1YITQ

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yitQ00
3CCRQ 1W2BP 1KC8R 1S72Q 1VQ5Q 1KD1R 3CCQQ 3CCVQ 1M1KR 1QVFP 1VQMQ 1Q82R 3CPWP 3I56Q 1K73R 1VQKQ 3CXCP 1KQSP 3G4SQ 1NJIR 1YIJQ 2OTJQ 2QA4Q 1Q86R 3CC4Q 3CMAQ 2QEXQ 3CCLQ 3CCSQ 3CMEQ 3CCEQ 1YHQQ 1VQ9Q 3CCMQ 3G6EQ 3OW2P 1YJNQ 1YJWQ 1VQ4Q 1YITQ 1YJ9Q 3G71Q 1VQNQ 1K9MR 3CC2Q 1Q81R 1VQ6Q 1VQOQ 1N8RR 1JJ2P 1VQLQ 1M90R 3I55Q 2OTLQ 1VQ7Q 3CCJQ 1YI2Q 1QVGP 1VQ8Q 3CCUQ 1VQPQ 3CD6Q 1Q7YR 1K8AR 3CC7Q
chains in the Genus database with same CATH superfamily
2LX9A 3PGGA 1QCOA 1MMAA 5GMKl 3RKWA 3HRTA 2CZ7B 3JCMh 1TXQA 2X4XA 1LOJA 3EG1A 4DBQA 5GAMe 1AWWA 1WX6A 2BKDN 1Q95G 5LJ3d 1QWFA 2JS2A 5KYWB 4M75G 4EMKC 1KIKA 3JCMX 3P8HA 4NL2A 1W2BP 3MEUA 2EQMA 1KQSP 3I56A 3NGPA 1OX9A 3FIFA 3NTKA 1SG5A 3CCUT 8ATCB 1QCFA 3BE3A 3OYHA 2M16A 2O2OA 4C92B 2OAUA 2XD0A 2QQRA 4C92A 1BCOA 2C0IA 2R58A 1K8AR 3CCRQ 1B34A 1YCYA 4JJDA 2RQVA 5D6XA 1T0HA 4A53A 2FPFA 2QEXQ 1F1BB 2JNGA 3OYNA 4O6JA 2LC4A 2KAFA 2E41A 1TWBA 2DL3A 4A4EA 2DETA 3SDZA 1JO8A 4B9WA 4M77A 3WVEB 2V8JA 4E6RA 2XDPA 4JRQA 3MEVA 3DLLA 3JRZA 2CT4A 2RQRA 1VQLT 4A4HA 1NZ9A 5KE2A 2KYBA 2XU8A 3PMTA 1YP5A 2V8IA 4IIMA 1DJ7B 4EIKA 4BDYA 2D0NA 2LQWA 2A28A 1YHQA 3PTAA 4EMGA 1CKAA 2ED0A 2H3JA 1VQ4Q 5CQXA 2X9HA 5KYNA 2RHUA 1UDLA 3BY7A 3CCVA 4Z8AA 1VQKQ 2FPEA 4ANJA 5CK9A 2RJDA 1M90U 3VYGA 3EG3A 4F16A 1WGSA 4Z02A 3VS0A 1IB8A 2LRQA 2VUBA 2DJQA 1YITQ 4RKUE 2DLPA 5D7UA 2RNAA 2COWA 3M4YA 2RA2A 1N5ZA 5GAMd 2ATCB 3PFSA 4CRIA 4M78G 1ABOA 1WDXA 3X20B 2E6ZA 2K2MA 3H41A 2FEIA 4ORZA 4M7DB 3O8VA 4M7DA 2EYQA 4E7JA 1KHIA 2DIQA 3QHSA 2JVVA 1QKXA 3PVQA 3VU3C 3MPUB 3RMQA 5I22A 4DOVA 4PJOC 3OB9A 1M3AA 1A0NB 1D1AA 3RUXA 4CI0C 1ZA1B 4HVVA 4YTLA 2GQVA 4J9GA 1PNJA 3HKSA 4OMLA 2D6FA 1BI2A 3OYFA 3FRNA 5GANg 1Q81U 3L2VA 3KUFA 1WIEA 2XKOC 5DY9A 3CMAQ 2E3IA 1RLPC 2GNCA 4E7KA 2LQ8A 3VS5A 2LDMA 3CMET 1G3YA 4C8QC 1WQ7A 4N4IA 1ZQ1A 4DA4A 2CUBA 2DEUA 3A8LB 4FSSA 3CCRA 1X69A 2GGRA 2Z0WA 3JSCA 2EGEA 1QVPA 3JCMg 3QYGB 1KQ1A 1R77A 1D0ZA 2MAMA 4FL6A 1M3CA 4XTUA 2QEXA 5GANe 3LH5A 3PVLA 2KROA 4KUDK 5FWBA 3CCLT 3C95A 1MUZA 5LJ5d 3CC7Q 3OQ5A 4HCZA 4JLIA 1E7OA 4B6MA 4QVDA 1FMWA 3META 2OTJQ 1Y0MA 2YUPA 2OI3A 4B9XA 3JCMe 3MEWA 4XU2A 5LJ3f 1VQ4A 1JJ2P 5GAN7 3PIOA 2KYMA 1D1CA 2EAYA 3PE0A 3G71T 1E6GA 3FC3A 1ZUKA 2RM4A 1BU1A 2A7YA 1VQKA 2VXFA 1ZA2B 4IUVA 3CC4Q 4EDUA 4RTXA 1KFZA 2RHYA 1VA7A 2EKOA 2EQJA 3GOXA 2R5AA 3OBYA 4N0AA 1FWZA 2NLUA 1D3BB 1TS9A 2RPNA 4OP0A 3QZ9B 3QXEB 1AZGB 3WXMB 1K9MU 1UGVA 2P4TA 1VQ8T 4F7UF 3QJ6A 1KC8C 1KD1U 1M1KU 4C8QG 1W6XA 3DB4A 5CQYA 1PC0A 1V76A 4OVAA 2F2WA 2GTOA 1YBYA 1JXMA 3OYEA 2SRCA 2J6FA 3TQ7P 4XU1A 2QQBA 2VWFA 1CSKA 1J3TA 3JCMQ 3CMAA 5GAN5 4RCCA 4M75F 2YWWA 4JJCA 4BUGA 6AT1B 1VQOA 2YRDA 1UHFA 1ZSZB 2PTKA 3VV0A 4FYWB 1ZSZA 2HDAA 4KBMB 3M4GA 1KG1A 3QSUA 1TOVA 4E7IA 2D8HA 1RAGB 4XTXA 1YIJA 3SWNA 2LJ0A 4L6V5 5GMKj 2EFIA 3DKMA 3CMEQ 5KCOA 5IXFA 3G6EQ 1TSFA 3QWYA 2DBKA 3CC2Q 1ZX6A 1TH7A 2EQIA 3ZEHA 2X35A 5GAMf 3JCMd 5CAIA 1WQWA 3QBYA 3S6WA 2CGHA 3CC7A 1WHLA 1VQ5A 3TSZA 2RQTA 3TREA 2BZYA 1V29B 1MMGA 2RQUA 3QPHA 3M0UA 1TUDA 2D9TA 2HBPA 4D6WA 4X34A 4E7LA 3EGXA 3UWNA 3M0SA 5C6SA 3CCLQ 2OTJA 3JB9G 5CKBA 3NTIA 4F7UE 1GCPA 2PNIA 2HL3A 5LL6S 4J7IA 3OYCA 2NWMA 3SWNC 1NJIU 5D6WA 3JCMV 3IQLA 1YHQT 3CD6A 5CKDA 1VIFA 3QWXX 1WHMA 2HSEB 4M7AD 4BDZA 5GAOm 2AKLA 2LQNA 1IZ6A 4OMQA 4TVRA 3J81E 3CC4A 2JJ9A 3CCVT 4M75E 2RB6A 3LYIA 3G71Q 1K73U 1XQHA 1RACB 1X6GA 2FG0A 4FSXA 2W10A 3C4SA 4RTWA 1M1FA 4XAXB 1RABB 3Q1JA 2VGNA 5CKEA 1SSHA 2BTTA 1RI9A 3TSWA 3CCEQ 4E7HA 1VYVA 3OW2P 4AFUC 2M9UA 3GNGA 3M53A 4M78F 2CH4A 4LNPA 2MCNA 1K9MR 2CP2A 2DTOA 1N8RR 1XTDA 2BIVA 1VUBA 4C0GA 3HPWA 5LJ5f 3V8LA 1VQ8Q 3H0FA 2C0OA 2DRKA 3NFCA 4JLGA 4HT9A 3CPWP 2VKNA 3UF4A 3KBGA 3X26B 4PJJA 3VKIA 4BI4A 1JB0E 2YLCA 2KK4A 4F7UB 2E5QA 4NL3A 2BE9B 4F7UA 2DXBA 3HHTB 1VYTA 1LNXA 4IUPA 2RJEA 4XTZA 5DLOA 2M1HA 4PKCC 1S1NA 1VQ7Q 1FYNA 4C92D 5KYXB 1IXDA 2RHZA 4HT8A 1WJSA 1QVFP 1NEGA 1M8MA 1IGQA 3EFSA 1G3WA 2EGAA 1EZZB 2XDBA 4II1A 3C12A 2CH4W 1OQKA 2MOXA 4RTVA 1BI0A 4M75B 1X6BA 1ZHIA 1BI3A 3G6EA 4M75A 4LDVA 3CC2A 4JRIA 3I55Q 3OYLA 2K3BA 2QEXT 3VRYA 2MIOA 1M4ZA 1H641 3JB9H 1Q82R 2YLBA 2CP5A 3L42A 4LUEA 1X43A 2CP6A 1HD3A 4M78E 5L8RE 3TEEA 2JM9A 3VS4A 2JOYA 2O01E 3MP1A 3QJYA 2QGGA 4N4HA 2XICA 1FMVA 4DEYA 4PJMA 5GAN8 4Y91A 1VQ4T 1NJIR 5KH6A 4LD6A 4F04B 1OZ3A 1WYXA 4MZMA 1C6VX 3ASKA 1G3SA 2DPPB 1V1CA 2QDLA 2QAZA 1NM7A 1VQKT 3T9NA 2QASA 2M51A 2H3EB 1B07A 4C0DB 2MI6A 2JMCA 5FU7C 4VUBA 2EQKA 2AT1B 3CCVQ 4KRTA 3EG9A 2RMOA 2ABLA 4J7FA 4M7AA 2DVJA 5FRMA 4M7DD 4QT7A 1WXBA 2XG8D 3A98A 1OULA 4OGCA 2EVRA 3KFVA 1I1JA 1VOMA 2DFUA 3CCEA 3AT1B 3JCMf 5GMKh 3EFRA 1WJQA 3DB3A 5GAOr 1Y07A 2QYZA 4LDUA 1VQ8A 1GFCA 2HKNA 2LCSA 1K4US 1FXXA 2PUOB 4CC7A 4E47A 2JUFA 4AFSC 4ME7A 3J7AF 4C0ZA 1M30A 1QVGS 2EYYA 2XHCA 1D0XA 4M78B 1K73C 5CKFA 5KCHA 1X2KA 3CMAT 1AT1B 1VQ7A 3RR6A 2HQHA 5KYWA 3MEAA 4J83A 2VXEA 1VQOT 2RK2A 1OI1A 1TG0A 3ZL7C 2I2LA 4WF2A 2EKHA 3M59A 5HK3A 2VGMA 2DXTA 4C5GA 4JJNK 2KXDA 3VYHB 2RJCA 4MZPA 2KI7A 3TCJA 1NYGA 1M9SA 1YIJT 1AEYA 5ECAA 3I55A 1XJWB 4E2FB 3OMCA 5DLQE 1WLPB 3U23A 2PZ1A 2F5KA 1MHNA 4PLLA 3URGA 3MCAB 1QKWA 4ATOA 2GF7A 2MWPA 1QVGA 2RO0A 1Q86R 2PU9B 4J9IA 4E7ZA 1VQ5T 3CC7T 2X4YA 1LCKA 1FMKA 4A4KA 9ATCB 5A0DA 5HKCA 4LDXA 2HQEA 4PJLA 2OTJT 5IN1A 5FU6C 3M0QA 2K9GA 1SHGA 2NUZA 5GMKm 3VS7A 4J6WA 2A37A 1JQQA 4DBFA 3VS1A 2V26A 1AWOA 3HRSA 1BYMA 4C92C 4C8QE 4HCBA 3CD6T 1JBMA 1OV3A 1R0BG 2EIFA 4D8DA 3X25B 1KC8U 4ELYC 1WZOA 3G7ZA 4ZNXA 3C94A 3CC4T 3ZFJA 3JB9J 2J7IA 2WSEE 1JXOA 1AVZC 2A08A 2FL7A 2L3QA 4M77C 1K8AC 3QZ5B 3RKXA 3S3NA 2L5QA 1RAHB 3EG2A 4ZN1A 3OYKA 2E6NA 3J80E 2O9SA 1HJDA 1X6OA 1Y96B 5D6YA 2KVQG 1Y71A 2YUQA 4OMPA 2QK0A 2VYTA 3HRUA 3EGDB 3RERA 3JCMb 2SEMA 2O88A 1N27A 2EW3A 2X4JA 2H8HA 3LWIA 4BI8B 4HVUA 2R5MA 3I5SA 4QQGA 1EX4A 2RD1A 3CCQA 1MMNA 1UGPB 1OPKA 4C8QB 1OOTA 4CC4B 1I5LA 4OMOA 1I5OB 3FB9A 3BFMA 1QW1A 2MK5A 3M5AA 4C5HA 2DO3A 2DTIA 1OU8A 2O31A 1VQOQ 2L0AA 2J05A 4RTTA 4M7DC 1BKBA 2EYZA 2OTLQ 1WJRA 4FYXB 1JEGA 3G6ET 4ZGEB 2HBWA 1G2BA 4QVCA 3CC2T 2BZXA 5CR2A 5I21A 1YIJQ 4AMCA 4BB7A 4PNOA 2LMJA 4P5NA 4ZN3A 2JM8A 4OB3B 4M4ZA 1VQNA 2KEAA 1B3QA 2KXCA 5GAN2 3SHWA 1KQSS 1PD1A 4ZGJB 5GMKe 2QI2A 4M77G 1VQ5Q 1UJYA 3E19A 3O5ZA 1GBRA 4LXCA 2RH2A 3EGUA 3A8MB 3BDUA 1GCQA 3HTRA 2CP7A 4MDXA 1YJWQ 1AZEA 3KXTA 2DIGA 2L89A 1VQPQ 3CD6Q 1KSWA 1PM3A 2KRMA 5LJ5j 2DXUA 2KR3A 1KC8R 3JCMP 2ENMA 3CXCP 3L1AA 4LD9K 4X9CA 2DF6A 2DL8A 4PJOG 1M2OA 1W2BA 4A4GA 3TVTA 2OJ2A 1KQSA 5GJVB 1IO6A 2G3RA 4J5YA 2K5LA 1M90R 2X3XD 5AT1B 3OYMA 4HA8A 2V1RA 3CCET 1JRIA 2DXCA 4LUDA 4R55A 4A4FA 3ZBDA 1D3BA 4OB1B 2ROTA 2YRCA 1OZ2A 4L5GA 3FDRA 2K3XA 3RDVA 1AOJA 2CSQA 2LP5A 4LDYA 2PVDB 2EYXA 5DM7R 3MKDA 3RBBB 3MO8A 2E70A 3VS2A 1YJ9Q 2MWOA 4OMMA 4JS5A 5GAOn 4N4GA 4AT1B 2MF2A 1BB9A 3WVDB 3RNJA 1Y7XA 3GNFB 2XMFA 1IRXA 2F1LA 4N0AC 4KH0B 1VQ7T 3L2ZA 1Q7YC 1PRMC 2FZCB 2A0FB 2GFUA 2RI2A 1YCSB 1Q81R 2AZVA 4M75D 1U1TA 2CYZB 1MNEA 1G5VA 3JV3A 4Y28E 5GANd 5IHIA 4R0KA 2OTLA 2M02A 3OYIA 2KGTA 2LNHB 2EJFA 2O4XB 3FJ5A 3LLRA 3JCMJ 1KQ2A 3E2UA 3I55T 2DKGA 2FO0A 1MV3A 2ESWA 2JW4A 1RUWA 2VB6A 2XI9A 5FRNA 1SRLA 1WHGA 4C5IA 1SPKA 4XK8E 3OA6A 2ZPIB 2P84A 2DZCA 1SF9A 3JAME 5IXBA 1ZUUA 3G4SA 1GBQA 2RF0A 3H0HA 3M58A 1ZSZC 2DYIA 1VQ9A 2EGCA 1K9AA 2GFAA 4A54A 5CO7A 1YJWA 1RAEB 4JRPA 4AG2C 2IPOB 5KYYB 3A8OB 2COYA 2E10A 3I5RA 1VQPA 3CBPA 2VV5A 3H6ZA 4LN2A 5CKHA 3M57A 4A63B 4J9HA 4FIBA 5M9OA 2PVOB 1T0JA 1M8VA 4J9CA 3OSVA 4J8OA 4J6YA 1WHKA 3H8ZA 3OMGA 2HL5C 3VUBA 1C0MA 1NE8A 3MHXA 2AZSA 2JT4A 5I2MA 2ZPHB 3UT1A 1TUGB 4PK4A 2LJ3A 1SEMA 2FYKA 3L2WA 4HCKA 4MDWA 4R56A 2Y90A 3HSBA 3H0IA 3HFNA 1ARKA 1H92A 4UC4A 3OYGA 1AHJB 3M55A 4RUGA 2EQUA 1YJ9A 2K3YA 4M78D 1XOVA 2J06A 4KULA 4XU0A 1N6AA 1ZLMA 1UE9A 1KD1R 1M1KR 2OAWA 3OS2A 4JDSA 2E3HA 4IURA 4KGXB 3CCQT 4FT2A 1NG2A 3CEYA 1K0SA 2HSPA 5C0MA 1Z9ZA 3G1JA 5KYXA 3GBQA 5LJ3g 2FHDA 2K2VA 2WSCE 1JJ2A 1BCMA 4KT0E 4LE9A 5LJ5h 1UJ0A 1M2VB 4HKEA 5FW9A 1YJNQ 1M2VA 2CT3A 4FT4A 2JTFA 4PL6A 4Y92A 3A5ZB 1NPRA 3A8GB 3S3MA 1VQNT 1HSQA 3CPFA 1N8RC 2L8DA 1Z9QA 2DE0X 2J6OA 4BY6B 4DBRA 1UECA 3P8BB 3UDCA 5LJ3e 1GXIE 1K1ZA 4RCBA 2K7AA 2DL4A 1K8AU 1BIBA 1NYFA 1QQJA 1X2QA 3EFOB 2QQ9A 2YDLA 2IIMA 2FVUA 3M54A 1RAFB 3EFOA 2PUKB 1PKTA 1PG5B 1YI2A 2C06A 1S72Q 4M75C 1BBZA 3ER0A 2DAQA 5GAN6 2QA4A 2DYBA 4AFQC 5HY6A 4HVWA 3LGLA 2CSIA 3OS1A 5GANf 2DK3A 2CREA 1AD5A 3V8JA 2K57A 2YHTA 2LQKA 2GQIA 3HP9A 3DLMA 4PJOF 1D1BA 1MGQA 5IHKA 4RTYA 5EC7A 1K73R 3NHNA 2A3LA 1OU9A 4GLKA 3EHRA 4NS5A 3NTHA 1UTIA 2QDYB 3PT9A 2PVGB 4AG1C 4F17A 4WTOB 3R6OA 4MMKA 3UPUA 2E65A 1Y57A 3QO3A 1ACMB 3RKYA 4CC3A 2F2VA 4XQ3A 1WHJA 2DX1A 4C0DC 2DL5A 2NYSA 3PIPA 4C8QF 4EMKB 1KK7A 3VUZA 5IT9E 4C8QD 4EMKA 1RAAB 1LVKA 2NUTB 3EG0A 4M77E 2DTHA 4M7AC 1EFNA 2OX7A 4M78A 2COZA 3FLGA 2JN0A 3ULRB 1PCXA 2QXFA 4BACA 3EH1A 3A8HB 3L2UA 3CCQQ 3OW2S 4PFOA 4EPCA 2DM1A 2OTLT 2KSSA 3CCSQ 1UB4A 2KNBB 1PWTA 2WACA 2AKKA 1YJNA 3TU4K 3CPWS 2F2XA 3RMSA 5LJ3j 2DRMA 1G3TA 4PJOE 2KDSA 1X27A 1BIAA 4M78C 1YNZA 1OPLA 4IIOA 5FU6B 1AWXA 1G8XA 2X51A 3CCMQ 3OSSC 2CKKA 2E1HA 1UEBA 1VQNQ 3G4ST 1JU5C 1MV0B 4J9DA 1QVFS 5IH2A 1VQ9T 3OW2A 1B34B 2X3WD 1R0CB 2BUDA 5GJWB 1YJWT 3JB9F 1S72A 4M7DE 1D09B 3OY9A 2ZPEB 3JB9D 5LJ5g 2NUPB 1UHCA 3VS3A 4OB2B 2NUPA 2L3PA 2YUNA 1VQPT 3E1SA 3E9FA 4QVZA 3CPWA 4IUTA 5GAN4 2CP0A 2RI3A 2CUDA 1K0XA 4LDWA 4M77B 2K4YA 2L3RA 1VQ6A 1OX8A 4K11A 2K5IA 2DEQA 2CP3A 1YN8A 1IHVA 1ABQA 2MYSA 4X1VA 2V1QA 1X01A 1QP2A 3UA6A 1EIFA 2ED1A 4MZTA 2DNUA 4JZ4A 1CKBA 2DVEA 3C0CA 4M7AG 3MP6A 1UGQB 2P0PA 1QVFA 4RMOA 4XU3A 4BE0A 3EHQA 5LJ5e 2RHIA 2ZZDA 4F14A 1Q7YU 4QQ6A 5GAOp 2KRNA 3L2QA 1Q86C 3QKJA 2HD0A 4QQDA 4IKFA 4BE2A 4PJOB 4KUIA 1YJ9T 2BE7D 1VQMQ 4PJOA 3QUIA 2RK1A 2KT1A 1Y96A 3CBMA 1I0CA 1K76A 2QQAA 2RHXA 4QKUA 4Z89A 2YRVA 1M3BA 3ME9A 1OEBA 3EGDA 2HEQA 2A36A 3JB9I 1T3SA 3CCJA 2JS0A 2RN8A 5J39A 5GAMj 3X28B 1AWJA 2E12A 4DEXA 1U8RA 4EMHA 2LJ1A 4OB0B 3OYJA 2ROLA 3FEOA 4OGEA 3VJPA 3CCSA 1ZUYA 2QGFB 1ZBXA 4C8QA 2AHJB 2XIDA 1WXUA 1B7TA 2RQWA 1H3ZA 3QYHB 1MNDA 3LH0A 2KE9A 2LTOA 2P0QA 2KT8A 4C92G 1H3HA 2HNIA 2HMAA 2ZPFB 5J3BA 5A0LA 2CS7A 3PMIA 3CCMA 5L23A 2HQXA 2ZCFB 1W4SA 1W2BS 4DBHA 2BZ8A 3AHUA 4J9FA 1M1GA 3GP8A 3CCUQ 1NLPC 2IG0A 2PQWA 1T3LA 3G4SQ 2DJZA 1YI2T 1OYXA 2RJFA 2DMOA 3VRZA 1VQ9Q 3BW1A 3GF5A 3LWHA 3JCMc 4DQ2A 4ZTFA 3HFOA 2QA4T 2D0QB 1O75A 2LNVA 2K6DA 1UGSB 3M9QA 4XTVA 3LW5E 1SSFA 2G6FX 2MMPA 2EJGA 2D1XA 4RTUA 5IHNA 2JXBA 3M0TA 3CQTA 4FW1A 3P8DA 5AYFA 1BK2A 3F70A 3S3OA 2R57A 3OYDA 2Y4XA 1M5Q1 3N5BB 2B8AA 1TU0B 2KQWA 2J6KA 4JJBA 5A2QE 5A0GA 1VQLQ 3FJPA 5GAN3 1GCQC 3X24B 1Q7YR 2FB7A 2JTEA 2CZ6B 4X9DA 1VQMA 2F69A 3V7RA 1WI7A 4PJNA 5LJ3h 1GL5A 1D0YA 4QW2A 1WA7A 2LVMA 1TUCA 1XNIA 1P92A 1QCNA 4NOYA 2DL7A 2XK0A 2Y4YA 4M7DG 4JRKA 2ZGWA 1YITA 1U5SA 4PLIA 5FROA 3RIRA 4Q5WA 3D7SB 2M0YA 2EYWA 1NBEB 1QMCA 2FZKB 4JZ3A 4XTYA 5IAYA 1TTHB 1N8RU 4HCCA 2QG9B 4DOWA 2EPDA 4L59A 1LJOA 2LCCA 1UG1A 3PNWC 2F5TX 3H9NA 2M0OA 5I2SA 3REAB 1RADB 2YUOA 5I11A 4FU6A 4BD3A 1YJNT 1RLQC 1C1AA 2W0ZA 1WHHA 2O4XA 1M90C 1YWOA 5KYUB 3V7SA 5KYUA 4WCIA 4JPBW 5GAOl 1HYOA 3I56T 1U06A 4HXJA 1PSEA 2HKQB 4ELZC 4KGVB 3I35A 2DD4A 1WFWA 5GANj 4GLMA 2YT6A 3CCUA 4C0FA 3OYAA 3UA7A 2K5FA 3SWNB 5J26A 1QWEA 1LPLA 4PFPA 2L3SA 3OYBA 4RTZA 3E9GA 4ESRA 4Z88A 2ZPBB 2B86A 1S72T 1I4K1 4O5VA 3OS0A 1Q82U 2VASA 3SFMA 4OF1A 1YI2Q 4OMNA 4IUQA 2FRYA 2LX7A 2GBQA 5KYYA 1UGRB 3EGXB 1Q81C 1VQ6T 2DILA 4AFZC 3QDFA 2HZYA 2P4RA 5CVIA 4MMLA 3SB2A 2QA4Q 5GAMh 2V8KA 3LX7A 1I07A 2ECZA 4J9BA 1BI1A 2KMTA 2AK5A 3EH2A 1ZBJA 2L2PA 3M0RA 1IHWA 1VQLA 1IGUA 2C0TA 1RI0A 3QDRB 2FZGB 1MMDA 4M7AF 1G83A 2YXYA 3L2RA 4ZGDB 3GPLA 3LGFA 2DBMA 2E64A 1W1FA 2JZ2A 1JJ2S 1YWPA 1W70A 1PRLC 4J9EA 3OBWA 1NEBA 3CXCS 5KE3A 3NMZC 1QVGP 2WSFE 3I9QA 4FW2A 1SRMA 2RI5A 1PSFA 3GIBA 3EAEA 3CCJT 1HXDA 1U3OA 2DERA 4BE1A 2D8JA 1O9SA 1RL2A 1WPYA 1HK9A 2HAXA 2FPDA 3CCST 2LT1A 2LT4A 3R6NA 4FCYA 3QIIA 3OYYA 4PFZA 4JS4A 1N9RA 2QTXA 2YSQA 2EBPA 2K79A 1PKSA 3SD4A 1UUEA 1PHTA 2KRSA 1E6HA 1WNLA 3M0PA 1NPPA 2MPXC 4RG2A 1VIEA 3CXCA 4C92F 3UATA 3INZA 2JTMA 2ZPGB 5CCAA 3CCMT 2P0KA 3MJXA 4M7AE 2VC8A 1GRIA 3REBB 4FYYB 3M56A 3I56Q 1K9MC 3THKA 3MP8A 4D8KA 2E5KA 3CBOA 1SHFA 3CMEA 3NPFA 3CCRT 1R8OB 1WXTA 1UFFA 2EWNA 1KD1C 1M1KC 2LZ6B 4CC2A 4BI3A 5FLXE 4M77F 1H8KA 1I81A 3GLXA 4M77D 2QTVA 2KY9A 5HCKA 1Q86U 5FWCA 2GTJA 4FYVB 2DA9A 5CIUA 4V2SA 2O9VA 4KGZB 1ZSGA 3VS6A 2FRWA 5GAOq 3SEMA 5FU7B 3V8KA 2IVWA 3JCMW 4FM4B 3CCLA 2X4WA 4J6XA 2XDDA 2CZ0B 3BDLA 4E7SA 1KHCA 2I0NA 1VQ6Q 4RG8A 2JMAA 2QQSA 2CDTA 2E4HA 4BY6C 2HCKA 8AT1B 1I8FA 4C5EA 2VVKA 4PJOD 2AIRB 4GY5A 1M27C 2DZ9A 1U1SA 1YHQQ 5EG2A 2DD5A 1VQMT 1Q82C 1X75C 3G71A 2KBTA 3HL8A 4C92E 4XTWA 1QP3A 3RESA 4JUVA 1N9SA 3QG1A 7AT1B 4KH1B 1YITT 3EG9B 4GBQA 4M7AB 1VYUA 4M7DF 3V7CA 2LCLA 5GAMg 5GANh 1YFNA 1GFDA 1QLYA 1RAIB 3OS5A 2GCXA 2ZAEA 2EJ9A 1SKUB 3A1PA 1IREB 1NLOC 4OMFB 1KJWA 2CZ1B 1PD0A 2NUTA 4F7UG 1NJIC 4ZTJA 5HK0A 3CCJQ 4IUUA 5GMKi 1FX7A
chains in the Genus database with same CATH topology
3CCRQ 1W2BP 1KC8R 1S72Q 1VQ5Q 1KD1R 3CCQQ 3CCVQ 1M1KR 1QVFP 1VQMQ 1Q82R 3CPWP 3I56Q 1K73R 1VQKQ 3CXCP 1KQSP 3G4SQ 1NJIR 1YIJQ 2OTJQ 2QA4Q 1Q86R 3CC4Q 3CMAQ 2QEXQ 3CCLQ 3CCSQ 3CMEQ 3CCEQ 1YHQQ 1VQ9Q 3CCMQ 3G6EQ 3OW2P 1YJNQ 1YJWQ 1VQ4Q 1YITQ 1YJ9Q 3G71Q 1VQNQ 1K9MR 3CC2Q 1Q81R 1VQ6Q 1VQOQ 1N8RR 1JJ2P 1VQLQ 1M90R 3I55Q 2OTLQ 1VQ7Q 3CCJQ 1YI2Q 1QVGP 1VQ8Q 3CCUQ 1VQPQ 3CD6Q 1Q7YR 1K8AR 3CC7Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR Q;  1W2B P;  1KC8 R;  1S72 Q;  1VQ5 Q;  1KD1 R;  3CCQ Q;  3CCV Q;  1M1K R;  1QVF P;  1VQM Q;  1Q82 R;  3CPW P;  3I56 Q;  1K73 R;  1VQK Q;  3CXC P;  1KQS P;  3G4S Q;  1NJI R;  1YIJ Q;  2OTJ Q;  2QA4 Q;  1Q86 R;  3CC4 Q;  3CMA Q;  2QEX Q;  3CCL Q;  3CCS Q;  3CME Q;  3CCE Q;  1YHQ Q;  1VQ9 Q;  3CCM Q;  3G6E Q;  3OW2 P;  1YJN Q;  1YJW Q;  1VQ4 Q;  1YIT Q;  1YJ9 Q;  3G71 Q;  1VQN Q;  1K9M R;  3CC2 Q;  1Q81 R;  1VQ6 Q;  1VQO Q;  1N8R R;  1JJ2 P;  1VQL Q;  1M90 R;  3I55 Q;  2OTL Q;  1VQ7 Q;  3CCJ Q;  1YI2 Q;  1QVG P;  1VQ8 Q;  3CCU Q;  1VQP Q;  3CD6 Q;  1Q7Y R;  1K8A R;  3CC7 Q; 
#chains in the Genus database with same CATH topology
 2LX9 A;  3PGG A;  1QCO A;  1MMA A;  5GMK l;  3RKW A;  3HRT A;  2CZ7 B;  3JCM h;  1TXQ A;  2X4X A;  1LOJ A;  3EG1 A;  4DBQ A;  5GAM e;  1AWW A;  1WX6 A;  2BKD N;  1Q95 G;  5LJ3 d;  1QWF A;  2JS2 A;  5KYW B;  4M75 G;  4EMK C;  1KIK A;  3JCM X;  3P8H A;  4NL2 A;  1W2B P;  3MEU A;  2EQM A;  1KQS P;  3I56 A;  3NGP A;  1OX9 A;  3FIF A;  3NTK A;  1SG5 A;  3CCU T;  8ATC B;  1QCF A;  3BE3 A;  3OYH A;  2M16 A;  2O2O A;  4C92 B;  2OAU A;  2XD0 A;  2QQR A;  4C92 A;  1BCO A;  2C0I A;  2R58 A;  1K8A R;  3CCR Q;  1B34 A;  1YCY A;  4JJD A;  2RQV A;  5D6X A;  1T0H A;  4A53 A;  2FPF A;  2QEX Q;  1F1B B;  2JNG A;  3OYN A;  4O6J A;  2LC4 A;  2KAF A;  2E41 A;  1TWB A;  2DL3 A;  4A4E A;  2DET A;  3SDZ A;  1JO8 A;  4B9W A;  4M77 A;  3WVE B;  2V8J A;  4E6R A;  2XDP A;  4JRQ A;  3MEV A;  3DLL A;  3JRZ A;  2CT4 A;  2RQR A;  1VQL T;  4A4H A;  1NZ9 A;  5KE2 A;  2KYB A;  2XU8 A;  3PMT A;  1YP5 A;  2V8I A;  4IIM A;  1DJ7 B;  4EIK A;  4BDY A;  2D0N A;  2LQW A;  2A28 A;  1YHQ A;  3PTA A;  4EMG A;  1CKA A;  2ED0 A;  2H3J A;  1VQ4 Q;  5CQX A;  2X9H A;  5KYN A;  2RHU A;  1UDL A;  3BY7 A;  3CCV A;  4Z8A A;  1VQK Q;  2FPE A;  4ANJ A;  5CK9 A;  2RJD A;  1M90 U;  3VYG A;  3EG3 A;  4F16 A;  1WGS A;  4Z02 A;  3VS0 A;  1IB8 A;  2LRQ A;  2VUB A;  2DJQ A;  1YIT Q;  4RKU E;  2DLP A;  5D7U A;  2RNA A;  2COW A;  3M4Y A;  2RA2 A;  1N5Z A;  5GAM d;  2ATC B;  3PFS A;  4CRI A;  4M78 G;  1ABO A;  1WDX A;  3X20 B;  2E6Z A;  2K2M A;  3H41 A;  2FEI A;  4ORZ A;  4M7D B;  3O8V A;  4M7D A;  2EYQ A;  4E7J A;  1KHI A;  2DIQ A;  3QHS A;  2JVV A;  1QKX A;  3PVQ A;  3VU3 C;  3MPU B;  3RMQ A;  5I22 A;  4DOV A;  4PJO C;  3OB9 A;  1M3A A;  1A0N B;  1D1A A;  3RUX A;  4CI0 C;  1ZA1 B;  4HVV A;  4YTL A;  2GQV A;  4J9G A;  1PNJ A;  3HKS A;  4OML A;  2D6F A;  1BI2 A;  3OYF A;  3FRN A;  5GAN g;  1Q81 U;  3L2V A;  3KUF A;  1WIE A;  2XKO C;  5DY9 A;  3CMA Q;  2E3I A;  1RLP C;  2GNC A;  4E7K A;  2LQ8 A;  3VS5 A;  2LDM A;  3CME T;  1G3Y A;  4C8Q C;  1WQ7 A;  4N4I A;  1ZQ1 A;  4DA4 A;  2CUB A;  2DEU A;  3A8L B;  4FSS A;  3CCR A;  1X69 A;  2GGR A;  2Z0W A;  3JSC A;  2EGE A;  1QVP A;  3JCM g;  3QYG B;  1KQ1 A;  1R77 A;  1D0Z A;  2MAM A;  4FL6 A;  1M3C A;  4XTU A;  2QEX A;  5GAN e;  3LH5 A;  3PVL A;  2KRO A;  4KUD K;  5FWB A;  3CCL T;  3C95 A;  1MUZ A;  5LJ5 d;  3CC7 Q;  3OQ5 A;  4HCZ A;  4JLI A;  1E7O A;  4B6M A;  4QVD A;  1FMW A;  3MET A;  2OTJ Q;  1Y0M A;  2YUP A;  2OI3 A;  4B9X A;  3JCM e;  3MEW A;  4XU2 A;  5LJ3 f;  1VQ4 A;  1JJ2 P;  5GAN 7;  3PIO A;  2KYM A;  1D1C A;  2EAY A;  3PE0 A;  3G71 T;  1E6G A;  3FC3 A;  1ZUK A;  2RM4 A;  1BU1 A;  2A7Y A;  1VQK A;  2VXF A;  1ZA2 B;  4IUV A;  3CC4 Q;  4EDU A;  4RTX A;  1KFZ A;  2RHY A;  1VA7 A;  2EKO A;  2EQJ A;  3GOX A;  2R5A A;  3OBY A;  4N0A A;  1FWZ A;  2NLU A;  1D3B B;  1TS9 A;  2RPN A;  4OP0 A;  3QZ9 B;  3QXE B;  1AZG B;  3WXM B;  1K9M U;  1UGV A;  2P4T A;  1VQ8 T;  4F7U F;  3QJ6 A;  1KC8 C;  1KD1 U;  1M1K U;  4C8Q G;  1W6X A;  3DB4 A;  5CQY A;  1PC0 A;  1V76 A;  4OVA A;  2F2W A;  2GTO A;  1YBY A;  1JXM A;  3OYE A;  2SRC A;  2J6F A;  3TQ7 P;  4XU1 A;  2QQB A;  2VWF A;  1CSK A;  1J3T A;  3JCM Q;  3CMA A;  5GAN 5;  4RCC A;  4M75 F;  2YWW A;  4JJC A;  4BUG A;  6AT1 B;  1VQO A;  2YRD A;  1UHF A;  1ZSZ B;  2PTK A;  3VV0 A;  4FYW B;  1ZSZ A;  2HDA A;  4KBM B;  3M4G A;  1KG1 A;  3QSU A;  1TOV A;  4E7I A;  2D8H A;  1RAG B;  4XTX A;  1YIJ A;  3SWN A;  2LJ0 A;  4L6V 5;  5GMK j;  2EFI A;  3DKM A;  3CME Q;  5KCO A;  5IXF A;  3G6E Q;  1TSF A;  3QWY A;  2DBK A;  3CC2 Q;  1ZX6 A;  1TH7 A;  2EQI A;  3ZEH A;  2X35 A;  5GAM f;  3JCM d;  5CAI A;  1WQW A;  3QBY A;  3S6W A;  2CGH A;  3CC7 A;  1WHL A;  1VQ5 A;  3TSZ A;  2RQT A;  3TRE A;  2BZY A;  1V29 B;  1MMG A;  2RQU A;  3QPH A;  3M0U A;  1TUD A;  2D9T A;  2HBP A;  4D6W A;  4X34 A;  4E7L A;  3EGX A;  3UWN A;  3M0S A;  5C6S A;  3CCL Q;  2OTJ A;  3JB9 G;  5CKB A;  3NTI A;  4F7U E;  1GCP A;  2PNI A;  2HL3 A;  5LL6 S;  4J7I A;  3OYC A;  2NWM A;  3SWN C;  1NJI U;  5D6W A;  3JCM V;  3IQL A;  1YHQ T;  3CD6 A;  5CKD A;  1VIF A;  3QWX X;  1WHM A;  2HSE B;  4M7A D;  4BDZ A;  5GAO m;  2AKL A;  2LQN A;  1IZ6 A;  4OMQ A;  4TVR A;  3J81 E;  3CC4 A;  2JJ9 A;  3CCV T;  4M75 E;  2RB6 A;  3LYI A;  3G71 Q;  1K73 U;  1XQH A;  1RAC B;  1X6G A;  2FG0 A;  4FSX A;  2W10 A;  3C4S A;  4RTW A;  1M1F A;  4XAX B;  1RAB B;  3Q1J A;  2VGN A;  5CKE A;  1SSH A;  2BTT A;  1RI9 A;  3TSW A;  3CCE Q;  4E7H A;  1VYV A;  3OW2 P;  4AFU C;  2M9U A;  3GNG A;  3M53 A;  4M78 F;  2CH4 A;  4LNP A;  2MCN A;  1K9M R;  2CP2 A;  2DTO A;  1N8R R;  1XTD A;  2BIV A;  1VUB A;  4C0G A;  3HPW A;  5LJ5 f;  3V8L A;  1VQ8 Q;  3H0F A;  2C0O A;  2DRK A;  3NFC A;  4JLG A;  4HT9 A;  3CPW P;  2VKN A;  3UF4 A;  3KBG A;  3X26 B;  4PJJ A;  3VKI A;  4BI4 A;  1JB0 E;  2YLC A;  2KK4 A;  4F7U B;  2E5Q A;  4NL3 A;  2BE9 B;  4F7U A;  2DXB A;  3HHT B;  1VYT A;  1LNX A;  4IUP A;  2RJE A;  4XTZ A;  5DLO A;  2M1H A;  4PKC C;  1S1N A;  1VQ7 Q;  1FYN A;  4C92 D;  5KYX B;  1IXD A;  2RHZ A;  4HT8 A;  1WJS A;  1QVF P;  1NEG A;  1M8M A;  1IGQ A;  3EFS A;  1G3W A;  2EGA A;  1EZZ B;  2XDB A;  4II1 A;  3C12 A;  2CH4 W;  1OQK A;  2MOX A;  4RTV A;  1BI0 A;  4M75 B;  1X6B A;  1ZHI A;  1BI3 A;  3G6E A;  4M75 A;  4LDV A;  3CC2 A;  4JRI A;  3I55 Q;  3OYL A;  2K3B A;  2QEX T;  3VRY A;  2MIO A;  1M4Z A;  1H64 1;  3JB9 H;  1Q82 R;  2YLB A;  2CP5 A;  3L42 A;  4LUE A;  1X43 A;  2CP6 A;  1HD3 A;  4M78 E;  5L8R E;  3TEE A;  2JM9 A;  3VS4 A;  2JOY A;  2O01 E;  3MP1 A;  3QJY A;  2QGG A;  4N4H A;  2XIC A;  1FMV A;  4DEY A;  4PJM A;  5GAN 8;  4Y91 A;  1VQ4 T;  1NJI R;  5KH6 A;  4LD6 A;  4F04 B;  1OZ3 A;  1WYX A;  4MZM A;  1C6V X;  3ASK A;  1G3S A;  2DPP B;  1V1C A;  2QDL A;  2QAZ A;  1NM7 A;  1VQK T;  3T9N A;  2QAS A;  2M51 A;  2H3E B;  1B07 A;  4C0D B;  2MI6 A;  2JMC A;  5FU7 C;  4VUB A;  2EQK A;  2AT1 B;  3CCV Q;  4KRT A;  3EG9 A;  2RMO A;  2ABL A;  4J7F A;  4M7A A;  2DVJ A;  5FRM A;  4M7D D;  4QT7 A;  1WXB A;  2XG8 D;  3A98 A;  1OUL A;  4OGC A;  2EVR A;  3KFV A;  1I1J A;  1VOM A;  2DFU A;  3CCE A;  3AT1 B;  3JCM f;  5GMK h;  3EFR A;  1WJQ A;  3DB3 A;  5GAO r;  1Y07 A;  2QYZ A;  4LDU A;  1VQ8 A;  1GFC A;  2HKN A;  2LCS A;  1K4U S;  1FXX A;  2PUO B;  4CC7 A;  4E47 A;  2JUF A;  4AFS C;  4ME7 A;  3J7A F;  4C0Z A;  1M30 A;  1QVG S;  2EYY A;  2XHC A;  1D0X A;  4M78 B;  1K73 C;  5CKF A;  5KCH A;  1X2K A;  3CMA T;  1AT1 B;  1VQ7 A;  3RR6 A;  2HQH A;  5KYW A;  3MEA A;  4J83 A;  2VXE A;  1VQO T;  2RK2 A;  1OI1 A;  1TG0 A;  3ZL7 C;  2I2L A;  4WF2 A;  2EKH A;  3M59 A;  5HK3 A;  2VGM A;  2DXT A;  4C5G A;  4JJN K;  2KXD A;  3VYH B;  2RJC A;  4MZP A;  2KI7 A;  3TCJ A;  1NYG A;  1M9S A;  1YIJ T;  1AEY A;  5ECA A;  3I55 A;  1XJW B;  4E2F B;  3OMC A;  5DLQ E;  1WLP B;  3U23 A;  2PZ1 A;  2F5K A;  1MHN A;  4PLL A;  3URG A;  3MCA B;  1QKW A;  4ATO A;  2GF7 A;  2MWP A;  1QVG A;  2RO0 A;  1Q86 R;  2PU9 B;  4J9I A;  4E7Z A;  1VQ5 T;  3CC7 T;  2X4Y A;  1LCK A;  1FMK A;  4A4K A;  9ATC B;  5A0D A;  5HKC A;  4LDX A;  2HQE A;  4PJL A;  2OTJ T;  5IN1 A;  5FU6 C;  3M0Q A;  2K9G A;  1SHG A;  2NUZ A;  5GMK m;  3VS7 A;  4J6W A;  2A37 A;  1JQQ A;  4DBF A;  3VS1 A;  2V26 A;  1AWO A;  3HRS A;  1BYM A;  4C92 C;  4C8Q E;  4HCB A;  3CD6 T;  1JBM A;  1OV3 A;  1R0B G;  2EIF A;  4D8D A;  3X25 B;  1KC8 U;  4ELY C;  1WZO A;  3G7Z A;  4ZNX A;  3C94 A;  3CC4 T;  3ZFJ A;  3JB9 J;  2J7I A;  2WSE E;  1JXO A;  1AVZ C;  2A08 A;  2FL7 A;  2L3Q A;  4M77 C;  1K8A C;  3QZ5 B;  3RKX A;  3S3N A;  2L5Q A;  1RAH B;  3EG2 A;  4ZN1 A;  3OYK A;  2E6N A;  3J80 E;  2O9S A;  1HJD A;  1X6O A;  1Y96 B;  5D6Y A;  2KVQ G;  1Y71 A;  2YUQ A;  4OMP A;  2QK0 A;  2VYT A;  3HRU A;  3EGD B;  3RER A;  3JCM b;  2SEM A;  2O88 A;  1N27 A;  2EW3 A;  2X4J A;  2H8H A;  3LWI A;  4BI8 B;  4HVU A;  2R5M A;  3I5S A;  4QQG A;  1EX4 A;  2RD1 A;  3CCQ A;  1MMN A;  1UGP B;  1OPK A;  4C8Q B;  1OOT A;  4CC4 B;  1I5L A;  4OMO A;  1I5O B;  3FB9 A;  3BFM A;  1QW1 A;  2MK5 A;  3M5A A;  4C5H A;  2DO3 A;  2DTI A;  1OU8 A;  2O31 A;  1VQO Q;  2L0A A;  2J05 A;  4RTT A;  4M7D C;  1BKB A;  2EYZ A;  2OTL Q;  1WJR A;  4FYX B;  1JEG A;  3G6E T;  4ZGE B;  2HBW A;  1G2B A;  4QVC A;  3CC2 T;  2BZX A;  5CR2 A;  5I21 A;  1YIJ Q;  4AMC A;  4BB7 A;  4PNO A;  2LMJ A;  4P5N A;  4ZN3 A;  2JM8 A;  4OB3 B;  4M4Z A;  1VQN A;  2KEA A;  1B3Q A;  2KXC A;  5GAN 2;  3SHW A;  1KQS S;  1PD1 A;  4ZGJ B;  5GMK e;  2QI2 A;  4M77 G;  1VQ5 Q;  1UJY A;  3E19 A;  3O5Z A;  1GBR A;  4LXC A;  2RH2 A;  3EGU A;  3A8M B;  3BDU A;  1GCQ A;  3HTR A;  2CP7 A;  4MDX A;  1YJW Q;  1AZE A;  3KXT A;  2DIG A;  2L89 A;  1VQP Q;  3CD6 Q;  1KSW A;  1PM3 A;  2KRM A;  5LJ5 j;  2DXU A;  2KR3 A;  1KC8 R;  3JCM P;  2ENM A;  3CXC P;  3L1A A;  4LD9 K;  4X9C A;  2DF6 A;  2DL8 A;  4PJO G;  1M2O A;  1W2B A;  4A4G A;  3TVT A;  2OJ2 A;  1KQS A;  5GJV B;  1IO6 A;  2G3R A;  4J5Y A;  2K5L A;  1M90 R;  2X3X D;  5AT1 B;  3OYM A;  4HA8 A;  2V1R A;  3CCE T;  1JRI A;  2DXC A;  4LUD A;  4R55 A;  4A4F A;  3ZBD A;  1D3B A;  4OB1 B;  2ROT A;  2YRC A;  1OZ2 A;  4L5G A;  3FDR A;  2K3X A;  3RDV A;  1AOJ A;  2CSQ A;  2LP5 A;  4LDY A;  2PVD B;  2EYX A;  5DM7 R;  3MKD A;  3RBB B;  3MO8 A;  2E70 A;  3VS2 A;  1YJ9 Q;  2MWO A;  4OMM A;  4JS5 A;  5GAO n;  4N4G A;  4AT1 B;  2MF2 A;  1BB9 A;  3WVD B;  3RNJ A;  1Y7X A;  3GNF B;  2XMF A;  1IRX A;  2F1L A;  4N0A C;  4KH0 B;  1VQ7 T;  3L2Z A;  1Q7Y C;  1PRM C;  2FZC B;  2A0F B;  2GFU A;  2RI2 A;  1YCS B;  1Q81 R;  2AZV A;  4M75 D;  1U1T A;  2CYZ B;  1MNE A;  1G5V A;  3JV3 A;  4Y28 E;  5GAN d;  5IHI A;  4R0K A;  2OTL A;  2M02 A;  3OYI A;  2KGT A;  2LNH B;  2EJF A;  2O4X B;  3FJ5 A;  3LLR A;  3JCM J;  1KQ2 A;  3E2U A;  3I55 T;  2DKG A;  2FO0 A;  1MV3 A;  2ESW A;  2JW4 A;  1RUW A;  2VB6 A;  2XI9 A;  5FRN A;  1SRL A;  1WHG A;  4C5I A;  1SPK A;  4XK8 E;  3OA6 A;  2ZPI B;  2P84 A;  2DZC A;  1SF9 A;  3JAM E;  5IXB A;  1ZUU A;  3G4S A;  1GBQ A;  2RF0 A;  3H0H A;  3M58 A;  1ZSZ C;  2DYI A;  1VQ9 A;  2EGC A;  1K9A A;  2GFA A;  4A54 A;  5CO7 A;  1YJW A;  1RAE B;  4JRP A;  4AG2 C;  2IPO B;  5KYY B;  3A8O B;  2COY A;  2E10 A;  3I5R A;  1VQP A;  3CBP A;  2VV5 A;  3H6Z A;  4LN2 A;  5CKH A;  3M57 A;  4A63 B;  4J9H A;  4FIB A;  5M9O A;  2PVO B;  1T0J A;  1M8V A;  4J9C A;  3OSV A;  4J8O A;  4J6Y A;  1WHK A;  3H8Z A;  3OMG A;  2HL5 C;  3VUB A;  1C0M A;  1NE8 A;  3MHX A;  2AZS A;  2JT4 A;  5I2M A;  2ZPH B;  3UT1 A;  1TUG B;  4PK4 A;  2LJ3 A;  1SEM A;  2FYK A;  3L2W A;  4HCK A;  4MDW A;  4R56 A;  2Y90 A;  3HSB A;  3H0I A;  3HFN A;  1ARK A;  1H92 A;  4UC4 A;  3OYG A;  1AHJ B;  3M55 A;  4RUG A;  2EQU A;  1YJ9 A;  2K3Y A;  4M78 D;  1XOV A;  2J06 A;  4KUL A;  4XU0 A;  1N6A A;  1ZLM A;  1UE9 A;  1KD1 R;  1M1K R;  2OAW A;  3OS2 A;  4JDS A;  2E3H A;  4IUR A;  4KGX B;  3CCQ T;  4FT2 A;  1NG2 A;  3CEY A;  1K0S A;  2HSP A;  5C0M A;  1Z9Z A;  3G1J A;  5KYX A;  3GBQ A;  5LJ3 g;  2FHD A;  2K2V A;  2WSC E;  1JJ2 A;  1BCM A;  4KT0 E;  4LE9 A;  5LJ5 h;  1UJ0 A;  1M2V B;  4HKE A;  5FW9 A;  1YJN Q;  1M2V A;  2CT3 A;  4FT4 A;  2JTF A;  4PL6 A;  4Y92 A;  3A5Z B;  1NPR A;  3A8G B;  3S3M A;  1VQN T;  1HSQ A;  3CPF A;  1N8R C;  2L8D A;  1Z9Q A;  2DE0 X;  2J6O A;  4BY6 B;  4DBR A;  1UEC A;  3P8B B;  3UDC A;  5LJ3 e;  1GXI E;  1K1Z A;  4RCB A;  2K7A A;  2DL4 A;  1K8A U;  1BIB A;  1NYF A;  1QQJ A;  1X2Q A;  3EFO B;  2QQ9 A;  2YDL A;  2IIM A;  2FVU A;  3M54 A;  1RAF B;  3EFO A;  2PUK B;  1PKT A;  1PG5 B;  1YI2 A;  2C06 A;  1S72 Q;  4M75 C;  1BBZ A;  3ER0 A;  2DAQ A;  5GAN 6;  2QA4 A;  2DYB A;  4AFQ C;  5HY6 A;  4HVW A;  3LGL A;  2CSI A;  3OS1 A;  5GAN f;  2DK3 A;  2CRE A;  1AD5 A;  3V8J A;  2K57 A;  2YHT A;  2LQK A;  2GQI A;  3HP9 A;  3DLM A;  4PJO F;  1D1B A;  1MGQ A;  5IHK A;  4RTY A;  5EC7 A;  1K73 R;  3NHN A;  2A3L A;  1OU9 A;  4GLK A;  3EHR A;  4NS5 A;  3NTH A;  1UTI A;  2QDY B;  3PT9 A;  2PVG B;  4AG1 C;  4F17 A;  4WTO B;  3R6O A;  4MMK A;  3UPU A;  2E65 A;  1Y57 A;  3QO3 A;  1ACM B;  3RKY A;  4CC3 A;  2F2V A;  4XQ3 A;  1WHJ A;  2DX1 A;  4C0D C;  2DL5 A;  2NYS A;  3PIP A;  4C8Q F;  4EMK B;  1KK7 A;  3VUZ A;  5IT9 E;  4C8Q D;  4EMK A;  1RAA B;  1LVK A;  2NUT B;  3EG0 A;  4M77 E;  2DTH A;  4M7A C;  1EFN A;  2OX7 A;  4M78 A;  2COZ A;  3FLG A;  2JN0 A;  3ULR B;  1PCX A;  2QXF A;  4BAC A;  3EH1 A;  3A8H B;  3L2U A;  3CCQ Q;  3OW2 S;  4PFO A;  4EPC A;  2DM1 A;  2OTL T;  2KSS A;  3CCS Q;  1UB4 A;  2KNB B;  1PWT A;  2WAC A;  2AKK A;  1YJN A;  3TU4 K;  3CPW S;  2F2X A;  3RMS A;  5LJ3 j;  2DRM A;  1G3T A;  4PJO E;  2KDS A;  1X27 A;  1BIA A;  4M78 C;  1YNZ A;  1OPL A;  4IIO A;  5FU6 B;  1AWX A;  1G8X A;  2X51 A;  3CCM Q;  3OSS C;  2CKK A;  2E1H A;  1UEB A;  1VQN Q;  3G4S T;  1JU5 C;  1MV0 B;  4J9D A;  1QVF S;  5IH2 A;  1VQ9 T;  3OW2 A;  1B34 B;  2X3W D;  1R0C B;  2BUD A;  5GJW B;  1YJW T;  3JB9 F;  1S72 A;  4M7D E;  1D09 B;  3OY9 A;  2ZPE B;  3JB9 D;  5LJ5 g;  2NUP B;  1UHC A;  3VS3 A;  4OB2 B;  2NUP A;  2L3P A;  2YUN A;  1VQP T;  3E1S A;  3E9F A;  4QVZ A;  3CPW A;  4IUT A;  5GAN 4;  2CP0 A;  2RI3 A;  2CUD A;  1K0X A;  4LDW A;  4M77 B;  2K4Y A;  2L3R A;  1VQ6 A;  1OX8 A;  4K11 A;  2K5I A;  2DEQ A;  2CP3 A;  1YN8 A;  1IHV A;  1ABQ A;  2MYS A;  4X1V A;  2V1Q A;  1X01 A;  1QP2 A;  3UA6 A;  1EIF A;  2ED1 A;  4MZT A;  2DNU A;  4JZ4 A;  1CKB A;  2DVE A;  3C0C A;  4M7A G;  3MP6 A;  1UGQ B;  2P0P A;  1QVF A;  4RMO A;  4XU3 A;  4BE0 A;  3EHQ A;  5LJ5 e;  2RHI A;  2ZZD A;  4F14 A;  1Q7Y U;  4QQ6 A;  5GAO p;  2KRN A;  3L2Q A;  1Q86 C;  3QKJ A;  2HD0 A;  4QQD A;  4IKF A;  4BE2 A;  4PJO B;  4KUI A;  1YJ9 T;  2BE7 D;  1VQM Q;  4PJO A;  3QUI A;  2RK1 A;  2KT1 A;  1Y96 A;  3CBM A;  1I0C A;  1K76 A;  2QQA A;  2RHX A;  4QKU A;  4Z89 A;  2YRV A;  1M3B A;  3ME9 A;  1OEB A;  3EGD A;  2HEQ A;  2A36 A;  3JB9 I;  1T3S A;  3CCJ A;  2JS0 A;  2RN8 A;  5J39 A;  5GAM j;  3X28 B;  1AWJ A;  2E12 A;  4DEX A;  1U8R A;  4EMH A;  2LJ1 A;  4OB0 B;  3OYJ A;  2ROL A;  3FEO A;  4OGE A;  3VJP A;  3CCS A;  1ZUY A;  2QGF B;  1ZBX A;  4C8Q A;  2AHJ B;  2XID A;  1WXU A;  1B7T A;  2RQW A;  1H3Z A;  3QYH B;  1MND A;  3LH0 A;  2KE9 A;  2LTO A;  2P0Q A;  2KT8 A;  4C92 G;  1H3H A;  2HNI A;  2HMA A;  2ZPF B;  5J3B A;  5A0L A;  2CS7 A;  3PMI A;  3CCM A;  5L23 A;  2HQX A;  2ZCF B;  1W4S A;  1W2B S;  4DBH A;  2BZ8 A;  3AHU A;  4J9F A;  1M1G A;  3GP8 A;  3CCU Q;  1NLP C;  2IG0 A;  2PQW A;  1T3L A;  3G4S Q;  2DJZ A;  1YI2 T;  1OYX A;  2RJF A;  2DMO A;  3VRZ A;  1VQ9 Q;  3BW1 A;  3GF5 A;  3LWH A;  3JCM c;  4DQ2 A;  4ZTF A;  3HFO A;  2QA4 T;  2D0Q B;  1O75 A;  2LNV A;  2K6D A;  1UGS B;  3M9Q A;  4XTV A;  3LW5 E;  1SSF A;  2G6F X;  2MMP A;  2EJG A;  2D1X A;  4RTU A;  5IHN A;  2JXB A;  3M0T A;  3CQT A;  4FW1 A;  3P8D A;  5AYF A;  1BK2 A;  3F70 A;  3S3O A;  2R57 A;  3OYD A;  2Y4X A;  1M5Q 1;  3N5B B;  2B8A A;  1TU0 B;  2KQW A;  2J6K A;  4JJB A;  5A2Q E;  5A0G A;  1VQL Q;  3FJP A;  5GAN 3;  1GCQ C;  3X24 B;  1Q7Y R;  2FB7 A;  2JTE A;  2CZ6 B;  4X9D A;  1VQM A;  2F69 A;  3V7R A;  1WI7 A;  4PJN A;  5LJ3 h;  1GL5 A;  1D0Y A;  4QW2 A;  1WA7 A;  2LVM A;  1TUC A;  1XNI A;  1P92 A;  1QCN A;  4NOY A;  2DL7 A;  2XK0 A;  2Y4Y A;  4M7D G;  4JRK A;  2ZGW A;  1YIT A;  1U5S A;  4PLI A;  5FRO A;  3RIR A;  4Q5W A;  3D7S B;  2M0Y A;  2EYW A;  1NBE B;  1QMC A;  2FZK B;  4JZ3 A;  4XTY A;  5IAY A;  1TTH B;  1N8R U;  4HCC A;  2QG9 B;  4DOW A;  2EPD A;  4L59 A;  1LJO A;  2LCC A;  1UG1 A;  3PNW C;  2F5T X;  3H9N A;  2M0O A;  5I2S A;  3REA B;  1RAD B;  2YUO A;  5I11 A;  4FU6 A;  4BD3 A;  1YJN T;  1RLQ C;  1C1A A;  2W0Z A;  1WHH A;  2O4X A;  1M90 C;  1YWO A;  5KYU B;  3V7S A;  5KYU A;  4WCI A;  4JPB W;  5GAO l;  1HYO A;  3I56 T;  1U06 A;  4HXJ A;  1PSE A;  2HKQ B;  4ELZ C;  4KGV B;  3I35 A;  2DD4 A;  1WFW A;  5GAN j;  4GLM A;  2YT6 A;  3CCU A;  4C0F A;  3OYA A;  3UA7 A;  2K5F A;  3SWN B;  5J26 A;  1QWE A;  1LPL A;  4PFP A;  2L3S A;  3OYB A;  4RTZ A;  3E9G A;  4ESR A;  4Z88 A;  2ZPB B;  2B86 A;  1S72 T;  1I4K 1;  4O5V A;  3OS0 A;  1Q82 U;  2VAS A;  3SFM A;  4OF1 A;  1YI2 Q;  4OMN A;  4IUQ A;  2FRY A;  2LX7 A;  2GBQ A;  5KYY A;  1UGR B;  3EGX B;  1Q81 C;  1VQ6 T;  2DIL A;  4AFZ C;  3QDF A;  2HZY A;  2P4R A;  5CVI A;  4MML A;  3SB2 A;  2QA4 Q;  5GAM h;  2V8K A;  3LX7 A;  1I07 A;  2ECZ A;  4J9B A;  1BI1 A;  2KMT A;  2AK5 A;  3EH2 A;  1ZBJ A;  2L2P A;  3M0R A;  1IHW A;  1VQL A;  1IGU A;  2C0T A;  1RI0 A;  3QDR B;  2FZG B;  1MMD A;  4M7A F;  1G83 A;  2YXY A;  3L2R A;  4ZGD B;  3GPL A;  3LGF A;  2DBM A;  2E64 A;  1W1F A;  2JZ2 A;  1JJ2 S;  1YWP A;  1W70 A;  1PRL C;  4J9E A;  3OBW A;  1NEB A;  3CXC S;  5KE3 A;  3NMZ C;  1QVG P;  2WSF E;  3I9Q A;  4FW2 A;  1SRM A;  2RI5 A;  1PSF A;  3GIB A;  3EAE A;  3CCJ T;  1HXD A;  1U3O A;  2DER A;  4BE1 A;  2D8J A;  1O9S A;  1RL2 A;  1WPY A;  1HK9 A;  2HAX A;  2FPD A;  3CCS T;  2LT1 A;  2LT4 A;  3R6N A;  4FCY A;  3QII A;  3OYY A;  4PFZ A;  4JS4 A;  1N9R A;  2QTX A;  2YSQ A;  2EBP A;  2K79 A;  1PKS A;  3SD4 A;  1UUE A;  1PHT A;  2KRS A;  1E6H A;  1WNL A;  3M0P A;  1NPP A;  2MPX C;  4RG2 A;  1VIE A;  3CXC A;  4C92 F;  3UAT A;  3INZ A;  2JTM A;  2ZPG B;  5CCA A;  3CCM T;  2P0K A;  3MJX A;  4M7A E;  2VC8 A;  1GRI A;  3REB B;  4FYY B;  3M56 A;  3I56 Q;  1K9M C;  3THK A;  3MP8 A;  4D8K A;  2E5K A;  3CBO A;  1SHF A;  3CME A;  3NPF A;  3CCR T;  1R8O B;  1WXT A;  1UFF A;  2EWN A;  1KD1 C;  1M1K C;  2LZ6 B;  4CC2 A;  4BI3 A;  5FLX E;  4M77 F;  1H8K A;  1I81 A;  3GLX A;  4M77 D;  2QTV A;  2KY9 A;  5HCK A;  1Q86 U;  5FWC A;  2GTJ A;  4FYV B;  2DA9 A;  5CIU A;  4V2S A;  2O9V A;  4KGZ B;  1ZSG A;  3VS6 A;  2FRW A;  5GAO q;  3SEM A;  5FU7 B;  3V8K A;  2IVW A;  3JCM W;  4FM4 B;  3CCL A;  2X4W A;  4J6X A;  2XDD A;  2CZ0 B;  3BDL A;  4E7S A;  1KHC A;  2I0N A;  1VQ6 Q;  4RG8 A;  2JMA A;  2QQS A;  2CDT A;  2E4H A;  4BY6 C;  2HCK A;  8AT1 B;  1I8F A;  4C5E A;  2VVK A;  4PJO D;  2AIR B;  4GY5 A;  1M27 C;  2DZ9 A;  1U1S A;  1YHQ Q;  5EG2 A;  2DD5 A;  1VQM T;  1Q82 C;  1X75 C;  3G71 A;  2KBT A;  3HL8 A;  4C92 E;  4XTW A;  1QP3 A;  3RES A;  4JUV A;  1N9S A;  3QG1 A;  7AT1 B;  4KH1 B;  1YIT T;  3EG9 B;  4GBQ A;  4M7A B;  1VYU A;  4M7D F;  3V7C A;  2LCL A;  5GAM g;  5GAN h;  1YFN A;  1GFD A;  1QLY A;  1RAI B;  3OS5 A;  2GCX A;  2ZAE A;  2EJ9 A;  1SKU B;  3A1P A;  1IRE B;  1NLO C;  4OMF B;  1KJW A;  2CZ1 B;  1PD0 A;  2NUT A;  4F7U G;  1NJI C;  4ZTJ A;  5HK0 A;  3CCJ Q;  4IUU A;  5GMK i;  1FX7 A; 
#chains in the Genus database with same CATH homology
 3CCR Q;  1W2B P;  1KC8 R;  1S72 Q;  1VQ5 Q;  1KD1 R;  3CCQ Q;  3CCV Q;  1M1K R;  1QVF P;  1VQM Q;  1Q82 R;  3CPW P;  3I56 Q;  1K73 R;  1VQK Q;  3CXC P;  1KQS P;  3G4S Q;  1NJI R;  1YIJ Q;  2OTJ Q;  2QA4 Q;  1Q86 R;  3CC4 Q;  3CMA Q;  2QEX Q;  3CCL Q;  3CCS Q;  3CME Q;  3CCE Q;  1YHQ Q;  1VQ9 Q;  3CCM Q;  3G6E Q;  3OW2 P;  1YJN Q;  1YJW Q;  1VQ4 Q;  1YIT Q;  1YJ9 Q;  3G71 Q;  1VQN Q;  1K9M R;  3CC2 Q;  1Q81 R;  1VQ6 Q;  1VQO Q;  1N8R R;  1JJ2 P;  1VQL Q;  1M90 R;  3I55 Q;  2OTL Q;  1VQ7 Q;  3CCJ Q;  1YI2 Q;  1QVG P;  1VQ8 Q;  3CCU Q;  1VQP Q;  3CD6 Q;  1Q7Y R;  1K8A R;  3CC7 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...