1IGUA

C-terminal domain of the transcriptional repressor protein korb
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
DPDKLKKAIVQVEHDERPARLILNRRPPAEGYAWLKYEDDGQEFEANLADVKLVALIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcriptional repressor protein KorB
publication title An Src homology 3-like domain is responsible for dimerization of the repressor protein KorB encoded by the promiscuous IncP plasmid RP4.
pubmed doi rcsb
source organism Escherichia coli
total genus 9
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06613 KorB_C KorB C-terminal beta-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.150 Mainly Beta Roll SH3 type barrels. KorB, C-terminal domain 1iguA00
1IGQA 1IGUA
chains in the Genus database with same CATH superfamily
1VQ8A 3CCVQ 3M0RA 3ULRB 5GAMj 1V1CA 2FRWA 4M78F 1JJ2S 3NPFA 1D09B 4KUIA 1Q86C 3H0HA 4E7ZA 3EG0A 4OP0A 1AD5A 2E65A 1D0YA 4BI3A 1Q86R 3MP1A 1VQ6Q 2VKNA 2CP5A 2YDLA 1RAGB 3FEOA 1S72A 2CT4A 1WJQA 2EQJA 4XTWA 1M8VA 4F7UE 3O8VA 4BD3A 2DX1A 3M59A 3NFCA 3G71Q 3JB9J 5HCKA 3EGDA 3FIFA 3CCQT 1SSFA 1SKUB 1OX8A 2E64A 2FZCB 3JCMh 1SF9A 2EQUA 2L0AA 3DB3A 3JCMf 2NUPB 4JRPA 1B7TA 2CSIA 1IGUA 4XTUA 4M4ZA 3OBYA 1UECA 4C5HA 4OMQA 1KQ2A 3LH5A 2MF2A 5IAYA 2KGTA 1S1NA 1RI9A 2EGCA 1TUCA 2ROTA 3EG9B 2O9SA 1X2QA 4JLIA 4C92C 2B86A 4ORZA 4PJNA 2X35A 4AG1C 1YNZA 4HT8A 1QW1A 3SWNB 1KHIA 4DBFA 4ME7A 3CD6T 3CC7T 2E3IA 4RTTA 5KYYB 1XQHA 3VJPA 2HL5C 2RHYA 2F2WA 4F7UB 1NLPC 1BI1A 2KK4A 2MI6A 4M7DC 5HKCA 2DF6A 3VRZA 1VQKA 4RTZA 1TTHB 1JEGA 3JCMV 2QQRA 2NLUA 2DZ9A 3L2QA 1PG5B 4HCKA 1YJWT 3ZL7C 4L59A 2MIOA 1B34A 1OZ2A 2DL5A 2OX7A 4IUPA 2YUPA 2JMCA 3M58A 4FT2A 2P4RA 2RI2A 2RJFA 4LDUA 4M77G 2FHDA 4PJOG 3ER0A 1MHNA 2J06A 3EFRA 3X20B 3I56T 1AZGB 2LJ1A 3H41A 5D7UA 5KE3A 1YJNT 2RK1A 3M0SA 1MMGA 1RUWA 3RESA 3I5RA 2OTLT 1JRIA 3FLGA 3I55A 1RAAB 4WF2A 5LJ3e 3RMSA 3CPWA 1FX7A 4M78D 2X4WA 5LL6S 3VS5A 1W2BS 2JOYA 2LJ0A 2KAFA 3RR6A 1MMDA 3RBBB 1UHFA 3REBB 5GAN8 3FJ5A 1M8MA 2KE9A 2H3JA 1QVGS 3CCUA 5GMKh 2LCLA 2PVDB 1I5OB 1C0MA 1VQ7A 3CCQQ 3QUIA 1FMKA 5GMKi 2VXEA 4MMLA 4F7UG 2KRSA 4Z88A 5LJ5e 4Z8AA 4UC4A 1VQMT 2QXFA 1M2VB 1IHVA 2K2VA 5DM7R 2F69A 5LJ3j 1GFDA 2AKLA 1D0ZA 2O4XA 4C92F 1W6XA 4MDWA 2LRQA 1M1KC 2AHJB 5D6WA 1ZLMA 4J6YA 3RKXA 3Q1JA 2OAUA 2HQHA 4LNPA 5I11A 4C5IA 1YI2T 1M1KR 2VV5A 1EFNA 1N9RA 2EKHA 1QKXA 2AT1B 4J9GA 2EAYA 2KRMA 2C0TA 2CYZB 5LJ5j 5CIUA 4FSXA 2LJ3A 2RNAA 2VC8A 1AHJB 3OYCA 2EJFA 5A0GA 2X3XD 3DLLA 3CC2A 2DEUA 3CD6Q 3CC7Q 2WSCE 3PMTA 2RQUA 5GAN4 3VS0A 1ZA2B 4BY6C 3TSZA 3LWHA 1KK7A 1H8KA 2VVKA 3CMEA 1RLQC 3I5SA 4MZPA 2RHZA 2X4XA 3OYMA 1YITT 2DD4A 4A4HA 3OB9A 3CXCS 3CEYA 1ZSZA 4J9IA 1YHQT 2O88A 5GAMh 4L6V5 3M5AA 4M77F 2K5IA 1YJWQ 3TREA 3N5BB 1TG0A 4C0ZA 1WIEA 1Z9QA 5GAMf 2FZGB 2DFUA 4M7AC 2GTJA 5CK9A 4M75E 4RKUE 3OY9A 3R6NA 3M0PA 5FU6C 3SEMA 4L5GA 4EMGA 2O2OA 2JT4A 4C8QB 3I56Q 3F70A 3DKMA 1M1GA 1P92A 3L42A 4OMFB 1YJNQ 1HSQA 2D8HA 2RI5A 3M0TA 4XTXA 1OZ3A 4JRKA 2OTLQ 2LCSA 1KQSA 2J05A 4RTYA 3SB2A 1MUZA 3LW5E 4CC2A 4KULA 1H3HA 4AG2C 3HRSA 4AMCA 4R55A 3EFOA 2LDMA 3QYHB 3GNGA 4R0KA 3C0CA 2XG8D 3JCMd 2FYKA 2FPFA 1UUEA 4RTWA 3M56A 1VQMQ 3E1SA 1AT1B 3UWNA 3OS1A 2Z0WA 1QVFS 1R8OB 1PRLC 3TQ7P 2MWPA 3EH2A 3VV0A 4MZTA 4PFOA 5GAN7 1BU1A 5IXFA 1B07A 3PVQA 1U5SA 2RJEA 2HBPA 1Z9ZA 2JM9A 3FRNA 4OB1B 2DRMA 2K5FA 2QA4A 4LN2A 1WQWA 1WHJA 3OYKA 1YI2Q 1X6BA 2EYWA 1KQSP 4C92D 3CCLT 2IVWA 2P0QA 3QXEB 1I4K1 2ED0A 4WCIA 4E7HA 1PHTA 2E6ZA 3EG3A 1YWPA 3SD4A 3OYBA 2V26A 2X51A 3MCAB 3CCJA 1K8AR 3CCST 2DE0X 5CKBA 1PSEA 3QDRB 3TEEA 2L3PA 2ZCFB 2BZXA 3JCMb 2P84A 4FU6A 2D0NA 3CC4T 1TS9A 2ENMA 3QG1A 1R0BG 2E70A 2L3SA 2Y90A 1QQJA 1XOVA 2R58A 2EBPA 1YITQ 4E7KA 3JB9H 3CBMA 2A3LA 4LUEA 4KGZB 2DYIA 2E10A 4BE1A 3C94A 3VS3A 2OJ2A 2XHCA 3OSVA 2R5MA 4FCYA 1YHQQ 1NM7A 5GAOm 3JB9F 3GOXA 1G8XA 3CCMA 3HP9A 1WI7A 1K4US 2A36A 4JJDA 2RN8A 1QP2A 4J6WA 2GFAA 1FXXA 4N0AC 3OYDA 4AFUC 4NL2A 1IZ6A 2EW3A 5KYNA 4M77D 3GF5A 2X3WD 1TUGB 1VQ8T 1Q81C 2QQAA 2HD0A 4M75G 4OVAA 3CCRA 3QO3A 2OTJA 1K9AA 2ZGWA 2DLPA 3T9NA 5KYXA 1Q81R 3EGXA 2HKQB 4JLGA 2E6NA 2K5LA 1EX4A 1D1AA 3ASKA 2BKDN 4M78C 5J26A 5GAN2 1ABQA 4J9EA 2FPDA 2QTVA 1M1KU 5I21A 1VQ9A 1PWTA 3X26B 3ZEHA 2EQIA 2CP6A 3UT1A 2KXDA 3MHXA 3QIIA 4JDSA 1JQQA 2M0YA 1NJIU 2QGFB 2MYSA 1T0JA 3INZA 1UGRB 1XNIA 1K73U 1Y96A 1LCKA 1OOTA 2LCCA 4NL3A 2LQWA 3HSBA 3RNJA 2V8KA 2J7IA 5FRNA 4JPBW 2L89A 3GNFB 1WQ7A 2DTHA 2OAWA 1BK2A 4OMNA 1WPYA 4DQ2A 3G6ET 1W1FA 2DJQA 2EFIA 2VYTA 4X1VA 2G3RA 4RG8A 3JCMP 1Q95G 2AZVA 4NS5A 1RAFB 4EMKC 1GRIA 4Y91A 2KMTA 4RTVA 4C5EA 5LJ3g 1OX9A 2JTEA 5GAN6 3CCLQ 1NYFA 1OV3A 3UA7A 1U8RA 1VIEA 4TVRA 4QKUA 2QEXA 1ZBXA 2YT6A 1QWFA 4YTLA 3CCSQ 1WZOA 1X75C 2BZYA 1Q7YC 1IREB 5FWBA 4OB0B 3UF4A 2HQEA 4ZGDB 4MZMA 4C0FA 2LVMA 2RO0A 1SG5A 2M16A 3JCMW 3CMAA 3CC4Q 4M7DE 5LJ5g 3L2ZA 3UDCA 3BY7A 2R57A 5GAMd 1PC0A 4ELZC 2K79A 1WHGA 2O31A 4AT1B 2EQKA 2JTMA 2RQTA 2K3XA 4PJOA 1UJYA 2OI3A 3GP8A 4F16A 2GQVA 2QDLA 1PM3A 1SHFA 2HZYA 1ZX6A 3E2UA 3CCVA 3JB9D 3A98A 3S3NA 1WHHA 3TVTA 2J6OA 2LTOA 1N27A 2QAZA 2LC4A 3EG9A 2MCNA 5CQXA 1VQ8Q 2KYBA 4C92B 3PMIA 1OPKA 1KHCA 4XK8E 3SWNA 3V8KA 5CO7A 1VQ6A 1M3AA 2PNIA 1EZZB 2H8HA 1BCMA 1X2KA 2EGEA 5KYYA 2YRDA 3DLMA 3WVEB 2LMJA 1VUBA 2JMAA 5IHKA 1PRMC 4QVCA 1VQOT 4OGEA 1LJOA 4F7UA 3BDLA 2F2VA 1KIKA 2EYZA 2BE9B 4M7DB 2KBTA 3G71A 1G3YA 1VIFA 4PJJA 3CPWS 1UE9A 3JCMX 1K0XA 1K8AU 2FPEA 2E5KA 4JUVA 4J7IA 2VUBA 1MMAA 2NUTB 1M2OA 2QYZA 1W4SA 1A0NB 4E47A 3OW2A 1OU9A 1VQ7T 1VQLA 5CKHA 1WHMA 5A2QE 1TUDA 2BIVA 1D3BB 1VQPT 2V8JA 3SHWA 3LLRA 2HL3A 1GBRA 5CVIA 3L2VA 1SEMA 4BUGA 3G6EQ 1WXUA 4J9DA 1M5Q1 1XJWB 3MEVA 3HFOA 1G3WA 2YRVA 2KT8A 1X6OA 4XTZA 1KC8U 1WJRA 1GCQA 4A4KA 5HK0A 2A08A 4IUQA 3MPUB 5CAIA 2KNBB 2E12A 1RLPC 1W70A 2CZ1B 2CSQA 3NMZC 2HBWA 3RKWA 2JNGA 1YJ9T 3X28B 3C95A 2PQWA 2O01E 3CC2T 3OW2P 5IH2A 4AFQC 5KCOA 4GLKA 4PFZA 1AZEA 4A63B 1IRXA 2LQ8A 3DB4A 4Z02A 1B3QA 3OYEA 1M9SA 3CMET 4FSSA 1Q81U 2EYQA 2CZ0B 2QQ9A 3PE0A 5KH6A 5CKDA 4ZGJB 2LNHB 2D6FA 2I2LA 1UGPB 1I0CA 2K9GA 5KE2A 3URGA 1YCYA 4V2SA 3G4ST 3NGPA 4BI8B 1WDXA 1G83A 4ANJA 4F17A 1IHWA 4XU0A 3QWXX 4OF1A 4DEXA 4XTYA 2LX7A 2R5AA 3L2UA 1ARKA 4M77C 2RJCA 4PJOC 3CPFA 2L5QA 2DL8A 4RMOA 1K1ZA 5GMKm 4OB2B 3L1AA 4FYVB 2IG0A 4HT9A 4BY6B 1QKWA 1PKSA 2DEQA 2XU8A 2DTIA 1YWOA 2D9TA 1VQOQ 4ATOA 5GANg 2EJGA 2K3YA 4OMOA 4WTOB 4K11A 3GLXA 2RB6A 2CT3A 4Y92A 3HL8A 2JTFA 1UGVA 3A1PA 5C0MA 4GY5A 1VQ7Q 2LP5A 1D0XA 1NYGA 3OS0A 1BYMA 1JJ2P 1ACMB 1VQPQ 3V7CA 4A4GA 4M7AB 2DVJA 1Y57A 1ZUUA 1VQ5T 1QMCA 3EFSA 2VB6A 5FU6B 1HXDA 1VYTA 4C8QE 1WX6A 4KT0E 4J7FA 4C8QA 1RADB 2QQSA 1BIBA 2GBQA 3HTRA 2DPPB 4E6RA 1G3SA 2L3QA 4EPCA 4DOVA 5L8RE 1O75A 4ZTJA 1ZUKA 1KJWA 2CH4A 1RAEB 2HSEB 2LT1A 4FW2A 3CD6A 2M0OA 3CC7A 1YJ9Q 3PTAA 2XICA 3M54A 2ED1A 3A5ZB 1GCQC 1KD1C 3CC2Q 1OU8A 1Q86U 1YIJT 2CP2A 2K3BA 3PT9A 3S3MA 1CSKA 5IHNA 4E2FB 3CMEQ 1KD1R 2FRYA 3M0UA 4J9FA 4PJOF 4JS4A 3HHTB 4FL6A 4J83A 2E41A 4DA4A 2QG9B 4XU2A 1YJWA 1V76A 3G4SQ 3AHUA 4QVDA 2P0PA 3JB9I 1WYXA 3CCMT 1N6AA 4KH1B 2JZ2A 2LQKA 3OYYA 4M75A 3M53A 3H9NA 4RUGA 1QCFA 4B6MA 1OULA 2E5QA 3OQ5A 3QHSA 2YXYA 2GCXA 4LD9K 4PNOA 2KRNA 1I07A 1BI3A 2RK2A 3C4SA 4PL6A 1YJNA 1ZBJA 3V7SA 1KSWA 4LDWA 3FB9A 1OEBA 1W2BA 2VASA 1X6GA 2OTLA 2QGGA 4M78E 3VU3C 2ATCB 2XIDA 3BDUA 2DM1A 3OYFA 3CBOA 4F7UF 2DMOA 5D6YA 2DVEA 4CC3A 2F1LA 1QVGA 1UDLA 2DXBA 2HNIA 2KY9A 1GCPA 1PNJA 1TXQA 3E9GA 4BE0A 2CH4W 5D6XA 1VOMA 4A4EA 3JCMe 1JO8A 2AZSA 1J3TA 2DBMA 1VQMA 1SSHA 2QDYB 2RQVA 3JCMJ 3EGUA 1GFCA 1UB4A 2HKNA 1I5LA 3ME9A 4IIOA 4EDUA 1GBQA 3EG1A 1RAIB 2D8JA 4QW2A 3LGLA 1VQ5Q 4A54A 1HK9A 4KRTA 4JRIA 3M4GA 2J6KA 1YI2A 1W2BP 2FO0A 4Q5WA 5DLOA 4QQ6A 4C8QG 1VA7A 5IHIA 4JJBA 1VQ4A 4N4GA 5CR2A 4FW1A 4C0GA 4J9CA 1VYVA 5C6SA 1QVGP 1HYOA 3GBQA 5J39A 3CBPA 3P8DA 4M78B 1UFFA 2EKOA 4HXJA 1D1CA 1BBZA 1I8FA 3HPWA 4XQ3A 2FB7A 3PIOA 2KXCA 3V8LA 1K0SA 3QJYA 2PU9B 1Y07A 1PCXA 4MMKA 5ECAA 3CXCA 1NEBA 3L2RA 2SRCA 2XK0A 3NHNA 5GANe 2JJ9A 2B8AA 1YIJQ 1JB0E 1YITA 1HJDA 3OYAA 3OYJA 2DK3A 2RHXA 3J80E 2RJDA 1N8RC 4KGVB 2IPOB 4D6WA 2DO3A 2Y4XA 1VQNA 2DERA 4D8DA 1R0CB 3CCET 3OYNA 1N8RR 1OYXA 4X9DA 1SRMA 1ZSZC 2EGAA 1MMNA 4CC4B 4ZN1A 1FYNA 4PLIA 4PJMA 3CCMQ 3OS5A 4PJOD 4EMKB 2AK5A 5GANj 4AFSC 3MJXA 2CZ6B 3A8OB 4CI0C 9ATCB 1F1BB 1X27A 2V8IA 3LWIA 2JS2A 4M75C 4QQGA 1Y0MA 1NE8A 2V1RA 1M1FA 3CXCP 3FC3A 4ZGEB 4QQDA 2DA9A 5GMKe 1S72T 1WLPB 4JJCA 3U23A 1AEYA 5LJ3h 1SHGA 3RERA 4J9HA 1I81A 4J5YA 2DL3A 1D1BA 2KSSA 2L8DA 5LJ3f 2K4YA 2DXTA 2DD5A 2KT1A 3HRUA 1QVFA 4OGCA 4BACA 3EHQA 5CKFA 1WNLA 1PSFA 2RHUA 2YWWA 4XU1A 3RDVA 1VQLT 1AWWA 2ZPFB 5LJ5h 2HSPA 1T3SA 4C8QF 5GMKj 2GFUA 3MEAA 2XMFA 3M55A 2PTKA 5LJ5f 2GF7A 3VKIA 3LH0A 2M9UA 1TSFA 1U3OA 2L3RA 4C92E 4JZ3A 2Y4YA 5FU7C 3G1JA 2MAMA 3RIRA 3CCLA 4PLLA 5KYUB 1BKBA 3QJ6A 3PNWC 3JCMc 3CCSA 4RCCA 2CZ7B 3NTHA 2XD0A 1Q7YR 5GAOn 4M7DA 1Y71A 2YLBA 1QVFP 3CC4A 3EGXB 4HKEA 3J7AF 4IURA 3J81E 2ZPIB 3P8HA 2NUTA 1RL2A 4RG2A 3P8BB 5GAMe 2JW4A 3EAEA 3OMGA 3KFVA 1VQKT 3BFMA 2A28A 2C0OA 4A53A 5EC7A 4ESRA 1ZA1B 3OYIA 2NUPA 2ECZA 1AWOA 5GJVB 3OYLA 2LNVA 3CCEQ 2QK0A 3MKDA 1IGQA 4M75F 4Z89A 1QP3A 4PK4A 3LGFA 3M9QA 4M77E 2DYBA 3OA6A 2YLCA 2AKKA 2E1HA 4LD6A 5I2SA 3MO8A 2LQNA 4KBMB 1K9MC 1MNEA 3QYGB 2QTXA 3UA6A 2QASA 3I55T 3E19A 3BW1A 2CP3A 5KYWB 4B9WA 1K9MR 1MNDA 3JV3A 3H0FA 1ZQ1A 3V7RA 7AT1B 5GAOq 3OYGA 1S72Q 3H8ZA 1NPRA 1UJ0A 2JN0A 2HDAA 2GGRA 1UGSB 2FZKB 2DL7A 4J9BA 3CCUT 2YHTA 2HAXA 1SPKA 5HK3A 3SFMA 1RAHB 3PVLA 1H641 3OYHA 4HCZA 4FT4A 3S3OA 4HA8A 4N4IA 4DBHA 2K7AA 1VQLQ 1VYUA 2JUFA 2VGNA 2AIRB 4E7LA 1MGQA 1Q82C 2BUDA 1ZUYA 1ZHIA 1OQKA 2KEAA 2EWNA 2ZAEA 2EIFA 3G6EA 4M77B 3BE3A 4PJOB 1Q82R 3META 2F2XA 2RQWA 4XAXB 4C0DC 4IUVA 3RUXA 3EH1A 4E7JA 2MPXC 2ZPGB 5EG2A 5AYFA 4C8QD 1N8RU 2A0FB 4C92G 1YCSB 4KH0B 3VS1A 2FG0A 3ZBDA 2PZ1A 1U1TA 3AT1B 1UG1A 4N4HA 1QLYA 5GAN5 3JRZA 1DJ7B 2DL4A 3QSUA 4LDVA 1U1SA 3JCMg 4DEYA 4M7DG 1M2VA 1R77A 2MK5A 1KG1A 2IIMA 2HMAA 4QVZA 3EGDB 4D8KA 2A7YA 4AFZC 3JSCA 1VQKQ 3PGGA 2DRKA 3PIPA 4XU3A 1NLOC 2V1QA 4M7AE 5GANh 4M7AA 4NOYA 4FYWB 1PD1A 1JJ2A 2DILA 1FMWA 1UHCA 2YUNA 5GANf 1BB9A 2NUZA 1X01A 1NBEB 3C12A 3NTIA 2YRCA 2DZCA 4M75D 2ESWA 2FVUA 1BIAA 2BTTA 1T3LA 3H0IA 2CGHA 1KQ1A 1PD0A 4C5GA 4RTUA 2DBKA 3M57A 3I55Q 1WFWA 5LJ3d 4LDYA 2X4YA 1X43A 4O5VA 2ROLA 4HVWA 4IIMA 1M90C 3M0QA 1N5ZA 3OMCA 2CKKA 1YN8A 5AT1B 3SWNC 4JRQA 1KQSS 1VQOA 1RABB 5CQYA 3CCQA 2NWMA 1JXMA 1M90R 1YP5A 3CCUQ 3MEWA 3A8GB 5FROA 5GJWB 3RMQA 3QWYA 5LJ5d 1CKBA 1OI1A 5I2MA 2GTOA 1Q7YU 5GAOl 2JS0A 4O6JA 1Y7XA 2VXFA 2XDPA 2ZZDA 1VQPA 1G2BA 2D1XA 1K76A 2MWOA 3UATA 2DIGA 2BE7D 1G3TA 2I0NA 3V8JA 5A0LA 1B34B 2CP7A 2D0QB 2EJ9A 2CP0A 2QA4T 2KVQG 1SRLA 4HVUA 3PFSA 1BI2A 4FYYB 3WXMB 1NJIC 1T0HA 4R56A 1NZ9A 3CCJT 1TWBA 3CPWP 1VQ4T 2COWA 1K73C 2PUKB 3TCJA 2XDBA 4M7DF 1NJIR 5A0DA 2XKOC 2WSFE 5CKEA 5M9OA 1YJ9A 2W0ZA 1K73R 2RMOA 3O5ZA 1WA7A 2RM4A 3HRTA 1I1JA 8ATCB 1BCOA 3OBWA 1ABOA 2M1HA 2K6DA 5IXBA 1WHKA 5I22A 3D7SB 1K9MU 4DOWA 3QDFA 2RD1A 3VUZA 2KR3A 1M3BA 3M4YA 2CREA 1TH7A 4ZTFA 2E3HA 3MEUA 4N0AA 1VQNT 4DBRA 2DJZA 1RACB 3G4SA 4M7AG 1FWZA 2BZ8A 3A8LB 4KUDK 2VWFA 5DLQE 2O4XB 2RHIA 3I56A 4PKCC 3JAME 3GIBA 1JU5C 1MV3A 2CUDA 1M3CA 1UGQB 2MMPA 2YUOA 3JB9G 4F14A 1NEGA 4VUBA 2ZPBB 4P5NA 2ABLA 3CCRT 4M78A 2OTJT 3HKSA 1KFZA 1TU0B 1GL5A 5GAOr 4IUTA 2LX9A 4OMPA 4J8OA 4CC7A 2PVGB 1Q82U 1BI0A 8AT1B 1VQ9T 4BB7A 2C06A 2DXUA 2EYYA 5GAMg 1LOJA 1NG2A 1E7OA 4HCBA 2XI9A 4XTVA 4EIKA 2W10A 3QKJA 2EYXA 3VUBA 4OMMA 2E4HA 4BDZA 2LZ6B 4PJLA 5J3BA 1AWXA 3VS7A 2LT4A 2EQMA 1ZSZB 3VYGA 2X9HA 1UTIA 2RA2A 4ELYC 5KCHA 5IN1A 1EIFA 1N9SA 2EPDA 4BE2A 4EMKA 1VQ5A 2KDSA 4RTXA 1G5VA 4X34A 2P4TA 2QA4Q 1MV0B 2RF0A 1XTDA 4MDXA 3MP8A 1QWEA 2HEQA 5FRMA 4M75B 1C6VX 2PUOB 4C8QC 1RI0A 1K8AC 4HCCA 1WJSA 1YFNA 2KYMA 2RPNA 2QEXT 3CCJQ 5GAN3 2CS7A 1VQ4Q 1NPPA 1JBMA 1PKTA 4KGXB 4F04B 5FWCA 2H3EB 4LDXA 1H92A 2X4JA 3CMAT 2COZA 2KI7A 5IT9E 3EFOB 4M7DD 2COYA 1YIJA 2FL7A 1H3ZA 3E9FA 2P0KA 5GANd 2JM8A 1YHQA 4CRIA 4A4FA 2L2PA 4M7AF 1WXBA 1QVPA 1WGSA 3EG2A 4PFPA 1KC8C 4BDYA 2A37A 3FJPA 3QPHA 4X9CA 1M90U 1VQNQ 4B9XA 3VRYA 4Y28E 1OPLA 1KC8R 2KROA 4OB3B 3A8MB 1C1AA 1JXOA 3MP6A 5FU7B 4DBQA 3CCVT 3I9QA 2DAQA 4FM4B 3VS2A 4GLMA 2J6FA 3LYIA 2DNUA 3CQTA 2RH2A 2DTOA 2WACA 3FDRA 4JJNK 5KYUA 2MOXA 1AWJA 2SEMA 3LX7A 3CCRQ 1FMVA 2M51A 3JCMQ 2FEIA 1M4ZA 3REAB 2OTJQ 3S6WA 5FLXE 1V29B 1VQ6T 4M78G 4GBQA 2HCKA 4ZNXA 3X24B 2VGMA 1WXTA 2GNCA 3SDZA 4HVVA 4EMHA 2QQBA 3EHRA 1VQ9Q 3WVDB 4LXCA 1E6HA 1YBYA 3G71T 1WHLA 4FYXB 5CCAA 4J6XA 1UEBA 3G7ZA 3THKA 4IUUA 1AOJA 3TSWA 2ZPHB 2XDDA 5DY9A 2O9VA 4LUDA 2QI2A 1GXIE 1LVKA 3VS4A 3OW2S 1X69A 2PVOB 4E7IA 3QBYA 2CUBA 1KD1U 1AVZC 2C0IA 2YSQA 2YUQA 4C92A 3A8HB 1IO6A 2GQIA 3VS6A 1LPLA 6AT1B 1IB8A 2CDTA 2NYSA 4OMLA 3KUFA 5GAOp 5KYWA 1ZSGA 5GMKl 1IXDA 2HQXA 3IQLA 3L2WA 2F5TX 4FIBA 1U06A 3NTKA 3ZFJA 3X25B 1QCNA 3QZ5B 2QEXQ 4JS5A 2JVVA 4ZN3A 2DXCA 3KXTA 5KYXB 2M02A 3TU4K 1TOVA 2RI3A 5FW9A 1HD3A 3OSSC 1QCOA 3CMAQ 5HY6A 5L23A 1O9SA 1D3BA 2F5KA 2DKGA 1E6GA 3I35A 3OS2A 4E7SA 1M27C 2KQWA 4IKFA 2K57A 4II1A 1CKAA 3UPUA 2G6FX 1Y96B 3VYHB 2DETA 2EVRA 2ZPEB 4JZ4A 2DIQA 3H6ZA 4QT7A 4RCBA 3GPLA 3CCEA 3QZ9B 3KBGA 1M30A 4LE9A 2WSEE 4PJOE 3HFNA 2RQRA 1LNXA 4M77A 4BI4A 3R6OA 3RKYA 4M7AD 2K2MA 4C0DB 2JXBA
chains in the Genus database with same CATH topology
1IGQA 1IGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IGQ A;  1IGU A; 
#chains in the Genus database with same CATH topology
 1VQ8 A;  3CCV Q;  3M0R A;  3ULR B;  5GAM j;  1V1C A;  2FRW A;  4M78 F;  1JJ2 S;  3NPF A;  1D09 B;  4KUI A;  1Q86 C;  3H0H A;  4E7Z A;  3EG0 A;  4OP0 A;  1AD5 A;  2E65 A;  1D0Y A;  4BI3 A;  1Q86 R;  3MP1 A;  1VQ6 Q;  2VKN A;  2CP5 A;  2YDL A;  1RAG B;  3FEO A;  1S72 A;  2CT4 A;  1WJQ A;  2EQJ A;  4XTW A;  1M8V A;  4F7U E;  3O8V A;  4BD3 A;  2DX1 A;  3M59 A;  3NFC A;  3G71 Q;  3JB9 J;  5HCK A;  3EGD A;  3FIF A;  3CCQ T;  1SSF A;  1SKU B;  1OX8 A;  2E64 A;  2FZC B;  3JCM h;  1SF9 A;  2EQU A;  2L0A A;  3DB3 A;  3JCM f;  2NUP B;  4JRP A;  1B7T A;  2CSI A;  1IGU A;  4XTU A;  4M4Z A;  3OBY A;  1UEC A;  4C5H A;  4OMQ A;  1KQ2 A;  3LH5 A;  2MF2 A;  5IAY A;  2KGT A;  1S1N A;  1RI9 A;  2EGC A;  1TUC A;  2ROT A;  3EG9 B;  2O9S A;  1X2Q A;  4JLI A;  4C92 C;  2B86 A;  4ORZ A;  4PJN A;  2X35 A;  4AG1 C;  1YNZ A;  4HT8 A;  1QW1 A;  3SWN B;  1KHI A;  4DBF A;  4ME7 A;  3CD6 T;  3CC7 T;  2E3I A;  4RTT A;  5KYY B;  1XQH A;  3VJP A;  2HL5 C;  2RHY A;  2F2W A;  4F7U B;  1NLP C;  1BI1 A;  2KK4 A;  2MI6 A;  4M7D C;  5HKC A;  2DF6 A;  3VRZ A;  1VQK A;  4RTZ A;  1TTH B;  1JEG A;  3JCM V;  2QQR A;  2NLU A;  2DZ9 A;  3L2Q A;  1PG5 B;  4HCK A;  1YJW T;  3ZL7 C;  4L59 A;  2MIO A;  1B34 A;  1OZ2 A;  2DL5 A;  2OX7 A;  4IUP A;  2YUP A;  2JMC A;  3M58 A;  4FT2 A;  2P4R A;  2RI2 A;  2RJF A;  4LDU A;  4M77 G;  2FHD A;  4PJO G;  3ER0 A;  1MHN A;  2J06 A;  3EFR A;  3X20 B;  3I56 T;  1AZG B;  2LJ1 A;  3H41 A;  5D7U A;  5KE3 A;  1YJN T;  2RK1 A;  3M0S A;  1MMG A;  1RUW A;  3RES A;  3I5R A;  2OTL T;  1JRI A;  3FLG A;  3I55 A;  1RAA B;  4WF2 A;  5LJ3 e;  3RMS A;  3CPW A;  1FX7 A;  4M78 D;  2X4W A;  5LL6 S;  3VS5 A;  1W2B S;  2JOY A;  2LJ0 A;  2KAF A;  3RR6 A;  1MMD A;  3RBB B;  1UHF A;  3REB B;  5GAN 8;  3FJ5 A;  1M8M A;  2KE9 A;  2H3J A;  1QVG S;  3CCU A;  5GMK h;  2LCL A;  2PVD B;  1I5O B;  1C0M A;  1VQ7 A;  3CCQ Q;  3QUI A;  1FMK A;  5GMK i;  2VXE A;  4MML A;  4F7U G;  2KRS A;  4Z88 A;  5LJ5 e;  4Z8A A;  4UC4 A;  1VQM T;  2QXF A;  1M2V B;  1IHV A;  2K2V A;  5DM7 R;  2F69 A;  5LJ3 j;  1GFD A;  2AKL A;  1D0Z A;  2O4X A;  4C92 F;  1W6X A;  4MDW A;  2LRQ A;  1M1K C;  2AHJ B;  5D6W A;  1ZLM A;  4J6Y A;  3RKX A;  3Q1J A;  2OAU A;  2HQH A;  4LNP A;  5I11 A;  4C5I A;  1YI2 T;  1M1K R;  2VV5 A;  1EFN A;  1N9R A;  2EKH A;  1QKX A;  2AT1 B;  4J9G A;  2EAY A;  2KRM A;  2C0T A;  2CYZ B;  5LJ5 j;  5CIU A;  4FSX A;  2LJ3 A;  2RNA A;  2VC8 A;  1AHJ B;  3OYC A;  2EJF A;  5A0G A;  2X3X D;  3DLL A;  3CC2 A;  2DEU A;  3CD6 Q;  3CC7 Q;  2WSC E;  3PMT A;  2RQU A;  5GAN 4;  3VS0 A;  1ZA2 B;  4BY6 C;  3TSZ A;  3LWH A;  1KK7 A;  1H8K A;  2VVK A;  3CME A;  1RLQ C;  3I5S A;  4MZP A;  2RHZ A;  2X4X A;  3OYM A;  1YIT T;  2DD4 A;  4A4H A;  3OB9 A;  3CXC S;  3CEY A;  1ZSZ A;  4J9I A;  1YHQ T;  2O88 A;  5GAM h;  4L6V 5;  3M5A A;  4M77 F;  2K5I A;  1YJW Q;  3TRE A;  3N5B B;  1TG0 A;  4C0Z A;  1WIE A;  1Z9Q A;  5GAM f;  2FZG B;  2DFU A;  4M7A C;  2GTJ A;  5CK9 A;  4M75 E;  4RKU E;  3OY9 A;  3R6N A;  3M0P A;  5FU6 C;  3SEM A;  4L5G A;  4EMG A;  2O2O A;  2JT4 A;  4C8Q B;  3I56 Q;  3F70 A;  3DKM A;  1M1G A;  1P92 A;  3L42 A;  4OMF B;  1YJN Q;  1HSQ A;  2D8H A;  2RI5 A;  3M0T A;  4XTX A;  1OZ3 A;  4JRK A;  2OTL Q;  2LCS A;  1KQS A;  2J05 A;  4RTY A;  3SB2 A;  1MUZ A;  3LW5 E;  4CC2 A;  4KUL A;  1H3H A;  4AG2 C;  3HRS A;  4AMC A;  4R55 A;  3EFO A;  2LDM A;  3QYH B;  3GNG A;  4R0K A;  3C0C A;  2XG8 D;  3JCM d;  2FYK A;  2FPF A;  1UUE A;  4RTW A;  3M56 A;  1VQM Q;  3E1S A;  1AT1 B;  3UWN A;  3OS1 A;  2Z0W A;  1QVF S;  1R8O B;  1PRL C;  3TQ7 P;  2MWP A;  3EH2 A;  3VV0 A;  4MZT A;  4PFO A;  5GAN 7;  1BU1 A;  5IXF A;  1B07 A;  3PVQ A;  1U5S A;  2RJE A;  2HBP A;  1Z9Z A;  2JM9 A;  3FRN A;  4OB1 B;  2DRM A;  2K5F A;  2QA4 A;  4LN2 A;  1WQW A;  1WHJ A;  3OYK A;  1YI2 Q;  1X6B A;  2EYW A;  1KQS P;  4C92 D;  3CCL T;  2IVW A;  2P0Q A;  3QXE B;  1I4K 1;  2ED0 A;  4WCI A;  4E7H A;  1PHT A;  2E6Z A;  3EG3 A;  1YWP A;  3SD4 A;  3OYB A;  2V26 A;  2X51 A;  3MCA B;  3CCJ A;  1K8A R;  3CCS T;  2DE0 X;  5CKB A;  1PSE A;  3QDR B;  3TEE A;  2L3P A;  2ZCF B;  2BZX A;  3JCM b;  2P84 A;  4FU6 A;  2D0N A;  3CC4 T;  1TS9 A;  2ENM A;  3QG1 A;  1R0B G;  2E70 A;  2L3S A;  2Y90 A;  1QQJ A;  1XOV A;  2R58 A;  2EBP A;  1YIT Q;  4E7K A;  3JB9 H;  3CBM A;  2A3L A;  4LUE A;  4KGZ B;  2DYI A;  2E10 A;  4BE1 A;  3C94 A;  3VS3 A;  2OJ2 A;  2XHC A;  3OSV A;  2R5M A;  4FCY A;  1YHQ Q;  1NM7 A;  5GAO m;  3JB9 F;  3GOX A;  1G8X A;  3CCM A;  3HP9 A;  1WI7 A;  1K4U S;  2A36 A;  4JJD A;  2RN8 A;  1QP2 A;  4J6W A;  2GFA A;  1FXX A;  4N0A C;  3OYD A;  4AFU C;  4NL2 A;  1IZ6 A;  2EW3 A;  5KYN A;  4M77 D;  3GF5 A;  2X3W D;  1TUG B;  1VQ8 T;  1Q81 C;  2QQA A;  2HD0 A;  4M75 G;  4OVA A;  3CCR A;  3QO3 A;  2OTJ A;  1K9A A;  2ZGW A;  2DLP A;  3T9N A;  5KYX A;  1Q81 R;  3EGX A;  2HKQ B;  4JLG A;  2E6N A;  2K5L A;  1EX4 A;  1D1A A;  3ASK A;  2BKD N;  4M78 C;  5J26 A;  5GAN 2;  1ABQ A;  4J9E A;  2FPD A;  2QTV A;  1M1K U;  5I21 A;  1VQ9 A;  1PWT A;  3X26 B;  3ZEH A;  2EQI A;  2CP6 A;  3UT1 A;  2KXD A;  3MHX A;  3QII A;  4JDS A;  1JQQ A;  2M0Y A;  1NJI U;  2QGF B;  2MYS A;  1T0J A;  3INZ A;  1UGR B;  1XNI A;  1K73 U;  1Y96 A;  1LCK A;  1OOT A;  2LCC A;  4NL3 A;  2LQW A;  3HSB A;  3RNJ A;  2V8K A;  2J7I A;  5FRN A;  4JPB W;  2L89 A;  3GNF B;  1WQ7 A;  2DTH A;  2OAW A;  1BK2 A;  4OMN A;  1WPY A;  4DQ2 A;  3G6E T;  1W1F A;  2DJQ A;  2EFI A;  2VYT A;  4X1V A;  2G3R A;  4RG8 A;  3JCM P;  1Q95 G;  2AZV A;  4NS5 A;  1RAF B;  4EMK C;  1GRI A;  4Y91 A;  2KMT A;  4RTV A;  4C5E A;  5LJ3 g;  1OX9 A;  2JTE A;  5GAN 6;  3CCL Q;  1NYF A;  1OV3 A;  3UA7 A;  1U8R A;  1VIE A;  4TVR A;  4QKU A;  2QEX A;  1ZBX A;  2YT6 A;  1QWF A;  4YTL A;  3CCS Q;  1WZO A;  1X75 C;  2BZY A;  1Q7Y C;  1IRE B;  5FWB A;  4OB0 B;  3UF4 A;  2HQE A;  4ZGD B;  4MZM A;  4C0F A;  2LVM A;  2RO0 A;  1SG5 A;  2M16 A;  3JCM W;  3CMA A;  3CC4 Q;  4M7D E;  5LJ5 g;  3L2Z A;  3UDC A;  3BY7 A;  2R57 A;  5GAM d;  1PC0 A;  4ELZ C;  2K79 A;  1WHG A;  2O31 A;  4AT1 B;  2EQK A;  2JTM A;  2RQT A;  2K3X A;  4PJO A;  1UJY A;  2OI3 A;  3GP8 A;  4F16 A;  2GQV A;  2QDL A;  1PM3 A;  1SHF A;  2HZY A;  1ZX6 A;  3E2U A;  3CCV A;  3JB9 D;  3A98 A;  3S3N A;  1WHH A;  3TVT A;  2J6O A;  2LTO A;  1N27 A;  2QAZ A;  2LC4 A;  3EG9 A;  2MCN A;  5CQX A;  1VQ8 Q;  2KYB A;  4C92 B;  3PMI A;  1OPK A;  1KHC A;  4XK8 E;  3SWN A;  3V8K A;  5CO7 A;  1VQ6 A;  1M3A A;  2PNI A;  1EZZ B;  2H8H A;  1BCM A;  1X2K A;  2EGE A;  5KYY A;  2YRD A;  3DLM A;  3WVE B;  2LMJ A;  1VUB A;  2JMA A;  5IHK A;  1PRM C;  4QVC A;  1VQO T;  4OGE A;  1LJO A;  4F7U A;  3BDL A;  2F2V A;  1KIK A;  2EYZ A;  2BE9 B;  4M7D B;  2KBT A;  3G71 A;  1G3Y A;  1VIF A;  4PJJ A;  3CPW S;  1UE9 A;  3JCM X;  1K0X A;  1K8A U;  2FPE A;  2E5K A;  4JUV A;  4J7I A;  2VUB A;  1MMA A;  2NUT B;  1M2O A;  2QYZ A;  1W4S A;  1A0N B;  4E47 A;  3OW2 A;  1OU9 A;  1VQ7 T;  1VQL A;  5CKH A;  1WHM A;  5A2Q E;  1TUD A;  2BIV A;  1D3B B;  1VQP T;  2V8J A;  3SHW A;  3LLR A;  2HL3 A;  1GBR A;  5CVI A;  3L2V A;  1SEM A;  4BUG A;  3G6E Q;  1WXU A;  4J9D A;  1M5Q 1;  1XJW B;  3MEV A;  3HFO A;  1G3W A;  2YRV A;  2KT8 A;  1X6O A;  4XTZ A;  1KC8 U;  1WJR A;  1GCQ A;  4A4K A;  5HK0 A;  2A08 A;  4IUQ A;  3MPU B;  5CAI A;  2KNB B;  2E12 A;  1RLP C;  1W70 A;  2CZ1 B;  2CSQ A;  3NMZ C;  2HBW A;  3RKW A;  2JNG A;  1YJ9 T;  3X28 B;  3C95 A;  2PQW A;  2O01 E;  3CC2 T;  3OW2 P;  5IH2 A;  4AFQ C;  5KCO A;  4GLK A;  4PFZ A;  1AZE A;  4A63 B;  1IRX A;  2LQ8 A;  3DB4 A;  4Z02 A;  1B3Q A;  3OYE A;  1M9S A;  3CME T;  4FSS A;  1Q81 U;  2EYQ A;  2CZ0 B;  2QQ9 A;  3PE0 A;  5KH6 A;  5CKD A;  4ZGJ B;  2LNH B;  2D6F A;  2I2L A;  1UGP B;  1I0C A;  2K9G A;  5KE2 A;  3URG A;  1YCY A;  4V2S A;  3G4S T;  3NGP A;  4BI8 B;  1WDX A;  1G83 A;  4ANJ A;  4F17 A;  1IHW A;  4XU0 A;  3QWX X;  4OF1 A;  4DEX A;  4XTY A;  2LX7 A;  2R5A A;  3L2U A;  1ARK A;  4M77 C;  2RJC A;  4PJO C;  3CPF A;  2L5Q A;  2DL8 A;  4RMO A;  1K1Z A;  5GMK m;  4OB2 B;  3L1A A;  4FYV B;  2IG0 A;  4HT9 A;  4BY6 B;  1QKW A;  1PKS A;  2DEQ A;  2XU8 A;  2DTI A;  1YWO A;  2D9T A;  1VQO Q;  4ATO A;  5GAN g;  2EJG A;  2K3Y A;  4OMO A;  4WTO B;  4K11 A;  3GLX A;  2RB6 A;  2CT3 A;  4Y92 A;  3HL8 A;  2JTF A;  1UGV A;  3A1P A;  5C0M A;  4GY5 A;  1VQ7 Q;  2LP5 A;  1D0X A;  1NYG A;  3OS0 A;  1BYM A;  1JJ2 P;  1ACM B;  1VQP Q;  3V7C A;  4A4G A;  4M7A B;  2DVJ A;  1Y57 A;  1ZUU A;  1VQ5 T;  1QMC A;  3EFS A;  2VB6 A;  5FU6 B;  1HXD A;  1VYT A;  4C8Q E;  1WX6 A;  4KT0 E;  4J7F A;  4C8Q A;  1RAD B;  2QQS A;  1BIB A;  2GBQ A;  3HTR A;  2DPP B;  4E6R A;  1G3S A;  2L3Q A;  4EPC A;  4DOV A;  5L8R E;  1O75 A;  4ZTJ A;  1ZUK A;  1KJW A;  2CH4 A;  1RAE B;  2HSE B;  2LT1 A;  4FW2 A;  3CD6 A;  2M0O A;  3CC7 A;  1YJ9 Q;  3PTA A;  2XIC A;  3M54 A;  2ED1 A;  3A5Z B;  1GCQ C;  1KD1 C;  3CC2 Q;  1OU8 A;  1Q86 U;  1YIJ T;  2CP2 A;  2K3B A;  3PT9 A;  3S3M A;  1CSK A;  5IHN A;  4E2F B;  3CME Q;  1KD1 R;  2FRY A;  3M0U A;  4J9F A;  4PJO F;  4JS4 A;  3HHT B;  4FL6 A;  4J83 A;  2E41 A;  4DA4 A;  2QG9 B;  4XU2 A;  1YJW A;  1V76 A;  3G4S Q;  3AHU A;  4QVD A;  2P0P A;  3JB9 I;  1WYX A;  3CCM T;  1N6A A;  4KH1 B;  2JZ2 A;  2LQK A;  3OYY A;  4M75 A;  3M53 A;  3H9N A;  4RUG A;  1QCF A;  4B6M A;  1OUL A;  2E5Q A;  3OQ5 A;  3QHS A;  2YXY A;  2GCX A;  4LD9 K;  4PNO A;  2KRN A;  1I07 A;  1BI3 A;  2RK2 A;  3C4S A;  4PL6 A;  1YJN A;  1ZBJ A;  3V7S A;  1KSW A;  4LDW A;  3FB9 A;  1OEB A;  1W2B A;  2VAS A;  1X6G A;  2OTL A;  2QGG A;  4M78 E;  3VU3 C;  2ATC B;  2XID A;  3BDU A;  2DM1 A;  3OYF A;  3CBO A;  4F7U F;  2DMO A;  5D6Y A;  2DVE A;  4CC3 A;  2F1L A;  1QVG A;  1UDL A;  2DXB A;  2HNI A;  2KY9 A;  1GCP A;  1PNJ A;  1TXQ A;  3E9G A;  4BE0 A;  2CH4 W;  5D6X A;  1VOM A;  4A4E A;  3JCM e;  1JO8 A;  2AZS A;  1J3T A;  2DBM A;  1VQM A;  1SSH A;  2QDY B;  2RQV A;  3JCM J;  3EGU A;  1GFC A;  1UB4 A;  2HKN A;  1I5L A;  3ME9 A;  4IIO A;  4EDU A;  1GBQ A;  3EG1 A;  1RAI B;  2D8J A;  4QW2 A;  3LGL A;  1VQ5 Q;  4A54 A;  1HK9 A;  4KRT A;  4JRI A;  3M4G A;  2J6K A;  1YI2 A;  1W2B P;  2FO0 A;  4Q5W A;  5DLO A;  4QQ6 A;  4C8Q G;  1VA7 A;  5IHI A;  4JJB A;  1VQ4 A;  4N4G A;  5CR2 A;  4FW1 A;  4C0G A;  4J9C A;  1VYV A;  5C6S A;  1QVG P;  1HYO A;  3GBQ A;  5J39 A;  3CBP A;  3P8D A;  4M78 B;  1UFF A;  2EKO A;  4HXJ A;  1D1C A;  1BBZ A;  1I8F A;  3HPW A;  4XQ3 A;  2FB7 A;  3PIO A;  2KXC A;  3V8L A;  1K0S A;  3QJY A;  2PU9 B;  1Y07 A;  1PCX A;  4MMK A;  5ECA A;  3CXC A;  1NEB A;  3L2R A;  2SRC A;  2XK0 A;  3NHN A;  5GAN e;  2JJ9 A;  2B8A A;  1YIJ Q;  1JB0 E;  1YIT A;  1HJD A;  3OYA A;  3OYJ A;  2DK3 A;  2RHX A;  3J80 E;  2RJD A;  1N8R C;  4KGV B;  2IPO B;  4D6W A;  2DO3 A;  2Y4X A;  1VQN A;  2DER A;  4D8D A;  1R0C B;  3CCE T;  3OYN A;  1N8R R;  1OYX A;  4X9D A;  1SRM A;  1ZSZ C;  2EGA A;  1MMN A;  4CC4 B;  4ZN1 A;  1FYN A;  4PLI A;  4PJM A;  3CCM Q;  3OS5 A;  4PJO D;  4EMK B;  2AK5 A;  5GAN j;  4AFS C;  3MJX A;  2CZ6 B;  3A8O B;  4CI0 C;  9ATC B;  1F1B B;  1X27 A;  2V8I A;  3LWI A;  2JS2 A;  4M75 C;  4QQG A;  1Y0M A;  1NE8 A;  2V1R A;  1M1F A;  3CXC P;  3FC3 A;  4ZGE B;  4QQD A;  2DA9 A;  5GMK e;  1S72 T;  1WLP B;  4JJC A;  3U23 A;  1AEY A;  5LJ3 h;  1SHG A;  3RER A;  4J9H A;  1I81 A;  4J5Y A;  2DL3 A;  1D1B A;  2KSS A;  2L8D A;  5LJ3 f;  2K4Y A;  2DXT A;  2DD5 A;  2KT1 A;  3HRU A;  1QVF A;  4OGC A;  4BAC A;  3EHQ A;  5CKF A;  1WNL A;  1PSF A;  2RHU A;  2YWW A;  4XU1 A;  3RDV A;  1VQL T;  1AWW A;  2ZPF B;  5LJ5 h;  2HSP A;  1T3S A;  4C8Q F;  5GMK j;  2GFU A;  3MEA A;  2XMF A;  3M55 A;  2PTK A;  5LJ5 f;  2GF7 A;  3VKI A;  3LH0 A;  2M9U A;  1TSF A;  1U3O A;  2L3R A;  4C92 E;  4JZ3 A;  2Y4Y A;  5FU7 C;  3G1J A;  2MAM A;  3RIR A;  3CCL A;  4PLL A;  5KYU B;  1BKB A;  3QJ6 A;  3PNW C;  3JCM c;  3CCS A;  4RCC A;  2CZ7 B;  3NTH A;  2XD0 A;  1Q7Y R;  5GAO n;  4M7D A;  1Y71 A;  2YLB A;  1QVF P;  3CC4 A;  3EGX B;  4HKE A;  3J7A F;  4IUR A;  3J81 E;  2ZPI B;  3P8H A;  2NUT A;  1RL2 A;  4RG2 A;  3P8B B;  5GAM e;  2JW4 A;  3EAE A;  3OMG A;  3KFV A;  1VQK T;  3BFM A;  2A28 A;  2C0O A;  4A53 A;  5EC7 A;  4ESR A;  1ZA1 B;  3OYI A;  2NUP A;  2ECZ A;  1AWO A;  5GJV B;  3OYL A;  2LNV A;  3CCE Q;  2QK0 A;  3MKD A;  1IGQ A;  4M75 F;  4Z89 A;  1QP3 A;  4PK4 A;  3LGF A;  3M9Q A;  4M77 E;  2DYB A;  3OA6 A;  2YLC A;  2AKK A;  2E1H A;  4LD6 A;  5I2S A;  3MO8 A;  2LQN A;  4KBM B;  1K9M C;  1MNE A;  3QYG B;  2QTX A;  3UA6 A;  2QAS A;  3I55 T;  3E19 A;  3BW1 A;  2CP3 A;  5KYW B;  4B9W A;  1K9M R;  1MND A;  3JV3 A;  3H0F A;  1ZQ1 A;  3V7R A;  7AT1 B;  5GAO q;  3OYG A;  1S72 Q;  3H8Z A;  1NPR A;  1UJ0 A;  2JN0 A;  2HDA A;  2GGR A;  1UGS B;  2FZK B;  2DL7 A;  4J9B A;  3CCU T;  2YHT A;  2HAX A;  1SPK A;  5HK3 A;  3SFM A;  1RAH B;  3PVL A;  1H64 1;  3OYH A;  4HCZ A;  4FT4 A;  3S3O A;  4HA8 A;  4N4I A;  4DBH A;  2K7A A;  1VQL Q;  1VYU A;  2JUF A;  2VGN A;  2AIR B;  4E7L A;  1MGQ A;  1Q82 C;  2BUD A;  1ZUY A;  1ZHI A;  1OQK A;  2KEA A;  2EWN A;  2ZAE A;  2EIF A;  3G6E A;  4M77 B;  3BE3 A;  4PJO B;  1Q82 R;  3MET A;  2F2X A;  2RQW A;  4XAX B;  4C0D C;  4IUV A;  3RUX A;  3EH1 A;  4E7J A;  2MPX C;  2ZPG B;  5EG2 A;  5AYF A;  4C8Q D;  1N8R U;  2A0F B;  4C92 G;  1YCS B;  4KH0 B;  3VS1 A;  2FG0 A;  3ZBD A;  2PZ1 A;  1U1T A;  3AT1 B;  1UG1 A;  4N4H A;  1QLY A;  5GAN 5;  3JRZ A;  1DJ7 B;  2DL4 A;  3QSU A;  4LDV A;  1U1S A;  3JCM g;  4DEY A;  4M7D G;  1M2V A;  1R77 A;  2MK5 A;  1KG1 A;  2IIM A;  2HMA A;  4QVZ A;  3EGD B;  4D8K A;  2A7Y A;  4AFZ C;  3JSC A;  1VQK Q;  3PGG A;  2DRK A;  3PIP A;  4XU3 A;  1NLO C;  2V1Q A;  4M7A E;  5GAN h;  4M7A A;  4NOY A;  4FYW B;  1PD1 A;  1JJ2 A;  2DIL A;  1FMW A;  1UHC A;  2YUN A;  5GAN f;  1BB9 A;  2NUZ A;  1X01 A;  1NBE B;  3C12 A;  3NTI A;  2YRC A;  2DZC A;  4M75 D;  2ESW A;  2FVU A;  1BIA A;  2BTT A;  1T3L A;  3H0I A;  2CGH A;  1KQ1 A;  1PD0 A;  4C5G A;  4RTU A;  2DBK A;  3M57 A;  3I55 Q;  1WFW A;  5LJ3 d;  4LDY A;  2X4Y A;  1X43 A;  4O5V A;  2ROL A;  4HVW A;  4IIM A;  1M90 C;  3M0Q A;  1N5Z A;  3OMC A;  2CKK A;  1YN8 A;  5AT1 B;  3SWN C;  4JRQ A;  1KQS S;  1VQO A;  1RAB B;  5CQY A;  3CCQ A;  2NWM A;  1JXM A;  1M90 R;  1YP5 A;  3CCU Q;  3MEW A;  3A8G B;  5FRO A;  5GJW B;  3RMQ A;  3QWY A;  5LJ5 d;  1CKB A;  1OI1 A;  5I2M A;  2GTO A;  1Q7Y U;  5GAO l;  2JS0 A;  4O6J A;  1Y7X A;  2VXF A;  2XDP A;  2ZZD A;  1VQP A;  1G2B A;  2D1X A;  1K76 A;  2MWO A;  3UAT A;  2DIG A;  2BE7 D;  1G3T A;  2I0N A;  3V8J A;  5A0L A;  1B34 B;  2CP7 A;  2D0Q B;  2EJ9 A;  2CP0 A;  2QA4 T;  2KVQ G;  1SRL A;  4HVU A;  3PFS A;  1BI2 A;  4FYY B;  3WXM B;  1NJI C;  1T0H A;  4R56 A;  1NZ9 A;  3CCJ T;  1TWB A;  3CPW P;  1VQ4 T;  2COW A;  1K73 C;  2PUK B;  3TCJ A;  2XDB A;  4M7D F;  1NJI R;  5A0D A;  2XKO C;  2WSF E;  5CKE A;  5M9O A;  1YJ9 A;  2W0Z A;  1K73 R;  2RMO A;  3O5Z A;  1WA7 A;  2RM4 A;  3HRT A;  1I1J A;  8ATC B;  1BCO A;  3OBW A;  1ABO A;  2M1H A;  2K6D A;  5IXB A;  1WHK A;  5I22 A;  3D7S B;  1K9M U;  4DOW A;  3QDF A;  2RD1 A;  3VUZ A;  2KR3 A;  1M3B A;  3M4Y A;  2CRE A;  1TH7 A;  4ZTF A;  2E3H A;  3MEU A;  4N0A A;  1VQN T;  4DBR A;  2DJZ A;  1RAC B;  3G4S A;  4M7A G;  1FWZ A;  2BZ8 A;  3A8L B;  4KUD K;  2VWF A;  5DLQ E;  2O4X B;  2RHI A;  3I56 A;  4PKC C;  3JAM E;  3GIB A;  1JU5 C;  1MV3 A;  2CUD A;  1M3C A;  1UGQ B;  2MMP A;  2YUO A;  3JB9 G;  4F14 A;  1NEG A;  4VUB A;  2ZPB B;  4P5N A;  2ABL A;  3CCR T;  4M78 A;  2OTJ T;  3HKS A;  1KFZ A;  1TU0 B;  1GL5 A;  5GAO r;  4IUT A;  2LX9 A;  4OMP A;  4J8O A;  4CC7 A;  2PVG B;  1Q82 U;  1BI0 A;  8AT1 B;  1VQ9 T;  4BB7 A;  2C06 A;  2DXU A;  2EYY A;  5GAM g;  1LOJ A;  1NG2 A;  1E7O A;  4HCB A;  2XI9 A;  4XTV A;  4EIK A;  2W10 A;  3QKJ A;  2EYX A;  3VUB A;  4OMM A;  2E4H A;  4BDZ A;  2LZ6 B;  4PJL A;  5J3B A;  1AWX A;  3VS7 A;  2LT4 A;  2EQM A;  1ZSZ B;  3VYG A;  2X9H A;  1UTI A;  2RA2 A;  4ELY C;  5KCH A;  5IN1 A;  1EIF A;  1N9S A;  2EPD A;  4BE2 A;  4EMK A;  1VQ5 A;  2KDS A;  4RTX A;  1G5V A;  4X34 A;  2P4T A;  2QA4 Q;  1MV0 B;  2RF0 A;  1XTD A;  4MDX A;  3MP8 A;  1QWE A;  2HEQ A;  5FRM A;  4M75 B;  1C6V X;  2PUO B;  4C8Q C;  1RI0 A;  1K8A C;  4HCC A;  1WJS A;  1YFN A;  2KYM A;  2RPN A;  2QEX T;  3CCJ Q;  5GAN 3;  2CS7 A;  1VQ4 Q;  1NPP A;  1JBM A;  1PKT A;  4KGX B;  4F04 B;  5FWC A;  2H3E B;  4LDX A;  1H92 A;  2X4J A;  3CMA T;  2COZ A;  2KI7 A;  5IT9 E;  3EFO B;  4M7D D;  2COY A;  1YIJ A;  2FL7 A;  1H3Z A;  3E9F A;  2P0K A;  5GAN d;  2JM8 A;  1YHQ A;  4CRI A;  4A4F A;  2L2P A;  4M7A F;  1WXB A;  1QVP A;  1WGS A;  3EG2 A;  4PFP A;  1KC8 C;  4BDY A;  2A37 A;  3FJP A;  3QPH A;  4X9C A;  1M90 U;  1VQN Q;  4B9X A;  3VRY A;  4Y28 E;  1OPL A;  1KC8 R;  2KRO A;  4OB3 B;  3A8M B;  1C1A A;  1JXO A;  3MP6 A;  5FU7 B;  4DBQ A;  3CCV T;  3I9Q A;  2DAQ A;  4FM4 B;  3VS2 A;  4GLM A;  2J6F A;  3LYI A;  2DNU A;  3CQT A;  2RH2 A;  2DTO A;  2WAC A;  3FDR A;  4JJN K;  5KYU A;  2MOX A;  1AWJ A;  2SEM A;  3LX7 A;  3CCR Q;  1FMV A;  2M51 A;  3JCM Q;  2FEI A;  1M4Z A;  3REA B;  2OTJ Q;  3S6W A;  5FLX E;  1V29 B;  1VQ6 T;  4M78 G;  4GBQ A;  2HCK A;  4ZNX A;  3X24 B;  2VGM A;  1WXT A;  2GNC A;  3SDZ A;  4HVV A;  4EMH A;  2QQB A;  3EHR A;  1VQ9 Q;  3WVD B;  4LXC A;  1E6H A;  1YBY A;  3G71 T;  1WHL A;  4FYX B;  5CCA A;  4J6X A;  1UEB A;  3G7Z A;  3THK A;  4IUU A;  1AOJ A;  3TSW A;  2ZPH B;  2XDD A;  5DY9 A;  2O9V A;  4LUD A;  2QI2 A;  1GXI E;  1LVK A;  3VS4 A;  3OW2 S;  1X69 A;  2PVO B;  4E7I A;  3QBY A;  2CUB A;  1KD1 U;  1AVZ C;  2C0I A;  2YSQ A;  2YUQ A;  4C92 A;  3A8H B;  1IO6 A;  2GQI A;  3VS6 A;  1LPL A;  6AT1 B;  1IB8 A;  2CDT A;  2NYS A;  4OML A;  3KUF A;  5GAO p;  5KYW A;  1ZSG A;  5GMK l;  1IXD A;  2HQX A;  3IQL A;  3L2W A;  2F5T X;  4FIB A;  1U06 A;  3NTK A;  3ZFJ A;  3X25 B;  1QCN A;  3QZ5 B;  2QEX Q;  4JS5 A;  2JVV A;  4ZN3 A;  2DXC A;  3KXT A;  5KYX B;  2M02 A;  3TU4 K;  1TOV A;  2RI3 A;  5FW9 A;  1HD3 A;  3OSS C;  1QCO A;  3CMA Q;  5HY6 A;  5L23 A;  1O9S A;  1D3B A;  2F5K A;  2DKG A;  1E6G A;  3I35 A;  3OS2 A;  4E7S A;  1M27 C;  2KQW A;  4IKF A;  2K57 A;  4II1 A;  1CKA A;  3UPU A;  2G6F X;  1Y96 B;  3VYH B;  2DET A;  2EVR A;  2ZPE B;  4JZ4 A;  2DIQ A;  3H6Z A;  4QT7 A;  4RCB A;  3GPL A;  3CCE A;  3QZ9 B;  3KBG A;  1M30 A;  4LE9 A;  2WSE E;  4PJO E;  3HFN A;  2RQR A;  1LNX A;  4M77 A;  4BI4 A;  3R6O A;  3RKY A;  4M7A D;  2K2M A;  4C0D B;  2JXB A; 
#chains in the Genus database with same CATH homology
 1IGQ A;  1IGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...