1IGUA

C-terminal domain of the transcriptional repressor protein korb
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
DPDKLKKAIVQVEHDERPARLILNRRPPAEGYAWLKYEDDGQEFEANLADVKLVALIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional repressor protein KorB
publication title An Src homology 3-like domain is responsible for dimerization of the repressor protein KorB encoded by the promiscuous IncP plasmid RP4.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 9
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06613 KorB_C KorB C-terminal beta-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.150 Mainly Beta Roll SH3 type barrels. KorB, C-terminal domain 1iguA00
1IGQA 1IGUA
chains in the Genus database with same CATH superfamily
3PFSA 4CRIA 1IB8A 3EG9B 2WACA 4QQGA 4HA8A 4M7DE 1D09B 2O4XB 4X9DA 4M78E 2JJ9A 2DE0X 1TUDA 2F2WA 4C0DB 1ARKA 4PJOC 1YHQA 5GAMg 4QQ6A 4RTUA 2COWA 2ENMA 1PKTA 2RJCA 3INZA 4ELYC 1OULA 4JJBA 2FG0A 2ZGWA 1D0XA 4JZ4A 2OTLT 1W2BA 1QP2A 3CC4A 1PSEA 1AEYA 1H641 2BE9B 1PD1A 1H3ZA 2F1LA 3CCEA 2RA2A 1JB0E 4PJOA 4FW1A 8AT1B 3ER0A 2EIFA 1PSFA 1X27A 2R5AA 3BY7A 1LCKA 5AT1B 2JNGA 4HVWA 1MV3A 1NEGA 1U06A 1IREB 3HSBA 3CCLA 1UGPB 5KH6A 4N4IA 2EQUA 1VQOA 4F14A 2JTEA 4QT7A 5D6YA 4M7AD 5GAOp 2JUFA 2MI6A 4WCIA 2XDDA 3MEUA 1M30A 1QLYA 2AKKA 4J9IA 2ROTA 3LGFA 3URGA 2FPDA 3H41A 3QYHB 2EVRA 2K3YA 4R0KA 4PJOF 3VJPA 2PVOB 3VS7A 1MV0B 2KEAA 3MEVA 4BUGA 4ANJA 1G3YA 1ZSZA 3OYJA 1S72Q 3X25B 3PT9A 3QJ6A 1SSHA 1QVPA 4CC3A 4EMKB 1X01A 3ME9A 2QXFA 2L8DA 2EWNA 1N8RC 3OYAA 3CC2A 1W6XA 2QQAA 3E1SA 2EQIA 4Q5WA 2JMCA 3OYGA 2DF6A 1SRMA 5I2SA 4JZ3A 2AIRB 5I11A 3FEOA 1KQSA 2O9VA 1WJRA 2KY9A 2DBMA 3RKWA 3J81E 1M2VB 2YRVA 2FZCB 3IQLA 3QBYA 4BB7A 1K76A 4C92G 4FYVB 4M77C 4BY6C 2E64A 5GAN2 1VQLT 4M75F 1K0XA 4PFPA 2WSCE 5LL6S 4PJOE 4HT8A 3VU3C 1U1TA 2BIVA 3NGPA 3CCST 3EH1A 2PVGB 4J9FA 1KC8C 3REBB 5GANd 2GGRA 5FRNA 3EHRA 1M1KU 5DLOA 2CKKA 3OYCA 5GMKj 1ZQ1A 2DPPB 1C1AA 6AT1B 1S1NA 1VQ9A 1K9MC 5GAOm 2KI7A 2NUPB 2ZPFB 5GMKe 1FWZA 4DBRA 3JCMJ 3L2WA 2YHTA 5KYYA 3EG2A 4BDZA 4HCKA 2HQXA 1ZSGA 5IHKA 3CCVA 1BIAA 1WHMA 1X6OA 2E70A 3VRYA 3H0FA 2QQBA 2CZ7B 2EYXA 1NM7A 3WXMB 2IVWA 5KYWB 1QVGP 1G3WA 2ZPGB 4II1A 4M7DG 2LJ3A 3PIOA 2GQIA 4D6WA 1HJDA 3OYFA 1D1CA 2CSQA 4M75E 2M16A 4ZNXA 3A8HB 2V1RA 4M78G 3C95A 2HCKA 3MCAB 3U23A 1O9SA 1YJ9Q 5M9OA 4X1VA 2RK2A 3LYIA 1VQ7A 3VS3A 4F7UA 4ELZC 4BDYA 4LD6A 1RAAB 4C8QC 2Y90A 4J9BA 5LJ5j 4NL3A 3SEMA 4ZGDB 4KUDK 3M59A 2BZYA 2XIDA 3S6WA 4OVAA 2X4YA 1OX9A 3BDUA 3BDLA 1WA7A 3RKXA 4E7HA 1VQNQ 4LDWA 4C5EA 2OAUA 4LDYA 1ZHIA 2ABLA 3MPUB 2JMAA 4DBHA 2DETA 5AYFA 1QVFA 1GCQA 2O01E 1GRIA 2O2OA 2VYTA 3VV0A 4C8QA 1MNDA 2BE7D 1KHCA 4B9WA 1Y96B 4IKFA 1NJIR 3VUBA 2I2LA 1LOJA 1TWBA 2PUKB 1JQQA 4KH1B 4F7UF 5GANe 3QZ9B 1S72T 2EQKA 5KE2A 4MMLA 2E10A 4N4HA 3OYBA 2AT1B 3LWHA 4JUVA 2KSSA 2HSPA 3GPLA 2EQJA 3M56A 1K8AU 1Q7YC 3JCMh 1PKSA 2JM9A 2HD0A 3V8KA 2K6DA 1X6BA 1WXUA 1B3QA 5FWCA 2ZPEB 1QCFA 1GFCA 4C8QF 4Z88A 5CVIA 1VQ5A 2Y4YA 4AG2C 2E4HA 3M9QA 2O9SA 2KBTA 2P4TA 2E41A 4GY5A 5HKCA 3CCJQ 5DM7R 1ZUKA 3UT1A 4Z89A 1VQPQ 1W70A 2BTTA 3FDRA 4AG1C 3M5AA 1TTHB 2HL5C 4RTXA 3V7SA 1VQ6Q 1NLPC 1UG1A 2CP7A 2RHXA 4JJNK 1CSKA 1KK7A 3O5ZA 4F7UE 3SDZA 2G3RA 3CEYA 1U1SA 5A0GA 1K0SA 3TEEA 5HK0A 1AD5A 3QDFA 3L2UA 4J7IA 2GFAA 1M8MA 2EYYA 1OEBA 2LDMA 1WXTA 1Y07A 1M27C 3CCRA 3E9FA 1PCXA 4M7AC 1KQSP 1T3SA 2OJ2A 2YUNA 4RTZA 3PVLA 2QTXA 2E1HA 4PJOG 3VKIA 4A53A 1Q81U 1W2BS 2CP2A 4PLLA 4M7AB 1AOJA 2RHYA 3SB2A 2NUZA 1I5LA 2LCLA 5FWBA 4AFSC 1VQKQ 1LNXA 4OB1B 1YJNQ 2GQVA 2YUQA 5D6XA 5DLQE 4J6WA 2R57A 1D3BB 2DK3A 4LE9A 1C0MA 2GF7A 1RAHB 1VQ4A 1K73U 1HXDA 5ECAA 1KHIA 4VUBA 1M90C 4E7IA 1YJ9T 2EQMA 1I0CA 1NYGA 1KD1R 1FXXA 2LVMA 3EFOA 1O75A 5KCOA 4OMMA 4FM4B 1NEBA 1M1GA 4E7SA 1MGQA 2YUPA 1Q86R 3CD6Q 3VS5A 1JO8A 5I22A 1MNEA 5EG2A 2LCSA 2PVDB 4N0AC 1VQNT 3P8BB 4E2FB 3THKA 1D1AA 3KFVA 1AZGB 1KJWA 1TS9A 3DB4A 3I55Q 1YJWA 3BW1A 3MP6A 4JRKA 3EGXB 3RUXA 2DTIA 4RTVA 3CCMQ 1RAIB 2PU9B 1QW1A 5GAN8 1UTIA 4XTYA 2FB7A 4FW2A 3TU4K 4V2SA 4WTOB 4XK8E 4L5GA 4BI3A 3NTHA 5LJ3h 4PKCC 4Y28E 1OQKA 1OPLA 4N4GA 3PVQA 3CXCA 3CPWA 2EPDA 3TREA 5GMKl 1N9SA 1QQJA 4IUVA 1KQSS 5KE3A 3M58A 1MUZA 2ZPHB 1RABB 1GBRA 3CC7Q 1H3HA 2JZ2A 3R6OA 3CMAQ 3UPUA 2DL5A 2ZPBB 3SWNA 2LCCA 1PHTA 5GJWB 1G8XA 3WVDB 1TOVA 4DOWA 2L3PA 4RCCA 3O8VA 1QWFA 8ATCB 3OYMA 1Y0MA 2JN0A 4JS5A 3CCQA 1BBZA 3CCJT 1Z9ZA 4ORZA 3LLRA 5FLXE 1ZA2B 2LP5A 3M4YA 4DA4A 2LQ8A 1VQPT 3SFMA 1YWOA 3OS1A 2K2MA 2KE9A 5CKEA 2DVJA 1UUEA 1AVZC 2E12A 1SHFA 1VQ6T 4DEYA 2A0FB 2DNUA 3Q1JA 3ZEHA 1K9AA 1BI3A 5LJ5f 4BI4A 2HDAA 1OX8A 4KRTA 2FRYA 4JRPA 4XU3A 2X4JA 3CBMA 1JBMA 2X3WD 3E19A 2RD1A 2YDLA 4EDUA 2JXBA 1HSQA 1YHQQ 4FT2A 3UF4A 5KYXA 2D1XA 5LJ5g 3JCMc 2C0OA 1V1CA 1ZLMA 3PNWC 5A0DA 4MMKA 2DX1A 3VS4A 1IO6A 2PUOB 3CC4Q 1M4ZA 2Z0WA 4F04B 5GAN6 4J9EA 1G2BA 1K1ZA 2YRCA 1YP5A 4F7UG 1WPYA 2GTOA 1AWJA 4FSXA 3RNJA 4PFZA 3PTAA 1ABQA 3CCEQ 1VQKT 1QVGA 5HY6A 2XKOC 2RB6A 1YJNT 2COZA 2YRDA 3QPHA 5C0MA 4FCYA 4RTWA 4HVUA 2DFUA 2DO3A 4J6YA 4RG8A 2CYZB 4B9XA 1Q82U 2KNBB 3L1AA 4C0DC 3CCLQ 1OI1A 4HXJA 1M1KC 2FRWA 3CCUA 4C8QG 1VQOQ 1E6GA 2NWMA 3EFRA 4GLMA 2RM4A 3RKYA 3OYEA 2QDYB 2VB6A 3FIFA 3G6EA 2HAXA 2HQEA 2MIOA 3QJYA 3EG9A 4PL6A 3CD6T 1UGRB 3QIIA 2DL3A 1ZA1B 1QVFS 4YTLA 4KH0B 3UA7A 3FRNA 4NS5A 2QEXA 2F69A 3I55T 2L3SA 4OP0A 3GIBA 1MMGA 1P92A 3CCMT 1WHHA 3HKSA 1WDXA 3P8HA 2MF2A 2M1HA 4OGCA 3DLMA 3QWXX 2DBKA 2LTOA 2V8JA 2F5KA 3OMGA 1K9MR 2CSIA 4JS4A 2DD5A 3CC2Q 1AWWA 1VQ8T 5GAOr 1VQLA 2RK1A 5J39A 3GF5A 4C0FA 4E47A 1GFDA 1X2KA 2EKOA 2K79A 1VQMA 4A4FA 1EZZB 3QO3A 5GMKi 2L3QA 2DXUA 1YNZA 2J06A 2YXYA 3CMAT 2KT8A 3OYDA 1X69A 3QZ5B 4O6JA 5CQYA 2RQWA 4AT1B 3ZFJA 4EMKC 3JB9H 3EGDA 4C0GA 1BI0A 3L2VA 1XOVA 4J7FA 4R56A 3X24B 1PRMC 4OB2B 2LX9A 4A4KA 2FYKA 2K57A 3BE3A 1AZEA 1ZSZB 4FU6A 2CT3A 3HRUA 1UE9A 4QVCA 4M75B 4C92D 1WI7A 5CAIA 3CXCP 3CPWP 3OB9A 1K8AC 1VQ9Q 3G1JA 4LN2A 5CKHA 2DRMA 1BIBA 2X4WA 3HL8A 3G4SA 4DBFA 4XTWA 2JW4A 1UGQB 2DM1A 1YHQT 4OMOA 5L8RE 5A0LA 1YCSB 1M2OA 3CCVQ 2FVUA 1E7OA 5EC7A 5LJ5d 3CC4T 3LGLA 2XMFA 7AT1B 2CDTA 2GCXA 2DZCA 4K11A 1NLOC 2RMOA 1FYNA 1M2VA 1RAFB 5FU6C 2B8AA 2AHJB 2J7IA 3CCET 4OF1A 2F2VA 2XICA 1KD1U 2HBPA 2DJQA 1Q7YR 3TCJA 5D7UA 4AFZC 3UA6A 1AWOA 2EGAA 5CQXA 5GAN3 1VQ7Q 3JB9F 5FU6B 3PGGA 2H8HA 2K5LA 2M0YA 1TUCA 2CH4W 2VXFA 1YIJA 2A28A 4M77A 3M57A 1V76A 4EPCA 1VYTA 2L0AA 5GAOn 2KROA 4RTTA 5CKFA 1FMKA 4C0ZA 3G71A 1QCOA 3S3NA 9ATCB 4A4EA 3SD4A 5GAN7 1Q81C 1XTDA 3MP1A 2ATCB 1C6VX 2JT4A 1D0YA 2Y4XA 1QKWA 2OAWA 1H8KA 4MDWA 3HTRA 1A0NB 4PFOA 3HFNA 1ACMB 2RQUA 2LJ1A 5GAOl 2M51A 1B7TA 2J05A 4M77F 3V7CA 5KYWA 1GL5A 2RNAA 1K73C 1IRXA 2X35A 4HT9A 4BD3A 3I56A 1Y7XA 1B34B 1KSWA 1UHFA 4X9CA 2RHZA 1BKBA 3CXCS 3CPWS 4OMFB 5GANh 5J26A 2J6OA 4NL2A 4IURA 1N27A 5IHNA 4C5GA 4OMLA 4TVRA 5KYNA 1BCMA 5CKBA 1VQ5Q 2PTKA 2VV5A 1SG5A 2LNHB 5LJ5e 3OYLA 1OZ2A 1WX6A 3LH5A 1GBQA 1R0CB 4E7ZA 2LQKA 4MZTA 2RJEA 5FW9A 2EGEA 3PMIA 3M0RA 3A1PA 2CT4A 4JLGA 2AZSA 2NUTA 3UDCA 1M90R 5GAMh 3JCMP 2E6NA 4Y92A 2QA4A 3LX7A 2PNIA 4KGZB 2OX7A 1JEGA 2VGNA 3LW5E 4QVDA 2RPNA 3NMZC 4M77E 1SHGA 2RN8A 3QG1A 2QI2A 1R8OB 3CCRQ 1GXIE 2I0NA 1UJYA 4J6XA 1W4SA 2QGGA 1VQ9T 5CK9A 4LDVA 4KBMB 3BFMA 3MO8A 3VYHB 1DJ7B 2O31A 3UATA 4ZN1A 4KULA 2CUBA 3HRTA 1M3BA 1UB4A 3N5BB 3NTIA 3CCVT 2ZCFB 1QVGS 3A98A 2EKHA 3OBYA 1VA7A 3CMEA 3MJXA 3OYYA 2E5QA 1NBEB 2P0KA 2DIQA 2W10A 3I35A 3WVEB 4JDSA 3OYKA 1VQ4Q 2A08A 5CR2A 4PK4A 1VYVA 1IZ6A 1I8FA 2AKLA 3GNFB 1YBYA 4KT0E 4FT4A 4E6RA 2LQWA 1PC0A 3M53A 2OI3A 3J80E 1YI2A 2C0IA 2YLCA 3ZL7C 3OS5A 3MP8A 1YJWQ 4C8QE 3RDVA 4C5IA 2X3XD 1WQ7A 1T0HA 2KMTA 1MMAA 4M7AA 4J9DA 1NPPA 3CBPA 5IH2A 2DAQA 2RQVA 4XU1A 1Y57A 1CKBA 4LXCA 4M75D 5D6WA 4E7KA 1Q82C 2LRQA 4HKEA 1OU8A 1D3BA 1M5Q1 3REAB 2DL4A 3TSWA 2K9GA 2EYWA 1LVKA 3RBBB 2DYBA 4C92B 1UEBA 3EGUA 1I07A 2RQTA 2FO0A 1N9RA 1ZUYA 5CO7A 4ZTJA 2DKGA 2QG9B 5IXBA 2NLUA 4PJNA 2CP5A 2QQRA 2J6FA 4M7AF 2DXTA 4XAXB 3CCQQ 5GAN5 3C4SA 2RF0A 1X43A 3QWYA 3VS0A 1T0JA 2EAYA 3VUZA 2L3RA 3CPFA 3NFCA 2DZ9A 3R6NA 2XD0A 4RMOA 2CUDA 3JB9G 1M1KR 3L2RA 2H3EB 3EGXA 2IG0A 2IIMA 1T3LA 2OTJA 1F1BB 5KYUB 4L59A 2KYMA 4N0AA 2XDPA 2JTFA 1FMVA 3J7AF 3RIRA 2MCNA 2YUOA 2V26A 4DQ2A 4BE0A 1Z9QA 4UC4A 4QW2A 1BI1A 3CCRT 3F70A 4ESRA 2X51A 2E5KA 1GCPA 2BKDN 3S3MA 2GTJA 4HVVA 2ED0A 1YITA 1WZOA 2HNIA 1SKUB 4M7DB 2P0QA 2L2PA 2FEIA 4M78B 4RKUE 1NE8A 1G5VA 2QK0A 2HZYA 4QQDA 1LPLA 2W0ZA 3SWNB 2RI3A 2D0QB 4FYXB 3A5ZB 4M77G 4M7AE 1YFNA 2DIGA 2QQ9A 3PMTA 3KBGA 1IHVA 1SSFA 1PM3A 5GAOq 2OTLA 2DEUA 5LJ3j 1VQ4T 2M9UA 1UGVA 3KUFA 4EIKA 4EMGA 3CCUQ 2KXDA 2LNVA 3NTKA 4KGVB 1HD3A 1TG0A 3CBOA 3ULRB 2EJ9A 3G6EQ 1I81A 3L42A 1QKXA 2RJFA 4E7LA 2ESWA 1Q95G 2DTOA 1VQ8A 3AHUA 2D8HA 1KQ2A 1N5ZA 2C0TA 1OZ3A 3H6ZA 2QEXQ 2V1QA 3G7ZA 1YJWT 2YWWA 1JJ2P 4IUUA 2WSFE 3OQ5A 3GBQA 4J9HA 2FZKB 3PIPA 1N8RR 3VYGA 5FU7B 2A7YA 1ZUUA 2M02A 3HPWA 2KVQG 3C94A 4CC4B 2DD4A 4Z02A 1KD1C 3JCMX 4IUQA 1EIFA 3QYGB 1VQLQ 4LDXA 1UHCA 4E7JA 2SRCA 1KIKA 4PJMA 1VQMQ 1ABOA 1ZX6A 1NYFA 3RMSA 2HQHA 3GOXA 2D8JA 3A8OB 3V8JA 1NJIU 1K4US 2O4XA 5GAMf 1I1JA 4JRQA 2EFIA 2JVVA 1UGSB 1U3OA 4BI8B 1LJOA 1SF9A 1KC8R 2DJZA 3CCQT 4XU0A 2DA9A 2QDLA 5GAN4 1BB9A 2DL8A 3E2UA 2SEMA 4JLIA 2EBPA 2E3HA 4A54A 2K3XA 2HSEB 4BE2A 2EJGA 3JCMf 1G83A 1I5OB 1U5SA 4PJOB 2LC4A 1JU5C 3QUIA 3QXEB 5FROA 1WJSA 2K2VA 2G6FX 4FIBA 3M55A 1TXQA 2B86A 1Q81R 2QQSA 4ZGJB 3OSSC 4GLKA 1CKAA 4D8KA 1KG1A 3G4SQ 3JCMg 3CCSA 3M4GA 4A63B 3CQTA 2MYSA 2FPEA 3JCMV 2E6ZA 1IXDA 4WF2A 3CC7T 2KRMA 1MMDA 3A8MB 1WFWA 2HL3A 2LJ0A 3OY9A 1JJ2S 3MEAA 1K73R 1ZSZC 3OW2P 3VS6A 1N6AA 2BUDA 2L89A 3EGDB 4M75C 4L6V5 4F16A 3SHWA 1M3AA 4CC2A 1BYMA 2RHUA 2DL7A 3TQ7P 1H92A 1YIJQ 2RI2A 3QKJA 5FRMA 2KXCA 2DEQA 3H0HA 3FJPA 3FC3A 4EMKA 2V8KA 3CCUT 3G71Q 1RL2A 1VOMA 4R55A 1VIEA 2VGMA 2QGFB 4BE1A 4M7AG 2R5MA 3AT1B 1RLQC 3EG3A 4M75A 4XTZA 2VC8A 3PE0A 3G6ET 3M0QA 1W1FA 3V7RA 1Y71A 1RUWA 1XQHA 3QDRB 2DRKA 2QASA 2DLPA 3QSUA 3X26B 1RI0A 2QEXT 3RR6A 1ZBXA 5CKDA 2DTHA 1WHJA 5GMKh 2EGCA 4HCCA 3OYIA 1RLPC 4PJLA 1M3CA 2EYZA 4HCBA 5KCHA 3OS2A 3MEWA 1IGQA 2YSQA 3HRSA 3I56Q 1RAGB 3E9GA 2D6FA 1Q86U 4DBQA 1MMNA 3GP8A 3CCLT 2ZPIB 1HYOA 1VYUA 3M0TA 3JAME 1S72A 4M7DD 3VRZA 4M77B 4BY6B 1ZBJA 1VQOT 1VQMT 4M78D 3OSVA 1M1FA 3H8ZA 5IHIA 2GBQA 4OB0B 2RJDA 1NG2A 1SPKA 2DXCA 2QYZA 3A8LB 2K5FA 2VXEA 3OYHA 5HCKA 4J8OA 4XTVA 3NPFA 2NUPA 3OW2S 2ED1A 5KYYB 2D9TA 2XK0A 1G3TA 5LJ5h 4CC7A 2QA4Q 2ZZDA 4RG2A 1FMWA 5LJ3f 5HK3A 3MHXA 3EFSA 4LD9K 2RO0A 5GAMd 1KFZA 1BCOA 3C0CA 3CC2T 5LJ3g 3JCMW 3RERA 2MMPA 2KDSA 4IUPA 1XNIA 3OBWA 4XU2A 4F7UB 2LT4A 1AWXA 2MPXC 4JJDA 1B34A 1KQ1A 3EG1A 3G4ST 3H0IA 1X75C 1M9SA 1QCNA 1RACB 3VS1A 4PJJA 3ZBDA 3LH0A 1U8RA 3RESA 4OB3B 2KGTA 3JSCA 4ZTFA 2CS7A 3JCMd 1GCQC 4A4GA 2FZGB 2KR3A 1EFNA 4AMCA 3CMEQ 1Q82R 2XHCA 4PLIA 4ZN3A 2HKNA 4JPBW 4C8QB 2K5IA 2GNCA 1PG5B 2FPFA 2DERA 1WLPB 1WNLA 2NUTB 2K7AA 1W2BP 4JJCA 2ZAEA 1Y96A 3M0PA 5GANj 1AT1B 4M4ZA 1MHNA 2K3BA 2EW3A 3TSZA 3TVTA 2BZ8A 1YI2Q 1YIJT 3HHTB 4NOYA 4AFUC 2RHIA 3JB9J 5IN1A 3G71T 4P5NA 3KXTA 1JXOA 1YJ9A 1N8RU 4ATOA 3M0UA 2E3IA 1VIFA 1FX7A 2KRSA 1OYXA 5A2QE 1NZ9A 2R58A 1JRIA 2KYBA 2CP3A 5GAMj 1JJ2A 1V29B 1RADB 2O88A 2VKNA 2FL7A 4D8DA 3FLGA 2MOXA 3OMCA 2LX7A 2XI9A 1VQNA 5GAMe 4PNOA 4PJOD 4J5YA 1UFFA 2RQRA 2CP0A 3MKDA 2LZ6B 4KGXB 1AHJB 2DVEA 3DB3A 4LNPA 1VQ7T 3I56T 2LT1A 2KAFA 2PZ1A 4X34A 1WIEA 4OGEA 5I2MA 3EG0A 4F17A 3A8GB 4J9GA 4IIMA 3JCMe 4LUEA 2A36A 1OU9A 4HCZA 1KC8U 2ROLA 1OOTA 2VUBA 3META 3C12A 1R77A 1BU1A 3D7SB 3I5RA 1SRLA 2KK4A 2EJFA 2CZ0B 2F2XA 2JS2A 1K9MU 2C06A 2CZ1B 2QAZA 3RMQA 1BI2A 2A3LA 2QTVA 3JB9I 4Y91A 2HEQA 2LQNA 2OTJQ 2QA4T 1NPRA 4J9CA 3GNGA 3DLLA 1PWTA 2E65A 2AK5A 2GFUA 2X9HA 3EH2A 4C92C 1IHWA 2AZVA 5C6SA 3CCJA 4LDUA 3GLXA 2BZXA 2V8IA 3X20B 4QVZA 2YLBA 4RCBA 1VQPA 2XDBA 2KT1A 2JOYA 2XU8A 3JB9D 1YITQ 3EFOB 3NHNA 1VQ6A 5LJ3d 1HK9A 4FYYB 4FL6A 2X4XA 3HP9A 1NJIC 1VQ5T 1PRLC 1WGSA 4C92A 2MWPA 1WYXA 1D0ZA 2D0NA 3OA6A 4MZPA 2DILA 4RTYA 3OW2A 3CMET 2KQWA 1IGUA 3X28B 2OTLQ 4M75G 4DEXA 2HKQB 5J3BA 2DYIA 1VUBA 4KUIA 2MWOA 2KRNA 4RUGA 4MDXA 4O5VA 5DY9A 1OV3A 2HBWA 1YCYA 1VQKA 1WXBA 1D1BA 4LUDA 5GMKm 1E6HA 4M77D 5L23A 1YJNA 5IAYA 1PNJA 4GBQA 4M7DC 5KYUA 1B07A 4M78C 4IIOA 1YI2T 4C92F 3S3OA 2P84A 2LMJA 5CCAA 4DOVA 1VQ8Q 3SWNC 1WHGA 1X2QA 2FHDA 1PD0A 2P0PA 2VASA 1WHKA 1QP3A 3VS2A 1Q7YU 2MK5A 4OMQA 4M7DA 3JV3A 2P4RA 1EX4A 3UWNA 3ASKA 2XG8D 4M78A 1TSFA 4MZMA 4IUTA 4XTXA 1RI9A 3CD6A 1X6GA 3QHSA 3T9NA 2H3JA 5IT9E 3L2ZA 1QMCA 2YT6A 2RI5A 3OS0A 1QVFP 3I55A 4OMPA 1TH7A 1UECA 5CIUA 4ZGEB 3FJ5A 3CCMA 1YN8A 1UJ0A 1I4K1 2RH2A 5LJ3e 2CZ6B 2IPOB 2MAMA 5GJVB 1BK2A 1TU0B 1UDLA 4XTUA 1XJWB 2CREA 4OMNA 5IXFA 5I21A 1WJQA 4C92E 4J83A 3I9QA 1RAEB 4M7DF 2VWFA 2WSEE 3I5SA 5KYXB 2CP6A 2EYQA 4XQ3A 4M78F 5FU7C 1JXMA 3M0SA 2JS0A 3DKMA 3JRZA 4C8QD 3JCMQ 2PQWA 4FSSA 3L2QA 1M8VA 2J6KA 4ME7A 4C5HA 3CC7A 2COYA 4B6MA 3H9NA 1J3TA 3CMAA 1K8AR 2JM8A 2JTMA 2K4YA 3V8LA 5GANf 1R0BG 2OTJT 4JRIA 1QWEA 4Z8AA 3EAEA 2L5QA 1SEMA 3P8DA 2VVKA 1TUGB 1Q86C 4CI0C 1WHLA 2F5TX 4BACA 2DXBA 4FYWB 1WQWA 4AFQC 2M0OA 1G3SA 2CH4A 5GANg 3CCSQ 4A4HA 4EMHA 2A37A 1YWPA 2DMOA 3M54A 1OPKA 2HMAA 4QKUA 2NYSA 2CGHA 3FB9A 3HFOA 2ECZA 3LWIA 1YITT 3EHQA 1M90U 3OYNA 3JCMb
chains in the Genus database with same CATH topology
1IGQA 1IGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IGQ A;  1IGU A; 
#chains in the Genus database with same CATH topology
 3PFS A;  4CRI A;  1IB8 A;  3EG9 B;  2WAC A;  4QQG A;  4HA8 A;  4M7D E;  1D09 B;  2O4X B;  4X9D A;  4M78 E;  2JJ9 A;  2DE0 X;  1TUD A;  2F2W A;  4C0D B;  1ARK A;  4PJO C;  1YHQ A;  5GAM g;  4QQ6 A;  4RTU A;  2COW A;  2ENM A;  1PKT A;  2RJC A;  3INZ A;  4ELY C;  1OUL A;  4JJB A;  2FG0 A;  2ZGW A;  1D0X A;  4JZ4 A;  2OTL T;  1W2B A;  1QP2 A;  3CC4 A;  1PSE A;  1AEY A;  1H64 1;  2BE9 B;  1PD1 A;  1H3Z A;  2F1L A;  3CCE A;  2RA2 A;  1JB0 E;  4PJO A;  4FW1 A;  8AT1 B;  3ER0 A;  2EIF A;  1PSF A;  1X27 A;  2R5A A;  3BY7 A;  1LCK A;  5AT1 B;  2JNG A;  4HVW A;  1MV3 A;  1NEG A;  1U06 A;  1IRE B;  3HSB A;  3CCL A;  1UGP B;  5KH6 A;  4N4I A;  2EQU A;  1VQO A;  4F14 A;  2JTE A;  4QT7 A;  5D6Y A;  4M7A D;  5GAO p;  2JUF A;  2MI6 A;  4WCI A;  2XDD A;  3MEU A;  1M30 A;  1QLY A;  2AKK A;  4J9I A;  2ROT A;  3LGF A;  3URG A;  2FPD A;  3H41 A;  3QYH B;  2EVR A;  2K3Y A;  4R0K A;  4PJO F;  3VJP A;  2PVO B;  3VS7 A;  1MV0 B;  2KEA A;  3MEV A;  4BUG A;  4ANJ A;  1G3Y A;  1ZSZ A;  3OYJ A;  1S72 Q;  3X25 B;  3PT9 A;  3QJ6 A;  1SSH A;  1QVP A;  4CC3 A;  4EMK B;  1X01 A;  3ME9 A;  2QXF A;  2L8D A;  2EWN A;  1N8R C;  3OYA A;  3CC2 A;  1W6X A;  2QQA A;  3E1S A;  2EQI A;  4Q5W A;  2JMC A;  3OYG A;  2DF6 A;  1SRM A;  5I2S A;  4JZ3 A;  2AIR B;  5I11 A;  3FEO A;  1KQS A;  2O9V A;  1WJR A;  2KY9 A;  2DBM A;  3RKW A;  3J81 E;  1M2V B;  2YRV A;  2FZC B;  3IQL A;  3QBY A;  4BB7 A;  1K76 A;  4C92 G;  4FYV B;  4M77 C;  4BY6 C;  2E64 A;  5GAN 2;  1VQL T;  4M75 F;  1K0X A;  4PFP A;  2WSC E;  5LL6 S;  4PJO E;  4HT8 A;  3VU3 C;  1U1T A;  2BIV A;  3NGP A;  3CCS T;  3EH1 A;  2PVG B;  4J9F A;  1KC8 C;  3REB B;  5GAN d;  2GGR A;  5FRN A;  3EHR A;  1M1K U;  5DLO A;  2CKK A;  3OYC A;  5GMK j;  1ZQ1 A;  2DPP B;  1C1A A;  6AT1 B;  1S1N A;  1VQ9 A;  1K9M C;  5GAO m;  2KI7 A;  2NUP B;  2ZPF B;  5GMK e;  1FWZ A;  4DBR A;  3JCM J;  3L2W A;  2YHT A;  5KYY A;  3EG2 A;  4BDZ A;  4HCK A;  2HQX A;  1ZSG A;  5IHK A;  3CCV A;  1BIA A;  1WHM A;  1X6O A;  2E70 A;  3VRY A;  3H0F A;  2QQB A;  2CZ7 B;  2EYX A;  1NM7 A;  3WXM B;  2IVW A;  5KYW B;  1QVG P;  1G3W A;  2ZPG B;  4II1 A;  4M7D G;  2LJ3 A;  3PIO A;  2GQI A;  4D6W A;  1HJD A;  3OYF A;  1D1C A;  2CSQ A;  4M75 E;  2M16 A;  4ZNX A;  3A8H B;  2V1R A;  4M78 G;  3C95 A;  2HCK A;  3MCA B;  3U23 A;  1O9S A;  1YJ9 Q;  5M9O A;  4X1V A;  2RK2 A;  3LYI A;  1VQ7 A;  3VS3 A;  4F7U A;  4ELZ C;  4BDY A;  4LD6 A;  1RAA B;  4C8Q C;  2Y90 A;  4J9B A;  5LJ5 j;  4NL3 A;  3SEM A;  4ZGD B;  4KUD K;  3M59 A;  2BZY A;  2XID A;  3S6W A;  4OVA A;  2X4Y A;  1OX9 A;  3BDU A;  3BDL A;  1WA7 A;  3RKX A;  4E7H A;  1VQN Q;  4LDW A;  4C5E A;  2OAU A;  4LDY A;  1ZHI A;  2ABL A;  3MPU B;  2JMA A;  4DBH A;  2DET A;  5AYF A;  1QVF A;  1GCQ A;  2O01 E;  1GRI A;  2O2O A;  2VYT A;  3VV0 A;  4C8Q A;  1MND A;  2BE7 D;  1KHC A;  4B9W A;  1Y96 B;  4IKF A;  1NJI R;  3VUB A;  2I2L A;  1LOJ A;  1TWB A;  2PUK B;  1JQQ A;  4KH1 B;  4F7U F;  5GAN e;  3QZ9 B;  1S72 T;  2EQK A;  5KE2 A;  4MML A;  2E10 A;  4N4H A;  3OYB A;  2AT1 B;  3LWH A;  4JUV A;  2KSS A;  2HSP A;  3GPL A;  2EQJ A;  3M56 A;  1K8A U;  1Q7Y C;  3JCM h;  1PKS A;  2JM9 A;  2HD0 A;  3V8K A;  2K6D A;  1X6B A;  1WXU A;  1B3Q A;  5FWC A;  2ZPE B;  1QCF A;  1GFC A;  4C8Q F;  4Z88 A;  5CVI A;  1VQ5 A;  2Y4Y A;  4AG2 C;  2E4H A;  3M9Q A;  2O9S A;  2KBT A;  2P4T A;  2E41 A;  4GY5 A;  5HKC A;  3CCJ Q;  5DM7 R;  1ZUK A;  3UT1 A;  4Z89 A;  1VQP Q;  1W70 A;  2BTT A;  3FDR A;  4AG1 C;  3M5A A;  1TTH B;  2HL5 C;  4RTX A;  3V7S A;  1VQ6 Q;  1NLP C;  1UG1 A;  2CP7 A;  2RHX A;  4JJN K;  1CSK A;  1KK7 A;  3O5Z A;  4F7U E;  3SDZ A;  2G3R A;  3CEY A;  1U1S A;  5A0G A;  1K0S A;  3TEE A;  5HK0 A;  1AD5 A;  3QDF A;  3L2U A;  4J7I A;  2GFA A;  1M8M A;  2EYY A;  1OEB A;  2LDM A;  1WXT A;  1Y07 A;  1M27 C;  3CCR A;  3E9F A;  1PCX A;  4M7A C;  1KQS P;  1T3S A;  2OJ2 A;  2YUN A;  4RTZ A;  3PVL A;  2QTX A;  2E1H A;  4PJO G;  3VKI A;  4A53 A;  1Q81 U;  1W2B S;  2CP2 A;  4PLL A;  4M7A B;  1AOJ A;  2RHY A;  3SB2 A;  2NUZ A;  1I5L A;  2LCL A;  5FWB A;  4AFS C;  1VQK Q;  1LNX A;  4OB1 B;  1YJN Q;  2GQV A;  2YUQ A;  5D6X A;  5DLQ E;  4J6W A;  2R57 A;  1D3B B;  2DK3 A;  4LE9 A;  1C0M A;  2GF7 A;  1RAH B;  1VQ4 A;  1K73 U;  1HXD A;  5ECA A;  1KHI A;  4VUB A;  1M90 C;  4E7I A;  1YJ9 T;  2EQM A;  1I0C A;  1NYG A;  1KD1 R;  1FXX A;  2LVM A;  3EFO A;  1O75 A;  5KCO A;  4OMM A;  4FM4 B;  1NEB A;  1M1G A;  4E7S A;  1MGQ A;  2YUP A;  1Q86 R;  3CD6 Q;  3VS5 A;  1JO8 A;  5I22 A;  1MNE A;  5EG2 A;  2LCS A;  2PVD B;  4N0A C;  1VQN T;  3P8B B;  4E2F B;  3THK A;  1D1A A;  3KFV A;  1AZG B;  1KJW A;  1TS9 A;  3DB4 A;  3I55 Q;  1YJW A;  3BW1 A;  3MP6 A;  4JRK A;  3EGX B;  3RUX A;  2DTI A;  4RTV A;  3CCM Q;  1RAI B;  2PU9 B;  1QW1 A;  5GAN 8;  1UTI A;  4XTY A;  2FB7 A;  4FW2 A;  3TU4 K;  4V2S A;  4WTO B;  4XK8 E;  4L5G A;  4BI3 A;  3NTH A;  5LJ3 h;  4PKC C;  4Y28 E;  1OQK A;  1OPL A;  4N4G A;  3PVQ A;  3CXC A;  3CPW A;  2EPD A;  3TRE A;  5GMK l;  1N9S A;  1QQJ A;  4IUV A;  1KQS S;  5KE3 A;  3M58 A;  1MUZ A;  2ZPH B;  1RAB B;  1GBR A;  3CC7 Q;  1H3H A;  2JZ2 A;  3R6O A;  3CMA Q;  3UPU A;  2DL5 A;  2ZPB B;  3SWN A;  2LCC A;  1PHT A;  5GJW B;  1G8X A;  3WVD B;  1TOV A;  4DOW A;  2L3P A;  4RCC A;  3O8V A;  1QWF A;  8ATC B;  3OYM A;  1Y0M A;  2JN0 A;  4JS5 A;  3CCQ A;  1BBZ A;  3CCJ T;  1Z9Z A;  4ORZ A;  3LLR A;  5FLX E;  1ZA2 B;  2LP5 A;  3M4Y A;  4DA4 A;  2LQ8 A;  1VQP T;  3SFM A;  1YWO A;  3OS1 A;  2K2M A;  2KE9 A;  5CKE A;  2DVJ A;  1UUE A;  1AVZ C;  2E12 A;  1SHF A;  1VQ6 T;  4DEY A;  2A0F B;  2DNU A;  3Q1J A;  3ZEH A;  1K9A A;  1BI3 A;  5LJ5 f;  4BI4 A;  2HDA A;  1OX8 A;  4KRT A;  2FRY A;  4JRP A;  4XU3 A;  2X4J A;  3CBM A;  1JBM A;  2X3W D;  3E19 A;  2RD1 A;  2YDL A;  4EDU A;  2JXB A;  1HSQ A;  1YHQ Q;  4FT2 A;  3UF4 A;  5KYX A;  2D1X A;  5LJ5 g;  3JCM c;  2C0O A;  1V1C A;  1ZLM A;  3PNW C;  5A0D A;  4MMK A;  2DX1 A;  3VS4 A;  1IO6 A;  2PUO B;  3CC4 Q;  1M4Z A;  2Z0W A;  4F04 B;  5GAN 6;  4J9E A;  1G2B A;  1K1Z A;  2YRC A;  1YP5 A;  4F7U G;  1WPY A;  2GTO A;  1AWJ A;  4FSX A;  3RNJ A;  4PFZ A;  3PTA A;  1ABQ A;  3CCE Q;  1VQK T;  1QVG A;  5HY6 A;  2XKO C;  2RB6 A;  1YJN T;  2COZ A;  2YRD A;  3QPH A;  5C0M A;  4FCY A;  4RTW A;  4HVU A;  2DFU A;  2DO3 A;  4J6Y A;  4RG8 A;  2CYZ B;  4B9X A;  1Q82 U;  2KNB B;  3L1A A;  4C0D C;  3CCL Q;  1OI1 A;  4HXJ A;  1M1K C;  2FRW A;  3CCU A;  4C8Q G;  1VQO Q;  1E6G A;  2NWM A;  3EFR A;  4GLM A;  2RM4 A;  3RKY A;  3OYE A;  2QDY B;  2VB6 A;  3FIF A;  3G6E A;  2HAX A;  2HQE A;  2MIO A;  3QJY A;  3EG9 A;  4PL6 A;  3CD6 T;  1UGR B;  3QII A;  2DL3 A;  1ZA1 B;  1QVF S;  4YTL A;  4KH0 B;  3UA7 A;  3FRN A;  4NS5 A;  2QEX A;  2F69 A;  3I55 T;  2L3S A;  4OP0 A;  3GIB A;  1MMG A;  1P92 A;  3CCM T;  1WHH A;  3HKS A;  1WDX A;  3P8H A;  2MF2 A;  2M1H A;  4OGC A;  3DLM A;  3QWX X;  2DBK A;  2LTO A;  2V8J A;  2F5K A;  3OMG A;  1K9M R;  2CSI A;  4JS4 A;  2DD5 A;  3CC2 Q;  1AWW A;  1VQ8 T;  5GAO r;  1VQL A;  2RK1 A;  5J39 A;  3GF5 A;  4C0F A;  4E47 A;  1GFD A;  1X2K A;  2EKO A;  2K79 A;  1VQM A;  4A4F A;  1EZZ B;  3QO3 A;  5GMK i;  2L3Q A;  2DXU A;  1YNZ A;  2J06 A;  2YXY A;  3CMA T;  2KT8 A;  3OYD A;  1X69 A;  3QZ5 B;  4O6J A;  5CQY A;  2RQW A;  4AT1 B;  3ZFJ A;  4EMK C;  3JB9 H;  3EGD A;  4C0G A;  1BI0 A;  3L2V A;  1XOV A;  4J7F A;  4R56 A;  3X24 B;  1PRM C;  4OB2 B;  2LX9 A;  4A4K A;  2FYK A;  2K57 A;  3BE3 A;  1AZE A;  1ZSZ B;  4FU6 A;  2CT3 A;  3HRU A;  1UE9 A;  4QVC A;  4M75 B;  4C92 D;  1WI7 A;  5CAI A;  3CXC P;  3CPW P;  3OB9 A;  1K8A C;  1VQ9 Q;  3G1J A;  4LN2 A;  5CKH A;  2DRM A;  1BIB A;  2X4W A;  3HL8 A;  3G4S A;  4DBF A;  4XTW A;  2JW4 A;  1UGQ B;  2DM1 A;  1YHQ T;  4OMO A;  5L8R E;  5A0L A;  1YCS B;  1M2O A;  3CCV Q;  2FVU A;  1E7O A;  5EC7 A;  5LJ5 d;  3CC4 T;  3LGL A;  2XMF A;  7AT1 B;  2CDT A;  2GCX A;  2DZC A;  4K11 A;  1NLO C;  2RMO A;  1FYN A;  1M2V A;  1RAF B;  5FU6 C;  2B8A A;  2AHJ B;  2J7I A;  3CCE T;  4OF1 A;  2F2V A;  2XIC A;  1KD1 U;  2HBP A;  2DJQ A;  1Q7Y R;  3TCJ A;  5D7U A;  4AFZ C;  3UA6 A;  1AWO A;  2EGA A;  5CQX A;  5GAN 3;  1VQ7 Q;  3JB9 F;  5FU6 B;  3PGG A;  2H8H A;  2K5L A;  2M0Y A;  1TUC A;  2CH4 W;  2VXF A;  1YIJ A;  2A28 A;  4M77 A;  3M57 A;  1V76 A;  4EPC A;  1VYT A;  2L0A A;  5GAO n;  2KRO A;  4RTT A;  5CKF A;  1FMK A;  4C0Z A;  3G71 A;  1QCO A;  3S3N A;  9ATC B;  4A4E A;  3SD4 A;  5GAN 7;  1Q81 C;  1XTD A;  3MP1 A;  2ATC B;  1C6V X;  2JT4 A;  1D0Y A;  2Y4X A;  1QKW A;  2OAW A;  1H8K A;  4MDW A;  3HTR A;  1A0N B;  4PFO A;  3HFN A;  1ACM B;  2RQU A;  2LJ1 A;  5GAO l;  2M51 A;  1B7T A;  2J05 A;  4M77 F;  3V7C A;  5KYW A;  1GL5 A;  2RNA A;  1K73 C;  1IRX A;  2X35 A;  4HT9 A;  4BD3 A;  3I56 A;  1Y7X A;  1B34 B;  1KSW A;  1UHF A;  4X9C A;  2RHZ A;  1BKB A;  3CXC S;  3CPW S;  4OMF B;  5GAN h;  5J26 A;  2J6O A;  4NL2 A;  4IUR A;  1N27 A;  5IHN A;  4C5G A;  4OML A;  4TVR A;  5KYN A;  1BCM A;  5CKB A;  1VQ5 Q;  2PTK A;  2VV5 A;  1SG5 A;  2LNH B;  5LJ5 e;  3OYL A;  1OZ2 A;  1WX6 A;  3LH5 A;  1GBQ A;  1R0C B;  4E7Z A;  2LQK A;  4MZT A;  2RJE A;  5FW9 A;  2EGE A;  3PMI A;  3M0R A;  3A1P A;  2CT4 A;  4JLG A;  2AZS A;  2NUT A;  3UDC A;  1M90 R;  5GAM h;  3JCM P;  2E6N A;  4Y92 A;  2QA4 A;  3LX7 A;  2PNI A;  4KGZ B;  2OX7 A;  1JEG A;  2VGN A;  3LW5 E;  4QVD A;  2RPN A;  3NMZ C;  4M77 E;  1SHG A;  2RN8 A;  3QG1 A;  2QI2 A;  1R8O B;  3CCR Q;  1GXI E;  2I0N A;  1UJY A;  4J6X A;  1W4S A;  2QGG A;  1VQ9 T;  5CK9 A;  4LDV A;  4KBM B;  3BFM A;  3MO8 A;  3VYH B;  1DJ7 B;  2O31 A;  3UAT A;  4ZN1 A;  4KUL A;  2CUB A;  3HRT A;  1M3B A;  1UB4 A;  3N5B B;  3NTI A;  3CCV T;  2ZCF B;  1QVG S;  3A98 A;  2EKH A;  3OBY A;  1VA7 A;  3CME A;  3MJX A;  3OYY A;  2E5Q A;  1NBE B;  2P0K A;  2DIQ A;  2W10 A;  3I35 A;  3WVE B;  4JDS A;  3OYK A;  1VQ4 Q;  2A08 A;  5CR2 A;  4PK4 A;  1VYV A;  1IZ6 A;  1I8F A;  2AKL A;  3GNF B;  1YBY A;  4KT0 E;  4FT4 A;  4E6R A;  2LQW A;  1PC0 A;  3M53 A;  2OI3 A;  3J80 E;  1YI2 A;  2C0I A;  2YLC A;  3ZL7 C;  3OS5 A;  3MP8 A;  1YJW Q;  4C8Q E;  3RDV A;  4C5I A;  2X3X D;  1WQ7 A;  1T0H A;  2KMT A;  1MMA A;  4M7A A;  4J9D A;  1NPP A;  3CBP A;  5IH2 A;  2DAQ A;  2RQV A;  4XU1 A;  1Y57 A;  1CKB A;  4LXC A;  4M75 D;  5D6W A;  4E7K A;  1Q82 C;  2LRQ A;  4HKE A;  1OU8 A;  1D3B A;  1M5Q 1;  3REA B;  2DL4 A;  3TSW A;  2K9G A;  2EYW A;  1LVK A;  3RBB B;  2DYB A;  4C92 B;  1UEB A;  3EGU A;  1I07 A;  2RQT A;  2FO0 A;  1N9R A;  1ZUY A;  5CO7 A;  4ZTJ A;  2DKG A;  2QG9 B;  5IXB A;  2NLU A;  4PJN A;  2CP5 A;  2QQR A;  2J6F A;  4M7A F;  2DXT A;  4XAX B;  3CCQ Q;  5GAN 5;  3C4S A;  2RF0 A;  1X43 A;  3QWY A;  3VS0 A;  1T0J A;  2EAY A;  3VUZ A;  2L3R A;  3CPF A;  3NFC A;  2DZ9 A;  3R6N A;  2XD0 A;  4RMO A;  2CUD A;  3JB9 G;  1M1K R;  3L2R A;  2H3E B;  3EGX A;  2IG0 A;  2IIM A;  1T3L A;  2OTJ A;  1F1B B;  5KYU B;  4L59 A;  2KYM A;  4N0A A;  2XDP A;  2JTF A;  1FMV A;  3J7A F;  3RIR A;  2MCN A;  2YUO A;  2V26 A;  4DQ2 A;  4BE0 A;  1Z9Q A;  4UC4 A;  4QW2 A;  1BI1 A;  3CCR T;  3F70 A;  4ESR A;  2X51 A;  2E5K A;  1GCP A;  2BKD N;  3S3M A;  2GTJ A;  4HVV A;  2ED0 A;  1YIT A;  1WZO A;  2HNI A;  1SKU B;  4M7D B;  2P0Q A;  2L2P A;  2FEI A;  4M78 B;  4RKU E;  1NE8 A;  1G5V A;  2QK0 A;  2HZY A;  4QQD A;  1LPL A;  2W0Z A;  3SWN B;  2RI3 A;  2D0Q B;  4FYX B;  3A5Z B;  4M77 G;  4M7A E;  1YFN A;  2DIG A;  2QQ9 A;  3PMT A;  3KBG A;  1IHV A;  1SSF A;  1PM3 A;  5GAO q;  2OTL A;  2DEU A;  5LJ3 j;  1VQ4 T;  2M9U A;  1UGV A;  3KUF A;  4EIK A;  4EMG A;  3CCU Q;  2KXD A;  2LNV A;  3NTK A;  4KGV B;  1HD3 A;  1TG0 A;  3CBO A;  3ULR B;  2EJ9 A;  3G6E Q;  1I81 A;  3L42 A;  1QKX A;  2RJF A;  4E7L A;  2ESW A;  1Q95 G;  2DTO A;  1VQ8 A;  3AHU A;  2D8H A;  1KQ2 A;  1N5Z A;  2C0T A;  1OZ3 A;  3H6Z A;  2QEX Q;  2V1Q A;  3G7Z A;  1YJW T;  2YWW A;  1JJ2 P;  4IUU A;  2WSF E;  3OQ5 A;  3GBQ A;  4J9H A;  2FZK B;  3PIP A;  1N8R R;  3VYG A;  5FU7 B;  2A7Y A;  1ZUU A;  2M02 A;  3HPW A;  2KVQ G;  3C94 A;  4CC4 B;  2DD4 A;  4Z02 A;  1KD1 C;  3JCM X;  4IUQ A;  1EIF A;  3QYG B;  1VQL Q;  4LDX A;  1UHC A;  4E7J A;  2SRC A;  1KIK A;  4PJM A;  1VQM Q;  1ABO A;  1ZX6 A;  1NYF A;  3RMS A;  2HQH A;  3GOX A;  2D8J A;  3A8O B;  3V8J A;  1NJI U;  1K4U S;  2O4X A;  5GAM f;  1I1J A;  4JRQ A;  2EFI A;  2JVV A;  1UGS B;  1U3O A;  4BI8 B;  1LJO A;  1SF9 A;  1KC8 R;  2DJZ A;  3CCQ T;  4XU0 A;  2DA9 A;  2QDL A;  5GAN 4;  1BB9 A;  2DL8 A;  3E2U A;  2SEM A;  4JLI A;  2EBP A;  2E3H A;  4A54 A;  2K3X A;  2HSE B;  4BE2 A;  2EJG A;  3JCM f;  1G83 A;  1I5O B;  1U5S A;  4PJO B;  2LC4 A;  1JU5 C;  3QUI A;  3QXE B;  5FRO A;  1WJS A;  2K2V A;  2G6F X;  4FIB A;  3M55 A;  1TXQ A;  2B86 A;  1Q81 R;  2QQS A;  4ZGJ B;  3OSS C;  4GLK A;  1CKA A;  4D8K A;  1KG1 A;  3G4S Q;  3JCM g;  3CCS A;  3M4G A;  4A63 B;  3CQT A;  2MYS A;  2FPE A;  3JCM V;  2E6Z A;  1IXD A;  4WF2 A;  3CC7 T;  2KRM A;  1MMD A;  3A8M B;  1WFW A;  2HL3 A;  2LJ0 A;  3OY9 A;  1JJ2 S;  3MEA A;  1K73 R;  1ZSZ C;  3OW2 P;  3VS6 A;  1N6A A;  2BUD A;  2L89 A;  3EGD B;  4M75 C;  4L6V 5;  4F16 A;  3SHW A;  1M3A A;  4CC2 A;  1BYM A;  2RHU A;  2DL7 A;  3TQ7 P;  1H92 A;  1YIJ Q;  2RI2 A;  3QKJ A;  5FRM A;  2KXC A;  2DEQ A;  3H0H A;  3FJP A;  3FC3 A;  4EMK A;  2V8K A;  3CCU T;  3G71 Q;  1RL2 A;  1VOM A;  4R55 A;  1VIE A;  2VGM A;  2QGF B;  4BE1 A;  4M7A G;  2R5M A;  3AT1 B;  1RLQ C;  3EG3 A;  4M75 A;  4XTZ A;  2VC8 A;  3PE0 A;  3G6E T;  3M0Q A;  1W1F A;  3V7R A;  1Y71 A;  1RUW A;  1XQH A;  3QDR B;  2DRK A;  2QAS A;  2DLP A;  3QSU A;  3X26 B;  1RI0 A;  2QEX T;  3RR6 A;  1ZBX A;  5CKD A;  2DTH A;  1WHJ A;  5GMK h;  2EGC A;  4HCC A;  3OYI A;  1RLP C;  4PJL A;  1M3C A;  2EYZ A;  4HCB A;  5KCH A;  3OS2 A;  3MEW A;  1IGQ A;  2YSQ A;  3HRS A;  3I56 Q;  1RAG B;  3E9G A;  2D6F A;  1Q86 U;  4DBQ A;  1MMN A;  3GP8 A;  3CCL T;  2ZPI B;  1HYO A;  1VYU A;  3M0T A;  3JAM E;  1S72 A;  4M7D D;  3VRZ A;  4M77 B;  4BY6 B;  1ZBJ A;  1VQO T;  1VQM T;  4M78 D;  3OSV A;  1M1F A;  3H8Z A;  5IHI A;  2GBQ A;  4OB0 B;  2RJD A;  1NG2 A;  1SPK A;  2DXC A;  2QYZ A;  3A8L B;  2K5F A;  2VXE A;  3OYH A;  5HCK A;  4J8O A;  4XTV A;  3NPF A;  2NUP A;  3OW2 S;  2ED1 A;  5KYY B;  2D9T A;  2XK0 A;  1G3T A;  5LJ5 h;  4CC7 A;  2QA4 Q;  2ZZD A;  4RG2 A;  1FMW A;  5LJ3 f;  5HK3 A;  3MHX A;  3EFS A;  4LD9 K;  2RO0 A;  5GAM d;  1KFZ A;  1BCO A;  3C0C A;  3CC2 T;  5LJ3 g;  3JCM W;  3RER A;  2MMP A;  2KDS A;  4IUP A;  1XNI A;  3OBW A;  4XU2 A;  4F7U B;  2LT4 A;  1AWX A;  2MPX C;  4JJD A;  1B34 A;  1KQ1 A;  3EG1 A;  3G4S T;  3H0I A;  1X75 C;  1M9S A;  1QCN A;  1RAC B;  3VS1 A;  4PJJ A;  3ZBD A;  3LH0 A;  1U8R A;  3RES A;  4OB3 B;  2KGT A;  3JSC A;  4ZTF A;  2CS7 A;  3JCM d;  1GCQ C;  4A4G A;  2FZG B;  2KR3 A;  1EFN A;  4AMC A;  3CME Q;  1Q82 R;  2XHC A;  4PLI A;  4ZN3 A;  2HKN A;  4JPB W;  4C8Q B;  2K5I A;  2GNC A;  1PG5 B;  2FPF A;  2DER A;  1WLP B;  1WNL A;  2NUT B;  2K7A A;  1W2B P;  4JJC A;  2ZAE A;  1Y96 A;  3M0P A;  5GAN j;  1AT1 B;  4M4Z A;  1MHN A;  2K3B A;  2EW3 A;  3TSZ A;  3TVT A;  2BZ8 A;  1YI2 Q;  1YIJ T;  3HHT B;  4NOY A;  4AFU C;  2RHI A;  3JB9 J;  5IN1 A;  3G71 T;  4P5N A;  3KXT A;  1JXO A;  1YJ9 A;  1N8R U;  4ATO A;  3M0U A;  2E3I A;  1VIF A;  1FX7 A;  2KRS A;  1OYX A;  5A2Q E;  1NZ9 A;  2R58 A;  1JRI A;  2KYB A;  2CP3 A;  5GAM j;  1JJ2 A;  1V29 B;  1RAD B;  2O88 A;  2VKN A;  2FL7 A;  4D8D A;  3FLG A;  2MOX A;  3OMC A;  2LX7 A;  2XI9 A;  1VQN A;  5GAM e;  4PNO A;  4PJO D;  4J5Y A;  1UFF A;  2RQR A;  2CP0 A;  3MKD A;  2LZ6 B;  4KGX B;  1AHJ B;  2DVE A;  3DB3 A;  4LNP A;  1VQ7 T;  3I56 T;  2LT1 A;  2KAF A;  2PZ1 A;  4X34 A;  1WIE A;  4OGE A;  5I2M A;  3EG0 A;  4F17 A;  3A8G B;  4J9G A;  4IIM A;  3JCM e;  4LUE A;  2A36 A;  1OU9 A;  4HCZ A;  1KC8 U;  2ROL A;  1OOT A;  2VUB A;  3MET A;  3C12 A;  1R77 A;  1BU1 A;  3D7S B;  3I5R A;  1SRL A;  2KK4 A;  2EJF A;  2CZ0 B;  2F2X A;  2JS2 A;  1K9M U;  2C06 A;  2CZ1 B;  2QAZ A;  3RMQ A;  1BI2 A;  2A3L A;  2QTV A;  3JB9 I;  4Y91 A;  2HEQ A;  2LQN A;  2OTJ Q;  2QA4 T;  1NPR A;  4J9C A;  3GNG A;  3DLL A;  1PWT A;  2E65 A;  2AK5 A;  2GFU A;  2X9H A;  3EH2 A;  4C92 C;  1IHW A;  2AZV A;  5C6S A;  3CCJ A;  4LDU A;  3GLX A;  2BZX A;  2V8I A;  3X20 B;  4QVZ A;  2YLB A;  4RCB A;  1VQP A;  2XDB A;  2KT1 A;  2JOY A;  2XU8 A;  3JB9 D;  1YIT Q;  3EFO B;  3NHN A;  1VQ6 A;  5LJ3 d;  1HK9 A;  4FYY B;  4FL6 A;  2X4X A;  3HP9 A;  1NJI C;  1VQ5 T;  1PRL C;  1WGS A;  4C92 A;  2MWP A;  1WYX A;  1D0Z A;  2D0N A;  3OA6 A;  4MZP A;  2DIL A;  4RTY A;  3OW2 A;  3CME T;  2KQW A;  1IGU A;  3X28 B;  2OTL Q;  4M75 G;  4DEX A;  2HKQ B;  5J3B A;  2DYI A;  1VUB A;  4KUI A;  2MWO A;  2KRN A;  4RUG A;  4MDX A;  4O5V A;  5DY9 A;  1OV3 A;  2HBW A;  1YCY A;  1VQK A;  1WXB A;  1D1B A;  4LUD A;  5GMK m;  1E6H A;  4M77 D;  5L23 A;  1YJN A;  5IAY A;  1PNJ A;  4GBQ A;  4M7D C;  5KYU A;  1B07 A;  4M78 C;  4IIO A;  1YI2 T;  4C92 F;  3S3O A;  2P84 A;  2LMJ A;  5CCA A;  4DOV A;  1VQ8 Q;  3SWN C;  1WHG A;  1X2Q A;  2FHD A;  1PD0 A;  2P0P A;  2VAS A;  1WHK A;  1QP3 A;  3VS2 A;  1Q7Y U;  2MK5 A;  4OMQ A;  4M7D A;  3JV3 A;  2P4R A;  1EX4 A;  3UWN A;  3ASK A;  2XG8 D;  4M78 A;  1TSF A;  4MZM A;  4IUT A;  4XTX A;  1RI9 A;  3CD6 A;  1X6G A;  3QHS A;  3T9N A;  2H3J A;  5IT9 E;  3L2Z A;  1QMC A;  2YT6 A;  2RI5 A;  3OS0 A;  1QVF P;  3I55 A;  4OMP A;  1TH7 A;  1UEC A;  5CIU A;  4ZGE B;  3FJ5 A;  3CCM A;  1YN8 A;  1UJ0 A;  1I4K 1;  2RH2 A;  5LJ3 e;  2CZ6 B;  2IPO B;  2MAM A;  5GJV B;  1BK2 A;  1TU0 B;  1UDL A;  4XTU A;  1XJW B;  2CRE A;  4OMN A;  5IXF A;  5I21 A;  1WJQ A;  4C92 E;  4J83 A;  3I9Q A;  1RAE B;  4M7D F;  2VWF A;  2WSE E;  3I5S A;  5KYX B;  2CP6 A;  2EYQ A;  4XQ3 A;  4M78 F;  5FU7 C;  1JXM A;  3M0S A;  2JS0 A;  3DKM A;  3JRZ A;  4C8Q D;  3JCM Q;  2PQW A;  4FSS A;  3L2Q A;  1M8V A;  2J6K A;  4ME7 A;  4C5H A;  3CC7 A;  2COY A;  4B6M A;  3H9N A;  1J3T A;  3CMA A;  1K8A R;  2JM8 A;  2JTM A;  2K4Y A;  3V8L A;  5GAN f;  1R0B G;  2OTJ T;  4JRI A;  1QWE A;  4Z8A A;  3EAE A;  2L5Q A;  1SEM A;  3P8D A;  2VVK A;  1TUG B;  1Q86 C;  4CI0 C;  1WHL A;  2F5T X;  4BAC A;  2DXB A;  4FYW B;  1WQW A;  4AFQ C;  2M0O A;  1G3S A;  2CH4 A;  5GAN g;  3CCS Q;  4A4H A;  4EMH A;  2A37 A;  1YWP A;  2DMO A;  3M54 A;  1OPK A;  2HMA A;  4QKU A;  2NYS A;  2CGH A;  3FB9 A;  3HFO A;  2ECZ A;  3LWI A;  1YIT T;  3EHQ A;  1M90 U;  3OYN A;  3JCM b; 
#chains in the Genus database with same CATH homology
 1IGQ A;  1IGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...