2FB7A

Nmr solution structure of protein from zebra fish dr.13312
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
80
Chain Sequence
PYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCEPPKPIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sm-like protein, LSm-14_N (RAP55)
publication title NMR Solution Structure of protein from Zebra Fish Dr.13312
rcsb
source organism Danio rerio
molecule tags Structural genomics, unknown function
total genus 9
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fb7A00
2E41A 4EMHA 2Y90A 3JCMJ 1JRIA 4C8QE 5LJ3g 1BIBA 5GAOq 4EMKB 2E10A 4V2SA 4XU2A 5LJ3e 3BDUA 4M78D 2I2LA 5GMKm 3BY7A 4XU3A 1WQ7A 4C8QA 3BW1A 4M7DA 4F7UF 3JCMe 2DJZA 2FB7A 3M4GA 4NL2A 1U1SA 3QHSA 3SWNA 1I4K1 2DTIA 4M7AE 4RCBA 2JN0A 4M78G 4M7AB 2E65A 2K57A 1B34B 3RKWA 4M75A 4C92D 5LJ5j 3SB2A 5GAN7 4NOYA 4XTVA 1LOJA 4HA8A 5GMKe 2RD1A 2QTXA 2YLBA 1LJOA 5LJ5g 2EAYA 4MMKA 3JCMW 3JCMV 4WF2A 4XQ3A 5GAN6 4C92G 4M77B 3JCMQ 5LJ3j 2DVEA 4X9CA 4M7AC 3BFMA 5GAOr 1Y96B 2DXTA 5GANg 3V8KA 4A54A 3RKYA 4F7UE 5GANe 3HFNA 5I21A 4M77F 4F7UB 2E1HA 5LJ5d 4EMGA 4PJOB 2DXUA 4C8QD 3VU3C 3JB9H 4M7DD 4M77C 3JCMP 4EMKA 3EFRA 4XTWA 3JCMg 4QVDA 3FJPA 3HFOA 5GAOl 1I5LA 5GAMg 5GAN3 2VXFA 4OP0A 4PJOF 5GAMe 1M5Q1 5LJ3d 2RM4A 4M75D 5GMKj 4C92F 4C8QG 2YLCA 4M7DG 4PJOC 5LJ5f 5DY9A 4QVCA 3JCMd 1N9SA 3EFSA 4C92C 4M7AA 2DTHA 3V8LA 5GAN4 1B34A 4PJOE 1X01A 4RCCA 5GAN8 5GMKi 3JCMX 4DQ2A 4M75G 5GANj 1YCYA 4M77E 3V8JA 5LJ5h 3JB9J 3FIFA 3PGGA 5LJ3f 2DZCA 3V7RA 1KQ2A 4A53A 2FYKA 4HT8A 2EWNA 4M77A 3RIRA 1TH7A 3QSUA 2DEQA 4XTZA 3JCMf 5GAN5 3GIBA 3HSBA 1Y96A 4M78F 3L1AA 4XTUA 5LJ3h 4C8QF 5GMKl 1HK9A 5GAMj 5GAOm 3JB9I 4NL3A 4M7DF 4C92E 3JCMb 4F7UA 4M78C 3JB9D 4C92B 4M7DC 1KQ1A 3JCMh 5GANd 4J6YA 4PJOA 2DKGA 2DTOA 4MMLA 4M75F 5GAOp 2EJFA 4JRIA 4N0AC 1D3BB 1HXDA 3AHUA 4M75C 4XU0A 2E64A 3JB9G 4M7AD 2ZGWA 4J5YA 3RKXA 3L2ZA 1BIAA 1WNLA 1JBMA 4JRKA 5GMKh 2EJ9A 5GAMd 5GAOn 1H641 5GANf 1I8FA 4JLIA 3JCMc 5CAIA 4M78E 1I81A 2YHTA 3RUXA 3QO3A 4M7AG 4M7DE 4M78B 4C8QB 4M7DB 3QUIA 4J6XA 4J6WA 1LNXA 4M77D 4XU1A 1WPYA 1MGQA 2EJGA 3FB9A 3SWNB 4M78A 4XTYA 3V7CA 5GANh 4XTXA 2VXEA 4M75E 3RESA 3V7SA 4Y91A 5GAMf 3RERA 4M75B 3INZA 3JB9F 1WQWA 4M77G 4N0AA 4EMKC 4PJOD 4C8QC 4JUVA 4X9DA 4HT9A 5GAMh 3SWNC 1N9RA 1U1TA 4C92A 2DZ9A 2RA2A 2CGHA 4F7UG 4PNOA 1M8VA 5GAN2 4M7AF 2VC8A 4PJOG 5LJ5e 1D3BA 2HNIA 2RB6A
chains in the Genus database with same CATH superfamily
1KHCA 1RI0A 5D7UA 1F1BB 4ME7A 3FDRA 4NS5A 3MKDA 1VQKT 1G3SA 2DVJA 2FRYA 2FRWA 2PUOB 3CC4A 1RUWA 2HMAA 2KVQG 4QQ6A 4E7LA 2ABLA 1PSFA 3OS0A 2DK3A 2E70A 1E7OA 4XTVA 4RTUA 3TU4K 1AZEA 2RD1A 4B6MA 4RG2A 3GNGA 3JCMV 2C06A 3F70A 2RNAA 3H6ZA 3G6ET 1Y96B 5GANg 1VQOT 2DL7A 2MI6A 1ZA2B 2RHXA 1VIFA 4M77C 2CUDA 4KBMB 2CZ0B 2YLCA 2ECZA 4KT0E 3OYMA 3CC4Q 3EFSA 5GMKi 4KH0B 1WYXA 2BE7D 4DQ2A 1HJDA 2YSQA 4LXCA 5KYXB 1Q86U 3FEOA 1K73U 1X2KA 3QBYA 5LJ3f 4A4FA 1ZUKA 4A53A 4M77A 3RIRA 1QVFA 4PJJA 1M8MA 3JCMf 4BACA 4M78F 3L1AA 5GAMj 2X4YA 4C5EA 4IUTA 3PFSA 1UGPB 4DBRA 3UATA 3DB3A 4D8KA 2DFUA 2YDLA 3JB9G 5HCKA 1V1CA 1WLPB 2MOXA 3NTIA 4ELZC 2LT4A 5HK0A 1T3SA 5CAIA 1XTDA 1JEGA 4M7AG 3QWXX 3VS2A 2D0QB 4J9GA 1EX4A 2EQMA 2F5KA 1KSWA 2CZ6B 3VRZA 1N8RR 4OB2B 1WA7A 1WQWA 1BI0A 1UUEA 2F2WA 3FJ5A 4C0DB 1GL5A 4ZGJB 3GOXA 2ZPGB 1ZA1B 2DLPA 3A8HB 2YWWA 3UA6A 2L89A 2HEQA 2CH4W 3ZBDA 1KG1A 2F2XA 2KYMA 1T3LA 4NL2A 4LN2A 3CCMA 4OGEA 3NGPA 3CXCP 5LJ5j 2IPOB 2X3XD 3LYIA 2K7AA 4J9FA 1M2VA 1N5ZA 3OYFA 3H0HA 2K2MA 2NUPA 4C5IA 4R56A 2EQJA 2YUPA 5D6YA 2GFAA 2E1HA 2EYWA 2JOYA 4DA4A 3NHNA 2E6NA 2DXUA 2V1RA 2GGRA 2LNHB 2RO0A 5GAOl 4ATOA 1RAIB 4LDWA 5GAMe 1KFZA 1M27C 4VUBA 2LRQA 1N9SA 5GAN4 2RQVA 2M1HA 3A1PA 4E7ZA 1D0XA 3CCMQ 2KE9A 2PZ1A 4E7SA 3PGGA 4A4GA 3CCQA 3RNJA 1V76A 1SEMA 2MCNA 3CCEA 4PJOE 3WVEB 4C8QF 2QQAA 2B86A 3OQ5A 2QA4A 3JB9D 3JRZA 2YRVA 3JV3A 1R8OB 2MF2A 5GAOp 1VQPT 4M7AD 4AFQC 3M5AA 5FRMA 4X1VA 4JRKA 2QI2A 1I0CA 4E47A 1YI2A 1PSEA 5GANh 2QAZA 3V7CA 2LX7A 3H0FA 1SHFA 1ZUUA 3CCQQ 2JTEA 4FT2A 2PNIA 4JZ4A 3CCEQ 4OMNA 1Z9ZA 4PJOG 3D7SB 3N5BB 5LJ5e 1YCYA 2QK0A 4AG1C 3CMAT 2IIMA 2RHYA 3G7ZA 2COYA 1BIBA 4AFZC 3A8MB 1XNIA 2O4XA 5CKBA 4TVRA 2GFUA 1U06A 2M9UA 2DTIA 4RCBA 1T0JA 2CP6A 1YI2Q 1YJWA 1PRMC 2A36A 1XOVA 4JRQA 2CP7A 3JCMW 1SF9A 4C92G 4ZN1A 1M2OA 1RLPC 1N6AA 2EQKA 2DXTA 4A63B 2GTJA 1MV0B 3CQTA 1Q82R 3DB4A 3CCUA 1BI1A 4M77F 1WXTA 2O2OA 2CP0A 3TVTA 2OI3A 3P8HA 1X75C 3H9NA 4WTOB 3CMEA 2CT3A 2X3WD 1FYNA 4QKUA 1WFWA 3E9FA 3DLMA 4KRTA 2J6OA 2Z0WA 1QVGA 4J9DA 4BY6B 1VQMT 1YJWQ 1FMVA 3A8OB 1AZGB 4JPBW 4MZPA 1WX6A 2DA9A 3EH1A 2H8HA 5EC7A 1NBEB 3MP8A 3OYEA 3E2UA 4F7UA 4OB3B 4M7DC 4WCIA 4ZNXA 3CCUQ 1PD1A 2E64A 1YJNA 3EG0A 1RADB 2ZGWA 3M56A 1WNLA 2VWFA 3QWYA 3JCMc 3CMEQ 3QUIA 4RUGA 1WZOA 1WPYA 4FYXB 4HCZA 5IN1A 1OYXA 1PC0A 1VQ6T 3G71Q 2CT4A 3OYNA 4C5HA 2XU8A 4PJOD 1W2BS 2P0KA 1TSFA 1VQLA 1S72A 1Q7YC 2PVGB 1ZLMA 4Q5WA 5GAN2 1VIEA 4PJLA 4EMHA 2DL8A 1AD5A 4BE2A 2YT6A 1WHGA 5LJ3g 1BCMA 3HP9A 2K4YA 1YJNQ 3I55A 1VA7A 2FB7A 5L8RE 2VASA 3QZ9B 4M75A 4C92D 3TCJA 2PUKB 1UFFA 4MZTA 2ZPFB 1LJOA 3TREA 3QDRB 1OPKA 4M77B 1M4ZA 2XHCA 3MHXA 4J7IA 3OS2A 3DKMA 2LCLA 1VQLQ 1UGQB 2SEMA 3CCJQ 1S72Q 2CSIA 4F7UE 3PNWC 3HFNA 5FWCA 3CCVA 5A0DA 5KE3A 1YJ9A 2M02A 2Y4XA 3OW2S 2C0OA 3HRTA 1M3AA 1CSKA 1RABB 1ZUYA 3I55Q 2YXYA 3EH2A 1QWFA 1M9SA 1NE8A 4PFPA 2LQKA 1M90C 4AFSC 2DRKA 1ZHIA 2E12A 3OS5A 3GIBA 5CK9A 2ROTA 2LDMA 1K9MR 3E9GA 3J81E 3NMZC 1H3HA 1JJ2P 1IRXA 4OB0B 2C0TA 3I9QA 4XU0A 3CCVQ 2OX7A 5CKEA 1YJ9Q 1NJIR 5GAMd 3PTAA 2KYBA 2QQBA 4QQGA 1U8RA 2KMTA 4KULA 5CVIA 4J6WA 1WHKA 4IUPA 2KSSA 4M75E 1AOJA 4Y91A 1TUDA 1LCKA 4AFUC 4PJMA 4E7IA 3I5SA 1M2VB 1WXUA 1W70A 2LCCA 2CS7A 2NUPB 3OBYA 1ZSZC 1KQ2A 2FEIA 2JJ9A 2LT1A 2HL5C 3M54A 1YHQT 4BD3A 3JCMJ 1EIFA 2FZGB 4KH1B 1OU9A 3EGXA 1YN8A 1TUCA 1FMWA 3R6NA 3M4GA 2H3JA 1K73C 5FRNA 1M1KR 4OMLA 5I2SA 2CZ7B 2E65A 3GLXA 1ZSZA 1I1JA 3CBOA 1VQ8A 4OMMA 2AZSA 2ROLA 1BI2A 3OYJA 4X9CA 2MWPA 3URGA 1LPLA 4E2FB 2NUZA 4PFZA 1OEBA 3MEAA 5LJ5d 1JB0E 3VJPA 1PHTA 1QQJA 2RK1A 2BTTA 4XTWA 5KYNA 4JS4A 4UC4A 2VXFA 1JO8A 1MMDA 2M51A 3X26B 2ZPEB 4GLMA 3M58A 2IVWA 2EFIA 2NLUA 4FYVB 2JW4A 4RKUE 3X20B 3UT1A 1WI7A 1Y57A 1VQNT 2KI7A 2FYKA 3PVLA 3MO8A 4XTZA 3TEEA 5LJ3h 4M7DF 4NL3A 2OTJT 5GAOm 3THKA 2EQUA 4PK4A 3JCMh 4J6YA 3UPUA 3AT1B 3EFOA 1NYGA 3OSVA 4FSSA 3RKXA 5GAOn 1JBMA 2PQWA 2XDPA 2V8KA 2EYZA 2O4XB 4M78E 3TSZA 3C94A 1JU5C 1NPPA 3INZA 4C8QC 2VV5A 4HT9A 1ABOA 3I56A 3CD6A 4CC4B 4BB7A 3QYGB 4FSXA 1D3BA 2BIVA 2DD5A 3OY9A 5DM7R 1KC8C 2XIDA 3VRYA 2BUDA 1BK2A 2KR3A 2KXDA 4C8QA 3QYHB 2QQSA 5CCAA 2K9GA 5CQYA 1OOTA 1M90U 2JN0A 4M78G 2DL4A 4NOYA 1YFNA 3G4SQ 2CP5A 4J9BA 3RR6A 1Q95G 1HD3A 3Q1JA 5IHIA 2RHUA 4F04B 5GAOr 3S6WA 3NTHA 3I56Q 3CD6Q 2EGAA 5I21A 4F7UB 1KQSA 3VU3C 2OAWA 1TOVA 1O9SA 1UGSB 3EFRA 2RMOA 1I5LA 3M9QA 2HD0A 2RF0A 1VYTA 5DY9A 1EFNA 3IQLA 3EG9A 1B34A 5FLXE 1X01A 4Z8AA 5I11A 4LUEA 4OVAA 1WJRA 2HQEA 4QVZA 2P4RA 3CPWP 2DZCA 2DPPB 4ORZA 1AWWA 3LGFA 2HQXA 2M0OA 2D9TA 3JB9I 5GMKl 4RG8A 2MYSA 4JZ3A 4LDUA 2HKQB 2QEXT 3M57A 2LVMA 5ECAA 2J6KA 3M59A 3L2ZA 3QXEB 4RTYA 1IXDA 4HVUA 4J6XA 1SSFA 3HKSA 2KXCA 2KNBB 4XTXA 1NLOC 5GAMf 3VS4A 2QA4T 4M75B 2YUNA 2A7YA 4ZGDB 5CR2A 4JUVA 3M55A 2HKNA 2WSEE 5AT1B 1VQ9A 2KRSA 4L5GA 3SWNC 5CKDA 3PIOA 3MCAB 1K8AR 1KD1R 4EIKA 4XAXB 3HPWA 1W6XA 5IH2A 3CCRQ 3PMIA 4M78D 3LLRA 1Y0MA 4FL6A 3BW1A 2OTLQ 3S3NA 1TG0A 2KBTA 4PKCC 3SWNA 1R0BG 3I5RA 4PLIA 4WF2A 1QKXA 3NTKA 1SSHA 3JCMQ 5C0MA 1Q81C 1VQ9Q 2DIGA 1DJ7B 2E3IA 4A54A 2YRDA 3LWHA 3OYHA 4BDZA 1K9MU 3KXTA 1PM3A 3OYCA 1UEBA 2DM1A 2JXBA 1M5Q1 2PVOB 2EGEA 5LJ5f 4C92C 2LNVA 1PKSA 1VUBA 2EKHA 3C4SA 3EG3A 5IXBA 4YTLA 4J83A 2EYXA 4M77E 1TUGB 1VQKA 3X24B 1W4SA 5KYUA 5EG2A 2DERA 1AWXA 4LNPA 1HK9A 3JAME 1WHJA 4JJBA 2KY9A 4JJDA 1KC8U 5CQXA 1GFDA 2M0YA 1YITT 4JRIA 5J26A 2ENMA 1EZZB 3CCLT 1VQ7Q 2EIFA 4ELYC 1TS9A 4J5YA 1E6HA 2ED1A 3G6EA 3CPWS 1VQOA 1GXIE 4M78B 2EJGA 2L2PA 2CP3A 5C6SA 1OV3A 5IT9E 6AT1B 3V7SA 3JB9F 4M77G 4EMKC 4Y92A 1ZSZB 1VQKQ 1W2BP 3X25B 4BI3A 1N9RA 4IIMA 5CIUA 3REAB 1WHHA 1RAAB 4FU6A 2FVUA 4M7AF 1I07A 2FZKB 1V29B 3MP1A 4K11A 1KJWA 1HSQA 4RTZA 2HDAA 3L2RA 2L3QA 1N27A 2JMAA 3J80E 2GNCA 1WQ7A 2XKOC 3FLGA 5FU7C 1ZX6A 3G6EQ 1G3WA 1VQOQ 3META 3HRUA 4MZMA 2L3PA 3O5ZA 3OYYA 1VQ4T 1N8RC 4MMKA 4ZGEB 2PU9B 1J3TA 1R0CB 2DETA 1RACB 5M9OA 2NYSA 1D0ZA 1MV3A 5DLQE 3JB9H 5FW9A 2X35A 4D8DA 3EFOB 2A08A 2GQIA 3OW2P 3CEYA 5FU6C 2DF6A 1C1AA 3M0UA 1RAEB 2P0PA 2DAQA 1BU1A 4RTWA 1YNZA 2FO0A 1TH7A 2QGFB 4HCKA 4HXJA 3RDVA 1WJSA 2RQUA 2ZPBB 4R55A 2Y4YA 4GLKA 4N0AC 1D3BB 3HRSA 4BI4A 4OMFB 3CC7T 5GMKh 3G71A 2HBWA 4BI8B 1ZBJA 2J05A 4C8QB 4M77D 1H3ZA 1O75A 1QKWA 1TU0B 1QCOA 3SEMA 1XQHA 2VXEA 3RESA 1SG5A 2A28A 4N0AA 3LH5A 3MEUA 1Q81U 2JVVA 1SPKA 1U3OA 4IIOA 2GBQA 2DXCA 1K0XA 3GPLA 2L3SA 3CC2T 2D0NA 4DOVA 1JRIA 5GAOq 2RI2A 2X51A 2RQRA 2JZ2A 4M7DA 2DJZA 2V8JA 1KIKA 5A2QE 3P8DA 1UJ0A 2JNGA 3EG9B 1B34B 1IGQA 1PRLC 1X6OA 2KQWA 3EHRA 2RJFA 8AT1B 3CCJA 3EGUA 1PKTA 1RL2A 1LOJA 2ATCB 3C12A 3EAEA 2DRMA 2EAYA 1K9AA 3RKYA 4DEXA 4FCYA 4EMGA 1ZBXA 1C6VX 1GCPA 3JCMg 4KUIA 5GAMg 5A0GA 1Y7XA 4C92F 4FW2A 2C0IA 4QVCA 1VQ8T 4JS5A 2DTHA 4GBQA 4MDWA 3CMAA 5GANj 1K0SA 1SKUB 3H0IA 3JB9J 2O9SA 3VS6A 1MMNA 1Q86R 3QKJA 1TXQA 5KYYA 3V7RA 5KYXA 3J7AF 1VQPQ 4HT8A 2LC4A 3O8VA 2IG0A 4A4KA 1OZ2A 4LE9A 4D6WA 3CCST 2ED0A 2NWMA 2ZAEA 1Q82C 2DTOA 5KCHA 2MWOA 1UHCA 1BBZA 1UGRB 2PTKA 1E6GA 2E4HA 4JJCA 1VQ5T 2BZ8A 3CXCA 1X69A 2FPFA 1K8AU 4IUUA 4ZTFA 3RMSA 4M7DE 3TQ7P 3VS1A 1LNXA 4XU1A 4JJNK 1IHVA 2QGGA 1MGQA 3SWNB 1HYOA 2JT4A 3QJYA 3CMAQ 1N8RU 4II1A 1YIJT 2MAMA 4ANJA 2GQVA 3VS5A 1UB4A 3GP8A 4M4ZA 7AT1B 3JSCA 4F7UG 4PNOA 1Y07A 1UJYA 4Z88A 2JTMA 4QW2A 4JDSA 1B07A 2Y90A 1QVFP 1VQMA 2VKNA 2I0NA 2DIQA 2DMOA 4XU2A 2X4WA 2E5QA 5FWBA 2P0QA 2EYYA 3QHSA 2PVDB 1NPRA 4RTTA 1D1CA 3WVDB 3SB2A 4CI0C 1BI3A 4CC3A 1ZQ1A 5HKCA 2DVEA 1M1GA 5GANe 1X27A 1VQ6A 2FL7A 2X9HA 2KRMA 2R5AA 5GAN3 1VQMQ 4OGCA 1G5VA 1IHWA 2NUTA 3WXMB 1UDLA 4PJNA 4KGZB 4M75G 4E7KA 2EW3A 2CZ1B 2AK5A 3SHWA 1PNJA 3ME9A 3QSUA 2W10A 3CC2Q 3CC4T 4FYWB 2K3YA 4R0KA 5I2MA 3GBQA 5CO7A 2CDTA 1VQ6Q 1OULA 3M0QA 1WIEA 2OJ2A 1MNDA 5J3BA 3FRNA 4J9HA 1QCFA 2P84A 2KDSA 1KQSS 9ATCB 1MHNA 3RUXA 1I5OB 3DLLA 2R57A 2ZZDA 3FB9A 2E5KA 2K3BA 4XTYA 1SRLA 2COWA 4BE1A 1AT1B 3BE3A 3L42A 3VYGA 2O88A 5GAMh 3LGLA 3OYDA 2ZPHB 1FX7A 1M8VA 4E7JA 2RJCA 1Y71A 1K9MC 2HNIA 2RB6A 2E41A 5IXFA 4PFOA 1VYUA 2E10A 1NJIC 4BUGA 3OYAA 4ESRA 2LJ0A 2HQHA 3G4SA 2WSFE 1I4K1 3QIIA 2K57A 3NPFA 4Z89A 2LX9A 4OMPA 1ARKA 3OB9A 3CCSQ 2YLBA 3OS1A 5GAN6 4M7AC 3C95A 4LDVA 1QVFS 1Q82U 3ZEHA 3V8KA 2LZ6B 1D1AA 2QDLA 4BY6C 4PLLA 3FJPA 3HFOA 3H8ZA 1SRMA 4BDYA 4M75D 4C0FA 3HTRA 3U23A 4M7AA 3JCMX 2JM8A 2ZCFB 1M1KC 5LJ5h 3FIFA 2KT1A 3EGDA 1D1BA 1P92A 3VYHB 3SFMA 2DEQA 3QZ5B 3ULRB 3LH0A 2DE0X 3CCMT 2GF7A 1FXXA 3MP6A 1HXDA 5KE2A 1ZSGA 2COZA 1BIAA 1OQKA 2XDDA 3GF5A 2EQIA 2LMJA 2DL3A 4DBQA 2LJ1A 2MIOA 4JLIA 2QTVA 2LCSA 3QO3A 4M7DB 1PG5B 4A4EA 3L2QA 2XMFA 1YHQQ 2VB6A 4E7HA 1AEYA 1JQQA 4IURA 4PL6A 4Z02A 3L2WA 2DZ9A 3A8LB 1QP3A 3OYGA 1UG1A 4C0GA 3CCRA 5CKHA 2JMCA 2XI9A 1BKBA 2LJ3A 3OSSC 1QVGP 4J9CA 1X43A 2OTLA 2DX1A 1VQNA 3H41A 2JS0A 3CCQT 2LP5A 4C8QE 4V2SA 4CC2A 2VYTA 2RJEA 2OTJA 3CCET 4AMCA 4M7AE 3UF4A 1FWZA 1QMCA 3RBBB 1X6BA 2A37A 5KYWA 5HK3A 1W1FA 1JJ2A 5KYYB 1GCQC 5LJ3j 1OX9A 8ATCB 4EDUA 2QDYB 3EG2A 1YI2T 1NEBA 3T9NA 4F17A 2CP2A 3E1SA 4RTXA 3TSWA 1RLQC 2AT1B 1K76A 2EYQA 2B8AA 1VQNQ 1WHLA 5IHNA 1MMAA 3M0TA 2KRNA 4CC7A 4C8QG 4PJOC 4LDYA 2OTJQ 2YUQA 1GCQA 3V8LA 5GAN8 4FW1A 2R58A 4IUVA 1AWJA 5IAYA 1QVPA 2H3EB 4KUDK 4Y28E 3EHQA 1C0MA 3VS0A 2LQ8A 3PMTA 2D1XA 1UE9A 1VQ7A 4OMQA 2KT8A 3M53A 5GANd 4PJOA 2RK2A 2A0FB 2DKGA 2KGTA 3VS3A 4OF1A 3ASKA 1GBRA 3BDLA 3ZFJA 1YJWT 1NJIU 2O31A 2K3XA 2RPNA 2BZYA 3E19A 4F16A 1M3BA 1Z9QA 1I81A 4DEYA 3M0PA 2FHDA 3CCUT 2HBPA 2O9VA 1G8XA 1UTIA 5IHKA 3LX7A 4N4HA 2VUBA 2K5IA 1U1TA 4C92A 2RA2A 1QW1A 1JXMA 3CMET 3G71T 1K4US 2X4XA 1RAGB 1VOMA 2KEAA 3EGXB 4C0ZA 3VS7A 5LJ3e 2JUFA 2RHZA 1MNEA 3BY7A 2XK0A 2RH2A 3JCMe 1M1KU 1U1SA 2NUTB 2QEXA 2FPDA 2E3HA 3A8GB 2QASA 1YJNT 4DBFA 1QVGS 4F14A 5KH6A 3SD4A 1TTHB 3ER0A 1OPLA 3KFVA 1K1ZA 3QPHA 3FC3A 4J7FA 2KK4A 4C8QD 1K8AC 1KD1C 4EMKA 2D6FA 2DBKA 1PD0A 2RM4A 4B9WA 1VQLT 4FM4B 3CCJT 1S72T 2F5TX 4RCCA 2RQTA 1YCSB 3ZL7C 3I35A 5L23A 2QEXQ 1OU8A 4A4HA 1QCNA 2EWNA 3OYIA 3LWIA 3I55T 1Q7YR 2AKLA 4C92E 3G1JA 3UDCA 1AWOA 2ZPIB 3OYKA 3OYBA 2LQWA 3AHUA 1CKAA 2MK5A 2QA4Q 2QYZA 4FIBA 1GRIA 2DXBA 2CUBA 3KBGA 2DYBA 1OX8A 2JS2A 4OMOA 2V1QA 3CCVT 4J9IA 5KCOA 1YJ9T 1KHIA 1NEGA 1D09B 4KGXB 2DBMA 2DJQA 4EPCA 2DD4A 2RN8A 2A3LA 2VGNA 4QQDA 2P4TA 2CSQA 3RMQA 2HCKA 4B9XA 3CPWA 2J7IA 2L5QA 3BDUA 2I2LA 2HL3A 4XU3A 4L59A 1B3QA 2L0AA 2MPXC 3CXCS 1YITA 4M7AB 4GY5A 1M90R 2L3RA 2XD0A 4JRPA 1JXOA 5GAN7 3CCLA 1XJWB 1ABQA 2L8DA 3EGDB 5GJVB 1RAFB 5CKFA 4XQ3A 1OI1A 5LL6S 1PWTA 1IZ6A 1NYFA 4RTVA 1AHJB 1SHGA 2G3RA 5A0LA 1B7TA 2DEUA 1CKBA 4AT1B 1M1FA 4PJOF 5DLOA 1WXBA 2QG9B 3GNFB 3X28B 4AG2C 1VQPA 2F69A 2QQ9A 4XK8E 3S3MA 2CYZB 1YITQ 3VV0A 5HY6A 2HSPA 2E6ZA 3CCLQ 3QJ6A 5GAN5 1Y96A 4XTUA 3RERA 1QP2A 1M30A 1WHMA 1GFCA 2FZCB 2DYIA 3UWNA 1TWBA 1BYMA 2M16A 3OBWA 4M75C 2KROA 1FMKA 1D0YA 1VQ4A 1U5SA 2EPDA 2EJ9A 2V8IA 1KK7A 5GANf 2BE9B 2K2VA 3M0SA 1KQSP 2O01E 2YHTA 1K73R 4OB1B 2GCXA 4FYYB 2K79A 2VGMA 4J8OA 3OMCA 4ZN3A 5KYWB 1VYVA 2HSEB 1AVZC 3A98A 2RI5A 2RHIA 2VC8A 4C5GA 4IKFA 1KD1U 3VKIA 2DO3A 2XICA 2SRCA 4KGVB 2AIRB 4C0DC 3KUFA 3MEWA 3R6OA 5FROA 1UECA 1G2BA 1VQ4Q 2OAUA 2QXFA 5GMKm 2EKOA 1PCXA 4LUDA 2YRCA 1MMGA 4N4GA 2AKKA 2LQNA 3CC7A 4HA8A 3NFCA 5LJ5g 3BFMA 4L6V5 1ACMB 2CKKA 2BKDN 1IO6A 2ESWA 1H92A 4PJOB 1BCOA 3JCMP 1G83A 4QVDA 3G4ST 4OP0A 1A0NB 5LJ3d 5GMKj 4M7DG 2F1LA 3HL8A 3I56T 2EBPA 1W2BA 1BB9A 3CD6T 3JCMd 3S3OA 5D6WA 1GBQA 3SDZA 3V8JA 3CC2A 3L2UA 5KYUB 1NG2A 2D8JA 2VVKA 3C0CA 3PIPA 1X6GA 1RI9A 3VUBA 2W0ZA 3CC7Q 1NLPC 4IUQA 2JM9A 2XDBA 4M78C 4C92B 4X34A 4N4IA 2K6DA 2AZVA 3CBMA 1WGSA 2EJFA 1KC8R 2EVRA 2RJDA 1G3YA 4LD9K 1H8KA 2AHJB 2FG0A 2HZYA 2R5MA 1YP5A 4P5NA 4BE0A 3CBPA 5J39A 4LDXA 4M78A 4JLGA 2J06A 4DOWA 1Q86C 4RMOA 2CREA 4HVVA 3VUZA 2X4JA 3MJXA 3OW2A 3P8BB 3QDFA 3CPFA 3REBB 2XG8D 2F2VA 2DILA 3OYLA 1R77A 1OZ3A 4EMKB 2K5LA 1QLYA 1WDXA 4F7UF 3CCSA 4ZTJA 1UGVA 4HCBA 2MMPA 4HVWA 3MPUB 3A5ZB 3RKWA 2DL5A 3PVQA 1VQ5A 1QWEA 3CCRT 5GMKe 1G3TA 2QTXA 1NZ9A 2J6FA 2OTLT 4HCCA 5FU7B 2DNUA 1VQ8Q 1Q7YU 1LVKA 2FPEA 4M7DD 5AYFA 1YIJA 1S1NA 3MEVA 5GJWB 2V26A 1VQ9T 2D8HA 2QQRA 3QG1A 3OMGA 2KAFA 2RI3A 3L2VA 1X2QA 2CH4A 4MDXA 4O6JA 4E6RA 3EG1A 1M3CA 1IB8A 1VQ5Q 1IGUA 3OA6A 3HSBA 4J9EA 2EGCA 2K5FA 5FU6B 4FT4A 1WJQA 3HHTB 3PT9A 3JCMb 2YUOA 1KQ1A 1JJ2S 4O5VA 2GTOA 3LW5E 4M75F 4MMLA 5I22A 1YIJQ 1NM7A 5D6XA 1IREB 4DBHA 1UHFA 4HKEA 1YBYA 2LTOA 1H641 2JTFA 1I8FA 1YHQA 1RAHB 3UA7A 2WACA 1T0HA 4LD6A 4CRIA 2WSCE 3M4YA 1YWOA 1VQ7T 3M0RA 4X9DA 1YWPA 2G6FX 1Q81R 4QT7A 2CGHA 2HAXA 1MUZA 2RQWA 3PE0A 2BZXA
chains in the Genus database with same CATH topology
1KHCA 1RI0A 2LT1A 2X4XA 3M54A 1YHQT 3CC2T 4ME7A 4BD3A 3JCMJ 4DOVA 1JRIA 1EIFA 3FDRA 4NS5A 4C0ZA 2RI2A 5GAOq 1VQKT 5LJ3e 1G3SA 2JUFA 2RHZA 2PUOB 3BY7A 3CC4A 2JZ2A 2XK0A 4M7DA 2RH2A 3JCMe 2DJZA 2V8JA 3M4GA 1M1KU 2H3JA 1U1SA 2KVQG 3P8DA 4QQ6A 5A2QE 4E7LA 1K73C 5FRNA 2QEXA 2JNGA 5I2SA 2CZ7B 2E65A 1B34B 1X6OA 2KQWA 3GLXA 3CBOA 1PSFA 2RJFA 3CCJA 1VQ8A 3A8GB 2DK3A 2E70A 4XTVA 1RL2A 1LOJA 3EAEA 3C12A 2RD1A 3OS0A 3TU4K 1YJNT 1QVGS 4RG2A 2EAYA 3GNGA 3JCMV 1BI2A 3OYJA 2C06A 3F70A 4X9CA 5KH6A 3H6ZA 2MWPA 3G6ET 3SD4A 1Y96B 5GANg 3URGA 2MI6A 1VQOT 3ER0A 3RKYA 3MEAA 3QPHA 5LJ5d 2RHXA 3FC3A 1VIFA 1JB0E 4J7FA 2KK4A 3VJPA 1ZBXA 4C8QD 4EMGA 4M77C 2RK1A 1K8AC 1KD1C 4EMKA 4XTWA 3JCMg 2D6FA 4JS4A 4KUIA 4KBMB 5GAMg 2CZ0B 2VXFA 4UC4A 5A0GA 2RM4A 4B9WA 1Y7XA 4C92F 2YLCA 1VQLT 4FM4B 3X26B 2ZPEB 4QVCA 4KT0E 3OYMA 3CCJT 1S72T 3EFSA 1VQ8T 2F5TX 2DTHA 3M58A 4JS5A 2IVWA 4RCCA 5GMKi 4DQ2A 4MDWA 3CMAA 5GANj 2EFIA 2NLUA 1Q86U 3FEOA 1K73U 4RKUE 3X20B 3JB9J 3QBYA 3UT1A 5LJ3f 3QKJA 4A4FA 4A4HA 1VQNT 3V7RA 3J7AF 4A53A 2FYKA 4HT8A 2EWNA 2LC4A 3MO8A 2IG0A 3O8VA 4M77A 3RIRA 4XTZA 3TEEA 3JCMf 3OYIA 3I55T 3LWIA 4A4KA 4BACA 1OZ2A 3L1AA 4M78F 5LJ3h 2X4YA 5GAMj 5GAOm 4NL3A 4M7DF 2OTJT 4C5EA 4C92E 4IUTA 4D6WA 3CCST 3PFSA 1UGPB 2EQUA 3UDCA 3JCMh 4J6YA 1Q82C 2DTOA 2ZPIB 2MWOA 3DB3A 5KCHA 1UGRB 3UPUA 3OYKA 3OYBA 3AHUA 1VQ5T 3JB9G 3CXCA 3OSVA 1K8AU 3RKXA 3NTIA 4ELZC 5GAOn 1JBMA 2PQWA 2XDPA 4FIBA 2V8KA 2LT4A 4IUUA 2DXBA 4ZTFA 2O4XB 5HK0A 5CAIA 1XTDA 4M78E 3RMSA 3KBGA 4M7AG 4M7DE 2D0QB 3C94A 1LNXA 4XU1A 4JJNK 2EQMA 1MGQA 3SWNB 2F5KA 3QJYA 1NPPA 1N8RU 3CCVT 4II1A 2CZ6B 3INZA 5KCOA 1YIJT 1YJ9T 1KHIA 2MAMA 1WQWA 2GQVA 4OB2B 1BI0A 4C8QC 1UB4A 2VV5A 3GP8A 4HT9A 4C0DB 3JSCA 3I56A 3CD6A 4F7UG 4PNOA 4ZGJB 1Y07A 4BB7A 4EPCA 3QYGB 2JTMA 2DD4A 4FSXA 4QW2A 3GOXA 1D3BA 2BIVA 4JDSA 2ZPGB 2DD5A 3OY9A 2A3LA 2VGNA 2Y90A 2XIDA 5DM7R 1KC8C 1VQMA 3A8HB 4QQDA 2P4TA 2DIQA 2BUDA 3RMQA 2L89A 4B9XA 3CPWA 4XU2A 2L5QA 3BDUA 2I2LA 4XU3A 3ZBDA 1KG1A 4C8QA 2X4WA 2E5QA 3QYHB 2P0QA 4L59A 2QQSA 4NL2A 5CCAA 3QHSA 2PVDB 3CCMA 4OGEA 5CQYA 1NPRA 3CXCS 1M90U 2JN0A 4M78G 4M7AB 1YITA 4GY5A 3WVDB 2L3RA 5LJ5j 3SB2A 4CI0C 4JRPA 1BI3A 4NOYA 5GAN7 3CCLA 2XD0A 1ZQ1A 5HKCA 3LYIA 2L8DA 5CKFA 4XQ3A 1OI1A 3Q1JA 5LL6S 2DVEA 3OYFA 1IZ6A 2RHUA 5GAOr 3S6WA 1AHJB 1M1GA 2G3RA 3NTHA 4C5IA 4R56A 2EQJA 5GANe 5D6YA 5A0LA 2GFAA 5I21A 4F7UB 1KQSA 2E1HA 2JOYA 4DA4A 1VQ6A 2E6NA 1QVFA 2FL7A 2DXUA 3VU3C 1O9SA 1UGSB 2RO0A 3EFRA 5GAOl 1I5LA 2R5AA 4ATOA 5GAN3 1M1FA 4LDWA 4OGCA 4PJOF 5GAMe 5DLOA 1G5VA 3M9QA 2HD0A 4VUBA 3GNFB 2LRQA 3X28B 5DY9A 1N9SA 1VQPA 2F69A 3WXMB 5GAN4 1B34A 2M1HA 1X01A 5FLXE 2QQ9A 4XK8E 4OVAA 1WJRA 2HQEA 4M75G 4E7KA 2CZ1B 3S3MA 2CYZB 4QVZA 3PGGA 3VV0A 5HY6A 2DZCA 4A4GA 3CCQA 2DPPB 3ME9A 2E6ZA 3LGFA 3QJ6A 3QSUA 2HQXA 5GAN5 3CCEA 2M0OA 1Y96A 2D9TA 4XTUA 1QP2A 3WVEB 4C8QF 5GMKl 3JB9I 3RERA 4PJOE 2QQAA 4RG8A 3OQ5A 3CC4T 2QA4A 3UWNA 3JRZA 4LDUA 3JB9D 2K3YA 5I2MA 2YRVA 1R8OB 5CO7A 2MF2A 5GAOp 2QEXT 1BYMA 2M16A 3M57A 3OBWA 2LVMA 4M75C 1VQPT 4M7AD 5J3BA 1VQ4A 3FRNA 3M59A 3M5AA 5FRMA 3L2ZA 3QXEB 4JRKA 2KDSA 2EJ9A 2QI2A 2V8IA 1KQSS 5GANf 2K2VA 1MHNA 3RUXA 2O01E 2YHTA 4OB1B 4E47A 2GCXA 4J6XA 3DLLA 2R57A 1SSFA 2VGMA 1YI2A 1PSEA 2ZZDA 3HKSA 3FB9A 5GANh 4XTYA 3V7CA 4XTXA 5GAMf 2QA4T 4BE1A 4M75B 2A7YA 4ZGDB 4J8OA 3L42A 5CR2A 3OMCA 4ZN3A 4JUVA 3M55A 2WSEE 3VYGA 1VQ9A 5GAMh 4L5GA 3SWNC 5CKDA 3LGLA 4FT2A 2RI5A 3OYDA 2RHIA 1FX7A 2ZPHB 1M8VA 2VC8A 4E7JA 4PJOG 4C5GA 3N5BB 3PIOA 2RJCA 1Y71A 1KD1U 3VKIA 2DO3A 2XICA 3MCAB 2HNIA 1YCYA 5LJ5e 1K9MC 2RB6A 3CMAT 2E41A 4C0DC 4XAXB 3KUFA 3HPWA 2RHYA 3G7ZA 3MEWA 3R6OA 1BIBA 2E10A 3A8MB 3PMIA 5FROA 1XNIA 1NJIC 4M78D 2OAUA 2O4XA 2QXFA 3LLRA 5GMKm 4BUGA 4FL6A 5CKBA 4TVRA 3BW1A 2EKOA 3OYAA 2GFUA 3S3NA 3G4SA 2M9UA 2WSFE 4PKCC 1I4K1 2DTIA 3SWNA 4RCBA 3QIIA 2K57A 1YJWA 4N4GA 2LX9A 1XOVA 3OB9A 4JRQA 3CC7A 4HA8A 3NFCA 2YLBA 3OS1A 5LJ5g 3JCMW 4PLIA 4WF2A 3NTKA 5GAN6 4C92G 4ZN1A 3JCMQ 4M7AC 3C95A 4LDVA 5C0MA 3BFMA 1N6AA 1Q81C 4L6V5 3ZEHA 2DIGA 2EQKA 2DXTA 1DJ7B 1Q82U 4IKFA 2CKKA 3V8KA 4A54A 3DB4A 3CCUA 1BI1A 2BKDN 4M77F 3LWHA 3OYHA 4PJOB 4BDZA 3G71T 1K9MU 3KXTA 4BY6C 3JCMP 4QVDA 3P8HA 4PLLA 3G4ST 3FJPA 3HFOA 3H8ZA 1X75C 3OYCA 1UEBA 4OP0A 4BDYA 1M5Q1 5LJ3d 4M75D 2PVOB 5GMKj 4C0FA 4M7DG 3CMEA 3HL8A 3I56T 5LJ5f 1W2BA 3CD6T 3JCMd 4C92C 4M7AA 3S3OA 2LNVA 3C4SA 1VUBA 5D6WA 3JCMX 3E9FA 2ZCFB 4YTLA 3DLMA 1M1KC 4J83A 3SDZA 4M77E 3V8JA 5LJ5h 3CC2A 3L2UA 3FIFA 1QVGA 4BY6B 1VQMT 3A8OB 1VQKA 1P92A 3X24B 3PIPA 3VYHB 1W4SA 3SFMA 3VUBA 4MZPA 2DEQA 5EG2A 4IUQA 1HK9A 3QZ5B 3JAME 3MP8A 3OYEA 3LH0A 4F7UA 4M78C 4OB3B 4C92B 2XDBA 4M7DC 2KY9A 4X34A 1KC8U 4N4IA 5CQXA 3CCMT 2GF7A 1FXXA 1WGSA 2EJFA 3CBMA 3MP6A 4JRIA 5J26A 1YITT 2RJDA 1HXDA 5KE2A 3CCLT 2E64A 1G3YA 1YJNA 4LD9K 2EIFA 2AHJB 4ELYC 2ZGWA 4J5YA 1BIAA 1WNLA 3M56A 2XDDA 3GF5A 2R5MA 4P5NA 3G6EA 3CPWS 4BE0A 3JCMc 3CBPA 4JLIA 5J39A 1VQOA 4LDXA 1GXIE 3QO3A 4M78B 4M7DB 3QUIA 1WPYA 4HCZA 5IN1A 1OYXA 2EJGA 4M78A 4A4EA 4JLGA 5C6SA 5IT9E 1VQ6T 3OYNA 3L2QA 3V7SA 4C5HA 4DOWA 3JB9F 1Q86C 4RMOA 2XU8A 4M77G 4EMKC 1W2BS 4PJOD 4E7HA 2P0KA 4IURA 4PL6A 4Z02A 3VUZA 3L2WA 3X25B 2X4JA 4BI3A 1VQLA 1N9RA 5CIUA 2DZ9A 1S72A 1Q7YC 2PVGB 4FU6A 2FVUA 3A8LB 1QP3A 4Q5WA 5GAN2 3OW2A 4M7AF 3OYGA 1V29B 3CCRA 4C0GA 5CKHA 2XI9A 3P8BB 1BKBA 3OSSC 1VIEA 3MP1A 3CPFA 2XG8D 4EMHA 2OTLA 3OYLA 4BE2A 1VQNA 3CCQT 1OZ3A 4C8QE 5LJ3g 3L2RA 4EMKB 4V2SA 1N27A 3HP9A 2K4YA 3J80E 2K5LA 2VYTA 3I55A 2RJEA 2OTJA 3CCET 1WQ7A 2XKOC 3FLGA 5FU7C 4F7UF 3CCSA 1G3WA 2FB7A 4ZTJA 3META 4HCBA 4M7AE 2MMPA 1FWZA 5L8RE 3A5ZB 3QZ9B 3RKWA 4M75A 4C92D 3TCJA 1VQ5A 2PUKB 3HRUA 4MZMA 5HK3A 4MZTA 3CCRT 1JJ2A 5GMKe 1G3TA 1VQ4T 2QTXA 2ZPFB 3OYYA 1LJOA 1NZ9A 3TREA 3QDRB 4MMKA 1N8RC 4ZGEB 2PU9B 4M77B 1M4ZA 2XHCA 3MHXA 4J7IA 5LJ3j 3OS2A 3DKMA 2OTLT 4HCCA 2LCLA 5FU7B 4EDUA 1UGQB 2QDYB 1Q7YU 4F7UE 3PNWC 5M9OA 3HFNA 1YI2T 3T9NA 5DLQE 4M7DD 3E1SA 3CCVA 3JB9H 2X35A 5AYFA 5A0DA 5KE3A 2EYQA 1YIJA 1YJ9A 2B8AA 2Y4XA 3OW2S 3HRTA 3MEVA 3CEYA 5FU6C 4C8QG 1VQ9T 4PJOC 4LDYA 2QQRA 3QG1A 3OMGA 2KAFA 2RI3A 3V8LA 3L2VA 2P0PA 5GAN8 2DAQA 2R58A 1M9SA 1NE8A 4IUVA 4O6JA 2LQKA 1M90C 5IAYA 1QVPA 1ZHIA 2E12A 3OS5A 4KUDK 4Y28E 3OA6A 1TH7A 3GIBA 3HSBA 5CK9A 2K5FA 5FU6B 2LQ8A 3PMTA 4FT4A 1WJQA 3HHTB 1VQ7A 3PT9A 3JCMb 2LDMA 1WJSA 3M53A 3E9GA 3J81E 1KQ1A 5GANd 2RK2A 2ZPBB 4PJOA 2DKGA 4R55A 1JJ2S 3LW5E 4MMLA 3ASKA 4M75F 2Y4YA 3BDLA 4GLKA 4O5VA 4N0AC 4OF1A 1QVFS 4OB0B 1D3BB 3HRSA 3ZFJA 1YJWT 4BI4A 4XU0A 4OMFB 1NJIU 2K3XA 3E19A 5CKEA 3CC7T 5D6XA 5GAMd 5GMKh 1IREB 3PTAA 4HKEA 1YBYA 3G71A 2LTOA 1H641 2JTFA 4BI8B 2QQBA 1I8FA 1YHQA 4QQGA 1I81A 1U8RA 2KMTA 4KULA 5CVIA 2WACA 4C8QB 4J6WA 4M77D 2FHDA 1H3ZA 4LD6A 3CCUT 2HBPA 1O75A 4CRIA 2WSCE 4IUPA 2KSSA 3M4YA 1XQHA 2VXEA 4M75E 3RESA 1VQ7T 4Y91A 4N0AA 3MEUA 1Q81U 3LX7A 4X9DA 4N4HA 4E7IA 2JVVA 2VUBA 2K5IA 1U1TA 4C92A 2RA2A 2CGHA 1QW1A 2LCCA 3CMET 2HAXA 2CS7A 2DXCA 3OBYA 1KQ2A 3GPLA 4MDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E41 A;  4EMH A;  2Y90 A;  3JCM J;  1JRI A;  4C8Q E;  5LJ3 g;  1BIB A;  5GAO q;  4EMK B;  2E10 A;  4V2S A;  4XU2 A;  5LJ3 e;  3BDU A;  4M78 D;  2I2L A;  5GMK m;  3BY7 A;  4XU3 A;  1WQ7 A;  4C8Q A;  3BW1 A;  4M7D A;  4F7U F;  3JCM e;  2DJZ A;  2FB7 A;  3M4G A;  4NL2 A;  1U1S A;  3QHS A;  3SWN A;  1I4K 1;  2DTI A;  4M7A E;  4RCB A;  2JN0 A;  4M78 G;  4M7A B;  2E65 A;  2K57 A;  1B34 B;  3RKW A;  4M75 A;  4C92 D;  5LJ5 j;  3SB2 A;  5GAN 7;  4NOY A;  4XTV A;  1LOJ A;  4HA8 A;  5GMK e;  2RD1 A;  2QTX A;  2YLB A;  1LJO A;  5LJ5 g;  2EAY A;  4MMK A;  3JCM W;  3JCM V;  4WF2 A;  4XQ3 A;  5GAN 6;  4C92 G;  4M77 B;  3JCM Q;  5LJ3 j;  2DVE A;  4X9C A;  4M7A C;  3BFM A;  5GAO r;  1Y96 B;  2DXT A;  5GAN g;  3V8K A;  4A54 A;  3RKY A;  4F7U E;  5GAN e;  3HFN A;  5I21 A;  4M77 F;  4F7U B;  2E1H A;  5LJ5 d;  4EMG A;  4PJO B;  2DXU A;  4C8Q D;  3VU3 C;  3JB9 H;  4M7D D;  4M77 C;  3JCM P;  4EMK A;  3EFR A;  4XTW A;  3JCM g;  4QVD A;  3FJP A;  3HFO A;  5GAO l;  1I5L A;  5GAM g;  5GAN 3;  2VXF A;  4OP0 A;  4PJO F;  5GAM e;  1M5Q 1;  5LJ3 d;  2RM4 A;  4M75 D;  5GMK j;  4C92 F;  4C8Q G;  2YLC A;  4M7D G;  4PJO C;  5LJ5 f;  5DY9 A;  4QVC A;  3JCM d;  1N9S A;  3EFS A;  4C92 C;  4M7A A;  2DTH A;  3V8L A;  5GAN 4;  1B34 A;  4PJO E;  1X01 A;  4RCC A;  5GAN 8;  5GMK i;  3JCM X;  4DQ2 A;  4M75 G;  5GAN j;  1YCY A;  4M77 E;  3V8J A;  5LJ5 h;  3JB9 J;  3FIF A;  3PGG A;  5LJ3 f;  2DZC A;  3V7R A;  1KQ2 A;  4A53 A;  2FYK A;  4HT8 A;  2EWN A;  4M77 A;  3RIR A;  1TH7 A;  3QSU A;  2DEQ A;  4XTZ A;  3JCM f;  5GAN 5;  3GIB A;  3HSB A;  1Y96 A;  4M78 F;  3L1A A;  4XTU A;  5LJ3 h;  4C8Q F;  5GMK l;  1HK9 A;  5GAM j;  5GAO m;  3JB9 I;  4NL3 A;  4M7D F;  4C92 E;  3JCM b;  4F7U A;  4M78 C;  3JB9 D;  4C92 B;  4M7D C;  1KQ1 A;  3JCM h;  5GAN d;  4J6Y A;  4PJO A;  2DKG A;  2DTO A;  4MML A;  4M75 F;  5GAO p;  2EJF A;  4JRI A;  4N0A C;  1D3B B;  1HXD A;  3AHU A;  4M75 C;  4XU0 A;  2E64 A;  3JB9 G;  4M7A D;  2ZGW A;  4J5Y A;  3RKX A;  3L2Z A;  1BIA A;  1WNL A;  1JBM A;  4JRK A;  5GMK h;  2EJ9 A;  5GAM d;  5GAO n;  1H64 1;  5GAN f;  1I8F A;  4JLI A;  3JCM c;  5CAI A;  4M78 E;  1I81 A;  2YHT A;  3RUX A;  3QO3 A;  4M7A G;  4M7D E;  4M78 B;  4C8Q B;  4M7D B;  3QUI A;  4J6X A;  4J6W A;  1LNX A;  4M77 D;  4XU1 A;  1WPY A;  1MGQ A;  2EJG A;  3FB9 A;  3SWN B;  4M78 A;  4XTY A;  3V7C A;  5GAN h;  4XTX A;  2VXE A;  4M75 E;  3RES A;  3V7S A;  4Y91 A;  5GAM f;  3RER A;  4M75 B;  3INZ A;  3JB9 F;  1WQW A;  4M77 G;  4N0A A;  4EMK C;  4PJO D;  4C8Q C;  4JUV A;  4X9D A;  4HT9 A;  5GAM h;  3SWN C;  1N9R A;  1U1T A;  4C92 A;  2DZ9 A;  2RA2 A;  2CGH A;  4F7U G;  4PNO A;  1M8V A;  5GAN 2;  4M7A F;  2VC8 A;  4PJO G;  5LJ5 e;  1D3B A;  2HNI A;  2RB6 A; 
#chains in the Genus database with same CATH topology
 1KHC A;  1RI0 A;  5D7U A;  1F1B B;  4ME7 A;  3FDR A;  4NS5 A;  3MKD A;  1VQK T;  1G3S A;  2DVJ A;  2FRY A;  2FRW A;  2PUO B;  3CC4 A;  1RUW A;  2HMA A;  2KVQ G;  4QQ6 A;  4E7L A;  2ABL A;  1PSF A;  3OS0 A;  2DK3 A;  2E70 A;  1E7O A;  4XTV A;  4RTU A;  3TU4 K;  1AZE A;  2RD1 A;  4B6M A;  4RG2 A;  3GNG A;  3JCM V;  2C06 A;  3F70 A;  2RNA A;  3H6Z A;  3G6E T;  1Y96 B;  5GAN g;  1VQO T;  2DL7 A;  2MI6 A;  1ZA2 B;  2RHX A;  1VIF A;  4M77 C;  2CUD A;  4KBM B;  2CZ0 B;  2YLC A;  2ECZ A;  4KT0 E;  3OYM A;  3CC4 Q;  3EFS A;  5GMK i;  4KH0 B;  1WYX A;  2BE7 D;  4DQ2 A;  1HJD A;  2YSQ A;  4LXC A;  5KYX B;  1Q86 U;  3FEO A;  1K73 U;  1X2K A;  3QBY A;  5LJ3 f;  4A4F A;  1ZUK A;  4A53 A;  4M77 A;  3RIR A;  1QVF A;  4PJJ A;  1M8M A;  3JCM f;  4BAC A;  4M78 F;  3L1A A;  5GAM j;  2X4Y A;  4C5E A;  4IUT A;  3PFS A;  1UGP B;  4DBR A;  3UAT A;  3DB3 A;  4D8K A;  2DFU A;  2YDL A;  3JB9 G;  5HCK A;  1V1C A;  1WLP B;  2MOX A;  3NTI A;  4ELZ C;  2LT4 A;  5HK0 A;  1T3S A;  5CAI A;  1XTD A;  1JEG A;  4M7A G;  3QWX X;  3VS2 A;  2D0Q B;  4J9G A;  1EX4 A;  2EQM A;  2F5K A;  1KSW A;  2CZ6 B;  3VRZ A;  1N8R R;  4OB2 B;  1WA7 A;  1WQW A;  1BI0 A;  1UUE A;  2F2W A;  3FJ5 A;  4C0D B;  1GL5 A;  4ZGJ B;  3GOX A;  2ZPG B;  1ZA1 B;  2DLP A;  3A8H B;  2YWW A;  3UA6 A;  2L89 A;  2HEQ A;  2CH4 W;  3ZBD A;  1KG1 A;  2F2X A;  2KYM A;  1T3L A;  4NL2 A;  4LN2 A;  3CCM A;  4OGE A;  3NGP A;  3CXC P;  5LJ5 j;  2IPO B;  2X3X D;  3LYI A;  2K7A A;  4J9F A;  1M2V A;  1N5Z A;  3OYF A;  3H0H A;  2K2M A;  2NUP A;  4C5I A;  4R56 A;  2EQJ A;  2YUP A;  5D6Y A;  2GFA A;  2E1H A;  2EYW A;  2JOY A;  4DA4 A;  3NHN A;  2E6N A;  2DXU A;  2V1R A;  2GGR A;  2LNH B;  2RO0 A;  5GAO l;  4ATO A;  1RAI B;  4LDW A;  5GAM e;  1KFZ A;  1M27 C;  4VUB A;  2LRQ A;  1N9S A;  5GAN 4;  2RQV A;  2M1H A;  3A1P A;  4E7Z A;  1D0X A;  3CCM Q;  2KE9 A;  2PZ1 A;  4E7S A;  3PGG A;  4A4G A;  3CCQ A;  3RNJ A;  1V76 A;  1SEM A;  2MCN A;  3CCE A;  4PJO E;  3WVE B;  4C8Q F;  2QQA A;  2B86 A;  3OQ5 A;  2QA4 A;  3JB9 D;  3JRZ A;  2YRV A;  3JV3 A;  1R8O B;  2MF2 A;  5GAO p;  1VQP T;  4M7A D;  4AFQ C;  3M5A A;  5FRM A;  4X1V A;  4JRK A;  2QI2 A;  1I0C A;  4E47 A;  1YI2 A;  1PSE A;  5GAN h;  2QAZ A;  3V7C A;  2LX7 A;  3H0F A;  1SHF A;  1ZUU A;  3CCQ Q;  2JTE A;  4FT2 A;  2PNI A;  4JZ4 A;  3CCE Q;  4OMN A;  1Z9Z A;  4PJO G;  3D7S B;  3N5B B;  5LJ5 e;  1YCY A;  2QK0 A;  4AG1 C;  3CMA T;  2IIM A;  2RHY A;  3G7Z A;  2COY A;  1BIB A;  4AFZ C;  3A8M B;  1XNI A;  2O4X A;  5CKB A;  4TVR A;  2GFU A;  1U06 A;  2M9U A;  2DTI A;  4RCB A;  1T0J A;  2CP6 A;  1YI2 Q;  1YJW A;  1PRM C;  2A36 A;  1XOV A;  4JRQ A;  2CP7 A;  3JCM W;  1SF9 A;  4C92 G;  4ZN1 A;  1M2O A;  1RLP C;  1N6A A;  2EQK A;  2DXT A;  4A63 B;  2GTJ A;  1MV0 B;  3CQT A;  1Q82 R;  3DB4 A;  3CCU A;  1BI1 A;  4M77 F;  1WXT A;  2O2O A;  2CP0 A;  3TVT A;  2OI3 A;  3P8H A;  1X75 C;  3H9N A;  4WTO B;  3CME A;  2CT3 A;  2X3W D;  1FYN A;  4QKU A;  1WFW A;  3E9F A;  3DLM A;  4KRT A;  2J6O A;  2Z0W A;  1QVG A;  4J9D A;  4BY6 B;  1VQM T;  1YJW Q;  1FMV A;  3A8O B;  1AZG B;  4JPB W;  4MZP A;  1WX6 A;  2DA9 A;  3EH1 A;  2H8H A;  5EC7 A;  1NBE B;  3MP8 A;  3OYE A;  3E2U A;  4F7U A;  4OB3 B;  4M7D C;  4WCI A;  4ZNX A;  3CCU Q;  1PD1 A;  2E64 A;  1YJN A;  3EG0 A;  1RAD B;  2ZGW A;  3M56 A;  1WNL A;  2VWF A;  3QWY A;  3JCM c;  3CME Q;  3QUI A;  4RUG A;  1WZO A;  1WPY A;  4FYX B;  4HCZ A;  5IN1 A;  1OYX A;  1PC0 A;  1VQ6 T;  3G71 Q;  2CT4 A;  3OYN A;  4C5H A;  2XU8 A;  4PJO D;  1W2B S;  2P0K A;  1TSF A;  1VQL A;  1S72 A;  1Q7Y C;  2PVG B;  1ZLM A;  4Q5W A;  5GAN 2;  1VIE A;  4PJL A;  4EMH A;  2DL8 A;  1AD5 A;  4BE2 A;  2YT6 A;  1WHG A;  5LJ3 g;  1BCM A;  3HP9 A;  2K4Y A;  1YJN Q;  3I55 A;  1VA7 A;  2FB7 A;  5L8R E;  2VAS A;  3QZ9 B;  4M75 A;  4C92 D;  3TCJ A;  2PUK B;  1UFF A;  4MZT A;  2ZPF B;  1LJO A;  3TRE A;  3QDR B;  1OPK A;  4M77 B;  1M4Z A;  2XHC A;  3MHX A;  4J7I A;  3OS2 A;  3DKM A;  2LCL A;  1VQL Q;  1UGQ B;  2SEM A;  3CCJ Q;  1S72 Q;  2CSI A;  4F7U E;  3PNW C;  3HFN A;  5FWC A;  3CCV A;  5A0D A;  5KE3 A;  1YJ9 A;  2M02 A;  2Y4X A;  3OW2 S;  2C0O A;  3HRT A;  1M3A A;  1CSK A;  1RAB B;  1ZUY A;  3I55 Q;  2YXY A;  3EH2 A;  1QWF A;  1M9S A;  1NE8 A;  4PFP A;  2LQK A;  1M90 C;  4AFS C;  2DRK A;  1ZHI A;  2E12 A;  3OS5 A;  3GIB A;  5CK9 A;  2ROT A;  2LDM A;  1K9M R;  3E9G A;  3J81 E;  3NMZ C;  1H3H A;  1JJ2 P;  1IRX A;  4OB0 B;  2C0T A;  3I9Q A;  4XU0 A;  3CCV Q;  2OX7 A;  5CKE A;  1YJ9 Q;  1NJI R;  5GAM d;  3PTA A;  2KYB A;  2QQB A;  4QQG A;  1U8R A;  2KMT A;  4KUL A;  5CVI A;  4J6W A;  1WHK A;  4IUP A;  2KSS A;  4M75 E;  1AOJ A;  4Y91 A;  1TUD A;  1LCK A;  4AFU C;  4PJM A;  4E7I A;  3I5S A;  1M2V B;  1WXU A;  1W70 A;  2LCC A;  2CS7 A;  2NUP B;  3OBY A;  1ZSZ C;  1KQ2 A;  2FEI A;  2JJ9 A;  2LT1 A;  2HL5 C;  3M54 A;  1YHQ T;  4BD3 A;  3JCM J;  1EIF A;  2FZG B;  4KH1 B;  1OU9 A;  3EGX A;  1YN8 A;  1TUC A;  1FMW A;  3R6N A;  3M4G A;  2H3J A;  1K73 C;  5FRN A;  1M1K R;  4OML A;  5I2S A;  2CZ7 B;  2E65 A;  3GLX A;  1ZSZ A;  1I1J A;  3CBO A;  1VQ8 A;  4OMM A;  2AZS A;  2ROL A;  1BI2 A;  3OYJ A;  4X9C A;  2MWP A;  3URG A;  1LPL A;  4E2F B;  2NUZ A;  4PFZ A;  1OEB A;  3MEA A;  5LJ5 d;  1JB0 E;  3VJP A;  1PHT A;  1QQJ A;  2RK1 A;  2BTT A;  4XTW A;  5KYN A;  4JS4 A;  4UC4 A;  2VXF A;  1JO8 A;  1MMD A;  2M51 A;  3X26 B;  2ZPE B;  4GLM A;  3M58 A;  2IVW A;  2EFI A;  2NLU A;  4FYV B;  2JW4 A;  4RKU E;  3X20 B;  3UT1 A;  1WI7 A;  1Y57 A;  1VQN T;  2KI7 A;  2FYK A;  3PVL A;  3MO8 A;  4XTZ A;  3TEE A;  5LJ3 h;  4M7D F;  4NL3 A;  2OTJ T;  5GAO m;  3THK A;  2EQU A;  4PK4 A;  3JCM h;  4J6Y A;  3UPU A;  3AT1 B;  3EFO A;  1NYG A;  3OSV A;  4FSS A;  3RKX A;  5GAO n;  1JBM A;  2PQW A;  2XDP A;  2V8K A;  2EYZ A;  2O4X B;  4M78 E;  3TSZ A;  3C94 A;  1JU5 C;  1NPP A;  3INZ A;  4C8Q C;  2VV5 A;  4HT9 A;  1ABO A;  3I56 A;  3CD6 A;  4CC4 B;  4BB7 A;  3QYG B;  4FSX A;  1D3B A;  2BIV A;  2DD5 A;  3OY9 A;  5DM7 R;  1KC8 C;  2XID A;  3VRY A;  2BUD A;  1BK2 A;  2KR3 A;  2KXD A;  4C8Q A;  3QYH B;  2QQS A;  5CCA A;  2K9G A;  5CQY A;  1OOT A;  1M90 U;  2JN0 A;  4M78 G;  2DL4 A;  4NOY A;  1YFN A;  3G4S Q;  2CP5 A;  4J9B A;  3RR6 A;  1Q95 G;  1HD3 A;  3Q1J A;  5IHI A;  2RHU A;  4F04 B;  5GAO r;  3S6W A;  3NTH A;  3I56 Q;  3CD6 Q;  2EGA A;  5I21 A;  4F7U B;  1KQS A;  3VU3 C;  2OAW A;  1TOV A;  1O9S A;  1UGS B;  3EFR A;  2RMO A;  1I5L A;  3M9Q A;  2HD0 A;  2RF0 A;  1VYT A;  5DY9 A;  1EFN A;  3IQL A;  3EG9 A;  1B34 A;  5FLX E;  1X01 A;  4Z8A A;  5I11 A;  4LUE A;  4OVA A;  1WJR A;  2HQE A;  4QVZ A;  2P4R A;  3CPW P;  2DZC A;  2DPP B;  4ORZ A;  1AWW A;  3LGF A;  2HQX A;  2M0O A;  2D9T A;  3JB9 I;  5GMK l;  4RG8 A;  2MYS A;  4JZ3 A;  4LDU A;  2HKQ B;  2QEX T;  3M57 A;  2LVM A;  5ECA A;  2J6K A;  3M59 A;  3L2Z A;  3QXE B;  4RTY A;  1IXD A;  4HVU A;  4J6X A;  1SSF A;  3HKS A;  2KXC A;  2KNB B;  4XTX A;  1NLO C;  5GAM f;  3VS4 A;  2QA4 T;  4M75 B;  2YUN A;  2A7Y A;  4ZGD B;  5CR2 A;  4JUV A;  3M55 A;  2HKN A;  2WSE E;  5AT1 B;  1VQ9 A;  2KRS A;  4L5G A;  3SWN C;  5CKD A;  3PIO A;  3MCA B;  1K8A R;  1KD1 R;  4EIK A;  4XAX B;  3HPW A;  1W6X A;  5IH2 A;  3CCR Q;  3PMI A;  4M78 D;  3LLR A;  1Y0M A;  4FL6 A;  3BW1 A;  2OTL Q;  3S3N A;  1TG0 A;  2KBT A;  4PKC C;  3SWN A;  1R0B G;  3I5R A;  4PLI A;  4WF2 A;  1QKX A;  3NTK A;  1SSH A;  3JCM Q;  5C0M A;  1Q81 C;  1VQ9 Q;  2DIG A;  1DJ7 B;  2E3I A;  4A54 A;  2YRD A;  3LWH A;  3OYH A;  4BDZ A;  1K9M U;  3KXT A;  1PM3 A;  3OYC A;  1UEB A;  2DM1 A;  2JXB A;  1M5Q 1;  2PVO B;  2EGE A;  5LJ5 f;  4C92 C;  2LNV A;  1PKS A;  1VUB A;  2EKH A;  3C4S A;  3EG3 A;  5IXB A;  4YTL A;  4J83 A;  2EYX A;  4M77 E;  1TUG B;  1VQK A;  3X24 B;  1W4S A;  5KYU A;  5EG2 A;  2DER A;  1AWX A;  4LNP A;  1HK9 A;  3JAM E;  1WHJ A;  4JJB A;  2KY9 A;  4JJD A;  1KC8 U;  5CQX A;  1GFD A;  2M0Y A;  1YIT T;  4JRI A;  5J26 A;  2ENM A;  1EZZ B;  3CCL T;  1VQ7 Q;  2EIF A;  4ELY C;  1TS9 A;  4J5Y A;  1E6H A;  2ED1 A;  3G6E A;  3CPW S;  1VQO A;  1GXI E;  4M78 B;  2EJG A;  2L2P A;  2CP3 A;  5C6S A;  1OV3 A;  5IT9 E;  6AT1 B;  3V7S A;  3JB9 F;  4M77 G;  4EMK C;  4Y92 A;  1ZSZ B;  1VQK Q;  1W2B P;  3X25 B;  4BI3 A;  1N9R A;  4IIM A;  5CIU A;  3REA B;  1WHH A;  1RAA B;  4FU6 A;  2FVU A;  4M7A F;  1I07 A;  2FZK B;  1V29 B;  3MP1 A;  4K11 A;  1KJW A;  1HSQ A;  4RTZ A;  2HDA A;  3L2R A;  2L3Q A;  1N27 A;  2JMA A;  3J80 E;  2GNC A;  1WQ7 A;  2XKO C;  3FLG A;  5FU7 C;  1ZX6 A;  3G6E Q;  1G3W A;  1VQO Q;  3MET A;  3HRU A;  4MZM A;  2L3P A;  3O5Z A;  3OYY A;  1VQ4 T;  1N8R C;  4MMK A;  4ZGE B;  2PU9 B;  1J3T A;  1R0C B;  2DET A;  1RAC B;  5M9O A;  2NYS A;  1D0Z A;  1MV3 A;  5DLQ E;  3JB9 H;  5FW9 A;  2X35 A;  4D8D A;  3EFO B;  2A08 A;  2GQI A;  3OW2 P;  3CEY A;  5FU6 C;  2DF6 A;  1C1A A;  3M0U A;  1RAE B;  2P0P A;  2DAQ A;  1BU1 A;  4RTW A;  1YNZ A;  2FO0 A;  1TH7 A;  2QGF B;  4HCK A;  4HXJ A;  3RDV A;  1WJS A;  2RQU A;  2ZPB B;  4R55 A;  2Y4Y A;  4GLK A;  4N0A C;  1D3B B;  3HRS A;  4BI4 A;  4OMF B;  3CC7 T;  5GMK h;  3G71 A;  2HBW A;  4BI8 B;  1ZBJ A;  2J05 A;  4C8Q B;  4M77 D;  1H3Z A;  1O75 A;  1QKW A;  1TU0 B;  1QCO A;  3SEM A;  1XQH A;  2VXE A;  3RES A;  1SG5 A;  2A28 A;  4N0A A;  3LH5 A;  3MEU A;  1Q81 U;  2JVV A;  1SPK A;  1U3O A;  4IIO A;  2GBQ A;  2DXC A;  1K0X A;  3GPL A;  2L3S A;  3CC2 T;  2D0N A;  4DOV A;  1JRI A;  5GAO q;  2RI2 A;  2X51 A;  2RQR A;  2JZ2 A;  4M7D A;  2DJZ A;  2V8J A;  1KIK A;  5A2Q E;  3P8D A;  1UJ0 A;  2JNG A;  3EG9 B;  1B34 B;  1IGQ A;  1PRL C;  1X6O A;  2KQW A;  3EHR A;  2RJF A;  8AT1 B;  3CCJ A;  3EGU A;  1PKT A;  1RL2 A;  1LOJ A;  2ATC B;  3C12 A;  3EAE A;  2DRM A;  2EAY A;  1K9A A;  3RKY A;  4DEX A;  4FCY A;  4EMG A;  1ZBX A;  1C6V X;  1GCP A;  3JCM g;  4KUI A;  5GAM g;  5A0G A;  1Y7X A;  4C92 F;  4FW2 A;  2C0I A;  4QVC A;  1VQ8 T;  4JS5 A;  2DTH A;  4GBQ A;  4MDW A;  3CMA A;  5GAN j;  1K0S A;  1SKU B;  3H0I A;  3JB9 J;  2O9S A;  3VS6 A;  1MMN A;  1Q86 R;  3QKJ A;  1TXQ A;  5KYY A;  3V7R A;  5KYX A;  3J7A F;  1VQP Q;  4HT8 A;  2LC4 A;  3O8V A;  2IG0 A;  4A4K A;  1OZ2 A;  4LE9 A;  4D6W A;  3CCS T;  2ED0 A;  2NWM A;  2ZAE A;  1Q82 C;  2DTO A;  5KCH A;  2MWO A;  1UHC A;  1BBZ A;  1UGR B;  2PTK A;  1E6G A;  2E4H A;  4JJC A;  1VQ5 T;  2BZ8 A;  3CXC A;  1X69 A;  2FPF A;  1K8A U;  4IUU A;  4ZTF A;  3RMS A;  4M7D E;  3TQ7 P;  3VS1 A;  1LNX A;  4XU1 A;  4JJN K;  1IHV A;  2QGG A;  1MGQ A;  3SWN B;  1HYO A;  2JT4 A;  3QJY A;  3CMA Q;  1N8R U;  4II1 A;  1YIJ T;  2MAM A;  4ANJ A;  2GQV A;  3VS5 A;  1UB4 A;  3GP8 A;  4M4Z A;  7AT1 B;  3JSC A;  4F7U G;  4PNO A;  1Y07 A;  1UJY A;  4Z88 A;  2JTM A;  4QW2 A;  4JDS A;  1B07 A;  2Y90 A;  1QVF P;  1VQM A;  2VKN A;  2I0N A;  2DIQ A;  2DMO A;  4XU2 A;  2X4W A;  2E5Q A;  5FWB A;  2P0Q A;  2EYY A;  3QHS A;  2PVD B;  1NPR A;  4RTT A;  1D1C A;  3WVD B;  3SB2 A;  4CI0 C;  1BI3 A;  4CC3 A;  1ZQ1 A;  5HKC A;  2DVE A;  1M1G A;  5GAN e;  1X27 A;  1VQ6 A;  2FL7 A;  2X9H A;  2KRM A;  2R5A A;  5GAN 3;  1VQM Q;  4OGC A;  1G5V A;  1IHW A;  2NUT A;  3WXM B;  1UDL A;  4PJN A;  4KGZ B;  4M75 G;  4E7K A;  2EW3 A;  2CZ1 B;  2AK5 A;  3SHW A;  1PNJ A;  3ME9 A;  3QSU A;  2W10 A;  3CC2 Q;  3CC4 T;  4FYW B;  2K3Y A;  4R0K A;  5I2M A;  3GBQ A;  5CO7 A;  2CDT A;  1VQ6 Q;  1OUL A;  3M0Q A;  1WIE A;  2OJ2 A;  1MND A;  5J3B A;  3FRN A;  4J9H A;  1QCF A;  2P84 A;  2KDS A;  1KQS S;  9ATC B;  1MHN A;  3RUX A;  1I5O B;  3DLL A;  2R57 A;  2ZZD A;  3FB9 A;  2E5K A;  2K3B A;  4XTY A;  1SRL A;  2COW A;  4BE1 A;  1AT1 B;  3BE3 A;  3L42 A;  3VYG A;  2O88 A;  5GAM h;  3LGL A;  3OYD A;  2ZPH B;  1FX7 A;  1M8V A;  4E7J A;  2RJC A;  1Y71 A;  1K9M C;  2HNI A;  2RB6 A;  2E41 A;  5IXF A;  4PFO A;  1VYU A;  2E10 A;  1NJI C;  4BUG A;  3OYA A;  4ESR A;  2LJ0 A;  2HQH A;  3G4S A;  2WSF E;  1I4K 1;  3QII A;  2K57 A;  3NPF A;  4Z89 A;  2LX9 A;  4OMP A;  1ARK A;  3OB9 A;  3CCS Q;  2YLB A;  3OS1 A;  5GAN 6;  4M7A C;  3C95 A;  4LDV A;  1QVF S;  1Q82 U;  3ZEH A;  3V8K A;  2LZ6 B;  1D1A A;  2QDL A;  4BY6 C;  4PLL A;  3FJP A;  3HFO A;  3H8Z A;  1SRM A;  4BDY A;  4M75 D;  4C0F A;  3HTR A;  3U23 A;  4M7A A;  3JCM X;  2JM8 A;  2ZCF B;  1M1K C;  5LJ5 h;  3FIF A;  2KT1 A;  3EGD A;  1D1B A;  1P92 A;  3VYH B;  3SFM A;  2DEQ A;  3QZ5 B;  3ULR B;  3LH0 A;  2DE0 X;  3CCM T;  2GF7 A;  1FXX A;  3MP6 A;  1HXD A;  5KE2 A;  1ZSG A;  2COZ A;  1BIA A;  1OQK A;  2XDD A;  3GF5 A;  2EQI A;  2LMJ A;  2DL3 A;  4DBQ A;  2LJ1 A;  2MIO A;  4JLI A;  2QTV A;  2LCS A;  3QO3 A;  4M7D B;  1PG5 B;  4A4E A;  3L2Q A;  2XMF A;  1YHQ Q;  2VB6 A;  4E7H A;  1AEY A;  1JQQ A;  4IUR A;  4PL6 A;  4Z02 A;  3L2W A;  2DZ9 A;  3A8L B;  1QP3 A;  3OYG A;  1UG1 A;  4C0G A;  3CCR A;  5CKH A;  2JMC A;  2XI9 A;  1BKB A;  2LJ3 A;  3OSS C;  1QVG P;  4J9C A;  1X43 A;  2OTL A;  2DX1 A;  1VQN A;  3H41 A;  2JS0 A;  3CCQ T;  2LP5 A;  4C8Q E;  4V2S A;  4CC2 A;  2VYT A;  2RJE A;  2OTJ A;  3CCE T;  4AMC A;  4M7A E;  3UF4 A;  1FWZ A;  1QMC A;  3RBB B;  1X6B A;  2A37 A;  5KYW A;  5HK3 A;  1W1F A;  1JJ2 A;  5KYY B;  1GCQ C;  5LJ3 j;  1OX9 A;  8ATC B;  4EDU A;  2QDY B;  3EG2 A;  1YI2 T;  1NEB A;  3T9N A;  4F17 A;  2CP2 A;  3E1S A;  4RTX A;  3TSW A;  1RLQ C;  2AT1 B;  1K76 A;  2EYQ A;  2B8A A;  1VQN Q;  1WHL A;  5IHN A;  1MMA A;  3M0T A;  2KRN A;  4CC7 A;  4C8Q G;  4PJO C;  4LDY A;  2OTJ Q;  2YUQ A;  1GCQ A;  3V8L A;  5GAN 8;  4FW1 A;  2R58 A;  4IUV A;  1AWJ A;  5IAY A;  1QVP A;  2H3E B;  4KUD K;  4Y28 E;  3EHQ A;  1C0M A;  3VS0 A;  2LQ8 A;  3PMT A;  2D1X A;  1UE9 A;  1VQ7 A;  4OMQ A;  2KT8 A;  3M53 A;  5GAN d;  4PJO A;  2RK2 A;  2A0F B;  2DKG A;  2KGT A;  3VS3 A;  4OF1 A;  3ASK A;  1GBR A;  3BDL A;  3ZFJ A;  1YJW T;  1NJI U;  2O31 A;  2K3X A;  2RPN A;  2BZY A;  3E19 A;  4F16 A;  1M3B A;  1Z9Q A;  1I81 A;  4DEY A;  3M0P A;  2FHD A;  3CCU T;  2HBP A;  2O9V A;  1G8X A;  1UTI A;  5IHK A;  3LX7 A;  4N4H A;  2VUB A;  2K5I A;  1U1T A;  4C92 A;  2RA2 A;  1QW1 A;  1JXM A;  3CME T;  3G71 T;  1K4U S;  2X4X A;  1RAG B;  1VOM A;  2KEA A;  3EGX B;  4C0Z A;  3VS7 A;  5LJ3 e;  2JUF A;  2RHZ A;  1MNE A;  3BY7 A;  2XK0 A;  2RH2 A;  3JCM e;  1M1K U;  1U1S A;  2NUT B;  2QEX A;  2FPD A;  2E3H A;  3A8G B;  2QAS A;  1YJN T;  4DBF A;  1QVG S;  4F14 A;  5KH6 A;  3SD4 A;  1TTH B;  3ER0 A;  1OPL A;  3KFV A;  1K1Z A;  3QPH A;  3FC3 A;  4J7F A;  2KK4 A;  4C8Q D;  1K8A C;  1KD1 C;  4EMK A;  2D6F A;  2DBK A;  1PD0 A;  2RM4 A;  4B9W A;  1VQL T;  4FM4 B;  3CCJ T;  1S72 T;  2F5T X;  4RCC A;  2RQT A;  1YCS B;  3ZL7 C;  3I35 A;  5L23 A;  2QEX Q;  1OU8 A;  4A4H A;  1QCN A;  2EWN A;  3OYI A;  3LWI A;  3I55 T;  1Q7Y R;  2AKL A;  4C92 E;  3G1J A;  3UDC A;  1AWO A;  2ZPI B;  3OYK A;  3OYB A;  2LQW A;  3AHU A;  1CKA A;  2MK5 A;  2QA4 Q;  2QYZ A;  4FIB A;  1GRI A;  2DXB A;  2CUB A;  3KBG A;  2DYB A;  1OX8 A;  2JS2 A;  4OMO A;  2V1Q A;  3CCV T;  4J9I A;  5KCO A;  1YJ9 T;  1KHI A;  1NEG A;  1D09 B;  4KGX B;  2DBM A;  2DJQ A;  4EPC A;  2DD4 A;  2RN8 A;  2A3L A;  2VGN A;  4QQD A;  2P4T A;  2CSQ A;  3RMQ A;  2HCK A;  4B9X A;  3CPW A;  2J7I A;  2L5Q A;  3BDU A;  2I2L A;  2HL3 A;  4XU3 A;  4L59 A;  1B3Q A;  2L0A A;  2MPX C;  3CXC S;  1YIT A;  4M7A B;  4GY5 A;  1M90 R;  2L3R A;  2XD0 A;  4JRP A;  1JXO A;  5GAN 7;  3CCL A;  1XJW B;  1ABQ A;  2L8D A;  3EGD B;  5GJV B;  1RAF B;  5CKF A;  4XQ3 A;  1OI1 A;  5LL6 S;  1PWT A;  1IZ6 A;  1NYF A;  4RTV A;  1AHJ B;  1SHG A;  2G3R A;  5A0L A;  1B7T A;  2DEU A;  1CKB A;  4AT1 B;  1M1F A;  4PJO F;  5DLO A;  1WXB A;  2QG9 B;  3GNF B;  3X28 B;  4AG2 C;  1VQP A;  2F69 A;  2QQ9 A;  4XK8 E;  3S3M A;  2CYZ B;  1YIT Q;  3VV0 A;  5HY6 A;  2HSP A;  2E6Z A;  3CCL Q;  3QJ6 A;  5GAN 5;  1Y96 A;  4XTU A;  3RER A;  1QP2 A;  1M30 A;  1WHM A;  1GFC A;  2FZC B;  2DYI A;  3UWN A;  1TWB A;  1BYM A;  2M16 A;  3OBW A;  4M75 C;  2KRO A;  1FMK A;  1D0Y A;  1VQ4 A;  1U5S A;  2EPD A;  2EJ9 A;  2V8I A;  1KK7 A;  5GAN f;  2BE9 B;  2K2V A;  3M0S A;  1KQS P;  2O01 E;  2YHT A;  1K73 R;  4OB1 B;  2GCX A;  4FYY B;  2K79 A;  2VGM A;  4J8O A;  3OMC A;  4ZN3 A;  5KYW B;  1VYV A;  2HSE B;  1AVZ C;  3A98 A;  2RI5 A;  2RHI A;  2VC8 A;  4C5G A;  4IKF A;  1KD1 U;  3VKI A;  2DO3 A;  2XIC A;  2SRC A;  4KGV B;  2AIR B;  4C0D C;  3KUF A;  3MEW A;  3R6O A;  5FRO A;  1UEC A;  1G2B A;  1VQ4 Q;  2OAU A;  2QXF A;  5GMK m;  2EKO A;  1PCX A;  4LUD A;  2YRC A;  1MMG A;  4N4G A;  2AKK A;  2LQN A;  3CC7 A;  4HA8 A;  3NFC A;  5LJ5 g;  3BFM A;  4L6V 5;  1ACM B;  2CKK A;  2BKD N;  1IO6 A;  2ESW A;  1H92 A;  4PJO B;  1BCO A;  3JCM P;  1G83 A;  4QVD A;  3G4S T;  4OP0 A;  1A0N B;  5LJ3 d;  5GMK j;  4M7D G;  2F1L A;  3HL8 A;  3I56 T;  2EBP A;  1W2B A;  1BB9 A;  3CD6 T;  3JCM d;  3S3O A;  5D6W A;  1GBQ A;  3SDZ A;  3V8J A;  3CC2 A;  3L2U A;  5KYU B;  1NG2 A;  2D8J A;  2VVK A;  3C0C A;  3PIP A;  1X6G A;  1RI9 A;  3VUB A;  2W0Z A;  3CC7 Q;  1NLP C;  4IUQ A;  2JM9 A;  2XDB A;  4M78 C;  4C92 B;  4X34 A;  4N4I A;  2K6D A;  2AZV A;  3CBM A;  1WGS A;  2EJF A;  1KC8 R;  2EVR A;  2RJD A;  1G3Y A;  4LD9 K;  1H8K A;  2AHJ B;  2FG0 A;  2HZY A;  2R5M A;  1YP5 A;  4P5N A;  4BE0 A;  3CBP A;  5J39 A;  4LDX A;  4M78 A;  4JLG A;  2J06 A;  4DOW A;  1Q86 C;  4RMO A;  2CRE A;  4HVV A;  3VUZ A;  2X4J A;  3MJX A;  3OW2 A;  3P8B B;  3QDF A;  3CPF A;  3REB B;  2XG8 D;  2F2V A;  2DIL A;  3OYL A;  1R77 A;  1OZ3 A;  4EMK B;  2K5L A;  1QLY A;  1WDX A;  4F7U F;  3CCS A;  4ZTJ A;  1UGV A;  4HCB A;  2MMP A;  4HVW A;  3MPU B;  3A5Z B;  3RKW A;  2DL5 A;  3PVQ A;  1VQ5 A;  1QWE A;  3CCR T;  5GMK e;  1G3T A;  2QTX A;  1NZ9 A;  2J6F A;  2OTL T;  4HCC A;  5FU7 B;  2DNU A;  1VQ8 Q;  1Q7Y U;  1LVK A;  2FPE A;  4M7D D;  5AYF A;  1YIJ A;  1S1N A;  3MEV A;  5GJW B;  2V26 A;  1VQ9 T;  2D8H A;  2QQR A;  3QG1 A;  3OMG A;  2KAF A;  2RI3 A;  3L2V A;  1X2Q A;  2CH4 A;  4MDX A;  4O6J A;  4E6R A;  3EG1 A;  1M3C A;  1IB8 A;  1VQ5 Q;  1IGU A;  3OA6 A;  3HSB A;  4J9E A;  2EGC A;  2K5F A;  5FU6 B;  4FT4 A;  1WJQ A;  3HHT B;  3PT9 A;  3JCM b;  2YUO A;  1KQ1 A;  1JJ2 S;  4O5V A;  2GTO A;  3LW5 E;  4M75 F;  4MML A;  5I22 A;  1YIJ Q;  1NM7 A;  5D6X A;  1IRE B;  4DBH A;  1UHF A;  4HKE A;  1YBY A;  2LTO A;  1H64 1;  2JTF A;  1I8F A;  1YHQ A;  1RAH B;  3UA7 A;  2WAC A;  1T0H A;  4LD6 A;  4CRI A;  2WSC E;  3M4Y A;  1YWO A;  1VQ7 T;  3M0R A;  4X9D A;  1YWP A;  2G6F X;  1Q81 R;  4QT7 A;  2CGH A;  2HAX A;  1MUZ A;  2RQW A;  3PE0 A;  2BZX A; 
#chains in the Genus database with same CATH homology
 1KHC A;  1RI0 A;  2LT1 A;  2X4X A;  3M54 A;  1YHQ T;  3CC2 T;  4ME7 A;  4BD3 A;  3JCM J;  4DOV A;  1JRI A;  1EIF A;  3FDR A;  4NS5 A;  4C0Z A;  2RI2 A;  5GAO q;  1VQK T;  5LJ3 e;  1G3S A;  2JUF A;  2RHZ A;  2PUO B;  3BY7 A;  3CC4 A;  2JZ2 A;  2XK0 A;  4M7D A;  2RH2 A;  3JCM e;  2DJZ A;  2V8J A;  3M4G A;  1M1K U;  2H3J A;  1U1S A;  2KVQ G;  3P8D A;  4QQ6 A;  5A2Q E;  4E7L A;  1K73 C;  5FRN A;  2QEX A;  2JNG A;  5I2S A;  2CZ7 B;  2E65 A;  1B34 B;  1X6O A;  2KQW A;  3GLX A;  3CBO A;  1PSF A;  2RJF A;  3CCJ A;  1VQ8 A;  3A8G B;  2DK3 A;  2E70 A;  4XTV A;  1RL2 A;  1LOJ A;  3EAE A;  3C12 A;  2RD1 A;  3OS0 A;  3TU4 K;  1YJN T;  1QVG S;  4RG2 A;  2EAY A;  3GNG A;  3JCM V;  1BI2 A;  3OYJ A;  2C06 A;  3F70 A;  4X9C A;  5KH6 A;  3H6Z A;  2MWP A;  3G6E T;  3SD4 A;  1Y96 B;  5GAN g;  3URG A;  2MI6 A;  1VQO T;  3ER0 A;  3RKY A;  3MEA A;  3QPH A;  5LJ5 d;  2RHX A;  3FC3 A;  1VIF A;  1JB0 E;  4J7F A;  2KK4 A;  3VJP A;  1ZBX A;  4C8Q D;  4EMG A;  4M77 C;  2RK1 A;  1K8A C;  1KD1 C;  4EMK A;  4XTW A;  3JCM g;  2D6F A;  4JS4 A;  4KUI A;  4KBM B;  5GAM g;  2CZ0 B;  2VXF A;  4UC4 A;  5A0G A;  2RM4 A;  4B9W A;  1Y7X A;  4C92 F;  2YLC A;  1VQL T;  4FM4 B;  3X26 B;  2ZPE B;  4QVC A;  4KT0 E;  3OYM A;  3CCJ T;  1S72 T;  3EFS A;  1VQ8 T;  2F5T X;  2DTH A;  3M58 A;  4JS5 A;  2IVW A;  4RCC A;  5GMK i;  4DQ2 A;  4MDW A;  3CMA A;  5GAN j;  2EFI A;  2NLU A;  1Q86 U;  3FEO A;  1K73 U;  4RKU E;  3X20 B;  3JB9 J;  3QBY A;  3UT1 A;  5LJ3 f;  3QKJ A;  4A4F A;  4A4H A;  1VQN T;  3V7R A;  3J7A F;  4A53 A;  2FYK A;  4HT8 A;  2EWN A;  2LC4 A;  3MO8 A;  2IG0 A;  3O8V A;  4M77 A;  3RIR A;  4XTZ A;  3TEE A;  3JCM f;  3OYI A;  3I55 T;  3LWI A;  4A4K A;  4BAC A;  1OZ2 A;  3L1A A;  4M78 F;  5LJ3 h;  2X4Y A;  5GAM j;  5GAO m;  4NL3 A;  4M7D F;  2OTJ T;  4C5E A;  4C92 E;  4IUT A;  4D6W A;  3CCS T;  3PFS A;  1UGP B;  2EQU A;  3UDC A;  3JCM h;  4J6Y A;  1Q82 C;  2DTO A;  2ZPI B;  2MWO A;  3DB3 A;  5KCH A;  1UGR B;  3UPU A;  3OYK A;  3OYB A;  3AHU A;  1VQ5 T;  3JB9 G;  3CXC A;  3OSV A;  1K8A U;  3RKX A;  3NTI A;  4ELZ C;  5GAO n;  1JBM A;  2PQW A;  2XDP A;  4FIB A;  2V8K A;  2LT4 A;  4IUU A;  2DXB A;  4ZTF A;  2O4X B;  5HK0 A;  5CAI A;  1XTD A;  4M78 E;  3RMS A;  3KBG A;  4M7A G;  4M7D E;  2D0Q B;  3C94 A;  1LNX A;  4XU1 A;  4JJN K;  2EQM A;  1MGQ A;  3SWN B;  2F5K A;  3QJY A;  1NPP A;  1N8R U;  3CCV T;  4II1 A;  2CZ6 B;  3INZ A;  5KCO A;  1YIJ T;  1YJ9 T;  1KHI A;  2MAM A;  1WQW A;  2GQV A;  4OB2 B;  1BI0 A;  4C8Q C;  1UB4 A;  2VV5 A;  3GP8 A;  4HT9 A;  4C0D B;  3JSC A;  3I56 A;  3CD6 A;  4F7U G;  4PNO A;  4ZGJ B;  1Y07 A;  4BB7 A;  4EPC A;  3QYG B;  2JTM A;  2DD4 A;  4FSX A;  4QW2 A;  3GOX A;  1D3B A;  2BIV A;  4JDS A;  2ZPG B;  2DD5 A;  3OY9 A;  2A3L A;  2VGN A;  2Y90 A;  2XID A;  5DM7 R;  1KC8 C;  1VQM A;  3A8H B;  4QQD A;  2P4T A;  2DIQ A;  2BUD A;  3RMQ A;  2L89 A;  4B9X A;  3CPW A;  4XU2 A;  2L5Q A;  3BDU A;  2I2L A;  4XU3 A;  3ZBD A;  1KG1 A;  4C8Q A;  2X4W A;  2E5Q A;  3QYH B;  2P0Q A;  4L59 A;  2QQS A;  4NL2 A;  5CCA A;  3QHS A;  2PVD B;  3CCM A;  4OGE A;  5CQY A;  1NPR A;  3CXC S;  1M90 U;  2JN0 A;  4M78 G;  4M7A B;  1YIT A;  4GY5 A;  3WVD B;  2L3R A;  5LJ5 j;  3SB2 A;  4CI0 C;  4JRP A;  1BI3 A;  4NOY A;  5GAN 7;  3CCL A;  2XD0 A;  1ZQ1 A;  5HKC A;  3LYI A;  2L8D A;  5CKF A;  4XQ3 A;  1OI1 A;  3Q1J A;  5LL6 S;  2DVE A;  3OYF A;  1IZ6 A;  2RHU A;  5GAO r;  3S6W A;  1AHJ B;  1M1G A;  2G3R A;  3NTH A;  4C5I A;  4R56 A;  2EQJ A;  5GAN e;  5D6Y A;  5A0L A;  2GFA A;  5I21 A;  4F7U B;  1KQS A;  2E1H A;  2JOY A;  4DA4 A;  1VQ6 A;  2E6N A;  1QVF A;  2FL7 A;  2DXU A;  3VU3 C;  1O9S A;  1UGS B;  2RO0 A;  3EFR A;  5GAO l;  1I5L A;  2R5A A;  4ATO A;  5GAN 3;  1M1F A;  4LDW A;  4OGC A;  4PJO F;  5GAM e;  5DLO A;  1G5V A;  3M9Q A;  2HD0 A;  4VUB A;  3GNF B;  2LRQ A;  3X28 B;  5DY9 A;  1N9S A;  1VQP A;  2F69 A;  3WXM B;  5GAN 4;  1B34 A;  2M1H A;  1X01 A;  5FLX E;  2QQ9 A;  4XK8 E;  4OVA A;  1WJR A;  2HQE A;  4M75 G;  4E7K A;  2CZ1 B;  3S3M A;  2CYZ B;  4QVZ A;  3PGG A;  3VV0 A;  5HY6 A;  2DZC A;  4A4G A;  3CCQ A;  2DPP B;  3ME9 A;  2E6Z A;  3LGF A;  3QJ6 A;  3QSU A;  2HQX A;  5GAN 5;  3CCE A;  2M0O A;  1Y96 A;  2D9T A;  4XTU A;  1QP2 A;  3WVE B;  4C8Q F;  5GMK l;  3JB9 I;  3RER A;  4PJO E;  2QQA A;  4RG8 A;  3OQ5 A;  3CC4 T;  2QA4 A;  3UWN A;  3JRZ A;  4LDU A;  3JB9 D;  2K3Y A;  5I2M A;  2YRV A;  1R8O B;  5CO7 A;  2MF2 A;  5GAO p;  2QEX T;  1BYM A;  2M16 A;  3M57 A;  3OBW A;  2LVM A;  4M75 C;  1VQP T;  4M7A D;  5J3B A;  1VQ4 A;  3FRN A;  3M59 A;  3M5A A;  5FRM A;  3L2Z A;  3QXE B;  4JRK A;  2KDS A;  2EJ9 A;  2QI2 A;  2V8I A;  1KQS S;  5GAN f;  2K2V A;  1MHN A;  3RUX A;  2O01 E;  2YHT A;  4OB1 B;  4E47 A;  2GCX A;  4J6X A;  3DLL A;  2R57 A;  1SSF A;  2VGM A;  1YI2 A;  1PSE A;  2ZZD A;  3HKS A;  3FB9 A;  5GAN h;  4XTY A;  3V7C A;  4XTX A;  5GAM f;  2QA4 T;  4BE1 A;  4M75 B;  2A7Y A;  4ZGD B;  4J8O A;  3L42 A;  5CR2 A;  3OMC A;  4ZN3 A;  4JUV A;  3M55 A;  2WSE E;  3VYG A;  1VQ9 A;  5GAM h;  4L5G A;  3SWN C;  5CKD A;  3LGL A;  4FT2 A;  2RI5 A;  3OYD A;  2RHI A;  1FX7 A;  2ZPH B;  1M8V A;  2VC8 A;  4E7J A;  4PJO G;  4C5G A;  3N5B B;  3PIO A;  2RJC A;  1Y71 A;  1KD1 U;  3VKI A;  2DO3 A;  2XIC A;  3MCA B;  2HNI A;  1YCY A;  5LJ5 e;  1K9M C;  2RB6 A;  3CMA T;  2E41 A;  4C0D C;  4XAX B;  3KUF A;  3HPW A;  2RHY A;  3G7Z A;  3MEW A;  3R6O A;  1BIB A;  2E10 A;  3A8M B;  3PMI A;  5FRO A;  1XNI A;  1NJI C;  4M78 D;  2OAU A;  2O4X A;  2QXF A;  3LLR A;  5GMK m;  4BUG A;  4FL6 A;  5CKB A;  4TVR A;  3BW1 A;  2EKO A;  3OYA A;  2GFU A;  3S3N A;  3G4S A;  2M9U A;  2WSF E;  4PKC C;  1I4K 1;  2DTI A;  3SWN A;  4RCB A;  3QII A;  2K57 A;  1YJW A;  4N4G A;  2LX9 A;  1XOV A;  3OB9 A;  4JRQ A;  3CC7 A;  4HA8 A;  3NFC A;  2YLB A;  3OS1 A;  5LJ5 g;  3JCM W;  4PLI A;  4WF2 A;  3NTK A;  5GAN 6;  4C92 G;  4ZN1 A;  3JCM Q;  4M7A C;  3C95 A;  4LDV A;  5C0M A;  3BFM A;  1N6A A;  1Q81 C;  4L6V 5;  3ZEH A;  2DIG A;  2EQK A;  2DXT A;  1DJ7 B;  1Q82 U;  4IKF A;  2CKK A;  3V8K A;  4A54 A;  3DB4 A;  3CCU A;  1BI1 A;  2BKD N;  4M77 F;  3LWH A;  3OYH A;  4PJO B;  4BDZ A;  3G71 T;  1K9M U;  3KXT A;  4BY6 C;  3JCM P;  4QVD A;  3P8H A;  4PLL A;  3G4S T;  3FJP A;  3HFO A;  3H8Z A;  1X75 C;  3OYC A;  1UEB A;  4OP0 A;  4BDY A;  1M5Q 1;  5LJ3 d;  4M75 D;  2PVO B;  5GMK j;  4C0F A;  4M7D G;  3CME A;  3HL8 A;  3I56 T;  5LJ5 f;  1W2B A;  3CD6 T;  3JCM d;  4C92 C;  4M7A A;  3S3O A;  2LNV A;  3C4S A;  1VUB A;  5D6W A;  3JCM X;  3E9F A;  2ZCF B;  4YTL A;  3DLM A;  1M1K C;  4J83 A;  3SDZ A;  4M77 E;  3V8J A;  5LJ5 h;  3CC2 A;  3L2U A;  3FIF A;  1QVG A;  4BY6 B;  1VQM T;  3A8O B;  1VQK A;  1P92 A;  3X24 B;  3PIP A;  3VYH B;  1W4S A;  3SFM A;  3VUB A;  4MZP A;  2DEQ A;  5EG2 A;  4IUQ A;  1HK9 A;  3QZ5 B;  3JAM E;  3MP8 A;  3OYE A;  3LH0 A;  4F7U A;  4M78 C;  4OB3 B;  4C92 B;  2XDB A;  4M7D C;  2KY9 A;  4X34 A;  1KC8 U;  4N4I A;  5CQX A;  3CCM T;  2GF7 A;  1FXX A;  1WGS A;  2EJF A;  3CBM A;  3MP6 A;  4JRI A;  5J26 A;  1YIT T;  2RJD A;  1HXD A;  5KE2 A;  3CCL T;  2E64 A;  1G3Y A;  1YJN A;  4LD9 K;  2EIF A;  2AHJ B;  4ELY C;  2ZGW A;  4J5Y A;  1BIA A;  1WNL A;  3M56 A;  2XDD A;  3GF5 A;  2R5M A;  4P5N A;  3G6E A;  3CPW S;  4BE0 A;  3JCM c;  3CBP A;  4JLI A;  5J39 A;  1VQO A;  4LDX A;  1GXI E;  3QO3 A;  4M78 B;  4M7D B;  3QUI A;  1WPY A;  4HCZ A;  5IN1 A;  1OYX A;  2EJG A;  4M78 A;  4A4E A;  4JLG A;  5C6S A;  5IT9 E;  1VQ6 T;  3OYN A;  3L2Q A;  3V7S A;  4C5H A;  4DOW A;  3JB9 F;  1Q86 C;  4RMO A;  2XU8 A;  4M77 G;  4EMK C;  1W2B S;  4PJO D;  4E7H A;  2P0K A;  4IUR A;  4PL6 A;  4Z02 A;  3VUZ A;  3L2W A;  3X25 B;  2X4J A;  4BI3 A;  1VQL A;  1N9R A;  5CIU A;  2DZ9 A;  1S72 A;  1Q7Y C;  2PVG B;  4FU6 A;  2FVU A;  3A8L B;  1QP3 A;  4Q5W A;  5GAN 2;  3OW2 A;  4M7A F;  3OYG A;  1V29 B;  3CCR A;  4C0G A;  5CKH A;  2XI9 A;  3P8B B;  1BKB A;  3OSS C;  1VIE A;  3MP1 A;  3CPF A;  2XG8 D;  4EMH A;  2OTL A;  3OYL A;  4BE2 A;  1VQN A;  3CCQ T;  1OZ3 A;  4C8Q E;  5LJ3 g;  3L2R A;  4EMK B;  4V2S A;  1N27 A;  3HP9 A;  2K4Y A;  3J80 E;  2K5L A;  2VYT A;  3I55 A;  2RJE A;  2OTJ A;  3CCE T;  1WQ7 A;  2XKO C;  3FLG A;  5FU7 C;  4F7U F;  3CCS A;  1G3W A;  2FB7 A;  4ZTJ A;  3MET A;  4HCB A;  4M7A E;  2MMP A;  1FWZ A;  5L8R E;  3A5Z B;  3QZ9 B;  3RKW A;  4M75 A;  4C92 D;  3TCJ A;  1VQ5 A;  2PUK B;  3HRU A;  4MZM A;  5HK3 A;  4MZT A;  3CCR T;  1JJ2 A;  5GMK e;  1G3T A;  1VQ4 T;  2QTX A;  2ZPF B;  3OYY A;  1LJO A;  1NZ9 A;  3TRE A;  3QDR B;  4MMK A;  1N8R C;  4ZGE B;  2PU9 B;  4M77 B;  1M4Z A;  2XHC A;  3MHX A;  4J7I A;  5LJ3 j;  3OS2 A;  3DKM A;  2OTL T;  4HCC A;  2LCL A;  5FU7 B;  4EDU A;  1UGQ B;  2QDY B;  1Q7Y U;  4F7U E;  3PNW C;  5M9O A;  3HFN A;  1YI2 T;  3T9N A;  5DLQ E;  4M7D D;  3E1S A;  3CCV A;  3JB9 H;  2X35 A;  5AYF A;  5A0D A;  5KE3 A;  2EYQ A;  1YIJ A;  1YJ9 A;  2B8A A;  2Y4X A;  3OW2 S;  3HRT A;  3MEV A;  3CEY A;  5FU6 C;  4C8Q G;  1VQ9 T;  4PJO C;  4LDY A;  2QQR A;  3QG1 A;  3OMG A;  2KAF A;  2RI3 A;  3V8L A;  3L2V A;  2P0P A;  5GAN 8;  2DAQ A;  2R58 A;  1M9S A;  1NE8 A;  4IUV A;  4O6J A;  2LQK A;  1M90 C;  5IAY A;  1QVP A;  1ZHI A;  2E12 A;  3OS5 A;  4KUD K;  4Y28 E;  3OA6 A;  1TH7 A;  3GIB A;  3HSB A;  5CK9 A;  2K5F A;  5FU6 B;  2LQ8 A;  3PMT A;  4FT4 A;  1WJQ A;  3HHT B;  1VQ7 A;  3PT9 A;  3JCM b;  2LDM A;  1WJS A;  3M53 A;  3E9G A;  3J81 E;  1KQ1 A;  5GAN d;  2RK2 A;  2ZPB B;  4PJO A;  2DKG A;  4R55 A;  1JJ2 S;  3LW5 E;  4MML A;  3ASK A;  4M75 F;  2Y4Y A;  3BDL A;  4GLK A;  4O5V A;  4N0A C;  4OF1 A;  1QVF S;  4OB0 B;  1D3B B;  3HRS A;  3ZFJ A;  1YJW T;  4BI4 A;  4XU0 A;  4OMF B;  1NJI U;  2K3X A;  3E19 A;  5CKE A;  3CC7 T;  5D6X A;  5GAM d;  5GMK h;  1IRE B;  3PTA A;  4HKE A;  1YBY A;  3G71 A;  2LTO A;  1H64 1;  2JTF A;  4BI8 B;  2QQB A;  1I8F A;  1YHQ A;  4QQG A;  1I81 A;  1U8R A;  2KMT A;  4KUL A;  5CVI A;  2WAC A;  4C8Q B;  4J6W A;  4M77 D;  2FHD A;  1H3Z A;  4LD6 A;  3CCU T;  2HBP A;  1O75 A;  4CRI A;  2WSC E;  4IUP A;  2KSS A;  3M4Y A;  1XQH A;  2VXE A;  4M75 E;  3RES A;  1VQ7 T;  4Y91 A;  4N0A A;  3MEU A;  1Q81 U;  3LX7 A;  4X9D A;  4N4H A;  4E7I A;  2JVV A;  2VUB A;  2K5I A;  1U1T A;  4C92 A;  2RA2 A;  2CGH A;  1QW1 A;  2LCC A;  3CME T;  2HAX A;  2CS7 A;  2DXC A;  3OBY A;  1KQ2 A;  3GPL A;  4MDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...