2CSQA

Solution structure of the second sh3 domain of human rim-binding protein 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
97
structure length
97
Chain Sequence
GSSGSSGTDPGAEELPARIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEIQADDEEMMDQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIM binding protein 2
publication title Solution structure of the second SH3 domain of human RIM-binding protein 2
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 7
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2csqA01
1K76A 2CDTA 2ED0A 2DMOA 1JXMA 1K1ZA 5IHNA 4JZ4A 3M0UA 2W0ZA 5GJWB 1UUEA 1U06A 2ABLA 2GTJA 1EFNA 4JPBW 2HSPA 1B3QA 2KYBA 2X3XD 3RBBB 2F2XA 3H0FA 2CREA 1AD5A 4AFUC 2O88A 2KR3A 3VRZA 3VS6A 2D8HA 1WYXA 1GBRA 3KFVA 2DILA 2OAWA 2JS0A 4WCIA 1W70A 2VVKA 4Z8AA 1OPKA 1JEGA 2KROA 1ZX6A 1VYUA 5EC7A 1JXOA 1V1CA 1OPLA 3O5ZA 1E7OA 3NGPA 2EYWA 3SEMA 1BB9A 1SHFA 3GBQA 2SEMA 2KXDA 2B86A 3JV3A 2CH4A 1KFZA 1HJDA 3VS0A 1SSHA 1SRMA 1H92A 1UHFA 1ZSGA 2A28A 2A08A 4RTXA 1W1FA 1Z9QA 1T0HA 2DL7A 2DL5A 4HCKA 1T0JA 2JS2A 2IIMA 2KRSA 2AZVA 3EG1A 4D8DA 2RQWA 2BTTA 4ORZA 3VS7A 1IO6A 1WI7A 5I11A 2CH4W 1YN8A 2LMJA 4J9FA 2DYBA 1FYNA 1N5ZA 1QKWA 1CKAA 2PTKA 5IXBA 4OMNA 3I35A 2FEIA 4RTYA 1AZGB 1OV3A 2I0NA 1NYFA 2JT4A 1WLPB 1U5SA 2HCKA 4JZ3A 1QCFA 2RQVA 2M0YA 4CC2A 2RQTA 2ESWA 1GBQA 1YNZA 2K7AA 1GL5A 2NUZA 1PWTA 2FPFA 1AEYA 1MV0B 4OMLA 2P4RA 2DM1A 4GBQA 1AOJA 1TG0A 2DL3A 3PE0A 2QDLA 3M0RA 1LCKA 2RMOA 1K0XA 2EPDA 4E6RA 3RNJA 4DEXA 4IIMA 1YWPA 1CKBA 1GCPA 1GCQA 1T3LA 1MUZA 1AWXA 2J6KA 1WX6A 2J6FA 1VYVA 1GFCA 2ECZA 1A0NB 2KGTA 3ULRB 1VYTA 2LQWA 3M0PA 3I5RA 2FPDA 1BBZA 1G2BA 1OOTA 2RF0A 1YP5A 3QWXX 2RPNA 2RQUA 1QWFA 2CUDA 2LNHB 4RUGA 1YWOA 2PZ1A 2NWMA 1OEBA 2YT6A 2H8HA 2RQRA 2LCSA 1X6GA 2C0OA 2YUPA 2GBQA 2BZYA 3VS4A 1VA7A 2EVRA 3UATA 3NMZC 2DNUA 1ZLMA 1GCQC 4K11A 1PRMC 5FWBA 2DBKA 3R6NA 1PRLC 3A98A 4F16A 1UHCA 2CSQA 2E5KA 2JMAA 2KRMA 3M0QA 4LN2A 4J9HA 4HXJA 1SHGA 2JXBA 4QT7A 1WXUA 3IQLA 1K0SA 2V1QA 2LX7A 3VS5A 1J3TA 1RLPC 3VS3A 2RNAA 2DLPA 1UECA 1UE9A 1UTIA 1WXTA 3UA7A 1NYGA 4RTZA 4GLMA 2J6OA 1AWWA 2A36A 4Z88A 5ECAA 1X27A 2SRCA 5HCKA 1M3AA 2K9GA 2MCNA 1JU5C 1XOVA 1M8MA 1ZUUA 4JJCA 2GTOA 2FG0A 2DL4A 5L23A 4J9DA 1UFFA 3LH5A 1PKTA 2DRMA 4M4ZA 2O31A 3REAB 1U3OA 1Z9ZA 1H8KA 3EHQA 1UJ0A 2K6DA 2RN8A 4AFQC 2LP5A 2EGAA 2HBWA 4OMOA 2CUBA 2BZXA 2C0TA 1RUWA 2LZ6B 1M30A 3M0TA 2O9VA 3THKA 1UJYA 2AK5A 1NEGA 2M51A 2EW3A 1X69A 2EBPA 3H0IA 4AG2C 1AWOA 2DL8A 2O9SA 4Z89A 2D8JA 3UF4A 4LUEA 5I22A 2DRKA 1NLPC 4IIOA 1UG1A 3H0HA 2YUOA 2OI3A 2LQNA 3CQTA 5GJVB 1NG2A 2CT3A 2AKKA 2J7IA 4A63B 4RTVA 2DJQA 2MOXA 4ESRA 2D0NA 4CC3A 3EG2A 4OMQA 3H41A 1I0CA 2ED1A 4J9EA 1WA7A 3PVQA 3FJ5A 1SEMA 2FPEA 3TSWA 2JW4A 5FW9A 1WIEA 5FWCA 1WFWA 1HSQA 2EGCA 5IH2A 1QWEA 4RTTA 1NEBA 4OMPA 4CC7A 1H3HA 2EKHA 1QLYA 3EGUA 2L3PA 3I5SA 4EIKA 1RI9A 2FRWA 2D1XA 2C0IA 3SHWA 3EG0A 4J9BA 3UA6A 2HEQA 4HVVA 2LJ1A 2OJ2A 4F14A 2K2MA 4DEYA 1TUDA 1UDLA 5IHKA 4AG1C 1E6GA 2KT8A 2YSQA 2BZ8A 1NM7A 2A37A 1X2KA 2K3BA 4D8KA 2DX1A 4ZNXA 1PKSA 2EYZA 3EG3A 2J06A 3NPFA 4HVUA 1JO8A 4J9CA 1X6BA 2JMCA 2KBTA 1JQQA 4R0KA 2YUQA 1FMKA 1SRLA 2EQIA 2L3SA 2YDLA 1YCSB 1T3SA 2DE0X 1I07A 1ARKA 1KIKA 1GFDA 4AFZC 1S1NA 2VWFA 3I9QA 3NHNA 2FRYA 3VRYA 2X3WD 2GQIA 2MIOA 2ROLA 2DF6A 2XMFA 4X1VA 1KSWA 2HDAA 2JTEA 1QKXA 2F2WA 1BK2A 2L3QA 2KEAA 4JJDA 3PVLA 4OMMA 1HD3A 2EYXA 2L2PA 4LUDA 1M3BA 2GNCA 2LJ3A 3C0CA 3VS2A 1W6XA 1BU1A 1M3CA 2VKNA 2GGRA 1Y0MA 2LJ0A 4J9GA 4RTWA 3EHRA 1AWJA 4KRTA 3QWYA 4AFSC 1GRIA 2YUNA 1Y57A 1RLQC 1UGVA 2W10A 1KJWA 2KE9A 2FO0A 2KNBB 4Y92A 5IHIA 2DA9A 2CT4A 1I1JA 4F17A 2DBMA 2ENMA 1ABQA 2O2OA 2EGEA 1PNJA 4RTUA 1K4US 1B07A 2KRNA 4JJBA 4LNPA 1CSKA 4CC4B 1X2QA 5IXFA 1PHTA 3ZL7C 2PNIA 2JM9A 1AZEA 1E6HA 3U23A 2AKLA 2KT1A 2CSIA 1ZUKA 2F2VA 1K9AA 1G83A 2AZSA 2KYMA 1ABOA 3M0SA 2KXCA 3REBB 3TSZA 3TVTA 2V1RA 2L0AA 2ROTA 1TUCA 1M27C 4HVWA 4J9IA 1ZUYA 1WXBA 1SPKA 1NLOC 4FSSA 4LE9A 2JM8A 3VS1A 1AVZC 2J05A 1X43A 1ZBJA 2EYYA 1WDXA 2G6FX 2K79A 1MV3A 2DVJA
chains in the Genus database with same CATH superfamily
3EGDB 3CC4T 1ZA1B 5EG2A 1RAHB 1YITQ 1Q7YC 2M16A 1YJNT 3DB4A 3V7CA 2GTJA 3R6OA 2KYBA 1W2BS 3GNFB 2NUTB 2VB6A 3I55A 1GBRA 3V8JA 3M58A 2IPOB 2JS0A 3CCVT 4FM4B 3MP6A 1W70A 4JRPA 4XTVA 1OPKA 4C92A 1QVGP 4BACA 3JRZA 4BE0A 5EC7A 4C0DB 5KYUA 1VQMA 4QVZA 4OGCA 1QVFP 4OP0A 4O6JA 3M55A 4OF1A 1YITT 4M7DD 4DA4A 1BCOA 2CH4A 1KFZA 2WACA 2QA4Q 5FU6C 4E2FB 3CPWS 4M77E 2LCLA 2DL7A 1YJ9Q 4C8QE 2X4JA 3HTRA 1MGQA 3CCJQ 4C92C 3JCMc 1RACB 3EG1A 2PVOB 4M77G 4ORZA 3OYLA 3OYEA 1IO6A 2BKDN 4C8QG 2LMJA 4M7AB 2OX7A 4M75F 1FYNA 2DEQA 5KYWA 4F04B 3T9NA 4OMNA 5IXBA 5GAOq 1OV3A 4OB1B 2JT4A 4DBRA 1S72A 3JCMV 1U5SA 2HCKA 2QA4T 4FL6A 2QK0A 2M0YA 4CC2A 2ESWA 2K7AA 1YJ9T 3CCJT 1YFNA 3VU3C 1VIEA 2CP2A 1YBYA 2OAUA 5CKDA 3MP1A 3L2UA 1D1BA 3CD6Q 1M9SA 2QGFB 1Q81U 2FVUA 1MUZA 1AWXA 2FB7A 5KE3A 3CBPA 4MMLA 2KGTA 4J7FA 1QP2A 4FW1A 5C0MA 2XU8A 3P8HA 2DK3A 4LD9K 3EFOA 1G2BA 2RPNA 2CUDA 2LNHB 3CPFA 3SWNB 1OEBA 3JCMe 4OGEA 4LDYA 1I4K1 2LCSA 9ATCB 4M75D 4E47A 4BY6C 1Q82U 2EVRA 3CD6T 3ME9A 4HT9A 2DNUA 5J26A 2DBKA 3S3MA 3O8VA 3G71A 4M77B 3FEOA 4N0AA 2RHXA 4LN2A 4PJOF 4HXJA 4PL6A 4C8QB 4LD6A 1K0SA 2V1QA 4ZN1A 2RNAA 5A0LA 1WJQA 2DYIA 3CCEA 3MP8A 1UE9A 1VQ8Q 3LX7A 3CCQQ 4N4IA 5AT1B 1MHNA 1ZA2B 3QBYA 5ECAA 1X27A 4OVAA 2PUOB 1XOVA 4C5GA 1Q81R 4JJCA 1YHQQ 5L23A 3M59A 4J9DA 5AYFA 1UFFA 3OW2A 5KCOA 3E1SA 2V26A 1U3OA 1OX8A 1H8KA 1UJ0A 2RN8A 3FRNA 3F70A 2LP5A 2IVWA 2HBWA 2HZYA 2CUBA 2BZXA 1Y71A 3CC2Q 1RUWA 2EQJA 2QYZA 2EIFA 4JLGA 2O9VA 2ZGWA 4ELZC 4NS5A 3CCQT 1UJYA 2HQHA 1Q82R 2M51A 5GANh 2QG9B 2RHZA 4B6MA 1WJSA 1YCYA 8ATCB 2MF2A 3J7AF 4WTOB 2O9SA 4Z89A 1YHQT 1UG1A 1KQSS 5KYYA 2VV5A 2YUOA 2LTOA 2LQNA 4FW2A 4PJOD 4RTVA 2DJQA 3OSSC 1LOJA 3EG2A 4Z02A 3H41A 1VQ6Q 4J5YA 2ED1A 4M78A 3CC2T 3FJ5A 1QVGA 4JRIA 5I21A 3GF5A 5FWCA 2E41A 1QVFA 4MDXA 1K9MR 4E7LA 3X25B 2EKHA 2L3PA 2D1XA 2A7YA 2E70A 2F5KA 2RHIA 3EGXA 3EG0A 3G4SA 4X34A 3UA6A 4XQ3A 3L2VA 2HEQA 1H641 1AT1B 4M78C 4MZMA 3OS1A 3MEAA 2YLCA 1TUDA 3VYHB 4FT2A 5IHKA 2DXBA 5GAN4 2YSQA 2BZ8A 2A37A 2XD0A 1JJ2A 3EG3A 4HVUA 4EMHA 1Q81C 4F7UA 2X4YA 4J9CA 1X6BA 5GAOr 4C5EA 4NL3A 3E9FA 1M2VB 2YUQA 1VQNA 1SRLA 5A0DA 1I07A 1M1KU 5GAN2 1KIKA 4PFOA 1K8AU 3C4SA 3G6EQ 1BI3A 4J6WA 2MIOA 2NUPA 2YRDA 2F5TX 2MYSA 1KSWA 2F2WA 2E10A 1Q82C 4PFZA 4DBFA 3QXEB 2L2PA 3JB9J 2EQUA 4OB3B 3A8GB 2OTJQ 1Y0MA 4DOVA 4J9GA 4ELYC 1B7TA 2CZ1B 3P8DA 1UGVA 4E7SA 3GLXA 1UGRB 2AT1B 2KNBB 2DXTA 3G6ET 5KE2A 1ZSZA 4C92E 2HAXA 3X28B 1SF9A 5LJ3h 2XDDA 4MMKA 4F17A 4QQ6A 2DBMA 3I56Q 3H9NA 4E7IA 2EKOA 4RG2A 2JTFA 4C92G 4ZTFA 1N9RA 2OTJT 1VQPA 4LNPA 3CBMA 5CQYA 4CC4B 3SFMA 4B9WA 2ZPBB 2CSIA 4J8OA 1ZSZC 1G83A 2AZSA 1WPYA 2YXYA 2CP7A 4V2SA 3M0SA 4KGXB 3KBGA 5LJ5g 3REBB 3BW1A 5C6SA 2R58A 3HKSA 3TVTA 2KQWA 5HK3A 2V1RA 2L0AA 3PTAA 5FROA 5LL6S 3I56T 1LNXA 5HK0A 3OB9A 4ME7A 4X9DA 2EYYA 3QUIA 1TWBA 2VXFA 3UDCA 3CXCA 8AT1B 1JXMA 5IHNA 3JCMf 1VQKQ 3M0UA 4HCBA 5GJWB 2MK5A 3DB3A 1QMCA 1B3QA 3RBBB 1LVKA 1O75A 3OBWA 2E3IA 3VS6A 2KMTA 3URGA 1WYXA 4QKUA 3PIOA 2K5LA 1WHGA 2OAWA 1VQ4Q 1I81A 1MMGA 3OYAA 3CCMA 4Z8AA 4ZTJA 1IZ6A 1JEGA 2KROA 1V1CA 1OPLA 5FU6B 1TTHB 2VUBA 1IREB 2WSEE 5GMKh 1SHFA 3GBQA 5LJ5j 4C92B 5D6WA 1VQKT 2M9UA 5CIUA 2ZAEA 2E5QA 1H92A 3QDRB 5KYUB 4RTXA 4XTZA 3I55T 1W1FA 2VYTA 5GAMh 1T0HA 1BI2A 2EWNA 2MWPA 1I5OB 1VQ9Q 2IIMA 5LJ5d 2LVMA 1VQ4T 1M1KC 4XAXB 5IT9E 1K8AC 3BE3A 3V8LA 1YN8A 4J9FA 3HRUA 1XQHA 3LGLA 3JCMX 4RMOA 1AZGB 4JZ3A 4A54A 4BDZA 1QCFA 1PD0A 2RQVA 4M7DA 2QQAA 5KYWB 3A5ZB 2X35A 4ZGDB 4J83A 1OULA 1PWTA 1VQ9T 1VQOQ 1D0YA 5CVIA 1EZZB 3HFOA 1TUGB 1AOJA 4XTYA 1TG0A 4OB2B 2NLUA 1QW1A 5DY9A 1TSFA 2ZCFB 3PE0A 2QDLA 3M0RA 3FC3A 3CMEA 3E2UA 2FZGB 3VKIA 4DEXA 4M7DC 1CKBA 4II1A 1RADB 1U1SA 1G8XA 1WQWA 1WX6A 2ECZA 1KQ2A 3CMAQ 3QZ9B 3ULRB 1IHVA 3SDZA 4BY6B 3I5RA 1VOMA 4KGZB 2FPDA 1BBZA 2RF0A 3QDFA 1VQOT 4NL2A 4RUGA 5GANe 1YWOA 2RK2A 1B34A 2YT6A 3VYGA 3QZ5B 3JB9F 3QIIA 2YUPA 3M9QA 3EFOB 3HRSA 2BZYA 4M78E 3VS4A 4KH1B 3UPUA 3JCMW 4LDVA 4K11A 5FWBA 3H8ZA 3CCRA 3A98A 2CSQA 4GY5A 4M78G 2E5KA 4J9HA 3CMAT 4E7HA 2DTOA 4QT7A 1WXUA 3IQLA 4KUIA 3CCSA 3RDVA 5GAN3 1N6AA 4LDUA 1UGQB 1WXTA 3UA7A 1NYGA 2BIVA 2L5QA 4GLMA 2J6OA 4XU1A 1PSFA 1JB0E 3M57A 3MO8A 2MCNA 3NTKA 2EJGA 1M8MA 1ZUUA 3M5AA 2GTOA 4M75A 5I2SA 3LH5A 3MKDA 2DRMA 2O31A 3S6WA 1FX7A 3M56A 5L8RE 4FSXA 2K57A 3V7RA 3EHQA 2XIDA 2ZPHB 4NOYA 7AT1B 4XU0A 3L2ZA 1JJ2P 1M30A 4QVDA 1M8VA 4RG8A 4F7UG 2HQXA 3JB9D 2AK5A 1NEGA 1HXDA 1N9SA 1KHCA 2ZPEB 2QAZA 2QQBA 3CPWP 4M75C 2GFUA 2YRVA 1D1AA 3H0IA 1VQ5Q 2RH2A 2VC8A 4FYXB 4LUEA 2DRKA 4J6YA 3H0HA 4JJNK 3BY7A 1OU8A 2CT3A 2AKKA 1WHJA 2ZZDA 3ZBDA 2D0NA 4CC3A 1BIBA 2KSSA 4OMQA 3L42A 4J9EA 3SB2A 1VQ7A 2QEXQ 2QI2A 4LXCA 2PQWA 5KYYB 2JW4A 3FLGA 5FW9A 1WIEA 1WFWA 3H6ZA 2DIQA 2EGCA 1KG1A 3CC7A 4RTTA 5FRMA 4M78B 2QXFA 4IUVA 4CC7A 2XK0A 1G3YA 5J39A 3CC4A 1QLYA 1VQ5T 4RCBA 4PJLA 2FRWA 2RJFA 3S3OA 1YJNA 5CKEA 4QW2A 3SHWA 2X9HA 4J9BA 3BDLA 3OYGA 4HVVA 2OJ2A 1IXDA 2RI3A 5LJ3e 4PJOA 1UDLA 3EGXB 1OU9A 2QEXT 2R57A 3CCVA 2D6FA 3EG9A 3PMTA 1X2KA 2LNVA 2RB6A 4ZNXA 4DOWA 1PKSA 4PKCC 1FWZA 3JB9H 3RKXA 1YITA 3MEUA 4R0KA 1C6VX 3OYCA 1FMKA 2EQIA 1YCSB 3ZFJA 1PG5B 2X4WA 4F7UB 4PJOC 1ARKA 3AHUA 1S1NA 3NHNA 2R5MA 2EQKA 2FRYA 3JAME 2E6ZA 2GQIA 1OX9A 2RHUA 2ROLA 3OS2A 2XMFA 4TVRA 2DZ9A 1BK2A 2L3QA 3PVLA 4N0AC 2LT4A 2EJFA 2XICA 3QYGB 3OYDA 2GNCA 3ER0A 2P0PA 4A4HA 2NUPB 2VKNA 3JCMP 2QGGA 2JOYA 2XHCA 1AWJA 2QA4A 4X9CA 3QWYA 2YUNA 1Y57A 4IUTA 3CXCP 1MNEA 2W10A 1WHLA 1NPPA 2F69A 1KJWA 3OYBA 2KI7A 1YJ9A 1I8FA 1Y07A 4N4HA 3J80E 1WHHA 4Y92A 5IHIA 3CCJA 2O4XA 1X75C 3UWNA 2Y4YA 2CS7A 4B9XA 2G3RA 1I1JA 4M7AF 1HYOA 2O2OA 3LW5E 2EGEA 5GAOp 1G3WA 2E4HA 5GMKi 4E7KA 2Y4XA 1B07A 2A3LA 2KRNA 1ZSZB 1M2OA 4EDUA 3OMCA 5IXFA 1BI1A 3ZL7C 1YI2Q 5GMKe 2P0KA 1AZEA 1Y96A 1BKBA 2H3JA 2RK1A 2KYMA 1ABOA 4JDSA 5GAMe 2LT1A 1W2BA 4L59A 3QPHA 5CR2A 1KQSP 2MI6A 4HCZA 2BE7D 1GXIE 3C12A 1WXBA 1SPKA 2HKQB 2E3HA 1NLOC 4LE9A 2JM8A 4LDXA 1M1FA 3VS1A 1RAEB 2FHDA 2JTMA 4KT0E 1X43A 1ZBJA 1YI2T 4M7DE 4EMKA 2Z0WA 1K73U 1K76A 3C94A 2CDTA 2ED0A 2DMOA 3VJPA 5GANf 3GNGA 5GAN5 4M7DG 4JZ4A 2YHTA 1QVPA 2W0ZA 1UUEA 4M7AD 2DO3A 1MMNA 1U06A 2MWOA 3CPWA 2ABLA 1EFNA 2PU9B 4JPBW 2HSPA 3H0FA 1YJWQ 4AFUC 2O88A 2KR3A 3VRZA 2V8KA 1V29B 3TREA 4AMCA 4WCIA 1M90U 4XTXA 4EMKC 3N5BB 1QQJA 4M77F 1ZX6A 1VYUA 5GANj 1JXOA 2E65A 1ACMB 4C8QF 1M5Q1 3NGPA 2HL5C 2RI5A 4HT8A 2CZ7B 2L3RA 3C95A 4Q5WA 2KXDA 3JV3A 1BIAA 2QQSA 2LQ8A 4R55A 1YIJA 1HJDA 1VQ8A 1SSHA 5GANd 1SRMA 3A8OB 1UHFA 1ZSGA 2XDPA 3L1AA 3OYFA 1MMDA 2A28A 1Z9QA 1YJWT 2EAYA 4HCKA 1T0JA 5CO7A 2KDSA 2KRSA 2AZVA 3JB9I 3DLMA 4JS5A 2GQVA 2V8IA 4D8DA 1SSFA 3VS7A 1D1CA 1K73R 1WNLA 3NTIA 2CZ6B 1WI7A 2Y90A 1OZ2A 4PJNA 3HHTB 2DYBA 1EX4A 1R0BG 3L2QA 1Q86U 4E7JA 2PTKA 4L5GA 4OMFB 3RMSA 3CC2A 3I35A 2RJDA 4Y91A 1RAIB 1TU0B 3DKMA 2RO0A 4C5HA 4EPCA 2L89A 1M1KR 2R5AA 5CK9A 1K8AR 1GBQA 1NJIU 1UB4A 3JCMg 2JN0A 2ZPGB 2YRCA 1AEYA 3RKWA 2MPXC 2QDYB 2LC4A 5A0GA 4M77D 1VQLQ 1KC8U 4M7DB 2P4RA 3WVDB 3CCUQ 2OTLQ 4C8QD 3RMQA 3QJ6A 3OYHA 4BD3A 1UGSB 4J6XA 4M75G 2AHJB 3VUBA 5DLOA 1LCKA 1VQ6A 3WXMB 3CCLQ 1K0XA 5CKFA 3RNJA 4IIMA 1YWPA 4FYWB 1GCQA 1T3LA 2J6KA 2J6FA 3MHXA 1A0NB 3D7SB 1BCMA 1VYTA 1Y7XA 1OOTA 2RQUA 1QWFA 1EIFA 4DQ2A 1N8RU 2PZ1A 2NWMA 1R0CB 1IGUA 1VQLT 3CCUT 1N27A 1Q86R 2OTLT 2RQRA 1F1BB 5LJ3f 2QTXA 1O9SA 4BE1A 3I55Q 1VA7A 3KXTA 3UT1A 3UATA 3RKYA 1OZ3A 3NMZC 4BI3A 3CCLT 2CP5A 1GCQC 1B34B 1UEBA 1PRMC 3JSCA 2H3EB 1UHCA 3Q1JA 2CP3A 2JMAA 2KRMA 1NJIR 3CBOA 3M0QA 3J81E 1VQMQ 1SHGA 3G1JA 2MAMA 4C0ZA 3QKJA 4FYYB 4IURA 1WQ7A 1NE8A 6AT1B 2LX7A 3VS5A 1J3TA 2DLPA 2DEUA 1K73C 4QVCA 2F1LA 2A36A 4Z88A 2SRCA 3JCMd 4PJOE 2KY9A 1JU5C 3G6EA 3G7ZA 2DL4A 4JRQA 2MMPA 1KQSA 2HL3A 3REAB 2M02A 3L2WA 3LYIA 3QYHB 2E64A 3QG1A 4PJOG 3META 2K6DA 4AFQC 5M9OA 1M90C 4C5IA 1VQMT 3OYMA 2CP0A 2EGAA 4OMOA 4M75B 1MMAA 2C0TA 4FCYA 2OTJA 4UC4A 1S72Q 3M0TA 5FLXE 4Y28E 3QJYA 3THKA 4XK8E 1FMVA 2M0OA 1QP3A 2WSCE 2NYSA 1X69A 3A1PA 4AG2C 3OYNA 1ZQ1A 3UF4A 5I22A 4IIOA 3HP9A 2GF7A 2HSEB 2OI3A 3OW2S 5J3BA 3CQTA 1NG2A 4BI8B 3I56A 5FU7C 3LGFA 1I0CA 4BB7A 1WA7A 3PVQA 1KQ1A 1BYMA 5DLQE 2KK4A 2ZPFB 3OA6A 1S72T 1Q86C 2DTIA 4A4EA 1QWEA 4QQDA 1NEBA 5DM7R 4QQGA 4EIKA 1LPLA 5GAMf 2C0IA 1D3BA 2RHYA 3TQ7P 1NJIC 5GMKj 1D0ZA 4BI4A 4F14A 2K2MA 1KC8C 2QASA 1U8RA 2HKNA 4FIBA 4AG1C 1E6GA 2KT8A 1QVGS 1NM7A 5CAIA 3G71Q 2KVQG 2K3BA 2M1HA 4D8KA 1VUBA 4DBQA 5GAMj 2EYZA 3NPFA 1QCOA 5I2MA 4PJOB 1QVFS 2GCXA 3FJPA 2JMCA 4XU3A 3EH2A 1I5LA 3EG9B 4ZGJB 4JRKA 3CCEQ 1OYXA 1VQKA 2L3SA 5GAMd 1R8OB 2VGNA 4KBMB 1PM3A 1N8RC 3M54A 1GFDA 4AFZC 4JLIA 3I9QA 3OYIA 2E12A 4PK4A 1W2BP 5KYXA 1VQ4A 2HDAA 3G71T 2KEAA 3KUFA 3HSBA 2YWWA 1JJ2S 2EYXA 1OI1A 1D09B 4GLKA 1M3BA 2CYZB 1NBEB 1W6XA 1BU1A 4F7UE 4C92F 2CKKA 3VV0A 3A8LB 1WHMA 4RTWA 3CCET 1RABB 5CCAA 5A2QE 4PJMA 3HPWA 2FO0A 2GFAA 1VQ9A 3EFSA 3EH1A 1FXXA 2DA9A 2CGHA 2FZKB 3X24B 5GAN8 4PLIA 2CT4A 3RR6A 2P84A 4PFPA 5FRNA 5GMKl 2ENMA 1ABQA 1R77A 1PNJA 3FIFA 1IB8A 4MZPA 2DFUA 1MNDA 2O4XB 4MZTA 1K4US 2KAFA 2XG8D 4XTWA 4RKUE 2PNIA 2JM9A 1E6HA 3U23A 2FZCB 2KT1A 2RD1A 4D6WA 1ZUKA 3RUXA 1K9AA 4XU2A 1C0MA 1QCNA 1VQOA 2DTHA 2KXCA 1PD1A 3G4SQ 2COYA 5KYNA 5GAN6 1X6OA 1Y96B 2I2LA 4EMGA 2QQRA 1TUCA 4J9IA 1IGQA 1ZUYA 3OS0A 2PVDB 4C92D 3EGDA 1RAFB 4FSSA 4DBHA 1PSEA 4A4FA 4N4GA 2K5FA 2DVJA 4IKFA 3CMAA 2NUTA 1K1ZA 1M1GA 2JZ2A 3P8BB 4PJJA 1VQNQ 3G4ST 5HKCA 4EMKB 3PGGA 5LJ5e 2VGMA 2X3XD 2F2XA 2CREA 1D0XA 1AD5A 4CRIA 2D8HA 2QQ9A 3KFVA 2DILA 5D6YA 2JUFA 3OS5A 1OQKA 2VVKA 3M4YA 2FYKA 5D6XA 2EJ9A 3O5ZA 1E7OA 2EYWA 3SEMA 2RJCA 1G3SA 1BB9A 1G3TA 2SEMA 1YIJQ 3PIPA 1XJWB 4IUUA 2B86A 3CXCS 4BE2A 1VQNT 3PFSA 3QSUA 5GMKm 2A08A 4C0DC 2HD0A 4M7AA 2DL5A 1K9MU 3OYKA 4P5NA 2VXEA 2JS2A 4FYVB 1TH7A 1AHJB 4E7ZA 2K4YA 2AIRB 3JCMJ 2RQWA 2BTTA 3M4GA 5I11A 2CH4W 4ATOA 2JJ9A 2P0QA 4VUBA 1N5ZA 1QKWA 1CKAA 2K3XA 2RA2A 1YIJT 2FEIA 4RTYA 1VQ8T 1TXQA 1VQPQ 2I0NA 2K3YA 3EFRA 1NYFA 5KH6A 1ZHIA 1WLPB 2C06A 4M7AC 3RESA 3RERA 1DJ7B 3CEYA 3PNWC 2RQTA 5GAOl 3ZEHA 5GANg 1YNZA 1GL5A 3NTHA 1V76A 2NUZA 1G5VA 2FPFA 1VQ5A 5CKHA 2HQEA 4ZGEB 1MV0B 2VASA 4OMLA 3E19A 2DM1A 4GBQA 2LX9A 4FT4A 2CP6A 2A0FB 2RJEA 2DL3A 3NFCA 2DVEA 2RMOA 2QEXA 3QO3A 1VQPT 2EPDA 2JVVA 4E6RA 2DXCA 3CD6A 4XTUA 4RCCA 3JCMQ 1GCPA 3LLRA 3SWNA 4A53A 1JRIA 3OYYA 3S3NA 1VYVA 4M78F 2X51A 1GFCA 4ZN3A 3E9GA 2LQWA 3M0PA 2COWA 1WJRA 2QTVA 1NPRA 3VUZA 1KHIA 1YP5A 3QWXX 2L8DA 4C0FA 1RI0A 4KGVB 3MEVA 4OB0B 3INZA 2H8HA 1VQ6T 1X6GA 2C0OA 3A8MB 1C1AA 4M77A 2GBQA 2LCCA 4C8QA 2V8JA 3L2RA 1ZLMA 3SWNC 1TOVA 1XNIA 3CCMQ 2WSFE 4R56A 3R6NA 3OBYA 1PRLC 2HBPA 2K2VA 4F16A 3JCMb 4A4KA 2LRQA 4BDYA 2JXBA 3QHSA 1RLPC 1FMWA 3V8KA 3VS3A 4IUQA 1UECA 1UTIA 3OYJA 4RTZA 3BDUA 4M77C 2DETA 4MDWA 4F7UF 3JB9G 1AWWA 4C8QC 3CCQA 3HRTA 5HCKA 1M3AA 2K9GA 2ATCB 2LDMA 2FG0A 5CKBA 5GAN7 2IG0A 4M4ZA 1PKTA 3OQ5A 2DPPB 3TEEA 3CCMT 1YHQA 2PUKB 1Z9ZA 2BE9B 4M78D 5GAOn 3X26B 5GAOm 3LWIA 1RAAB 3MEWA 4BUGA 3MPUB 2LZ6B 4WF2A 3OSVA 3PT9A 4C0GA 1W4SA 2X4XA 2RI2A 2E1HA 3RIRA 2XDBA 5CQXA 5HY6A 2EW3A 3HL8A 3JCMh 3OY9A 1LJOA 1KD1U 3FB9A 5KCHA 2EBPA 5FU7B 1AWOA 2DL8A 2B8AA 2D8JA 1M90R 1NLPC 5IAYA 4M75E 4LDWA 1K9MC 5LJ5h 5LJ3g 5GJVB 2J7IA 4HCCA 4A63B 1U1TA 2BUDA 2MOXA 4KH0B 4ESRA 3WVEB 3CMEQ 1SEMA 4HKEA 2FPEA 1IRXA 2DD4A 3TSWA 1PC0A 1HSQA 1YI2A 1Q7YU 5IH2A 1PCXA 2D0QB 4OMPA 2O01E 1H3HA 2K5IA 3EGUA 3I5SA 1RI9A 2EFIA 1WHKA 4CI0C 4JUVA 1P92A 1RL2A 2LJ1A 1M4ZA 4IUPA 3LWHA 4ANJA 3TU4K 4DEYA 2LQKA 3MJXA 3CMET 1D3BB 1HK9A 3CCRQ 3V7SA 4L6V5 2ZPIB 4O5VA 1M2VA 4JS4A 2DX1A 1KD1R 2RM4A 1WGSA 2P4TA 5D7UA 2J06A 1JO8A 1SG5A 3GOXA 2KBTA 3CCSQ 3GIBA 1JQQA 4PNOA 1KC8R 5LJ3j 2YDLA 5LJ5f 2DERA 1T3SA 2DE0X 2DZCA 2XI9A 1YJWA 2VWFA 3VRYA 2X3WD 2YLBA 1Q7YR 2DF6A 4X1VA 1X01A 3CCRT 2JTEA 5LJ3d 1QKXA 2PVGB 4JJDA 2HNIA 4OMMA 4KULA 4AT1B 1SKUB 1VIFA 1HD3A 3LH0A 1WZOA 4LUDA 2CZ0B 2LJ3A 3C0CA 3VS2A 5KYXB 1IHWA 1BI0A 1KK7A 1M3CA 3CCST 2GGRA 2LJ0A 5IN1A 3TCJA 1N8RR 2D9TA 2HMAA 3EHRA 4KRTA 2EYQA 3MCAB 4AFSC 1GRIA 3EAEA 1ZBXA 1RLQC 3PMIA 2FL7A 2KE9A 4YTLA 1JBMA 5GAMg 2DD5A 4HA8A 2DAQA 3FDRA 4A4GA 1UGPB 1H3ZA 2COZA 1XTDA 4J7IA 3SD4A 3AT1B 1RAGB 4RTUA 3M53A 1VQ7Q 4JJBA 1NZ9A 3OMGA 1CSKA 1X2QA 1PHTA 2DKGA 2DXUA 2XKOC 3CC7Q 3GP8A 2AKLA 2DIGA 4M7AE 3CC4Q 2F2VA 3HFNA 3A8HB 1TS9A 1YJNQ 3X20B 4M7DF 4PLLA 3TSZA 1KD1C 1VQLA 4M7AG 3CCUA 2JNGA 2ROTA 2OTLA 3ASKA 3OW2P 1M27C 4HVWA 2EQMA 3GPLA 1VQ7T 3CCLA 4FU6A 3CCVQ 2DJZA 1AVZC 2E6NA 4KUDK 2J05A 3DLLA 1WDXA 1Q95G 2G6FX 3CC7T 2K79A 3BFMA 1MV3A 3VS0A
chains in the Genus database with same CATH topology
1K76A 2CDTA 2ED0A 2DMOA 1JXMA 1K1ZA 5IHNA 4JZ4A 3M0UA 2W0ZA 5GJWB 1UUEA 1U06A 2ABLA 2GTJA 1EFNA 4JPBW 2HSPA 1B3QA 2KYBA 2X3XD 3RBBB 2F2XA 3H0FA 2CREA 1AD5A 4AFUC 2O88A 2KR3A 3VRZA 3VS6A 2D8HA 1WYXA 1GBRA 3KFVA 2DILA 2OAWA 2JS0A 4WCIA 1W70A 2VVKA 4Z8AA 1OPKA 1JEGA 2KROA 1ZX6A 1VYUA 5EC7A 1JXOA 1V1CA 1OPLA 3O5ZA 1E7OA 3NGPA 2EYWA 3SEMA 1BB9A 1SHFA 3GBQA 2SEMA 2KXDA 2B86A 3JV3A 2CH4A 1KFZA 1HJDA 3VS0A 1SSHA 1SRMA 1H92A 1UHFA 1ZSGA 2A28A 2A08A 4RTXA 1W1FA 1Z9QA 1T0HA 2DL7A 2DL5A 4HCKA 1T0JA 2JS2A 2IIMA 2KRSA 2AZVA 3EG1A 4D8DA 2RQWA 2BTTA 4ORZA 3VS7A 1IO6A 1WI7A 5I11A 2CH4W 1YN8A 2LMJA 4J9FA 2DYBA 1FYNA 1N5ZA 1QKWA 1CKAA 2PTKA 5IXBA 4OMNA 3I35A 2FEIA 4RTYA 1AZGB 1OV3A 2I0NA 1NYFA 2JT4A 1WLPB 1U5SA 2HCKA 4JZ3A 1QCFA 2RQVA 2M0YA 4CC2A 2RQTA 2ESWA 1GBQA 1YNZA 2K7AA 1GL5A 2NUZA 1PWTA 2FPFA 1AEYA 1MV0B 4OMLA 2P4RA 2DM1A 4GBQA 1AOJA 1TG0A 2DL3A 3PE0A 2QDLA 3M0RA 1LCKA 2RMOA 1K0XA 2EPDA 4E6RA 3RNJA 4DEXA 4IIMA 1YWPA 1CKBA 1GCPA 1GCQA 1T3LA 1MUZA 1AWXA 2J6KA 1WX6A 2J6FA 1VYVA 1GFCA 2ECZA 1A0NB 2KGTA 3ULRB 1VYTA 2LQWA 3M0PA 3I5RA 2FPDA 1BBZA 1G2BA 1OOTA 2RF0A 1YP5A 3QWXX 2RPNA 2RQUA 1QWFA 2CUDA 2LNHB 4RUGA 1YWOA 2PZ1A 2NWMA 1OEBA 2YT6A 2H8HA 2RQRA 2LCSA 1X6GA 2C0OA 2YUPA 2GBQA 2BZYA 3VS4A 1VA7A 2EVRA 3UATA 3NMZC 2DNUA 1ZLMA 1GCQC 4K11A 1PRMC 5FWBA 2DBKA 3R6NA 1PRLC 3A98A 4F16A 1UHCA 2CSQA 2E5KA 2JMAA 2KRMA 3M0QA 4LN2A 4J9HA 4HXJA 1SHGA 2JXBA 4QT7A 1WXUA 3IQLA 1K0SA 2V1QA 2LX7A 3VS5A 1J3TA 1RLPC 3VS3A 2RNAA 2DLPA 1UECA 1UE9A 1UTIA 1WXTA 3UA7A 1NYGA 4RTZA 4GLMA 2J6OA 1AWWA 2A36A 4Z88A 5ECAA 1X27A 2SRCA 5HCKA 1M3AA 2K9GA 2MCNA 1JU5C 1XOVA 1M8MA 1ZUUA 4JJCA 2GTOA 2FG0A 2DL4A 5L23A 4J9DA 1UFFA 3LH5A 1PKTA 2DRMA 4M4ZA 2O31A 3REAB 1U3OA 1Z9ZA 1H8KA 3EHQA 1UJ0A 2K6DA 2RN8A 4AFQC 2LP5A 2EGAA 2HBWA 4OMOA 2CUBA 2BZXA 2C0TA 1RUWA 2LZ6B 1M30A 3M0TA 2O9VA 3THKA 1UJYA 2AK5A 1NEGA 2M51A 2EW3A 1X69A 2EBPA 3H0IA 4AG2C 1AWOA 2DL8A 2O9SA 4Z89A 2D8JA 3UF4A 4LUEA 5I22A 2DRKA 1NLPC 4IIOA 1UG1A 3H0HA 2YUOA 2OI3A 2LQNA 3CQTA 5GJVB 1NG2A 2CT3A 2AKKA 2J7IA 4A63B 4RTVA 2DJQA 2MOXA 4ESRA 2D0NA 4CC3A 3EG2A 4OMQA 3H41A 1I0CA 2ED1A 4J9EA 1WA7A 3PVQA 3FJ5A 1SEMA 2FPEA 3TSWA 2JW4A 5FW9A 1WIEA 5FWCA 1WFWA 1HSQA 2EGCA 5IH2A 1QWEA 4RTTA 1NEBA 4OMPA 4CC7A 1H3HA 2EKHA 1QLYA 3EGUA 2L3PA 3I5SA 4EIKA 1RI9A 2FRWA 2D1XA 2C0IA 3SHWA 3EG0A 4J9BA 3UA6A 2HEQA 4HVVA 2LJ1A 2OJ2A 4F14A 2K2MA 4DEYA 1TUDA 1UDLA 5IHKA 4AG1C 1E6GA 2KT8A 2YSQA 2BZ8A 1NM7A 2A37A 1X2KA 2K3BA 4D8KA 2DX1A 4ZNXA 1PKSA 2EYZA 3EG3A 2J06A 3NPFA 4HVUA 1JO8A 4J9CA 1X6BA 2JMCA 2KBTA 1JQQA 4R0KA 2YUQA 1FMKA 1SRLA 2EQIA 2L3SA 2YDLA 1YCSB 1T3SA 2DE0X 1I07A 1ARKA 1KIKA 1GFDA 4AFZC 1S1NA 2VWFA 3I9QA 3NHNA 2FRYA 3VRYA 2X3WD 2GQIA 2MIOA 2ROLA 2DF6A 2XMFA 4X1VA 1KSWA 2HDAA 2JTEA 1QKXA 2F2WA 1BK2A 2L3QA 2KEAA 4JJDA 3PVLA 4OMMA 1HD3A 2EYXA 2L2PA 4LUDA 1M3BA 2GNCA 2LJ3A 3C0CA 3VS2A 1W6XA 1BU1A 1M3CA 2VKNA 2GGRA 1Y0MA 2LJ0A 4J9GA 4RTWA 3EHRA 1AWJA 4KRTA 3QWYA 4AFSC 1GRIA 2YUNA 1Y57A 1RLQC 1UGVA 2W10A 1KJWA 2KE9A 2FO0A 2KNBB 4Y92A 5IHIA 2DA9A 2CT4A 1I1JA 4F17A 2DBMA 2ENMA 1ABQA 2O2OA 2EGEA 1PNJA 4RTUA 1K4US 1B07A 2KRNA 4JJBA 4LNPA 1CSKA 4CC4B 1X2QA 5IXFA 1PHTA 3ZL7C 2PNIA 2JM9A 1AZEA 1E6HA 3U23A 2AKLA 2KT1A 2CSIA 1ZUKA 2F2VA 1K9AA 1G83A 2AZSA 2KYMA 1ABOA 3M0SA 2KXCA 3REBB 3TSZA 3TVTA 2V1RA 2L0AA 2ROTA 1TUCA 1M27C 4HVWA 4J9IA 1ZUYA 1WXBA 1SPKA 1NLOC 4FSSA 4LE9A 2JM8A 3VS1A 1AVZC 2J05A 1X43A 1ZBJA 2EYYA 1WDXA 2G6FX 2K79A 1MV3A 2DVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K76 A;  2CDT A;  2ED0 A;  2DMO A;  1JXM A;  1K1Z A;  5IHN A;  4JZ4 A;  3M0U A;  2W0Z A;  5GJW B;  1UUE A;  1U06 A;  2ABL A;  2GTJ A;  1EFN A;  4JPB W;  2HSP A;  1B3Q A;  2KYB A;  2X3X D;  3RBB B;  2F2X A;  3H0F A;  2CRE A;  1AD5 A;  4AFU C;  2O88 A;  2KR3 A;  3VRZ A;  3VS6 A;  2D8H A;  1WYX A;  1GBR A;  3KFV A;  2DIL A;  2OAW A;  2JS0 A;  4WCI A;  1W70 A;  2VVK A;  4Z8A A;  1OPK A;  1JEG A;  2KRO A;  1ZX6 A;  1VYU A;  5EC7 A;  1JXO A;  1V1C A;  1OPL A;  3O5Z A;  1E7O A;  3NGP A;  2EYW A;  3SEM A;  1BB9 A;  1SHF A;  3GBQ A;  2SEM A;  2KXD A;  2B86 A;  3JV3 A;  2CH4 A;  1KFZ A;  1HJD A;  3VS0 A;  1SSH A;  1SRM A;  1H92 A;  1UHF A;  1ZSG A;  2A28 A;  2A08 A;  4RTX A;  1W1F A;  1Z9Q A;  1T0H A;  2DL7 A;  2DL5 A;  4HCK A;  1T0J A;  2JS2 A;  2IIM A;  2KRS A;  2AZV A;  3EG1 A;  4D8D A;  2RQW A;  2BTT A;  4ORZ A;  3VS7 A;  1IO6 A;  1WI7 A;  5I11 A;  2CH4 W;  1YN8 A;  2LMJ A;  4J9F A;  2DYB A;  1FYN A;  1N5Z A;  1QKW A;  1CKA A;  2PTK A;  5IXB A;  4OMN A;  3I35 A;  2FEI A;  4RTY A;  1AZG B;  1OV3 A;  2I0N A;  1NYF A;  2JT4 A;  1WLP B;  1U5S A;  2HCK A;  4JZ3 A;  1QCF A;  2RQV A;  2M0Y A;  4CC2 A;  2RQT A;  2ESW A;  1GBQ A;  1YNZ A;  2K7A A;  1GL5 A;  2NUZ A;  1PWT A;  2FPF A;  1AEY A;  1MV0 B;  4OML A;  2P4R A;  2DM1 A;  4GBQ A;  1AOJ A;  1TG0 A;  2DL3 A;  3PE0 A;  2QDL A;  3M0R A;  1LCK A;  2RMO A;  1K0X A;  2EPD A;  4E6R A;  3RNJ A;  4DEX A;  4IIM A;  1YWP A;  1CKB A;  1GCP A;  1GCQ A;  1T3L A;  1MUZ A;  1AWX A;  2J6K A;  1WX6 A;  2J6F A;  1VYV A;  1GFC A;  2ECZ A;  1A0N B;  2KGT A;  3ULR B;  1VYT A;  2LQW A;  3M0P A;  3I5R A;  2FPD A;  1BBZ A;  1G2B A;  1OOT A;  2RF0 A;  1YP5 A;  3QWX X;  2RPN A;  2RQU A;  1QWF A;  2CUD A;  2LNH B;  4RUG A;  1YWO A;  2PZ1 A;  2NWM A;  1OEB A;  2YT6 A;  2H8H A;  2RQR A;  2LCS A;  1X6G A;  2C0O A;  2YUP A;  2GBQ A;  2BZY A;  3VS4 A;  1VA7 A;  2EVR A;  3UAT A;  3NMZ C;  2DNU A;  1ZLM A;  1GCQ C;  4K11 A;  1PRM C;  5FWB A;  2DBK A;  3R6N A;  1PRL C;  3A98 A;  4F16 A;  1UHC A;  2CSQ A;  2E5K A;  2JMA A;  2KRM A;  3M0Q A;  4LN2 A;  4J9H A;  4HXJ A;  1SHG A;  2JXB A;  4QT7 A;  1WXU A;  3IQL A;  1K0S A;  2V1Q A;  2LX7 A;  3VS5 A;  1J3T A;  1RLP C;  3VS3 A;  2RNA A;  2DLP A;  1UEC A;  1UE9 A;  1UTI A;  1WXT A;  3UA7 A;  1NYG A;  4RTZ A;  4GLM A;  2J6O A;  1AWW A;  2A36 A;  4Z88 A;  5ECA A;  1X27 A;  2SRC A;  5HCK A;  1M3A A;  2K9G A;  2MCN A;  1JU5 C;  1XOV A;  1M8M A;  1ZUU A;  4JJC A;  2GTO A;  2FG0 A;  2DL4 A;  5L23 A;  4J9D A;  1UFF A;  3LH5 A;  1PKT A;  2DRM A;  4M4Z A;  2O31 A;  3REA B;  1U3O A;  1Z9Z A;  1H8K A;  3EHQ A;  1UJ0 A;  2K6D A;  2RN8 A;  4AFQ C;  2LP5 A;  2EGA A;  2HBW A;  4OMO A;  2CUB A;  2BZX A;  2C0T A;  1RUW A;  2LZ6 B;  1M30 A;  3M0T A;  2O9V A;  3THK A;  1UJY A;  2AK5 A;  1NEG A;  2M51 A;  2EW3 A;  1X69 A;  2EBP A;  3H0I A;  4AG2 C;  1AWO A;  2DL8 A;  2O9S A;  4Z89 A;  2D8J A;  3UF4 A;  4LUE A;  5I22 A;  2DRK A;  1NLP C;  4IIO A;  1UG1 A;  3H0H A;  2YUO A;  2OI3 A;  2LQN A;  3CQT A;  5GJV B;  1NG2 A;  2CT3 A;  2AKK A;  2J7I A;  4A63 B;  4RTV A;  2DJQ A;  2MOX A;  4ESR A;  2D0N A;  4CC3 A;  3EG2 A;  4OMQ A;  3H41 A;  1I0C A;  2ED1 A;  4J9E A;  1WA7 A;  3PVQ A;  3FJ5 A;  1SEM A;  2FPE A;  3TSW A;  2JW4 A;  5FW9 A;  1WIE A;  5FWC A;  1WFW A;  1HSQ A;  2EGC A;  5IH2 A;  1QWE A;  4RTT A;  1NEB A;  4OMP A;  4CC7 A;  1H3H A;  2EKH A;  1QLY A;  3EGU A;  2L3P A;  3I5S A;  4EIK A;  1RI9 A;  2FRW A;  2D1X A;  2C0I A;  3SHW A;  3EG0 A;  4J9B A;  3UA6 A;  2HEQ A;  4HVV A;  2LJ1 A;  2OJ2 A;  4F14 A;  2K2M A;  4DEY A;  1TUD A;  1UDL A;  5IHK A;  4AG1 C;  1E6G A;  2KT8 A;  2YSQ A;  2BZ8 A;  1NM7 A;  2A37 A;  1X2K A;  2K3B A;  4D8K A;  2DX1 A;  4ZNX A;  1PKS A;  2EYZ A;  3EG3 A;  2J06 A;  3NPF A;  4HVU A;  1JO8 A;  4J9C A;  1X6B A;  2JMC A;  2KBT A;  1JQQ A;  4R0K A;  2YUQ A;  1FMK A;  1SRL A;  2EQI A;  2L3S A;  2YDL A;  1YCS B;  1T3S A;  2DE0 X;  1I07 A;  1ARK A;  1KIK A;  1GFD A;  4AFZ C;  1S1N A;  2VWF A;  3I9Q A;  3NHN A;  2FRY A;  3VRY A;  2X3W D;  2GQI A;  2MIO A;  2ROL A;  2DF6 A;  2XMF A;  4X1V A;  1KSW A;  2HDA A;  2JTE A;  1QKX A;  2F2W A;  1BK2 A;  2L3Q A;  2KEA A;  4JJD A;  3PVL A;  4OMM A;  1HD3 A;  2EYX A;  2L2P A;  4LUD A;  1M3B A;  2GNC A;  2LJ3 A;  3C0C A;  3VS2 A;  1W6X A;  1BU1 A;  1M3C A;  2VKN A;  2GGR A;  1Y0M A;  2LJ0 A;  4J9G A;  4RTW A;  3EHR A;  1AWJ A;  4KRT A;  3QWY A;  4AFS C;  1GRI A;  2YUN A;  1Y57 A;  1RLQ C;  1UGV A;  2W10 A;  1KJW A;  2KE9 A;  2FO0 A;  2KNB B;  4Y92 A;  5IHI A;  2DA9 A;  2CT4 A;  1I1J A;  4F17 A;  2DBM A;  2ENM A;  1ABQ A;  2O2O A;  2EGE A;  1PNJ A;  4RTU A;  1K4U S;  1B07 A;  2KRN A;  4JJB A;  4LNP A;  1CSK A;  4CC4 B;  1X2Q A;  5IXF A;  1PHT A;  3ZL7 C;  2PNI A;  2JM9 A;  1AZE A;  1E6H A;  3U23 A;  2AKL A;  2KT1 A;  2CSI A;  1ZUK A;  2F2V A;  1K9A A;  1G83 A;  2AZS A;  2KYM A;  1ABO A;  3M0S A;  2KXC A;  3REB B;  3TSZ A;  3TVT A;  2V1R A;  2L0A A;  2ROT A;  1TUC A;  1M27 C;  4HVW A;  4J9I A;  1ZUY A;  1WXB A;  1SPK A;  1NLO C;  4FSS A;  4LE9 A;  2JM8 A;  3VS1 A;  1AVZ C;  2J05 A;  1X43 A;  1ZBJ A;  2EYY A;  1WDX A;  2G6F X;  2K79 A;  1MV3 A;  2DVJ A; 
#chains in the Genus database with same CATH topology
 3EGD B;  3CC4 T;  1ZA1 B;  5EG2 A;  1RAH B;  1YIT Q;  1Q7Y C;  2M16 A;  1YJN T;  3DB4 A;  3V7C A;  2GTJ A;  3R6O A;  2KYB A;  1W2B S;  3GNF B;  2NUT B;  2VB6 A;  3I55 A;  1GBR A;  3V8J A;  3M58 A;  2IPO B;  2JS0 A;  3CCV T;  4FM4 B;  3MP6 A;  1W70 A;  4JRP A;  4XTV A;  1OPK A;  4C92 A;  1QVG P;  4BAC A;  3JRZ A;  4BE0 A;  5EC7 A;  4C0D B;  5KYU A;  1VQM A;  4QVZ A;  4OGC A;  1QVF P;  4OP0 A;  4O6J A;  3M55 A;  4OF1 A;  1YIT T;  4M7D D;  4DA4 A;  1BCO A;  2CH4 A;  1KFZ A;  2WAC A;  2QA4 Q;  5FU6 C;  4E2F B;  3CPW S;  4M77 E;  2LCL A;  2DL7 A;  1YJ9 Q;  4C8Q E;  2X4J A;  3HTR A;  1MGQ A;  3CCJ Q;  4C92 C;  3JCM c;  1RAC B;  3EG1 A;  2PVO B;  4M77 G;  4ORZ A;  3OYL A;  3OYE A;  1IO6 A;  2BKD N;  4C8Q G;  2LMJ A;  4M7A B;  2OX7 A;  4M75 F;  1FYN A;  2DEQ A;  5KYW A;  4F04 B;  3T9N A;  4OMN A;  5IXB A;  5GAO q;  1OV3 A;  4OB1 B;  2JT4 A;  4DBR A;  1S72 A;  3JCM V;  1U5S A;  2HCK A;  2QA4 T;  4FL6 A;  2QK0 A;  2M0Y A;  4CC2 A;  2ESW A;  2K7A A;  1YJ9 T;  3CCJ T;  1YFN A;  3VU3 C;  1VIE A;  2CP2 A;  1YBY A;  2OAU A;  5CKD A;  3MP1 A;  3L2U A;  1D1B A;  3CD6 Q;  1M9S A;  2QGF B;  1Q81 U;  2FVU A;  1MUZ A;  1AWX A;  2FB7 A;  5KE3 A;  3CBP A;  4MML A;  2KGT A;  4J7F A;  1QP2 A;  4FW1 A;  5C0M A;  2XU8 A;  3P8H A;  2DK3 A;  4LD9 K;  3EFO A;  1G2B A;  2RPN A;  2CUD A;  2LNH B;  3CPF A;  3SWN B;  1OEB A;  3JCM e;  4OGE A;  4LDY A;  1I4K 1;  2LCS A;  9ATC B;  4M75 D;  4E47 A;  4BY6 C;  1Q82 U;  2EVR A;  3CD6 T;  3ME9 A;  4HT9 A;  2DNU A;  5J26 A;  2DBK A;  3S3M A;  3O8V A;  3G71 A;  4M77 B;  3FEO A;  4N0A A;  2RHX A;  4LN2 A;  4PJO F;  4HXJ A;  4PL6 A;  4C8Q B;  4LD6 A;  1K0S A;  2V1Q A;  4ZN1 A;  2RNA A;  5A0L A;  1WJQ A;  2DYI A;  3CCE A;  3MP8 A;  1UE9 A;  1VQ8 Q;  3LX7 A;  3CCQ Q;  4N4I A;  5AT1 B;  1MHN A;  1ZA2 B;  3QBY A;  5ECA A;  1X27 A;  4OVA A;  2PUO B;  1XOV A;  4C5G A;  1Q81 R;  4JJC A;  1YHQ Q;  5L23 A;  3M59 A;  4J9D A;  5AYF A;  1UFF A;  3OW2 A;  5KCO A;  3E1S A;  2V26 A;  1U3O A;  1OX8 A;  1H8K A;  1UJ0 A;  2RN8 A;  3FRN A;  3F70 A;  2LP5 A;  2IVW A;  2HBW A;  2HZY A;  2CUB A;  2BZX A;  1Y71 A;  3CC2 Q;  1RUW A;  2EQJ A;  2QYZ A;  2EIF A;  4JLG A;  2O9V A;  2ZGW A;  4ELZ C;  4NS5 A;  3CCQ T;  1UJY A;  2HQH A;  1Q82 R;  2M51 A;  5GAN h;  2QG9 B;  2RHZ A;  4B6M A;  1WJS A;  1YCY A;  8ATC B;  2MF2 A;  3J7A F;  4WTO B;  2O9S A;  4Z89 A;  1YHQ T;  1UG1 A;  1KQS S;  5KYY A;  2VV5 A;  2YUO A;  2LTO A;  2LQN A;  4FW2 A;  4PJO D;  4RTV A;  2DJQ A;  3OSS C;  1LOJ A;  3EG2 A;  4Z02 A;  3H41 A;  1VQ6 Q;  4J5Y A;  2ED1 A;  4M78 A;  3CC2 T;  3FJ5 A;  1QVG A;  4JRI A;  5I21 A;  3GF5 A;  5FWC A;  2E41 A;  1QVF A;  4MDX A;  1K9M R;  4E7L A;  3X25 B;  2EKH A;  2L3P A;  2D1X A;  2A7Y A;  2E70 A;  2F5K A;  2RHI A;  3EGX A;  3EG0 A;  3G4S A;  4X34 A;  3UA6 A;  4XQ3 A;  3L2V A;  2HEQ A;  1H64 1;  1AT1 B;  4M78 C;  4MZM A;  3OS1 A;  3MEA A;  2YLC A;  1TUD A;  3VYH B;  4FT2 A;  5IHK A;  2DXB A;  5GAN 4;  2YSQ A;  2BZ8 A;  2A37 A;  2XD0 A;  1JJ2 A;  3EG3 A;  4HVU A;  4EMH A;  1Q81 C;  4F7U A;  2X4Y A;  4J9C A;  1X6B A;  5GAO r;  4C5E A;  4NL3 A;  3E9F A;  1M2V B;  2YUQ A;  1VQN A;  1SRL A;  5A0D A;  1I07 A;  1M1K U;  5GAN 2;  1KIK A;  4PFO A;  1K8A U;  3C4S A;  3G6E Q;  1BI3 A;  4J6W A;  2MIO A;  2NUP A;  2YRD A;  2F5T X;  2MYS A;  1KSW A;  2F2W A;  2E10 A;  1Q82 C;  4PFZ A;  4DBF A;  3QXE B;  2L2P A;  3JB9 J;  2EQU A;  4OB3 B;  3A8G B;  2OTJ Q;  1Y0M A;  4DOV A;  4J9G A;  4ELY C;  1B7T A;  2CZ1 B;  3P8D A;  1UGV A;  4E7S A;  3GLX A;  1UGR B;  2AT1 B;  2KNB B;  2DXT A;  3G6E T;  5KE2 A;  1ZSZ A;  4C92 E;  2HAX A;  3X28 B;  1SF9 A;  5LJ3 h;  2XDD A;  4MMK A;  4F17 A;  4QQ6 A;  2DBM A;  3I56 Q;  3H9N A;  4E7I A;  2EKO A;  4RG2 A;  2JTF A;  4C92 G;  4ZTF A;  1N9R A;  2OTJ T;  1VQP A;  4LNP A;  3CBM A;  5CQY A;  4CC4 B;  3SFM A;  4B9W A;  2ZPB B;  2CSI A;  4J8O A;  1ZSZ C;  1G83 A;  2AZS A;  1WPY A;  2YXY A;  2CP7 A;  4V2S A;  3M0S A;  4KGX B;  3KBG A;  5LJ5 g;  3REB B;  3BW1 A;  5C6S A;  2R58 A;  3HKS A;  3TVT A;  2KQW A;  5HK3 A;  2V1R A;  2L0A A;  3PTA A;  5FRO A;  5LL6 S;  3I56 T;  1LNX A;  5HK0 A;  3OB9 A;  4ME7 A;  4X9D A;  2EYY A;  3QUI A;  1TWB A;  2VXF A;  3UDC A;  3CXC A;  8AT1 B;  1JXM A;  5IHN A;  3JCM f;  1VQK Q;  3M0U A;  4HCB A;  5GJW B;  2MK5 A;  3DB3 A;  1QMC A;  1B3Q A;  3RBB B;  1LVK A;  1O75 A;  3OBW A;  2E3I A;  3VS6 A;  2KMT A;  3URG A;  1WYX A;  4QKU A;  3PIO A;  2K5L A;  1WHG A;  2OAW A;  1VQ4 Q;  1I81 A;  1MMG A;  3OYA A;  3CCM A;  4Z8A A;  4ZTJ A;  1IZ6 A;  1JEG A;  2KRO A;  1V1C A;  1OPL A;  5FU6 B;  1TTH B;  2VUB A;  1IRE B;  2WSE E;  5GMK h;  1SHF A;  3GBQ A;  5LJ5 j;  4C92 B;  5D6W A;  1VQK T;  2M9U A;  5CIU A;  2ZAE A;  2E5Q A;  1H92 A;  3QDR B;  5KYU B;  4RTX A;  4XTZ A;  3I55 T;  1W1F A;  2VYT A;  5GAM h;  1T0H A;  1BI2 A;  2EWN A;  2MWP A;  1I5O B;  1VQ9 Q;  2IIM A;  5LJ5 d;  2LVM A;  1VQ4 T;  1M1K C;  4XAX B;  5IT9 E;  1K8A C;  3BE3 A;  3V8L A;  1YN8 A;  4J9F A;  3HRU A;  1XQH A;  3LGL A;  3JCM X;  4RMO A;  1AZG B;  4JZ3 A;  4A54 A;  4BDZ A;  1QCF A;  1PD0 A;  2RQV A;  4M7D A;  2QQA A;  5KYW B;  3A5Z B;  2X35 A;  4ZGD B;  4J83 A;  1OUL A;  1PWT A;  1VQ9 T;  1VQO Q;  1D0Y A;  5CVI A;  1EZZ B;  3HFO A;  1TUG B;  1AOJ A;  4XTY A;  1TG0 A;  4OB2 B;  2NLU A;  1QW1 A;  5DY9 A;  1TSF A;  2ZCF B;  3PE0 A;  2QDL A;  3M0R A;  3FC3 A;  3CME A;  3E2U A;  2FZG B;  3VKI A;  4DEX A;  4M7D C;  1CKB A;  4II1 A;  1RAD B;  1U1S A;  1G8X A;  1WQW A;  1WX6 A;  2ECZ A;  1KQ2 A;  3CMA Q;  3QZ9 B;  3ULR B;  1IHV A;  3SDZ A;  4BY6 B;  3I5R A;  1VOM A;  4KGZ B;  2FPD A;  1BBZ A;  2RF0 A;  3QDF A;  1VQO T;  4NL2 A;  4RUG A;  5GAN e;  1YWO A;  2RK2 A;  1B34 A;  2YT6 A;  3VYG A;  3QZ5 B;  3JB9 F;  3QII A;  2YUP A;  3M9Q A;  3EFO B;  3HRS A;  2BZY A;  4M78 E;  3VS4 A;  4KH1 B;  3UPU A;  3JCM W;  4LDV A;  4K11 A;  5FWB A;  3H8Z A;  3CCR A;  3A98 A;  2CSQ A;  4GY5 A;  4M78 G;  2E5K A;  4J9H A;  3CMA T;  4E7H A;  2DTO A;  4QT7 A;  1WXU A;  3IQL A;  4KUI A;  3CCS A;  3RDV A;  5GAN 3;  1N6A A;  4LDU A;  1UGQ B;  1WXT A;  3UA7 A;  1NYG A;  2BIV A;  2L5Q A;  4GLM A;  2J6O A;  4XU1 A;  1PSF A;  1JB0 E;  3M57 A;  3MO8 A;  2MCN A;  3NTK A;  2EJG A;  1M8M A;  1ZUU A;  3M5A A;  2GTO A;  4M75 A;  5I2S A;  3LH5 A;  3MKD A;  2DRM A;  2O31 A;  3S6W A;  1FX7 A;  3M56 A;  5L8R E;  4FSX A;  2K57 A;  3V7R A;  3EHQ A;  2XID A;  2ZPH B;  4NOY A;  7AT1 B;  4XU0 A;  3L2Z A;  1JJ2 P;  1M30 A;  4QVD A;  1M8V A;  4RG8 A;  4F7U G;  2HQX A;  3JB9 D;  2AK5 A;  1NEG A;  1HXD A;  1N9S A;  1KHC A;  2ZPE B;  2QAZ A;  2QQB A;  3CPW P;  4M75 C;  2GFU A;  2YRV A;  1D1A A;  3H0I A;  1VQ5 Q;  2RH2 A;  2VC8 A;  4FYX B;  4LUE A;  2DRK A;  4J6Y A;  3H0H A;  4JJN K;  3BY7 A;  1OU8 A;  2CT3 A;  2AKK A;  1WHJ A;  2ZZD A;  3ZBD A;  2D0N A;  4CC3 A;  1BIB A;  2KSS A;  4OMQ A;  3L42 A;  4J9E A;  3SB2 A;  1VQ7 A;  2QEX Q;  2QI2 A;  4LXC A;  2PQW A;  5KYY B;  2JW4 A;  3FLG A;  5FW9 A;  1WIE A;  1WFW A;  3H6Z A;  2DIQ A;  2EGC A;  1KG1 A;  3CC7 A;  4RTT A;  5FRM A;  4M78 B;  2QXF A;  4IUV A;  4CC7 A;  2XK0 A;  1G3Y A;  5J39 A;  3CC4 A;  1QLY A;  1VQ5 T;  4RCB A;  4PJL A;  2FRW A;  2RJF A;  3S3O A;  1YJN A;  5CKE A;  4QW2 A;  3SHW A;  2X9H A;  4J9B A;  3BDL A;  3OYG A;  4HVV A;  2OJ2 A;  1IXD A;  2RI3 A;  5LJ3 e;  4PJO A;  1UDL A;  3EGX B;  1OU9 A;  2QEX T;  2R57 A;  3CCV A;  2D6F A;  3EG9 A;  3PMT A;  1X2K A;  2LNV A;  2RB6 A;  4ZNX A;  4DOW A;  1PKS A;  4PKC C;  1FWZ A;  3JB9 H;  3RKX A;  1YIT A;  3MEU A;  4R0K A;  1C6V X;  3OYC A;  1FMK A;  2EQI A;  1YCS B;  3ZFJ A;  1PG5 B;  2X4W A;  4F7U B;  4PJO C;  1ARK A;  3AHU A;  1S1N A;  3NHN A;  2R5M A;  2EQK A;  2FRY A;  3JAM E;  2E6Z A;  2GQI A;  1OX9 A;  2RHU A;  2ROL A;  3OS2 A;  2XMF A;  4TVR A;  2DZ9 A;  1BK2 A;  2L3Q A;  3PVL A;  4N0A C;  2LT4 A;  2EJF A;  2XIC A;  3QYG B;  3OYD A;  2GNC A;  3ER0 A;  2P0P A;  4A4H A;  2NUP B;  2VKN A;  3JCM P;  2QGG A;  2JOY A;  2XHC A;  1AWJ A;  2QA4 A;  4X9C A;  3QWY A;  2YUN A;  1Y57 A;  4IUT A;  3CXC P;  1MNE A;  2W10 A;  1WHL A;  1NPP A;  2F69 A;  1KJW A;  3OYB A;  2KI7 A;  1YJ9 A;  1I8F A;  1Y07 A;  4N4H A;  3J80 E;  1WHH A;  4Y92 A;  5IHI A;  3CCJ A;  2O4X A;  1X75 C;  3UWN A;  2Y4Y A;  2CS7 A;  4B9X A;  2G3R A;  1I1J A;  4M7A F;  1HYO A;  2O2O A;  3LW5 E;  2EGE A;  5GAO p;  1G3W A;  2E4H A;  5GMK i;  4E7K A;  2Y4X A;  1B07 A;  2A3L A;  2KRN A;  1ZSZ B;  1M2O A;  4EDU A;  3OMC A;  5IXF A;  1BI1 A;  3ZL7 C;  1YI2 Q;  5GMK e;  2P0K A;  1AZE A;  1Y96 A;  1BKB A;  2H3J A;  2RK1 A;  2KYM A;  1ABO A;  4JDS A;  5GAM e;  2LT1 A;  1W2B A;  4L59 A;  3QPH A;  5CR2 A;  1KQS P;  2MI6 A;  4HCZ A;  2BE7 D;  1GXI E;  3C12 A;  1WXB A;  1SPK A;  2HKQ B;  2E3H A;  1NLO C;  4LE9 A;  2JM8 A;  4LDX A;  1M1F A;  3VS1 A;  1RAE B;  2FHD A;  2JTM A;  4KT0 E;  1X43 A;  1ZBJ A;  1YI2 T;  4M7D E;  4EMK A;  2Z0W A;  1K73 U;  1K76 A;  3C94 A;  2CDT A;  2ED0 A;  2DMO A;  3VJP A;  5GAN f;  3GNG A;  5GAN 5;  4M7D G;  4JZ4 A;  2YHT A;  1QVP A;  2W0Z A;  1UUE A;  4M7A D;  2DO3 A;  1MMN A;  1U06 A;  2MWO A;  3CPW A;  2ABL A;  1EFN A;  2PU9 B;  4JPB W;  2HSP A;  3H0F A;  1YJW Q;  4AFU C;  2O88 A;  2KR3 A;  3VRZ A;  2V8K A;  1V29 B;  3TRE A;  4AMC A;  4WCI A;  1M90 U;  4XTX A;  4EMK C;  3N5B B;  1QQJ A;  4M77 F;  1ZX6 A;  1VYU A;  5GAN j;  1JXO A;  2E65 A;  1ACM B;  4C8Q F;  1M5Q 1;  3NGP A;  2HL5 C;  2RI5 A;  4HT8 A;  2CZ7 B;  2L3R A;  3C95 A;  4Q5W A;  2KXD A;  3JV3 A;  1BIA A;  2QQS A;  2LQ8 A;  4R55 A;  1YIJ A;  1HJD A;  1VQ8 A;  1SSH A;  5GAN d;  1SRM A;  3A8O B;  1UHF A;  1ZSG A;  2XDP A;  3L1A A;  3OYF A;  1MMD A;  2A28 A;  1Z9Q A;  1YJW T;  2EAY A;  4HCK A;  1T0J A;  5CO7 A;  2KDS A;  2KRS A;  2AZV A;  3JB9 I;  3DLM A;  4JS5 A;  2GQV A;  2V8I A;  4D8D A;  1SSF A;  3VS7 A;  1D1C A;  1K73 R;  1WNL A;  3NTI A;  2CZ6 B;  1WI7 A;  2Y90 A;  1OZ2 A;  4PJN A;  3HHT B;  2DYB A;  1EX4 A;  1R0B G;  3L2Q A;  1Q86 U;  4E7J A;  2PTK A;  4L5G A;  4OMF B;  3RMS A;  3CC2 A;  3I35 A;  2RJD A;  4Y91 A;  1RAI B;  1TU0 B;  3DKM A;  2RO0 A;  4C5H A;  4EPC A;  2L89 A;  1M1K R;  2R5A A;  5CK9 A;  1K8A R;  1GBQ A;  1NJI U;  1UB4 A;  3JCM g;  2JN0 A;  2ZPG B;  2YRC A;  1AEY A;  3RKW A;  2MPX C;  2QDY B;  2LC4 A;  5A0G A;  4M77 D;  1VQL Q;  1KC8 U;  4M7D B;  2P4R A;  3WVD B;  3CCU Q;  2OTL Q;  4C8Q D;  3RMQ A;  3QJ6 A;  3OYH A;  4BD3 A;  1UGS B;  4J6X A;  4M75 G;  2AHJ B;  3VUB A;  5DLO A;  1LCK A;  1VQ6 A;  3WXM B;  3CCL Q;  1K0X A;  5CKF A;  3RNJ A;  4IIM A;  1YWP A;  4FYW B;  1GCQ A;  1T3L A;  2J6K A;  2J6F A;  3MHX A;  1A0N B;  3D7S B;  1BCM A;  1VYT A;  1Y7X A;  1OOT A;  2RQU A;  1QWF A;  1EIF A;  4DQ2 A;  1N8R U;  2PZ1 A;  2NWM A;  1R0C B;  1IGU A;  1VQL T;  3CCU T;  1N27 A;  1Q86 R;  2OTL T;  2RQR A;  1F1B B;  5LJ3 f;  2QTX A;  1O9S A;  4BE1 A;  3I55 Q;  1VA7 A;  3KXT A;  3UT1 A;  3UAT A;  3RKY A;  1OZ3 A;  3NMZ C;  4BI3 A;  3CCL T;  2CP5 A;  1GCQ C;  1B34 B;  1UEB A;  1PRM C;  3JSC A;  2H3E B;  1UHC A;  3Q1J A;  2CP3 A;  2JMA A;  2KRM A;  1NJI R;  3CBO A;  3M0Q A;  3J81 E;  1VQM Q;  1SHG A;  3G1J A;  2MAM A;  4C0Z A;  3QKJ A;  4FYY B;  4IUR A;  1WQ7 A;  1NE8 A;  6AT1 B;  2LX7 A;  3VS5 A;  1J3T A;  2DLP A;  2DEU A;  1K73 C;  4QVC A;  2F1L A;  2A36 A;  4Z88 A;  2SRC A;  3JCM d;  4PJO E;  2KY9 A;  1JU5 C;  3G6E A;  3G7Z A;  2DL4 A;  4JRQ A;  2MMP A;  1KQS A;  2HL3 A;  3REA B;  2M02 A;  3L2W A;  3LYI A;  3QYH B;  2E64 A;  3QG1 A;  4PJO G;  3MET A;  2K6D A;  4AFQ C;  5M9O A;  1M90 C;  4C5I A;  1VQM T;  3OYM A;  2CP0 A;  2EGA A;  4OMO A;  4M75 B;  1MMA A;  2C0T A;  4FCY A;  2OTJ A;  4UC4 A;  1S72 Q;  3M0T A;  5FLX E;  4Y28 E;  3QJY A;  3THK A;  4XK8 E;  1FMV A;  2M0O A;  1QP3 A;  2WSC E;  2NYS A;  1X69 A;  3A1P A;  4AG2 C;  3OYN A;  1ZQ1 A;  3UF4 A;  5I22 A;  4IIO A;  3HP9 A;  2GF7 A;  2HSE B;  2OI3 A;  3OW2 S;  5J3B A;  3CQT A;  1NG2 A;  4BI8 B;  3I56 A;  5FU7 C;  3LGF A;  1I0C A;  4BB7 A;  1WA7 A;  3PVQ A;  1KQ1 A;  1BYM A;  5DLQ E;  2KK4 A;  2ZPF B;  3OA6 A;  1S72 T;  1Q86 C;  2DTI A;  4A4E A;  1QWE A;  4QQD A;  1NEB A;  5DM7 R;  4QQG A;  4EIK A;  1LPL A;  5GAM f;  2C0I A;  1D3B A;  2RHY A;  3TQ7 P;  1NJI C;  5GMK j;  1D0Z A;  4BI4 A;  4F14 A;  2K2M A;  1KC8 C;  2QAS A;  1U8R A;  2HKN A;  4FIB A;  4AG1 C;  1E6G A;  2KT8 A;  1QVG S;  1NM7 A;  5CAI A;  3G71 Q;  2KVQ G;  2K3B A;  2M1H A;  4D8K A;  1VUB A;  4DBQ A;  5GAM j;  2EYZ A;  3NPF A;  1QCO A;  5I2M A;  4PJO B;  1QVF S;  2GCX A;  3FJP A;  2JMC A;  4XU3 A;  3EH2 A;  1I5L A;  3EG9 B;  4ZGJ B;  4JRK A;  3CCE Q;  1OYX A;  1VQK A;  2L3S A;  5GAM d;  1R8O B;  2VGN A;  4KBM B;  1PM3 A;  1N8R C;  3M54 A;  1GFD A;  4AFZ C;  4JLI A;  3I9Q A;  3OYI A;  2E12 A;  4PK4 A;  1W2B P;  5KYX A;  1VQ4 A;  2HDA A;  3G71 T;  2KEA A;  3KUF A;  3HSB A;  2YWW A;  1JJ2 S;  2EYX A;  1OI1 A;  1D09 B;  4GLK A;  1M3B A;  2CYZ B;  1NBE B;  1W6X A;  1BU1 A;  4F7U E;  4C92 F;  2CKK A;  3VV0 A;  3A8L B;  1WHM A;  4RTW A;  3CCE T;  1RAB B;  5CCA A;  5A2Q E;  4PJM A;  3HPW A;  2FO0 A;  2GFA A;  1VQ9 A;  3EFS A;  3EH1 A;  1FXX A;  2DA9 A;  2CGH A;  2FZK B;  3X24 B;  5GAN 8;  4PLI A;  2CT4 A;  3RR6 A;  2P84 A;  4PFP A;  5FRN A;  5GMK l;  2ENM A;  1ABQ A;  1R77 A;  1PNJ A;  3FIF A;  1IB8 A;  4MZP A;  2DFU A;  1MND A;  2O4X B;  4MZT A;  1K4U S;  2KAF A;  2XG8 D;  4XTW A;  4RKU E;  2PNI A;  2JM9 A;  1E6H A;  3U23 A;  2FZC B;  2KT1 A;  2RD1 A;  4D6W A;  1ZUK A;  3RUX A;  1K9A A;  4XU2 A;  1C0M A;  1QCN A;  1VQO A;  2DTH A;  2KXC A;  1PD1 A;  3G4S Q;  2COY A;  5KYN A;  5GAN 6;  1X6O A;  1Y96 B;  2I2L A;  4EMG A;  2QQR A;  1TUC A;  4J9I A;  1IGQ A;  1ZUY A;  3OS0 A;  2PVD B;  4C92 D;  3EGD A;  1RAF B;  4FSS A;  4DBH A;  1PSE A;  4A4F A;  4N4G A;  2K5F A;  2DVJ A;  4IKF A;  3CMA A;  2NUT A;  1K1Z A;  1M1G A;  2JZ2 A;  3P8B B;  4PJJ A;  1VQN Q;  3G4S T;  5HKC A;  4EMK B;  3PGG A;  5LJ5 e;  2VGM A;  2X3X D;  2F2X A;  2CRE A;  1D0X A;  1AD5 A;  4CRI A;  2D8H A;  2QQ9 A;  3KFV A;  2DIL A;  5D6Y A;  2JUF A;  3OS5 A;  1OQK A;  2VVK A;  3M4Y A;  2FYK A;  5D6X A;  2EJ9 A;  3O5Z A;  1E7O A;  2EYW A;  3SEM A;  2RJC A;  1G3S A;  1BB9 A;  1G3T A;  2SEM A;  1YIJ Q;  3PIP A;  1XJW B;  4IUU A;  2B86 A;  3CXC S;  4BE2 A;  1VQN T;  3PFS A;  3QSU A;  5GMK m;  2A08 A;  4C0D C;  2HD0 A;  4M7A A;  2DL5 A;  1K9M U;  3OYK A;  4P5N A;  2VXE A;  2JS2 A;  4FYV B;  1TH7 A;  1AHJ B;  4E7Z A;  2K4Y A;  2AIR B;  3JCM J;  2RQW A;  2BTT A;  3M4G A;  5I11 A;  2CH4 W;  4ATO A;  2JJ9 A;  2P0Q A;  4VUB A;  1N5Z A;  1QKW A;  1CKA A;  2K3X A;  2RA2 A;  1YIJ T;  2FEI A;  4RTY A;  1VQ8 T;  1TXQ A;  1VQP Q;  2I0N A;  2K3Y A;  3EFR A;  1NYF A;  5KH6 A;  1ZHI A;  1WLP B;  2C06 A;  4M7A C;  3RES A;  3RER A;  1DJ7 B;  3CEY A;  3PNW C;  2RQT A;  5GAO l;  3ZEH A;  5GAN g;  1YNZ A;  1GL5 A;  3NTH A;  1V76 A;  2NUZ A;  1G5V A;  2FPF A;  1VQ5 A;  5CKH A;  2HQE A;  4ZGE B;  1MV0 B;  2VAS A;  4OML A;  3E19 A;  2DM1 A;  4GBQ A;  2LX9 A;  4FT4 A;  2CP6 A;  2A0F B;  2RJE A;  2DL3 A;  3NFC A;  2DVE A;  2RMO A;  2QEX A;  3QO3 A;  1VQP T;  2EPD A;  2JVV A;  4E6R A;  2DXC A;  3CD6 A;  4XTU A;  4RCC A;  3JCM Q;  1GCP A;  3LLR A;  3SWN A;  4A53 A;  1JRI A;  3OYY A;  3S3N A;  1VYV A;  4M78 F;  2X51 A;  1GFC A;  4ZN3 A;  3E9G A;  2LQW A;  3M0P A;  2COW A;  1WJR A;  2QTV A;  1NPR A;  3VUZ A;  1KHI A;  1YP5 A;  3QWX X;  2L8D A;  4C0F A;  1RI0 A;  4KGV B;  3MEV A;  4OB0 B;  3INZ A;  2H8H A;  1VQ6 T;  1X6G A;  2C0O A;  3A8M B;  1C1A A;  4M77 A;  2GBQ A;  2LCC A;  4C8Q A;  2V8J A;  3L2R A;  1ZLM A;  3SWN C;  1TOV A;  1XNI A;  3CCM Q;  2WSF E;  4R56 A;  3R6N A;  3OBY A;  1PRL C;  2HBP A;  2K2V A;  4F16 A;  3JCM b;  4A4K A;  2LRQ A;  4BDY A;  2JXB A;  3QHS A;  1RLP C;  1FMW A;  3V8K A;  3VS3 A;  4IUQ A;  1UEC A;  1UTI A;  3OYJ A;  4RTZ A;  3BDU A;  4M77 C;  2DET A;  4MDW A;  4F7U F;  3JB9 G;  1AWW A;  4C8Q C;  3CCQ A;  3HRT A;  5HCK A;  1M3A A;  2K9G A;  2ATC B;  2LDM A;  2FG0 A;  5CKB A;  5GAN 7;  2IG0 A;  4M4Z A;  1PKT A;  3OQ5 A;  2DPP B;  3TEE A;  3CCM T;  1YHQ A;  2PUK B;  1Z9Z A;  2BE9 B;  4M78 D;  5GAO n;  3X26 B;  5GAO m;  3LWI A;  1RAA B;  3MEW A;  4BUG A;  3MPU B;  2LZ6 B;  4WF2 A;  3OSV A;  3PT9 A;  4C0G A;  1W4S A;  2X4X A;  2RI2 A;  2E1H A;  3RIR A;  2XDB A;  5CQX A;  5HY6 A;  2EW3 A;  3HL8 A;  3JCM h;  3OY9 A;  1LJO A;  1KD1 U;  3FB9 A;  5KCH A;  2EBP A;  5FU7 B;  1AWO A;  2DL8 A;  2B8A A;  2D8J A;  1M90 R;  1NLP C;  5IAY A;  4M75 E;  4LDW A;  1K9M C;  5LJ5 h;  5LJ3 g;  5GJV B;  2J7I A;  4HCC A;  4A63 B;  1U1T A;  2BUD A;  2MOX A;  4KH0 B;  4ESR A;  3WVE B;  3CME Q;  1SEM A;  4HKE A;  2FPE A;  1IRX A;  2DD4 A;  3TSW A;  1PC0 A;  1HSQ A;  1YI2 A;  1Q7Y U;  5IH2 A;  1PCX A;  2D0Q B;  4OMP A;  2O01 E;  1H3H A;  2K5I A;  3EGU A;  3I5S A;  1RI9 A;  2EFI A;  1WHK A;  4CI0 C;  4JUV A;  1P92 A;  1RL2 A;  2LJ1 A;  1M4Z A;  4IUP A;  3LWH A;  4ANJ A;  3TU4 K;  4DEY A;  2LQK A;  3MJX A;  3CME T;  1D3B B;  1HK9 A;  3CCR Q;  3V7S A;  4L6V 5;  2ZPI B;  4O5V A;  1M2V A;  4JS4 A;  2DX1 A;  1KD1 R;  2RM4 A;  1WGS A;  2P4T A;  5D7U A;  2J06 A;  1JO8 A;  1SG5 A;  3GOX A;  2KBT A;  3CCS Q;  3GIB A;  1JQQ A;  4PNO A;  1KC8 R;  5LJ3 j;  2YDL A;  5LJ5 f;  2DER A;  1T3S A;  2DE0 X;  2DZC A;  2XI9 A;  1YJW A;  2VWF A;  3VRY A;  2X3W D;  2YLB A;  1Q7Y R;  2DF6 A;  4X1V A;  1X01 A;  3CCR T;  2JTE A;  5LJ3 d;  1QKX A;  2PVG B;  4JJD A;  2HNI A;  4OMM A;  4KUL A;  4AT1 B;  1SKU B;  1VIF A;  1HD3 A;  3LH0 A;  1WZO A;  4LUD A;  2CZ0 B;  2LJ3 A;  3C0C A;  3VS2 A;  5KYX B;  1IHW A;  1BI0 A;  1KK7 A;  1M3C A;  3CCS T;  2GGR A;  2LJ0 A;  5IN1 A;  3TCJ A;  1N8R R;  2D9T A;  2HMA A;  3EHR A;  4KRT A;  2EYQ A;  3MCA B;  4AFS C;  1GRI A;  3EAE A;  1ZBX A;  1RLQ C;  3PMI A;  2FL7 A;  2KE9 A;  4YTL A;  1JBM A;  5GAM g;  2DD5 A;  4HA8 A;  2DAQ A;  3FDR A;  4A4G A;  1UGP B;  1H3Z A;  2COZ A;  1XTD A;  4J7I A;  3SD4 A;  3AT1 B;  1RAG B;  4RTU A;  3M53 A;  1VQ7 Q;  4JJB A;  1NZ9 A;  3OMG A;  1CSK A;  1X2Q A;  1PHT A;  2DKG A;  2DXU A;  2XKO C;  3CC7 Q;  3GP8 A;  2AKL A;  2DIG A;  4M7A E;  3CC4 Q;  2F2V A;  3HFN A;  3A8H B;  1TS9 A;  1YJN Q;  3X20 B;  4M7D F;  4PLL A;  3TSZ A;  1KD1 C;  1VQL A;  4M7A G;  3CCU A;  2JNG A;  2ROT A;  2OTL A;  3ASK A;  3OW2 P;  1M27 C;  4HVW A;  2EQM A;  3GPL A;  1VQ7 T;  3CCL A;  4FU6 A;  3CCV Q;  2DJZ A;  1AVZ C;  2E6N A;  4KUD K;  2J05 A;  3DLL A;  1WDX A;  1Q95 G;  2G6F X;  3CC7 T;  2K79 A;  3BFM A;  1MV3 A;  3VS0 A; 
#chains in the Genus database with same CATH homology
 1K76 A;  2CDT A;  2ED0 A;  2DMO A;  1JXM A;  1K1Z A;  5IHN A;  4JZ4 A;  3M0U A;  2W0Z A;  5GJW B;  1UUE A;  1U06 A;  2ABL A;  2GTJ A;  1EFN A;  4JPB W;  2HSP A;  1B3Q A;  2KYB A;  2X3X D;  3RBB B;  2F2X A;  3H0F A;  2CRE A;  1AD5 A;  4AFU C;  2O88 A;  2KR3 A;  3VRZ A;  3VS6 A;  2D8H A;  1WYX A;  1GBR A;  3KFV A;  2DIL A;  2OAW A;  2JS0 A;  4WCI A;  1W70 A;  2VVK A;  4Z8A A;  1OPK A;  1JEG A;  2KRO A;  1ZX6 A;  1VYU A;  5EC7 A;  1JXO A;  1V1C A;  1OPL A;  3O5Z A;  1E7O A;  3NGP A;  2EYW A;  3SEM A;  1BB9 A;  1SHF A;  3GBQ A;  2SEM A;  2KXD A;  2B86 A;  3JV3 A;  2CH4 A;  1KFZ A;  1HJD A;  3VS0 A;  1SSH A;  1SRM A;  1H92 A;  1UHF A;  1ZSG A;  2A28 A;  2A08 A;  4RTX A;  1W1F A;  1Z9Q A;  1T0H A;  2DL7 A;  2DL5 A;  4HCK A;  1T0J A;  2JS2 A;  2IIM A;  2KRS A;  2AZV A;  3EG1 A;  4D8D A;  2RQW A;  2BTT A;  4ORZ A;  3VS7 A;  1IO6 A;  1WI7 A;  5I11 A;  2CH4 W;  1YN8 A;  2LMJ A;  4J9F A;  2DYB A;  1FYN A;  1N5Z A;  1QKW A;  1CKA A;  2PTK A;  5IXB A;  4OMN A;  3I35 A;  2FEI A;  4RTY A;  1AZG B;  1OV3 A;  2I0N A;  1NYF A;  2JT4 A;  1WLP B;  1U5S A;  2HCK A;  4JZ3 A;  1QCF A;  2RQV A;  2M0Y A;  4CC2 A;  2RQT A;  2ESW A;  1GBQ A;  1YNZ A;  2K7A A;  1GL5 A;  2NUZ A;  1PWT A;  2FPF A;  1AEY A;  1MV0 B;  4OML A;  2P4R A;  2DM1 A;  4GBQ A;  1AOJ A;  1TG0 A;  2DL3 A;  3PE0 A;  2QDL A;  3M0R A;  1LCK A;  2RMO A;  1K0X A;  2EPD A;  4E6R A;  3RNJ A;  4DEX A;  4IIM A;  1YWP A;  1CKB A;  1GCP A;  1GCQ A;  1T3L A;  1MUZ A;  1AWX A;  2J6K A;  1WX6 A;  2J6F A;  1VYV A;  1GFC A;  2ECZ A;  1A0N B;  2KGT A;  3ULR B;  1VYT A;  2LQW A;  3M0P A;  3I5R A;  2FPD A;  1BBZ A;  1G2B A;  1OOT A;  2RF0 A;  1YP5 A;  3QWX X;  2RPN A;  2RQU A;  1QWF A;  2CUD A;  2LNH B;  4RUG A;  1YWO A;  2PZ1 A;  2NWM A;  1OEB A;  2YT6 A;  2H8H A;  2RQR A;  2LCS A;  1X6G A;  2C0O A;  2YUP A;  2GBQ A;  2BZY A;  3VS4 A;  1VA7 A;  2EVR A;  3UAT A;  3NMZ C;  2DNU A;  1ZLM A;  1GCQ C;  4K11 A;  1PRM C;  5FWB A;  2DBK A;  3R6N A;  1PRL C;  3A98 A;  4F16 A;  1UHC A;  2CSQ A;  2E5K A;  2JMA A;  2KRM A;  3M0Q A;  4LN2 A;  4J9H A;  4HXJ A;  1SHG A;  2JXB A;  4QT7 A;  1WXU A;  3IQL A;  1K0S A;  2V1Q A;  2LX7 A;  3VS5 A;  1J3T A;  1RLP C;  3VS3 A;  2RNA A;  2DLP A;  1UEC A;  1UE9 A;  1UTI A;  1WXT A;  3UA7 A;  1NYG A;  4RTZ A;  4GLM A;  2J6O A;  1AWW A;  2A36 A;  4Z88 A;  5ECA A;  1X27 A;  2SRC A;  5HCK A;  1M3A A;  2K9G A;  2MCN A;  1JU5 C;  1XOV A;  1M8M A;  1ZUU A;  4JJC A;  2GTO A;  2FG0 A;  2DL4 A;  5L23 A;  4J9D A;  1UFF A;  3LH5 A;  1PKT A;  2DRM A;  4M4Z A;  2O31 A;  3REA B;  1U3O A;  1Z9Z A;  1H8K A;  3EHQ A;  1UJ0 A;  2K6D A;  2RN8 A;  4AFQ C;  2LP5 A;  2EGA A;  2HBW A;  4OMO A;  2CUB A;  2BZX A;  2C0T A;  1RUW A;  2LZ6 B;  1M30 A;  3M0T A;  2O9V A;  3THK A;  1UJY A;  2AK5 A;  1NEG A;  2M51 A;  2EW3 A;  1X69 A;  2EBP A;  3H0I A;  4AG2 C;  1AWO A;  2DL8 A;  2O9S A;  4Z89 A;  2D8J A;  3UF4 A;  4LUE A;  5I22 A;  2DRK A;  1NLP C;  4IIO A;  1UG1 A;  3H0H A;  2YUO A;  2OI3 A;  2LQN A;  3CQT A;  5GJV B;  1NG2 A;  2CT3 A;  2AKK A;  2J7I A;  4A63 B;  4RTV A;  2DJQ A;  2MOX A;  4ESR A;  2D0N A;  4CC3 A;  3EG2 A;  4OMQ A;  3H41 A;  1I0C A;  2ED1 A;  4J9E A;  1WA7 A;  3PVQ A;  3FJ5 A;  1SEM A;  2FPE A;  3TSW A;  2JW4 A;  5FW9 A;  1WIE A;  5FWC A;  1WFW A;  1HSQ A;  2EGC A;  5IH2 A;  1QWE A;  4RTT A;  1NEB A;  4OMP A;  4CC7 A;  1H3H A;  2EKH A;  1QLY A;  3EGU A;  2L3P A;  3I5S A;  4EIK A;  1RI9 A;  2FRW A;  2D1X A;  2C0I A;  3SHW A;  3EG0 A;  4J9B A;  3UA6 A;  2HEQ A;  4HVV A;  2LJ1 A;  2OJ2 A;  4F14 A;  2K2M A;  4DEY A;  1TUD A;  1UDL A;  5IHK A;  4AG1 C;  1E6G A;  2KT8 A;  2YSQ A;  2BZ8 A;  1NM7 A;  2A37 A;  1X2K A;  2K3B A;  4D8K A;  2DX1 A;  4ZNX A;  1PKS A;  2EYZ A;  3EG3 A;  2J06 A;  3NPF A;  4HVU A;  1JO8 A;  4J9C A;  1X6B A;  2JMC A;  2KBT A;  1JQQ A;  4R0K A;  2YUQ A;  1FMK A;  1SRL A;  2EQI A;  2L3S A;  2YDL A;  1YCS B;  1T3S A;  2DE0 X;  1I07 A;  1ARK A;  1KIK A;  1GFD A;  4AFZ C;  1S1N A;  2VWF A;  3I9Q A;  3NHN A;  2FRY A;  3VRY A;  2X3W D;  2GQI A;  2MIO A;  2ROL A;  2DF6 A;  2XMF A;  4X1V A;  1KSW A;  2HDA A;  2JTE A;  1QKX A;  2F2W A;  1BK2 A;  2L3Q A;  2KEA A;  4JJD A;  3PVL A;  4OMM A;  1HD3 A;  2EYX A;  2L2P A;  4LUD A;  1M3B A;  2GNC A;  2LJ3 A;  3C0C A;  3VS2 A;  1W6X A;  1BU1 A;  1M3C A;  2VKN A;  2GGR A;  1Y0M A;  2LJ0 A;  4J9G A;  4RTW A;  3EHR A;  1AWJ A;  4KRT A;  3QWY A;  4AFS C;  1GRI A;  2YUN A;  1Y57 A;  1RLQ C;  1UGV A;  2W10 A;  1KJW A;  2KE9 A;  2FO0 A;  2KNB B;  4Y92 A;  5IHI A;  2DA9 A;  2CT4 A;  1I1J A;  4F17 A;  2DBM A;  2ENM A;  1ABQ A;  2O2O A;  2EGE A;  1PNJ A;  4RTU A;  1K4U S;  1B07 A;  2KRN A;  4JJB A;  4LNP A;  1CSK A;  4CC4 B;  1X2Q A;  5IXF A;  1PHT A;  3ZL7 C;  2PNI A;  2JM9 A;  1AZE A;  1E6H A;  3U23 A;  2AKL A;  2KT1 A;  2CSI A;  1ZUK A;  2F2V A;  1K9A A;  1G83 A;  2AZS A;  2KYM A;  1ABO A;  3M0S A;  2KXC A;  3REB B;  3TSZ A;  3TVT A;  2V1R A;  2L0A A;  2ROT A;  1TUC A;  1M27 C;  4HVW A;  4J9I A;  1ZUY A;  1WXB A;  1SPK A;  1NLO C;  4FSS A;  4LE9 A;  2JM8 A;  3VS1 A;  1AVZ C;  2J05 A;  1X43 A;  1ZBJ A;  2EYY A;  1WDX A;  2G6F X;  2K79 A;  1MV3 A;  2DVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...