NLOA 2Z2ZA 2ROPA 1A9NB 3OB9A 2RDJA 4MT1A 5JJBA 3JQKA 4HI2A 1R0AB 2B6AA 2N4DA 3NP5A 3P6YC 5KT3A 4Z89A 4PXBA 3FGVA 3OS1A 4LFCF 1H3HA 3CDAA 4ED6A 3CD6T 4RCBA 3MMBA 3JV3A 1M5VC 1VQOT 4K4VA 4DSFA 1ELOA 2DGTA 1K0SA 3M32B 4B9NA 3UN5A 4JS5A 4B3OA 2W9AA 4RCCA 1X6GA 3A3PB 3CCQS 3GR1A 2KBTA 3N5BA 4B9UA 3MEKA 3DLGB 4P9SA 4CO5A 3UFCX 4ILMA 2YWGA 3LANA 1RWMB 1KLMB 2M4MA 2IFXA 5L1IA 4M75E 4O3RA 2M7SA 2W9CA 4X4UA 4JI1J 3W2VB 4IRDA 2W9BA 3I9ZA 1QCFA 2QMWA 3DB3A 1FVQA 2RJFA 1RBOB 2AKLA 5T14A 1YI2Q 1JO8A 1N8RR 1JKHA 2R8IA 3MR6A 1V1CA 2Q6BA 3QRRA 3DU5A 4I2QA 1TK0A 1ZUYA 2H65B 1EETB 1CJTA 4NL5A 1WFWA 1GTEA 3POTB 3PIP<