1E6HA

A-spectrin sh3 domain a11v, m25i, v44i, v58l mutants
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
DETGKELVLVLYDYQEKSPREVTIKKGDILTLLNSTNKDWWKIEVNDRQGFVPAAYLKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN
publication title Conformational Strain in the Hydrophobic Core and its Implications for Protein Folding and Design
pubmed doi rcsb
source organism Gallus gallus
molecule tags Sh3-domain
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1e6hA00
1K0XA 1RI9A 1ZUUA 3NHNA 3PE0A 5FWBA 2K9GA 2A08A 3M0TA 2O9VA 4ZNXA 2CUDA 2KXDA 1UDLA 2L0AA 4FSSA 5IXBA 1TG0A 2DLPA 4DEXA 2YDLA 1I1JA 2RN8A 2HCKA 2C0IA 1X2KA 3C0CA 1T0HA 4RTXA 3VS2A 1UJYA 1ZUKA 1JU5C 3H0IA 3FJ5A 1WIEA 1Z9QA 4F17A 3EG2A 2L3QA 2GTOA 1QKWA 2DBKA 2V1RA 4OMNA 1BBZA 3UF4A 4LN2A 3UA6A 1GL5A 2KBTA 4CC3A 4RTUA 4GBQA 2A36A 2D0NA 1U3OA 1MV0B 1UGVA 1ZBJA 2NUZA 2K79A 5ECAA 1Y0MA 2EYZA 1WXBA 1MV3A 2J05A 2LNHB 4AG1C 1AWOA 4HXJA 1QWFA 2P4RA 1AZGB 3VS5A 1G83A 2ED0A 2AKLA 2OAWA 2D8JA 1Z9ZA 1K1ZA 2HEQA 2EGAA 1I07A 2VWFA 1EFNA 2RPNA 1AWXA 1NLPC 1W1FA 1T0JA 2CDTA 3IQLA 1BU1A 1UHCA 1LCKA 1GRIA 1JXOA 3NPFA 1UTIA 2X3XD 2B86A 1ZSGA 2PTKA 1AZEA 2BTTA 1SEMA 1SRMA 2A28A 1E6GA 2D1XA 2MIOA 2V1QA 4J9HA 1B3QA 2HDAA 1GFCA 4HVVA 1N5ZA 2FG0A 2KEAA 4CC2A 1AWWA 2JXBA 4J9DA 2K2MA 4ESRA 1WDXA 1WFWA 2FRYA 3I5RA 2F2XA 4JZ3A 2W10A 4DEYA 2DBMA 3ULRB 3SHWA 4LUEA 3R6NA 3UA7A 2KNBB 3EG1A 1OOTA 2KE9A 1KJWA 2DRKA 1K4US 2KGTA 2CT3A 2YUQA 1ZLMA 5IH2A 2LQWA 3THKA 2YUOA 1UFFA 2LJ0A 4QT7A 1GCPA 3EGUA 1E6HA 2EBPA 5GJVB 1HD3A 1TUCA 2VVKA 1UHFA 3REBB 1E7OA 4CC4B 3U23A 4OMQA 2EVRA 2FPEA 1CSKA 1GCQA 2QDLA 2GQIA 2CT4A 4WCIA 2J7IA 2YUPA 5GJWB 3ZL7C 1S1NA 2YT6A 2JM8A 2CH4W 2K6DA 3VS6A 2ENMA 2DL5A 2JS0A 2L3SA 2RQVA 2DX1A 2KRNA 1JXMA 2F2WA 2X3WD 2CH4A 3KFVA 1H3HA 1OPLA 1NEBA 1ZX6A 1RLQC 4IIOA 2GBQA 4RTTA 5HCKA 4JJCA 2DA9A 2F2VA 1H92A 2DL4A 1V1CA 3VS1A 4LE9A 1OPKA 3H0FA 2ABLA 1AEYA 4J9GA 1GBQA 2RQTA 1NG2A 2BZYA 2J6OA 1PRMC 2EYWA 2I0NA 4HVWA 4JJDA 2KYMA 1W70A 2XMFA 2OI3A 3I5SA 2BZXA 2LCSA 1QKXA 5I22A 1AOJA 2O9SA 2M0YA 1W6XA 1KIKA 2LJ3A 1K76A 1YNZA 1XOVA 2EYYA 5IHKA 3VS3A 1SPKA 2GNCA 4IIMA 1M3CA 3REAB 3VRYA 3EHQA 4RTWA 2JTEA 1SSHA 1X6BA 2M51A 3H41A 1B07A 4RTZA 3I35A 2LX7A 4OMLA 1WI7A 1X43A 1WLPB 2PZ1A 2KRMA 4JZ4A 1M3BA 1QWEA 2JM9A 4KRTA 2A37A 2FRWA 3QWYA 4LUDA 2JMAA 2JT4A 2KR3A 5EC7A 3JV3A 2LMJA 3LH5A 2ED1A 2J6KA 4J9BA 2RQUA 1SHFA 2DRMA 3EG0A 3NMZC 4AFSC 2K3BA 4A63B 4GLMA 1ABQA 2DMOA 2AKKA 2RMOA 3TSZA 4D8DA 4K11A 3GBQA 1BK2A 4HCKA 1RLPC 1GBRA 2O2OA 1TUDA 2DNUA 1UUEA 1X2QA 2BZ8A 1WXTA 2DE0X 3RBBB 2DVJA 2RQRA 1KFZA 1YN8A 2D8HA 2ROTA 1UE9A 4AG2C 2DJQA 4AFZC 2EW3A 1I0CA 1NEGA 4RTYA 4AFUC 1AVZC 2VKNA 1SHGA 1FMKA 2H8HA 2RNAA 2DYBA 4J9FA 1T3SA 2OJ2A 2DM1A 2FPFA 2DL3A 4D8KA 2KXCA 1QLYA 3PVLA 3A98A 2CUBA 3O5ZA 2EYXA 1X6GA 4Z89A 2EQIA 4M4ZA 2LP5A 1NM7A 1OV3A 4JPBW 1IO6A 2HSPA 1U06A 2JMCA 1AD5A 1MUZA 2C0OA 4HVUA 3CQTA 2O31A 2J06A 4OMOA 2DF6A 3VS0A 2G6FX 1NLOC 2GTJA 2AZSA 4J9EA 1VA7A 2FO0A 1GFDA 2K7AA 2AZVA 3SEMA 4E6RA 2YUNA 5IXFA 1JO8A 2EGEA 2C0TA 4R0KA 2KT8A 5FWCA 5IHIA 2JS2A 2LJ1A 1PHTA 3NGPA 2MOXA 3RNJA 2EGCA 3VS7A 2RQWA 1H8KA 1OEBA 2O88A 1YWOA 1UECA 1RUWA 1M8MA 4RUGA 3TSWA 1ARKA 2KROA 1WA7A 2YSQA 1A0NB 1AWJA 1J3TA 1HSQA 3VS4A 2E5KA 1YP5A 2KT1A 2J6FA 1WYXA 2JW4A 2EPDA 1PRLC 2DILA 1NYFA 4CC7A 2ROLA 1VYUA 3TVTA 2NWMA 2RF0A 3VRZA 4EIKA 2L3PA 2SRCA 1WX6A 1ABOA 1K9AA 5IHNA 1PNJA 4RTVA 2CREA 4Z88A 1X69A 1Y57A 1FYNA 1HJDA 1CKBA 3PVQA 1QCFA 1JQQA 4AFQC 3EHRA 2ECZA 3M0PA 3H0HA 1K0SA 1PWTA 2L2PA 1M27C 1UG1A 1YCSB 2DL8A 3M0RA 4X1VA 1GCQC 2KYBA 4JJBA 4J9CA 1YWPA 1T3LA 2DL7A 1UJ0A 2EKHA 2PNIA 4Y92A 1ZUYA 1BB9A 2CSIA 3M0UA 2MCNA 4F14A 4OMMA 3M0SA 2SEMA 1G2BA 2ESWA 4LNPA 1VYTA 5FW9A 3M0QA 3UATA 2LQNA 4Z8AA 4F16A 5L23A 1PKSA 2HBWA 1CKAA 1M3AA 5I11A 2FEIA 2AK5A 2FPDA 1NYGA 3I9QA 2IIMA 4OMPA 1U5SA 1VYVA 1M30A 1WXUA 1KSWA 2GGRA 4ORZA 2W0ZA 2CSQA 2KRSA 1X27A 3EG3A 4J9IA 1SRLA 1JEGA 1PKTA 3QWXX 2LZ6B
chains in the Genus database with same CATH superfamily
1JBMA 1D3BB 3C4SA 3CCSQ 3G71Q 2L89A 1RAGB 3WXMB 2CUDA 2X35A 5CVIA 3OQ5A 1TG0A 2YLBA 3E9GA 3FLGA 2HL3A 2RHIA 2E12A 2C0IA 4HA8A 3CD6A 2WSCE 4KBMB 3SWNA 3FDRA 3FJ5A 1WIEA 4F17A 4RG8A 5KYNA 1M2VA 3CD6Q 4LD9K 4Y28E 1GL5A 2ZAEA 2RI2A 3QYGB 1X01A 1FX7A 3PMTA 1Y0MA 5CK9A 2E3IA 2QQRA 5GAMj 5KYXB 3MKDA 3TCJA 3L2QA 5LJ3h 3G4SQ 2OAWA 5GMKj 1K1ZA 3HTRA 2HEQA 1Q82R 4E2FB 4FW2A 2ZPGB 1EFNA 3CPWS 2JZ2A 2PUKB 3OS5A 1AWXA 3QZ5B 3QPHA 3CPFA 4ZN3A 1Q86C 3OS0A 1YBYA 3E9FA 4L59A 4JRPA 1UHCA 5IAYA 4P5NA 3PIOA 4QVCA 1NZ9A 2RJDA 1FMVA 4QVDA 1MNEA 3I56A 2PTKA 4PLIA 3OYFA 4PK4A 3DLMA 2BTTA 2COZA 1WHGA 3NTKA 2V1QA 2RJCA 2HDAA 1GFCA 1WHKA 4B9WA 2E10A 2FG0A 1I5OB 4J9DA 4EMKA 2DAQA 1IHVA 1IGUA 1YJNQ 2FRYA 2HBPA 1KD1U 2F2XA 2W10A 5CKFA 3RKYA 3CCRT 1D0ZA 1K73C 2KNBB 4JDSA 2O4XB 2FL7A 3ER0A 3JCMP 1RAEB 1YFNA 5GAN3 1KJWA 3H8ZA 2DRKA 5GANd 2QA4T 1N9RA 1TSFA 4QQ6A 4KUDK 2K4YA 3THKA 3X26B 2QEXT 4QT7A 3X28B 4AT1B 2EBPA 2ZGWA 1UHFA 3REBB 2RK2A 5KYXA 1C0MA 1Q81U 2CT4A 3ZL7C 1S1NA 2ZPBB 2DZCA 3AHUA 2ENMA 2DL5A 4M77F 2RQVA 3OYAA 2X3WD 2CH4A 4X9DA 4QQGA 3QYHB 1WPYA 1OPLA 2DXUA 1KC8U 3A8HB 5C0MA 1ZX6A 5LJ5g 1RLQC 5KYUB 1YHQA 4MMKA 2GBQA 4DBQA 5C6SA 5HCKA 1LOJA 2DA9A 1H92A 1N6AA 1V1CA 4N4IA 1YCYA 3VS1A 3S3OA 1KQ2A 4J9GA 1YHQQ 4KGVB 2NUTB 1PD1A 4R55A 1NG2A 2I0NA 4O5VA 1EX4A 2KYMA 1W70A 2XMFA 3I5SA 2BZXA 3CXCA 5GMKm 2Y4XA 1QKXA 3OYIA 5I2MA 2M0YA 3RKWA 2LJ3A 1K76A 1D09B 2CKKA 3VS3A 2KQWA 1SPKA 2BUDA 1JJ2A 1VUBA 3JCMc 2O4XA 2CP0A 3EHQA 3TEEA 3SDZA 1F1BB 3JB9I 4FU6A 1SSHA 4II1A 1UB4A 1MMGA 1VQ4A 3QJ6A 2Z0WA 1NPPA 3LWIA 1X43A 4JJNK 1D0YA 1VQ4Q 2KRMA 1QWEA 1YI2A 3MHXA 2ZPHB 1N9SA 1KQSA 3MEWA 3CC7T 2MF2A 2RQUA 4LDXA 1YI2Q 5LJ3g 3G6ET 2E65A 2RJFA 3X20B 1ABQA 3MJXA 3CMAA 3LYIA 2QXFA 1IB8A 2AKKA 3TSZA 4D8DA 2DJZA 5KYUA 5GAMe 1JB0E 1BKBA 2VB6A 1VQ8T 2DVJA 1YN8A 2D8HA 1UE9A 4JRIA 1U1SA 4IUUA 2NUTA 4A53A 1NEGA 3C94A 2VKNA 1SHGA 8ATCB 1FMKA 3JCMd 3PGGA 2H8HA 1MMAA 3A1PA 2RA2A 1T3SA 2AHJB 2DETA 2FPFA 4D8KA 2BE9B 2KXCA 1QLYA 5FRNA 2CUBA 4MDWA 1X6GA 1W2BA 1Y71A 3EFOA 4J6XA 4JPBW 4M7AB 3OYEA 4M78E 1U06A 3RKXA 2C0OA 2OTLT 2J06A 3QG1A 3JB9H 4FYWB 2R5MA 3VS0A 3VU3C 3PTAA 4MDXA 2AZSA 4M78C 5GAN4 3JCMJ 5GMKl 2AZVA 4E6RA 1LJOA 3OYJA 2C0TA 4M7AG 4R0KA 2B8AA 4PL6A 3JSCA 2YRCA 2X51A 3CCST 3NGPA 3G71T 2MOXA 5GAOr 3CCVT 2K5IA 2RJEA 3TSWA 1ARKA 2KROA 1WA7A 2RH2A 3V8KA 3E2UA 1AWJA 4B9XA 3H9NA 1PD0A 5CQXA 3S3MA 2KT1A 2F69A 2RHXA 2J6FA 1WYXA 5A0GA 3ZBDA 4RCCA 1RACB 4CC7A 2HNIA 3CD6T 4J6WA 2FZGB 2RF0A 1G5VA 2L3PA 3CCJA 3KBGA 4C8QD 2K5FA 4C92E 1PNJA 5CKBA 1SSFA 1I4K1 1EIFA 4DBRA 2LC4A 4C92C 3G4ST 3OW2S 1FYNA 3SB2A 3VYGA 5GMKi 2E64A 1HJDA 2XG8D 1CKBA 2DERA 1QCFA 2H3JA 3PFSA 5FRMA 1VQ6A 1I81A 1PWTA 4M7AA 2L2PA 1UG1A 3MCAB 1Q7YC 3LH0A 5KYWA 1Y7XA 1GCQC 4JUVA 3CC4A 3DB3A 2PNIA 5I21A 1BB9A 3CPWA 2EQMA 3M0SA 5IT9E 3I55Q 3DB4A 3M0QA 5L23A 2DD5A 5I11A 2ATCB 2FEIA 4M75D 2LNVA 3EFRA 2CP7A 3S3NA 1BCMA 2YRVA 1U5SA 1VYVA 2PUOB 3UDCA 3LLRA 2GGRA 2DTIA 1YJNT 1VQLA 3EG3A 1B34B 4J9IA 4QKUA 3OYCA 2LZ6B 2HQEA 1RI9A 1K0XA 1RAHB 2L3RA 4A4HA 1VQLQ 2CYZB 5CKDA 2KK4A 2QQAA 2XI9A 2BKDN 2O9VA 4ZNXA 4C8QF 2L0AA 1YJWQ 5IXBA 1KQ1A 2R5AA 2YDLA 1I5LA 1I1JA 2HCKA 3VS2A 3OYLA 5CAIA 1S72A 3F70A 4IUTA 4NOYA 2L3QA 2GTOA 1QKWA 2QTVA 2DBKA 2V1RA 4E7LA 1BBZA 1KHIA 1S72Q 1UEBA 2KBTA 2FYKA 2A36A 2VYTA 2D0NA 1QW1A 4C92B 1UGVA 3WVDB 5ECAA 2K79A 1BI2A 3QJYA 4C0GA 3C95A 2JUFA 4C0DC 3M5AA 4A4EA 1IXDA 5LL6S 5M9OA 4PJJA 3UWNA 1VQMA 1QWFA 3A5ZB 1G83A 1Q7YR 2KVQG 1Z9ZA 2MYSA 3L2UA 1VQMQ 4X9CA 5L8RE 4YTLA 4C92G 2COWA 4M78A 1YHQT 2DKGA 1D1BA 1NLPC 1W1FA 2O01E 2X9HA 3GIBA 3EGDB 3NTHA 1UTIA 2P0KA 5LJ3j 5GANf 1KHCA 2VUBA 1ZSGA 2IVWA 4NL3A 1B34A 2A28A 1E6GA 1K8AC 4GY5A 1OU8A 4J9HA 2MPXC 3FC3A 5GAOn 1QVFP 2LDMA 4VUBA 1AWWA 4X34A 3CCEQ 2JXBA 1B7TA 2VGMA 3JCMX 3OYBA 3I5RA 3OYMA 4XU3A 2PVOB 4DEYA 4MZMA 2HZYA 3V7CA 1UGQB 2JOYA 3ULRB 2JNGA 3R6NA 3META 3CCUA 3CCLQ 5GAN8 1K4US 2KGTA 2CT3A 1YJ9A 2YUQA 1VQNA 2LQWA 2QYZA 1WGSA 1VOMA 3CCUQ 4BDZA 1YI2T 4C92A 1E6HA 5GJVB 4FW1A 1NJIC 2V8KA 3J7AF 1VQNQ 1OULA 4CC4B 3DKMA 1CSKA 1GCQA 1WZOA 2E70A 2J7IA 3QSUA 4XTVA 5GJWB 1OX8A 4BI8B 1BI1A 2JM8A 4PJOD 3VS6A 1VQKA 1JXMA 1AHJB 3VV0A 5GANh 1H3HA 2KY9A 1U1TA 4KT0E 5J26A 1VQKQ 3GOXA 3EGDA 4RTTA 2V26A 4JJCA 3LW5E 2V8JA 3OYGA 1G3TA 2DL4A 2DPPB 2E5QA 2JVVA 5DY9A 2BZYA 2J6OA 3JB9G 1PRMC 2EYWA 1BI3A 4RG2A 2HD0A 2BIVA 2OI3A 3PMIA 1WJRA 2CS7A 4M7DD 1AOJA 2LCLA 4XTWA 1OZ2A 3BY7A 3URGA 3M4YA 2VV5A 1W6XA 2EYYA 1VQOA 1TU0B 5HY6A 3L42A 3HFNA 4XU2A 1ZHIA 2GNCA 4IIMA 5GAN5 3BFMA 5LJ5e 4M77D 1FMWA 3P8BB 3EG9B 1O75A 3BDUA 1EZZB 3UPUA 1IZ6A 2RHYA 4JS4A 3OA6A 3CXCP 5J39A 3I56Q 2JM9A 1NJIR 4PJOF 5HKCA 4LUDA 1D3BA 5EC7A 3JCMf 2ED1A 3QKJA 1QMCA 2E4HA 3VKIA 4AFSC 3H6ZA 3PNWC 3JRZA 3MP8A 5GAOp 4GLMA 1PSFA 1WHLA 4UC4A 2O2OA 2YHTA 4RCBA 1X2QA 1LPLA 2BZ8A 2DE0X 2L8DA 2RQRA 1KFZA 4AG2C 2DJQA 2DFUA 4LD6A 4AFZC 2EW3A 4M7DF 1P92A 4F7UE 1AVZC 4A4GA 1G3WA 1DJ7B 3VUZA 2HMAA 4IKFA 2RNAA 3JAME 3OW2A 1KQSP 2V8IA 3EFSA 3E1SA 1QVGP 2DM1A 4BE0A 1ZSZB 2DL3A 3JCMb 4ZN1A 5LJ3e 3MEUA 1PSEA 2DTHA 4E7IA 3I55T 5J3BA 1WNLA 2OTJA 3AT1B 4M4ZA 1OV3A 4OB0B 2HSPA 1AD5A 1M9SA 1MUZA 4C8QB 3CQTA 2O31A 2HL5C 4LDYA 3EG9A 1Q86R 2QGGA 1N8RC 2QQSA 2G6FX 4FYYB 2RI5A 3OYDA 3KUFA 1VA7A 4BY6B 2DO3A 3JCMh 1GFDA 2K7AA 3SEMA 2EGEA 1M90C 1U8RA 5IHIA 4C8QG 2LJ1A 2JTMA 1VQLT 1ZQ1A 3S6WA 4M7AE 3FEOA 3LGLA 3HRTA 1M1FA 1W2BP 2EIFA 1YJWT 4OGCA 3OY9A 2LT1A 4RUGA 1M1KC 4M7AC 2YSQA 1A0NB 1HSQA 1K9MC 3D7SB 3VS4A 1KK7A 1ZA2B 1YP5A 1K73R 2JJ9A 4M75B 4O6JA 3C12A 2EPDA 4J7FA 1PRLC 4DOWA 2DILA 2LT4A 1S72T 2CP3A 2DXCA 1Q82U 4EIKA 8AT1B 3L2ZA 3HHTB 2LQ8A 1WX6A 5D6XA 2KI7A 1ABOA 1K9AA 5IHNA 4BD3A 3J81E 2A3LA 2CREA 4AMCA 4M75G 4Z88A 4F7UB 1ZSZA 2XIDA 4L6V5 1VQMT 4NL2A 3PVQA 1PCXA 4LDUA 4PKCC 3CMEA 1TOVA 1M27C 1XNIA 1NJIU 4HCBA 2RD1A 2DL7A 2HQXA 3CMAQ 3CMEQ 3M0UA 1QCOA 4F7UG 3PT9A 4FSXA 6AT1B 4LNPA 1VYTA 4KH1B 4XK8E 1TS9A 5GMKe 3UATA 2LQNA 4C5IA 1N8RR 1SKUB 4PJMA 4F16A 1PKSA 2VXEA 2HBWA 1M3AA 3RMQA 4EMGA 2DXTA 5GAMd 2FPDA 7AT1B 1M90R 3CCET 4MZPA 1M30A 1TH7A 1WXUA 4PNOA 2LCCA 2R58A 2CP5A 1X27A 2EJGA 1H641 3QWXX 1M1KR 1ZUUA 3NHNA 3CCLT 5FWBA 4M75A 2K9GA 1UGRB 1PM3A 1UDLA 1XTDA 2DEUA 2ZPFB 4DEXA 2DTOA 1YITA 5KCHA 1QVFS 1R77A 3GLXA 4DBHA 5KE3A 1UJYA 4E7ZA 1ZUKA 1JU5C 3R6OA 1YITQ 3EG2A 4KH0B 1NBEB 1OYXA 4F7UA 4QQDA 3CBPA 1Q86U 3UF4A 4RTUA 3X25B 1U3OA 4M77E 1WXBA 5D6YA 3P8HA 1MV3A 2XK0A 4AG1C 2GCXA 3UT1A 2XKOC 4HXJA 5DLQE 3OYNA 1BI0A 2P4TA 3MPUB 4TVRA 1VQKT 3VS5A 2ED0A 2AKLA 1IHWA 2DEQA 2OX7A 2D8JA 3OS1A 2FVUA 2VWFA 4B6MA 2QI2A 2RPNA 1VQPA 2COYA 3JCMg 4E7SA 3M58A 1D0XA 3JCMW 1G8XA 4HKEA 2CDTA 3IQLA 2KMTA 1BU1A 5CO7A 3CCRA 1LCKA 1GRIA 4PFZA 3CCJQ 1VQPQ 1K73U 3BW1A 5FU7C 4ATOA 1FXXA 3QDRB 1M5Q1 2LTOA 2DK3A 2HKNA 1SEMA 2D1XA 2MIOA 4NS5A 1B3QA 3CC2A 3GP8A 4WF2A 4HVVA 1N5ZA 1VQ6Q 4CC2A 3OYKA 4FYVB 4C0ZA 1VIEA 3O8VA 3RERA 2G3RA 3CC2Q 4ESRA 3CC4Q 1WDXA 2EQJA 4JZ3A 3SHWA 4LUEA 3UA7A 4L5GA 3TREA 1QQJA 3QIIA 3EG1A 1OOTA 2KE9A 2YWWA 3I56T 3HFOA 2MAMA 2P0QA 5CR2A 3J80E 4M7DB 2YUOA 1JRIA 1GCPA 4J7IA 2YRDA 1HD3A 3RESA 1TUCA 1UGSB 3OYYA 1WHHA 5FLXE 1RAIB 2X4XA 3RUXA 2QK0A 1YIJA 3U23A 3FJPA 4JRQA 2RB6A 2FPEA 2QDLA 3ME9A 3FRNA 1KD1C 2GQIA 4WCIA 2YUPA 4M77B 1M2OA 3ASKA 2XD0A 1YIJQ 4M7DG 1SG5A 2K6DA 3CXCS 2EJFA 2JS0A 3MO8A 2KRNA 2F2WA 2PVDB 4Y91A 3CEYA 4OP0A 1NE8A 1PC0A 2Y4YA 1NEBA 1R8OB 3OSVA 3LGFA 4A4KA 4M77G 2E41A 5FU7B 4LE9A 1OPKA 4OB1B 3JCMV 1AEYA 1Q81C 5CCAA 4HVWA 4JJDA 5GANj 3LX7A 4N0AC 5DM7R 4FM4B 2F5TX 2M02A 3QHSA 2QAZA 1KIKA 1VQ7A 5IHKA 1YNZA 1XOVA 1KC8C 4FT2A 4ZGDB 3FB9A 2LX9A 4C0FA 1M3CA 4CRIA 1QVGS 3REAB 3VRYA 1X6OA 3G6EA 2EYQA 1VQ7Q 2JTEA 1RAFB 4KGXB 3H41A 1B07A 4RTZA 4M7DA 4EMHA 2PVGB 2NUPB 2LX7A 4OMFB 1WI7A 1WLPB 1VQ8A 4OB3B 3EGXB 4XTUA 3VUBA 2CZ1B 4KRTA 2A37A 2FRWA 5CKEA 1Y07A 3HP9A 2LMJA 4M77A 3PIPA 2J6KA 2OAUA 1SHFA 1V76A 1M2VB 4IUPA 3NMZC 1KD1R 3OMCA 1WHMA 2RK1A 4A63B 2D6FA 3M9QA 2AIRB 2DMOA 2XDBA 2DZ9A 1VQ4T 4K11A 1H3ZA 3GBQA 1BK2A 1RLPC 1W2BS 1TUDA 5GAN2 3G1JA 1X75C 1OI1A 2KDSA 2ROTA 2GQVA 4RTYA 1YJ9Q 4FYXB 3V7RA 2EQKA 1BIBA 2YLCA 4J9FA 4ZGJB 2OJ2A 3CMAT 3CMET 5HK0A 2LQKA 4BDYA 2R57A 3PVLA 3O5ZA 2JTFA 2EYXA 4CI0C 3G71A 4Z89A 2EQIA 1IREB 2LP5A 3CCVA 2WSFE 5KCOA 4HVUA 3A8MB 4M7AF 3VJPA 2D9TA 4OMOA 4BE2A 2DF6A 2WACA 3CCVQ 2K2VA 2XHCA 5D6WA 2EFIA 4EMKB 2NUPA 4J9EA 2FO0A 2QTXA 3EGXA 3OW2P 4DQ2A 1JO8A 2IPOB 3OS2A 1K8AR 4OB2B 4J83A 2GFUA 4PFPA 3V8LA 1PHTA 3L1AA 5D7UA 1ZSZC 2CP6A 3RNJA 3VS7A 1VQ5A 3OSSC 2RQWA 4C8QE 4M78D 4XQ3A 2O88A 2I2LA 2C06A 1QP3A 1UECA 1VQ5Q 3G4SA 2KSSA 4C8QC 1J3TA 1MGQA 1VQOQ 2DD4A 2E5KA 3CBOA 4MZTA 1YITT 5HK3A 2CZ7B 2JW4A 2YXYA 1QVFA 1Q7YU 4BY6C 5KYYB 2ROLA 2CZ0B 3TVTA 2NWMA 2XDDA 3BE3A 4DA4A 2M1HA 4E7JA 3QUIA 5CIUA 3BDLA 4ZTFA 1ZA1B 3OMGA 5LJ5d 4N0AA 3EH2A 2PU9B 4BACA 4ZGEB 4N4HA 1X69A 2AT1B 4PJNA 5GAMf 3M54A 4RKUE 4V2SA 1Y57A 1JJ2P 4M75E 4ANJA 1JQQA 4AFQC 2ECZA 1K0SA 1IRXA 1BYMA 3CCMA 2M0OA 4M75C 4X1VA 5GANe 4J9CA 1YJNA 1YWPA 1T3LA 2EKOA 2EWNA 3HRUA 3G7ZA 3L2RA 4Y92A 2MCNA 3CCJT 1VQPT 1GXIE 4C92D 3CCMQ 2D0QB 2E6ZA 2SEMA 1G2BA 2ESWA 4KUIA 3RR6A 3MEVA 1TUGB 3MEAA 2HSEB 4M78F 2A0FB 4EPCA 2EAYA 4JLGA 1FWZA 1VQ6T 3SD4A 2IIMA 4OMPA 3HRSA 4ELYC 1G3YA 3CC2T 1I8FA 2QQBA 3CC4T 4ORZA 2W0ZA 3HKSA 4BI3A 4FT4A 1Q95G 1VQ9A 3PE0A 4IURA 3E19A 3RIRA 2OTJQ 2A08A 3M0TA 4QW2A 5KYYA 2KXDA 4FSSA 1VQ9Q 5LJ3d 2DLPA 2P0PA 4C5HA 2RN8A 1X2KA 3C0CA 1T0HA 4RTXA 5CKHA 5GAMh 3H0IA 1Z9QA 4KGZB 4OMNA 3CCQA 4LN2A 3UA6A 5GMKh 2K57A 4CC3A 1LVKA 4GBQA 1YIJT 2BE7D 1MV0B 1ZBJA 2NUZA 2EYZA 3CCQQ 4C92F 3RDVA 2J05A 2LNHB 1AWOA 5GANg 1K8AU 3JB9J 1XJWB 2P4RA 1AZGB 1OZ3A 1M1GA 1MHNA 2QDYB 2EGAA 3QZ9B 4LDVA 1Y96B 1I07A 1C1AA 3EFOB 4OVAA 1RABB 2VC8A 2DVEA 1T0JA 4LXCA 2GF7A 4GLKA 4BB7A 3L2VA 1JXOA 2EJ9A 3NPFA 3LWHA 2X3XD 3V8JA 2B86A 2MWOA 2CZ6B 5A0LA 3JB9D 3N5BB 1AZEA 4J5YA 1SRMA 4BE1A 3JCMQ 2XU8A 1AT1B 2KAFA 3QXEB 4XTXA 1VQ7T 2NYSA 4C8QA 3M53A 2KEAA 3M59A 9ATCB 1QVGA 2K2MA 1D1AA 4PLLA 1MMDA 1WFWA 2VASA 1TXQA 1QCNA 2DBMA 1WJQA 3JCMe 4PJOE 4A4FA 4ELZC 3M56A 1ZLMA 1W4SA 1R0BG 2JN0A 5IH2A 3GPLA 1UFFA 2H3EB 2LJ0A 2ZPEB 3EGUA 4E7HA 4PJOC 3ZFJA 2VVKA 2L5QA 2ZPIB 4E7KA 1E7OA 5FU6C 1D1CA 1HYOA 4OMQA 2EVRA 3CPWP 4ME7A 4R56A 3M4GA 1K9MR 4N4GA 5I2SA 1R0CB 2RHZA 2YT6A 2CH4W 3CCUT 1Y96A 1MMNA 3M57A 2L3SA 2DX1A 2E3HA 1YJ9T 4M7DE 4D6WA 3KFVA 1QVPA 1VQNT 3JB9F 4IIOA 5KYWB 2MMPA 4M7DC 2K3YA 3P8DA 4C5GA 4FIBA 4HT8A 2MWPA 3GF5A 5FROA 4XAXB 2F2VA 1OQKA 3SFMA 1BCOA 3H0FA 2ABLA 1GBQA 2RQTA 2WSEE 3DLLA 4E47A 2EQUA 3HPWA 2IG0A 2LCSA 4M77C 5I22A 1OU9A 1IGQA 4ZTJA 2O9SA 4Q5WA 5A0DA 1V29B 2A7YA 1MNDA 3T9NA 1WJSA 2XICA 5A2QE 1ZBXA 2K5LA 3OBWA 4RTWA 1C6VX 5GAMg 1X6BA 2FZKB 2M51A 2ZZDA 4IUVA 2QASA 3I35A 2Y90A 1KG1A 2RO0A 4OMLA 3HL8A 2QA4A 3CCRQ 2P84A 4PJOB 4JS5A 2QEXA 3A8GB 2PZ1A 1VQ5T 2ZCFB 4JZ4A 1M3BA 4JRKA 4JLIA 3QWYA 1VQOT 2QA4Q 2JMAA 4HCCA 2JT4A 1RADB 2KR3A 5FU6B 4A54A 3JV3A 2X4WA 4FCYA 3LH5A 2QEXQ 1SF9A 4J9BA 3OYHA 3TU4K 4F04B 4OGEA 4HCZA 2DRMA 3EG0A 2RHUA 4DBFA 2K3BA 4PJOG 3EAEA 1N27A 2RMOA 5GAOq 4HCKA 3I55A 3RMSA 1GBRA 5GAN7 2DNUA 1UUEA 3A8LB 2QQ9A 2QG9B 1WXTA 3RBBB 1RAAB 3QO3A 3WVEB 1QP2A 1HXDA 1I0CA 4M78B 1N8RU 4AFUC 2VXFA 1TWBA 3SWNC 3X24B 2DYBA 4RMOA 4FL6A 3QDFA 4Z02A 4XTZA 1M90U 1WQWA 2HKQB 3OB9A 3CCMT 3Q1JA 2RI3A 3A98A 2DXBA 4C5EA 4M78G 1NM7A 5LJ5j 1YJWA 1IO6A 3MP1A 1M1KU 2DIGA 2JMCA 5GAOm 3HSBA 2VGNA 5CQYA 1JJ2S 2X4YA 1NPRA 3A8OB 1K9MU 1NLOC 3M55A 2GTJA 4J8OA 2PQWA 3CBMA 4PJOA 4J6YA 2YUNA 5IXFA 2LVMA 2K3XA 1G3SA 2RM4A 2KT8A 5FWCA 5AYFA 2JS2A 2OTJT 1RI0A 2FHDA 3OBYA 4PFOA 4HT9A 2EGCA 5EG2A 5LJ5f 4EDUA 5KE2A 1ACMB 1H8KA 2E1HA 1OEBA 1VQ9T 1YWOA 1RUWA 1M8MA 4MMLA 2FZCB 1KQSS 1TTHB 3CC7A 3EH1A 4KULA 1BIAA 3NFCA 3QBYA 4EMKC 3L2WA 3CC7Q 3G6EQ 1NYFA 1VYUA 4M75F 3TQ7P 2DIQA 3VRZA 4M7AD 5IN1A 3V7SA 1XQHA 2E6NA 2LRQA 2SRCA 3FIFA 3CCQT 2F5KA 2GFAA 1PG5B 4DOVA 3SWNB 2QGFB 4RTVA 2NLUA 1O9SA 1VQ8Q 2FB7A 3GNFB 4XU1A 4IUQA 4PJLA 3KXTA 4BUGA 4F7UF 3EHRA 3M0PA 3CCEA 2HQHA 3H0HA 1LNXA 5GAN6 4QVZA 2M16A 3VYHB 1YCSB 2DL8A 3M0RA 2MI6A 2CGHA 1M8VA 2KYBA 4JJBA 2HAXA 1VIFA 2F1LA 1UJ0A 2EKHA 2X4JA 1ZUYA 2CSIA 4F14A 1Q82C 1WHJA 3GNGA 4OMMA 2CP2A 4XU0A 3CCLA 1HK9A 5FW9A 2OTLA 4Z8AA 3NTIA 4WTOB 5LJ3f 1M4ZA 1CKAA 5LJ5h 4OF1A 2AK5A 1Q81R 5AT1B 2OTLQ 2DYIA 3MP6A 5DLOA 1NYGA 3I9QA 1OX9A 3ZEHA 1UGPB 1RL2A 1KSWA 2M9UA 2CSQA 2KRSA 2XDPA 3CCSA 4BI4A 3INZA 5KH6A 5GAOl 1SRLA 4LDWA 1WQ7A 1JEGA 1PKTA 1KC8R 4XTYA 2MK5A 4C0DB
chains in the Genus database with same CATH topology
1K0XA 1RI9A 1ZUUA 3NHNA 3PE0A 5FWBA 2K9GA 2A08A 3M0TA 2O9VA 4ZNXA 2CUDA 2KXDA 1UDLA 2L0AA 4FSSA 5IXBA 1TG0A 2DLPA 4DEXA 2YDLA 1I1JA 2RN8A 2HCKA 2C0IA 1X2KA 3C0CA 1T0HA 4RTXA 3VS2A 1UJYA 1ZUKA 1JU5C 3H0IA 3FJ5A 1WIEA 1Z9QA 4F17A 3EG2A 2L3QA 2GTOA 1QKWA 2DBKA 2V1RA 4OMNA 1BBZA 3UF4A 4LN2A 3UA6A 1GL5A 2KBTA 4CC3A 4RTUA 4GBQA 2A36A 2D0NA 1U3OA 1MV0B 1UGVA 1ZBJA 2NUZA 2K79A 5ECAA 1Y0MA 2EYZA 1WXBA 1MV3A 2J05A 2LNHB 4AG1C 1AWOA 4HXJA 1QWFA 2P4RA 1AZGB 3VS5A 1G83A 2ED0A 2AKLA 2OAWA 2D8JA 1Z9ZA 1K1ZA 2HEQA 2EGAA 1I07A 2VWFA 1EFNA 2RPNA 1AWXA 1NLPC 1W1FA 1T0JA 2CDTA 3IQLA 1BU1A 1UHCA 1LCKA 1GRIA 1JXOA 3NPFA 1UTIA 2X3XD 2B86A 1ZSGA 2PTKA 1AZEA 2BTTA 1SEMA 1SRMA 2A28A 1E6GA 2D1XA 2MIOA 2V1QA 4J9HA 1B3QA 2HDAA 1GFCA 4HVVA 1N5ZA 2FG0A 2KEAA 4CC2A 1AWWA 2JXBA 4J9DA 2K2MA 4ESRA 1WDXA 1WFWA 2FRYA 3I5RA 2F2XA 4JZ3A 2W10A 4DEYA 2DBMA 3ULRB 3SHWA 4LUEA 3R6NA 3UA7A 2KNBB 3EG1A 1OOTA 2KE9A 1KJWA 2DRKA 1K4US 2KGTA 2CT3A 2YUQA 1ZLMA 5IH2A 2LQWA 3THKA 2YUOA 1UFFA 2LJ0A 4QT7A 1GCPA 3EGUA 1E6HA 2EBPA 5GJVB 1HD3A 1TUCA 2VVKA 1UHFA 3REBB 1E7OA 4CC4B 3U23A 4OMQA 2EVRA 2FPEA 1CSKA 1GCQA 2QDLA 2GQIA 2CT4A 4WCIA 2J7IA 2YUPA 5GJWB 3ZL7C 1S1NA 2YT6A 2JM8A 2CH4W 2K6DA 3VS6A 2ENMA 2DL5A 2JS0A 2L3SA 2RQVA 2DX1A 2KRNA 1JXMA 2F2WA 2X3WD 2CH4A 3KFVA 1H3HA 1OPLA 1NEBA 1ZX6A 1RLQC 4IIOA 2GBQA 4RTTA 5HCKA 4JJCA 2DA9A 2F2VA 1H92A 2DL4A 1V1CA 3VS1A 4LE9A 1OPKA 3H0FA 2ABLA 1AEYA 4J9GA 1GBQA 2RQTA 1NG2A 2BZYA 2J6OA 1PRMC 2EYWA 2I0NA 4HVWA 4JJDA 2KYMA 1W70A 2XMFA 2OI3A 3I5SA 2BZXA 2LCSA 1QKXA 5I22A 1AOJA 2O9SA 2M0YA 1W6XA 1KIKA 2LJ3A 1K76A 1YNZA 1XOVA 2EYYA 5IHKA 3VS3A 1SPKA 2GNCA 4IIMA 1M3CA 3REAB 3VRYA 3EHQA 4RTWA 2JTEA 1SSHA 1X6BA 2M51A 3H41A 1B07A 4RTZA 3I35A 2LX7A 4OMLA 1WI7A 1X43A 1WLPB 2PZ1A 2KRMA 4JZ4A 1M3BA 1QWEA 2JM9A 4KRTA 2A37A 2FRWA 3QWYA 4LUDA 2JMAA 2JT4A 2KR3A 5EC7A 3JV3A 2LMJA 3LH5A 2ED1A 2J6KA 4J9BA 2RQUA 1SHFA 2DRMA 3EG0A 3NMZC 4AFSC 2K3BA 4A63B 4GLMA 1ABQA 2DMOA 2AKKA 2RMOA 3TSZA 4D8DA 4K11A 3GBQA 1BK2A 4HCKA 1RLPC 1GBRA 2O2OA 1TUDA 2DNUA 1UUEA 1X2QA 2BZ8A 1WXTA 2DE0X 3RBBB 2DVJA 2RQRA 1KFZA 1YN8A 2D8HA 2ROTA 1UE9A 4AG2C 2DJQA 4AFZC 2EW3A 1I0CA 1NEGA 4RTYA 4AFUC 1AVZC 2VKNA 1SHGA 1FMKA 2H8HA 2RNAA 2DYBA 4J9FA 1T3SA 2OJ2A 2DM1A 2FPFA 2DL3A 4D8KA 2KXCA 1QLYA 3PVLA 3A98A 2CUBA 3O5ZA 2EYXA 1X6GA 4Z89A 2EQIA 4M4ZA 2LP5A 1NM7A 1OV3A 4JPBW 1IO6A 2HSPA 1U06A 2JMCA 1AD5A 1MUZA 2C0OA 4HVUA 3CQTA 2O31A 2J06A 4OMOA 2DF6A 3VS0A 2G6FX 1NLOC 2GTJA 2AZSA 4J9EA 1VA7A 2FO0A 1GFDA 2K7AA 2AZVA 3SEMA 4E6RA 2YUNA 5IXFA 1JO8A 2EGEA 2C0TA 4R0KA 2KT8A 5FWCA 5IHIA 2JS2A 2LJ1A 1PHTA 3NGPA 2MOXA 3RNJA 2EGCA 3VS7A 2RQWA 1H8KA 1OEBA 2O88A 1YWOA 1UECA 1RUWA 1M8MA 4RUGA 3TSWA 1ARKA 2KROA 1WA7A 2YSQA 1A0NB 1AWJA 1J3TA 1HSQA 3VS4A 2E5KA 1YP5A 2KT1A 2J6FA 1WYXA 2JW4A 2EPDA 1PRLC 2DILA 1NYFA 4CC7A 2ROLA 1VYUA 3TVTA 2NWMA 2RF0A 3VRZA 4EIKA 2L3PA 2SRCA 1WX6A 1ABOA 1K9AA 5IHNA 1PNJA 4RTVA 2CREA 4Z88A 1X69A 1Y57A 1FYNA 1HJDA 1CKBA 3PVQA 1QCFA 1JQQA 4AFQC 3EHRA 2ECZA 3M0PA 3H0HA 1K0SA 1PWTA 2L2PA 1M27C 1UG1A 1YCSB 2DL8A 3M0RA 4X1VA 1GCQC 2KYBA 4JJBA 4J9CA 1YWPA 1T3LA 2DL7A 1UJ0A 2EKHA 2PNIA 4Y92A 1ZUYA 1BB9A 2CSIA 3M0UA 2MCNA 4F14A 4OMMA 3M0SA 2SEMA 1G2BA 2ESWA 4LNPA 1VYTA 5FW9A 3M0QA 3UATA 2LQNA 4Z8AA 4F16A 5L23A 1PKSA 2HBWA 1CKAA 1M3AA 5I11A 2FEIA 2AK5A 2FPDA 1NYGA 3I9QA 2IIMA 4OMPA 1U5SA 1VYVA 1M30A 1WXUA 1KSWA 2GGRA 4ORZA 2W0ZA 2CSQA 2KRSA 1X27A 3EG3A 4J9IA 1SRLA 1JEGA 1PKTA 3QWXX 2LZ6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0X A;  1RI9 A;  1ZUU A;  3NHN A;  3PE0 A;  5FWB A;  2K9G A;  2A08 A;  3M0T A;  2O9V A;  4ZNX A;  2CUD A;  2KXD A;  1UDL A;  2L0A A;  4FSS A;  5IXB A;  1TG0 A;  2DLP A;  4DEX A;  2YDL A;  1I1J A;  2RN8 A;  2HCK A;  2C0I A;  1X2K A;  3C0C A;  1T0H A;  4RTX A;  3VS2 A;  1UJY A;  1ZUK A;  1JU5 C;  3H0I A;  3FJ5 A;  1WIE A;  1Z9Q A;  4F17 A;  3EG2 A;  2L3Q A;  2GTO A;  1QKW A;  2DBK A;  2V1R A;  4OMN A;  1BBZ A;  3UF4 A;  4LN2 A;  3UA6 A;  1GL5 A;  2KBT A;  4CC3 A;  4RTU A;  4GBQ A;  2A36 A;  2D0N A;  1U3O A;  1MV0 B;  1UGV A;  1ZBJ A;  2NUZ A;  2K79 A;  5ECA A;  1Y0M A;  2EYZ A;  1WXB A;  1MV3 A;  2J05 A;  2LNH B;  4AG1 C;  1AWO A;  4HXJ A;  1QWF A;  2P4R A;  1AZG B;  3VS5 A;  1G83 A;  2ED0 A;  2AKL A;  2OAW A;  2D8J A;  1Z9Z A;  1K1Z A;  2HEQ A;  2EGA A;  1I07 A;  2VWF A;  1EFN A;  2RPN A;  1AWX A;  1NLP C;  1W1F A;  1T0J A;  2CDT A;  3IQL A;  1BU1 A;  1UHC A;  1LCK A;  1GRI A;  1JXO A;  3NPF A;  1UTI A;  2X3X D;  2B86 A;  1ZSG A;  2PTK A;  1AZE A;  2BTT A;  1SEM A;  1SRM A;  2A28 A;  1E6G A;  2D1X A;  2MIO A;  2V1Q A;  4J9H A;  1B3Q A;  2HDA A;  1GFC A;  4HVV A;  1N5Z A;  2FG0 A;  2KEA A;  4CC2 A;  1AWW A;  2JXB A;  4J9D A;  2K2M A;  4ESR A;  1WDX A;  1WFW A;  2FRY A;  3I5R A;  2F2X A;  4JZ3 A;  2W10 A;  4DEY A;  2DBM A;  3ULR B;  3SHW A;  4LUE A;  3R6N A;  3UA7 A;  2KNB B;  3EG1 A;  1OOT A;  2KE9 A;  1KJW A;  2DRK A;  1K4U S;  2KGT A;  2CT3 A;  2YUQ A;  1ZLM A;  5IH2 A;  2LQW A;  3THK A;  2YUO A;  1UFF A;  2LJ0 A;  4QT7 A;  1GCP A;  3EGU A;  1E6H A;  2EBP A;  5GJV B;  1HD3 A;  1TUC A;  2VVK A;  1UHF A;  3REB B;  1E7O A;  4CC4 B;  3U23 A;  4OMQ A;  2EVR A;  2FPE A;  1CSK A;  1GCQ A;  2QDL A;  2GQI A;  2CT4 A;  4WCI A;  2J7I A;  2YUP A;  5GJW B;  3ZL7 C;  1S1N A;  2YT6 A;  2JM8 A;  2CH4 W;  2K6D A;  3VS6 A;  2ENM A;  2DL5 A;  2JS0 A;  2L3S A;  2RQV A;  2DX1 A;  2KRN A;  1JXM A;  2F2W A;  2X3W D;  2CH4 A;  3KFV A;  1H3H A;  1OPL A;  1NEB A;  1ZX6 A;  1RLQ C;  4IIO A;  2GBQ A;  4RTT A;  5HCK A;  4JJC A;  2DA9 A;  2F2V A;  1H92 A;  2DL4 A;  1V1C A;  3VS1 A;  4LE9 A;  1OPK A;  3H0F A;  2ABL A;  1AEY A;  4J9G A;  1GBQ A;  2RQT A;  1NG2 A;  2BZY A;  2J6O A;  1PRM C;  2EYW A;  2I0N A;  4HVW A;  4JJD A;  2KYM A;  1W70 A;  2XMF A;  2OI3 A;  3I5S A;  2BZX A;  2LCS A;  1QKX A;  5I22 A;  1AOJ A;  2O9S A;  2M0Y A;  1W6X A;  1KIK A;  2LJ3 A;  1K76 A;  1YNZ A;  1XOV A;  2EYY A;  5IHK A;  3VS3 A;  1SPK A;  2GNC A;  4IIM A;  1M3C A;  3REA B;  3VRY A;  3EHQ A;  4RTW A;  2JTE A;  1SSH A;  1X6B A;  2M51 A;  3H41 A;  1B07 A;  4RTZ A;  3I35 A;  2LX7 A;  4OML A;  1WI7 A;  1X43 A;  1WLP B;  2PZ1 A;  2KRM A;  4JZ4 A;  1M3B A;  1QWE A;  2JM9 A;  4KRT A;  2A37 A;  2FRW A;  3QWY A;  4LUD A;  2JMA A;  2JT4 A;  2KR3 A;  5EC7 A;  3JV3 A;  2LMJ A;  3LH5 A;  2ED1 A;  2J6K A;  4J9B A;  2RQU A;  1SHF A;  2DRM A;  3EG0 A;  3NMZ C;  4AFS C;  2K3B A;  4A63 B;  4GLM A;  1ABQ A;  2DMO A;  2AKK A;  2RMO A;  3TSZ A;  4D8D A;  4K11 A;  3GBQ A;  1BK2 A;  4HCK A;  1RLP C;  1GBR A;  2O2O A;  1TUD A;  2DNU A;  1UUE A;  1X2Q A;  2BZ8 A;  1WXT A;  2DE0 X;  3RBB B;  2DVJ A;  2RQR A;  1KFZ A;  1YN8 A;  2D8H A;  2ROT A;  1UE9 A;  4AG2 C;  2DJQ A;  4AFZ C;  2EW3 A;  1I0C A;  1NEG A;  4RTY A;  4AFU C;  1AVZ C;  2VKN A;  1SHG A;  1FMK A;  2H8H A;  2RNA A;  2DYB A;  4J9F A;  1T3S A;  2OJ2 A;  2DM1 A;  2FPF A;  2DL3 A;  4D8K A;  2KXC A;  1QLY A;  3PVL A;  3A98 A;  2CUB A;  3O5Z A;  2EYX A;  1X6G A;  4Z89 A;  2EQI A;  4M4Z A;  2LP5 A;  1NM7 A;  1OV3 A;  4JPB W;  1IO6 A;  2HSP A;  1U06 A;  2JMC A;  1AD5 A;  1MUZ A;  2C0O A;  4HVU A;  3CQT A;  2O31 A;  2J06 A;  4OMO A;  2DF6 A;  3VS0 A;  2G6F X;  1NLO C;  2GTJ A;  2AZS A;  4J9E A;  1VA7 A;  2FO0 A;  1GFD A;  2K7A A;  2AZV A;  3SEM A;  4E6R A;  2YUN A;  5IXF A;  1JO8 A;  2EGE A;  2C0T A;  4R0K A;  2KT8 A;  5FWC A;  5IHI A;  2JS2 A;  2LJ1 A;  1PHT A;  3NGP A;  2MOX A;  3RNJ A;  2EGC A;  3VS7 A;  2RQW A;  1H8K A;  1OEB A;  2O88 A;  1YWO A;  1UEC A;  1RUW A;  1M8M A;  4RUG A;  3TSW A;  1ARK A;  2KRO A;  1WA7 A;  2YSQ A;  1A0N B;  1AWJ A;  1J3T A;  1HSQ A;  3VS4 A;  2E5K A;  1YP5 A;  2KT1 A;  2J6F A;  1WYX A;  2JW4 A;  2EPD A;  1PRL C;  2DIL A;  1NYF A;  4CC7 A;  2ROL A;  1VYU A;  3TVT A;  2NWM A;  2RF0 A;  3VRZ A;  4EIK A;  2L3P A;  2SRC A;  1WX6 A;  1ABO A;  1K9A A;  5IHN A;  1PNJ A;  4RTV A;  2CRE A;  4Z88 A;  1X69 A;  1Y57 A;  1FYN A;  1HJD A;  1CKB A;  3PVQ A;  1QCF A;  1JQQ A;  4AFQ C;  3EHR A;  2ECZ A;  3M0P A;  3H0H A;  1K0S A;  1PWT A;  2L2P A;  1M27 C;  1UG1 A;  1YCS B;  2DL8 A;  3M0R A;  4X1V A;  1GCQ C;  2KYB A;  4JJB A;  4J9C A;  1YWP A;  1T3L A;  2DL7 A;  1UJ0 A;  2EKH A;  2PNI A;  4Y92 A;  1ZUY A;  1BB9 A;  2CSI A;  3M0U A;  2MCN A;  4F14 A;  4OMM A;  3M0S A;  2SEM A;  1G2B A;  2ESW A;  4LNP A;  1VYT A;  5FW9 A;  3M0Q A;  3UAT A;  2LQN A;  4Z8A A;  4F16 A;  5L23 A;  1PKS A;  2HBW A;  1CKA A;  1M3A A;  5I11 A;  2FEI A;  2AK5 A;  2FPD A;  1NYG A;  3I9Q A;  2IIM A;  4OMP A;  1U5S A;  1VYV A;  1M30 A;  1WXU A;  1KSW A;  2GGR A;  4ORZ A;  2W0Z A;  2CSQ A;  2KRS A;  1X27 A;  3EG3 A;  4J9I A;  1SRL A;  1JEG A;  1PKT A;  3QWX X;  2LZ6 B; 
#chains in the Genus database with same CATH topology
 1JBM A;  1D3B B;  3C4S A;  3CCS Q;  3G71 Q;  2L89 A;  1RAG B;  3WXM B;  2CUD A;  2X35 A;  5CVI A;  3OQ5 A;  1TG0 A;  2YLB A;  3E9G A;  3FLG A;  2HL3 A;  2RHI A;  2E12 A;  2C0I A;  4HA8 A;  3CD6 A;  2WSC E;  4KBM B;  3SWN A;  3FDR A;  3FJ5 A;  1WIE A;  4F17 A;  4RG8 A;  5KYN A;  1M2V A;  3CD6 Q;  4LD9 K;  4Y28 E;  1GL5 A;  2ZAE A;  2RI2 A;  3QYG B;  1X01 A;  1FX7 A;  3PMT A;  1Y0M A;  5CK9 A;  2E3I A;  2QQR A;  5GAM j;  5KYX B;  3MKD A;  3TCJ A;  3L2Q A;  5LJ3 h;  3G4S Q;  2OAW A;  5GMK j;  1K1Z A;  3HTR A;  2HEQ A;  1Q82 R;  4E2F B;  4FW2 A;  2ZPG B;  1EFN A;  3CPW S;  2JZ2 A;  2PUK B;  3OS5 A;  1AWX A;  3QZ5 B;  3QPH A;  3CPF A;  4ZN3 A;  1Q86 C;  3OS0 A;  1YBY A;  3E9F A;  4L59 A;  4JRP A;  1UHC A;  5IAY A;  4P5N A;  3PIO A;  4QVC A;  1NZ9 A;  2RJD A;  1FMV A;  4QVD A;  1MNE A;  3I56 A;  2PTK A;  4PLI A;  3OYF A;  4PK4 A;  3DLM A;  2BTT A;  2COZ A;  1WHG A;  3NTK A;  2V1Q A;  2RJC A;  2HDA A;  1GFC A;  1WHK A;  4B9W A;  2E10 A;  2FG0 A;  1I5O B;  4J9D A;  4EMK A;  2DAQ A;  1IHV A;  1IGU A;  1YJN Q;  2FRY A;  2HBP A;  1KD1 U;  2F2X A;  2W10 A;  5CKF A;  3RKY A;  3CCR T;  1D0Z A;  1K73 C;  2KNB B;  4JDS A;  2O4X B;  2FL7 A;  3ER0 A;  3JCM P;  1RAE B;  1YFN A;  5GAN 3;  1KJW A;  3H8Z A;  2DRK A;  5GAN d;  2QA4 T;  1N9R A;  1TSF A;  4QQ6 A;  4KUD K;  2K4Y A;  3THK A;  3X26 B;  2QEX T;  4QT7 A;  3X28 B;  4AT1 B;  2EBP A;  2ZGW A;  1UHF A;  3REB B;  2RK2 A;  5KYX A;  1C0M A;  1Q81 U;  2CT4 A;  3ZL7 C;  1S1N A;  2ZPB B;  2DZC A;  3AHU A;  2ENM A;  2DL5 A;  4M77 F;  2RQV A;  3OYA A;  2X3W D;  2CH4 A;  4X9D A;  4QQG A;  3QYH B;  1WPY A;  1OPL A;  2DXU A;  1KC8 U;  3A8H B;  5C0M A;  1ZX6 A;  5LJ5 g;  1RLQ C;  5KYU B;  1YHQ A;  4MMK A;  2GBQ A;  4DBQ A;  5C6S A;  5HCK A;  1LOJ A;  2DA9 A;  1H92 A;  1N6A A;  1V1C A;  4N4I A;  1YCY A;  3VS1 A;  3S3O A;  1KQ2 A;  4J9G A;  1YHQ Q;  4KGV B;  2NUT B;  1PD1 A;  4R55 A;  1NG2 A;  2I0N A;  4O5V A;  1EX4 A;  2KYM A;  1W70 A;  2XMF A;  3I5S A;  2BZX A;  3CXC A;  5GMK m;  2Y4X A;  1QKX A;  3OYI A;  5I2M A;  2M0Y A;  3RKW A;  2LJ3 A;  1K76 A;  1D09 B;  2CKK A;  3VS3 A;  2KQW A;  1SPK A;  2BUD A;  1JJ2 A;  1VUB A;  3JCM c;  2O4X A;  2CP0 A;  3EHQ A;  3TEE A;  3SDZ A;  1F1B B;  3JB9 I;  4FU6 A;  1SSH A;  4II1 A;  1UB4 A;  1MMG A;  1VQ4 A;  3QJ6 A;  2Z0W A;  1NPP A;  3LWI A;  1X43 A;  4JJN K;  1D0Y A;  1VQ4 Q;  2KRM A;  1QWE A;  1YI2 A;  3MHX A;  2ZPH B;  1N9S A;  1KQS A;  3MEW A;  3CC7 T;  2MF2 A;  2RQU A;  4LDX A;  1YI2 Q;  5LJ3 g;  3G6E T;  2E65 A;  2RJF A;  3X20 B;  1ABQ A;  3MJX A;  3CMA A;  3LYI A;  2QXF A;  1IB8 A;  2AKK A;  3TSZ A;  4D8D A;  2DJZ A;  5KYU A;  5GAM e;  1JB0 E;  1BKB A;  2VB6 A;  1VQ8 T;  2DVJ A;  1YN8 A;  2D8H A;  1UE9 A;  4JRI A;  1U1S A;  4IUU A;  2NUT A;  4A53 A;  1NEG A;  3C94 A;  2VKN A;  1SHG A;  8ATC B;  1FMK A;  3JCM d;  3PGG A;  2H8H A;  1MMA A;  3A1P A;  2RA2 A;  1T3S A;  2AHJ B;  2DET A;  2FPF A;  4D8K A;  2BE9 B;  2KXC A;  1QLY A;  5FRN A;  2CUB A;  4MDW A;  1X6G A;  1W2B A;  1Y71 A;  3EFO A;  4J6X A;  4JPB W;  4M7A B;  3OYE A;  4M78 E;  1U06 A;  3RKX A;  2C0O A;  2OTL T;  2J06 A;  3QG1 A;  3JB9 H;  4FYW B;  2R5M A;  3VS0 A;  3VU3 C;  3PTA A;  4MDX A;  2AZS A;  4M78 C;  5GAN 4;  3JCM J;  5GMK l;  2AZV A;  4E6R A;  1LJO A;  3OYJ A;  2C0T A;  4M7A G;  4R0K A;  2B8A A;  4PL6 A;  3JSC A;  2YRC A;  2X51 A;  3CCS T;  3NGP A;  3G71 T;  2MOX A;  5GAO r;  3CCV T;  2K5I A;  2RJE A;  3TSW A;  1ARK A;  2KRO A;  1WA7 A;  2RH2 A;  3V8K A;  3E2U A;  1AWJ A;  4B9X A;  3H9N A;  1PD0 A;  5CQX A;  3S3M A;  2KT1 A;  2F69 A;  2RHX A;  2J6F A;  1WYX A;  5A0G A;  3ZBD A;  4RCC A;  1RAC B;  4CC7 A;  2HNI A;  3CD6 T;  4J6W A;  2FZG B;  2RF0 A;  1G5V A;  2L3P A;  3CCJ A;  3KBG A;  4C8Q D;  2K5F A;  4C92 E;  1PNJ A;  5CKB A;  1SSF A;  1I4K 1;  1EIF A;  4DBR A;  2LC4 A;  4C92 C;  3G4S T;  3OW2 S;  1FYN A;  3SB2 A;  3VYG A;  5GMK i;  2E64 A;  1HJD A;  2XG8 D;  1CKB A;  2DER A;  1QCF A;  2H3J A;  3PFS A;  5FRM A;  1VQ6 A;  1I81 A;  1PWT A;  4M7A A;  2L2P A;  1UG1 A;  3MCA B;  1Q7Y C;  3LH0 A;  5KYW A;  1Y7X A;  1GCQ C;  4JUV A;  3CC4 A;  3DB3 A;  2PNI A;  5I21 A;  1BB9 A;  3CPW A;  2EQM A;  3M0S A;  5IT9 E;  3I55 Q;  3DB4 A;  3M0Q A;  5L23 A;  2DD5 A;  5I11 A;  2ATC B;  2FEI A;  4M75 D;  2LNV A;  3EFR A;  2CP7 A;  3S3N A;  1BCM A;  2YRV A;  1U5S A;  1VYV A;  2PUO B;  3UDC A;  3LLR A;  2GGR A;  2DTI A;  1YJN T;  1VQL A;  3EG3 A;  1B34 B;  4J9I A;  4QKU A;  3OYC A;  2LZ6 B;  2HQE A;  1RI9 A;  1K0X A;  1RAH B;  2L3R A;  4A4H A;  1VQL Q;  2CYZ B;  5CKD A;  2KK4 A;  2QQA A;  2XI9 A;  2BKD N;  2O9V A;  4ZNX A;  4C8Q F;  2L0A A;  1YJW Q;  5IXB A;  1KQ1 A;  2R5A A;  2YDL A;  1I5L A;  1I1J A;  2HCK A;  3VS2 A;  3OYL A;  5CAI A;  1S72 A;  3F70 A;  4IUT A;  4NOY A;  2L3Q A;  2GTO A;  1QKW A;  2QTV A;  2DBK A;  2V1R A;  4E7L A;  1BBZ A;  1KHI A;  1S72 Q;  1UEB A;  2KBT A;  2FYK A;  2A36 A;  2VYT A;  2D0N A;  1QW1 A;  4C92 B;  1UGV A;  3WVD B;  5ECA A;  2K79 A;  1BI2 A;  3QJY A;  4C0G A;  3C95 A;  2JUF A;  4C0D C;  3M5A A;  4A4E A;  1IXD A;  5LL6 S;  5M9O A;  4PJJ A;  3UWN A;  1VQM A;  1QWF A;  3A5Z B;  1G83 A;  1Q7Y R;  2KVQ G;  1Z9Z A;  2MYS A;  3L2U A;  1VQM Q;  4X9C A;  5L8R E;  4YTL A;  4C92 G;  2COW A;  4M78 A;  1YHQ T;  2DKG A;  1D1B A;  1NLP C;  1W1F A;  2O01 E;  2X9H A;  3GIB A;  3EGD B;  3NTH A;  1UTI A;  2P0K A;  5LJ3 j;  5GAN f;  1KHC A;  2VUB A;  1ZSG A;  2IVW A;  4NL3 A;  1B34 A;  2A28 A;  1E6G A;  1K8A C;  4GY5 A;  1OU8 A;  4J9H A;  2MPX C;  3FC3 A;  5GAO n;  1QVF P;  2LDM A;  4VUB A;  1AWW A;  4X34 A;  3CCE Q;  2JXB A;  1B7T A;  2VGM A;  3JCM X;  3OYB A;  3I5R A;  3OYM A;  4XU3 A;  2PVO B;  4DEY A;  4MZM A;  2HZY A;  3V7C A;  1UGQ B;  2JOY A;  3ULR B;  2JNG A;  3R6N A;  3MET A;  3CCU A;  3CCL Q;  5GAN 8;  1K4U S;  2KGT A;  2CT3 A;  1YJ9 A;  2YUQ A;  1VQN A;  2LQW A;  2QYZ A;  1WGS A;  1VOM A;  3CCU Q;  4BDZ A;  1YI2 T;  4C92 A;  1E6H A;  5GJV B;  4FW1 A;  1NJI C;  2V8K A;  3J7A F;  1VQN Q;  1OUL A;  4CC4 B;  3DKM A;  1CSK A;  1GCQ A;  1WZO A;  2E70 A;  2J7I A;  3QSU A;  4XTV A;  5GJW B;  1OX8 A;  4BI8 B;  1BI1 A;  2JM8 A;  4PJO D;  3VS6 A;  1VQK A;  1JXM A;  1AHJ B;  3VV0 A;  5GAN h;  1H3H A;  2KY9 A;  1U1T A;  4KT0 E;  5J26 A;  1VQK Q;  3GOX A;  3EGD A;  4RTT A;  2V26 A;  4JJC A;  3LW5 E;  2V8J A;  3OYG A;  1G3T A;  2DL4 A;  2DPP B;  2E5Q A;  2JVV A;  5DY9 A;  2BZY A;  2J6O A;  3JB9 G;  1PRM C;  2EYW A;  1BI3 A;  4RG2 A;  2HD0 A;  2BIV A;  2OI3 A;  3PMI A;  1WJR A;  2CS7 A;  4M7D D;  1AOJ A;  2LCL A;  4XTW A;  1OZ2 A;  3BY7 A;  3URG A;  3M4Y A;  2VV5 A;  1W6X A;  2EYY A;  1VQO A;  1TU0 B;  5HY6 A;  3L42 A;  3HFN A;  4XU2 A;  1ZHI A;  2GNC A;  4IIM A;  5GAN 5;  3BFM A;  5LJ5 e;  4M77 D;  1FMW A;  3P8B B;  3EG9 B;  1O75 A;  3BDU A;  1EZZ B;  3UPU A;  1IZ6 A;  2RHY A;  4JS4 A;  3OA6 A;  3CXC P;  5J39 A;  3I56 Q;  2JM9 A;  1NJI R;  4PJO F;  5HKC A;  4LUD A;  1D3B A;  5EC7 A;  3JCM f;  2ED1 A;  3QKJ A;  1QMC A;  2E4H A;  3VKI A;  4AFS C;  3H6Z A;  3PNW C;  3JRZ A;  3MP8 A;  5GAO p;  4GLM A;  1PSF A;  1WHL A;  4UC4 A;  2O2O A;  2YHT A;  4RCB A;  1X2Q A;  1LPL A;  2BZ8 A;  2DE0 X;  2L8D A;  2RQR A;  1KFZ A;  4AG2 C;  2DJQ A;  2DFU A;  4LD6 A;  4AFZ C;  2EW3 A;  4M7D F;  1P92 A;  4F7U E;  1AVZ C;  4A4G A;  1G3W A;  1DJ7 B;  3VUZ A;  2HMA A;  4IKF A;  2RNA A;  3JAM E;  3OW2 A;  1KQS P;  2V8I A;  3EFS A;  3E1S A;  1QVG P;  2DM1 A;  4BE0 A;  1ZSZ B;  2DL3 A;  3JCM b;  4ZN1 A;  5LJ3 e;  3MEU A;  1PSE A;  2DTH A;  4E7I A;  3I55 T;  5J3B A;  1WNL A;  2OTJ A;  3AT1 B;  4M4Z A;  1OV3 A;  4OB0 B;  2HSP A;  1AD5 A;  1M9S A;  1MUZ A;  4C8Q B;  3CQT A;  2O31 A;  2HL5 C;  4LDY A;  3EG9 A;  1Q86 R;  2QGG A;  1N8R C;  2QQS A;  2G6F X;  4FYY B;  2RI5 A;  3OYD A;  3KUF A;  1VA7 A;  4BY6 B;  2DO3 A;  3JCM h;  1GFD A;  2K7A A;  3SEM A;  2EGE A;  1M90 C;  1U8R A;  5IHI A;  4C8Q G;  2LJ1 A;  2JTM A;  1VQL T;  1ZQ1 A;  3S6W A;  4M7A E;  3FEO A;  3LGL A;  3HRT A;  1M1F A;  1W2B P;  2EIF A;  1YJW T;  4OGC A;  3OY9 A;  2LT1 A;  4RUG A;  1M1K C;  4M7A C;  2YSQ A;  1A0N B;  1HSQ A;  1K9M C;  3D7S B;  3VS4 A;  1KK7 A;  1ZA2 B;  1YP5 A;  1K73 R;  2JJ9 A;  4M75 B;  4O6J A;  3C12 A;  2EPD A;  4J7F A;  1PRL C;  4DOW A;  2DIL A;  2LT4 A;  1S72 T;  2CP3 A;  2DXC A;  1Q82 U;  4EIK A;  8AT1 B;  3L2Z A;  3HHT B;  2LQ8 A;  1WX6 A;  5D6X A;  2KI7 A;  1ABO A;  1K9A A;  5IHN A;  4BD3 A;  3J81 E;  2A3L A;  2CRE A;  4AMC A;  4M75 G;  4Z88 A;  4F7U B;  1ZSZ A;  2XID A;  4L6V 5;  1VQM T;  4NL2 A;  3PVQ A;  1PCX A;  4LDU A;  4PKC C;  3CME A;  1TOV A;  1M27 C;  1XNI A;  1NJI U;  4HCB A;  2RD1 A;  2DL7 A;  2HQX A;  3CMA Q;  3CME Q;  3M0U A;  1QCO A;  4F7U G;  3PT9 A;  4FSX A;  6AT1 B;  4LNP A;  1VYT A;  4KH1 B;  4XK8 E;  1TS9 A;  5GMK e;  3UAT A;  2LQN A;  4C5I A;  1N8R R;  1SKU B;  4PJM A;  4F16 A;  1PKS A;  2VXE A;  2HBW A;  1M3A A;  3RMQ A;  4EMG A;  2DXT A;  5GAM d;  2FPD A;  7AT1 B;  1M90 R;  3CCE T;  4MZP A;  1M30 A;  1TH7 A;  1WXU A;  4PNO A;  2LCC A;  2R58 A;  2CP5 A;  1X27 A;  2EJG A;  1H64 1;  3QWX X;  1M1K R;  1ZUU A;  3NHN A;  3CCL T;  5FWB A;  4M75 A;  2K9G A;  1UGR B;  1PM3 A;  1UDL A;  1XTD A;  2DEU A;  2ZPF B;  4DEX A;  2DTO A;  1YIT A;  5KCH A;  1QVF S;  1R77 A;  3GLX A;  4DBH A;  5KE3 A;  1UJY A;  4E7Z A;  1ZUK A;  1JU5 C;  3R6O A;  1YIT Q;  3EG2 A;  4KH0 B;  1NBE B;  1OYX A;  4F7U A;  4QQD A;  3CBP A;  1Q86 U;  3UF4 A;  4RTU A;  3X25 B;  1U3O A;  4M77 E;  1WXB A;  5D6Y A;  3P8H A;  1MV3 A;  2XK0 A;  4AG1 C;  2GCX A;  3UT1 A;  2XKO C;  4HXJ A;  5DLQ E;  3OYN A;  1BI0 A;  2P4T A;  3MPU B;  4TVR A;  1VQK T;  3VS5 A;  2ED0 A;  2AKL A;  1IHW A;  2DEQ A;  2OX7 A;  2D8J A;  3OS1 A;  2FVU A;  2VWF A;  4B6M A;  2QI2 A;  2RPN A;  1VQP A;  2COY A;  3JCM g;  4E7S A;  3M58 A;  1D0X A;  3JCM W;  1G8X A;  4HKE A;  2CDT A;  3IQL A;  2KMT A;  1BU1 A;  5CO7 A;  3CCR A;  1LCK A;  1GRI A;  4PFZ A;  3CCJ Q;  1VQP Q;  1K73 U;  3BW1 A;  5FU7 C;  4ATO A;  1FXX A;  3QDR B;  1M5Q 1;  2LTO A;  2DK3 A;  2HKN A;  1SEM A;  2D1X A;  2MIO A;  4NS5 A;  1B3Q A;  3CC2 A;  3GP8 A;  4WF2 A;  4HVV A;  1N5Z A;  1VQ6 Q;  4CC2 A;  3OYK A;  4FYV B;  4C0Z A;  1VIE A;  3O8V A;  3RER A;  2G3R A;  3CC2 Q;  4ESR A;  3CC4 Q;  1WDX A;  2EQJ A;  4JZ3 A;  3SHW A;  4LUE A;  3UA7 A;  4L5G A;  3TRE A;  1QQJ A;  3QII A;  3EG1 A;  1OOT A;  2KE9 A;  2YWW A;  3I56 T;  3HFO A;  2MAM A;  2P0Q A;  5CR2 A;  3J80 E;  4M7D B;  2YUO A;  1JRI A;  1GCP A;  4J7I A;  2YRD A;  1HD3 A;  3RES A;  1TUC A;  1UGS B;  3OYY A;  1WHH A;  5FLX E;  1RAI B;  2X4X A;  3RUX A;  2QK0 A;  1YIJ A;  3U23 A;  3FJP A;  4JRQ A;  2RB6 A;  2FPE A;  2QDL A;  3ME9 A;  3FRN A;  1KD1 C;  2GQI A;  4WCI A;  2YUP A;  4M77 B;  1M2O A;  3ASK A;  2XD0 A;  1YIJ Q;  4M7D G;  1SG5 A;  2K6D A;  3CXC S;  2EJF A;  2JS0 A;  3MO8 A;  2KRN A;  2F2W A;  2PVD B;  4Y91 A;  3CEY A;  4OP0 A;  1NE8 A;  1PC0 A;  2Y4Y A;  1NEB A;  1R8O B;  3OSV A;  3LGF A;  4A4K A;  4M77 G;  2E41 A;  5FU7 B;  4LE9 A;  1OPK A;  4OB1 B;  3JCM V;  1AEY A;  1Q81 C;  5CCA A;  4HVW A;  4JJD A;  5GAN j;  3LX7 A;  4N0A C;  5DM7 R;  4FM4 B;  2F5T X;  2M02 A;  3QHS A;  2QAZ A;  1KIK A;  1VQ7 A;  5IHK A;  1YNZ A;  1XOV A;  1KC8 C;  4FT2 A;  4ZGD B;  3FB9 A;  2LX9 A;  4C0F A;  1M3C A;  4CRI A;  1QVG S;  3REA B;  3VRY A;  1X6O A;  3G6E A;  2EYQ A;  1VQ7 Q;  2JTE A;  1RAF B;  4KGX B;  3H41 A;  1B07 A;  4RTZ A;  4M7D A;  4EMH A;  2PVG B;  2NUP B;  2LX7 A;  4OMF B;  1WI7 A;  1WLP B;  1VQ8 A;  4OB3 B;  3EGX B;  4XTU A;  3VUB A;  2CZ1 B;  4KRT A;  2A37 A;  2FRW A;  5CKE A;  1Y07 A;  3HP9 A;  2LMJ A;  4M77 A;  3PIP A;  2J6K A;  2OAU A;  1SHF A;  1V76 A;  1M2V B;  4IUP A;  3NMZ C;  1KD1 R;  3OMC A;  1WHM A;  2RK1 A;  4A63 B;  2D6F A;  3M9Q A;  2AIR B;  2DMO A;  2XDB A;  2DZ9 A;  1VQ4 T;  4K11 A;  1H3Z A;  3GBQ A;  1BK2 A;  1RLP C;  1W2B S;  1TUD A;  5GAN 2;  3G1J A;  1X75 C;  1OI1 A;  2KDS A;  2ROT A;  2GQV A;  4RTY A;  1YJ9 Q;  4FYX B;  3V7R A;  2EQK A;  1BIB A;  2YLC A;  4J9F A;  4ZGJ B;  2OJ2 A;  3CMA T;  3CME T;  5HK0 A;  2LQK A;  4BDY A;  2R57 A;  3PVL A;  3O5Z A;  2JTF A;  2EYX A;  4CI0 C;  3G71 A;  4Z89 A;  2EQI A;  1IRE B;  2LP5 A;  3CCV A;  2WSF E;  5KCO A;  4HVU A;  3A8M B;  4M7A F;  3VJP A;  2D9T A;  4OMO A;  4BE2 A;  2DF6 A;  2WAC A;  3CCV Q;  2K2V A;  2XHC A;  5D6W A;  2EFI A;  4EMK B;  2NUP A;  4J9E A;  2FO0 A;  2QTX A;  3EGX A;  3OW2 P;  4DQ2 A;  1JO8 A;  2IPO B;  3OS2 A;  1K8A R;  4OB2 B;  4J83 A;  2GFU A;  4PFP A;  3V8L A;  1PHT A;  3L1A A;  5D7U A;  1ZSZ C;  2CP6 A;  3RNJ A;  3VS7 A;  1VQ5 A;  3OSS C;  2RQW A;  4C8Q E;  4M78 D;  4XQ3 A;  2O88 A;  2I2L A;  2C06 A;  1QP3 A;  1UEC A;  1VQ5 Q;  3G4S A;  2KSS A;  4C8Q C;  1J3T A;  1MGQ A;  1VQO Q;  2DD4 A;  2E5K A;  3CBO A;  4MZT A;  1YIT T;  5HK3 A;  2CZ7 B;  2JW4 A;  2YXY A;  1QVF A;  1Q7Y U;  4BY6 C;  5KYY B;  2ROL A;  2CZ0 B;  3TVT A;  2NWM A;  2XDD A;  3BE3 A;  4DA4 A;  2M1H A;  4E7J A;  3QUI A;  5CIU A;  3BDL A;  4ZTF A;  1ZA1 B;  3OMG A;  5LJ5 d;  4N0A A;  3EH2 A;  2PU9 B;  4BAC A;  4ZGE B;  4N4H A;  1X69 A;  2AT1 B;  4PJN A;  5GAM f;  3M54 A;  4RKU E;  4V2S A;  1Y57 A;  1JJ2 P;  4M75 E;  4ANJ A;  1JQQ A;  4AFQ C;  2ECZ A;  1K0S A;  1IRX A;  1BYM A;  3CCM A;  2M0O A;  4M75 C;  4X1V A;  5GAN e;  4J9C A;  1YJN A;  1YWP A;  1T3L A;  2EKO A;  2EWN A;  3HRU A;  3G7Z A;  3L2R A;  4Y92 A;  2MCN A;  3CCJ T;  1VQP T;  1GXI E;  4C92 D;  3CCM Q;  2D0Q B;  2E6Z A;  2SEM A;  1G2B A;  2ESW A;  4KUI A;  3RR6 A;  3MEV A;  1TUG B;  3MEA A;  2HSE B;  4M78 F;  2A0F B;  4EPC A;  2EAY A;  4JLG A;  1FWZ A;  1VQ6 T;  3SD4 A;  2IIM A;  4OMP A;  3HRS A;  4ELY C;  1G3Y A;  3CC2 T;  1I8F A;  2QQB A;  3CC4 T;  4ORZ A;  2W0Z A;  3HKS A;  4BI3 A;  4FT4 A;  1Q95 G;  1VQ9 A;  3PE0 A;  4IUR A;  3E19 A;  3RIR A;  2OTJ Q;  2A08 A;  3M0T A;  4QW2 A;  5KYY A;  2KXD A;  4FSS A;  1VQ9 Q;  5LJ3 d;  2DLP A;  2P0P A;  4C5H A;  2RN8 A;  1X2K A;  3C0C A;  1T0H A;  4RTX A;  5CKH A;  5GAM h;  3H0I A;  1Z9Q A;  4KGZ B;  4OMN A;  3CCQ A;  4LN2 A;  3UA6 A;  5GMK h;  2K57 A;  4CC3 A;  1LVK A;  4GBQ A;  1YIJ T;  2BE7 D;  1MV0 B;  1ZBJ A;  2NUZ A;  2EYZ A;  3CCQ Q;  4C92 F;  3RDV A;  2J05 A;  2LNH B;  1AWO A;  5GAN g;  1K8A U;  3JB9 J;  1XJW B;  2P4R A;  1AZG B;  1OZ3 A;  1M1G A;  1MHN A;  2QDY B;  2EGA A;  3QZ9 B;  4LDV A;  1Y96 B;  1I07 A;  1C1A A;  3EFO B;  4OVA A;  1RAB B;  2VC8 A;  2DVE A;  1T0J A;  4LXC A;  2GF7 A;  4GLK A;  4BB7 A;  3L2V A;  1JXO A;  2EJ9 A;  3NPF A;  3LWH A;  2X3X D;  3V8J A;  2B86 A;  2MWO A;  2CZ6 B;  5A0L A;  3JB9 D;  3N5B B;  1AZE A;  4J5Y A;  1SRM A;  4BE1 A;  3JCM Q;  2XU8 A;  1AT1 B;  2KAF A;  3QXE B;  4XTX A;  1VQ7 T;  2NYS A;  4C8Q A;  3M53 A;  2KEA A;  3M59 A;  9ATC B;  1QVG A;  2K2M A;  1D1A A;  4PLL A;  1MMD A;  1WFW A;  2VAS A;  1TXQ A;  1QCN A;  2DBM A;  1WJQ A;  3JCM e;  4PJO E;  4A4F A;  4ELZ C;  3M56 A;  1ZLM A;  1W4S A;  1R0B G;  2JN0 A;  5IH2 A;  3GPL A;  1UFF A;  2H3E B;  2LJ0 A;  2ZPE B;  3EGU A;  4E7H A;  4PJO C;  3ZFJ A;  2VVK A;  2L5Q A;  2ZPI B;  4E7K A;  1E7O A;  5FU6 C;  1D1C A;  1HYO A;  4OMQ A;  2EVR A;  3CPW P;  4ME7 A;  4R56 A;  3M4G A;  1K9M R;  4N4G A;  5I2S A;  1R0C B;  2RHZ A;  2YT6 A;  2CH4 W;  3CCU T;  1Y96 A;  1MMN A;  3M57 A;  2L3S A;  2DX1 A;  2E3H A;  1YJ9 T;  4M7D E;  4D6W A;  3KFV A;  1QVP A;  1VQN T;  3JB9 F;  4IIO A;  5KYW B;  2MMP A;  4M7D C;  2K3Y A;  3P8D A;  4C5G A;  4FIB A;  4HT8 A;  2MWP A;  3GF5 A;  5FRO A;  4XAX B;  2F2V A;  1OQK A;  3SFM A;  1BCO A;  3H0F A;  2ABL A;  1GBQ A;  2RQT A;  2WSE E;  3DLL A;  4E47 A;  2EQU A;  3HPW A;  2IG0 A;  2LCS A;  4M77 C;  5I22 A;  1OU9 A;  1IGQ A;  4ZTJ A;  2O9S A;  4Q5W A;  5A0D A;  1V29 B;  2A7Y A;  1MND A;  3T9N A;  1WJS A;  2XIC A;  5A2Q E;  1ZBX A;  2K5L A;  3OBW A;  4RTW A;  1C6V X;  5GAM g;  1X6B A;  2FZK B;  2M51 A;  2ZZD A;  4IUV A;  2QAS A;  3I35 A;  2Y90 A;  1KG1 A;  2RO0 A;  4OML A;  3HL8 A;  2QA4 A;  3CCR Q;  2P84 A;  4PJO B;  4JS5 A;  2QEX A;  3A8G B;  2PZ1 A;  1VQ5 T;  2ZCF B;  4JZ4 A;  1M3B A;  4JRK A;  4JLI A;  3QWY A;  1VQO T;  2QA4 Q;  2JMA A;  4HCC A;  2JT4 A;  1RAD B;  2KR3 A;  5FU6 B;  4A54 A;  3JV3 A;  2X4W A;  4FCY A;  3LH5 A;  2QEX Q;  1SF9 A;  4J9B A;  3OYH A;  3TU4 K;  4F04 B;  4OGE A;  4HCZ A;  2DRM A;  3EG0 A;  2RHU A;  4DBF A;  2K3B A;  4PJO G;  3EAE A;  1N27 A;  2RMO A;  5GAO q;  4HCK A;  3I55 A;  3RMS A;  1GBR A;  5GAN 7;  2DNU A;  1UUE A;  3A8L B;  2QQ9 A;  2QG9 B;  1WXT A;  3RBB B;  1RAA B;  3QO3 A;  3WVE B;  1QP2 A;  1HXD A;  1I0C A;  4M78 B;  1N8R U;  4AFU C;  2VXF A;  1TWB A;  3SWN C;  3X24 B;  2DYB A;  4RMO A;  4FL6 A;  3QDF A;  4Z02 A;  4XTZ A;  1M90 U;  1WQW A;  2HKQ B;  3OB9 A;  3CCM T;  3Q1J A;  2RI3 A;  3A98 A;  2DXB A;  4C5E A;  4M78 G;  1NM7 A;  5LJ5 j;  1YJW A;  1IO6 A;  3MP1 A;  1M1K U;  2DIG A;  2JMC A;  5GAO m;  3HSB A;  2VGN A;  5CQY A;  1JJ2 S;  2X4Y A;  1NPR A;  3A8O B;  1K9M U;  1NLO C;  3M55 A;  2GTJ A;  4J8O A;  2PQW A;  3CBM A;  4PJO A;  4J6Y A;  2YUN A;  5IXF A;  2LVM A;  2K3X A;  1G3S A;  2RM4 A;  2KT8 A;  5FWC A;  5AYF A;  2JS2 A;  2OTJ T;  1RI0 A;  2FHD A;  3OBY A;  4PFO A;  4HT9 A;  2EGC A;  5EG2 A;  5LJ5 f;  4EDU A;  5KE2 A;  1ACM B;  1H8K A;  2E1H A;  1OEB A;  1VQ9 T;  1YWO A;  1RUW A;  1M8M A;  4MML A;  2FZC B;  1KQS S;  1TTH B;  3CC7 A;  3EH1 A;  4KUL A;  1BIA A;  3NFC A;  3QBY A;  4EMK C;  3L2W A;  3CC7 Q;  3G6E Q;  1NYF A;  1VYU A;  4M75 F;  3TQ7 P;  2DIQ A;  3VRZ A;  4M7A D;  5IN1 A;  3V7S A;  1XQH A;  2E6N A;  2LRQ A;  2SRC A;  3FIF A;  3CCQ T;  2F5K A;  2GFA A;  1PG5 B;  4DOV A;  3SWN B;  2QGF B;  4RTV A;  2NLU A;  1O9S A;  1VQ8 Q;  2FB7 A;  3GNF B;  4XU1 A;  4IUQ A;  4PJL A;  3KXT A;  4BUG A;  4F7U F;  3EHR A;  3M0P A;  3CCE A;  2HQH A;  3H0H A;  1LNX A;  5GAN 6;  4QVZ A;  2M16 A;  3VYH B;  1YCS B;  2DL8 A;  3M0R A;  2MI6 A;  2CGH A;  1M8V A;  2KYB A;  4JJB A;  2HAX A;  1VIF A;  2F1L A;  1UJ0 A;  2EKH A;  2X4J A;  1ZUY A;  2CSI A;  4F14 A;  1Q82 C;  1WHJ A;  3GNG A;  4OMM A;  2CP2 A;  4XU0 A;  3CCL A;  1HK9 A;  5FW9 A;  2OTL A;  4Z8A A;  3NTI A;  4WTO B;  5LJ3 f;  1M4Z A;  1CKA A;  5LJ5 h;  4OF1 A;  2AK5 A;  1Q81 R;  5AT1 B;  2OTL Q;  2DYI A;  3MP6 A;  5DLO A;  1NYG A;  3I9Q A;  1OX9 A;  3ZEH A;  1UGP B;  1RL2 A;  1KSW A;  2M9U A;  2CSQ A;  2KRS A;  2XDP A;  3CCS A;  4BI4 A;  3INZ A;  5KH6 A;  5GAO l;  1SRL A;  4LDW A;  1WQ7 A;  1JEG A;  1PKT A;  1KC8 R;  4XTY A;  2MK5 A;  4C0D B; 
#chains in the Genus database with same CATH homology
 1K0X A;  1RI9 A;  1ZUU A;  3NHN A;  3PE0 A;  5FWB A;  2K9G A;  2A08 A;  3M0T A;  2O9V A;  4ZNX A;  2CUD A;  2KXD A;  1UDL A;  2L0A A;  4FSS A;  5IXB A;  1TG0 A;  2DLP A;  4DEX A;  2YDL A;  1I1J A;  2RN8 A;  2HCK A;  2C0I A;  1X2K A;  3C0C A;  1T0H A;  4RTX A;  3VS2 A;  1UJY A;  1ZUK A;  1JU5 C;  3H0I A;  3FJ5 A;  1WIE A;  1Z9Q A;  4F17 A;  3EG2 A;  2L3Q A;  2GTO A;  1QKW A;  2DBK A;  2V1R A;  4OMN A;  1BBZ A;  3UF4 A;  4LN2 A;  3UA6 A;  1GL5 A;  2KBT A;  4CC3 A;  4RTU A;  4GBQ A;  2A36 A;  2D0N A;  1U3O A;  1MV0 B;  1UGV A;  1ZBJ A;  2NUZ A;  2K79 A;  5ECA A;  1Y0M A;  2EYZ A;  1WXB A;  1MV3 A;  2J05 A;  2LNH B;  4AG1 C;  1AWO A;  4HXJ A;  1QWF A;  2P4R A;  1AZG B;  3VS5 A;  1G83 A;  2ED0 A;  2AKL A;  2OAW A;  2D8J A;  1Z9Z A;  1K1Z A;  2HEQ A;  2EGA A;  1I07 A;  2VWF A;  1EFN A;  2RPN A;  1AWX A;  1NLP C;  1W1F A;  1T0J A;  2CDT A;  3IQL A;  1BU1 A;  1UHC A;  1LCK A;  1GRI A;  1JXO A;  3NPF A;  1UTI A;  2X3X D;  2B86 A;  1ZSG A;  2PTK A;  1AZE A;  2BTT A;  1SEM A;  1SRM A;  2A28 A;  1E6G A;  2D1X A;  2MIO A;  2V1Q A;  4J9H A;  1B3Q A;  2HDA A;  1GFC A;  4HVV A;  1N5Z A;  2FG0 A;  2KEA A;  4CC2 A;  1AWW A;  2JXB A;  4J9D A;  2K2M A;  4ESR A;  1WDX A;  1WFW A;  2FRY A;  3I5R A;  2F2X A;  4JZ3 A;  2W10 A;  4DEY A;  2DBM A;  3ULR B;  3SHW A;  4LUE A;  3R6N A;  3UA7 A;  2KNB B;  3EG1 A;  1OOT A;  2KE9 A;  1KJW A;  2DRK A;  1K4U S;  2KGT A;  2CT3 A;  2YUQ A;  1ZLM A;  5IH2 A;  2LQW A;  3THK A;  2YUO A;  1UFF A;  2LJ0 A;  4QT7 A;  1GCP A;  3EGU A;  1E6H A;  2EBP A;  5GJV B;  1HD3 A;  1TUC A;  2VVK A;  1UHF A;  3REB B;  1E7O A;  4CC4 B;  3U23 A;  4OMQ A;  2EVR A;  2FPE A;  1CSK A;  1GCQ A;  2QDL A;  2GQI A;  2CT4 A;  4WCI A;  2J7I A;  2YUP A;  5GJW B;  3ZL7 C;  1S1N A;  2YT6 A;  2JM8 A;  2CH4 W;  2K6D A;  3VS6 A;  2ENM A;  2DL5 A;  2JS0 A;  2L3S A;  2RQV A;  2DX1 A;  2KRN A;  1JXM A;  2F2W A;  2X3W D;  2CH4 A;  3KFV A;  1H3H A;  1OPL A;  1NEB A;  1ZX6 A;  1RLQ C;  4IIO A;  2GBQ A;  4RTT A;  5HCK A;  4JJC A;  2DA9 A;  2F2V A;  1H92 A;  2DL4 A;  1V1C A;  3VS1 A;  4LE9 A;  1OPK A;  3H0F A;  2ABL A;  1AEY A;  4J9G A;  1GBQ A;  2RQT A;  1NG2 A;  2BZY A;  2J6O A;  1PRM C;  2EYW A;  2I0N A;  4HVW A;  4JJD A;  2KYM A;  1W70 A;  2XMF A;  2OI3 A;  3I5S A;  2BZX A;  2LCS A;  1QKX A;  5I22 A;  1AOJ A;  2O9S A;  2M0Y A;  1W6X A;  1KIK A;  2LJ3 A;  1K76 A;  1YNZ A;  1XOV A;  2EYY A;  5IHK A;  3VS3 A;  1SPK A;  2GNC A;  4IIM A;  1M3C A;  3REA B;  3VRY A;  3EHQ A;  4RTW A;  2JTE A;  1SSH A;  1X6B A;  2M51 A;  3H41 A;  1B07 A;  4RTZ A;  3I35 A;  2LX7 A;  4OML A;  1WI7 A;  1X43 A;  1WLP B;  2PZ1 A;  2KRM A;  4JZ4 A;  1M3B A;  1QWE A;  2JM9 A;  4KRT A;  2A37 A;  2FRW A;  3QWY A;  4LUD A;  2JMA A;  2JT4 A;  2KR3 A;  5EC7 A;  3JV3 A;  2LMJ A;  3LH5 A;  2ED1 A;  2J6K A;  4J9B A;  2RQU A;  1SHF A;  2DRM A;  3EG0 A;  3NMZ C;  4AFS C;  2K3B A;  4A63 B;  4GLM A;  1ABQ A;  2DMO A;  2AKK A;  2RMO A;  3TSZ A;  4D8D A;  4K11 A;  3GBQ A;  1BK2 A;  4HCK A;  1RLP C;  1GBR A;  2O2O A;  1TUD A;  2DNU A;  1UUE A;  1X2Q A;  2BZ8 A;  1WXT A;  2DE0 X;  3RBB B;  2DVJ A;  2RQR A;  1KFZ A;  1YN8 A;  2D8H A;  2ROT A;  1UE9 A;  4AG2 C;  2DJQ A;  4AFZ C;  2EW3 A;  1I0C A;  1NEG A;  4RTY A;  4AFU C;  1AVZ C;  2VKN A;  1SHG A;  1FMK A;  2H8H A;  2RNA A;  2DYB A;  4J9F A;  1T3S A;  2OJ2 A;  2DM1 A;  2FPF A;  2DL3 A;  4D8K A;  2KXC A;  1QLY A;  3PVL A;  3A98 A;  2CUB A;  3O5Z A;  2EYX A;  1X6G A;  4Z89 A;  2EQI A;  4M4Z A;  2LP5 A;  1NM7 A;  1OV3 A;  4JPB W;  1IO6 A;  2HSP A;  1U06 A;  2JMC A;  1AD5 A;  1MUZ A;  2C0O A;  4HVU A;  3CQT A;  2O31 A;  2J06 A;  4OMO A;  2DF6 A;  3VS0 A;  2G6F X;  1NLO C;  2GTJ A;  2AZS A;  4J9E A;  1VA7 A;  2FO0 A;  1GFD A;  2K7A A;  2AZV A;  3SEM A;  4E6R A;  2YUN A;  5IXF A;  1JO8 A;  2EGE A;  2C0T A;  4R0K A;  2KT8 A;  5FWC A;  5IHI A;  2JS2 A;  2LJ1 A;  1PHT A;  3NGP A;  2MOX A;  3RNJ A;  2EGC A;  3VS7 A;  2RQW A;  1H8K A;  1OEB A;  2O88 A;  1YWO A;  1UEC A;  1RUW A;  1M8M A;  4RUG A;  3TSW A;  1ARK A;  2KRO A;  1WA7 A;  2YSQ A;  1A0N B;  1AWJ A;  1J3T A;  1HSQ A;  3VS4 A;  2E5K A;  1YP5 A;  2KT1 A;  2J6F A;  1WYX A;  2JW4 A;  2EPD A;  1PRL C;  2DIL A;  1NYF A;  4CC7 A;  2ROL A;  1VYU A;  3TVT A;  2NWM A;  2RF0 A;  3VRZ A;  4EIK A;  2L3P A;  2SRC A;  1WX6 A;  1ABO A;  1K9A A;  5IHN A;  1PNJ A;  4RTV A;  2CRE A;  4Z88 A;  1X69 A;  1Y57 A;  1FYN A;  1HJD A;  1CKB A;  3PVQ A;  1QCF A;  1JQQ A;  4AFQ C;  3EHR A;  2ECZ A;  3M0P A;  3H0H A;  1K0S A;  1PWT A;  2L2P A;  1M27 C;  1UG1 A;  1YCS B;  2DL8 A;  3M0R A;  4X1V A;  1GCQ C;  2KYB A;  4JJB A;  4J9C A;  1YWP A;  1T3L A;  2DL7 A;  1UJ0 A;  2EKH A;  2PNI A;  4Y92 A;  1ZUY A;  1BB9 A;  2CSI A;  3M0U A;  2MCN A;  4F14 A;  4OMM A;  3M0S A;  2SEM A;  1G2B A;  2ESW A;  4LNP A;  1VYT A;  5FW9 A;  3M0Q A;  3UAT A;  2LQN A;  4Z8A A;  4F16 A;  5L23 A;  1PKS A;  2HBW A;  1CKA A;  1M3A A;  5I11 A;  2FEI A;  2AK5 A;  2FPD A;  1NYG A;  3I9Q A;  2IIM A;  4OMP A;  1U5S A;  1VYV A;  1M30 A;  1WXU A;  1KSW A;  2GGR A;  4ORZ A;  2W0Z A;  2CSQ A;  2KRS A;  1X27 A;  3EG3 A;  4J9I A;  1SRL A;  1JEG A;  1PKT A;  3QWX X;  2LZ6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...