2FB7A

Nmr solution structure of protein from zebra fish dr.13312
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
80
Chain Sequence
PYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCEPPKPIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sm-like protein, LSm-14_N (RAP55)
publication title NMR Solution Structure of protein from Zebra Fish Dr.13312
rcsb
source organism Danio rerio
molecule tags Structural genomics, unknown function
total genus 9
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fb7A00
3L2ZA 4QVCA 4EMKA 4RCCA 5DY9A 3FB9A 2E65A 4J6WA 4JLIA 3RUXA 3SWNA 5LJ3d 4C8QF 4C8QB 4PJOC 4XTUA 2JN0A 1I8FA 4XTVA 4A53A 4HA8A 5LJ5e 3QO3A 5GAMh 3AHUA 4M77F 4F7UG 4M77B 2DTHA 1M5Q1 2E41A 1MGQA 4M75G 3EFRA 3JB9F 4M7DE 4J6XA 4JRKA 4M77A 4M78E 4C92E 5GAMd 3V7RA 3JCMe 4DQ2A 4V2SA 2EJFA 1B34B 2DVEA 4M7AE 5CAIA 1D3BB 2Y90A 1B34A 1H641 2FYKA 5GAN6 1D3BA 4M7DA 2E10A 4C92A 4M78A 1KQ2A 3HFOA 5LJ3h 1HK9A 3RIRA 4EMKB 4HT8A 4C8QG 4XTXA 3SWNB 3BW1A 1WQ7A 2DZCA 4X9DA 4M78D 1Y96A 4M75C 4A54A 2EAYA 3QUIA 4C92D 5GAOl 2I2LA 1WPYA 4M7AD 4M77G 5LJ5f 4XTYA 3SB2A 5GANf 3JB9G 2YHTA 2EJ9A 5GAN3 1WNLA 5GMKl 2VXEA 1X01A 3V8KA 3SWNC 4PJOE 1BIBA 4JRIA 4OP0A 1U1SA 1N9RA 5GAMe 5LJ5g 4X9CA 3HFNA 5GANg 2ZGWA 3RKWA 2HNIA 2QTXA 2DZ9A 4C8QC 2RD1A 3JCMJ 1JRIA 2DJZA 3JB9J 5GAOr 4M7DF 4M7DB 4C92F 4M78F 3EFSA 2YLCA 4C92B 4M78B 5GAN5 4M77C 2DTOA 2CGHA 1KQ1A 4MMLA 4M7AF 4M7AB 4PJOD 3M4GA 1N9SA 1Y96B 2DEQA 2EJGA 3JCMV 3JCMc 5LJ5h 5GAMj 5GANh 5GMKh 4M7AA 1I4K1 1HXDA 3INZA 5LJ3e 1YCYA 5GAN7 4J5YA 4N0AA 4F7UE 3QHSA 5LJ5d 4XTWA 3V7CA 1LOJA 5GANd 4M75E 2VC8A 5GAN2 4EMKC 4RCBA 5GAN4 2RM4A 1LNXA 3JCMf 4WF2A 1TH7A 2E64A 3PGGA 4M7DG 4C92G 2DXTA 4M78G 4QVDA 4PJOF 5LJ3j 3RKXA 4NOYA 3JCMP 2DXUA 4M7AG 1I81A 3JCMX 4M75D 3FJPA 3JCMg 4C8QE 4PJOA 2YLBA 1WQWA 1LJOA 4NL2A 5GMKi 3RESA 4J6YA 3QSUA 2VXFA 4NL3A 3BDUA 3JCMb 4M77E 5LJ3f 5I21A 3JCMW 2E1HA 2DTIA 5GAOm 4HT9A 4PNOA 3RKYA 4XU1A 3BY7A 4XU3A 5GAOq 3BFMA 4C8QA 3RERA 5GANe 4M7DC 3JB9I 3V8LA 4M78C 4C92C 5GMKe 3L1AA 4EMGA 4XQ3A 4Y91A 5GAOp 3JCMh 5LJ3g 4C8QD 3JCMQ 4M7DD 4M7AC 4XTZA 2EWNA 3FIFA 4JUVA 3V7SA 4F7UF 5GAMf 4F7UB 5GMKm 1U1TA 2K57A 2RA2A 4M75F 4MMKA 4N0AC 4PJOG 4M75B 1JBMA 4M77D 3JCMd 5GAOn 4F7UA 4XU2A 3VU3C 3JB9H 3JB9D 2DKGA 2RB6A 1BIAA 4M75A 4PJOB 5GAMg 5LJ5j 3GIBA 5GANj 2FB7A 5GMKj 3HSBA 5GAN8 1I5LA 4EMHA 1M8VA 4XU0A 3V8JA
chains in the Genus database with same CATH superfamily
1MMGA 3ASKA 2OAWA 1M1KU 2RF0A 2GQVA 4DA4A 2JUFA 2KSSA 3RUXA 2GFAA 3VRZA 5HK3A 1VQ9Q 2HMAA 2L3RA 3VUBA 2RQWA 1VIFA 4JRKA 1OOTA 2P0KA 2OTJT 1I5OB 3LGFA 5IHKA 3PMIA 1Q82U 2F2WA 4J8OA 3CCQT 1VQ4Q 2MAMA 2MF2A 3MHXA 3A98A 2VGMA 2W0ZA 4RUGA 3UDCA 4KH1B 2DM1A 3DB4A 2V26A 2DL7A 4KGVB 3VS1A 1QVFS 1VQ6A 3OW2P 3TCJA 3BDLA 4OB1B 1M90R 4WCIA 3TSWA 3JB9J 4M7DB 5IHIA 2RO0A 1YIJT 1YHQT 1XTDA 3AT1B 5A0DA 1AWXA 1Q7YU 2QQAA 2YUQA 3CC2Q 3UF4A 4JS4A 3A8HB 1ZA2B 1VOMA 4A63B 4GLKA 5DLQE 5FRMA 1JJ2A 3R6NA 5D7UA 1P92A 4LN2A 4KT0E 4Z8AA 1T0HA 2X9HA 2CZ0B 1RI9A 1Z9QA 1PWTA 1JXMA 3CMEA 3L1AA 3CC7Q 1BCOA 1K9AA 2MMPA 1WHGA 2V8JA 3HL8A 5IAYA 4M77D 3QIIA 1OV3A 1SKUB 3ZL7C 5KYWB 2ECZA 1BKBA 2PZ1A 2OAUA 1ARKA 3S3MA 5LL6S 2DL4A 4PJLA 1UJYA 5CCAA 4ZN1A 4ANJA 1Q81C 4CC3A 2KRNA 1HYOA 4FYWB 3I55A 2E6ZA 3MJXA 2CUDA 1MMNA 2CZ6B 2FVUA 3X25B 2RMOA 1U3OA 4J9EA 1B34A 3HKSA 4BDYA 4D8KA 2A28A 3REBB 3SWNB 4LDWA 4M75C 1GFDA 1X6GA 2D0QB 3QUIA 3OYNA 3DLMA 2DRMA 4M7AD 1JU5C 2M1HA 1Q86C 1K0SA 3CC2T 2EJ9A 1X01A 4JRIA 4BACA 1OYXA 2F2VA 5LJ5g 1F1BB 5GANg 4FU6A 4FSXA 4C8QC 3FJ5A 1GBQA 4C92F 2GCXA 3PT9A 4AG1C 2PNIA 2ZPBB 5AYFA 2K7AA 2KYBA 2E6NA 2RHZA 1W6XA 3NTIA 1W2BP 1RAHB 5FLXE 2YSQA 4EMKC 1TUDA 1N5ZA 2DL8A 3PGGA 1YJWT 2YUNA 1I81A 3JCMg 1PSEA 3CCQA 3CBOA 2CSIA 4E6RA 1VQPQ 4HT9A 2NWMA 1UEBA 4M78C 1IO6A 2FPEA 4BI3A 2L89A 3URGA 2QG9B 2M9UA 3X26B 5KYYB 4JUVA 4F7UF 2EQIA 2L3QA 2LX7A 3NTHA 4XU2A 4IUTA 5CKEA 5GMKj 4F16A 5GAN8 1D0YA 1PHTA 1OEBA 1YIJA 2KT1A 2RI3A 1K76A 3GF5A 3M0UA 4RG8A 1WX6A 2D0NA 1D1CA 2COZA 3I5SA 2CKKA 2M16A 2CH4W 4M7DE 3CXCP 2L2PA 1ABOA 3RMQA 4V2SA 2KR3A 3QKJA 2ZCFB 4F17A 2NUZA 5CAIA 4KGZB 2FYKA 4OB3B 3MKDA 1KHIA 1KG1A 1YCSB 3MO8A 1UHFA 4JJBA 5GAOl 1TWBA 1MHNA 5LJ5f 1AWWA 5GANf 4FW2A 3JB9G 2WACA 2GNCA 4PJOE 2V8IA 2F1LA 1GCQA 2DZ9A 1JRIA 1G3YA 2NUTB 3HRSA 2VVKA 2C06A 4LDVA 1OU9A 5A2QE 5FU7C 2YRVA 1YFNA 4R0KA 4IUVA 1VYUA 2RHIA 2E3HA 3OS0A 1WXBA 3JCMf 2QEXT 1KSWA 2A3LA 1QCFA 3QZ9B 3EG0A 2DILA 1KIKA 3CCJT 1SRLA 2QA4Q 2EKHA 1KC8U 5GANe 3CCRQ 4RTYA 3QDFA 4JJCA 1UECA 4DOVA 4J9DA 3V7SA 3CC2A 2QGGA 3EGXB 2K57A 1SPKA 4QT7A 4LDXA 1V29B 2NYSA 2RB6A 1UG1A 3MEVA 4LDYA 2HSEB 2DXBA 4K11A 3GP8A 2K5IA 2XKOC 9ATCB 4CC2A 4FYVB 4MZTA 2FPFA 2ZPHB 4IUUA 3N5BB 2DTHA 2JT4A 4HVVA 1WGSA 1OX9A 1X2QA 2A0FB 3JSCA 3QG1A 3ER0A 3VKIA 3JCMe 4PLIA 3P8HA 2DVEA 5CO7A 4Q5WA 3LW5E 1YJWA 1K73R 3VV0A 5I11A 2DJQA 1YJNQ 4A4HA 2XK0A 3M9QA 4C5HA 1ZSZA 3SB2A 3TVTA 5IH2A 2MWPA 2AT1B 1VQ6Q 4O6JA 3OY9A 1VQNQ 2DIGA 2B8AA 3RKWA 1KD1R 2DA9A 3JCMJ 3GNGA 4CC7A 2K3BA 3MP6A 4C92B 3HPWA 4O5VA 4JZ4A 2EGAA 3O8VA 1NLPC 4GBQA 2QA4T 2YDLA 5CKHA 2V1QA 3JRZA 1TXQA 3P8BB 4M4ZA 1QVPA 2RHUA 3CBMA 4RTZA 2DD5A 1NLOC 1M3BA 4KH0B 3EG9B 3OS5A 3LGLA 3PNWC 1VQOT 1GCQC 3RESA 4E7HA 1VQ8Q 1TOVA 1NJIU 4EMGA 1AD5A 2PUOB 1M9SA 3D7SB 3CPWS 4F7UB 4E7IA 3X24B 1OULA 4M75F 1M2VB 5ECAA 5KE3A 8ATCB 4JDSA 4ZTFA 2HKQB 5CQYA 2R5MA 4C0FA 1QMCA 3CCLT 1H3HA 3QJYA 2O31A 1X6BA 1YJNT 4J9BA 4C8QF 4XTUA 3OS2A 1VQPA 5GAMh 1VQNT 4BB7A 1N8RC 1T3LA 4J6XA 1DJ7B 2QAZA 1VIEA 1RLPC 2QQRA 3WVDB 5IXBA 4LDUA 1IXDA 5FROA 4HT8A 1YNZA 4M7DD 3CEYA 2I2LA 2HKNA 4PL6A 4BY6B 4N4HA 4M77G 5D6XA 1Q81U 2X35A 3ME9A 5M9OA 2NLUA 3CCJA 2X3WD 1QKWA 4C0DB 2OX7A 3HFNA 1EZZB 2EQJA 3QXEB 4M78F 3NFCA 1RAAB 4PJOD 1YI2T 1B07A 5FWBA 1VQ8T 1I4K1 1BI3A 1QVGS 4LXCA 1Q86U 1R8OB 1M3AA 1VQ7T 2QDYB 1QWFA 5GAN2 1TU0B 1UGVA 3NTKA 4BD3A 1ZSZC 1KFZA 3MP8A 1QCOA 2D1XA 2OTJQ 2XU8A 2SRCA 3M0TA 4C5GA 4M7AG 3FJPA 1G5VA 1C1AA 3OW2S 4L5GA 3UA7A 1ZSGA 1ACMB 3BDUA 2DX1A 1IREB 2ED1A 4PJNA 1ZA1B 4A4EA 4HCCA 1GRIA 4C5IA 2KDSA 3OYYA 3OYFA 2X4WA 3SFMA 3VYGA 5J39A 5LJ5j 3UWNA 5GANj 1S72T 3HSBA 4PFOA 2EYXA 2AZSA 1YHQQ 2QTVA 2J7IA 1UGQB 1NE8A 5DY9A 1K8AU 2YT6A 5LJ3d 1GCPA 5KH6A 1I8FA 2JNGA 4R55A 4HA8A 3QO3A 2HBWA 2QA4A 2X3XD 2KRMA 1I0CA 4C92E 2LJ1A 1M90U 3TQ7P 2DERA 3GBQA 2I0NA 2Z0WA 4D6WA 4M7DA 3L2QA 1AOJA 3BW1A 3S3NA 2DZCA 3QBYA 3EGDB 1VQOA 1X2KA 2QI2A 2XG8D 2DMOA 2IVWA 2JM9A 1KQSA 4E2FB 4HCBA 2FRYA 4HXJA 5HKCA 3PIPA 2HNIA 2JXBA 5GAOr 4A4GA 1MMAA 2PVGB 3PFSA 1Y57A 3M59A 3SDZA 2E4HA 2WSEE 2LCSA 1JJ2P 1W1FA 1PC0A 3CCLA 4J5YA 4F7UE 5C6SA 3QHSA 1OPLA 1YJNA 1RAGB 5FW9A 2HZYA 2RM4A 3Q1JA 2COYA 1VQNA 1LPLA 4ZGEB 2E5QA 3R6OA 2HCKA 1RUWA 4E7KA 5IN1A 5KYWA 4ME7A 2L3SA 1Q95G 2KE9A 3L42A 4AFZC 5GAOm 2E70A 3A5ZB 1IRXA 4KRTA 4Z89A 3JCMQ 1WJSA 4M75B 1UUEA 1W2BS 4ZNXA 3JB9H 3X28B 4PJOB 3E9FA 3EFOB 1AT1B 2E12A 3CCMT 1D0ZA 2E65A 3SWNA 2D6FA 3OA6A 4C8QB 3E19A 5A0LA 1VQ8A 1WJQA 4C0GA 4L59A 4OMNA 2HSPA 4DBFA 2LT4A 1VQ7A 3HP9A 1IZ6A 1K9MC 1T0JA 3EH2A 1YJWQ 4J83A 1SF9A 1D3BA 3SHWA 4EMKB 1FXXA 2RQVA 4OMLA 2ROTA 1NYFA 3S3OA 1K4US 3OQ5A 1M3CA 1PD0A 4P5NA 3RBBB 3O5ZA 3CBPA 3LLRA 2KY9A 4DEYA 4GLMA 3CD6T 4M78B 2FRWA 2VWFA 3CXCS 4R56A 1ZLMA 4JPBW 1EIFA 2BZXA 1QWEA 1PCXA 2NUPB 2ATCB 2CP7A 1IHVA 1RAEB 1MNDA 1IHWA 1H3ZA 5FU6B 4RCBA 4OGCA 1WHHA 5KYYA 1IGUA 3EG1A 1MNEA 1VQ5T 4C0ZA 2XIDA 3RKXA 1TSFA 2XHCA 6AT1B 3OMCA 1PNJA 2DBMA 2YLBA 3FC3A 2GTOA 1SHGA 4E7JA 4ATOA 3OYLA 3BY7A 4XU3A 3S6WA 1JO8A 5LJ3g 2K9GA 2VUBA 5KYUA 2FZCB 4OMFB 4XTZA 3G1JA 2P4TA 1JXOA 2MIOA 1JBMA 4EIKA 1PSFA 3VU3C 4WTOB 3DKMA 5GJVB 1BIAA 2VB6A 1VYVA 2K2VA 2LCLA 1LVKA 1SHFA 1I5LA 2OTJA 3OYMA 2EYZA 2JOYA 4XTVA 2LNVA 4KUDK 4QQDA 2SEMA 1WJRA 1AHJB 2J06A 2Y4XA 4M77A 5GAMd 5KCHA 1KHCA 5FU7B 2OTLT 1B34B 4LD6A 2QEXQ 3FRNA 1QVFA 4VUBA 2P0PA 4DEXA 1CSKA 5LJ3h 2NUTA 4CRIA 1LCKA 4C92D 4MZPA 2HL5C 3CCJQ 1YHQA 4JJDA 3VS3A 3I9QA 2DEUA 2XDBA 2JJ9A 5L8RE 3SWNC 1C0MA 2QASA 3WXMB 1WHJA 2O4XA 2FEIA 2RK2A 2QTXA 1EX4A 4E7ZA 2GF7A 3SEMA 3L2VA 4BDZA 1U8RA 1ZX6A 4FYXB 2DXCA 4KGXB 2JM8A 1M1KC 1WI7A 5KYXB 1N9SA 2DEQA 2FO0A 3GPLA 4RTWA 3CCST 4M7AA 4DBRA 3CCMA 4M75E 2MI6A 2VASA 2AKLA 2IG0A 3SD4A 5GAN4 1TH7A 4M7DG 3EGXA 1Q82C 3OBWA 1W70A 2LMJA 2ZPIB 4RMOA 1XQHA 4NOYA 3JCMP 1GL5A 8AT1B 4C8QE 1WQWA 3KUFA 2KROA 3RR6A 4J6YA 1ZBXA 3QSUA 2COWA 5LJ3f 5I2SA 2DVJA 2RQUA 1FMKA 1SG5A 1N27A 2E5KA 2FL7A 1VQMT 2VGNA 5CK9A 1TUGB 4PJOG 1N8RR 4MMKA 2KGTA 1TUCA 3OYGA 1W4SA 1JB0E 2DKGA 3LH0A 3PMTA 4AMCA 1K73U 3CD6A 2BKDN 3ZBDA 1D0XA 3EAEA 3A8GB 4Y92A 1Q7YC 2XI9A 2GTJA 2QQBA 4NS5A 5LJ5e 2E41A 1D1AA 1O75A 1JQQA 4M78E 2QYZA 3M0PA 1IGQA 2EJFA 1KD1U 2Y90A 3KBGA 2MOXA 3M0QA 1VQ5A 2CH4A 4C92A 1KQ2A 1VQOQ 2RHYA 1QLYA 1FWZA 2CP2A 1X69A 4CC4B 4QKUA 4N4GA 2LQWA 1U1SA 1N9RA 1UB4A 2LJ0A 2RI2A 3UATA 3HRTA 2JS2A 2LX9A 4QVZA 1V76A 1BI2A 1BK2A 3EG9A 3KFVA 1WLPB 2DRKA 3QJ6A 4FW1A 3EFSA 1QKXA 4M77C 5DLOA 2ENMA 1KQ1A 2BZYA 3CCLQ 1HXDA 1YCYA 3H9NA 3EHRA 2RPNA 2KAFA 2W10A 3EHQA 2JTFA 3VS5A 3M5AA 1M2VA 2CSQA 5GMKi 1E6HA 3M56A 4NL3A 3OYHA 2GQIA 1WHMA 3BFMA 2ABLA 2QXFA 2K4YA 1NEGA 3H8ZA 4IUQA 4ZGJB 4XQ3A 5CKDA 4M7AC 4PFPA 2BE7D 1HD3A 1YJ9T 5IT9E 5CKFA 4LUDA 1UFFA 3CCVQ 5GAMg 3C94A 3L2ZA 1BCMA 4QVCA 1M8MA 1NEBA 1RLQC 4J9GA 1YI2Q 1OZ3A 2DL3A 1E7OA 2LP5A 3CCSA 1VQLT 1OZ2A 2CT4A 1VQ7Q 3JB9F 4J7FA 1AZGB 1MMDA 1Y07A 2XICA 4IURA 4OF1A 1UGPB 4RTVA 4J9FA 2E10A 2LQKA 3G7ZA 1S1NA 2MPXC 4MDXA 1MUZA 2QQ9A 4X9DA 3A1PA 4KULA 4J9HA 1C6VX 3IQLA 2DBKA 3L2UA 3EG2A 2ZGWA 1UGRB 2A7YA 2QEXA 1UGSB 1S72Q 2KNBB 5I22A 2LTOA 2JVVA 2M0YA 2MWOA 5GMKh 5L23A 3VS2A 2M51A 2XMFA 2O9VA 2O88A 2AHJB 3DLLA 3OSVA 3H0HA 4LE9A 2CUBA 2CZ7B 2JMCA 1PKTA 2DXTA 2J6KA 3CCVT 3I56T 1NPRA 2HEQA 4B6MA 3MP1A 2CP0A 4M75D 2K3XA 1RAIB 2K3YA 4Z88A 3MPUB 3H41A 3PIOA 1BYMA 2YRCA 1PKSA 3CCEQ 1Z9ZA 2FPDA 2DE0X 4AFSC 1NJIR 1T3SA 3OBYA 2YWWA 2O01E 4C8QD 2RNAA 2ZPFB 5GAMf 5EC7A 1JJ2S 4A4FA 3PVLA 4HVWA 5D6WA 2AKKA 1K9MR 2JMAA 4II1A 4YTLA 2GFUA 4FYYB 4EMHA 1UJ0A 4IKFA 1YBYA 4E7SA 3VS7A 2JW4A 3EGDA 2AZVA 3M53A 3HHTB 5J26A 5KCOA 4J7IA 3CQTA 3VS0A 1ZUUA 2ZPEB 1KQSP 4ZTJA 1OI1A 4RKUE 3EG3A 1OU8A 1HK9A 2D8HA 2EQMA 2C0TA 4M78D 2LDMA 1NBEB 2EAYA 4PFZA 1KC8C 2LCCA 1YWOA 2EW3A 1M1FA 1D09B 1VQKT 3V8KA 1VYTA 5GAMe 2ZAEA 3CCUT 4BY6C 1YN8A 1QP2A 2PVDB 4PJJA 2YLCA 4C0DC 2KBTA 1KK7A 3OYIA 1QW1A 3OYEA 4BE1A 1Y96B 3CCET 4RTUA 2K5LA 3CCMQ 1YITT 4XTWA 3V7CA 3ULRB 5IXFA 1PD1A 3RMSA 3C4SA 3T9NA 2KYMA 1TS9A 4DBHA 1VQLA 4FM4B 2RN8A 1FYNA 1BI1A 3VRYA 3ZEHA 4ELYC 5J3BA 3C95A 4C92G 3OB9A 3G6ET 2XDPA 3G71T 3CPWA 3JCMX 1VUBA 1WHLA 4PJOA 1WZOA 4UC4A 4LD9K 3VS6A 2RQRA 3EFOA 3JCMb 2RJEA 4FT2A 3HRUA 2IIMA 3RKYA 4XU1A 4C8QA 2RJDA 1Y71A 3JB9I 1ZBJA 2Y4YA 1G83A 2PQWA 1GXIE 3FIFA 3M55A 1SRMA 2F2XA 1QVGP 3LX7A 3CD6Q 2BZ8A 3U23A 2XDDA 1K8AR 4EMKA 3FB9A 4JRPA 4A53A 1NYGA 4XK8E 1AZEA 4M77F 4F7UG 3OSSC 2RH2A 4DQ2A 1GBRA 1NZ9A 2CDTA 2CT3A 2QK0A 2EYWA 2KI7A 1VQ5Q 1FMWA 3TREA 2L5QA 3OYBA 3OYCA 4M78A 5FRNA 1CKBA 3CCVA 3I56A 1M1KR 4XTXA 4FIBA 1XJWB 3OMGA 1HJDA 2AIRB 2LC4A 1PM3A 2KXCA 2LJ3A 1NJIC 2NUPA 2X51A 2ESWA 1YI2A 5GMKl 3PVQA 1UHCA 1QVGA 2OJ2A 4HVUA 2OI3A 4ZGDB 1Q82R 2KEAA 4PK4A 1IB8A 1CKAA 4Z02A 4OMOA 5CQXA 4M7AF 1RACB 4MMLA 4J9IA 3JCMc 3M54A 1EFNA 2E3IA 3TU4K 4B9WA 2A08A 1VQ9T 4ESRA 3OW2A 4LNPA 1WYXA 1BU1A 4FL6A 3OYAA 2ROLA 3FEOA 4HKEA 5D6YA 1NM7A 2DYIA 1TTHB 2LVMA 4JRQA 1VQ4T 2OTLQ 4A4KA 4AFUC 4NL2A 2DNUA 2YRDA 3J80E 2CP6A 3OYKA 2DPPB 1S72A 3FDRA 1Q7YR 4M7DC 3V8LA 2HQXA 1X75C 1M1GA 2C0IA 5GAOn 1VQKA 3M0SA 2VV5A 1Y0MA 2EFIA 3P8DA 3CCUA 2KQWA 5A0GA 1M8VA 4XU0A 3A8MB 2EYQA 3VYHB 1QVFP 2DF6A 2BE9B 2KXDA 3QPHA 3VUZA 3CCSQ 4PJOC 2JN0A 2WSFE 5EG2A 3CCEA 1PG5B 1QQJA 1VA7A 2EQKA 4EDUA 1H92A 2EKOA 2EYYA 1YITA 2KK4A 1GFCA 4PKCC 2F69A 1D3BB 2C0OA 1RI0A 1YWPA 3HTRA 2DYBA 3TEEA 3CPFA 4TVRA 4J9CA 4HCKA 2CS7A 5CKBA 5HK0A 2HAXA 3G6EA 2X4JA 1I1JA 1WQ7A 2DFUA 4AG2C 5KYXA 3G71A 3CC7T 2CREA 3M0RA 3QDRB 3QZ5B 2LRQA 3MEAA 4IIOA 3LWIA 3KXTA 1BIBA 4OP0A 1X6OA 3REAB 4CI0C 2M02A 4X9CA 1VQMQ 1U5SA 3TSZA 2BIVA 1PRMC 1K1ZA 3G4SQ 1UTIA 2RJFA 2DTOA 2GGRA 1WFWA 3OYJA 3M4GA 2FZGB 1K8AC 5LJ5h 5GAMj 5GANh 2EPDA 4IIMA 3EGUA 2LQNA 2FZKB 1PRLC 2J6FA 2G3RA 5AT1B 1N6AA 4X1VA 2HQHA 2R57A 3H6ZA 1M90C 1N8RU 2M0OA 2K5FA 3CMAQ 3E1SA 1ZUYA 2ZPGB 5FU6C 1LJOA 1W2BA 2YUOA 3LWHA 3JCMW 1BI0A 3RERA 1WHKA 5KYUB 3E2UA 1H8KA 5GAOp 3JCMh 1OPKA 4D8DA 2JZ2A 5FWCA 2RI5A 5KE2A 4OB0B 1M27C 2DLPA 3I5RA 4RTXA 4RCCA 2KMTA 1G2BA 4RG2A 3OYDA 2DETA 4ELZC 2P4RA 2PTKA 5IHNA 1WXUA 1UDLA 2CYZB 4M77B 1M5Q1 1VQ9A 4M75G 2GBQA 3L2WA 1NG2A 1RABB 3RDVA 3G4ST 4AT1B 2H8HA 4QQ6A 2LT1A 5GAN6 3QWXX 2YXYA 1M4ZA 2DO3A 4JZ3A 3HFOA 2A36A 1VQ4A 4C8QG 2MYSA 1VQPT 4BUGA 4A54A 3FLGA 4XAXB 3J7AF 2O2OA 4OVAA 1RL2A 3CXCA 3H0IA 5C0MA 2JTEA 5CIUA 2VXEA 2DIQA 2O4XB 4C5EA 4JLGA 3MCAB 2CP5A 3OS1A 3CMAT 1QP3A 4N4IA 1YJ9Q 5CVIA 4PLLA 2YUPA 4ZN3A 3RNJA 4DBQA 3MEWA 4M7AB 1J3TA 2EJGA 5KYNA 4MZMA 2FHDA 3NHNA 2VKNA 3UT1A 5LJ3e 2D9TA 2LZ6B 3NMZC 4N0AA 1SEMA 2HD0A 3L2RA 2AK5A 3CC4Q 1O9SA 2O9SA 1VQLQ 2FG0A 2HBPA 2DAQA 4EPCA 1BB9A 4F14A 2R58A 4KUIA 4OGEA 4M78G 2HL3A 3UA6A 1G3TA 1WIEA 2K2MA 1RAFB 2VXFA 4Y28E 2KT8A 3PTAA 2DTIA 2F5TX 4Y91A 1X27A 2HDAA 3LH5A 3CC7A 1MV3A 1ZHIA 2DK3A 1U1TA 2RA2A 1B3QA 3THKA 3GLXA 2EQUA 4F7UA 1V1CA 3J81E 3QYGB 1FX7A 4BI8B 1E6GA 4F04B 7AT1B 3GIBA 3C0CA 3EH1A 1G3SA 3F70A 4KBMB 2OTLA 2EIFA 2PVOB 4JLIA 1KC8R 4BI4A 5DM7R 1SSHA 3AHUA 1ABQA 2QDLA 3EFRA 2MK5A 2X4XA 1R0BG 3V7RA 4L6V5 1QCNA 2RQTA 2RK1A 4PJMA 3M57A 3I56Q 1AVZC 2B86A 3BE3A 4BE0A 5I2MA 1JEGA 1D1BA 3H0FA 1OX8A 1WPYA 3CCRT 3NPFA 3QWYA 3E9GA 4XTYA 2V1RA 3CC4T 2YHTA 4OB2B 1WNLA 2EBPA 2KRSA 3NGPA 2QQSA 1WDXA 4HCZA 1HSQA 2CZ1B 4M7DF 2RJCA 4E7LA 2P84A 2JS0A 3ZFJA 1KJWA 2R5AA 4JS5A 1WA7A 3INZA 3CMEQ 1KQSS 1ZSZB 4OMPA 1G8XA 5GJWB 1LOJA 3DB3A 2VC8A 1TG0A 1SSFA 2G6FX 1LNXA 1AWJA 2ZZDA 1M2OA 4FSSA 2DL5A 4X34A 3LYIA 2E64A 3UPUA 1ZUKA 4PJOF 1VQMA 1K9MU 2L3PA 2QGFB 2DXUA 3PE0A 1AEYA 2K79A 3G4SA 2ED0A 1AWOA 2IPOB 4M77E 2E1HA 4E47A 3X20B 4PNOA 3I55Q 1VQ6T 4B9XA 5CR2A 4C92C 2L0AA 2PUKB 4MDWA 2X4YA 2EWNA 2XD0A 5GMKm 2MCNA 1VQKQ 4N0AC 3CCUQ 3JB9D 2LQ8A 3VS4A 2FB7A 1YP5A 3CMAA 3V8JA 1X43A 2EVRA 4J6WA 5HY6A 4QQGA 1Y7XA 1RADB 3VJPA 1YITQ 1MGQA 3M58A 2JTMA 1BBZA 3META 1WXTA 4M7AE 3C12A 1FMVA 1H641 4GY5A 2V8KA 1XOVA 4LUEA 3G6EQ 4DOWA 3GOXA 3G71Q 3RIRA 2H3JA 1OQKA 2K6DA 2A37A 1R0CB 2KVQG 3CMET 1Y96A 2VYTA 4JJNK 4AFQC 2DD4A 3MEUA 4FCYA 2RHXA 5GAN3 4FT4A 1U06A 3M4YA 1A0NB 3JAME 2RD1A 2P0QA 2BUDA 2DJZA 2PU9B 1K73C 5GAN5 3CCQQ 2CGHA 3JCMV 3CPWP 2LNHB 1R77A 3I55T 4OMQA 1NPPA 5GAN7 2H3EB 3A8LB 1Q81R 3A8OB 3WVEB 5LJ5d 2HQEA 5GANd 1G3WA 4ORZA 2EGCA 1M30A 2J05A 4IUPA 1KD1C 4WF2A 4QVDA 5LJ3j 2F5KA 3QYHB 1UE9A 1YJ9A 3GNFB 1YIJQ 1ZQ1A 2CP3A 4OMMA 5I21A 5GAOq 2J6OA 1Q86R 3JV3A 4RTTA 5GMKe 1XNIA 4BE2A 2D8JA 3CCRA 1MV0B 2WSCE 2BTTA 3CC4A 5HCKA 3JCMd 3I35A 2EGEA 1B7TA 4M75A 2L8DA 1I07A 4QW2A 1K0XA
chains in the Genus database with same CATH topology
3A8MB 3CCLT 3ZBDA 3ASKA 3QJYA 1M1KU 2GQVA 2EYQA 3VYHB 4DA4A 2JUFA 3EAEA 3A8GB 1YJNT 2KSSA 3RUXA 1Q7YC 4C8QF 3QPHA 2XI9A 3VUZA 2GFAA 4PJOC 5HK3A 4XTUA 2JN0A 2QQBA 4NS5A 2WSFE 5EG2A 3OS2A 2L3RA 5LJ5e 5GAMh 3CCEA 1VQPA 4EDUA 2EQKA 2E41A 3VUBA 1VIFA 1VQNT 2EKOA 4BB7A 1YITA 1O75A 1N8RC 4J6XA 4JRKA 1DJ7B 4M78E 2KK4A 2P0KA 2OTJT 2EJFA 4PKCC 1VIEA 3LGFA 1KD1U 2F69A 1D3BB 2Y90A 3PMIA 2QQRA 3KBGA 1Q82U 1RI0A 4J8OA 3CCQT 3WVDB 2MAMA 1VQ5A 4LDUA 4C92A 1KQ2A 5FROA 3TEEA 3CPFA 4TVRA 1VQPT 4HT8A 2CS7A 5CKBA 2MF2A 5HK0A 2RHYA 2X4JA 1WQ7A 3MHXA 3G6EA 3G71A 3CEYA 1FWZA 4M7DD 2I2LA 2VGMA 4PL6A 4BY6B 4N4HA 4M77G 5D6XA 3CC7T 3UDCA 2X35A 3ME9A 1Q81U 3DB4A 5M9OA 2NLUA 3QDRB 3CCJA 3QZ5B 2LRQA 3MEAA 3LWIA 3KXTA 4C0DB 4N4GA 1BIBA 1QVFS 4OP0A 1X6OA 1U1SA 1N9RA 4CI0C 1UB4A 3TCJA 1VQ6A 4X9CA 3HFNA 2RI2A 2EQJA 3BDLA 3HRTA 4OB1B 2LX9A 3QXEB 4QVZA 2BIVA 3JB9J 1BI2A 3QJ6A 4M7DB 4M78F 3EFSA 2RO0A 2RJFA 3NFCA 2DTOA 4M77C 5DLOA 1YIJT 1YHQT 3OYJA 1KQ1A 4PJOD 3M4GA 1YI2T 1K8AC 5LJ5h 5GAMj 5GANh 1VQ8T 1XTDA 1I4K1 1HXDA 1BI3A 5A0DA 1YCYA 1QVGS 1Q7YU 2QQAA 1Q86U 1R8OB 1VQ7T 2QDYB 5GAN2 4JS4A 2KAFA 3A8HB 2G3RA 1N6AA 3NTKA 2R57A 3H6ZA 1M90C 1N8RU 2JTFA 2M0OA 2K5FA 4BD3A 4GLKA 3MP8A 5DLQE 3M5AA 3E1SA 5FRMA 2XU8A 4C5GA 2ZPGB 4M7AG 3FJPA 5FU6C 1JJ2A 1G5VA 1LJOA 5GMKi 4L5GA 1P92A 3OW2S 3M56A 1W2BA 4NL3A 4KT0E 3OYHA 3BDUA 3LWHA 3JCMW 1BI0A 2CZ0B 1IREB 3RERA 3BFMA 2QXFA 2K4YA 4ZGJB 3H8ZA 4IUQA 3CMEA 4A4EA 3L1AA 5GAOp 4XQ3A 3JCMh 4HCCA 5CKDA 4M7AC 2MMPA 2V8JA 4C5IA 2JZ2A 3HL8A 2RI5A 5IAYA 1YJ9T 4M77D 2KDSA 3OYYA 3QIIA 5CKFA 5KE2A 3OYFA 5IT9E 4OB0B 2X4WA 3SFMA 3VYGA 5J39A 5GAMg 5LJ5j 3UWNA 5GANj 1S72T 3HSBA 1BKBA 3C94A 3L2ZA 2OAUA 4QVCA 3S3MA 1UGQB 1NE8A 2KMTA 4RCCA 5DY9A 5LL6S 1K8AU 1OZ3A 4RG2A 5LJ3d 5CCAA 4ZN1A 5KH6A 3OYDA 1Q81C 4ELZC 1I8FA 2JNGA 4R55A 4HA8A 3QO3A 3CCSA 1VQLT 1OZ2A 2QA4A 2CYZB 4M77B 1M5Q1 3I55A 1VQ9A 4M75G 3JB9F 4J7FA 2E6ZA 4C92E 2CZ6B 1Y07A 3L2WA 1M90U 2XICA 2FVUA 3X25B 4IURA 3G4ST 4OF1A 1UGPB 1B34A 3HKSA 4QQ6A 2LT1A 4BDYA 5GAN6 4D6WA 4M7DA 2E10A 1M4ZA 2DO3A 2LQKA 3G7ZA 3L2QA 3HFOA 4MDXA 1VQ4A 4C8QG 2QQ9A 3SWNB 4BUGA 3BW1A 4X9DA 2DZCA 4LDWA 4A54A 3S3NA 4M75C 2D0QB 3QBYA 3FLGA 3QUIA 3OYNA 3DLMA 1VQOA 4XAXB 4M7AD 2M1HA 1Q86C 4KULA 3J7AF 3CXCA 4OVAA 1RL2A 3CC2T 2QI2A 5C0MA 2EJ9A 5CIUA 2XG8D 2VXEA 1X01A 2IVWA 3L2UA 2DIQA 2O4XB 1KQSA 4JRIA 4C5EA 4BACA 4HCBA 1OYXA 5LJ5g 5GANg 2ZGWA 5HKCA 4JLGA 3PIPA 4ZTFA 3MCAB 4FU6A 2HNIA 4FSXA 4C8QC 3OS1A 1UGRB 3CMAT 1QP3A 4N4IA 5GAOr 5CVIA 4A4GA 2A7YA 4PLLA 4C92F 2PVGB 4ZN3A 3PFSA 2GCXA 3PT9A 2QEXA 1UGSB 3MEWA 2ZPBB 4M7AB 5AYFA 2EJGA 2LTOA 3M59A 4MZMA 2JVVA 3SDZA 2FHDA 2WSEE 2MWOA 5GMKh 2E6NA 3UT1A 5LJ3e 2D9TA 3CCLA 2RHZA 3NTIA 4J5YA 4N0AA 4F7UE 5C6SA 3QHSA 1YJNA 2HD0A 2AHJB 3L2RA 3DLLA 3OSVA 5FLXE 1O9SA 4EMKC 2HBPA 2DAQA 2RM4A 4EPCA 3Q1JA 2CZ7B 3PGGA 2R58A 4KUIA 1YJWT 4OGEA 2DXTA 4M78G 1VQNA 4ZGEB 3CCVT 2E5QA 3I56T 1NPRA 3R6OA 3MP1A 1I81A 1G3TA 4M75D 3JCMg 4E7KA 2K3XA 2K3YA 5IN1A 1PSEA 4ME7A 3PIOA 2VXFA 3CCQA 3CBOA 4Y28E 1BYMA 3L42A 3PTAA 2DTIA 5GAOm 4HT9A 2E70A 3A5ZB 1UEBA 4M78C 2F5TX 3OBYA 4Y91A 4BI3A 2L89A 2O01E 3URGA 4C8QD 3JCMQ 2M9UA 3X26B 3CC7A 1ZHIA 2ZPFB 4JUVA 4F7UF 5GAMf 1WJSA 1JJ2S 2DK3A 1U1TA 2RA2A 4A4FA 4M75B 3NTHA 3GLXA 2EQUA 4XU2A 4F7UA 1W2BS 5D6WA 3JB9H 3J81E 4IUTA 3QYGB 5CKEA 3X28B 1FX7A 4BI8B 4II1A 3GIBA 4PJOB 4YTLA 2GFUA 1G3SA 5GMKj 5GAN8 3E9FA 3F70A 4EMHA 4KBMB 2OTLA 2EIFA 2E12A 3CCMT 4IKFA 2PVOB 2E65A 1YBYA 4JLIA 3SWNA 3OA6A 1YIJA 2D6FA 4C8QB 2RI3A 3GF5A 4BI4A 3E19A 4RG8A 3M53A 3HHTB 5J26A 5A0LA 5DM7R 1VQ8A 1WJQA 4C0GA 5KCOA 3AHUA 4L59A 4J7IA 2CKKA 3EFRA 2M16A 2LT4A 2X4XA 4M7DE 3V7RA 1VQ7A 3RMQA 3HP9A 4L6V5 4V2SA 3QKJA 1IZ6A 2ZCFB 2ZPEB 1K9MC 5CAIA 2RK1A 4ZTJA 1OI1A 4J83A 3M57A 4RKUE 2FYKA 1D3BA 4OB3B 1KHIA 1KG1A 3MO8A 4EMKB 1HK9A 4BE0A 5I2MA 2EQMA 2LDMA 1FXXA 4M78D 5GAOl 2EAYA 3S3OA 1WPYA 1KC8C 3CCRT 2LCCA 1MHNA 3E9GA 5LJ5f 4XTYA 5GANf 3OQ5A 3CC4T 3JB9G 2YHTA 2WACA 4OB2B 1M1FA 1WNLA 4P5NA 1VQKT 3V8KA 2QQSA 4PJOE 2V8IA 3CBPA 4HCZA 3LLRA 5GAMe 2KY9A 3CCUT 4BY6C 2DZ9A 3CD6T 1JRIA 1QP2A 2PVDB 2CZ1B 4M7DF 2RJCA 2YLCA 4M78B 4C0DC 1G3YA 4E7LA 3OYIA 3HRSA 1QW1A 3CXCS 4R56A 3OYEA 4BE1A 3ZFJA 1Y96B 2R5AA 2C06A 4LDVA 5A2QE 5FU7C 1EIFA 2YRVA 3CCET 2K5LA 4JS5A 3INZA 1KQSS 4IUVA 1YITT 2RHIA 4XTWA 3V7CA 1LOJA 3DB3A 2VC8A 3RMSA 3OS0A 1H3ZA 1SSFA 5FU6B 3C4SA 4RCBA 3T9NA 4OGCA 1LNXA 2ZZDA 4X34A 1VQLA 4FM4B 3LYIA 3JCMf 2QEXT 1BI1A 2E64A 3ZEHA 4ELYC 5J3BA 3C95A 4C92G 3UPUA 1VQ5T 4C0ZA 4PJOF 2XIDA 2A3LA 3RKXA 1VQMA 3OB9A 1K9MU 2HAXA 2XHCA 3G6ET 2DXUA 3QZ9B 2XDPA 3G71T 3CPWA 3JCMX 3OMCA 1VUBA 4PJOA 2YLBA 4UC4A 3FC3A 3G4SA 4LD9K 3JCMb 3CCJT 2RJEA 4M77E 4FT2A 2E1HA 3HRUA 4E47A 4E7JA 3X20B 4ATOA 4PNOA 3RKYA 4XU1A 3BY7A 4XU3A 3OYLA 1KC8U 4C8QA 1VQ6T 5GANe 2RJDA 1Y71A 4B9XA 4C92C 5CR2A 4MDWA 2PUKB 3JB9I 3S6WA 2Y4YA 5LJ3g 2VUBA 2X4YA 2PQWA 4OMFB 1GXIE 4XTZA 2EWNA 4DOVA 2XD0A 3FIFA 3V7SA 5GMKm 3M55A 3CC2A 2P4TA 4N0AC 2K57A 1JBMA 1PSFA 4LDXA 1V29B 3VU3C 3DKMA 3JB9D 2RB6A 1BIAA 2LQ8A 3LX7A 3MEVA 2K2VA 2LCLA 2FB7A 4LDYA 1I5LA 3CMAA 2DXBA 2OTJA 3V8JA 3OYMA 3GP8A 2K5IA 2XKOC 2XDDA 4EMKA 3FB9A 4J6WA 4JRPA 4MZTA 5HY6A 4QQGA 2JOYA 2ZPHB 1Y7XA 4IUUA 2LNVA 4XTVA 4A53A 4KUDK 3VJPA 4QQDA 4XK8E 4M77F 3N5BB 4F7UG 2DTHA 1WGSA 1MGQA 1WJRA 1AHJB 3M58A 2JTMA 2Y4XA 3OSSC 3JSCA 4M77A 2RH2A 3ER0A 3QG1A 3VKIA 1KHCA 4DQ2A 3META 4PLIA 5FU7B 5KCHA 3JCMe 1NZ9A 3P8HA 1B34B 2DVEA 2OTLT 4LD6A 4M7AE 5CO7A 3FRNA 3C12A 1QVFA 4Q5WA 1H641 2L5QA 4GY5A 3LW5E 4VUBA 3TREA 2V8KA 2P0PA 3OYBA 1XOVA 3OYCA 1YJWA 3VV0A 4M78A 4DOWA 3GOXA 5FRNA 3CCVA 5LJ3h 3I56A 3RIRA 4CRIA 2H3JA 4XTXA 4FIBA 2KVQG 4C92D 3CMET 1Y96A 4MZPA 2VYTA 3OMGA 4JJNK 2LC4A 4A4HA 2XK0A 1YHQA 2DD4A 3M9QA 3MEUA 4C5HA 1NJIC 3SB2A 2MWPA 1YI2A 1M8VA 2RHXA 5GAN3 2XDBA 5GMKl 4FT4A 4O6JA 5L8RE 3SWNC 3M4YA 3WXMB 3OY9A 1QVGA 2O4XA 2DIGA 2B8AA 2RK2A 3RKWA 2QTXA 4ZGDB 3JAME 2RD1A 3JCMJ 2P0QA 2BUDA 2DJZA 3GNGA 2PU9B 2GF7A 3MP6A 3L2VA 4BDZA 4Z02A 4C92B 1K73C 5GAN5 1U8RA 3HPWA 4O5VA 2DXCA 5GAMd 1M1KC 2CGHA 5CQXA 4MMLA 4M7AF 1N9SA 2DEQA 3JCMV 3O8VA 3JCMc 3M54A 3GPLA 3CCST 4B9WA 3TU4K 4M7AA 2QA4T 1VQ9T 3I55T 5CKHA 1NPPA 5GAN7 3OW2A 3A8LB 3A8OB 3WVEB 3CCMA 5LJ5d 2HQEA 5GANd 4M75E 1G3WA 2MI6A 2IG0A 3JRZA 3SD4A 3P8BB 4FL6A 5GAN4 3OYAA 1QVPA 2RHUA 3FEOA 4IUPA 3CBMA 1KD1C 2DD5A 1TH7A 4HKEA 4WF2A 5D6YA 4M7DG 1Q82C 3OBWA 4QVDA 2LVMA 5LJ3j 4JRQA 2F5KA 1VQ4T 2ZPIB 3QYHB 3OS5A 1XQHA 3LGLA 4NOYA 3PNWC 4A4KA 4RMOA 3JCMP 4C8QE 1WQWA 3KUFA 4NL2A 3GNFB 1VQOT 1YJ9A 3RESA 4J6YA 1ZQ1A 1ZBXA 4E7HA 3J80E 3QSUA 5I2SA 5LJ3f 2DPPB 5I21A 3OYKA 1S72A 3FDRA 1N27A 5GAOq 4M7DC 2FL7A 3V8LA 2HQXA 5GMKe 1NJIU 1XNIA 4BE2A 1X75C 4EMGA 3CCRA 2PUOB 1M1GA 2VGNA 1VQMT 1M9SA 3CPWS 4E7IA 2WSCE 4F7UB 5CK9A 4PJOG 3X24B 3CC4A 4M75F 4MMKA 5GAOn 3JCMd 1VQKA 3OYGA 1W4SA 5KE3A 1JB0E 2VV5A 2DKGA 3LH0A 3PMTA 2EFIA 3P8DA 4JDSA 2L8DA 4M75A 5CQYA 3CCUA 2R5MA 2KQWA 4C0FA 5A0GA 4QW2A 1K73U 3CD6A 2BKDN 4XU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2Z A;  4QVC A;  4EMK A;  4RCC A;  5DY9 A;  3FB9 A;  2E65 A;  4J6W A;  4JLI A;  3RUX A;  3SWN A;  5LJ3 d;  4C8Q F;  4C8Q B;  4PJO C;  4XTU A;  2JN0 A;  1I8F A;  4XTV A;  4A53 A;  4HA8 A;  5LJ5 e;  3QO3 A;  5GAM h;  3AHU A;  4M77 F;  4F7U G;  4M77 B;  2DTH A;  1M5Q 1;  2E41 A;  1MGQ A;  4M75 G;  3EFR A;  3JB9 F;  4M7D E;  4J6X A;  4JRK A;  4M77 A;  4M78 E;  4C92 E;  5GAM d;  3V7R A;  3JCM e;  4DQ2 A;  4V2S A;  2EJF A;  1B34 B;  2DVE A;  4M7A E;  5CAI A;  1D3B B;  2Y90 A;  1B34 A;  1H64 1;  2FYK A;  5GAN 6;  1D3B A;  4M7D A;  2E10 A;  4C92 A;  4M78 A;  1KQ2 A;  3HFO A;  5LJ3 h;  1HK9 A;  3RIR A;  4EMK B;  4HT8 A;  4C8Q G;  4XTX A;  3SWN B;  3BW1 A;  1WQ7 A;  2DZC A;  4X9D A;  4M78 D;  1Y96 A;  4M75 C;  4A54 A;  2EAY A;  3QUI A;  4C92 D;  5GAO l;  2I2L A;  1WPY A;  4M7A D;  4M77 G;  5LJ5 f;  4XTY A;  3SB2 A;  5GAN f;  3JB9 G;  2YHT A;  2EJ9 A;  5GAN 3;  1WNL A;  5GMK l;  2VXE A;  1X01 A;  3V8K A;  3SWN C;  4PJO E;  1BIB A;  4JRI A;  4OP0 A;  1U1S A;  1N9R A;  5GAM e;  5LJ5 g;  4X9C A;  3HFN A;  5GAN g;  2ZGW A;  3RKW A;  2HNI A;  2QTX A;  2DZ9 A;  4C8Q C;  2RD1 A;  3JCM J;  1JRI A;  2DJZ A;  3JB9 J;  5GAO r;  4M7D F;  4M7D B;  4C92 F;  4M78 F;  3EFS A;  2YLC A;  4C92 B;  4M78 B;  5GAN 5;  4M77 C;  2DTO A;  2CGH A;  1KQ1 A;  4MML A;  4M7A F;  4M7A B;  4PJO D;  3M4G A;  1N9S A;  1Y96 B;  2DEQ A;  2EJG A;  3JCM V;  3JCM c;  5LJ5 h;  5GAM j;  5GAN h;  5GMK h;  4M7A A;  1I4K 1;  1HXD A;  3INZ A;  5LJ3 e;  1YCY A;  5GAN 7;  4J5Y A;  4N0A A;  4F7U E;  3QHS A;  5LJ5 d;  4XTW A;  3V7C A;  1LOJ A;  5GAN d;  4M75 E;  2VC8 A;  5GAN 2;  4EMK C;  4RCB A;  5GAN 4;  2RM4 A;  1LNX A;  3JCM f;  4WF2 A;  1TH7 A;  2E64 A;  3PGG A;  4M7D G;  4C92 G;  2DXT A;  4M78 G;  4QVD A;  4PJO F;  5LJ3 j;  3RKX A;  4NOY A;  3JCM P;  2DXU A;  4M7A G;  1I81 A;  3JCM X;  4M75 D;  3FJP A;  3JCM g;  4C8Q E;  4PJO A;  2YLB A;  1WQW A;  1LJO A;  4NL2 A;  5GMK i;  3RES A;  4J6Y A;  3QSU A;  2VXF A;  4NL3 A;  3BDU A;  3JCM b;  4M77 E;  5LJ3 f;  5I21 A;  3JCM W;  2E1H A;  2DTI A;  5GAO m;  4HT9 A;  4PNO A;  3RKY A;  4XU1 A;  3BY7 A;  4XU3 A;  5GAO q;  3BFM A;  4C8Q A;  3RER A;  5GAN e;  4M7D C;  3JB9 I;  3V8L A;  4M78 C;  4C92 C;  5GMK e;  3L1A A;  4EMG A;  4XQ3 A;  4Y91 A;  5GAO p;  3JCM h;  5LJ3 g;  4C8Q D;  3JCM Q;  4M7D D;  4M7A C;  4XTZ A;  2EWN A;  3FIF A;  4JUV A;  3V7S A;  4F7U F;  5GAM f;  4F7U B;  5GMK m;  1U1T A;  2K57 A;  2RA2 A;  4M75 F;  4MMK A;  4N0A C;  4PJO G;  4M75 B;  1JBM A;  4M77 D;  3JCM d;  5GAO n;  4F7U A;  4XU2 A;  3VU3 C;  3JB9 H;  3JB9 D;  2DKG A;  2RB6 A;  1BIA A;  4M75 A;  4PJO B;  5GAM g;  5LJ5 j;  3GIB A;  5GAN j;  2FB7 A;  5GMK j;  3HSB A;  5GAN 8;  1I5L A;  4EMH A;  1M8V A;  4XU0 A;  3V8J A; 
#chains in the Genus database with same CATH topology
 1MMG A;  3ASK A;  2OAW A;  1M1K U;  2RF0 A;  2GQV A;  4DA4 A;  2JUF A;  2KSS A;  3RUX A;  2GFA A;  3VRZ A;  5HK3 A;  1VQ9 Q;  2HMA A;  2L3R A;  3VUB A;  2RQW A;  1VIF A;  4JRK A;  1OOT A;  2P0K A;  2OTJ T;  1I5O B;  3LGF A;  5IHK A;  3PMI A;  1Q82 U;  2F2W A;  4J8O A;  3CCQ T;  1VQ4 Q;  2MAM A;  2MF2 A;  3MHX A;  3A98 A;  2VGM A;  2W0Z A;  4RUG A;  3UDC A;  4KH1 B;  2DM1 A;  3DB4 A;  2V26 A;  2DL7 A;  4KGV B;  3VS1 A;  1QVF S;  1VQ6 A;  3OW2 P;  3TCJ A;  3BDL A;  4OB1 B;  1M90 R;  4WCI A;  3TSW A;  3JB9 J;  4M7D B;  5IHI A;  2RO0 A;  1YIJ T;  1YHQ T;  1XTD A;  3AT1 B;  5A0D A;  1AWX A;  1Q7Y U;  2QQA A;  2YUQ A;  3CC2 Q;  3UF4 A;  4JS4 A;  3A8H B;  1ZA2 B;  1VOM A;  4A63 B;  4GLK A;  5DLQ E;  5FRM A;  1JJ2 A;  3R6N A;  5D7U A;  1P92 A;  4LN2 A;  4KT0 E;  4Z8A A;  1T0H A;  2X9H A;  2CZ0 B;  1RI9 A;  1Z9Q A;  1PWT A;  1JXM A;  3CME A;  3L1A A;  3CC7 Q;  1BCO A;  1K9A A;  2MMP A;  1WHG A;  2V8J A;  3HL8 A;  5IAY A;  4M77 D;  3QII A;  1OV3 A;  1SKU B;  3ZL7 C;  5KYW B;  2ECZ A;  1BKB A;  2PZ1 A;  2OAU A;  1ARK A;  3S3M A;  5LL6 S;  2DL4 A;  4PJL A;  1UJY A;  5CCA A;  4ZN1 A;  4ANJ A;  1Q81 C;  4CC3 A;  2KRN A;  1HYO A;  4FYW B;  3I55 A;  2E6Z A;  3MJX A;  2CUD A;  1MMN A;  2CZ6 B;  2FVU A;  3X25 B;  2RMO A;  1U3O A;  4J9E A;  1B34 A;  3HKS A;  4BDY A;  4D8K A;  2A28 A;  3REB B;  3SWN B;  4LDW A;  4M75 C;  1GFD A;  1X6G A;  2D0Q B;  3QUI A;  3OYN A;  3DLM A;  2DRM A;  4M7A D;  1JU5 C;  2M1H A;  1Q86 C;  1K0S A;  3CC2 T;  2EJ9 A;  1X01 A;  4JRI A;  4BAC A;  1OYX A;  2F2V A;  5LJ5 g;  1F1B B;  5GAN g;  4FU6 A;  4FSX A;  4C8Q C;  3FJ5 A;  1GBQ A;  4C92 F;  2GCX A;  3PT9 A;  4AG1 C;  2PNI A;  2ZPB B;  5AYF A;  2K7A A;  2KYB A;  2E6N A;  2RHZ A;  1W6X A;  3NTI A;  1W2B P;  1RAH B;  5FLX E;  2YSQ A;  4EMK C;  1TUD A;  1N5Z A;  2DL8 A;  3PGG A;  1YJW T;  2YUN A;  1I81 A;  3JCM g;  1PSE A;  3CCQ A;  3CBO A;  2CSI A;  4E6R A;  1VQP Q;  4HT9 A;  2NWM A;  1UEB A;  4M78 C;  1IO6 A;  2FPE A;  4BI3 A;  2L89 A;  3URG A;  2QG9 B;  2M9U A;  3X26 B;  5KYY B;  4JUV A;  4F7U F;  2EQI A;  2L3Q A;  2LX7 A;  3NTH A;  4XU2 A;  4IUT A;  5CKE A;  5GMK j;  4F16 A;  5GAN 8;  1D0Y A;  1PHT A;  1OEB A;  1YIJ A;  2KT1 A;  2RI3 A;  1K76 A;  3GF5 A;  3M0U A;  4RG8 A;  1WX6 A;  2D0N A;  1D1C A;  2COZ A;  3I5S A;  2CKK A;  2M16 A;  2CH4 W;  4M7D E;  3CXC P;  2L2P A;  1ABO A;  3RMQ A;  4V2S A;  2KR3 A;  3QKJ A;  2ZCF B;  4F17 A;  2NUZ A;  5CAI A;  4KGZ B;  2FYK A;  4OB3 B;  3MKD A;  1KHI A;  1KG1 A;  1YCS B;  3MO8 A;  1UHF A;  4JJB A;  5GAO l;  1TWB A;  1MHN A;  5LJ5 f;  1AWW A;  5GAN f;  4FW2 A;  3JB9 G;  2WAC A;  2GNC A;  4PJO E;  2V8I A;  2F1L A;  1GCQ A;  2DZ9 A;  1JRI A;  1G3Y A;  2NUT B;  3HRS A;  2VVK A;  2C06 A;  4LDV A;  1OU9 A;  5A2Q E;  5FU7 C;  2YRV A;  1YFN A;  4R0K A;  4IUV A;  1VYU A;  2RHI A;  2E3H A;  3OS0 A;  1WXB A;  3JCM f;  2QEX T;  1KSW A;  2A3L A;  1QCF A;  3QZ9 B;  3EG0 A;  2DIL A;  1KIK A;  3CCJ T;  1SRL A;  2QA4 Q;  2EKH A;  1KC8 U;  5GAN e;  3CCR Q;  4RTY A;  3QDF A;  4JJC A;  1UEC A;  4DOV A;  4J9D A;  3V7S A;  3CC2 A;  2QGG A;  3EGX B;  2K57 A;  1SPK A;  4QT7 A;  4LDX A;  1V29 B;  2NYS A;  2RB6 A;  1UG1 A;  3MEV A;  4LDY A;  2HSE B;  2DXB A;  4K11 A;  3GP8 A;  2K5I A;  2XKO C;  9ATC B;  4CC2 A;  4FYV B;  4MZT A;  2FPF A;  2ZPH B;  4IUU A;  3N5B B;  2DTH A;  2JT4 A;  4HVV A;  1WGS A;  1OX9 A;  1X2Q A;  2A0F B;  3JSC A;  3QG1 A;  3ER0 A;  3VKI A;  3JCM e;  4PLI A;  3P8H A;  2DVE A;  5CO7 A;  4Q5W A;  3LW5 E;  1YJW A;  1K73 R;  3VV0 A;  5I11 A;  2DJQ A;  1YJN Q;  4A4H A;  2XK0 A;  3M9Q A;  4C5H A;  1ZSZ A;  3SB2 A;  3TVT A;  5IH2 A;  2MWP A;  2AT1 B;  1VQ6 Q;  4O6J A;  3OY9 A;  1VQN Q;  2DIG A;  2B8A A;  3RKW A;  1KD1 R;  2DA9 A;  3JCM J;  3GNG A;  4CC7 A;  2K3B A;  3MP6 A;  4C92 B;  3HPW A;  4O5V A;  4JZ4 A;  2EGA A;  3O8V A;  1NLP C;  4GBQ A;  2QA4 T;  2YDL A;  5CKH A;  2V1Q A;  3JRZ A;  1TXQ A;  3P8B B;  4M4Z A;  1QVP A;  2RHU A;  3CBM A;  4RTZ A;  2DD5 A;  1NLO C;  1M3B A;  4KH0 B;  3EG9 B;  3OS5 A;  3LGL A;  3PNW C;  1VQO T;  1GCQ C;  3RES A;  4E7H A;  1VQ8 Q;  1TOV A;  1NJI U;  4EMG A;  1AD5 A;  2PUO B;  1M9S A;  3D7S B;  3CPW S;  4F7U B;  4E7I A;  3X24 B;  1OUL A;  4M75 F;  1M2V B;  5ECA A;  5KE3 A;  8ATC B;  4JDS A;  4ZTF A;  2HKQ B;  5CQY A;  2R5M A;  4C0F A;  1QMC A;  3CCL T;  1H3H A;  3QJY A;  2O31 A;  1X6B A;  1YJN T;  4J9B A;  4C8Q F;  4XTU A;  3OS2 A;  1VQP A;  5GAM h;  1VQN T;  4BB7 A;  1N8R C;  1T3L A;  4J6X A;  1DJ7 B;  2QAZ A;  1VIE A;  1RLP C;  2QQR A;  3WVD B;  5IXB A;  4LDU A;  1IXD A;  5FRO A;  4HT8 A;  1YNZ A;  4M7D D;  3CEY A;  2I2L A;  2HKN A;  4PL6 A;  4BY6 B;  4N4H A;  4M77 G;  5D6X A;  1Q81 U;  2X35 A;  3ME9 A;  5M9O A;  2NLU A;  3CCJ A;  2X3W D;  1QKW A;  4C0D B;  2OX7 A;  3HFN A;  1EZZ B;  2EQJ A;  3QXE B;  4M78 F;  3NFC A;  1RAA B;  4PJO D;  1YI2 T;  1B07 A;  5FWB A;  1VQ8 T;  1I4K 1;  1BI3 A;  1QVG S;  4LXC A;  1Q86 U;  1R8O B;  1M3A A;  1VQ7 T;  2QDY B;  1QWF A;  5GAN 2;  1TU0 B;  1UGV A;  3NTK A;  4BD3 A;  1ZSZ C;  1KFZ A;  3MP8 A;  1QCO A;  2D1X A;  2OTJ Q;  2XU8 A;  2SRC A;  3M0T A;  4C5G A;  4M7A G;  3FJP A;  1G5V A;  1C1A A;  3OW2 S;  4L5G A;  3UA7 A;  1ZSG A;  1ACM B;  3BDU A;  2DX1 A;  1IRE B;  2ED1 A;  4PJN A;  1ZA1 B;  4A4E A;  4HCC A;  1GRI A;  4C5I A;  2KDS A;  3OYY A;  3OYF A;  2X4W A;  3SFM A;  3VYG A;  5J39 A;  5LJ5 j;  3UWN A;  5GAN j;  1S72 T;  3HSB A;  4PFO A;  2EYX A;  2AZS A;  1YHQ Q;  2QTV A;  2J7I A;  1UGQ B;  1NE8 A;  5DY9 A;  1K8A U;  2YT6 A;  5LJ3 d;  1GCP A;  5KH6 A;  1I8F A;  2JNG A;  4R55 A;  4HA8 A;  3QO3 A;  2HBW A;  2QA4 A;  2X3X D;  2KRM A;  1I0C A;  4C92 E;  2LJ1 A;  1M90 U;  3TQ7 P;  2DER A;  3GBQ A;  2I0N A;  2Z0W A;  4D6W A;  4M7D A;  3L2Q A;  1AOJ A;  3BW1 A;  3S3N A;  2DZC A;  3QBY A;  3EGD B;  1VQO A;  1X2K A;  2QI2 A;  2XG8 D;  2DMO A;  2IVW A;  2JM9 A;  1KQS A;  4E2F B;  4HCB A;  2FRY A;  4HXJ A;  5HKC A;  3PIP A;  2HNI A;  2JXB A;  5GAO r;  4A4G A;  1MMA A;  2PVG B;  3PFS A;  1Y57 A;  3M59 A;  3SDZ A;  2E4H A;  2WSE E;  2LCS A;  1JJ2 P;  1W1F A;  1PC0 A;  3CCL A;  4J5Y A;  4F7U E;  5C6S A;  3QHS A;  1OPL A;  1YJN A;  1RAG B;  5FW9 A;  2HZY A;  2RM4 A;  3Q1J A;  2COY A;  1VQN A;  1LPL A;  4ZGE B;  2E5Q A;  3R6O A;  2HCK A;  1RUW A;  4E7K A;  5IN1 A;  5KYW A;  4ME7 A;  2L3S A;  1Q95 G;  2KE9 A;  3L42 A;  4AFZ C;  5GAO m;  2E70 A;  3A5Z B;  1IRX A;  4KRT A;  4Z89 A;  3JCM Q;  1WJS A;  4M75 B;  1UUE A;  1W2B S;  4ZNX A;  3JB9 H;  3X28 B;  4PJO B;  3E9F A;  3EFO B;  1AT1 B;  2E12 A;  3CCM T;  1D0Z A;  2E65 A;  3SWN A;  2D6F A;  3OA6 A;  4C8Q B;  3E19 A;  5A0L A;  1VQ8 A;  1WJQ A;  4C0G A;  4L59 A;  4OMN A;  2HSP A;  4DBF A;  2LT4 A;  1VQ7 A;  3HP9 A;  1IZ6 A;  1K9M C;  1T0J A;  3EH2 A;  1YJW Q;  4J83 A;  1SF9 A;  1D3B A;  3SHW A;  4EMK B;  1FXX A;  2RQV A;  4OML A;  2ROT A;  1NYF A;  3S3O A;  1K4U S;  3OQ5 A;  1M3C A;  1PD0 A;  4P5N A;  3RBB B;  3O5Z A;  3CBP A;  3LLR A;  2KY9 A;  4DEY A;  4GLM A;  3CD6 T;  4M78 B;  2FRW A;  2VWF A;  3CXC S;  4R56 A;  1ZLM A;  4JPB W;  1EIF A;  2BZX A;  1QWE A;  1PCX A;  2NUP B;  2ATC B;  2CP7 A;  1IHV A;  1RAE B;  1MND A;  1IHW A;  1H3Z A;  5FU6 B;  4RCB A;  4OGC A;  1WHH A;  5KYY A;  1IGU A;  3EG1 A;  1MNE A;  1VQ5 T;  4C0Z A;  2XID A;  3RKX A;  1TSF A;  2XHC A;  6AT1 B;  3OMC A;  1PNJ A;  2DBM A;  2YLB A;  3FC3 A;  2GTO A;  1SHG A;  4E7J A;  4ATO A;  3OYL A;  3BY7 A;  4XU3 A;  3S6W A;  1JO8 A;  5LJ3 g;  2K9G A;  2VUB A;  5KYU A;  2FZC B;  4OMF B;  4XTZ A;  3G1J A;  2P4T A;  1JXO A;  2MIO A;  1JBM A;  4EIK A;  1PSF A;  3VU3 C;  4WTO B;  3DKM A;  5GJV B;  1BIA A;  2VB6 A;  1VYV A;  2K2V A;  2LCL A;  1LVK A;  1SHF A;  1I5L A;  2OTJ A;  3OYM A;  2EYZ A;  2JOY A;  4XTV A;  2LNV A;  4KUD K;  4QQD A;  2SEM A;  1WJR A;  1AHJ B;  2J06 A;  2Y4X A;  4M77 A;  5GAM d;  5KCH A;  1KHC A;  5FU7 B;  2OTL T;  1B34 B;  4LD6 A;  2QEX Q;  3FRN A;  1QVF A;  4VUB A;  2P0P A;  4DEX A;  1CSK A;  5LJ3 h;  2NUT A;  4CRI A;  1LCK A;  4C92 D;  4MZP A;  2HL5 C;  3CCJ Q;  1YHQ A;  4JJD A;  3VS3 A;  3I9Q A;  2DEU A;  2XDB A;  2JJ9 A;  5L8R E;  3SWN C;  1C0M A;  2QAS A;  3WXM B;  1WHJ A;  2O4X A;  2FEI A;  2RK2 A;  2QTX A;  1EX4 A;  4E7Z A;  2GF7 A;  3SEM A;  3L2V A;  4BDZ A;  1U8R A;  1ZX6 A;  4FYX B;  2DXC A;  4KGX B;  2JM8 A;  1M1K C;  1WI7 A;  5KYX B;  1N9S A;  2DEQ A;  2FO0 A;  3GPL A;  4RTW A;  3CCS T;  4M7A A;  4DBR A;  3CCM A;  4M75 E;  2MI6 A;  2VAS A;  2AKL A;  2IG0 A;  3SD4 A;  5GAN 4;  1TH7 A;  4M7D G;  3EGX A;  1Q82 C;  3OBW A;  1W70 A;  2LMJ A;  2ZPI B;  4RMO A;  1XQH A;  4NOY A;  3JCM P;  1GL5 A;  8AT1 B;  4C8Q E;  1WQW A;  3KUF A;  2KRO A;  3RR6 A;  4J6Y A;  1ZBX A;  3QSU A;  2COW A;  5LJ3 f;  5I2S A;  2DVJ A;  2RQU A;  1FMK A;  1SG5 A;  1N27 A;  2E5K A;  2FL7 A;  1VQM T;  2VGN A;  5CK9 A;  1TUG B;  4PJO G;  1N8R R;  4MMK A;  2KGT A;  1TUC A;  3OYG A;  1W4S A;  1JB0 E;  2DKG A;  3LH0 A;  3PMT A;  4AMC A;  1K73 U;  3CD6 A;  2BKD N;  3ZBD A;  1D0X A;  3EAE A;  3A8G B;  4Y92 A;  1Q7Y C;  2XI9 A;  2GTJ A;  2QQB A;  4NS5 A;  5LJ5 e;  2E41 A;  1D1A A;  1O75 A;  1JQQ A;  4M78 E;  2QYZ A;  3M0P A;  1IGQ A;  2EJF A;  1KD1 U;  2Y90 A;  3KBG A;  2MOX A;  3M0Q A;  1VQ5 A;  2CH4 A;  4C92 A;  1KQ2 A;  1VQO Q;  2RHY A;  1QLY A;  1FWZ A;  2CP2 A;  1X69 A;  4CC4 B;  4QKU A;  4N4G A;  2LQW A;  1U1S A;  1N9R A;  1UB4 A;  2LJ0 A;  2RI2 A;  3UAT A;  3HRT A;  2JS2 A;  2LX9 A;  4QVZ A;  1V76 A;  1BI2 A;  1BK2 A;  3EG9 A;  3KFV A;  1WLP B;  2DRK A;  3QJ6 A;  4FW1 A;  3EFS A;  1QKX A;  4M77 C;  5DLO A;  2ENM A;  1KQ1 A;  2BZY A;  3CCL Q;  1HXD A;  1YCY A;  3H9N A;  3EHR A;  2RPN A;  2KAF A;  2W10 A;  3EHQ A;  2JTF A;  3VS5 A;  3M5A A;  1M2V A;  2CSQ A;  5GMK i;  1E6H A;  3M56 A;  4NL3 A;  3OYH A;  2GQI A;  1WHM A;  3BFM A;  2ABL A;  2QXF A;  2K4Y A;  1NEG A;  3H8Z A;  4IUQ A;  4ZGJ B;  4XQ3 A;  5CKD A;  4M7A C;  4PFP A;  2BE7 D;  1HD3 A;  1YJ9 T;  5IT9 E;  5CKF A;  4LUD A;  1UFF A;  3CCV Q;  5GAM g;  3C94 A;  3L2Z A;  1BCM A;  4QVC A;  1M8M A;  1NEB A;  1RLQ C;  4J9G A;  1YI2 Q;  1OZ3 A;  2DL3 A;  1E7O A;  2LP5 A;  3CCS A;  1VQL T;  1OZ2 A;  2CT4 A;  1VQ7 Q;  3JB9 F;  4J7F A;  1AZG B;  1MMD A;  1Y07 A;  2XIC A;  4IUR A;  4OF1 A;  1UGP B;  4RTV A;  4J9F A;  2E10 A;  2LQK A;  3G7Z A;  1S1N A;  2MPX C;  4MDX A;  1MUZ A;  2QQ9 A;  4X9D A;  3A1P A;  4KUL A;  4J9H A;  1C6V X;  3IQL A;  2DBK A;  3L2U A;  3EG2 A;  2ZGW A;  1UGR B;  2A7Y A;  2QEX A;  1UGS B;  1S72 Q;  2KNB B;  5I22 A;  2LTO A;  2JVV A;  2M0Y A;  2MWO A;  5GMK h;  5L23 A;  3VS2 A;  2M51 A;  2XMF A;  2O9V A;  2O88 A;  2AHJ B;  3DLL A;  3OSV A;  3H0H A;  4LE9 A;  2CUB A;  2CZ7 B;  2JMC A;  1PKT A;  2DXT A;  2J6K A;  3CCV T;  3I56 T;  1NPR A;  2HEQ A;  4B6M A;  3MP1 A;  2CP0 A;  4M75 D;  2K3X A;  1RAI B;  2K3Y A;  4Z88 A;  3MPU B;  3H41 A;  3PIO A;  1BYM A;  2YRC A;  1PKS A;  3CCE Q;  1Z9Z A;  2FPD A;  2DE0 X;  4AFS C;  1NJI R;  1T3S A;  3OBY A;  2YWW A;  2O01 E;  4C8Q D;  2RNA A;  2ZPF B;  5GAM f;  5EC7 A;  1JJ2 S;  4A4F A;  3PVL A;  4HVW A;  5D6W A;  2AKK A;  1K9M R;  2JMA A;  4II1 A;  4YTL A;  2GFU A;  4FYY B;  4EMH A;  1UJ0 A;  4IKF A;  1YBY A;  4E7S A;  3VS7 A;  2JW4 A;  3EGD A;  2AZV A;  3M53 A;  3HHT B;  5J26 A;  5KCO A;  4J7I A;  3CQT A;  3VS0 A;  1ZUU A;  2ZPE B;  1KQS P;  4ZTJ A;  1OI1 A;  4RKU E;  3EG3 A;  1OU8 A;  1HK9 A;  2D8H A;  2EQM A;  2C0T A;  4M78 D;  2LDM A;  1NBE B;  2EAY A;  4PFZ A;  1KC8 C;  2LCC A;  1YWO A;  2EW3 A;  1M1F A;  1D09 B;  1VQK T;  3V8K A;  1VYT A;  5GAM e;  2ZAE A;  3CCU T;  4BY6 C;  1YN8 A;  1QP2 A;  2PVD B;  4PJJ A;  2YLC A;  4C0D C;  2KBT A;  1KK7 A;  3OYI A;  1QW1 A;  3OYE A;  4BE1 A;  1Y96 B;  3CCE T;  4RTU A;  2K5L A;  3CCM Q;  1YIT T;  4XTW A;  3V7C A;  3ULR B;  5IXF A;  1PD1 A;  3RMS A;  3C4S A;  3T9N A;  2KYM A;  1TS9 A;  4DBH A;  1VQL A;  4FM4 B;  2RN8 A;  1FYN A;  1BI1 A;  3VRY A;  3ZEH A;  4ELY C;  5J3B A;  3C95 A;  4C92 G;  3OB9 A;  3G6E T;  2XDP A;  3G71 T;  3CPW A;  3JCM X;  1VUB A;  1WHL A;  4PJO A;  1WZO A;  4UC4 A;  4LD9 K;  3VS6 A;  2RQR A;  3EFO A;  3JCM b;  2RJE A;  4FT2 A;  3HRU A;  2IIM A;  3RKY A;  4XU1 A;  4C8Q A;  2RJD A;  1Y71 A;  3JB9 I;  1ZBJ A;  2Y4Y A;  1G83 A;  2PQW A;  1GXI E;  3FIF A;  3M55 A;  1SRM A;  2F2X A;  1QVG P;  3LX7 A;  3CD6 Q;  2BZ8 A;  3U23 A;  2XDD A;  1K8A R;  4EMK A;  3FB9 A;  4JRP A;  4A53 A;  1NYG A;  4XK8 E;  1AZE A;  4M77 F;  4F7U G;  3OSS C;  2RH2 A;  4DQ2 A;  1GBR A;  1NZ9 A;  2CDT A;  2CT3 A;  2QK0 A;  2EYW A;  2KI7 A;  1VQ5 Q;  1FMW A;  3TRE A;  2L5Q A;  3OYB A;  3OYC A;  4M78 A;  5FRN A;  1CKB A;  3CCV A;  3I56 A;  1M1K R;  4XTX A;  4FIB A;  1XJW B;  3OMG A;  1HJD A;  2AIR B;  2LC4 A;  1PM3 A;  2KXC A;  2LJ3 A;  1NJI C;  2NUP A;  2X51 A;  2ESW A;  1YI2 A;  5GMK l;  3PVQ A;  1UHC A;  1QVG A;  2OJ2 A;  4HVU A;  2OI3 A;  4ZGD B;  1Q82 R;  2KEA A;  4PK4 A;  1IB8 A;  1CKA A;  4Z02 A;  4OMO A;  5CQX A;  4M7A F;  1RAC B;  4MML A;  4J9I A;  3JCM c;  3M54 A;  1EFN A;  2E3I A;  3TU4 K;  4B9W A;  2A08 A;  1VQ9 T;  4ESR A;  3OW2 A;  4LNP A;  1WYX A;  1BU1 A;  4FL6 A;  3OYA A;  2ROL A;  3FEO A;  4HKE A;  5D6Y A;  1NM7 A;  2DYI A;  1TTH B;  2LVM A;  4JRQ A;  1VQ4 T;  2OTL Q;  4A4K A;  4AFU C;  4NL2 A;  2DNU A;  2YRD A;  3J80 E;  2CP6 A;  3OYK A;  2DPP B;  1S72 A;  3FDR A;  1Q7Y R;  4M7D C;  3V8L A;  2HQX A;  1X75 C;  1M1G A;  2C0I A;  5GAO n;  1VQK A;  3M0S A;  2VV5 A;  1Y0M A;  2EFI A;  3P8D A;  3CCU A;  2KQW A;  5A0G A;  1M8V A;  4XU0 A;  3A8M B;  2EYQ A;  3VYH B;  1QVF P;  2DF6 A;  2BE9 B;  2KXD A;  3QPH A;  3VUZ A;  3CCS Q;  4PJO C;  2JN0 A;  2WSF E;  5EG2 A;  3CCE A;  1PG5 B;  1QQJ A;  1VA7 A;  2EQK A;  4EDU A;  1H92 A;  2EKO A;  2EYY A;  1YIT A;  2KK4 A;  1GFC A;  4PKC C;  2F69 A;  1D3B B;  2C0O A;  1RI0 A;  1YWP A;  3HTR A;  2DYB A;  3TEE A;  3CPF A;  4TVR A;  4J9C A;  4HCK A;  2CS7 A;  5CKB A;  5HK0 A;  2HAX A;  3G6E A;  2X4J A;  1I1J A;  1WQ7 A;  2DFU A;  4AG2 C;  5KYX A;  3G71 A;  3CC7 T;  2CRE A;  3M0R A;  3QDR B;  3QZ5 B;  2LRQ A;  3MEA A;  4IIO A;  3LWI A;  3KXT A;  1BIB A;  4OP0 A;  1X6O A;  3REA B;  4CI0 C;  2M02 A;  4X9C A;  1VQM Q;  1U5S A;  3TSZ A;  2BIV A;  1PRM C;  1K1Z A;  3G4S Q;  1UTI A;  2RJF A;  2DTO A;  2GGR A;  1WFW A;  3OYJ A;  3M4G A;  2FZG B;  1K8A C;  5LJ5 h;  5GAM j;  5GAN h;  2EPD A;  4IIM A;  3EGU A;  2LQN A;  2FZK B;  1PRL C;  2J6F A;  2G3R A;  5AT1 B;  1N6A A;  4X1V A;  2HQH A;  2R57 A;  3H6Z A;  1M90 C;  1N8R U;  2M0O A;  2K5F A;  3CMA Q;  3E1S A;  1ZUY A;  2ZPG B;  5FU6 C;  1LJO A;  1W2B A;  2YUO A;  3LWH A;  3JCM W;  1BI0 A;  3RER A;  1WHK A;  5KYU B;  3E2U A;  1H8K A;  5GAO p;  3JCM h;  1OPK A;  4D8D A;  2JZ2 A;  5FWC A;  2RI5 A;  5KE2 A;  4OB0 B;  1M27 C;  2DLP A;  3I5R A;  4RTX A;  4RCC A;  2KMT A;  1G2B A;  4RG2 A;  3OYD A;  2DET A;  4ELZ C;  2P4R A;  2PTK A;  5IHN A;  1WXU A;  1UDL A;  2CYZ B;  4M77 B;  1M5Q 1;  1VQ9 A;  4M75 G;  2GBQ A;  3L2W A;  1NG2 A;  1RAB B;  3RDV A;  3G4S T;  4AT1 B;  2H8H A;  4QQ6 A;  2LT1 A;  5GAN 6;  3QWX X;  2YXY A;  1M4Z A;  2DO3 A;  4JZ3 A;  3HFO A;  2A36 A;  1VQ4 A;  4C8Q G;  2MYS A;  1VQP T;  4BUG A;  4A54 A;  3FLG A;  4XAX B;  3J7A F;  2O2O A;  4OVA A;  1RL2 A;  3CXC A;  3H0I A;  5C0M A;  2JTE A;  5CIU A;  2VXE A;  2DIQ A;  2O4X B;  4C5E A;  4JLG A;  3MCA B;  2CP5 A;  3OS1 A;  3CMA T;  1QP3 A;  4N4I A;  1YJ9 Q;  5CVI A;  4PLL A;  2YUP A;  4ZN3 A;  3RNJ A;  4DBQ A;  3MEW A;  4M7A B;  1J3T A;  2EJG A;  5KYN A;  4MZM A;  2FHD A;  3NHN A;  2VKN A;  3UT1 A;  5LJ3 e;  2D9T A;  2LZ6 B;  3NMZ C;  4N0A A;  1SEM A;  2HD0 A;  3L2R A;  2AK5 A;  3CC4 Q;  1O9S A;  2O9S A;  1VQL Q;  2FG0 A;  2HBP A;  2DAQ A;  4EPC A;  1BB9 A;  4F14 A;  2R58 A;  4KUI A;  4OGE A;  4M78 G;  2HL3 A;  3UA6 A;  1G3T A;  1WIE A;  2K2M A;  1RAF B;  2VXF A;  4Y28 E;  2KT8 A;  3PTA A;  2DTI A;  2F5T X;  4Y91 A;  1X27 A;  2HDA A;  3LH5 A;  3CC7 A;  1MV3 A;  1ZHI A;  2DK3 A;  1U1T A;  2RA2 A;  1B3Q A;  3THK A;  3GLX A;  2EQU A;  4F7U A;  1V1C A;  3J81 E;  3QYG B;  1FX7 A;  4BI8 B;  1E6G A;  4F04 B;  7AT1 B;  3GIB A;  3C0C A;  3EH1 A;  1G3S A;  3F70 A;  4KBM B;  2OTL A;  2EIF A;  2PVO B;  4JLI A;  1KC8 R;  4BI4 A;  5DM7 R;  1SSH A;  3AHU A;  1ABQ A;  2QDL A;  3EFR A;  2MK5 A;  2X4X A;  1R0B G;  3V7R A;  4L6V 5;  1QCN A;  2RQT A;  2RK1 A;  4PJM A;  3M57 A;  3I56 Q;  1AVZ C;  2B86 A;  3BE3 A;  4BE0 A;  5I2M A;  1JEG A;  1D1B A;  3H0F A;  1OX8 A;  1WPY A;  3CCR T;  3NPF A;  3QWY A;  3E9G A;  4XTY A;  2V1R A;  3CC4 T;  2YHT A;  4OB2 B;  1WNL A;  2EBP A;  2KRS A;  3NGP A;  2QQS A;  1WDX A;  4HCZ A;  1HSQ A;  2CZ1 B;  4M7D F;  2RJC A;  4E7L A;  2P84 A;  2JS0 A;  3ZFJ A;  1KJW A;  2R5A A;  4JS5 A;  1WA7 A;  3INZ A;  3CME Q;  1KQS S;  1ZSZ B;  4OMP A;  1G8X A;  5GJW B;  1LOJ A;  3DB3 A;  2VC8 A;  1TG0 A;  1SSF A;  2G6F X;  1LNX A;  1AWJ A;  2ZZD A;  1M2O A;  4FSS A;  2DL5 A;  4X34 A;  3LYI A;  2E64 A;  3UPU A;  1ZUK A;  4PJO F;  1VQM A;  1K9M U;  2L3P A;  2QGF B;  2DXU A;  3PE0 A;  1AEY A;  2K79 A;  3G4S A;  2ED0 A;  1AWO A;  2IPO B;  4M77 E;  2E1H A;  4E47 A;  3X20 B;  4PNO A;  3I55 Q;  1VQ6 T;  4B9X A;  5CR2 A;  4C92 C;  2L0A A;  2PUK B;  4MDW A;  2X4Y A;  2EWN A;  2XD0 A;  5GMK m;  2MCN A;  1VQK Q;  4N0A C;  3CCU Q;  3JB9 D;  2LQ8 A;  3VS4 A;  2FB7 A;  1YP5 A;  3CMA A;  3V8J A;  1X43 A;  2EVR A;  4J6W A;  5HY6 A;  4QQG A;  1Y7X A;  1RAD B;  3VJP A;  1YIT Q;  1MGQ A;  3M58 A;  2JTM A;  1BBZ A;  3MET A;  1WXT A;  4M7A E;  3C12 A;  1FMV A;  1H64 1;  4GY5 A;  2V8K A;  1XOV A;  4LUE A;  3G6E Q;  4DOW A;  3GOX A;  3G71 Q;  3RIR A;  2H3J A;  1OQK A;  2K6D A;  2A37 A;  1R0C B;  2KVQ G;  3CME T;  1Y96 A;  2VYT A;  4JJN K;  4AFQ C;  2DD4 A;  3MEU A;  4FCY A;  2RHX A;  5GAN 3;  4FT4 A;  1U06 A;  3M4Y A;  1A0N B;  3JAM E;  2RD1 A;  2P0Q A;  2BUD A;  2DJZ A;  2PU9 B;  1K73 C;  5GAN 5;  3CCQ Q;  2CGH A;  3JCM V;  3CPW P;  2LNH B;  1R77 A;  3I55 T;  4OMQ A;  1NPP A;  5GAN 7;  2H3E B;  3A8L B;  1Q81 R;  3A8O B;  3WVE B;  5LJ5 d;  2HQE A;  5GAN d;  1G3W A;  4ORZ A;  2EGC A;  1M30 A;  2J05 A;  4IUP A;  1KD1 C;  4WF2 A;  4QVD A;  5LJ3 j;  2F5K A;  3QYH B;  1UE9 A;  1YJ9 A;  3GNF B;  1YIJ Q;  1ZQ1 A;  2CP3 A;  4OMM A;  5I21 A;  5GAO q;  2J6O A;  1Q86 R;  3JV3 A;  4RTT A;  5GMK e;  1XNI A;  4BE2 A;  2D8J A;  3CCR A;  1MV0 B;  2WSC E;  2BTT A;  3CC4 A;  5HCK A;  3JCM d;  3I35 A;  2EGE A;  1B7T A;  4M75 A;  2L8D A;  1I07 A;  4QW2 A;  1K0X A; 
#chains in the Genus database with same CATH homology
 3A8M B;  3CCL T;  3ZBD A;  3ASK A;  3QJY A;  1M1K U;  2GQV A;  2EYQ A;  3VYH B;  4DA4 A;  2JUF A;  3EAE A;  3A8G B;  1YJN T;  2KSS A;  3RUX A;  1Q7Y C;  4C8Q F;  3QPH A;  2XI9 A;  3VUZ A;  2GFA A;  4PJO C;  5HK3 A;  4XTU A;  2JN0 A;  2QQB A;  4NS5 A;  2WSF E;  5EG2 A;  3OS2 A;  2L3R A;  5LJ5 e;  5GAM h;  3CCE A;  1VQP A;  4EDU A;  2EQK A;  2E41 A;  3VUB A;  1VIF A;  1VQN T;  2EKO A;  4BB7 A;  1YIT A;  1O75 A;  1N8R C;  4J6X A;  4JRK A;  1DJ7 B;  4M78 E;  2KK4 A;  2P0K A;  2OTJ T;  2EJF A;  4PKC C;  1VIE A;  3LGF A;  1KD1 U;  2F69 A;  1D3B B;  2Y90 A;  3PMI A;  2QQR A;  3KBG A;  1Q82 U;  1RI0 A;  4J8O A;  3CCQ T;  3WVD B;  2MAM A;  1VQ5 A;  4LDU A;  4C92 A;  1KQ2 A;  5FRO A;  3TEE A;  3CPF A;  4TVR A;  1VQP T;  4HT8 A;  2CS7 A;  5CKB A;  2MF2 A;  5HK0 A;  2RHY A;  2X4J A;  1WQ7 A;  3MHX A;  3G6E A;  3G71 A;  3CEY A;  1FWZ A;  4M7D D;  2I2L A;  2VGM A;  4PL6 A;  4BY6 B;  4N4H A;  4M77 G;  5D6X A;  3CC7 T;  3UDC A;  2X35 A;  3ME9 A;  1Q81 U;  3DB4 A;  5M9O A;  2NLU A;  3QDR B;  3CCJ A;  3QZ5 B;  2LRQ A;  3MEA A;  3LWI A;  3KXT A;  4C0D B;  4N4G A;  1BIB A;  1QVF S;  4OP0 A;  1X6O A;  1U1S A;  1N9R A;  4CI0 C;  1UB4 A;  3TCJ A;  1VQ6 A;  4X9C A;  3HFN A;  2RI2 A;  2EQJ A;  3BDL A;  3HRT A;  4OB1 B;  2LX9 A;  3QXE B;  4QVZ A;  2BIV A;  3JB9 J;  1BI2 A;  3QJ6 A;  4M7D B;  4M78 F;  3EFS A;  2RO0 A;  2RJF A;  3NFC A;  2DTO A;  4M77 C;  5DLO A;  1YIJ T;  1YHQ T;  3OYJ A;  1KQ1 A;  4PJO D;  3M4G A;  1YI2 T;  1K8A C;  5LJ5 h;  5GAM j;  5GAN h;  1VQ8 T;  1XTD A;  1I4K 1;  1HXD A;  1BI3 A;  5A0D A;  1YCY A;  1QVG S;  1Q7Y U;  2QQA A;  1Q86 U;  1R8O B;  1VQ7 T;  2QDY B;  5GAN 2;  4JS4 A;  2KAF A;  3A8H B;  2G3R A;  1N6A A;  3NTK A;  2R57 A;  3H6Z A;  1M90 C;  1N8R U;  2JTF A;  2M0O A;  2K5F A;  4BD3 A;  4GLK A;  3MP8 A;  5DLQ E;  3M5A A;  3E1S A;  5FRM A;  2XU8 A;  4C5G A;  2ZPG B;  4M7A G;  3FJP A;  5FU6 C;  1JJ2 A;  1G5V A;  1LJO A;  5GMK i;  4L5G A;  1P92 A;  3OW2 S;  3M56 A;  1W2B A;  4NL3 A;  4KT0 E;  3OYH A;  3BDU A;  3LWH A;  3JCM W;  1BI0 A;  2CZ0 B;  1IRE B;  3RER A;  3BFM A;  2QXF A;  2K4Y A;  4ZGJ B;  3H8Z A;  4IUQ A;  3CME A;  4A4E A;  3L1A A;  5GAO p;  4XQ3 A;  3JCM h;  4HCC A;  5CKD A;  4M7A C;  2MMP A;  2V8J A;  4C5I A;  2JZ2 A;  3HL8 A;  2RI5 A;  5IAY A;  1YJ9 T;  4M77 D;  2KDS A;  3OYY A;  3QII A;  5CKF A;  5KE2 A;  3OYF A;  5IT9 E;  4OB0 B;  2X4W A;  3SFM A;  3VYG A;  5J39 A;  5GAM g;  5LJ5 j;  3UWN A;  5GAN j;  1S72 T;  3HSB A;  1BKB A;  3C94 A;  3L2Z A;  2OAU A;  4QVC A;  3S3M A;  1UGQ B;  1NE8 A;  2KMT A;  4RCC A;  5DY9 A;  5LL6 S;  1K8A U;  1OZ3 A;  4RG2 A;  5LJ3 d;  5CCA A;  4ZN1 A;  5KH6 A;  3OYD A;  1Q81 C;  4ELZ C;  1I8F A;  2JNG A;  4R55 A;  4HA8 A;  3QO3 A;  3CCS A;  1VQL T;  1OZ2 A;  2QA4 A;  2CYZ B;  4M77 B;  1M5Q 1;  3I55 A;  1VQ9 A;  4M75 G;  3JB9 F;  4J7F A;  2E6Z A;  4C92 E;  2CZ6 B;  1Y07 A;  3L2W A;  1M90 U;  2XIC A;  2FVU A;  3X25 B;  4IUR A;  3G4S T;  4OF1 A;  1UGP B;  1B34 A;  3HKS A;  4QQ6 A;  2LT1 A;  4BDY A;  5GAN 6;  4D6W A;  4M7D A;  2E10 A;  1M4Z A;  2DO3 A;  2LQK A;  3G7Z A;  3L2Q A;  3HFO A;  4MDX A;  1VQ4 A;  4C8Q G;  2QQ9 A;  3SWN B;  4BUG A;  3BW1 A;  4X9D A;  2DZC A;  4LDW A;  4A54 A;  3S3N A;  4M75 C;  2D0Q B;  3QBY A;  3FLG A;  3QUI A;  3OYN A;  3DLM A;  1VQO A;  4XAX B;  4M7A D;  2M1H A;  1Q86 C;  4KUL A;  3J7A F;  3CXC A;  4OVA A;  1RL2 A;  3CC2 T;  2QI2 A;  5C0M A;  2EJ9 A;  5CIU A;  2XG8 D;  2VXE A;  1X01 A;  2IVW A;  3L2U A;  2DIQ A;  2O4X B;  1KQS A;  4JRI A;  4C5E A;  4BAC A;  4HCB A;  1OYX A;  5LJ5 g;  5GAN g;  2ZGW A;  5HKC A;  4JLG A;  3PIP A;  4ZTF A;  3MCA B;  4FU6 A;  2HNI A;  4FSX A;  4C8Q C;  3OS1 A;  1UGR B;  3CMA T;  1QP3 A;  4N4I A;  5GAO r;  5CVI A;  4A4G A;  2A7Y A;  4PLL A;  4C92 F;  2PVG B;  4ZN3 A;  3PFS A;  2GCX A;  3PT9 A;  2QEX A;  1UGS B;  3MEW A;  2ZPB B;  4M7A B;  5AYF A;  2EJG A;  2LTO A;  3M59 A;  4MZM A;  2JVV A;  3SDZ A;  2FHD A;  2WSE E;  2MWO A;  5GMK h;  2E6N A;  3UT1 A;  5LJ3 e;  2D9T A;  3CCL A;  2RHZ A;  3NTI A;  4J5Y A;  4N0A A;  4F7U E;  5C6S A;  3QHS A;  1YJN A;  2HD0 A;  2AHJ B;  3L2R A;  3DLL A;  3OSV A;  5FLX E;  1O9S A;  4EMK C;  2HBP A;  2DAQ A;  2RM4 A;  4EPC A;  3Q1J A;  2CZ7 B;  3PGG A;  2R58 A;  4KUI A;  1YJW T;  4OGE A;  2DXT A;  4M78 G;  1VQN A;  4ZGE B;  3CCV T;  2E5Q A;  3I56 T;  1NPR A;  3R6O A;  3MP1 A;  1I81 A;  1G3T A;  4M75 D;  3JCM g;  4E7K A;  2K3X A;  2K3Y A;  5IN1 A;  1PSE A;  4ME7 A;  3PIO A;  2VXF A;  3CCQ A;  3CBO A;  4Y28 E;  1BYM A;  3L42 A;  3PTA A;  2DTI A;  5GAO m;  4HT9 A;  2E70 A;  3A5Z B;  1UEB A;  4M78 C;  2F5T X;  3OBY A;  4Y91 A;  4BI3 A;  2L89 A;  2O01 E;  3URG A;  4C8Q D;  3JCM Q;  2M9U A;  3X26 B;  3CC7 A;  1ZHI A;  2ZPF B;  4JUV A;  4F7U F;  5GAM f;  1WJS A;  1JJ2 S;  2DK3 A;  1U1T A;  2RA2 A;  4A4F A;  4M75 B;  3NTH A;  3GLX A;  2EQU A;  4XU2 A;  4F7U A;  1W2B S;  5D6W A;  3JB9 H;  3J81 E;  4IUT A;  3QYG B;  5CKE A;  3X28 B;  1FX7 A;  4BI8 B;  4II1 A;  3GIB A;  4PJO B;  4YTL A;  2GFU A;  1G3S A;  5GMK j;  5GAN 8;  3E9F A;  3F70 A;  4EMH A;  4KBM B;  2OTL A;  2EIF A;  2E12 A;  3CCM T;  4IKF A;  2PVO B;  2E65 A;  1YBY A;  4JLI A;  3SWN A;  3OA6 A;  1YIJ A;  2D6F A;  4C8Q B;  2RI3 A;  3GF5 A;  4BI4 A;  3E19 A;  4RG8 A;  3M53 A;  3HHT B;  5J26 A;  5A0L A;  5DM7 R;  1VQ8 A;  1WJQ A;  4C0G A;  5KCO A;  3AHU A;  4L59 A;  4J7I A;  2CKK A;  3EFR A;  2M16 A;  2LT4 A;  2X4X A;  4M7D E;  3V7R A;  1VQ7 A;  3RMQ A;  3HP9 A;  4L6V 5;  4V2S A;  3QKJ A;  1IZ6 A;  2ZCF B;  2ZPE B;  1K9M C;  5CAI A;  2RK1 A;  4ZTJ A;  1OI1 A;  4J83 A;  3M57 A;  4RKU E;  2FYK A;  1D3B A;  4OB3 B;  1KHI A;  1KG1 A;  3MO8 A;  4EMK B;  1HK9 A;  4BE0 A;  5I2M A;  2EQM A;  2LDM A;  1FXX A;  4M78 D;  5GAO l;  2EAY A;  3S3O A;  1WPY A;  1KC8 C;  3CCR T;  2LCC A;  1MHN A;  3E9G A;  5LJ5 f;  4XTY A;  5GAN f;  3OQ5 A;  3CC4 T;  3JB9 G;  2YHT A;  2WAC A;  4OB2 B;  1M1F A;  1WNL A;  4P5N A;  1VQK T;  3V8K A;  2QQS A;  4PJO E;  2V8I A;  3CBP A;  4HCZ A;  3LLR A;  5GAM e;  2KY9 A;  3CCU T;  4BY6 C;  2DZ9 A;  3CD6 T;  1JRI A;  1QP2 A;  2PVD B;  2CZ1 B;  4M7D F;  2RJC A;  2YLC A;  4M78 B;  4C0D C;  1G3Y A;  4E7L A;  3OYI A;  3HRS A;  1QW1 A;  3CXC S;  4R56 A;  3OYE A;  4BE1 A;  3ZFJ A;  1Y96 B;  2R5A A;  2C06 A;  4LDV A;  5A2Q E;  5FU7 C;  1EIF A;  2YRV A;  3CCE T;  2K5L A;  4JS5 A;  3INZ A;  1KQS S;  4IUV A;  1YIT T;  2RHI A;  4XTW A;  3V7C A;  1LOJ A;  3DB3 A;  2VC8 A;  3RMS A;  3OS0 A;  1H3Z A;  1SSF A;  5FU6 B;  3C4S A;  4RCB A;  3T9N A;  4OGC A;  1LNX A;  2ZZD A;  4X34 A;  1VQL A;  4FM4 B;  3LYI A;  3JCM f;  2QEX T;  1BI1 A;  2E64 A;  3ZEH A;  4ELY C;  5J3B A;  3C95 A;  4C92 G;  3UPU A;  1VQ5 T;  4C0Z A;  4PJO F;  2XID A;  2A3L A;  3RKX A;  1VQM A;  3OB9 A;  1K9M U;  2HAX A;  2XHC A;  3G6E T;  2DXU A;  3QZ9 B;  2XDP A;  3G71 T;  3CPW A;  3JCM X;  3OMC A;  1VUB A;  4PJO A;  2YLB A;  4UC4 A;  3FC3 A;  3G4S A;  4LD9 K;  3JCM b;  3CCJ T;  2RJE A;  4M77 E;  4FT2 A;  2E1H A;  3HRU A;  4E47 A;  4E7J A;  3X20 B;  4ATO A;  4PNO A;  3RKY A;  4XU1 A;  3BY7 A;  4XU3 A;  3OYL A;  1KC8 U;  4C8Q A;  1VQ6 T;  5GAN e;  2RJD A;  1Y71 A;  4B9X A;  4C92 C;  5CR2 A;  4MDW A;  2PUK B;  3JB9 I;  3S6W A;  2Y4Y A;  5LJ3 g;  2VUB A;  2X4Y A;  2PQW A;  4OMF B;  1GXI E;  4XTZ A;  2EWN A;  4DOV A;  2XD0 A;  3FIF A;  3V7S A;  5GMK m;  3M55 A;  3CC2 A;  2P4T A;  4N0A C;  2K57 A;  1JBM A;  1PSF A;  4LDX A;  1V29 B;  3VU3 C;  3DKM A;  3JB9 D;  2RB6 A;  1BIA A;  2LQ8 A;  3LX7 A;  3MEV A;  2K2V A;  2LCL A;  2FB7 A;  4LDY A;  1I5L A;  3CMA A;  2DXB A;  2OTJ A;  3V8J A;  3OYM A;  3GP8 A;  2K5I A;  2XKO C;  2XDD A;  4EMK A;  3FB9 A;  4J6W A;  4JRP A;  4MZT A;  5HY6 A;  4QQG A;  2JOY A;  2ZPH B;  1Y7X A;  4IUU A;  2LNV A;  4XTV A;  4A53 A;  4KUD K;  3VJP A;  4QQD A;  4XK8 E;  4M77 F;  3N5B B;  4F7U G;  2DTH A;  1WGS A;  1MGQ A;  1WJR A;  1AHJ B;  3M58 A;  2JTM A;  2Y4X A;  3OSS C;  3JSC A;  4M77 A;  2RH2 A;  3ER0 A;  3QG1 A;  3VKI A;  1KHC A;  4DQ2 A;  3MET A;  4PLI A;  5FU7 B;  5KCH A;  3JCM e;  1NZ9 A;  3P8H A;  1B34 B;  2DVE A;  2OTL T;  4LD6 A;  4M7A E;  5CO7 A;  3FRN A;  3C12 A;  1QVF A;  4Q5W A;  1H64 1;  2L5Q A;  4GY5 A;  3LW5 E;  4VUB A;  3TRE A;  2V8K A;  2P0P A;  3OYB A;  1XOV A;  3OYC A;  1YJW A;  3VV0 A;  4M78 A;  4DOW A;  3GOX A;  5FRN A;  3CCV A;  5LJ3 h;  3I56 A;  3RIR A;  4CRI A;  2H3J A;  4XTX A;  4FIB A;  2KVQ G;  4C92 D;  3CME T;  1Y96 A;  4MZP A;  2VYT A;  3OMG A;  4JJN K;  2LC4 A;  4A4H A;  2XK0 A;  1YHQ A;  2DD4 A;  3M9Q A;  3MEU A;  4C5H A;  1NJI C;  3SB2 A;  2MWP A;  1YI2 A;  1M8V A;  2RHX A;  5GAN 3;  2XDB A;  5GMK l;  4FT4 A;  4O6J A;  5L8R E;  3SWN C;  3M4Y A;  3WXM B;  3OY9 A;  1QVG A;  2O4X A;  2DIG A;  2B8A A;  2RK2 A;  3RKW A;  2QTX A;  4ZGD B;  3JAM E;  2RD1 A;  3JCM J;  2P0Q A;  2BUD A;  2DJZ A;  3GNG A;  2PU9 B;  2GF7 A;  3MP6 A;  3L2V A;  4BDZ A;  4Z02 A;  4C92 B;  1K73 C;  5GAN 5;  1U8R A;  3HPW A;  4O5V A;  2DXC A;  5GAM d;  1M1K C;  2CGH A;  5CQX A;  4MML A;  4M7A F;  1N9S A;  2DEQ A;  3JCM V;  3O8V A;  3JCM c;  3M54 A;  3GPL A;  3CCS T;  4B9W A;  3TU4 K;  4M7A A;  2QA4 T;  1VQ9 T;  3I55 T;  5CKH A;  1NPP A;  5GAN 7;  3OW2 A;  3A8L B;  3A8O B;  3WVE B;  3CCM A;  5LJ5 d;  2HQE A;  5GAN d;  4M75 E;  1G3W A;  2MI6 A;  2IG0 A;  3JRZ A;  3SD4 A;  3P8B B;  4FL6 A;  5GAN 4;  3OYA A;  1QVP A;  2RHU A;  3FEO A;  4IUP A;  3CBM A;  1KD1 C;  2DD5 A;  1TH7 A;  4HKE A;  4WF2 A;  5D6Y A;  4M7D G;  1Q82 C;  3OBW A;  4QVD A;  2LVM A;  5LJ3 j;  4JRQ A;  2F5K A;  1VQ4 T;  2ZPI B;  3QYH B;  3OS5 A;  1XQH A;  3LGL A;  4NOY A;  3PNW C;  4A4K A;  4RMO A;  3JCM P;  4C8Q E;  1WQW A;  3KUF A;  4NL2 A;  3GNF B;  1VQO T;  1YJ9 A;  3RES A;  4J6Y A;  1ZQ1 A;  1ZBX A;  4E7H A;  3J80 E;  3QSU A;  5I2S A;  5LJ3 f;  2DPP B;  5I21 A;  3OYK A;  1S72 A;  3FDR A;  1N27 A;  5GAO q;  4M7D C;  2FL7 A;  3V8L A;  2HQX A;  5GMK e;  1NJI U;  1XNI A;  4BE2 A;  1X75 C;  4EMG A;  3CCR A;  2PUO B;  1M1G A;  2VGN A;  1VQM T;  1M9S A;  3CPW S;  4E7I A;  2WSC E;  4F7U B;  5CK9 A;  4PJO G;  3X24 B;  3CC4 A;  4M75 F;  4MMK A;  5GAO n;  3JCM d;  1VQK A;  3OYG A;  1W4S A;  5KE3 A;  1JB0 E;  2VV5 A;  2DKG A;  3LH0 A;  3PMT A;  2EFI A;  3P8D A;  4JDS A;  2L8D A;  4M75 A;  5CQY A;  3CCU A;  2R5M A;  2KQW A;  4C0F A;  5A0G A;  4QW2 A;  1K73 U;  3CD6 A;  2BKD N;  4XU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...