1E6HA

A-spectrin sh3 domain a11v, m25i, v44i, v58l mutants
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
b'DETGKELVLVLYDYQEKSPREVTIKKGDILTLLNSTNKDWWKIEVNDRQGFVPAAYLKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN
molecule tags Sh3-domain
source organism Gallus gallus
publication title Conformational Strain in the Hydrophobic Core and its Implications for Protein Folding and Design
pubmed doi rcsb
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1e6hA00
3ULRB 1RUWA 1UUEA 1A0NB 2YUPA 2P4RA 2DILA 4M4ZA 1UE9A 1WDXA 3EHQA 3H0IA 2RQUA 1WLPB 2V1QA 3EGUA 5ECAA 1FMKA 1K0XA 1M30A 2C0TA 2ESWA 2EQIA 3EG3A 1YWOA 2YUOA 1NYFA 1ZSGA 4LUDA 4AFQC 2HDAA 3VRYA 2O88A 2FEIA 4RTUA 3C0CA 2GTOA 2RQRA 3VS1A 1GCQC 1U5SA 1SHGA 2W0ZA 2K7AA 2DA9A 3H0HA 3M0UA 1OPKA 1ABOA 2DF6A 4F16A 2ABLA 2JM9A 1JQQA 1NEBA 3M0SA 5IHIA 1YP5A 2H8HA 2JMAA 4HVWA 2JS2A 2J6OA 3RNJA 1AZEA 3SHWA 2K2MA 1UJYA 4AFZC 2HEQA 1NEGA 2L3SA 1CKAA 1M3AA 2JM8A 2RQWA 1MV0B 1SRLA 1RLPC 1TUCA 2X3WD 4R0KA 2DL8A 3ZL7C 1K4US 1AWXA 1AEYA 4RTVA 4Z88A 1CKBA 2EGCA 2LQNA 3EHRA 2EYWA 1T0JA 1JXMA 2LNHB 1SRMA 2MOXA 4D8DA 5IXFA 2F2XA 2DRKA 1WXBA 4LUEA 5IHKA 2LJ0A 3I35A 2JS0A 1E7OA 2FPDA 3UA6A 1M27C 3VRZA 2LCSA 2EBPA 1AWJA 1RI9A 4JZ3A 2YDLA 3SEMA 3FJ5A 2J06A 3VS7A 2GGRA 1QKXA 2JT4A 4Y92A 1U06A 1YWPA 1X6GA 2K79A 4JJCA 2JMCA 3TVTA 1T0HA 2QDLA 3VS6A 1NG2A 4X1VA 3TSWA 3VS3A 1HD3A 1QWEA 2EW3A 2SEMA 2W10A 1U3OA 3QWXX 2BZ8A 2K9GA 1BB9A 1AWWA 2DYBA 2LX7A 4F14A 2CUDA 2FPFA 4J9HA 2CT4A 2YUNA 3CQTA 4JPBW 2RNAA 1I1JA 4IIMA 4GBQA 1ZUKA 1JXOA 1GBRA 5HCKA 2CH4A 2KNBB 4OMMA 1MV3A 1B07A 2O9VA 4EIKA 1SSHA 2HSPA 1QKWA 1J3TA 1I07A 5IXBA 2RQTA 2LQWA 1QCFA 1TUDA 1PKTA 2J6FA 1WXUA 2ENMA 2L3QA 4A63B 2HBWA 4CC3A 1GL5A 2DJQA 4ORZA 2GNCA 3VS4A 4FSSA 1H3HA 1QWFA 1N5ZA 1WIEA 3GBQA 3I9QA 4J9FA 2DMOA 1X6BA 2CT3A 4AFSC 2DBMA 4DEYA 2DNUA 2KYMA 5L23A 2F2VA 2CH4W 3R6NA 3REAB 2DLPA 2KBTA 1BBZA 1KFZA 1GCPA 2LZ6B 2GBQA 1WI7A 4RUGA 3EG2A 1G2BA 2CSIA 2KGTA 1QLYA 3IQLA 2D1XA 3PVLA 4AFUC 4Z89A 1UHCA 3M0PA 2EKHA 1OOTA 3EG1A 4J9IA 2F2WA 4J9BA 1WX6A 4ZNXA 3REBB 4RTWA 1VA7A 1AD5A 2KT1A 1ZBJA 4LE9A 2FPEA 2KYBA 2KRMA 1EFNA 3M0QA 2L2PA 1JU5C 1UFFA 2EYXA 2VWFA 2LMJA 2K6DA 2DM1A 5FW9A 1TG0A 1HSQA 3TSZA 2KRNA 2CDTA 2AZSA 1RLQC 2BTTA 1X69A 1WFWA 1OPLA 3I5SA 2E5KA 1SEMA 2A08A 5FWCA 2DBKA 1T3SA 2V1RA 5GJWB 3RBBB 3PE0A 2ECZA 2JTEA 3VS5A 1FYNA 1VYVA 1K9AA 1JO8A 2DL4A 3NPFA 2SRCA 4LN2A 2AK5A 1M3BA 1AVZC 2FG0A 2O9SA 2KXDA 4J9CA 2X3XD 1KJWA 1IO6A 3EG0A 2DRMA 2DVJA 4HCKA 5GJVB 2DL3A 1GFCA 2ROLA 4OMNA 2RMOA 1ZUYA 2D0NA 2FRYA 2FO0A 2J7IA 4HVVA 1PKSA 1GRIA 1UGVA 2J05A 2A36A 2CSQA 5FWBA 1NLOC 2ED0A 1ARKA 2D8HA 1K1ZA 1PRMC 4GLMA 4RTYA 4CC2A 4RTTA 3UF4A 4OMPA 1M3CA 2JW4A 4RTZA 2HCKA 1GFDA 2RN8A 1YN8A 2PTKA 1I0CA 1ZUUA 2C0OA 2YUQA 2M0YA 2KT8A 4OMOA 2CREA 2OAWA 4QT7A 3A98A 2RF0A 2A37A 1S1NA 3I5RA 1UECA 1NYGA 2L3PA 3JV3A 1H8KA 1NLPC 5I22A 1WYXA 3LH5A 1GBQA 1WXTA 3UATA 2K3BA 1XOVA 4Z8AA 1X27A 1X2KA 1GCQA 2EGAA 4J9DA 3KFVA 2ROTA 4F17A 2MIOA 2LJ3A 3M0RA 4ESRA 1KIKA 2DX1A 1E6GA 4J9GA 4HXJA 3H41A 1UG1A 2EYYA 1UDLA 1V1CA 4OMLA 2LP5A 4OMQA 1M8MA 1H92A 2LJ1A 2RPNA 2RQVA 5I11A 2VVKA 1AOJA 2EVRA 4AG2C 1BU1A 3QWYA 2AKKA 1LCKA 1ZX6A 3UA7A 2J6KA 2KROA 1VYTA 1KSWA 1W6XA 1OV3A 2EPDA 2M51A 2PZ1A 5IH2A 4J9EA 4JJDA 1CSKA 1ZLMA 1JEGA 2GQIA 1NM7A 2O31A 1UJ0A 1OEBA 4JJBA 5EC7A 3NHNA 2EGEA 1Y57A 1AWOA 1Y0MA 2CUBA 2G6FX 2DL5A 3U23A 1Z9ZA 4RTXA 1X43A 2NUZA 4AG1C 3THKA 1W70A 2KXCA 4WCIA 1SPKA 2OJ2A 3VS2A 1K0SA 2KEAA 2MCNA 2BZXA 4CC4B 1VYUA 2KR3A 1W1FA 4KRTA 2NWMA 1WA7A 3O5ZA 2EYZA 1Z9QA 2B86A 4IIOA 1HJDA 2L0AA 2AZVA 1T3LA 2JXBA 2PNIA 1PRLC 3PVQA 2DL7A 2ED1A 2XMFA 2C0IA 1ABQA 1PWTA 2A28A 2YSQA 1PHTA 4HVUA 4JZ4A 1MUZA 2OI3A 1B3QA 1UTIA 2BZYA 1YNZA 4K11A 1BK2A 1YCSB 2KE9A 2D8JA 1K76A 2DE0X 1G83A 1UHFA 1SHFA 2KRSA 2O2OA 2GTJA 1AZGB 1E6HA 4LNPA 2AKLA 2VKNA 2FRWA 3H0FA 3M0TA 1X2QA 5IHNA 4D8KA 1PNJA 4DEXA 4CC7A 3NGPA 4E6RA 3VS0A 2YT6A 2I0NA 3NMZC 2IIMA
chains in the Genus database with same CATH superfamily
1B34A 1RUWA 2NUTB 4ELYC 3G71T 2P4RA 2E1HA 4M4ZA 3JCMP 3CCSA 1VQ6T 4Q5WA 4M75D 2V1QA 3EGUA 5ECAA 1FMKA 1OU8A 2ZAEA 2QA4Q 2YUOA 4KT0E 4BI3A 3VRYA 4RTUA 2PUOB 1YJWT 3RERA 3VS1A 4IURA 1Q7YR 2GF7A 2NUPB 2B8AA 2L5QA 1VQNQ 2DF6A 4F16A 2I2LA 2COZA 1VQKA 1GXIE 3CC7A 2D6FA 2JMAA 1YJ9T 4O5VA 1F1BB 4C5IA 2K2MA 3A8OB 5GAN7 2ZPGB 1UJYA 5GMKm 4AFZC 1NEGA 3OS1A 4XTZA 1M3AA 2X51A 1X6OA 3RDVA 1BCMA 2NUTA 1SRLA 3OYHA 3CXCA 3HPWA 2M02A 2DL8A 3EH2A 3ZL7C 4YTLA 3VYGA 4KH0B 1PD1A 4PLIA 2LQNA 4IUQA 3QPHA 2MOXA 1VQ4Q 3CD6A 1K9MR 1VQNA 2DRKA 5CR2A 4LUEA 3C12A 4D6WA 2JS0A 1WZOA 3GPLA 2NUPA 5GANg 4N0AA 1KG1A 3RKXA 5D6YA 1AWJA 1RI9A 3E1SA 4JZ3A 2YDLA 2FZKB 2QGFB 2J06A 1VQ7Q 4Y92A 1QKXA 2VC8A 4PNOA 1YWPA 3QYHB 4XU1A 1T0HA 4EMKB 4A4FA 4C8QD 2QDLA 1NG2A 3G4SA 3TSWA 1QWEA 2BZ8A 1KC8U 2HNIA 2DYBA 4VUBA 2LQ8A 1M4ZA 4C0FA 1I8FA 5GAN3 5GAN2 2HQHA 2CT4A 2YUNA 3P8DA 3HL8A 1I1JA 4M7AA 1YI2Q 2CH4A 4M7AD 4OP0A 2CP7A 4C8QB 3OS2A 1VUBA 2O9VA 5A0DA 1QKWA 1J3TA 1I07A 5FLXE 2M9UA 1G3TA 3OMGA 1N9SA 2RO0A 1WXUA 1PSFA 4A63B 5GANf 4M78F 3V7SA 5CQYA 1H3HA 1Q7YU 1TTHB 1K9MC 4PJJA 1WIEA 3GBQA 5GAOp 3EG9B 1JRIA 3PT9A 1RAHB 3JCMJ 5LJ3f 2DMOA 2CT3A 4AFSC 2OTJT 2DBMA 1W2BP 4HCCA 4FW1A 5KYNA 2O4XA 3CC7T 3FEOA 1BBZA 4J7FA 4RG8A 2CP5A 4RUGA 1G2BA 4N0AC 1MMDA 4M77B 3EAEA 2KGTA 4JLIA 5LJ3g 3PVLA 2EWNA 1UHCA 3BDUA 3M0PA 5IAYA 1YJWA 3EG1A 5M9OA 4J9BA 4XTVA 4XK8E 4ZNXA 4M78E 1EX4A 1WHMA 3SWNC 1TSFA 3M0QA 1VQ4T 3A8LB 4HCZA 1AHJB 1PSEA 2K6DA 4QQ6A 1VQLT 4LDUA 2DPPB 4TVRA 1QVFP 1RLQC 2BTTA 3JAME 1IGQA 3TU4K 2LDMA 4ZGEB 1VQMA 2DTHA 2X9HA 5LJ5f 4DA4A 2VASA 1NJIR 1K9AA 3GIBA 1FXXA 4JJNK 4UC4A 4PLLA 1AVZC 5KYWB 2O9SA 3FB9A 1IO6A 1M5Q1 2DVJA 2XI9A 3CEYA 2E4HA 2JZ2A 3HHTB 3M4GA 4IUTA 1M90R 2FO0A 3CXCP 2DEUA 1VOMA 1NLOC 4KBMB 2ZPFB 4OB1B 2FZCB 2YRCA 1K1ZA 3CCET 3CCVA 1PM3A 1X75C 4E7IA 1KD1R 2LNVA 2HCKA 2RN8A 4J8OA 3HRTA 2PTKA 5CKHA 2CP0A 2DFUA 1I0CA 2RH2A 2M1HA 2QQRA 1ZUUA 2C0OA 4PJNA 2PQWA 2RF0A 3J7AF 2L3PA 5I22A 1NLPC 4C0ZA 4IKFA 2A0FB 1FWZA 3QUIA 3FDRA 4A4GA 3UATA 4KULA 2FB7A 4C0GA 3OW2S 2K3BA 2YRDA 4FCYA 2M0OA 1X2KA 4E7ZA 1GCQA 2EGAA 4F7UA 3CMEQ 1ZA2B 3M58A 4F17A 3JCMe 4F7UG 2RJDA 4M75C 4ESRA 2XD0A 9ATCB 4OVAA 2DYIA 4DQ2A 1E6GA 4HXJA 4J83A 2ZPEB 1UDLA 1K8AC 2OTLQ 4PKCC 3INZA 4DBFA 4M7DC 1U1SA 1YJNQ 1M8MA 3MP1A 1H92A 5I11A 5KH6A 1XNIA 1AOJA 3M55A 3JB9J 1PC0A 5J39A 5GAOm 1BU1A 4M7AC 3I56Q 1KQSA 3GLXA 2CP3A 2BIVA 4CI0C 2EPDA 2M51A 2PZ1A 5FROA 5IH2A 1CSKA 2GQIA 3VU3C 2E3IA 2Y90A 4B9WA 2IPOB 1QVGA 1Y57A 3AT1B 1WHKA 3SWNB 2CUBA 3V7CA 2G6FX 3V7RA 1WQWA 3CCUA 3OYNA 1WJQA 1YIJA 4AG1C 3THKA 2KXCA 3NFCA 4II1A 3LWIA 1SPKA 1K0SA 2MCNA 2C06A 1VYUA 3X26B 2Y4YA 3QSUA 1SKUB 4JRKA 1WA7A 2A3LA 1Z9QA 2B86A 1HJDA 1ZQ1A 2L0AA 1BI2A 2AZVA 1VQ5Q 1PRLC 2XMFA 2LRQA 1WQ7A 2A28A 3PMIA 1OQKA 1QCOA 3RUXA 4BE0A 5LJ5d 1QVPA 1VQPA 2G3RA 3BW1A 4DBRA 2P4TA 2KDSA 1RADB 2KSSA 1VQ8T 2MPXC 1N6AA 3DLLA 1KQSS 1YNZA 3ME9A 1YCSB 5DM7R 3OSVA 2D8JA 2LVMA 1G83A 2XG8D 3PMTA 5DY9A 3ZFJA 3CXCS 4EPCA 3UT1A 1OX8A 3JCMb 3EGXB 3T9NA 3G6EA 1X2QA 4PJMA 1BI1A 2VXFA 3LYIA 3NGPA 5CO7A 3NMZC 3CC2T 1UUEA 4FIBA 2QEXQ 1A0NB 1V29B 1UE9A 1WDXA 1WPYA 5HKCA 3EHQA 4RKUE 1G5VA 1WLPB 3QO3A 2QYZA 2K2VA 4EMHA 2DJZA 1M30A 3CCEA 4BACA 5FRMA 2ESWA 3MEWA 3EG3A 3HTRA 1YWOA 1TH7A 1ZSGA 2HDAA 2O88A 2FEIA 3MJXA 3O8VA 1G8XA 1TOVA 3CCJT 2JTFA 5GAMe 4AT1B 2HBPA 2HQEA 2QI2A 3FLGA 1ABOA 2GCXA 4GLKA 3JSCA 3CC4T 1JQQA 3M0SA 4HT9A 5IHIA 5KE2A 3EGDB 4C8QE 3VV0A 3VUBA 5LJ5g 1NBEB 2MWOA 5LJ5h 2JJ9A 2HEQA 4PJOC 3HRUA 2Y4XA 2BE9B 1EIFA 3GP8A 2PVOB 2JM8A 4BE2A 5KYYB 4RMOA 2X3WD 4OF1A 1QP2A 4LXCA 3JCMQ 1VQLA 3CCQA 2XDBA 3EHRA 4LDYA 4PJOG 1Q86C 1JXMA 1TWBA 2MMPA 4PFOA 4B6MA 1WXBA 2WACA 1YHQT 2P0PA 1Q81C 1KHIA 3MHXA 4JRPA 4L5GA 2LCSA 3J80E 2PVDB 4BUGA 2XICA 1W4SA 2E6NA 3FJ5A 2Z0WA 4BDZA 2JT4A 2CZ0B 4X34A 1U06A 5GAN6 1X6GA 5LJ3j 3CCLT 3OW2P 3R6OA 3UDCA 2XDPA 3VS6A 4KH1B 2HQXA 1U3OA 2IVWA 3QWXX 2DETA 1BB9A 3VUZA 4E7HA 3MP8A 4M75F 4JPBW 3OYIA 3GNGA 4MDWA 1VQ9Q 1K8AU 4IIMA 4C92B 1B34B 3A5ZB 2RHIA 3JCMd 1SG5A 2YXYA 3CPWA 1WHJA 4CRIA 5I21A 4AMCA 2RQTA 2RI2A 2VXEA 2QTXA 1PKTA 4A4KA 5AT1B 3RMQA 3Q1JA 1QP3A 4CC3A 2LTOA 2RHXA 2DJQA 2YLBA 2GNCA 4C92G 3VS4A 3FC3A 2QG9B 4KUDK 1YHQA 1RAEB 3I9QA 1VQ7T 4JRIA 4J9FA 2QQSA 4DBHA 3GF5A 1M1FA 1S72T 2KYMA 5L23A 2CH4W 3R6NA 1OZ2A 5KYUB 3G4SQ 2CYZB 1HK9A 1RL2A 5KYXB 1VQ9T 2K3YA 1Q81R 1S72A 1O9SA 1N27A 1VIEA 4ZTFA 2GFUA 3E2UA 2EKHA 2YWWA 3M5AA 2CZ6B 4J9IA 3CMEA 3OSSC 4EDUA 3OS0A 4M78G 1WX6A 4BI8B 2V8JA 3REBB 4MZPA 3CD6T 1AD5A 4LDVA 3X25B 1ZBJA 2KRMA 4FW2A 4F04B 1JU5C 1LOJA 2EYXA 2QQ9A 2LMJA 2RB6A 2DM1A 1TG0A 1KQ1A 2QGGA 2KRNA 4J6XA 4C5HA 5CKDA 2DK3A 3LGLA 3S6WA 2A08A 4QQGA 1T3SA 3SD4A 1QCNA 1JBMA 4M7AG 2QK0A 2QQBA 3FIFA 2JTEA 3VS5A 5HK0A 1VYVA 3NPFA 5GAMj 2F1LA 2SRCA 4ZGJB 1M3BA 2DTOA 1YJ9A 1EZZB 1Q82C 3HRSA 1K73C 4M75A 5GJVB 1VQOT 4N4GA 2JUFA 5FU7C 2P0KA 3G6ET 4OGEA 2ROLA 2RMOA 1ZUYA 5GAMd 2FRYA 1XTDA 1GRIA 4M7DE 4BD3A 2D8HA 1PRMC 4C8QC 1K8AR 4CC2A 4IUUA 4NL3A 1VQ6A 3DLMA 1U1TA 1WNLA 1VQPT 3CCQT 3G71A 2DAQA 4M78B 1B7TA 4ZTJA 4E7KA 2M0YA 2KT8A 1YI2T 2QEXT 2BKDN 1H641 4M78C 2A7YA 4QT7A 4RCBA 1K9MU 3TCJA 1IHWA 3LH5A 2RD1A 2R5MA 2O4XB 4C92F 1GBQA 2QDYB 3OYGA 5IT9E 2ZGWA 1QVFS 4M77D 1XOVA 3V8JA 1YIJQ 3PIOA 1YITT 1YIJT 2EAYA 3CC4A 4M77F 3WVDB 1ZA1B 2ZPIB 2NYSA 1KD1C 1KIKA 4HT8A 2X4WA 1Q81U 2ATCB 3KBGA 3H8ZA 3ASKA 2EYYA 3FJPA 2K57A 4OMLA 4BY6C 1U8RA 1PD0A 1UGSB 2RPNA 1VQ5T 3QJ6A 4NS5A 2RQVA 3CCMQ 5LJ3e 4PJLA 5DLOA 1YBYA 4BE1A 2EVRA 4J5YA 4AG2C 3QG1A 1M90C 1ZX6A 3G7ZA 3UA7A 2J6KA 3OQ5A 4KGVB 1VYTA 1KSWA 3JCMV 1OV3A 1MMGA 4J9EA 2DIQA 1TUGB 1JEGA 1NM7A 2O31A 1UJ0A 4QVZA 3SFMA 4O6JA 5EC7A 2E6ZA 1NJIC 1G3WA 2WSCE 1M1KR 3H9NA 1KQSP 1AT1B 1Z9ZA 2MI6A 4RTXA 4A54A 4WCIA 4M7DG 3VS2A 4A4HA 2DZCA 4PJOB 1C0MA 5GMKe 5D6XA 2KR3A 4J7IA 2X35A 2NWMA 2EYZA 3OYAA 4IIOA 3EFOB 3X24B 1Q95G 3E9FA 2PNIA 5A0LA 3LX7A 2DXUA 2ED1A 4XTXA 1D1CA 5GMKi 1VQ8Q 4ZN3A 1M2OA 4KGZB 5CIUA 1PHTA 1JJ2A 2VYTA 3TEEA 2LCCA 4JZ4A 2QA4A 1OX9A 5LJ3d 5CKBA 4M7AE 2CS7A 4K11A 1RAGB 5GAN8 2DE0X 3CCUT 1MNEA 3CCMA 3C95A 3QZ5B 2GTJA 1E6HA 3BDLA 3M57A 2AKLA 4FM4B 3C4SA 3CCUQ 2FRWA 5CKEA 4Z02A 4HCBA 3M0TA 2AT1B 5IHNA 4D8KA 4E6RA 4XU0A 3VS0A 4QKUA 4FT4A 3ULRB 2ZPBB 3OB9A 2JOYA 2C0TA 3OYDA 3CBMA 3S3NA 2EQIA 4C8QG 1WJRA 2RHZA 4ZN1A 3TQ7P 2DIGA 1NJIU 2EIFA 3KUFA 4LUDA 4WTOB 2LQKA 3C0CA 2GTOA 3E19A 2EKOA 1U5SA 1SHGA 2W0ZA 2K7AA 3PTAA 3H0HA 3M0UA 1VQ4A 1OPKA 2RHUA 4FYVB 2ABLA 2DERA 1NEBA 2XIDA 1RABB 1V76A 3M59A 1YP5A 2H8HA 4C5GA 3OMCA 4JS4A 3LLRA 3LGFA 3CC7Q 2JS2A 1AZEA 1ZHIA 2KAFA 3JCMf 4J6WA 2HL3A 3CPWP 2L3SA 3I55A 2RA2A 3BFMA 2RQWA 1MV0B 1AWXA 4RTVA 4Y91A 5GAN4 2LT1A 2EGCA 1UGRB 2EYWA 3MEVA 3CCLQ 2OTJA 3C94A 5D6WA 3CCVT 4D8DA 3EG9A 5IHKA 2LJ0A 3I35A 4PL6A 1KQ2A 2FPDA 3UA6A 4GY5A 1M27C 1VQLQ 3VRZA 4HKEA 2EBPA 5A0GA 4RCCA 3SEMA 2GGRA 3L2VA 3HFNA 2K79A 3I55Q 4JJCA 1BIBA 3TVTA 2W10A 5J3BA 2K9GA 3DB4A 1D0ZA 3OYBA 2FPFA 2DXTA 3JCMc 4J9HA 6AT1B 1PG5B 3JB9D 3OS5A 2RNAA 3QYGB 5LJ3h 4E7JA 2HMAA 5L8RE 1JXOA 1GBRA 1Q7YC 5HCKA 3CD6Q 3QIIA 2KNBB 3V8LA 4OMMA 5D7UA 1MV3A 3S3MA 1B07A 2VGMA 4E47A 1SSHA 1JJ2S 3CCQQ 2COWA 4C92D 1QMCA 2LQWA 1IGUA 1TU0B 2V8KA 1M1KC 2ENMA 2RJEA 1M2VB 3OYEA 5J26A 1D0YA 3CCJQ 2OAUA 4BDYA 1R0BG 2QXFA 1N5ZA 3BY7A 2XK0A 5CQXA 3CMAQ 3ZBDA 3EH1A 2LX9A 4M75E 4M75G 1VQOQ 3EGDA 4PFZA 3REAB 4C8QF 3E9GA 1IXDA 2DLPA 4A53A 1JJ2P 2KQWA 3P8BB 1KFZA 4E7LA 1GCPA 5LJ5j 2LZ6B 2GBQA 3CBOA 3EG2A 5KYUA 5CCAA 1OYXA 2XKOC 3JB9G 1QW1A 4ANJA 5GANh 3IQLA 4Z89A 1X01A 3JCMg 3L2RA 2F2WA 4M7DD 4LDWA 2KT1A 5GAMf 1QVGP 4LE9A 2FPEA 2KYBA 2JNGA 1NPRA 5CAIA 4BB7A 3CCLA 1EFNA 2GQVA 2L2PA 4JDSA 5GAOr 4LDXA 2OTJQ 4KGXB 2OX7A 5A2QE 1NPPA 5FW9A 1RAAB 3TSZA 2E12A 1FMVA 1SF9A 1WFWA 2E5KA 1R77A 1SEMA 3CCVQ 2DBKA 3RBBB 3MPUB 3PE0A 1P92A 1FYNA 8AT1B 2DL4A 3JB9F 3H6ZA 4LN2A 4F7UB 1D1BA 1QVFA 2AK5A 1M1KU 2X3XD 1KJWA 1RAIB 1K73U 1HXDA 1BIAA 2DRMA 4HCKA 2DL3A 4NL2A 1S72Q 1GFCA 3EFRA 1KK7A 4LD6A 8ATCB 4FL6A 2D0NA 3PIPA 2DEQA 2EJFA 1IRXA 1PKSA 4HVVA 2CKKA 1YJ9Q 2A36A 2CSQA 5FWBA 2ED0A 3JB9I 5GAOl 2RJCA 4RTTA 2HD0A 3UF4A 1Q82R 3I56T 4RTZA 1NZ9A 2H3JA 2K5IA 1YN8A 2HAXA 1H3ZA 3CCJA 2YUQA 2YLCA 2CREA 4FU6A 1YJNT 3SWNA 4EMGA 2OAWA 3A98A 2D9TA 5AYFA 2E5QA 1UECA 1H8KA 3MKDA 1WYXA 2BE7D 3QZ9B 3G71Q 1WXTA 1R8OB 2F69A 2X4JA 1W2BA 2VUBA 3X20B 2DKGA 5KE3A 5GANd 1X27A 3CC2A 3AHUA 3QKJA 1VQKT 4J9DA 2E65A 3D7SB 2CZ1B 2ROTA 3UWNA 2MIOA 2LJ3A 2QAZA 2RHYA 2LC4A 2DX1A 4J9GA 1UG1A 4A4EA 2HKQB 1V1CA 4KUIA 4JRQA 1D09B 4MMKA 2RK2A 2LP5A 3OBYA 4OMQA 5GMKh 2EYQA 3P8HA 2VVKA 4C92C 3QBYA 1C1AA 3X28B 3VYHB 2IG0A 1ZSZA 3CCST 1YITA 1LCKA 2O01E 4C0DB 2KROA 1YITQ 1W6XA 1XJWB 4JJDA 4R55A 4XTUA 1ZLMA 3A8HB 1Y96B 3DKMA 2LCLA 1OEBA 4JJBA 2E10A 4M7DA 4PK4A 1Y0MA 1AWOA 4OB3B 3JCMX 5KCHA 1D1AA 3N5BB 1YI2A 1X43A 2NUZA 1G3SA 1W70A 2CGHA 2DD5A 4M78D 2PVGB 4MZMA 1N9RA 2QASA 2KEAA 2XHCA 4PJOF 1W1FA 1LPLA 4WF2A 3O5ZA 4PJOD 1MMAA 3GNFB 2EQKA 3OYCA 3MO8A 3CCMT 1T3LA 4JS5A 5KYWA 3PVQA 2DL7A 2C0IA 1ABQA 1VIFA 3OA6A 3EFOA 4XQ3A 1PWTA 2EFIA 1OU9A 4FSXA 2JVVA 4HVUA 3OW2A 2HSEB 1MUZA 3GOXA 4OMFB 2OI3A 3OYJA 1VQOA 1UTIA 2RI5A 5GANe 1BK2A 1ZBXA 4ATOA 1LVKA 3L2ZA 1MGQA 3URGA 2O2OA 5KYYA 1WHLA 3MEAA 1AZGB 2WSEE 5HK3A 4QW2A 2VKNA 1D0XA 2HKNA 3HP9A 3DB3A 2LT4A 1G3YA 4DEXA 4CC7A 1LJOA 3MP6A 2I0NA 1D3BA 1BI3A 3OYMA 2YUPA 2DILA 4C8QA 1IB8A 2RK1A 2ZZDA 3H0IA 2RQUA 2FL7A 4OB0B 2XDDA 1K0XA 2MYSA 3RIRA 4RG2A 1BI0A 1FX7A 1W2BS 1NYFA 4V2SA 1WHHA 1VQKQ 1RI0A 2DZ9A 3M53A 4AFQC 4QVCA 4OB2B 1QQJA 2RQRA 4ZGDB 1GCQC 3META 4IUVA 1KC8C 4NOYA 2DA9A 3RR6A 1Q86U 1VQ9A 5GAMg 2KVQG 2JM9A 3G1JA 5HY6A 5I2MA 1M90U 2FHDA 1VQ5A 2FYKA 2EQUA 1BYMA 3CBPA 4HVWA 2MAMA 2J6OA 2KK4A 2K5FA 3RNJA 2HZYA 3SHWA 2NLUA 4C0DC 1WHGA 4MZTA 1MHNA 3OY9A 1CKAA 1IREB 1XQHA 2XU8A 2YRVA 1RLPC 4OGCA 1TUCA 4J6YA 4R0KA 4FYXB 4LD9K 1K4US 4XTWA 1AEYA 1M9SA 3EGXA 3OYKA 4N4IA 2E64A 4Z88A 1CKBA 2M16A 2V8IA 3NTIA 1T0JA 3HFOA 2LNHB 1SRMA 1OZ3A 4M75B 5IXFA 2F2XA 4M77C 2OTLT 2K4YA 3CCRT 1O75A 1E7OA 3HKSA 2EJGA 2KY9A 2DVEA 3V8KA 1VQPQ 3RESA 5KCOA 3CMAA 2FVUA 2V26A 3VS7A 4BY6B 2JMCA 3JRZA 1VQMQ 5CVIA 3VS3A 4X1VA 1C6VX 1HD3A 1MNDA 2EW3A 2SEMA 3M4YA 3BE3A 1K73R 3L2WA 1AWWA 2LX7A 4F14A 2E3HA 2CUDA 1WGSA 4M7AB 3CQTA 1YCYA 3G6EQ 1I4K1 2FZGB 4GBQA 1ZUKA 4N4HA 1TS9A 2AIRB 3A1PA 4M77E 3SB2A 2PU9B 4M7DB 1BCOA 2KMTA 4EIKA 2HSPA 5IXBA 3UPUA 1KHCA 1QCFA 1TUDA 2J6FA 1Q82U 3OYLA 2L3QA 1GL5A 2HBWA 3L42A 4ORZA 4FSSA 3ZEHA 1QWFA 4QVDA 2VV5A 5FU6B 3L2QA 1Q86R 1X6BA 2RI3A 1ACMB 4DEYA 5FRNA 2R58A 5GAOn 2DNUA 2F2VA 1TXQA 2K3XA 4DOWA 4DBQA 2KBTA 2P84A 5GANj 1WI7A 2JTMA 1QVGS 2CSIA 1DJ7B 3VKIA 3MCAB 2GFAA 5FU7B 1QLYA 2D1XA 4AFUC 4E2FB 3QDFA 2P0QA 1OOTA 1N8RR 1UEBA 1VQMT 1OI1A 1JB0E 1ZSZC 1I5LA 1UGPB 3G4ST 4RTWA 1VA7A 3HSBA 4C92A 4JUVA 2DD4A 4M78A 4FYYB 3FRNA 5CK9A 1UFFA 2VWFA 2X4YA 4JLGA 4DOVA 3LH0A 1HSQA 3CCRQ 1VQ7A 2CDTA 2AZSA 4PJOA 1X69A 2CP2A 1OPLA 3I5SA 4EMKC 5FWCA 4XU3A 5I2SA 3JCMW 2V1RA 4MDXA 5GJWB 1VQNT 2ECZA 3I55T 5C6SA 1JO8A 2RJFA 4L59A 4XU2A 1I5OB 2ZPHB 2FG0A 1FMWA 2KXDA 4J9CA 1KC8R 3EG0A 2HL5C 5GAMh 1LNXA 1N8RC 1M2VA 2DO3A 5IN1A 3CPFA 4OMNA 1IZ6A 4EMKA 3OYYA 3CMAT 2J7IA 5KYXA 2J05A 1MMNA 1UGVA 2CP6A 3F70A 5LJ5e 2L3RA 3CCRA 1ARKA 4HA8A 4ME7A 3CC4Q 2OTLA 4GLMA 4RTYA 2D0QB 3JB9H 1SSFA 4OMPA 1M3CA 3EFSA 3L1AA 2JW4A 2VGNA 5FU6C 3RKYA 3LWHA 1GFDA 3A8MB 2RM4A 1Y7XA 5GAOq 1YHQQ 2VB6A 4OMOA 4QQDA 3QJYA 2A37A 4M7AF 1S1NA 3I5RA 3KXTA 1NYGA 3JV3A 2R57A 1IHVA 1M8VA 1D3BB 1HYOA 2JN0A 2L8DA 1Y71A 3MEUA 7AT1B 3RKWA 1YJWQ 4M7DF 2E41A 3M54A 1R0CB 4PFPA 4Z8AA 4E7SA 2DTIA 2EQJA 2YHTA 3KFVA 2KI7A 4F7UE 2QA4T 1YFNA 3CCSQ 3M0RA 1PCXA 3J81E 1M1GA 1VQ6Q 3ER0A 4FYWB 4PJOE 3QHSA 5C0MA 2L89A 2PUKB 3H41A 4BI4A 3OBWA 2ZCFB 4M77G 2AHJB 4FT2A 3PFSA 2QEXA 3RMSA 3NTKA 1KD1U 2LJ1A 4IUPA 1N8RU 4R56A 2DXBA 1RAFB 2MF2A 4P5NA 2E70A 3QWYA 2AKKA 2F5KA 2QQAA 2WSFE 3OYFA 3QDRB 2R5AA 4X9CA 5GMKl 2QTVA 3WVEB 3CPWS 2MK5A 3NHNA 1UGQB 2EGEA 5GMKj 3JCMh 1WJSA 1Y96A 3S3OA 4MMLA 4F7UF 2COYA 2DL5A 3U23A 3CC2Q 3WXMB 1RACB 2EJ9A 2OJ2A 5DLQE 2BZXA 4CC4B 3VJPA 4KRTA 3SDZA 2K5LA 4B9XA 4Y28E 3QXEB 3CCEQ 4C5EA 2JXBA 1YJNA 1BKBA 2DXCA 2X4XA 5EG2A 3L2UA 2MWPA 5CKFA 2YSQA 1VQ8A 1I81A 3I56A 4M77A 1B3QA 2EQMA 3M9QA 3PGGA 2BZYA 1OULA 5GAN5 2KE9A 3CMET 4L6V5 1K76A 1Y07A 1UB4A 4C92E 1NE8A 1UHFA 1SHFA 2KRSA 4LNPA 2CZ7B 4ELZC 3TREA 2F5TX 3PNWC 3A8GB 4XAXB 4XTYA 2BUDA 3H0FA 3LW5E 1ZSZB 5LL6S 1PNJA 4X9DA 2YT6A 3NTHA 3M56A 2H3EB 2IIMA
chains in the Genus database with same CATH topology
3ULRB 1RUWA 1UUEA 1A0NB 2YUPA 2P4RA 2DILA 4M4ZA 1UE9A 1WDXA 3EHQA 3H0IA 2RQUA 1WLPB 2V1QA 3EGUA 5ECAA 1FMKA 1K0XA 1M30A 2C0TA 2ESWA 2EQIA 3EG3A 1YWOA 2YUOA 1NYFA 1ZSGA 4LUDA 4AFQC 2HDAA 3VRYA 2O88A 2FEIA 4RTUA 3C0CA 2GTOA 2RQRA 3VS1A 1GCQC 1U5SA 1SHGA 2W0ZA 2K7AA 2DA9A 3H0HA 3M0UA 1OPKA 1ABOA 2DF6A 4F16A 2ABLA 2JM9A 1JQQA 1NEBA 3M0SA 5IHIA 1YP5A 2H8HA 2JMAA 4HVWA 2JS2A 2J6OA 3RNJA 1AZEA 3SHWA 2K2MA 1UJYA 4AFZC 2HEQA 1NEGA 2L3SA 1CKAA 1M3AA 2JM8A 2RQWA 1MV0B 1SRLA 1RLPC 1TUCA 2X3WD 4R0KA 2DL8A 3ZL7C 1K4US 1AWXA 1AEYA 4RTVA 4Z88A 1CKBA 2EGCA 2LQNA 3EHRA 2EYWA 1T0JA 1JXMA 2LNHB 1SRMA 2MOXA 4D8DA 5IXFA 2F2XA 2DRKA 1WXBA 4LUEA 5IHKA 2LJ0A 3I35A 2JS0A 1E7OA 2FPDA 3UA6A 1M27C 3VRZA 2LCSA 2EBPA 1AWJA 1RI9A 4JZ3A 2YDLA 3SEMA 3FJ5A 2J06A 3VS7A 2GGRA 1QKXA 2JT4A 4Y92A 1U06A 1YWPA 1X6GA 2K79A 4JJCA 2JMCA 3TVTA 1T0HA 2QDLA 3VS6A 1NG2A 4X1VA 3TSWA 3VS3A 1HD3A 1QWEA 2EW3A 2SEMA 2W10A 1U3OA 3QWXX 2BZ8A 2K9GA 1BB9A 1AWWA 2DYBA 2LX7A 4F14A 2CUDA 2FPFA 4J9HA 2CT4A 2YUNA 3CQTA 4JPBW 2RNAA 1I1JA 4IIMA 4GBQA 1ZUKA 1JXOA 1GBRA 5HCKA 2CH4A 2KNBB 4OMMA 1MV3A 1B07A 2O9VA 4EIKA 1SSHA 2HSPA 1QKWA 1J3TA 1I07A 5IXBA 2RQTA 2LQWA 1QCFA 1TUDA 1PKTA 2J6FA 1WXUA 2ENMA 2L3QA 4A63B 2HBWA 4CC3A 1GL5A 2DJQA 4ORZA 2GNCA 3VS4A 4FSSA 1H3HA 1QWFA 1N5ZA 1WIEA 3GBQA 3I9QA 4J9FA 2DMOA 1X6BA 2CT3A 4AFSC 2DBMA 4DEYA 2DNUA 2KYMA 5L23A 2F2VA 2CH4W 3R6NA 3REAB 2DLPA 2KBTA 1BBZA 1KFZA 1GCPA 2LZ6B 2GBQA 1WI7A 4RUGA 3EG2A 1G2BA 2CSIA 2KGTA 1QLYA 3IQLA 2D1XA 3PVLA 4AFUC 4Z89A 1UHCA 3M0PA 2EKHA 1OOTA 3EG1A 4J9IA 2F2WA 4J9BA 1WX6A 4ZNXA 3REBB 4RTWA 1VA7A 1AD5A 2KT1A 1ZBJA 4LE9A 2FPEA 2KYBA 2KRMA 1EFNA 3M0QA 2L2PA 1JU5C 1UFFA 2EYXA 2VWFA 2LMJA 2K6DA 2DM1A 5FW9A 1TG0A 1HSQA 3TSZA 2KRNA 2CDTA 2AZSA 1RLQC 2BTTA 1X69A 1WFWA 1OPLA 3I5SA 2E5KA 1SEMA 2A08A 5FWCA 2DBKA 1T3SA 2V1RA 5GJWB 3RBBB 3PE0A 2ECZA 2JTEA 3VS5A 1FYNA 1VYVA 1K9AA 1JO8A 2DL4A 3NPFA 2SRCA 4LN2A 2AK5A 1M3BA 1AVZC 2FG0A 2O9SA 2KXDA 4J9CA 2X3XD 1KJWA 1IO6A 3EG0A 2DRMA 2DVJA 4HCKA 5GJVB 2DL3A 1GFCA 2ROLA 4OMNA 2RMOA 1ZUYA 2D0NA 2FRYA 2FO0A 2J7IA 4HVVA 1PKSA 1GRIA 1UGVA 2J05A 2A36A 2CSQA 5FWBA 1NLOC 2ED0A 1ARKA 2D8HA 1K1ZA 1PRMC 4GLMA 4RTYA 4CC2A 4RTTA 3UF4A 4OMPA 1M3CA 2JW4A 4RTZA 2HCKA 1GFDA 2RN8A 1YN8A 2PTKA 1I0CA 1ZUUA 2C0OA 2YUQA 2M0YA 2KT8A 4OMOA 2CREA 2OAWA 4QT7A 3A98A 2RF0A 2A37A 1S1NA 3I5RA 1UECA 1NYGA 2L3PA 3JV3A 1H8KA 1NLPC 5I22A 1WYXA 3LH5A 1GBQA 1WXTA 3UATA 2K3BA 1XOVA 4Z8AA 1X27A 1X2KA 1GCQA 2EGAA 4J9DA 3KFVA 2ROTA 4F17A 2MIOA 2LJ3A 3M0RA 4ESRA 1KIKA 2DX1A 1E6GA 4J9GA 4HXJA 3H41A 1UG1A 2EYYA 1UDLA 1V1CA 4OMLA 2LP5A 4OMQA 1M8MA 1H92A 2LJ1A 2RPNA 2RQVA 5I11A 2VVKA 1AOJA 2EVRA 4AG2C 1BU1A 3QWYA 2AKKA 1LCKA 1ZX6A 3UA7A 2J6KA 2KROA 1VYTA 1KSWA 1W6XA 1OV3A 2EPDA 2M51A 2PZ1A 5IH2A 4J9EA 4JJDA 1CSKA 1ZLMA 1JEGA 2GQIA 1NM7A 2O31A 1UJ0A 1OEBA 4JJBA 5EC7A 3NHNA 2EGEA 1Y57A 1AWOA 1Y0MA 2CUBA 2G6FX 2DL5A 3U23A 1Z9ZA 4RTXA 1X43A 2NUZA 4AG1C 3THKA 1W70A 2KXCA 4WCIA 1SPKA 2OJ2A 3VS2A 1K0SA 2KEAA 2MCNA 2BZXA 4CC4B 1VYUA 2KR3A 1W1FA 4KRTA 2NWMA 1WA7A 3O5ZA 2EYZA 1Z9QA 2B86A 4IIOA 1HJDA 2L0AA 2AZVA 1T3LA 2JXBA 2PNIA 1PRLC 3PVQA 2DL7A 2ED1A 2XMFA 2C0IA 1ABQA 1PWTA 2A28A 2YSQA 1PHTA 4HVUA 4JZ4A 1MUZA 2OI3A 1B3QA 1UTIA 2BZYA 1YNZA 4K11A 1BK2A 1YCSB 2KE9A 2D8JA 1K76A 2DE0X 1G83A 1UHFA 1SHFA 2KRSA 2O2OA 2GTJA 1AZGB 1E6HA 4LNPA 2AKLA 2VKNA 2FRWA 3H0FA 3M0TA 1X2QA 5IHNA 4D8KA 1PNJA 4DEXA 4CC7A 3NGPA 4E6RA 3VS0A 2YT6A 2I0NA 3NMZC 2IIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULR B;  1RUW A;  1UUE A;  1A0N B;  2YUP A;  2P4R A;  2DIL A;  4M4Z A;  1UE9 A;  1WDX A;  3EHQ A;  3H0I A;  2RQU A;  1WLP B;  2V1Q A;  3EGU A;  5ECA A;  1FMK A;  1K0X A;  1M30 A;  2C0T A;  2ESW A;  2EQI A;  3EG3 A;  1YWO A;  2YUO A;  1NYF A;  1ZSG A;  4LUD A;  4AFQ C;  2HDA A;  3VRY A;  2O88 A;  2FEI A;  4RTU A;  3C0C A;  2GTO A;  2RQR A;  3VS1 A;  1GCQ C;  1U5S A;  1SHG A;  2W0Z A;  2K7A A;  2DA9 A;  3H0H A;  3M0U A;  1OPK A;  1ABO A;  2DF6 A;  4F16 A;  2ABL A;  2JM9 A;  1JQQ A;  1NEB A;  3M0S A;  5IHI A;  1YP5 A;  2H8H A;  2JMA A;  4HVW A;  2JS2 A;  2J6O A;  3RNJ A;  1AZE A;  3SHW A;  2K2M A;  1UJY A;  4AFZ C;  2HEQ A;  1NEG A;  2L3S A;  1CKA A;  1M3A A;  2JM8 A;  2RQW A;  1MV0 B;  1SRL A;  1RLP C;  1TUC A;  2X3W D;  4R0K A;  2DL8 A;  3ZL7 C;  1K4U S;  1AWX A;  1AEY A;  4RTV A;  4Z88 A;  1CKB A;  2EGC A;  2LQN A;  3EHR A;  2EYW A;  1T0J A;  1JXM A;  2LNH B;  1SRM A;  2MOX A;  4D8D A;  5IXF A;  2F2X A;  2DRK A;  1WXB A;  4LUE A;  5IHK A;  2LJ0 A;  3I35 A;  2JS0 A;  1E7O A;  2FPD A;  3UA6 A;  1M27 C;  3VRZ A;  2LCS A;  2EBP A;  1AWJ A;  1RI9 A;  4JZ3 A;  2YDL A;  3SEM A;  3FJ5 A;  2J06 A;  3VS7 A;  2GGR A;  1QKX A;  2JT4 A;  4Y92 A;  1U06 A;  1YWP A;  1X6G A;  2K79 A;  4JJC A;  2JMC A;  3TVT A;  1T0H A;  2QDL A;  3VS6 A;  1NG2 A;  4X1V A;  3TSW A;  3VS3 A;  1HD3 A;  1QWE A;  2EW3 A;  2SEM A;  2W10 A;  1U3O A;  3QWX X;  2BZ8 A;  2K9G A;  1BB9 A;  1AWW A;  2DYB A;  2LX7 A;  4F14 A;  2CUD A;  2FPF A;  4J9H A;  2CT4 A;  2YUN A;  3CQT A;  4JPB W;  2RNA A;  1I1J A;  4IIM A;  4GBQ A;  1ZUK A;  1JXO A;  1GBR A;  5HCK A;  2CH4 A;  2KNB B;  4OMM A;  1MV3 A;  1B07 A;  2O9V A;  4EIK A;  1SSH A;  2HSP A;  1QKW A;  1J3T A;  1I07 A;  5IXB A;  2RQT A;  2LQW A;  1QCF A;  1TUD A;  1PKT A;  2J6F A;  1WXU A;  2ENM A;  2L3Q A;  4A63 B;  2HBW A;  4CC3 A;  1GL5 A;  2DJQ A;  4ORZ A;  2GNC A;  3VS4 A;  4FSS A;  1H3H A;  1QWF A;  1N5Z A;  1WIE A;  3GBQ A;  3I9Q A;  4J9F A;  2DMO A;  1X6B A;  2CT3 A;  4AFS C;  2DBM A;  4DEY A;  2DNU A;  2KYM A;  5L23 A;  2F2V A;  2CH4 W;  3R6N A;  3REA B;  2DLP A;  2KBT A;  1BBZ A;  1KFZ A;  1GCP A;  2LZ6 B;  2GBQ A;  1WI7 A;  4RUG A;  3EG2 A;  1G2B A;  2CSI A;  2KGT A;  1QLY A;  3IQL A;  2D1X A;  3PVL A;  4AFU C;  4Z89 A;  1UHC A;  3M0P A;  2EKH A;  1OOT A;  3EG1 A;  4J9I A;  2F2W A;  4J9B A;  1WX6 A;  4ZNX A;  3REB B;  4RTW A;  1VA7 A;  1AD5 A;  2KT1 A;  1ZBJ A;  4LE9 A;  2FPE A;  2KYB A;  2KRM A;  1EFN A;  3M0Q A;  2L2P A;  1JU5 C;  1UFF A;  2EYX A;  2VWF A;  2LMJ A;  2K6D A;  2DM1 A;  5FW9 A;  1TG0 A;  1HSQ A;  3TSZ A;  2KRN A;  2CDT A;  2AZS A;  1RLQ C;  2BTT A;  1X69 A;  1WFW A;  1OPL A;  3I5S A;  2E5K A;  1SEM A;  2A08 A;  5FWC A;  2DBK A;  1T3S A;  2V1R A;  5GJW B;  3RBB B;  3PE0 A;  2ECZ A;  2JTE A;  3VS5 A;  1FYN A;  1VYV A;  1K9A A;  1JO8 A;  2DL4 A;  3NPF A;  2SRC A;  4LN2 A;  2AK5 A;  1M3B A;  1AVZ C;  2FG0 A;  2O9S A;  2KXD A;  4J9C A;  2X3X D;  1KJW A;  1IO6 A;  3EG0 A;  2DRM A;  2DVJ A;  4HCK A;  5GJV B;  2DL3 A;  1GFC A;  2ROL A;  4OMN A;  2RMO A;  1ZUY A;  2D0N A;  2FRY A;  2FO0 A;  2J7I A;  4HVV A;  1PKS A;  1GRI A;  1UGV A;  2J05 A;  2A36 A;  2CSQ A;  5FWB A;  1NLO C;  2ED0 A;  1ARK A;  2D8H A;  1K1Z A;  1PRM C;  4GLM A;  4RTY A;  4CC2 A;  4RTT A;  3UF4 A;  4OMP A;  1M3C A;  2JW4 A;  4RTZ A;  2HCK A;  1GFD A;  2RN8 A;  1YN8 A;  2PTK A;  1I0C A;  1ZUU A;  2C0O A;  2YUQ A;  2M0Y A;  2KT8 A;  4OMO A;  2CRE A;  2OAW A;  4QT7 A;  3A98 A;  2RF0 A;  2A37 A;  1S1N A;  3I5R A;  1UEC A;  1NYG A;  2L3P A;  3JV3 A;  1H8K A;  1NLP C;  5I22 A;  1WYX A;  3LH5 A;  1GBQ A;  1WXT A;  3UAT A;  2K3B A;  1XOV A;  4Z8A A;  1X27 A;  1X2K A;  1GCQ A;  2EGA A;  4J9D A;  3KFV A;  2ROT A;  4F17 A;  2MIO A;  2LJ3 A;  3M0R A;  4ESR A;  1KIK A;  2DX1 A;  1E6G A;  4J9G A;  4HXJ A;  3H41 A;  1UG1 A;  2EYY A;  1UDL A;  1V1C A;  4OML A;  2LP5 A;  4OMQ A;  1M8M A;  1H92 A;  2LJ1 A;  2RPN A;  2RQV A;  5I11 A;  2VVK A;  1AOJ A;  2EVR A;  4AG2 C;  1BU1 A;  3QWY A;  2AKK A;  1LCK A;  1ZX6 A;  3UA7 A;  2J6K A;  2KRO A;  1VYT A;  1KSW A;  1W6X A;  1OV3 A;  2EPD A;  2M51 A;  2PZ1 A;  5IH2 A;  4J9E A;  4JJD A;  1CSK A;  1ZLM A;  1JEG A;  2GQI A;  1NM7 A;  2O31 A;  1UJ0 A;  1OEB A;  4JJB A;  5EC7 A;  3NHN A;  2EGE A;  1Y57 A;  1AWO A;  1Y0M A;  2CUB A;  2G6F X;  2DL5 A;  3U23 A;  1Z9Z A;  4RTX A;  1X43 A;  2NUZ A;  4AG1 C;  3THK A;  1W70 A;  2KXC A;  4WCI A;  1SPK A;  2OJ2 A;  3VS2 A;  1K0S A;  2KEA A;  2MCN A;  2BZX A;  4CC4 B;  1VYU A;  2KR3 A;  1W1F A;  4KRT A;  2NWM A;  1WA7 A;  3O5Z A;  2EYZ A;  1Z9Q A;  2B86 A;  4IIO A;  1HJD A;  2L0A A;  2AZV A;  1T3L A;  2JXB A;  2PNI A;  1PRL C;  3PVQ A;  2DL7 A;  2ED1 A;  2XMF A;  2C0I A;  1ABQ A;  1PWT A;  2A28 A;  2YSQ A;  1PHT A;  4HVU A;  4JZ4 A;  1MUZ A;  2OI3 A;  1B3Q A;  1UTI A;  2BZY A;  1YNZ A;  4K11 A;  1BK2 A;  1YCS B;  2KE9 A;  2D8J A;  1K76 A;  2DE0 X;  1G83 A;  1UHF A;  1SHF A;  2KRS A;  2O2O A;  2GTJ A;  1AZG B;  1E6H A;  4LNP A;  2AKL A;  2VKN A;  2FRW A;  3H0F A;  3M0T A;  1X2Q A;  5IHN A;  4D8K A;  1PNJ A;  4DEX A;  4CC7 A;  3NGP A;  4E6R A;  3VS0 A;  2YT6 A;  2I0N A;  3NMZ C;  2IIM A; 
#chains in the Genus database with same CATH topology
 1B34 A;  1RUW A;  2NUT B;  4ELY C;  3G71 T;  2P4R A;  2E1H A;  4M4Z A;  3JCM P;  3CCS A;  1VQ6 T;  4Q5W A;  4M75 D;  2V1Q A;  3EGU A;  5ECA A;  1FMK A;  1OU8 A;  2ZAE A;  2QA4 Q;  2YUO A;  4KT0 E;  4BI3 A;  3VRY A;  4RTU A;  2PUO B;  1YJW T;  3RER A;  3VS1 A;  4IUR A;  1Q7Y R;  2GF7 A;  2NUP B;  2B8A A;  2L5Q A;  1VQN Q;  2DF6 A;  4F16 A;  2I2L A;  2COZ A;  1VQK A;  1GXI E;  3CC7 A;  2D6F A;  2JMA A;  1YJ9 T;  4O5V A;  1F1B B;  4C5I A;  2K2M A;  3A8O B;  5GAN 7;  2ZPG B;  1UJY A;  5GMK m;  4AFZ C;  1NEG A;  3OS1 A;  4XTZ A;  1M3A A;  2X51 A;  1X6O A;  3RDV A;  1BCM A;  2NUT A;  1SRL A;  3OYH A;  3CXC A;  3HPW A;  2M02 A;  2DL8 A;  3EH2 A;  3ZL7 C;  4YTL A;  3VYG A;  4KH0 B;  1PD1 A;  4PLI A;  2LQN A;  4IUQ A;  3QPH A;  2MOX A;  1VQ4 Q;  3CD6 A;  1K9M R;  1VQN A;  2DRK A;  5CR2 A;  4LUE A;  3C12 A;  4D6W A;  2JS0 A;  1WZO A;  3GPL A;  2NUP A;  5GAN g;  4N0A A;  1KG1 A;  3RKX A;  5D6Y A;  1AWJ A;  1RI9 A;  3E1S A;  4JZ3 A;  2YDL A;  2FZK B;  2QGF B;  2J06 A;  1VQ7 Q;  4Y92 A;  1QKX A;  2VC8 A;  4PNO A;  1YWP A;  3QYH B;  4XU1 A;  1T0H A;  4EMK B;  4A4F A;  4C8Q D;  2QDL A;  1NG2 A;  3G4S A;  3TSW A;  1QWE A;  2BZ8 A;  1KC8 U;  2HNI A;  2DYB A;  4VUB A;  2LQ8 A;  1M4Z A;  4C0F A;  1I8F A;  5GAN 3;  5GAN 2;  2HQH A;  2CT4 A;  2YUN A;  3P8D A;  3HL8 A;  1I1J A;  4M7A A;  1YI2 Q;  2CH4 A;  4M7A D;  4OP0 A;  2CP7 A;  4C8Q B;  3OS2 A;  1VUB A;  2O9V A;  5A0D A;  1QKW A;  1J3T A;  1I07 A;  5FLX E;  2M9U A;  1G3T A;  3OMG A;  1N9S A;  2RO0 A;  1WXU A;  1PSF A;  4A63 B;  5GAN f;  4M78 F;  3V7S A;  5CQY A;  1H3H A;  1Q7Y U;  1TTH B;  1K9M C;  4PJJ A;  1WIE A;  3GBQ A;  5GAO p;  3EG9 B;  1JRI A;  3PT9 A;  1RAH B;  3JCM J;  5LJ3 f;  2DMO A;  2CT3 A;  4AFS C;  2OTJ T;  2DBM A;  1W2B P;  4HCC A;  4FW1 A;  5KYN A;  2O4X A;  3CC7 T;  3FEO A;  1BBZ A;  4J7F A;  4RG8 A;  2CP5 A;  4RUG A;  1G2B A;  4N0A C;  1MMD A;  4M77 B;  3EAE A;  2KGT A;  4JLI A;  5LJ3 g;  3PVL A;  2EWN A;  1UHC A;  3BDU A;  3M0P A;  5IAY A;  1YJW A;  3EG1 A;  5M9O A;  4J9B A;  4XTV A;  4XK8 E;  4ZNX A;  4M78 E;  1EX4 A;  1WHM A;  3SWN C;  1TSF A;  3M0Q A;  1VQ4 T;  3A8L B;  4HCZ A;  1AHJ B;  1PSE A;  2K6D A;  4QQ6 A;  1VQL T;  4LDU A;  2DPP B;  4TVR A;  1QVF P;  1RLQ C;  2BTT A;  3JAM E;  1IGQ A;  3TU4 K;  2LDM A;  4ZGE B;  1VQM A;  2DTH A;  2X9H A;  5LJ5 f;  4DA4 A;  2VAS A;  1NJI R;  1K9A A;  3GIB A;  1FXX A;  4JJN K;  4UC4 A;  4PLL A;  1AVZ C;  5KYW B;  2O9S A;  3FB9 A;  1IO6 A;  1M5Q 1;  2DVJ A;  2XI9 A;  3CEY A;  2E4H A;  2JZ2 A;  3HHT B;  3M4G A;  4IUT A;  1M90 R;  2FO0 A;  3CXC P;  2DEU A;  1VOM A;  1NLO C;  4KBM B;  2ZPF B;  4OB1 B;  2FZC B;  2YRC A;  1K1Z A;  3CCE T;  3CCV A;  1PM3 A;  1X75 C;  4E7I A;  1KD1 R;  2LNV A;  2HCK A;  2RN8 A;  4J8O A;  3HRT A;  2PTK A;  5CKH A;  2CP0 A;  2DFU A;  1I0C A;  2RH2 A;  2M1H A;  2QQR A;  1ZUU A;  2C0O A;  4PJN A;  2PQW A;  2RF0 A;  3J7A F;  2L3P A;  5I22 A;  1NLP C;  4C0Z A;  4IKF A;  2A0F B;  1FWZ A;  3QUI A;  3FDR A;  4A4G A;  3UAT A;  4KUL A;  2FB7 A;  4C0G A;  3OW2 S;  2K3B A;  2YRD A;  4FCY A;  2M0O A;  1X2K A;  4E7Z A;  1GCQ A;  2EGA A;  4F7U A;  3CME Q;  1ZA2 B;  3M58 A;  4F17 A;  3JCM e;  4F7U G;  2RJD A;  4M75 C;  4ESR A;  2XD0 A;  9ATC B;  4OVA A;  2DYI A;  4DQ2 A;  1E6G A;  4HXJ A;  4J83 A;  2ZPE B;  1UDL A;  1K8A C;  2OTL Q;  4PKC C;  3INZ A;  4DBF A;  4M7D C;  1U1S A;  1YJN Q;  1M8M A;  3MP1 A;  1H92 A;  5I11 A;  5KH6 A;  1XNI A;  1AOJ A;  3M55 A;  3JB9 J;  1PC0 A;  5J39 A;  5GAO m;  1BU1 A;  4M7A C;  3I56 Q;  1KQS A;  3GLX A;  2CP3 A;  2BIV A;  4CI0 C;  2EPD A;  2M51 A;  2PZ1 A;  5FRO A;  5IH2 A;  1CSK A;  2GQI A;  3VU3 C;  2E3I A;  2Y90 A;  4B9W A;  2IPO B;  1QVG A;  1Y57 A;  3AT1 B;  1WHK A;  3SWN B;  2CUB A;  3V7C A;  2G6F X;  3V7R A;  1WQW A;  3CCU A;  3OYN A;  1WJQ A;  1YIJ A;  4AG1 C;  3THK A;  2KXC A;  3NFC A;  4II1 A;  3LWI A;  1SPK A;  1K0S A;  2MCN A;  2C06 A;  1VYU A;  3X26 B;  2Y4Y A;  3QSU A;  1SKU B;  4JRK A;  1WA7 A;  2A3L A;  1Z9Q A;  2B86 A;  1HJD A;  1ZQ1 A;  2L0A A;  1BI2 A;  2AZV A;  1VQ5 Q;  1PRL C;  2XMF A;  2LRQ A;  1WQ7 A;  2A28 A;  3PMI A;  1OQK A;  1QCO A;  3RUX A;  4BE0 A;  5LJ5 d;  1QVP A;  1VQP A;  2G3R A;  3BW1 A;  4DBR A;  2P4T A;  2KDS A;  1RAD B;  2KSS A;  1VQ8 T;  2MPX C;  1N6A A;  3DLL A;  1KQS S;  1YNZ A;  3ME9 A;  1YCS B;  5DM7 R;  3OSV A;  2D8J A;  2LVM A;  1G83 A;  2XG8 D;  3PMT A;  5DY9 A;  3ZFJ A;  3CXC S;  4EPC A;  3UT1 A;  1OX8 A;  3JCM b;  3EGX B;  3T9N A;  3G6E A;  1X2Q A;  4PJM A;  1BI1 A;  2VXF A;  3LYI A;  3NGP A;  5CO7 A;  3NMZ C;  3CC2 T;  1UUE A;  4FIB A;  2QEX Q;  1A0N B;  1V29 B;  1UE9 A;  1WDX A;  1WPY A;  5HKC A;  3EHQ A;  4RKU E;  1G5V A;  1WLP B;  3QO3 A;  2QYZ A;  2K2V A;  4EMH A;  2DJZ A;  1M30 A;  3CCE A;  4BAC A;  5FRM A;  2ESW A;  3MEW A;  3EG3 A;  3HTR A;  1YWO A;  1TH7 A;  1ZSG A;  2HDA A;  2O88 A;  2FEI A;  3MJX A;  3O8V A;  1G8X A;  1TOV A;  3CCJ T;  2JTF A;  5GAM e;  4AT1 B;  2HBP A;  2HQE A;  2QI2 A;  3FLG A;  1ABO A;  2GCX A;  4GLK A;  3JSC A;  3CC4 T;  1JQQ A;  3M0S A;  4HT9 A;  5IHI A;  5KE2 A;  3EGD B;  4C8Q E;  3VV0 A;  3VUB A;  5LJ5 g;  1NBE B;  2MWO A;  5LJ5 h;  2JJ9 A;  2HEQ A;  4PJO C;  3HRU A;  2Y4X A;  2BE9 B;  1EIF A;  3GP8 A;  2PVO B;  2JM8 A;  4BE2 A;  5KYY B;  4RMO A;  2X3W D;  4OF1 A;  1QP2 A;  4LXC A;  3JCM Q;  1VQL A;  3CCQ A;  2XDB A;  3EHR A;  4LDY A;  4PJO G;  1Q86 C;  1JXM A;  1TWB A;  2MMP A;  4PFO A;  4B6M A;  1WXB A;  2WAC A;  1YHQ T;  2P0P A;  1Q81 C;  1KHI A;  3MHX A;  4JRP A;  4L5G A;  2LCS A;  3J80 E;  2PVD B;  4BUG A;  2XIC A;  1W4S A;  2E6N A;  3FJ5 A;  2Z0W A;  4BDZ A;  2JT4 A;  2CZ0 B;  4X34 A;  1U06 A;  5GAN 6;  1X6G A;  5LJ3 j;  3CCL T;  3OW2 P;  3R6O A;  3UDC A;  2XDP A;  3VS6 A;  4KH1 B;  2HQX A;  1U3O A;  2IVW A;  3QWX X;  2DET A;  1BB9 A;  3VUZ A;  4E7H A;  3MP8 A;  4M75 F;  4JPB W;  3OYI A;  3GNG A;  4MDW A;  1VQ9 Q;  1K8A U;  4IIM A;  4C92 B;  1B34 B;  3A5Z B;  2RHI A;  3JCM d;  1SG5 A;  2YXY A;  3CPW A;  1WHJ A;  4CRI A;  5I21 A;  4AMC A;  2RQT A;  2RI2 A;  2VXE A;  2QTX A;  1PKT A;  4A4K A;  5AT1 B;  3RMQ A;  3Q1J A;  1QP3 A;  4CC3 A;  2LTO A;  2RHX A;  2DJQ A;  2YLB A;  2GNC A;  4C92 G;  3VS4 A;  3FC3 A;  2QG9 B;  4KUD K;  1YHQ A;  1RAE B;  3I9Q A;  1VQ7 T;  4JRI A;  4J9F A;  2QQS A;  4DBH A;  3GF5 A;  1M1F A;  1S72 T;  2KYM A;  5L23 A;  2CH4 W;  3R6N A;  1OZ2 A;  5KYU B;  3G4S Q;  2CYZ B;  1HK9 A;  1RL2 A;  5KYX B;  1VQ9 T;  2K3Y A;  1Q81 R;  1S72 A;  1O9S A;  1N27 A;  1VIE A;  4ZTF A;  2GFU A;  3E2U A;  2EKH A;  2YWW A;  3M5A A;  2CZ6 B;  4J9I A;  3CME A;  3OSS C;  4EDU A;  3OS0 A;  4M78 G;  1WX6 A;  4BI8 B;  2V8J A;  3REB B;  4MZP A;  3CD6 T;  1AD5 A;  4LDV A;  3X25 B;  1ZBJ A;  2KRM A;  4FW2 A;  4F04 B;  1JU5 C;  1LOJ A;  2EYX A;  2QQ9 A;  2LMJ A;  2RB6 A;  2DM1 A;  1TG0 A;  1KQ1 A;  2QGG A;  2KRN A;  4J6X A;  4C5H A;  5CKD A;  2DK3 A;  3LGL A;  3S6W A;  2A08 A;  4QQG A;  1T3S A;  3SD4 A;  1QCN A;  1JBM A;  4M7A G;  2QK0 A;  2QQB A;  3FIF A;  2JTE A;  3VS5 A;  5HK0 A;  1VYV A;  3NPF A;  5GAM j;  2F1L A;  2SRC A;  4ZGJ B;  1M3B A;  2DTO A;  1YJ9 A;  1EZZ B;  1Q82 C;  3HRS A;  1K73 C;  4M75 A;  5GJV B;  1VQO T;  4N4G A;  2JUF A;  5FU7 C;  2P0K A;  3G6E T;  4OGE A;  2ROL A;  2RMO A;  1ZUY A;  5GAM d;  2FRY A;  1XTD A;  1GRI A;  4M7D E;  4BD3 A;  2D8H A;  1PRM C;  4C8Q C;  1K8A R;  4CC2 A;  4IUU A;  4NL3 A;  1VQ6 A;  3DLM A;  1U1T A;  1WNL A;  1VQP T;  3CCQ T;  3G71 A;  2DAQ A;  4M78 B;  1B7T A;  4ZTJ A;  4E7K A;  2M0Y A;  2KT8 A;  1YI2 T;  2QEX T;  2BKD N;  1H64 1;  4M78 C;  2A7Y A;  4QT7 A;  4RCB A;  1K9M U;  3TCJ A;  1IHW A;  3LH5 A;  2RD1 A;  2R5M A;  2O4X B;  4C92 F;  1GBQ A;  2QDY B;  3OYG A;  5IT9 E;  2ZGW A;  1QVF S;  4M77 D;  1XOV A;  3V8J A;  1YIJ Q;  3PIO A;  1YIT T;  1YIJ T;  2EAY A;  3CC4 A;  4M77 F;  3WVD B;  1ZA1 B;  2ZPI B;  2NYS A;  1KD1 C;  1KIK A;  4HT8 A;  2X4W A;  1Q81 U;  2ATC B;  3KBG A;  3H8Z A;  3ASK A;  2EYY A;  3FJP A;  2K57 A;  4OML A;  4BY6 C;  1U8R A;  1PD0 A;  1UGS B;  2RPN A;  1VQ5 T;  3QJ6 A;  4NS5 A;  2RQV A;  3CCM Q;  5LJ3 e;  4PJL A;  5DLO A;  1YBY A;  4BE1 A;  2EVR A;  4J5Y A;  4AG2 C;  3QG1 A;  1M90 C;  1ZX6 A;  3G7Z A;  3UA7 A;  2J6K A;  3OQ5 A;  4KGV B;  1VYT A;  1KSW A;  3JCM V;  1OV3 A;  1MMG A;  4J9E A;  2DIQ A;  1TUG B;  1JEG A;  1NM7 A;  2O31 A;  1UJ0 A;  4QVZ A;  3SFM A;  4O6J A;  5EC7 A;  2E6Z A;  1NJI C;  1G3W A;  2WSC E;  1M1K R;  3H9N A;  1KQS P;  1AT1 B;  1Z9Z A;  2MI6 A;  4RTX A;  4A54 A;  4WCI A;  4M7D G;  3VS2 A;  4A4H A;  2DZC A;  4PJO B;  1C0M A;  5GMK e;  5D6X A;  2KR3 A;  4J7I A;  2X35 A;  2NWM A;  2EYZ A;  3OYA A;  4IIO A;  3EFO B;  3X24 B;  1Q95 G;  3E9F A;  2PNI A;  5A0L A;  3LX7 A;  2DXU A;  2ED1 A;  4XTX A;  1D1C A;  5GMK i;  1VQ8 Q;  4ZN3 A;  1M2O A;  4KGZ B;  5CIU A;  1PHT A;  1JJ2 A;  2VYT A;  3TEE A;  2LCC A;  4JZ4 A;  2QA4 A;  1OX9 A;  5LJ3 d;  5CKB A;  4M7A E;  2CS7 A;  4K11 A;  1RAG B;  5GAN 8;  2DE0 X;  3CCU T;  1MNE A;  3CCM A;  3C95 A;  3QZ5 B;  2GTJ A;  1E6H A;  3BDL A;  3M57 A;  2AKL A;  4FM4 B;  3C4S A;  3CCU Q;  2FRW A;  5CKE A;  4Z02 A;  4HCB A;  3M0T A;  2AT1 B;  5IHN A;  4D8K A;  4E6R A;  4XU0 A;  3VS0 A;  4QKU A;  4FT4 A;  3ULR B;  2ZPB B;  3OB9 A;  2JOY A;  2C0T A;  3OYD A;  3CBM A;  3S3N A;  2EQI A;  4C8Q G;  1WJR A;  2RHZ A;  4ZN1 A;  3TQ7 P;  2DIG A;  1NJI U;  2EIF A;  3KUF A;  4LUD A;  4WTO B;  2LQK A;  3C0C A;  2GTO A;  3E19 A;  2EKO A;  1U5S A;  1SHG A;  2W0Z A;  2K7A A;  3PTA A;  3H0H A;  3M0U A;  1VQ4 A;  1OPK A;  2RHU A;  4FYV B;  2ABL A;  2DER A;  1NEB A;  2XID A;  1RAB B;  1V76 A;  3M59 A;  1YP5 A;  2H8H A;  4C5G A;  3OMC A;  4JS4 A;  3LLR A;  3LGF A;  3CC7 Q;  2JS2 A;  1AZE A;  1ZHI A;  2KAF A;  3JCM f;  4J6W A;  2HL3 A;  3CPW P;  2L3S A;  3I55 A;  2RA2 A;  3BFM A;  2RQW A;  1MV0 B;  1AWX A;  4RTV A;  4Y91 A;  5GAN 4;  2LT1 A;  2EGC A;  1UGR B;  2EYW A;  3MEV A;  3CCL Q;  2OTJ A;  3C94 A;  5D6W A;  3CCV T;  4D8D A;  3EG9 A;  5IHK A;  2LJ0 A;  3I35 A;  4PL6 A;  1KQ2 A;  2FPD A;  3UA6 A;  4GY5 A;  1M27 C;  1VQL Q;  3VRZ A;  4HKE A;  2EBP A;  5A0G A;  4RCC A;  3SEM A;  2GGR A;  3L2V A;  3HFN A;  2K79 A;  3I55 Q;  4JJC A;  1BIB A;  3TVT A;  2W10 A;  5J3B A;  2K9G A;  3DB4 A;  1D0Z A;  3OYB A;  2FPF A;  2DXT A;  3JCM c;  4J9H A;  6AT1 B;  1PG5 B;  3JB9 D;  3OS5 A;  2RNA A;  3QYG B;  5LJ3 h;  4E7J A;  2HMA A;  5L8R E;  1JXO A;  1GBR A;  1Q7Y C;  5HCK A;  3CD6 Q;  3QII A;  2KNB B;  3V8L A;  4OMM A;  5D7U A;  1MV3 A;  3S3M A;  1B07 A;  2VGM A;  4E47 A;  1SSH A;  1JJ2 S;  3CCQ Q;  2COW A;  4C92 D;  1QMC A;  2LQW A;  1IGU A;  1TU0 B;  2V8K A;  1M1K C;  2ENM A;  2RJE A;  1M2V B;  3OYE A;  5J26 A;  1D0Y A;  3CCJ Q;  2OAU A;  4BDY A;  1R0B G;  2QXF A;  1N5Z A;  3BY7 A;  2XK0 A;  5CQX A;  3CMA Q;  3ZBD A;  3EH1 A;  2LX9 A;  4M75 E;  4M75 G;  1VQO Q;  3EGD A;  4PFZ A;  3REA B;  4C8Q F;  3E9G A;  1IXD A;  2DLP A;  4A53 A;  1JJ2 P;  2KQW A;  3P8B B;  1KFZ A;  4E7L A;  1GCP A;  5LJ5 j;  2LZ6 B;  2GBQ A;  3CBO A;  3EG2 A;  5KYU A;  5CCA A;  1OYX A;  2XKO C;  3JB9 G;  1QW1 A;  4ANJ A;  5GAN h;  3IQL A;  4Z89 A;  1X01 A;  3JCM g;  3L2R A;  2F2W A;  4M7D D;  4LDW A;  2KT1 A;  5GAM f;  1QVG P;  4LE9 A;  2FPE A;  2KYB A;  2JNG A;  1NPR A;  5CAI A;  4BB7 A;  3CCL A;  1EFN A;  2GQV A;  2L2P A;  4JDS A;  5GAO r;  4LDX A;  2OTJ Q;  4KGX B;  2OX7 A;  5A2Q E;  1NPP A;  5FW9 A;  1RAA B;  3TSZ A;  2E12 A;  1FMV A;  1SF9 A;  1WFW A;  2E5K A;  1R77 A;  1SEM A;  3CCV Q;  2DBK A;  3RBB B;  3MPU B;  3PE0 A;  1P92 A;  1FYN A;  8AT1 B;  2DL4 A;  3JB9 F;  3H6Z A;  4LN2 A;  4F7U B;  1D1B A;  1QVF A;  2AK5 A;  1M1K U;  2X3X D;  1KJW A;  1RAI B;  1K73 U;  1HXD A;  1BIA A;  2DRM A;  4HCK A;  2DL3 A;  4NL2 A;  1S72 Q;  1GFC A;  3EFR A;  1KK7 A;  4LD6 A;  8ATC B;  4FL6 A;  2D0N A;  3PIP A;  2DEQ A;  2EJF A;  1IRX A;  1PKS A;  4HVV A;  2CKK A;  1YJ9 Q;  2A36 A;  2CSQ A;  5FWB A;  2ED0 A;  3JB9 I;  5GAO l;  2RJC A;  4RTT A;  2HD0 A;  3UF4 A;  1Q82 R;  3I56 T;  4RTZ A;  1NZ9 A;  2H3J A;  2K5I A;  1YN8 A;  2HAX A;  1H3Z A;  3CCJ A;  2YUQ A;  2YLC A;  2CRE A;  4FU6 A;  1YJN T;  3SWN A;  4EMG A;  2OAW A;  3A98 A;  2D9T A;  5AYF A;  2E5Q A;  1UEC A;  1H8K A;  3MKD A;  1WYX A;  2BE7 D;  3QZ9 B;  3G71 Q;  1WXT A;  1R8O B;  2F69 A;  2X4J A;  1W2B A;  2VUB A;  3X20 B;  2DKG A;  5KE3 A;  5GAN d;  1X27 A;  3CC2 A;  3AHU A;  3QKJ A;  1VQK T;  4J9D A;  2E65 A;  3D7S B;  2CZ1 B;  2ROT A;  3UWN A;  2MIO A;  2LJ3 A;  2QAZ A;  2RHY A;  2LC4 A;  2DX1 A;  4J9G A;  1UG1 A;  4A4E A;  2HKQ B;  1V1C A;  4KUI A;  4JRQ A;  1D09 B;  4MMK A;  2RK2 A;  2LP5 A;  3OBY A;  4OMQ A;  5GMK h;  2EYQ A;  3P8H A;  2VVK A;  4C92 C;  3QBY A;  1C1A A;  3X28 B;  3VYH B;  2IG0 A;  1ZSZ A;  3CCS T;  1YIT A;  1LCK A;  2O01 E;  4C0D B;  2KRO A;  1YIT Q;  1W6X A;  1XJW B;  4JJD A;  4R55 A;  4XTU A;  1ZLM A;  3A8H B;  1Y96 B;  3DKM A;  2LCL A;  1OEB A;  4JJB A;  2E10 A;  4M7D A;  4PK4 A;  1Y0M A;  1AWO A;  4OB3 B;  3JCM X;  5KCH A;  1D1A A;  3N5B B;  1YI2 A;  1X43 A;  2NUZ A;  1G3S A;  1W70 A;  2CGH A;  2DD5 A;  4M78 D;  2PVG B;  4MZM A;  1N9R A;  2QAS A;  2KEA A;  2XHC A;  4PJO F;  1W1F A;  1LPL A;  4WF2 A;  3O5Z A;  4PJO D;  1MMA A;  3GNF B;  2EQK A;  3OYC A;  3MO8 A;  3CCM T;  1T3L A;  4JS5 A;  5KYW A;  3PVQ A;  2DL7 A;  2C0I A;  1ABQ A;  1VIF A;  3OA6 A;  3EFO A;  4XQ3 A;  1PWT A;  2EFI A;  1OU9 A;  4FSX A;  2JVV A;  4HVU A;  3OW2 A;  2HSE B;  1MUZ A;  3GOX A;  4OMF B;  2OI3 A;  3OYJ A;  1VQO A;  1UTI A;  2RI5 A;  5GAN e;  1BK2 A;  1ZBX A;  4ATO A;  1LVK A;  3L2Z A;  1MGQ A;  3URG A;  2O2O A;  5KYY A;  1WHL A;  3MEA A;  1AZG B;  2WSE E;  5HK3 A;  4QW2 A;  2VKN A;  1D0X A;  2HKN A;  3HP9 A;  3DB3 A;  2LT4 A;  1G3Y A;  4DEX A;  4CC7 A;  1LJO A;  3MP6 A;  2I0N A;  1D3B A;  1BI3 A;  3OYM A;  2YUP A;  2DIL A;  4C8Q A;  1IB8 A;  2RK1 A;  2ZZD A;  3H0I A;  2RQU A;  2FL7 A;  4OB0 B;  2XDD A;  1K0X A;  2MYS A;  3RIR A;  4RG2 A;  1BI0 A;  1FX7 A;  1W2B S;  1NYF A;  4V2S A;  1WHH A;  1VQK Q;  1RI0 A;  2DZ9 A;  3M53 A;  4AFQ C;  4QVC A;  4OB2 B;  1QQJ A;  2RQR A;  4ZGD B;  1GCQ C;  3MET A;  4IUV A;  1KC8 C;  4NOY A;  2DA9 A;  3RR6 A;  1Q86 U;  1VQ9 A;  5GAM g;  2KVQ G;  2JM9 A;  3G1J A;  5HY6 A;  5I2M A;  1M90 U;  2FHD A;  1VQ5 A;  2FYK A;  2EQU A;  1BYM A;  3CBP A;  4HVW A;  2MAM A;  2J6O A;  2KK4 A;  2K5F A;  3RNJ A;  2HZY A;  3SHW A;  2NLU A;  4C0D C;  1WHG A;  4MZT A;  1MHN A;  3OY9 A;  1CKA A;  1IRE B;  1XQH A;  2XU8 A;  2YRV A;  1RLP C;  4OGC A;  1TUC A;  4J6Y A;  4R0K A;  4FYX B;  4LD9 K;  1K4U S;  4XTW A;  1AEY A;  1M9S A;  3EGX A;  3OYK A;  4N4I A;  2E64 A;  4Z88 A;  1CKB A;  2M16 A;  2V8I A;  3NTI A;  1T0J A;  3HFO A;  2LNH B;  1SRM A;  1OZ3 A;  4M75 B;  5IXF A;  2F2X A;  4M77 C;  2OTL T;  2K4Y A;  3CCR T;  1O75 A;  1E7O A;  3HKS A;  2EJG A;  2KY9 A;  2DVE A;  3V8K A;  1VQP Q;  3RES A;  5KCO A;  3CMA A;  2FVU A;  2V26 A;  3VS7 A;  4BY6 B;  2JMC A;  3JRZ A;  1VQM Q;  5CVI A;  3VS3 A;  4X1V A;  1C6V X;  1HD3 A;  1MND A;  2EW3 A;  2SEM A;  3M4Y A;  3BE3 A;  1K73 R;  3L2W A;  1AWW A;  2LX7 A;  4F14 A;  2E3H A;  2CUD A;  1WGS A;  4M7A B;  3CQT A;  1YCY A;  3G6E Q;  1I4K 1;  2FZG B;  4GBQ A;  1ZUK A;  4N4H A;  1TS9 A;  2AIR B;  3A1P A;  4M77 E;  3SB2 A;  2PU9 B;  4M7D B;  1BCO A;  2KMT A;  4EIK A;  2HSP A;  5IXB A;  3UPU A;  1KHC A;  1QCF A;  1TUD A;  2J6F A;  1Q82 U;  3OYL A;  2L3Q A;  1GL5 A;  2HBW A;  3L42 A;  4ORZ A;  4FSS A;  3ZEH A;  1QWF A;  4QVD A;  2VV5 A;  5FU6 B;  3L2Q A;  1Q86 R;  1X6B A;  2RI3 A;  1ACM B;  4DEY A;  5FRN A;  2R58 A;  5GAO n;  2DNU A;  2F2V A;  1TXQ A;  2K3X A;  4DOW A;  4DBQ A;  2KBT A;  2P84 A;  5GAN j;  1WI7 A;  2JTM A;  1QVG S;  2CSI A;  1DJ7 B;  3VKI A;  3MCA B;  2GFA A;  5FU7 B;  1QLY A;  2D1X A;  4AFU C;  4E2F B;  3QDF A;  2P0Q A;  1OOT A;  1N8R R;  1UEB A;  1VQM T;  1OI1 A;  1JB0 E;  1ZSZ C;  1I5L A;  1UGP B;  3G4S T;  4RTW A;  1VA7 A;  3HSB A;  4C92 A;  4JUV A;  2DD4 A;  4M78 A;  4FYY B;  3FRN A;  5CK9 A;  1UFF A;  2VWF A;  2X4Y A;  4JLG A;  4DOV A;  3LH0 A;  1HSQ A;  3CCR Q;  1VQ7 A;  2CDT A;  2AZS A;  4PJO A;  1X69 A;  2CP2 A;  1OPL A;  3I5S A;  4EMK C;  5FWC A;  4XU3 A;  5I2S A;  3JCM W;  2V1R A;  4MDX A;  5GJW B;  1VQN T;  2ECZ A;  3I55 T;  5C6S A;  1JO8 A;  2RJF A;  4L59 A;  4XU2 A;  1I5O B;  2ZPH B;  2FG0 A;  1FMW A;  2KXD A;  4J9C A;  1KC8 R;  3EG0 A;  2HL5 C;  5GAM h;  1LNX A;  1N8R C;  1M2V A;  2DO3 A;  5IN1 A;  3CPF A;  4OMN A;  1IZ6 A;  4EMK A;  3OYY A;  3CMA T;  2J7I A;  5KYX A;  2J05 A;  1MMN A;  1UGV A;  2CP6 A;  3F70 A;  5LJ5 e;  2L3R A;  3CCR A;  1ARK A;  4HA8 A;  4ME7 A;  3CC4 Q;  2OTL A;  4GLM A;  4RTY A;  2D0Q B;  3JB9 H;  1SSF A;  4OMP A;  1M3C A;  3EFS A;  3L1A A;  2JW4 A;  2VGN A;  5FU6 C;  3RKY A;  3LWH A;  1GFD A;  3A8M B;  2RM4 A;  1Y7X A;  5GAO q;  1YHQ Q;  2VB6 A;  4OMO A;  4QQD A;  3QJY A;  2A37 A;  4M7A F;  1S1N A;  3I5R A;  3KXT A;  1NYG A;  3JV3 A;  2R57 A;  1IHV A;  1M8V A;  1D3B B;  1HYO A;  2JN0 A;  2L8D A;  1Y71 A;  3MEU A;  7AT1 B;  3RKW A;  1YJW Q;  4M7D F;  2E41 A;  3M54 A;  1R0C B;  4PFP A;  4Z8A A;  4E7S A;  2DTI A;  2EQJ A;  2YHT A;  3KFV A;  2KI7 A;  4F7U E;  2QA4 T;  1YFN A;  3CCS Q;  3M0R A;  1PCX A;  3J81 E;  1M1G A;  1VQ6 Q;  3ER0 A;  4FYW B;  4PJO E;  3QHS A;  5C0M A;  2L89 A;  2PUK B;  3H41 A;  4BI4 A;  3OBW A;  2ZCF B;  4M77 G;  2AHJ B;  4FT2 A;  3PFS A;  2QEX A;  3RMS A;  3NTK A;  1KD1 U;  2LJ1 A;  4IUP A;  1N8R U;  4R56 A;  2DXB A;  1RAF B;  2MF2 A;  4P5N A;  2E70 A;  3QWY A;  2AKK A;  2F5K A;  2QQA A;  2WSF E;  3OYF A;  3QDR B;  2R5A A;  4X9C A;  5GMK l;  2QTV A;  3WVE B;  3CPW S;  2MK5 A;  3NHN A;  1UGQ B;  2EGE A;  5GMK j;  3JCM h;  1WJS A;  1Y96 A;  3S3O A;  4MML A;  4F7U F;  2COY A;  2DL5 A;  3U23 A;  3CC2 Q;  3WXM B;  1RAC B;  2EJ9 A;  2OJ2 A;  5DLQ E;  2BZX A;  4CC4 B;  3VJP A;  4KRT A;  3SDZ A;  2K5L A;  4B9X A;  4Y28 E;  3QXE B;  3CCE Q;  4C5E A;  2JXB A;  1YJN A;  1BKB A;  2DXC A;  2X4X A;  5EG2 A;  3L2U A;  2MWP A;  5CKF A;  2YSQ A;  1VQ8 A;  1I81 A;  3I56 A;  4M77 A;  1B3Q A;  2EQM A;  3M9Q A;  3PGG A;  2BZY A;  1OUL A;  5GAN 5;  2KE9 A;  3CME T;  4L6V 5;  1K76 A;  1Y07 A;  1UB4 A;  4C92 E;  1NE8 A;  1UHF A;  1SHF A;  2KRS A;  4LNP A;  2CZ7 B;  4ELZ C;  3TRE A;  2F5T X;  3PNW C;  3A8G B;  4XAX B;  4XTY A;  2BUD A;  3H0F A;  3LW5 E;  1ZSZ B;  5LL6 S;  1PNJ A;  4X9D A;  2YT6 A;  3NTH A;  3M56 A;  2H3E B;  2IIM A; 
#chains in the Genus database with same CATH homology
 3ULR B;  1RUW A;  1UUE A;  1A0N B;  2YUP A;  2P4R A;  2DIL A;  4M4Z A;  1UE9 A;  1WDX A;  3EHQ A;  3H0I A;  2RQU A;  1WLP B;  2V1Q A;  3EGU A;  5ECA A;  1FMK A;  1K0X A;  1M30 A;  2C0T A;  2ESW A;  2EQI A;  3EG3 A;  1YWO A;  2YUO A;  1NYF A;  1ZSG A;  4LUD A;  4AFQ C;  2HDA A;  3VRY A;  2O88 A;  2FEI A;  4RTU A;  3C0C A;  2GTO A;  2RQR A;  3VS1 A;  1GCQ C;  1U5S A;  1SHG A;  2W0Z A;  2K7A A;  2DA9 A;  3H0H A;  3M0U A;  1OPK A;  1ABO A;  2DF6 A;  4F16 A;  2ABL A;  2JM9 A;  1JQQ A;  1NEB A;  3M0S A;  5IHI A;  1YP5 A;  2H8H A;  2JMA A;  4HVW A;  2JS2 A;  2J6O A;  3RNJ A;  1AZE A;  3SHW A;  2K2M A;  1UJY A;  4AFZ C;  2HEQ A;  1NEG A;  2L3S A;  1CKA A;  1M3A A;  2JM8 A;  2RQW A;  1MV0 B;  1SRL A;  1RLP C;  1TUC A;  2X3W D;  4R0K A;  2DL8 A;  3ZL7 C;  1K4U S;  1AWX A;  1AEY A;  4RTV A;  4Z88 A;  1CKB A;  2EGC A;  2LQN A;  3EHR A;  2EYW A;  1T0J A;  1JXM A;  2LNH B;  1SRM A;  2MOX A;  4D8D A;  5IXF A;  2F2X A;  2DRK A;  1WXB A;  4LUE A;  5IHK A;  2LJ0 A;  3I35 A;  2JS0 A;  1E7O A;  2FPD A;  3UA6 A;  1M27 C;  3VRZ A;  2LCS A;  2EBP A;  1AWJ A;  1RI9 A;  4JZ3 A;  2YDL A;  3SEM A;  3FJ5 A;  2J06 A;  3VS7 A;  2GGR A;  1QKX A;  2JT4 A;  4Y92 A;  1U06 A;  1YWP A;  1X6G A;  2K79 A;  4JJC A;  2JMC A;  3TVT A;  1T0H A;  2QDL A;  3VS6 A;  1NG2 A;  4X1V A;  3TSW A;  3VS3 A;  1HD3 A;  1QWE A;  2EW3 A;  2SEM A;  2W10 A;  1U3O A;  3QWX X;  2BZ8 A;  2K9G A;  1BB9 A;  1AWW A;  2DYB A;  2LX7 A;  4F14 A;  2CUD A;  2FPF A;  4J9H A;  2CT4 A;  2YUN A;  3CQT A;  4JPB W;  2RNA A;  1I1J A;  4IIM A;  4GBQ A;  1ZUK A;  1JXO A;  1GBR A;  5HCK A;  2CH4 A;  2KNB B;  4OMM A;  1MV3 A;  1B07 A;  2O9V A;  4EIK A;  1SSH A;  2HSP A;  1QKW A;  1J3T A;  1I07 A;  5IXB A;  2RQT A;  2LQW A;  1QCF A;  1TUD A;  1PKT A;  2J6F A;  1WXU A;  2ENM A;  2L3Q A;  4A63 B;  2HBW A;  4CC3 A;  1GL5 A;  2DJQ A;  4ORZ A;  2GNC A;  3VS4 A;  4FSS A;  1H3H A;  1QWF A;  1N5Z A;  1WIE A;  3GBQ A;  3I9Q A;  4J9F A;  2DMO A;  1X6B A;  2CT3 A;  4AFS C;  2DBM A;  4DEY A;  2DNU A;  2KYM A;  5L23 A;  2F2V A;  2CH4 W;  3R6N A;  3REA B;  2DLP A;  2KBT A;  1BBZ A;  1KFZ A;  1GCP A;  2LZ6 B;  2GBQ A;  1WI7 A;  4RUG A;  3EG2 A;  1G2B A;  2CSI A;  2KGT A;  1QLY A;  3IQL A;  2D1X A;  3PVL A;  4AFU C;  4Z89 A;  1UHC A;  3M0P A;  2EKH A;  1OOT A;  3EG1 A;  4J9I A;  2F2W A;  4J9B A;  1WX6 A;  4ZNX A;  3REB B;  4RTW A;  1VA7 A;  1AD5 A;  2KT1 A;  1ZBJ A;  4LE9 A;  2FPE A;  2KYB A;  2KRM A;  1EFN A;  3M0Q A;  2L2P A;  1JU5 C;  1UFF A;  2EYX A;  2VWF A;  2LMJ A;  2K6D A;  2DM1 A;  5FW9 A;  1TG0 A;  1HSQ A;  3TSZ A;  2KRN A;  2CDT A;  2AZS A;  1RLQ C;  2BTT A;  1X69 A;  1WFW A;  1OPL A;  3I5S A;  2E5K A;  1SEM A;  2A08 A;  5FWC A;  2DBK A;  1T3S A;  2V1R A;  5GJW B;  3RBB B;  3PE0 A;  2ECZ A;  2JTE A;  3VS5 A;  1FYN A;  1VYV A;  1K9A A;  1JO8 A;  2DL4 A;  3NPF A;  2SRC A;  4LN2 A;  2AK5 A;  1M3B A;  1AVZ C;  2FG0 A;  2O9S A;  2KXD A;  4J9C A;  2X3X D;  1KJW A;  1IO6 A;  3EG0 A;  2DRM A;  2DVJ A;  4HCK A;  5GJV B;  2DL3 A;  1GFC A;  2ROL A;  4OMN A;  2RMO A;  1ZUY A;  2D0N A;  2FRY A;  2FO0 A;  2J7I A;  4HVV A;  1PKS A;  1GRI A;  1UGV A;  2J05 A;  2A36 A;  2CSQ A;  5FWB A;  1NLO C;  2ED0 A;  1ARK A;  2D8H A;  1K1Z A;  1PRM C;  4GLM A;  4RTY A;  4CC2 A;  4RTT A;  3UF4 A;  4OMP A;  1M3C A;  2JW4 A;  4RTZ A;  2HCK A;  1GFD A;  2RN8 A;  1YN8 A;  2PTK A;  1I0C A;  1ZUU A;  2C0O A;  2YUQ A;  2M0Y A;  2KT8 A;  4OMO A;  2CRE A;  2OAW A;  4QT7 A;  3A98 A;  2RF0 A;  2A37 A;  1S1N A;  3I5R A;  1UEC A;  1NYG A;  2L3P A;  3JV3 A;  1H8K A;  1NLP C;  5I22 A;  1WYX A;  3LH5 A;  1GBQ A;  1WXT A;  3UAT A;  2K3B A;  1XOV A;  4Z8A A;  1X27 A;  1X2K A;  1GCQ A;  2EGA A;  4J9D A;  3KFV A;  2ROT A;  4F17 A;  2MIO A;  2LJ3 A;  3M0R A;  4ESR A;  1KIK A;  2DX1 A;  1E6G A;  4J9G A;  4HXJ A;  3H41 A;  1UG1 A;  2EYY A;  1UDL A;  1V1C A;  4OML A;  2LP5 A;  4OMQ A;  1M8M A;  1H92 A;  2LJ1 A;  2RPN A;  2RQV A;  5I11 A;  2VVK A;  1AOJ A;  2EVR A;  4AG2 C;  1BU1 A;  3QWY A;  2AKK A;  1LCK A;  1ZX6 A;  3UA7 A;  2J6K A;  2KRO A;  1VYT A;  1KSW A;  1W6X A;  1OV3 A;  2EPD A;  2M51 A;  2PZ1 A;  5IH2 A;  4J9E A;  4JJD A;  1CSK A;  1ZLM A;  1JEG A;  2GQI A;  1NM7 A;  2O31 A;  1UJ0 A;  1OEB A;  4JJB A;  5EC7 A;  3NHN A;  2EGE A;  1Y57 A;  1AWO A;  1Y0M A;  2CUB A;  2G6F X;  2DL5 A;  3U23 A;  1Z9Z A;  4RTX A;  1X43 A;  2NUZ A;  4AG1 C;  3THK A;  1W70 A;  2KXC A;  4WCI A;  1SPK A;  2OJ2 A;  3VS2 A;  1K0S A;  2KEA A;  2MCN A;  2BZX A;  4CC4 B;  1VYU A;  2KR3 A;  1W1F A;  4KRT A;  2NWM A;  1WA7 A;  3O5Z A;  2EYZ A;  1Z9Q A;  2B86 A;  4IIO A;  1HJD A;  2L0A A;  2AZV A;  1T3L A;  2JXB A;  2PNI A;  1PRL C;  3PVQ A;  2DL7 A;  2ED1 A;  2XMF A;  2C0I A;  1ABQ A;  1PWT A;  2A28 A;  2YSQ A;  1PHT A;  4HVU A;  4JZ4 A;  1MUZ A;  2OI3 A;  1B3Q A;  1UTI A;  2BZY A;  1YNZ A;  4K11 A;  1BK2 A;  1YCS B;  2KE9 A;  2D8J A;  1K76 A;  2DE0 X;  1G83 A;  1UHF A;  1SHF A;  2KRS A;  2O2O A;  2GTJ A;  1AZG B;  1E6H A;  4LNP A;  2AKL A;  2VKN A;  2FRW A;  3H0F A;  3M0T A;  1X2Q A;  5IHN A;  4D8K A;  1PNJ A;  4DEX A;  4CC7 A;  3NGP A;  4E6R A;  3VS0 A;  2YT6 A;  2I0N A;  3NMZ C;  2IIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...