2CSQA

Solution structure of the second sh3 domain of human rim-binding protein 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
97
structure length
97
Chain Sequence
b'GSSGSSGTDPGAEELPARIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEIQADDEEMMDQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIM binding protein 2
publication title Solution structure of the second SH3 domain of human RIM-binding protein 2
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 7
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2csqA01
2OJ2A 1YWPA 1OPKA 4DEXA 1GBRA 4OMQA 1JQQA 2J7IA 1UDLA 1ZX6A 2EVRA 2DL4A 3THKA 3EGUA 1SHGA 1X6GA 2CSIA 2JMAA 2RQRA 4E6RA 1MV3A 2LQNA 2F2VA 2DBMA 4HCKA 1X69A 5IXBA 2DILA 1T0JA 2H8HA 1NYFA 4F14A 2O88A 4LN2A 1X43A 1AZEA 2EGCA 2X3WD 2RNAA 1SSHA 5FW9A 1WLPB 1GRIA 3H0HA 2K6DA 1BU1A 2ABLA 4HVVA 3RNJA 1H3HA 2JS0A 1OOTA 2DVJA 2KYMA 2CUBA 5GJVB 4ZNXA 4AG1C 1BK2A 3VRZA 2DX1A 5L23A 3A98A 1GFDA 1NM7A 2BZXA 1ZBJA 1J3TA 1AWXA 1TUCA 2HBWA 3FJ5A 1E6GA 1ZUUA 1ARKA 1PRMC 1PNJA 4RTVA 2FG0A 3UF4A 2KBTA 4GBQA 4Z89A 1W70A 2J05A 2C0TA 4X1VA 4OMLA 2JM9A 1WI7A 4AFZC 1M3BA 1MUZA 1AWWA 3I5RA 1NYGA 2DL8A 1YNZA 2KROA 2K79A 4R0KA 3NPFA 1OPLA 2ECZA 2RPNA 2D1XA 4JJDA 1QCFA 1AWOA 4JZ4A 2DMOA 4J9DA 1M30A 1QKWA 1RI9A 2A08A 2FPEA 2KT1A 3RBBB 2GBQA 1WA7A 1CKAA 1MV0B 2DL7A 3EG2A 3UATA 1CKBA 1YP5A 2KEAA 1UGVA 1AVZC 2LQWA 2FEIA 1PKTA 3EG0A 1GFCA 1QKXA 2D8JA 2ROTA 1NLOC 3U23A 4RUGA 3I5SA 2GQIA 1PRLC 1YN8A 2JS2A 1OV3A 2LNHB 3VRYA 4F17A 1M8MA 4OMOA 1PHTA 2MIOA 2D0NA 2AZSA 3O5ZA 2KXDA 2HSPA 2V1RA 1CSKA 2A28A 2DRMA 3H41A 1JXMA 1T0HA 1Y0MA 2ROLA 2DM1A 1RLQC 2JW4A 3M0RA 1WX6A 2RF0A 2KGTA 3EHRA 1M27C 2JM8A 3NGPA 1PKSA 4K11A 1WYXA 2DL3A 3VS5A 1S1NA 4RTZA 5IHNA 1SPKA 1QWEA 2KRMA 2YSQA 1Z9ZA 1IO6A 2AZVA 3REAB 1UUEA 2I0NA 2YUOA 1ZUYA 1UE9A 1AEYA 1AD5A 2ENMA 2LJ1A 1SEMA 2NWMA 1K76A 2FO0A 1NLPC 1T3SA 5IXFA 4HXJA 1WFWA 3VS4A 2MCNA 4J9HA 2RN8A 2CT4A 1H8KA 1ZLMA 2GGRA 3VS1A 2M51A 2L3SA 2GTJA 2LJ3A 2EPDA 3VS6A 3EHQA 4DEYA 1FMKA 3KFVA 1VYTA 4RTXA 1U06A 4Y92A 1KFZA 1UJYA 2KT8A 4RTTA 2JT4A 3UA6A 2XMFA 3NMZC 1WDXA 1SRMA 2CT3A 1UECA 2G6FX 1W1FA 4RTWA 2V1QA 3SEMA 1VYVA 2DL5A 1QWFA 3QWXX 2M0YA 2LJ0A 4Z8AA 3I9QA 1ZSGA 2EGAA 4J9EA 4CC3A 1B3QA 1UHFA 3CQTA 1M3CA 3M0SA 3PVQA 3NHNA 2JMCA 1WXUA 3M0UA 2DRKA 2CREA 4RTUA 3LH5A 2KE9A 2BZ8A 1G83A 4HVUA 1TG0A 3ULRB 2J6KA 2DE0X 1GCQC 3QWYA 2B86A 2KR3A 2YDLA 2DF6A 2O9VA 3TSZA 4OMMA 1KJWA 1X2QA 1AWJA 2ED0A 1GCPA 2PTKA 3C0CA 2ED1A 1K9AA 3EG3A 2EYWA 4J9GA 2DLPA 2VKNA 4A63B 2K7AA 4LUEA 1VA7A 1KSWA 2LZ6B 1G2BA 2EQIA 2J6OA 2W10A 3JV3A 1GBQA 2CSQA 2KNBB 5HCKA 1GL5A 3ZL7C 5I22A 2A37A 1X6BA 1HD3A 5FWBA 1XOVA 2F2WA 2X3XD 2BTTA 2A36A 2FRYA 5I11A 2JTEA 1QLYA 1I1JA 1TUDA 1JXOA 4CC4B 5IH2A 4J9FA 1JU5C 2SEMA 4J9CA 4ORZA 2YUNA 2EYZA 3VS0A 2KYBA 3GBQA 4J9BA 1UHCA 1E6HA 4AFUC 1GCQA 2OI3A 2EYXA 1YCSB 3H0IA 4JJCA 2E5KA 2QDLA 4WCIA 2VVKA 1N5ZA 2KXCA 2EYYA 2LP5A 3M0TA 4M4ZA 4QT7A 1UTIA 2FPDA 1X27A 3TVTA 1OEBA 1UFFA 4J9IA 2YUPA 2PZ1A 1NG2A 2MOXA 1UG1A 3VS2A 2OAWA 4F16A 4CC7A 1A0NB 4OMPA 4RTYA 1W6XA 4LUDA 1T3LA 3VS7A 1WIEA 4LE9A 1ZUKA 4JJBA 1PWTA 1I07A 2DJQA 2C0IA 2GNCA 2KRSA 2L3PA 2RQTA 2L0AA 4HVWA 2J6FA 3EG1A 1HJDA 4AG2C 4D8KA 2YT6A 2HDAA 2RQVA 1HSQA 1B07A 1V1CA 2FRWA 3TSWA 2J06A 4JPBW 4CC2A 2D8HA 2K3BA 2KRNA 1K0XA 2CH4A 1BB9A 2EBPA 2P4RA 2L3QA 5EC7A 1RLPC 2ESWA 4FSSA 2O9SA 1VYUA 2O31A 5IHIA 3IQLA 3PE0A 1KIKA 1UJ0A 3R6NA 1I0CA 4Z88A 2DYBA 3UA7A 2DA9A 2YUQA 2IIMA 2RQUA 2LX7A 2HCKA 2CDTA 1E7OA 3M0QA 1SRLA 5FWCA 5GJWB 2AKKA 1YWOA 5IHKA 2JXBA 1SHFA 2BZYA 1WXBA 2K9GA 1JO8A 3H0FA 2RMOA 3M0PA 1X2KA 2EW3A 2O2OA 2CH4W 2DBKA 4IIOA 1Y57A 3REBB 4OMNA 1RUWA 1JEGA 2DNUA 2CUDA 1M3AA 1ABOA 5ECAA 3SHWA 4EIKA 1LCKA 1U3OA 1AOJA 2SRCA 1WXTA 2FPFA 1BBZA 2HEQA 1K1ZA 1H92A 3VS3A 4GLMA 4ESRA 1K4US 4AFSC 1Z9QA 2AKLA 2EGEA 2F2XA 2C0OA 2K2MA 3PVLA 4LNPA 1U5SA 4IIMA 1NEBA 1AZGB 2W0ZA 1ABQA 1K0SA 2VWFA 2NUZA 1FYNA 3I35A 2RQWA 2LCSA 4AFQC 4D8DA 2L2PA 1NEGA 2LMJA 2EKHA 2GTOA 2AK5A 1EFNA 4JZ3A 2PNIA 4KRTA
chains in the Genus database with same CATH superfamily
7AT1B 4XU3A 1YWPA 4DEXA 1GBRA 4OMQA 3JCMd 5LJ3g 3CMAA 3G6EA 3MCAB 2J7IA 1ZX6A 1R0CB 1QVPA 2CSIA 3OS1A 2QA4Q 3JCMW 5IXBA 2DILA 2M9UA 2ZPFB 1YIJA 1XNIA 1VQ5Q 1K73R 1EIFA 2O88A 3SWNB 1AZEA 2X3WD 1EX4A 1WLPB 2LNVA 3H0HA 4HCZA 1VQMQ 2QK0A 1WJSA 4DBRA 1OOTA 4EMGA 1G3YA 3NTHA 3BY7A 2DX1A 3CMAQ 1OZ2A 4FSXA 1YJWT 1KQSP 3EFRA 4C92C 3H9NA 1YIJQ 3TCJA 1Y07A 2HBWA 2JN0A 2ZPGB 1PNJA 2G3RA 4RTVA 4FT2A 4A54A 2X4XA 3EGXB 3L2RA 1G8XA 1W70A 3OBWA 2NUPB 4BE2A 2C0TA 4X1VA 3VUZA 1M4ZA 3RDVA 5KE2A 1MUZA 3I5RA 3QJ6A 2DL8A 3ZFJA 5CO7A 1U8RA 4F7UG 3KXTA 4GY5A 3T9NA 2K79A 1FXXA 1YJ9A 1OPLA 1OZ3A 4JJDA 1AWOA 4XTYA 4PJOG 2HKNA 2ZPHB 3A8OB 2GCXA 2DXCA 3FB9A 2RK1A 3LGLA 1XJWB 2HZYA 2K57A 5LJ5g 1HYOA 2KMTA 1K9MR 3PMTA 1CKAA 2DL7A 2HNIA 1UGVA 3QZ9B 1LNXA 4M7DD 1QMCA 3J7AF 1YFNA 2MK5A 4N4IA 1PG5B 1QKXA 2L5QA 5GAMd 1BI3A 3CCRT 2D8JA 1VQNA 1UGRB 2GQIA 5CK9A 3VRYA 2JNGA 4PJLA 1M8MA 3QYGB 3FLGA 4LDWA 3S3OA 2D0NA 4M77A 3JB9I 4QQDA 4E7IA 1V29B 1SSFA 5KYWB 2EYQA 3H41A 1T0HA 2MYSA 2HD0A 1I5LA 2YWWA 1D1BA 3M0RA 2JW4A 5GAN5 3Q1JA 4X34A 4FL6A 4BY6B 2RF0A 2KGTA 4JUVA 2IVWA 1M27C 2JM8A 4QVZA 3VS5A 1S1NA 4RTZA 5KYUA 5IHNA 4M77G 2CP7A 3REAB 2YUOA 1ZUYA 4BI4A 2F1LA 2LVMA 2L89A 2CZ7B 3P8BB 4ZN1A 1NLPC 1ZSZB 4JLGA 5J26A 4HXJA 2MCNA 4JS4A 4J9HA 2XICA 5GAMf 4M7DC 3OYNA 4M7AD 1VQ8Q 1IRXA 4M75E 4E7JA 5I2MA 1ZLMA 1IHVA 3VS1A 4M77E 3CCMT 1VQ6A 5LJ5d 1FMKA 3KFVA 2DIGA 5GAOq 3DB3A 4RTXA 2KSSA 5FU6C 2OTJA 3NMZC 2CT3A 1SRMA 3HPWA 1M5Q1 1W1FA 4RTWA 1ZA2B 2XDBA 3VYHB 2E6NA 1VYVA 2M0YA 4D6WA 3CBPA 4LD6A 3I9QA 1ZSGA 4MDXA 4CC3A 2E3IA 1KC8R 1VQ6Q 3FRNA 3PVQA 1YI2Q 2JMCA 5GANg 2BZ8A 2OTJQ 1KQ1A 4NOYA 1TG0A 2FZGB 3OYDA 1MHNA 3OMCA 2DE0X 1GCQC 5KYNA 1KJWA 2JTFA 4M7AC 2PTKA 3RMQA 4XTVA 2RJEA 2EYWA 4PJNA 3A8HB 4PFPA 3CC2A 2VKNA 2K7AA 5IN1A 4L6V5 2KAFA 2DERA 1ZQ1A 3CCST 1GBQA 2KNBB 4XAXB 3MKDA 2EAYA 4A4HA 1GL5A 3ZL7C 2A37A 3CCJT 1JB0E 2EQUA 4ZGDB 1HD3A 2V8IA 1QCNA 5FWBA 1QVGA 3QKJA 3LWHA 2F2WA 3LWIA 4PFOA 2A36A 3HL8A 1TUDA 2LQKA 2VXFA 3X25B 4DA4A 4E7KA 5A0DA 1TWBA 2FYKA 1IXDA 4LD9K 2RK2A 1BI0A 1D3BA 2EYZA 1H3ZA 3SFMA 3VS0A 4BY6C 4ZTJA 1S72T 3GOXA 2HL5C 2RHXA 4AFUC 2EYXA 3MJXA 1WJQA 1N5ZA 4J6YA 5GANd 4N0AC 2Y90A 1JRIA 2LP5A 2QG9B 3M0TA 3JCMb 1VQKQ 3PIPA 1VQ4T 4ME7A 4FYVB 4J9IA 2YUPA 4KGZB 1OX8A 4EMKC 2BKDN 1UG1A 1ZSZC 3TREA 3M59A 4J6WA 3EAEA 3ZBDA 3CPWA 2HQXA 1WNLA 4KUIA 3DLMA 1I07A 5KYXA 2KRSA 2RQTA 2R58A 1P92A 3HFNA 3ME9A 2J6FA 2F5TX 4D8KA 2DXUA 4M78B 1RADB 1D0XA 4N4HA 1PSEA 1BYMA 4QQ6A 2RO0A 2QQSA 2RQVA 4XK8E 1B07A 4CC2A 2DYIA 3RIRA 1K0XA 3RMSA 2ESWA 5LJ3e 3FDRA 3ER0A 5IHIA 4OB3B 1U1SA 2AIRB 3OYMA 1I0CA 2CGHA 5GMKl 4QKUA 4OB1B 2CDTA 1SRLA 5GJWB 2K5FA 1M9SA 4M75F 4QVDA 2PUOB 2AKKA 2GFUA 1JJ2S 3QXEB 5IHKA 2YRCA 2EQMA 2KDSA 3CPWP 1VQOA 3M4YA 2K9GA 1KD1U 2QQRA 4B9XA 2QA4T 4NL3A 2VGNA 4LDVA 1X2KA 2EW3A 2O2OA 4X9DA 1VQ5T 2E10A 3EH2A 2KVQG 4QQGA 4IIOA 4HA8A 3CPFA 4FW1A 1VQMT 1ABOA 3SWNA 4A53A 2FPFA 4M78F 3PGGA 3VS3A 3J80E 3CXCS 5A0GA 3CCVA 4BD3A 3CMAT 4RKUE 1Z9QA 1QP2A 2ZPBB 1N9RA 2AKLA 2EGEA 2ZZDA 2F2XA 3A5ZB 1I5OB 2X4JA 4LNPA 2WACA 1YIJT 1NEBA 1K0SA 2A7YA 2NUZA 3I35A 3M54A 1M90R 2KK4A 4D8DA 2HAXA 2LMJA 2P0PA 4C5IA 2GTOA 1EFNA 4KULA 1FWZA 3S3MA 4PJOC 4OMFB 1IREB 2PNIA 3OYGA 3OA6A 1NJIU 1OPKA 3EGXA 3CCVQ 2D9TA 1NPRA 2PVGB 1V76A 1UDLA 2EVRA 2NUPA 3N5BB 2RJCA 3BFMA 2F2VA 4HCKA 3JCMQ 3MP1A 3OYKA 3HRSA 3MO8A 1T0JA 1SG5A 4F14A 4HT9A 1X43A 3RKXA 1SSHA 2K6DA 2ABLA 4HVVA 3JCMP 3E9FA 2JS0A 4O6JA 5GJVB 4JS5A 4B9WA 5CAIA 3FEOA 3CCEA 2ZGWA 2BZXA 4IUVA 1ZBJA 2HBPA 2WSEE 5A0LA 3A8GB 1J3TA 1YJ9T 3CBMA 4PNOA 2DEUA 4UC4A 1ZUUA 1PRMC 4J83A 4M77C 3UF4A 1TSFA 2JVVA 2RB6A 4C5EA 4GBQA 3EFOB 2PU9B 2JM9A 3CCEQ 1O75A 3OQ5A 5KYWA 1NPPA 4FW2A 1YNZA 5J3BA 1KHIA 4FIBA 1JJ2P 1VQNT 3NPFA 2FHDA 1Y96B 1NBEB 2D1XA 1QCFA 4C92F 4J9DA 2GFAA 1M30A 2EJFA 3VYGA 2A08A 3JB9H 5GAN6 1TXQA 2FPEA 2KT1A 4TVRA 1IB8A 2DFUA 1Q82U 5CQXA 2E12A 2RA2A 4CI0C 3EG2A 3JB9F 2MWOA 2XHCA 2KEAA 4OF1A 2D6FA 2FEIA 1QVFS 1PKTA 3CXCP 3I55A 1GFCA 4MMLA 2ROTA 3U23A 4RUGA 1WQWA 3I5SA 2JS2A 2LNHB 2DZ9A 1VQPQ 1PHTA 4XQ3A 4NL2A 1M2OA 3O5ZA 1EZZB 2A28A 1C0MA 1Y0MA 4PLLA 1KQSA 1ZBXA 1WHJA 3CCLQ 5GAOp 3NGPA 3I55Q 1PKSA 1WPYA 2DL3A 3UWNA 1VQ6T 2ZPEB 1YI2T 3S6WA 1SPKA 3P8HA 2JTMA 2YSQA 1WHLA 1VQ9A 2WSCE 2OTJT 4M7DB 1ZA1B 1C1AA 5AT1B 2ENMA 2LJ1A 2RD1A 3VU3C 5FLXE 5IXFA 1WFWA 3GNFB 2XKOC 2FVUA 5FU6B 2HMAA 3EGDB 1TU0B 3VS6A 3EHQA 4EPCA 4DEYA 2X51A 3QUIA 1VQ9Q 1U06A 4Y92A 3S3NA 2E6ZA 2X35A 4RTTA 2JT4A 3UA6A 2XMFA 1WDXA 3MEWA 3OBYA 2V1QA 2XI9A 3G7ZA 4C8QB 1G3SA 2LQ8A 2LDMA 3JCMf 1QWFA 3G71Q 5GAN8 2EJ9A 2NLUA 3OYHA 3QIIA 2LRQA 3MEVA 4J9EA 1KG1A 1TOVA 3JSCA 3CC2T 3CQTA 5GAN7 3NHNA 4M7DF 1OULA 1IZ6A 1WXUA 3M0UA 1W2BP 3OW2S 3PTAA 3LH5A 3OYLA 4HVUA 4M7AB 4E7SA 4ZTFA 2LC4A 5LJ3d 3ULRB 3R6OA 2XK0A 1N6AA 2HSEB 2KR3A 1MMNA 1BIAA 2DF6A 3TSZA 4OMMA 1X2QA 2ED0A 4KH0B 2ED1A 1X6OA 3CC7Q 4BE1A 2YRVA 4OB2B 5CKBA 5L8RE 3PIOA 1M90C 2QI2A 8AT1B 1G2BA 2EQIA 4M75A 2CSQA 4JRKA 5HCKA 1WHMA 2HKQB 2MWPA 3C94A 1WQ7A 5GAN4 3NFCA 4J7IA 1RAHB 2COZA 5I11A 2YLBA 2JTEA 1QLYA 2JOYA 1VQ8A 2EQKA 8ATCB 4M7AF 3RKWA 4M75G 5LJ3f 4M78A 4BUGA 2NUTB 1YHQA 4C8QD 1IGQA 4F04B 1RL2A 1OQKA 2R5AA 5CKFA 4C0GA 3H0IA 2BUDA 1M2VB 2E5KA 1RAFB 4WCIA 4EMKB 3M58A 2EYYA 1N8RU 1D1CA 3OMGA 4M4ZA 1NZ9A 4BE0A 2FPDA 1X27A 3TVTA 1M1KU 1OEBA 3HRTA 1WHHA 4M78G 4FCYA 2PZ1A 4E7HA 1YHQQ 1A0NB 1YI2A 1RAAB 2P0KA 5AYFA 5KCHA 1NE8A 1W6XA 4N4GA 3UDCA 4ZGEB 4BDZA 3GP8A 3L2WA 2PUKB 1PWTA 2VYTA 2C0IA 1YITA 1Q81U 4II1A 2LX9A 4AT1B 4BDYA 4HVWA 4RG8A 1TUGB 4M78E 1R77A 1VQOT 5CR2A 2DEQA 3OSSC 2DIQA 1KK7A 4LDXA 3KUFA 1WGSA 2FRWA 2CS7A 1MMGA 2OTLA 4C8QC 4Y91A 2ZPIB 4OGCA 1BB9A 4R55A 5EC7A 1MNDA 1TS9A 2DKGA 4R56A 3OW2P 2RI3A 1R0BG 3IQLA 3QO3A 3CCQQ 4Z88A 2VASA 4DOWA 4KGVB 1YITQ 2HCKA 3BE3A 1E7OA 5CIUA 3M0QA 5FWCA 3QHSA 3OYCA 3CCVT 3NTIA 2QQ9A 4CRIA 5LJ5f 4B6MA 1SHFA 1MMDA 1UEBA 3CEYA 2OTLQ 1Q7YU 2CH4W 2CP3A 5FRMA 3REBB 5GAMj 2YHTA 1WJRA 1RUWA 2DNUA 2CUDA 5ECAA 1DJ7B 2ZAEA 1U3OA 1AOJA 1YBYA 4VUBA 2EFIA 1BBZA 2HEQA 1H92A 4F7UB 4ESRA 1K4US 1YJWQ 2DTOA 1KD1R 4C92A 1VQKA 1OU9A 3PVLA 5GMKi 2O4XA 4ANJA 1LVKA 1XQHA 4PJOB 1U5SA 1YCYA 2IG0A 2FZCB 3JCMX 1RACB 4AFQC 3E2UA 2EKHA 5CKHA 4GLKA 2D0QB 4JZ3A 2EQJA 2DXBA 4IUUA 5I21A 5KCOA 2OJ2A 1PSFA 3QPHA 3CCET 2PVOB 4C92G 2LCCA 3I56Q 3EH1A 3EFOA 5FU7C 3EGUA 1SHGA 5GMKj 2EIFA 2Y4XA 1X69A 1VQLA 3JB9G 4O5VA 1N8RC 2H8HA 1NYFA 4LN2A 5HY6A 2EGCA 2PQWA 4P5NA 2MF2A 1R8OB 1M1KC 1PD0A 4XU0A 1Y96A 2DO3A 5KYYB 3WVEB 4F7UF 1NJIR 1JBMA 4C92E 2DVJA 2KYMA 3NTKA 3LH0A 4ZNXA 1BK2A 3VRZA 3L1AA 4FU6A 4MZPA 1K8AU 2WSFE 3TQ7P 4M77B 1PC0A 5D6YA 3GNGA 1M1FA 3O8VA 1RAIB 3INZA 3RERA 1Q81C 1VQLQ 5D6XA 1HK9A 1TUCA 1FMVA 3FJ5A 1E6GA 3EG9B 2Y4YA 4JRQA 1RAEB 3V8KA 1YJNA 2OAUA 5GANf 4PLIA 4Z89A 2LT1A 2MPXC 4EDUA 4PJOD 4AFZC 1M3BA 2YXYA 1NYGA 4ZGJB 3I55T 1IGUA 2BE7D 2QEXA 3PFSA 3OY9A 2ECZA 2XD0A 4C0DC 3CD6Q 2RPNA 3LW5E 4JZ4A 2DMOA 1YJNQ 3UPUA 3OS0A 1Q7YC 3HTRA 4KT0E 4M7DA 2ATCB 2GBQA 3MP6A 4LDYA 1MV0B 5GAMe 1AVZC 4JDSA 3CCMQ 4KH1B 2FL7A 5GAMh 4JLIA 3ZEHA 1NLOC 5HKCA 2QEXQ 1PRLC 1YN8A 2F5KA 1OV3A 4F17A 2DZCA 3RUXA 1VQ9T 2MIOA 2X9HA 3EGDA 2KXDA 3L42A 3CBOA 2HSPA 4M7DG 2CYZB 2V1RA 1CSKA 2DRMA 4M77D 2XDDA 2DAQA 1Q82R 3WXMB 3V7CA 3ASKA 1I81A 4XU1A 2DM1A 3KBGA 1D0ZA 5GAOr 3EHRA 2CP2A 4K11A 3X24B 1WYXA 2K4YA 1SKUB 3M4GA 1H641 4E2FB 1MGQA 4C0ZA 1LPLA 1Z9ZA 1IO6A 1G3TA 5KH6A 1UUEA 4ATOA 1U1TA 1AEYA 4PFZA 4M7DE 1AD5A 1SEMA 2H3JA 2NWMA 5EG2A 1B7TA 5GMKh 4M7AA 3CCUA 3VS4A 1UGSB 4BI8B 2RN8A 1JJ2A 3CC7T 5LL6S 2CT4A 1PD1A 4QW2A 2GGRA 3MEAA 5LJ5h 2GTJA 5DM7R 3E1SA 4FYWB 1SF9A 2RH2A 4RMOA 3MEUA 4M75C 1AT1B 3PT9A 1KFZA 1UJYA 2V8KA 3CCJQ 2O01E 4BI3A 4M7AG 5DLQE 1UECA 3L2ZA 1M8VA 4L59A 3CCUQ 3CXCA 2DL5A 4EMHA 1D3BB 4Z8AA 2LTOA 2EGAA 2HQEA 3BW1A 2QGGA 3J81E 4LXCA 4HKEA 1UHFA 5M9OA 1MMAA 3SB2A 4A4EA 2DPPB 3M56A 2CREA 1S72Q 2KE9A 3L2UA 3F70A 1FX7A 4M7AE 1VQPA 2J6KA 4ZN3A 4A4KA 2NUTA 2ZCFB 3OYFA 1KD1C 3QWYA 2B86A 3JB9J 2QQAA 4N0AA 4MMKA 2O9VA 2P0QA 3OYBA 3C0CA 4DBQA 1K9AA 3EG3A 2GQVA 1M2VA 4EMKA 1F1BB 2CZ1B 2QAZA 3A8MB 1VQ8T 1ZSZA 3CCLA 4A63B 1VA7A 1HXDA 5CQYA 2J6OA 2W10A 1YHQT 2MMPA 2XU8A 1B34B 1X6BA 1VIFA 3DLLA 4JRIA 3M53A 2X3XD 1W4SA 2BTTA 4Y28E 3C4SA 3CC4A 3V7RA 1I1JA 4DQ2A 5IH2A 1JU5C 2SEMA 1D09B 1TTHB 3GIBA 1IHWA 1VQ7A 4HCBA 4J9CA 1GXIE 3VUBA 1QP3A 4MZTA 2YUNA 3M57A 1NJIC 2DTIA 2YRDA 4J7FA 3GBQA 4J9BA 1UHCA 3QBYA 1E6HA 2QYZA 3EFSA 2QTVA 1YCSB 4JJCA 2QDLA 5GANh 1YITT 5C0MA 4MDWA 2KXCA 5J39A 4X9CA 3CC4Q 4QT7A 1W2BA 1Y7XA 3G71A 1UTIA 4PJJA 2R5MA 3G4SA 1UFFA 2M02A 2VB6A 4XTXA 3H6ZA 1VQ7Q 1MNEA 2OTLT 3HKSA 3AT1B 4F16A 4RTYA 4J8OA 4LUDA 3WVDB 2RHYA 2MAMA 5GAMg 3MHXA 4LE9A 1O9SA 2DJQA 1N8RR 2L3PA 5CVIA 3G6EQ 3EG1A 4AG2C 1QVFA 1M1KR 2YT6A 3CC7A 1RABB 3G4SQ 2KQWA 4F7UA 2CP5A 1HSQA 2K2VA 2J06A 3VV0A 3OYAA 2D8HA 2K3YA 4A4GA 2K3BA 2KRNA 2CH4A 2P4RA 2AT1B 1RLPC 2BE9B 4FSSA 2DETA 2O31A 2VXEA 4PJOA 5GAOm 4DOVA 3PE0A 3JCMJ 3HRUA 1Q81R 2X4YA 2C06A 1YWOA 3I56T 2A3LA 2JXBA 4HT8A 2BZYA 1WXBA 4DBFA 1VQKT 1JO8A 5DLOA 4C5HA 5FROA 2RMOA 2EWNA 3M0PA 3X28B 5IAYA 3JCMc 2DBKA 1QVFP 1Q82C 4OMNA 1Q86U 1M3AA 4EIKA 3C12A 1LCKA 4C8QF 3GF5A 2RI5A 4BB7A 3QJYA 5C6SA 2PVDB 5HK0A 2QDYB 5KYYA 4F7UE 4GLMA 3SD4A 4AFSC 2C0OA 1Q7YR 1YJ9Q 4YTLA 2DK3A 1VQLT 5FRNA 4PJOE 4IIMA 2VV5A 2W0ZA 2VWFA 4XTUA 1K73U 2DJZA 4LDUA 4JRPA 3OYYA 2BIVA 2AK5A 3BDLA 3EG9A 5FU7B 3E9GA 2XG8D 2KI7A 3M55A 4FYYB 2EKOA 1JQQA 4IUTA 3THKA 2DL4A 1OI1A 2A0FB 1X6GA 1VQNQ 2JMAA 2RQRA 4E6RA 2GF7A 1MV3A 2LQNA 3CMEA 2DBMA 3OW2A 1RI0A 4L5GA 3OYJA 3CD6T 2Z0WA 2RNAA 5FW9A 1GRIA 2EJGA 1BIBA 1BU1A 1X75C 2MI6A 1YJNT 3RNJA 1UGPB 2HL3A 3BDUA 1H3HA 3CCQA 3SWNC 2CUBA 4AG1C 1QVGS 1N27A 5L23A 3A98A 3JRZA 2E64A 1GFDA 1NM7A 3RESA 3PMIA 3OYEA 1X01A 3MP8A 3CMEQ 4E7ZA 2QEXT 1AWXA 2QTXA 1BI1A 1ARKA 2LT4A 2RM4A 2FG0A 1Q95G 3OYIA 3P8DA 2KBTA 4IURA 2CZ6B 1OYXA 4KUDK 2J05A 1BKBA 4OMLA 1BCMA 1PCXA 1K8AR 5LJ3j 1WI7A 4C0DB 1AWWA 1K9MU 1G5VA 2HQHA 1YJWA 2KROA 4R0KA 2CP0A 1OX9A 3HFOA 3X20B 3RR6A 4OB0B 2NYSA 1QKWA 1RI9A 3V7SA 2P84A 3CPWS 1OU8A 3RBBB 1WA7A 2LCLA 2M1HA 3UATA 1CKBA 5D7UA 1YP5A 1Q86C 2LQWA 3EG0A 3I56A 3A1PA 2RHIA 1D1AA 5GAN3 4OMOA 4IKFA 3JCMV 4PJMA 2AZSA 3LLRA 2K5LA 2M0OA 4Q5WA 1JXMA 3CCUT 2QQBA 1K73C 2ROLA 3JCMe 3OSVA 1RLQC 1WX6A 3JCMh 3CC2Q 2DXTA 3CCRA 1LOJA 2RJDA 1QWEA 2I2LA 2KRMA 4J6XA 4XTZA 2AZVA 2I0NA 3OB9A 1UE9A 3FIFA 2FB7A 5GAN2 5CKDA 1K76A 5LJ5j 2FO0A 2CZ0B 5I2SA 1T3SA 3PNWC 4KBMB 4OP0A 3LYIA 2CKKA 2XIDA 2E65A 5CCAA 1XTDA 2YLCA 4M75B 1H8KA 2E70A 1QVGP 3TEEA 2M51A 4PJOF 3CCRQ 2L3SA 2LJ3A 3UT1A 2EPDA 4FT4A 1KC8U 1VYTA 2E4HA 3LGFA 3CD6A 2KT8A 1VQPT 2P4TA 3L2QA 3M9QA 2G6FX 3SEMA 2COYA 2QASA 2CP6A 3OS2A 3QWXX 1B34A 2LJ0A 5KYUB 2H3EB 4JJNK 2DD5A 1QCOA 4HCCA 1B3QA 3CCLT 3CCMA 1M3CA 3M0SA 1I8FA 2RI2A 4QVCA 2DRKA 4RTUA 4PK4A 6AT1B 4KGXB 3URGA 1K9MC 1G83A 5LJ3h 4MZMA 2QGFB 3QG1A 2RJFA 2COWA 2YDLA 4RCCA 3V8JA 1KHCA 1AWJA 1GCPA 5IT9E 4M77F 2IPOB 3CC4T 4J9GA 3VKIA 4XU2A 1BI2A 2DLPA 4LUEA 1VQ7T 1KSWA 2LZ6B 3JV3A 4J5YA 1VIEA 3QDFA 4OGEA 3JAME 2X4WA 1WHKA 4M75D 5I22A 2DTHA 2JZ2A 1XOVA 3VJPA 2E3HA 1M1GA 3G6ET 2FRYA 3QSUA 1VQOQ 2DD4A 4C0FA 3G71T 1JXOA 1WZOA 2VGMA 4CC4B 5KE3A 4J9FA 3FC3A 3G4ST 4C8QA 2XDPA 1D0YA 2RHUA 2OX7A 5GANj 4ORZA 3CCSA 3QZ5B 2KYBA 3OS5A 4M78D 2E1HA 2L3RA 1GCQA 2OI3A 4AMCA 5GMKe 3CCJA 2JJ9A 2VVKA 3QYHB 2VUBA 1BCOA 3DB4A 1LJOA 2DVEA 3HSBA 3MPUB 4V2SA 2R57A 4C8QG 2M16A 1I4K1 1G3WA 2RHZA 1FMWA 5A2QE 5LJ5e 1NG2A 2MOXA 1QW1A 3VS2A 2OAWA 4CC7A 4PL6A 3CCSQ 3A8LB 4OMPA 2VC8A 1C6VX 2V26A 1T3LA 3VS7A 1S72A 1K8AC 1WIEA 3GPLA 4C92B 1ZUKA 1WHGA 4JJBA 3HHTB 4XTWA 4DBHA 1KC8C 2GNCA 4IUQA 3X26B 2L0AA 4C8QE 2O4XB 1HJDA 1KQSS 2FZKB 4A4FA 4IUPA 5GAOl 4NS5A 4OVAA 1VQ4A 2QXFA 4FYXB 2HDAA 1VUBA 3GLXA 4ELYC 4RCBA 1V1CA 3TSWA 4JPBW 3AHUA 3C95A 2EBPA 2L3QA 4M78C 2E5QA 4Z02A 2O9SA 1VYUA 3JCMg 4E7LA 1KIKA 4PKCC 1UJ0A 3R6NA 2DYBA 3UA7A 4C5GA 2DA9A 2YUQA 2IIMA 2RQUA 2LX7A 1KQ2A 1W2BS 1VQ4Q 5DY9A 1ACMB 1UB4A 3H0FA 1QQJA 3DKMA 5GMKm 1AHJB 2KY9A 1Y57A 2AHJB 5KYXB 2K3XA 3E19A 1JEGA 1RAGB 3SHWA 1M90U 5HK3A 1N9SA 4BACA 3V8LA 1TH7A 2SRCA 1WXTA 2L8DA 3TU4K 3D7SB 4ELZC 1K1ZA 5GAOn 2JUFA 1Y71A 2K5IA 1ZHIA 1VOMA 4FM4B 3LX7A 3HP9A 3RKYA 2K2MA 2QA4A 3CMET 3SDZA 3M5AA 4C92D 3L2VA 2F69A 3H8ZA 1VQ5A 1AZGB 1UGQB 1ABQA 5D6WA 4WTOB 2E41A 1FYNA 1Q86R 5CKEA 9ATCB 2RQWA 3FJPA 2LCSA 3G1JA 2L2PA 4RG2A 3QDRB 1VQMA 1NEGA 2B8AA 1PM3A 2V8JA 4E47A 3JB9D 3META 5GANe 3CCQT 4WF2A 4KRTA
chains in the Genus database with same CATH topology
2OJ2A 1YWPA 1OPKA 4DEXA 1GBRA 4OMQA 1JQQA 2J7IA 1UDLA 1ZX6A 2EVRA 2DL4A 3THKA 3EGUA 1SHGA 1X6GA 2CSIA 2JMAA 2RQRA 4E6RA 1MV3A 2LQNA 2F2VA 2DBMA 4HCKA 1X69A 5IXBA 2DILA 1T0JA 2H8HA 1NYFA 4F14A 2O88A 4LN2A 1X43A 1AZEA 2EGCA 2X3WD 2RNAA 1SSHA 5FW9A 1WLPB 1GRIA 3H0HA 2K6DA 1BU1A 2ABLA 4HVVA 3RNJA 1H3HA 2JS0A 1OOTA 2DVJA 2KYMA 2CUBA 5GJVB 4ZNXA 4AG1C 1BK2A 3VRZA 2DX1A 5L23A 3A98A 1GFDA 1NM7A 2BZXA 1ZBJA 1J3TA 1AWXA 1TUCA 2HBWA 3FJ5A 1E6GA 1ZUUA 1ARKA 1PRMC 1PNJA 4RTVA 2FG0A 3UF4A 2KBTA 4GBQA 4Z89A 1W70A 2J05A 2C0TA 4X1VA 4OMLA 2JM9A 1WI7A 4AFZC 1M3BA 1MUZA 1AWWA 3I5RA 1NYGA 2DL8A 1YNZA 2KROA 2K79A 4R0KA 3NPFA 1OPLA 2ECZA 2RPNA 2D1XA 4JJDA 1QCFA 1AWOA 4JZ4A 2DMOA 4J9DA 1M30A 1QKWA 1RI9A 2A08A 2FPEA 2KT1A 3RBBB 2GBQA 1WA7A 1CKAA 1MV0B 2DL7A 3EG2A 3UATA 1CKBA 1YP5A 2KEAA 1UGVA 1AVZC 2LQWA 2FEIA 1PKTA 3EG0A 1GFCA 1QKXA 2D8JA 2ROTA 1NLOC 3U23A 4RUGA 3I5SA 2GQIA 1PRLC 1YN8A 2JS2A 1OV3A 2LNHB 3VRYA 4F17A 1M8MA 4OMOA 1PHTA 2MIOA 2D0NA 2AZSA 3O5ZA 2KXDA 2HSPA 2V1RA 1CSKA 2A28A 2DRMA 3H41A 1JXMA 1T0HA 1Y0MA 2ROLA 2DM1A 1RLQC 2JW4A 3M0RA 1WX6A 2RF0A 2KGTA 3EHRA 1M27C 2JM8A 3NGPA 1PKSA 4K11A 1WYXA 2DL3A 3VS5A 1S1NA 4RTZA 5IHNA 1SPKA 1QWEA 2KRMA 2YSQA 1Z9ZA 1IO6A 2AZVA 3REAB 1UUEA 2I0NA 2YUOA 1ZUYA 1UE9A 1AEYA 1AD5A 2ENMA 2LJ1A 1SEMA 2NWMA 1K76A 2FO0A 1NLPC 1T3SA 5IXFA 4HXJA 1WFWA 3VS4A 2MCNA 4J9HA 2RN8A 2CT4A 1H8KA 1ZLMA 2GGRA 3VS1A 2M51A 2L3SA 2GTJA 2LJ3A 2EPDA 3VS6A 3EHQA 4DEYA 1FMKA 3KFVA 1VYTA 4RTXA 1U06A 4Y92A 1KFZA 1UJYA 2KT8A 4RTTA 2JT4A 3UA6A 2XMFA 3NMZC 1WDXA 1SRMA 2CT3A 1UECA 2G6FX 1W1FA 4RTWA 2V1QA 3SEMA 1VYVA 2DL5A 1QWFA 3QWXX 2M0YA 2LJ0A 4Z8AA 3I9QA 1ZSGA 2EGAA 4J9EA 4CC3A 1B3QA 1UHFA 3CQTA 1M3CA 3M0SA 3PVQA 3NHNA 2JMCA 1WXUA 3M0UA 2DRKA 2CREA 4RTUA 3LH5A 2KE9A 2BZ8A 1G83A 4HVUA 1TG0A 3ULRB 2J6KA 2DE0X 1GCQC 3QWYA 2B86A 2KR3A 2YDLA 2DF6A 2O9VA 3TSZA 4OMMA 1KJWA 1X2QA 1AWJA 2ED0A 1GCPA 2PTKA 3C0CA 2ED1A 1K9AA 3EG3A 2EYWA 4J9GA 2DLPA 2VKNA 4A63B 2K7AA 4LUEA 1VA7A 1KSWA 2LZ6B 1G2BA 2EQIA 2J6OA 2W10A 3JV3A 1GBQA 2CSQA 2KNBB 5HCKA 1GL5A 3ZL7C 5I22A 2A37A 1X6BA 1HD3A 5FWBA 1XOVA 2F2WA 2X3XD 2BTTA 2A36A 2FRYA 5I11A 2JTEA 1QLYA 1I1JA 1TUDA 1JXOA 4CC4B 5IH2A 4J9FA 1JU5C 2SEMA 4J9CA 4ORZA 2YUNA 2EYZA 3VS0A 2KYBA 3GBQA 4J9BA 1UHCA 1E6HA 4AFUC 1GCQA 2OI3A 2EYXA 1YCSB 3H0IA 4JJCA 2E5KA 2QDLA 4WCIA 2VVKA 1N5ZA 2KXCA 2EYYA 2LP5A 3M0TA 4M4ZA 4QT7A 1UTIA 2FPDA 1X27A 3TVTA 1OEBA 1UFFA 4J9IA 2YUPA 2PZ1A 1NG2A 2MOXA 1UG1A 3VS2A 2OAWA 4F16A 4CC7A 1A0NB 4OMPA 4RTYA 1W6XA 4LUDA 1T3LA 3VS7A 1WIEA 4LE9A 1ZUKA 4JJBA 1PWTA 1I07A 2DJQA 2C0IA 2GNCA 2KRSA 2L3PA 2RQTA 2L0AA 4HVWA 2J6FA 3EG1A 1HJDA 4AG2C 4D8KA 2YT6A 2HDAA 2RQVA 1HSQA 1B07A 1V1CA 2FRWA 3TSWA 2J06A 4JPBW 4CC2A 2D8HA 2K3BA 2KRNA 1K0XA 2CH4A 1BB9A 2EBPA 2P4RA 2L3QA 5EC7A 1RLPC 2ESWA 4FSSA 2O9SA 1VYUA 2O31A 5IHIA 3IQLA 3PE0A 1KIKA 1UJ0A 3R6NA 1I0CA 4Z88A 2DYBA 3UA7A 2DA9A 2YUQA 2IIMA 2RQUA 2LX7A 2HCKA 2CDTA 1E7OA 3M0QA 1SRLA 5FWCA 5GJWB 2AKKA 1YWOA 5IHKA 2JXBA 1SHFA 2BZYA 1WXBA 2K9GA 1JO8A 3H0FA 2RMOA 3M0PA 1X2KA 2EW3A 2O2OA 2CH4W 2DBKA 4IIOA 1Y57A 3REBB 4OMNA 1RUWA 1JEGA 2DNUA 2CUDA 1M3AA 1ABOA 5ECAA 3SHWA 4EIKA 1LCKA 1U3OA 1AOJA 2SRCA 1WXTA 2FPFA 1BBZA 2HEQA 1K1ZA 1H92A 3VS3A 4GLMA 4ESRA 1K4US 4AFSC 1Z9QA 2AKLA 2EGEA 2F2XA 2C0OA 2K2MA 3PVLA 4LNPA 1U5SA 4IIMA 1NEBA 1AZGB 2W0ZA 1ABQA 1K0SA 2VWFA 2NUZA 1FYNA 3I35A 2RQWA 2LCSA 4AFQC 4D8DA 2L2PA 1NEGA 2LMJA 2EKHA 2GTOA 2AK5A 1EFNA 4JZ3A 2PNIA 4KRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJ2 A;  1YWP A;  1OPK A;  4DEX A;  1GBR A;  4OMQ A;  1JQQ A;  2J7I A;  1UDL A;  1ZX6 A;  2EVR A;  2DL4 A;  3THK A;  3EGU A;  1SHG A;  1X6G A;  2CSI A;  2JMA A;  2RQR A;  4E6R A;  1MV3 A;  2LQN A;  2F2V A;  2DBM A;  4HCK A;  1X69 A;  5IXB A;  2DIL A;  1T0J A;  2H8H A;  1NYF A;  4F14 A;  2O88 A;  4LN2 A;  1X43 A;  1AZE A;  2EGC A;  2X3W D;  2RNA A;  1SSH A;  5FW9 A;  1WLP B;  1GRI A;  3H0H A;  2K6D A;  1BU1 A;  2ABL A;  4HVV A;  3RNJ A;  1H3H A;  2JS0 A;  1OOT A;  2DVJ A;  2KYM A;  2CUB A;  5GJV B;  4ZNX A;  4AG1 C;  1BK2 A;  3VRZ A;  2DX1 A;  5L23 A;  3A98 A;  1GFD A;  1NM7 A;  2BZX A;  1ZBJ A;  1J3T A;  1AWX A;  1TUC A;  2HBW A;  3FJ5 A;  1E6G A;  1ZUU A;  1ARK A;  1PRM C;  1PNJ A;  4RTV A;  2FG0 A;  3UF4 A;  2KBT A;  4GBQ A;  4Z89 A;  1W70 A;  2J05 A;  2C0T A;  4X1V A;  4OML A;  2JM9 A;  1WI7 A;  4AFZ C;  1M3B A;  1MUZ A;  1AWW A;  3I5R A;  1NYG A;  2DL8 A;  1YNZ A;  2KRO A;  2K79 A;  4R0K A;  3NPF A;  1OPL A;  2ECZ A;  2RPN A;  2D1X A;  4JJD A;  1QCF A;  1AWO A;  4JZ4 A;  2DMO A;  4J9D A;  1M30 A;  1QKW A;  1RI9 A;  2A08 A;  2FPE A;  2KT1 A;  3RBB B;  2GBQ A;  1WA7 A;  1CKA A;  1MV0 B;  2DL7 A;  3EG2 A;  3UAT A;  1CKB A;  1YP5 A;  2KEA A;  1UGV A;  1AVZ C;  2LQW A;  2FEI A;  1PKT A;  3EG0 A;  1GFC A;  1QKX A;  2D8J A;  2ROT A;  1NLO C;  3U23 A;  4RUG A;  3I5S A;  2GQI A;  1PRL C;  1YN8 A;  2JS2 A;  1OV3 A;  2LNH B;  3VRY A;  4F17 A;  1M8M A;  4OMO A;  1PHT A;  2MIO A;  2D0N A;  2AZS A;  3O5Z A;  2KXD A;  2HSP A;  2V1R A;  1CSK A;  2A28 A;  2DRM A;  3H41 A;  1JXM A;  1T0H A;  1Y0M A;  2ROL A;  2DM1 A;  1RLQ C;  2JW4 A;  3M0R A;  1WX6 A;  2RF0 A;  2KGT A;  3EHR A;  1M27 C;  2JM8 A;  3NGP A;  1PKS A;  4K11 A;  1WYX A;  2DL3 A;  3VS5 A;  1S1N A;  4RTZ A;  5IHN A;  1SPK A;  1QWE A;  2KRM A;  2YSQ A;  1Z9Z A;  1IO6 A;  2AZV A;  3REA B;  1UUE A;  2I0N A;  2YUO A;  1ZUY A;  1UE9 A;  1AEY A;  1AD5 A;  2ENM A;  2LJ1 A;  1SEM A;  2NWM A;  1K76 A;  2FO0 A;  1NLP C;  1T3S A;  5IXF A;  4HXJ A;  1WFW A;  3VS4 A;  2MCN A;  4J9H A;  2RN8 A;  2CT4 A;  1H8K A;  1ZLM A;  2GGR A;  3VS1 A;  2M51 A;  2L3S A;  2GTJ A;  2LJ3 A;  2EPD A;  3VS6 A;  3EHQ A;  4DEY A;  1FMK A;  3KFV A;  1VYT A;  4RTX A;  1U06 A;  4Y92 A;  1KFZ A;  1UJY A;  2KT8 A;  4RTT A;  2JT4 A;  3UA6 A;  2XMF A;  3NMZ C;  1WDX A;  1SRM A;  2CT3 A;  1UEC A;  2G6F X;  1W1F A;  4RTW A;  2V1Q A;  3SEM A;  1VYV A;  2DL5 A;  1QWF A;  3QWX X;  2M0Y A;  2LJ0 A;  4Z8A A;  3I9Q A;  1ZSG A;  2EGA A;  4J9E A;  4CC3 A;  1B3Q A;  1UHF A;  3CQT A;  1M3C A;  3M0S A;  3PVQ A;  3NHN A;  2JMC A;  1WXU A;  3M0U A;  2DRK A;  2CRE A;  4RTU A;  3LH5 A;  2KE9 A;  2BZ8 A;  1G83 A;  4HVU A;  1TG0 A;  3ULR B;  2J6K A;  2DE0 X;  1GCQ C;  3QWY A;  2B86 A;  2KR3 A;  2YDL A;  2DF6 A;  2O9V A;  3TSZ A;  4OMM A;  1KJW A;  1X2Q A;  1AWJ A;  2ED0 A;  1GCP A;  2PTK A;  3C0C A;  2ED1 A;  1K9A A;  3EG3 A;  2EYW A;  4J9G A;  2DLP A;  2VKN A;  4A63 B;  2K7A A;  4LUE A;  1VA7 A;  1KSW A;  2LZ6 B;  1G2B A;  2EQI A;  2J6O A;  2W10 A;  3JV3 A;  1GBQ A;  2CSQ A;  2KNB B;  5HCK A;  1GL5 A;  3ZL7 C;  5I22 A;  2A37 A;  1X6B A;  1HD3 A;  5FWB A;  1XOV A;  2F2W A;  2X3X D;  2BTT A;  2A36 A;  2FRY A;  5I11 A;  2JTE A;  1QLY A;  1I1J A;  1TUD A;  1JXO A;  4CC4 B;  5IH2 A;  4J9F A;  1JU5 C;  2SEM A;  4J9C A;  4ORZ A;  2YUN A;  2EYZ A;  3VS0 A;  2KYB A;  3GBQ A;  4J9B A;  1UHC A;  1E6H A;  4AFU C;  1GCQ A;  2OI3 A;  2EYX A;  1YCS B;  3H0I A;  4JJC A;  2E5K A;  2QDL A;  4WCI A;  2VVK A;  1N5Z A;  2KXC A;  2EYY A;  2LP5 A;  3M0T A;  4M4Z A;  4QT7 A;  1UTI A;  2FPD A;  1X27 A;  3TVT A;  1OEB A;  1UFF A;  4J9I A;  2YUP A;  2PZ1 A;  1NG2 A;  2MOX A;  1UG1 A;  3VS2 A;  2OAW A;  4F16 A;  4CC7 A;  1A0N B;  4OMP A;  4RTY A;  1W6X A;  4LUD A;  1T3L A;  3VS7 A;  1WIE A;  4LE9 A;  1ZUK A;  4JJB A;  1PWT A;  1I07 A;  2DJQ A;  2C0I A;  2GNC A;  2KRS A;  2L3P A;  2RQT A;  2L0A A;  4HVW A;  2J6F A;  3EG1 A;  1HJD A;  4AG2 C;  4D8K A;  2YT6 A;  2HDA A;  2RQV A;  1HSQ A;  1B07 A;  1V1C A;  2FRW A;  3TSW A;  2J06 A;  4JPB W;  4CC2 A;  2D8H A;  2K3B A;  2KRN A;  1K0X A;  2CH4 A;  1BB9 A;  2EBP A;  2P4R A;  2L3Q A;  5EC7 A;  1RLP C;  2ESW A;  4FSS A;  2O9S A;  1VYU A;  2O31 A;  5IHI A;  3IQL A;  3PE0 A;  1KIK A;  1UJ0 A;  3R6N A;  1I0C A;  4Z88 A;  2DYB A;  3UA7 A;  2DA9 A;  2YUQ A;  2IIM A;  2RQU A;  2LX7 A;  2HCK A;  2CDT A;  1E7O A;  3M0Q A;  1SRL A;  5FWC A;  5GJW B;  2AKK A;  1YWO A;  5IHK A;  2JXB A;  1SHF A;  2BZY A;  1WXB A;  2K9G A;  1JO8 A;  3H0F A;  2RMO A;  3M0P A;  1X2K A;  2EW3 A;  2O2O A;  2CH4 W;  2DBK A;  4IIO A;  1Y57 A;  3REB B;  4OMN A;  1RUW A;  1JEG A;  2DNU A;  2CUD A;  1M3A A;  1ABO A;  5ECA A;  3SHW A;  4EIK A;  1LCK A;  1U3O A;  1AOJ A;  2SRC A;  1WXT A;  2FPF A;  1BBZ A;  2HEQ A;  1K1Z A;  1H92 A;  3VS3 A;  4GLM A;  4ESR A;  1K4U S;  4AFS C;  1Z9Q A;  2AKL A;  2EGE A;  2F2X A;  2C0O A;  2K2M A;  3PVL A;  4LNP A;  1U5S A;  4IIM A;  1NEB A;  1AZG B;  2W0Z A;  1ABQ A;  1K0S A;  2VWF A;  2NUZ A;  1FYN A;  3I35 A;  2RQW A;  2LCS A;  4AFQ C;  4D8D A;  2L2P A;  1NEG A;  2LMJ A;  2EKH A;  2GTO A;  2AK5 A;  1EFN A;  4JZ3 A;  2PNI A;  4KRT A; 
#chains in the Genus database with same CATH topology
 7AT1 B;  4XU3 A;  1YWP A;  4DEX A;  1GBR A;  4OMQ A;  3JCM d;  5LJ3 g;  3CMA A;  3G6E A;  3MCA B;  2J7I A;  1ZX6 A;  1R0C B;  1QVP A;  2CSI A;  3OS1 A;  2QA4 Q;  3JCM W;  5IXB A;  2DIL A;  2M9U A;  2ZPF B;  1YIJ A;  1XNI A;  1VQ5 Q;  1K73 R;  1EIF A;  2O88 A;  3SWN B;  1AZE A;  2X3W D;  1EX4 A;  1WLP B;  2LNV A;  3H0H A;  4HCZ A;  1VQM Q;  2QK0 A;  1WJS A;  4DBR A;  1OOT A;  4EMG A;  1G3Y A;  3NTH A;  3BY7 A;  2DX1 A;  3CMA Q;  1OZ2 A;  4FSX A;  1YJW T;  1KQS P;  3EFR A;  4C92 C;  3H9N A;  1YIJ Q;  3TCJ A;  1Y07 A;  2HBW A;  2JN0 A;  2ZPG B;  1PNJ A;  2G3R A;  4RTV A;  4FT2 A;  4A54 A;  2X4X A;  3EGX B;  3L2R A;  1G8X A;  1W70 A;  3OBW A;  2NUP B;  4BE2 A;  2C0T A;  4X1V A;  3VUZ A;  1M4Z A;  3RDV A;  5KE2 A;  1MUZ A;  3I5R A;  3QJ6 A;  2DL8 A;  3ZFJ A;  5CO7 A;  1U8R A;  4F7U G;  3KXT A;  4GY5 A;  3T9N A;  2K79 A;  1FXX A;  1YJ9 A;  1OPL A;  1OZ3 A;  4JJD A;  1AWO A;  4XTY A;  4PJO G;  2HKN A;  2ZPH B;  3A8O B;  2GCX A;  2DXC A;  3FB9 A;  2RK1 A;  3LGL A;  1XJW B;  2HZY A;  2K57 A;  5LJ5 g;  1HYO A;  2KMT A;  1K9M R;  3PMT A;  1CKA A;  2DL7 A;  2HNI A;  1UGV A;  3QZ9 B;  1LNX A;  4M7D D;  1QMC A;  3J7A F;  1YFN A;  2MK5 A;  4N4I A;  1PG5 B;  1QKX A;  2L5Q A;  5GAM d;  1BI3 A;  3CCR T;  2D8J A;  1VQN A;  1UGR B;  2GQI A;  5CK9 A;  3VRY A;  2JNG A;  4PJL A;  1M8M A;  3QYG B;  3FLG A;  4LDW A;  3S3O A;  2D0N A;  4M77 A;  3JB9 I;  4QQD A;  4E7I A;  1V29 B;  1SSF A;  5KYW B;  2EYQ A;  3H41 A;  1T0H A;  2MYS A;  2HD0 A;  1I5L A;  2YWW A;  1D1B A;  3M0R A;  2JW4 A;  5GAN 5;  3Q1J A;  4X34 A;  4FL6 A;  4BY6 B;  2RF0 A;  2KGT A;  4JUV A;  2IVW A;  1M27 C;  2JM8 A;  4QVZ A;  3VS5 A;  1S1N A;  4RTZ A;  5KYU A;  5IHN A;  4M77 G;  2CP7 A;  3REA B;  2YUO A;  1ZUY A;  4BI4 A;  2F1L A;  2LVM A;  2L89 A;  2CZ7 B;  3P8B B;  4ZN1 A;  1NLP C;  1ZSZ B;  4JLG A;  5J26 A;  4HXJ A;  2MCN A;  4JS4 A;  4J9H A;  2XIC A;  5GAM f;  4M7D C;  3OYN A;  4M7A D;  1VQ8 Q;  1IRX A;  4M75 E;  4E7J A;  5I2M A;  1ZLM A;  1IHV A;  3VS1 A;  4M77 E;  3CCM T;  1VQ6 A;  5LJ5 d;  1FMK A;  3KFV A;  2DIG A;  5GAO q;  3DB3 A;  4RTX A;  2KSS A;  5FU6 C;  2OTJ A;  3NMZ C;  2CT3 A;  1SRM A;  3HPW A;  1M5Q 1;  1W1F A;  4RTW A;  1ZA2 B;  2XDB A;  3VYH B;  2E6N A;  1VYV A;  2M0Y A;  4D6W A;  3CBP A;  4LD6 A;  3I9Q A;  1ZSG A;  4MDX A;  4CC3 A;  2E3I A;  1KC8 R;  1VQ6 Q;  3FRN A;  3PVQ A;  1YI2 Q;  2JMC A;  5GAN g;  2BZ8 A;  2OTJ Q;  1KQ1 A;  4NOY A;  1TG0 A;  2FZG B;  3OYD A;  1MHN A;  3OMC A;  2DE0 X;  1GCQ C;  5KYN A;  1KJW A;  2JTF A;  4M7A C;  2PTK A;  3RMQ A;  4XTV A;  2RJE A;  2EYW A;  4PJN A;  3A8H B;  4PFP A;  3CC2 A;  2VKN A;  2K7A A;  5IN1 A;  4L6V 5;  2KAF A;  2DER A;  1ZQ1 A;  3CCS T;  1GBQ A;  2KNB B;  4XAX B;  3MKD A;  2EAY A;  4A4H A;  1GL5 A;  3ZL7 C;  2A37 A;  3CCJ T;  1JB0 E;  2EQU A;  4ZGD B;  1HD3 A;  2V8I A;  1QCN A;  5FWB A;  1QVG A;  3QKJ A;  3LWH A;  2F2W A;  3LWI A;  4PFO A;  2A36 A;  3HL8 A;  1TUD A;  2LQK A;  2VXF A;  3X25 B;  4DA4 A;  4E7K A;  5A0D A;  1TWB A;  2FYK A;  1IXD A;  4LD9 K;  2RK2 A;  1BI0 A;  1D3B A;  2EYZ A;  1H3Z A;  3SFM A;  3VS0 A;  4BY6 C;  4ZTJ A;  1S72 T;  3GOX A;  2HL5 C;  2RHX A;  4AFU C;  2EYX A;  3MJX A;  1WJQ A;  1N5Z A;  4J6Y A;  5GAN d;  4N0A C;  2Y90 A;  1JRI A;  2LP5 A;  2QG9 B;  3M0T A;  3JCM b;  1VQK Q;  3PIP A;  1VQ4 T;  4ME7 A;  4FYV B;  4J9I A;  2YUP A;  4KGZ B;  1OX8 A;  4EMK C;  2BKD N;  1UG1 A;  1ZSZ C;  3TRE A;  3M59 A;  4J6W A;  3EAE A;  3ZBD A;  3CPW A;  2HQX A;  1WNL A;  4KUI A;  3DLM A;  1I07 A;  5KYX A;  2KRS A;  2RQT A;  2R58 A;  1P92 A;  3HFN A;  3ME9 A;  2J6F A;  2F5T X;  4D8K A;  2DXU A;  4M78 B;  1RAD B;  1D0X A;  4N4H A;  1PSE A;  1BYM A;  4QQ6 A;  2RO0 A;  2QQS A;  2RQV A;  4XK8 E;  1B07 A;  4CC2 A;  2DYI A;  3RIR A;  1K0X A;  3RMS A;  2ESW A;  5LJ3 e;  3FDR A;  3ER0 A;  5IHI A;  4OB3 B;  1U1S A;  2AIR B;  3OYM A;  1I0C A;  2CGH A;  5GMK l;  4QKU A;  4OB1 B;  2CDT A;  1SRL A;  5GJW B;  2K5F A;  1M9S A;  4M75 F;  4QVD A;  2PUO B;  2AKK A;  2GFU A;  1JJ2 S;  3QXE B;  5IHK A;  2YRC A;  2EQM A;  2KDS A;  3CPW P;  1VQO A;  3M4Y A;  2K9G A;  1KD1 U;  2QQR A;  4B9X A;  2QA4 T;  4NL3 A;  2VGN A;  4LDV A;  1X2K A;  2EW3 A;  2O2O A;  4X9D A;  1VQ5 T;  2E10 A;  3EH2 A;  2KVQ G;  4QQG A;  4IIO A;  4HA8 A;  3CPF A;  4FW1 A;  1VQM T;  1ABO A;  3SWN A;  4A53 A;  2FPF A;  4M78 F;  3PGG A;  3VS3 A;  3J80 E;  3CXC S;  5A0G A;  3CCV A;  4BD3 A;  3CMA T;  4RKU E;  1Z9Q A;  1QP2 A;  2ZPB B;  1N9R A;  2AKL A;  2EGE A;  2ZZD A;  2F2X A;  3A5Z B;  1I5O B;  2X4J A;  4LNP A;  2WAC A;  1YIJ T;  1NEB A;  1K0S A;  2A7Y A;  2NUZ A;  3I35 A;  3M54 A;  1M90 R;  2KK4 A;  4D8D A;  2HAX A;  2LMJ A;  2P0P A;  4C5I A;  2GTO A;  1EFN A;  4KUL A;  1FWZ A;  3S3M A;  4PJO C;  4OMF B;  1IRE B;  2PNI A;  3OYG A;  3OA6 A;  1NJI U;  1OPK A;  3EGX A;  3CCV Q;  2D9T A;  1NPR A;  2PVG B;  1V76 A;  1UDL A;  2EVR A;  2NUP A;  3N5B B;  2RJC A;  3BFM A;  2F2V A;  4HCK A;  3JCM Q;  3MP1 A;  3OYK A;  3HRS A;  3MO8 A;  1T0J A;  1SG5 A;  4F14 A;  4HT9 A;  1X43 A;  3RKX A;  1SSH A;  2K6D A;  2ABL A;  4HVV A;  3JCM P;  3E9F A;  2JS0 A;  4O6J A;  5GJV B;  4JS5 A;  4B9W A;  5CAI A;  3FEO A;  3CCE A;  2ZGW A;  2BZX A;  4IUV A;  1ZBJ A;  2HBP A;  2WSE E;  5A0L A;  3A8G B;  1J3T A;  1YJ9 T;  3CBM A;  4PNO A;  2DEU A;  4UC4 A;  1ZUU A;  1PRM C;  4J83 A;  4M77 C;  3UF4 A;  1TSF A;  2JVV A;  2RB6 A;  4C5E A;  4GBQ A;  3EFO B;  2PU9 B;  2JM9 A;  3CCE Q;  1O75 A;  3OQ5 A;  5KYW A;  1NPP A;  4FW2 A;  1YNZ A;  5J3B A;  1KHI A;  4FIB A;  1JJ2 P;  1VQN T;  3NPF A;  2FHD A;  1Y96 B;  1NBE B;  2D1X A;  1QCF A;  4C92 F;  4J9D A;  2GFA A;  1M30 A;  2EJF A;  3VYG A;  2A08 A;  3JB9 H;  5GAN 6;  1TXQ A;  2FPE A;  2KT1 A;  4TVR A;  1IB8 A;  2DFU A;  1Q82 U;  5CQX A;  2E12 A;  2RA2 A;  4CI0 C;  3EG2 A;  3JB9 F;  2MWO A;  2XHC A;  2KEA A;  4OF1 A;  2D6F A;  2FEI A;  1QVF S;  1PKT A;  3CXC P;  3I55 A;  1GFC A;  4MML A;  2ROT A;  3U23 A;  4RUG A;  1WQW A;  3I5S A;  2JS2 A;  2LNH B;  2DZ9 A;  1VQP Q;  1PHT A;  4XQ3 A;  4NL2 A;  1M2O A;  3O5Z A;  1EZZ B;  2A28 A;  1C0M A;  1Y0M A;  4PLL A;  1KQS A;  1ZBX A;  1WHJ A;  3CCL Q;  5GAO p;  3NGP A;  3I55 Q;  1PKS A;  1WPY A;  2DL3 A;  3UWN A;  1VQ6 T;  2ZPE B;  1YI2 T;  3S6W A;  1SPK A;  3P8H A;  2JTM A;  2YSQ A;  1WHL A;  1VQ9 A;  2WSC E;  2OTJ T;  4M7D B;  1ZA1 B;  1C1A A;  5AT1 B;  2ENM A;  2LJ1 A;  2RD1 A;  3VU3 C;  5FLX E;  5IXF A;  1WFW A;  3GNF B;  2XKO C;  2FVU A;  5FU6 B;  2HMA A;  3EGD B;  1TU0 B;  3VS6 A;  3EHQ A;  4EPC A;  4DEY A;  2X51 A;  3QUI A;  1VQ9 Q;  1U06 A;  4Y92 A;  3S3N A;  2E6Z A;  2X35 A;  4RTT A;  2JT4 A;  3UA6 A;  2XMF A;  1WDX A;  3MEW A;  3OBY A;  2V1Q A;  2XI9 A;  3G7Z A;  4C8Q B;  1G3S A;  2LQ8 A;  2LDM A;  3JCM f;  1QWF A;  3G71 Q;  5GAN 8;  2EJ9 A;  2NLU A;  3OYH A;  3QII A;  2LRQ A;  3MEV A;  4J9E A;  1KG1 A;  1TOV A;  3JSC A;  3CC2 T;  3CQT A;  5GAN 7;  3NHN A;  4M7D F;  1OUL A;  1IZ6 A;  1WXU A;  3M0U A;  1W2B P;  3OW2 S;  3PTA A;  3LH5 A;  3OYL A;  4HVU A;  4M7A B;  4E7S A;  4ZTF A;  2LC4 A;  5LJ3 d;  3ULR B;  3R6O A;  2XK0 A;  1N6A A;  2HSE B;  2KR3 A;  1MMN A;  1BIA A;  2DF6 A;  3TSZ A;  4OMM A;  1X2Q A;  2ED0 A;  4KH0 B;  2ED1 A;  1X6O A;  3CC7 Q;  4BE1 A;  2YRV A;  4OB2 B;  5CKB A;  5L8R E;  3PIO A;  1M90 C;  2QI2 A;  8AT1 B;  1G2B A;  2EQI A;  4M75 A;  2CSQ A;  4JRK A;  5HCK A;  1WHM A;  2HKQ B;  2MWP A;  3C94 A;  1WQ7 A;  5GAN 4;  3NFC A;  4J7I A;  1RAH B;  2COZ A;  5I11 A;  2YLB A;  2JTE A;  1QLY A;  2JOY A;  1VQ8 A;  2EQK A;  8ATC B;  4M7A F;  3RKW A;  4M75 G;  5LJ3 f;  4M78 A;  4BUG A;  2NUT B;  1YHQ A;  4C8Q D;  1IGQ A;  4F04 B;  1RL2 A;  1OQK A;  2R5A A;  5CKF A;  4C0G A;  3H0I A;  2BUD A;  1M2V B;  2E5K A;  1RAF B;  4WCI A;  4EMK B;  3M58 A;  2EYY A;  1N8R U;  1D1C A;  3OMG A;  4M4Z A;  1NZ9 A;  4BE0 A;  2FPD A;  1X27 A;  3TVT A;  1M1K U;  1OEB A;  3HRT A;  1WHH A;  4M78 G;  4FCY A;  2PZ1 A;  4E7H A;  1YHQ Q;  1A0N B;  1YI2 A;  1RAA B;  2P0K A;  5AYF A;  5KCH A;  1NE8 A;  1W6X A;  4N4G A;  3UDC A;  4ZGE B;  4BDZ A;  3GP8 A;  3L2W A;  2PUK B;  1PWT A;  2VYT A;  2C0I A;  1YIT A;  1Q81 U;  4II1 A;  2LX9 A;  4AT1 B;  4BDY A;  4HVW A;  4RG8 A;  1TUG B;  4M78 E;  1R77 A;  1VQO T;  5CR2 A;  2DEQ A;  3OSS C;  2DIQ A;  1KK7 A;  4LDX A;  3KUF A;  1WGS A;  2FRW A;  2CS7 A;  1MMG A;  2OTL A;  4C8Q C;  4Y91 A;  2ZPI B;  4OGC A;  1BB9 A;  4R55 A;  5EC7 A;  1MND A;  1TS9 A;  2DKG A;  4R56 A;  3OW2 P;  2RI3 A;  1R0B G;  3IQL A;  3QO3 A;  3CCQ Q;  4Z88 A;  2VAS A;  4DOW A;  4KGV B;  1YIT Q;  2HCK A;  3BE3 A;  1E7O A;  5CIU A;  3M0Q A;  5FWC A;  3QHS A;  3OYC A;  3CCV T;  3NTI A;  2QQ9 A;  4CRI A;  5LJ5 f;  4B6M A;  1SHF A;  1MMD A;  1UEB A;  3CEY A;  2OTL Q;  1Q7Y U;  2CH4 W;  2CP3 A;  5FRM A;  3REB B;  5GAM j;  2YHT A;  1WJR A;  1RUW A;  2DNU A;  2CUD A;  5ECA A;  1DJ7 B;  2ZAE A;  1U3O A;  1AOJ A;  1YBY A;  4VUB A;  2EFI A;  1BBZ A;  2HEQ A;  1H92 A;  4F7U B;  4ESR A;  1K4U S;  1YJW Q;  2DTO A;  1KD1 R;  4C92 A;  1VQK A;  1OU9 A;  3PVL A;  5GMK i;  2O4X A;  4ANJ A;  1LVK A;  1XQH A;  4PJO B;  1U5S A;  1YCY A;  2IG0 A;  2FZC B;  3JCM X;  1RAC B;  4AFQ C;  3E2U A;  2EKH A;  5CKH A;  4GLK A;  2D0Q B;  4JZ3 A;  2EQJ A;  2DXB A;  4IUU A;  5I21 A;  5KCO A;  2OJ2 A;  1PSF A;  3QPH A;  3CCE T;  2PVO B;  4C92 G;  2LCC A;  3I56 Q;  3EH1 A;  3EFO A;  5FU7 C;  3EGU A;  1SHG A;  5GMK j;  2EIF A;  2Y4X A;  1X69 A;  1VQL A;  3JB9 G;  4O5V A;  1N8R C;  2H8H A;  1NYF A;  4LN2 A;  5HY6 A;  2EGC A;  2PQW A;  4P5N A;  2MF2 A;  1R8O B;  1M1K C;  1PD0 A;  4XU0 A;  1Y96 A;  2DO3 A;  5KYY B;  3WVE B;  4F7U F;  1NJI R;  1JBM A;  4C92 E;  2DVJ A;  2KYM A;  3NTK A;  3LH0 A;  4ZNX A;  1BK2 A;  3VRZ A;  3L1A A;  4FU6 A;  4MZP A;  1K8A U;  2WSF E;  3TQ7 P;  4M77 B;  1PC0 A;  5D6Y A;  3GNG A;  1M1F A;  3O8V A;  1RAI B;  3INZ A;  3RER A;  1Q81 C;  1VQL Q;  5D6X A;  1HK9 A;  1TUC A;  1FMV A;  3FJ5 A;  1E6G A;  3EG9 B;  2Y4Y A;  4JRQ A;  1RAE B;  3V8K A;  1YJN A;  2OAU A;  5GAN f;  4PLI A;  4Z89 A;  2LT1 A;  2MPX C;  4EDU A;  4PJO D;  4AFZ C;  1M3B A;  2YXY A;  1NYG A;  4ZGJ B;  3I55 T;  1IGU A;  2BE7 D;  2QEX A;  3PFS A;  3OY9 A;  2ECZ A;  2XD0 A;  4C0D C;  3CD6 Q;  2RPN A;  3LW5 E;  4JZ4 A;  2DMO A;  1YJN Q;  3UPU A;  3OS0 A;  1Q7Y C;  3HTR A;  4KT0 E;  4M7D A;  2ATC B;  2GBQ A;  3MP6 A;  4LDY A;  1MV0 B;  5GAM e;  1AVZ C;  4JDS A;  3CCM Q;  4KH1 B;  2FL7 A;  5GAM h;  4JLI A;  3ZEH A;  1NLO C;  5HKC A;  2QEX Q;  1PRL C;  1YN8 A;  2F5K A;  1OV3 A;  4F17 A;  2DZC A;  3RUX A;  1VQ9 T;  2MIO A;  2X9H A;  3EGD A;  2KXD A;  3L42 A;  3CBO A;  2HSP A;  4M7D G;  2CYZ B;  2V1R A;  1CSK A;  2DRM A;  4M77 D;  2XDD A;  2DAQ A;  1Q82 R;  3WXM B;  3V7C A;  3ASK A;  1I81 A;  4XU1 A;  2DM1 A;  3KBG A;  1D0Z A;  5GAO r;  3EHR A;  2CP2 A;  4K11 A;  3X24 B;  1WYX A;  2K4Y A;  1SKU B;  3M4G A;  1H64 1;  4E2F B;  1MGQ A;  4C0Z A;  1LPL A;  1Z9Z A;  1IO6 A;  1G3T A;  5KH6 A;  1UUE A;  4ATO A;  1U1T A;  1AEY A;  4PFZ A;  4M7D E;  1AD5 A;  1SEM A;  2H3J A;  2NWM A;  5EG2 A;  1B7T A;  5GMK h;  4M7A A;  3CCU A;  3VS4 A;  1UGS B;  4BI8 B;  2RN8 A;  1JJ2 A;  3CC7 T;  5LL6 S;  2CT4 A;  1PD1 A;  4QW2 A;  2GGR A;  3MEA A;  5LJ5 h;  2GTJ A;  5DM7 R;  3E1S A;  4FYW B;  1SF9 A;  2RH2 A;  4RMO A;  3MEU A;  4M75 C;  1AT1 B;  3PT9 A;  1KFZ A;  1UJY A;  2V8K A;  3CCJ Q;  2O01 E;  4BI3 A;  4M7A G;  5DLQ E;  1UEC A;  3L2Z A;  1M8V A;  4L59 A;  3CCU Q;  3CXC A;  2DL5 A;  4EMH A;  1D3B B;  4Z8A A;  2LTO A;  2EGA A;  2HQE A;  3BW1 A;  2QGG A;  3J81 E;  4LXC A;  4HKE A;  1UHF A;  5M9O A;  1MMA A;  3SB2 A;  4A4E A;  2DPP B;  3M56 A;  2CRE A;  1S72 Q;  2KE9 A;  3L2U A;  3F70 A;  1FX7 A;  4M7A E;  1VQP A;  2J6K A;  4ZN3 A;  4A4K A;  2NUT A;  2ZCF B;  3OYF A;  1KD1 C;  3QWY A;  2B86 A;  3JB9 J;  2QQA A;  4N0A A;  4MMK A;  2O9V A;  2P0Q A;  3OYB A;  3C0C A;  4DBQ A;  1K9A A;  3EG3 A;  2GQV A;  1M2V A;  4EMK A;  1F1B B;  2CZ1 B;  2QAZ A;  3A8M B;  1VQ8 T;  1ZSZ A;  3CCL A;  4A63 B;  1VA7 A;  1HXD A;  5CQY A;  2J6O A;  2W10 A;  1YHQ T;  2MMP A;  2XU8 A;  1B34 B;  1X6B A;  1VIF A;  3DLL A;  4JRI A;  3M53 A;  2X3X D;  1W4S A;  2BTT A;  4Y28 E;  3C4S A;  3CC4 A;  3V7R A;  1I1J A;  4DQ2 A;  5IH2 A;  1JU5 C;  2SEM A;  1D09 B;  1TTH B;  3GIB A;  1IHW A;  1VQ7 A;  4HCB A;  4J9C A;  1GXI E;  3VUB A;  1QP3 A;  4MZT A;  2YUN A;  3M57 A;  1NJI C;  2DTI A;  2YRD A;  4J7F A;  3GBQ A;  4J9B A;  1UHC A;  3QBY A;  1E6H A;  2QYZ A;  3EFS A;  2QTV A;  1YCS B;  4JJC A;  2QDL A;  5GAN h;  1YIT T;  5C0M A;  4MDW A;  2KXC A;  5J39 A;  4X9C A;  3CC4 Q;  4QT7 A;  1W2B A;  1Y7X A;  3G71 A;  1UTI A;  4PJJ A;  2R5M A;  3G4S A;  1UFF A;  2M02 A;  2VB6 A;  4XTX A;  3H6Z A;  1VQ7 Q;  1MNE A;  2OTL T;  3HKS A;  3AT1 B;  4F16 A;  4RTY A;  4J8O A;  4LUD A;  3WVD B;  2RHY A;  2MAM A;  5GAM g;  3MHX A;  4LE9 A;  1O9S A;  2DJQ A;  1N8R R;  2L3P A;  5CVI A;  3G6E Q;  3EG1 A;  4AG2 C;  1QVF A;  1M1K R;  2YT6 A;  3CC7 A;  1RAB B;  3G4S Q;  2KQW A;  4F7U A;  2CP5 A;  1HSQ A;  2K2V A;  2J06 A;  3VV0 A;  3OYA A;  2D8H A;  2K3Y A;  4A4G A;  2K3B A;  2KRN A;  2CH4 A;  2P4R A;  2AT1 B;  1RLP C;  2BE9 B;  4FSS A;  2DET A;  2O31 A;  2VXE A;  4PJO A;  5GAO m;  4DOV A;  3PE0 A;  3JCM J;  3HRU A;  1Q81 R;  2X4Y A;  2C06 A;  1YWO A;  3I56 T;  2A3L A;  2JXB A;  4HT8 A;  2BZY A;  1WXB A;  4DBF A;  1VQK T;  1JO8 A;  5DLO A;  4C5H A;  5FRO A;  2RMO A;  2EWN A;  3M0P A;  3X28 B;  5IAY A;  3JCM c;  2DBK A;  1QVF P;  1Q82 C;  4OMN A;  1Q86 U;  1M3A A;  4EIK A;  3C12 A;  1LCK A;  4C8Q F;  3GF5 A;  2RI5 A;  4BB7 A;  3QJY A;  5C6S A;  2PVD B;  5HK0 A;  2QDY B;  5KYY A;  4F7U E;  4GLM A;  3SD4 A;  4AFS C;  2C0O A;  1Q7Y R;  1YJ9 Q;  4YTL A;  2DK3 A;  1VQL T;  5FRN A;  4PJO E;  4IIM A;  2VV5 A;  2W0Z A;  2VWF A;  4XTU A;  1K73 U;  2DJZ A;  4LDU A;  4JRP A;  3OYY A;  2BIV A;  2AK5 A;  3BDL A;  3EG9 A;  5FU7 B;  3E9G A;  2XG8 D;  2KI7 A;  3M55 A;  4FYY B;  2EKO A;  1JQQ A;  4IUT A;  3THK A;  2DL4 A;  1OI1 A;  2A0F B;  1X6G A;  1VQN Q;  2JMA A;  2RQR A;  4E6R A;  2GF7 A;  1MV3 A;  2LQN A;  3CME A;  2DBM A;  3OW2 A;  1RI0 A;  4L5G A;  3OYJ A;  3CD6 T;  2Z0W A;  2RNA A;  5FW9 A;  1GRI A;  2EJG A;  1BIB A;  1BU1 A;  1X75 C;  2MI6 A;  1YJN T;  3RNJ A;  1UGP B;  2HL3 A;  3BDU A;  1H3H A;  3CCQ A;  3SWN C;  2CUB A;  4AG1 C;  1QVG S;  1N27 A;  5L23 A;  3A98 A;  3JRZ A;  2E64 A;  1GFD A;  1NM7 A;  3RES A;  3PMI A;  3OYE A;  1X01 A;  3MP8 A;  3CME Q;  4E7Z A;  2QEX T;  1AWX A;  2QTX A;  1BI1 A;  1ARK A;  2LT4 A;  2RM4 A;  2FG0 A;  1Q95 G;  3OYI A;  3P8D A;  2KBT A;  4IUR A;  2CZ6 B;  1OYX A;  4KUD K;  2J05 A;  1BKB A;  4OML A;  1BCM A;  1PCX A;  1K8A R;  5LJ3 j;  1WI7 A;  4C0D B;  1AWW A;  1K9M U;  1G5V A;  2HQH A;  1YJW A;  2KRO A;  4R0K A;  2CP0 A;  1OX9 A;  3HFO A;  3X20 B;  3RR6 A;  4OB0 B;  2NYS A;  1QKW A;  1RI9 A;  3V7S A;  2P84 A;  3CPW S;  1OU8 A;  3RBB B;  1WA7 A;  2LCL A;  2M1H A;  3UAT A;  1CKB A;  5D7U A;  1YP5 A;  1Q86 C;  2LQW A;  3EG0 A;  3I56 A;  3A1P A;  2RHI A;  1D1A A;  5GAN 3;  4OMO A;  4IKF A;  3JCM V;  4PJM A;  2AZS A;  3LLR A;  2K5L A;  2M0O A;  4Q5W A;  1JXM A;  3CCU T;  2QQB A;  1K73 C;  2ROL A;  3JCM e;  3OSV A;  1RLQ C;  1WX6 A;  3JCM h;  3CC2 Q;  2DXT A;  3CCR A;  1LOJ A;  2RJD A;  1QWE A;  2I2L A;  2KRM A;  4J6X A;  4XTZ A;  2AZV A;  2I0N A;  3OB9 A;  1UE9 A;  3FIF A;  2FB7 A;  5GAN 2;  5CKD A;  1K76 A;  5LJ5 j;  2FO0 A;  2CZ0 B;  5I2S A;  1T3S A;  3PNW C;  4KBM B;  4OP0 A;  3LYI A;  2CKK A;  2XID A;  2E65 A;  5CCA A;  1XTD A;  2YLC A;  4M75 B;  1H8K A;  2E70 A;  1QVG P;  3TEE A;  2M51 A;  4PJO F;  3CCR Q;  2L3S A;  2LJ3 A;  3UT1 A;  2EPD A;  4FT4 A;  1KC8 U;  1VYT A;  2E4H A;  3LGF A;  3CD6 A;  2KT8 A;  1VQP T;  2P4T A;  3L2Q A;  3M9Q A;  2G6F X;  3SEM A;  2COY A;  2QAS A;  2CP6 A;  3OS2 A;  3QWX X;  1B34 A;  2LJ0 A;  5KYU B;  2H3E B;  4JJN K;  2DD5 A;  1QCO A;  4HCC A;  1B3Q A;  3CCL T;  3CCM A;  1M3C A;  3M0S A;  1I8F A;  2RI2 A;  4QVC A;  2DRK A;  4RTU A;  4PK4 A;  6AT1 B;  4KGX B;  3URG A;  1K9M C;  1G83 A;  5LJ3 h;  4MZM A;  2QGF B;  3QG1 A;  2RJF A;  2COW A;  2YDL A;  4RCC A;  3V8J A;  1KHC A;  1AWJ A;  1GCP A;  5IT9 E;  4M77 F;  2IPO B;  3CC4 T;  4J9G A;  3VKI A;  4XU2 A;  1BI2 A;  2DLP A;  4LUE A;  1VQ7 T;  1KSW A;  2LZ6 B;  3JV3 A;  4J5Y A;  1VIE A;  3QDF A;  4OGE A;  3JAM E;  2X4W A;  1WHK A;  4M75 D;  5I22 A;  2DTH A;  2JZ2 A;  1XOV A;  3VJP A;  2E3H A;  1M1G A;  3G6E T;  2FRY A;  3QSU A;  1VQO Q;  2DD4 A;  4C0F A;  3G71 T;  1JXO A;  1WZO A;  2VGM A;  4CC4 B;  5KE3 A;  4J9F A;  3FC3 A;  3G4S T;  4C8Q A;  2XDP A;  1D0Y A;  2RHU A;  2OX7 A;  5GAN j;  4ORZ A;  3CCS A;  3QZ5 B;  2KYB A;  3OS5 A;  4M78 D;  2E1H A;  2L3R A;  1GCQ A;  2OI3 A;  4AMC A;  5GMK e;  3CCJ A;  2JJ9 A;  2VVK A;  3QYH B;  2VUB A;  1BCO A;  3DB4 A;  1LJO A;  2DVE A;  3HSB A;  3MPU B;  4V2S A;  2R57 A;  4C8Q G;  2M16 A;  1I4K 1;  1G3W A;  2RHZ A;  1FMW A;  5A2Q E;  5LJ5 e;  1NG2 A;  2MOX A;  1QW1 A;  3VS2 A;  2OAW A;  4CC7 A;  4PL6 A;  3CCS Q;  3A8L B;  4OMP A;  2VC8 A;  1C6V X;  2V26 A;  1T3L A;  3VS7 A;  1S72 A;  1K8A C;  1WIE A;  3GPL A;  4C92 B;  1ZUK A;  1WHG A;  4JJB A;  3HHT B;  4XTW A;  4DBH A;  1KC8 C;  2GNC A;  4IUQ A;  3X26 B;  2L0A A;  4C8Q E;  2O4X B;  1HJD A;  1KQS S;  2FZK B;  4A4F A;  4IUP A;  5GAO l;  4NS5 A;  4OVA A;  1VQ4 A;  2QXF A;  4FYX B;  2HDA A;  1VUB A;  3GLX A;  4ELY C;  4RCB A;  1V1C A;  3TSW A;  4JPB W;  3AHU A;  3C95 A;  2EBP A;  2L3Q A;  4M78 C;  2E5Q A;  4Z02 A;  2O9S A;  1VYU A;  3JCM g;  4E7L A;  1KIK A;  4PKC C;  1UJ0 A;  3R6N A;  2DYB A;  3UA7 A;  4C5G A;  2DA9 A;  2YUQ A;  2IIM A;  2RQU A;  2LX7 A;  1KQ2 A;  1W2B S;  1VQ4 Q;  5DY9 A;  1ACM B;  1UB4 A;  3H0F A;  1QQJ A;  3DKM A;  5GMK m;  1AHJ B;  2KY9 A;  1Y57 A;  2AHJ B;  5KYX B;  2K3X A;  3E19 A;  1JEG A;  1RAG B;  3SHW A;  1M90 U;  5HK3 A;  1N9S A;  4BAC A;  3V8L A;  1TH7 A;  2SRC A;  1WXT A;  2L8D A;  3TU4 K;  3D7S B;  4ELZ C;  1K1Z A;  5GAO n;  2JUF A;  1Y71 A;  2K5I A;  1ZHI A;  1VOM A;  4FM4 B;  3LX7 A;  3HP9 A;  3RKY A;  2K2M A;  2QA4 A;  3CME T;  3SDZ A;  3M5A A;  4C92 D;  3L2V A;  2F69 A;  3H8Z A;  1VQ5 A;  1AZG B;  1UGQ B;  1ABQ A;  5D6W A;  4WTO B;  2E41 A;  1FYN A;  1Q86 R;  5CKE A;  9ATC B;  2RQW A;  3FJP A;  2LCS A;  3G1J A;  2L2P A;  4RG2 A;  3QDR B;  1VQM A;  1NEG A;  2B8A A;  1PM3 A;  2V8J A;  4E47 A;  3JB9 D;  3MET A;  5GAN e;  3CCQ T;  4WF2 A;  4KRT A; 
#chains in the Genus database with same CATH homology
 2OJ2 A;  1YWP A;  1OPK A;  4DEX A;  1GBR A;  4OMQ A;  1JQQ A;  2J7I A;  1UDL A;  1ZX6 A;  2EVR A;  2DL4 A;  3THK A;  3EGU A;  1SHG A;  1X6G A;  2CSI A;  2JMA A;  2RQR A;  4E6R A;  1MV3 A;  2LQN A;  2F2V A;  2DBM A;  4HCK A;  1X69 A;  5IXB A;  2DIL A;  1T0J A;  2H8H A;  1NYF A;  4F14 A;  2O88 A;  4LN2 A;  1X43 A;  1AZE A;  2EGC A;  2X3W D;  2RNA A;  1SSH A;  5FW9 A;  1WLP B;  1GRI A;  3H0H A;  2K6D A;  1BU1 A;  2ABL A;  4HVV A;  3RNJ A;  1H3H A;  2JS0 A;  1OOT A;  2DVJ A;  2KYM A;  2CUB A;  5GJV B;  4ZNX A;  4AG1 C;  1BK2 A;  3VRZ A;  2DX1 A;  5L23 A;  3A98 A;  1GFD A;  1NM7 A;  2BZX A;  1ZBJ A;  1J3T A;  1AWX A;  1TUC A;  2HBW A;  3FJ5 A;  1E6G A;  1ZUU A;  1ARK A;  1PRM C;  1PNJ A;  4RTV A;  2FG0 A;  3UF4 A;  2KBT A;  4GBQ A;  4Z89 A;  1W70 A;  2J05 A;  2C0T A;  4X1V A;  4OML A;  2JM9 A;  1WI7 A;  4AFZ C;  1M3B A;  1MUZ A;  1AWW A;  3I5R A;  1NYG A;  2DL8 A;  1YNZ A;  2KRO A;  2K79 A;  4R0K A;  3NPF A;  1OPL A;  2ECZ A;  2RPN A;  2D1X A;  4JJD A;  1QCF A;  1AWO A;  4JZ4 A;  2DMO A;  4J9D A;  1M30 A;  1QKW A;  1RI9 A;  2A08 A;  2FPE A;  2KT1 A;  3RBB B;  2GBQ A;  1WA7 A;  1CKA A;  1MV0 B;  2DL7 A;  3EG2 A;  3UAT A;  1CKB A;  1YP5 A;  2KEA A;  1UGV A;  1AVZ C;  2LQW A;  2FEI A;  1PKT A;  3EG0 A;  1GFC A;  1QKX A;  2D8J A;  2ROT A;  1NLO C;  3U23 A;  4RUG A;  3I5S A;  2GQI A;  1PRL C;  1YN8 A;  2JS2 A;  1OV3 A;  2LNH B;  3VRY A;  4F17 A;  1M8M A;  4OMO A;  1PHT A;  2MIO A;  2D0N A;  2AZS A;  3O5Z A;  2KXD A;  2HSP A;  2V1R A;  1CSK A;  2A28 A;  2DRM A;  3H41 A;  1JXM A;  1T0H A;  1Y0M A;  2ROL A;  2DM1 A;  1RLQ C;  2JW4 A;  3M0R A;  1WX6 A;  2RF0 A;  2KGT A;  3EHR A;  1M27 C;  2JM8 A;  3NGP A;  1PKS A;  4K11 A;  1WYX A;  2DL3 A;  3VS5 A;  1S1N A;  4RTZ A;  5IHN A;  1SPK A;  1QWE A;  2KRM A;  2YSQ A;  1Z9Z A;  1IO6 A;  2AZV A;  3REA B;  1UUE A;  2I0N A;  2YUO A;  1ZUY A;  1UE9 A;  1AEY A;  1AD5 A;  2ENM A;  2LJ1 A;  1SEM A;  2NWM A;  1K76 A;  2FO0 A;  1NLP C;  1T3S A;  5IXF A;  4HXJ A;  1WFW A;  3VS4 A;  2MCN A;  4J9H A;  2RN8 A;  2CT4 A;  1H8K A;  1ZLM A;  2GGR A;  3VS1 A;  2M51 A;  2L3S A;  2GTJ A;  2LJ3 A;  2EPD A;  3VS6 A;  3EHQ A;  4DEY A;  1FMK A;  3KFV A;  1VYT A;  4RTX A;  1U06 A;  4Y92 A;  1KFZ A;  1UJY A;  2KT8 A;  4RTT A;  2JT4 A;  3UA6 A;  2XMF A;  3NMZ C;  1WDX A;  1SRM A;  2CT3 A;  1UEC A;  2G6F X;  1W1F A;  4RTW A;  2V1Q A;  3SEM A;  1VYV A;  2DL5 A;  1QWF A;  3QWX X;  2M0Y A;  2LJ0 A;  4Z8A A;  3I9Q A;  1ZSG A;  2EGA A;  4J9E A;  4CC3 A;  1B3Q A;  1UHF A;  3CQT A;  1M3C A;  3M0S A;  3PVQ A;  3NHN A;  2JMC A;  1WXU A;  3M0U A;  2DRK A;  2CRE A;  4RTU A;  3LH5 A;  2KE9 A;  2BZ8 A;  1G83 A;  4HVU A;  1TG0 A;  3ULR B;  2J6K A;  2DE0 X;  1GCQ C;  3QWY A;  2B86 A;  2KR3 A;  2YDL A;  2DF6 A;  2O9V A;  3TSZ A;  4OMM A;  1KJW A;  1X2Q A;  1AWJ A;  2ED0 A;  1GCP A;  2PTK A;  3C0C A;  2ED1 A;  1K9A A;  3EG3 A;  2EYW A;  4J9G A;  2DLP A;  2VKN A;  4A63 B;  2K7A A;  4LUE A;  1VA7 A;  1KSW A;  2LZ6 B;  1G2B A;  2EQI A;  2J6O A;  2W10 A;  3JV3 A;  1GBQ A;  2CSQ A;  2KNB B;  5HCK A;  1GL5 A;  3ZL7 C;  5I22 A;  2A37 A;  1X6B A;  1HD3 A;  5FWB A;  1XOV A;  2F2W A;  2X3X D;  2BTT A;  2A36 A;  2FRY A;  5I11 A;  2JTE A;  1QLY A;  1I1J A;  1TUD A;  1JXO A;  4CC4 B;  5IH2 A;  4J9F A;  1JU5 C;  2SEM A;  4J9C A;  4ORZ A;  2YUN A;  2EYZ A;  3VS0 A;  2KYB A;  3GBQ A;  4J9B A;  1UHC A;  1E6H A;  4AFU C;  1GCQ A;  2OI3 A;  2EYX A;  1YCS B;  3H0I A;  4JJC A;  2E5K A;  2QDL A;  4WCI A;  2VVK A;  1N5Z A;  2KXC A;  2EYY A;  2LP5 A;  3M0T A;  4M4Z A;  4QT7 A;  1UTI A;  2FPD A;  1X27 A;  3TVT A;  1OEB A;  1UFF A;  4J9I A;  2YUP A;  2PZ1 A;  1NG2 A;  2MOX A;  1UG1 A;  3VS2 A;  2OAW A;  4F16 A;  4CC7 A;  1A0N B;  4OMP A;  4RTY A;  1W6X A;  4LUD A;  1T3L A;  3VS7 A;  1WIE A;  4LE9 A;  1ZUK A;  4JJB A;  1PWT A;  1I07 A;  2DJQ A;  2C0I A;  2GNC A;  2KRS A;  2L3P A;  2RQT A;  2L0A A;  4HVW A;  2J6F A;  3EG1 A;  1HJD A;  4AG2 C;  4D8K A;  2YT6 A;  2HDA A;  2RQV A;  1HSQ A;  1B07 A;  1V1C A;  2FRW A;  3TSW A;  2J06 A;  4JPB W;  4CC2 A;  2D8H A;  2K3B A;  2KRN A;  1K0X A;  2CH4 A;  1BB9 A;  2EBP A;  2P4R A;  2L3Q A;  5EC7 A;  1RLP C;  2ESW A;  4FSS A;  2O9S A;  1VYU A;  2O31 A;  5IHI A;  3IQL A;  3PE0 A;  1KIK A;  1UJ0 A;  3R6N A;  1I0C A;  4Z88 A;  2DYB A;  3UA7 A;  2DA9 A;  2YUQ A;  2IIM A;  2RQU A;  2LX7 A;  2HCK A;  2CDT A;  1E7O A;  3M0Q A;  1SRL A;  5FWC A;  5GJW B;  2AKK A;  1YWO A;  5IHK A;  2JXB A;  1SHF A;  2BZY A;  1WXB A;  2K9G A;  1JO8 A;  3H0F A;  2RMO A;  3M0P A;  1X2K A;  2EW3 A;  2O2O A;  2CH4 W;  2DBK A;  4IIO A;  1Y57 A;  3REB B;  4OMN A;  1RUW A;  1JEG A;  2DNU A;  2CUD A;  1M3A A;  1ABO A;  5ECA A;  3SHW A;  4EIK A;  1LCK A;  1U3O A;  1AOJ A;  2SRC A;  1WXT A;  2FPF A;  1BBZ A;  2HEQ A;  1K1Z A;  1H92 A;  3VS3 A;  4GLM A;  4ESR A;  1K4U S;  4AFS C;  1Z9Q A;  2AKL A;  2EGE A;  2F2X A;  2C0O A;  2K2M A;  3PVL A;  4LNP A;  1U5S A;  4IIM A;  1NEB A;  1AZG B;  2W0Z A;  1ABQ A;  1K0S A;  2VWF A;  2NUZ A;  1FYN A;  3I35 A;  2RQW A;  2LCS A;  4AFQ C;  4D8D A;  2L2P A;  1NEG A;  2LMJ A;  2EKH A;  2GTO A;  2AK5 A;  1EFN A;  4JZ3 A;  2PNI A;  4KRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...