1E6HA

A-spectrin sh3 domain a11v, m25i, v44i, v58l mutants
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
DETGKELVLVLYDYQEKSPREVTIKKGDILTLLNSTNKDWWKIEVNDRQGFVPAAYLKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN
publication title Conformational Strain in the Hydrophobic Core and its Implications for Protein Folding and Design
pubmed doi rcsb
source organism Gallus gallus
molecule tags Sh3-domain
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1e6hA00
1QKWA 1SRLA 3ULRB 2PNIA 3CQTA 2AKKA 2K2MA 2YDLA 1UFFA 1ARKA 1ABOA 2GTJA 2KNBB 2KYBA 4J9FA 2CDTA 4RTTA 4WCIA 1T3SA 1PWTA 2ED0A 2DF6A 1KIKA 3REBB 4AFZC 2HDAA 2RQTA 2KYMA 2LQWA 3U23A 2FRWA 2ROTA 3EG0A 1AEYA 2OJ2A 5IHKA 1M3CA 3M0QA 2EYZA 3TSZA 4LN2A 2YT6A 2RQWA 1I0CA 1H92A 2RPNA 2JMCA 1GFCA 4Z89A 1T3LA 2CSIA 1AZEA 2J7IA 4ZNXA 2FRYA 1U3OA 4KRTA 2F2WA 2DBKA 3PE0A 5GJVB 3M0SA 2EYXA 2LNHB 3JV3A 1PRLC 3RBBB 2KT8A 3NHNA 2KE9A 3VS5A 2CREA 4LE9A 2AK5A 1FMKA 4OMQA 3NMZC 3LH5A 2BZXA 1H3HA 2LJ1A 2VVKA 2ESWA 2JMAA 3UF4A 5I22A 2K79A 2J06A 2EVRA 3ZL7C 1Z9ZA 1OEBA 3VS3A 1Z9QA 1AVZC 2K6DA 1TUCA 1VYVA 1WFWA 2YUOA 1GCPA 3R6NA 2JM8A 1K0XA 4RTWA 1A0NB 4GBQA 1UUEA 1M27C 3PVQA 2CT3A 3EHRA 2HCKA 1G2BA 4LUDA 2QDLA 1UTIA 1TG0A 2JS0A 3M0PA 4OMPA 1KSWA 3GBQA 3VS6A 2LX7A 2AZVA 1S1NA 2E5KA 2NWMA 3NPFA 2HEQA 1X2KA 2J05A 3VS4A 4AG2C 1BK2A 3QWXX 4JJCA 1SPKA 4RTUA 4LNPA 2A28A 2L3PA 2W10A 1NEBA 1RLPC 4DEYA 2M51A 2JS2A 4D8KA 1ABQA 1HD3A 1X27A 4JJBA 5GJWB 2L2PA 1V1CA 2KT1A 1UECA 2RQVA 2MOXA 4AFUC 4F17A 5HCKA 2K3BA 3QWYA 1I07A 2FG0A 1MV3A 2EGAA 2F2VA 1NEGA 2D8JA 1HJDA 1AWXA 1RLQC 1AD5A 2RMOA 1I1JA 1BU1A 1YNZA 1ZUUA 1IO6A 5FWBA 1FYNA 2M0YA 2VWFA 4HVWA 1U5SA 3EGUA 2KR3A 2K9GA 1UHCA 3SHWA 2LP5A 2ABLA 2RF0A 1ZUKA 2FEIA 1AZGB 2KEAA 4F14A 4CC2A 1K1ZA 2KRNA 2O88A 1ZSGA 1KFZA 3O5ZA 2EPDA 3M0TA 1WYXA 1X69A 1AOJA 3VS0A 4IIOA 2CH4W 2DL4A 2G6FX 1X6GA 4EIKA 4RTZA 2BZYA 1YP5A 2JXBA 1EFNA 3FJ5A 1K0SA 1E6HA 2C0OA 3EG2A 3H0FA 2X3XD 2KBTA 1QCFA 1JXOA 5ECAA 2B86A 3I9QA 2RQRA 2O2OA 1GL5A 2KXDA 3KFVA 1B3QA 5EC7A 2NUZA 2KRMA 4M4ZA 2KXCA 3H41A 1RI9A 2DA9A 4OMOA 1NG2A 2HSPA 5IH2A 1GBQA 2GQIA 3I5SA 4DEXA 2BZ8A 4CC7A 2EYWA 1CSKA 1K4US 1ZBJA 2EYYA 1WLPB 1GBRA 1MV0B 2JW4A 4R0KA 2EGEA 1YWOA 1YN8A 2ED1A 4HVVA 1B07A 2KRSA 1H8KA 2L3QA 2KROA 4LUEA 3PVLA 1NYGA 5FW9A 1M3BA 4CC4B 2JT4A 1KJWA 2W0ZA 1CKBA 3I35A 1OPKA 2DL8A 3UA7A 4ESRA 1UGVA 1JO8A 2DBMA 2A36A 2DLPA 2KGTA 1M8MA 1X6BA 2I0NA 2GBQA 1QWFA 1UE9A 1NM7A 4X1VA 2FPEA 2LMJA 3THKA 2LQNA 2EQIA 3M0UA 1RUWA 1J3TA 2DL5A 2H8HA 1M3AA 1HSQA 1N5ZA 1JEGA 2FPFA 2RN8A 2A37A 2DMOA 5IXBA 4HVUA 4RUGA 1QKXA 2YUQA 2JM9A 1UG1A 1Y0MA 3M0RA 5IXFA 2LJ0A 1SHGA 2GTOA 1U06A 2LJ3A 2FPDA 1VA7A 2V1QA 4HXJA 4A63B 2DJQA 1UJYA 2SEMA 2CUDA 5FWCA 1WX6A 1YCSB 4JZ4A 3TSWA 4RTVA 3REAB 4CC3A 1JQQA 1W1FA 2EW3A 1PNJA 2CT4A 3SEMA 1T0JA 2GGRA 2RNAA 1T0HA 3VRYA 4AG1C 1BB9A 2J6KA 2DRMA 4K11A 2XMFA 1G83A 2J6FA 2HBWA 2DRKA 3H0HA 4AFQC 1GCQA 4HCKA 4D8DA 1ZLMA 2CH4A 4J9IA 2A08A 1WDXA 1GFDA 2DX1A 2YSQA 2DVJA 4J9CA 1QLYA 3UA6A 4ORZA 1WXBA 2PZ1A 1W70A 3VS7A 4JJDA 3RNJA 1JU5C 1SSHA 1GCQC 1NYFA 4AFSC 2PTKA 4OMMA 2O31A 1GRIA 1VYUA 2CUBA 1WIEA 2V1RA 1MUZA 3NGPA 4J9GA 2AKLA 2AZSA 4JPBW 2C0TA 3I5RA 1VYTA 2OAWA 1UDLA 1UHFA 2D0NA 2DL3A 1AWOA 1E6GA 1ZUYA 2YUNA 1Y57A 3IQLA 1OOTA 2EGCA 2DL7A 2J6OA 4RTYA 2MIOA 2DILA 3EG1A 4J9EA 1NLPC 1XOVA 2CSQA 1K9AA 4J9BA 1WXTA 2L3SA 3A98A 2DM1A 1PHTA 2DE0X 3TVTA 2X3WD 5L23A 1WA7A 2EKHA 4RTXA 1X43A 4QT7A 4Z88A 4E6RA 1PKTA 2MCNA 1JXMA 1W6XA 2JTEA 2RQUA 2O9VA 2DNUA 2EBPA 1WXUA 4GLMA 4J9HA 2DYBA 1AWWA 1M30A 1SHFA 2D8HA 4Y92A 2P4RA 5IHNA 1SEMA 2L0AA 1YWPA 2YUPA 2FO0A 1PRMC 2ECZA 3UATA 2GNCA 1K76A 2O9SA 1PKSA 1X2QA 3VS2A 4FSSA 5I11A 2IIMA 2LCSA 2VKNA 4IIMA 3VS1A 1LCKA 1TUDA 3VRZA 2D1XA 4JZ3A 2C0IA 1QWEA 5IHIA 2K7AA 4Z8AA 4J9DA 2BTTA 1UJ0A 1OV3A 1AWJA 1WI7A 2ROLA 2SRCA 1BBZA 2ENMA 1NLOC 1SRMA 3H0IA 1ZX6A 1E7OA 4F16A 1CKAA 4OMLA 3EG3A 2LZ6B 1OPLA 3EHQA 2OI3A 4OMNA 2F2XA 3C0CA
chains in the Genus database with same CATH superfamily
2O01E 3X25B 1I81A 4MMKA 5KYUB 1M2VA 5GMKm 2AKKA 4F7UB 2QDYB 3VJPA 3QJ6A 1ARKA 3L2ZA 2GTJA 4RTTA 4WCIA 2ED0A 2DF6A 2VASA 5C0MA 1R8OB 3LH0A 1N8RC 3CCSA 1SSFA 3U23A 2ROTA 1WHLA 1AEYA 2DTOA 5IHKA 2O4XB 1M3CA 3M0QA 2XICA 5GANd 4QQDA 2FB7A 4PJMA 2RQWA 1BI2A 1S72Q 1I0CA 1H92A 4EPCA 1T3LA 4ELZC 5KE3A 2J7IA 4RMOA 5CVIA 4A4KA 1VQ5Q 2KSSA 4J6YA 4ZNXA 2FRYA 1VQ9Q 1UEBA 2DBKA 1BIAA 1WZOA 3M0SA 2PVGB 2EYXA 2RB6A 3GIBA 2KT8A 2QQRA 2QEXT 3I55Q 4C8QF 3CCMT 3C4SA 2OX7A 4OMQA 1FMKA 3A5ZB 3NMZC 1H3HA 1FMVA 3TQ7P 2KK4A 2VVKA 4NL3A 3CC7T 4M7AC 2R58A 2J06A 1W4SA 4M78B 4EMKB 3FJPA 1OEBA 2Y4XA 4J7IA 3HRTA 1X75C 1VYVA 4JLIA 3R6NA 4JRQA 3M4GA 4ZTJA 1WQ7A 2AT1B 1KG1A 2CT3A 2E6NA 1G2BA 1XNIA 1V29B 1KSWA 3GBQA 1OYXA 4CRIA 1Q86U 2GCXA 1S1NA 1YIJQ 1X2KA 5LJ3g 2J05A 3MEAA 1C6VX 4RTUA 2L3PA 1NEBA 4DEYA 3T9NA 2M51A 3CCRQ 2COZA 2JS2A 4II1A 1NPRA 4JJBA 1V1CA 4PJOA 1AHJB 2D6FA 1S72T 3LGFA 4AFUC 5HCKA 1QCOA 4ANJA 1QMCA 5FROA 2M02A 3AT1B 1I07A 3M58A 2AHJB 1MV3A 5A0GA 3JCMc 2K5IA 2BUDA 1AWXA 2HQXA 4M77E 1KHIA 1RLQC 5CCAA 3FDRA 4XTZA 4KUDK 1IO6A 2JOYA 1RL2A 4RG8A 3CXCA 1VOMA 2RH2A 5FWBA 4FT2A 1I8FA 2MAMA 3EH2A 3OQ5A 3SHWA 1ZUKA 3JCMg 1AZGB 5CO7A 2KRNA 4M7AD 1Q95G 1BI1A 3LWIA 1QP3A 3CC7A 1KFZA 4FIBA 3M0TA 4M75D 2P0QA 5CIUA 3L2VA 3CXCP 3RDVA 1OZ2A 5GMKl 3G4SQ 2G6FX 3Q1JA 2CZ1B 2CZ7B 4EIKA 5LJ5e 3V8KA 3ZBDA 1YP5A 4M7DG 3OMGA 5GAN4 3CCJT 1YIJT 1K0SA 1E6HA 3EG2A 1VIFA 3H0FA 3QKJA 5LJ5j 5DLOA 4IUTA 1JXOA 5D6WA 5GANe 2RQRA 1D1AA 1NPPA 1OQKA 4C92G 5GAN3 3H41A 4M77F 5GANj 2E3IA 3UPUA 3QPHA 3L2UA 2HSPA 2A3LA 5IH2A 4ATOA 3I5SA 2BZ8A 1SF9A 2EYWA 5CKHA 5GAMh 1WLPB 2RHUA 1GBRA 1YJWQ 2EGEA 1S72A 1YN8A 1PSEA 4M78C 2ED1A 2MWOA 4EMKC 1K9MC 4MDXA 2P0PA 2KRSA 2RHYA 4XTVA 1JB0E 1NYGA 1VQ5A 1IGUA 1KJWA 3I35A 4AT1B 1OPKA 1VQ9A 1JO8A 2QI2A 3E9GA 2DLPA 2X4JA 3QIIA 4JLGA 1N6AA 5LL6S 3URGA 2LQ8A 3L42A 3A8LB 4BUGA 2GBQA 1NM7A 3I55A 2FPEA 2LMJA 1N8RU 2RJFA 4ZTFA 1YJ9T 4BE2A 3M0UA 1IHVA 1M3AA 1HSQA 4PJNA 1TTHB 4HCCA 3RESA 2FPFA 3M53A 2VGMA 2A37A 4HVUA 4RUGA 2DD4A 3OSVA 2OTJQ 3EG9A 4OMFB 2JM9A 2QGGA 5GANg 3CC2Q 3QXEB 3JB9F 4M7DB 1U06A 2FPDA 1VA7A 3QG1A 4FYYB 5KH6A 1MNDA 4C8QA 1M2OA 1TUGB 4RTVA 3REAB 4A4EA 4QVDA 2RNAA 1NJIC 4BI8B 4C92B 4AG1C 4K11A 2XMFA 1YIJA 4ZGJB 4DQ2A 4XQ3A 2ZPEB 1JRIA 4BD3A 1XQHA 1ZSZA 5CAIA 4AFQC 1GCQA 3CCRA 4D8DA 3M55A 4BDZA 1H641 2OAUA 3M9QA 1G3SA 2WSEE 1BKBA 1GFDA 1KQSA 2QXFA 3JCMX 1ZQ1A 1FWZA 2YXYA 1H3ZA 2NLUA 1M4ZA 3TCJA 1NYFA 2FZCB 1QP2A 4OMMA 1GRIA 1VYUA 4M78D 2GFAA 2DFUA 3NGPA 2ZZDA 1D3BA 4J6WA 4JJNK 2MK5A 2WACA 3GNFB 5AYFA 2DL3A 1AWOA 1D1CA 2RI5A 1KC8C 1KQSP 3IQLA 2EGCA 2FL7A 3GP8A 1MMNA 1YITQ 1K9AA 3E19A 4QVZA 3X26B 3CCUQ 4X34A 2L3SA 3UT1A 2L3RA 3SDZA 3CC2T 3OYYA 1RAAB 3RIRA 1VQOQ 1JXMA 5CKEA 2F1LA 4M77G 3CC4Q 1Q7YR 2O9VA 4DA4A 4N4IA 4XTWA 3G4SA 3H8ZA 1VQKT 1SEMA 2MI6A 3VYGA 1NBEB 3O8VA 1Y07A 1I5OB 5GAMf 1PKSA 1FMWA 3DB4A 3CMAQ 2QTXA 4N4GA 3NTKA 1G3YA 2KMTA 4PJOE 5I21A 1DJ7B 2DZ9A 3OYHA 1HYOA 4C0DB 3CCET 1QWEA 4B6MA 2K7AA 1KQSS 2BTTA 1UJ0A 1OV3A 1AWJA 1PCXA 2ENMA 3M57A 4EMGA 4QW2A 1YJWA 4KGVB 3HL8A 2LZ6B 3S3NA 3EHQA 4N0AC 2OI3A 4FT4A 3I56Q 1SRLA 4M77A 2MF2A 3ULRB 4M7DC 2K2MA 2RA2A 4IURA 4FYXB 2YDLA 1UFFA 4OB2B 4XU3A 1ABOA 3TREA 3KXTA 2KNBB 1I5LA 1YITT 1Y96A 1T3SA 3CCUT 2H3JA 5GAOr 2K3XA 1KIKA 2HQHA 1VQOT 2HDAA 4C92C 4FYVB 2FRWA 3EG0A 4EDUA 3TSZA 5J39A 2OTJA 3CPFA 3CCVQ 1K9MU 4LN2A 3CC2A 1M90U 2LQKA 1GFCA 1RADB 4Z89A 1KQ1A 1EX4A 2CSIA 1QVFA 1AZEA 4DBRA 1SKUB 1QVGA 3CMAT 1U3OA 2F2WA 4KULA 1VQKA 2LNHB 1MMAA 2R5MA 1Q82R 3RBBB 3G7ZA 2HAXA 2OTLT 2CREA 4GLKA 2EYQA 3LH5A 1VQLT 2ESWA 5I22A 2X35A 1RAGB 2COYA 4QKUA 2LTOA 3OYKA 1QVFP 5A2QE 1QVGP 4E7SA 2YRDA 1GCPA 3OYAA 1K0XA 1PC0A 2RHIA 4XTYA 3ZFJA 1G3TA 2E4HA 1PSFA 3PVQA 1LOJA 2QDLA 1M1KC 1NJIU 4OMPA 1VQ8T 3VS6A 4DOWA 1YI2T 2QA4Q 3WVDB 1C1AA 2LRQA 2E5KA 2NWMA 2CZ6B 2QEXQ 4J83A 1XJWB 4M7DD 2VV5A 4E7HA 3VS4A 3CCMQ 4JJCA 1SPKA 3GPLA 1FXXA 2P0KA 1ABQA 1HD3A 1YITA 4XTXA 2DTIA 5IAYA 3CC7Q 3A8HB 3CCUA 5GJWB 2L2PA 3CCVT 1WNLA 2V8JA 1UECA 3CPWA 4C92D 1VQOA 2MOXA 2YRCA 4X9CA 2COWA 2RK1A 4C8QE 4F17A 4JUVA 3OYJA 2FG0A 4L5GA 4IKFA 2F2VA 1NEGA 2E10A 5DY9A 2D8JA 5GMKh 3LW5E 1WPYA 2ZCFB 1TXQA 1TH7A 2DPPB 4MZMA 2EFIA 1KC8U 1R0CB 5LJ5d 1UGRB 3CMAA 1OU8A 3CPWP 2XK0A 3M54A 2KR3A 8ATCB 5LJ3f 2HKQB 1FX7A 4OP0A 1BI3A 4VUBA 1IRXA 2ABLA 2ZPBB 3OW2S 4JDSA 2FEIA 1G3WA 2JUFA 4F14A 4DBHA 1RI0A 3C12A 2EPDA 4RCCA 2DEQA 3MPUB 3LYIA 3OYFA 3MP8A 1LPLA 3L1AA 5KYYA 2QA4T 4OB1B 3CCQT 4PJOG 4ELYC 4O6JA 4PJJA 1TSFA 2EQUA 3MEUA 3I56A 3FB9A 2C0OA 1JBMA 1ZHIA 1K8AC 2K5LA 2X3XD 1QCFA 4LDVA 3LLRA 5HY6A 1RAIB 1VQ8A 2VXEA 3I9QA 2M1HA 1YJNT 1GL5A 2KXDA 1Q81R 4M4ZA 1RI9A 1IZ6A 4XU2A 1MMGA 2FZGB 4M75C 2FZKB 2ZPFB 4HKEA 1W2BA 3JCMf 4DBQA 2HZYA 1CSKA 2I2LA 1K4US 3MP1A 1ZBJA 2EYYA 3CCVA 2YRVA 5J26A 3EAEA 4R0KA 4E7JA 4HT8A 4HVVA 3FRNA 1B07A 4BACA 4QVCA 4LUEA 1PD1A 3PVLA 4CC4B 2JT4A 3SWNA 1MMDA 3CCJQ 2EAYA 2A36A 3FC3A 4E7ZA 1ZA1B 5FLXE 2I0NA 4BY6B 1QWFA 1W2BP 3F70A 4X1VA 3MCAB 4PJLA 4ZN3A 5AT1B 1N9RA 3THKA 2FHDA 2M16A 4JRPA 2XDPA 1J3TA 4B9WA 2H8HA 3JCMW 5IXBA 3TEEA 1QKXA 5CQYA 4BI3A 1K73R 1VQMT 4PJOB 2GTOA 4B9XA 2LJ3A 4HXJA 4A63B 3E9FA 4J7FA 2DJQA 1UJYA 1YCSB 5CQXA 1JQQA 2EW3A 2CT4A 4LDWA 1T0HA 2A7YA 2QA4A 4E7IA 3FIFA 2QEXA 1G83A 1QVPA 1IB8A 3RKXA 3D7SB 3CCMA 3MEWA 2Z0WA 2DRKA 2H3EB 3G6ET 1YJ9Q 1ZLMA 2CH4A 1YJNA 2K3YA 4J9CA 1QLYA 2V26A 1NZ9A 1JU5C 4AFSC 4M7AE 1M1KU 1BCOA 3CD6Q 2O31A 5KE2A 1WIEA 3META 4E47A 4LD6A 2XHCA 2DJZA 4J9GA 2AKLA 2AZSA 1WHGA 2DK3A 2OAWA 1UDLA 1VQPQ 2D0NA 2Y90A 5GMKe 1PD0A 3X28B 2FVUA 3RMQA 1OOTA 3OYDA 3QJYA 4C8QG 2DL7A 4RTYA 5GMKj 2MIOA 2XDBA 1IXDA 1WXTA 2JTFA 2DM1A 1UGSB 2DE0X 5L23A 4BE0A 4E6RA 1PKTA 3SB2A 1W6XA 3OY9A 1M90C 2DNUA 1KD1R 1WXUA 2K2VA 4PK4A 3CBPA 2DYBA 1SHFA 4Y92A 2X9HA 3CXCS 3L2WA 1B34A 2L0AA 1YWPA 2YUPA 3M56A 2JTMA 2ECZA 5GAMd 2GNCA 5FU6B 4FSSA 1YFNA 4DBFA 5LJ5g 1Y7XA 4M7AF 4KGZB 3M4YA 2LCSA 2VKNA 1LCKA 2CP3A 2M0OA 2NUPA 2XIDA 3EFOA 4PKCC 4M75F 3P8DA 4BY6C 1YHQT 5DLQE 2CP6A 1WI7A 2ROLA 5HKCA 3CD6T 1EIFA 1SRMA 3C94A 3A8MB 4F16A 1CKAA 4FW2A 2HSEB 3EG3A 4AMCA 2K5FA 3EG9B 3DB3A 1SG5A 1OPLA 3FEOA 3JB9I 1VQKQ 3VS0A 4IIOA 1VQPT 3C0CA 1K8AU 2LCLA 3CCJA 4C8QB 1JJ2A 3HP9A 2CGHA 2PNIA 3CQTA 1VQ7T 2CDTA 1PWTA 1U1SA 4FYWB 5KCHA 4AFZC 3CCEQ 3QO3A 2RQTA 3MEVA 2KYMA 2LQWA 4PLIA 1ZSZB 2MPXC 4A53A 2EYZA 1LNXA 3P8BB 4Y28E 1JJ2P 5FU7B 2NUTA 2RPNA 2JMCA 3OS2A 2KQWA 3EGXA 3BW1A 3BE3A 5GAN8 3QDFA 4XK8E 3VUZA 4PLLA 2M9UA 2VGNA 4FL6A 5GAOm 3JV3A 2EQJA 3TU4K 3HKSA 2KE9A 3GNGA 3VS5A 1B7TA 2CP5A 4F7UF 5J3BA 1D3BB 2EJFA 4LE9A 2AK5A 2BZXA 1WGSA 4RG2A 1GXIE 2JZ2A 1YJ9A 2JMAA 1U1TA 2B8AA 2EVRA 4A54A 1Z9ZA 3VS3A 5KCOA 1Z9QA 1PG5B 2X4YA 1BIBA 1WFWA 3BFMA 3S3MA 1C0MA 2K4YA 2EQMA 1A0NB 2QG9B 1UUEA 5CKBA 1Q86R 3CD6A 2HCKA 5KYWA 5DM7R 3M0PA 3OYEA 2AZVA 3GOXA 3HRUA 1EZZB 1VQPA 4DOVA 2HMAA 3JAME 3NPFA 2HEQA 4PJOD 1YBYA 2DXBA 4IUQA 1LVKA 3UDCA 2OTLQ 4AG2C 4LNPA 3V7RA 2LT4A 4D8KA 4ZN1A 3LX7A 1D0XA 3HPWA 1X27A 1VQLQ 2X4WA 1WHJA 4R55A 9ATCB 4M7AG 3QSUA 3MJXA 4NS5A 2KT1A 2V8IA 4FSXA 2QQSA 1WJSA 4E7KA 4M78F 5GAMe 3QWYA 5LJ3h 3PIOA 4PNOA 1D09B 2C06A 3JB9G 2EGAA 4HA8A 5GAMj 5A0LA 2CP0A 1Q7YC 1UB4A 1HJDA 1AD5A 1VQ8Q 4MMLA 1YI2Q 4QQGA 2LC4A 1O9SA 3V8JA 1FYNA 2M0YA 4O5VA 3OA6A 4HVWA 3WVEB 1U5SA 4M77B 2JJ9A 2K9GA 1UHCA 4E2FB 2LP5A 3OB9A 4L59A 5GAN6 1G8XA 3PNWC 1Y96B 2YHTA 5EG2A 3JSCA 4CC2A 1K1ZA 2DAQA 4JRKA 2O88A 3SFMA 2E41A 2RK2A 1AT1B 1IREB 2MMPA 3LWHA 5KYXA 3EGDA 1X69A 1VQNQ 2P84A 1IGQA 1R0BG 5I2SA 4M7AA 5GAOq 4FU6A 3JCMh 2HQEA 2BZYA 2JXBA 2BE7D 1YCYA 2E5QA 4M75A 3MP6A 5FU7C 2ZPIB 5GAMg 2B86A 5C6SA 2CZ0B 3A8GB 3VU3C 2O2OA 1F1BB 2CP7A 3KFVA 1B3QA 5EC7A 3G71Q 4FM4B 4HCZA 2PQWA 2KXCA 3QZ9B 2DA9A 3CCST 1NG2A 2EJ9A 2QGFB 3DLMA 3CCEA 3RMSA 1RAEB 1OX8A 5D6YA 3MO8A 2DYIA 4DEXA 2MYSA 3JCMd 4CC7A 2XU8A 3V7SA 4C5IA 2BIVA 3HRSA 1MV0B 2DEUA 1MNEA 5GAOl 2L3QA 7AT1B 4GY5A 2W0ZA 3CCQQ 2NYSA 5M9OA 2QAZA 4ESRA 2DBMA 3JCMV 4OB3B 2KI7A 2QQAA 3OYMA 3OYBA 1N8RR 1D0ZA 2D0QB 4BDYA 1YJNQ 1D0YA 1XTDA 4XU0A 3X24B 2EQIA 1Q82C 3LGLA 5A0DA 1RUWA 2RHXA 2DL5A 1N5ZA 2CS7A 4C8QD 4C0DC 1VQNT 2RN8A 3E1SA 2YUQA 2E6ZA 3VKIA 1UG1A 3QYGB 1Y0MA 1QVFS 3G1JA 3M0RA 1QVGS 2DIQA 1SHGA 1ZA2B 1VUBA 3HSBA 2V1QA 1WHMA 5KYUA 2SEMA 2CUDA 5FWCA 4LDXA 3QBYA 4F7UA 2DXCA 1W1FA 1ZBXA 1K8AR 2HKNA 1PNJA 3SEMA 1TU0B 3VRYA 1U8RA 1M2VB 3SD4A 2J6KA 2DRMA 3G71T 5GANh 4ME7A 5GMKi 2OTLA 2HBWA 2BKDN 4LXCA 2O4XA 3H0HA 5IN1A 2DD5A 2HNIA 2PVOB 2DETA 4J9IA 1VQLA 1M1FA 1OI1A 2A08A 2KY9A 5D7UA 2WSFE 3HHTB 3CMEQ 4M77C 4PL6A 3OBYA 2DVJA 1MGQA 3PMTA 4C0ZA 3UA6A 3QDRB 4ORZA 5L8RE 1WXBA 1VQMQ 2VXFA 1SSHA 1N27A 3VYHB 3C95A 2PTKA 3X20B 3PT9A 4M7DF 5LJ3e 2CUBA 4OVAA 2V1RA 2HBPA 4J6XA 5KYYB 1VQ4Q 3S3OA 2E12A 4JPBW 3I5RA 2R57A 5LJ3j 1YI2A 1UHFA 2DZCA 1R77A 3L2RA 1ZUYA 5I2MA 3N5BB 4M78A 4C92F 4EMKA 4QQ6A 2J6OA 2DILA 4C5EA 4J9EA 1WHKA 2E1HA 1NLPC 1OZ3A 3CPWS 3G6EQ 2JN0A 1M1GA 3GLXA 1NE8A 3TVTA 3OYNA 1X43A 2MCNA 2DERA 1RAHB 2JTEA 2RQUA 2VYTA 4KT0E 2EBPA 3CEYA 1VQNA 4A4FA 3P8HA 4GLMA 5IT9E 1M30A 1Q7YU 2D8HA 3CBOA 2P4RA 5IHNA 4IUVA 2DIGA 2CYZB 2IVWA 4CI0C 2FO0A 1RABB 4LD9K 3UATA 3OS1A 2F69A 1X2QA 1X6OA 3JCMe 3MKDA 2RJDA 3SWNB 2EKOA 2K57A 2IIMA 3QUIA 3VS1A 1HXDA 3CMET 3G71A 2D1XA 3J7AF 4JZ3A 5GAOn 4TVRA 5IHIA 4Z8AA 2BE9B 1G5VA 4J9DA 4X9DA 1BYMA 2YLCA 2XD0A 1QCNA 2SRCA 2PU9B 1Q81C 1BBZA 2V8KA 1NLOC 3H0IA 1ZX6A 4M77D 3PTAA 1E7OA 3NFCA 3E2UA 4OMLA 2VB6A 1VQ4T 1V76A 1N9SA 5KYNA 3A8OB 1VQ5T 4OMNA 1VQ9T 1QKWA 3CCQA 2F5TX 4IUUA 1BI0A 2PUKB 1OULA 1PM3A 3PGGA 2LT1A 3I55T 2KYBA 4J9FA 2Y4YA 3DKMA 4N4HA 4OB0B 4XU1A 3EFSA 3RKYA 5LJ5f 4OF1A 1W2BS 3REBB 4KBMB 5CR2A 2FYKA 2QYZA 1O75A 1K9MR 1IHWA 2OJ2A 4E7LA 1YHQQ 2E65A 1RACB 1M90R 5GANf 3L2QA 2KVQG 2YT6A 2LCCA 3CCLQ 4M75E 1ACMB 4D6WA 2RHZA 4JS4A 2A0FB 1K73C 3BY7A 3M59A 4KRTA 1M5Q1 3PE0A 4XAXB 5GJVB 3JB9D 1WJRA 1PRLC 4KGXB 2HD0A 3V8LA 1VQ7Q 3NHNA 4C5HA 1Q82U 3J80E 3CCRT 2LJ1A 2HL5C 3VUBA 2AIRB 3UF4A 2K79A 2EQKA 2GQVA 2LVMA 3ZL7C 3CMEA 2P4TA 1AVZC 2K6DA 3GF5A 3RUXA 1TWBA 1TUCA 2YUOA 2GF7A 2E3HA 1VQMA 2JM8A 4RTWA 1NJIR 4GBQA 3A1PA 1M27C 1WQWA 3EHRA 2KDSA 4LUDA 2ZPHB 1UTIA 1TG0A 2JS0A 3NTHA 2LX7A 2QQBA 1VQ4A 2GFUA 4IUPA 2RJCA 3HTRA 1B34B 2RO0A 2QASA 2F5KA 2L89A 1BCMA 2WSCE 3NTIA 1BK2A 3QWXX 3OS5A 5HK3A 4BI4A 2G3RA 2A28A 2W10A 2LDMA 4N0AA 1RLPC 1KHCA 3G6EA 1WJQA 4M7DA 3SWNC 2NUPB 2RQVA 3PMIA 3EFOB 2CP2A 4C0FA 3CCLT 3CBMA 4F7UE 2K3BA 4Q5WA 1X01A 4NL2A 3RKWA 3PIPA 3G4ST 2XKOC 3R6OA 4C92A 4PJOC 3OYLA 1MHNA 1KC8R 1KD1C 3BDUA 2RMOA 1I1JA 1BU1A 1YNZA 1ZUUA 3BDLA 4BB7A 2VWFA 2ZGWA 3PFSA 4PFPA 1VQ6Q 3EGUA 4C0GA 2EJGA 2RF0A 4JS5A 1TS9A 4RCBA 3OYCA 2KEAA 3JB9J 4FCYA 5D6XA 3JCMb 1ZSGA 3O5ZA 1WYXA 2IG0A 3M5AA 4WTOB 1YJWT 1AOJA 5GAN5 1HK9A 2JNGA 2HL3A 1OX9A 1P92A 2CH4W 2DL4A 3JRZA 2JVVA 1X6GA 4LDUA 4RTZA 1EFNA 3FJ5A 2NUTB 2RI2A 4M78E 1OU9A 3JCMQ 3JCMJ 2DKGA 3EGXB 2KBTA 2E70A 5ECAA 2X51A 5FRMA 2L8DA 3RR6A 4L6V5 3INZA 2NUZA 5GAN7 2KRMA 2RI3A 2VUBA 2RM4A 4KH0B 3QZ5B 4OMOA 5GAN2 3KUFA 2XDDA 1GBQA 2GQIA 1Q81U 3J81E 5CKFA 2OTJT 1YHQA 3EH1A 2JW4A 4PFZA 4V2SA 1YWOA 3CCLA 3HFNA 2X4XA 2L5QA 2ZPGB 1JJ2S 1H8KA 2QK0A 2VC8A 2KROA 4MDWA 5FW9A 1M3BA 2DXUA 1WHHA 1CKBA 4C5GA 2DL8A 2DO3A 4UC4A 3UA7A 1UGVA 1VQ6T 2KGTA 1M8MA 2MWPA 1X6BA 2R5AA 5KYWB 3WXMB 1VQ7A 1UE9A 3EFRA 3KBGA 1M8VA 2XG8D 5FU6C 2LQNA 4A4HA 4J8OA 3CCSQ 4XTUA 2PUOB 4M75G 3H9NA 3ME9A 1JEGA 2DMOA 3OYIA 3V7CA 5GAOp 3H6ZA 5IXFA 2LJ0A 3FLGA 3OMCA 4F04B 1K73U 1WX6A 4JZ4A 2ATCB 3TSWA 4CC3A 3QYHB 1UGQB 3OBWA 4R56A 4KUIA 1T0JA 2GGRA 4KH1B 1KQ2A 5LJ3d 1BB9A 1Q86C 4Y91A 4BE1A 8AT1B 4C8QC 2J6FA 2KAFA 4OGCA 2RJEA 4HCKA 2CKKA 2IPOB 3S6WA 3MHXA 3ZEHA 1D1BA 4HT9A 1WDXA 2DX1A 2QQ9A 2YSQA 1QQJA 3QHSA 3CC4T 4EMHA 1M1KR 4FW1A 2PZ1A 1W70A 3VS7A 1ZSZC 4JJDA 3RNJA 5CK9A 1GCQC 1QW1A 1VIEA 1UGPB 4PJOF 1Y71A 2QTVA 5KYXB 3EGDB 4PFOA 1MUZA 3OSSC 2C0TA 1VYTA 4M7AB 3JB9H 2E64A 3HFOA 2EWNA 1KK7A 1E6GA 2YUNA 1Y57A 4M75B 4RKUE 1VQ6A 2DXTA 3EG1A 4F7UG 1XOVA 2CSQA 2YLBA 3UWNA 1I4K1 4A4GA 1RAFB 4ZGDB 4J9BA 3A98A 2YWWA 3OS0A 1PHTA 2X3WD 4Z02A 1WA7A 2EKHA 4RTXA 4QT7A 4Z88A 4ZGEB 5CKDA 3DLLA 3VV0A 3OW2A 2DVEA 3RERA 4JRIA 4MZTA 1LJOA 4J9HA 4J5YA 2EIFA 2PVDB 1AWWA 1M9SA 1KD1U 3I56T 2RD1A 2LX9A 4LDYA 1PRMC 2ZAEA 4NOYA 1K76A 2O9SA 3VS2A 1TOVA 4YTLA 2D9TA 5I11A 3AHUA 2XI9A 3OW2P 4M7DE 4IIMA 5HK0A 1TUDA 6AT1B 3VRZA 2C0IA 3ER0A 3ASKA 4P5NA 2LNVA 4MZPA 4WF2A 4OGEA 4HCBA 4C92E 4M78G 5LJ5h 3OYGA 3JCMP 3CC4A 2DTHA 5FRNA 2F2XA
chains in the Genus database with same CATH topology
1QKWA 1SRLA 3ULRB 2PNIA 3CQTA 2AKKA 2K2MA 2YDLA 1UFFA 1ARKA 1ABOA 2GTJA 2KNBB 2KYBA 4J9FA 2CDTA 4RTTA 4WCIA 1T3SA 1PWTA 2ED0A 2DF6A 1KIKA 3REBB 4AFZC 2HDAA 2RQTA 2KYMA 2LQWA 3U23A 2FRWA 2ROTA 3EG0A 1AEYA 2OJ2A 5IHKA 1M3CA 3M0QA 2EYZA 3TSZA 4LN2A 2YT6A 2RQWA 1I0CA 1H92A 2RPNA 2JMCA 1GFCA 4Z89A 1T3LA 2CSIA 1AZEA 2J7IA 4ZNXA 2FRYA 1U3OA 4KRTA 2F2WA 2DBKA 3PE0A 5GJVB 3M0SA 2EYXA 2LNHB 3JV3A 1PRLC 3RBBB 2KT8A 3NHNA 2KE9A 3VS5A 2CREA 4LE9A 2AK5A 1FMKA 4OMQA 3NMZC 3LH5A 2BZXA 1H3HA 2LJ1A 2VVKA 2ESWA 2JMAA 3UF4A 5I22A 2K79A 2J06A 2EVRA 3ZL7C 1Z9ZA 1OEBA 3VS3A 1Z9QA 1AVZC 2K6DA 1TUCA 1VYVA 1WFWA 2YUOA 1GCPA 3R6NA 2JM8A 1K0XA 4RTWA 1A0NB 4GBQA 1UUEA 1M27C 3PVQA 2CT3A 3EHRA 2HCKA 1G2BA 4LUDA 2QDLA 1UTIA 1TG0A 2JS0A 3M0PA 4OMPA 1KSWA 3GBQA 3VS6A 2LX7A 2AZVA 1S1NA 2E5KA 2NWMA 3NPFA 2HEQA 1X2KA 2J05A 3VS4A 4AG2C 1BK2A 3QWXX 4JJCA 1SPKA 4RTUA 4LNPA 2A28A 2L3PA 2W10A 1NEBA 1RLPC 4DEYA 2M51A 2JS2A 4D8KA 1ABQA 1HD3A 1X27A 4JJBA 5GJWB 2L2PA 1V1CA 2KT1A 1UECA 2RQVA 2MOXA 4AFUC 4F17A 5HCKA 2K3BA 3QWYA 1I07A 2FG0A 1MV3A 2EGAA 2F2VA 1NEGA 2D8JA 1HJDA 1AWXA 1RLQC 1AD5A 2RMOA 1I1JA 1BU1A 1YNZA 1ZUUA 1IO6A 5FWBA 1FYNA 2M0YA 2VWFA 4HVWA 1U5SA 3EGUA 2KR3A 2K9GA 1UHCA 3SHWA 2LP5A 2ABLA 2RF0A 1ZUKA 2FEIA 1AZGB 2KEAA 4F14A 4CC2A 1K1ZA 2KRNA 2O88A 1ZSGA 1KFZA 3O5ZA 2EPDA 3M0TA 1WYXA 1X69A 1AOJA 3VS0A 4IIOA 2CH4W 2DL4A 2G6FX 1X6GA 4EIKA 4RTZA 2BZYA 1YP5A 2JXBA 1EFNA 3FJ5A 1K0SA 1E6HA 2C0OA 3EG2A 3H0FA 2X3XD 2KBTA 1QCFA 1JXOA 5ECAA 2B86A 3I9QA 2RQRA 2O2OA 1GL5A 2KXDA 3KFVA 1B3QA 5EC7A 2NUZA 2KRMA 4M4ZA 2KXCA 3H41A 1RI9A 2DA9A 4OMOA 1NG2A 2HSPA 5IH2A 1GBQA 2GQIA 3I5SA 4DEXA 2BZ8A 4CC7A 2EYWA 1CSKA 1K4US 1ZBJA 2EYYA 1WLPB 1GBRA 1MV0B 2JW4A 4R0KA 2EGEA 1YWOA 1YN8A 2ED1A 4HVVA 1B07A 2KRSA 1H8KA 2L3QA 2KROA 4LUEA 3PVLA 1NYGA 5FW9A 1M3BA 4CC4B 2JT4A 1KJWA 2W0ZA 1CKBA 3I35A 1OPKA 2DL8A 3UA7A 4ESRA 1UGVA 1JO8A 2DBMA 2A36A 2DLPA 2KGTA 1M8MA 1X6BA 2I0NA 2GBQA 1QWFA 1UE9A 1NM7A 4X1VA 2FPEA 2LMJA 3THKA 2LQNA 2EQIA 3M0UA 1RUWA 1J3TA 2DL5A 2H8HA 1M3AA 1HSQA 1N5ZA 1JEGA 2FPFA 2RN8A 2A37A 2DMOA 5IXBA 4HVUA 4RUGA 1QKXA 2YUQA 2JM9A 1UG1A 1Y0MA 3M0RA 5IXFA 2LJ0A 1SHGA 2GTOA 1U06A 2LJ3A 2FPDA 1VA7A 2V1QA 4HXJA 4A63B 2DJQA 1UJYA 2SEMA 2CUDA 5FWCA 1WX6A 1YCSB 4JZ4A 3TSWA 4RTVA 3REAB 4CC3A 1JQQA 1W1FA 2EW3A 1PNJA 2CT4A 3SEMA 1T0JA 2GGRA 2RNAA 1T0HA 3VRYA 4AG1C 1BB9A 2J6KA 2DRMA 4K11A 2XMFA 1G83A 2J6FA 2HBWA 2DRKA 3H0HA 4AFQC 1GCQA 4HCKA 4D8DA 1ZLMA 2CH4A 4J9IA 2A08A 1WDXA 1GFDA 2DX1A 2YSQA 2DVJA 4J9CA 1QLYA 3UA6A 4ORZA 1WXBA 2PZ1A 1W70A 3VS7A 4JJDA 3RNJA 1JU5C 1SSHA 1GCQC 1NYFA 4AFSC 2PTKA 4OMMA 2O31A 1GRIA 1VYUA 2CUBA 1WIEA 2V1RA 1MUZA 3NGPA 4J9GA 2AKLA 2AZSA 4JPBW 2C0TA 3I5RA 1VYTA 2OAWA 1UDLA 1UHFA 2D0NA 2DL3A 1AWOA 1E6GA 1ZUYA 2YUNA 1Y57A 3IQLA 1OOTA 2EGCA 2DL7A 2J6OA 4RTYA 2MIOA 2DILA 3EG1A 4J9EA 1NLPC 1XOVA 2CSQA 1K9AA 4J9BA 1WXTA 2L3SA 3A98A 2DM1A 1PHTA 2DE0X 3TVTA 2X3WD 5L23A 1WA7A 2EKHA 4RTXA 1X43A 4QT7A 4Z88A 4E6RA 1PKTA 2MCNA 1JXMA 1W6XA 2JTEA 2RQUA 2O9VA 2DNUA 2EBPA 1WXUA 4GLMA 4J9HA 2DYBA 1AWWA 1M30A 1SHFA 2D8HA 4Y92A 2P4RA 5IHNA 1SEMA 2L0AA 1YWPA 2YUPA 2FO0A 1PRMC 2ECZA 3UATA 2GNCA 1K76A 2O9SA 1PKSA 1X2QA 3VS2A 4FSSA 5I11A 2IIMA 2LCSA 2VKNA 4IIMA 3VS1A 1LCKA 1TUDA 3VRZA 2D1XA 4JZ3A 2C0IA 1QWEA 5IHIA 2K7AA 4Z8AA 4J9DA 2BTTA 1UJ0A 1OV3A 1AWJA 1WI7A 2ROLA 2SRCA 1BBZA 2ENMA 1NLOC 1SRMA 3H0IA 1ZX6A 1E7OA 4F16A 1CKAA 4OMLA 3EG3A 2LZ6B 1OPLA 3EHQA 2OI3A 4OMNA 2F2XA 3C0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKW A;  1SRL A;  3ULR B;  2PNI A;  3CQT A;  2AKK A;  2K2M A;  2YDL A;  1UFF A;  1ARK A;  1ABO A;  2GTJ A;  2KNB B;  2KYB A;  4J9F A;  2CDT A;  4RTT A;  4WCI A;  1T3S A;  1PWT A;  2ED0 A;  2DF6 A;  1KIK A;  3REB B;  4AFZ C;  2HDA A;  2RQT A;  2KYM A;  2LQW A;  3U23 A;  2FRW A;  2ROT A;  3EG0 A;  1AEY A;  2OJ2 A;  5IHK A;  1M3C A;  3M0Q A;  2EYZ A;  3TSZ A;  4LN2 A;  2YT6 A;  2RQW A;  1I0C A;  1H92 A;  2RPN A;  2JMC A;  1GFC A;  4Z89 A;  1T3L A;  2CSI A;  1AZE A;  2J7I A;  4ZNX A;  2FRY A;  1U3O A;  4KRT A;  2F2W A;  2DBK A;  3PE0 A;  5GJV B;  3M0S A;  2EYX A;  2LNH B;  3JV3 A;  1PRL C;  3RBB B;  2KT8 A;  3NHN A;  2KE9 A;  3VS5 A;  2CRE A;  4LE9 A;  2AK5 A;  1FMK A;  4OMQ A;  3NMZ C;  3LH5 A;  2BZX A;  1H3H A;  2LJ1 A;  2VVK A;  2ESW A;  2JMA A;  3UF4 A;  5I22 A;  2K79 A;  2J06 A;  2EVR A;  3ZL7 C;  1Z9Z A;  1OEB A;  3VS3 A;  1Z9Q A;  1AVZ C;  2K6D A;  1TUC A;  1VYV A;  1WFW A;  2YUO A;  1GCP A;  3R6N A;  2JM8 A;  1K0X A;  4RTW A;  1A0N B;  4GBQ A;  1UUE A;  1M27 C;  3PVQ A;  2CT3 A;  3EHR A;  2HCK A;  1G2B A;  4LUD A;  2QDL A;  1UTI A;  1TG0 A;  2JS0 A;  3M0P A;  4OMP A;  1KSW A;  3GBQ A;  3VS6 A;  2LX7 A;  2AZV A;  1S1N A;  2E5K A;  2NWM A;  3NPF A;  2HEQ A;  1X2K A;  2J05 A;  3VS4 A;  4AG2 C;  1BK2 A;  3QWX X;  4JJC A;  1SPK A;  4RTU A;  4LNP A;  2A28 A;  2L3P A;  2W10 A;  1NEB A;  1RLP C;  4DEY A;  2M51 A;  2JS2 A;  4D8K A;  1ABQ A;  1HD3 A;  1X27 A;  4JJB A;  5GJW B;  2L2P A;  1V1C A;  2KT1 A;  1UEC A;  2RQV A;  2MOX A;  4AFU C;  4F17 A;  5HCK A;  2K3B A;  3QWY A;  1I07 A;  2FG0 A;  1MV3 A;  2EGA A;  2F2V A;  1NEG A;  2D8J A;  1HJD A;  1AWX A;  1RLQ C;  1AD5 A;  2RMO A;  1I1J A;  1BU1 A;  1YNZ A;  1ZUU A;  1IO6 A;  5FWB A;  1FYN A;  2M0Y A;  2VWF A;  4HVW A;  1U5S A;  3EGU A;  2KR3 A;  2K9G A;  1UHC A;  3SHW A;  2LP5 A;  2ABL A;  2RF0 A;  1ZUK A;  2FEI A;  1AZG B;  2KEA A;  4F14 A;  4CC2 A;  1K1Z A;  2KRN A;  2O88 A;  1ZSG A;  1KFZ A;  3O5Z A;  2EPD A;  3M0T A;  1WYX A;  1X69 A;  1AOJ A;  3VS0 A;  4IIO A;  2CH4 W;  2DL4 A;  2G6F X;  1X6G A;  4EIK A;  4RTZ A;  2BZY A;  1YP5 A;  2JXB A;  1EFN A;  3FJ5 A;  1K0S A;  1E6H A;  2C0O A;  3EG2 A;  3H0F A;  2X3X D;  2KBT A;  1QCF A;  1JXO A;  5ECA A;  2B86 A;  3I9Q A;  2RQR A;  2O2O A;  1GL5 A;  2KXD A;  3KFV A;  1B3Q A;  5EC7 A;  2NUZ A;  2KRM A;  4M4Z A;  2KXC A;  3H41 A;  1RI9 A;  2DA9 A;  4OMO A;  1NG2 A;  2HSP A;  5IH2 A;  1GBQ A;  2GQI A;  3I5S A;  4DEX A;  2BZ8 A;  4CC7 A;  2EYW A;  1CSK A;  1K4U S;  1ZBJ A;  2EYY A;  1WLP B;  1GBR A;  1MV0 B;  2JW4 A;  4R0K A;  2EGE A;  1YWO A;  1YN8 A;  2ED1 A;  4HVV A;  1B07 A;  2KRS A;  1H8K A;  2L3Q A;  2KRO A;  4LUE A;  3PVL A;  1NYG A;  5FW9 A;  1M3B A;  4CC4 B;  2JT4 A;  1KJW A;  2W0Z A;  1CKB A;  3I35 A;  1OPK A;  2DL8 A;  3UA7 A;  4ESR A;  1UGV A;  1JO8 A;  2DBM A;  2A36 A;  2DLP A;  2KGT A;  1M8M A;  1X6B A;  2I0N A;  2GBQ A;  1QWF A;  1UE9 A;  1NM7 A;  4X1V A;  2FPE A;  2LMJ A;  3THK A;  2LQN A;  2EQI A;  3M0U A;  1RUW A;  1J3T A;  2DL5 A;  2H8H A;  1M3A A;  1HSQ A;  1N5Z A;  1JEG A;  2FPF A;  2RN8 A;  2A37 A;  2DMO A;  5IXB A;  4HVU A;  4RUG A;  1QKX A;  2YUQ A;  2JM9 A;  1UG1 A;  1Y0M A;  3M0R A;  5IXF A;  2LJ0 A;  1SHG A;  2GTO A;  1U06 A;  2LJ3 A;  2FPD A;  1VA7 A;  2V1Q A;  4HXJ A;  4A63 B;  2DJQ A;  1UJY A;  2SEM A;  2CUD A;  5FWC A;  1WX6 A;  1YCS B;  4JZ4 A;  3TSW A;  4RTV A;  3REA B;  4CC3 A;  1JQQ A;  1W1F A;  2EW3 A;  1PNJ A;  2CT4 A;  3SEM A;  1T0J A;  2GGR A;  2RNA A;  1T0H A;  3VRY A;  4AG1 C;  1BB9 A;  2J6K A;  2DRM A;  4K11 A;  2XMF A;  1G83 A;  2J6F A;  2HBW A;  2DRK A;  3H0H A;  4AFQ C;  1GCQ A;  4HCK A;  4D8D A;  1ZLM A;  2CH4 A;  4J9I A;  2A08 A;  1WDX A;  1GFD A;  2DX1 A;  2YSQ A;  2DVJ A;  4J9C A;  1QLY A;  3UA6 A;  4ORZ A;  1WXB A;  2PZ1 A;  1W70 A;  3VS7 A;  4JJD A;  3RNJ A;  1JU5 C;  1SSH A;  1GCQ C;  1NYF A;  4AFS C;  2PTK A;  4OMM A;  2O31 A;  1GRI A;  1VYU A;  2CUB A;  1WIE A;  2V1R A;  1MUZ A;  3NGP A;  4J9G A;  2AKL A;  2AZS A;  4JPB W;  2C0T A;  3I5R A;  1VYT A;  2OAW A;  1UDL A;  1UHF A;  2D0N A;  2DL3 A;  1AWO A;  1E6G A;  1ZUY A;  2YUN A;  1Y57 A;  3IQL A;  1OOT A;  2EGC A;  2DL7 A;  2J6O A;  4RTY A;  2MIO A;  2DIL A;  3EG1 A;  4J9E A;  1NLP C;  1XOV A;  2CSQ A;  1K9A A;  4J9B A;  1WXT A;  2L3S A;  3A98 A;  2DM1 A;  1PHT A;  2DE0 X;  3TVT A;  2X3W D;  5L23 A;  1WA7 A;  2EKH A;  4RTX A;  1X43 A;  4QT7 A;  4Z88 A;  4E6R A;  1PKT A;  2MCN A;  1JXM A;  1W6X A;  2JTE A;  2RQU A;  2O9V A;  2DNU A;  2EBP A;  1WXU A;  4GLM A;  4J9H A;  2DYB A;  1AWW A;  1M30 A;  1SHF A;  2D8H A;  4Y92 A;  2P4R A;  5IHN A;  1SEM A;  2L0A A;  1YWP A;  2YUP A;  2FO0 A;  1PRM C;  2ECZ A;  3UAT A;  2GNC A;  1K76 A;  2O9S A;  1PKS A;  1X2Q A;  3VS2 A;  4FSS A;  5I11 A;  2IIM A;  2LCS A;  2VKN A;  4IIM A;  3VS1 A;  1LCK A;  1TUD A;  3VRZ A;  2D1X A;  4JZ3 A;  2C0I A;  1QWE A;  5IHI A;  2K7A A;  4Z8A A;  4J9D A;  2BTT A;  1UJ0 A;  1OV3 A;  1AWJ A;  1WI7 A;  2ROL A;  2SRC A;  1BBZ A;  2ENM A;  1NLO C;  1SRM A;  3H0I A;  1ZX6 A;  1E7O A;  4F16 A;  1CKA A;  4OML A;  3EG3 A;  2LZ6 B;  1OPL A;  3EHQ A;  2OI3 A;  4OMN A;  2F2X A;  3C0C A; 
#chains in the Genus database with same CATH topology
 2O01 E;  3X25 B;  1I81 A;  4MMK A;  5KYU B;  1M2V A;  5GMK m;  2AKK A;  4F7U B;  2QDY B;  3VJP A;  3QJ6 A;  1ARK A;  3L2Z A;  2GTJ A;  4RTT A;  4WCI A;  2ED0 A;  2DF6 A;  2VAS A;  5C0M A;  1R8O B;  3LH0 A;  1N8R C;  3CCS A;  1SSF A;  3U23 A;  2ROT A;  1WHL A;  1AEY A;  2DTO A;  5IHK A;  2O4X B;  1M3C A;  3M0Q A;  2XIC A;  5GAN d;  4QQD A;  2FB7 A;  4PJM A;  2RQW A;  1BI2 A;  1S72 Q;  1I0C A;  1H92 A;  4EPC A;  1T3L A;  4ELZ C;  5KE3 A;  2J7I A;  4RMO A;  5CVI A;  4A4K A;  1VQ5 Q;  2KSS A;  4J6Y A;  4ZNX A;  2FRY A;  1VQ9 Q;  1UEB A;  2DBK A;  1BIA A;  1WZO A;  3M0S A;  2PVG B;  2EYX A;  2RB6 A;  3GIB A;  2KT8 A;  2QQR A;  2QEX T;  3I55 Q;  4C8Q F;  3CCM T;  3C4S A;  2OX7 A;  4OMQ A;  1FMK A;  3A5Z B;  3NMZ C;  1H3H A;  1FMV A;  3TQ7 P;  2KK4 A;  2VVK A;  4NL3 A;  3CC7 T;  4M7A C;  2R58 A;  2J06 A;  1W4S A;  4M78 B;  4EMK B;  3FJP A;  1OEB A;  2Y4X A;  4J7I A;  3HRT A;  1X75 C;  1VYV A;  4JLI A;  3R6N A;  4JRQ A;  3M4G A;  4ZTJ A;  1WQ7 A;  2AT1 B;  1KG1 A;  2CT3 A;  2E6N A;  1G2B A;  1XNI A;  1V29 B;  1KSW A;  3GBQ A;  1OYX A;  4CRI A;  1Q86 U;  2GCX A;  1S1N A;  1YIJ Q;  1X2K A;  5LJ3 g;  2J05 A;  3MEA A;  1C6V X;  4RTU A;  2L3P A;  1NEB A;  4DEY A;  3T9N A;  2M51 A;  3CCR Q;  2COZ A;  2JS2 A;  4II1 A;  1NPR A;  4JJB A;  1V1C A;  4PJO A;  1AHJ B;  2D6F A;  1S72 T;  3LGF A;  4AFU C;  5HCK A;  1QCO A;  4ANJ A;  1QMC A;  5FRO A;  2M02 A;  3AT1 B;  1I07 A;  3M58 A;  2AHJ B;  1MV3 A;  5A0G A;  3JCM c;  2K5I A;  2BUD A;  1AWX A;  2HQX A;  4M77 E;  1KHI A;  1RLQ C;  5CCA A;  3FDR A;  4XTZ A;  4KUD K;  1IO6 A;  2JOY A;  1RL2 A;  4RG8 A;  3CXC A;  1VOM A;  2RH2 A;  5FWB A;  4FT2 A;  1I8F A;  2MAM A;  3EH2 A;  3OQ5 A;  3SHW A;  1ZUK A;  3JCM g;  1AZG B;  5CO7 A;  2KRN A;  4M7A D;  1Q95 G;  1BI1 A;  3LWI A;  1QP3 A;  3CC7 A;  1KFZ A;  4FIB A;  3M0T A;  4M75 D;  2P0Q A;  5CIU A;  3L2V A;  3CXC P;  3RDV A;  1OZ2 A;  5GMK l;  3G4S Q;  2G6F X;  3Q1J A;  2CZ1 B;  2CZ7 B;  4EIK A;  5LJ5 e;  3V8K A;  3ZBD A;  1YP5 A;  4M7D G;  3OMG A;  5GAN 4;  3CCJ T;  1YIJ T;  1K0S A;  1E6H A;  3EG2 A;  1VIF A;  3H0F A;  3QKJ A;  5LJ5 j;  5DLO A;  4IUT A;  1JXO A;  5D6W A;  5GAN e;  2RQR A;  1D1A A;  1NPP A;  1OQK A;  4C92 G;  5GAN 3;  3H41 A;  4M77 F;  5GAN j;  2E3I A;  3UPU A;  3QPH A;  3L2U A;  2HSP A;  2A3L A;  5IH2 A;  4ATO A;  3I5S A;  2BZ8 A;  1SF9 A;  2EYW A;  5CKH A;  5GAM h;  1WLP B;  2RHU A;  1GBR A;  1YJW Q;  2EGE A;  1S72 A;  1YN8 A;  1PSE A;  4M78 C;  2ED1 A;  2MWO A;  4EMK C;  1K9M C;  4MDX A;  2P0P A;  2KRS A;  2RHY A;  4XTV A;  1JB0 E;  1NYG A;  1VQ5 A;  1IGU A;  1KJW A;  3I35 A;  4AT1 B;  1OPK A;  1VQ9 A;  1JO8 A;  2QI2 A;  3E9G A;  2DLP A;  2X4J A;  3QII A;  4JLG A;  1N6A A;  5LL6 S;  3URG A;  2LQ8 A;  3L42 A;  3A8L B;  4BUG A;  2GBQ A;  1NM7 A;  3I55 A;  2FPE A;  2LMJ A;  1N8R U;  2RJF A;  4ZTF A;  1YJ9 T;  4BE2 A;  3M0U A;  1IHV A;  1M3A A;  1HSQ A;  4PJN A;  1TTH B;  4HCC A;  3RES A;  2FPF A;  3M53 A;  2VGM A;  2A37 A;  4HVU A;  4RUG A;  2DD4 A;  3OSV A;  2OTJ Q;  3EG9 A;  4OMF B;  2JM9 A;  2QGG A;  5GAN g;  3CC2 Q;  3QXE B;  3JB9 F;  4M7D B;  1U06 A;  2FPD A;  1VA7 A;  3QG1 A;  4FYY B;  5KH6 A;  1MND A;  4C8Q A;  1M2O A;  1TUG B;  4RTV A;  3REA B;  4A4E A;  4QVD A;  2RNA A;  1NJI C;  4BI8 B;  4C92 B;  4AG1 C;  4K11 A;  2XMF A;  1YIJ A;  4ZGJ B;  4DQ2 A;  4XQ3 A;  2ZPE B;  1JRI A;  4BD3 A;  1XQH A;  1ZSZ A;  5CAI A;  4AFQ C;  1GCQ A;  3CCR A;  4D8D A;  3M55 A;  4BDZ A;  1H64 1;  2OAU A;  3M9Q A;  1G3S A;  2WSE E;  1BKB A;  1GFD A;  1KQS A;  2QXF A;  3JCM X;  1ZQ1 A;  1FWZ A;  2YXY A;  1H3Z A;  2NLU A;  1M4Z A;  3TCJ A;  1NYF A;  2FZC B;  1QP2 A;  4OMM A;  1GRI A;  1VYU A;  4M78 D;  2GFA A;  2DFU A;  3NGP A;  2ZZD A;  1D3B A;  4J6W A;  4JJN K;  2MK5 A;  2WAC A;  3GNF B;  5AYF A;  2DL3 A;  1AWO A;  1D1C A;  2RI5 A;  1KC8 C;  1KQS P;  3IQL A;  2EGC A;  2FL7 A;  3GP8 A;  1MMN A;  1YIT Q;  1K9A A;  3E19 A;  4QVZ A;  3X26 B;  3CCU Q;  4X34 A;  2L3S A;  3UT1 A;  2L3R A;  3SDZ A;  3CC2 T;  3OYY A;  1RAA B;  3RIR A;  1VQO Q;  1JXM A;  5CKE A;  2F1L A;  4M77 G;  3CC4 Q;  1Q7Y R;  2O9V A;  4DA4 A;  4N4I A;  4XTW A;  3G4S A;  3H8Z A;  1VQK T;  1SEM A;  2MI6 A;  3VYG A;  1NBE B;  3O8V A;  1Y07 A;  1I5O B;  5GAM f;  1PKS A;  1FMW A;  3DB4 A;  3CMA Q;  2QTX A;  4N4G A;  3NTK A;  1G3Y A;  2KMT A;  4PJO E;  5I21 A;  1DJ7 B;  2DZ9 A;  3OYH A;  1HYO A;  4C0D B;  3CCE T;  1QWE A;  4B6M A;  2K7A A;  1KQS S;  2BTT A;  1UJ0 A;  1OV3 A;  1AWJ A;  1PCX A;  2ENM A;  3M57 A;  4EMG A;  4QW2 A;  1YJW A;  4KGV B;  3HL8 A;  2LZ6 B;  3S3N A;  3EHQ A;  4N0A C;  2OI3 A;  4FT4 A;  3I56 Q;  1SRL A;  4M77 A;  2MF2 A;  3ULR B;  4M7D C;  2K2M A;  2RA2 A;  4IUR A;  4FYX B;  2YDL A;  1UFF A;  4OB2 B;  4XU3 A;  1ABO A;  3TRE A;  3KXT A;  2KNB B;  1I5L A;  1YIT T;  1Y96 A;  1T3S A;  3CCU T;  2H3J A;  5GAO r;  2K3X A;  1KIK A;  2HQH A;  1VQO T;  2HDA A;  4C92 C;  4FYV B;  2FRW A;  3EG0 A;  4EDU A;  3TSZ A;  5J39 A;  2OTJ A;  3CPF A;  3CCV Q;  1K9M U;  4LN2 A;  3CC2 A;  1M90 U;  2LQK A;  1GFC A;  1RAD B;  4Z89 A;  1KQ1 A;  1EX4 A;  2CSI A;  1QVF A;  1AZE A;  4DBR A;  1SKU B;  1QVG A;  3CMA T;  1U3O A;  2F2W A;  4KUL A;  1VQK A;  2LNH B;  1MMA A;  2R5M A;  1Q82 R;  3RBB B;  3G7Z A;  2HAX A;  2OTL T;  2CRE A;  4GLK A;  2EYQ A;  3LH5 A;  1VQL T;  2ESW A;  5I22 A;  2X35 A;  1RAG B;  2COY A;  4QKU A;  2LTO A;  3OYK A;  1QVF P;  5A2Q E;  1QVG P;  4E7S A;  2YRD A;  1GCP A;  3OYA A;  1K0X A;  1PC0 A;  2RHI A;  4XTY A;  3ZFJ A;  1G3T A;  2E4H A;  1PSF A;  3PVQ A;  1LOJ A;  2QDL A;  1M1K C;  1NJI U;  4OMP A;  1VQ8 T;  3VS6 A;  4DOW A;  1YI2 T;  2QA4 Q;  3WVD B;  1C1A A;  2LRQ A;  2E5K A;  2NWM A;  2CZ6 B;  2QEX Q;  4J83 A;  1XJW B;  4M7D D;  2VV5 A;  4E7H A;  3VS4 A;  3CCM Q;  4JJC A;  1SPK A;  3GPL A;  1FXX A;  2P0K A;  1ABQ A;  1HD3 A;  1YIT A;  4XTX A;  2DTI A;  5IAY A;  3CC7 Q;  3A8H B;  3CCU A;  5GJW B;  2L2P A;  3CCV T;  1WNL A;  2V8J A;  1UEC A;  3CPW A;  4C92 D;  1VQO A;  2MOX A;  2YRC A;  4X9C A;  2COW A;  2RK1 A;  4C8Q E;  4F17 A;  4JUV A;  3OYJ A;  2FG0 A;  4L5G A;  4IKF A;  2F2V A;  1NEG A;  2E10 A;  5DY9 A;  2D8J A;  5GMK h;  3LW5 E;  1WPY A;  2ZCF B;  1TXQ A;  1TH7 A;  2DPP B;  4MZM A;  2EFI A;  1KC8 U;  1R0C B;  5LJ5 d;  1UGR B;  3CMA A;  1OU8 A;  3CPW P;  2XK0 A;  3M54 A;  2KR3 A;  8ATC B;  5LJ3 f;  2HKQ B;  1FX7 A;  4OP0 A;  1BI3 A;  4VUB A;  1IRX A;  2ABL A;  2ZPB B;  3OW2 S;  4JDS A;  2FEI A;  1G3W A;  2JUF A;  4F14 A;  4DBH A;  1RI0 A;  3C12 A;  2EPD A;  4RCC A;  2DEQ A;  3MPU B;  3LYI A;  3OYF A;  3MP8 A;  1LPL A;  3L1A A;  5KYY A;  2QA4 T;  4OB1 B;  3CCQ T;  4PJO G;  4ELY C;  4O6J A;  4PJJ A;  1TSF A;  2EQU A;  3MEU A;  3I56 A;  3FB9 A;  2C0O A;  1JBM A;  1ZHI A;  1K8A C;  2K5L A;  2X3X D;  1QCF A;  4LDV A;  3LLR A;  5HY6 A;  1RAI B;  1VQ8 A;  2VXE A;  3I9Q A;  2M1H A;  1YJN T;  1GL5 A;  2KXD A;  1Q81 R;  4M4Z A;  1RI9 A;  1IZ6 A;  4XU2 A;  1MMG A;  2FZG B;  4M75 C;  2FZK B;  2ZPF B;  4HKE A;  1W2B A;  3JCM f;  4DBQ A;  2HZY A;  1CSK A;  2I2L A;  1K4U S;  3MP1 A;  1ZBJ A;  2EYY A;  3CCV A;  2YRV A;  5J26 A;  3EAE A;  4R0K A;  4E7J A;  4HT8 A;  4HVV A;  3FRN A;  1B07 A;  4BAC A;  4QVC A;  4LUE A;  1PD1 A;  3PVL A;  4CC4 B;  2JT4 A;  3SWN A;  1MMD A;  3CCJ Q;  2EAY A;  2A36 A;  3FC3 A;  4E7Z A;  1ZA1 B;  5FLX E;  2I0N A;  4BY6 B;  1QWF A;  1W2B P;  3F70 A;  4X1V A;  3MCA B;  4PJL A;  4ZN3 A;  5AT1 B;  1N9R A;  3THK A;  2FHD A;  2M16 A;  4JRP A;  2XDP A;  1J3T A;  4B9W A;  2H8H A;  3JCM W;  5IXB A;  3TEE A;  1QKX A;  5CQY A;  4BI3 A;  1K73 R;  1VQM T;  4PJO B;  2GTO A;  4B9X A;  2LJ3 A;  4HXJ A;  4A63 B;  3E9F A;  4J7F A;  2DJQ A;  1UJY A;  1YCS B;  5CQX A;  1JQQ A;  2EW3 A;  2CT4 A;  4LDW A;  1T0H A;  2A7Y A;  2QA4 A;  4E7I A;  3FIF A;  2QEX A;  1G83 A;  1QVP A;  1IB8 A;  3RKX A;  3D7S B;  3CCM A;  3MEW A;  2Z0W A;  2DRK A;  2H3E B;  3G6E T;  1YJ9 Q;  1ZLM A;  2CH4 A;  1YJN A;  2K3Y A;  4J9C A;  1QLY A;  2V26 A;  1NZ9 A;  1JU5 C;  4AFS C;  4M7A E;  1M1K U;  1BCO A;  3CD6 Q;  2O31 A;  5KE2 A;  1WIE A;  3MET A;  4E47 A;  4LD6 A;  2XHC A;  2DJZ A;  4J9G A;  2AKL A;  2AZS A;  1WHG A;  2DK3 A;  2OAW A;  1UDL A;  1VQP Q;  2D0N A;  2Y90 A;  5GMK e;  1PD0 A;  3X28 B;  2FVU A;  3RMQ A;  1OOT A;  3OYD A;  3QJY A;  4C8Q G;  2DL7 A;  4RTY A;  5GMK j;  2MIO A;  2XDB A;  1IXD A;  1WXT A;  2JTF A;  2DM1 A;  1UGS B;  2DE0 X;  5L23 A;  4BE0 A;  4E6R A;  1PKT A;  3SB2 A;  1W6X A;  3OY9 A;  1M90 C;  2DNU A;  1KD1 R;  1WXU A;  2K2V A;  4PK4 A;  3CBP A;  2DYB A;  1SHF A;  4Y92 A;  2X9H A;  3CXC S;  3L2W A;  1B34 A;  2L0A A;  1YWP A;  2YUP A;  3M56 A;  2JTM A;  2ECZ A;  5GAM d;  2GNC A;  5FU6 B;  4FSS A;  1YFN A;  4DBF A;  5LJ5 g;  1Y7X A;  4M7A F;  4KGZ B;  3M4Y A;  2LCS A;  2VKN A;  1LCK A;  2CP3 A;  2M0O A;  2NUP A;  2XID A;  3EFO A;  4PKC C;  4M75 F;  3P8D A;  4BY6 C;  1YHQ T;  5DLQ E;  2CP6 A;  1WI7 A;  2ROL A;  5HKC A;  3CD6 T;  1EIF A;  1SRM A;  3C94 A;  3A8M B;  4F16 A;  1CKA A;  4FW2 A;  2HSE B;  3EG3 A;  4AMC A;  2K5F A;  3EG9 B;  3DB3 A;  1SG5 A;  1OPL A;  3FEO A;  3JB9 I;  1VQK Q;  3VS0 A;  4IIO A;  1VQP T;  3C0C A;  1K8A U;  2LCL A;  3CCJ A;  4C8Q B;  1JJ2 A;  3HP9 A;  2CGH A;  2PNI A;  3CQT A;  1VQ7 T;  2CDT A;  1PWT A;  1U1S A;  4FYW B;  5KCH A;  4AFZ C;  3CCE Q;  3QO3 A;  2RQT A;  3MEV A;  2KYM A;  2LQW A;  4PLI A;  1ZSZ B;  2MPX C;  4A53 A;  2EYZ A;  1LNX A;  3P8B B;  4Y28 E;  1JJ2 P;  5FU7 B;  2NUT A;  2RPN A;  2JMC A;  3OS2 A;  2KQW A;  3EGX A;  3BW1 A;  3BE3 A;  5GAN 8;  3QDF A;  4XK8 E;  3VUZ A;  4PLL A;  2M9U A;  2VGN A;  4FL6 A;  5GAO m;  3JV3 A;  2EQJ A;  3TU4 K;  3HKS A;  2KE9 A;  3GNG A;  3VS5 A;  1B7T A;  2CP5 A;  4F7U F;  5J3B A;  1D3B B;  2EJF A;  4LE9 A;  2AK5 A;  2BZX A;  1WGS A;  4RG2 A;  1GXI E;  2JZ2 A;  1YJ9 A;  2JMA A;  1U1T A;  2B8A A;  2EVR A;  4A54 A;  1Z9Z A;  3VS3 A;  5KCO A;  1Z9Q A;  1PG5 B;  2X4Y A;  1BIB A;  1WFW A;  3BFM A;  3S3M A;  1C0M A;  2K4Y A;  2EQM A;  1A0N B;  2QG9 B;  1UUE A;  5CKB A;  1Q86 R;  3CD6 A;  2HCK A;  5KYW A;  5DM7 R;  3M0P A;  3OYE A;  2AZV A;  3GOX A;  3HRU A;  1EZZ B;  1VQP A;  4DOV A;  2HMA A;  3JAM E;  3NPF A;  2HEQ A;  4PJO D;  1YBY A;  2DXB A;  4IUQ A;  1LVK A;  3UDC A;  2OTL Q;  4AG2 C;  4LNP A;  3V7R A;  2LT4 A;  4D8K A;  4ZN1 A;  3LX7 A;  1D0X A;  3HPW A;  1X27 A;  1VQL Q;  2X4W A;  1WHJ A;  4R55 A;  9ATC B;  4M7A G;  3QSU A;  3MJX A;  4NS5 A;  2KT1 A;  2V8I A;  4FSX A;  2QQS A;  1WJS A;  4E7K A;  4M78 F;  5GAM e;  3QWY A;  5LJ3 h;  3PIO A;  4PNO A;  1D09 B;  2C06 A;  3JB9 G;  2EGA A;  4HA8 A;  5GAM j;  5A0L A;  2CP0 A;  1Q7Y C;  1UB4 A;  1HJD A;  1AD5 A;  1VQ8 Q;  4MML A;  1YI2 Q;  4QQG A;  2LC4 A;  1O9S A;  3V8J A;  1FYN A;  2M0Y A;  4O5V A;  3OA6 A;  4HVW A;  3WVE B;  1U5S A;  4M77 B;  2JJ9 A;  2K9G A;  1UHC A;  4E2F B;  2LP5 A;  3OB9 A;  4L59 A;  5GAN 6;  1G8X A;  3PNW C;  1Y96 B;  2YHT A;  5EG2 A;  3JSC A;  4CC2 A;  1K1Z A;  2DAQ A;  4JRK A;  2O88 A;  3SFM A;  2E41 A;  2RK2 A;  1AT1 B;  1IRE B;  2MMP A;  3LWH A;  5KYX A;  3EGD A;  1X69 A;  1VQN Q;  2P84 A;  1IGQ A;  1R0B G;  5I2S A;  4M7A A;  5GAO q;  4FU6 A;  3JCM h;  2HQE A;  2BZY A;  2JXB A;  2BE7 D;  1YCY A;  2E5Q A;  4M75 A;  3MP6 A;  5FU7 C;  2ZPI B;  5GAM g;  2B86 A;  5C6S A;  2CZ0 B;  3A8G B;  3VU3 C;  2O2O A;  1F1B B;  2CP7 A;  3KFV A;  1B3Q A;  5EC7 A;  3G71 Q;  4FM4 B;  4HCZ A;  2PQW A;  2KXC A;  3QZ9 B;  2DA9 A;  3CCS T;  1NG2 A;  2EJ9 A;  2QGF B;  3DLM A;  3CCE A;  3RMS A;  1RAE B;  1OX8 A;  5D6Y A;  3MO8 A;  2DYI A;  4DEX A;  2MYS A;  3JCM d;  4CC7 A;  2XU8 A;  3V7S A;  4C5I A;  2BIV A;  3HRS A;  1MV0 B;  2DEU A;  1MNE A;  5GAO l;  2L3Q A;  7AT1 B;  4GY5 A;  2W0Z A;  3CCQ Q;  2NYS A;  5M9O A;  2QAZ A;  4ESR A;  2DBM A;  3JCM V;  4OB3 B;  2KI7 A;  2QQA A;  3OYM A;  3OYB A;  1N8R R;  1D0Z A;  2D0Q B;  4BDY A;  1YJN Q;  1D0Y A;  1XTD A;  4XU0 A;  3X24 B;  2EQI A;  1Q82 C;  3LGL A;  5A0D A;  1RUW A;  2RHX A;  2DL5 A;  1N5Z A;  2CS7 A;  4C8Q D;  4C0D C;  1VQN T;  2RN8 A;  3E1S A;  2YUQ A;  2E6Z A;  3VKI A;  1UG1 A;  3QYG B;  1Y0M A;  1QVF S;  3G1J A;  3M0R A;  1QVG S;  2DIQ A;  1SHG A;  1ZA2 B;  1VUB A;  3HSB A;  2V1Q A;  1WHM A;  5KYU A;  2SEM A;  2CUD A;  5FWC A;  4LDX A;  3QBY A;  4F7U A;  2DXC A;  1W1F A;  1ZBX A;  1K8A R;  2HKN A;  1PNJ A;  3SEM A;  1TU0 B;  3VRY A;  1U8R A;  1M2V B;  3SD4 A;  2J6K A;  2DRM A;  3G71 T;  5GAN h;  4ME7 A;  5GMK i;  2OTL A;  2HBW A;  2BKD N;  4LXC A;  2O4X A;  3H0H A;  5IN1 A;  2DD5 A;  2HNI A;  2PVO B;  2DET A;  4J9I A;  1VQL A;  1M1F A;  1OI1 A;  2A08 A;  2KY9 A;  5D7U A;  2WSF E;  3HHT B;  3CME Q;  4M77 C;  4PL6 A;  3OBY A;  2DVJ A;  1MGQ A;  3PMT A;  4C0Z A;  3UA6 A;  3QDR B;  4ORZ A;  5L8R E;  1WXB A;  1VQM Q;  2VXF A;  1SSH A;  1N27 A;  3VYH B;  3C95 A;  2PTK A;  3X20 B;  3PT9 A;  4M7D F;  5LJ3 e;  2CUB A;  4OVA A;  2V1R A;  2HBP A;  4J6X A;  5KYY B;  1VQ4 Q;  3S3O A;  2E12 A;  4JPB W;  3I5R A;  2R57 A;  5LJ3 j;  1YI2 A;  1UHF A;  2DZC A;  1R77 A;  3L2R A;  1ZUY A;  5I2M A;  3N5B B;  4M78 A;  4C92 F;  4EMK A;  4QQ6 A;  2J6O A;  2DIL A;  4C5E A;  4J9E A;  1WHK A;  2E1H A;  1NLP C;  1OZ3 A;  3CPW S;  3G6E Q;  2JN0 A;  1M1G A;  3GLX A;  1NE8 A;  3TVT A;  3OYN A;  1X43 A;  2MCN A;  2DER A;  1RAH B;  2JTE A;  2RQU A;  2VYT A;  4KT0 E;  2EBP A;  3CEY A;  1VQN A;  4A4F A;  3P8H A;  4GLM A;  5IT9 E;  1M30 A;  1Q7Y U;  2D8H A;  3CBO A;  2P4R A;  5IHN A;  4IUV A;  2DIG A;  2CYZ B;  2IVW A;  4CI0 C;  2FO0 A;  1RAB B;  4LD9 K;  3UAT A;  3OS1 A;  2F69 A;  1X2Q A;  1X6O A;  3JCM e;  3MKD A;  2RJD A;  3SWN B;  2EKO A;  2K57 A;  2IIM A;  3QUI A;  3VS1 A;  1HXD A;  3CME T;  3G71 A;  2D1X A;  3J7A F;  4JZ3 A;  5GAO n;  4TVR A;  5IHI A;  4Z8A A;  2BE9 B;  1G5V A;  4J9D A;  4X9D A;  1BYM A;  2YLC A;  2XD0 A;  1QCN A;  2SRC A;  2PU9 B;  1Q81 C;  1BBZ A;  2V8K A;  1NLO C;  3H0I A;  1ZX6 A;  4M77 D;  3PTA A;  1E7O A;  3NFC A;  3E2U A;  4OML A;  2VB6 A;  1VQ4 T;  1V76 A;  1N9S A;  5KYN A;  3A8O B;  1VQ5 T;  4OMN A;  1VQ9 T;  1QKW A;  3CCQ A;  2F5T X;  4IUU A;  1BI0 A;  2PUK B;  1OUL A;  1PM3 A;  3PGG A;  2LT1 A;  3I55 T;  2KYB A;  4J9F A;  2Y4Y A;  3DKM A;  4N4H A;  4OB0 B;  4XU1 A;  3EFS A;  3RKY A;  5LJ5 f;  4OF1 A;  1W2B S;  3REB B;  4KBM B;  5CR2 A;  2FYK A;  2QYZ A;  1O75 A;  1K9M R;  1IHW A;  2OJ2 A;  4E7L A;  1YHQ Q;  2E65 A;  1RAC B;  1M90 R;  5GAN f;  3L2Q A;  2KVQ G;  2YT6 A;  2LCC A;  3CCL Q;  4M75 E;  1ACM B;  4D6W A;  2RHZ A;  4JS4 A;  2A0F B;  1K73 C;  3BY7 A;  3M59 A;  4KRT A;  1M5Q 1;  3PE0 A;  4XAX B;  5GJV B;  3JB9 D;  1WJR A;  1PRL C;  4KGX B;  2HD0 A;  3V8L A;  1VQ7 Q;  3NHN A;  4C5H A;  1Q82 U;  3J80 E;  3CCR T;  2LJ1 A;  2HL5 C;  3VUB A;  2AIR B;  3UF4 A;  2K79 A;  2EQK A;  2GQV A;  2LVM A;  3ZL7 C;  3CME A;  2P4T A;  1AVZ C;  2K6D A;  3GF5 A;  3RUX A;  1TWB A;  1TUC A;  2YUO A;  2GF7 A;  2E3H A;  1VQM A;  2JM8 A;  4RTW A;  1NJI R;  4GBQ A;  3A1P A;  1M27 C;  1WQW A;  3EHR A;  2KDS A;  4LUD A;  2ZPH B;  1UTI A;  1TG0 A;  2JS0 A;  3NTH A;  2LX7 A;  2QQB A;  1VQ4 A;  2GFU A;  4IUP A;  2RJC A;  3HTR A;  1B34 B;  2RO0 A;  2QAS A;  2F5K A;  2L89 A;  1BCM A;  2WSC E;  3NTI A;  1BK2 A;  3QWX X;  3OS5 A;  5HK3 A;  4BI4 A;  2G3R A;  2A28 A;  2W10 A;  2LDM A;  4N0A A;  1RLP C;  1KHC A;  3G6E A;  1WJQ A;  4M7D A;  3SWN C;  2NUP B;  2RQV A;  3PMI A;  3EFO B;  2CP2 A;  4C0F A;  3CCL T;  3CBM A;  4F7U E;  2K3B A;  4Q5W A;  1X01 A;  4NL2 A;  3RKW A;  3PIP A;  3G4S T;  2XKO C;  3R6O A;  4C92 A;  4PJO C;  3OYL A;  1MHN A;  1KC8 R;  1KD1 C;  3BDU A;  2RMO A;  1I1J A;  1BU1 A;  1YNZ A;  1ZUU A;  3BDL A;  4BB7 A;  2VWF A;  2ZGW A;  3PFS A;  4PFP A;  1VQ6 Q;  3EGU A;  4C0G A;  2EJG A;  2RF0 A;  4JS5 A;  1TS9 A;  4RCB A;  3OYC A;  2KEA A;  3JB9 J;  4FCY A;  5D6X A;  3JCM b;  1ZSG A;  3O5Z A;  1WYX A;  2IG0 A;  3M5A A;  4WTO B;  1YJW T;  1AOJ A;  5GAN 5;  1HK9 A;  2JNG A;  2HL3 A;  1OX9 A;  1P92 A;  2CH4 W;  2DL4 A;  3JRZ A;  2JVV A;  1X6G A;  4LDU A;  4RTZ A;  1EFN A;  3FJ5 A;  2NUT B;  2RI2 A;  4M78 E;  1OU9 A;  3JCM Q;  3JCM J;  2DKG A;  3EGX B;  2KBT A;  2E70 A;  5ECA A;  2X51 A;  5FRM A;  2L8D A;  3RR6 A;  4L6V 5;  3INZ A;  2NUZ A;  5GAN 7;  2KRM A;  2RI3 A;  2VUB A;  2RM4 A;  4KH0 B;  3QZ5 B;  4OMO A;  5GAN 2;  3KUF A;  2XDD A;  1GBQ A;  2GQI A;  1Q81 U;  3J81 E;  5CKF A;  2OTJ T;  1YHQ A;  3EH1 A;  2JW4 A;  4PFZ A;  4V2S A;  1YWO A;  3CCL A;  3HFN A;  2X4X A;  2L5Q A;  2ZPG B;  1JJ2 S;  1H8K A;  2QK0 A;  2VC8 A;  2KRO A;  4MDW A;  5FW9 A;  1M3B A;  2DXU A;  1WHH A;  1CKB A;  4C5G A;  2DL8 A;  2DO3 A;  4UC4 A;  3UA7 A;  1UGV A;  1VQ6 T;  2KGT A;  1M8M A;  2MWP A;  1X6B A;  2R5A A;  5KYW B;  3WXM B;  1VQ7 A;  1UE9 A;  3EFR A;  3KBG A;  1M8V A;  2XG8 D;  5FU6 C;  2LQN A;  4A4H A;  4J8O A;  3CCS Q;  4XTU A;  2PUO B;  4M75 G;  3H9N A;  3ME9 A;  1JEG A;  2DMO A;  3OYI A;  3V7C A;  5GAO p;  3H6Z A;  5IXF A;  2LJ0 A;  3FLG A;  3OMC A;  4F04 B;  1K73 U;  1WX6 A;  4JZ4 A;  2ATC B;  3TSW A;  4CC3 A;  3QYH B;  1UGQ B;  3OBW A;  4R56 A;  4KUI A;  1T0J A;  2GGR A;  4KH1 B;  1KQ2 A;  5LJ3 d;  1BB9 A;  1Q86 C;  4Y91 A;  4BE1 A;  8AT1 B;  4C8Q C;  2J6F A;  2KAF A;  4OGC A;  2RJE A;  4HCK A;  2CKK A;  2IPO B;  3S6W A;  3MHX A;  3ZEH A;  1D1B A;  4HT9 A;  1WDX A;  2DX1 A;  2QQ9 A;  2YSQ A;  1QQJ A;  3QHS A;  3CC4 T;  4EMH A;  1M1K R;  4FW1 A;  2PZ1 A;  1W70 A;  3VS7 A;  1ZSZ C;  4JJD A;  3RNJ A;  5CK9 A;  1GCQ C;  1QW1 A;  1VIE A;  1UGP B;  4PJO F;  1Y71 A;  2QTV A;  5KYX B;  3EGD B;  4PFO A;  1MUZ A;  3OSS C;  2C0T A;  1VYT A;  4M7A B;  3JB9 H;  2E64 A;  3HFO A;  2EWN A;  1KK7 A;  1E6G A;  2YUN A;  1Y57 A;  4M75 B;  4RKU E;  1VQ6 A;  2DXT A;  3EG1 A;  4F7U G;  1XOV A;  2CSQ A;  2YLB A;  3UWN A;  1I4K 1;  4A4G A;  1RAF B;  4ZGD B;  4J9B A;  3A98 A;  2YWW A;  3OS0 A;  1PHT A;  2X3W D;  4Z02 A;  1WA7 A;  2EKH A;  4RTX A;  4QT7 A;  4Z88 A;  4ZGE B;  5CKD A;  3DLL A;  3VV0 A;  3OW2 A;  2DVE A;  3RER A;  4JRI A;  4MZT A;  1LJO A;  4J9H A;  4J5Y A;  2EIF A;  2PVD B;  1AWW A;  1M9S A;  1KD1 U;  3I56 T;  2RD1 A;  2LX9 A;  4LDY A;  1PRM C;  2ZAE A;  4NOY A;  1K76 A;  2O9S A;  3VS2 A;  1TOV A;  4YTL A;  2D9T A;  5I11 A;  3AHU A;  2XI9 A;  3OW2 P;  4M7D E;  4IIM A;  5HK0 A;  1TUD A;  6AT1 B;  3VRZ A;  2C0I A;  3ER0 A;  3ASK A;  4P5N A;  2LNV A;  4MZP A;  4WF2 A;  4OGE A;  4HCB A;  4C92 E;  4M78 G;  5LJ5 h;  3OYG A;  3JCM P;  3CC4 A;  2DTH A;  5FRN A;  2F2X A; 
#chains in the Genus database with same CATH homology
 1QKW A;  1SRL A;  3ULR B;  2PNI A;  3CQT A;  2AKK A;  2K2M A;  2YDL A;  1UFF A;  1ARK A;  1ABO A;  2GTJ A;  2KNB B;  2KYB A;  4J9F A;  2CDT A;  4RTT A;  4WCI A;  1T3S A;  1PWT A;  2ED0 A;  2DF6 A;  1KIK A;  3REB B;  4AFZ C;  2HDA A;  2RQT A;  2KYM A;  2LQW A;  3U23 A;  2FRW A;  2ROT A;  3EG0 A;  1AEY A;  2OJ2 A;  5IHK A;  1M3C A;  3M0Q A;  2EYZ A;  3TSZ A;  4LN2 A;  2YT6 A;  2RQW A;  1I0C A;  1H92 A;  2RPN A;  2JMC A;  1GFC A;  4Z89 A;  1T3L A;  2CSI A;  1AZE A;  2J7I A;  4ZNX A;  2FRY A;  1U3O A;  4KRT A;  2F2W A;  2DBK A;  3PE0 A;  5GJV B;  3M0S A;  2EYX A;  2LNH B;  3JV3 A;  1PRL C;  3RBB B;  2KT8 A;  3NHN A;  2KE9 A;  3VS5 A;  2CRE A;  4LE9 A;  2AK5 A;  1FMK A;  4OMQ A;  3NMZ C;  3LH5 A;  2BZX A;  1H3H A;  2LJ1 A;  2VVK A;  2ESW A;  2JMA A;  3UF4 A;  5I22 A;  2K79 A;  2J06 A;  2EVR A;  3ZL7 C;  1Z9Z A;  1OEB A;  3VS3 A;  1Z9Q A;  1AVZ C;  2K6D A;  1TUC A;  1VYV A;  1WFW A;  2YUO A;  1GCP A;  3R6N A;  2JM8 A;  1K0X A;  4RTW A;  1A0N B;  4GBQ A;  1UUE A;  1M27 C;  3PVQ A;  2CT3 A;  3EHR A;  2HCK A;  1G2B A;  4LUD A;  2QDL A;  1UTI A;  1TG0 A;  2JS0 A;  3M0P A;  4OMP A;  1KSW A;  3GBQ A;  3VS6 A;  2LX7 A;  2AZV A;  1S1N A;  2E5K A;  2NWM A;  3NPF A;  2HEQ A;  1X2K A;  2J05 A;  3VS4 A;  4AG2 C;  1BK2 A;  3QWX X;  4JJC A;  1SPK A;  4RTU A;  4LNP A;  2A28 A;  2L3P A;  2W10 A;  1NEB A;  1RLP C;  4DEY A;  2M51 A;  2JS2 A;  4D8K A;  1ABQ A;  1HD3 A;  1X27 A;  4JJB A;  5GJW B;  2L2P A;  1V1C A;  2KT1 A;  1UEC A;  2RQV A;  2MOX A;  4AFU C;  4F17 A;  5HCK A;  2K3B A;  3QWY A;  1I07 A;  2FG0 A;  1MV3 A;  2EGA A;  2F2V A;  1NEG A;  2D8J A;  1HJD A;  1AWX A;  1RLQ C;  1AD5 A;  2RMO A;  1I1J A;  1BU1 A;  1YNZ A;  1ZUU A;  1IO6 A;  5FWB A;  1FYN A;  2M0Y A;  2VWF A;  4HVW A;  1U5S A;  3EGU A;  2KR3 A;  2K9G A;  1UHC A;  3SHW A;  2LP5 A;  2ABL A;  2RF0 A;  1ZUK A;  2FEI A;  1AZG B;  2KEA A;  4F14 A;  4CC2 A;  1K1Z A;  2KRN A;  2O88 A;  1ZSG A;  1KFZ A;  3O5Z A;  2EPD A;  3M0T A;  1WYX A;  1X69 A;  1AOJ A;  3VS0 A;  4IIO A;  2CH4 W;  2DL4 A;  2G6F X;  1X6G A;  4EIK A;  4RTZ A;  2BZY A;  1YP5 A;  2JXB A;  1EFN A;  3FJ5 A;  1K0S A;  1E6H A;  2C0O A;  3EG2 A;  3H0F A;  2X3X D;  2KBT A;  1QCF A;  1JXO A;  5ECA A;  2B86 A;  3I9Q A;  2RQR A;  2O2O A;  1GL5 A;  2KXD A;  3KFV A;  1B3Q A;  5EC7 A;  2NUZ A;  2KRM A;  4M4Z A;  2KXC A;  3H41 A;  1RI9 A;  2DA9 A;  4OMO A;  1NG2 A;  2HSP A;  5IH2 A;  1GBQ A;  2GQI A;  3I5S A;  4DEX A;  2BZ8 A;  4CC7 A;  2EYW A;  1CSK A;  1K4U S;  1ZBJ A;  2EYY A;  1WLP B;  1GBR A;  1MV0 B;  2JW4 A;  4R0K A;  2EGE A;  1YWO A;  1YN8 A;  2ED1 A;  4HVV A;  1B07 A;  2KRS A;  1H8K A;  2L3Q A;  2KRO A;  4LUE A;  3PVL A;  1NYG A;  5FW9 A;  1M3B A;  4CC4 B;  2JT4 A;  1KJW A;  2W0Z A;  1CKB A;  3I35 A;  1OPK A;  2DL8 A;  3UA7 A;  4ESR A;  1UGV A;  1JO8 A;  2DBM A;  2A36 A;  2DLP A;  2KGT A;  1M8M A;  1X6B A;  2I0N A;  2GBQ A;  1QWF A;  1UE9 A;  1NM7 A;  4X1V A;  2FPE A;  2LMJ A;  3THK A;  2LQN A;  2EQI A;  3M0U A;  1RUW A;  1J3T A;  2DL5 A;  2H8H A;  1M3A A;  1HSQ A;  1N5Z A;  1JEG A;  2FPF A;  2RN8 A;  2A37 A;  2DMO A;  5IXB A;  4HVU A;  4RUG A;  1QKX A;  2YUQ A;  2JM9 A;  1UG1 A;  1Y0M A;  3M0R A;  5IXF A;  2LJ0 A;  1SHG A;  2GTO A;  1U06 A;  2LJ3 A;  2FPD A;  1VA7 A;  2V1Q A;  4HXJ A;  4A63 B;  2DJQ A;  1UJY A;  2SEM A;  2CUD A;  5FWC A;  1WX6 A;  1YCS B;  4JZ4 A;  3TSW A;  4RTV A;  3REA B;  4CC3 A;  1JQQ A;  1W1F A;  2EW3 A;  1PNJ A;  2CT4 A;  3SEM A;  1T0J A;  2GGR A;  2RNA A;  1T0H A;  3VRY A;  4AG1 C;  1BB9 A;  2J6K A;  2DRM A;  4K11 A;  2XMF A;  1G83 A;  2J6F A;  2HBW A;  2DRK A;  3H0H A;  4AFQ C;  1GCQ A;  4HCK A;  4D8D A;  1ZLM A;  2CH4 A;  4J9I A;  2A08 A;  1WDX A;  1GFD A;  2DX1 A;  2YSQ A;  2DVJ A;  4J9C A;  1QLY A;  3UA6 A;  4ORZ A;  1WXB A;  2PZ1 A;  1W70 A;  3VS7 A;  4JJD A;  3RNJ A;  1JU5 C;  1SSH A;  1GCQ C;  1NYF A;  4AFS C;  2PTK A;  4OMM A;  2O31 A;  1GRI A;  1VYU A;  2CUB A;  1WIE A;  2V1R A;  1MUZ A;  3NGP A;  4J9G A;  2AKL A;  2AZS A;  4JPB W;  2C0T A;  3I5R A;  1VYT A;  2OAW A;  1UDL A;  1UHF A;  2D0N A;  2DL3 A;  1AWO A;  1E6G A;  1ZUY A;  2YUN A;  1Y57 A;  3IQL A;  1OOT A;  2EGC A;  2DL7 A;  2J6O A;  4RTY A;  2MIO A;  2DIL A;  3EG1 A;  4J9E A;  1NLP C;  1XOV A;  2CSQ A;  1K9A A;  4J9B A;  1WXT A;  2L3S A;  3A98 A;  2DM1 A;  1PHT A;  2DE0 X;  3TVT A;  2X3W D;  5L23 A;  1WA7 A;  2EKH A;  4RTX A;  1X43 A;  4QT7 A;  4Z88 A;  4E6R A;  1PKT A;  2MCN A;  1JXM A;  1W6X A;  2JTE A;  2RQU A;  2O9V A;  2DNU A;  2EBP A;  1WXU A;  4GLM A;  4J9H A;  2DYB A;  1AWW A;  1M30 A;  1SHF A;  2D8H A;  4Y92 A;  2P4R A;  5IHN A;  1SEM A;  2L0A A;  1YWP A;  2YUP A;  2FO0 A;  1PRM C;  2ECZ A;  3UAT A;  2GNC A;  1K76 A;  2O9S A;  1PKS A;  1X2Q A;  3VS2 A;  4FSS A;  5I11 A;  2IIM A;  2LCS A;  2VKN A;  4IIM A;  3VS1 A;  1LCK A;  1TUD A;  3VRZ A;  2D1X A;  4JZ3 A;  2C0I A;  1QWE A;  5IHI A;  2K7A A;  4Z8A A;  4J9D A;  2BTT A;  1UJ0 A;  1OV3 A;  1AWJ A;  1WI7 A;  2ROL A;  2SRC A;  1BBZ A;  2ENM A;  1NLO C;  1SRM A;  3H0I A;  1ZX6 A;  1E7O A;  4F16 A;  1CKA A;  4OML A;  3EG3 A;  2LZ6 B;  1OPL A;  3EHQ A;  2OI3 A;  4OMN A;  2F2X A;  3C0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...