2CSQA

Solution structure of the second sh3 domain of human rim-binding protein 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
97
structure length
97
Chain Sequence
GSSGSSGTDPGAEELPARIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEIQADDEEMMDQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords RIM binding protein 2
publication title Solution structure of the second SH3 domain of human RIM-binding protein 2
rcsb
source organism Homo sapiens
total genus 7
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2csqA01
4HVVA 2GBQA 3I5SA 2PZ1A 2RQUA 2O9SA 1S1NA 5IHIA 1BK2A 3VS6A 4OMNA 5GJVB 1AZEA 1X27A 2RMOA 1WIEA 1YNZA 1QKXA 2DBKA 1RLQC 2E5KA 2GGRA 2H8HA 2L0AA 1OOTA 1SHGA 2BZ8A 2DX1A 3UF4A 1Y57A 4AFUC 2D8JA 2FPFA 2CDTA 1AWXA 1I07A 1NEBA 2FG0A 2JS0A 2SRCA 2RQTA 3VS3A 1YWPA 2CREA 2D8HA 1ZLMA 2YUNA 2LJ1A 1JXOA 3VRZA 2YDLA 3M0TA 3TSWA 4F17A 3CQTA 4HXJA 1W6XA 2ED1A 2EGAA 2FPEA 1K0XA 2DVJA 2DL7A 2JM9A 2L3QA 4J9EA 2JMAA 2M51A 4F16A 1ZBJA 3REBB 3H0HA 4J9FA 1KSWA 4J9HA 4Y92A 4K11A 1YN8A 1VYTA 2CT4A 3VS1A 2OJ2A 4GLMA 1HJDA 3EG2A 1PRMC 2EYYA 4KRTA 3EG0A 1PKTA 4OMPA 5FWCA 1ARKA 1E6HA 1B3QA 2F2XA 4CC4B 1QWFA 4FSSA 3VS5A 2DA9A 3I9QA 2LMJA 3GBQA 2YUQA 1HSQA 2MOXA 2CH4W 2JW4A 1CKAA 1G2BA 2NWMA 5ECAA 1SEMA 2J6FA 4J9IA 1T3SA 5I22A 2DNUA 2C0IA 1TUCA 1MV3A 2FRYA 1FMKA 1AWWA 2ECZA 2YT6A 4E6RA 2GNCA 1RUWA 2KNBB 2F2VA 1CKBA 3PVQA 1GBRA 1ZUKA 2MIOA 1UGVA 4EIKA 1TG0A 2EVRA 1YP5A 1N5ZA 2RNAA 2DL8A 2J06A 2EPDA 1CSKA 2DLPA 1M8MA 2EGCA 1U5SA 4JJBA 4JZ4A 3RBBB 2VVKA 1H8KA 2KE9A 1T3LA 1X2KA 3QWYA 3C0CA 1AEYA 1FYNA 3EG3A 5FWBA 2DL3A 1AWOA 3VS4A 1RI9A 2CUBA 1QKWA 1QWEA 3REAB 2LQNA 4AG2C 2AZSA 1LCKA 2KGTA 1Z9ZA 2X3XD 4IIMA 2K3BA 2QDLA 1K4US 3M0QA 2K7AA 2ESWA 2EBPA 4X1VA 2KRSA 2DM1A 4WCIA 2EKHA 1K0SA 2RN8A 2DL4A 1PNJA 4LUEA 1BB9A 1E6GA 1WXUA 1UFFA 1KIKA 1SPKA 1W1FA 1GFCA 2GTOA 2BZXA 1K1ZA 4RUGA 1GCPA 2V1QA 5L23A 2DRMA 2DJQA 1MV0B 1A0NB 1NYFA 1H92A 2EW3A 1SHFA 1OPKA 1Y0MA 2FPDA 2W10A 4RTZA 1WX6A 2HDAA 1AWJA 1QLYA 2DF6A 4IIOA 4RTXA 2A28A 1OV3A 2EQIA 2KBTA 2B86A 2LJ3A 1EFNA 1NM7A 3M0RA 1K76A 5IH2A 2DYBA 2C0OA 3NHNA 4J9CA 4F14A 2CT3A 4AFQC 2JMCA 2O2OA 1M3BA 4LE9A 1WLPB 2ED0A 3H41A 4J9GA 3TSZA 2HSPA 2C0TA 4OMMA 4JZ3A 2CSIA 3I5RA 2KEAA 2V1RA 1VYVA 3VRYA 2ROTA 1GCQC 1YCSB 2AK5A 2DILA 4DEXA 1AVZC 2RQRA 3IQLA 1TUDA 2X3WD 4HCKA 4Z89A 2LQWA 1XOVA 2ENMA 4Z88A 4JPBW 3H0IA 4LNPA 5IHKA 2OI3A 2FRWA 1J3TA 1NYGA 3PE0A 4RTTA 1UTIA 2RQWA 2L3SA 4CC2A 1NLOC 1UECA 2O9VA 1U06A 5EC7A 1YWOA 3FJ5A 4A63B 1OPLA 2K79A 2YUPA 2L2PA 1ZUUA 2RF0A 2RQVA 2J6OA 3SEMA 1GCQA 4RTYA 2J05A 2DE0X 2CSQA 1VA7A 2FEIA 2GQIA 2LJ0A 2LZ6B 4J9BA 2CH4A 4JJDA 5I11A 3QWXX 1T0JA 4CC7A 2AZVA 2KXDA 2DBMA 1WI7A 1JQQA 2RPNA 2EYWA 4OMOA 1WA7A 1UJYA 1JEGA 1ZUYA 1SRLA 4LUDA 2O88A 2BTTA 3M0SA 4ZNXA 2KR3A 3NMZC 1PHTA 1NG2A 4CC3A 1AZGB 2SEMA 2I0NA 3U23A 1UHFA 2AKLA 4JJCA 1JO8A 1ZSGA 3UATA 1ABQA 4D8DA 2O31A 2VKNA 1NLPC 1X43A 1ZX6A 2NUZA 1I1JA 2EYZA 1V1CA 1Z9QA 2YUOA 1M3AA 1SSHA 2JS2A 1X6BA 3RNJA 4RTVA 3PVLA 4J9DA 2KYBA 1JXMA 4Z8AA 3THKA 1BBZA 2KT8A 2J6KA 2PNIA 3KFVA 1UJ0A 2A36A 2JM8A 1GRIA 3A98A 3M0PA 4HVWA 2KYMA 2GTJA 3VS2A 2G6FX 2YSQA 3EHQA 3H0FA 5IXBA 2PTKA 2LNHB 2ABLA 1UDLA 2LX7A 2ROLA 1M3CA 1PRLC 2BZYA 2A08A 2A37A 1RLPC 2P4RA 2DMOA 1BU1A 5IXFA 4AFZC 1T0HA 1KJWA 3UA7A 1I0CA 2CUDA 2K9GA 4GBQA 2IIMA 1GL5A 1G83A 2DRKA 1HD3A 1X2QA 3VS0A 2XMFA 2EYXA 3I35A 2D1XA 3VS7A 1H3HA 2L3PA 3R6NA 2D0NA 3EGUA 1UE9A 2J7IA 2K2MA 4RTWA 2LP5A 2HEQA 1E7OA 3LH5A 1B07A 1SRMA 1PWTA 2HCKA 3NGPA 2OAWA 3JV3A 2KRNA 4RTUA 2LCSA 1W70A 1WXTA 1IO6A 2KRMA 5FW9A 1ABOA 2JXBA 1UUEA 1X6GA 2KXCA 3NPFA 2F2WA 4M4ZA 3M0UA 1JU5C 4R0KA 4OMQA 1U3OA 3UA6A 3O5ZA 2DL5A 3EG1A 5IHNA 2FO0A 2W0ZA 4HVUA 4AFSC 3ULRB 1NEGA 1KFZA 2JT4A 2KT1A 1AOJA 1M30A 1M27C 1K9AA 1QCFA 2EGEA 4QT7A 1GFDA 3TVTA 1UHCA 2VWFA 1VYUA 4ORZA 4LN2A 5HCKA 1UG1A 1GBQA 1MUZA 2AKKA 2HBWA 1PKSA 4AG1C 3EHRA 4DEYA 1WFWA 1X69A 1AD5A 1OEBA 2MCNA 4ESRA 1WYXA 2K6DA 2M0YA 2JTEA 2KROA 4D8KA 5GJWB 3SHWA 1WDXA 4OMLA 1WXBA 3ZL7C
chains in the Genus database with same CATH superfamily
1NJIR 4WTOB 2RQUA 2O9SA 4LD9K 2DO3A 3OYNA 4JLIA 4PJOD 5GJVB 1IXDA 1AZEA 2NLUA 4EDUA 5KH6A 1YNZA 3CPFA 4TVRA 1SHGA 2DX1A 2D8JA 2D0QB 2FPFA 2CDTA 5LJ3g 5GANf 1N9RA 2CREA 4DBRA 1ZLMA 2YUNA 2LJ1A 4HA8A 2KVQG 1MMDA 1FXXA 4M7AB 2YDLA 2E70A 1ACMB 4F17A 1HK9A 1Y96B 4QVDA 3HFOA 1N8RU 1K0XA 2DVJA 3JB9G 2L5QA 2JM9A 4LDYA 1B7TA 2Z0WA 2JMAA 3MP1A 4F16A 3REBB 4J9FA 4Y92A 2PUOB 1D0XA 5LJ5h 1Q86C 2PQWA 1SSFA 2E41A 2QA4A 1YJNA 3A8MB 4MZMA 2K5FA 3RMQA 2EYYA 1M2VB 1E6HA 2LC4A 2M16A 4ZGDB 1NE8A 1RAGB 4M7DC 1SG5A 4FYYB 5FU7B 3PGGA 3CC4Q 3UPUA 4ELZC 2OTJT 4HCBA 3MEVA 1VUBA 1CKAA 1G2BA 2DXTA 3OYCA 2VXFA 1RADB 4J9IA 1NZ9A 2C0IA 2YHTA 1TUCA 4C5IA 1KQ2A 1AWWA 2HL5C 2YT6A 4E6RA 2RHIA 3HL8A 5FROA 5GAN3 5DLQE 4EIKA 1TG0A 2V8KA 4DOVA 1N5ZA 4QKUA 2DL8A 4IURA 5GAMg 1ZBXA 4ANJA 3G7ZA 5LJ5e 2OTJA 2RHYA 1I8FA 2EGCA 3JCMd 3I55Q 2CZ6B 4JZ4A 3RBBB 3V8LA 1WZOA 1D1BA 1IRXA 1H8KA 2KE9A 5KCOA 2COYA 1AEYA 1FYNA 3EG3A 4LDWA 1FWZA 4OMFB 1RI9A 2CUBA 3FRNA 4WF2A 2E4HA 1OZ2A 1N8RC 1Z9ZA 5DY9A 1KC8U 3L42A 3M0QA 2K7AA 5GAOn 1LNXA 2KRSA 2DM1A 1WJQA 5HKCA 5D6WA 2RN8A 2NUTB 2CP7A 3QBYA 3RKYA 3CXCA 5J3BA 3EG9B 1AHJB 1LJOA 4RUGA 3M53A 3CCMT 1GCPA 3OYKA 5L23A 4PJNA 3AHUA 2DRMA 2LX9A 2DERA 2ZPEB 5L8RE 3PNWC 2DAQA 2W10A 4RTZA 1M4ZA 1MNEA 5J26A 3UWNA 4BY6C 5GAN8 4LDXA 4C8QC 4C5HA 2KBTA 4FT2A 3VUBA 2B86A 4FW2A 2LJ3A 3CCMA 1KQSA 3M57A 1NM7A 3M0RA 5IH2A 2XDBA 3QG1A 4JS5A 4F14A 2CT3A 5HK3A 3GOXA 1KHIA 4BDYA 1BYMA 4LE9A 4C5EA 2HSPA 2QG9B 2C0TA 5KYXB 2I2LA 2VASA 3AT1B 7AT1B 5I21A 4KT0E 1GCQC 2LT4A 2KDSA 3LWIA 2X3WD 4PJLA 4FM4B 2RK2A 1I5OB 3QIIA 2ZPGB 2LQWA 4Z88A 4JPBW 3PT9A 5IHKA 1IB8A 3RDVA 2E6ZA 1VQMA 1VQNQ 3PMTA 2PVGB 2F5TX 2OTJQ 2MAMA 1KC8C 1ZHIA 2RO0A 1U06A 5KE2A 1VQKT 1YWOA 4M7DD 3SWNC 4A63B 2YUPA 3JCMf 2RQVA 2HQEA 3CCJT 2YLBA 2DE0X 2CSQA 4PJOE 2CH4A 1G3TA 5I11A 1M1GA 1WHKA 2ZGWA 5DM7R 4GY5A 4CC7A 3QZ5B 2KXDA 2KQWA 3JRZA 3EFRA 1HXDA 4C92A 1JQQA 2ZPIB 4DBFA 1UJYA 2HKNA 2EQJA 1SRLA 2O88A 2BTTA 2A3LA 3PIPA 5LJ3j 4ZNXA 2EQMA 2K5LA 2RI2A 3V7SA 3CCJA 1NG2A 4Z02A 1M1KU 2I0NA 1JJ2P 1VQ9A 4EPCA 2AKLA 4JJCA 1JO8A 1ZSGA 3UATA 2O31A 1MMAA 1TU0B 1VQLT 2EYZA 1ZA1B 3OS2A 4J8OA 5GMKe 2C06A 2RJCA 3PVLA 4IUUA 2VGMA 2YRVA 3WVEB 2KYBA 1PG5B 1JXMA 1BBZA 1KD1R 2KT8A 4M75C 3KFVA 5LL6S 1FMWA 2M02A 4M7AA 1VQLA 1Y96A 3L2UA 3ASKA 3EHQA 3OB9A 1ZA2B 4C0ZA 5GANj 4PJOB 1OX8A 2ROLA 1W2BP 2BZYA 4E7ZA 2KI7A 2V8JA 2X4WA 2CGHA 4O5VA 2DEQA 2K9GA 4XK8E 3HSBA 2IIMA 3JCMe 5KYNA 3UT1A 1MHNA 3QHSA 1G83A 4C8QD 2EJGA 2DTHA 2EYXA 3HPWA 5D7UA 2VGNA 4JRKA 2DPPB 2D1XA 3JB9H 4E7IA 4A4KA 2D9TA 3L2ZA 4A4GA 1N9SA 1RABB 4FT4A 1QMCA 2COZA 5KYWB 1M1KC 1MGQA 3CBPA 2GQVA 3INZA 1ABOA 2MPXC 4OMQA 3L2VA 1VQKQ 1I81A 1QVPA 5IHNA 4EMKB 2QTVA 1R8OB 4BB7A 2KT1A 1M27C 2EGEA 4NS5A 3P8DA 4J83A 5CAIA 1D3BB 1JB0E 5CCAA 1VYUA 4UC4A 5AYFA 3S6WA 1GBQA 1MUZA 3CBMA 1Q86R 3HFNA 1WFWA 3OQ5A 1OX9A 2K6DA 1ZSZB 2B8AA 1WDXA 4OMLA 2DXUA 1UGRB 3EG9A 3I5SA 1VIEA 4B9WA 1U1TA 2MMPA 1VQLQ 3MP8A 1X27A 5IN1A 2JUFA 2RMOA 3CXCS 1QCNA 5CKFA 3FIFA 1W4SA 2JZ2A 2EQKA 2L0AA 4ZGEB 3V8KA 2BZ8A 2RI3A 3OYGA 2KSSA 4M78E 3JCMX 1Y57A 1VQ7Q 2JS0A 2SRCA 2Y4YA 3OYEA 2D8HA 1FMVA 5CR2A 1YIJT 1PSEA 2RHZA 3CC2T 2KK4A 3CQTA 1W6XA 2FPEA 1D09B 2ZPFB 2P0QA 2DL7A 2L3QA 1KQSS 4M75D 3C94A 4J9EA 4C0FA 2M51A 2MYSA 5KYXA 1RAFB 1ZBJA 3H0HA 4M7DE 1N8RR 2XD0A 3ZFJA 2YLCA 3CD6T 2D6FA 3CPWP 1Y7XA 2CZ1B 3QYGB 3CCLT 1NBEB 1PKTA 5FWCA 2F2XA 3G71T 2E1HA 1S72T 1PC0A 4CC4B 3VS5A 3C95A 2DA9A 3TEEA 1U8RA 3I9QA 2YUQA 5GAMd 1SEMA 2J6FA 1TWBA 2FRYA 2ECZA 3OSVA 2Y4XA 1CKBA 1ZUKA 1O75A 4PK4A 3CCLA 4F7UE 1YJ9T 5CQXA 5GAN7 1HYOA 2EVRA 3CCQA 2RNAA 1XJWB 3P8HA 1CSKA 2DLPA 4NL2A 3EFSA 3A8LB 3NTIA 3M59A 2R58A 1G8XA 4OB2B 4XAXB 3QWYA 4RG8A 5FWBA 3EGDB 1F1BB 5CKHA 1YJ9A 2CP3A 3CCET 2DL3A 4M7DB 1AWOA 4XTVA 3QJYA 1WHMA 1QWEA 3REAB 1M8VA 2LQNA 1LCKA 2KGTA 4ZN3A 4IIMA 2KMTA 2K3BA 3V8JA 2XDPA 5LJ5f 3LLRA 3G4SQ 2ESWA 2EBPA 4X1VA 1M90U 4PJOG 4M78F 4XU1A 2WSEE 1X75C 1K9MU 4PNOA 4N4HA 2O01E 1GFCA 2GTOA 3NTKA 1BCOA 4MZPA 3CCEA 4X9DA 4XTUA 4X9CA 2DJQA 3CC7T 4C8QE 3GIBA 3CMAT 2LTOA 2QA4T 1YJNT 1SHFA 4PJOA 2XKOC 1AWJA 1QLYA 3EAEA 4RTXA 4M78C 4M7DF 2A28A 1OV3A 3OY9A 1WNLA 1DJ7B 2RK1A 2CP2A 4J5YA 2C0OA 1YIJQ 5LJ3h 5LJ5g 3CC2Q 3HRUA 4N0AA 3CC7A 3HKSA 2O2OA 3CCSA 1M3BA 3CMAA 3E9GA 1WLPB 4J9GA 3QUIA 2G3RA 4OMMA 4JZ3A 1IGUA 4E7LA 2CSIA 2KEAA 2V1RA 3VRYA 3CMEA 1Q81R 2AK5A 1N6AA 3CD6Q 1WHLA 5GANg 4HCKA 3QZ9B 1N27A 5KYWA 3CCLQ 2YWWA 4F7UF 1KQ1A 3G71Q 1S72Q 3F70A 4R55A 4C92C 1IZ6A 1P92A 4RG2A 2ZPHB 5HY6A 2OI3A 1J3TA 1NYGA 1UTIA 3MEUA 4BY6B 2HBPA 1NLOC 1UECA 1M90C 1H641 4QQDA 2ZCFB 1QVFS 9ATCB 1K9MC 2K79A 3PMIA 4XU0A 1K8AU 1LOJA 3BY7A 1D0ZA 1YJ9Q 3HTRA 1D3BA 4YTLA 2FEIA 4JJDA 1WPYA 2QYZA 4A54A 1T0JA 1QW1A 3OSSC 1OU9A 3KBGA 2QAZA 1WI7A 2RPNA 3JCMc 5GAMh 1ZUYA 3G6ET 3X25B 1WHJA 1X01A 2RJEA 3X20B 3OS5A 2RB6A 3NMZC 1C1AA 2GF7A 1G5VA 1PHTA 4M7AC 3CCEQ 3VUZA 1QVGS 1AZGB 2RJFA 3U23A 2F1LA 4D8DA 1JJ2A 4FYVB 4C8QF 1I1JA 1WGSA 1B34B 2AIRB 4IKFA 1Z9QA 4EMGA 4M75E 1M1KR 1M3AA 1SSHA 2JS2A 1X6BA 4J6YA 3RNJA 3G6EA 2X4XA 4J9DA 2DZCA 4ZN1A 3HRTA 3DLLA 2K3YA 2QGFB 2J6KA 4OB3B 2IG0A 3CC7Q 2DIGA 2JM8A 1BIBA 5GAMe 3CMAQ 4R56A 2QA4Q 1YJNQ 2F5KA 2RA2A 1RI0A 5IXBA 2LNHB 2ABLA 4DA4A 2KY9A 2QQRA 4E7HA 1RACB 1VQ5A 4CI0C 1BI2A 1VQMT 2DMOA 1BU1A 8AT1B 5IXFA 1K8AC 2X35A 3A8HB 1KK7A 2CUDA 1I4K1 3J7AF 4M78D 3MPUB 4GBQA 4M78G 4BDZA 2E64A 2JTMA 2R5MA 2XMFA 3ME9A 5D6YA 1TUGB 2QI2A 4M77C 3HP9A 4IUPA 4BI4A 3EGUA 1UE9A 2EWNA 3ER0A 2LP5A 4VUBA 4M75B 3QDFA 1E7OA 1B07A 1NJIC 3OYJA 1PWTA 2HCKA 3X24B 2QGGA 2LCSA 5KYUB 2DK3A 4M7DG 2KRMA 2LRQA 3RKXA 3CCUT 1UUEA 4PJJA 2EIFA 3VKIA 5J39A 1U3OA 4XU2A 3UA6A 3O5ZA 2YRCA 4IUTA 5HK0A 4AFSC 5FU6B 4Y28E 2EJ9A 2MK5A 1VQ9T 3ULRB 3Q1JA 4QT7A 2QQBA 5KYYB 3GF5A 4XQ3A 3EGDA 3V7RA 2HAXA 4RCCA 2RI5A 1VOMA 4ORZA 3FLGA 4KGZB 4Y91A 3CCUA 4M7DA 2QQAA 4IUVA 2VYTA 2LDMA 5FRNA 3PFSA 4QW2A 1R0BG 4M75F 4FYWB 1AD5A 1UB4A 2MWPA 4ESRA 4A4HA 1WYXA 3G6EQ 4F7UG 2JTEA 4D8KA 5GJWB 4BUGA 3M4YA 2MF2A 4PL6A 3JCMg 2GBQA 1XQHA 1S1NA 2DTOA 4OGCA 3OYDA 1YCYA 1YITA 1BK2A 2WSCE 5A2QE 4JLGA 3T9NA 5LJ5j 4OMNA 3CXCP 3CCMQ 2QASA 4M7AD 3OYFA 2GGRA 2H8HA 2A7YA 1WJRA 1OULA 4J6WA 3FJPA 4KUDK 2DYIA 1I07A 2IVWA 4LD6A 2RQTA 2EJFA 4OP0A 4HT9A 3VRZA 2P84A 3M0TA 3KXTA 4CRIA 1RAEB 4FCYA 2K5IA 1RAIB 2CZ7B 2K3XA 1M2VA 1VQMQ 3E19A 3VYHB 1KSWA 1V76A 4K11A 4XTXA 4C8QG 3M5AA 3O8VA 1VYTA 1BIAA 3OMCA 5D6XA 2CT4A 3VS1A 3GP8A 4KGVB 2OJ2A 4GLMA 3CPWA 4ATOA 1PRMC 4KRTA 4RKUE 1B3QA 2DD5A 2A0FB 1M9SA 1QWFA 3X26B 3D7SB 4C0GA 3JCMV 1VQOT 3CCRT 2DXBA 4KBMB 5ECAA 5FLXE 1T3SA 1TXQA 4DBHA 5I22A 3EGXB 2DXCA 2DVEA 1TS9A 4M77D 3A5ZB 4II1A 4JDSA 5A0DA 4AMCA 2KNBB 2F2VA 3PTAA 3OW2P 2EYQA 1GBRA 2MIOA 3CCUQ 3OYYA 2H3JA 1TSFA 3JSCA 1OI1A 1Q7YU 3CCJQ 1SKUB 3MEWA 3QYHB 8ATCB 1XTDA 4ELYC 1M8MA 1VQ9Q 1VQOA 3CCRA 3L2QA 1U5SA 4JJBA 1BI0A 3EH1A 1UGSB 2K2VA 2EFIA 1VIFA 2NUPB 2M1HA 2RHUA 3LH0A 2LVMA 2GFAA 2FL7A 1NPRA 2DIQA 2HKQB 5CKEA 3VS4A 2NUTA 1QKWA 5GAOr 4NL3A 2AZSA 1B34A 2QDLA 5LJ3d 1WQWA 4LXCA 2LCLA 2L8DA 2ZZDA 3SB2A 1K0SA 1JJ2S 1RAHB 1PD0A 2JTFA 2DL4A 1PNJA 1WXUA 3QDRB 1UFFA 1KIKA 1SPKA 2FB7A 1VQ4A 2YRDA 4J7IA 1XNIA 3QPHA 5CO7A 1IGQA 3I56T 3OBWA 1MV0B 4XTWA 1A0NB 3WXMB 4C0DB 2AT1B 1OPKA 3BE3A 2HDAA 3OBYA 2P0KA 5KE3A 1RL2A 4M75G 2M9UA 3LW5E 1EFNA 3NHNA 5GANd 1KG1A 4RMOA 5I2SA 3I56A 2DD4A 1Q7YC 2X51A 5GMKj 3TSZA 2ED0A 2V8IA 3DB4A 3I5RA 4C92E 1VYVA 2CKKA 3JCMQ 2DILA 4DEXA 1AVZC 3CCQT 5I2MA 1TUDA 1ZQ1A 4M75A 3OYAA 3MKDA 4DBQA 4BACA 5CQYA 2ENMA 1D1CA 3H0IA 4LNPA 5KYUA 3TCJA 3E1SA 2PVOB 1EX4A 2FRWA 3H9NA 2HD0A 1VQOQ 3CCRQ 4RTTA 4CC2A 4M78B 2E3IA 2O9VA 5IAYA 3TU4K 1QVFP 3SDZA 3LX7A 3V7CA 1YJWT 1C6VX 3FJ5A 4MMKA 1OPLA 1ZUUA 5KYYA 3DKMA 4KH1B 2J05A 1Y71A 2GQIA 4J9BA 5GMKm 1VQ8T 3QWXX 3I55T 1K8AR 2AZVA 4M7AE 2DBMA 1D0YA 4OGEA 2EYWA 2XI9A 4OMOA 4O6JA 1JEGA 1D1AA 1YJWA 4LUDA 2XICA 2CP6A 4L5GA 1Y07A 4OB0B 5LJ3f 1TOVA 2KR3A 1UGQB 4KULA 1QVGP 2E6NA 2ZAEA 3NFCA 4FIBA 1WHGA 2PVDB 4E7JA 1VQ8A 2E12A 1C0MA 2IPOB 3I55A 2VKNA 1X43A 1KC8R 1M5Q1 1V1CA 3HHTB 3OYBA 2YUOA 4P5NA 3E2UA 4RTVA 1VQ6T 3OS0A 3CCST 4QVCA 2K57A 2HNIA 3A8OB 2COWA 1O9SA 4Z8AA 3THKA 4F7UB 5A0GA 2PNIA 3I56Q 2CP5A 4A4EA 4PLIA 2A36A 3CMET 1PD1A 3M0PA 3DLMA 4QQ6A 2GCXA 5C0MA 4ME7A 2YSQA 3CEYA 2PTKA 3P8BB 1NPPA 1Q82U 4C92F 1UDLA 4QVZA 2LX7A 3FEOA 1VQ6A 2A37A 3VU3C 2P4RA 5M9OA 1TTHB 5A0LA 4M77E 4XU3A 1QP2A 1YHQT 1KJWA 3JB9D 1YI2T 1I0CA 4D6WA 1GL5A 4QQGA 2DRKA 5GAMf 3LYIA 1X2QA 2BKDN 3E9FA 1BI3A 3I35A 1Q95G 4C5GA 2RM4A 1H3HA 3CPWS 3CCQQ 2L3PA 4HT8A 2DJZA 2CYZB 3EGXA 2K2MA 1YBYA 4GLKA 3OYMA 3VYGA 1WQ7A 1YHQA 1YI2A 3LH5A 3JB9J 1SRMA 1VQNT 3MHXA 2VUBA 4EMKA 1EZZB 3NGPA 3MJXA 1TH7A 3JV3A 4L59A 4RTUA 5LJ3e 3A8GB 4C8QB 4Q5WA 5GANh 3OYIA 2ZPBB 2BIVA 2JXBA 1X6GA 2KXCA 3NPFA 4M7AF 3M0UA 2QDYB 1JU5C 4R0KA 1WJSA 2DL5A 3EG1A 1LPLA 3QSUA 2FO0A 2W0ZA 3QXEB 1YJWQ 1KFZA 1BKBA 2O4XB 1K73U 5EG2A 1K9AA 1QCFA 4BI8B 3HRSA 4JS4A 2NUPA 1GFDA 3FB9A 3TVTA 1VQNA 1UHCA 5GAOl 2P4TA 1VQ8Q 1ZSZA 2X9HA 2RHXA 4LN2A 4MDXA 4OF1A 1UG1A 3L2WA 2P0PA 1KHCA 2HBWA 4M77B 4JRPA 3EFOB 1NJIU 3RERA 3EHRA 4DEYA 3M9QA 1X69A 2MCNA 4B6MA 1Q82C 2QXFA 2XG8D 1R0CB 2HQHA 5GANe 1GXIE 1M1FA 3ZL7C 1G3WA 4HVVA 2JNGA 2PZ1A 5CKBA 3MP6A 4PFZA 5IHIA 5C6SA 3SWNB 1IHVA 3VS6A 1VQ5T 1RAAB 4E7KA 2E10A 3MO8A 1QCOA 2LNVA 1WIEA 2VC8A 4V2SA 4ZTJA 1QKXA 2GFUA 2DBKA 3GNFB 1RLQC 2E5KA 4HCZA 1OOTA 1VQ6Q 2VXEA 4MZTA 5FU7C 3CCSQ 2HMAA 3UF4A 4AFUC 5GAN6 2LT1A 1AWXA 1NEBA 2FG0A 4M77F 3BW1A 3VS3A 3WVDB 1PM3A 1YWPA 5GAN2 3M56A 2DTIA 3CMEQ 3M55A 3C12A 1QP3A 4JRIA 1JXOA 5CIUA 1W2BA 2DETA 4HKEA 3TSWA 3H8ZA 4HXJA 2ED1A 2EGAA 5AT1B 2PU9B 4JJNK 2FZGB 3S3NA 2CS7A 4J9HA 1OYXA 2HL3A 3OYLA 3JCMb 1K73C 1Q81U 1YN8A 2MWOA 1YHQQ 1YI2Q 4EMHA 5GAN5 1HJDA 2X4YA 5DLOA 5GAOq 3EG2A 4DOWA 3EG0A 3G1JA 4OMPA 1ARKA 2RJDA 3MCAB 4FSSA 2JJ9A 3GPLA 4FSXA 4ZGJB 2LMJA 3GBQA 1HSQA 1M2OA 2MOXA 4M78A 2CH4W 2R5AA 2JW4A 3CCVT 2NWMA 1MNDA 2DNUA 4X34A 4J7FA 1MV3A 1FMKA 2EAYA 3OMGA 2GNCA 1RUWA 3PVQA 3JB9I 2XIDA 2E3HA 4C92D 2RH2A 4C92G 4BE0A 1UGVA 3OW2A 4IUQA 1MMNA 2JN0A 1YP5A 2QQSA 5KCHA 3URGA 2BE9B 2J06A 2EPDA 4KH0B 3LGFA 3META 1YITT 2XK0A 3CCVA 3RR6A 5GMKh 3A1PA 2VV5A 1Q7YR 2VVKA 2E65A 3RKWA 1T3LA 1X2KA 3GLXA 5GAN4 3C0CA 2L89A 3OA6A 1AT1B 1VQKA 4AG2C 2FYKA 4AT1B 3RUXA 2X3XD 1K4US 2ATCB 4PLLA 4WCIA 2EKHA 3RIRA 3X28B 4LUEA 1Q81C 1BB9A 1E6GA 4M7AG 1W1FA 2BZXA 1K1ZA 1SF9A 1VQ5Q 2NYSA 4F7UA 1BI1A 2JOYA 2WSFE 2YXYA 2V1QA 4BI3A 3ZEHA 3JCMh 4MDWA 1UGPB 3J80E 1X6OA 5GMKl 4A4FA 4LDUA 2HSEB 1NYFA 3N5BB 1H92A 2EW3A 1Y0MA 2FPDA 1VQ7T 4F04B 1WX6A 4E47A 3MEAA 2DF6A 4IIOA 3DB3A 1KQSP 2EQIA 1K76A 2DYBA 2JVVA 4J9CA 3RMSA 3M4GA 4AFQC 1R77A 2JMCA 2M0OA 5GAOm 1G3YA 5FU6C 4FU6A 2QEXT 4DQ2A 3H41A 5CK9A 2K4YA 2BUDA 1VQ7A 3M54A 3TQ7P 4XTYA 2AHJB 2QTXA 2ROTA 1YCSB 3PIOA 3JCMW 3BDUA 1FX7A 2RQRA 3IQLA 3VV0A 4A53A 2OAUA 4Z89A 2LQKA 5GAMj 1XOVA 3R6OA 4C8QA 3CBOA 4PFOA 2DFUA 2QEXA 5IT9E 2OTLT 3KUFA 4M77G 3RESA 3PE0A 2RQWA 3CCVQ 2L3SA 1QQJA 2OX7A 4PJOF 5EC7A 1YFNA 2O4XA 4LDVA 3OYHA 1QVFA 2L2PA 2EKOA 3JCMJ 2RF0A 5CVIA 1VQPT 2J6OA 3SEMA 3LGLA 1GCQA 4FW1A 4ZTFA 3SFMA 4RTYA 2HZYA 3M58A 2LJ0A 1VA7A 3FC3A 2LZ6B 1WHHA 2DEUA 4BE1A 2FZCB 3LWHA 2OTLA 4M77A 3EH2A 1BCMA 1VQ4T 1YITQ 3EFOA 1EIFA 1WA7A 3BFMA 4NOYA 3SD4A 2RD1A 4OB1B 4PJOC 2KAFA 1VQPA 3M0SA 4N4IA 2DKGA 1JRIA 3JB9F 1V29B 2QQ9A 2PUKB 4CC3A 4PFPA 5GAOp 3SWNA 2SEMA 1QVGA 2HQXA 3BDLA 5GMKi 1UHFA 4MMLA 1ABQA 3G4ST 1NLPC 1ZX6A 2NUZA 3FDRA 4E2FB 4N0AC 4FL6A 4HCCA 3H6ZA 4L6V5 1M90R 2XU8A 2VB6A 1KD1U 1JBMA 4PJMA 3C4SA 1K9MR 2XDDA 1H3ZA 4KGXB 5LJ5d 5CKDA 1U1SA 2H3EB 1OZ3A 3QJ6A 1UJ0A 2FZKB 3G4SA 1GRIA 3A98A 2DZ9A 1IHWA 4HVWA 2KYMA 2GTJA 3VS2A 2G6FX 4E7SA 3QO3A 3H0FA 2Y90A 2E5QA 1M3CA 4XTZA 1PRLC 1W2BS 2A08A 1RLPC 4EMKC 5FRMA 4AFZC 2R57A 1T0HA 2X4JA 3UA7A 1Q82R 1MMGA 3JAME 4OVAA 2XHCA 2L3RA 4KUIA 2QEXQ 2LQ8A 2CP0A 4BD3A 1OQKA 1HD3A 3VJPA 3VS0A 3L2RA 3J81E 4N4GA 3VS7A 3CC4T 3R6NA 1PCXA 2CZ0B 2D0NA 1YIJA 4RTWA 2J7IA 1ZSZC 3CC2A 2HEQA 2FVUA 3QKJA 4FYXB 2OAWA 4J6XA 2KRNA 1W70A 3JCMP 1WXTA 1IO6A 4BE2A 2OTLQ 5FW9A 2LCCA 2QK0A 3UDCA 2F2WA 4M4ZA 3S3MA 2F69A 2V26A 2WACA 3CD6A 3NTHA 3CC4A 1KD1C 4HVUA 3OW2S 1NEGA 1UEBA 2JT4A 1VQPQ 1AOJA 1M30A 3G71A 1S72A 1PSFA 1Q86U 1IREB 4JRQA 3OS1A 3TREA 4B9XA 2VWFA 5HCKA 4C0DC 2BE7D 1K73R 2AKKA 1OU8A 1VQ4Q 2EQUA 3ZBDA 1PKSA 3GNGA 4PKCC 4AG1C 1LVKA 1OEBA 4C92B 1I5LA 1G3SA 4RCBA 6AT1B 4JUVA 2MI6A 2M0YA 2KROA 3L1AA 3SHWA 3S3OA 1WXBA 2FHDA
chains in the Genus database with same CATH topology
4HVVA 2GBQA 3I5SA 2PZ1A 2RQUA 2O9SA 1S1NA 5IHIA 1BK2A 3VS6A 4OMNA 5GJVB 1AZEA 1X27A 2RMOA 1WIEA 1YNZA 1QKXA 2DBKA 1RLQC 2E5KA 2GGRA 2H8HA 2L0AA 1OOTA 1SHGA 2BZ8A 2DX1A 3UF4A 1Y57A 4AFUC 2D8JA 2FPFA 2CDTA 1AWXA 1I07A 1NEBA 2FG0A 2JS0A 2SRCA 2RQTA 3VS3A 1YWPA 2CREA 2D8HA 1ZLMA 2YUNA 2LJ1A 1JXOA 3VRZA 2YDLA 3M0TA 3TSWA 4F17A 3CQTA 4HXJA 1W6XA 2ED1A 2EGAA 2FPEA 1K0XA 2DVJA 2DL7A 2JM9A 2L3QA 4J9EA 2JMAA 2M51A 4F16A 1ZBJA 3REBB 3H0HA 4J9FA 1KSWA 4J9HA 4Y92A 4K11A 1YN8A 1VYTA 2CT4A 3VS1A 2OJ2A 4GLMA 1HJDA 3EG2A 1PRMC 2EYYA 4KRTA 3EG0A 1PKTA 4OMPA 5FWCA 1ARKA 1E6HA 1B3QA 2F2XA 4CC4B 1QWFA 4FSSA 3VS5A 2DA9A 3I9QA 2LMJA 3GBQA 2YUQA 1HSQA 2MOXA 2CH4W 2JW4A 1CKAA 1G2BA 2NWMA 5ECAA 1SEMA 2J6FA 4J9IA 1T3SA 5I22A 2DNUA 2C0IA 1TUCA 1MV3A 2FRYA 1FMKA 1AWWA 2ECZA 2YT6A 4E6RA 2GNCA 1RUWA 2KNBB 2F2VA 1CKBA 3PVQA 1GBRA 1ZUKA 2MIOA 1UGVA 4EIKA 1TG0A 2EVRA 1YP5A 1N5ZA 2RNAA 2DL8A 2J06A 2EPDA 1CSKA 2DLPA 1M8MA 2EGCA 1U5SA 4JJBA 4JZ4A 3RBBB 2VVKA 1H8KA 2KE9A 1T3LA 1X2KA 3QWYA 3C0CA 1AEYA 1FYNA 3EG3A 5FWBA 2DL3A 1AWOA 3VS4A 1RI9A 2CUBA 1QKWA 1QWEA 3REAB 2LQNA 4AG2C 2AZSA 1LCKA 2KGTA 1Z9ZA 2X3XD 4IIMA 2K3BA 2QDLA 1K4US 3M0QA 2K7AA 2ESWA 2EBPA 4X1VA 2KRSA 2DM1A 4WCIA 2EKHA 1K0SA 2RN8A 2DL4A 1PNJA 4LUEA 1BB9A 1E6GA 1WXUA 1UFFA 1KIKA 1SPKA 1W1FA 1GFCA 2GTOA 2BZXA 1K1ZA 4RUGA 1GCPA 2V1QA 5L23A 2DRMA 2DJQA 1MV0B 1A0NB 1NYFA 1H92A 2EW3A 1SHFA 1OPKA 1Y0MA 2FPDA 2W10A 4RTZA 1WX6A 2HDAA 1AWJA 1QLYA 2DF6A 4IIOA 4RTXA 2A28A 1OV3A 2EQIA 2KBTA 2B86A 2LJ3A 1EFNA 1NM7A 3M0RA 1K76A 5IH2A 2DYBA 2C0OA 3NHNA 4J9CA 4F14A 2CT3A 4AFQC 2JMCA 2O2OA 1M3BA 4LE9A 1WLPB 2ED0A 3H41A 4J9GA 3TSZA 2HSPA 2C0TA 4OMMA 4JZ3A 2CSIA 3I5RA 2KEAA 2V1RA 1VYVA 3VRYA 2ROTA 1GCQC 1YCSB 2AK5A 2DILA 4DEXA 1AVZC 2RQRA 3IQLA 1TUDA 2X3WD 4HCKA 4Z89A 2LQWA 1XOVA 2ENMA 4Z88A 4JPBW 3H0IA 4LNPA 5IHKA 2OI3A 2FRWA 1J3TA 1NYGA 3PE0A 4RTTA 1UTIA 2RQWA 2L3SA 4CC2A 1NLOC 1UECA 2O9VA 1U06A 5EC7A 1YWOA 3FJ5A 4A63B 1OPLA 2K79A 2YUPA 2L2PA 1ZUUA 2RF0A 2RQVA 2J6OA 3SEMA 1GCQA 4RTYA 2J05A 2DE0X 2CSQA 1VA7A 2FEIA 2GQIA 2LJ0A 2LZ6B 4J9BA 2CH4A 4JJDA 5I11A 3QWXX 1T0JA 4CC7A 2AZVA 2KXDA 2DBMA 1WI7A 1JQQA 2RPNA 2EYWA 4OMOA 1WA7A 1UJYA 1JEGA 1ZUYA 1SRLA 4LUDA 2O88A 2BTTA 3M0SA 4ZNXA 2KR3A 3NMZC 1PHTA 1NG2A 4CC3A 1AZGB 2SEMA 2I0NA 3U23A 1UHFA 2AKLA 4JJCA 1JO8A 1ZSGA 3UATA 1ABQA 4D8DA 2O31A 2VKNA 1NLPC 1X43A 1ZX6A 2NUZA 1I1JA 2EYZA 1V1CA 1Z9QA 2YUOA 1M3AA 1SSHA 2JS2A 1X6BA 3RNJA 4RTVA 3PVLA 4J9DA 2KYBA 1JXMA 4Z8AA 3THKA 1BBZA 2KT8A 2J6KA 2PNIA 3KFVA 1UJ0A 2A36A 2JM8A 1GRIA 3A98A 3M0PA 4HVWA 2KYMA 2GTJA 3VS2A 2G6FX 2YSQA 3EHQA 3H0FA 5IXBA 2PTKA 2LNHB 2ABLA 1UDLA 2LX7A 2ROLA 1M3CA 1PRLC 2BZYA 2A08A 2A37A 1RLPC 2P4RA 2DMOA 1BU1A 5IXFA 4AFZC 1T0HA 1KJWA 3UA7A 1I0CA 2CUDA 2K9GA 4GBQA 2IIMA 1GL5A 1G83A 2DRKA 1HD3A 1X2QA 3VS0A 2XMFA 2EYXA 3I35A 2D1XA 3VS7A 1H3HA 2L3PA 3R6NA 2D0NA 3EGUA 1UE9A 2J7IA 2K2MA 4RTWA 2LP5A 2HEQA 1E7OA 3LH5A 1B07A 1SRMA 1PWTA 2HCKA 3NGPA 2OAWA 3JV3A 2KRNA 4RTUA 2LCSA 1W70A 1WXTA 1IO6A 2KRMA 5FW9A 1ABOA 2JXBA 1UUEA 1X6GA 2KXCA 3NPFA 2F2WA 4M4ZA 3M0UA 1JU5C 4R0KA 4OMQA 1U3OA 3UA6A 3O5ZA 2DL5A 3EG1A 5IHNA 2FO0A 2W0ZA 4HVUA 4AFSC 3ULRB 1NEGA 1KFZA 2JT4A 2KT1A 1AOJA 1M30A 1M27C 1K9AA 1QCFA 2EGEA 4QT7A 1GFDA 3TVTA 1UHCA 2VWFA 1VYUA 4ORZA 4LN2A 5HCKA 1UG1A 1GBQA 1MUZA 2AKKA 2HBWA 1PKSA 4AG1C 3EHRA 4DEYA 1WFWA 1X69A 1AD5A 1OEBA 2MCNA 4ESRA 1WYXA 2K6DA 2M0YA 2JTEA 2KROA 4D8KA 5GJWB 3SHWA 1WDXA 4OMLA 1WXBA 3ZL7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVV A;  2GBQ A;  3I5S A;  2PZ1 A;  2RQU A;  2O9S A;  1S1N A;  5IHI A;  1BK2 A;  3VS6 A;  4OMN A;  5GJV B;  1AZE A;  1X27 A;  2RMO A;  1WIE A;  1YNZ A;  1QKX A;  2DBK A;  1RLQ C;  2E5K A;  2GGR A;  2H8H A;  2L0A A;  1OOT A;  1SHG A;  2BZ8 A;  2DX1 A;  3UF4 A;  1Y57 A;  4AFU C;  2D8J A;  2FPF A;  2CDT A;  1AWX A;  1I07 A;  1NEB A;  2FG0 A;  2JS0 A;  2SRC A;  2RQT A;  3VS3 A;  1YWP A;  2CRE A;  2D8H A;  1ZLM A;  2YUN A;  2LJ1 A;  1JXO A;  3VRZ A;  2YDL A;  3M0T A;  3TSW A;  4F17 A;  3CQT A;  4HXJ A;  1W6X A;  2ED1 A;  2EGA A;  2FPE A;  1K0X A;  2DVJ A;  2DL7 A;  2JM9 A;  2L3Q A;  4J9E A;  2JMA A;  2M51 A;  4F16 A;  1ZBJ A;  3REB B;  3H0H A;  4J9F A;  1KSW A;  4J9H A;  4Y92 A;  4K11 A;  1YN8 A;  1VYT A;  2CT4 A;  3VS1 A;  2OJ2 A;  4GLM A;  1HJD A;  3EG2 A;  1PRM C;  2EYY A;  4KRT A;  3EG0 A;  1PKT A;  4OMP A;  5FWC A;  1ARK A;  1E6H A;  1B3Q A;  2F2X A;  4CC4 B;  1QWF A;  4FSS A;  3VS5 A;  2DA9 A;  3I9Q A;  2LMJ A;  3GBQ A;  2YUQ A;  1HSQ A;  2MOX A;  2CH4 W;  2JW4 A;  1CKA A;  1G2B A;  2NWM A;  5ECA A;  1SEM A;  2J6F A;  4J9I A;  1T3S A;  5I22 A;  2DNU A;  2C0I A;  1TUC A;  1MV3 A;  2FRY A;  1FMK A;  1AWW A;  2ECZ A;  2YT6 A;  4E6R A;  2GNC A;  1RUW A;  2KNB B;  2F2V A;  1CKB A;  3PVQ A;  1GBR A;  1ZUK A;  2MIO A;  1UGV A;  4EIK A;  1TG0 A;  2EVR A;  1YP5 A;  1N5Z A;  2RNA A;  2DL8 A;  2J06 A;  2EPD A;  1CSK A;  2DLP A;  1M8M A;  2EGC A;  1U5S A;  4JJB A;  4JZ4 A;  3RBB B;  2VVK A;  1H8K A;  2KE9 A;  1T3L A;  1X2K A;  3QWY A;  3C0C A;  1AEY A;  1FYN A;  3EG3 A;  5FWB A;  2DL3 A;  1AWO A;  3VS4 A;  1RI9 A;  2CUB A;  1QKW A;  1QWE A;  3REA B;  2LQN A;  4AG2 C;  2AZS A;  1LCK A;  2KGT A;  1Z9Z A;  2X3X D;  4IIM A;  2K3B A;  2QDL A;  1K4U S;  3M0Q A;  2K7A A;  2ESW A;  2EBP A;  4X1V A;  2KRS A;  2DM1 A;  4WCI A;  2EKH A;  1K0S A;  2RN8 A;  2DL4 A;  1PNJ A;  4LUE A;  1BB9 A;  1E6G A;  1WXU A;  1UFF A;  1KIK A;  1SPK A;  1W1F A;  1GFC A;  2GTO A;  2BZX A;  1K1Z A;  4RUG A;  1GCP A;  2V1Q A;  5L23 A;  2DRM A;  2DJQ A;  1MV0 B;  1A0N B;  1NYF A;  1H92 A;  2EW3 A;  1SHF A;  1OPK A;  1Y0M A;  2FPD A;  2W10 A;  4RTZ A;  1WX6 A;  2HDA A;  1AWJ A;  1QLY A;  2DF6 A;  4IIO A;  4RTX A;  2A28 A;  1OV3 A;  2EQI A;  2KBT A;  2B86 A;  2LJ3 A;  1EFN A;  1NM7 A;  3M0R A;  1K76 A;  5IH2 A;  2DYB A;  2C0O A;  3NHN A;  4J9C A;  4F14 A;  2CT3 A;  4AFQ C;  2JMC A;  2O2O A;  1M3B A;  4LE9 A;  1WLP B;  2ED0 A;  3H41 A;  4J9G A;  3TSZ A;  2HSP A;  2C0T A;  4OMM A;  4JZ3 A;  2CSI A;  3I5R A;  2KEA A;  2V1R A;  1VYV A;  3VRY A;  2ROT A;  1GCQ C;  1YCS B;  2AK5 A;  2DIL A;  4DEX A;  1AVZ C;  2RQR A;  3IQL A;  1TUD A;  2X3W D;  4HCK A;  4Z89 A;  2LQW A;  1XOV A;  2ENM A;  4Z88 A;  4JPB W;  3H0I A;  4LNP A;  5IHK A;  2OI3 A;  2FRW A;  1J3T A;  1NYG A;  3PE0 A;  4RTT A;  1UTI A;  2RQW A;  2L3S A;  4CC2 A;  1NLO C;  1UEC A;  2O9V A;  1U06 A;  5EC7 A;  1YWO A;  3FJ5 A;  4A63 B;  1OPL A;  2K79 A;  2YUP A;  2L2P A;  1ZUU A;  2RF0 A;  2RQV A;  2J6O A;  3SEM A;  1GCQ A;  4RTY A;  2J05 A;  2DE0 X;  2CSQ A;  1VA7 A;  2FEI A;  2GQI A;  2LJ0 A;  2LZ6 B;  4J9B A;  2CH4 A;  4JJD A;  5I11 A;  3QWX X;  1T0J A;  4CC7 A;  2AZV A;  2KXD A;  2DBM A;  1WI7 A;  1JQQ A;  2RPN A;  2EYW A;  4OMO A;  1WA7 A;  1UJY A;  1JEG A;  1ZUY A;  1SRL A;  4LUD A;  2O88 A;  2BTT A;  3M0S A;  4ZNX A;  2KR3 A;  3NMZ C;  1PHT A;  1NG2 A;  4CC3 A;  1AZG B;  2SEM A;  2I0N A;  3U23 A;  1UHF A;  2AKL A;  4JJC A;  1JO8 A;  1ZSG A;  3UAT A;  1ABQ A;  4D8D A;  2O31 A;  2VKN A;  1NLP C;  1X43 A;  1ZX6 A;  2NUZ A;  1I1J A;  2EYZ A;  1V1C A;  1Z9Q A;  2YUO A;  1M3A A;  1SSH A;  2JS2 A;  1X6B A;  3RNJ A;  4RTV A;  3PVL A;  4J9D A;  2KYB A;  1JXM A;  4Z8A A;  3THK A;  1BBZ A;  2KT8 A;  2J6K A;  2PNI A;  3KFV A;  1UJ0 A;  2A36 A;  2JM8 A;  1GRI A;  3A98 A;  3M0P A;  4HVW A;  2KYM A;  2GTJ A;  3VS2 A;  2G6F X;  2YSQ A;  3EHQ A;  3H0F A;  5IXB A;  2PTK A;  2LNH B;  2ABL A;  1UDL A;  2LX7 A;  2ROL A;  1M3C A;  1PRL C;  2BZY A;  2A08 A;  2A37 A;  1RLP C;  2P4R A;  2DMO A;  1BU1 A;  5IXF A;  4AFZ C;  1T0H A;  1KJW A;  3UA7 A;  1I0C A;  2CUD A;  2K9G A;  4GBQ A;  2IIM A;  1GL5 A;  1G83 A;  2DRK A;  1HD3 A;  1X2Q A;  3VS0 A;  2XMF A;  2EYX A;  3I35 A;  2D1X A;  3VS7 A;  1H3H A;  2L3P A;  3R6N A;  2D0N A;  3EGU A;  1UE9 A;  2J7I A;  2K2M A;  4RTW A;  2LP5 A;  2HEQ A;  1E7O A;  3LH5 A;  1B07 A;  1SRM A;  1PWT A;  2HCK A;  3NGP A;  2OAW A;  3JV3 A;  2KRN A;  4RTU A;  2LCS A;  1W70 A;  1WXT A;  1IO6 A;  2KRM A;  5FW9 A;  1ABO A;  2JXB A;  1UUE A;  1X6G A;  2KXC A;  3NPF A;  2F2W A;  4M4Z A;  3M0U A;  1JU5 C;  4R0K A;  4OMQ A;  1U3O A;  3UA6 A;  3O5Z A;  2DL5 A;  3EG1 A;  5IHN A;  2FO0 A;  2W0Z A;  4HVU A;  4AFS C;  3ULR B;  1NEG A;  1KFZ A;  2JT4 A;  2KT1 A;  1AOJ A;  1M30 A;  1M27 C;  1K9A A;  1QCF A;  2EGE A;  4QT7 A;  1GFD A;  3TVT A;  1UHC A;  2VWF A;  1VYU A;  4ORZ A;  4LN2 A;  5HCK A;  1UG1 A;  1GBQ A;  1MUZ A;  2AKK A;  2HBW A;  1PKS A;  4AG1 C;  3EHR A;  4DEY A;  1WFW A;  1X69 A;  1AD5 A;  1OEB A;  2MCN A;  4ESR A;  1WYX A;  2K6D A;  2M0Y A;  2JTE A;  2KRO A;  4D8K A;  5GJW B;  3SHW A;  1WDX A;  4OML A;  1WXB A;  3ZL7 C; 
#chains in the Genus database with same CATH topology
 1NJI R;  4WTO B;  2RQU A;  2O9S A;  4LD9 K;  2DO3 A;  3OYN A;  4JLI A;  4PJO D;  5GJV B;  1IXD A;  1AZE A;  2NLU A;  4EDU A;  5KH6 A;  1YNZ A;  3CPF A;  4TVR A;  1SHG A;  2DX1 A;  2D8J A;  2D0Q B;  2FPF A;  2CDT A;  5LJ3 g;  5GAN f;  1N9R A;  2CRE A;  4DBR A;  1ZLM A;  2YUN A;  2LJ1 A;  4HA8 A;  2KVQ G;  1MMD A;  1FXX A;  4M7A B;  2YDL A;  2E70 A;  1ACM B;  4F17 A;  1HK9 A;  1Y96 B;  4QVD A;  3HFO A;  1N8R U;  1K0X A;  2DVJ A;  3JB9 G;  2L5Q A;  2JM9 A;  4LDY A;  1B7T A;  2Z0W A;  2JMA A;  3MP1 A;  4F16 A;  3REB B;  4J9F A;  4Y92 A;  2PUO B;  1D0X A;  5LJ5 h;  1Q86 C;  2PQW A;  1SSF A;  2E41 A;  2QA4 A;  1YJN A;  3A8M B;  4MZM A;  2K5F A;  3RMQ A;  2EYY A;  1M2V B;  1E6H A;  2LC4 A;  2M16 A;  4ZGD B;  1NE8 A;  1RAG B;  4M7D C;  1SG5 A;  4FYY B;  5FU7 B;  3PGG A;  3CC4 Q;  3UPU A;  4ELZ C;  2OTJ T;  4HCB A;  3MEV A;  1VUB A;  1CKA A;  1G2B A;  2DXT A;  3OYC A;  2VXF A;  1RAD B;  4J9I A;  1NZ9 A;  2C0I A;  2YHT A;  1TUC A;  4C5I A;  1KQ2 A;  1AWW A;  2HL5 C;  2YT6 A;  4E6R A;  2RHI A;  3HL8 A;  5FRO A;  5GAN 3;  5DLQ E;  4EIK A;  1TG0 A;  2V8K A;  4DOV A;  1N5Z A;  4QKU A;  2DL8 A;  4IUR A;  5GAM g;  1ZBX A;  4ANJ A;  3G7Z A;  5LJ5 e;  2OTJ A;  2RHY A;  1I8F A;  2EGC A;  3JCM d;  3I55 Q;  2CZ6 B;  4JZ4 A;  3RBB B;  3V8L A;  1WZO A;  1D1B A;  1IRX A;  1H8K A;  2KE9 A;  5KCO A;  2COY A;  1AEY A;  1FYN A;  3EG3 A;  4LDW A;  1FWZ A;  4OMF B;  1RI9 A;  2CUB A;  3FRN A;  4WF2 A;  2E4H A;  1OZ2 A;  1N8R C;  1Z9Z A;  5DY9 A;  1KC8 U;  3L42 A;  3M0Q A;  2K7A A;  5GAO n;  1LNX A;  2KRS A;  2DM1 A;  1WJQ A;  5HKC A;  5D6W A;  2RN8 A;  2NUT B;  2CP7 A;  3QBY A;  3RKY A;  3CXC A;  5J3B A;  3EG9 B;  1AHJ B;  1LJO A;  4RUG A;  3M53 A;  3CCM T;  1GCP A;  3OYK A;  5L23 A;  4PJN A;  3AHU A;  2DRM A;  2LX9 A;  2DER A;  2ZPE B;  5L8R E;  3PNW C;  2DAQ A;  2W10 A;  4RTZ A;  1M4Z A;  1MNE A;  5J26 A;  3UWN A;  4BY6 C;  5GAN 8;  4LDX A;  4C8Q C;  4C5H A;  2KBT A;  4FT2 A;  3VUB A;  2B86 A;  4FW2 A;  2LJ3 A;  3CCM A;  1KQS A;  3M57 A;  1NM7 A;  3M0R A;  5IH2 A;  2XDB A;  3QG1 A;  4JS5 A;  4F14 A;  2CT3 A;  5HK3 A;  3GOX A;  1KHI A;  4BDY A;  1BYM A;  4LE9 A;  4C5E A;  2HSP A;  2QG9 B;  2C0T A;  5KYX B;  2I2L A;  2VAS A;  3AT1 B;  7AT1 B;  5I21 A;  4KT0 E;  1GCQ C;  2LT4 A;  2KDS A;  3LWI A;  2X3W D;  4PJL A;  4FM4 B;  2RK2 A;  1I5O B;  3QII A;  2ZPG B;  2LQW A;  4Z88 A;  4JPB W;  3PT9 A;  5IHK A;  1IB8 A;  3RDV A;  2E6Z A;  1VQM A;  1VQN Q;  3PMT A;  2PVG B;  2F5T X;  2OTJ Q;  2MAM A;  1KC8 C;  1ZHI A;  2RO0 A;  1U06 A;  5KE2 A;  1VQK T;  1YWO A;  4M7D D;  3SWN C;  4A63 B;  2YUP A;  3JCM f;  2RQV A;  2HQE A;  3CCJ T;  2YLB A;  2DE0 X;  2CSQ A;  4PJO E;  2CH4 A;  1G3T A;  5I11 A;  1M1G A;  1WHK A;  2ZGW A;  5DM7 R;  4GY5 A;  4CC7 A;  3QZ5 B;  2KXD A;  2KQW A;  3JRZ A;  3EFR A;  1HXD A;  4C92 A;  1JQQ A;  2ZPI B;  4DBF A;  1UJY A;  2HKN A;  2EQJ A;  1SRL A;  2O88 A;  2BTT A;  2A3L A;  3PIP A;  5LJ3 j;  4ZNX A;  2EQM A;  2K5L A;  2RI2 A;  3V7S A;  3CCJ A;  1NG2 A;  4Z02 A;  1M1K U;  2I0N A;  1JJ2 P;  1VQ9 A;  4EPC A;  2AKL A;  4JJC A;  1JO8 A;  1ZSG A;  3UAT A;  2O31 A;  1MMA A;  1TU0 B;  1VQL T;  2EYZ A;  1ZA1 B;  3OS2 A;  4J8O A;  5GMK e;  2C06 A;  2RJC A;  3PVL A;  4IUU A;  2VGM A;  2YRV A;  3WVE B;  2KYB A;  1PG5 B;  1JXM A;  1BBZ A;  1KD1 R;  2KT8 A;  4M75 C;  3KFV A;  5LL6 S;  1FMW A;  2M02 A;  4M7A A;  1VQL A;  1Y96 A;  3L2U A;  3ASK A;  3EHQ A;  3OB9 A;  1ZA2 B;  4C0Z A;  5GAN j;  4PJO B;  1OX8 A;  2ROL A;  1W2B P;  2BZY A;  4E7Z A;  2KI7 A;  2V8J A;  2X4W A;  2CGH A;  4O5V A;  2DEQ A;  2K9G A;  4XK8 E;  3HSB A;  2IIM A;  3JCM e;  5KYN A;  3UT1 A;  1MHN A;  3QHS A;  1G83 A;  4C8Q D;  2EJG A;  2DTH A;  2EYX A;  3HPW A;  5D7U A;  2VGN A;  4JRK A;  2DPP B;  2D1X A;  3JB9 H;  4E7I A;  4A4K A;  2D9T A;  3L2Z A;  4A4G A;  1N9S A;  1RAB B;  4FT4 A;  1QMC A;  2COZ A;  5KYW B;  1M1K C;  1MGQ A;  3CBP A;  2GQV A;  3INZ A;  1ABO A;  2MPX C;  4OMQ A;  3L2V A;  1VQK Q;  1I81 A;  1QVP A;  5IHN A;  4EMK B;  2QTV A;  1R8O B;  4BB7 A;  2KT1 A;  1M27 C;  2EGE A;  4NS5 A;  3P8D A;  4J83 A;  5CAI A;  1D3B B;  1JB0 E;  5CCA A;  1VYU A;  4UC4 A;  5AYF A;  3S6W A;  1GBQ A;  1MUZ A;  3CBM A;  1Q86 R;  3HFN A;  1WFW A;  3OQ5 A;  1OX9 A;  2K6D A;  1ZSZ B;  2B8A A;  1WDX A;  4OML A;  2DXU A;  1UGR B;  3EG9 A;  3I5S A;  1VIE A;  4B9W A;  1U1T A;  2MMP A;  1VQL Q;  3MP8 A;  1X27 A;  5IN1 A;  2JUF A;  2RMO A;  3CXC S;  1QCN A;  5CKF A;  3FIF A;  1W4S A;  2JZ2 A;  2EQK A;  2L0A A;  4ZGE B;  3V8K A;  2BZ8 A;  2RI3 A;  3OYG A;  2KSS A;  4M78 E;  3JCM X;  1Y57 A;  1VQ7 Q;  2JS0 A;  2SRC A;  2Y4Y A;  3OYE A;  2D8H A;  1FMV A;  5CR2 A;  1YIJ T;  1PSE A;  2RHZ A;  3CC2 T;  2KK4 A;  3CQT A;  1W6X A;  2FPE A;  1D09 B;  2ZPF B;  2P0Q A;  2DL7 A;  2L3Q A;  1KQS S;  4M75 D;  3C94 A;  4J9E A;  4C0F A;  2M51 A;  2MYS A;  5KYX A;  1RAF B;  1ZBJ A;  3H0H A;  4M7D E;  1N8R R;  2XD0 A;  3ZFJ A;  2YLC A;  3CD6 T;  2D6F A;  3CPW P;  1Y7X A;  2CZ1 B;  3QYG B;  3CCL T;  1NBE B;  1PKT A;  5FWC A;  2F2X A;  3G71 T;  2E1H A;  1S72 T;  1PC0 A;  4CC4 B;  3VS5 A;  3C95 A;  2DA9 A;  3TEE A;  1U8R A;  3I9Q A;  2YUQ A;  5GAM d;  1SEM A;  2J6F A;  1TWB A;  2FRY A;  2ECZ A;  3OSV A;  2Y4X A;  1CKB A;  1ZUK A;  1O75 A;  4PK4 A;  3CCL A;  4F7U E;  1YJ9 T;  5CQX A;  5GAN 7;  1HYO A;  2EVR A;  3CCQ A;  2RNA A;  1XJW B;  3P8H A;  1CSK A;  2DLP A;  4NL2 A;  3EFS A;  3A8L B;  3NTI A;  3M59 A;  2R58 A;  1G8X A;  4OB2 B;  4XAX B;  3QWY A;  4RG8 A;  5FWB A;  3EGD B;  1F1B B;  5CKH A;  1YJ9 A;  2CP3 A;  3CCE T;  2DL3 A;  4M7D B;  1AWO A;  4XTV A;  3QJY A;  1WHM A;  1QWE A;  3REA B;  1M8V A;  2LQN A;  1LCK A;  2KGT A;  4ZN3 A;  4IIM A;  2KMT A;  2K3B A;  3V8J A;  2XDP A;  5LJ5 f;  3LLR A;  3G4S Q;  2ESW A;  2EBP A;  4X1V A;  1M90 U;  4PJO G;  4M78 F;  4XU1 A;  2WSE E;  1X75 C;  1K9M U;  4PNO A;  4N4H A;  2O01 E;  1GFC A;  2GTO A;  3NTK A;  1BCO A;  4MZP A;  3CCE A;  4X9D A;  4XTU A;  4X9C A;  2DJQ A;  3CC7 T;  4C8Q E;  3GIB A;  3CMA T;  2LTO A;  2QA4 T;  1YJN T;  1SHF A;  4PJO A;  2XKO C;  1AWJ A;  1QLY A;  3EAE A;  4RTX A;  4M78 C;  4M7D F;  2A28 A;  1OV3 A;  3OY9 A;  1WNL A;  1DJ7 B;  2RK1 A;  2CP2 A;  4J5Y A;  2C0O A;  1YIJ Q;  5LJ3 h;  5LJ5 g;  3CC2 Q;  3HRU A;  4N0A A;  3CC7 A;  3HKS A;  2O2O A;  3CCS A;  1M3B A;  3CMA A;  3E9G A;  1WLP B;  4J9G A;  3QUI A;  2G3R A;  4OMM A;  4JZ3 A;  1IGU A;  4E7L A;  2CSI A;  2KEA A;  2V1R A;  3VRY A;  3CME A;  1Q81 R;  2AK5 A;  1N6A A;  3CD6 Q;  1WHL A;  5GAN g;  4HCK A;  3QZ9 B;  1N27 A;  5KYW A;  3CCL Q;  2YWW A;  4F7U F;  1KQ1 A;  3G71 Q;  1S72 Q;  3F70 A;  4R55 A;  4C92 C;  1IZ6 A;  1P92 A;  4RG2 A;  2ZPH B;  5HY6 A;  2OI3 A;  1J3T A;  1NYG A;  1UTI A;  3MEU A;  4BY6 B;  2HBP A;  1NLO C;  1UEC A;  1M90 C;  1H64 1;  4QQD A;  2ZCF B;  1QVF S;  9ATC B;  1K9M C;  2K79 A;  3PMI A;  4XU0 A;  1K8A U;  1LOJ A;  3BY7 A;  1D0Z A;  1YJ9 Q;  3HTR A;  1D3B A;  4YTL A;  2FEI A;  4JJD A;  1WPY A;  2QYZ A;  4A54 A;  1T0J A;  1QW1 A;  3OSS C;  1OU9 A;  3KBG A;  2QAZ A;  1WI7 A;  2RPN A;  3JCM c;  5GAM h;  1ZUY A;  3G6E T;  3X25 B;  1WHJ A;  1X01 A;  2RJE A;  3X20 B;  3OS5 A;  2RB6 A;  3NMZ C;  1C1A A;  2GF7 A;  1G5V A;  1PHT A;  4M7A C;  3CCE Q;  3VUZ A;  1QVG S;  1AZG B;  2RJF A;  3U23 A;  2F1L A;  4D8D A;  1JJ2 A;  4FYV B;  4C8Q F;  1I1J A;  1WGS A;  1B34 B;  2AIR B;  4IKF A;  1Z9Q A;  4EMG A;  4M75 E;  1M1K R;  1M3A A;  1SSH A;  2JS2 A;  1X6B A;  4J6Y A;  3RNJ A;  3G6E A;  2X4X A;  4J9D A;  2DZC A;  4ZN1 A;  3HRT A;  3DLL A;  2K3Y A;  2QGF B;  2J6K A;  4OB3 B;  2IG0 A;  3CC7 Q;  2DIG A;  2JM8 A;  1BIB A;  5GAM e;  3CMA Q;  4R56 A;  2QA4 Q;  1YJN Q;  2F5K A;  2RA2 A;  1RI0 A;  5IXB A;  2LNH B;  2ABL A;  4DA4 A;  2KY9 A;  2QQR A;  4E7H A;  1RAC B;  1VQ5 A;  4CI0 C;  1BI2 A;  1VQM T;  2DMO A;  1BU1 A;  8AT1 B;  5IXF A;  1K8A C;  2X35 A;  3A8H B;  1KK7 A;  2CUD A;  1I4K 1;  3J7A F;  4M78 D;  3MPU B;  4GBQ A;  4M78 G;  4BDZ A;  2E64 A;  2JTM A;  2R5M A;  2XMF A;  3ME9 A;  5D6Y A;  1TUG B;  2QI2 A;  4M77 C;  3HP9 A;  4IUP A;  4BI4 A;  3EGU A;  1UE9 A;  2EWN A;  3ER0 A;  2LP5 A;  4VUB A;  4M75 B;  3QDF A;  1E7O A;  1B07 A;  1NJI C;  3OYJ A;  1PWT A;  2HCK A;  3X24 B;  2QGG A;  2LCS A;  5KYU B;  2DK3 A;  4M7D G;  2KRM A;  2LRQ A;  3RKX A;  3CCU T;  1UUE A;  4PJJ A;  2EIF A;  3VKI A;  5J39 A;  1U3O A;  4XU2 A;  3UA6 A;  3O5Z A;  2YRC A;  4IUT A;  5HK0 A;  4AFS C;  5FU6 B;  4Y28 E;  2EJ9 A;  2MK5 A;  1VQ9 T;  3ULR B;  3Q1J A;  4QT7 A;  2QQB A;  5KYY B;  3GF5 A;  4XQ3 A;  3EGD A;  3V7R A;  2HAX A;  4RCC A;  2RI5 A;  1VOM A;  4ORZ A;  3FLG A;  4KGZ B;  4Y91 A;  3CCU A;  4M7D A;  2QQA A;  4IUV A;  2VYT A;  2LDM A;  5FRN A;  3PFS A;  4QW2 A;  1R0B G;  4M75 F;  4FYW B;  1AD5 A;  1UB4 A;  2MWP A;  4ESR A;  4A4H A;  1WYX A;  3G6E Q;  4F7U G;  2JTE A;  4D8K A;  5GJW B;  4BUG A;  3M4Y A;  2MF2 A;  4PL6 A;  3JCM g;  2GBQ A;  1XQH A;  1S1N A;  2DTO A;  4OGC A;  3OYD A;  1YCY A;  1YIT A;  1BK2 A;  2WSC E;  5A2Q E;  4JLG A;  3T9N A;  5LJ5 j;  4OMN A;  3CXC P;  3CCM Q;  2QAS A;  4M7A D;  3OYF A;  2GGR A;  2H8H A;  2A7Y A;  1WJR A;  1OUL A;  4J6W A;  3FJP A;  4KUD K;  2DYI A;  1I07 A;  2IVW A;  4LD6 A;  2RQT A;  2EJF A;  4OP0 A;  4HT9 A;  3VRZ A;  2P84 A;  3M0T A;  3KXT A;  4CRI A;  1RAE B;  4FCY A;  2K5I A;  1RAI B;  2CZ7 B;  2K3X A;  1M2V A;  1VQM Q;  3E19 A;  3VYH B;  1KSW A;  1V76 A;  4K11 A;  4XTX A;  4C8Q G;  3M5A A;  3O8V A;  1VYT A;  1BIA A;  3OMC A;  5D6X A;  2CT4 A;  3VS1 A;  3GP8 A;  4KGV B;  2OJ2 A;  4GLM A;  3CPW A;  4ATO A;  1PRM C;  4KRT A;  4RKU E;  1B3Q A;  2DD5 A;  2A0F B;  1M9S A;  1QWF A;  3X26 B;  3D7S B;  4C0G A;  3JCM V;  1VQO T;  3CCR T;  2DXB A;  4KBM B;  5ECA A;  5FLX E;  1T3S A;  1TXQ A;  4DBH A;  5I22 A;  3EGX B;  2DXC A;  2DVE A;  1TS9 A;  4M77 D;  3A5Z B;  4II1 A;  4JDS A;  5A0D A;  4AMC A;  2KNB B;  2F2V A;  3PTA A;  3OW2 P;  2EYQ A;  1GBR A;  2MIO A;  3CCU Q;  3OYY A;  2H3J A;  1TSF A;  3JSC A;  1OI1 A;  1Q7Y U;  3CCJ Q;  1SKU B;  3MEW A;  3QYH B;  8ATC B;  1XTD A;  4ELY C;  1M8M A;  1VQ9 Q;  1VQO A;  3CCR A;  3L2Q A;  1U5S A;  4JJB A;  1BI0 A;  3EH1 A;  1UGS B;  2K2V A;  2EFI A;  1VIF A;  2NUP B;  2M1H A;  2RHU A;  3LH0 A;  2LVM A;  2GFA A;  2FL7 A;  1NPR A;  2DIQ A;  2HKQ B;  5CKE A;  3VS4 A;  2NUT A;  1QKW A;  5GAO r;  4NL3 A;  2AZS A;  1B34 A;  2QDL A;  5LJ3 d;  1WQW A;  4LXC A;  2LCL A;  2L8D A;  2ZZD A;  3SB2 A;  1K0S A;  1JJ2 S;  1RAH B;  1PD0 A;  2JTF A;  2DL4 A;  1PNJ A;  1WXU A;  3QDR B;  1UFF A;  1KIK A;  1SPK A;  2FB7 A;  1VQ4 A;  2YRD A;  4J7I A;  1XNI A;  3QPH A;  5CO7 A;  1IGQ A;  3I56 T;  3OBW A;  1MV0 B;  4XTW A;  1A0N B;  3WXM B;  4C0D B;  2AT1 B;  1OPK A;  3BE3 A;  2HDA A;  3OBY A;  2P0K A;  5KE3 A;  1RL2 A;  4M75 G;  2M9U A;  3LW5 E;  1EFN A;  3NHN A;  5GAN d;  1KG1 A;  4RMO A;  5I2S A;  3I56 A;  2DD4 A;  1Q7Y C;  2X51 A;  5GMK j;  3TSZ A;  2ED0 A;  2V8I A;  3DB4 A;  3I5R A;  4C92 E;  1VYV A;  2CKK A;  3JCM Q;  2DIL A;  4DEX A;  1AVZ C;  3CCQ T;  5I2M A;  1TUD A;  1ZQ1 A;  4M75 A;  3OYA A;  3MKD A;  4DBQ A;  4BAC A;  5CQY A;  2ENM A;  1D1C A;  3H0I A;  4LNP A;  5KYU A;  3TCJ A;  3E1S A;  2PVO B;  1EX4 A;  2FRW A;  3H9N A;  2HD0 A;  1VQO Q;  3CCR Q;  4RTT A;  4CC2 A;  4M78 B;  2E3I A;  2O9V A;  5IAY A;  3TU4 K;  1QVF P;  3SDZ A;  3LX7 A;  3V7C A;  1YJW T;  1C6V X;  3FJ5 A;  4MMK A;  1OPL A;  1ZUU A;  5KYY A;  3DKM A;  4KH1 B;  2J05 A;  1Y71 A;  2GQI A;  4J9B A;  5GMK m;  1VQ8 T;  3QWX X;  3I55 T;  1K8A R;  2AZV A;  4M7A E;  2DBM A;  1D0Y A;  4OGE A;  2EYW A;  2XI9 A;  4OMO A;  4O6J A;  1JEG A;  1D1A A;  1YJW A;  4LUD A;  2XIC A;  2CP6 A;  4L5G A;  1Y07 A;  4OB0 B;  5LJ3 f;  1TOV A;  2KR3 A;  1UGQ B;  4KUL A;  1QVG P;  2E6N A;  2ZAE A;  3NFC A;  4FIB A;  1WHG A;  2PVD B;  4E7J A;  1VQ8 A;  2E12 A;  1C0M A;  2IPO B;  3I55 A;  2VKN A;  1X43 A;  1KC8 R;  1M5Q 1;  1V1C A;  3HHT B;  3OYB A;  2YUO A;  4P5N A;  3E2U A;  4RTV A;  1VQ6 T;  3OS0 A;  3CCS T;  4QVC A;  2K57 A;  2HNI A;  3A8O B;  2COW A;  1O9S A;  4Z8A A;  3THK A;  4F7U B;  5A0G A;  2PNI A;  3I56 Q;  2CP5 A;  4A4E A;  4PLI A;  2A36 A;  3CME T;  1PD1 A;  3M0P A;  3DLM A;  4QQ6 A;  2GCX A;  5C0M A;  4ME7 A;  2YSQ A;  3CEY A;  2PTK A;  3P8B B;  1NPP A;  1Q82 U;  4C92 F;  1UDL A;  4QVZ A;  2LX7 A;  3FEO A;  1VQ6 A;  2A37 A;  3VU3 C;  2P4R A;  5M9O A;  1TTH B;  5A0L A;  4M77 E;  4XU3 A;  1QP2 A;  1YHQ T;  1KJW A;  3JB9 D;  1YI2 T;  1I0C A;  4D6W A;  1GL5 A;  4QQG A;  2DRK A;  5GAM f;  3LYI A;  1X2Q A;  2BKD N;  3E9F A;  1BI3 A;  3I35 A;  1Q95 G;  4C5G A;  2RM4 A;  1H3H A;  3CPW S;  3CCQ Q;  2L3P A;  4HT8 A;  2DJZ A;  2CYZ B;  3EGX A;  2K2M A;  1YBY A;  4GLK A;  3OYM A;  3VYG A;  1WQ7 A;  1YHQ A;  1YI2 A;  3LH5 A;  3JB9 J;  1SRM A;  1VQN T;  3MHX A;  2VUB A;  4EMK A;  1EZZ B;  3NGP A;  3MJX A;  1TH7 A;  3JV3 A;  4L59 A;  4RTU A;  5LJ3 e;  3A8G B;  4C8Q B;  4Q5W A;  5GAN h;  3OYI A;  2ZPB B;  2BIV A;  2JXB A;  1X6G A;  2KXC A;  3NPF A;  4M7A F;  3M0U A;  2QDY B;  1JU5 C;  4R0K A;  1WJS A;  2DL5 A;  3EG1 A;  1LPL A;  3QSU A;  2FO0 A;  2W0Z A;  3QXE B;  1YJW Q;  1KFZ A;  1BKB A;  2O4X B;  1K73 U;  5EG2 A;  1K9A A;  1QCF A;  4BI8 B;  3HRS A;  4JS4 A;  2NUP A;  1GFD A;  3FB9 A;  3TVT A;  1VQN A;  1UHC A;  5GAO l;  2P4T A;  1VQ8 Q;  1ZSZ A;  2X9H A;  2RHX A;  4LN2 A;  4MDX A;  4OF1 A;  1UG1 A;  3L2W A;  2P0P A;  1KHC A;  2HBW A;  4M77 B;  4JRP A;  3EFO B;  1NJI U;  3RER A;  3EHR A;  4DEY A;  3M9Q A;  1X69 A;  2MCN A;  4B6M A;  1Q82 C;  2QXF A;  2XG8 D;  1R0C B;  2HQH A;  5GAN e;  1GXI E;  1M1F A;  3ZL7 C;  1G3W A;  4HVV A;  2JNG A;  2PZ1 A;  5CKB A;  3MP6 A;  4PFZ A;  5IHI A;  5C6S A;  3SWN B;  1IHV A;  3VS6 A;  1VQ5 T;  1RAA B;  4E7K A;  2E10 A;  3MO8 A;  1QCO A;  2LNV A;  1WIE A;  2VC8 A;  4V2S A;  4ZTJ A;  1QKX A;  2GFU A;  2DBK A;  3GNF B;  1RLQ C;  2E5K A;  4HCZ A;  1OOT A;  1VQ6 Q;  2VXE A;  4MZT A;  5FU7 C;  3CCS Q;  2HMA A;  3UF4 A;  4AFU C;  5GAN 6;  2LT1 A;  1AWX A;  1NEB A;  2FG0 A;  4M77 F;  3BW1 A;  3VS3 A;  3WVD B;  1PM3 A;  1YWP A;  5GAN 2;  3M56 A;  2DTI A;  3CME Q;  3M55 A;  3C12 A;  1QP3 A;  4JRI A;  1JXO A;  5CIU A;  1W2B A;  2DET A;  4HKE A;  3TSW A;  3H8Z A;  4HXJ A;  2ED1 A;  2EGA A;  5AT1 B;  2PU9 B;  4JJN K;  2FZG B;  3S3N A;  2CS7 A;  4J9H A;  1OYX A;  2HL3 A;  3OYL A;  3JCM b;  1K73 C;  1Q81 U;  1YN8 A;  2MWO A;  1YHQ Q;  1YI2 Q;  4EMH A;  5GAN 5;  1HJD A;  2X4Y A;  5DLO A;  5GAO q;  3EG2 A;  4DOW A;  3EG0 A;  3G1J A;  4OMP A;  1ARK A;  2RJD A;  3MCA B;  4FSS A;  2JJ9 A;  3GPL A;  4FSX A;  4ZGJ B;  2LMJ A;  3GBQ A;  1HSQ A;  1M2O A;  2MOX A;  4M78 A;  2CH4 W;  2R5A A;  2JW4 A;  3CCV T;  2NWM A;  1MND A;  2DNU A;  4X34 A;  4J7F A;  1MV3 A;  1FMK A;  2EAY A;  3OMG A;  2GNC A;  1RUW A;  3PVQ A;  3JB9 I;  2XID A;  2E3H A;  4C92 D;  2RH2 A;  4C92 G;  4BE0 A;  1UGV A;  3OW2 A;  4IUQ A;  1MMN A;  2JN0 A;  1YP5 A;  2QQS A;  5KCH A;  3URG A;  2BE9 B;  2J06 A;  2EPD A;  4KH0 B;  3LGF A;  3MET A;  1YIT T;  2XK0 A;  3CCV A;  3RR6 A;  5GMK h;  3A1P A;  2VV5 A;  1Q7Y R;  2VVK A;  2E65 A;  3RKW A;  1T3L A;  1X2K A;  3GLX A;  5GAN 4;  3C0C A;  2L89 A;  3OA6 A;  1AT1 B;  1VQK A;  4AG2 C;  2FYK A;  4AT1 B;  3RUX A;  2X3X D;  1K4U S;  2ATC B;  4PLL A;  4WCI A;  2EKH A;  3RIR A;  3X28 B;  4LUE A;  1Q81 C;  1BB9 A;  1E6G A;  4M7A G;  1W1F A;  2BZX A;  1K1Z A;  1SF9 A;  1VQ5 Q;  2NYS A;  4F7U A;  1BI1 A;  2JOY A;  2WSF E;  2YXY A;  2V1Q A;  4BI3 A;  3ZEH A;  3JCM h;  4MDW A;  1UGP B;  3J80 E;  1X6O A;  5GMK l;  4A4F A;  4LDU A;  2HSE B;  1NYF A;  3N5B B;  1H92 A;  2EW3 A;  1Y0M A;  2FPD A;  1VQ7 T;  4F04 B;  1WX6 A;  4E47 A;  3MEA A;  2DF6 A;  4IIO A;  3DB3 A;  1KQS P;  2EQI A;  1K76 A;  2DYB A;  2JVV A;  4J9C A;  3RMS A;  3M4G A;  4AFQ C;  1R77 A;  2JMC A;  2M0O A;  5GAO m;  1G3Y A;  5FU6 C;  4FU6 A;  2QEX T;  4DQ2 A;  3H41 A;  5CK9 A;  2K4Y A;  2BUD A;  1VQ7 A;  3M54 A;  3TQ7 P;  4XTY A;  2AHJ B;  2QTX A;  2ROT A;  1YCS B;  3PIO A;  3JCM W;  3BDU A;  1FX7 A;  2RQR A;  3IQL A;  3VV0 A;  4A53 A;  2OAU A;  4Z89 A;  2LQK A;  5GAM j;  1XOV A;  3R6O A;  4C8Q A;  3CBO A;  4PFO A;  2DFU A;  2QEX A;  5IT9 E;  2OTL T;  3KUF A;  4M77 G;  3RES A;  3PE0 A;  2RQW A;  3CCV Q;  2L3S A;  1QQJ A;  2OX7 A;  4PJO F;  5EC7 A;  1YFN A;  2O4X A;  4LDV A;  3OYH A;  1QVF A;  2L2P A;  2EKO A;  3JCM J;  2RF0 A;  5CVI A;  1VQP T;  2J6O A;  3SEM A;  3LGL A;  1GCQ A;  4FW1 A;  4ZTF A;  3SFM A;  4RTY A;  2HZY A;  3M58 A;  2LJ0 A;  1VA7 A;  3FC3 A;  2LZ6 B;  1WHH A;  2DEU A;  4BE1 A;  2FZC B;  3LWH A;  2OTL A;  4M77 A;  3EH2 A;  1BCM A;  1VQ4 T;  1YIT Q;  3EFO A;  1EIF A;  1WA7 A;  3BFM A;  4NOY A;  3SD4 A;  2RD1 A;  4OB1 B;  4PJO C;  2KAF A;  1VQP A;  3M0S A;  4N4I A;  2DKG A;  1JRI A;  3JB9 F;  1V29 B;  2QQ9 A;  2PUK B;  4CC3 A;  4PFP A;  5GAO p;  3SWN A;  2SEM A;  1QVG A;  2HQX A;  3BDL A;  5GMK i;  1UHF A;  4MML A;  1ABQ A;  3G4S T;  1NLP C;  1ZX6 A;  2NUZ A;  3FDR A;  4E2F B;  4N0A C;  4FL6 A;  4HCC A;  3H6Z A;  4L6V 5;  1M90 R;  2XU8 A;  2VB6 A;  1KD1 U;  1JBM A;  4PJM A;  3C4S A;  1K9M R;  2XDD A;  1H3Z A;  4KGX B;  5LJ5 d;  5CKD A;  1U1S A;  2H3E B;  1OZ3 A;  3QJ6 A;  1UJ0 A;  2FZK B;  3G4S A;  1GRI A;  3A98 A;  2DZ9 A;  1IHW A;  4HVW A;  2KYM A;  2GTJ A;  3VS2 A;  2G6F X;  4E7S A;  3QO3 A;  3H0F A;  2Y90 A;  2E5Q A;  1M3C A;  4XTZ A;  1PRL C;  1W2B S;  2A08 A;  1RLP C;  4EMK C;  5FRM A;  4AFZ C;  2R57 A;  1T0H A;  2X4J A;  3UA7 A;  1Q82 R;  1MMG A;  3JAM E;  4OVA A;  2XHC A;  2L3R A;  4KUI A;  2QEX Q;  2LQ8 A;  2CP0 A;  4BD3 A;  1OQK A;  1HD3 A;  3VJP A;  3VS0 A;  3L2R A;  3J81 E;  4N4G A;  3VS7 A;  3CC4 T;  3R6N A;  1PCX A;  2CZ0 B;  2D0N A;  1YIJ A;  4RTW A;  2J7I A;  1ZSZ C;  3CC2 A;  2HEQ A;  2FVU A;  3QKJ A;  4FYX B;  2OAW A;  4J6X A;  2KRN A;  1W70 A;  3JCM P;  1WXT A;  1IO6 A;  4BE2 A;  2OTL Q;  5FW9 A;  2LCC A;  2QK0 A;  3UDC A;  2F2W A;  4M4Z A;  3S3M A;  2F69 A;  2V26 A;  2WAC A;  3CD6 A;  3NTH A;  3CC4 A;  1KD1 C;  4HVU A;  3OW2 S;  1NEG A;  1UEB A;  2JT4 A;  1VQP Q;  1AOJ A;  1M30 A;  3G71 A;  1S72 A;  1PSF A;  1Q86 U;  1IRE B;  4JRQ A;  3OS1 A;  3TRE A;  4B9X A;  2VWF A;  5HCK A;  4C0D C;  2BE7 D;  1K73 R;  2AKK A;  1OU8 A;  1VQ4 Q;  2EQU A;  3ZBD A;  1PKS A;  3GNG A;  4PKC C;  4AG1 C;  1LVK A;  1OEB A;  4C92 B;  1I5L A;  1G3S A;  4RCB A;  6AT1 B;  4JUV A;  2MI6 A;  2M0Y A;  2KRO A;  3L1A A;  3SHW A;  3S3O A;  1WXB A;  2FHD A; 
#chains in the Genus database with same CATH homology
 4HVV A;  2GBQ A;  3I5S A;  2PZ1 A;  2RQU A;  2O9S A;  1S1N A;  5IHI A;  1BK2 A;  3VS6 A;  4OMN A;  5GJV B;  1AZE A;  1X27 A;  2RMO A;  1WIE A;  1YNZ A;  1QKX A;  2DBK A;  1RLQ C;  2E5K A;  2GGR A;  2H8H A;  2L0A A;  1OOT A;  1SHG A;  2BZ8 A;  2DX1 A;  3UF4 A;  1Y57 A;  4AFU C;  2D8J A;  2FPF A;  2CDT A;  1AWX A;  1I07 A;  1NEB A;  2FG0 A;  2JS0 A;  2SRC A;  2RQT A;  3VS3 A;  1YWP A;  2CRE A;  2D8H A;  1ZLM A;  2YUN A;  2LJ1 A;  1JXO A;  3VRZ A;  2YDL A;  3M0T A;  3TSW A;  4F17 A;  3CQT A;  4HXJ A;  1W6X A;  2ED1 A;  2EGA A;  2FPE A;  1K0X A;  2DVJ A;  2DL7 A;  2JM9 A;  2L3Q A;  4J9E A;  2JMA A;  2M51 A;  4F16 A;  1ZBJ A;  3REB B;  3H0H A;  4J9F A;  1KSW A;  4J9H A;  4Y92 A;  4K11 A;  1YN8 A;  1VYT A;  2CT4 A;  3VS1 A;  2OJ2 A;  4GLM A;  1HJD A;  3EG2 A;  1PRM C;  2EYY A;  4KRT A;  3EG0 A;  1PKT A;  4OMP A;  5FWC A;  1ARK A;  1E6H A;  1B3Q A;  2F2X A;  4CC4 B;  1QWF A;  4FSS A;  3VS5 A;  2DA9 A;  3I9Q A;  2LMJ A;  3GBQ A;  2YUQ A;  1HSQ A;  2MOX A;  2CH4 W;  2JW4 A;  1CKA A;  1G2B A;  2NWM A;  5ECA A;  1SEM A;  2J6F A;  4J9I A;  1T3S A;  5I22 A;  2DNU A;  2C0I A;  1TUC A;  1MV3 A;  2FRY A;  1FMK A;  1AWW A;  2ECZ A;  2YT6 A;  4E6R A;  2GNC A;  1RUW A;  2KNB B;  2F2V A;  1CKB A;  3PVQ A;  1GBR A;  1ZUK A;  2MIO A;  1UGV A;  4EIK A;  1TG0 A;  2EVR A;  1YP5 A;  1N5Z A;  2RNA A;  2DL8 A;  2J06 A;  2EPD A;  1CSK A;  2DLP A;  1M8M A;  2EGC A;  1U5S A;  4JJB A;  4JZ4 A;  3RBB B;  2VVK A;  1H8K A;  2KE9 A;  1T3L A;  1X2K A;  3QWY A;  3C0C A;  1AEY A;  1FYN A;  3EG3 A;  5FWB A;  2DL3 A;  1AWO A;  3VS4 A;  1RI9 A;  2CUB A;  1QKW A;  1QWE A;  3REA B;  2LQN A;  4AG2 C;  2AZS A;  1LCK A;  2KGT A;  1Z9Z A;  2X3X D;  4IIM A;  2K3B A;  2QDL A;  1K4U S;  3M0Q A;  2K7A A;  2ESW A;  2EBP A;  4X1V A;  2KRS A;  2DM1 A;  4WCI A;  2EKH A;  1K0S A;  2RN8 A;  2DL4 A;  1PNJ A;  4LUE A;  1BB9 A;  1E6G A;  1WXU A;  1UFF A;  1KIK A;  1SPK A;  1W1F A;  1GFC A;  2GTO A;  2BZX A;  1K1Z A;  4RUG A;  1GCP A;  2V1Q A;  5L23 A;  2DRM A;  2DJQ A;  1MV0 B;  1A0N B;  1NYF A;  1H92 A;  2EW3 A;  1SHF A;  1OPK A;  1Y0M A;  2FPD A;  2W10 A;  4RTZ A;  1WX6 A;  2HDA A;  1AWJ A;  1QLY A;  2DF6 A;  4IIO A;  4RTX A;  2A28 A;  1OV3 A;  2EQI A;  2KBT A;  2B86 A;  2LJ3 A;  1EFN A;  1NM7 A;  3M0R A;  1K76 A;  5IH2 A;  2DYB A;  2C0O A;  3NHN A;  4J9C A;  4F14 A;  2CT3 A;  4AFQ C;  2JMC A;  2O2O A;  1M3B A;  4LE9 A;  1WLP B;  2ED0 A;  3H41 A;  4J9G A;  3TSZ A;  2HSP A;  2C0T A;  4OMM A;  4JZ3 A;  2CSI A;  3I5R A;  2KEA A;  2V1R A;  1VYV A;  3VRY A;  2ROT A;  1GCQ C;  1YCS B;  2AK5 A;  2DIL A;  4DEX A;  1AVZ C;  2RQR A;  3IQL A;  1TUD A;  2X3W D;  4HCK A;  4Z89 A;  2LQW A;  1XOV A;  2ENM A;  4Z88 A;  4JPB W;  3H0I A;  4LNP A;  5IHK A;  2OI3 A;  2FRW A;  1J3T A;  1NYG A;  3PE0 A;  4RTT A;  1UTI A;  2RQW A;  2L3S A;  4CC2 A;  1NLO C;  1UEC A;  2O9V A;  1U06 A;  5EC7 A;  1YWO A;  3FJ5 A;  4A63 B;  1OPL A;  2K79 A;  2YUP A;  2L2P A;  1ZUU A;  2RF0 A;  2RQV A;  2J6O A;  3SEM A;  1GCQ A;  4RTY A;  2J05 A;  2DE0 X;  2CSQ A;  1VA7 A;  2FEI A;  2GQI A;  2LJ0 A;  2LZ6 B;  4J9B A;  2CH4 A;  4JJD A;  5I11 A;  3QWX X;  1T0J A;  4CC7 A;  2AZV A;  2KXD A;  2DBM A;  1WI7 A;  1JQQ A;  2RPN A;  2EYW A;  4OMO A;  1WA7 A;  1UJY A;  1JEG A;  1ZUY A;  1SRL A;  4LUD A;  2O88 A;  2BTT A;  3M0S A;  4ZNX A;  2KR3 A;  3NMZ C;  1PHT A;  1NG2 A;  4CC3 A;  1AZG B;  2SEM A;  2I0N A;  3U23 A;  1UHF A;  2AKL A;  4JJC A;  1JO8 A;  1ZSG A;  3UAT A;  1ABQ A;  4D8D A;  2O31 A;  2VKN A;  1NLP C;  1X43 A;  1ZX6 A;  2NUZ A;  1I1J A;  2EYZ A;  1V1C A;  1Z9Q A;  2YUO A;  1M3A A;  1SSH A;  2JS2 A;  1X6B A;  3RNJ A;  4RTV A;  3PVL A;  4J9D A;  2KYB A;  1JXM A;  4Z8A A;  3THK A;  1BBZ A;  2KT8 A;  2J6K A;  2PNI A;  3KFV A;  1UJ0 A;  2A36 A;  2JM8 A;  1GRI A;  3A98 A;  3M0P A;  4HVW A;  2KYM A;  2GTJ A;  3VS2 A;  2G6F X;  2YSQ A;  3EHQ A;  3H0F A;  5IXB A;  2PTK A;  2LNH B;  2ABL A;  1UDL A;  2LX7 A;  2ROL A;  1M3C A;  1PRL C;  2BZY A;  2A08 A;  2A37 A;  1RLP C;  2P4R A;  2DMO A;  1BU1 A;  5IXF A;  4AFZ C;  1T0H A;  1KJW A;  3UA7 A;  1I0C A;  2CUD A;  2K9G A;  4GBQ A;  2IIM A;  1GL5 A;  1G83 A;  2DRK A;  1HD3 A;  1X2Q A;  3VS0 A;  2XMF A;  2EYX A;  3I35 A;  2D1X A;  3VS7 A;  1H3H A;  2L3P A;  3R6N A;  2D0N A;  3EGU A;  1UE9 A;  2J7I A;  2K2M A;  4RTW A;  2LP5 A;  2HEQ A;  1E7O A;  3LH5 A;  1B07 A;  1SRM A;  1PWT A;  2HCK A;  3NGP A;  2OAW A;  3JV3 A;  2KRN A;  4RTU A;  2LCS A;  1W70 A;  1WXT A;  1IO6 A;  2KRM A;  5FW9 A;  1ABO A;  2JXB A;  1UUE A;  1X6G A;  2KXC A;  3NPF A;  2F2W A;  4M4Z A;  3M0U A;  1JU5 C;  4R0K A;  4OMQ A;  1U3O A;  3UA6 A;  3O5Z A;  2DL5 A;  3EG1 A;  5IHN A;  2FO0 A;  2W0Z A;  4HVU A;  4AFS C;  3ULR B;  1NEG A;  1KFZ A;  2JT4 A;  2KT1 A;  1AOJ A;  1M30 A;  1M27 C;  1K9A A;  1QCF A;  2EGE A;  4QT7 A;  1GFD A;  3TVT A;  1UHC A;  2VWF A;  1VYU A;  4ORZ A;  4LN2 A;  5HCK A;  1UG1 A;  1GBQ A;  1MUZ A;  2AKK A;  2HBW A;  1PKS A;  4AG1 C;  3EHR A;  4DEY A;  1WFW A;  1X69 A;  1AD5 A;  1OEB A;  2MCN A;  4ESR A;  1WYX A;  2K6D A;  2M0Y A;  2JTE A;  2KRO A;  4D8K A;  5GJW B;  3SHW A;  1WDX A;  4OML A;  1WXB A;  3ZL7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...