1E6HA

A-spectrin sh3 domain a11v, m25i, v44i, v58l mutants
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
DETGKELVLVLYDYQEKSPREVTIKKGDILTLLNSTNKDWWKIEVNDRQGFVPAAYLKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sh3-domain
molecule keywords SPECTRIN ALPHA CHAIN
publication title Conformational Strain in the Hydrophobic Core and its Implications for Protein Folding and Design
pubmed doi rcsb
source organism Gallus gallus
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1e6hA00
5GJWB 1B3QA 1T3SA 3RBBB 5I22A 1AZEA 2ENMA 1NM7A 1UECA 1SHFA 1WXBA 3QWXX 2KR3A 2OAWA 2G6FX 4JZ3A 5IHIA 2K6DA 1BU1A 5EC7A 4D8KA 4M4ZA 1H3HA 3SEMA 4IIMA 1X6GA 1X27A 1UG1A 3I9QA 1NLPC 4AG1C 2VVKA 2M0YA 3M0SA 4LUEA 1UDLA 1QWFA 4OMLA 2KT8A 1GFCA 2PZ1A 1HJDA 2CT4A 2DL5A 2EGEA 2CH4A 5ECAA 4HVUA 1XOVA 5IHKA 1T0HA 4AFZC 1VYVA 2MCNA 4J9IA 1SEMA 3VS5A 4R0KA 4J9DA 4Z88A 2DRKA 2CDTA 2PTKA 3VS4A 1Z9ZA 4Z89A 2FPEA 3TVTA 1KIKA 2JMCA 3NHNA 2OI3A 2KNBB 2D8HA 4K11A 3REBB 1AEYA 1NLOC 1WXTA 2RMOA 1ZX6A 2EYZA 1ZUKA 2RQUA 4WCIA 2JXBA 2A36A 1WI7A 2BZYA 1E6HA 1RLPC 1UFFA 1EFNA 1T0JA 4CC2A 2HBWA 3A98A 3PE0A 2RQVA 1QLYA 1WDXA 2NUZA 1TG0A 2K9GA 1BK2A 1Z9QA 3M0UA 1BBZA 2J7IA 1WYXA 1YWPA 1AD5A 2CUBA 1ZLMA 1JO8A 1K1ZA 1PRMC 3THKA 1UHFA 1S1NA 5FWCA 2A37A 4JZ4A 1X6BA 2AKKA 2LZ6B 2QDLA 2F2XA 1WLPB 2AZVA 2FPFA 2GQIA 4LE9A 2DLPA 4RTVA 2DX1A 2DBKA 1Y0MA 2FRWA 1PKTA 1M8MA 2KEAA 2LQNA 1OPKA 2KRSA 2LJ3A 4OMOA 3JV3A 2YUNA 4DEYA 1CKAA 2RQTA 3C0CA 1GFDA 2CREA 3LH5A 2EPDA 3I5RA 2BTTA 2P4RA 3TSZA 1SHGA 3SHWA 1VYUA 4F17A 2RF0A 4IIOA 4JPBW 2J05A 5GJVB 1WFWA 2BZXA 1KJWA 1TUCA 2PNIA 3UATA 1TUDA 1AWJA 2LJ0A 3EG3A 4AG2C 3NPFA 2DJQA 2NWMA 1K76A 4RUGA 1YP5A 2A28A 2AKLA 2K2MA 3EG0A 1V1CA 4J9CA 3VRYA 1IO6A 1RLQC 2KRNA 2EW3A 1RUWA 2X3XD 3ZL7C 1CKBA 2YDLA 3IQLA 1ZUYA 2F2WA 1YWOA 3EHQA 4J9BA 1LCKA 5IH2A 3EG1A 1Y57A 1WX6A 4Z8AA 2SRCA 2EYXA 2EYYA 1SRMA 1MV0B 3I5SA 5L23A 2DF6A 2GBQA 2DL7A 4RTXA 1FMKA 2JS2A 2HCKA 1B07A 4LNPA 1PHTA 2V1RA 2RQWA 4GLMA 3NMZC 2KBTA 1PWTA 2CSIA 1X69A 4J9FA 1M27C 4AFSC 2KYBA 1U3OA 1HSQA 2DRMA 2EYWA 3UA6A 1UGVA 2EVRA 3H41A 1GL5A 2D1XA 1WXUA 2RN8A 2VWFA 2L2PA 2CT3A 3VS0A 3CQTA 5I11A 1M30A 5IHNA 4J9HA 2LX7A 2OJ2A 4J9GA 1RI9A 1X43A 4HCKA 4RTYA 1GBQA 2YUPA 1X2QA 2DA9A 3ULRB 3VRZA 3UF4A 2KT1A 1K0XA 2KXDA 2D0NA 1KSWA 2JMAA 5IXBA 2I0NA 2MIOA 2O2OA 3VS2A 2DL3A 2X3WD 2F2VA 2JM8A 4HVVA 4D8DA 1QKXA 1N5ZA 1K4US 1QCFA 3REAB 1M3CA 1ABOA 2ED0A 4LUDA 2HEQA 4CC7A 4CC4B 2EGAA 3QWYA 1PRLC 1GCPA 1YCSB 3O5ZA 1OEBA 2J6KA 4FSSA 3RNJA 1VA7A 1U5SA 2W10A 4RTZA 2L0AA 4OMPA 1AZGB 1JXMA 2KXCA 2V1QA 1SPKA 1W6XA 2LCSA 2LP5A 1UJYA 2O9SA 4HXJA 1GBRA 1I0CA 2KGTA 1U06A 5HCKA 2L3PA 1W70A 2B86A 2AK5A 3U23A 1W1FA 2XMFA 1AWWA 4DEXA 4E6RA 1GCQC 4J9EA 4CC3A 1UE9A 2DMOA 1SSHA 2K3BA 1UTIA 2W0ZA 2DBMA 2FO0A 2YSQA 2LNHB 2ROTA 2L3QA 1SRLA 2E5KA 1NYGA 3KFVA 2ESWA 4ZNXA 4ORZA 4OMQA 2ABLA 2ECZA 2YUQA 1HD3A 2HSPA 2DE0X 3M0RA 1PKSA 2O31A 3M0QA 4F16A 2LQWA 2RQRA 1J3TA 1YN8A 1ZBJA 2EQIA 2JT4A 2L3SA 3H0IA 2YUOA 2KRMA 2C0OA 5IXFA 1X2KA 1UUEA 4RTWA 3EG2A 2FG0A 3VS1A 2O88A 1WA7A 2J06A 4RTUA 2D8JA 2KROA 3VS6A 1CSKA 2GTJA 1YNZA 2DL8A 1I07A 1I1JA 2CSQA 2O9VA 1MV3A 2AZSA 2J6OA 1UHCA 1KFZA 1K0SA 3NGPA 1M3AA 3VS3A 2SEMA 1E6GA 1E7OA 3UA7A 2A08A 2FPDA 1OPLA 3H0FA 2ED1A 4OMMA 3GBQA 3VS7A 1AVZC 2GNCA 3M0TA 2IIMA 3FJ5A 1FYNA 4Y92A 1ZSGA 2JW4A 2DNUA 4AFQC 1ARKA 1A0NB 1ZUUA 1NEGA 1K9AA 1NG2A 2HDAA 3PVQA 2DL4A 4GBQA 2JTEA 1AOJA 1GRIA 2ROLA 4AFUC 1H8KA 1G2BA 3EGUA 2JM9A 2GGRA 2KYMA 4KRTA 3I35A 2EBPA 2BZ8A 2C0IA 2CH4W 4OMNA 1MUZA 4QT7A 1AWXA 2DVJA 2DM1A 2CUDA 2FEIA 1OOTA 2K7AA 2LMJA 2RPNA 1JQQA 2EKHA 1H92A 2K79A 4HVWA 2J6FA 1QWEA 1NEBA 2DYBA 2MOXA 3TSWA 1NYFA 4X1VA 3PVLA 1G83A 1ABQA 1WIEA 1VYTA 1JEGA 1PNJA 3R6NA 3M0PA 1UJ0A 2YT6A 4A63B 2JS0A 4RTTA 5FW9A 1M3BA 4LN2A 1AWOA 1JXOA 2VKNA 5FWBA 1GCQA 1QKWA 1T3LA 4JJDA 4ESRA 4F14A 2KE9A 1OV3A 2C0TA 3H0HA 4JJBA 2RNAA 3EHRA 4JJCA 2LJ1A 2FRYA 1BB9A 2GTOA 4EIKA 2M51A 2H8HA 1JU5C 2EGCA 2DILA
chains in the Genus database with same CATH superfamily
1YITQ 1WHLA 4M75A 3FLGA 1QMCA 2KR3A 2G6FX 5HK0A 1TU0B 4FU6A 1LOJA 3CMEQ 4M4ZA 4ZTFA 2H3EB 1LNXA 2M0OA 1ZSZA 2R57A 1YIJT 4QQ6A 2VVKA 4OB1B 2M0YA 1M1KU 1QP3A 1UDLA 2HAXA 1QWFA 1Q7YU 2DL5A 5ECAA 1XOVA 1BI1A 4EMHA 4PJOG 2Y90A 4BY6C 3JCMf 4JLGA 3J80E 2ZPHB 3FB9A 5FU6B 4Z88A 3I56Q 4FM4B 1N27A 1VQMA 4HT9A 4M7AC 1Z9ZA 1H641 4E7IA 2JMCA 2QQSA 1VQ4A 1HYOA 2KNBB 5GAMg 2D8HA 4MDXA 2LQKA 2WSCE 3G71T 1WXTA 1VQOQ 2NUTA 3DKMA 2RQUA 3M58A 1Q82R 2K5FA 3RDVA 4LDXA 5CAIA 1E6HA 1BIAA 4M78C 1EFNA 2DTHA 1VQ5A 2HBWA 4OVAA 3PIPA 2CZ7B 4M7DD 1IREB 3CCVA 1IGQA 2BKDN 2NYSA 3TQ7P 1LJOA 3CMET 3G6EQ 4M77D 2LQ8A 1WYXA 1MNDA 3QXEB 1YWPA 4B6MA 1VQ7A 3QUIA 2KY9A 4BD3A 2X9HA 2VC8A 2PUOB 2KDSA 1S1NA 3QYHB 5FLXE 2AKKA 2LZ6B 2XK0A 3DB3A 2F2XA 3UPUA 2IG0A 2C06A 3LH0A 2EQJA 4PL6A 1NJIU 1TWBA 4RTVA 4L5GA 4M7AG 1M8MA 5LJ3e 3I56T 1VIFA 2MWPA 2LJ3A 1KC8R 4DEYA 4DBHA 3G7ZA 3C0CA 1TTHB 4C8QB 2PVDB 3D7SB 1OI1A 5GAOq 3I5RA 2GFAA 4PJLA 1P92A 5GANe 4BB7A 5IAYA 1VYUA 2HD0A 3A8LB 2IPOB 3HHTB 1VQOT 4O5VA 3VV0A 1VQPA 5GJVB 4ELZC 1AWJA 3C12A 1N8RU 4M78G 1RAAB 4C5GA 4F7UB 4FW1A 3CXCA 1QVFA 4A4FA 4M75C 5GAN5 4C92F 1IRXA 2QTVA 3OW2P 4NOYA 1IO6A 2KRNA 2EW3A 4IUVA 1CKBA 2YDLA 1S72Q 1ZUYA 1ZSZC 1H3ZA 4J9BA 2E65A 1RACB 4E7LA 1WX6A 4IURA 3I5SA 2GQVA 4C92A 4OMFB 5L23A 3CD6Q 4C0ZA 5CKFA 2DL7A 1VQ6Q 2JS2A 3BW1A 1KQSA 2R5MA 4QVDA 4PK4A 3JB9G 1BYMA 2RHUA 4PJOB 3OYAA 2P0KA 2XHCA 1HSQA 2DRMA 2EYWA 2L8DA 3CC2T 1JBMA 2DTOA 2MF2A 4DBFA 3H41A 2ZCFB 4ZN1A 2OAUA 2ZPEB 2VWFA 2O4XA 5LJ5d 5I11A 5GAMe 5GMKl 4ANJA 4WTOB 5A0LA 3OSSC 1AHJB 4J9GA 2F69A 2MI6A 5AYFA 3F70A 1G3TA 5LJ3j 2YUPA 2DA9A 3QDFA 1B34B 1WJQA 1I8FA 5DY9A 2KT1A 3FEOA 3CCJQ 1KSWA 5IXBA 2O2OA 3VS2A 1RAGB 2DL3A 5GANj 1KD1U 4HVVA 2K5IA 3P8BB 1K4US 4M7DE 5GAN4 3REAB 1M3CA 2Z0WA 4R55A 2HEQA 4PJJA 1PRLC 1GCPA 3LWHA 4M77E 1M2VA 3X28B 1X75C 3MEVA 2CP2A 1S72T 1LPLA 5A0GA 2VB6A 2EYQA 2L0AA 2LP5A 1UJYA 4HXJA 3JCMc 1I0CA 2KGTA 3CD6T 2R5AA 1U06A 3X25B 1VQ6T 4FL6A 2Y4XA 4E6RA 3V8KA 1UTIA 2YSQA 5CK9A 3LWIA 1SRLA 3CCLA 3KFVA 2JNGA 2K2VA 1QCOA 2ECZA 2CS7A 2DE0X 3M0RA 1JJ2P 1PKSA 2O31A 4Q5WA 3OYHA 1WHKA 2LQWA 4EMKA 1YN8A 1U8RA 1ZBJA 3JB9H 2EQIA 4E2FB 2JT4A 3JCMP 4C8QF 5GAN3 5IXFA 1FX7A 1UUEA 3SFMA 3VUZA 1JJ2S 3VS1A 2O88A 1WA7A 5GAMj 4N0AA 2X4YA 1CSKA 1YNZA 1D3BB 1I1JA 1M4ZA 2O9VA 3CCJT 4LD6A 5GMKm 3NGPA 4C8QA 3TU4K 3HSBA 1E6GA 4IUUA 1FYNA 1PCXA 4BI8B 2LCLA 5CVIA 5LJ5g 3HP9A 1ZSGA 2JW4A 1D0XA 2WSEE 5L8RE 3A8OB 3V8JA 1ZUUA 3UDCA 3L2ZA 3TEEA 1YI2Q 1NG2A 4C92C 3PVQA 3EH1A 3CCEQ 1XNIA 1ZA1B 2DL4A 6AT1B 1MMGA 1ZBXA 2YRCA 5GAN2 2FYKA 2PVGB 3BDUA 1O9SA 4II1A 1MUZA 4QT7A 3A8HB 1AWXA 4IKFA 2CUDA 2K7AA 1NE8A 5KYYA 2LMJA 2RPNA 5FU7C 2EKHA 4GLKA 1V76A 4PLIA 3CCQA 3CBPA 2WSFE 4BE1A 1RAHB 2E1HA 1WIEA 1D1BA 1LVKA 3CC7A 5KCOA 3ASKA 3OA6A 2FHDA 1PNJA 2DK3A 3META 1QVGS 3EFOB 3WVEB 1M5Q1 2MAMA 2RO0A 5FW9A 1K8AC 1TSFA 4LN2A 2MPXC 3SDZA 2VKNA 5HK3A 1QKWA 4AT1B 1Q81U 1QW1A 1B34A 1VQKA 2C0TA 3H0HA 5KCHA 3INZA 2FRYA 4J8OA 5I2SA 1YI2T 2H8HA 1JU5C 5CQYA 5GJWB 3A8GB 4DQ2A 3VJPA 3CCET 3RBBB 3E19A 4PJOD 5I22A 1AZEA 2ENMA 1UECA 1WXBA 3UT1A 3RMSA 2OAWA 5IHIA 4JZ3A 1YJWQ 2ZPFB 2K3YA 4D8KA 3S3OA 1H3HA 3SEMA 1D1CA 2DEUA 2VUBA 5DM7R 4IIMA 2KQWA 1K9MU 4KUIA 1WZOA 2X51A 1RL2A 4FIBA 4CI0C 5M9OA 2ATCB 1TS9A 2RA2A 1IHWA 4EMKC 2QASA 2KT8A 3CCUA 1KQ1A 3OYJA 2OTJQ 2EGEA 2V8IA 4IUQA 1T0HA 4AFZC 4J9IA 4DOWA 4N0AC 1SEMA 3VS5A 3WVDB 4R0KA 5GAN7 2HL5C 1HK9A 2E12A 4J9DA 1OX8A 3HRTA 4E7JA 2CDTA 1VQNA 4ZGDB 3TVTA 2COWA 3OYMA 5LJ3h 5IT9E 2HZYA 2EYZA 4XU2A 5GANh 2YLCA 3JCMW 1WI7A 2DZCA 3EFRA 3KBGA 1T0JA 3URGA 3CC4Q 4CC2A 4MZMA 1VQ9Q 1WDXA 2AHJB 2NUPB 1BK2A 4MZPA 4PKCC 4RCBA 4E7KA 1YJWT 3BE3A 1Z9QA 3G1JA 3M0UA 2DXCA 2X35A 2LVMA 2VXEA 1U1SA 4C8QE 3RESA 4QW2A 5CIUA 3QPHA 3BY7A 4RCCA 1AD5A 4AMCA 1JO8A 4FYXB 1K1ZA 2GCXA 1IZ6A 1UHFA 2M9UA 4C5HA 4ME7A 5FWCA 1Y7XA 4JZ4A 2OTJT 2QDLA 4EDUA 5GMKi 4F7UE 1RI0A 4LE9A 5CKBA 1QP2A 2HNIA 2OX7A 2KVQG 2DX1A 4LXCA 2DBKA 1Y0MA 4KGVB 3EG9A 3JV3A 2YUNA 2E10A 5KYUA 5KYWB 2P0QA 1TH7A 1NPPA 2CREA 3QIIA 2EPDA 5GAMh 5J26A 4OGCA 3NFCA 2A3LA 1SHGA 3SHWA 9ATCB 1ZHIA 2BE7D 4IIOA 1VQMQ 1G5VA 2BZXA 1KK7A 1TUCA 4BI3A 4M7DF 2DYIA 1VQ4Q 1G3WA 2LRQA 3RMQA 1XQHA 5LJ5j 2FB7A 4C0DC 3JB9D 4PJOE 2NWMA 3O8VA 1YP5A 2AKLA 3CC4T 4M77F 3CCMT 1K8AR 2K2MA 3EG0A 4GY5A 1V29B 1JJ2A 3OMGA 1K9MC 2V8JA 4J9CA 3VRYA 1VQ9T 2BIVA 1RLQC 3RIRA 2DZ9A 1RUWA 4M7DA 5GMKe 4X34A 2EAYA 1YWOA 3EHQA 1WHJA 1VQ5Q 2YXYA 3E9FA 2EYXA 4KGXB 3SWNB 2XICA 2F5TX 4M77A 3M54A 3CCVQ 4OGEA 4DA4A 2GBQA 1MHNA 3E2UA 1Y07A 1KG1A 2F1LA 1B7TA 1PWTA 1X69A 2K5LA 3RKXA 2KMTA 1VQ7Q 2FZCB 3GNGA 2DXBA 2KYBA 2PUKB 2D1XA 4C5IA 1WXUA 4HCCA 2RN8A 2HKNA 3VS0A 1M30A 2EIFA 1N6AA 1UGPB 2OJ2A 3PTAA 3HRSA 1YITT 1FWZA 1X43A 4RTYA 1WHMA 3EAEA 4PNOA 3OS1A 4F04B 3TCJA 4FYYB 1K0XA 1VQMT 4BE0A 2JMAA 1VQ4T 3DLLA 2JM8A 1M90C 1BI3A 2E5QA 4CRIA 3DB4A 4P5NA 1VQPQ 2KK4A 4XTXA 1YCSB 2CGHA 3MEUA 3OYLA 1I5LA 1FMVA 1QVGA 2W10A 3BFMA 1VQ5T 4OMPA 1AZGB 3OYKA 1PC0A 2DD4A 4JUVA 1SPKA 3CCVT 3JCMd 3H6ZA 3MKDA 3JCMb 1Q86C 4L59A 5GMKj 1XTDA 3EGXB 4XU0A 5HCKA 1OU9A 1W70A 2B86A 2X4XA 1GCQC 4J9EA 1YHQA 1UE9A 2DMOA 2K3BA 2RJDA 4E7SA 7AT1B 2LNHB 2ZGWA 2E5KA 2AT1B 2QYZA 4BE2A 1VQ7T 1RADB 4EPCA 2ESWA 4ZNXA 4OMQA 2ZPBB 2YUQA 1HD3A 1O75A 2HSPA 4OB2B 3ZBDA 4X9DA 2A0FB 2P84A 2C0OA 1X2KA 3CPWP 4BDYA 4RTWA 5CKHA 2FG0A 3ZEHA 1M1KC 2J06A 3H9NA 2D8JA 2KROA 3VS6A 2GTJA 3G6ET 3OS0A 3OW2S 4MMKA 1Q7YC 2E3IA 3QG1A 3CPWS 3CC2A 2DTIA 3MP1A 4B9WA 2QQBA 1K0SA 3RR6A 3VS3A 2SEMA 4XTYA 4OF1A 3UA7A 4EMGA 2A08A 3CMAQ 1VQPT 1NZ9A 2QDYB 2HQEA 1JB0E 4M7DC 3CCSA 1FMWA 2IIMA 4X9CA 4XAXB 4Y92A 2DNUA 2HKQB 1ARKA 4A4HA 1VUBA 2CZ1B 4M77C 3GF5A 4LDVA 2CP0A 3OQ5A 4ZN3A 2OTLA 4AFUC 3M4YA 4A4KA 5IN1A 4KT0E 1G2BA 1K9MR 2QA4Q 1U1TA 3I35A 2CH4W 2C0IA 4OMNA 2XD0A 2XIDA 3GLXA 2R58A 2DM1A 2CZ6B 2FEIA 4HCZA 3OBWA 1H92A 4J7IA 1I4K1 4M75G 3M56A 2DYBA 1M2OA 3MJXA 5CKDA 2JTFA 4C5EA 3CCLQ 4BDZA 1G83A 5EG2A 2V26A 1QVPA 2LT4A 3G4SA 1VYTA 3A5ZB 1JEGA 3MP6A 3JCMg 3M0PA 2P4TA 1TUGB 2YT6A 1R77A 1G8XA 3CEYA 3L1AA 3E9GA 2JS0A 2IVWA 4RTTA 1WHGA 2BUDA 1AWOA 2MYSA 3MO8A 2QGFB 1OX9A 4NS5A 4JJDA 4ESRA 1QCNA 1HXDA 1NJIC 3CMAT 4J6YA 4DOVA 4F14A 3FDRA 4BY6B 1OV3A 4E47A 1C0MA 5I2MA 2RNAA 1VIEA 2LJ1A 5LJ5h 4JRPA 4ELYC 1BIBA 5A0DA 3SB2A 2EGCA 2QTXA 2AIRB 1I81A 4M7AB 3SD4A 1B3QA 2D6FA 2EJGA 1OZ2A 4FSXA 1YJ9Q 1M90R 1JRIA 1NM7A 1SHFA 3LLRA 3QBYA 1PSEA 2RHYA 1BU1A 3OB9A 2EQKA 1KHCA 2QA4T 2HSEB 4KBMB 1N8RC 3JCMV 1X27A 3TREA 1UG1A 3I9QA 5D6WA 1NLPC 4AG1C 5GAOl 4LUEA 1Q82U 4M78B 4OMLA 2I2LA 1GFCA 2PZ1A 3EGXA 1Q86R 3QKJA 4F7UF 3H8ZA 2HMAA 2CH4A 2QI2A 4HVUA 2FZGB 1VYVA 3CCLT 4FYVB 8ATCB 5D6YA 3CCRA 2E3HA 2YWWA 1IB8A 3I55A 1WNLA 1K73U 2FL7A 4WF2A 4ZGJB 4DBQA 5LJ3f 2HBPA 3VS4A 3CCQQ 4F7UA 2FPEA 3RKYA 3JAME 3PMTA 2DIGA 3CC7Q 2G3RA 4K11A 1VQ8A 3REBB 1AEYA 4JRKA 1M1KR 1C6VX 2VGMA 4WCIA 4PJOF 2A36A 3NTHA 3FJPA 2BZYA 1G3SA 1Q7YR 2RHIA 3CPFA 2E64A 2VV5A 3A98A 1M9SA 3S3MA 1PG5B 1KC8U 2RQVA 4N4IA 1YJ9T 1VQKQ 4RG2A 1YCYA 1TG0A 3RKWA 3GP8A 4PJOA 3QDRB 3OYGA 1FXXA 3EGDB 1BBZA 1RAEB 1KD1C 5FU6C 3AT1B 2EKOA 3OYIA 5GMKh 2JOYA 2CUBA 1PRMC 4ATOA 2GFUA 1XJWB 2YHTA 4M75B 1R0CB 2A37A 3OY9A 2QEXQ 4XTUA 3JCMe 4BI4A 1PD0A 2AZVA 4J6XA 2FPFA 1ZSZB 5GAN6 3S6WA 1UEBA 2DLPA 3V7CA 1OQKA 5GAOm 3CCUQ 4C92G 3GPLA 2LQNA 1UB4A 4OMOA 4HT8A 3CCQT 2KI7A 5GAMf 1GFDA 1GXIE 3LH5A 3CC7T 1RAFB 4XU1A 5KYNA 2RF0A 2J05A 4A4EA 2COYA 3CXCP 1VQNQ 2DXTA 1KJWA 1VQLA 2LJ0A 2HQHA 2P0PA 1K76A 4RUGA 3GOXA 3J7AF 4M7AF 4N4GA 1YFNA 1VQKT 3M4GA 3KXTA 2X3XD 3ZL7C 2K57A 4FYWB 1NJIR 2NUTB 3QSUA 3OW2A 2F2WA 3OMCA 5IH2A 3CPWA 4Z8AA 1SRMA 1MV0B 1YJNA 2DF6A 4C8QC 1FMKA 2DPPB 3HKSA 2HCKA 1B07A 3QJYA 4JRQA 4LNPA 1WGSA 2RQWA 3NMZC 2QEXT 2CSIA 1K73C 4FT2A 4J9FA 2EJFA 1N8RR 4JDSA 4AFSC 1U3OA 4PJNA 3QYGB 4XQ3A 1D3BA 3UA6A 2EVRA 1D1AA 5J39A 2YRVA 2L2PA 2CT3A 2XG8D 2LTOA 2LX7A 1RI9A 1OYXA 5KYXB 2D9TA 1GBQA 5CKEA 1ACMB 4XTWA 1N9SA 1RABB 5GAOn 3UF4A 4OB0B 3WXMB 3LGFA 2PU9B 3JB9F 4M7AD 2D0NA 3PT9A 1VQNT 2I0NA 2F2VA 1N5ZA 1QCFA 4JRIA 1WJRA 2EGAA 3QWYA 2EFIA 1PSFA 3O5ZA 1KQ2A 4PJOC 3EH2A 1OEBA 2J6KA 4FSSA 1KHIA 1SKUB 2RHZA 2XDPA 4M78D 1YBYA 2NLUA 1OU8A 4XTVA 5DLQE 1W6XA 4C8QG 1YIJA 2O9SA 2RH2A 1GBRA 4MZTA 1Q81C 2LNVA 2RB6A 1RAIB 3JCMQ 1WPYA 4IUPA 2L3PA 2AK5A 2CYZB 2XMFA 3CCMA 4DEXA 3JB9I 1X6OA 2W0ZA 2DBMA 3EGDA 3HPWA 2ROTA 1KD1R 2ABLA 2RD1A 5CO7A 3EFOA 4C92B 3M0QA 4F16A 2RQRA 2DFUA 2L89A 3JRZA 2XU8A 2F5KA 2L3SA 3H0IA 2YUOA 2CP7A 2KRMA 3QZ9B 3PNWC 3OS2A 5HY6A 3VYGA 1AT1B 3G71A 2RK2A 3LX7A 3OSVA 1MV3A 2E6NA 2O4XB 5FU7B 3JSCA 4NL2A 4JLIA 2QQRA 2DETA 4PFPA 1IGUA 2FPDA 1OPLA 1YITA 3H0FA 4MDWA 4OMMA 4RG8A 1AVZC 3LGLA 3MHXA 3CMEA 4M75D 3X24B 2HDAA 3AHUA 4GBQA 2JTEA 3X20B 2ROLA 3M55A 3MP8A 1TXQA 4RKUE 1H8KA 3A8MB 2KSSA 2JM9A 2GGRA 1M2VB 2RHXA 5AT1B 2EBPA 4PLLA 2KAFA 5KH6A 2DO3A 4TVRA 3NTKA 3L2QA 2K79A 5GAOr 3LYIA 1YHQQ 3I56A 4FT4A 4N4HA 3OS5A 3PVLA 3ZFJA 5FRNA 2YLBA 3X26B 3PFSA 4UC4A 1K73R 5LL6S 4M7AE 1OZ3A 3R6NA 1M8VA 8AT1B 3HRUA 1UJ0A 5C6SA 1VQOA 4E7HA 2JUFA 3Q1JA 4EMKB 1VOMA 1NPRA 1EIFA 5KYXA 2NUPA 2MK5A 5FWBA 4KH0B 1MGQA 5C0MA 3VYHB 5LJ5f 2D0QB 2KE9A 4M78E 3CC2Q 3PMIA 3EHRA 4JJCA 3C4SA 1D0ZA 2PQWA 1BB9A 2GF7A 3G6EA 1W4SA 2L3RA 5A2QE 2DILA 4E7ZA 1MMDA 4QQGA 1T3SA 3CCSQ 2JN0A 3QWXX 1MMNA 3CBOA 2K6DA 1W2BP 2VXFA 4LDYA 4V2SA 5EC7A 1R0BG 3GIBA 1BCOA 1X6GA 2DJZA 3VU3C 3MPUB 5CCAA 2EQMA 3MEWA 3C94A 2OTLQ 3M0SA 3V7RA 1W2BS 3BDLA 5CQXA 5KYWA 1YHQT 2VYTA 1Q81R 1HJDA 2CT4A 5IHKA 4A4GA 5CR2A 4PJMA 1EX4A 2COZA 5D7UA 2MCNA 3PIOA 2CP3A 2EQUA 5KE3A 3J81E 4D6WA 2XKOC 3JCMh 1Y71A 5KYYB 3OYYA 2DRKA 4FCYA 2PTKA 4Z89A 1M1GA 5I21A 1KIKA 4KULA 4DBRA 3NHNA 1SF9A 2OI3A 3G4SQ 2K3XA 3M59A 1NLOC 5HKCA 2BE9B 2RMOA 1ZX6A 3ME9A 3HTRA 1ZUKA 2A7YA 3CBMA 3VKIA 3N5BB 3UWNA 2JXBA 4M75E 1I5OB 1S72A 3SWNA 3KUFA 1RLPC 1UFFA 4R56A 1TOVA 3PE0A 1UGQB 1QLYA 2NUZA 4Y28E 3CCST 4JS5A 1WQ7A 2K9GA 3CD6A 1VQ6A 3P8DA 2M02A 3CMAA 4C92D 2J7IA 3V7SA 3L2UA 4LDUA 1M1FA 2M1HA 4XK8E 2LC4A 2MMPA 2OTLT 1ZLMA 1ZQ1A 4C0DB 3M5AA 3THKA 1N9RA 1X6BA 3GNFB 1K8AU 4M7DG 1WLPB 5FRMA 2GQIA 2QA4A 2DERA 3EFSA 2FRWA 1PKTA 4J83A 4M77G 2KEAA 1OPKA 2KRSA 4PFZA 3CCJA 1CKAA 2RQTA 2ZPIB 3S3NA 2LCCA 3CCRQ 5GAOp 3G4ST 2BTTA 4KGZB 2M16A 2P4RA 3I55Q 3TSZA 2XDDA 4F17A 4JPBW 1WFWA 4B9XA 3LW5E 2PNIA 3UATA 1TUDA 3JB9J 2WACA 1UGSB 1Y96B 3EG3A 4IUTA 4YTLA 4AG2C 2QGGA 4RMOA 3NPFA 1VQ8Q 2DJQA 1UGRB 1MNEA 2A28A 1DJ7B 3M9QA 1V1CA 2RJFA 2HQXA 1D0YA 2Y4YA 4JJNK 3IQLA 1LCKA 3EG1A 1Y57A 2DIQA 2SRCA 4MMLA 2PVOB 2EYYA 2DVEA 2LDMA 3PGGA 2XI9A 4KUDK 2LX9A 4RTXA 2RI3A 2MWOA 1PHTA 2V1RA 2DKGA 4GLMA 1YJ9A 4O6JA 2KBTA 4OP0A 3L2VA 3RERA 1M27C 4Z02A 5GANf 1ZA2B 1UGVA 2O01E 1GL5A 2E6ZA 2V8KA 1MMAA 3JCMJ 3OBYA 3CQTA 4OB3B 2DXUA 5IHNA 3FC3A 4J9HA 3E1SA 4HCKA 3CCRT 4XU3A 1X2QA 3ULRB 3I55T 3VRZA 1WJSA 3NTIA 4HA8A 1D09B 2KXDA 4C8QD 3FRNA 3HFNA 3SWNC 1X01A 5D6XA 3EG9B 2MIOA 2X3WD 3MCAB 5KYUB 2RM4A 1BI0A 1EZZB 3M53A 1QKXA 3V8LA 4D8DA 4J5YA 4NL3A 1YI2A 1VQ8T 1ABOA 1PD1A 1WQWA 2ED0A 4LUDA 4QVCA 1QVGP 3CCEA 4CC7A 4CC4B 4VUBA 1SSFA 1VQLQ 1WHHA 4C92E 3RNJA 2K4YA 1VA7A 1U5SA 2ZZDA 4RTZA 2RI5A 4KH1B 3L2WA 4QVZA 4QKUA 1JXMA 2KXCA 2V1QA 3MEAA 5GAN8 3OYEA 2DAQA 2LCSA 4LD9K 3RUXA 2QXFA 2B8AA 4BACA 3U23A 2H3JA 1W1FA 1AWWA 2JZ2A 2VASA 4CC3A 1F1BB 1SSHA 2JTMA 3A1PA 5LJ3d 2FO0A 4M7DB 1C1AA 1QQJA 2L3QA 1NYGA 2E70A 1YJNQ 2E4HA 2RJEA 2QQAA 4ORZA 1QVFP 4M77B 1PM3A 1J3TA 5GANd 3QHSA 4ZTJA 3QJ6A 3CXCS 1QVFS 3QO3A 3EG2A 3FIFA 3P8HA 4RTUA 2ZAEA 2FVUA 2QEXA 2CKKA 1Q82C 1R8OB 2XDBA 1W2BA 2DL8A 1I07A 2CSQA 1NBEB 1Q95G 2AZSA 1KQSP 3OYFA 2J6OA 4LDWA 1BI2A 4XTZA 1UHCA 1KFZA 4M7AA 4J7FA 1M3AA 4C0GA 2JJ9A 3HFOA 2CP5A 1E7OA 2HL3A 4M78F 4PFOA 3T9NA 4FW2A 1KQSS 2ED1A 3GBQA 3VS7A 2ZPGB 5J3BA 2GNCA 3M0TA 1VQLT 3FJ5A 1SG5A 1YJWA 4AFQC 1BCMA 1A0NB 1NEGA 1K9AA 4JS4A 1Y96A 2EWNA 2LT1A 2DD5A 3CCUT 3ER0A 4M78A 2CZ0B 3L2RA 1G3YA 1BKBA 1AOJA 1GRIA 4A54A 5DLOA 5LJ5e 3R6OA 4ZGEB 3EGUA 4QQDA 3OYNA 2KYMA 4KRTA 3OYDA 2OTJA 2BZ8A 5GAMd 2EJ9A 1YIJQ 2DVJA 1YJNT 4HKEA 1OOTA 2CP6A 1KC8C 2DEQA 1JQQA 3C95A 2QQ9A 2L5QA 3CCMQ 4HVWA 4A53A 2J6FA 1IXDA 1QWEA 1NEBA 2MOXA 3JCMX 5KE2A 3VUBA 3TSWA 3HL8A 1NYFA 4X1VA 1M90U 1ABQA 2RJCA 2JVVA 4Y91A 3OYBA 4HCBA 2YRDA 3OYCA 2RK1A 1IHVA 4C0FA 2X4JA 2RI2A 4J6WA 4A63B 2E41A 2QAZA 1M3BA 5LJ3g 2VGNA 1JXOA 3DLMA 3QZ5B 2FZKB 1OULA 2QK0A 4L6V5 3G71Q 1GCQA 1T3LA 1Q86U 4M75F 3CC4A 1VQ9A 4BUGA 4JJBA 5GANg 2GTOA 4EIKA 5FROA 2X4WA 2M51A 3M57A 4F7UG 3L42A 2QG9B
chains in the Genus database with same CATH topology
5GJWB 1B3QA 1T3SA 3RBBB 5I22A 1AZEA 2ENMA 1NM7A 1UECA 1SHFA 1WXBA 3QWXX 2KR3A 2OAWA 2G6FX 4JZ3A 5IHIA 2K6DA 1BU1A 5EC7A 4D8KA 4M4ZA 1H3HA 3SEMA 4IIMA 1X6GA 1X27A 1UG1A 3I9QA 1NLPC 4AG1C 2VVKA 2M0YA 3M0SA 4LUEA 1UDLA 1QWFA 4OMLA 2KT8A 1GFCA 2PZ1A 1HJDA 2CT4A 2DL5A 2EGEA 2CH4A 5ECAA 4HVUA 1XOVA 5IHKA 1T0HA 4AFZC 1VYVA 2MCNA 4J9IA 1SEMA 3VS5A 4R0KA 4J9DA 4Z88A 2DRKA 2CDTA 2PTKA 3VS4A 1Z9ZA 4Z89A 2FPEA 3TVTA 1KIKA 2JMCA 3NHNA 2OI3A 2KNBB 2D8HA 4K11A 3REBB 1AEYA 1NLOC 1WXTA 2RMOA 1ZX6A 2EYZA 1ZUKA 2RQUA 4WCIA 2JXBA 2A36A 1WI7A 2BZYA 1E6HA 1RLPC 1UFFA 1EFNA 1T0JA 4CC2A 2HBWA 3A98A 3PE0A 2RQVA 1QLYA 1WDXA 2NUZA 1TG0A 2K9GA 1BK2A 1Z9QA 3M0UA 1BBZA 2J7IA 1WYXA 1YWPA 1AD5A 2CUBA 1ZLMA 1JO8A 1K1ZA 1PRMC 3THKA 1UHFA 1S1NA 5FWCA 2A37A 4JZ4A 1X6BA 2AKKA 2LZ6B 2QDLA 2F2XA 1WLPB 2AZVA 2FPFA 2GQIA 4LE9A 2DLPA 4RTVA 2DX1A 2DBKA 1Y0MA 2FRWA 1PKTA 1M8MA 2KEAA 2LQNA 1OPKA 2KRSA 2LJ3A 4OMOA 3JV3A 2YUNA 4DEYA 1CKAA 2RQTA 3C0CA 1GFDA 2CREA 3LH5A 2EPDA 3I5RA 2BTTA 2P4RA 3TSZA 1SHGA 3SHWA 1VYUA 4F17A 2RF0A 4IIOA 4JPBW 2J05A 5GJVB 1WFWA 2BZXA 1KJWA 1TUCA 2PNIA 3UATA 1TUDA 1AWJA 2LJ0A 3EG3A 4AG2C 3NPFA 2DJQA 2NWMA 1K76A 4RUGA 1YP5A 2A28A 2AKLA 2K2MA 3EG0A 1V1CA 4J9CA 3VRYA 1IO6A 1RLQC 2KRNA 2EW3A 1RUWA 2X3XD 3ZL7C 1CKBA 2YDLA 3IQLA 1ZUYA 2F2WA 1YWOA 3EHQA 4J9BA 1LCKA 5IH2A 3EG1A 1Y57A 1WX6A 4Z8AA 2SRCA 2EYXA 2EYYA 1SRMA 1MV0B 3I5SA 5L23A 2DF6A 2GBQA 2DL7A 4RTXA 1FMKA 2JS2A 2HCKA 1B07A 4LNPA 1PHTA 2V1RA 2RQWA 4GLMA 3NMZC 2KBTA 1PWTA 2CSIA 1X69A 4J9FA 1M27C 4AFSC 2KYBA 1U3OA 1HSQA 2DRMA 2EYWA 3UA6A 1UGVA 2EVRA 3H41A 1GL5A 2D1XA 1WXUA 2RN8A 2VWFA 2L2PA 2CT3A 3VS0A 3CQTA 5I11A 1M30A 5IHNA 4J9HA 2LX7A 2OJ2A 4J9GA 1RI9A 1X43A 4HCKA 4RTYA 1GBQA 2YUPA 1X2QA 2DA9A 3ULRB 3VRZA 3UF4A 2KT1A 1K0XA 2KXDA 2D0NA 1KSWA 2JMAA 5IXBA 2I0NA 2MIOA 2O2OA 3VS2A 2DL3A 2X3WD 2F2VA 2JM8A 4HVVA 4D8DA 1QKXA 1N5ZA 1K4US 1QCFA 3REAB 1M3CA 1ABOA 2ED0A 4LUDA 2HEQA 4CC7A 4CC4B 2EGAA 3QWYA 1PRLC 1GCPA 1YCSB 3O5ZA 1OEBA 2J6KA 4FSSA 3RNJA 1VA7A 1U5SA 2W10A 4RTZA 2L0AA 4OMPA 1AZGB 1JXMA 2KXCA 2V1QA 1SPKA 1W6XA 2LCSA 2LP5A 1UJYA 2O9SA 4HXJA 1GBRA 1I0CA 2KGTA 1U06A 5HCKA 2L3PA 1W70A 2B86A 2AK5A 3U23A 1W1FA 2XMFA 1AWWA 4DEXA 4E6RA 1GCQC 4J9EA 4CC3A 1UE9A 2DMOA 1SSHA 2K3BA 1UTIA 2W0ZA 2DBMA 2FO0A 2YSQA 2LNHB 2ROTA 2L3QA 1SRLA 2E5KA 1NYGA 3KFVA 2ESWA 4ZNXA 4ORZA 4OMQA 2ABLA 2ECZA 2YUQA 1HD3A 2HSPA 2DE0X 3M0RA 1PKSA 2O31A 3M0QA 4F16A 2LQWA 2RQRA 1J3TA 1YN8A 1ZBJA 2EQIA 2JT4A 2L3SA 3H0IA 2YUOA 2KRMA 2C0OA 5IXFA 1X2KA 1UUEA 4RTWA 3EG2A 2FG0A 3VS1A 2O88A 1WA7A 2J06A 4RTUA 2D8JA 2KROA 3VS6A 1CSKA 2GTJA 1YNZA 2DL8A 1I07A 1I1JA 2CSQA 2O9VA 1MV3A 2AZSA 2J6OA 1UHCA 1KFZA 1K0SA 3NGPA 1M3AA 3VS3A 2SEMA 1E6GA 1E7OA 3UA7A 2A08A 2FPDA 1OPLA 3H0FA 2ED1A 4OMMA 3GBQA 3VS7A 1AVZC 2GNCA 3M0TA 2IIMA 3FJ5A 1FYNA 4Y92A 1ZSGA 2JW4A 2DNUA 4AFQC 1ARKA 1A0NB 1ZUUA 1NEGA 1K9AA 1NG2A 2HDAA 3PVQA 2DL4A 4GBQA 2JTEA 1AOJA 1GRIA 2ROLA 4AFUC 1H8KA 1G2BA 3EGUA 2JM9A 2GGRA 2KYMA 4KRTA 3I35A 2EBPA 2BZ8A 2C0IA 2CH4W 4OMNA 1MUZA 4QT7A 1AWXA 2DVJA 2DM1A 2CUDA 2FEIA 1OOTA 2K7AA 2LMJA 2RPNA 1JQQA 2EKHA 1H92A 2K79A 4HVWA 2J6FA 1QWEA 1NEBA 2DYBA 2MOXA 3TSWA 1NYFA 4X1VA 3PVLA 1G83A 1ABQA 1WIEA 1VYTA 1JEGA 1PNJA 3R6NA 3M0PA 1UJ0A 2YT6A 4A63B 2JS0A 4RTTA 5FW9A 1M3BA 4LN2A 1AWOA 1JXOA 2VKNA 5FWBA 1GCQA 1QKWA 1T3LA 4JJDA 4ESRA 4F14A 2KE9A 1OV3A 2C0TA 3H0HA 4JJBA 2RNAA 3EHRA 4JJCA 2LJ1A 2FRYA 1BB9A 2GTOA 4EIKA 2M51A 2H8HA 1JU5C 2EGCA 2DILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GJW B;  1B3Q A;  1T3S A;  3RBB B;  5I22 A;  1AZE A;  2ENM A;  1NM7 A;  1UEC A;  1SHF A;  1WXB A;  3QWX X;  2KR3 A;  2OAW A;  2G6F X;  4JZ3 A;  5IHI A;  2K6D A;  1BU1 A;  5EC7 A;  4D8K A;  4M4Z A;  1H3H A;  3SEM A;  4IIM A;  1X6G A;  1X27 A;  1UG1 A;  3I9Q A;  1NLP C;  4AG1 C;  2VVK A;  2M0Y A;  3M0S A;  4LUE A;  1UDL A;  1QWF A;  4OML A;  2KT8 A;  1GFC A;  2PZ1 A;  1HJD A;  2CT4 A;  2DL5 A;  2EGE A;  2CH4 A;  5ECA A;  4HVU A;  1XOV A;  5IHK A;  1T0H A;  4AFZ C;  1VYV A;  2MCN A;  4J9I A;  1SEM A;  3VS5 A;  4R0K A;  4J9D A;  4Z88 A;  2DRK A;  2CDT A;  2PTK A;  3VS4 A;  1Z9Z A;  4Z89 A;  2FPE A;  3TVT A;  1KIK A;  2JMC A;  3NHN A;  2OI3 A;  2KNB B;  2D8H A;  4K11 A;  3REB B;  1AEY A;  1NLO C;  1WXT A;  2RMO A;  1ZX6 A;  2EYZ A;  1ZUK A;  2RQU A;  4WCI A;  2JXB A;  2A36 A;  1WI7 A;  2BZY A;  1E6H A;  1RLP C;  1UFF A;  1EFN A;  1T0J A;  4CC2 A;  2HBW A;  3A98 A;  3PE0 A;  2RQV A;  1QLY A;  1WDX A;  2NUZ A;  1TG0 A;  2K9G A;  1BK2 A;  1Z9Q A;  3M0U A;  1BBZ A;  2J7I A;  1WYX A;  1YWP A;  1AD5 A;  2CUB A;  1ZLM A;  1JO8 A;  1K1Z A;  1PRM C;  3THK A;  1UHF A;  1S1N A;  5FWC A;  2A37 A;  4JZ4 A;  1X6B A;  2AKK A;  2LZ6 B;  2QDL A;  2F2X A;  1WLP B;  2AZV A;  2FPF A;  2GQI A;  4LE9 A;  2DLP A;  4RTV A;  2DX1 A;  2DBK A;  1Y0M A;  2FRW A;  1PKT A;  1M8M A;  2KEA A;  2LQN A;  1OPK A;  2KRS A;  2LJ3 A;  4OMO A;  3JV3 A;  2YUN A;  4DEY A;  1CKA A;  2RQT A;  3C0C A;  1GFD A;  2CRE A;  3LH5 A;  2EPD A;  3I5R A;  2BTT A;  2P4R A;  3TSZ A;  1SHG A;  3SHW A;  1VYU A;  4F17 A;  2RF0 A;  4IIO A;  4JPB W;  2J05 A;  5GJV B;  1WFW A;  2BZX A;  1KJW A;  1TUC A;  2PNI A;  3UAT A;  1TUD A;  1AWJ A;  2LJ0 A;  3EG3 A;  4AG2 C;  3NPF A;  2DJQ A;  2NWM A;  1K76 A;  4RUG A;  1YP5 A;  2A28 A;  2AKL A;  2K2M A;  3EG0 A;  1V1C A;  4J9C A;  3VRY A;  1IO6 A;  1RLQ C;  2KRN A;  2EW3 A;  1RUW A;  2X3X D;  3ZL7 C;  1CKB A;  2YDL A;  3IQL A;  1ZUY A;  2F2W A;  1YWO A;  3EHQ A;  4J9B A;  1LCK A;  5IH2 A;  3EG1 A;  1Y57 A;  1WX6 A;  4Z8A A;  2SRC A;  2EYX A;  2EYY A;  1SRM A;  1MV0 B;  3I5S A;  5L23 A;  2DF6 A;  2GBQ A;  2DL7 A;  4RTX A;  1FMK A;  2JS2 A;  2HCK A;  1B07 A;  4LNP A;  1PHT A;  2V1R A;  2RQW A;  4GLM A;  3NMZ C;  2KBT A;  1PWT A;  2CSI A;  1X69 A;  4J9F A;  1M27 C;  4AFS C;  2KYB A;  1U3O A;  1HSQ A;  2DRM A;  2EYW A;  3UA6 A;  1UGV A;  2EVR A;  3H41 A;  1GL5 A;  2D1X A;  1WXU A;  2RN8 A;  2VWF A;  2L2P A;  2CT3 A;  3VS0 A;  3CQT A;  5I11 A;  1M30 A;  5IHN A;  4J9H A;  2LX7 A;  2OJ2 A;  4J9G A;  1RI9 A;  1X43 A;  4HCK A;  4RTY A;  1GBQ A;  2YUP A;  1X2Q A;  2DA9 A;  3ULR B;  3VRZ A;  3UF4 A;  2KT1 A;  1K0X A;  2KXD A;  2D0N A;  1KSW A;  2JMA A;  5IXB A;  2I0N A;  2MIO A;  2O2O A;  3VS2 A;  2DL3 A;  2X3W D;  2F2V A;  2JM8 A;  4HVV A;  4D8D A;  1QKX A;  1N5Z A;  1K4U S;  1QCF A;  3REA B;  1M3C A;  1ABO A;  2ED0 A;  4LUD A;  2HEQ A;  4CC7 A;  4CC4 B;  2EGA A;  3QWY A;  1PRL C;  1GCP A;  1YCS B;  3O5Z A;  1OEB A;  2J6K A;  4FSS A;  3RNJ A;  1VA7 A;  1U5S A;  2W10 A;  4RTZ A;  2L0A A;  4OMP A;  1AZG B;  1JXM A;  2KXC A;  2V1Q A;  1SPK A;  1W6X A;  2LCS A;  2LP5 A;  1UJY A;  2O9S A;  4HXJ A;  1GBR A;  1I0C A;  2KGT A;  1U06 A;  5HCK A;  2L3P A;  1W70 A;  2B86 A;  2AK5 A;  3U23 A;  1W1F A;  2XMF A;  1AWW A;  4DEX A;  4E6R A;  1GCQ C;  4J9E A;  4CC3 A;  1UE9 A;  2DMO A;  1SSH A;  2K3B A;  1UTI A;  2W0Z A;  2DBM A;  2FO0 A;  2YSQ A;  2LNH B;  2ROT A;  2L3Q A;  1SRL A;  2E5K A;  1NYG A;  3KFV A;  2ESW A;  4ZNX A;  4ORZ A;  4OMQ A;  2ABL A;  2ECZ A;  2YUQ A;  1HD3 A;  2HSP A;  2DE0 X;  3M0R A;  1PKS A;  2O31 A;  3M0Q A;  4F16 A;  2LQW A;  2RQR A;  1J3T A;  1YN8 A;  1ZBJ A;  2EQI A;  2JT4 A;  2L3S A;  3H0I A;  2YUO A;  2KRM A;  2C0O A;  5IXF A;  1X2K A;  1UUE A;  4RTW A;  3EG2 A;  2FG0 A;  3VS1 A;  2O88 A;  1WA7 A;  2J06 A;  4RTU A;  2D8J A;  2KRO A;  3VS6 A;  1CSK A;  2GTJ A;  1YNZ A;  2DL8 A;  1I07 A;  1I1J A;  2CSQ A;  2O9V A;  1MV3 A;  2AZS A;  2J6O A;  1UHC A;  1KFZ A;  1K0S A;  3NGP A;  1M3A A;  3VS3 A;  2SEM A;  1E6G A;  1E7O A;  3UA7 A;  2A08 A;  2FPD A;  1OPL A;  3H0F A;  2ED1 A;  4OMM A;  3GBQ A;  3VS7 A;  1AVZ C;  2GNC A;  3M0T A;  2IIM A;  3FJ5 A;  1FYN A;  4Y92 A;  1ZSG A;  2JW4 A;  2DNU A;  4AFQ C;  1ARK A;  1A0N B;  1ZUU A;  1NEG A;  1K9A A;  1NG2 A;  2HDA A;  3PVQ A;  2DL4 A;  4GBQ A;  2JTE A;  1AOJ A;  1GRI A;  2ROL A;  4AFU C;  1H8K A;  1G2B A;  3EGU A;  2JM9 A;  2GGR A;  2KYM A;  4KRT A;  3I35 A;  2EBP A;  2BZ8 A;  2C0I A;  2CH4 W;  4OMN A;  1MUZ A;  4QT7 A;  1AWX A;  2DVJ A;  2DM1 A;  2CUD A;  2FEI A;  1OOT A;  2K7A A;  2LMJ A;  2RPN A;  1JQQ A;  2EKH A;  1H92 A;  2K79 A;  4HVW A;  2J6F A;  1QWE A;  1NEB A;  2DYB A;  2MOX A;  3TSW A;  1NYF A;  4X1V A;  3PVL A;  1G83 A;  1ABQ A;  1WIE A;  1VYT A;  1JEG A;  1PNJ A;  3R6N A;  3M0P A;  1UJ0 A;  2YT6 A;  4A63 B;  2JS0 A;  4RTT A;  5FW9 A;  1M3B A;  4LN2 A;  1AWO A;  1JXO A;  2VKN A;  5FWB A;  1GCQ A;  1QKW A;  1T3L A;  4JJD A;  4ESR A;  4F14 A;  2KE9 A;  1OV3 A;  2C0T A;  3H0H A;  4JJB A;  2RNA A;  3EHR A;  4JJC A;  2LJ1 A;  2FRY A;  1BB9 A;  2GTO A;  4EIK A;  2M51 A;  2H8H A;  1JU5 C;  2EGC A;  2DIL A; 
#chains in the Genus database with same CATH topology
 1YIT Q;  1WHL A;  4M75 A;  3FLG A;  1QMC A;  2KR3 A;  2G6F X;  5HK0 A;  1TU0 B;  4FU6 A;  1LOJ A;  3CME Q;  4M4Z A;  4ZTF A;  2H3E B;  1LNX A;  2M0O A;  1ZSZ A;  2R57 A;  1YIJ T;  4QQ6 A;  2VVK A;  4OB1 B;  2M0Y A;  1M1K U;  1QP3 A;  1UDL A;  2HAX A;  1QWF A;  1Q7Y U;  2DL5 A;  5ECA A;  1XOV A;  1BI1 A;  4EMH A;  4PJO G;  2Y90 A;  4BY6 C;  3JCM f;  4JLG A;  3J80 E;  2ZPH B;  3FB9 A;  5FU6 B;  4Z88 A;  3I56 Q;  4FM4 B;  1N27 A;  1VQM A;  4HT9 A;  4M7A C;  1Z9Z A;  1H64 1;  4E7I A;  2JMC A;  2QQS A;  1VQ4 A;  1HYO A;  2KNB B;  5GAM g;  2D8H A;  4MDX A;  2LQK A;  2WSC E;  3G71 T;  1WXT A;  1VQO Q;  2NUT A;  3DKM A;  2RQU A;  3M58 A;  1Q82 R;  2K5F A;  3RDV A;  4LDX A;  5CAI A;  1E6H A;  1BIA A;  4M78 C;  1EFN A;  2DTH A;  1VQ5 A;  2HBW A;  4OVA A;  3PIP A;  2CZ7 B;  4M7D D;  1IRE B;  3CCV A;  1IGQ A;  2BKD N;  2NYS A;  3TQ7 P;  1LJO A;  3CME T;  3G6E Q;  4M77 D;  2LQ8 A;  1WYX A;  1MND A;  3QXE B;  1YWP A;  4B6M A;  1VQ7 A;  3QUI A;  2KY9 A;  4BD3 A;  2X9H A;  2VC8 A;  2PUO B;  2KDS A;  1S1N A;  3QYH B;  5FLX E;  2AKK A;  2LZ6 B;  2XK0 A;  3DB3 A;  2F2X A;  3UPU A;  2IG0 A;  2C06 A;  3LH0 A;  2EQJ A;  4PL6 A;  1NJI U;  1TWB A;  4RTV A;  4L5G A;  4M7A G;  1M8M A;  5LJ3 e;  3I56 T;  1VIF A;  2MWP A;  2LJ3 A;  1KC8 R;  4DEY A;  4DBH A;  3G7Z A;  3C0C A;  1TTH B;  4C8Q B;  2PVD B;  3D7S B;  1OI1 A;  5GAO q;  3I5R A;  2GFA A;  4PJL A;  1P92 A;  5GAN e;  4BB7 A;  5IAY A;  1VYU A;  2HD0 A;  3A8L B;  2IPO B;  3HHT B;  1VQO T;  4O5V A;  3VV0 A;  1VQP A;  5GJV B;  4ELZ C;  1AWJ A;  3C12 A;  1N8R U;  4M78 G;  1RAA B;  4C5G A;  4F7U B;  4FW1 A;  3CXC A;  1QVF A;  4A4F A;  4M75 C;  5GAN 5;  4C92 F;  1IRX A;  2QTV A;  3OW2 P;  4NOY A;  1IO6 A;  2KRN A;  2EW3 A;  4IUV A;  1CKB A;  2YDL A;  1S72 Q;  1ZUY A;  1ZSZ C;  1H3Z A;  4J9B A;  2E65 A;  1RAC B;  4E7L A;  1WX6 A;  4IUR A;  3I5S A;  2GQV A;  4C92 A;  4OMF B;  5L23 A;  3CD6 Q;  4C0Z A;  5CKF A;  2DL7 A;  1VQ6 Q;  2JS2 A;  3BW1 A;  1KQS A;  2R5M A;  4QVD A;  4PK4 A;  3JB9 G;  1BYM A;  2RHU A;  4PJO B;  3OYA A;  2P0K A;  2XHC A;  1HSQ A;  2DRM A;  2EYW A;  2L8D A;  3CC2 T;  1JBM A;  2DTO A;  2MF2 A;  4DBF A;  3H41 A;  2ZCF B;  4ZN1 A;  2OAU A;  2ZPE B;  2VWF A;  2O4X A;  5LJ5 d;  5I11 A;  5GAM e;  5GMK l;  4ANJ A;  4WTO B;  5A0L A;  3OSS C;  1AHJ B;  4J9G A;  2F69 A;  2MI6 A;  5AYF A;  3F70 A;  1G3T A;  5LJ3 j;  2YUP A;  2DA9 A;  3QDF A;  1B34 B;  1WJQ A;  1I8F A;  5DY9 A;  2KT1 A;  3FEO A;  3CCJ Q;  1KSW A;  5IXB A;  2O2O A;  3VS2 A;  1RAG B;  2DL3 A;  5GAN j;  1KD1 U;  4HVV A;  2K5I A;  3P8B B;  1K4U S;  4M7D E;  5GAN 4;  3REA B;  1M3C A;  2Z0W A;  4R55 A;  2HEQ A;  4PJJ A;  1PRL C;  1GCP A;  3LWH A;  4M77 E;  1M2V A;  3X28 B;  1X75 C;  3MEV A;  2CP2 A;  1S72 T;  1LPL A;  5A0G A;  2VB6 A;  2EYQ A;  2L0A A;  2LP5 A;  1UJY A;  4HXJ A;  3JCM c;  1I0C A;  2KGT A;  3CD6 T;  2R5A A;  1U06 A;  3X25 B;  1VQ6 T;  4FL6 A;  2Y4X A;  4E6R A;  3V8K A;  1UTI A;  2YSQ A;  5CK9 A;  3LWI A;  1SRL A;  3CCL A;  3KFV A;  2JNG A;  2K2V A;  1QCO A;  2ECZ A;  2CS7 A;  2DE0 X;  3M0R A;  1JJ2 P;  1PKS A;  2O31 A;  4Q5W A;  3OYH A;  1WHK A;  2LQW A;  4EMK A;  1YN8 A;  1U8R A;  1ZBJ A;  3JB9 H;  2EQI A;  4E2F B;  2JT4 A;  3JCM P;  4C8Q F;  5GAN 3;  5IXF A;  1FX7 A;  1UUE A;  3SFM A;  3VUZ A;  1JJ2 S;  3VS1 A;  2O88 A;  1WA7 A;  5GAM j;  4N0A A;  2X4Y A;  1CSK A;  1YNZ A;  1D3B B;  1I1J A;  1M4Z A;  2O9V A;  3CCJ T;  4LD6 A;  5GMK m;  3NGP A;  4C8Q A;  3TU4 K;  3HSB A;  1E6G A;  4IUU A;  1FYN A;  1PCX A;  4BI8 B;  2LCL A;  5CVI A;  5LJ5 g;  3HP9 A;  1ZSG A;  2JW4 A;  1D0X A;  2WSE E;  5L8R E;  3A8O B;  3V8J A;  1ZUU A;  3UDC A;  3L2Z A;  3TEE A;  1YI2 Q;  1NG2 A;  4C92 C;  3PVQ A;  3EH1 A;  3CCE Q;  1XNI A;  1ZA1 B;  2DL4 A;  6AT1 B;  1MMG A;  1ZBX A;  2YRC A;  5GAN 2;  2FYK A;  2PVG B;  3BDU A;  1O9S A;  4II1 A;  1MUZ A;  4QT7 A;  3A8H B;  1AWX A;  4IKF A;  2CUD A;  2K7A A;  1NE8 A;  5KYY A;  2LMJ A;  2RPN A;  5FU7 C;  2EKH A;  4GLK A;  1V76 A;  4PLI A;  3CCQ A;  3CBP A;  2WSF E;  4BE1 A;  1RAH B;  2E1H A;  1WIE A;  1D1B A;  1LVK A;  3CC7 A;  5KCO A;  3ASK A;  3OA6 A;  2FHD A;  1PNJ A;  2DK3 A;  3MET A;  1QVG S;  3EFO B;  3WVE B;  1M5Q 1;  2MAM A;  2RO0 A;  5FW9 A;  1K8A C;  1TSF A;  4LN2 A;  2MPX C;  3SDZ A;  2VKN A;  5HK3 A;  1QKW A;  4AT1 B;  1Q81 U;  1QW1 A;  1B34 A;  1VQK A;  2C0T A;  3H0H A;  5KCH A;  3INZ A;  2FRY A;  4J8O A;  5I2S A;  1YI2 T;  2H8H A;  1JU5 C;  5CQY A;  5GJW B;  3A8G B;  4DQ2 A;  3VJP A;  3CCE T;  3RBB B;  3E19 A;  4PJO D;  5I22 A;  1AZE A;  2ENM A;  1UEC A;  1WXB A;  3UT1 A;  3RMS A;  2OAW A;  5IHI A;  4JZ3 A;  1YJW Q;  2ZPF B;  2K3Y A;  4D8K A;  3S3O A;  1H3H A;  3SEM A;  1D1C A;  2DEU A;  2VUB A;  5DM7 R;  4IIM A;  2KQW A;  1K9M U;  4KUI A;  1WZO A;  2X51 A;  1RL2 A;  4FIB A;  4CI0 C;  5M9O A;  2ATC B;  1TS9 A;  2RA2 A;  1IHW A;  4EMK C;  2QAS A;  2KT8 A;  3CCU A;  1KQ1 A;  3OYJ A;  2OTJ Q;  2EGE A;  2V8I A;  4IUQ A;  1T0H A;  4AFZ C;  4J9I A;  4DOW A;  4N0A C;  1SEM A;  3VS5 A;  3WVD B;  4R0K A;  5GAN 7;  2HL5 C;  1HK9 A;  2E12 A;  4J9D A;  1OX8 A;  3HRT A;  4E7J A;  2CDT A;  1VQN A;  4ZGD B;  3TVT A;  2COW A;  3OYM A;  5LJ3 h;  5IT9 E;  2HZY A;  2EYZ A;  4XU2 A;  5GAN h;  2YLC A;  3JCM W;  1WI7 A;  2DZC A;  3EFR A;  3KBG A;  1T0J A;  3URG A;  3CC4 Q;  4CC2 A;  4MZM A;  1VQ9 Q;  1WDX A;  2AHJ B;  2NUP B;  1BK2 A;  4MZP A;  4PKC C;  4RCB A;  4E7K A;  1YJW T;  3BE3 A;  1Z9Q A;  3G1J A;  3M0U A;  2DXC A;  2X35 A;  2LVM A;  2VXE A;  1U1S A;  4C8Q E;  3RES A;  4QW2 A;  5CIU A;  3QPH A;  3BY7 A;  4RCC A;  1AD5 A;  4AMC A;  1JO8 A;  4FYX B;  1K1Z A;  2GCX A;  1IZ6 A;  1UHF A;  2M9U A;  4C5H A;  4ME7 A;  5FWC A;  1Y7X A;  4JZ4 A;  2OTJ T;  2QDL A;  4EDU A;  5GMK i;  4F7U E;  1RI0 A;  4LE9 A;  5CKB A;  1QP2 A;  2HNI A;  2OX7 A;  2KVQ G;  2DX1 A;  4LXC A;  2DBK A;  1Y0M A;  4KGV B;  3EG9 A;  3JV3 A;  2YUN A;  2E10 A;  5KYU A;  5KYW B;  2P0Q A;  1TH7 A;  1NPP A;  2CRE A;  3QII A;  2EPD A;  5GAM h;  5J26 A;  4OGC A;  3NFC A;  2A3L A;  1SHG A;  3SHW A;  9ATC B;  1ZHI A;  2BE7 D;  4IIO A;  1VQM Q;  1G5V A;  2BZX A;  1KK7 A;  1TUC A;  4BI3 A;  4M7D F;  2DYI A;  1VQ4 Q;  1G3W A;  2LRQ A;  3RMQ A;  1XQH A;  5LJ5 j;  2FB7 A;  4C0D C;  3JB9 D;  4PJO E;  2NWM A;  3O8V A;  1YP5 A;  2AKL A;  3CC4 T;  4M77 F;  3CCM T;  1K8A R;  2K2M A;  3EG0 A;  4GY5 A;  1V29 B;  1JJ2 A;  3OMG A;  1K9M C;  2V8J A;  4J9C A;  3VRY A;  1VQ9 T;  2BIV A;  1RLQ C;  3RIR A;  2DZ9 A;  1RUW A;  4M7D A;  5GMK e;  4X34 A;  2EAY A;  1YWO A;  3EHQ A;  1WHJ A;  1VQ5 Q;  2YXY A;  3E9F A;  2EYX A;  4KGX B;  3SWN B;  2XIC A;  2F5T X;  4M77 A;  3M54 A;  3CCV Q;  4OGE A;  4DA4 A;  2GBQ A;  1MHN A;  3E2U A;  1Y07 A;  1KG1 A;  2F1L A;  1B7T A;  1PWT A;  1X69 A;  2K5L A;  3RKX A;  2KMT A;  1VQ7 Q;  2FZC B;  3GNG A;  2DXB A;  2KYB A;  2PUK B;  2D1X A;  4C5I A;  1WXU A;  4HCC A;  2RN8 A;  2HKN A;  3VS0 A;  1M30 A;  2EIF A;  1N6A A;  1UGP B;  2OJ2 A;  3PTA A;  3HRS A;  1YIT T;  1FWZ A;  1X43 A;  4RTY A;  1WHM A;  3EAE A;  4PNO A;  3OS1 A;  4F04 B;  3TCJ A;  4FYY B;  1K0X A;  1VQM T;  4BE0 A;  2JMA A;  1VQ4 T;  3DLL A;  2JM8 A;  1M90 C;  1BI3 A;  2E5Q A;  4CRI A;  3DB4 A;  4P5N A;  1VQP Q;  2KK4 A;  4XTX A;  1YCS B;  2CGH A;  3MEU A;  3OYL A;  1I5L A;  1FMV A;  1QVG A;  2W10 A;  3BFM A;  1VQ5 T;  4OMP A;  1AZG B;  3OYK A;  1PC0 A;  2DD4 A;  4JUV A;  1SPK A;  3CCV T;  3JCM d;  3H6Z A;  3MKD A;  3JCM b;  1Q86 C;  4L59 A;  5GMK j;  1XTD A;  3EGX B;  4XU0 A;  5HCK A;  1OU9 A;  1W70 A;  2B86 A;  2X4X A;  1GCQ C;  4J9E A;  1YHQ A;  1UE9 A;  2DMO A;  2K3B A;  2RJD A;  4E7S A;  7AT1 B;  2LNH B;  2ZGW A;  2E5K A;  2AT1 B;  2QYZ A;  4BE2 A;  1VQ7 T;  1RAD B;  4EPC A;  2ESW A;  4ZNX A;  4OMQ A;  2ZPB B;  2YUQ A;  1HD3 A;  1O75 A;  2HSP A;  4OB2 B;  3ZBD A;  4X9D A;  2A0F B;  2P84 A;  2C0O A;  1X2K A;  3CPW P;  4BDY A;  4RTW A;  5CKH A;  2FG0 A;  3ZEH A;  1M1K C;  2J06 A;  3H9N A;  2D8J A;  2KRO A;  3VS6 A;  2GTJ A;  3G6E T;  3OS0 A;  3OW2 S;  4MMK A;  1Q7Y C;  2E3I A;  3QG1 A;  3CPW S;  3CC2 A;  2DTI A;  3MP1 A;  4B9W A;  2QQB A;  1K0S A;  3RR6 A;  3VS3 A;  2SEM A;  4XTY A;  4OF1 A;  3UA7 A;  4EMG A;  2A08 A;  3CMA Q;  1VQP T;  1NZ9 A;  2QDY B;  2HQE A;  1JB0 E;  4M7D C;  3CCS A;  1FMW A;  2IIM A;  4X9C A;  4XAX B;  4Y92 A;  2DNU A;  2HKQ B;  1ARK A;  4A4H A;  1VUB A;  2CZ1 B;  4M77 C;  3GF5 A;  4LDV A;  2CP0 A;  3OQ5 A;  4ZN3 A;  2OTL A;  4AFU C;  3M4Y A;  4A4K A;  5IN1 A;  4KT0 E;  1G2B A;  1K9M R;  2QA4 Q;  1U1T A;  3I35 A;  2CH4 W;  2C0I A;  4OMN A;  2XD0 A;  2XID A;  3GLX A;  2R58 A;  2DM1 A;  2CZ6 B;  2FEI A;  4HCZ A;  3OBW A;  1H92 A;  4J7I A;  1I4K 1;  4M75 G;  3M56 A;  2DYB A;  1M2O A;  3MJX A;  5CKD A;  2JTF A;  4C5E A;  3CCL Q;  4BDZ A;  1G83 A;  5EG2 A;  2V26 A;  1QVP A;  2LT4 A;  3G4S A;  1VYT A;  3A5Z B;  1JEG A;  3MP6 A;  3JCM g;  3M0P A;  2P4T A;  1TUG B;  2YT6 A;  1R77 A;  1G8X A;  3CEY A;  3L1A A;  3E9G A;  2JS0 A;  2IVW A;  4RTT A;  1WHG A;  2BUD A;  1AWO A;  2MYS A;  3MO8 A;  2QGF B;  1OX9 A;  4NS5 A;  4JJD A;  4ESR A;  1QCN A;  1HXD A;  1NJI C;  3CMA T;  4J6Y A;  4DOV A;  4F14 A;  3FDR A;  4BY6 B;  1OV3 A;  4E47 A;  1C0M A;  5I2M A;  2RNA A;  1VIE A;  2LJ1 A;  5LJ5 h;  4JRP A;  4ELY C;  1BIB A;  5A0D A;  3SB2 A;  2EGC A;  2QTX A;  2AIR B;  1I81 A;  4M7A B;  3SD4 A;  1B3Q A;  2D6F A;  2EJG A;  1OZ2 A;  4FSX A;  1YJ9 Q;  1M90 R;  1JRI A;  1NM7 A;  1SHF A;  3LLR A;  3QBY A;  1PSE A;  2RHY A;  1BU1 A;  3OB9 A;  2EQK A;  1KHC A;  2QA4 T;  2HSE B;  4KBM B;  1N8R C;  3JCM V;  1X27 A;  3TRE A;  1UG1 A;  3I9Q A;  5D6W A;  1NLP C;  4AG1 C;  5GAO l;  4LUE A;  1Q82 U;  4M78 B;  4OML A;  2I2L A;  1GFC A;  2PZ1 A;  3EGX A;  1Q86 R;  3QKJ A;  4F7U F;  3H8Z A;  2HMA A;  2CH4 A;  2QI2 A;  4HVU A;  2FZG B;  1VYV A;  3CCL T;  4FYV B;  8ATC B;  5D6Y A;  3CCR A;  2E3H A;  2YWW A;  1IB8 A;  3I55 A;  1WNL A;  1K73 U;  2FL7 A;  4WF2 A;  4ZGJ B;  4DBQ A;  5LJ3 f;  2HBP A;  3VS4 A;  3CCQ Q;  4F7U A;  2FPE A;  3RKY A;  3JAM E;  3PMT A;  2DIG A;  3CC7 Q;  2G3R A;  4K11 A;  1VQ8 A;  3REB B;  1AEY A;  4JRK A;  1M1K R;  1C6V X;  2VGM A;  4WCI A;  4PJO F;  2A36 A;  3NTH A;  3FJP A;  2BZY A;  1G3S A;  1Q7Y R;  2RHI A;  3CPF A;  2E64 A;  2VV5 A;  3A98 A;  1M9S A;  3S3M A;  1PG5 B;  1KC8 U;  2RQV A;  4N4I A;  1YJ9 T;  1VQK Q;  4RG2 A;  1YCY A;  1TG0 A;  3RKW A;  3GP8 A;  4PJO A;  3QDR B;  3OYG A;  1FXX A;  3EGD B;  1BBZ A;  1RAE B;  1KD1 C;  5FU6 C;  3AT1 B;  2EKO A;  3OYI A;  5GMK h;  2JOY A;  2CUB A;  1PRM C;  4ATO A;  2GFU A;  1XJW B;  2YHT A;  4M75 B;  1R0C B;  2A37 A;  3OY9 A;  2QEX Q;  4XTU A;  3JCM e;  4BI4 A;  1PD0 A;  2AZV A;  4J6X A;  2FPF A;  1ZSZ B;  5GAN 6;  3S6W A;  1UEB A;  2DLP A;  3V7C A;  1OQK A;  5GAO m;  3CCU Q;  4C92 G;  3GPL A;  2LQN A;  1UB4 A;  4OMO A;  4HT8 A;  3CCQ T;  2KI7 A;  5GAM f;  1GFD A;  1GXI E;  3LH5 A;  3CC7 T;  1RAF B;  4XU1 A;  5KYN A;  2RF0 A;  2J05 A;  4A4E A;  2COY A;  3CXC P;  1VQN Q;  2DXT A;  1KJW A;  1VQL A;  2LJ0 A;  2HQH A;  2P0P A;  1K76 A;  4RUG A;  3GOX A;  3J7A F;  4M7A F;  4N4G A;  1YFN A;  1VQK T;  3M4G A;  3KXT A;  2X3X D;  3ZL7 C;  2K57 A;  4FYW B;  1NJI R;  2NUT B;  3QSU A;  3OW2 A;  2F2W A;  3OMC A;  5IH2 A;  3CPW A;  4Z8A A;  1SRM A;  1MV0 B;  1YJN A;  2DF6 A;  4C8Q C;  1FMK A;  2DPP B;  3HKS A;  2HCK A;  1B07 A;  3QJY A;  4JRQ A;  4LNP A;  1WGS A;  2RQW A;  3NMZ C;  2QEX T;  2CSI A;  1K73 C;  4FT2 A;  4J9F A;  2EJF A;  1N8R R;  4JDS A;  4AFS C;  1U3O A;  4PJN A;  3QYG B;  4XQ3 A;  1D3B A;  3UA6 A;  2EVR A;  1D1A A;  5J39 A;  2YRV A;  2L2P A;  2CT3 A;  2XG8 D;  2LTO A;  2LX7 A;  1RI9 A;  1OYX A;  5KYX B;  2D9T A;  1GBQ A;  5CKE A;  1ACM B;  4XTW A;  1N9S A;  1RAB B;  5GAO n;  3UF4 A;  4OB0 B;  3WXM B;  3LGF A;  2PU9 B;  3JB9 F;  4M7A D;  2D0N A;  3PT9 A;  1VQN T;  2I0N A;  2F2V A;  1N5Z A;  1QCF A;  4JRI A;  1WJR A;  2EGA A;  3QWY A;  2EFI A;  1PSF A;  3O5Z A;  1KQ2 A;  4PJO C;  3EH2 A;  1OEB A;  2J6K A;  4FSS A;  1KHI A;  1SKU B;  2RHZ A;  2XDP A;  4M78 D;  1YBY A;  2NLU A;  1OU8 A;  4XTV A;  5DLQ E;  1W6X A;  4C8Q G;  1YIJ A;  2O9S A;  2RH2 A;  1GBR A;  4MZT A;  1Q81 C;  2LNV A;  2RB6 A;  1RAI B;  3JCM Q;  1WPY A;  4IUP A;  2L3P A;  2AK5 A;  2CYZ B;  2XMF A;  3CCM A;  4DEX A;  3JB9 I;  1X6O A;  2W0Z A;  2DBM A;  3EGD A;  3HPW A;  2ROT A;  1KD1 R;  2ABL A;  2RD1 A;  5CO7 A;  3EFO A;  4C92 B;  3M0Q A;  4F16 A;  2RQR A;  2DFU A;  2L89 A;  3JRZ A;  2XU8 A;  2F5K A;  2L3S A;  3H0I A;  2YUO A;  2CP7 A;  2KRM A;  3QZ9 B;  3PNW C;  3OS2 A;  5HY6 A;  3VYG A;  1AT1 B;  3G71 A;  2RK2 A;  3LX7 A;  3OSV A;  1MV3 A;  2E6N A;  2O4X B;  5FU7 B;  3JSC A;  4NL2 A;  4JLI A;  2QQR A;  2DET A;  4PFP A;  1IGU A;  2FPD A;  1OPL A;  1YIT A;  3H0F A;  4MDW A;  4OMM A;  4RG8 A;  1AVZ C;  3LGL A;  3MHX A;  3CME A;  4M75 D;  3X24 B;  2HDA A;  3AHU A;  4GBQ A;  2JTE A;  3X20 B;  2ROL A;  3M55 A;  3MP8 A;  1TXQ A;  4RKU E;  1H8K A;  3A8M B;  2KSS A;  2JM9 A;  2GGR A;  1M2V B;  2RHX A;  5AT1 B;  2EBP A;  4PLL A;  2KAF A;  5KH6 A;  2DO3 A;  4TVR A;  3NTK A;  3L2Q A;  2K79 A;  5GAO r;  3LYI A;  1YHQ Q;  3I56 A;  4FT4 A;  4N4H A;  3OS5 A;  3PVL A;  3ZFJ A;  5FRN A;  2YLB A;  3X26 B;  3PFS A;  4UC4 A;  1K73 R;  5LL6 S;  4M7A E;  1OZ3 A;  3R6N A;  1M8V A;  8AT1 B;  3HRU A;  1UJ0 A;  5C6S A;  1VQO A;  4E7H A;  2JUF A;  3Q1J A;  4EMK B;  1VOM A;  1NPR A;  1EIF A;  5KYX A;  2NUP A;  2MK5 A;  5FWB A;  4KH0 B;  1MGQ A;  5C0M A;  3VYH B;  5LJ5 f;  2D0Q B;  2KE9 A;  4M78 E;  3CC2 Q;  3PMI A;  3EHR A;  4JJC A;  3C4S A;  1D0Z A;  2PQW A;  1BB9 A;  2GF7 A;  3G6E A;  1W4S A;  2L3R A;  5A2Q E;  2DIL A;  4E7Z A;  1MMD A;  4QQG A;  1T3S A;  3CCS Q;  2JN0 A;  3QWX X;  1MMN A;  3CBO A;  2K6D A;  1W2B P;  2VXF A;  4LDY A;  4V2S A;  5EC7 A;  1R0B G;  3GIB A;  1BCO A;  1X6G A;  2DJZ A;  3VU3 C;  3MPU B;  5CCA A;  2EQM A;  3MEW A;  3C94 A;  2OTL Q;  3M0S A;  3V7R A;  1W2B S;  3BDL A;  5CQX A;  5KYW A;  1YHQ T;  2VYT A;  1Q81 R;  1HJD A;  2CT4 A;  5IHK A;  4A4G A;  5CR2 A;  4PJM A;  1EX4 A;  2COZ A;  5D7U A;  2MCN A;  3PIO A;  2CP3 A;  2EQU A;  5KE3 A;  3J81 E;  4D6W A;  2XKO C;  3JCM h;  1Y71 A;  5KYY B;  3OYY A;  2DRK A;  4FCY A;  2PTK A;  4Z89 A;  1M1G A;  5I21 A;  1KIK A;  4KUL A;  4DBR A;  3NHN A;  1SF9 A;  2OI3 A;  3G4S Q;  2K3X A;  3M59 A;  1NLO C;  5HKC A;  2BE9 B;  2RMO A;  1ZX6 A;  3ME9 A;  3HTR A;  1ZUK A;  2A7Y A;  3CBM A;  3VKI A;  3N5B B;  3UWN A;  2JXB A;  4M75 E;  1I5O B;  1S72 A;  3SWN A;  3KUF A;  1RLP C;  1UFF A;  4R56 A;  1TOV A;  3PE0 A;  1UGQ B;  1QLY A;  2NUZ A;  4Y28 E;  3CCS T;  4JS5 A;  1WQ7 A;  2K9G A;  3CD6 A;  1VQ6 A;  3P8D A;  2M02 A;  3CMA A;  4C92 D;  2J7I A;  3V7S A;  3L2U A;  4LDU A;  1M1F A;  2M1H A;  4XK8 E;  2LC4 A;  2MMP A;  2OTL T;  1ZLM A;  1ZQ1 A;  4C0D B;  3M5A A;  3THK A;  1N9R A;  1X6B A;  3GNF B;  1K8A U;  4M7D G;  1WLP B;  5FRM A;  2GQI A;  2QA4 A;  2DER A;  3EFS A;  2FRW A;  1PKT A;  4J83 A;  4M77 G;  2KEA A;  1OPK A;  2KRS A;  4PFZ A;  3CCJ A;  1CKA A;  2RQT A;  2ZPI B;  3S3N A;  2LCC A;  3CCR Q;  5GAO p;  3G4S T;  2BTT A;  4KGZ B;  2M16 A;  2P4R A;  3I55 Q;  3TSZ A;  2XDD A;  4F17 A;  4JPB W;  1WFW A;  4B9X A;  3LW5 E;  2PNI A;  3UAT A;  1TUD A;  3JB9 J;  2WAC A;  1UGS B;  1Y96 B;  3EG3 A;  4IUT A;  4YTL A;  4AG2 C;  2QGG A;  4RMO A;  3NPF A;  1VQ8 Q;  2DJQ A;  1UGR B;  1MNE A;  2A28 A;  1DJ7 B;  3M9Q A;  1V1C A;  2RJF A;  2HQX A;  1D0Y A;  2Y4Y A;  4JJN K;  3IQL A;  1LCK A;  3EG1 A;  1Y57 A;  2DIQ A;  2SRC A;  4MML A;  2PVO B;  2EYY A;  2DVE A;  2LDM A;  3PGG A;  2XI9 A;  4KUD K;  2LX9 A;  4RTX A;  2RI3 A;  2MWO A;  1PHT A;  2V1R A;  2DKG A;  4GLM A;  1YJ9 A;  4O6J A;  2KBT A;  4OP0 A;  3L2V A;  3RER A;  1M27 C;  4Z02 A;  5GAN f;  1ZA2 B;  1UGV A;  2O01 E;  1GL5 A;  2E6Z A;  2V8K A;  1MMA A;  3JCM J;  3OBY A;  3CQT A;  4OB3 B;  2DXU A;  5IHN A;  3FC3 A;  4J9H A;  3E1S A;  4HCK A;  3CCR T;  4XU3 A;  1X2Q A;  3ULR B;  3I55 T;  3VRZ A;  1WJS A;  3NTI A;  4HA8 A;  1D09 B;  2KXD A;  4C8Q D;  3FRN A;  3HFN A;  3SWN C;  1X01 A;  5D6X A;  3EG9 B;  2MIO A;  2X3W D;  3MCA B;  5KYU B;  2RM4 A;  1BI0 A;  1EZZ B;  3M53 A;  1QKX A;  3V8L A;  4D8D A;  4J5Y A;  4NL3 A;  1YI2 A;  1VQ8 T;  1ABO A;  1PD1 A;  1WQW A;  2ED0 A;  4LUD A;  4QVC A;  1QVG P;  3CCE A;  4CC7 A;  4CC4 B;  4VUB A;  1SSF A;  1VQL Q;  1WHH A;  4C92 E;  3RNJ A;  2K4Y A;  1VA7 A;  1U5S A;  2ZZD A;  4RTZ A;  2RI5 A;  4KH1 B;  3L2W A;  4QVZ A;  4QKU A;  1JXM A;  2KXC A;  2V1Q A;  3MEA A;  5GAN 8;  3OYE A;  2DAQ A;  2LCS A;  4LD9 K;  3RUX A;  2QXF A;  2B8A A;  4BAC A;  3U23 A;  2H3J A;  1W1F A;  1AWW A;  2JZ2 A;  2VAS A;  4CC3 A;  1F1B B;  1SSH A;  2JTM A;  3A1P A;  5LJ3 d;  2FO0 A;  4M7D B;  1C1A A;  1QQJ A;  2L3Q A;  1NYG A;  2E70 A;  1YJN Q;  2E4H A;  2RJE A;  2QQA A;  4ORZ A;  1QVF P;  4M77 B;  1PM3 A;  1J3T A;  5GAN d;  3QHS A;  4ZTJ A;  3QJ6 A;  3CXC S;  1QVF S;  3QO3 A;  3EG2 A;  3FIF A;  3P8H A;  4RTU A;  2ZAE A;  2FVU A;  2QEX A;  2CKK A;  1Q82 C;  1R8O B;  2XDB A;  1W2B A;  2DL8 A;  1I07 A;  2CSQ A;  1NBE B;  1Q95 G;  2AZS A;  1KQS P;  3OYF A;  2J6O A;  4LDW A;  1BI2 A;  4XTZ A;  1UHC A;  1KFZ A;  4M7A A;  4J7F A;  1M3A A;  4C0G A;  2JJ9 A;  3HFO A;  2CP5 A;  1E7O A;  2HL3 A;  4M78 F;  4PFO A;  3T9N A;  4FW2 A;  1KQS S;  2ED1 A;  3GBQ A;  3VS7 A;  2ZPG B;  5J3B A;  2GNC A;  3M0T A;  1VQL T;  3FJ5 A;  1SG5 A;  1YJW A;  4AFQ C;  1BCM A;  1A0N B;  1NEG A;  1K9A A;  4JS4 A;  1Y96 A;  2EWN A;  2LT1 A;  2DD5 A;  3CCU T;  3ER0 A;  4M78 A;  2CZ0 B;  3L2R A;  1G3Y A;  1BKB A;  1AOJ A;  1GRI A;  4A54 A;  5DLO A;  5LJ5 e;  3R6O A;  4ZGE B;  3EGU A;  4QQD A;  3OYN A;  2KYM A;  4KRT A;  3OYD A;  2OTJ A;  2BZ8 A;  5GAM d;  2EJ9 A;  1YIJ Q;  2DVJ A;  1YJN T;  4HKE A;  1OOT A;  2CP6 A;  1KC8 C;  2DEQ A;  1JQQ A;  3C95 A;  2QQ9 A;  2L5Q A;  3CCM Q;  4HVW A;  4A53 A;  2J6F A;  1IXD A;  1QWE A;  1NEB A;  2MOX A;  3JCM X;  5KE2 A;  3VUB A;  3TSW A;  3HL8 A;  1NYF A;  4X1V A;  1M90 U;  1ABQ A;  2RJC A;  2JVV A;  4Y91 A;  3OYB A;  4HCB A;  2YRD A;  3OYC A;  2RK1 A;  1IHV A;  4C0F A;  2X4J A;  2RI2 A;  4J6W A;  4A63 B;  2E41 A;  2QAZ A;  1M3B A;  5LJ3 g;  2VGN A;  1JXO A;  3DLM A;  3QZ5 B;  2FZK B;  1OUL A;  2QK0 A;  4L6V 5;  3G71 Q;  1GCQ A;  1T3L A;  1Q86 U;  4M75 F;  3CC4 A;  1VQ9 A;  4BUG A;  4JJB A;  5GAN g;  2GTO A;  4EIK A;  5FRO A;  2X4W A;  2M51 A;  3M57 A;  4F7U G;  3L42 A;  2QG9 B; 
#chains in the Genus database with same CATH homology
 5GJW B;  1B3Q A;  1T3S A;  3RBB B;  5I22 A;  1AZE A;  2ENM A;  1NM7 A;  1UEC A;  1SHF A;  1WXB A;  3QWX X;  2KR3 A;  2OAW A;  2G6F X;  4JZ3 A;  5IHI A;  2K6D A;  1BU1 A;  5EC7 A;  4D8K A;  4M4Z A;  1H3H A;  3SEM A;  4IIM A;  1X6G A;  1X27 A;  1UG1 A;  3I9Q A;  1NLP C;  4AG1 C;  2VVK A;  2M0Y A;  3M0S A;  4LUE A;  1UDL A;  1QWF A;  4OML A;  2KT8 A;  1GFC A;  2PZ1 A;  1HJD A;  2CT4 A;  2DL5 A;  2EGE A;  2CH4 A;  5ECA A;  4HVU A;  1XOV A;  5IHK A;  1T0H A;  4AFZ C;  1VYV A;  2MCN A;  4J9I A;  1SEM A;  3VS5 A;  4R0K A;  4J9D A;  4Z88 A;  2DRK A;  2CDT A;  2PTK A;  3VS4 A;  1Z9Z A;  4Z89 A;  2FPE A;  3TVT A;  1KIK A;  2JMC A;  3NHN A;  2OI3 A;  2KNB B;  2D8H A;  4K11 A;  3REB B;  1AEY A;  1NLO C;  1WXT A;  2RMO A;  1ZX6 A;  2EYZ A;  1ZUK A;  2RQU A;  4WCI A;  2JXB A;  2A36 A;  1WI7 A;  2BZY A;  1E6H A;  1RLP C;  1UFF A;  1EFN A;  1T0J A;  4CC2 A;  2HBW A;  3A98 A;  3PE0 A;  2RQV A;  1QLY A;  1WDX A;  2NUZ A;  1TG0 A;  2K9G A;  1BK2 A;  1Z9Q A;  3M0U A;  1BBZ A;  2J7I A;  1WYX A;  1YWP A;  1AD5 A;  2CUB A;  1ZLM A;  1JO8 A;  1K1Z A;  1PRM C;  3THK A;  1UHF A;  1S1N A;  5FWC A;  2A37 A;  4JZ4 A;  1X6B A;  2AKK A;  2LZ6 B;  2QDL A;  2F2X A;  1WLP B;  2AZV A;  2FPF A;  2GQI A;  4LE9 A;  2DLP A;  4RTV A;  2DX1 A;  2DBK A;  1Y0M A;  2FRW A;  1PKT A;  1M8M A;  2KEA A;  2LQN A;  1OPK A;  2KRS A;  2LJ3 A;  4OMO A;  3JV3 A;  2YUN A;  4DEY A;  1CKA A;  2RQT A;  3C0C A;  1GFD A;  2CRE A;  3LH5 A;  2EPD A;  3I5R A;  2BTT A;  2P4R A;  3TSZ A;  1SHG A;  3SHW A;  1VYU A;  4F17 A;  2RF0 A;  4IIO A;  4JPB W;  2J05 A;  5GJV B;  1WFW A;  2BZX A;  1KJW A;  1TUC A;  2PNI A;  3UAT A;  1TUD A;  1AWJ A;  2LJ0 A;  3EG3 A;  4AG2 C;  3NPF A;  2DJQ A;  2NWM A;  1K76 A;  4RUG A;  1YP5 A;  2A28 A;  2AKL A;  2K2M A;  3EG0 A;  1V1C A;  4J9C A;  3VRY A;  1IO6 A;  1RLQ C;  2KRN A;  2EW3 A;  1RUW A;  2X3X D;  3ZL7 C;  1CKB A;  2YDL A;  3IQL A;  1ZUY A;  2F2W A;  1YWO A;  3EHQ A;  4J9B A;  1LCK A;  5IH2 A;  3EG1 A;  1Y57 A;  1WX6 A;  4Z8A A;  2SRC A;  2EYX A;  2EYY A;  1SRM A;  1MV0 B;  3I5S A;  5L23 A;  2DF6 A;  2GBQ A;  2DL7 A;  4RTX A;  1FMK A;  2JS2 A;  2HCK A;  1B07 A;  4LNP A;  1PHT A;  2V1R A;  2RQW A;  4GLM A;  3NMZ C;  2KBT A;  1PWT A;  2CSI A;  1X69 A;  4J9F A;  1M27 C;  4AFS C;  2KYB A;  1U3O A;  1HSQ A;  2DRM A;  2EYW A;  3UA6 A;  1UGV A;  2EVR A;  3H41 A;  1GL5 A;  2D1X A;  1WXU A;  2RN8 A;  2VWF A;  2L2P A;  2CT3 A;  3VS0 A;  3CQT A;  5I11 A;  1M30 A;  5IHN A;  4J9H A;  2LX7 A;  2OJ2 A;  4J9G A;  1RI9 A;  1X43 A;  4HCK A;  4RTY A;  1GBQ A;  2YUP A;  1X2Q A;  2DA9 A;  3ULR B;  3VRZ A;  3UF4 A;  2KT1 A;  1K0X A;  2KXD A;  2D0N A;  1KSW A;  2JMA A;  5IXB A;  2I0N A;  2MIO A;  2O2O A;  3VS2 A;  2DL3 A;  2X3W D;  2F2V A;  2JM8 A;  4HVV A;  4D8D A;  1QKX A;  1N5Z A;  1K4U S;  1QCF A;  3REA B;  1M3C A;  1ABO A;  2ED0 A;  4LUD A;  2HEQ A;  4CC7 A;  4CC4 B;  2EGA A;  3QWY A;  1PRL C;  1GCP A;  1YCS B;  3O5Z A;  1OEB A;  2J6K A;  4FSS A;  3RNJ A;  1VA7 A;  1U5S A;  2W10 A;  4RTZ A;  2L0A A;  4OMP A;  1AZG B;  1JXM A;  2KXC A;  2V1Q A;  1SPK A;  1W6X A;  2LCS A;  2LP5 A;  1UJY A;  2O9S A;  4HXJ A;  1GBR A;  1I0C A;  2KGT A;  1U06 A;  5HCK A;  2L3P A;  1W70 A;  2B86 A;  2AK5 A;  3U23 A;  1W1F A;  2XMF A;  1AWW A;  4DEX A;  4E6R A;  1GCQ C;  4J9E A;  4CC3 A;  1UE9 A;  2DMO A;  1SSH A;  2K3B A;  1UTI A;  2W0Z A;  2DBM A;  2FO0 A;  2YSQ A;  2LNH B;  2ROT A;  2L3Q A;  1SRL A;  2E5K A;  1NYG A;  3KFV A;  2ESW A;  4ZNX A;  4ORZ A;  4OMQ A;  2ABL A;  2ECZ A;  2YUQ A;  1HD3 A;  2HSP A;  2DE0 X;  3M0R A;  1PKS A;  2O31 A;  3M0Q A;  4F16 A;  2LQW A;  2RQR A;  1J3T A;  1YN8 A;  1ZBJ A;  2EQI A;  2JT4 A;  2L3S A;  3H0I A;  2YUO A;  2KRM A;  2C0O A;  5IXF A;  1X2K A;  1UUE A;  4RTW A;  3EG2 A;  2FG0 A;  3VS1 A;  2O88 A;  1WA7 A;  2J06 A;  4RTU A;  2D8J A;  2KRO A;  3VS6 A;  1CSK A;  2GTJ A;  1YNZ A;  2DL8 A;  1I07 A;  1I1J A;  2CSQ A;  2O9V A;  1MV3 A;  2AZS A;  2J6O A;  1UHC A;  1KFZ A;  1K0S A;  3NGP A;  1M3A A;  3VS3 A;  2SEM A;  1E6G A;  1E7O A;  3UA7 A;  2A08 A;  2FPD A;  1OPL A;  3H0F A;  2ED1 A;  4OMM A;  3GBQ A;  3VS7 A;  1AVZ C;  2GNC A;  3M0T A;  2IIM A;  3FJ5 A;  1FYN A;  4Y92 A;  1ZSG A;  2JW4 A;  2DNU A;  4AFQ C;  1ARK A;  1A0N B;  1ZUU A;  1NEG A;  1K9A A;  1NG2 A;  2HDA A;  3PVQ A;  2DL4 A;  4GBQ A;  2JTE A;  1AOJ A;  1GRI A;  2ROL A;  4AFU C;  1H8K A;  1G2B A;  3EGU A;  2JM9 A;  2GGR A;  2KYM A;  4KRT A;  3I35 A;  2EBP A;  2BZ8 A;  2C0I A;  2CH4 W;  4OMN A;  1MUZ A;  4QT7 A;  1AWX A;  2DVJ A;  2DM1 A;  2CUD A;  2FEI A;  1OOT A;  2K7A A;  2LMJ A;  2RPN A;  1JQQ A;  2EKH A;  1H92 A;  2K79 A;  4HVW A;  2J6F A;  1QWE A;  1NEB A;  2DYB A;  2MOX A;  3TSW A;  1NYF A;  4X1V A;  3PVL A;  1G83 A;  1ABQ A;  1WIE A;  1VYT A;  1JEG A;  1PNJ A;  3R6N A;  3M0P A;  1UJ0 A;  2YT6 A;  4A63 B;  2JS0 A;  4RTT A;  5FW9 A;  1M3B A;  4LN2 A;  1AWO A;  1JXO A;  2VKN A;  5FWB A;  1GCQ A;  1QKW A;  1T3L A;  4JJD A;  4ESR A;  4F14 A;  2KE9 A;  1OV3 A;  2C0T A;  3H0H A;  4JJB A;  2RNA A;  3EHR A;  4JJC A;  2LJ1 A;  2FRY A;  1BB9 A;  2GTO A;  4EIK A;  2M51 A;  2H8H A;  1JU5 C;  2EGC A;  2DIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...