1IGUA

C-terminal domain of the transcriptional repressor protein korb
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
DPDKLKKAIVQVEHDERPARLILNRRPPAEGYAWLKYEDDGQEFEANLADVKLVALIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional repressor protein KorB
publication title An Src homology 3-like domain is responsible for dimerization of the repressor protein KorB encoded by the promiscuous IncP plasmid RP4.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 9
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06613 KorB_C KorB C-terminal beta-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.150 Mainly Beta Roll SH3 type barrels. KorB, C-terminal domain 1iguA00
1IGUA 1IGQA
chains in the Genus database with same CATH superfamily
3I55Q 5CKBA 1QQJA 2FG0A 4D6WA 3BDLA 4EMKA 2EYZA 3ASKA 2P0PA 3REAB 1IXDA 2YUNA 3JCMP 2HSEB 3I55A 5GAMe 2G3RA 2DIGA 3CBMA 2ROTA 3M0RA 4OMOA 2M0OA 5FU6C 1WFWA 1VQLQ 2ZPEB 1S72Q 1LPLA 1VQ8Q 1NM7A 2YLBA 1UGVA 2F2XA 2XMFA 1VYVA 3CBOA 3NMZC 1I8FA 2R58A 3FIFA 1WDXA 1AZEA 2LTOA 2YWWA 1BBZA 4L59A 1VQLA 4M7AA 3OS5A 1YNZA 3OYEA 1S72A 1FXXA 4QQGA 1VQ8A 3HL8A 2ROLA 4M75B 3QWYA 4OMLA 5IHIA 4JDSA 1H3ZA 1TTHB 2CZ0B 3KFVA 3H0HA 3FC3A 2V8KA 1KQ1A 3RESA 4E7SA 3INZA 4C92F 1M1KU 5KYXA 1IGQA 5CIUA 2D1XA 5D6XA 1VQ4A 2GCXA 2ZPIB 2CP6A 1QVFA 3OYFA 1I5OB 4N0AA 2E65A 1IRXA 2RI5A 3RUXA 3L2WA 2KI7A 4JS4A 1BCMA 4ELZC 3DLMA 3X28B 4KGXB 4M7AG 3JCMg 3HRSA 1W2BA 1ABQA 5KYYB 3EHRA 1Y07A 2RM4A 3H0FA 3L2VA 1OZ3A 4DBQA 1FX7A 2DL7A 3WVDB 4N4IA 5LJ5h 3S3OA 3EGDB 4FT2A 4Y92A 1BB9A 3JCMV 2COWA 1P92A 4LDXA 3VJPA 3HKSA 4PJOE 1QMCA 4C92B 4ZGDB 4HVWA 3JCMX 4RTVA 3M0SA 3N5BB 4LDUA 5D6YA 2AK5A 5CVIA 1WX6A 1X6GA 1M90R 3OYNA 4DBFA 2K2MA 3NTHA 2ZCFB 5LJ5j 1FWZA 1OI1A 2O4XA 4HCZA 2BE9B 4C0DC 3G6EQ 3SDZA 1M2OA 4M78D 4M7DD 1VQ5A 2JTFA 3U23A 3OS2A 2FPDA 4HCBA 1D0XA 5GJWB 4O5VA 3EG9B 3G6EA 3L2RA 1RADB 2EQIA 3CCJQ 2QDLA 3D7SB 2LVMA 2RQWA 3RR6A 1KFZA 1YI2Q 2MOXA 2FPFA 4BI3A 1KQSS 2DKGA 2X4WA 3QDFA 2LQNA 2KVQG 4ATOA 1JB0E 2DJQA 2L3SA 2YLCA 4C92C 3OW2S 5GANh 4RCCA 1YJWQ 3MHXA 4FYXB 1PHTA 1PC0A 4J6WA 3JCMb 1TG0A 1Q86C 3EGXB 1H92A 4AT1B 2EWNA 4M77B 5IXBA 3OYKA 4Y91A 1D0YA 3L42A 4Z8AA 2ATCB 2JN0A 3JB9G 1BCOA 1QLYA 5GAN8 3CCRQ 1Y7XA 3V8JA 3QDRB 3M57A 4LD6A 4A4HA 3EG3A 3JCMJ 2QK0A 3GP8A 4CRIA 4IIOA 4M75A 2H3JA 1KC8C 5GANj 1PG5B 2XDPA 3RIRA 2MWOA 3CCRA 1OULA 3OW2P 2QEXT 2AKLA 4F17A 2M9UA 2NWMA 4FW2A 1RL2A 1FMVA 5CQXA 2LX7A 5I21A 2W10A 2W0ZA 1JXOA 2XIDA 4R56A 1K8AC 2AIRB 1BIAA 1ZHIA 2M02A 3HPWA 2FVUA 2X4XA 4D8DA 1G8XA 5IN1A 3OBYA 2RNAA 2KXDA 5A0DA 2YSQA 4F7UE 2HDAA 2RI2A 1YJNQ 2GTOA 1NJIU 1WHLA 1VQKT 5IHNA 4LN2A 4FSXA 4ZTFA 2V1QA 1I0CA 1RAEB 2LX9A 4IKFA 1Y96A 1NYGA 1IZ6A 3NTIA 4ZGEB 3CD6T 4HVUA 3CCEQ 3M4GA 1QVFS 2AKKA 5KYYA 2CZ1B 3QHSA 4J9CA 3CMAT 4LDWA 4OB1B 2LQKA 4F14A 4OB3B 3DB4A 2FZGB 5LJ5g 1QVPA 2FB7A 1YJ9Q 4R0KA 5CKDA 2ENMA 3ZFJA 3R6OA 2RHYA 1IGUA 4BE1A 4KULA 1K73R 1W2BS 2EJFA 1SKUB 4ZN1A 3URGA 3CPWA 2JJ9A 3LH0A 3CC2A 1FMKA 2KEAA 4RTXA 1VQOQ 2JUFA 1RABB 1HD3A 4C92A 2CP7A 4BI4A 1VQMQ 1QVFP 1WQWA 2RJEA 3CCVT 2DRMA 1UJ0A 2OTLQ 3QYHB 2RJCA 1XJWB 3M58A 2XDDA 2I2LA 5GAN3 1J3TA 1FYNA 1VQMA 3QZ5B 3G7ZA 1W2BP 4E7KA 4Z89A 2GQVA 4F04B 3JCMd 5A0LA 2LCCA 3EFSA 4BI8B 2C06A 2R5MA 4M7AD 2GQIA 4OP0A 2QGGA 3FRNA 1Q82U 4B6MA 3JCMQ 3C4SA 1T0JA 4KGVB 4HCCA 2DD5A 2LNHB 3NGPA 1YITQ 2KBTA 3HFOA 2HZYA 3M53A 4OB0B 3I56Q 5GANg 3RKXA 3G4SQ 1UGPB 2KDSA 1VQ9T 1A0NB 1MNEA 2DRKA 2E12A 4CC3A 2H8HA 2EYYA 2ABLA 4JJDA 2NLUA 4RG2A 4M77A 1WJQA 5DLOA 3CD6A 3MJXA 2RJDA 4LUEA 1EZZB 2X51A 3P8BB 2PVGB 4OMFB 2ED0A 3PGGA 3L1AA 3PVLA 4C0FA 3GPLA 4FL6A 2MMPA 2GGRA 1DJ7B 1M5Q1 1WHKA 3UDCA 1B3QA 1OU9A 1D09B 4LXCA 5LJ3e 4EMKB 3CCLQ 4PJLA 3MEVA 1UE9A 2HBPA 4PJOG 2DE0X 1OEBA 2RH2A 3KXTA 5DM7R 1XTDA 2EPDA 2HKQB 2KRNA 5CQYA 3CCLA 2WSCE 2ZPHB 1G83A 1WXUA 3L2ZA 4XU0A 1WI7A 2RQRA 2J6OA 1I1JA 2CUBA 2DO3A 1GFDA 1G5VA 1MUZA 5I11A 4OF1A 2DMOA 3MEWA 2EGCA 3NFCA 3OY9A 4M7AB 1CSKA 3RNJA 2F2WA 3VV0A 2D8HA 3META 2A0FB 1KQ2A 1BU1A 1Q95G 1R8OB 3C0CA 2HL3A 1WJRA 5IT9E 5FRMA 2M51A 4E7LA 4ME7A 3EFRA 4LDYA 1NZ9A 3M9QA 1KD1U 1I81A 2DILA 2KNBB 2FO0A 2K7AA 4BB7A 3TVTA 1QP3A 1QWFA 2KE9A 1E6GA 1TOVA 5EC7A 4DOWA 2KT1A 1VQ7A 3UATA 2IIMA 1B7TA 1WLPB 2JMAA 4JUVA 4AMCA 1UECA 4QW2A 1TXQA 2A28A 4JZ3A 9ATCB 3H41A 4EPCA 2K5LA 3CPWS 3CCMQ 1XNIA 4JLIA 4XU1A 1WXBA 2E6ZA 2J06A 3JB9F 1M1KR 4J6XA 1Q7YC 1MMAA 2DK3A 4XTYA 3JCMe 1UDLA 4MZTA 2RHUA 4PJNA 3CCUQ 4HT8A 1OU8A 2CH4W 1UUEA 1ZBJA 2VV5A 2VWFA 5GJVB 2BE7D 5LJ5d 3A8MB 5GAN4 4M75D 2A3LA 2BZ8A 3VS0A 2D0QB 1IHVA 4JJBA 3CPWP 2P4RA 2PNIA 1MMDA 2CGHA 1OX9A 4AFQC 1G3SA 2ZPGB 3M0UA 2F69A 4F7UG 4OMPA 4D8KA 2QA4Q 5IHKA 3M56A 4CC7A 5CO7A 4J6YA 2CUDA 1GFCA 2EIFA 3IQLA 3DLLA 1UTIA 2O4XB 2GF7A 4EIKA 1HXDA 1OX8A 1UB4A 2L3PA 3A5ZB 1O75A 3V7RA 5IH2A 5LL6S 1SRLA 4KH1B 1Q81C 2J6KA 4OVAA 3QWXX 4C8QF 4C8QE 2QQSA 3VS7A 1SPKA 1X2QA 3UPUA 2DTHA 3CXCA 3GBQA 1OPKA 3VRYA 1SEMA 2LDMA 4A4KA 3H9NA 2HQXA 3H0IA 3CC4Q 2YT6A 3MCAB 5LJ3g 3CMEQ 2YRVA 1YBYA 3OYDA 1YWPA 2XI9A 2J6FA 2VXFA 3CC4A 1QCOA 5IAYA 3CMEA 1O9SA 1WHJA 3VS5A 3OSVA 2CSQA 5GANd 1N8RC 1G3WA 2QGFB 1ZA2B 4C92D 2MCNA 5FWCA 2JTMA 4ANJA 3JRZA 1Y57A 3P8DA 1W70A 1G2BA 3CCQQ 1OOTA 3LX7A 4YTLA 4KT0E 1VQPT 1BI0A 1LOJA 5HK0A 3ZL7C 3FJPA 2KYBA 4X34A 2I0NA 3CCQA 4ZN3A 1ZSGA 1VQ4Q 2WSFE 3BDUA 5KYUB 2EW3A 2J7IA 2FYKA 4KBMB 2IPOB 2KQWA 1ZLMA 3OA6A 2V8JA 2E64A 1WXTA 1VQ6T 2P0KA 1WYXA 2EJGA 1C0MA 2L3QA 2V26A 5KCOA 2FEIA 2DXUA 4IIMA 5FLXE 4Y28E 1HYOA 2KGTA 4C0DB 3SB2A 3PT9A 3WXMB 5GAMf 3UA6A 1Y96B 4JRIA 4C5GA 3QIIA 4L5GA 4NOYA 3CCJT 2LMJA 4M77D 5GMKe 2K9GA 2E5KA 1D1CA 2DYIA 3E9GA 4C8QC 4EMHA 5GAOq 1NJIR 2DPPB 5J26A 1RUWA 3TSWA 5LJ5e 3OS0A 1UFFA 4X9DA 3PIOA 1AT1B 3G1JA 4BUGA 3OMGA 1TUDA 1YJWT 2BZXA 2QYZA 4E2FB 1PRLC 2KRSA 3RBBB 4PJOF 1M2VA 2DL5A 2KMTA 2XD0A 3A8OB 1PNJA 3M59A 3CEYA 3RDVA 1IHWA 2MAMA 1TH7A 4OMQA 4NS5A 2YRDA 1X6BA 1VQ5Q 1N8RU 2QTVA 1K1ZA 3VYGA 4A63B 4J83A 3I5SA 2MIOA 3OYGA 1PSEA 3KUFA 1VQNT 3BFMA 2LCSA 4ELYC 2AZVA 3M55A 1T3SA 3VS6A 2ECZA 1C6VX 2JNGA 1UGQB 3HRTA 3LW5E 1JEGA 3JCMc 1RI0A 2K79A 4LUDA 2VKNA 2YDLA 5C6SA 4J9HA 2DXCA 1YJNT 2HKNA 4PL6A 4QQ6A 2DVEA 1EFNA 3QO3A 2LT1A 1V29B 2DL4A 4PJOB 1SG5A 1QW1A 3MP6A 2LRQA 5CKEA 1BI3A 5CR2A 5GANe 1I5LA 1U5SA 1AWOA 1M90C 4OMMA 3TU4K 1Q82R 1AHJB 3CCET 2EKOA 1YP5A 4Z88A 5I2SA 2OX7A 2PVDB 2KSSA 3FJ5A 1W4SA 5GMKi 2DETA 5DY9A 2XICA 1ZUUA 2EKHA 4BDZA 5CAIA 1JQQA 3PMTA 1YHQT 2A36A 3PTAA 2FL7A 2JZ2A 3M5AA 3HTRA 1YIJT 1PSFA 2DIQA 3GIBA 2PZ1A 4J9FA 4R55A 4M4ZA 4M78E 4M7DE 2DZCA 4RG8A 4E7ZA 3JCMW 4DBRA 5I2MA 1VQOT 1OZ2A 2D0NA 3NPFA 2HD0A 3OB9A 3V8KA 4AFZC 4HA8A 1GCQC 3QXEB 2Y4XA 5LJ3d 2OTLT 1W6XA 5KYUA 1B34A 2PTKA 3OYIA 2ESWA 4B9XA 1NEBA 2EYXA 2LC4A 4GBQA 2OI3A 1ZSZB 4PJOC 2VUBA 3FEOA 2DBMA 4F7UF 1PM3A 4MMLA 3CC7T 2PVOB 1WNLA 3JB9H 3MO8A 1WZOA 3O8VA 4RMOA 1BI1A 1VQNA 2E6NA 2R57A 4ESRA 2HNIA 4J9DA 1TU0B 1U06A 4J9GA 4C8QG 2E3IA 5J3BA 4XU3A 4KUIA 5FW9A 2D9TA 4L6V5 3E19A 4VUBA 5GAOr 4TVRA 1YITT 1WPYA 3H8ZA 3CC2Q 2E1HA 4XTXA 3I56T 1UHFA 3GNGA 1GL5A 1YCYA 2M0YA 2IVWA 5A0GA 4XQ3A 4DOVA 3G4ST 1R77A 6AT1B 5HY6A 3X26B 4OMNA 2JTEA 5D7UA 2FZKB 2JVVA 3RERA 2CZ7B 4WTOB 4AG2C 2FHDA 5GAN2 2DA9A 4C0GA 1ZSZC 3QG1A 4F7UB 1K9MC 1PKTA 1KD1R 1M27C 1IREB 1GXIE 3TQ7P 1SSHA 3T9NA 1OPLA 2HEQA 2K4YA 3MEAA 4EMGA 2KAFA 3PE0A 2RHZA 2QEXQ 1Q86U 4RTUA 2JM8A 3TREA 3UF4A 2CS7A 4OGCA 4XAXB 2LCLA 4E7JA 2O31A 1NEGA 4HT9A 1BK2A 3OYJA 2DEUA 2EQMA 1K9AA 2QEXA 1AEYA 4FCYA 3GLXA 4FT4A 1KC8U 1WIEA 1WHMA 2C0TA 1K73C 1GCQA 4QT7A 3H6ZA 3QPHA 1VQKQ 2RHXA 2KRMA 4UC4A 2L5QA 2AHJB 1K8AU 1JJ2A 3DB3A 5GAOl 4PJOA 2BKDN 2DAQA 2DX1A 4KH0B 2XKOC 1VQKA 3CD6Q 2YHTA 2X4JA 3EH2A 1QKXA 3VS1A 2WACA 3CMAQ 1E6HA 1HK9A 4QQDA 1LVKA 2K3YA 4HXJA 2CT4A 1AOJA 1M3AA 3CMAA 1IO6A 4IUUA 3E9FA 2QG9B 2MF2A 8ATCB 3CBPA 3C12A 4DA4A 1ABOA 2L89A 2FZCB 1VIEA 1ZBXA 1QKWA 2F1LA 3CCST 2CKKA 3CCVQ 5GAOp 4PFZA 2RK2A 3I35A 3VUBA 3M54A 2NYSA 3OMCA 2EFIA 3EFOB 2PQWA 3AT1B 3JB9I 3CCVA 1ZSZA 2DJZA 2X4YA 3BY7A 4C5HA 3SWNB 1VUBA 2OJ2A 2JM9A 5M9OA 2GFUA 1ZUYA 4X9CA 3S3NA 4ZTJA 3EG2A 3CCUT 3VYHB 3G71T 5DLQE 2COYA 4A53A 2Y90A 1TUGB 2K2VA 4XTZA 2E70A 2OTJT 2D8JA 4OGEA 5FROA 4RTWA 4X1VA 1OQKA 4Q5WA 3JB9D 3MPUB 3HSBA 2F2VA 3S3MA 2RQVA 4HCKA 3E2UA 1UGSB 1ZX6A 1VQ9Q 2VGMA 2KT8A 4J7IA 1VQ7Q 2LQWA 1Q7YR 1KHCA 2EGAA 2P4TA 1NPRA 1WHGA 1SHFA 5CCAA 1N6AA 3RKYA 1AWWA 1VQ9A 2K3BA 3VUZA 2C0OA 2BZYA 5KCHA 1Z9QA 2MPXC 4BD3A 5LJ3f 2KXCA 1JXMA 4BY6B 4F7UA 3OBWA 2HBWA 1VYTA 2COZA 3SWNC 2F5TX 2HSPA 5CKHA 3EG0A 3NTKA 2EBPA 2VASA 1X01A 3I55T 4MDWA 3LLRA 4FIBA 2C0IA 1T0HA 2DNUA 1RAHB 1H8KA 2OAWA 2FRYA 3SHWA 1B07A 3UWNA 3X20B 4M78G 4M7DG 1QCNA 1JO8A 2QQRA 1UGRB 1QWEA 4IUVA 1FMWA 4QVZA 3AHUA 1RACB 1YCSB 3BE3A 1KG1A 3JCMh 1LCKA 2CDTA 1M2VB 1VQLT 3P8HA 4FU6A 1WHHA 1S72T 2YUPA 1VQ8T 2RB6A 2YXYA 1MMGA 4AFSC 1PD1A 2LJ3A 1NLOC 4IUQA 5EG2A 2HL5C 4BY6C 2L2PA 3G71A 4AFUC 2RHIA 1M1KC 1JJ2S 3QJYA 1ACMB 1MV3A 2RPNA 3SFMA 2NUTB 3PNWC 3OYMA 3A1PA 2RJFA 5GMKm 1JU5C 3PVQA 1N8RR 3OSSC 2M16A 2RA2A 1W1FA 4RTYA 1AZGB 4E7HA 2VYTA 3TEEA 4JLGA 4FW1A 2JT4A 3EH1A 4E7IA 3JCMf 2CT3A 2BIVA 3PIPA 2O2OA 3JB9J 1JJ2P 4M75F 4M75E 3CPFA 3MP1A 5HK3A 3LWIA 1KQSA 2QDYB 3ULRB 2OAUA 4A54A 3EFOA 1PCXA 1R0CB 1BYMA 5C0MA 4CI0C 2KY9A 3LYIA 3SWNA 4QVDA 1XOVA 2EQUA 2QQ9A 3V8LA 1VA7A 2DTIA 1RAIB 5AT1B 4PLIA 3OYLA 1SSFA 1M1GA 4QVCA 1Q7YU 5GAMh 4C8QB 4IUPA 1X69A 2RO0A 4PJJA 2H3EB 1I4K1 3CQTA 4P5NA 3JSCA 1AD5A 2GFAA 3OS1A 1K76A 1I07A 2SRCA 4J5YA 3GOXA 2K5FA 2D6FA 1M3BA 3A8LB 1GRIA 1B34B 2NUPB 4CC2A 4XU2A 1PD0A 1VQ5T 3ZEHA 1NE8A 1CKAA 5GAMj 3A98A 1U1TA 2O01E 4J9BA 3G6ET 1NPPA 3SEMA 4PJOD 3OYYA 1YN8A 4MDXA 3I5RA 1AVZC 5D6WA 2B86A 2CSIA 4C92E 2ZAEA 2CH4A 2MI6A 3OYAA 3QSUA 2CP5A 1Q81U 1V1CA 1F1BB 4N4GA 2MWPA 2SEMA 4O6JA 1K4US 2JXBA 1YI2T 1XQHA 1LJOA 4IUTA 1D3BB 2B8AA 1X75C 2HQHA 2EVRA 2GBQA 2XU8A 1NG2A 1BKBA 1RLPC 5GMKh 2QAZA 4LE9A 4M75C 3X24B 3HP9A 5L23A 3L2QA 1VYUA 3CCRT 1U3OA 5GAN5 7AT1B 4MZMA 1VQPQ 3EAEA 2XHCA 2RF0A 3OYCA 3V7CA 2E4HA 1G3YA 4PFPA 4J9IA 2G6FX 2YUOA 1NJIC 3L2UA 2NUTA 3UT1A 1VQPA 2CP0A 1RAAB 2DL3A 5GMKj 5GMKl 2DZ9A 4GLKA 3FLGA 2V8IA 1BI2A 3I9QA 2VXEA 2CREA 4PK4A 1EX4A 1TUCA 4J8OA 3OYHA 4RUGA 2EAYA 1K0XA 3PFSA 1C1AA 5AYFA 2A08A 2RMOA 1RI9A 4M77F 2JMCA 4M77E 2DXBA 1Q86R 1VQ6Q 4XTVA 1M3CA 1N9SA 5HCKA 4PNOA 3C95A 3VS4A 1YFNA 1RLQC 2LT4A 3CXCS 5KYWB 1E7OA 1PKSA 4RTZA 2DFUA 5LJ5f 2O88A 1VQ6A 1GBQA 2YUQA 5GAOm 2JS2A 4JRKA 1KC8R 4ZNXA 4BE2A 2FPEA 2DEQA 1WA7A 3MP8A 2Y4YA 4PJMA 5FRNA 3O5ZA 1K8AR 2DXTA 2E5QA 4KRTA 1QVGA 3CC2T 5GAMg 3CCJA 4N4HA 4ORZA 1YJ9T 2E3HA 5KE3A 1X2KA 2DYBA 4DEXA 1QP2A 2DLPA 3CXCP 4C8QA 2DBKA 3HHTB 1YI2A 4Z02A 2L8DA 4M78F 4M7DF 1QCFA 3GF5A 1UJYA 1PWTA 2A7YA 1X27A 2ZGWA 1D1BA 1IB8A 1VQMT 4NL3A 4C5IA 1YJWA 2XDBA 3A8GB 4BE0A 2VB6A 1KQSP 1JRIA 2NUPA 3E1SA 3QKJA 2GNCA 1VQNQ 1Q82C 2QXFA 4II1A 3BW1A 1M8VA 1M1FA 2CZ6B 2HCKA 3HFNA 3QZ9B 5GAN6 3OYBA 2LZ6B 2RI3A 1D0ZA 4NL2A 5GANf 3S6WA 2CYZB 3R6NA 1MGQA 1ZUKA 1NLPC 2NUZA 3LGLA 3VS2A 2F5KA 3WVEB 3J81E 3OQ5A 1N27A 2BTTA 1K9MR 4A4EA 1T3LA 4M78B 1TSFA 1AWJA 2AZSA 4PKCC 4M7DB 4PLLA 4WF2A 1D3BA 3ZBDA 3THKA 3LWHA 4M77C 1YJNA 1HJDA 3VKIA 3FDRA 2XK0A 1K0SA 4KGZB 2DF6A 2ZPFB 5J39A 4M75G 2DM1A 3F70A 5CK9A 3Q1JA 2HAXA 2PUKB 3VS3A 1Z9ZA 4AG1C 2AT1B 3PMIA 4KUDK 2MYSA 3CCEA 1YHQQ 1UEBA 1M90U 5KYNA 2RN8A 1YIJQ 2KR3A 3EGDA 4WCIA 2YRCA 3RKWA 1YHQA 1YJ9A 4V2SA 4RCBA 1V76A 1OYXA 1YIJA 2JS0A 4E47A 1KK7A 3KBGA 3MEUA 1EIFA 2PU9B 1M4ZA 3QJ6A 1UHCA 3X25B 3CCLT 2K6DA 2ZZDA 2L0AA 2K3XA 4FYYB 1VQOA 1BIBA 1Y71A 1R0BG 3HRUA 3RMQA 1U8RA 4M78C 4M7DC 2EQKA 4LDVA 2OTLA 3CC7Q 2IG0A 5FU7B 1JBMA 2V1RA 4JS5A 1MNDA 2L3RA 1ARKA 5KYWA 5GAN7 4JZ4A 3UA7A 1X43A 2CP3A 1KD1C 1RAFB 2LNVA 3EG9A 2HMAA 1RAGB 4C5EA 1G3TA 3CC7A 3QYGB 4FM4B 1YWOA 4A4FA 4JRQA 4MZPA 2PUOB 5I22A 4BACA 4C0ZA 3J7AF 3FB9A 2FRWA 4J7FA 2X3XD 4JRPA 2RK1A 1KSWA 4C92G 1MMNA 4JJCA 2QQBA 1KIKA 3VRZA 5KH6A 1H641 3GNFB 4RKUE 1VQ7T 4A4GA 1YITA 3A8HB 3I56A 2QTXA 3EGXA 3NHNA 2O9SA 3G4SA 1QVGS 2MK5A 3C94A 4M7AF 1MV0B 2LJ1A 3JV3A 1PRMC 2XG8D 4M7AE 4FSSA 4CC4B 4LNPA 4ZGJB 4IURA 2GTJA 5FU7C 1N9RA 3QUIA 2VC8A 2DL8A 4EDUA 2DERA 3CCMT 2P0QA 1NYFA 2RD1A 3VU3C 4JJNK 5L8RE 2VGNA 2K57A 1K9MU 2P84A 5LJ3h 4J9EA 1KHIA 2RQUA 1QVGP 2KK4A 1WJSA 3QBYA 2M1HA 4HKEA 1OV3A 2R5AA 4GY5A 2QASA 5GAMd 3M0QA 2KROA 3J80E 3M0PA 2DTOA 4M77G 4M78A 4M7DA 2EQJA 4XK8E 5LJ3j 8AT1B 4DEYA 1K73U 2QA4T 4LD9K 2EYQA 2X3WD 2ZPBB 1GCPA 1N5ZA 2J05A 1SHGA 3EG1A 1ZA1B 1SRMA 3ER0A 1LNXA 4FYWB 4E6RA 1D1AA 2JOYA 3TCJA 3V7SA 4EMKC 3EHQA 5A2QE 3M0TA 1WGSA 4MMKA 1WQ7A 5ECAA 5KYXB 1VIFA 1KJWA 2EJ9A 4OB2B 1GBRA 3CC4T 3CCSQ 3EGUA 3CMET 1NBEB 5FWBA 2ED1A 2Z0WA 2VVKA 1UG1A 5IXFA 4K11A 2E10A 2BUDA 4C8QD 3CCSA 5CKFA 1M30A 3SD4A 2DVJA 1U1SA 4GLMA 4HVVA 1AWXA 1Y0MA 2A37A 2LP5A 1Q81R 4M7AC 3DKMA 3CCMA 2KYMA 1S1NA 3G71Q 4F16A 1HSQA 3ME9A 1M9SA 1ZQ1A 3JAME 3MKDA 3CCQT 1VOMA 2OTJQ 1H3HA 4BDYA 2E41A 4JPBW 1CKBA 2DD4A 3CCUA 2HQEA 2K5IA 5HKCA 4PFOA 2OTJA 3LH5A 4FYVB 5GAOn 4QKUA 1TWBA 2JW4A 2X9HA 3RMSA 1VQ4T 5FU6B 2LQ8A 1X6OA 3LGFA 1SF9A 2QI2A 3REBB 2LJ0A 4N0AC 3TSZA 4DQ2A 2WSEE 2QQAA 2X35A 2O9VA 1TS9A 2QA4A 1M8MA 1MHNA 5KE2A 2EGEA 4B9WA 3M4YA 2RQTA 4DBHA 2CP2A 2EYWA 4XTWA 4XTUA 3OW2A 4RTTA
chains in the Genus database with same CATH topology
1IGUA 1IGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IGU A;  1IGQ A; 
#chains in the Genus database with same CATH topology
 3I55 Q;  5CKB A;  1QQJ A;  2FG0 A;  4D6W A;  3BDL A;  4EMK A;  2EYZ A;  3ASK A;  2P0P A;  3REA B;  1IXD A;  2YUN A;  3JCM P;  2HSE B;  3I55 A;  5GAM e;  2G3R A;  2DIG A;  3CBM A;  2ROT A;  3M0R A;  4OMO A;  2M0O A;  5FU6 C;  1WFW A;  1VQL Q;  2ZPE B;  1S72 Q;  1LPL A;  1VQ8 Q;  1NM7 A;  2YLB A;  1UGV A;  2F2X A;  2XMF A;  1VYV A;  3CBO A;  3NMZ C;  1I8F A;  2R58 A;  3FIF A;  1WDX A;  1AZE A;  2LTO A;  2YWW A;  1BBZ A;  4L59 A;  1VQL A;  4M7A A;  3OS5 A;  1YNZ A;  3OYE A;  1S72 A;  1FXX A;  4QQG A;  1VQ8 A;  3HL8 A;  2ROL A;  4M75 B;  3QWY A;  4OML A;  5IHI A;  4JDS A;  1H3Z A;  1TTH B;  2CZ0 B;  3KFV A;  3H0H A;  3FC3 A;  2V8K A;  1KQ1 A;  3RES A;  4E7S A;  3INZ A;  4C92 F;  1M1K U;  5KYX A;  1IGQ A;  5CIU A;  2D1X A;  5D6X A;  1VQ4 A;  2GCX A;  2ZPI B;  2CP6 A;  1QVF A;  3OYF A;  1I5O B;  4N0A A;  2E65 A;  1IRX A;  2RI5 A;  3RUX A;  3L2W A;  2KI7 A;  4JS4 A;  1BCM A;  4ELZ C;  3DLM A;  3X28 B;  4KGX B;  4M7A G;  3JCM g;  3HRS A;  1W2B A;  1ABQ A;  5KYY B;  3EHR A;  1Y07 A;  2RM4 A;  3H0F A;  3L2V A;  1OZ3 A;  4DBQ A;  1FX7 A;  2DL7 A;  3WVD B;  4N4I A;  5LJ5 h;  3S3O A;  3EGD B;  4FT2 A;  4Y92 A;  1BB9 A;  3JCM V;  2COW A;  1P92 A;  4LDX A;  3VJP A;  3HKS A;  4PJO E;  1QMC A;  4C92 B;  4ZGD B;  4HVW A;  3JCM X;  4RTV A;  3M0S A;  3N5B B;  4LDU A;  5D6Y A;  2AK5 A;  5CVI A;  1WX6 A;  1X6G A;  1M90 R;  3OYN A;  4DBF A;  2K2M A;  3NTH A;  2ZCF B;  5LJ5 j;  1FWZ A;  1OI1 A;  2O4X A;  4HCZ A;  2BE9 B;  4C0D C;  3G6E Q;  3SDZ A;  1M2O A;  4M78 D;  4M7D D;  1VQ5 A;  2JTF A;  3U23 A;  3OS2 A;  2FPD A;  4HCB A;  1D0X A;  5GJW B;  4O5V A;  3EG9 B;  3G6E A;  3L2R A;  1RAD B;  2EQI A;  3CCJ Q;  2QDL A;  3D7S B;  2LVM A;  2RQW A;  3RR6 A;  1KFZ A;  1YI2 Q;  2MOX A;  2FPF A;  4BI3 A;  1KQS S;  2DKG A;  2X4W A;  3QDF A;  2LQN A;  2KVQ G;  4ATO A;  1JB0 E;  2DJQ A;  2L3S A;  2YLC A;  4C92 C;  3OW2 S;  5GAN h;  4RCC A;  1YJW Q;  3MHX A;  4FYX B;  1PHT A;  1PC0 A;  4J6W A;  3JCM b;  1TG0 A;  1Q86 C;  3EGX B;  1H92 A;  4AT1 B;  2EWN A;  4M77 B;  5IXB A;  3OYK A;  4Y91 A;  1D0Y A;  3L42 A;  4Z8A A;  2ATC B;  2JN0 A;  3JB9 G;  1BCO A;  1QLY A;  5GAN 8;  3CCR Q;  1Y7X A;  3V8J A;  3QDR B;  3M57 A;  4LD6 A;  4A4H A;  3EG3 A;  3JCM J;  2QK0 A;  3GP8 A;  4CRI A;  4IIO A;  4M75 A;  2H3J A;  1KC8 C;  5GAN j;  1PG5 B;  2XDP A;  3RIR A;  2MWO A;  3CCR A;  1OUL A;  3OW2 P;  2QEX T;  2AKL A;  4F17 A;  2M9U A;  2NWM A;  4FW2 A;  1RL2 A;  1FMV A;  5CQX A;  2LX7 A;  5I21 A;  2W10 A;  2W0Z A;  1JXO A;  2XID A;  4R56 A;  1K8A C;  2AIR B;  1BIA A;  1ZHI A;  2M02 A;  3HPW A;  2FVU A;  2X4X A;  4D8D A;  1G8X A;  5IN1 A;  3OBY A;  2RNA A;  2KXD A;  5A0D A;  2YSQ A;  4F7U E;  2HDA A;  2RI2 A;  1YJN Q;  2GTO A;  1NJI U;  1WHL A;  1VQK T;  5IHN A;  4LN2 A;  4FSX A;  4ZTF A;  2V1Q A;  1I0C A;  1RAE B;  2LX9 A;  4IKF A;  1Y96 A;  1NYG A;  1IZ6 A;  3NTI A;  4ZGE B;  3CD6 T;  4HVU A;  3CCE Q;  3M4G A;  1QVF S;  2AKK A;  5KYY A;  2CZ1 B;  3QHS A;  4J9C A;  3CMA T;  4LDW A;  4OB1 B;  2LQK A;  4F14 A;  4OB3 B;  3DB4 A;  2FZG B;  5LJ5 g;  1QVP A;  2FB7 A;  1YJ9 Q;  4R0K A;  5CKD A;  2ENM A;  3ZFJ A;  3R6O A;  2RHY A;  1IGU A;  4BE1 A;  4KUL A;  1K73 R;  1W2B S;  2EJF A;  1SKU B;  4ZN1 A;  3URG A;  3CPW A;  2JJ9 A;  3LH0 A;  3CC2 A;  1FMK A;  2KEA A;  4RTX A;  1VQO Q;  2JUF A;  1RAB B;  1HD3 A;  4C92 A;  2CP7 A;  4BI4 A;  1VQM Q;  1QVF P;  1WQW A;  2RJE A;  3CCV T;  2DRM A;  1UJ0 A;  2OTL Q;  3QYH B;  2RJC A;  1XJW B;  3M58 A;  2XDD A;  2I2L A;  5GAN 3;  1J3T A;  1FYN A;  1VQM A;  3QZ5 B;  3G7Z A;  1W2B P;  4E7K A;  4Z89 A;  2GQV A;  4F04 B;  3JCM d;  5A0L A;  2LCC A;  3EFS A;  4BI8 B;  2C06 A;  2R5M A;  4M7A D;  2GQI A;  4OP0 A;  2QGG A;  3FRN A;  1Q82 U;  4B6M A;  3JCM Q;  3C4S A;  1T0J A;  4KGV B;  4HCC A;  2DD5 A;  2LNH B;  3NGP A;  1YIT Q;  2KBT A;  3HFO A;  2HZY A;  3M53 A;  4OB0 B;  3I56 Q;  5GAN g;  3RKX A;  3G4S Q;  1UGP B;  2KDS A;  1VQ9 T;  1A0N B;  1MNE A;  2DRK A;  2E12 A;  4CC3 A;  2H8H A;  2EYY A;  2ABL A;  4JJD A;  2NLU A;  4RG2 A;  4M77 A;  1WJQ A;  5DLO A;  3CD6 A;  3MJX A;  2RJD A;  4LUE A;  1EZZ B;  2X51 A;  3P8B B;  2PVG B;  4OMF B;  2ED0 A;  3PGG A;  3L1A A;  3PVL A;  4C0F A;  3GPL A;  4FL6 A;  2MMP A;  2GGR A;  1DJ7 B;  1M5Q 1;  1WHK A;  3UDC A;  1B3Q A;  1OU9 A;  1D09 B;  4LXC A;  5LJ3 e;  4EMK B;  3CCL Q;  4PJL A;  3MEV A;  1UE9 A;  2HBP A;  4PJO G;  2DE0 X;  1OEB A;  2RH2 A;  3KXT A;  5DM7 R;  1XTD A;  2EPD A;  2HKQ B;  2KRN A;  5CQY A;  3CCL A;  2WSC E;  2ZPH B;  1G83 A;  1WXU A;  3L2Z A;  4XU0 A;  1WI7 A;  2RQR A;  2J6O A;  1I1J A;  2CUB A;  2DO3 A;  1GFD A;  1G5V A;  1MUZ A;  5I11 A;  4OF1 A;  2DMO A;  3MEW A;  2EGC A;  3NFC A;  3OY9 A;  4M7A B;  1CSK A;  3RNJ A;  2F2W A;  3VV0 A;  2D8H A;  3MET A;  2A0F B;  1KQ2 A;  1BU1 A;  1Q95 G;  1R8O B;  3C0C A;  2HL3 A;  1WJR A;  5IT9 E;  5FRM A;  2M51 A;  4E7L A;  4ME7 A;  3EFR A;  4LDY A;  1NZ9 A;  3M9Q A;  1KD1 U;  1I81 A;  2DIL A;  2KNB B;  2FO0 A;  2K7A A;  4BB7 A;  3TVT A;  1QP3 A;  1QWF A;  2KE9 A;  1E6G A;  1TOV A;  5EC7 A;  4DOW A;  2KT1 A;  1VQ7 A;  3UAT A;  2IIM A;  1B7T A;  1WLP B;  2JMA A;  4JUV A;  4AMC A;  1UEC A;  4QW2 A;  1TXQ A;  2A28 A;  4JZ3 A;  9ATC B;  3H41 A;  4EPC A;  2K5L A;  3CPW S;  3CCM Q;  1XNI A;  4JLI A;  4XU1 A;  1WXB A;  2E6Z A;  2J06 A;  3JB9 F;  1M1K R;  4J6X A;  1Q7Y C;  1MMA A;  2DK3 A;  4XTY A;  3JCM e;  1UDL A;  4MZT A;  2RHU A;  4PJN A;  3CCU Q;  4HT8 A;  1OU8 A;  2CH4 W;  1UUE A;  1ZBJ A;  2VV5 A;  2VWF A;  5GJV B;  2BE7 D;  5LJ5 d;  3A8M B;  5GAN 4;  4M75 D;  2A3L A;  2BZ8 A;  3VS0 A;  2D0Q B;  1IHV A;  4JJB A;  3CPW P;  2P4R A;  2PNI A;  1MMD A;  2CGH A;  1OX9 A;  4AFQ C;  1G3S A;  2ZPG B;  3M0U A;  2F69 A;  4F7U G;  4OMP A;  4D8K A;  2QA4 Q;  5IHK A;  3M56 A;  4CC7 A;  5CO7 A;  4J6Y A;  2CUD A;  1GFC A;  2EIF A;  3IQL A;  3DLL A;  1UTI A;  2O4X B;  2GF7 A;  4EIK A;  1HXD A;  1OX8 A;  1UB4 A;  2L3P A;  3A5Z B;  1O75 A;  3V7R A;  5IH2 A;  5LL6 S;  1SRL A;  4KH1 B;  1Q81 C;  2J6K A;  4OVA A;  3QWX X;  4C8Q F;  4C8Q E;  2QQS A;  3VS7 A;  1SPK A;  1X2Q A;  3UPU A;  2DTH A;  3CXC A;  3GBQ A;  1OPK A;  3VRY A;  1SEM A;  2LDM A;  4A4K A;  3H9N A;  2HQX A;  3H0I A;  3CC4 Q;  2YT6 A;  3MCA B;  5LJ3 g;  3CME Q;  2YRV A;  1YBY A;  3OYD A;  1YWP A;  2XI9 A;  2J6F A;  2VXF A;  3CC4 A;  1QCO A;  5IAY A;  3CME A;  1O9S A;  1WHJ A;  3VS5 A;  3OSV A;  2CSQ A;  5GAN d;  1N8R C;  1G3W A;  2QGF B;  1ZA2 B;  4C92 D;  2MCN A;  5FWC A;  2JTM A;  4ANJ A;  3JRZ A;  1Y57 A;  3P8D A;  1W70 A;  1G2B A;  3CCQ Q;  1OOT A;  3LX7 A;  4YTL A;  4KT0 E;  1VQP T;  1BI0 A;  1LOJ A;  5HK0 A;  3ZL7 C;  3FJP A;  2KYB A;  4X34 A;  2I0N A;  3CCQ A;  4ZN3 A;  1ZSG A;  1VQ4 Q;  2WSF E;  3BDU A;  5KYU B;  2EW3 A;  2J7I A;  2FYK A;  4KBM B;  2IPO B;  2KQW A;  1ZLM A;  3OA6 A;  2V8J A;  2E64 A;  1WXT A;  1VQ6 T;  2P0K A;  1WYX A;  2EJG A;  1C0M A;  2L3Q A;  2V26 A;  5KCO A;  2FEI A;  2DXU A;  4IIM A;  5FLX E;  4Y28 E;  1HYO A;  2KGT A;  4C0D B;  3SB2 A;  3PT9 A;  3WXM B;  5GAM f;  3UA6 A;  1Y96 B;  4JRI A;  4C5G A;  3QII A;  4L5G A;  4NOY A;  3CCJ T;  2LMJ A;  4M77 D;  5GMK e;  2K9G A;  2E5K A;  1D1C A;  2DYI A;  3E9G A;  4C8Q C;  4EMH A;  5GAO q;  1NJI R;  2DPP B;  5J26 A;  1RUW A;  3TSW A;  5LJ5 e;  3OS0 A;  1UFF A;  4X9D A;  3PIO A;  1AT1 B;  3G1J A;  4BUG A;  3OMG A;  1TUD A;  1YJW T;  2BZX A;  2QYZ A;  4E2F B;  1PRL C;  2KRS A;  3RBB B;  4PJO F;  1M2V A;  2DL5 A;  2KMT A;  2XD0 A;  3A8O B;  1PNJ A;  3M59 A;  3CEY A;  3RDV A;  1IHW A;  2MAM A;  1TH7 A;  4OMQ A;  4NS5 A;  2YRD A;  1X6B A;  1VQ5 Q;  1N8R U;  2QTV A;  1K1Z A;  3VYG A;  4A63 B;  4J83 A;  3I5S A;  2MIO A;  3OYG A;  1PSE A;  3KUF A;  1VQN T;  3BFM A;  2LCS A;  4ELY C;  2AZV A;  3M55 A;  1T3S A;  3VS6 A;  2ECZ A;  1C6V X;  2JNG A;  1UGQ B;  3HRT A;  3LW5 E;  1JEG A;  3JCM c;  1RI0 A;  2K79 A;  4LUD A;  2VKN A;  2YDL A;  5C6S A;  4J9H A;  2DXC A;  1YJN T;  2HKN A;  4PL6 A;  4QQ6 A;  2DVE A;  1EFN A;  3QO3 A;  2LT1 A;  1V29 B;  2DL4 A;  4PJO B;  1SG5 A;  1QW1 A;  3MP6 A;  2LRQ A;  5CKE A;  1BI3 A;  5CR2 A;  5GAN e;  1I5L A;  1U5S A;  1AWO A;  1M90 C;  4OMM A;  3TU4 K;  1Q82 R;  1AHJ B;  3CCE T;  2EKO A;  1YP5 A;  4Z88 A;  5I2S A;  2OX7 A;  2PVD B;  2KSS A;  3FJ5 A;  1W4S A;  5GMK i;  2DET A;  5DY9 A;  2XIC A;  1ZUU A;  2EKH A;  4BDZ A;  5CAI A;  1JQQ A;  3PMT A;  1YHQ T;  2A36 A;  3PTA A;  2FL7 A;  2JZ2 A;  3M5A A;  3HTR A;  1YIJ T;  1PSF A;  2DIQ A;  3GIB A;  2PZ1 A;  4J9F A;  4R55 A;  4M4Z A;  4M78 E;  4M7D E;  2DZC A;  4RG8 A;  4E7Z A;  3JCM W;  4DBR A;  5I2M A;  1VQO T;  1OZ2 A;  2D0N A;  3NPF A;  2HD0 A;  3OB9 A;  3V8K A;  4AFZ C;  4HA8 A;  1GCQ C;  3QXE B;  2Y4X A;  5LJ3 d;  2OTL T;  1W6X A;  5KYU A;  1B34 A;  2PTK A;  3OYI A;  2ESW A;  4B9X A;  1NEB A;  2EYX A;  2LC4 A;  4GBQ A;  2OI3 A;  1ZSZ B;  4PJO C;  2VUB A;  3FEO A;  2DBM A;  4F7U F;  1PM3 A;  4MML A;  3CC7 T;  2PVO B;  1WNL A;  3JB9 H;  3MO8 A;  1WZO A;  3O8V A;  4RMO A;  1BI1 A;  1VQN A;  2E6N A;  2R57 A;  4ESR A;  2HNI A;  4J9D A;  1TU0 B;  1U06 A;  4J9G A;  4C8Q G;  2E3I A;  5J3B A;  4XU3 A;  4KUI A;  5FW9 A;  2D9T A;  4L6V 5;  3E19 A;  4VUB A;  5GAO r;  4TVR A;  1YIT T;  1WPY A;  3H8Z A;  3CC2 Q;  2E1H A;  4XTX A;  3I56 T;  1UHF A;  3GNG A;  1GL5 A;  1YCY A;  2M0Y A;  2IVW A;  5A0G A;  4XQ3 A;  4DOV A;  3G4S T;  1R77 A;  6AT1 B;  5HY6 A;  3X26 B;  4OMN A;  2JTE A;  5D7U A;  2FZK B;  2JVV A;  3RER A;  2CZ7 B;  4WTO B;  4AG2 C;  2FHD A;  5GAN 2;  2DA9 A;  4C0G A;  1ZSZ C;  3QG1 A;  4F7U B;  1K9M C;  1PKT A;  1KD1 R;  1M27 C;  1IRE B;  1GXI E;  3TQ7 P;  1SSH A;  3T9N A;  1OPL A;  2HEQ A;  2K4Y A;  3MEA A;  4EMG A;  2KAF A;  3PE0 A;  2RHZ A;  2QEX Q;  1Q86 U;  4RTU A;  2JM8 A;  3TRE A;  3UF4 A;  2CS7 A;  4OGC A;  4XAX B;  2LCL A;  4E7J A;  2O31 A;  1NEG A;  4HT9 A;  1BK2 A;  3OYJ A;  2DEU A;  2EQM A;  1K9A A;  2QEX A;  1AEY A;  4FCY A;  3GLX A;  4FT4 A;  1KC8 U;  1WIE A;  1WHM A;  2C0T A;  1K73 C;  1GCQ A;  4QT7 A;  3H6Z A;  3QPH A;  1VQK Q;  2RHX A;  2KRM A;  4UC4 A;  2L5Q A;  2AHJ B;  1K8A U;  1JJ2 A;  3DB3 A;  5GAO l;  4PJO A;  2BKD N;  2DAQ A;  2DX1 A;  4KH0 B;  2XKO C;  1VQK A;  3CD6 Q;  2YHT A;  2X4J A;  3EH2 A;  1QKX A;  3VS1 A;  2WAC A;  3CMA Q;  1E6H A;  1HK9 A;  4QQD A;  1LVK A;  2K3Y A;  4HXJ A;  2CT4 A;  1AOJ A;  1M3A A;  3CMA A;  1IO6 A;  4IUU A;  3E9F A;  2QG9 B;  2MF2 A;  8ATC B;  3CBP A;  3C12 A;  4DA4 A;  1ABO A;  2L89 A;  2FZC B;  1VIE A;  1ZBX A;  1QKW A;  2F1L A;  3CCS T;  2CKK A;  3CCV Q;  5GAO p;  4PFZ A;  2RK2 A;  3I35 A;  3VUB A;  3M54 A;  2NYS A;  3OMC A;  2EFI A;  3EFO B;  2PQW A;  3AT1 B;  3JB9 I;  3CCV A;  1ZSZ A;  2DJZ A;  2X4Y A;  3BY7 A;  4C5H A;  3SWN B;  1VUB A;  2OJ2 A;  2JM9 A;  5M9O A;  2GFU A;  1ZUY A;  4X9C A;  3S3N A;  4ZTJ A;  3EG2 A;  3CCU T;  3VYH B;  3G71 T;  5DLQ E;  2COY A;  4A53 A;  2Y90 A;  1TUG B;  2K2V A;  4XTZ A;  2E70 A;  2OTJ T;  2D8J A;  4OGE A;  5FRO A;  4RTW A;  4X1V A;  1OQK A;  4Q5W A;  3JB9 D;  3MPU B;  3HSB A;  2F2V A;  3S3M A;  2RQV A;  4HCK A;  3E2U A;  1UGS B;  1ZX6 A;  1VQ9 Q;  2VGM A;  2KT8 A;  4J7I A;  1VQ7 Q;  2LQW A;  1Q7Y R;  1KHC A;  2EGA A;  2P4T A;  1NPR A;  1WHG A;  1SHF A;  5CCA A;  1N6A A;  3RKY A;  1AWW A;  1VQ9 A;  2K3B A;  3VUZ A;  2C0O A;  2BZY A;  5KCH A;  1Z9Q A;  2MPX C;  4BD3 A;  5LJ3 f;  2KXC A;  1JXM A;  4BY6 B;  4F7U A;  3OBW A;  2HBW A;  1VYT A;  2COZ A;  3SWN C;  2F5T X;  2HSP A;  5CKH A;  3EG0 A;  3NTK A;  2EBP A;  2VAS A;  1X01 A;  3I55 T;  4MDW A;  3LLR A;  4FIB A;  2C0I A;  1T0H A;  2DNU A;  1RAH B;  1H8K A;  2OAW A;  2FRY A;  3SHW A;  1B07 A;  3UWN A;  3X20 B;  4M78 G;  4M7D G;  1QCN A;  1JO8 A;  2QQR A;  1UGR B;  1QWE A;  4IUV A;  1FMW A;  4QVZ A;  3AHU A;  1RAC B;  1YCS B;  3BE3 A;  1KG1 A;  3JCM h;  1LCK A;  2CDT A;  1M2V B;  1VQL T;  3P8H A;  4FU6 A;  1WHH A;  1S72 T;  2YUP A;  1VQ8 T;  2RB6 A;  2YXY A;  1MMG A;  4AFS C;  1PD1 A;  2LJ3 A;  1NLO C;  4IUQ A;  5EG2 A;  2HL5 C;  4BY6 C;  2L2P A;  3G71 A;  4AFU C;  2RHI A;  1M1K C;  1JJ2 S;  3QJY A;  1ACM B;  1MV3 A;  2RPN A;  3SFM A;  2NUT B;  3PNW C;  3OYM A;  3A1P A;  2RJF A;  5GMK m;  1JU5 C;  3PVQ A;  1N8R R;  3OSS C;  2M16 A;  2RA2 A;  1W1F A;  4RTY A;  1AZG B;  4E7H A;  2VYT A;  3TEE A;  4JLG A;  4FW1 A;  2JT4 A;  3EH1 A;  4E7I A;  3JCM f;  2CT3 A;  2BIV A;  3PIP A;  2O2O A;  3JB9 J;  1JJ2 P;  4M75 F;  4M75 E;  3CPF A;  3MP1 A;  5HK3 A;  3LWI A;  1KQS A;  2QDY B;  3ULR B;  2OAU A;  4A54 A;  3EFO A;  1PCX A;  1R0C B;  1BYM A;  5C0M A;  4CI0 C;  2KY9 A;  3LYI A;  3SWN A;  4QVD A;  1XOV A;  2EQU A;  2QQ9 A;  3V8L A;  1VA7 A;  2DTI A;  1RAI B;  5AT1 B;  4PLI A;  3OYL A;  1SSF A;  1M1G A;  4QVC A;  1Q7Y U;  5GAM h;  4C8Q B;  4IUP A;  1X69 A;  2RO0 A;  4PJJ A;  2H3E B;  1I4K 1;  3CQT A;  4P5N A;  3JSC A;  1AD5 A;  2GFA A;  3OS1 A;  1K76 A;  1I07 A;  2SRC A;  4J5Y A;  3GOX A;  2K5F A;  2D6F A;  1M3B A;  3A8L B;  1GRI A;  1B34 B;  2NUP B;  4CC2 A;  4XU2 A;  1PD0 A;  1VQ5 T;  3ZEH A;  1NE8 A;  1CKA A;  5GAM j;  3A98 A;  1U1T A;  2O01 E;  4J9B A;  3G6E T;  1NPP A;  3SEM A;  4PJO D;  3OYY A;  1YN8 A;  4MDX A;  3I5R A;  1AVZ C;  5D6W A;  2B86 A;  2CSI A;  4C92 E;  2ZAE A;  2CH4 A;  2MI6 A;  3OYA A;  3QSU A;  2CP5 A;  1Q81 U;  1V1C A;  1F1B B;  4N4G A;  2MWP A;  2SEM A;  4O6J A;  1K4U S;  2JXB A;  1YI2 T;  1XQH A;  1LJO A;  4IUT A;  1D3B B;  2B8A A;  1X75 C;  2HQH A;  2EVR A;  2GBQ A;  2XU8 A;  1NG2 A;  1BKB A;  1RLP C;  5GMK h;  2QAZ A;  4LE9 A;  4M75 C;  3X24 B;  3HP9 A;  5L23 A;  3L2Q A;  1VYU A;  3CCR T;  1U3O A;  5GAN 5;  7AT1 B;  4MZM A;  1VQP Q;  3EAE A;  2XHC A;  2RF0 A;  3OYC A;  3V7C A;  2E4H A;  1G3Y A;  4PFP A;  4J9I A;  2G6F X;  2YUO A;  1NJI C;  3L2U A;  2NUT A;  3UT1 A;  1VQP A;  2CP0 A;  1RAA B;  2DL3 A;  5GMK j;  5GMK l;  2DZ9 A;  4GLK A;  3FLG A;  2V8I A;  1BI2 A;  3I9Q A;  2VXE A;  2CRE A;  4PK4 A;  1EX4 A;  1TUC A;  4J8O A;  3OYH A;  4RUG A;  2EAY A;  1K0X A;  3PFS A;  1C1A A;  5AYF A;  2A08 A;  2RMO A;  1RI9 A;  4M77 F;  2JMC A;  4M77 E;  2DXB A;  1Q86 R;  1VQ6 Q;  4XTV A;  1M3C A;  1N9S A;  5HCK A;  4PNO A;  3C95 A;  3VS4 A;  1YFN A;  1RLQ C;  2LT4 A;  3CXC S;  5KYW B;  1E7O A;  1PKS A;  4RTZ A;  2DFU A;  5LJ5 f;  2O88 A;  1VQ6 A;  1GBQ A;  2YUQ A;  5GAO m;  2JS2 A;  4JRK A;  1KC8 R;  4ZNX A;  4BE2 A;  2FPE A;  2DEQ A;  1WA7 A;  3MP8 A;  2Y4Y A;  4PJM A;  5FRN A;  3O5Z A;  1K8A R;  2DXT A;  2E5Q A;  4KRT A;  1QVG A;  3CC2 T;  5GAM g;  3CCJ A;  4N4H A;  4ORZ A;  1YJ9 T;  2E3H A;  5KE3 A;  1X2K A;  2DYB A;  4DEX A;  1QP2 A;  2DLP A;  3CXC P;  4C8Q A;  2DBK A;  3HHT B;  1YI2 A;  4Z02 A;  2L8D A;  4M78 F;  4M7D F;  1QCF A;  3GF5 A;  1UJY A;  1PWT A;  2A7Y A;  1X27 A;  2ZGW A;  1D1B A;  1IB8 A;  1VQM T;  4NL3 A;  4C5I A;  1YJW A;  2XDB A;  3A8G B;  4BE0 A;  2VB6 A;  1KQS P;  1JRI A;  2NUP A;  3E1S A;  3QKJ A;  2GNC A;  1VQN Q;  1Q82 C;  2QXF A;  4II1 A;  3BW1 A;  1M8V A;  1M1F A;  2CZ6 B;  2HCK A;  3HFN A;  3QZ9 B;  5GAN 6;  3OYB A;  2LZ6 B;  2RI3 A;  1D0Z A;  4NL2 A;  5GAN f;  3S6W A;  2CYZ B;  3R6N A;  1MGQ A;  1ZUK A;  1NLP C;  2NUZ A;  3LGL A;  3VS2 A;  2F5K A;  3WVE B;  3J81 E;  3OQ5 A;  1N27 A;  2BTT A;  1K9M R;  4A4E A;  1T3L A;  4M78 B;  1TSF A;  1AWJ A;  2AZS A;  4PKC C;  4M7D B;  4PLL A;  4WF2 A;  1D3B A;  3ZBD A;  3THK A;  3LWH A;  4M77 C;  1YJN A;  1HJD A;  3VKI A;  3FDR A;  2XK0 A;  1K0S A;  4KGZ B;  2DF6 A;  2ZPF B;  5J39 A;  4M75 G;  2DM1 A;  3F70 A;  5CK9 A;  3Q1J A;  2HAX A;  2PUK B;  3VS3 A;  1Z9Z A;  4AG1 C;  2AT1 B;  3PMI A;  4KUD K;  2MYS A;  3CCE A;  1YHQ Q;  1UEB A;  1M90 U;  5KYN A;  2RN8 A;  1YIJ Q;  2KR3 A;  3EGD A;  4WCI A;  2YRC A;  3RKW A;  1YHQ A;  1YJ9 A;  4V2S A;  4RCB A;  1V76 A;  1OYX A;  1YIJ A;  2JS0 A;  4E47 A;  1KK7 A;  3KBG A;  3MEU A;  1EIF A;  2PU9 B;  1M4Z A;  3QJ6 A;  1UHC A;  3X25 B;  3CCL T;  2K6D A;  2ZZD A;  2L0A A;  2K3X A;  4FYY B;  1VQO A;  1BIB A;  1Y71 A;  1R0B G;  3HRU A;  3RMQ A;  1U8R A;  4M78 C;  4M7D C;  2EQK A;  4LDV A;  2OTL A;  3CC7 Q;  2IG0 A;  5FU7 B;  1JBM A;  2V1R A;  4JS5 A;  1MND A;  2L3R A;  1ARK A;  5KYW A;  5GAN 7;  4JZ4 A;  3UA7 A;  1X43 A;  2CP3 A;  1KD1 C;  1RAF B;  2LNV A;  3EG9 A;  2HMA A;  1RAG B;  4C5E A;  1G3T A;  3CC7 A;  3QYG B;  4FM4 B;  1YWO A;  4A4F A;  4JRQ A;  4MZP A;  2PUO B;  5I22 A;  4BAC A;  4C0Z A;  3J7A F;  3FB9 A;  2FRW A;  4J7F A;  2X3X D;  4JRP A;  2RK1 A;  1KSW A;  4C92 G;  1MMN A;  4JJC A;  2QQB A;  1KIK A;  3VRZ A;  5KH6 A;  1H64 1;  3GNF B;  4RKU E;  1VQ7 T;  4A4G A;  1YIT A;  3A8H B;  3I56 A;  2QTX A;  3EGX A;  3NHN A;  2O9S A;  3G4S A;  1QVG S;  2MK5 A;  3C94 A;  4M7A F;  1MV0 B;  2LJ1 A;  3JV3 A;  1PRM C;  2XG8 D;  4M7A E;  4FSS A;  4CC4 B;  4LNP A;  4ZGJ B;  4IUR A;  2GTJ A;  5FU7 C;  1N9R A;  3QUI A;  2VC8 A;  2DL8 A;  4EDU A;  2DER A;  3CCM T;  2P0Q A;  1NYF A;  2RD1 A;  3VU3 C;  4JJN K;  5L8R E;  2VGN A;  2K57 A;  1K9M U;  2P84 A;  5LJ3 h;  4J9E A;  1KHI A;  2RQU A;  1QVG P;  2KK4 A;  1WJS A;  3QBY A;  2M1H A;  4HKE A;  1OV3 A;  2R5A A;  4GY5 A;  2QAS A;  5GAM d;  3M0Q A;  2KRO A;  3J80 E;  3M0P A;  2DTO A;  4M77 G;  4M78 A;  4M7D A;  2EQJ A;  4XK8 E;  5LJ3 j;  8AT1 B;  4DEY A;  1K73 U;  2QA4 T;  4LD9 K;  2EYQ A;  2X3W D;  2ZPB B;  1GCP A;  1N5Z A;  2J05 A;  1SHG A;  3EG1 A;  1ZA1 B;  1SRM A;  3ER0 A;  1LNX A;  4FYW B;  4E6R A;  1D1A A;  2JOY A;  3TCJ A;  3V7S A;  4EMK C;  3EHQ A;  5A2Q E;  3M0T A;  1WGS A;  4MMK A;  1WQ7 A;  5ECA A;  5KYX B;  1VIF A;  1KJW A;  2EJ9 A;  4OB2 B;  1GBR A;  3CC4 T;  3CCS Q;  3EGU A;  3CME T;  1NBE B;  5FWB A;  2ED1 A;  2Z0W A;  2VVK A;  1UG1 A;  5IXF A;  4K11 A;  2E10 A;  2BUD A;  4C8Q D;  3CCS A;  5CKF A;  1M30 A;  3SD4 A;  2DVJ A;  1U1S A;  4GLM A;  4HVV A;  1AWX A;  1Y0M A;  2A37 A;  2LP5 A;  1Q81 R;  4M7A C;  3DKM A;  3CCM A;  2KYM A;  1S1N A;  3G71 Q;  4F16 A;  1HSQ A;  3ME9 A;  1M9S A;  1ZQ1 A;  3JAM E;  3MKD A;  3CCQ T;  1VOM A;  2OTJ Q;  1H3H A;  4BDY A;  2E41 A;  4JPB W;  1CKB A;  2DD4 A;  3CCU A;  2HQE A;  2K5I A;  5HKC A;  4PFO A;  2OTJ A;  3LH5 A;  4FYV B;  5GAO n;  4QKU A;  1TWB A;  2JW4 A;  2X9H A;  3RMS A;  1VQ4 T;  5FU6 B;  2LQ8 A;  1X6O A;  3LGF A;  1SF9 A;  2QI2 A;  3REB B;  2LJ0 A;  4N0A C;  3TSZ A;  4DQ2 A;  2WSE E;  2QQA A;  2X35 A;  2O9V A;  1TS9 A;  2QA4 A;  1M8M A;  1MHN A;  5KE2 A;  2EGE A;  4B9W A;  3M4Y A;  2RQT A;  4DBH A;  2CP2 A;  2EYW A;  4XTW A;  4XTU A;  3OW2 A;  4RTT A; 
#chains in the Genus database with same CATH homology
 1IGU A;  1IGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...