1GXIE

Psae subunit of the photosystem i of the cyanobacterium synechocystis sp. pcc 6803
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQAAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords PHOTOSYSTEM I REACTION CENTER SUBUNIT IV
publication title Solution NMR Structure and Backbone Dynamics of the Psae Subunit of Photosyetm I from Synechocystis Sp. Pcc 6803
pubmed doi rcsb
total genus 10
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1gxiE00
2ZPIB 3QXEB 2CZ7B 4FM4B 3VYGA 2QDYB 1IREB 2PVDB 2ZZDA 4L6V5 2ZPBB 2CZ6B 2CZ0B 1PSEA 3A8OB 2DXCA 2CZ1B 3X20B 2PUOB 3QYHB 4ZGJB 3A8HB 2DXBA 2DD5A 1UGRB 3WVEB 4RKUE 4Y28E 3QZ9B 2PU9B 2WSEE 1GXIE 2PVGB 2ZPHB 4OB2B 1PSFA 2PVOB 2AHJB 2DD4A 1QP2A 3WVDB 4ZGDB 1JB0E 4OB1B 4OB3B 3QZ5B 4ZGEB 4XK8E 5L8RE 2WSFE 1V29B 2CYZB 2O01E 3LW5E 3A8MB 3X25B 1UGQB 3X24B 2DPPB 3A8LB 3X26B 2ZCFB 3QYGB 4KT0E 3HHTB 3A8GB 1UGSB 3X28B 3VYHB 1QP3A 1DJ7B 4OB0B 2ZPEB 1UGPB 2D0QB 2WSCE 2PUKB 2ZPFB 1AHJB 2ZPGB
chains in the Genus database with same CATH superfamily
5IHNA 1IB8A 1KFZA 3QXEB 1IREB 2P4RA 2X51A 4X9DA 3RKWA 4M7DC 1C1AA 3QHSA 1Y71A 4PJOG 3M53A 2QG9B 1FYNA 2A3LA 5IXBA 2MWPA 2JUFA 5KYWB 4N4HA 2D0NA 1QVGA 2L0AA 2M0YA 4LDXA 2LJ0A 2CS7A 1WHKA 3DLMA 4J9HA 4CC7A 3QYHB 2JTFA 1YI2A 2DD5A 2RNAA 3CCJQ 4V2SA 1KHIA 5LJ3h 1KD1R 4PJOA 1E6HA 2CT3A 4GBQA 4FU6A 5GAOq 2H8HA 1W4SA 4OMQA 2JTMA 2EQUA 2QGFB 3I55A 1M1GA 2HKNA 4PLIA 3CCJT 4F17A 4E7KA 2RK2A 1I81A 2AT1B 5LJ3e 4C92D 2ECZA 3T9NA 2G6FX 3UA6A 3I56A 1VQ9T 4E2FB 3QPHA 1YHQQ 4JJBA 3L2QA 3HTRA 4BY6B 1VQ6Q 1K73C 3H0IA 3EHQA 3O8VA 2CSQA 2E4HA 2DL8A 1OULA 1TOVA 5AYFA 4AFZC 1SRLA 3RDVA 1OZ2A 2AKLA 4A4EA 1YHQT 1UECA 1WI7A 3KFVA 5GANf 4OB0B 4RTVA 2KGTA 1VQLA 2D0QB 2PUKB 2I0NA 2RQRA 2ZPFB 4C92E 5CCAA 3WXMB 1IXDA 1H8KA 2GQVA 4OMFB 1QW1A 3GP8A 1KG1A 1O75A 4RTUA 5A0DA 1TXQA 3MCAB 2I2LA 1M3BA 3ULRB 3HPWA 2L5QA 1OX8A 4J9DA 2VXFA 3CMAA 2RHIA 3OMGA 1X2KA 3FDRA 2GGRA 1RACB 3OS0A 2CKKA 4PJOB 4BI4A 2O88A 4J9FA 2Y4XA 4JZ4A 1NM7A 4X34A 1GCPA 1PSEA 3GBQA 1LJOA 1YP5A 2CP3A 3M54A 5CQXA 3FRNA 5A2QE 2M9UA 2KRSA 1OOTA 2GTJA 1YITA 3A8HB 3AT1B 2DXBA 2K3XA 3FC3A 2YLBA 3V7CA 3ZL7C 1M1FA 1MMGA 1JXOA 3JB9I 2E41A 1PSFA 1ZUYA 2FPFA 2HEQA 1LNXA 2O2OA 3MHXA 4IUVA 3CC7T 4PJOF 1N9RA 2HSEB 4M78D 1W2BS 3GOXA 4M7AC 5FWCA 2AK5A 3MEUA 4HCZA 2FRWA 1UUEA 4X9CA 2EYXA 1V29B 3GF5A 2CYZB 4JRPA 5GANh 3M58A 2M0OA 3OYDA 3CCMT 3EG1A 4RCCA 4QKUA 4OP0A 1IHWA 3NHNA 3G6EA 2X9HA 1S72A 1JRIA 3X26B 3L42A 4NS5A 3KBGA 2M16A 2KE9A 5I22A 2X35A 2XDPA 3GLXA 4CC4B 4N0AA 2YUQA 3QWYA 3CCET 2JS0A 1JEGA 1Y57A 1RI0A 2KROA 5GANe 3JB9J 4J7FA 1K73R 1ZBJA 3G71A 3OW2S 5DY9A 4ZTJA 4BACA 2KRMA 1BIBA 2ZPGB 1QCOA 2DYIA 3TCJA 3PGGA 5GAN8 4A54A 2OTLQ 3OYLA 2COZA 5LJ5f 1LVKA 2FVUA 3S6WA 3CCVT 4QQDA 3VS5A 2CZ6B 2CGHA 3EGXA 4HA8A 4XAXB 2BIVA 5CQYA 5GMKj 5KYUA 1J3TA 1BI2A 3MKDA 3OYFA 2OTLT 2K7AA 4XTWA 4ZN1A 4OMPA 2GFUA 3UT1A 2LDMA 4E7IA 1VQ8A 2ZAEA 2VWFA 2F2WA 2E6ZA 2E64A 4KH0B 3VJPA 4MMKA 5FW9A 3L2RA 3UPUA 5IAYA 4OMNA 1VQKA 2RJEA 3QSUA 2MMPA 5IT9E 1GL5A 1NLPC 5GJVB 2KK4A 1G2BA 2EBPA 3HFNA 3MO8A 2MWOA 1G3SA 2KNBB 1C6VX 5LL6S 2VUBA 3GNGA 4B9XA 3I35A 4A4HA 3FB9A 1WJQA 2WSFE 3M0QA 4NL2A 2J05A 4BDZA 4PK4A 3V7SA 1BU1A 2WACA 1RAHB 3LW5E 2CSIA 1MMNA 4J9BA 1MHNA 1VYUA 2RI5A 4LD9K 1K8AC 1I5LA 3ER0A 3OYJA 4C0DC 2VGMA 2ED0A 2R5MA 3MJXA 1UHCA 1WFWA 3CXCS 5GAMf 4EMKA 3NTHA 4JUVA 2RN8A 1VQOT 3JCMV 5DM7R 4JJDA 5IH2A 2K2MA 5LJ5h 2WSCE 1KQSS 1IHVA 2ED1A 3OYIA 5GAN5 3EGXB 5KYUB 2XIDA 4PKCC 2HQXA 2DTHA 3CMEA 4D6WA 5GAN4 3OYGA 2ZPBB 2JM8A 4PJJA 4F16A 5LJ5e 4PNOA 3U23A 1LOJA 3CD6Q 2JJ9A 1ZLMA 2E65A 4Y92A 1YIJT 3X20B 3H0FA 1N8RC 4RTXA 2PUOB 4J8OA 3REAB 2G3RA 4PJOE 3D7SB 4XTVA 4TVRA 3EGDA 3CD6T 2JMCA 2O4XA 1BKBA 1YJ9T 2L3QA 3CCQA 2KYBA 1QVGS 1SG5A 1K0SA 5GAN6 5GAN2 3TU4K 3QBYA 1M8VA 4C92C 5GMKi 1WHLA 2EJFA 3S3NA 4F04B 5GAOr 5HCKA 1VA7A 2EKHA 3P8BB 4QVZA 5FU7C 4BI3A 4EMKB 5I2SA 5GAMh 4JS4A 2CUDA 2DIQA 2O01E 5HK0A 3UF4A 4IURA 1UGQB 1WZOA 9ATCB 2E3IA 1MNEA 2JN0A 2DRMA 2FO0A 1VUBA 3QYGB 2A28A 5LJ5j 1BK2A 4EPCA 5GAMe 3L2UA 3CCLQ 1X43A 3CC2A 3MP1A 3KXTA 3BW1A 2RHUA 3CBOA 5CKFA 2JW4A 3OYYA 2QGGA 2P84A 2H3EB 3QJ6A 1YNZA 1TH7A 1VQ5Q 3CCLT 4BE0A 2Y4YA 4FW2A 2ZPIB 3HRTA 5GJWB 1I0CA 4L6V5 3VRZA 5IN1A 1GRIA 4WCIA 3I55T 3N5BB 3CCUA 2W0ZA 1NEBA 4DBRA 2O4XB 1BB9A 1VQNA 1WXUA 2EJGA 2EVRA 1W70A 4HCCA 2YRDA 2YWWA 1V76A 3J81E 4KUDK 1QCNA 5HKCA 4M78A 2K4YA 3CBMA 4HCKA 3VS4A 4MZPA 1X2QA 2L3RA 1KD1C 4O5VA 3G7ZA 3QZ9B 3BE3A 2EW3A 2PQWA 2KXCA 4EMHA 1B34A 1YJWA 2MOXA 1VIEA 1N5ZA 3DB4A 3CCRT 2K79A 2QQBA 2XHCA 1D1CA 3NFCA 2A0FB 5CR2A 2QA4Q 3V7RA 2AIRB 2LCLA 4GLKA 4M78C 2P0QA 5J39A 3LGLA 4CI0C 2D8HA 1VQLT 1ZUKA 1RAEB 2KRNA 2RHZA 4F7UG 1A0NB 2LP5A 3AHUA 1RL2A 1RAFB 2VKNA 1H92A 4E7SA 1WHHA 3VS1A 3JB9H 3FIFA 2RHXA 1UG1A 2RJDA 3C95A 4BI8B 1TUGB 2QYZA 4JLIA 1WJRA 2X3WD 3H41A 1G5VA 3FEOA 4F7UA 2DLPA 4HT9A 1WJSA 3CQTA 4PFPA 1U3OA 1Q81C 5LJ5d 5KYYA 3M4GA 3VKIA 5FWBA 2A7YA 4PJLA 4JRIA 3Q1JA 3ME9A 4LXCA 4PJNA 4BB7A 4Z02A 4N4GA 1KQSA 3UATA 1ZX6A 3M0RA 1RAIB 1N27A 2DVJA 4MZMA 2JOYA 3PIPA 2MPXC 2KBTA 1JBMA 1T0JA 1QVPA 1GFDA 2MF2A 4J9CA 1OYXA 4DBFA 2GBQA 3OQ5A 2H3JA 1CKBA 1B34B 1TUDA 2QEXA 4FYXB 1Z9ZA 4FSXA 2F5KA 1YN8A 4BY6C 4FCYA 2OJ2A 2EGCA 1OQKA 5AT1B 4Y28E 5L23A 2C06A 2M02A 3G6ET 1VQ7A 1K8AU 4JJCA 3FJ5A 1E7OA 2DILA 4KH1B 1HJDA 4M78F 4M4ZA 1QKWA 1RAAB 2LC4A 3JCMd 1K4US 3JV3A 1K9MC 3PFSA 1NJIC 4F7UB 4ELZC 2LX7A 3LLRA 1WYXA 3O5ZA 2RHYA 1VQ9Q 5KYYB 3EG9A 2XK0A 1PRMC 5GAOm 1BCMA 4UC4A 2F5TX 3QKJA 1H3ZA 1P92A 2VC8A 3EFSA 1Q82C 2XU8A 2GCXA 4PJOC 2EGEA 2EPDA 4IUUA 1QLYA 1WQ7A 3H8ZA 3EGUA 4M77G 5KCOA 2C0OA 4RCBA 3M59A 1N8RU 3G4SQ 2LQ8A 2DBKA 3P8DA 3KUFA 2XDDA 4F7UF 1C0MA 2JZ2A 1VQ8T 1LPLA 5I2MA 3C94A 2X4WA 2MIOA 1WDXA 1WPYA 3RBBB 3ZBDA 2CZ7B 4FM4B 4EMGA 2JXBA 1X6BA 3EFRA 4XQ3A 1M90C 3THKA 3G4ST 2K3BA 1Q81R 2B8AA 3CC4A 4IUQA 4JRKA 4DOVA 2F1LA 2JM9A 2JTEA 3SDZA 3RMSA 2DX1A 4ZGJB 1G83A 2LJ3A 1NPPA 2EQIA 3M4YA 1KC8C 1KJWA 1G8XA 2KMTA 1PKSA 4N4IA 5CKHA 2PVGB 1AZEA 1Y0MA 3OYAA 2YXYA 4KBMB 1UEBA 2OTJA 1OZ3A 1MV0B 1RABB 2K3YA 4M75G 2F2VA 4AFUC 2QA4A 5LJ3j 1SSHA 2OAUA 1RLPC 3EG9B 2EQJA 4HCBA 4FYVB 3CC7Q 2JMAA 2YDLA 4RTWA 2EGAA 1PNJA 1D3BB 4XK8E 3NTIA 1MMDA 1ZBXA 5D6YA 1VQPA 2NUTB 3TEEA 2RK1A 4BDYA 3EG2A 4ANJA 1AWJA 3OB9A 2SRCA 2V8JA 2FG0A 3A1PA 3CCMQ 1PRLC 4CC2A 2COYA 4KT0E 2K5FA 4FL6A 3FJPA 2D1XA 1YJNQ 1K9MR 1BI1A 1NJIR 4B6MA 2A37A 1GBQA 1PM3A 2V8IA 1OU8A 3JCMW 1KHCA 2K9GA 2E70A 4M77B 2CH4A 1FWZA 1CKAA 3CCEQ 1XTDA 1D1AA 5HY6A 5KCHA 1KD1U 1YJNT 2L3PA 3M56A 1SKUB 5HK3A 1U5SA 2QTXA 3DLLA 4II1A 1ARKA 2JT4A 1Q86C 1Q82R 2F2XA 5KE3A 4A63B 1Y7XA 4A4GA 4AFSC 2CP2A 4EDUA 1YCSB 3CCVQ 1VQMQ 3JCMg 4NOYA 2DVEA 4M78E 4C8QG 1JJ2P 1VQ4A 2LZ6B 4PFZA 3DKMA 2RI2A 3PNWC 2EFIA 2LT4A 4RKUE 4N0AC 4C5EA 2PU9B 1M90R 1VQMT 1AOJA 2ZPHB 1BYMA 2V1RA 3OS2A 2M1HA 4LDUA 3MPUB 4XU1A 1QVFP 1U1TA 1D09B 1G3WA 4E47A 1QKXA 1UTIA 3MP6A 2L3SA 1QWEA 4M75B 3JCMX 1ACMB 4RG2A 4LDVA 4DA4A 1Q81U 2LNHB 2IVWA 2BUDA 5LJ3d 4IUTA 1PHTA 3CCJA 1KC8R 2EQMA 2DFUA 3M0SA 5I11A 2NYSA 2E10A 5IXFA 1SHFA 2NLUA 2JS2A 4XTUA 4LUEA 2ROTA 3RIRA 5A0LA 4F7UE 3LYIA 2IG0A 1UE9A 2NWMA 3TREA 2CDTA 1WA7A 4R55A 1SEMA 5GAOp 1T3LA 1GFCA 2QQ9A 3SB2A 1DJ7B 5GANj 2K6DA 1WHJA 2RF0A 1QCFA 1M8MA 1YHQA 2V8KA 1VQ6A 1N6AA 4M7DD 4LNPA 1VQOQ 1AHJB 3CPWP 4A4KA 3GPLA 2K2VA 1NEGA 4OMOA 1WGSA 2ZZDA 4J83A 4ME7A 1VYVA 3V8KA 2HL3A 1IGUA 2RMOA 2DKGA 3SWNB 3OYMA 3GNFB 2HZYA 1ZA2B 4C8QB 1K9MU 1X27A 3UDCA 4JPBW 1YIJQ 1NJIU 4EMKC 2EWNA 2IPOB 1N9SA 3E19A 1OEBA 1SSFA 4L5GA 1VIFA 1Q86R 4FSSA 2J7IA 3JCMb 4Z8AA 1M3AA 3OSVA 3CCSQ 1XJWB 1YJ9Q 1Q82U 1NPRA 3S3MA 4ATOA 4OB3B 2DBMA 4X1VA 1PWTA 1K73U 3CCST 3P8HA 4CRIA 3CC7A 4J7IA 4A4FA 1NZ9A 4M77D 3NPFA 3M57A 4F14A 1QQJA 2CH4W 2K5IA 3MEAA 1XNIA 1GCQA 4WTOB 3JSCA 2HMAA 3JB9G 1IGQA 4RTZA 3A8LB 1M90U 3CCMA 2HQHA 5EG2A 3EH2A 2HDAA 2O31A 5D7UA 4LDYA 1D0ZA 1M5Q1 2DL3A 4QQ6A 1ZSZB 1M30A 1GCQC 5GANd 2GTOA 4XU0A 1Y07A 2VV5A 4MZTA 1TWBA 3L2VA 1PKTA 4FYYB 1KC8U 4Y91A 4MDXA 1W6XA 2YSQA 1YI2Q 2O9VA 5GAN3 2ABLA 1VQ7T 4QVCA 2DETA 1W1FA 1K76A 2DIGA 2KAFA 1IRXA 2RB6A 2YUPA 3V8LA 3L1AA 1I4K1 2FB7A 3JAME 3PMTA 4HVVA 2CP0A 3I55Q 3CBPA 1YI2T 2XI9A 2CZ1B 1YCYA 4M75D 5LJ3g 3J80E 4ORZA 1KIKA 5CO7A 2RD1A 2QQSA 3NTKA 1PD0A 3I56Q 4J9EA 2OTLA 4KGXB 2AZVA 4LDWA 2XKOC 4JZ3A 2XDBA 2DK3A 1R8OB 1XQHA 2SEMA 2PVOB 2GF7A 3RERA 5J26A 4M7AD 2J6FA 1WXBA 2BZ8A 1TTHB 4E7JA 3I56T 1QP2A 1EFNA 2MI6A 3CCRQ 2HBPA 3VS6A 4QT7A 2BZYA 3R6NA 2FPDA 4IKFA 2E3HA 2VXEA 3VS0A 3SFMA 2CP6A 3QZ5B 3INZA 3PIOA 1VQLQ 1RI9A 1UGVA 1MGQA 1T3SA 2KY9A 2RJFA 2ATCB 2NUPB 1D0XA 1MMAA 3A8MB 1SPKA 5ECAA 4JLGA 5CIUA 1W2BP 1Q86U 3CMAQ 4KGVB 1OPKA 5GAMj 3HHTB 3CC4T 3A8GB 1UJ0A 2LQWA 1BCOA 1TUCA 3QO3A 5FU6B 3M55A 3NGPA 2LT1A 3LX7A 4BUGA 1M2VB 3CMAT 4C8QD 3I5SA 3RKYA 1YITQ 1UJYA 3MEWA 1ZHIA 3G1JA 2DEQA 2X4YA 2F69A 2LMJA 3OS1A 3RR6A 2V1QA 4FIBA 4J6WA 2OTJT 3PMIA 2E6NA 2EIFA 3BDLA 3JB9F 3OW2P 1YITT 3LGFA 1U06A 3HRUA 4E6RA 1NYFA 2DA9A 2BE9B 1YWOA 2YT6A 1OX9A 1OV3A 2XD0A 1VQPT 1K0XA 4C5HA 5C6SA 2YRCA 3CD6A 2HCKA 1TSFA 3RMQA 4LD6A 2AHJB 3OBWA 3URGA 1X69A 4M7DG 4A53A 3OSSC 3G6EQ 2HSPA 2KXDA 1S72Q 4C0FA 3REBB 3J7AF 2DYBA 2R57A 1R0CB 3R6OA 4OF1A 5GANg 1ZQ1A 3EAEA 4XU3A 2Z0WA 1AWXA 4LE9A 4M7DA 2E1HA 3V8JA 3JRZA 1B3QA 1S72T 1Y96A 1Q7YC 3X25B 4BE1A 3META 1NE8A 2CREA 2D6FA 4RG8A 3C4SA 1MUZA 2ZCFB 1AVZC 1PD1A 4BD3A 2DAQA 4L59A 3VYHB 5FRNA 4ZN3A 3EG0A 3IQLA 5GAMd 3G71T 2DJQA 2RQWA 1VQ4T 4GY5A 4WF2A 2CP7A 2QI2A 2DXTA 4Q5WA 2L2PA 1NYGA 4PL6A 3RKXA 5CVIA 3E9FA 3CXCP 2BTTA 4K11A 4PFOA 1TU0B 4QW2A 5IHKA 2OI3A 5A0GA 2FL7A 1VQ8Q 2HNIA 1D3BA 4AT1B 3CCLA 4IIMA 3L2WA 3EFOA 3VUBA 1KQSP 2YLCA 1RADB 3CPFA 2NUTA 2GQIA 4D8KA 5CKDA 1I1JA 1VQKQ 3GIBA 2VGNA 2FRYA 2DXCA 4OMLA 4E7ZA 3EH1A 1B07A 2AKKA 2FEIA 3LWHA 1RUWA 1H3HA 2FZCB 2KI7A 2DTIA 2P0PA 1VQ5A 3JCMP 2FZKB 2FPEA 1RAGB 3SEMA 2LX9A 1YFNA 4IUPA 4NL3A 2RJCA 3OYNA 1WIEA 3MP8A 1MV3A 4M77A 1VQKT 2DERA 1FX7A 3VS3A 4OB2B 4ELYC 1EX4A 4VUBA 2YUOA 2MAMA 4ESRA 2OX7A 3VS2A 2MYSA 4EIKA 4FT4A 4M7DB 3CEYA 1K9AA 1Y96B 4JS5A 4C0ZA 3JB9D 2EYWA 2L8DA 2DZCA 4RUGA 3CCRA 2KT1A 4E7HA 2HQEA 4RTTA 1VQ6T 2RO0A 4M77C 2CT4A 2DEUA 2QXFA 1QVGP 4OGEA 4BE2A 4ZTFA 1WHMA 4DOWA 2J6KA 1U1SA 4HXJA 1BBZA 2LRQA 4JRQA 3EHRA 2KYMA 2KVQG 2LTOA 5GAN7 2FHDA 2QASA 3PE0A 2HKQB 3CMEQ 1FMKA 1CSKA 5LJ5g 3S3OA 1JJ2A 1KQ2A 3X28B 4M7DF 3PVQA 3VV0A 4PJMA 2RA2A 1I8FA 3BFMA 2RM4A 4PLLA 3EFOB 5EC7A 4M7AG 4KRTA 5C0MA 3HRSA 4M75A 3CMET 1KSWA 2PZ1A 1Q7YR 5GMKh 1QVFA 4IIOA 2DL5A 2CP5A 1BIAA 3BY7A 2EYYA 2GFAA 4KULA 2EYQA 4FYWB 2XG8D 1IO6A 2Y90A 3E1SA 1G3TA 4M7AA 3CCQQ 2CZ0B 4DBQA 1WQWA 4M75C 3OS5A 1HXDA 5GMKe 3QDFA 1Q95G 3I9QA 1M1KC 1NLOC 2D8JA 1X75C 3LH5A 2L89A 2QQRA 3CCQT 5CKBA 3RNJA 3M0PA 1JQQA 1JU5C 1T0HA 2X4JA 3PTAA 4R56A 2XMFA 4RTYA 5GAOn 1O9SA 3C0CA 2ZGWA 1ABOA 3WVDB 3RUXA 1D1BA 7AT1B 5GAMg 3CPWA 4M77F 5DLOA 3CC2Q 3QIIA 2FYKA 4AG2C 4LUDA 1RLQC 2J6OA 3SWNA 2VVKA 4LN2A 4C8QA 2KQWA 1X01A 3HP9A 3F70A 2HL5C 3VUZA 2B86A 2KEAA 1UB4A 4YTLA 3CC2T 4J9IA 1EIFA 2JNGA 2LNVA 1UGSB 3VS7A 3OYCA 2VYTA 4OGCA 3SWNC 3TSWA 1QP3A 2QK0A 4C5IA 3EG3A 3CCUQ 1HYOA 3QDRB 1UGPB 2R5AA 4C8QC 8AT1B 1HSQA 1VQNQ 1AWOA 1HD3A 3A98A 1VQ9A 4M7AB 5J3BA 3HL8A 1PC0A 4QVDA 1UFFA 1X6OA 4CC3A 5KH6A 1JO8A 1AZGB 4GLMA 2DTOA 4B9WA 3CCUT 4DBHA 4J9GA 3PT9A 1VQNT 1XOVA 1MNDA 4M75F 1YJWQ 3ZFJA 1WNLA 3LH0A 1H641 2DXUA 3M9QA 1SHGA 5KYNA 1QMCA 4AFQC 3G4SA 1OPLA 2VB6A 3I5RA 2RQUA 4D8DA 1GBRA 1UDLA 4M7AF 1YJWT 1ZSZA 1GXIE 1Q7YU 2FZGB 5CAIA 1YWPA 3HFOA 2DD4A 1UHFA 5DLQE 3JCMf 2RI3A 2QQAA 4R0KA 1PG5B 1WX6A 1M1KR 5CKEA 4ZGDB 1JB0E 2C0IA 4J6YA 2DMOA 4M7DE 1ZSZC 4ZGEB 2J06A 4PJOD 2QTVA 2GNCA 4C0GA 1S1NA 4HVWA 2W10A 2IIMA 2LCSA 2HBWA 1LCKA 4C5GA 2ENMA 4FW1A 2DL4A 3RESA 3X24B 2KR3A 2BZXA 3HKSA 2AZSA 3TSZA 2DPPB 4P5NA 5KYXA 4C92G 4MMLA 1WHGA 1G3YA 2V26A 3H0HA 2EAYA 2DE0X 1IZ6A 3JCMQ 4DQ2A 4C8QF 1M9SA 1FXXA 2PTKA 1KK7A 1F1BB 1M27C 2QEXQ 4C92A 3OBYA 2K57A 4OMMA 2A08A 2QDYB 1AD5A 2PVDB 1NG2A 3JCMJ 4MDWA 4C0DB 2YHTA 1PCXA 1BI0A 4E7LA 1YJNA 3M0UA 2NUPA 1VQ7Q 2KDSA 3SD4A 2QEXT 1AT1B 4XU2A 1I5OB 3QWXX 5D6XA 2RQVA 3CCEA 3ZEHA 4RMOA 2A36A 3OMCA 1QWFA 3JCMc 1V1CA 2X4XA 3TQ7P 1M3CA 3JCMh 8ATCB 1UGRB 4M77E 3WVEB 1ZUUA 4QQGA 1M2OA 5GMKl 2HAXA 1B7TA 1W2BA 1M2VA 2P0KA 5CK9A 2YUNA 4J6XA 3OYEA 2X3XD 1TG0A 4JJNK 3CCVA 3NMZC 1HK9A 1VQMA 2JVVA 3JCMe 1X6GA 1WLPB 5FU6C 2CUBA 2EQKA 4JDSA 2DL7A 4OB1B 5M9OA 2LQNA 1YBYA 3H6ZA 3E2UA 5KYXB 3DB3A 3FLGA 6AT1B 1ABQA 2DO3A 1R77A 2DJZA 1R0BG 3QG1A 2EKOA 2DZ9A 2LCCA 1BI3A 3OW2A 1K8AR 2M51A 4XTXA 5KE2A 2LJ1A 4C92B 2C0TA 3VU3C 4M78G 4DEYA 1NBEB 4ZNXA 3EGDB 3M0TA 4M75E 3CC4Q 1OU9A 4DEXA 5FU7B 1M1KU 1VQ5T 2RPNA 1ZA1B 2KSSA 4Z89A 3OYKA 2RQTA 2HD0A 5IHIA 4AMCA 1JJ2S 2MK5A 1I07A 3M5AA 3VRYA 3VYGA 1E6GA 3H9NA 4J5YA 4XTYA 2P4TA 4M7AE 2ESWA 1FMVA 4AG1C 2EJ9A 3L2ZA 1ZSGA 1OI1A 1JXMA 1SF9A 5D6WA 2D9TA 5FRMA 5FLXE 1FMWA 4C92F 3UA7A 2RH2A 2OTJQ 1VOMA 2O9SA 2BE7D 2PNIA 2NUZA 3A8OB 1VQOA 2E5QA 1QVFS 1WXTA 4Z88A 1N8RR 2QDLA 1KQ1A 4OVAA 1EZZB 1Z9QA 2COWA 4HT8A 4HKEA 3MEVA 3A5ZB 5I21A 5KYWA 2WSEE 3ASKA 4O6JA 5GMKm 2QA4T 1AEYA 3OY9A 3OYBA 2DM1A 1TS9A 5GAOl 1VQPQ 3OYHA 1AWWA 3OA6A 3SHWA 2LVMA 2VASA 4HVUA 1M4ZA 5LJ3f 2DRKA 2DF6A 4FT2A 1YIJA 1U8RA 1K1ZA 3LWIA 2XICA 1VYTA 2EYZA 3BDUA 3CXCA 3UWNA 4C8QE 3HSBA 5L8RE 2BKDN 3TVTA 2E5KA 2R58A 2K5LA 3CCSA 4XTZA 2ROLA 5FROA 2E12A 2DNUA 1YJ9A 3CPWS 2OAWA 3QUIA 1D0YA 3PVLA 4M78B 2MCNA 3C12A 2KT8A 4KGZB 1SRMA 2ZPEB 4KUIA 2QAZA 3G71Q 2YRVA 1VQ4Q 2LQKA 3E9GA 3QJYA
chains in the Genus database with same CATH topology
4BE0A 2K2VA 1QVFA 2Y4YA 2ZPIB 3QXEB 3HRTA 1BIAA 3BY7A 2GFAA 1WGSA 1IREB 2ZZDA 4KULA 4L6V5 2EYQA 3UPUA 4X9DA 2XG8D 5IN1A 4J83A 4ME7A 2Y90A 3E1SA 3RKWA 3I55T 3V8KA 1G3TA 4M7DC 3QHSA 3N5BB 1Y71A 4M7AA 4PJOG 3CCUA 3M53A 2A3LA 2CZ0B 2DKGA 1WQWA 2MWPA 2O4XB 4M75C 3SWNB 3OYMA 2JUFA 3OS5A 4N4HA 1HXDA 3GNFB 1QVGA 1VQNA 5GMKe 4LDXA 2EJGA 4C8QB 2CS7A 1K9MU 4HCCA 1M1KC 3DLMA 3J81E 3UDCA 4KUDK 1NJIU 3QYHB 5HKCA 4M78A 4EMKC 2K4YA 2JTFA 3CBMA 1X75C 1YI2A 2DD5A 2EWNA 2L89A 4MZPA 2QQRA 4V2SA 1KHIA 3CCQT 5LJ3h 2L3RA 1KD1C 1N9SA 3E19A 4O5VA 3G7ZA 4PJOA 1SSFA 5CKBA 3QZ9B 4L5GA 1VIFA 2X4JA 2PQWA 4FU6A 3JCMb 5GAOq 3PTAA 4EMHA 1W4SA 4R56A 1B34A 3OSVA 2JTMA 1YJWA 1VIEA 3CCRT 3DB4A 2QQBA 2XHCA 3NFCA 5GAOn 1O9SA 2EQUA 5CR2A 3I55A 1M1GA 3V7RA 2LCLA 2ZGWA 4GLKA 4M78C 4PLIA 2P0QA 1NPRA 3RUXA 3WVDB 5J39A 3CCJT 4E7KA 3S3MA 2RK2A 1I81A 3LGLA 4CI0C 5GAMg 5LJ3e 4C92D 1VQLT 3CPWA 4ATOA 4M77F 4OB3B 3T9NA 2RHZA 4F7UG 5DLOA 3I56A 1VQ9T 3QIIA 1K73U 1M90C 3CCST 2FYKA 3P8HA 4CRIA 3CC7A 4J7IA 3AHUA 1RL2A 3QPHA 3SWNA 4A4FA 1NZ9A 3L2QA 4BY6B 1K73C 4M77D 3JB9H 3FIFA 3M57A 2RHXA 3O8VA 2K5IA 3C95A 2RJDA 3MEAA 4BI8B 4C8QA 2KQWA 1XNIA 1X01A 3HP9A 3F70A 3JSCA 3VUZA 4JLIA 1WJRA 1UB4A 3JB9G 5AYFA 4YTLA 1G5VA 3CC2T 3A8LB 3FEOA 1M90U 1EIFA 4F7UA 3CCMA 1OZ2A 5EG2A 4A4EA 4HT9A 2JNGA 2LNVA 1YHQT 1UGSB 1WJSA 3OYCA 2VYTA 4OGCA 3SWNC 1QP3A 1Q81C 4LDYA 4C5IA 5GANf 5LJ5d 4OB0B 3M4GA 3VKIA 1M5Q1 2A7YA 3QDRB 1VQLA 4JRIA 1UGPB 2D0QB 2R5AA 4C8QC 3Q1JA 3ME9A 2PUKB 4QQ6A 5GANd 4C92E 2ZPFB 5CCAA 3WXMB 1VQ9A 4XU0A 4M7AB 5J3BA 4BB7A 2GQVA 3HL8A 1Y07A 4OMFB 4QVDA 1QW1A 1X6OA 2VV5A 4MZTA 4N4GA 4Z02A 1O75A 5KH6A 3L2VA 3GP8A 1KQSA 1KG1A 5A0DA 4MDXA 1KC8U 4Y91A 3MCAB 2I2LA 1N27A 2DTOA 3HPWA 2L5QA 4MZMA 5GAN3 2JOYA 2VXFA 4B9WA 3PIPA 3CMAA 3CCUT 1VQ7T 1JBMA 4QVCA 2RHIA 1QVPA 3PT9A 2DIGA 3OMGA 2KAFA 3FDRA 1VQNT 2MF2A 1OYXA 2RB6A 3V8LA 3L1AA 1XOVA 4M75F 1I4K1 3ZFJA 3OS0A 1WNLA 2CKKA 4PJOB 3LH0A 4BI4A 2FB7A 3JAME 1H641 3PMTA 2Y4XA 2DXUA 3M9QA 3OQ5A 2H3JA 4X34A 1PSEA 1LJOA 3G4SA 3M54A 5CQXA 3CBPA 1YI2T 2XI9A 2CZ1B 3FRNA 4LD9K 1B34B 1YCYA 4M75D 5LJ3g 5A2QE 2M9UA 2QEXA 1YITA 3J80E 3A8HB 2DXBA 2K3XA 5CO7A 2RD1A 2QQSA 3NTKA 4FSXA 2F5KA 3FC3A 4BY6C 2YLBA 4M7AF 2OTLA 3V7CA 1YJWT 4LDWA 2XKOC 1M1FA 4Y28E 3JB9I 2E41A 2C06A 1GXIE 2XDBA 1PSFA 2DK3A 1Q7YU 1R8OB 1XQHA 3G6ET 2PVOB 2GF7A 5CAIA 3RERA 5J26A 1VQ7A 4M7AD 1K8AU 3CC4A 3HFOA 1LNXA 2DD4A 5DLQE 4M78F 3JCMf 2RI3A 2QQAA 4E7JA 3I56T 1QP2A 2MI6A 2HBPA 2LC4A 3MHXA 4IUVA 5CKEA 4ZGDB 4PJOF 1JB0E 3JCMd 3CC7T 1N9RA 4IKFA 1K9MC 4J6YA 2VXEA 4M78D 3PFSA 1W2BS 1NJIC 3SFMA 4M7DE 4F7UB 4ELZC 3QZ5B 3LLRA 3INZA 4ZGEB 3GOXA 4M7AC 3PIOA 3MEUA 4PJOD 4HCZA 4C0GA 4X9CA 1MGQA 1V29B 3GF5A 2CYZB 2RHYA 1Q82U 4C5GA 4JRPA 2KY9A 2RJFA 5GANh 3M58A 2M0OA 3OYDA 3CCMT 4RCCA 3A8MB 2XK0A 4OP0A 3RESA 3X24B 5GAOm 3HKSA 4JLGA 5CIUA 4UC4A 3G6EA 2F5TX 3QKJA 2DPPB 1S72A 1Q86U 1JRIA 3X26B 4P5NA 3L42A 4MMLA 4C92G 5GAMj 1H3ZA 4NS5A 1P92A 3HHTB 2M16A 3KBGA 2VC8A 3EFSA 2X35A 2XDPA 1G3YA 2GCXA 2XU8A 3A8GB 3CC4T 1Q82C 4PJOC 3QO3A 3GLXA 5FU6B 2EAYA 4IUUA 4N0AA 1IZ6A 3JCMQ 4DQ2A 3CCET 4C8QF 1M9SA 1WQ7A 3H8ZA 1RI0A 5GANe 1FXXA 3M55A 4M77G 5KCOA 2LT1A 3LX7A 4RCBA 3M59A 4BUGA 3JB9J 1N8RU 4J7FA 2LQ8A 4PJOE 3G71A 3P8DA 3OW2S 3CMAT 3KUFA 5DY9A 4C8QD 4F7UF 2XDDA 3RKYA 4BACA 4ZTJA 3MEWA 1ZHIA 2JZ2A 4C92A 1VQ8T 5I2MA 1BIBA 2X4WA 2ZPGB 3C94A 2DEQA 3TCJA 1WPYA 3PGGA 5GAN8 2X4YA 3OBYA 2CZ7B 2K57A 4FM4B 3ZBDA 4A54A 4EMGA 3OYLA 2F69A 3OS1A 2QDYB 5LJ5f 2PVDB 3JCMJ 3EFRA 4MDWA 2FVUA 2YHTA 4XQ3A 4FIBA 1BI0A 4J6WA 3S6WA 4C0DB 4QQDA 3PMIA 3G4ST 3CCVT 4E7LA 2CZ6B 2OTJT 2E6NA 2EIFA 3BDLA 3JB9F 2KDSA 2CGHA 4HA8A 2B8AA 4XAXB 2BIVA 4IUQA 4JRKA 5CQYA 3SD4A 4DOVA 5GMKj 2QEXT 4XU2A 1YITT 1BI2A 3LGFA 3HRUA 3OYFA 5D6XA 3SDZA 3CCEA 3ZEHA 4RMOA 2OTLT 3RMSA 4ZGJB 3OMCA 3JCMc 4XTWA 4ZN1A 2X4XA 2GFUA 3UT1A 3JCMh 1NPPA 1UGRB 4M77E 3WVEB 2LDMA 3M4YA 2XD0A 1KC8C 4QQGA 5GMKl 2HAXA 4E7IA 1VQ8A 1VQPT 1W2BA 2KMTA 4C5HA 2P0KA 4N4IA 5CKHA 5C6SA 2E6ZA 2PVGB 2E64A 3VJPA 4MMKA 5CK9A 3RMQA 3CD6A 3L2RA 3OYAA 4J6XA 4LD6A 2AHJB 4KBMB 3OYEA 1UEBA 5IAYA 4JJNK 3OBWA 3URGA 4M7DG 3CCVA 1VQKA 2RJEA 1VQMA 1HK9A 3QSUA 2OTJA 1OZ3A 4A53A 2K3YA 3OSSC 4M75G 2QA4A 2JVVA 5LJ3j 2OAUA 4C0FA 3JCMe 2MMPA 5FU6C 2EQJA 3J7AF 5IT9E 2EQKA 2R57A 4HCBA 4JDSA 2KK4A 4OB1B 5M9OA 3HFNA 3MO8A 3R6OA 1YBYA 2MWOA 4OF1A 3H6ZA 5GANg 1G3SA 3DB3A 2VUBA 3GNGA 5LL6S 1ZQ1A 3EAEA 4B9XA 4A4HA 1D3BB 3FB9A 4XK8E 1WJQA 3NTIA 4XU3A 2WSFE 3FLGA 1ZBXA 2E1HA 4M7DA 4NL2A 2DO3A 5D6YA 4BDZA 3V8JA 3JRZA 3V7SA 1S72T 1Y96A 2WACA 3LW5E 1VQPA 3TEEA 2DJZA 1MHNA 2RK1A 3X25B 4BDYA 3META 4BE1A 2RI5A 1Q7YC 2EKOA 2DZ9A 1NE8A 2LCCA 3OB9A 1BI3A 2V8JA 3QG1A 3OW2A 3ER0A 3OYJA 1K8AC 4C0DC 1I5LA 2D6FA 4RG8A 2VGMA 3C4SA 2R5MA 2ZCFB 4XTXA 3CXCS 5KE2A 4KT0E 5GAMf 2K5FA 4C92B 3NTHA 3VU3C 4EMKA 4FL6A 4M78G 3FJPA 4JUVA 4BD3A 2DAQA 4L59A 1BI1A 3VYHB 5FRNA 4ZN3A 5GAMd 3G71T 1VQOT 3JCMV 2V8IA 5DM7R 4M75E 3JCMW 1VQ4T 4GY5A 1KHCA 5LJ5h 4WF2A 2WSCE 2E70A 4M77B 2QI2A 1KQSS 2DXTA 1FWZA 5FU7B 1M1KU 1VQ5T 4Q5WA 3OYIA 4PL6A 2KSSA 3RKXA 5GAN5 1XTDA 5CVIA 3E9FA 5HY6A 2XIDA 4PKCC 3OYKA 2HD0A 2HQXA 5KCHA 1KD1U 1YJNT 3M56A 1JJ2S 5HK3A 2DTHA 3M5AA 2QTXA 4QW2A 4J5YA 4II1A 3VYGA 3CMEA 4D6WA 5A0GA 4XTYA 2P4TA 2FL7A 3DLLA 4M7AE 5GAN4 2HNIA 3OYGA 1Q86C 1D3BA 2ZPBB 2EJ9A 5KE3A 3CCLA 3L2ZA 5LJ5e 1Y7XA 3VUBA 3L2WA 4PNOA 4A4GA 1OI1A 1LOJA 2YLCA 5D6WA 2D9TA 5FRMA 5FLXE 3CPFA 4EDUA 5CKDA 2E65A 4C92F 1YIJT 2RH2A 3JCMg 3GIBA 3A8OB 4NOYA 2VGNA 2DVEA 2DXCA 4M78E 3X20B 4C8QG 1VQOA 2E5QA 1N8RC 1QVFS 1VQ4A 2PUOB 3LWHA 1KQ1A 4J8OA 4OVAA 2G3RA 2DTIA 2P0PA 1VQ5A 3JCMP 3DKMA 4HT8A 2RI2A 4HKEA 3MEVA 3PNWC 4XTVA 3A5ZB 2LX9A 2EFIA 4TVRA 3CD6T 4IUPA 4NL3A 2RJCA 2LT4A 3OYNA 4RKUE 4N0AC 4C5EA 3MP8A 2O4XA 5I21A 2PU9B 4M77A 1VQKT 2WSEE 1VQMT 1BKBA 1FX7A 2ZPHB 1YJ9T 3ASKA 4O6JA 4OB2B 4ELYC 5GMKm 3OY9A 2QA4T 1YJNA 1BYMA 4VUBA 3OS2A 2M1HA 3OYBA 3CCQA 1QVGS 4LDUA 4XU1A 5GAOl 2MAMA 3OYHA 1U1TA 5GAN6 5GAN2 3OA6A 1G3WA 4E47A 3TU4K 2LVMA 3QBYA 4M7DB 4FT4A 1M4ZA 3MP6A 4C92C 1M8VA 5GMKi 3CEYA 1Y96B 4M75B 4C0ZA 3JCMX 2EJFA 5LJ3f 4JS5A 3S3NA 3JB9D 2L8DA 2DZCA 4RG2A 4LDVA 3CCRA 4FT2A 5GAOr 4DA4A 1YIJA 1U8RA 1Q81U 3LWIA 2IVWA 2XICA 2BUDA 5LJ3d 4E7HA 4IUTA 2HQEA 3BDUA 1VQ6T 2RO0A 3CXCA 3CCJA 4M77C 3P8BB 4QVZA 5FU7C 2QXFA 3UWNA 4BI3A 2EQMA 4EMKB 5I2SA 4OGEA 5GAMh 4JS4A 4BE2A 4C8QE 4ZTFA 3HSBA 5L8RE 4DOWA 2E10A 1U1SA 2BKDN 2LRQA 2NLUA 2DIQA 4JRQA 2R58A 2K5LA 4XTUA 2O01E 3RIRA 5A0LA 5HK0A 3CCSA 4XTZA 2KVQG 2LTOA 5GAN7 2FHDA 5FROA 2E12A 4IURA 1UGQB 4F7UE 1YJ9A 3LYIA 2IG0A 2JN0A 3CPWS 3TREA 1VUBA 3QYGB 3QUIA 5LJ5j 5LJ5g 3S3OA 1JJ2A 1KQ2A 4R55A 4EPCA 4M78B 5GAMe 3L2UA 3X28B 4M7DF 5GAOp 2QQ9A 3SB2A 1DJ7B 3C12A 3VV0A 5GANj 3MP1A 3CC2A 2RA2A 3KXTA 1I8FA 3BW1A 2ZPEB 3BFMA 2RM4A 2RHUA 4KUIA 1YHQA 2V8KA 4PLLA 3CBOA 5CKFA 1VQ6A 1N6AA 4M7AG 3OYYA 5C0MA 4M7DD 3HRSA 4M75A 2YRVA 1AHJB 3CMET 3QJ6A 2LQKA 3E9GA 5GMKh 1TH7A 3QJYA 4A4KA 3CCLT 3GPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPI B;  3QXE B;  2CZ7 B;  4FM4 B;  3VYG A;  2QDY B;  1IRE B;  2PVD B;  2ZZD A;  4L6V 5;  2ZPB B;  2CZ6 B;  2CZ0 B;  1PSE A;  3A8O B;  2DXC A;  2CZ1 B;  3X20 B;  2PUO B;  3QYH B;  4ZGJ B;  3A8H B;  2DXB A;  2DD5 A;  1UGR B;  3WVE B;  4RKU E;  4Y28 E;  3QZ9 B;  2PU9 B;  2WSE E;  1GXI E;  2PVG B;  2ZPH B;  4OB2 B;  1PSF A;  2PVO B;  2AHJ B;  2DD4 A;  1QP2 A;  3WVD B;  4ZGD B;  1JB0 E;  4OB1 B;  4OB3 B;  3QZ5 B;  4ZGE B;  4XK8 E;  5L8R E;  2WSF E;  1V29 B;  2CYZ B;  2O01 E;  3LW5 E;  3A8M B;  3X25 B;  1UGQ B;  3X24 B;  2DPP B;  3A8L B;  3X26 B;  2ZCF B;  3QYG B;  4KT0 E;  3HHT B;  3A8G B;  1UGS B;  3X28 B;  3VYH B;  1QP3 A;  1DJ7 B;  4OB0 B;  2ZPE B;  1UGP B;  2D0Q B;  2WSC E;  2PUK B;  2ZPF B;  1AHJ B;  2ZPG B; 
#chains in the Genus database with same CATH topology
 5IHN A;  1IB8 A;  1KFZ A;  3QXE B;  1IRE B;  2P4R A;  2X51 A;  4X9D A;  3RKW A;  4M7D C;  1C1A A;  3QHS A;  1Y71 A;  4PJO G;  3M53 A;  2QG9 B;  1FYN A;  2A3L A;  5IXB A;  2MWP A;  2JUF A;  5KYW B;  4N4H A;  2D0N A;  1QVG A;  2L0A A;  2M0Y A;  4LDX A;  2LJ0 A;  2CS7 A;  1WHK A;  3DLM A;  4J9H A;  4CC7 A;  3QYH B;  2JTF A;  1YI2 A;  2DD5 A;  2RNA A;  3CCJ Q;  4V2S A;  1KHI A;  5LJ3 h;  1KD1 R;  4PJO A;  1E6H A;  2CT3 A;  4GBQ A;  4FU6 A;  5GAO q;  2H8H A;  1W4S A;  4OMQ A;  2JTM A;  2EQU A;  2QGF B;  3I55 A;  1M1G A;  2HKN A;  4PLI A;  3CCJ T;  4F17 A;  4E7K A;  2RK2 A;  1I81 A;  2AT1 B;  5LJ3 e;  4C92 D;  2ECZ A;  3T9N A;  2G6F X;  3UA6 A;  3I56 A;  1VQ9 T;  4E2F B;  3QPH A;  1YHQ Q;  4JJB A;  3L2Q A;  3HTR A;  4BY6 B;  1VQ6 Q;  1K73 C;  3H0I A;  3EHQ A;  3O8V A;  2CSQ A;  2E4H A;  2DL8 A;  1OUL A;  1TOV A;  5AYF A;  4AFZ C;  1SRL A;  3RDV A;  1OZ2 A;  2AKL A;  4A4E A;  1YHQ T;  1UEC A;  1WI7 A;  3KFV A;  5GAN f;  4OB0 B;  4RTV A;  2KGT A;  1VQL A;  2D0Q B;  2PUK B;  2I0N A;  2RQR A;  2ZPF B;  4C92 E;  5CCA A;  3WXM B;  1IXD A;  1H8K A;  2GQV A;  4OMF B;  1QW1 A;  3GP8 A;  1KG1 A;  1O75 A;  4RTU A;  5A0D A;  1TXQ A;  3MCA B;  2I2L A;  1M3B A;  3ULR B;  3HPW A;  2L5Q A;  1OX8 A;  4J9D A;  2VXF A;  3CMA A;  2RHI A;  3OMG A;  1X2K A;  3FDR A;  2GGR A;  1RAC B;  3OS0 A;  2CKK A;  4PJO B;  4BI4 A;  2O88 A;  4J9F A;  2Y4X A;  4JZ4 A;  1NM7 A;  4X34 A;  1GCP A;  1PSE A;  3GBQ A;  1LJO A;  1YP5 A;  2CP3 A;  3M54 A;  5CQX A;  3FRN A;  5A2Q E;  2M9U A;  2KRS A;  1OOT A;  2GTJ A;  1YIT A;  3A8H B;  3AT1 B;  2DXB A;  2K3X A;  3FC3 A;  2YLB A;  3V7C A;  3ZL7 C;  1M1F A;  1MMG A;  1JXO A;  3JB9 I;  2E41 A;  1PSF A;  1ZUY A;  2FPF A;  2HEQ A;  1LNX A;  2O2O A;  3MHX A;  4IUV A;  3CC7 T;  4PJO F;  1N9R A;  2HSE B;  4M78 D;  1W2B S;  3GOX A;  4M7A C;  5FWC A;  2AK5 A;  3MEU A;  4HCZ A;  2FRW A;  1UUE A;  4X9C A;  2EYX A;  1V29 B;  3GF5 A;  2CYZ B;  4JRP A;  5GAN h;  3M58 A;  2M0O A;  3OYD A;  3CCM T;  3EG1 A;  4RCC A;  4QKU A;  4OP0 A;  1IHW A;  3NHN A;  3G6E A;  2X9H A;  1S72 A;  1JRI A;  3X26 B;  3L42 A;  4NS5 A;  3KBG A;  2M16 A;  2KE9 A;  5I22 A;  2X35 A;  2XDP A;  3GLX A;  4CC4 B;  4N0A A;  2YUQ A;  3QWY A;  3CCE T;  2JS0 A;  1JEG A;  1Y57 A;  1RI0 A;  2KRO A;  5GAN e;  3JB9 J;  4J7F A;  1K73 R;  1ZBJ A;  3G71 A;  3OW2 S;  5DY9 A;  4ZTJ A;  4BAC A;  2KRM A;  1BIB A;  2ZPG B;  1QCO A;  2DYI A;  3TCJ A;  3PGG A;  5GAN 8;  4A54 A;  2OTL Q;  3OYL A;  2COZ A;  5LJ5 f;  1LVK A;  2FVU A;  3S6W A;  3CCV T;  4QQD A;  3VS5 A;  2CZ6 B;  2CGH A;  3EGX A;  4HA8 A;  4XAX B;  2BIV A;  5CQY A;  5GMK j;  5KYU A;  1J3T A;  1BI2 A;  3MKD A;  3OYF A;  2OTL T;  2K7A A;  4XTW A;  4ZN1 A;  4OMP A;  2GFU A;  3UT1 A;  2LDM A;  4E7I A;  1VQ8 A;  2ZAE A;  2VWF A;  2F2W A;  2E6Z A;  2E64 A;  4KH0 B;  3VJP A;  4MMK A;  5FW9 A;  3L2R A;  3UPU A;  5IAY A;  4OMN A;  1VQK A;  2RJE A;  3QSU A;  2MMP A;  5IT9 E;  1GL5 A;  1NLP C;  5GJV B;  2KK4 A;  1G2B A;  2EBP A;  3HFN A;  3MO8 A;  2MWO A;  1G3S A;  2KNB B;  1C6V X;  5LL6 S;  2VUB A;  3GNG A;  4B9X A;  3I35 A;  4A4H A;  3FB9 A;  1WJQ A;  2WSF E;  3M0Q A;  4NL2 A;  2J05 A;  4BDZ A;  4PK4 A;  3V7S A;  1BU1 A;  2WAC A;  1RAH B;  3LW5 E;  2CSI A;  1MMN A;  4J9B A;  1MHN A;  1VYU A;  2RI5 A;  4LD9 K;  1K8A C;  1I5L A;  3ER0 A;  3OYJ A;  4C0D C;  2VGM A;  2ED0 A;  2R5M A;  3MJX A;  1UHC A;  1WFW A;  3CXC S;  5GAM f;  4EMK A;  3NTH A;  4JUV A;  2RN8 A;  1VQO T;  3JCM V;  5DM7 R;  4JJD A;  5IH2 A;  2K2M A;  5LJ5 h;  2WSC E;  1KQS S;  1IHV A;  2ED1 A;  3OYI A;  5GAN 5;  3EGX B;  5KYU B;  2XID A;  4PKC C;  2HQX A;  2DTH A;  3CME A;  4D6W A;  5GAN 4;  3OYG A;  2ZPB B;  2JM8 A;  4PJJ A;  4F16 A;  5LJ5 e;  4PNO A;  3U23 A;  1LOJ A;  3CD6 Q;  2JJ9 A;  1ZLM A;  2E65 A;  4Y92 A;  1YIJ T;  3X20 B;  3H0F A;  1N8R C;  4RTX A;  2PUO B;  4J8O A;  3REA B;  2G3R A;  4PJO E;  3D7S B;  4XTV A;  4TVR A;  3EGD A;  3CD6 T;  2JMC A;  2O4X A;  1BKB A;  1YJ9 T;  2L3Q A;  3CCQ A;  2KYB A;  1QVG S;  1SG5 A;  1K0S A;  5GAN 6;  5GAN 2;  3TU4 K;  3QBY A;  1M8V A;  4C92 C;  5GMK i;  1WHL A;  2EJF A;  3S3N A;  4F04 B;  5GAO r;  5HCK A;  1VA7 A;  2EKH A;  3P8B B;  4QVZ A;  5FU7 C;  4BI3 A;  4EMK B;  5I2S A;  5GAM h;  4JS4 A;  2CUD A;  2DIQ A;  2O01 E;  5HK0 A;  3UF4 A;  4IUR A;  1UGQ B;  1WZO A;  9ATC B;  2E3I A;  1MNE A;  2JN0 A;  2DRM A;  2FO0 A;  1VUB A;  3QYG B;  2A28 A;  5LJ5 j;  1BK2 A;  4EPC A;  5GAM e;  3L2U A;  3CCL Q;  1X43 A;  3CC2 A;  3MP1 A;  3KXT A;  3BW1 A;  2RHU A;  3CBO A;  5CKF A;  2JW4 A;  3OYY A;  2QGG A;  2P84 A;  2H3E B;  3QJ6 A;  1YNZ A;  1TH7 A;  1VQ5 Q;  3CCL T;  4BE0 A;  2Y4Y A;  4FW2 A;  2ZPI B;  3HRT A;  5GJW B;  1I0C A;  4L6V 5;  3VRZ A;  5IN1 A;  1GRI A;  4WCI A;  3I55 T;  3N5B B;  3CCU A;  2W0Z A;  1NEB A;  4DBR A;  2O4X B;  1BB9 A;  1VQN A;  1WXU A;  2EJG A;  2EVR A;  1W70 A;  4HCC A;  2YRD A;  2YWW A;  1V76 A;  3J81 E;  4KUD K;  1QCN A;  5HKC A;  4M78 A;  2K4Y A;  3CBM A;  4HCK A;  3VS4 A;  4MZP A;  1X2Q A;  2L3R A;  1KD1 C;  4O5V A;  3G7Z A;  3QZ9 B;  3BE3 A;  2EW3 A;  2PQW A;  2KXC A;  4EMH A;  1B34 A;  1YJW A;  2MOX A;  1VIE A;  1N5Z A;  3DB4 A;  3CCR T;  2K79 A;  2QQB A;  2XHC A;  1D1C A;  3NFC A;  2A0F B;  5CR2 A;  2QA4 Q;  3V7R A;  2AIR B;  2LCL A;  4GLK A;  4M78 C;  2P0Q A;  5J39 A;  3LGL A;  4CI0 C;  2D8H A;  1VQL T;  1ZUK A;  1RAE B;  2KRN A;  2RHZ A;  4F7U G;  1A0N B;  2LP5 A;  3AHU A;  1RL2 A;  1RAF B;  2VKN A;  1H92 A;  4E7S A;  1WHH A;  3VS1 A;  3JB9 H;  3FIF A;  2RHX A;  1UG1 A;  2RJD A;  3C95 A;  4BI8 B;  1TUG B;  2QYZ A;  4JLI A;  1WJR A;  2X3W D;  3H41 A;  1G5V A;  3FEO A;  4F7U A;  2DLP A;  4HT9 A;  1WJS A;  3CQT A;  4PFP A;  1U3O A;  1Q81 C;  5LJ5 d;  5KYY A;  3M4G A;  3VKI A;  5FWB A;  2A7Y A;  4PJL A;  4JRI A;  3Q1J A;  3ME9 A;  4LXC A;  4PJN A;  4BB7 A;  4Z02 A;  4N4G A;  1KQS A;  3UAT A;  1ZX6 A;  3M0R A;  1RAI B;  1N27 A;  2DVJ A;  4MZM A;  2JOY A;  3PIP A;  2MPX C;  2KBT A;  1JBM A;  1T0J A;  1QVP A;  1GFD A;  2MF2 A;  4J9C A;  1OYX A;  4DBF A;  2GBQ A;  3OQ5 A;  2H3J A;  1CKB A;  1B34 B;  1TUD A;  2QEX A;  4FYX B;  1Z9Z A;  4FSX A;  2F5K A;  1YN8 A;  4BY6 C;  4FCY A;  2OJ2 A;  2EGC A;  1OQK A;  5AT1 B;  4Y28 E;  5L23 A;  2C06 A;  2M02 A;  3G6E T;  1VQ7 A;  1K8A U;  4JJC A;  3FJ5 A;  1E7O A;  2DIL A;  4KH1 B;  1HJD A;  4M78 F;  4M4Z A;  1QKW A;  1RAA B;  2LC4 A;  3JCM d;  1K4U S;  3JV3 A;  1K9M C;  3PFS A;  1NJI C;  4F7U B;  4ELZ C;  2LX7 A;  3LLR A;  1WYX A;  3O5Z A;  2RHY A;  1VQ9 Q;  5KYY B;  3EG9 A;  2XK0 A;  1PRM C;  5GAO m;  1BCM A;  4UC4 A;  2F5T X;  3QKJ A;  1H3Z A;  1P92 A;  2VC8 A;  3EFS A;  1Q82 C;  2XU8 A;  2GCX A;  4PJO C;  2EGE A;  2EPD A;  4IUU A;  1QLY A;  1WQ7 A;  3H8Z A;  3EGU A;  4M77 G;  5KCO A;  2C0O A;  4RCB A;  3M59 A;  1N8R U;  3G4S Q;  2LQ8 A;  2DBK A;  3P8D A;  3KUF A;  2XDD A;  4F7U F;  1C0M A;  2JZ2 A;  1VQ8 T;  1LPL A;  5I2M A;  3C94 A;  2X4W A;  2MIO A;  1WDX A;  1WPY A;  3RBB B;  3ZBD A;  2CZ7 B;  4FM4 B;  4EMG A;  2JXB A;  1X6B A;  3EFR A;  4XQ3 A;  1M90 C;  3THK A;  3G4S T;  2K3B A;  1Q81 R;  2B8A A;  3CC4 A;  4IUQ A;  4JRK A;  4DOV A;  2F1L A;  2JM9 A;  2JTE A;  3SDZ A;  3RMS A;  2DX1 A;  4ZGJ B;  1G83 A;  2LJ3 A;  1NPP A;  2EQI A;  3M4Y A;  1KC8 C;  1KJW A;  1G8X A;  2KMT A;  1PKS A;  4N4I A;  5CKH A;  2PVG B;  1AZE A;  1Y0M A;  3OYA A;  2YXY A;  4KBM B;  1UEB A;  2OTJ A;  1OZ3 A;  1MV0 B;  1RAB B;  2K3Y A;  4M75 G;  2F2V A;  4AFU C;  2QA4 A;  5LJ3 j;  1SSH A;  2OAU A;  1RLP C;  3EG9 B;  2EQJ A;  4HCB A;  4FYV B;  3CC7 Q;  2JMA A;  2YDL A;  4RTW A;  2EGA A;  1PNJ A;  1D3B B;  4XK8 E;  3NTI A;  1MMD A;  1ZBX A;  5D6Y A;  1VQP A;  2NUT B;  3TEE A;  2RK1 A;  4BDY A;  3EG2 A;  4ANJ A;  1AWJ A;  3OB9 A;  2SRC A;  2V8J A;  2FG0 A;  3A1P A;  3CCM Q;  1PRL C;  4CC2 A;  2COY A;  4KT0 E;  2K5F A;  4FL6 A;  3FJP A;  2D1X A;  1YJN Q;  1K9M R;  1BI1 A;  1NJI R;  4B6M A;  2A37 A;  1GBQ A;  1PM3 A;  2V8I A;  1OU8 A;  3JCM W;  1KHC A;  2K9G A;  2E70 A;  4M77 B;  2CH4 A;  1FWZ A;  1CKA A;  3CCE Q;  1XTD A;  1D1A A;  5HY6 A;  5KCH A;  1KD1 U;  1YJN T;  2L3P A;  3M56 A;  1SKU B;  5HK3 A;  1U5S A;  2QTX A;  3DLL A;  4II1 A;  1ARK A;  2JT4 A;  1Q86 C;  1Q82 R;  2F2X A;  5KE3 A;  4A63 B;  1Y7X A;  4A4G A;  4AFS C;  2CP2 A;  4EDU A;  1YCS B;  3CCV Q;  1VQM Q;  3JCM g;  4NOY A;  2DVE A;  4M78 E;  4C8Q G;  1JJ2 P;  1VQ4 A;  2LZ6 B;  4PFZ A;  3DKM A;  2RI2 A;  3PNW C;  2EFI A;  2LT4 A;  4RKU E;  4N0A C;  4C5E A;  2PU9 B;  1M90 R;  1VQM T;  1AOJ A;  2ZPH B;  1BYM A;  2V1R A;  3OS2 A;  2M1H A;  4LDU A;  3MPU B;  4XU1 A;  1QVF P;  1U1T A;  1D09 B;  1G3W A;  4E47 A;  1QKX A;  1UTI A;  3MP6 A;  2L3S A;  1QWE A;  4M75 B;  3JCM X;  1ACM B;  4RG2 A;  4LDV A;  4DA4 A;  1Q81 U;  2LNH B;  2IVW A;  2BUD A;  5LJ3 d;  4IUT A;  1PHT A;  3CCJ A;  1KC8 R;  2EQM A;  2DFU A;  3M0S A;  5I11 A;  2NYS A;  2E10 A;  5IXF A;  1SHF A;  2NLU A;  2JS2 A;  4XTU A;  4LUE A;  2ROT A;  3RIR A;  5A0L A;  4F7U E;  3LYI A;  2IG0 A;  1UE9 A;  2NWM A;  3TRE A;  2CDT A;  1WA7 A;  4R55 A;  1SEM A;  5GAO p;  1T3L A;  1GFC A;  2QQ9 A;  3SB2 A;  1DJ7 B;  5GAN j;  2K6D A;  1WHJ A;  2RF0 A;  1QCF A;  1M8M A;  1YHQ A;  2V8K A;  1VQ6 A;  1N6A A;  4M7D D;  4LNP A;  1VQO Q;  1AHJ B;  3CPW P;  4A4K A;  3GPL A;  2K2V A;  1NEG A;  4OMO A;  1WGS A;  2ZZD A;  4J83 A;  4ME7 A;  1VYV A;  3V8K A;  2HL3 A;  1IGU A;  2RMO A;  2DKG A;  3SWN B;  3OYM A;  3GNF B;  2HZY A;  1ZA2 B;  4C8Q B;  1K9M U;  1X27 A;  3UDC A;  4JPB W;  1YIJ Q;  1NJI U;  4EMK C;  2EWN A;  2IPO B;  1N9S A;  3E19 A;  1OEB A;  1SSF A;  4L5G A;  1VIF A;  1Q86 R;  4FSS A;  2J7I A;  3JCM b;  4Z8A A;  1M3A A;  3OSV A;  3CCS Q;  1XJW B;  1YJ9 Q;  1Q82 U;  1NPR A;  3S3M A;  4ATO A;  4OB3 B;  2DBM A;  4X1V A;  1PWT A;  1K73 U;  3CCS T;  3P8H A;  4CRI A;  3CC7 A;  4J7I A;  4A4F A;  1NZ9 A;  4M77 D;  3NPF A;  3M57 A;  4F14 A;  1QQJ A;  2CH4 W;  2K5I A;  3MEA A;  1XNI A;  1GCQ A;  4WTO B;  3JSC A;  2HMA A;  3JB9 G;  1IGQ A;  4RTZ A;  3A8L B;  1M90 U;  3CCM A;  2HQH A;  5EG2 A;  3EH2 A;  2HDA A;  2O31 A;  5D7U A;  4LDY A;  1D0Z A;  1M5Q 1;  2DL3 A;  4QQ6 A;  1ZSZ B;  1M30 A;  1GCQ C;  5GAN d;  2GTO A;  4XU0 A;  1Y07 A;  2VV5 A;  4MZT A;  1TWB A;  3L2V A;  1PKT A;  4FYY B;  1KC8 U;  4Y91 A;  4MDX A;  1W6X A;  2YSQ A;  1YI2 Q;  2O9V A;  5GAN 3;  2ABL A;  1VQ7 T;  4QVC A;  2DET A;  1W1F A;  1K76 A;  2DIG A;  2KAF A;  1IRX A;  2RB6 A;  2YUP A;  3V8L A;  3L1A A;  1I4K 1;  2FB7 A;  3JAM E;  3PMT A;  4HVV A;  2CP0 A;  3I55 Q;  3CBP A;  1YI2 T;  2XI9 A;  2CZ1 B;  1YCY A;  4M75 D;  5LJ3 g;  3J80 E;  4ORZ A;  1KIK A;  5CO7 A;  2RD1 A;  2QQS A;  3NTK A;  1PD0 A;  3I56 Q;  4J9E A;  2OTL A;  4KGX B;  2AZV A;  4LDW A;  2XKO C;  4JZ3 A;  2XDB A;  2DK3 A;  1R8O B;  1XQH A;  2SEM A;  2PVO B;  2GF7 A;  3RER A;  5J26 A;  4M7A D;  2J6F A;  1WXB A;  2BZ8 A;  1TTH B;  4E7J A;  3I56 T;  1QP2 A;  1EFN A;  2MI6 A;  3CCR Q;  2HBP A;  3VS6 A;  4QT7 A;  2BZY A;  3R6N A;  2FPD A;  4IKF A;  2E3H A;  2VXE A;  3VS0 A;  3SFM A;  2CP6 A;  3QZ5 B;  3INZ A;  3PIO A;  1VQL Q;  1RI9 A;  1UGV A;  1MGQ A;  1T3S A;  2KY9 A;  2RJF A;  2ATC B;  2NUP B;  1D0X A;  1MMA A;  3A8M B;  1SPK A;  5ECA A;  4JLG A;  5CIU A;  1W2B P;  1Q86 U;  3CMA Q;  4KGV B;  1OPK A;  5GAM j;  3HHT B;  3CC4 T;  3A8G B;  1UJ0 A;  2LQW A;  1BCO A;  1TUC A;  3QO3 A;  5FU6 B;  3M55 A;  3NGP A;  2LT1 A;  3LX7 A;  4BUG A;  1M2V B;  3CMA T;  4C8Q D;  3I5S A;  3RKY A;  1YIT Q;  1UJY A;  3MEW A;  1ZHI A;  3G1J A;  2DEQ A;  2X4Y A;  2F69 A;  2LMJ A;  3OS1 A;  3RR6 A;  2V1Q A;  4FIB A;  4J6W A;  2OTJ T;  3PMI A;  2E6N A;  2EIF A;  3BDL A;  3JB9 F;  3OW2 P;  1YIT T;  3LGF A;  1U06 A;  3HRU A;  4E6R A;  1NYF A;  2DA9 A;  2BE9 B;  1YWO A;  2YT6 A;  1OX9 A;  1OV3 A;  2XD0 A;  1VQP T;  1K0X A;  4C5H A;  5C6S A;  2YRC A;  3CD6 A;  2HCK A;  1TSF A;  3RMQ A;  4LD6 A;  2AHJ B;  3OBW A;  3URG A;  1X69 A;  4M7D G;  4A53 A;  3OSS C;  3G6E Q;  2HSP A;  2KXD A;  1S72 Q;  4C0F A;  3REB B;  3J7A F;  2DYB A;  2R57 A;  1R0C B;  3R6O A;  4OF1 A;  5GAN g;  1ZQ1 A;  3EAE A;  4XU3 A;  2Z0W A;  1AWX A;  4LE9 A;  4M7D A;  2E1H A;  3V8J A;  3JRZ A;  1B3Q A;  1S72 T;  1Y96 A;  1Q7Y C;  3X25 B;  4BE1 A;  3MET A;  1NE8 A;  2CRE A;  2D6F A;  4RG8 A;  3C4S A;  1MUZ A;  2ZCF B;  1AVZ C;  1PD1 A;  4BD3 A;  2DAQ A;  4L59 A;  3VYH B;  5FRN A;  4ZN3 A;  3EG0 A;  3IQL A;  5GAM d;  3G71 T;  2DJQ A;  2RQW A;  1VQ4 T;  4GY5 A;  4WF2 A;  2CP7 A;  2QI2 A;  2DXT A;  4Q5W A;  2L2P A;  1NYG A;  4PL6 A;  3RKX A;  5CVI A;  3E9F A;  3CXC P;  2BTT A;  4K11 A;  4PFO A;  1TU0 B;  4QW2 A;  5IHK A;  2OI3 A;  5A0G A;  2FL7 A;  1VQ8 Q;  2HNI A;  1D3B A;  4AT1 B;  3CCL A;  4IIM A;  3L2W A;  3EFO A;  3VUB A;  1KQS P;  2YLC A;  1RAD B;  3CPF A;  2NUT A;  2GQI A;  4D8K A;  5CKD A;  1I1J A;  1VQK Q;  3GIB A;  2VGN A;  2FRY A;  2DXC A;  4OML A;  4E7Z A;  3EH1 A;  1B07 A;  2AKK A;  2FEI A;  3LWH A;  1RUW A;  1H3H A;  2FZC B;  2KI7 A;  2DTI A;  2P0P A;  1VQ5 A;  3JCM P;  2FZK B;  2FPE A;  1RAG B;  3SEM A;  2LX9 A;  1YFN A;  4IUP A;  4NL3 A;  2RJC A;  3OYN A;  1WIE A;  3MP8 A;  1MV3 A;  4M77 A;  1VQK T;  2DER A;  1FX7 A;  3VS3 A;  4OB2 B;  4ELY C;  1EX4 A;  4VUB A;  2YUO A;  2MAM A;  4ESR A;  2OX7 A;  3VS2 A;  2MYS A;  4EIK A;  4FT4 A;  4M7D B;  3CEY A;  1K9A A;  1Y96 B;  4JS5 A;  4C0Z A;  3JB9 D;  2EYW A;  2L8D A;  2DZC A;  4RUG A;  3CCR A;  2KT1 A;  4E7H A;  2HQE A;  4RTT A;  1VQ6 T;  2RO0 A;  4M77 C;  2CT4 A;  2DEU A;  2QXF A;  1QVG P;  4OGE A;  4BE2 A;  4ZTF A;  1WHM A;  4DOW A;  2J6K A;  1U1S A;  4HXJ A;  1BBZ A;  2LRQ A;  4JRQ A;  3EHR A;  2KYM A;  2KVQ G;  2LTO A;  5GAN 7;  2FHD A;  2QAS A;  3PE0 A;  2HKQ B;  3CME Q;  1FMK A;  1CSK A;  5LJ5 g;  3S3O A;  1JJ2 A;  1KQ2 A;  3X28 B;  4M7D F;  3PVQ A;  3VV0 A;  4PJM A;  2RA2 A;  1I8F A;  3BFM A;  2RM4 A;  4PLL A;  3EFO B;  5EC7 A;  4M7A G;  4KRT A;  5C0M A;  3HRS A;  4M75 A;  3CME T;  1KSW A;  2PZ1 A;  1Q7Y R;  5GMK h;  1QVF A;  4IIO A;  2DL5 A;  2CP5 A;  1BIA A;  3BY7 A;  2EYY A;  2GFA A;  4KUL A;  2EYQ A;  4FYW B;  2XG8 D;  1IO6 A;  2Y90 A;  3E1S A;  1G3T A;  4M7A A;  3CCQ Q;  2CZ0 B;  4DBQ A;  1WQW A;  4M75 C;  3OS5 A;  1HXD A;  5GMK e;  3QDF A;  1Q95 G;  3I9Q A;  1M1K C;  1NLO C;  2D8J A;  1X75 C;  3LH5 A;  2L89 A;  2QQR A;  3CCQ T;  5CKB A;  3RNJ A;  3M0P A;  1JQQ A;  1JU5 C;  1T0H A;  2X4J A;  3PTA A;  4R56 A;  2XMF A;  4RTY A;  5GAO n;  1O9S A;  3C0C A;  2ZGW A;  1ABO A;  3WVD B;  3RUX A;  1D1B A;  7AT1 B;  5GAM g;  3CPW A;  4M77 F;  5DLO A;  3CC2 Q;  3QII A;  2FYK A;  4AG2 C;  4LUD A;  1RLQ C;  2J6O A;  3SWN A;  2VVK A;  4LN2 A;  4C8Q A;  2KQW A;  1X01 A;  3HP9 A;  3F70 A;  2HL5 C;  3VUZ A;  2B86 A;  2KEA A;  1UB4 A;  4YTL A;  3CC2 T;  4J9I A;  1EIF A;  2JNG A;  2LNV A;  1UGS B;  3VS7 A;  3OYC A;  2VYT A;  4OGC A;  3SWN C;  3TSW A;  1QP3 A;  2QK0 A;  4C5I A;  3EG3 A;  3CCU Q;  1HYO A;  3QDR B;  1UGP B;  2R5A A;  4C8Q C;  8AT1 B;  1HSQ A;  1VQN Q;  1AWO A;  1HD3 A;  3A98 A;  1VQ9 A;  4M7A B;  5J3B A;  3HL8 A;  1PC0 A;  4QVD A;  1UFF A;  1X6O A;  4CC3 A;  5KH6 A;  1JO8 A;  1AZG B;  4GLM A;  2DTO A;  4B9W A;  3CCU T;  4DBH A;  4J9G A;  3PT9 A;  1VQN T;  1XOV A;  1MND A;  4M75 F;  1YJW Q;  3ZFJ A;  1WNL A;  3LH0 A;  1H64 1;  2DXU A;  3M9Q A;  1SHG A;  5KYN A;  1QMC A;  4AFQ C;  3G4S A;  1OPL A;  2VB6 A;  3I5R A;  2RQU A;  4D8D A;  1GBR A;  1UDL A;  4M7A F;  1YJW T;  1ZSZ A;  1GXI E;  1Q7Y U;  2FZG B;  5CAI A;  1YWP A;  3HFO A;  2DD4 A;  1UHF A;  5DLQ E;  3JCM f;  2RI3 A;  2QQA A;  4R0K A;  1PG5 B;  1WX6 A;  1M1K R;  5CKE A;  4ZGD B;  1JB0 E;  2C0I A;  4J6Y A;  2DMO A;  4M7D E;  1ZSZ C;  4ZGE B;  2J06 A;  4PJO D;  2QTV A;  2GNC A;  4C0G A;  1S1N A;  4HVW A;  2W10 A;  2IIM A;  2LCS A;  2HBW A;  1LCK A;  4C5G A;  2ENM A;  4FW1 A;  2DL4 A;  3RES A;  3X24 B;  2KR3 A;  2BZX A;  3HKS A;  2AZS A;  3TSZ A;  2DPP B;  4P5N A;  5KYX A;  4C92 G;  4MML A;  1WHG A;  1G3Y A;  2V26 A;  3H0H A;  2EAY A;  2DE0 X;  1IZ6 A;  3JCM Q;  4DQ2 A;  4C8Q F;  1M9S A;  1FXX A;  2PTK A;  1KK7 A;  1F1B B;  1M27 C;  2QEX Q;  4C92 A;  3OBY A;  2K57 A;  4OMM A;  2A08 A;  2QDY B;  1AD5 A;  2PVD B;  1NG2 A;  3JCM J;  4MDW A;  4C0D B;  2YHT A;  1PCX A;  1BI0 A;  4E7L A;  1YJN A;  3M0U A;  2NUP A;  1VQ7 Q;  2KDS A;  3SD4 A;  2QEX T;  1AT1 B;  4XU2 A;  1I5O B;  3QWX X;  5D6X A;  2RQV A;  3CCE A;  3ZEH A;  4RMO A;  2A36 A;  3OMC A;  1QWF A;  3JCM c;  1V1C A;  2X4X A;  3TQ7 P;  1M3C A;  3JCM h;  8ATC B;  1UGR B;  4M77 E;  3WVE B;  1ZUU A;  4QQG A;  1M2O A;  5GMK l;  2HAX A;  1B7T A;  1W2B A;  1M2V A;  2P0K A;  5CK9 A;  2YUN A;  4J6X A;  3OYE A;  2X3X D;  1TG0 A;  4JJN K;  3CCV A;  3NMZ C;  1HK9 A;  1VQM A;  2JVV A;  3JCM e;  1X6G A;  1WLP B;  5FU6 C;  2CUB A;  2EQK A;  4JDS A;  2DL7 A;  4OB1 B;  5M9O A;  2LQN A;  1YBY A;  3H6Z A;  3E2U A;  5KYX B;  3DB3 A;  3FLG A;  6AT1 B;  1ABQ A;  2DO3 A;  1R77 A;  2DJZ A;  1R0B G;  3QG1 A;  2EKO A;  2DZ9 A;  2LCC A;  1BI3 A;  3OW2 A;  1K8A R;  2M51 A;  4XTX A;  5KE2 A;  2LJ1 A;  4C92 B;  2C0T A;  3VU3 C;  4M78 G;  4DEY A;  1NBE B;  4ZNX A;  3EGD B;  3M0T A;  4M75 E;  3CC4 Q;  1OU9 A;  4DEX A;  5FU7 B;  1M1K U;  1VQ5 T;  2RPN A;  1ZA1 B;  2KSS A;  4Z89 A;  3OYK A;  2RQT A;  2HD0 A;  5IHI A;  4AMC A;  1JJ2 S;  2MK5 A;  1I07 A;  3M5A A;  3VRY A;  3VYG A;  1E6G A;  3H9N A;  4J5Y A;  4XTY A;  2P4T A;  4M7A E;  2ESW A;  1FMV A;  4AG1 C;  2EJ9 A;  3L2Z A;  1ZSG A;  1OI1 A;  1JXM A;  1SF9 A;  5D6W A;  2D9T A;  5FRM A;  5FLX E;  1FMW A;  4C92 F;  3UA7 A;  2RH2 A;  2OTJ Q;  1VOM A;  2O9S A;  2BE7 D;  2PNI A;  2NUZ A;  3A8O B;  1VQO A;  2E5Q A;  1QVF S;  1WXT A;  4Z88 A;  1N8R R;  2QDL A;  1KQ1 A;  4OVA A;  1EZZ B;  1Z9Q A;  2COW A;  4HT8 A;  4HKE A;  3MEV A;  3A5Z B;  5I21 A;  5KYW A;  2WSE E;  3ASK A;  4O6J A;  5GMK m;  2QA4 T;  1AEY A;  3OY9 A;  3OYB A;  2DM1 A;  1TS9 A;  5GAO l;  1VQP Q;  3OYH A;  1AWW A;  3OA6 A;  3SHW A;  2LVM A;  2VAS A;  4HVU A;  1M4Z A;  5LJ3 f;  2DRK A;  2DF6 A;  4FT2 A;  1YIJ A;  1U8R A;  1K1Z A;  3LWI A;  2XIC A;  1VYT A;  2EYZ A;  3BDU A;  3CXC A;  3UWN A;  4C8Q E;  3HSB A;  5L8R E;  2BKD N;  3TVT A;  2E5K A;  2R58 A;  2K5L A;  3CCS A;  4XTZ A;  2ROL A;  5FRO A;  2E12 A;  2DNU A;  1YJ9 A;  3CPW S;  2OAW A;  3QUI A;  1D0Y A;  3PVL A;  4M78 B;  2MCN A;  3C12 A;  2KT8 A;  4KGZ B;  1SRM A;  2ZPE B;  4KUI A;  2QAZ A;  3G71 Q;  2YRV A;  1VQ4 Q;  2LQK A;  3E9G A;  3QJY A; 
#chains in the Genus database with same CATH homology
 4BE0 A;  2K2V A;  1QVF A;  2Y4Y A;  2ZPI B;  3QXE B;  3HRT A;  1BIA A;  3BY7 A;  2GFA A;  1WGS A;  1IRE B;  2ZZD A;  4KUL A;  4L6V 5;  2EYQ A;  3UPU A;  4X9D A;  2XG8 D;  5IN1 A;  4J83 A;  4ME7 A;  2Y90 A;  3E1S A;  3RKW A;  3I55 T;  3V8K A;  1G3T A;  4M7D C;  3QHS A;  3N5B B;  1Y71 A;  4M7A A;  4PJO G;  3CCU A;  3M53 A;  2A3L A;  2CZ0 B;  2DKG A;  1WQW A;  2MWP A;  2O4X B;  4M75 C;  3SWN B;  3OYM A;  2JUF A;  3OS5 A;  4N4H A;  1HXD A;  3GNF B;  1QVG A;  1VQN A;  5GMK e;  4LDX A;  2EJG A;  4C8Q B;  2CS7 A;  1K9M U;  4HCC A;  1M1K C;  3DLM A;  3J81 E;  3UDC A;  4KUD K;  1NJI U;  3QYH B;  5HKC A;  4M78 A;  4EMK C;  2K4Y A;  2JTF A;  3CBM A;  1X75 C;  1YI2 A;  2DD5 A;  2EWN A;  2L89 A;  4MZP A;  2QQR A;  4V2S A;  1KHI A;  3CCQ T;  5LJ3 h;  2L3R A;  1KD1 C;  1N9S A;  3E19 A;  4O5V A;  3G7Z A;  4PJO A;  1SSF A;  5CKB A;  3QZ9 B;  4L5G A;  1VIF A;  2X4J A;  2PQW A;  4FU6 A;  3JCM b;  5GAO q;  3PTA A;  4EMH A;  1W4S A;  4R56 A;  1B34 A;  3OSV A;  2JTM A;  1YJW A;  1VIE A;  3CCR T;  3DB4 A;  2QQB A;  2XHC A;  3NFC A;  5GAO n;  1O9S A;  2EQU A;  5CR2 A;  3I55 A;  1M1G A;  3V7R A;  2LCL A;  2ZGW A;  4GLK A;  4M78 C;  4PLI A;  2P0Q A;  1NPR A;  3RUX A;  3WVD B;  5J39 A;  3CCJ T;  4E7K A;  3S3M A;  2RK2 A;  1I81 A;  3LGL A;  4CI0 C;  5GAM g;  5LJ3 e;  4C92 D;  1VQL T;  3CPW A;  4ATO A;  4M77 F;  4OB3 B;  3T9N A;  2RHZ A;  4F7U G;  5DLO A;  3I56 A;  1VQ9 T;  3QII A;  1K73 U;  1M90 C;  3CCS T;  2FYK A;  3P8H A;  4CRI A;  3CC7 A;  4J7I A;  3AHU A;  1RL2 A;  3QPH A;  3SWN A;  4A4F A;  1NZ9 A;  3L2Q A;  4BY6 B;  1K73 C;  4M77 D;  3JB9 H;  3FIF A;  3M57 A;  2RHX A;  3O8V A;  2K5I A;  3C95 A;  2RJD A;  3MEA A;  4BI8 B;  4C8Q A;  2KQW A;  1XNI A;  1X01 A;  3HP9 A;  3F70 A;  3JSC A;  3VUZ A;  4JLI A;  1WJR A;  1UB4 A;  3JB9 G;  5AYF A;  4YTL A;  1G5V A;  3CC2 T;  3A8L B;  3FEO A;  1M90 U;  1EIF A;  4F7U A;  3CCM A;  1OZ2 A;  5EG2 A;  4A4E A;  4HT9 A;  2JNG A;  2LNV A;  1YHQ T;  1UGS B;  1WJS A;  3OYC A;  2VYT A;  4OGC A;  3SWN C;  1QP3 A;  1Q81 C;  4LDY A;  4C5I A;  5GAN f;  5LJ5 d;  4OB0 B;  3M4G A;  3VKI A;  1M5Q 1;  2A7Y A;  3QDR B;  1VQL A;  4JRI A;  1UGP B;  2D0Q B;  2R5A A;  4C8Q C;  3Q1J A;  3ME9 A;  2PUK B;  4QQ6 A;  5GAN d;  4C92 E;  2ZPF B;  5CCA A;  3WXM B;  1VQ9 A;  4XU0 A;  4M7A B;  5J3B A;  4BB7 A;  2GQV A;  3HL8 A;  1Y07 A;  4OMF B;  4QVD A;  1QW1 A;  1X6O A;  2VV5 A;  4MZT A;  4N4G A;  4Z02 A;  1O75 A;  5KH6 A;  3L2V A;  3GP8 A;  1KQS A;  1KG1 A;  5A0D A;  4MDX A;  1KC8 U;  4Y91 A;  3MCA B;  2I2L A;  1N27 A;  2DTO A;  3HPW A;  2L5Q A;  4MZM A;  5GAN 3;  2JOY A;  2VXF A;  4B9W A;  3PIP A;  3CMA A;  3CCU T;  1VQ7 T;  1JBM A;  4QVC A;  2RHI A;  1QVP A;  3PT9 A;  2DIG A;  3OMG A;  2KAF A;  3FDR A;  1VQN T;  2MF2 A;  1OYX A;  2RB6 A;  3V8L A;  3L1A A;  1XOV A;  4M75 F;  1I4K 1;  3ZFJ A;  3OS0 A;  1WNL A;  2CKK A;  4PJO B;  3LH0 A;  4BI4 A;  2FB7 A;  3JAM E;  1H64 1;  3PMT A;  2Y4X A;  2DXU A;  3M9Q A;  3OQ5 A;  2H3J A;  4X34 A;  1PSE A;  1LJO A;  3G4S A;  3M54 A;  5CQX A;  3CBP A;  1YI2 T;  2XI9 A;  2CZ1 B;  3FRN A;  4LD9 K;  1B34 B;  1YCY A;  4M75 D;  5LJ3 g;  5A2Q E;  2M9U A;  2QEX A;  1YIT A;  3J80 E;  3A8H B;  2DXB A;  2K3X A;  5CO7 A;  2RD1 A;  2QQS A;  3NTK A;  4FSX A;  2F5K A;  3FC3 A;  4BY6 C;  2YLB A;  4M7A F;  2OTL A;  3V7C A;  1YJW T;  4LDW A;  2XKO C;  1M1F A;  4Y28 E;  3JB9 I;  2E41 A;  2C06 A;  1GXI E;  2XDB A;  1PSF A;  2DK3 A;  1Q7Y U;  1R8O B;  1XQH A;  3G6E T;  2PVO B;  2GF7 A;  5CAI A;  3RER A;  5J26 A;  1VQ7 A;  4M7A D;  1K8A U;  3CC4 A;  3HFO A;  1LNX A;  2DD4 A;  5DLQ E;  4M78 F;  3JCM f;  2RI3 A;  2QQA A;  4E7J A;  3I56 T;  1QP2 A;  2MI6 A;  2HBP A;  2LC4 A;  3MHX A;  4IUV A;  5CKE A;  4ZGD B;  4PJO F;  1JB0 E;  3JCM d;  3CC7 T;  1N9R A;  4IKF A;  1K9M C;  4J6Y A;  2VXE A;  4M78 D;  3PFS A;  1W2B S;  1NJI C;  3SFM A;  4M7D E;  4F7U B;  4ELZ C;  3QZ5 B;  3LLR A;  3INZ A;  4ZGE B;  3GOX A;  4M7A C;  3PIO A;  3MEU A;  4PJO D;  4HCZ A;  4C0G A;  4X9C A;  1MGQ A;  1V29 B;  3GF5 A;  2CYZ B;  2RHY A;  1Q82 U;  4C5G A;  4JRP A;  2KY9 A;  2RJF A;  5GAN h;  3M58 A;  2M0O A;  3OYD A;  3CCM T;  4RCC A;  3A8M B;  2XK0 A;  4OP0 A;  3RES A;  3X24 B;  5GAO m;  3HKS A;  4JLG A;  5CIU A;  4UC4 A;  3G6E A;  2F5T X;  3QKJ A;  2DPP B;  1S72 A;  1Q86 U;  1JRI A;  3X26 B;  4P5N A;  3L42 A;  4MML A;  4C92 G;  5GAM j;  1H3Z A;  4NS5 A;  1P92 A;  3HHT B;  2M16 A;  3KBG A;  2VC8 A;  3EFS A;  2X35 A;  2XDP A;  1G3Y A;  2GCX A;  2XU8 A;  3A8G B;  3CC4 T;  1Q82 C;  4PJO C;  3QO3 A;  3GLX A;  5FU6 B;  2EAY A;  4IUU A;  4N0A A;  1IZ6 A;  3JCM Q;  4DQ2 A;  3CCE T;  4C8Q F;  1M9S A;  1WQ7 A;  3H8Z A;  1RI0 A;  5GAN e;  1FXX A;  3M55 A;  4M77 G;  5KCO A;  2LT1 A;  3LX7 A;  4RCB A;  3M59 A;  4BUG A;  3JB9 J;  1N8R U;  4J7F A;  2LQ8 A;  4PJO E;  3G71 A;  3P8D A;  3OW2 S;  3CMA T;  3KUF A;  5DY9 A;  4C8Q D;  4F7U F;  2XDD A;  3RKY A;  4BAC A;  4ZTJ A;  3MEW A;  1ZHI A;  2JZ2 A;  4C92 A;  1VQ8 T;  5I2M A;  1BIB A;  2X4W A;  2ZPG B;  3C94 A;  2DEQ A;  3TCJ A;  1WPY A;  3PGG A;  5GAN 8;  2X4Y A;  3OBY A;  2CZ7 B;  2K57 A;  4FM4 B;  3ZBD A;  4A54 A;  4EMG A;  3OYL A;  2F69 A;  3OS1 A;  2QDY B;  5LJ5 f;  2PVD B;  3JCM J;  3EFR A;  4MDW A;  2FVU A;  2YHT A;  4XQ3 A;  4FIB A;  1BI0 A;  4J6W A;  3S6W A;  4C0D B;  4QQD A;  3PMI A;  3G4S T;  3CCV T;  4E7L A;  2CZ6 B;  2OTJ T;  2E6N A;  2EIF A;  3BDL A;  3JB9 F;  2KDS A;  2CGH A;  4HA8 A;  2B8A A;  4XAX B;  2BIV A;  4IUQ A;  4JRK A;  5CQY A;  3SD4 A;  4DOV A;  5GMK j;  2QEX T;  4XU2 A;  1YIT T;  1BI2 A;  3LGF A;  3HRU A;  3OYF A;  5D6X A;  3SDZ A;  3CCE A;  3ZEH A;  4RMO A;  2OTL T;  3RMS A;  4ZGJ B;  3OMC A;  3JCM c;  4XTW A;  4ZN1 A;  2X4X A;  2GFU A;  3UT1 A;  3JCM h;  1NPP A;  1UGR B;  4M77 E;  3WVE B;  2LDM A;  3M4Y A;  2XD0 A;  1KC8 C;  4QQG A;  5GMK l;  2HAX A;  4E7I A;  1VQ8 A;  1VQP T;  1W2B A;  2KMT A;  4C5H A;  2P0K A;  4N4I A;  5CKH A;  5C6S A;  2E6Z A;  2PVG B;  2E64 A;  3VJP A;  4MMK A;  5CK9 A;  3RMQ A;  3CD6 A;  3L2R A;  3OYA A;  4J6X A;  4LD6 A;  2AHJ B;  4KBM B;  3OYE A;  1UEB A;  5IAY A;  4JJN K;  3OBW A;  3URG A;  4M7D G;  3CCV A;  1VQK A;  2RJE A;  1VQM A;  1HK9 A;  3QSU A;  2OTJ A;  1OZ3 A;  4A53 A;  2K3Y A;  3OSS C;  4M75 G;  2QA4 A;  2JVV A;  5LJ3 j;  2OAU A;  4C0F A;  3JCM e;  2MMP A;  5FU6 C;  2EQJ A;  3J7A F;  5IT9 E;  2EQK A;  2R57 A;  4HCB A;  4JDS A;  2KK4 A;  4OB1 B;  5M9O A;  3HFN A;  3MO8 A;  3R6O A;  1YBY A;  2MWO A;  4OF1 A;  3H6Z A;  5GAN g;  1G3S A;  3DB3 A;  2VUB A;  3GNG A;  5LL6 S;  1ZQ1 A;  3EAE A;  4B9X A;  4A4H A;  1D3B B;  3FB9 A;  4XK8 E;  1WJQ A;  3NTI A;  4XU3 A;  2WSF E;  3FLG A;  1ZBX A;  2E1H A;  4M7D A;  4NL2 A;  2DO3 A;  5D6Y A;  4BDZ A;  3V8J A;  3JRZ A;  3V7S A;  1S72 T;  1Y96 A;  2WAC A;  3LW5 E;  1VQP A;  3TEE A;  2DJZ A;  1MHN A;  2RK1 A;  3X25 B;  4BDY A;  3MET A;  4BE1 A;  2RI5 A;  1Q7Y C;  2EKO A;  2DZ9 A;  1NE8 A;  2LCC A;  3OB9 A;  1BI3 A;  2V8J A;  3QG1 A;  3OW2 A;  3ER0 A;  3OYJ A;  1K8A C;  4C0D C;  1I5L A;  2D6F A;  4RG8 A;  2VGM A;  3C4S A;  2R5M A;  2ZCF B;  4XTX A;  3CXC S;  5KE2 A;  4KT0 E;  5GAM f;  2K5F A;  4C92 B;  3NTH A;  3VU3 C;  4EMK A;  4FL6 A;  4M78 G;  3FJP A;  4JUV A;  4BD3 A;  2DAQ A;  4L59 A;  1BI1 A;  3VYH B;  5FRN A;  4ZN3 A;  5GAM d;  3G71 T;  1VQO T;  3JCM V;  2V8I A;  5DM7 R;  4M75 E;  3JCM W;  1VQ4 T;  4GY5 A;  1KHC A;  5LJ5 h;  4WF2 A;  2WSC E;  2E70 A;  4M77 B;  2QI2 A;  1KQS S;  2DXT A;  1FWZ A;  5FU7 B;  1M1K U;  1VQ5 T;  4Q5W A;  3OYI A;  4PL6 A;  2KSS A;  3RKX A;  5GAN 5;  1XTD A;  5CVI A;  3E9F A;  5HY6 A;  2XID A;  4PKC C;  3OYK A;  2HD0 A;  2HQX A;  5KCH A;  1KD1 U;  1YJN T;  3M56 A;  1JJ2 S;  5HK3 A;  2DTH A;  3M5A A;  2QTX A;  4QW2 A;  4J5Y A;  4II1 A;  3VYG A;  3CME A;  4D6W A;  5A0G A;  4XTY A;  2P4T A;  2FL7 A;  3DLL A;  4M7A E;  5GAN 4;  2HNI A;  3OYG A;  1Q86 C;  1D3B A;  2ZPB B;  2EJ9 A;  5KE3 A;  3CCL A;  3L2Z A;  5LJ5 e;  1Y7X A;  3VUB A;  3L2W A;  4PNO A;  4A4G A;  1OI1 A;  1LOJ A;  2YLC A;  5D6W A;  2D9T A;  5FRM A;  5FLX E;  3CPF A;  4EDU A;  5CKD A;  2E65 A;  4C92 F;  1YIJ T;  2RH2 A;  3JCM g;  3GIB A;  3A8O B;  4NOY A;  2VGN A;  2DVE A;  2DXC A;  4M78 E;  3X20 B;  4C8Q G;  1VQO A;  2E5Q A;  1N8R C;  1QVF S;  1VQ4 A;  2PUO B;  3LWH A;  1KQ1 A;  4J8O A;  4OVA A;  2G3R A;  2DTI A;  2P0P A;  1VQ5 A;  3JCM P;  3DKM A;  4HT8 A;  2RI2 A;  4HKE A;  3MEV A;  3PNW C;  4XTV A;  3A5Z B;  2LX9 A;  2EFI A;  4TVR A;  3CD6 T;  4IUP A;  4NL3 A;  2RJC A;  2LT4 A;  3OYN A;  4RKU E;  4N0A C;  4C5E A;  3MP8 A;  2O4X A;  5I21 A;  2PU9 B;  4M77 A;  1VQK T;  2WSE E;  1VQM T;  1BKB A;  1FX7 A;  2ZPH B;  1YJ9 T;  3ASK A;  4O6J A;  4OB2 B;  4ELY C;  5GMK m;  3OY9 A;  2QA4 T;  1YJN A;  1BYM A;  4VUB A;  3OS2 A;  2M1H A;  3OYB A;  3CCQ A;  1QVG S;  4LDU A;  4XU1 A;  5GAO l;  2MAM A;  3OYH A;  1U1T A;  5GAN 6;  5GAN 2;  3OA6 A;  1G3W A;  4E47 A;  3TU4 K;  2LVM A;  3QBY A;  4M7D B;  4FT4 A;  1M4Z A;  3MP6 A;  4C92 C;  1M8V A;  5GMK i;  3CEY A;  1Y96 B;  4M75 B;  4C0Z A;  3JCM X;  2EJF A;  5LJ3 f;  4JS5 A;  3S3N A;  3JB9 D;  2L8D A;  2DZC A;  4RG2 A;  4LDV A;  3CCR A;  4FT2 A;  5GAO r;  4DA4 A;  1YIJ A;  1U8R A;  1Q81 U;  3LWI A;  2IVW A;  2XIC A;  2BUD A;  5LJ3 d;  4E7H A;  4IUT A;  2HQE A;  3BDU A;  1VQ6 T;  2RO0 A;  3CXC A;  3CCJ A;  4M77 C;  3P8B B;  4QVZ A;  5FU7 C;  2QXF A;  3UWN A;  4BI3 A;  2EQM A;  4EMK B;  5I2S A;  4OGE A;  5GAM h;  4JS4 A;  4BE2 A;  4C8Q E;  4ZTF A;  3HSB A;  5L8R E;  4DOW A;  2E10 A;  1U1S A;  2BKD N;  2LRQ A;  2NLU A;  2DIQ A;  4JRQ A;  2R58 A;  2K5L A;  4XTU A;  2O01 E;  3RIR A;  5A0L A;  5HK0 A;  3CCS A;  4XTZ A;  2KVQ G;  2LTO A;  5GAN 7;  2FHD A;  5FRO A;  2E12 A;  4IUR A;  1UGQ B;  4F7U E;  1YJ9 A;  3LYI A;  2IG0 A;  2JN0 A;  3CPW S;  3TRE A;  1VUB A;  3QYG B;  3QUI A;  5LJ5 j;  5LJ5 g;  3S3O A;  1JJ2 A;  1KQ2 A;  4R55 A;  4EPC A;  4M78 B;  5GAM e;  3L2U A;  3X28 B;  4M7D F;  5GAO p;  2QQ9 A;  3SB2 A;  1DJ7 B;  3C12 A;  3VV0 A;  5GAN j;  3MP1 A;  3CC2 A;  2RA2 A;  3KXT A;  1I8F A;  3BW1 A;  2ZPE B;  3BFM A;  2RM4 A;  2RHU A;  4KUI A;  1YHQ A;  2V8K A;  4PLL A;  3CBO A;  5CKF A;  1VQ6 A;  1N6A A;  4M7A G;  3OYY A;  5C0M A;  4M7D D;  3HRS A;  4M75 A;  2YRV A;  1AHJ B;  3CME T;  3QJ6 A;  2LQK A;  3E9G A;  5GMK h;  1TH7 A;  3QJY A;  4A4K A;  3CCL T;  3GPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...