4ZN1A

Crystal structure of mjspt4:spt5 complex conformation a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
138
Chain Sequence
b'MIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTPENIEKGDVVEIIAPFKGERAKVIRVDKHKEEVTLELENAPIPITLPVEGVKIVSKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor Spt5
molecule tags Transcription
source organism Methanocaldococcus jannaschii dsm 2661
publication title Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb
total genus 25
structure length 138
sequence length 145
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zn1A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 4zn1A01
3CC2A 2KDSA 4CRIA 2OTLT 5J26A 1N8RC 3OYYA 1NPPA 2L3RA 5IAYA 1YITA 3DB4A 3DB3A 1YJNT 1RL2A 1KC8C 1NZ9A 1VQMA 2QA4A 3G6EA 4YTLA 1KD1C 4X34A 5DM7R 3PIOA 1VQLT 1M1HA 1VQLA 3CPWA 1VQKA 1YBYA 1KQSS 1VQ7A 2LQ8A 3CCRA 1K73U 3CPFA 2OUGA 3OW2A 1VQOA 3HKSA 1YIJA 3G4ST 3KBGA 1Q82C 1BKBA 1YHQA 3CC4T 1M90U 3CCSA 3CCJA 4RG2A 3P8BB 1VQ5A 2MWPA 3I56T 5DLQE 3CC7A 2OTJA 2LVMA 3CCUA 1VQ8A 1KD1U 1W2BS 3OW2S 1M1GA 1Q86U 2IG0A 1VQ4T 3CCST 1Q7YU 3G71T 3CD6T 2JVVA 3G71A 5FLXE 2EIFA 1S72T 3EWGA 1QVFA 2JUFA 3CCUT 1VQ8T 1IZ6A 1YJWT 3QQCD 1SSFA 1VQPA 1W2BA 3CMET 4QQDA 3CCET 1K8AC 3CCJT 3J81E 1UEBA 2QEXA 3CMAT 3CCQT 1M1KC 1VQ6A 2QA4T 1VQ9A 2JNGA 2G3RA 2EXUA 1VQPT 1XNIA 3CCLA 2K06A 2OTLA 3CXCS 3LGLA 1N8RU 3PIPA 2MI6A 1K9MC 5J3BA 2JOYA 3LPEA 1VQ4A 1X6OA 3J7AF 3DLLA 1YJ9A 4TVRA 3H7HB 1Q7YC 2E70A 2QEXT 4ZN1A 1KC8U 1VQ7T 3I56A 1VQKT 1VQ5T 2E6ZA 2LCLA 4ZN3A 1Q81U 3CCMA 3CPWS 5LL6S 3CCLT 3CC4A 3A5ZB 1QVGA 3ER0A 3CMAA 1VQNA 3CCMT 1NJIC 2MWOA 1NPRA 1EIFA 3I55T 1VQMT 1YI2A 5HY6A 3CCVT 1KHIA 1VQ9T 1YITT 1YJNA 1K9MU 1VQNT 3CCQA 1Q86C 3JAME 1YIJT 1VQOT 2CKKA 3CMEA 3CCEA 2KVQG 1JJ2S 1K8AU 5A2QE 5IT9E 3LH0A 3TREA 1K73C 1KQSA 1NZ8A 3J80E 1S72A 1M1KU 3LGFA 1Q82U 2DO3A 3CXCA 1Q81C 1VQ6T 3G6ET 1YHQT 1M90C 1XTDA 1QVFS 3G4SA 3CD6A 1YJ9T 3CCVA 3I55A 1YI2T 3CCRT 1QVGS 3CC7T 2OTJT 1JJ2A 1YJWA 1NJIU 2XHCA 3CC2T
chains in the Genus database with same CATH superfamily
2Y90A 3M0SA 2B4UA 3RDVA 4K4TA 2HRTA 2QYGA 3NTIA 1FNMA 1N8RT 3DGPA 3PIOA 1TS9A 1VR6A 3G82A 1XTZA 2B4PA 5GMKh 3QFWA 3PO5A 2Q3PA 1G3YA 4A8KA 2BJ8A 4ERDA 2KZMA 5EWGA 5A6PA 3OYMA 1R8CA 4FNHA 1X4HA 2UUCJ 4ED1A 2RRAA 2LKZA 3JB9D 1A6LA 2HS3A 4BD3A 4QBUA 3NPFA 3T19A 4EIKA 5IT9Y 2WVCA 2DYIA 2ZH3A 3M6XA 4Y92A 5DM6Q 1OSCA 1HI0P 4WZMA 3QGHA 1Y9OA 2XLIA 1RHMB 2FDNA 2HDAA 3CJRA 1YJUA 1X6OA 4JI5F 1Y96B 2Z4PA 3VZIA 1U8WA 5GAMh 1IGUA 3AD7C 4J9LA 1D0YA 1RWVB 3GYNA 4QR0A 2EWHA 2CQCA 3EG3A 1Q16B 3QUIA 4M4ZA 1UKUA 4LD9K 4DLEA 1RKIA 1KHIA 2UU9F 2VUGA 3S6EA 2B6AA 1HW8A 1ZETA 2AD9A 2OEKA 2C0IA 1S1VB 1VLOA 5KFQA 1GCQA 3O8VA 5L1JA 4N56A 2V6AA 4AXJA 1UZDA 3OYFA 4FW2A 3UA7A 3KUFA 4KULA 5MLCV 4GLKA 2BUDA 4M78E 2J7WA 2GQVA 5D3GB 4ZVQB 3NY0A 3HFZB 3OYDA 2QQBA 5IT9U 2QL9B 1FK9B 2VHGA 3JB9G 2ZPGB 5ETKA 5U47A 2PMWA 3NNAA 1PSEA 4FNIA 3EXCX 5DLQE 2C2EA 1NK4A 4YMEA 2JVVA 1SV5A 2E7VA 2WCXA 1WTFA 4DL7A 5AJ3F 4NEYA 2DA9A 4XDCA 3DRXA 4PKCC 1ICEB 2YWKA 1LWEA 5LMNF 2KRMA 1QSSA 1W2BR 1W6XA 2K2VA 3H7HB 3CWJA 2CZ1B 2FC9A 4GVBB 4EGLA 3HI9A 2VFVA 2QE5A 1DAXA 3EM1A 5KT2A 5D0HA 1K9MR 4ZKAA 1NK6A 2HZCA 1AWXA 2HLUA 1N88A 3GSIA 4W92B 3PIOQ 1LW2A 3KMSA 2BKDN 3CJSA 2CP3A 2QXFA 3QZ5B 1WNEA 1KN6A 1VISA 4DL2A 3BKTA 2AT1B 2BZXA 3EG2A 2GVZA 7FD1A 5C42B 5IZHA 4JV2A 5DM7Q 3MR5A 3CC2T 5KOXA 1ZBTA 4M5GA 3PVQA 1FMKA 3IRWP 4J90A 4NRTA 1WC5A 3IC1A 3M8WA 4Y28E 2E5HA 2PNIA 2JS0A 1VQOA 2V8DA 4EMKB 3CC4T 1BQXA 2POKA 3DLGA 1NJYA 2ZKUA 1JLQA 3MUMP 1UVNA 5F8LA 4LSNB 3IWNC 4ZPDA 3MEGA 3C8YA 4ATOA 3TW0A 1CJUB 3EWGA 3P49B 1OQKA 1FJGF 2IVFB 1L3UA 3UNYA 3FEOA 3H9NA 2J7IA 3I0SA 3IN5A 4KH0B 1UJ5A 1B07A 5GJWB 2LMJA 5JMNA 4DR1J 5LJ3d 4K5RA 1S4EA 3DOKA 1N8RU 1IBCB 1H7WA 1HBOB 3DRSB 2JT4A 3ASKA 3HHNB 2KRNA 2Y9HA 1UJ4A 2WRMA 4RW6A 1T9UA 5GANf 3US5A 1WGSA 5LJ3e 2LYVA 4KRWA 1CLFA 2IA0A 2AHOB 4WF9Q 1RAIB 4YB6A 3V6DB 2CJQA 1PYSB 3LX7A 1WF0A 2F1LA 2R57A 2IVYA 2CZ7B 1RKJA 4EPCA 2W01A 1RI9A 5K5MA 5CIUA 2MPXC 3OL9A 1OULA 1Q5VA 4AMCA 4YEAA 2CDRB 3TX0A 4WIQA 2Z2MA 1GCPA 3SWNB 4PQAA 4W4MA 5T7LA 1AVZC 5CKBA 4DLGA 1Q78A 3DOLA 1KQSP 3W2WB 4N5SA 3DLJA 1RT1B 3EDQB 4JOUA 2YUOA 4OMLA 3HXMA 3OMGA 4Z89A 3AFGA 1T94A 3LH5A 4JRQA 3GIIA 4U7CA 1XMBA 1F1BB 1HD3A 2DBKA 4OYBA 3M0RA 2Q79A 3DU5A 1N33F 3CCQT 4UTGA 5LMUF 2MHNA 1D1BA 2VZ9A 2E5JA 4PJOC 3CMAQ 4WU2A 2DL4A 2LU2A 4RKUE 2BJ9A 1C0TA 3H98A 3MMCB 1UEVA 3J7AF 4GC7A 1FERA 3M0QA 4FDFA 1TL5A 1SPKA 3Q23A 1UFWA 4HT8A 1QD1A 1S12A 3D7SB 4C48A 2ZPBB 2FHJA 2BQUA 4C8YA 5KG5A 1NJWA 1U0SA 5D15A 4WP3A 4N4GA 2CH4A 3OUYB 1XOVA 3CCRT 1EHWA 1KQSR 2MK5A 4FYVB 2QMUB 3BO3A 1PC4A 1UPPA 1N56A 2KDOA 2C2ZB 3P5TL 1T9TA 1HWIA 1KQ1A 1XC9A 2DR9A 2QQRA 4C8QG 3CJ2A 3N5FA 3TAMB 5LL6d 2O4XA 2VODA 1SI9A 3KG1A 2HQHA 1IQTA 1RSCA 3EZUA 2J6KA 4HH1A 3OTEA 3Q89A 4KPYA 2X3DA 1D0XA 5DQIA 2GHVC 4ZOSA 3VS6A 1VQPS 3D54A 3M1VB 3HM9A 1X8DA 4L76A 4B9MA 4B02A 2O3DA 1X69A 1WIEA 3GFZA 3W66A 2ZM6J 3JQMA 2KKHA 5C24A 2RF2A 4EFAC 2UV8A 3K0JA 3UI3A 3FK4A 5HJYA 4OP0A 5LJ5h 1K9MC 3EGDA 3RKYA 3LAKA 4O4GB 1WJSA 4HVZA 3BSNA 2DB1A 1N5ZA 1YRUA 4WYWA 2A6OA 4HVVA 3M59A 1O51A 3KJFB 2JW4A 4P5NA 2CUBA 2B9WA 2EVRA 4X65J 1EQ0A 1MG7A 4ED5A 4RTUA 3KLIB 1JQQA 1CJUA 1OPLA 2DPPB 3DXBA 2J9EA 2ZH8A 1F5CA 2DNYA 4AFZC 2EFIA 2PEBA 2LEAA 1V6HA 4RUBA 5EHHA 4P6QA 1Q1KA 4UOHA 2M9UA 4ZP7A 3RB4A 2K3BA 2HBZB 3Q8YA 3Q0AA 3GLJA 1U6FA 4IOAQ 1RTZA 3A13A 3PW5A 2D6FA 2NXEA 3QIPA 2ZZDA 1YJWA 2QMWA 3MECB 2XEXA 1TKDA 3DGPB 2FPEA 3K8VA 4CLWA 3META 3MD3A 4DU7A 4OJ3A 4DEZA 2J6UA 4PG4A 4C8QF 1VQ5A 4ZHRA 5IHIA 2OTJA 2A7YA 2GFFA 3HD1A 2YQ1A 3ILOA 1YLXA 1XMQJ 1Q95G 2YX1A 2DD5A 4WCEQ 1VRUA 3KWMA 1GXIE 1F0XA 4UUXA 3KLFB 1OQ6A 3RAXA 2OD6A 2DBBA 2UXDF 4YS2A 5KFKA 4LF6F 1CC8A 1SJQA 1VQKQ 1DHMA 5I2MA 1RP5A 2HHTA 1C1AA 4ZN1A 1FA0A 1HW9A 3UW1A 1YWOA 3X24B 4IQMA 4ZN3A 3Q8UA 1HSQA 1I4K1 1HLWA 3OYKA 1FE4A 4M5MA 3TZYA 2YX4A 4ZLLA 2CQHA 5IFMA 2CG8A 3A8MB 2CREA 2R58A 4CNYA 3HHLD 2C22A 3CCMQ 2OPPA 3MZIA 4HCZA 1E6YB 1NJXA 1QQJA 2ZVIA 4DFJA 2ZDPA 4ES1A 1K1QA 4Y3CA 2DRBA 3MFHA 2B8AA 2QYCA 3CW2C 4TQSA 1D1AA 2P9CA 1NB7A 5D6WA 3R97A 2XTJP 3CJQA 3TA1A 3JCMb 3VS1A 4KUDK 5E3PA 1RBLA 4ZVOB 1ITPA 4CM0A 2VWFA 2L41A 3RU0A 5HI7A 4JYAJ 2BQ3A 4LE9A 3CDAA 1L3TA 3SFUA 4Y2CA 4UT4A 1C0MA 1FKOA 3HZEA 1Z4UA 3EG9B 2L89A 3FJ5A 2G6FX 2FJXA 3ZEHA 2FGCA 3IS9A 2EFVA 3DLBA 3I9V9 4LIWA 1QWEA 3ULRB 1FMVA 1SJRA 3OYAA 4RBUA 3FRYA 1ZUYA 1AWWA 1IGQA 2XZTB 3T41A 3F70A 3DMJB 3OJSA 4C0DC 2HNYB 2EYQA 1QCOA 2MB0B 2CSIA 1X01A 1R31A 2KXFA 1V3RA 1K9AA 2MQQA 3IS9B 1AZGB 4D3HA 1CULB 1BI1A 1PCXA 1J27A 3QFHA 2LQNA 5KFSA 3KUGA 3IRXB 4KJIA 1Z2ZA 2O4XB 3UATA 2W7PA 2W2NP 1XNQJ 1XTDA 5D0EA 4FXWA 1X2QA 2WTFA 5KFCA 4C92E 2ACYA 4PUOA 4M75E 2KYZA 4KV8A 1YITA 2YWHA 3MAQA 2LCCA 3CMEQ 1TK0A 5GAEU 1S1WB 1SKWA 3G8QA 2RI5A 3CCRA 1YJTA 2HBWA 2FRYA 5C24B 3IRXA 3UN3A 1HARA 1QVPA 3LGNA 2HRYA 4GRSA 3AAWB 3QLHB 3QGIA 5KOWA 4R0JA 2FPFA 4KH1B 4KSEB 2FPDA 3MEDB 5D0RA 3KDOA 4PJLA 2BYCA 2IVWA 5KFHA 3GIJA 2FVCA 1KVJA 3CXCS 1ZS6A 2PT0A 2AJ2A 2O66A 4HL9A 3KJVA 5JVGQ 3RUXA 3FZ2A 2VKRA 1PIEA 3M4YA 1GL5A 4J9OA 4MZPA 2E6ZA 3MUTP 7AT1B 4M94A 2LXUA 3QO9A 5AXNA 2CPJA 2CDTA 3P8HA 2F4FA 4TYBA 1EAYC 3VAMA 5CYMA 2JSXA 4PFPA 1U48A 1HWLA 1RWMB 3C19A 2QDYB 2DITA 4WK1A 4BC7A 1OPZA 5AE2A 5CZXA 4DX7A 2R7UA 1Y96A 4L74A 5L1LA 2A2DA 2JOQA 4DV5J 3GR0A 4C9DA 1Y00A 3FEXB 3OB9A 4AUKA 4A8YA 1OQ3A 3GB0A 2R8IA 4HCKA 2XB2D 4V1Ak 2HAFA 1JX4A 1XNQF 1YQHA 2XIDA 2Y8WA 4FBUA 3W7BA 3Q8RB 1X43A 2BUNA 3B4MA 4GO7X 1SCJB 4YHHF 4LSLB 4LN2A 1T11A 4IKFA 5K14B 5GAN3 2DXEA 3HKZD 1PBAA 4PJOD 5A8RA 3AOAA 2B9EA 5K8OA 1YKWA 2HWTA 3FSIA 1QLNA 2X4JA 2GHPA 3V4MA 2NUHA 4RG8A 1V5IB 2B43A 1M1FA 2WSCC 2DEJA 2O01C 4GVLA 5GAOr 2H51B 1VQ9T 4Y34A 2DRDA 5F8JA 4J7CA 4DR5J 3QZ9B 4C92D 1OX9A 2AKWB 2LP4A 1JJ2S 1J5EJ 1K73C 1PBUA 2JLEA 2LTOA 2VFRA 3PACA 4DCPB 2GMHA 2RHZA 4QIVA 3W9IA 3G7ZA 4QIGA 4RW4B 4GKJF 4K4SA 1YJNT 2D9TA 5AXLA 3VQSA 2UUTA 3GZ7A 3CCQQ 1OO0B 4DR3F 1HNZF 3GP8A 5D4NA 2XCAA 5GAMg 2DNUA 4EUVA 4LDXA 2R2SA 1OU9A 1W26A 2MJUA 4DV1F 2R3VA 2R7OA 4O3RA 1PRMC 4D8KA 1VQ8A 1X0PA 2IAJB 3W2VB 1NLKL 1FWZA 4YN3B 4R56A 5KT3A 3CCES 2E6NA 1N5VA 3R6GB 1M3AA 4C0GA 1YJRA 4J91A 1TKZB 3J81E 3B8HA 1IKYB 5JUMA 2EXUA 4F3MA 5KYUB 2XMFA 3JSCA 4EBDA 2YPYA 3LGMA 1ZM9A 2CPFA 2CJYB 2EKHA 3PGGA 1JMTA 3D66A 2VD3A 2YKAA 4NE9C 3KYLA 3CCMA 1UJ0A 4UQTA 1AA1B 4OJGA 4M7AB 1M4ZA 2GQ2A 3H2VE 3MKDA 4IUQA 1GNKA 1M5OC 4RNMA 3CCVS 1S76D 2K3KA 1NBEB 4WYLA 1NZ8A 1QVGP 1WHGA 3LWMA 2XZWA 1GFCA 1TKXA 2OJ2A 3VGTA 4M5IA 4FL6A 2F63A 1UW9A 4DV4F 3J81U 3CC4S 1QTNB 2J9DA 2R2RA 4DR5F 1RT7B 5HQLA 3GFHA 4OHXA 1FX2A 2RJFA 1UP1A 2WVBA 5GAHI 1VQLT 4A8OA 4NL2A 3M9QA 1KQSS 5JVHQ 3PW7A 5FLXY 3M8PB 4A4GA 2G1DA 1TAQA 2H9ZA 2AQ4A 2LDYA 3JB9k 3AT1B 2ALYB 1QJHA 1N36J 4LR9A 3LAMA 1X5SA 3CCST 1Q7YU 4ELUA 3E2UA 5E5NA 4Q2LA 1JBMA 3VF0B 2K8GA 3R7BB 2FQQB 3GIMA 2PUKB 2IIMA 3VS7A 4C8MA 5CYQA 3GOXA 2UZAA 3JCMh 3HSJA 3PTAA 1T03A 1Q8IA 2JHEA 2EBGA 2AW0A 3QYHB 3PVLA 3WQPA 2ZVSA 1WSRA 3ILJA 3POTB 2PIIA 4ZNXA 3BGRA 1B7FA 4YB1P 5DLOA 3ET6B 4A4EA 1OS5A 1UEKA 2AF6A 1MMDA 3CCMT 2JWNA 4B3OB 4U67Q 4S0MA 1NAQA 2GQQA 1MNEA 5LOQA 2F9JA 1SQGA 2VQEJ 2HLTA 4OZ3A 2R2UA 2R8HA 2EQMA 3MMJA 4DX8H 5HANA 2IRYA 4FPIA 1EP4B 2PMZD 3QT6A 3PXGa 5AT1B 1FCAA 1RT4B 1PD1A 5HSPA 1Q7LB 2QA1A 3MEEB 5D78A 2I2YA 4MDWA 4YY3F 3BDEA 1GAOA 5IV4A 3GV7B 2KTQA 3OTDA 2YKPA 1ZH5A 4NLPA 4YDXA 3I0RA 4DZDA 2AEFA 2F4VJ 1U6BA 1FJ7A 2DXUA 3ENWA 5GAOq 2Y1LB 3UO0A 3V6KA 2HG4A 4M5DB 2HEKA 2L8DA 3M55A 1BI2A 1VQ4T 5A8RB 4I69A 4GC6A 3TQ1A 3EHRA 2B7BB 3QQCD 3R5BA 2O2OA 1KS2A 1VQ6A 1VDHA 3OHAA 1WJ9A 4G3IA 3JQJA 2XNQA 2RAQA 2B7CB 4M7AA 4UZBA 5GAGU 1FDNA 4MZMA 3DRPB 4R8UB 3BREA 4NOHA 2CQIA 3HSZA 1ROFA 1HXDA 5A8KB 2HAIA 2M5YA 2X3GA 2XMJA 2VC1A 2X3XD 4M7AG 2RO0A 3TJ9A 4ZP9A 2NXJA 4NLSA 1RTIA 5IC4B 4B9LA 1VQMT 4DV7J 1FVQA 2MYFA 1WF1A 1TVRB 2P6SA 5BJRA 3VV0A 3D28A 1FEEA 1MGQA 1R0AB 3OR1A 3TZZA 1CPZA 2ASDA 4DSEA 1NK9A 4KYZA 3M58A 4IKAA 2VXEA 3JCMf 4BI4A 2ZH4A 5A8WB 3VAFA 3GJSB 1WEZA 4U95A 5GMDA 4C11B 3TO8A 3CJKA 4F7VA 2MZJA 2CVEA 2HCKA 4ENOA 4TXSA 1TKZA 2DF6A 2AJ4A 2CIMA 2EFOA 2RJDA 3THKA 4B9NA 2L3PA 2KH9A 1VRTB 4Q8EA 1X6BA 3CCSS 1P1LA 3QYGB 1ZZFA 3HL8A 3CD6S 4OX8A 1MV3A 3DM2A 3OYCA 2P84A 2RE1A 1Q8LA 4FBTA 2V5HG 2GIQA 2R7QA 2G3RA 3TNVA 2E1HA 2DEIA 1WUUA 4M75C 1RUWA 1ZBJA 2DZ9A 3SXLA 1T05A 2LQ5A 4JI6J 4FS2A 4DV1J 4OJHA 3RW6A 2VG5A 5E3RA 4F25A 3KLHB 2WZ1A 1S10A 3ZFJA 3HK2A 3VHQA 1UUEA 3MP1A 3QJPA 2KK4A 2RDJA 5HY6A 5GMEA 1NEEA 1AD5A 2Q43A 4J9UE 3UCUP 3P6YC 1KQSA 2HVEA 2W2MP 2DEQA 3ZTOA 1HFEL 1MMNA 2UXCJ 2CYZB 5L8RC 4X1VA 4LFAJ 3MM8A 1Z9QA 1TR0A 3M8QB 4ZTJA 2HZAA 3MECA 3G2XA 2DTIA 4DS5A 2LQBA 2HNDB 4H4OA 1IJEB 4OB1B 1O75A 4B9SA 2ZJPQ 5CQXA 4ZCKA 2YNIA 2OUGA 2XI9A 3QIIA 5GAOp 1MU2A 1FHTA 2PFDA 1ZQ1A 2J0QD 4RTWA 2X1AA 2NPIA 1H3HA 1YJWS 5CXTA 1N6QA 1Y3KA 2RD1A 1GMVA 2FD2A 2MMYA 1XK8A 1JXVA 2B51A 4Y2KA 3PNIA 2VBXA 3OBIA 1R6YA 5IT0A 5J2NB 2QA4T 3PRBA 1BXNA 2DYBA 3GV5B 3LTOA 2ZE2A 4OVAA 1KTQA 2ACMA 3MCAB 3AHPA 2DHSA 2F65A 4CLTA 4KBMB 4DR1F 1S57A 2RVJA 2YWFA 3WC2A 3QZ7A 2C2NA 4JJDA 5KFAA 2PVDB 1N6AA 2KZZA 1Z9ZA 3V8JA 4JI2J 4OMFB 3JRZA 3D6HB 1M5PC 1BGXT 1G3SA 4CWBA 5J2NA 1Y7XA 2R7TA 3CBMA 3JCMW 5A8KA 3KLEA 1M3BA 1Q4RA 5DDQC 4ZLNA 2CVIA 3TWZA 1CJVB 3FB9A 3LF0A 2NXUA 1R27B 3TRGA 4U7UK 3VAJA 3ONQA 1R43A 1UE9A 1U0HA 4USKA 3E01A 3DB3A 1JKHA 2ZHAA 4N47A 3NLCA 2DL5A 2FLNA 1S1WA 4W90B 1Y0MA 4ZVGA 3QWPA 3GLXA 2MQLA 3U7JA 2QEXQ 1NJIR 4FZVA 3SDEB 1WD6A 1KLMB 2W9CB 1VFJA 3DN9A 3M7VA 4DV0F 2AYMA 2M1HA 5DG9A 3QSIA 4DEYA 1LFPA 2ZPHB 3QGGA 2HYIB 1R8OB 2F69A 5HK4A 2MY8A 3T6BA 1S1TB 1X9MA 1O6XA 3FIFA 4WTOB 2NLWA 4DPUA 4NS5A 2BACA 3ZO7A 3DLMA 3SEMA 2QEXT 2BANA 5CABA 6FDRA 1JJHA 4OI0A 1ZUUA 1PILA 4UUWA 1GTHA 5AE3A 1RYSA 1QVFR 1HHQA 2CT4A 2DXBA 5DQGA 5CQGA 2WB1D 1XWLA 2GAHC 1P9QC 3T1HF 2ZAEA 2DL3A 3MHYA 4C5GA 2VOPA 1VIOA 4OJ1A 2OEJA 4RX6A 1Y0HA 4Y28C 3G6YA 1TQLA 4CH1A 1RA7A 2XSFA 4EU0A 4KIAA 4OF1A 2FJWA 4X66J 5HK0A 1X4AA 4CI0C 3EX7B 5K20B 5T41A 4DPOA 3PMTA 4L72B 4A8MP 1O5JA 2BBEA 4W98A 4B3TJ 4DG1A 3HVTB 1YHQS 3IP0A 2QTXA 4U96A 1YJWT 1S0VA 1JNZB 2KO1A 1WEYA 5EX3A 4J6XA 3T5HA 4N76A 3L2UA 1DRZA 1FRJA 4MK9A 2UVWA 4YR2A 3NFCA 1VGYA 5FLXU 3Q22A 1HPZB 4JI8J 2FVUA 2YKNB 2L3QA 3IG1B 2GVDA 3VU3C 3CC7Q 2F8MA 2FZKB 2OTLQ 2DISA 2M52A 4O0IA 1YI2S 2EKYA 2YKMB 3CPWP 2BIVA 2P9GA 5RUBA 2DVIA 8ATCB 5HVGA 3QBYA 3L09A 3V6JA 3MURP 2FIUA 4H4KA 4AQYF 3CCEA 2HFUA 5ETRA 1LQ9A 1Q53A 2EYZA 3GE9A 2EC2A 2JEJA 2FGOA 4UQGA 3TSWA 5K8MA 3N28A 1UJ6A 1UMJA 1TV6A 3RZAA 1NG2A 4C0OC 4KHPF 3GJRB 1H2UX 1UVMA 1LCKA 4J9PA 3GIKA 3BO2A 5ECAA 4OB0B 4EEYA 1VC0A 1YITQ 3L2VA 2YUQA 1TL7A 1S77D 4C0ZA 2FB7A 4JI1F 1H8KA 3HRUA 3E3XA 2ZH1A 4UC4A 2FC8A 1HHSA 3F0NA 5A2QU 2NYSA 2XYGB 3H25A 1IBKJ 4WBFA 2AX1A 2D8JA 4I2PA 4PKDB 4X4TA 5FU7B 5E7OB 4CIOA 5KG6A 4PJNA 2RQUA 3CTRA 1FO1A 2F8EX 4CZCA 4N0AC 3FFIA 5I22A 3OR2B 3R5CA 3EH2A 1NYFA 1T9YA 2CPXA 1YVFA 3V81B 3RRKA 3CCLS 2J0XA 2JRSA 3PJ9A 1CS4A 3OQ2A 4EYHB 2UXBJ 4E7IA 4ZVPB 5CCMA 3LP0B 1TFYA 2CQBA 2W4CA 4IH6A 2SRCA 5ETVA 3HSDA 4EO8A 3SCJE 4IRDA 1TUCA 4IUUA 3MPYA 4LRDA 4CM2A 3ZZRA 2J7KA 5KYUA 4LF6J 3W8PA 2LVWA 1KP6A 3MUVP 2DK2A 4DFMA 4BS2A 2JH3A 3MPWA 3R27A 4J9NA 4CLPA 3E19A 1RK8A 1RT7A 3LP0A 4QYRA 1KC8T 1R8BA 3SD4A 1FRLA 1TUGB 3K59A 1JXLA 4BDPA 4Y2AA 1QAXA 1S6OA 4ZVUB 3V8LA 2IBKA 2QQSA 3SWNA 2E9RX 4Z02A 2WVEA 4M78A 3EMTA 4ECWA 5LSOA 4B9UA 1R6VA 1RT5A 1NM7A 5FRMA 3E1SA 3DCAA 2BZ2A 3L7OA 3EVOA 3TEEA 2YKNA 5C5JA 4BE1A 2FHMA 2KT3A 1JLGA 1JU5C 1QP3A 3M05A 4YY3J 2KG1A 2DNPA 3V4IB 3MWBA 4OB3B 2CJBA 5L1IA 5CHCB 1S1XB 2X4WA 2CNOB 3ZTPA 3M8PA 1UTIA 4C8KA 5J2QA 2MKYA 2M8DB 3C15A 5SUHA 2LECA 2P6TA 4NZ6A 3ITHA 4RBTA 4FCYA 2MQOA 1X7VA 1VQOQ 3BW1A 3JSBA 4M7AC 1BB9A 4CLLA 2OPPB 1ZX6A 5I21A 4WFBQ 1FFSB 3UT1A 2DH7A 5KT7A 2RNAA 3O1LA 3BKFA 1LXJA 1R77A 2D9OA 4ZPAA 2DRKA 1Q0NA 2W9BB 2V26A 3G82B 1YHQT 1VQ5Q 3PHEA 3MP6A 2NSCA 3THPA 1UVIA 1QMCA 2LQKA 2BJ3A 3M9MB 3C16B 3WIUA 1M8MA 4BWJA 2D69A 4RCCA 2X1BA 5CAIA 2HVZA 2E41A 2ZGWA 2D0QB 2BXJA 3GG1A 1BQMA 3CJ8A 1T3LA 1XEZA 2O5DA 4C5HA 1VQ7Q 3I82A 4DSFA 3PT9A 4K11A 5IH2A 1RT2A 4TN2A 4C97A 3UPUA 5BR8J 2NUTA 4PG6A 4ATNA 4OZ5A 2QEXA 4OMPA 1RQ0A 1RWNB 2CPYA 4NLWA 1RABB 4LVOP 1S7HA 5H1SV 3FLGA 4CO5A 3FNNA 1C1BA 3CJ0A 3IBFB 3AD9C 4DL5A 4N4HA 4KE5A 2YBVA 4M75G 5KE3A 4C8LA 1CJTA 1Q81U 2D1CA 4P73A 3PY8A 4F67A 1S1VA 5DLFA 4U8YA 3JCMd 1B3QA 2EKOA 4ZITA 5LJ5e 1HMVB 1F5AA 4QKUA 1NM2A 3RGIA 1V3ZA 4KGXB 4M75A 2UV8G 3PV8A 3KG4A 1VQOT 4NLTA 3NCRA 4IFYA 2E7WA 2L3MA 1MSWD 3M2UB 1F2HA 4CYUB 1PJ5A 1RT4A 2V68A 1CEZA 1S99A 5G4DA 3QIDA 2F9DA 4QQ6A 1MWYA 4F2SA 4DWIA 1YHQQ 1S0NA 2F40A 4PRFA 5J2MB 2KSSA 2BDPA 4PXCA 2ILYA 2AZ3A 4P10A 3TX8A 4C8QA 2C0TA 3QG1A 3PX6A 5EX0A 4I1TA 2H8HA 1H74A 3FBEA 4ANEA 4RG2A 2HVDA 1TVRA 2COYA 2PE8A 1TZ0A 1LWEB 1TFWA 4EWTA 1ZAXA 3OR2A 4USWA 5B0FA 3M2VA 1CKBA 2DH8A 2EQUA 2M0YA 2ZWOA 2OKQA 2DTHA 4YR0A 3D2WA 4NI2A 1K0VA 4LVNP 1J3TA 2C2OB 3RRHA 3SSSA 2V8GA 3MD1A 1OEBA 3ELHA 2NXCA 5KFZA 1IKYA 3W60A 1DQ8A 2HBPA 4C92F 3MMAA 4R5PA 5J1EA 4KBIA 2L48A 4OMQA 3A5ZB 1FF2A 1FJEB 3LP1A 4JUVA 4D3GA 2V0NA 3J80Y 4F2RA 1VQNQ 5ITHA 1U1OA 4HEA9 5HBMA 1LW0B 5IV3A 3E9FA 4IG0B 4C8OA 1K9MU 2V1QA 2FJEB 4DV6J 1Q86C 3NS7B 1QKWA 1AYEA 4DSIA 2GV1A 1DTTB 2GA7A 4LF5F 3QLHA 2L08A 3C46A 5AXMA 1SH2A 3M54A 1Z2LA 2LX9A 1MV0B 3HFOA 2H54B 1T05B 3GU0A 4Q5WA 1Q79A 4RUCA 4CO1A 1AWJA 1RAOA 3VAKA 3OS5A 2XNRA 3A1PA 1RU2A 1SJ4P 1M30A 2QFIA 3AXKA 2FY1A 1VQLA 5GAN6 4K59A 1VS3A 1BCMA 2I2LA 4CC7A 4EBCA 2HGNA 1J5OA 4V19X 1YFNA 3TYTA 3MM5A 3WVDB 4JPBW 1U2FA 5KFGA 1KD1U 3HT0A 2ZZNA 1NDKA 2QV6A 3QO9B 4FF2A 2VPYB 4F36A 5JJBA 1WOSA 2HQIA 5J39A 3M4GA 4DQ2A 3QBCA 1N6QB 3NL0A 2HIQA 4PJOG 2RDIA 4JS5A 1MUZA 2EQJA 3HJVA 2BW7A 3PKMA 2GFAA 2XGQA 4DR7F 4DSKA 4M7DC 2PEHA 2OTLA 2ZFHA 3LGLA 2PO4A 1DFDA 1HPZA 5KG4A 4FYDA 3CO9A 1PYOB 4A53A 3QJJA 1FNOA 1G3OA 4QU6A 3MM5B 4FPRA 3FVYA 1IBLJ 3HSGA 4ZVSB 3KXDA 2YNFB 2YKMA 1YN8A 2U1AA 4C92G 3I55T 2UUAF 1VQNT 2JC1A 2YX7A 1M5VC 1RT3B 1Y71A 2ZPEB 2XULA 3PJWA 2Y0SD 4DFPA 1VQ6T 4ZJQA 5H9EK 2VDHA 1U2CA 4CC3A 1HIYA 2H48B 5F8NA 4ME7A 3N9UC 1S5ZA 2DY9A 5A6WA 2AU0A 4XK8E 2CUYA 1YDLA 3UCGA 2CAJA 2XK0A 1KEKA 3BBCA 1VQ7A 1N9RA 4ZPCA 1WOOA 1CVJA 2ZOGA 1NHVA 3PG9A 4L6V5 1VQ6Q 3BFMA 4QQGA 2LEBA 2RB7A 4IFYB 4NI2B 3MPUB 3MM9A 4ZVHA 3TJAA 4WIIA 4X9CA 2AYBA 1UAWA 5L1KA 3C94A 1ZLMA 3E51A 1U1LA 2QGGA 2WOMA 3TUZC 2IYIA 3VALA 1MW7A 2L2PA 3H6ZA 2EW3A 4C8QE 2WBMA 2RUSA 2XM3A 3BH7B 5T14A 5GAN8 4XDDA 3SWNC 3KLGA 1GQEA 2MZQA 2R5AA 3AB4B 2XSJB 3JCMQ 2A37A 4ECYA 2E44A 5LT5A 5GAMf 4GO5X 2IM0A 4XPEA 1Y5IB 3D68A 3K5PA 3EYZA 4Z8AA 4FN5A 4Z7YA 1IBMJ 3C14A 5IT9E 2DBMA 1NDPA 1WDDA 2XDBA 2AGQA 2RQMA 3G4SS 1K4US 1SPBP 1UZHA 1DQAA 2U2FA 3E01B 1FJCA 4MT1A 4JI8F 5GAOm 3D1OA 2EJ9A 3L95X 4RW6B 3A8LB 3M0PA 1VOMA 2IJNA 1RAHB 1UGQB 3OYLA 2CZVC 3EG0A 3SV3A 4WF2A 5GAN7 3RR8A 4F50A 2K5IA 1UA0A 3KJVB 2DR6A 5AXKA 4I67A 2V67A 1CJKB 2AJQA 3MM7B 4TY8A 4WE1B 3GNGA 4OYPA 3CIZA 2RK1A 1FWPA 2V8VA 5HKCA 1BI3A 4MYTA 4TVRA 1GBQA 4C5EA 4HR2A 2XMWA 1T3NA 2DNRA 2XYHB 2KXHA 2JFKA 5ETTA 2E1CA 2YSQA 2KHCA 2F2VA 3BQ2A 3CB4A 1WNLA 1QKXA 3JSYA 4WJBA 2JMCA 4XTWA 1BD6A 2BX6A 3C12A 3UVJA 1WYXA 4I4BA 2GNCA 2HIYA 4CC2A 3ISND 3P3DA 2Z0GA 1NEBA 2AK5A 2KR3A 4F02A 3D3CJ 4OZ2A 4DV7F 5B0DA 2E3HA 1YI2T 2IRXA 1U1KA 2ZH7A 3E8OA 1W7WA 3SSQA 3CCRQ 2BE9B 5M2UA 2GFUA 1VQMA 1UL3A 2NUPA 1RZMA 4HKEA 1OYEA 4R0KA 2X7IA 2Y4YA 3EFSA 3KMQA 3A4TA 5CCLA 3MI7X 4X66F 4QZVB 4I56A 4DL4A 1IKVB 4DR6F 2PSZA 2UXBF 4ECVA 2FLLA 3CCWA 1RT3A 4J9CA 2C3UA 3D5MA 2BEFA 4M7AE 1S4FA 1D3BA 3JCMe 1OPIA 3OY9A 4GY5A 3I55S 4XK8C 4BE2A 3LO3A 1H641 2OPQB 1C4AA 3OA6A 5CH7B 2X51A 4DA4A 2CQGA 4IYQA 4XTVA 3BSOA 3ETMA 1R8PA 1N54B 1VQ4A 1YJ9A 4PNOA 2DNKA 4C8ZA 2DAQA 4A54A 1CS4B 3M1VA 4ZCMA 5J1NA 2CP7A 5GADI 3CCUS 4PYAA 2OI3A 2GBQA 3GFXA 4NLUA 9ATCB 2HKQB 1TMJA 2IVMA 3GP9A 1XJWB 3PFOA 2DERA 4HVUA 1HQUB 5I3UA 4QVCA 4H54A 3OUYA 1YZ6A 4C98A 1K76A 1KK7A 2CP0A 5IQQA 1JJ2A 1VYVA 3DM2B 2RH3A 4JV1A 4GVBA 2OPSB 2QQ9A 5KFVA 5HN0A 1S9FA 2W0ZA 3VWSA 1PHTA 5I11A 2EEYA 1NCLA 2A28A 4EMKC 1M1HA 3OYBA 2H4WB 5CZVA 3W9HA 2Y8YA 5CKFA 4B3SJ 1NJZA 3DRPA 4XO0A 1RI0A 4WKYA 3HVWA 1IKWA 5DO2A 1YJ9S 3I5SA 2COZA 2B0GA 1RGVA 2J6TA 2AWZA 4NCGB 1HI8A 3TUPA 4PWDA 4X62F 2C3YA 1VMBA 4NA2A 4V19J 3M4XA 2J9DE 4DV3F 2DLPA 4I64A 3FRNA 3FSYA 3OYEA 4C3MA 1RBAA 3K5OA 5GADU 4FF1A 3AJDA 4O3OA 2RM4A 3GTYX 4I2QB 4Z2XA 1WPYA 4BB7A 2DNGA 2E5GA 2V8PA 4NLVA 2HHQA 3VAHA 3D1QA 2K79A 1VQKT 1IKXA 2BQRA 5C25A 5HMYA 2UUCF 4LQ9A 1NDCA 2OPRA 2XI2A 1CBKA 2LEPA 4FSSA 4J8OA 3C15B 1AOJA 3M30A 2DGSA 1P6TA 1ZAVA 1UTAA 1X60A 5KFJA 4XPCA 5KH6A 4BE0A 5M9OA 2LJ3A 3BR8A 1LK7A 3VS0A 4ALZA 4KPCA 1FXRA 4WXOA 2HEQA 2H5IB 1RCOB 4JB8B 2N3LA 1KNZA 2ZJQQ 4TU9A 2F2XA 1WXUA 4RPFA 5DDRC 4M5NA 2OTJT 5DJBA 5HAOA 2DMOA 2K1RB 1LNXA 3F73A 1BWVA 1G4CA 3VAIA 4GKJJ 3QXEB 2UVRA 4K4VA 4DR6J 1KC8C 4ECQA 1GXTA 4EMHA 2FLOA 3MOJB 1SC3B 5GANg 3CPWA 2WBRA 2Z2YB 2MQNA 4RWWA 5GAGI 5C7PA 2VQFF 1FNXH 1B64A 2CGHA 2QA4S 4BDZA 2BZYA 4Q5VA 5BYSA 2E1MC 1KC8R 2D3UA 2HS0A 3PEJA 2XY7A 4B9TA 1QVFA 4PXBA 1WFWA 1IUJA 3BDUA 4C92B 4ANJA 5GANd 3EG1A 1KWMA 2KXCA 3QJ6A 3AH6A 1FESA 3KJNB 4KAIA 4I0WA 3N6MA 1SUQB 1VJWA 2MDAA 3NBPB 2VPWB 5ETPA 2R4FA 4J6WA 4IUVA 1SIWB 4HA8A 4JZ3A 4M77A 3CC2Q 2EK6A 3JQKA 4LBHA 1VQ8S 5FJ4A 2ERRA 1QP2A 3CSKA 1EETA 1BU1A 2IM3A 2YHTA 1YJNA 1S49A 4EDUA 3MHXA 2XU8A 4IH7A 3W65A 2YNGB 1JO8A 4DBRA 4A4KA 2OFGX 4HT5A 3GNFB 2LNHB 1WHHA 1K1ZA 3J7ZT 1S9EB 2UUWA 3KK3A 2OP5A 3V7CA 3DMJA 1KSPA 3PEHA 2HWIA 2MKSA 1FYNA 5HQ8A 3BN7A 3UD3P 1BYMA 1EIYB 4C5IA 1GXLA 5DZ6A 1JRIA 4QVDA 3OBYA 1KQKA 3OV7A 3G8SA 4JRIA 3OW2A 2Z8QA 5KYXB 4WPAA 1WG4A 4F0HA 5HQMA 2QC3A 3CD5A 5A2QY 5CO7A 2KT2A 4USUA 3OW2S 1ZUKA 5GMKi 2DETA 3VQTA 1ACMB 3CCUT 3FBCA 2HGLA 3D0HE 3CCET 2J76E 4H4MB 3EICA 5THWA 4URGA 1KOHA 1FX7A 1JLFA 3KLEB 2RRNA 3QDFA 3CCLA 3Q2TC 2ZPFB 3VYHB 1YIJQ 3QRPA 3QPIA 2IDEA 4DL3A 3ZL7C 2J0SD 1T9VA 4DR4F 5L8RE 1LJOA 1GH8A 3BR9A 2QASA 3UCZP 1EKSA 4M78F 3A3OB 4A47A 1URNA 5IC6B 3QT5A 4IOBA 3CCQA 4LF7F 3OL7A 4ZJOA 1XQIA 2BM0A 4TLQA 2ZBCA 2D3ZA 4YB5A 2E3IA 3G71S 4IFVA 2O31A 5LSRA 3SB2A 1X9SA 2VPXB 3D1HA 3MEAA 3FKBA 2L5QA 4KGVB 4KO0B 2COLA 3UPFA 4MIWA 1RT6B 1N5YB 2RJCA 5CKDA 2OO4A 2E66A 4TU7A 1CULA 1N5QA 4NASA 3R5GA 4C8QB 3RBZA 1KFSA 2R7SA 4KKOA 4UOGA 1ABOA 1FDAA 1PAUB 5G0RB 1SC1B 3VVUA 4QU7A 2RIJA 2RKIB 4PAAA 1RLQC 2F2WA 3MEGB 3THTA 3VVTA 4B9VA 4L59A 3OXLA 4C0HA 3A3PB 5A0DA 5KFRA 2R2TA 3SYZA 2F1FA 3OTBA 4J9KA 1HR0J 4B9WA 3D3BJ 4C3KA 1ZZNA 4C8NA 2VG5B 5IQ6A 2LA4A 2XYPB 4M78B 4CQ1A 4JI0F 2KRBA 3KTQA 1G83A 1S6PB 1DTQA 5FDLB 2RF0A 5CQYA 5KG0A 3GG0A 2IM1A 3IG1A 4KTQA 1HK9A 2WW8A 3OTOF 4PXDA 1IXDA 1WHVA 3O2IA 3VR1A 2NUUG 1AHJB 3T5LA 1B4SA 2IRUA 4JS4A 1G3WA 2RS8A 4LF9F 3H5UA 3N5BB 3NGPA 2P9EA 3R5JB 3KJQB 1A9NB 2B3TB 1KIKA 2OD4A 1R0BG 1RTHA 4DI6A 2Q6BA 3LH0A 3PMIA 2ASLA 2KROA 1Q82U 4DG1B 5J1PA 5FIIA 1WI7A 1M2VA 1NPPA 1HL6A 3ZNUA 1KVIA 1U25A 4IDKA 2WVFA 1HNIA 2HQGA 2HL5C 4LSZB 1YJNQ 2GIFA 2ED1A 1FMWA 1UCNA 3EFOA 3BYRA 1AFIA 1I8FA 1T8EA 2CPEA 5ADZA 1TUWA 1UFKA 2DCUB 3OD2A 2VIHA 1WC4A 4KGKA 4DQPA 1Y7PA 2DHHA 2LJ0A 2KFYA 3Q2SC 4ETXA 1VQ8T 2AKKA 4O4RA 2FJVA 4OLOA 1CQNA 2MF2A 4K7QA 2DXFA 4ZGJB 2RQTA 2FYKA 1XBWA 4RUAA 5GAMd 2JNGA 4PLIA 3NWRA 2GCXA 1RTDB 4NZ0A 1ZM3A 3N79A 3FJPA 1M5SA 4PQUA 4Q0BB 4DX5A 3H20A 2BMBA 2X3WD 2H1YA 3CEDA 2EWNA 3OVAA 1YI2Q 3M2RA 1HBMB 1AWOA 1NJIT 4ZVFA 1NNDA 3CUNA 2QJ3A 1HD0A 3SFGA 2IAJA 4PG5A 3ER0A 2JMAA 3AD8C 1X5PA 5HVHA 2DVJA 2DCLA 3EGXA 2D9PA 2X35A 3NMRA 2R9LA 2FEIA 4ED3A 3OYNA 2B8PA 4OFZA 3VJPA 1PC0A 2BKOA 3DI6A 2BTTA 3OYIA 3PW2A 4NPOA 1MN9A 1VQ4S 2DO3A 1U09A 3TUJC 4LF9J 4DMZA 3CDWA 2D41A 4USTA 5G0RA 3KK1A 4E0DA 3BKUA 1BIAA 2HFSA 5F9LA 3TANA 5GAN4 3G1JA 3CC7S 5IXBA 2RU3A 3U1MA 1S1NA 4ESRA 4LF1A 4FIBA 1VYUA 3RRGA 2ZH2A 3FQKA 2A3LA 4RTZA 2YUPA 3LOUA 3ZXWA 5CAAA 4ID8A 1TP7A 3ITHB 2D74B 4OHZA 5CVIA 4D8DA 1IXKA 4PG7A 1VQ8Q 3M32B 4ICLA 1OPKA 4KR0B 1TK8A 1AXQA 2YH1A 4LQ3A 3IAS9 4X9DA 1R3NA 1OU8A 1JJCB 3K5NA 4N77A 4CLFA 2HHXA 1Q7YR 2CP2A 4LF2A 2ABLA 1LEOA 3B82A 4I6WA 1U24A 2H3JA 1WHMA 4B9XA 4HTJA 3KHHA 1JNRB 4ED2A 2MKKA 2H5EA 3IGVA 4RLEA 2FY8A 1BQNA 1ZA2B 2DZCA 3H41A 2VV5A 4WFNQ 1RTJB 2QLBB 2XBPA 4MH8A 3RERA 4ILRA 3H42A 1RJJA 4WE1A 5LJ3h 2KG0A 1U02A 2DNNA 5E0OA 3SMZA 2DNOA 2CXEA 3QJLA 4OZNA 4BHQA 1HNIB 1WI8A 3GONA 3A12A 5GMKa 1N8RR 2ZNYA 3L2QA 5GMKe 4IRCA 5CR2A 4AG1C 1M2OA 3JSMA 4AFQC 2FTRA 2MHEA 4LXCA 1JLGB 5IM0A 2HHWA 2O67A 1PWTA 3EGVA 2KY9A 3EVWA 4R55A 1LWXA 1WWHA 2PVGB 2RQVA 3M9NB 3VCDA 1LWCB 1YGYA 5L46A 2IC3B 2ZUGA 1RLPC 3BGFA 3MTJA 2BA9A 2JLGA 2SXLA 1SQEA 4CLZA 1T9XA 4F3OA 2HS4A 1S72S 1F5BA 1DBDA 1KVKA 4ZMMA 5L38A 3P8DA 3DYAA 3CMES 5A0YB 2ZH9A 1GCQC 3GV8B 2N4CA 3RW7A 1I3OB 1NKBA 1B99A 2DL7A 1F6TA 3EZ5A 4P52A 1LPLA 3LPEA 3NBPA 2DK3A 3HLUA 2X1FA 1ZSZC 2KN4A 3EFOB 1K8AR 1NHUA 4KHMA 3IBCB 1RTHB 3T3FA 1PJ6A 3PR5B 2OTJQ 3K7RA 3UR3C 1DJ7B 2D3O1 4J7IA 1N5SA 2QLXA 2C3MA 1SRLA 1Y07A 1EETB 1QUPA 1N32F 3CCQS 4G1QA 2RS2A 2QL5B 2V2QA 1U8RA 5KCOA 3V6HA 4IUFA 4TQRA 1VQMQ 3MR7A 3GJTB 4ZVEA 3BH6B 2FHDA 3BGUA 2HHPA 2CNKB 5F8GA 4OZ0A 2JTMA 2GMLA 3BSCA 2G2ZA 4FM4B 2XHCA 3DRRB 3CC2A 4CNZA 1FTCA 4YDDB 5L9NA 2BE2A 1FXDA 3FRZA 5LJ5g 3W1YC 4I2PB 3LWIA 2RJZA 2JL9A 2CSQA 3SEOA 1Q82C 3KBGA 4C6AA 1S6QB 4X2BA 4K4WA 4P7TA 5HCKA 2Y1RI 2E5KA 1VLYA 1WHLA 4AFFA 2J5AA 2MQPA 2BOPA 2AEJA 1BC6A 4B3TF 4CI0B 3H2LA 1TG0A 3OR1B 2M9KA 3G87A 3G96A 3D6MB 3ZBDA 3X26B 3GIRA 4P72A 2ATCB 2XWYA 1FKAF 2JVRA 3OSVA 3KK1B 2L9NA 4B08A 4JP8A 2MEWA 4AD6A 1FKPB 3PE0A 2XQCA 4O4GA 1OV3A 4A8SA 1PKUA 1UA1A 1NLOC 3I0SB 3DI6B 1KLNA 4ED6A 4Q2MA 1TXQA 3AY0A 4FYXB 2UVVA 5KFIA 2MKJA 5C2CA 4RUHA 3O6QA 2YPZA 4LSNA 3C2PA 5A2QE 5C6SA 4IR9A 3OYHA 2PZ1A 1U8SA 3Q8VA 1U4BA 2DXDA 3QO3A 1LKZA 4OZLA 2AZVA 4KHPJ 3THVA 3BO4A 1D0EA 1PSFA 4O44B 5KFMA 4RNHA 5E41A 3HFNA 1U1NA 4OGEA 2FHOB 2RHQB 4FT4A 2WSFE 3OLAA 5AYFA 4RTTA 1E7OA 2JEGA 1FVSA 4AYBD 3MP8A 3KKFA 3D4JA 1GBRA 2FPHX 1X0FA 3K5LA 2RNEA 2EGAA 1IM6A 4NLRA 2F5GA 2GX8A 1M1KR 1CC7A 2OAUA 2E4HA 4N0AA 2Y1IA 4JV5J 3OJUA 2OH2A 4ZTFA 4AT1B 1M5HA 1NSQA 2CWKA 5HMZA 3GR1A 2EGCA 1O8BA 1R8HA 1UVJA 4B3RJ 3CJ4A 3OT9A 1TL3B 2M0GB 2BANB 4QR1A 1ZM4A 4P7VA 4OMFG 1PAEX 2HNZA 3EPGA 4O3QA 2W8LA 3VZHA 1IVZA 4LUEA 4IOCQ 4X4VA 4P2XA 3QDRB 2EPDA 2ROGA 5GANe 1FFGB 5DG8A 1LWFA 1N32J 5ETMA 1HNVB 5HMWA 1ZSZA 2ZBQA 2KAFA 1X5TA 1AFJA 4FXVA 4IUTA 3NS5A 5CCAA 3OVSA 2GJIA 3E2EA 1RT1A 4NCBA 4GKKF 1PO6A 3G6XA 1WX6A 2KU7A 4X84A 4WZQA 1VIFA 2ZZTA 3H59A 1I81A 1KRPA 4XAXB 2XY5A 2O88A 2VPZB 4NWBA 3GYXB 3FCHA 4AL6A 2WONA 4RCBA 4JV0A 1BI0A 3HO1A 3I5RA 3A8HB 3TCJA 3SQOP 1YCYA 2LXIA 1KD1R 3OXFA 4M5JA 3VYGA 3KG0A 2ZNZA 4ID5A 1YJ7A 3EG9A 4LF7J 2FYXA 4J9GA 1IKVA 1RA6A 4K4XA 4DOZA 1KOOA 4CO3A 1UETA 4Q8FA 3W2WA 2KFZA 4VUBA 2YTCA 2Q66A 1HBUB 2GVDB 2MGZA 1VQ9A 3D0GE 3CCMS 2P0PA 2QYZA 2GQCA 1WC0A 4PQUB 5ETLA 4YHHJ 5D4PA 3SV4A 2QN6B 4ZIWA 2CQ2A 4I6AA 1U45A 2VA2A 1I94F 2RD5C 1VBZA 1HBMA 3R2CJ 2RF2B 1D1CA 4M77B 2VYTA 3L7UA 4QWBA 4OI1A 2EFNA 1C0TB 3G9CA 3EPIA 2IJFA 2KXNB 1VQLQ 1HBUA 1KD1T 3V7RA 1YBUA 2RU9A 2V2ZA 3NOGA 1RAGB 4MIBA 3JYTA 1RACB 4LRCA 3LYIA 1IJFB 2V1RA 4E2FB 4M78G 1Q5YA 1NZAA 3PIPQ 4O3NA 1UW4A 2MY7A 4CTAB 3CCSQ 4WFZA 1T3OA 4ILLA 3UQSA 6FD1A 5IAYA 2I8EA 3MEKA 4M5HA 4GKKJ 1RWPB 3VAGA 2RHXA 1HWUA 3MR2A 1TUVA 5F8MA 4TY9A 1JQGA 5ETOA 2EJGA 3U23A 1RAEB 1A0OB 2HSPA 2MJNA 2ROLA 3AB2B 3A8EA 4PYDA 4F8RA 1XN9A 3HHEA 2ZC4A 2HNZB 4HH0A 1OI1A 3GQCA 3N6LA 4MIAA 2OLWA 1DZ5A 3H4DA 1QM9A 1APSA 2DE0X 2E5LJ 2CZ6B 2XMTA 3R7NB 4OX9F 3ENQA 1GFWB 4ED0A 1UDLA 2NSBA 4JRKA 4PCQA 1N36F 2Y1JA 4DPTA 3I5BA 1MWQA 2BJ7A 3CPWS 2C2MB 2GAGC 3REAB 3MR6A 1S1XA 2ABYA 3OFFA 5CD4H 1FRMA 2VC0A 4ED8A 3N5BA 3UD5A 2FJDB 3KOAA 3CBOA 5E3QA 3JB9F 1SHGA 3AA9A 3J80E 1M1KU 5EWEA 3QAUA 4HHUA 1K73T 4HTIA 3TVZA 2ZD1B 1WZOA 5KT6A 5IT4A 1DTQB 4ECRA 1OWXA 3FEZA 1NK8A 2E10A 4CCHA 2F5TX 2I1RA 2VKNA 4CRJA 4CLUA 3HRSA 1F9EB 1ZSZB 2W9BA 5GAN5 3CCTA 4DPWA 2DFUA 3CDUA 4ECUA 4C0FA 3CJ3A 4E7LA 4OZ1A 3PR4A 2PN6A 4OQJA 1K9MT 3BGRB 3SHWA 2HK3A 4N7TA 1SQFA 4I6YA 1XERA 2ZE2B 2HAXA 3LALA 2AEMA 3JTPA 4FF4A 2EYWA 4Q7AA 4Y6IA 5D4OA 4FYWB 4URQU 3JB9H 4DR2J 3MTKA 5F0UA 1FKOB 1K44A 4HLBA 3GFYA 4DQQA 4OGCA 2JLFA 3TEGA 4B3SF 2QQAA 3W5YA 4PJOB 4EMDA 1VRQC 2QX0A 1LNQA 2GTOA 1VQSA 1VK8A 4J9IA 2LCWA 3BN4A 2GHWA 4FT2A 3NKYA 3HPOA 1HYOA 2DR5A 2IIHA 4OX9J 3M2RB 4RNOA 4IIOA 2DL8A 2NUPB 3HP6A 2KI7A 3LGHA 4X62J 4XIUA 1VK3A 4JI3J 1S79A 1PKSA 2DILA 3PTWA 1D09B 2CUDA 3RAMA 1T0TV 1XMQF 4ZLJA 4XTZA 2PI5A 1RHQB 2Z0WA 4OYWA 3RTVA 2DD8S 4JBCA 3C6TA 1HQ2A 3RB6A 6AT1B 2QLFB 4C2MA 2DHXA 4H4KC 2YDLA 3DRRA 1FK9A 2QT7A 4DFKA 1Y11A 3IFEA 3EUNA 2XO6A 3D0IE 1B0TA 5D4LA 3BPDA 1X6GA 1YNZA 3HHLA 1IWAA 2HNYA 1YIJA 1F9HA 3W62A 4PEOA 3DKDA 4WKRA 3O8WA 3TUIC 3C6UB 1F3FA 2OIHA 2CQ0A 3DOKB 3GPAA 1K8AT 4WP9A 2QTVA 4A48A 1T0JA 1CSKA 4M5LA 2VL1A 1U26A 4USHA 5CD4A 4AQYJ 1I1JA 1I07A 4J6YA 2B5JB 1UWAA 2UUAJ 5AJ3J 3MGJA 2KRSA 2VONA 3CGIA 3MCSA 1RI7A 3DLGB 1TTHB 1XNRF 2A36A 2C42A 4HI2A 3C6UA 5F0WA 1KJWA 4IQXA 4C11A 1L3KA 5F9NA 4OLPA 2W2OP 4U8VA 2CQ3A 5KG3A 1KLMA 3KNGA 2W9CA 3M53A 3JB9I 1W70A 1QDUB 4K4ZA 1HI1A 3UDLA 2O9SA 1X4EA 3C3LA 1U1SA 4KGZB 3ULHA 4B3MJ 1QVFS 3ZZPA 1KD1C 1VRUB 1NSAA 1TSFA 1XR6A 8AT1B 4OYIA 4PZVA 3G6EA 3PVXA 1RE1B 3MR3A 4PLLA 1G3TA 3TEHB 4M95A 1OX8A 3G6ES 1SSHA 3P8BB 2HVIA 2CT3A 5LJ3g 2E1RA 2C1EB 2V2VA 5LSLA 4WTYA 4P2MA 4DR2F 3QHSA 1RWWB 1E6VA 2OMOA 1YX2A 1P1TA 2Z58B 2BOAA 1B0VA 1RHRB 3HFVA 3M6UA 2I6WA 2BJ1A 3IGNA 2AZSA 1S0OA 4QWAA 1KFDA 4M77G 1SHFA 3I56Q 1A0NB 2CQ1A 4DN0A 2RUGA 1G2BA 3M8QA 4JI3F 4Y2IA 1H7XA 1NKCA 1D8YA 5L39A 2CQ4A 1YJVA 4JRPA 1BE4A 1WELA 1REGX 3NAIA 1U7LA 5BYRA 3M8SA 1X9WA 4DR4J 1DY3A 3UN5A 2C2KB 2I38A 3PFSA 2GS8A 3SIPB 3KLFA 4LDWA 4JI6F 4G65A 2DR7A 2VQFJ 4J9MA 1XNRJ 1RHUB 3I4PA 2MLZA 3V4IA 1ZPWX 3B54A 3PYDA 2AYEA 4NA1A 1B7YB 1OY6A 2R7XA 2B9YA 2KVIA 4DQSA 4YB7A 3MMCA 3CCVA 2XY6A 3KK2B 2W2PP 4PG8A 3C4SA 2KFNA 2VBZA 3IO1A 3FMBA 1OJ4A 3HHTB 3L42A 4QPTA 3X3UA 2IJRA 1V1CA 1MMLA 3X25B 2HFNA 1D0ZA 2K7AA 4HDGA 2K3XA 1KSWA 3EH1A 3PW0A 2W1BA 1EQMA 4DCOB 2ADCA 1M2VB 1KHVA 1R7IA 1U1QA 2DTOA 1G2EA 4DSJA 4ED4A 3CC7A 2EYXA 1B70B 3TAMA 4V2SA 4PFOA 4DQIA 2KEAA 4F3QA 1VQPA 2KJWA 3VTIA 1V76A 4IO1A 3TOQA 3TZXA 1VQ9Q 4NX9A 2YRCA 1WHYA 1X4CA 1WHKA 2VGMA 1MN7A 1X4DA 3M8ZA 3L2ZA 1FWKA 1HYSB 2BV3A 4DXLA 5HMXA 5KCHA 4WXWA 2ZKTA 3M0TA 2R8GA 2XMAA 4LUBA 2WOMB 2IM2A 4XAKA 3SQGA 2PGCA 1NEGA 3CMAA 4DN9A 3EGDB 2CA9A 4OI4A 1ELOA 1WHJA 3L7PA 2G2OA 2FG0A 3D9BA 1YWXA 2OPSA 2VFSA 1VC5A 1UHFA 2LT1A 5F8IA 3I87A 1KQFB 4C92C 2BZ8A 4YOEA 2J6OA 2DNQA 3LGFA 1NO8A 5B0BA 4MDXA 1X75C 2Y4XA 1FRHA 4LREA 2JN0A 4NLGA 1G7CB 1KR4A 4LFBJ 2UXDJ 1L3VA 2DRAA 2V8IA 2ROEA 5A8WA 4OMNA 1TKTA 5D77A 1YBYA 3CULA 3OS2A 2YH0A 1E6VB 2EYYA 3W5XA 1RCXB 2FVRA 2VOOA 2I5JB 1IR0A 4OB2B 3ZTQA 2LVMA 1N4LA 5EWFA 3R1HA 3G71T 1H73A 4K2JA 5FLXE 3C95A 3RNJA 4X4NA 3O44A 3GSDA 1ZOTA 1F3VA 2M7SA 4P2FA 3RMSA 2QZ8A 3EVMA 4CC4B 2B9XA 3BM7A 3JCMJ 1MROA 3VGSA 1QY7A 2LCSA 2F5KA 1HA1A 4PWUA 3BZQA 2DPIA 2FVSA 3JSMB 2KYMA 1VQ5S 1Y10A 1H98A 4X64F 4PJOF 2G4BA 2Z2ZA 2AJ0A 1Y5NB 5HLFB 1H0HB 3JTOA 1SF9A 4WK3A 4FKXA 5KT4A 2DKGA 4B6MA 4RU9A 3M8RA 2ZJRQ 5B08A 2K1RA 3ZZ0A 1YITT 3DLEA 4PK4A 1AZEA 2RN8A 4QW9A 3QJYA 4FKYA 1CG2A 3PRDA 1C6VX 3FSXA 5CKHA 3VS4A 3UVJB 2UVUA 1CSJA 3SBMA 1UFLA 3HVAA 3X1LB 4FF3A 1D8ZA 3LPYA 3TA0A 1F60B 2MZTA 4QYZJ 4K50A 2KJVA 4NLXA 5KTQA 2BE7D 3CVKA 3N01A 1NDLA 3RBEA 2PU9B 1IM4A 2AKLA 1KTVA 2CZ0B 2EFPA 4TYAA 4HHJA 2NS1B 1U1MA 4BCAA 2C2DA 2CPIA 2HQFA 2DIVA 5I2SA 2JUFA 4EBEA 3K58A 2OAWA 3G71Q 1TL3A 5KFNA 3I32A 4AFUC 4F7UB 1Y57A 2ZDOA 3OLBA 1W2IA 2EW9A 2AHJB 3V7SA 5K8PA 4JLIA 2DNHA 2X9HA 1DLOB 2VJUA 1TUDA 3ZZZA 3ETOA 1MHNA 4FVMA 2W10A 3IR5B 2NPFA 1LWFB 5LJ5d 2YNGA 2Z56B 5KAKA 1T03B 4F7UF 4WFAQ 1OZ2A 3RG6A 2QFJA 2J6FA 4L5GA 1GMUA 2A3JA 3UE2A 2HPUA 4C3LA 1KFZA 2HHUA 5HP1A 4DL6A 1ABQA 3W2VA 1R8AA 2DTJA 4F4KA 3VRZA 1FRKA 4CRIA 3C0CA 3TQ7P 4DF8A 1TMMA 4MZTA 3H40A 1R0AA 1SXLA 1E6HA 4DUYF 2XDDA 5FWCA 1VA7A 3Q83A 4A8XA 1NB2A 1N34J 3PCOB 4C7QA 2JZ5A 2CRLA 1HNXJ 3RMQA 3RBBB 3TQEA 1MROB 3X20B 4DSLA 1IWGA 2MIOA 1FE0A 2WSCE 2DY1A 3JSRA 1QLYA 3J7AN 5J1EB 1EFNA 4USIA 5IN1A 4ZDNA 2K3YA 3DRSA 3NTHA 1VQ7S 2E70A 4ECXA 5F41A 2K2MA 1YJNS 1VQ5T 2EQIA 2G0JA 2RHYA 2M88A 2ZBPA 4ZPWR 2R8KA 3PO4A 2YQ3A 3IR6B 4O6JA 3J7Z5 1NPRA 1LOUA 3K5MA 3KUHA 1S6PA 5FDLA 3CCVT 2FLPA 2OELA 2XZDB 3A3NB 1X2KA 1Q81R 3HX9A 2KVQG 2ZBRA 1M90C 4CTAA 1WTBA 4M7AF 1GEHA 5DGAA 5GMKl 2QI2A 2GTJA 4XU1A 1PD0A 5J26A 2HZYA 1IQZA 1YBAA 2QK0A 1Y5LB 1J5OB 1F9FA 5CYQB 3R1LA 5HLFA 4J9FA 4X34A 4N8NA 2E65A 4NLQA 4BWMA 2PUOB 2C3PA 1IREB 2NUZA 4ORZA 4EMKA 2IA6A 2L9WA 5LXYA 5IXUA 4X4PA 2ZHOA 3DLEB 2OTLS 1QWFA 3U27A 4MMOA 3WZ0A 3R5AA 1K0TA 2VBWA 5DS7A 3OMCA 3WIVA 2KXDA 3PNWC 4E98A 4RZRA 1LV5A 2ED0A 3I6PA 1WOPA 2DGWA 1VQNS 4J7FA 2EFGA 4E6RA 4HVWA 3L2RA 1N34F 2L9DA 4CP5A 4JI4F 1IB8A 4FYYB 4EI2A 2YNFA 1BIBA 1Q86R 3U02A 3CF5Q 4C92A 2MMPA 2YRDA 4M77F 1QAYA 3T9NA 5DETA 4R25A 3GMGA 4M7DG 3QAEA 1QTMA 1VQYA 4MMKA 5IOLA 1SUQA 1EIFA 4A4JA 4YR3A 3IWLA 3H8YA 3WBZA 1JJ2P 1FI4A 4CH7A 4F17A 3G4SA 1SV5B 1BCOA 4PJOA 3HPWA 2I9SA 3ISNC 2HURA 4C0BA 2EG2A 2GGPA 2N82B 2KMTA 1M90R 2DPJA 5T7LB 4DX6A 5DDOC 3HKSA 4HI1A 1CKAA 4NLOA 2FL7A 1RWUA 5GANj 3NGTA 1XR7A 3Q1JA 3I56T 1IR2A 1NHKL 5D3GA 4DV0J 4HCBA 2V4RA 2VFTA 3MEUA 4CH0S 5DDPC 2LDIA 4JZ4A 2K4YA 1PRLC 2GO9A 1PCAA 4RW4A 4A46A 1T02A 4X65F 4MKAA 2WW4A 2DR8A 1YWPA 4K2XA 2WAQD 4NYOA 2H5JB 3RIRA 5LJ3j 3KHLA 3R7SB 3SFMA 2KT1A 1SB6A 2RPNA 3KNAA 4O44A 2M4MA 1QVFP 2YLBA 5KFDA 1F2GA 3EGNA 4B3RF 4X4UA 2AX0A 4XQ3A 4CO2A 1RYRA 4NXMJ 3CD7A 1WI6A 1BUXA 3IA0A 2KT5A 4CYUA 5DZ7A 1LVKA 1MWZA 2EK1A 4OHVA 2HGMA 4M7DE 2LMIA 2HBRB 4PR6A 2V8HA 1W2BP 4J37A 4DDFA 2DHGA 5J2PA 3URGA 2CYYA 2RHSB 1K0SA 2VFUA 5IXFA 3SDEA 3CE8A 3K2YA 4RW8B 5EUHA 3G4ST 3P5BP 2RMLA 2HQCA 3LW5C 4UY8T 2WVDA 2XHWA 3OFGA 3IWXA 4ZHRB 5LJ3f 3QWUA 2EKNA 3CD6T 2QA4G 2F8HA 4ZPBA 1VQMS 5D6GA 1JEGA 4HT7A 2HKEA 2LJ1A 4QQDA 1FWLA 2VGNA 1KG1A 3FDRA 3EGUA 4LFCF 2NYHA 4MJKA 5FU6C 4HKQA 2V8JA 2MI6A 8RUCA 4J9VA 4PXEA 4QIWD 1GT8A 2QGFB 2RI2A 3AXMA 4DOWA 4KQZA 3UWNA 3SDZA 3CC4A 4N8OA 3MDFA 3FBBA 5HL7Q 1FDBA 5CYMB 3ZZOA 1HJDA 2DHAA 5IWAJ 2PA8D 5GAOn 1CJKA 2EJFA 3CJ5A 4EK2A 1N0UA 4JI7J 5CYJA 3UR0A 2HQDA 4DV2J 1NUEA 1T0HA 3AJ1A 2HQ3A 3GILA 4YUDA 4ZS6A 5HVFA 2WSFC 3PYGA 1QSYA 2YKQA 3W9JA 1HQEB 3B78A 3C16A 2Q1LA 3KLHA 1BBZA 3DB4A 3CO0P 3HD2A 3HHDA 3E9GA 3PZPA 4OIXA 4G1PA 4PPZA 3CPFA 4EYIB 2E64A 3LP2B 5DY9A 1IBKF 2GMJA 2GIRA 2E12A 3CCJA 3ENVA 2QSFA 2MYSA 3EJMA 2V2KA 1IRXA 2IDLA 1UGPB 3G4SQ 3RYLA 1VBKA 1Q86U 3M5AA 1LXNA 2D3OR 2NZCA 2ZITA 3T9ZA 3PRVA 1IZ6A 1HQEA 3PHTA 4C4WA 3NMAA 3OBWA 3W63A 4PPDA 3V2UC 4DUZJ 1HWKA 1OZ3A 4H4OB 4ELTA 1PG5B 1M9SA 3WX4A 2FJBB 2G2YA 4DEXA 5M2PA 2YKOA 3VKIA 5E3CA 2EQKA 3TVYA 4KB7A 4E7SA 1VQ4Q 1VYTA 4M1KA 2KGTA 5B09A 4LDYA 2CPHA 1WF2A 2FJAB 4IUPA 1UJYA 4F7UG 3CCRS 3MEEA 1FJGJ 4EMGA 2ECZA 1U6ZA 1YK9A 1PSDA 2VDIA 2E5LF 1VC6A 3CMAS 3WXMB 3TI0A 5GMKj 1GFDA 5IS2A 1IBLF 1O9SA 3DLLQ 2ZC3A 3FC3A 5A0LA 2YWEA 1YJ9Q 4UOCA 2ROTA 1VQ9S 4NZ7A 3RBXA 4F7UE 3RBDA 2DGXA 3K89A 1QE1B 1RL2A 3MJXA 1JJ2R 4Y2MA 5DM7R 1FTRA 1OSDA 1HWJA 1S1TA 1NXIA 2CQDA 1G6BA 2CWXA 4DPYA 1BKBA 2PQWA 4IIMA 3PJXA 1I6JA 2MWPA 5I42A 2W9AA 2RI3A 5GAMj 4O0NA 4J9QA 2RSQA 2X4YA 5LM7E 3S01A 2ZPIB 2NREA 3SCKE 3ILLA 2HSEB 3MXHP 1V3SA 1SBRA 3SCIE 2JEFA 2Z57B 2E29A 2ESWA 4DF4A 1WJRA 5KG2A 2K06A 1TKTB 5KE2A 2BABA 4OHWA 1VBXA 3S3MA 4CLKA 2DT9A 5FU6B 1WXBA 3OQ5A 1T3SA 4M63A 4F04B 2RDDA 3SZ2A 4K5SA 1T95A 3RESA 1QVGR 4JI1J 4Z7CA 2VG6A 3HF5A 3CCVQ 2K5FA 3PX4A 4PWDB 3QSYB 3D6FB 2J9CA 1WKKA 4RNFA 3MEWA 1QAIA 1Z1ZA 3S3OA 2EI5A 2KM8B 1N33J 1JLFB 4M8LA 3CMEA 4WFYA 3JAMU 1EX8A 2KM8C 4QYZK 1S72A 1UB4A 3AODA 5F8HA 1YJ9T 4RW8A 2R7RA 3D6TB 1J5EF 2QIFA 1A7GE 2CH4W 4X4OA 1S72Q 2E5IA 5D6XA 1JLEB 2L3RA 2VG6B 1IR1A 3GPLA 4YTLA 2VH7A 2UUBJ 3DDNA 4QT7A 2N4DA 1M1KT 2LLZA 2FB0A 2LU1A 5KYNA 3O5ZA 2W4PA 3JCMV 4HACA 3K8WA 3F41A 1SL0A 2EIFA 1PM3A 1S72T 3H0FA 2DXTA 2ADBA 2YUNA 2AJ1A 3DU6A 1VIXA 3CMET 3LP2A 4M7DF 3MM8B 2MOXA 1HNVA 1KQ2A 1V9OA 5CK9A 2N7YA 2C28A 4QIFA 2HNDA 3RR7A 1BWEA 2DGQA 3CQTA 2M02A 4E7KA 4ZGEB 2XMMA 3KFWX 2C06A 5BXIA 1N9SA 3MCOA 2VA3A 1E6GA 4DV5F 4Q45A 4OV1A 4OV6A 3BQ0A 5J2QB 5GAHU 2CJ9A 4BY6B 4F4WA 2GGRA 3J7YU 2QL7B 2WONB 2KT8A 3HHKA 1T9WA 2YXYA 1LWCA 2YRVA 3VV2B 4USVA 1Y4ZB 4Q44A 1VIEA 4QCLA 3PKYA 4Y00A 1UPMB 1LFWA 4JV5F 1HR0F 1LW2B 2EC0A 2JDJA 3JCMP 4BACA 4LFAF 5I42B 4NL5A 2VC8A 2AP6A 1UGSB 3M2UA 4Y0FA 4J9SA 1RT2B 1XQHA 4KT0E 5C42A 4NMLA 4OI3A 1QCFA 4OYMA 3L2WA 2WHOA 3A8GB 3EAEA 1U0HB 2J0WA 1AUDA 4QOTA 4E7HA 2A10A 4IG3A 2FZCB 2MZ1A 2BE2B 3ZC4A 1B7TA 2FUG9 2CP5A 1VQ6S 1IN0A 4YP3A 3NGSA 2ZBIA 3T1HJ 5JXSA 2IMOA 2C0OA 1UEBA 3NMZC 3CMAT 4ZPVR 1H92A 3I9ZA 3EDRB 1JKHB 1ZBXA 2V9KA 3R6NA 1OYXA 4QPXA 1UVLA 4BUGA 1ZTTA 2GQIA 1KQGB 5GAMe 3TZWA 2P5VA 4ANCA 3FZBA 2XWXA 2PFFB 2QDLA 4EZ6A 3CCLT 2CJAA 3NGUA 4RTXA 4BC9A 4MAKA 4IFVB 2PI4A 3DGVA 5HK3A 4A4FA 3FDSA 2IY5B 2OSRA 4XU2A 2EG1A 5E2QA 2MQMA 4P2SA 1RT6A 5E33A 2EFQA 1S9GA 3R6LB 1VCTA 2ROPA 3GJQB 1TKXB 4X4QA 1EB0A 1KHWA 4RW7B 3I4HX 5C2GA 2GC8A 1RT5B 3QZ8A 2E7XA 1JB0E 4BDYA 2HQXA 2GW8A 3J80U 4URSA 3MCMA 3L3CA 3MO8A 2P8IA 4E47A 2JTFA 2HKNA 1IKWB 3IAM9 1S1UB 2HBYB 3S8SA 5DRKA 1UG1A 1O0PA 3CD6Q 2FHKA 4ZA1A 3HHLC 1JIHA 1QUVA 5DLGA 1IHWA 4XU3A 2CS7A 3VS3A 3UN2A 1S48A 4AG2C 4ED7A 4QR2A 3CXCR 2HBQB 1C1CB 3CCZA 4Z88A 3KLIA 1X4BA 1YTYA 3DXSX 1XR5A 5GAEI 1Q82T 3HVRA 4FU6A 4KY3A 4GMKA 3DOLB 2KE9A 2E9TA 2C3OA 3P96A 5F3TA 2FHJD 4ZP6A 4DJBA 4M77D 3A8OB 1H6KX 3P45B 4F0MA 3UDVA 5DG7A 3ISZA 3PX0A 1B34A 3M6WA 4ZGDB 1YJWQ 3BQ1A 1SJFA 1TWBA 2M51A 2G0CA 1VQNA 3CCLQ 5D0GA 2ZOFA 2XI3A 3DYAB 1NSKL 3TSZA 1TAUA 4J9EA 3R8YA 4RU2A 3J81Y 4TNOA 1NRKA 1K8AU 4QWCA 1FRXA 4DZ6A 3QRQA 5ETSA 1Q81C 1WDXA 3UWTA 3BPSP 3CD0A 2MZRA 4FXDA 2PC6A 1Q82R 1RDRA 3PDNA 3T1AA 1L5UA 4RNNA 4OI2A 2VUBA 4QWDA 2OTLT 4BLGA 1XMOF 2B6AB 3OSSC 1KKHA 1UGVA 4IO9Q 1GMWA 2YNIB 1FX4A 2QLJB 1NK0A 3HKWA 4MFBB 1WHXA 1RWOB 3DDKA 2QA2A 2A08A 2L0AA 3UFCX 3H90A 4DOVA 1SG5A 1VQOS 2KQWA 2E9ZA 2JNJA 5IHNA 4O3PA 1WXTA 3G71A 1BY9A 2PVOB 2DM1A 3EXYA 1TL7B 5A0YA 2MKHA 3R5DA 3H0HA 4LMZA 3IXQA 4HHHA 3VS5A 3BB5A 2R7WA 2LRQA 3CDEA 2K5LA 1N52B 1AB8A 2M3DA 4L3KA 2RQRA 3MM9B 3UDCA 3OYGA 2ZH5A 1S9EA 3JB9J 4NL3A 3QMQA 2O1PA 3S6WA 3TA2A 3EGXB 2LFVA 4ECTA 2FRWA 4XTUA 1M27C 4RTVA 2AIRB 2OX7A 2LP5A 4M7DA 2W2QP 2NUTB 2OEMA 1IBMF 1Q86T 4OYXA 4OMOA 3FQLA 4E7ZA 3H4BA 3EHQA 1RLDA 1UFFA 2I5JA 4AL7A 2F4VF 4E8UA 4N4IA 3OFHA 3Q8PB 3ZFVA 2L3SA 1PJ7A 3G6VA 2PMHA 4F14A 3RJMB 1GX6A 2VVKA 2GCFA 3BGLA 4ZCLA 3RB0A 2F7VA 4NMXA 1NZ9A 3N6NA 3FMWA 5HP1B 1LK5A 3FGVA 2A18A 1S97A 2QEXS 9RUBA 3JS9A 2IHR1 1Q81T 1M3CA 3BS9A 1SKRA 3VUZA 5FRNA 4DPXA 3NTKA 4M5DA 2E1PA 5HROA 2B5JA 2XSJA 2ZEJA 4J83A 4ZPTR 3TR5A 2XLKA 3VGVA 1NLPC 2R5MA 2ATLA 4ES2A 3V81A 4RW7A 3BE3A 1SH0A 3CCUQ 2O01E 5B0CA 4L3NA 4KRTA 1AROP 1HBNA 3PIPA 4LF4J 5FROA 2JEIA 3MAHA 2JM9A 3LANA 2E5QA 1KC8U 1EZZB 1BMQB 3FBFA 3C14B 4NRUA 3V5RA 1D9DA 3TVTA 3QIPB 3Q86A 2CFXA 3IQLA 4JI0J 1TOVA 4ITSA 3LA0A 2HHVA 2C2RA 2LA6A 4ICLB 4KUIA 2XMVA 2LXFA 3BBFA 4TKTA 1SH3A 1XMOJ 3GWCA 4OYAA 4G6VB 2BM1A 4DU8A 2SEMA 4LR7A 1NJIU 5KYWA 5K14A 1N5YA 4TU8A 4M77E 3GF5A 4KKOB 2VICA 1JB0C 3X28B 4GBQA 3RR6A 2ILZA 3POTA 2DIUA 2FVQA 3Q8SB 2XS5A 2LDMA 4OYOA 4X64J 3NOCA 1DJ0A 4B3OA 1UWBA 1PGZA 2B4OA 5KYYB 1DARA 4M75F 2HFOA 2KYXA 1OY9A 1WHWA 2CZ9A 1B34B 2AV5A 5L9XA 3TJ8A 1U1PA 1JJ4A 2EVZA 1RWKB 5GMKm 4L73A 2D7SA 1C4CA 1Q8BA 4XU0A 4M7DB 1BQMB 4OHYA 4ELVA 4M75B 4DBQA 3SSRA 4Y65A 4MFBA 4DBFA 1SJ3P 2LQJA 5HATA 2IYGA 2ZM6F 4ID5B 1M5Q1 1NJIC 2G9OA 2FO0A 1W4SA 2CQPA 2XS2A 3AQOA 1VYAA 1TELA 4Q43A 3BY7A 3ZZTA 2DEUA 1RU1A 2B86A 3NEKA 2MCNA 4AXIA 2MGZB 2HK2A 1OMSA 2RQKA 3SQGB 4OX7A 1M90T 5KFYA 4F4YA 3TREA 1EX4A 1PC5A 3RB3A 1WSVA 4C8QD 3QT8A 2CKWA 1PYTA 4NA3A 2BRKA 2ASJA 2W7AA 3HMJG 1ZTWA 3Q8QB 1DQ9A 2MKIA 1RHJB 1RAFB 4J5OA 2X4XA 2XS7A 2DNZA 4Q0BA 3O5TB 1BK2A 4ETZA 1SRMA 3ZNJ1 3R9LA 4LRFA 1Y3JA 3PYEA 5A0GA 4JI5J 5KG1A 4U9RA 3N4WA 4ZIVA 1AZSA 3J7YI 4AFSC 3KLGB 3V8KA 5E3AA 1W2BS 1C2PA 4ZLPA 4DV6F 3RKWA 2CNLB 1FKPA 2Q6CA 4QW8A 1HNWF 3NCPA 3KHRA 3ICLA 2FVPA 1W2BA 5EN1A 4PJJA 4F26A 4JI2F 2UU9J 4RW9B 3CXCP 5J2MA 4DHVA 1V29B 1K73R 5D6YA 4E7JA 5J3BA 4II1A 1WKJA 4ANDA 1FRIA 1WC1A 4A8FA 4M78C 4BI8B 3FJ2A 1QAJA 2UUBF 1AW0A 1S6QA 3BJYA 3SCLE 5EG2A 1U1RA 3JCMc 4P75A 2GZOA 4C8QC 2RK2A 3IR7B 3TAPA 4P9SA 3W5ZA 1W25A 2WB4A 2NZ4A 4DUYJ 2LQWA 3KHGA 1LOJA 3CCJS 4MTPA 3JAME 2RHUA 4ZVTB 4J5YA 4KGMA 4CLSA 2CADA 4LR8A 3M9OB 2NCKL 1CJVA 2QLWA 4AE5A 1HNXF 1FT8A 4DBHA 3O3LA 4ER8A 1ZAWA 4GLMA 2JXBA 4J9BA 5EDWA 5M2RA 5KYYA 1ZA1B 3QGPA 3TU4K 2K6DA 2UP1A 1IKXB 1FFWB 2VASA 3I5CA 5KFEA 2XGPA 1DTTA 4A8QA 4JJBA 4OI6A 2MQ8A 1WKLA 1JXMA 3HJFA 2V94A 3M32A 2DGOA 3W61A 1H2TZ 3WC0A 3I96A 2K7KA 4RJVA 2DIQA 3HFKA 2ALZA 2K57A 4PFZA 4IRKA 1VUBA 3TP2A 1HNWJ 3H0IA 2KB2A 4X4RA 1TU0B 2HMIB 3ME9A 4NYZA 2HQEA 4RL1A 1FD8A 2LCLA 4OMMA 5LL6S 2GJFA 2RRBA 2NLUA 2MSTA 4USJC 3I5AA 1UEUA 4LBIA 3UNGC 1H72C 3I9QA 1V5VA 1TH7A 2HD0A 3A8JA 4I2QA 3S7RA 4DUTA 2WSEC 2AZ1A 1TL4A 1B0PA 1VQPQ 2RH2A 4G1QB 5LJ5j 1ZHIA 2DIGA 4MKVA 1N5TA 4K4YA 3DFEA 1JLCB 3M30B 1OOTA 5FW9A 3G8TA 4DV3J 2RQWA 4NXMF 2QO3A 3HP9A 4F0KA 4BI3A 1QVGA 1MMGA 2DD4A 1YBTA 1D9AA 1AZSB 2DXCA 5H9FJ 3UD4P 4OYZA 2DGTA 5LJ3Y 2QTWA 1H3ZA 2CJKA 1VQKA 3KFVA 1C0UA 2V63A 2G13A 2RQCA 3F56A 4LNPA 3LWHA 1NKEA 3QT7A 3LQVA 2BR0A 1G1XA 2WACA 2EGEA 1OYDA 3OHBA 4JJNK 1DLOA 2VG7A 3IM9A 4ELZC 3HVTA 1SVDA 3KDNA 1MNDA 3CIMA 4DL0C 1WORA 4HDHA 3ILIA 4WP8A 1GRIA 1YRTA 2DJQA 4FW1A 3HULA 4M7DD 1EP4A 1C0UB 2HMAA 1VHIA 2VB6A 3EE3A 2JS2A 3KK3B 3NP5A 4L6V3 2J7UA 1JWWA 4K0KF 3I56A 5C0MA 3B6BA 2DVEA 1RUSA 2PD1A 3PYFA 1IO6A 1RHKB 4ELYC 2D0NA 3LW5E 4I68A 1Q8KA 2IPOB 1RTIB 4KC5A 5I3PA 2HHHJ 3DDIA 1X4FA 2V69A 4LFCJ 2A1BA 2ZUAA 2EPIA 1VI7A 1EKRA 5IWAF 3R3TA 4FVCA 2JC0A 1WACA 3HCXA 2JVOA 3CC7T 2HVHA 5I4MA 2J6SA 4EO6A 2MSSA 2B56A 4DCJB 1FDDA 2M8HA 4O3SA 5LMUJ 3CCEQ 3MCNA 3BEGB 4CLYA 3T1YJ 4Y91A 5I3QA 4DS4A 3W3SA 2LQ8A 2V34A 2B4VA 2V4QA 2Y0BB 3CJTA 1VBYA 3J7A1 4KO0A 4J9DA 3OSNA 3J81j 4PABA 4O23A 4NEZA 5F3ZA 1M1GA 2OSQA 2OPRB 2UXCF 3ADAC 5L23A 1HBOA 4JLGA 2MKCA 3OTCA 3FC9A 3DC2A 3CCJT 4RMOA 2JJ4D 3IM8A 4A8WA 1SEMA 2RJEA 2OFHX 1XNIA 3KUEA 5KG7A 2M2BA 5BR8F 5KFLA 2DNMA 1R89A 3DNCA 4DUZF 1T7PA 3QATA 4LJMA 2JTEA 3TVKA 4LRAA 2AGPA 3MEVA 1H3DA 2NQPA 5FWBA 4RTYA 1VQKS 3QRRA 4NCGA 5EC7A 2P4TA 3CJKB 2OJ3A 3M56A 5K9FA 1YI2A 3BGOP 3OS0A 1I0CA 2YLCA 3CPWR 1K47A 2XDPA 2BVZA 4HYKA 2K7JA 3MM7A 3DLKA 4TY8B 4HACB 1M5KC 1RADB 1WA7A 1S9GB 3EZOA 2ZHBA 1X4GA 2WK4A 2PDAA 3BDLA 4HT9A 4NOYA 2KI2A 3OPKA 2KRRA 1IHVA 3MPVA 1MMAA 2KDSA 5D8HB 2XC9A 2WSEE 2QA4A 4EZ9A 1RWXB 1VQLS 2LC4A 3RAQA 3QYYA 2HHSA 1S7IA 2KVQE 1HNZJ 2QRRA 1YHQA 3M8YA 1M90U 4MK7A 4N41A 1GX5A 1FD2A 4QJVA 3V6DA 4JDSA 3OFEA 2IMWP 3H0PA 4FP9A 3H5XA 2M0OA 2VBYA 5BYQA 3A8IA 4TVAB 1OY8A 2DJZA 2XO7A 1TL1A 4TLRA 4RKUC 3AQPA 1YITS 3UF4A 1ZM2A 2CG4A 1M1KC 1MLAA 4J9RA 2EBPA 3CCJQ 4K0KJ 2FZGB 4LDVA 2CDQA 2VG7B 2RILA 3CMQA 2NXNA 4NXNF 1KHCA 1TV6B 5KFFA