2M0YA

Solution structure of the sh3 domain of dock180
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIFPASYIHLKEAIVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Dedicator of cytokinesis protein 1
publication title Solution structure of the SH3 domain of DOCK180.
pubmed doi rcsb
source organism Mus musculus
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2012-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2m0yA00
3NHNA 3REAB 2PTKA 1H8KA 1OPKA 2F2VA 1SSHA 1KJWA 2EPDA 2W10A 1AVZC 1RLPC 1E6GA 2LJ1A 3REBB 2AKKA 2CREA 1QLYA 2VVKA 1GCQA 2EGAA 4AFZC 3M0UA 1NM7A 2KBTA 1PKSA 4OMQA 1UJ0A 2RQUA 2SEMA 4LUDA 2H8HA 1WYXA 3VRZA 3UF4A 3VS3A 2D1XA 4J9CA 2DNUA 5IHKA 1WFWA 3NMZC 2KRMA 2MOXA 2A37A 2BZ8A 2J6FA 2O9VA 2KGTA 2X3XD 4CC3A 2YUNA 4JPBW 3RNJA 1BBZA 2DYBA 1UHFA 4OMPA 2A08A 1K4US 1EFNA 2BTTA 2IIMA 2KRSA 3PE0A 4ORZA 1QWFA 1GFDA 1QKXA 3VS7A 2OJ2A 2P4RA 3H41A 1UTIA 4JZ3A 2B86A 1CKAA 1GFCA 2DRKA 1JEGA 2DILA 2CSQA 2JS0A 2LMJA 1PRLC 5FWBA 1V1CA 1JXOA 2QDLA 1AEYA 4AG1C 1E6HA 3EG0A 1NLPC 4F14A 1PKTA 2K9GA 4OMMA 2F2WA 2LJ0A 3JV3A 3KFVA 2D8JA 2DMOA 3O5ZA 2DE0X 1BU1A 3NGPA 3UATA 2C0TA 1FYNA 5GJVB 2JS2A 3EG2A 1T0HA 2ESWA 2VKNA 2A28A 2ROTA 2YT6A 2DLPA 1WX6A 2AK5A 4JZ4A 2EBPA 1B07A 3H0IA 3TSWA 2RPNA 4HCKA 3VS2A 2O31A 4AG2C 1VYUA 2LQWA 1PRMC 2CSIA 2LX7A 2OAWA 4HXJA 3UA6A 2C0IA 1MV0B 5I22A 2HEQA 1X43A 1GL5A 4WCIA 2CT3A 2AZSA 2D0NA 2BZYA 1GCQC 2E5KA 1U06A 4D8KA 1NYGA 2DF6A 1RUWA 1K76A 1SHGA 2DL4A 4RTZA 5IHNA 1U5SA 4OMOA 2F2XA 2PZ1A 2YUPA 2KE9A 4R0KA 1VYTA 1GBQA 2V1RA 1Y0MA 2RQRA 2KXCA 2NWMA 1UHCA 2L2PA 3QWYA 2YDLA 1UJYA 2EYWA 1PNJA 1RLQC 4J9DA 2DBMA 3EHQA 1KIKA 1WXBA 4DEXA 2CT4A 1S1NA 3NPFA 2EQIA 1AZGB 2YUOA 1ZLMA 1X69A 2AKLA 2DL5A 1BK2A 2L3SA 5FWCA 1W1FA 2LNHB 1Z9ZA 4LUEA 2RMOA 2LZ6B 3PVLA 4AFUC 2K79A 2O9SA 4J9BA 2K7AA 1H92A 2L0AA 1K9AA 1G2BA 1NLOC 1OOTA 1HJDA 1WA7A 2JT4A 1CSKA 2O2OA 2EKHA 3C0CA 4HVWA 5ECAA 1XOVA 4OMNA 1ZUKA 4RUGA 1AWWA 1OV3A 1YN8A 2GNCA 2OI3A 3I9QA 1T0JA 1H3HA 2JXBA 1M3CA 1UE9A 1WIEA 1WXUA 2JW4A 5L23A 1YNZA 3EGUA 2NUZA 1VYVA 2ECZA 4F16A 4J9HA 1X2QA 1NEBA 2J6KA 4RTUA 2XMFA 1M8MA 2A36A 2GGRA 5GJWB 4RTWA 2FRWA 2DX1A 3I35A 1I1JA 2RQTA 2KYMA 2FPDA 1X2KA 1UECA 1FMKA 2K2MA 1X6GA 1PHTA 2JM8A 2K6DA 3M0SA 3EHRA 2JMAA 1GCPA 4JJDA 1TG0A 2KRNA 4RTYA 4AFQC 2HDAA 4LN2A 2FEIA 2L3QA 1BB9A 2CUBA 2DRMA 1KSWA 2YSQA 2J7IA 4GLMA 2KT1A 2SRCA 4E6RA 2GQIA 2HBWA 2KNBB 1AWXA 1OEBA 4J9GA 2EW3A 4K11A 1JQQA 3SHWA 2ROLA 4D8DA 2CH4W 4KRTA 4HVVA 1SRLA 4JJBA 2RF0A 1ZUYA 2EGEA 1ABQA 1SHFA 3VS5A 1WDXA 3LH5A 1PWTA 1MUZA 5IH2A 2KEAA 1UDLA 2O88A 4Z8AA 4AFSC 1T3LA 2KROA 1OPLA 1X27A 1T3SA 1UG1A 2DL3A 4IIOA 5IXBA 2MIOA 3TSZA 3VS1A 4RTXA 4A63B 5EC7A 2L3PA 4ESRA 3H0HA 2D8HA 1ZSGA 3SEMA 1HD3A 1HSQA 4DEYA 3IQLA 2ED0A 2M0YA 1AWOA 2LP5A 4Z88A 2FO0A 2GTOA 4Z89A 2EVRA 2PNIA 1Y57A 2BZXA 1LCKA 4CC2A 1I07A 2LQNA 2DA9A 2J05A 3M0QA 1WXTA 3THKA 3VRYA 2GTJA 4IIMA 2RQWA 1B3QA 1J3TA 1X6BA 3PVQA 2DL8A 1W6XA 2LCSA 2CUDA 1WI7A 3VS4A 4JJCA 1U3OA 2HCKA 2J06A 3A98A 2RNAA 1NEGA 1GRIA 2AZVA 1JO8A 4OMLA 2DJQA 2DVJA 2HSPA 4Y92A 4HVUA 1QWEA 1ARKA 5IXFA 1TUDA 5HCKA 3H0FA 1K0XA 2FPEA 2KR3A 1A0NB 2J6OA 2ENMA 2X3WD 1JU5C 1RI9A 2DBKA 4F17A 2K3BA 1Z9QA 2M51A 4J9EA 5IHIA 1M3AA 3R6NA 1SEMA 1ZBJA 2VWFA 3RBBB 1AOJA 3FJ5A 4FSSA 1WLPB 4ZNXA 1UUEA 1AZEA 1GBRA 2RN8A 2FPFA 3VS6A 2EGCA 1NYFA 2ED1A 2JTEA 3I5SA 4M4ZA 1YWPA 3TVTA 3CQTA 1KFZA 4CC4B 3U23A 3ULRB 2MCNA 4CC7A 2GBQA 1VA7A 4GBQA 1TUCA 1AWJA 2V1QA 2DM1A 3UA7A 3I5RA 3M0RA 1E7OA 1ZUUA 3QWXX 1UGVA 2ABLA 2LJ3A 3ZL7C 3M0TA 4LE9A 5I11A 1G83A 1ABOA 1AD5A 2W0ZA 2CDTA 2CH4A 1M30A 1YP5A 1QCFA 2EYZA 3GBQA 4RTVA 3EG3A 1N5ZA 1YCSB 2KXDA 2KT8A 1SRMA 1QKWA 4X1VA 2G6FX 3EG1A 2RQVA 2C0OA 2YUQA 2JM9A 2FG0A 4EIKA 1MV3A 4J9FA 3VS0A 1K0SA 2EYYA 1JXMA 2KYBA 1CKBA 1I0CA 1M3BA 1NG2A 5FW9A 1K1ZA 1SPKA 4LNPA 1ZX6A 2EYXA 4QT7A 1YWOA 2DL7A 4J9IA 1UFFA 1M27C 2FRYA 1W70A 3M0PA 1IO6A 2JMCA 2I0NA 4RTTA
chains in the Genus database with same CATH superfamily
3QXEB 3OW2A 1OPKA 1WNLA 2F2VA 3L2WA 2EPDA 4B9XA 4OB0B 2HNIA 1AVZC 1RLPC 1PC0A 3S3NA 5L8RE 2MF2A 3CCJA 4NS5A 3M4GA 2VVKA 2EGAA 2OTJA 3M0UA 1NM7A 4J83A 2DIGA 1I5LA 5GAMe 2AHJB 2GQVA 1DJ7B 1NPRA 3UF4A 3VS3A 4PKCC 4J9CA 1WHKA 1VQNT 2PVDB 2YRVA 5IHKA 1M90R 5A0DA 2A37A 3FB9A 3OSSC 2O9VA 2YUNA 1BBZA 1UHFA 4AMCA 3I56A 4N0AC 3OYJA 3G71A 2IIMA 3F70A 3MKDA 3ASKA 5A0GA 2D6FA 1Q7YU 5GAOm 2P4RA 1SG5A 1ZHIA 2B86A 1IB8A 3CD6T 3X24B 2DILA 4C92D 4C92G 1V1CA 1JXOA 3CD6Q 3EG0A 5HK0A 2KY9A 4KUDK 4FU6A 1PKTA 1XQHA 2LJ0A 2K2VA 3KFVA 4ZGEB 4C92F 2DMOA 3QIIA 3NGPA 2VKNA 1ZA1B 2PUKB 5CIUA 2QASA 2Y4YA 5CR2A 2AK5A 2CP6A 1VQ5A 3H0IA 5KYYA 3OYCA 3TSWA 2XDPA 1TU0B 4AG2C 4E7HA 2V26A 1LPLA 1QP3A 4KH0B 3UA6A 3DLMA 1QVFS 4QVDA 3OBWA 5KYUB 1KD1C 3TU4K 2Y4XA 5KYWA 5FU6B 2OTLA 2E5KA 1U06A 4RTZA 1OZ2A 4OMOA 4R0KA 2HKQB 1VYTA 5GAN8 1GXIE 1GBQA 2V1RA 1JJ2S 2E3IA 2NWMA 3JCMd 4LDUA 3CC7A 2QEXT 1YITA 3CPWS 3GNFB 1UJYA 2X35A 4C92E 1RLQC 2YRDA 4M77D 1D1BA 3L2RA 1NJIR 2QEXQ 2HQEA 4J6XA 3NPFA 1BCMA 3HRSA 3EG9A 4M75B 1YIJT 1Y96B 2ZPGB 1BK2A 2EQMA 3G4ST 3SWNA 4EMGA 2DJZA 3HTRA 4FW1A 3G4SQ 1RAFB 1Q82C 1G2BA 2EYQA 3EAEA 1PD0A 4XTXA 4OB3B 1XOVA 4RUGA 1YN8A 2EQKA 2OI3A 1T0JA 4J8OA 1YHQT 2O4XB 1S72T 1TWBA 1VQMA 1M3CA 4F7UB 3URGA 1UGSB 5I2MA 1YHQQ 3EGUA 1S72Q 2E41A 3HPWA 4EPCA 1VYVA 2ECZA 1VQPA 1HXDA 4M78D 3QZ5B 4J7IA 2XMFA 2DFUA 2JTFA 5GANd 1VIFA 4M77E 2QG9B 2RK1A 4KUIA 1N8RU 3X26B 2DX1A 2CKKA 2RI5A 4HA8A 2RQTA 2KYMA 5LJ5d 2FPDA 3X28B 1X2KA 4PLIA 4BE2A 2C06A 4JRKA 3JRZA 1X6GA 3CC4T 2K6DA 3OQ5A 3EH1A 4XAXB 2IVWA 4MDWA 3H6ZA 3CC4Q 2XIDA 4FCYA 2DTOA 2CS7A 2D0QB 2KRNA 4OP0A 1BB9A 2CUBA 2LDMA 3EFSA 5D6XA 2J7IA 4BDZA 2GQIA 1BI1A 2HBWA 2KNBB 1JJ2P 2EW3A 3SWNC 1JQQA 2P0QA 3CCJT 2DKGA 4KRTA 2DO3A 1FX7A 4HVVA 2OTJT 1BCOA 4R56A 3QG1A 4JRPA 1ZUYA 2DETA 2EGEA 5J39A 2K5LA 2FB7A 2RJCA 4M78E 5CQYA 3JCMV 3SD4A 2KEAA 1UDLA 2V8IA 2YHTA 4Z8AA 3JCMQ 4AFSC 1KHCA 1OYXA 4OB2B 3VU3C 4M7AB 1T3SA 2DL3A 5IXBA 9ATCB 3OYEA 1MNDA 3O8VA 3A8MB 3I56T 3G71T 4O5VA 1VQ8A 1K8AU 2D8HA 3L2ZA 2XKOC 4PLLA 4J5YA 3I56Q 2ZPIB 3G71Q 3IQLA 3OYDA 2LP5A 1ZA2B 4Z88A 4Z89A 1Y57A 2NYSA 3CCLA 1Q86C 3CEYA 2DIQA 6AT1B 1UGPB 1QVGS 2J05A 3M0QA 3EH2A 3VRYA 2RA2A 4XTWA 2M1HA 1X6BA 4C5EA 3VS4A 2XICA 1OULA 1U3OA 2FL7A 2L3RA 1I8FA 3BFMA 4GY5A 2AZVA 3NTKA 2CZ1B 1JO8A 2DJQA 1VQ5Q 4HVUA 1W2BA 5GAMd 5IT9E 4EDUA 4EMKB 2R5AA 5GMKi 2OTLT 2EJ9A 4XU0A 1TOVA 3VUZA 1RI9A 2H3JA 4PL6A 2HL5C 2OTLQ 1M2VA 4B9WA 2M51A 3FIFA 5HKCA 5A0LA 3GLXA 3DKMA 3RERA 1HK9A 1VQ4A 5GAN2 1YITT 2X4XA 3CC7T 2JNGA 2XDBA 3V7SA 1LVKA 1AZEA 1IHWA 5A2QE 2FZKB 1Y07A 3WXMB 1YITQ 3CC7Q 1LNXA 2COZA 2EGCA 2ED1A 2JTEA 3A8OB 3I5SA 3TVTA 3NTIA 3LWHA 1K73C 4CC7A 3PMIA 3I5RA 5LJ3j 2AIRB 4JLGA 2LJ3A 2ABLA 2Z0WA 5CCAA 4BD3A 1AD5A 2W0ZA 1QCFA 2EYZA 2OX7A 3JCMh 1OX9A 2P84A 3EG3A 3QPHA 3A1PA 2G6FX 3JCMf 3EG1A 4A54A 2DTHA 1V76A 3CCUQ 5LJ3g 1VQMT 1I0CA 2BKDN 3ZFJA 5FW9A 1K1ZA 4O6JA 4LNPA 1VQMQ 4PJOB 2VUBA 4M75A 1VQPT 1QVGP 4QT7A 1HYOA 1YWOA 1Y96A 4J9IA 1UFFA 4MMLA 1M27C 4FW2A 1IO6A 1UEBA 4WTOB 5FROA 3NHNA 2PTKA 1KJWA 3MCAB 5C0MA 1E6GA 2CYZB 1RAGB 2CREA 5KCOA 2DK3A 2K4YA 1QLYA 1KC8C 1GCQA 4BI4A 3KUFA 4C8QB 4NL3A 2DEQA 1VQKQ 5KYXB 2MYSA 3OMCA 4QKUA 2H8HA 3CCVA 1TS9A 2KK4A 2DNUA 2O4XA 3AT1B 1WFWA 3QYGB 3NMZC 4C5HA 1ACMB 1WPYA 1PSFA 4Y91A 2E64A 4F7UA 2COWA 3PIOA 2X3XD 3LWIA 3TREA 1YIJA 2BTTA 1LOJA 1RABB 5GANf 2KMTA 1OX8A 1RACB 3H41A 5LJ5h 4JZ3A 2X9HA 5FU6C 5GAN5 1CKAA 1GFCA 4Z02A 5LJ5f 1Q7YR 3M9QA 2JS0A 5HK3A 1AEYA 4ZN3A 4E7IA 4AG1C 1K9MC 2ZPEB 4F14A 1QW1A 5GAOq 2FZCB 4OMMA 2F2WA 1D0ZA 3JV3A 1G8XA 2P0KA 3WVEB 4QVCA 3O5ZA 3JCMb 2DE0X 1U1TA 8ATCB 5KYNA 1BU1A 3UATA 5GANj 5GJVB 3EG2A 2A28A 3MEVA 2DLPA 1WX6A 4X34A 4M75C 2EBPA 1VQ8Q 1B07A 2B8AA 1EIFA 3J81E 4BE0A 1M1KU 3VS2A 1KHIA 3GF5A 2E4HA 4A4FA 4TVRA 3S6WA 2C0IA 3CCLT 1IRXA 1SSFA 1X43A 5GANg 1GL5A 4WCIA 2CT3A 4HKEA 5CK9A 2AZSA 5GAOl 1GCQC 3CCLQ 4NL2A 2DF6A 2HD0A 3CCEA 1SHGA 2DL4A 3UPUA 5GMKj 1U5SA 1YCYA 2F2XA 4RG2A 5LJ5g 4FSXA 2ZPBB 1M4ZA 5CKBA 3EFRA 4M7AA 1BIAA 2CP5A 3CBOA 2L8DA 1KIKA 3HSBA 4DEXA 1S1NA 1AHJB 2YUOA 1ZLMA 1X69A 2E65A 2DL5A 4ANJA 1VQ7Q 2QI2A 5FWCA 1PG5B 1W1FA 2LNHB 2JUFA 2RD1A 3RR6A 2LZ6B 3D7SB 3TEEA 3OA6A 1VQOA 3PVLA 4AFUC 2K79A 2L0AA 2RHXA 1OOTA 3GOXA 1WA7A 1D0YA 1N9RA 2R57A 1VQ4T 2O2OA 3OYIA 1VUBA 3C0CA 2RK2A 3MP8A 4HVWA 4XTVA 4E47A 1ZUKA 1AWWA 2GNCA 5CKHA 1VQ4Q 1VQNQ 2X4YA 2XU8A 4IUQA 1PCXA 2GCXA 2GFUA 1KQSA 3X25B 3PIPA 5GAMh 1VQLA 1UE9A 1WIEA 2HZYA 4J6WA 1YNZA 1G5VA 3EFOB 1W2BS 3V7RA 5GAMf 3CCSA 3E9FA 1NEBA 2V8JA 3JB9I 2LT4A 1M8MA 2XG8D 4EMKA 2GGRA 4MDXA 3DB4A 2GF7A 2QK0A 2M02A 1UECA 4X9DA 1RAHB 3G6EA 1B34B 4L6V5 4KBMB 1N8RR 4FT4A 4M7AC 1PHTA 2JM8A 1V29B 2FYKA 2JMAA 4ATOA 2MAMA 2NUPB 4JJDA 3FC3A 2LCLA 4A4KA 2XK0A 1KSWA 1D3BB 4GLMA 2KT1A 1OU8A 2VXEA 3MEAA 2WSCE 3C94A 5GAMg 2ROLA 1LJOA 3JAME 1SRLA 2RF0A 2QAZA 1SHFA 3CCVT 1WDXA 1NJIC 4M7DD 4JUVA 5KH6A 3OYBA 2M16A 2F5KA 3CCVQ 1G3WA 1Q81U 4M77G 2QQSA 1C1AA 1X27A 2MK5A 3OYAA 3TSZA 4C0DB 4ESRA 3S3OA 3H0HA 4PJOA 4QW2A 4M77F 3MO8A 3C95A 1YJ9A 5AT1B 1YIJQ 2RJDA 5KE3A 1X75C 4IURA 1RL2A 2RI3A 3M58A 2GTOA 4EMKC 1K8AR 1R77A 2R5MA 2EVRA 2PNIA 4OF1A 2DA9A 5D6YA 4C8QA 3BY7A 1WXTA 5KYXA 4YTLA 5J3BA 2GTJA 2RQWA 2L89A 1J3TA 3OY9A 1U8RA 3QDRB 1KQ2A 1WI7A 5DM7R 4RMOA 2RNAA 3CMEA 2E3HA 1MMNA 4E7JA 4D6WA 1TTHB 4M78G 1PSEA 4OMLA 1WJRA 3TCJA 2HSPA 1QWEA 3G7ZA 5IXFA 1O75A 3AHUA 3KXTA 5HCKA 1K0XA 1I5OB 4BY6B 1YJNA 2J6OA 2ENMA 2X3WD 3CCQA 4M78F 1BKBA 2ZGWA 1JU5C 3GPLA 4M7DA 3M55A 3OMGA 3CCET 3L1AA 4F17A 2K3BA 3E1SA 4IUPA 1R0CB 3CCEQ 1QVFP 1M3AA 4LDYA 4FIBA 3PTAA 4E7SA 3RBBB 4NOYA 1AOJA 5CKDA 4FSSA 5GAOr 2RN8A 2FPFA 3VS6A 4M4ZA 4PJOC 4AT1B 4CRIA 3CQTA 3N5BB 2DXBA 3JB9D 1P92A 2GBQA 2QYZA 2LNVA 1TUCA 1AWJA 1KK7A 3NFCA 3M0RA 3CPWP 1E7OA 4FM4B 1ZUUA 1VQOT 1OU9A 1UGVA 2XHCA 3HL8A 1ABOA 1XNIA 1YFNA 3CPFA 3CCJQ 5FRMA 2OTJQ 4KGXB 1KD1U 3QYHB 3GBQA 4C8QC 4BUGA 4RTVA 2KXDA 5HY6A 2MWPA 1BI0A 2HQXA 4LD6A 4IKFA 3RKXA 2JM9A 2FG0A 4J9FA 1O9SA 1UB4A 4OGEA 4C0ZA 2KYBA 1VQLT 1VQ6T 1M3BA 1NG2A 1W4SA 1BI3A 3CCMT 1ZX6A 1RAAB 1VQLQ 3OW2S 3CCST 3LX7A 2P4TA 1TUGB 1N9SA 1W70A 2PQWA 4L5GA 1VQ9A 4DBQA 4M7DC 2EQJA 2AKKA 4AFZC 3OYLA 5GAN7 2KBTA 5GMKm 3G6ET 3G1JA 2XDDA 1MGQA 1UJ0A 1EZZB 2RQUA 1KQ1A 2KI7A 1Q82U 4XU2A 5FLXE 3M57A 2VB6A 3G6EQ 3VRZA 2D1XA 2LX9A 3BDLA 4HCBA 2PVOB 1KQSS 2KRMA 3OS2A 3META 3I55A 2J6FA 3DLLA 4JPBW 2K3XA 3EFOA 1QQJA 2A08A 4XQ3A 1K4US 1EFNA 3FRNA 4M75D 4M75G 2ZZDA 1M2OA 2DD4A 1WQ7A 2ZCFB 1GFDA 4OB1B 1QKXA 4KT0E 5LJ3e 2OJ2A 4J6YA 4KULA 1R8OB 1BI2A 5I2SA 1JEGA 2A3LA 2LMJA 1D0XA 1PRLC 3RIRA 2HL3A 3M5AA 1MMDA 4IUTA 5D6WA 2VV5A 1B34A 2OAUA 2NUTB 4B6MA 2K9GA 2F5TX 4XU3A 1QCOA 3JCMJ 3BDUA 2C0TA 2JS2A 2ESWA 4DQ2A 2NUPA 3T9NA 2MI6A 2ZAEA 2YT6A 4F7UG 1I81A 3M59A 1YJ9T 4JZ4A 2ZPFB 1H641 2RO0A 1U1SA 2CZ7B 1D3BA 2RPNA 4HCKA 5KYUA 4BACA 1R0BG 1VYUA 2LQWA 1YJ9Q 1PRMC 1QMCA 1Y7XA 2CSIA 2EFIA 4F7UF 3HP9A 3JCMX 5KYYB 2HBPA 3V8JA 2HEQA 1M1KR 2BZYA 4M75E 2K57A 4D8KA 1NYGA 2RJFA 1IGQA 3OW2P 5KYWB 3BE3A 3EGXB 1UGRB 2WSEE 3R6OA 1Y0MA 2RQRA 3EGDB 2KXCA 1UHCA 4KH1B 4PFOA 3QWYA 1N27A 3CMET 4J9DA 1JJ2A 4LXCA 2DBMA 1NBEB 3JCMP 2DZCA 3CMEQ 2DPPB 1VQPQ 2EJFA 1AZGB 2EQIA 1JBMA 1YJNT 3MEWA 2FZGB 2LQ8A 3CCQT 4JS5A 3TQ7P 3M4YA 4FYVB 1Z9ZA 4BB7A 4LUEA 2RMOA 3CCQQ 4F7UE 3CC2A 2QQAA 4EMHA 3VYHB 2K7AA 4C92B 2BUDA 2ZPHB 3SWNB 1Q86U 1NLOC 1HJDA 2P0PA 2VC8A 2JT4A 4PJNA 1G3YA 2EKHA 3MPUB 4OMNA 2GFAA 5CVIA 3JCMg 3JCMW 3I9QA 3QDFA 2WACA 1H3HA 4M7AD 4M7AG 3CMAA 1WJQA 4MZPA 3OS0A 2ATCB 1WXUA 2JW4A 2DEUA 1Q7YC 2NUZA 3SFMA 4F16A 4J9HA 2CP3A 1IXDA 2J6KA 1M9SA 2A36A 5GJWB 3NTHA 3UT1A 5GAOp 1FMVA 2DTIA 4RTWA 2FRWA 2CGHA 3I35A 3VJPA 2DXTA 2KSSA 5GMKe 3J7AF 1FMKA 3L42A 2HKNA 1MMAA 2K2MA 3HRUA 1WHHA 4PJLA 5KCHA 2QQRA 3M0SA 2LTOA 4C0DC 2CZ6B 5CQXA 3FDRA 1M5Q1 3A5ZB 4M77B 1GCPA 5LJ5j 2F1LA 1TG0A 4RTYA 4ELYC 2HDAA 4LN2A 2L3QA 3H9NA 2DRMA 2YSQA 3WVDB 1K73U 1VQ9T 1AWXA 1OEBA 1PM3A 4M7AE 4J9GA 2LC4A 1MNEA 4A4EA 4Y28E 3SHWA 1AT1B 4D8DA 3PFSA 5FU7B 2IPOB 3LGLA 4A4GA 2JN0A 4UC4A 1ABQA 2WSFE 3OYHA 3BW1A 4C0GA 1JB0E 1BIBA 1PWTA 4BI3A 1G3TA 4LD9K 3CXCA 3OBYA 2BE9B 1T3LA 1ZBXA 4HCZA 3I55T 1UG1A 2MIOA 1RAIB 4RTXA 4ELZC 5EC7A 1D09B 1YJWA 3I55Q 1Q81R 3SEMA 2VXFA 1HD3A 2CZ0B 3OYFA 4BY6C 4DEYA 3OYNA 3P8BB 4M78B 2M0YA 1OI1A 2FO0A 2RI2A 2EKOA 3A8GB 1M90C 1I4K1 1LCKA 3HHTB 2K3YA 4XU1A 2Y90A 4PNOA 3H8ZA 4HT9A 2LQNA 3THKA 3E9GA 4IIMA 1KC8U 1PD1A 3RKWA 2QA4A 3X20B 1Y71A 1QVGA 2LQKA 3PVQA 4A53A 2DL8A 1RAEB 1TSFA 2CUDA 5IAYA 1VQ6A 2JTMA 3JCMc 2HCKA 2J06A 3A98A 1NEGA 3LW5E 1GRIA 3MHXA 4ZN1A 3CCMA 4OVAA 4PJOD 4PJOG 3FEOA 1YI2A 2DVJA 1WHJA 2H3EB 1X6OA 2EIFA 2FPEA 2KR3A 2RHUA 1A0NB 4PJOF 4RCCA 1N8RC 2X4JA 1JRIA 4XK8E 4OGCA 1WZOA 1C6VX 5I21A 5CKEA 3V7CA 4N4HA 2V8KA 2JZ2A 1QVPA 2KVQG 4C8QD 4C8QG 4E7LA 4J9EA 5IHIA 2NUTA 3Q1JA 1WQWA 5GAMj 1K9MU 1ZBJA 1M2VB 3C12A 3FJ5A 3A8HB 4ZNXA 1QP2A 2VYTA 1GBRA 5LJ3d 4FYWB 4C8QF 2A0FB 4LDXA 2RHYA 3INZA 1SF9A 2HQHA 4E7KA 3MP1A 3PMTA 3PNWC 4CC4B 2E6ZA 5FRNA 3JB9J 1WHGA 4PJMA 2DM1A 3UA7A 2E1HA 3QWXX 4LE9A 1ZSZB 3CC2T 4PJOE 2CDTA 4M7DG 3CC2Q 1YCSB 4ZGJB 2RM4A 3EGXA 2DERA 2E10A 1QKWA 4X1VA 2BE7D 4PFPA 2RQVA 3EGDA 1KD1R 4M7DF 4JS4A 4EIKA 3JSCA 1SKUB 3CMAT 1K0SA 1WHLA 4DOVA 2EYYA 4LDVA 2QXFA 1CKBA 1K8AC 4C8QE 4JJNK 3CMAQ 3E2UA 1SPKA 4C0FA 2EYXA 3GIBA 5CKFA 4XTUA 3VV0A 2XI9A 4FYXB 3RKYA 2E5QA 3M0PA 2JMCA 2RH2A 2I0NA 2E70A 3GP8A 3REAB 1H8KA 1SSHA 2W10A 2RJEA 4QQDA 3MJXA 3LGFA 2LJ1A 3REBB 4C92A 4VUBA 1W2BP 2JVVA 1IZ6A 3MEUA 1PKSA 4BE1A 1NZ9A 4OMQA 4CI0C 2SEMA 1D1AA 2MWOA 4LUDA 1M90U 3QJYA 2CP7A 2LCCA 1WYXA 2O01E 3RMQA 3CCUA 4M7DE 3RUXA 2DD5A 1Q82R 2MOXA 2BZ8A 3E19A 5DLOA 2KGTA 4CC3A 3RNJA 2D9TA 2DYBA 4OMPA 1NE8A 2KRSA 3PE0A 4ORZA 1QWFA 3VS7A 1M1FA 4GLKA 1UTIA 2HAXA 2DRKA 2X51A 2CSQA 1YBYA 5FWBA 1IREB 2QDLA 3OYMA 1E6HA 1VQKA 1NLPC 2YLCA 4RCBA 5DLQE 4BDYA 3CCRA 2D8JA 5GMKl 3HFOA 1Q95G 1FYNA 4ME7A 3JB9G 1T0HA 1NPPA 4M77A 1YJWT 5GAN4 2ROTA 5LL6S 4V2SA 1IHVA 1YJWQ 1WJSA 3JB9F 2O31A 5M9OA 3LLRA 5KE2A 2LX7A 2OAWA 4HXJA 1VQOQ 1MV0B 4QVZA 1KG1A 5I22A 3KBGA 4QQ6A 3A8LB 4N4GA 4C92C 2D0NA 3S3MA 3OB9A 3QZ9B 1RUWA 1K76A 7AT1B 2QA4T 1VIEA 5IHNA 2PZ1A 1OZ3A 2YUPA 2KE9A 3CXCS 1NJIU 2QA4Q 5CAIA 1MMGA 2L2PA 3FLGA 2YDLA 2DXUA 2DZ9A 5DY9A 2EYWA 1PNJA 1VQ6Q 3JB9H 1FMWA 3EHQA 1WHMA 2QGFB 1YI2T 2L5QA 8AT1B 1WXBA 3CCMQ 2CT4A 3CCSQ 4M78A 1YI2Q 2JJ9A 3QUIA 1XTDA 2AKLA 2L3SA 4DBHA 2I2LA 4R55A 2CP2A 4DOWA 3RDVA 2O9SA 4ZGDB 4J9BA 1H92A 3QJ6A 1K9AA 4XTYA 1CSKA 5GAOn 1UGQB 2BIVA 2VGMA 5ECAA 4C5IA 2QQBA 1OV3A 3OS5A 3OS1A 1M1GA 3LH0A 4ZTFA 1Q86R 2PUOB 3L2VA 2DAQA 4M77C 2VGNA 2JXBA 1RADB 2CP0A 4IUVA 5L23A 2G3RA 1VQ5T 2PVGB 1X2QA 3ZEHA 4PFZA 4X9CA 4M75F 2R58A 3LYIA 4RTUA 2XD0A 3ER0A 1VQ7A 3DB3A 2QDYB 5EG2A 5FU7C 3ME9A 2EWNA 2RHIA 4KGZB 2E12A 4E2FB 2YLBA 5LJ3h 1I1JA 2COYA 3HRTA 3GNGA 2YRCA 3QO3A 4Q5WA 2LRQA 1B7TA 2KQWA 5LJ3f 4MZTA 2RHZA 1OQKA 2FVUA 2JOYA 1VQNA 3EHRA 4IUUA 3HFNA 4OMFB 4AFQC 4FL6A 2A7YA 3OSVA 1M1KC 1N6AA 2FEIA 3L2UA 4M78C 2LT1A 4DA4A 2SRCA 4E6RA 3JCMe 4II1A 3CXCP 2KAFA 1ZSZA 4K11A 4ZTJA 1QVFA 4MMKA 3HKSA 2CH4W 1K73R 1H3ZA 4JJBA 3CD6A 1RI0A 4QQGA 3CBPA 3VKIA 4DBFA 3FJPA 2DYIA 1XJWB 3M54A 4RKUE 2QTXA 3LH5A 3VS5A 4JDSA 1QCNA 4BI8B 2QGGA 1MUZA 5IH2A 2O88A 3CCUT 2EQUA 4E7ZA 2KROA 4A4HA 1OPLA 4XTZA 3RESA 4IIOA 3VS1A 3CPWA 3OYKA 2K5FA 2EAYA 4A63B 2L3PA 4RG8A 1FXXA 1ZSGA 2PU9B 1HSQA 3EG9B 2QQ9A 1YJNQ 2ED0A 1IGUA 1AWOA 5GAN3 3V8KA 1KQSP 4J7FA 2BZXA 3UDCA 4N4IA 4CC2A 1I07A 2AT1B 3QSUA 2F69A 3PT9A 4F04B 5C6SA 1WGSA 3VUBA 1M8VA 3MP6A 2IG0A 5GAN6 1VQKT 2DXCA 1G3SA 3CCRT 1B3QA 2LVMA 5GANe 1VOMA 3J80E 3RMSA 1W6XA 2MMPA 2LCSA 3CCRQ 1KC8R 4JJCA 5IN1A 2M0OA 2QEXA 5D7UA 4M7AF 5LJ5e 2VASA 3M53A 3CBMA 4Y92A 2QTVA 1ARKA 4C5GA 2E6NA 2MPXC 3VYGA 1TUDA 5GANh 3H0FA 3QKJA 4LDWA 1ZSZC 2M9UA 4FYYB 3G4SA 4DBRA 4P5NA 3P8DA 2KDSA 2YWWA 2DBKA 1X01A 1Z9QA 4L59A 4M7DB 3UWNA 3OYGA 3R6NA 1C0MA 2EJGA 4MZMA 1SEMA 2VWFA 2HMAA 1WLPB 1UUEA 3OYYA 5GMKh 1MHNA 1NYFA 4JRQA 3P8HA 1YHQA 1K9MR 5CO7A 1YWPA 5AYFA 1KFZA 1TH7A 2K5IA 1S72A 3U23A 3ULRB 2MCNA 1VQ8T 4N0AA 4JLIA 1VA7A 4GBQA 2V1QA 3M56A 3QHSA 3ZBDA 1FWZA 1VQ9Q 3ZL7C 3M0TA 4HCCA 5I11A 4PK4A 1G83A 3C4SA 4FT2A 3PGGA 4HT8A 2CH4A 3SDZA 1M30A 1YP5A 1N5ZA 2KT8A 3L2QA 1SRMA 2YXYA 3V8LA 1TXQA 4PJJA 3QBYA 2RB6A 1D1CA 1Q81C 2C0OA 2DVEA 4KGVB 2YUQA 2HSEB 1BYMA 1MV3A 3VS0A 2X4WA 1EX4A 1JXMA 3CC4A 2FHDA 4JRIA 2NLUA 5J26A 1ZQ1A 4WF2A 2DL7A 3SB2A 2FRYA 1VQ7T 1F1BB 4RTTA
chains in the Genus database with same CATH topology
3NHNA 3REAB 2PTKA 1H8KA 1OPKA 2F2VA 1SSHA 1KJWA 2EPDA 2W10A 1AVZC 1RLPC 1E6GA 2LJ1A 3REBB 2AKKA 2CREA 1QLYA 2VVKA 1GCQA 2EGAA 4AFZC 3M0UA 1NM7A 2KBTA 1PKSA 4OMQA 1UJ0A 2RQUA 2SEMA 4LUDA 2H8HA 1WYXA 3VRZA 3UF4A 3VS3A 2D1XA 4J9CA 2DNUA 5IHKA 1WFWA 3NMZC 2KRMA 2MOXA 2A37A 2BZ8A 2J6FA 2O9VA 2KGTA 2X3XD 4CC3A 2YUNA 4JPBW 3RNJA 1BBZA 2DYBA 1UHFA 4OMPA 2A08A 1K4US 1EFNA 2BTTA 2IIMA 2KRSA 3PE0A 4ORZA 1QWFA 1GFDA 1QKXA 3VS7A 2OJ2A 2P4RA 3H41A 1UTIA 4JZ3A 2B86A 1CKAA 1GFCA 2DRKA 1JEGA 2DILA 2CSQA 2JS0A 2LMJA 1PRLC 5FWBA 1V1CA 1JXOA 2QDLA 1AEYA 4AG1C 1E6HA 3EG0A 1NLPC 4F14A 1PKTA 2K9GA 4OMMA 2F2WA 2LJ0A 3JV3A 3KFVA 2D8JA 2DMOA 3O5ZA 2DE0X 1BU1A 3NGPA 3UATA 2C0TA 1FYNA 5GJVB 2JS2A 3EG2A 1T0HA 2ESWA 2VKNA 2A28A 2ROTA 2YT6A 2DLPA 1WX6A 2AK5A 4JZ4A 2EBPA 1B07A 3H0IA 3TSWA 2RPNA 4HCKA 3VS2A 2O31A 4AG2C 1VYUA 2LQWA 1PRMC 2CSIA 2LX7A 2OAWA 4HXJA 3UA6A 2C0IA 1MV0B 5I22A 2HEQA 1X43A 1GL5A 4WCIA 2CT3A 2AZSA 2D0NA 2BZYA 1GCQC 2E5KA 1U06A 4D8KA 1NYGA 2DF6A 1RUWA 1K76A 1SHGA 2DL4A 4RTZA 5IHNA 1U5SA 4OMOA 2F2XA 2PZ1A 2YUPA 2KE9A 4R0KA 1VYTA 1GBQA 2V1RA 1Y0MA 2RQRA 2KXCA 2NWMA 1UHCA 2L2PA 3QWYA 2YDLA 1UJYA 2EYWA 1PNJA 1RLQC 4J9DA 2DBMA 3EHQA 1KIKA 1WXBA 4DEXA 2CT4A 1S1NA 3NPFA 2EQIA 1AZGB 2YUOA 1ZLMA 1X69A 2AKLA 2DL5A 1BK2A 2L3SA 5FWCA 1W1FA 2LNHB 1Z9ZA 4LUEA 2RMOA 2LZ6B 3PVLA 4AFUC 2K79A 2O9SA 4J9BA 2K7AA 1H92A 2L0AA 1K9AA 1G2BA 1NLOC 1OOTA 1HJDA 1WA7A 2JT4A 1CSKA 2O2OA 2EKHA 3C0CA 4HVWA 5ECAA 1XOVA 4OMNA 1ZUKA 4RUGA 1AWWA 1OV3A 1YN8A 2GNCA 2OI3A 3I9QA 1T0JA 1H3HA 2JXBA 1M3CA 1UE9A 1WIEA 1WXUA 2JW4A 5L23A 1YNZA 3EGUA 2NUZA 1VYVA 2ECZA 4F16A 4J9HA 1X2QA 1NEBA 2J6KA 4RTUA 2XMFA 1M8MA 2A36A 2GGRA 5GJWB 4RTWA 2FRWA 2DX1A 3I35A 1I1JA 2RQTA 2KYMA 2FPDA 1X2KA 1UECA 1FMKA 2K2MA 1X6GA 1PHTA 2JM8A 2K6DA 3M0SA 3EHRA 2JMAA 1GCPA 4JJDA 1TG0A 2KRNA 4RTYA 4AFQC 2HDAA 4LN2A 2FEIA 2L3QA 1BB9A 2CUBA 2DRMA 1KSWA 2YSQA 2J7IA 4GLMA 2KT1A 2SRCA 4E6RA 2GQIA 2HBWA 2KNBB 1AWXA 1OEBA 4J9GA 2EW3A 4K11A 1JQQA 3SHWA 2ROLA 4D8DA 2CH4W 4KRTA 4HVVA 1SRLA 4JJBA 2RF0A 1ZUYA 2EGEA 1ABQA 1SHFA 3VS5A 1WDXA 3LH5A 1PWTA 1MUZA 5IH2A 2KEAA 1UDLA 2O88A 4Z8AA 4AFSC 1T3LA 2KROA 1OPLA 1X27A 1T3SA 1UG1A 2DL3A 4IIOA 5IXBA 2MIOA 3TSZA 3VS1A 4RTXA 4A63B 5EC7A 2L3PA 4ESRA 3H0HA 2D8HA 1ZSGA 3SEMA 1HD3A 1HSQA 4DEYA 3IQLA 2ED0A 2M0YA 1AWOA 2LP5A 4Z88A 2FO0A 2GTOA 4Z89A 2EVRA 2PNIA 1Y57A 2BZXA 1LCKA 4CC2A 1I07A 2LQNA 2DA9A 2J05A 3M0QA 1WXTA 3THKA 3VRYA 2GTJA 4IIMA 2RQWA 1B3QA 1J3TA 1X6BA 3PVQA 2DL8A 1W6XA 2LCSA 2CUDA 1WI7A 3VS4A 4JJCA 1U3OA 2HCKA 2J06A 3A98A 2RNAA 1NEGA 1GRIA 2AZVA 1JO8A 4OMLA 2DJQA 2DVJA 2HSPA 4Y92A 4HVUA 1QWEA 1ARKA 5IXFA 1TUDA 5HCKA 3H0FA 1K0XA 2FPEA 2KR3A 1A0NB 2J6OA 2ENMA 2X3WD 1JU5C 1RI9A 2DBKA 4F17A 2K3BA 1Z9QA 2M51A 4J9EA 5IHIA 1M3AA 3R6NA 1SEMA 1ZBJA 2VWFA 3RBBB 1AOJA 3FJ5A 4FSSA 1WLPB 4ZNXA 1UUEA 1AZEA 1GBRA 2RN8A 2FPFA 3VS6A 2EGCA 1NYFA 2ED1A 2JTEA 3I5SA 4M4ZA 1YWPA 3TVTA 3CQTA 1KFZA 4CC4B 3U23A 3ULRB 2MCNA 4CC7A 2GBQA 1VA7A 4GBQA 1TUCA 1AWJA 2V1QA 2DM1A 3UA7A 3I5RA 3M0RA 1E7OA 1ZUUA 3QWXX 1UGVA 2ABLA 2LJ3A 3ZL7C 3M0TA 4LE9A 5I11A 1G83A 1ABOA 1AD5A 2W0ZA 2CDTA 2CH4A 1M30A 1YP5A 1QCFA 2EYZA 3GBQA 4RTVA 3EG3A 1N5ZA 1YCSB 2KXDA 2KT8A 1SRMA 1QKWA 4X1VA 2G6FX 3EG1A 2RQVA 2C0OA 2YUQA 2JM9A 2FG0A 4EIKA 1MV3A 4J9FA 3VS0A 1K0SA 2EYYA 1JXMA 2KYBA 1CKBA 1I0CA 1M3BA 1NG2A 5FW9A 1K1ZA 1SPKA 4LNPA 1ZX6A 2EYXA 4QT7A 1YWOA 2DL7A 4J9IA 1UFFA 1M27C 2FRYA 1W70A 3M0PA 1IO6A 2JMCA 2I0NA 4RTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHN A;  3REA B;  2PTK A;  1H8K A;  1OPK A;  2F2V A;  1SSH A;  1KJW A;  2EPD A;  2W10 A;  1AVZ C;  1RLP C;  1E6G A;  2LJ1 A;  3REB B;  2AKK A;  2CRE A;  1QLY A;  2VVK A;  1GCQ A;  2EGA A;  4AFZ C;  3M0U A;  1NM7 A;  2KBT A;  1PKS A;  4OMQ A;  1UJ0 A;  2RQU A;  2SEM A;  4LUD A;  2H8H A;  1WYX A;  3VRZ A;  3UF4 A;  3VS3 A;  2D1X A;  4J9C A;  2DNU A;  5IHK A;  1WFW A;  3NMZ C;  2KRM A;  2MOX A;  2A37 A;  2BZ8 A;  2J6F A;  2O9V A;  2KGT A;  2X3X D;  4CC3 A;  2YUN A;  4JPB W;  3RNJ A;  1BBZ A;  2DYB A;  1UHF A;  4OMP A;  2A08 A;  1K4U S;  1EFN A;  2BTT A;  2IIM A;  2KRS A;  3PE0 A;  4ORZ A;  1QWF A;  1GFD A;  1QKX A;  3VS7 A;  2OJ2 A;  2P4R A;  3H41 A;  1UTI A;  4JZ3 A;  2B86 A;  1CKA A;  1GFC A;  2DRK A;  1JEG A;  2DIL A;  2CSQ A;  2JS0 A;  2LMJ A;  1PRL C;  5FWB A;  1V1C A;  1JXO A;  2QDL A;  1AEY A;  4AG1 C;  1E6H A;  3EG0 A;  1NLP C;  4F14 A;  1PKT A;  2K9G A;  4OMM A;  2F2W A;  2LJ0 A;  3JV3 A;  3KFV A;  2D8J A;  2DMO A;  3O5Z A;  2DE0 X;  1BU1 A;  3NGP A;  3UAT A;  2C0T A;  1FYN A;  5GJV B;  2JS2 A;  3EG2 A;  1T0H A;  2ESW A;  2VKN A;  2A28 A;  2ROT A;  2YT6 A;  2DLP A;  1WX6 A;  2AK5 A;  4JZ4 A;  2EBP A;  1B07 A;  3H0I A;  3TSW A;  2RPN A;  4HCK A;  3VS2 A;  2O31 A;  4AG2 C;  1VYU A;  2LQW A;  1PRM C;  2CSI A;  2LX7 A;  2OAW A;  4HXJ A;  3UA6 A;  2C0I A;  1MV0 B;  5I22 A;  2HEQ A;  1X43 A;  1GL5 A;  4WCI A;  2CT3 A;  2AZS A;  2D0N A;  2BZY A;  1GCQ C;  2E5K A;  1U06 A;  4D8K A;  1NYG A;  2DF6 A;  1RUW A;  1K76 A;  1SHG A;  2DL4 A;  4RTZ A;  5IHN A;  1U5S A;  4OMO A;  2F2X A;  2PZ1 A;  2YUP A;  2KE9 A;  4R0K A;  1VYT A;  1GBQ A;  2V1R A;  1Y0M A;  2RQR A;  2KXC A;  2NWM A;  1UHC A;  2L2P A;  3QWY A;  2YDL A;  1UJY A;  2EYW A;  1PNJ A;  1RLQ C;  4J9D A;  2DBM A;  3EHQ A;  1KIK A;  1WXB A;  4DEX A;  2CT4 A;  1S1N A;  3NPF A;  2EQI A;  1AZG B;  2YUO A;  1ZLM A;  1X69 A;  2AKL A;  2DL5 A;  1BK2 A;  2L3S A;  5FWC A;  1W1F A;  2LNH B;  1Z9Z A;  4LUE A;  2RMO A;  2LZ6 B;  3PVL A;  4AFU C;  2K79 A;  2O9S A;  4J9B A;  2K7A A;  1H92 A;  2L0A A;  1K9A A;  1G2B A;  1NLO C;  1OOT A;  1HJD A;  1WA7 A;  2JT4 A;  1CSK A;  2O2O A;  2EKH A;  3C0C A;  4HVW A;  5ECA A;  1XOV A;  4OMN A;  1ZUK A;  4RUG A;  1AWW A;  1OV3 A;  1YN8 A;  2GNC A;  2OI3 A;  3I9Q A;  1T0J A;  1H3H A;  2JXB A;  1M3C A;  1UE9 A;  1WIE A;  1WXU A;  2JW4 A;  5L23 A;  1YNZ A;  3EGU A;  2NUZ A;  1VYV A;  2ECZ A;  4F16 A;  4J9H A;  1X2Q A;  1NEB A;  2J6K A;  4RTU A;  2XMF A;  1M8M A;  2A36 A;  2GGR A;  5GJW B;  4RTW A;  2FRW A;  2DX1 A;  3I35 A;  1I1J A;  2RQT A;  2KYM A;  2FPD A;  1X2K A;  1UEC A;  1FMK A;  2K2M A;  1X6G A;  1PHT A;  2JM8 A;  2K6D A;  3M0S A;  3EHR A;  2JMA A;  1GCP A;  4JJD A;  1TG0 A;  2KRN A;  4RTY A;  4AFQ C;  2HDA A;  4LN2 A;  2FEI A;  2L3Q A;  1BB9 A;  2CUB A;  2DRM A;  1KSW A;  2YSQ A;  2J7I A;  4GLM A;  2KT1 A;  2SRC A;  4E6R A;  2GQI A;  2HBW A;  2KNB B;  1AWX A;  1OEB A;  4J9G A;  2EW3 A;  4K11 A;  1JQQ A;  3SHW A;  2ROL A;  4D8D A;  2CH4 W;  4KRT A;  4HVV A;  1SRL A;  4JJB A;  2RF0 A;  1ZUY A;  2EGE A;  1ABQ A;  1SHF A;  3VS5 A;  1WDX A;  3LH5 A;  1PWT A;  1MUZ A;  5IH2 A;  2KEA A;  1UDL A;  2O88 A;  4Z8A A;  4AFS C;  1T3L A;  2KRO A;  1OPL A;  1X27 A;  1T3S A;  1UG1 A;  2DL3 A;  4IIO A;  5IXB A;  2MIO A;  3TSZ A;  3VS1 A;  4RTX A;  4A63 B;  5EC7 A;  2L3P A;  4ESR A;  3H0H A;  2D8H A;  1ZSG A;  3SEM A;  1HD3 A;  1HSQ A;  4DEY A;  3IQL A;  2ED0 A;  2M0Y A;  1AWO A;  2LP5 A;  4Z88 A;  2FO0 A;  2GTO A;  4Z89 A;  2EVR A;  2PNI A;  1Y57 A;  2BZX A;  1LCK A;  4CC2 A;  1I07 A;  2LQN A;  2DA9 A;  2J05 A;  3M0Q A;  1WXT A;  3THK A;  3VRY A;  2GTJ A;  4IIM A;  2RQW A;  1B3Q A;  1J3T A;  1X6B A;  3PVQ A;  2DL8 A;  1W6X A;  2LCS A;  2CUD A;  1WI7 A;  3VS4 A;  4JJC A;  1U3O A;  2HCK A;  2J06 A;  3A98 A;  2RNA A;  1NEG A;  1GRI A;  2AZV A;  1JO8 A;  4OML A;  2DJQ A;  2DVJ A;  2HSP A;  4Y92 A;  4HVU A;  1QWE A;  1ARK A;  5IXF A;  1TUD A;  5HCK A;  3H0F A;  1K0X A;  2FPE A;  2KR3 A;  1A0N B;  2J6O A;  2ENM A;  2X3W D;  1JU5 C;  1RI9 A;  2DBK A;  4F17 A;  2K3B A;  1Z9Q A;  2M51 A;  4J9E A;  5IHI A;  1M3A A;  3R6N A;  1SEM A;  1ZBJ A;  2VWF A;  3RBB B;  1AOJ A;  3FJ5 A;  4FSS A;  1WLP B;  4ZNX A;  1UUE A;  1AZE A;  1GBR A;  2RN8 A;  2FPF A;  3VS6 A;  2EGC A;  1NYF A;  2ED1 A;  2JTE A;  3I5S A;  4M4Z A;  1YWP A;  3TVT A;  3CQT A;  1KFZ A;  4CC4 B;  3U23 A;  3ULR B;  2MCN A;  4CC7 A;  2GBQ A;  1VA7 A;  4GBQ A;  1TUC A;  1AWJ A;  2V1Q A;  2DM1 A;  3UA7 A;  3I5R A;  3M0R A;  1E7O A;  1ZUU A;  3QWX X;  1UGV A;  2ABL A;  2LJ3 A;  3ZL7 C;  3M0T A;  4LE9 A;  5I11 A;  1G83 A;  1ABO A;  1AD5 A;  2W0Z A;  2CDT A;  2CH4 A;  1M30 A;  1YP5 A;  1QCF A;  2EYZ A;  3GBQ A;  4RTV A;  3EG3 A;  1N5Z A;  1YCS B;  2KXD A;  2KT8 A;  1SRM A;  1QKW A;  4X1V A;  2G6F X;  3EG1 A;  2RQV A;  2C0O A;  2YUQ A;  2JM9 A;  2FG0 A;  4EIK A;  1MV3 A;  4J9F A;  3VS0 A;  1K0S A;  2EYY A;  1JXM A;  2KYB A;  1CKB A;  1I0C A;  1M3B A;  1NG2 A;  5FW9 A;  1K1Z A;  1SPK A;  4LNP A;  1ZX6 A;  2EYX A;  4QT7 A;  1YWO A;  2DL7 A;  4J9I A;  1UFF A;  1M27 C;  2FRY A;  1W70 A;  3M0P A;  1IO6 A;  2JMC A;  2I0N A;  4RTT A; 
#chains in the Genus database with same CATH topology
 3QXE B;  3OW2 A;  1OPK A;  1WNL A;  2F2V A;  3L2W A;  2EPD A;  4B9X A;  4OB0 B;  2HNI A;  1AVZ C;  1RLP C;  1PC0 A;  3S3N A;  5L8R E;  2MF2 A;  3CCJ A;  4NS5 A;  3M4G A;  2VVK A;  2EGA A;  2OTJ A;  3M0U A;  1NM7 A;  4J83 A;  2DIG A;  1I5L A;  5GAM e;  2AHJ B;  2GQV A;  1DJ7 B;  1NPR A;  3UF4 A;  3VS3 A;  4PKC C;  4J9C A;  1WHK A;  1VQN T;  2PVD B;  2YRV A;  5IHK A;  1M90 R;  5A0D A;  2A37 A;  3FB9 A;  3OSS C;  2O9V A;  2YUN A;  1BBZ A;  1UHF A;  4AMC A;  3I56 A;  4N0A C;  3OYJ A;  3G71 A;  2IIM A;  3F70 A;  3MKD A;  3ASK A;  5A0G A;  2D6F A;  1Q7Y U;  5GAO m;  2P4R A;  1SG5 A;  1ZHI A;  2B86 A;  1IB8 A;  3CD6 T;  3X24 B;  2DIL A;  4C92 D;  4C92 G;  1V1C A;  1JXO A;  3CD6 Q;  3EG0 A;  5HK0 A;  2KY9 A;  4KUD K;  4FU6 A;  1PKT A;  1XQH A;  2LJ0 A;  2K2V A;  3KFV A;  4ZGE B;  4C92 F;  2DMO A;  3QII A;  3NGP A;  2VKN A;  1ZA1 B;  2PUK B;  5CIU A;  2QAS A;  2Y4Y A;  5CR2 A;  2AK5 A;  2CP6 A;  1VQ5 A;  3H0I A;  5KYY A;  3OYC A;  3TSW A;  2XDP A;  1TU0 B;  4AG2 C;  4E7H A;  2V26 A;  1LPL A;  1QP3 A;  4KH0 B;  3UA6 A;  3DLM A;  1QVF S;  4QVD A;  3OBW A;  5KYU B;  1KD1 C;  3TU4 K;  2Y4X A;  5KYW A;  5FU6 B;  2OTL A;  2E5K A;  1U06 A;  4RTZ A;  1OZ2 A;  4OMO A;  4R0K A;  2HKQ B;  1VYT A;  5GAN 8;  1GXI E;  1GBQ A;  2V1R A;  1JJ2 S;  2E3I A;  2NWM A;  3JCM d;  4LDU A;  3CC7 A;  2QEX T;  1YIT A;  3CPW S;  3GNF B;  1UJY A;  2X35 A;  4C92 E;  1RLQ C;  2YRD A;  4M77 D;  1D1B A;  3L2R A;  1NJI R;  2QEX Q;  2HQE A;  4J6X A;  3NPF A;  1BCM A;  3HRS A;  3EG9 A;  4M75 B;  1YIJ T;  1Y96 B;  2ZPG B;  1BK2 A;  2EQM A;  3G4S T;  3SWN A;  4EMG A;  2DJZ A;  3HTR A;  4FW1 A;  3G4S Q;  1RAF B;  1Q82 C;  1G2B A;  2EYQ A;  3EAE A;  1PD0 A;  4XTX A;  4OB3 B;  1XOV A;  4RUG A;  1YN8 A;  2EQK A;  2OI3 A;  1T0J A;  4J8O A;  1YHQ T;  2O4X B;  1S72 T;  1TWB A;  1VQM A;  1M3C A;  4F7U B;  3URG A;  1UGS B;  5I2M A;  1YHQ Q;  3EGU A;  1S72 Q;  2E41 A;  3HPW A;  4EPC A;  1VYV A;  2ECZ A;  1VQP A;  1HXD A;  4M78 D;  3QZ5 B;  4J7I A;  2XMF A;  2DFU A;  2JTF A;  5GAN d;  1VIF A;  4M77 E;  2QG9 B;  2RK1 A;  4KUI A;  1N8R U;  3X26 B;  2DX1 A;  2CKK A;  2RI5 A;  4HA8 A;  2RQT A;  2KYM A;  5LJ5 d;  2FPD A;  3X28 B;  1X2K A;  4PLI A;  4BE2 A;  2C06 A;  4JRK A;  3JRZ A;  1X6G A;  3CC4 T;  2K6D A;  3OQ5 A;  3EH1 A;  4XAX B;  2IVW A;  4MDW A;  3H6Z A;  3CC4 Q;  2XID A;  4FCY A;  2DTO A;  2CS7 A;  2D0Q B;  2KRN A;  4OP0 A;  1BB9 A;  2CUB A;  2LDM A;  3EFS A;  5D6X A;  2J7I A;  4BDZ A;  2GQI A;  1BI1 A;  2HBW A;  2KNB B;  1JJ2 P;  2EW3 A;  3SWN C;  1JQQ A;  2P0Q A;  3CCJ T;  2DKG A;  4KRT A;  2DO3 A;  1FX7 A;  4HVV A;  2OTJ T;  1BCO A;  4R56 A;  3QG1 A;  4JRP A;  1ZUY A;  2DET A;  2EGE A;  5J39 A;  2K5L A;  2FB7 A;  2RJC A;  4M78 E;  5CQY A;  3JCM V;  3SD4 A;  2KEA A;  1UDL A;  2V8I A;  2YHT A;  4Z8A A;  3JCM Q;  4AFS C;  1KHC A;  1OYX A;  4OB2 B;  3VU3 C;  4M7A B;  1T3S A;  2DL3 A;  5IXB A;  9ATC B;  3OYE A;  1MND A;  3O8V A;  3A8M B;  3I56 T;  3G71 T;  4O5V A;  1VQ8 A;  1K8A U;  2D8H A;  3L2Z A;  2XKO C;  4PLL A;  4J5Y A;  3I56 Q;  2ZPI B;  3G71 Q;  3IQL A;  3OYD A;  2LP5 A;  1ZA2 B;  4Z88 A;  4Z89 A;  1Y57 A;  2NYS A;  3CCL A;  1Q86 C;  3CEY A;  2DIQ A;  6AT1 B;  1UGP B;  1QVG S;  2J05 A;  3M0Q A;  3EH2 A;  3VRY A;  2RA2 A;  4XTW A;  2M1H A;  1X6B A;  4C5E A;  3VS4 A;  2XIC A;  1OUL A;  1U3O A;  2FL7 A;  2L3R A;  1I8F A;  3BFM A;  4GY5 A;  2AZV A;  3NTK A;  2CZ1 B;  1JO8 A;  2DJQ A;  1VQ5 Q;  4HVU A;  1W2B A;  5GAM d;  5IT9 E;  4EDU A;  4EMK B;  2R5A A;  5GMK i;  2OTL T;  2EJ9 A;  4XU0 A;  1TOV A;  3VUZ A;  1RI9 A;  2H3J A;  4PL6 A;  2HL5 C;  2OTL Q;  1M2V A;  4B9W A;  2M51 A;  3FIF A;  5HKC A;  5A0L A;  3GLX A;  3DKM A;  3RER A;  1HK9 A;  1VQ4 A;  5GAN 2;  1YIT T;  2X4X A;  3CC7 T;  2JNG A;  2XDB A;  3V7S A;  1LVK A;  1AZE A;  1IHW A;  5A2Q E;  2FZK B;  1Y07 A;  3WXM B;  1YIT Q;  3CC7 Q;  1LNX A;  2COZ A;  2EGC A;  2ED1 A;  2JTE A;  3A8O B;  3I5S A;  3TVT A;  3NTI A;  3LWH A;  1K73 C;  4CC7 A;  3PMI A;  3I5R A;  5LJ3 j;  2AIR B;  4JLG A;  2LJ3 A;  2ABL A;  2Z0W A;  5CCA A;  4BD3 A;  1AD5 A;  2W0Z A;  1QCF A;  2EYZ A;  2OX7 A;  3JCM h;  1OX9 A;  2P84 A;  3EG3 A;  3QPH A;  3A1P A;  2G6F X;  3JCM f;  3EG1 A;  4A54 A;  2DTH A;  1V76 A;  3CCU Q;  5LJ3 g;  1VQM T;  1I0C A;  2BKD N;  3ZFJ A;  5FW9 A;  1K1Z A;  4O6J A;  4LNP A;  1VQM Q;  4PJO B;  2VUB A;  4M75 A;  1VQP T;  1QVG P;  4QT7 A;  1HYO A;  1YWO A;  1Y96 A;  4J9I A;  1UFF A;  4MML A;  1M27 C;  4FW2 A;  1IO6 A;  1UEB A;  4WTO B;  5FRO A;  3NHN A;  2PTK A;  1KJW A;  3MCA B;  5C0M A;  1E6G A;  2CYZ B;  1RAG B;  2CRE A;  5KCO A;  2DK3 A;  2K4Y A;  1QLY A;  1KC8 C;  1GCQ A;  4BI4 A;  3KUF A;  4C8Q B;  4NL3 A;  2DEQ A;  1VQK Q;  5KYX B;  2MYS A;  3OMC A;  4QKU A;  2H8H A;  3CCV A;  1TS9 A;  2KK4 A;  2DNU A;  2O4X A;  3AT1 B;  1WFW A;  3QYG B;  3NMZ C;  4C5H A;  1ACM B;  1WPY A;  1PSF A;  4Y91 A;  2E64 A;  4F7U A;  2COW A;  3PIO A;  2X3X D;  3LWI A;  3TRE A;  1YIJ A;  2BTT A;  1LOJ A;  1RAB B;  5GAN f;  2KMT A;  1OX8 A;  1RAC B;  3H41 A;  5LJ5 h;  4JZ3 A;  2X9H A;  5FU6 C;  5GAN 5;  1CKA A;  1GFC A;  4Z02 A;  5LJ5 f;  1Q7Y R;  3M9Q A;  2JS0 A;  5HK3 A;  1AEY A;  4ZN3 A;  4E7I A;  4AG1 C;  1K9M C;  2ZPE B;  4F14 A;  1QW1 A;  5GAO q;  2FZC B;  4OMM A;  2F2W A;  1D0Z A;  3JV3 A;  1G8X A;  2P0K A;  3WVE B;  4QVC A;  3O5Z A;  3JCM b;  2DE0 X;  1U1T A;  8ATC B;  5KYN A;  1BU1 A;  3UAT A;  5GAN j;  5GJV B;  3EG2 A;  2A28 A;  3MEV A;  2DLP A;  1WX6 A;  4X34 A;  4M75 C;  2EBP A;  1VQ8 Q;  1B07 A;  2B8A A;  1EIF A;  3J81 E;  4BE0 A;  1M1K U;  3VS2 A;  1KHI A;  3GF5 A;  2E4H A;  4A4F A;  4TVR A;  3S6W A;  2C0I A;  3CCL T;  1IRX A;  1SSF A;  1X43 A;  5GAN g;  1GL5 A;  4WCI A;  2CT3 A;  4HKE A;  5CK9 A;  2AZS A;  5GAO l;  1GCQ C;  3CCL Q;  4NL2 A;  2DF6 A;  2HD0 A;  3CCE A;  1SHG A;  2DL4 A;  3UPU A;  5GMK j;  1U5S A;  1YCY A;  2F2X A;  4RG2 A;  5LJ5 g;  4FSX A;  2ZPB B;  1M4Z A;  5CKB A;  3EFR A;  4M7A A;  1BIA A;  2CP5 A;  3CBO A;  2L8D A;  1KIK A;  3HSB A;  4DEX A;  1S1N A;  1AHJ B;  2YUO A;  1ZLM A;  1X69 A;  2E65 A;  2DL5 A;  4ANJ A;  1VQ7 Q;  2QI2 A;  5FWC A;  1PG5 B;  1W1F A;  2LNH B;  2JUF A;  2RD1 A;  3RR6 A;  2LZ6 B;  3D7S B;  3TEE A;  3OA6 A;  1VQO A;  3PVL A;  4AFU C;  2K79 A;  2L0A A;  2RHX A;  1OOT A;  3GOX A;  1WA7 A;  1D0Y A;  1N9R A;  2R57 A;  1VQ4 T;  2O2O A;  3OYI A;  1VUB A;  3C0C A;  2RK2 A;  3MP8 A;  4HVW A;  4XTV A;  4E47 A;  1ZUK A;  1AWW A;  2GNC A;  5CKH A;  1VQ4 Q;  1VQN Q;  2X4Y A;  2XU8 A;  4IUQ A;  1PCX A;  2GCX A;  2GFU A;  1KQS A;  3X25 B;  3PIP A;  5GAM h;  1VQL A;  1UE9 A;  1WIE A;  2HZY A;  4J6W A;  1YNZ A;  1G5V A;  3EFO B;  1W2B S;  3V7R A;  5GAM f;  3CCS A;  3E9F A;  1NEB A;  2V8J A;  3JB9 I;  2LT4 A;  1M8M A;  2XG8 D;  4EMK A;  2GGR A;  4MDX A;  3DB4 A;  2GF7 A;  2QK0 A;  2M02 A;  1UEC A;  4X9D A;  1RAH B;  3G6E A;  1B34 B;  4L6V 5;  4KBM B;  1N8R R;  4FT4 A;  4M7A C;  1PHT A;  2JM8 A;  1V29 B;  2FYK A;  2JMA A;  4ATO A;  2MAM A;  2NUP B;  4JJD A;  3FC3 A;  2LCL A;  4A4K A;  2XK0 A;  1KSW A;  1D3B B;  4GLM A;  2KT1 A;  1OU8 A;  2VXE A;  3MEA A;  2WSC E;  3C94 A;  5GAM g;  2ROL A;  1LJO A;  3JAM E;  1SRL A;  2RF0 A;  2QAZ A;  1SHF A;  3CCV T;  1WDX A;  1NJI C;  4M7D D;  4JUV A;  5KH6 A;  3OYB A;  2M16 A;  2F5K A;  3CCV Q;  1G3W A;  1Q81 U;  4M77 G;  2QQS A;  1C1A A;  1X27 A;  2MK5 A;  3OYA A;  3TSZ A;  4C0D B;  4ESR A;  3S3O A;  3H0H A;  4PJO A;  4QW2 A;  4M77 F;  3MO8 A;  3C95 A;  1YJ9 A;  5AT1 B;  1YIJ Q;  2RJD A;  5KE3 A;  1X75 C;  4IUR A;  1RL2 A;  2RI3 A;  3M58 A;  2GTO A;  4EMK C;  1K8A R;  1R77 A;  2R5M A;  2EVR A;  2PNI A;  4OF1 A;  2DA9 A;  5D6Y A;  4C8Q A;  3BY7 A;  1WXT A;  5KYX A;  4YTL A;  5J3B A;  2GTJ A;  2RQW A;  2L89 A;  1J3T A;  3OY9 A;  1U8R A;  3QDR B;  1KQ2 A;  1WI7 A;  5DM7 R;  4RMO A;  2RNA A;  3CME A;  2E3H A;  1MMN A;  4E7J A;  4D6W A;  1TTH B;  4M78 G;  1PSE A;  4OML A;  1WJR A;  3TCJ A;  2HSP A;  1QWE A;  3G7Z A;  5IXF A;  1O75 A;  3AHU A;  3KXT A;  5HCK A;  1K0X A;  1I5O B;  4BY6 B;  1YJN A;  2J6O A;  2ENM A;  2X3W D;  3CCQ A;  4M78 F;  1BKB A;  2ZGW A;  1JU5 C;  3GPL A;  4M7D A;  3M55 A;  3OMG A;  3CCE T;  3L1A A;  4F17 A;  2K3B A;  3E1S A;  4IUP A;  1R0C B;  3CCE Q;  1QVF P;  1M3A A;  4LDY A;  4FIB A;  3PTA A;  4E7S A;  3RBB B;  4NOY A;  1AOJ A;  5CKD A;  4FSS A;  5GAO r;  2RN8 A;  2FPF A;  3VS6 A;  4M4Z A;  4PJO C;  4AT1 B;  4CRI A;  3CQT A;  3N5B B;  2DXB A;  3JB9 D;  1P92 A;  2GBQ A;  2QYZ A;  2LNV A;  1TUC A;  1AWJ A;  1KK7 A;  3NFC A;  3M0R A;  3CPW P;  1E7O A;  4FM4 B;  1ZUU A;  1VQO T;  1OU9 A;  1UGV A;  2XHC A;  3HL8 A;  1ABO A;  1XNI A;  1YFN A;  3CPF A;  3CCJ Q;  5FRM A;  2OTJ Q;  4KGX B;  1KD1 U;  3QYH B;  3GBQ A;  4C8Q C;  4BUG A;  4RTV A;  2KXD A;  5HY6 A;  2MWP A;  1BI0 A;  2HQX A;  4LD6 A;  4IKF A;  3RKX A;  2JM9 A;  2FG0 A;  4J9F A;  1O9S A;  1UB4 A;  4OGE A;  4C0Z A;  2KYB A;  1VQL T;  1VQ6 T;  1M3B A;  1NG2 A;  1W4S A;  1BI3 A;  3CCM T;  1ZX6 A;  1RAA B;  1VQL Q;  3OW2 S;  3CCS T;  3LX7 A;  2P4T A;  1TUG B;  1N9S A;  1W70 A;  2PQW A;  4L5G A;  1VQ9 A;  4DBQ A;  4M7D C;  2EQJ A;  2AKK A;  4AFZ C;  3OYL A;  5GAN 7;  2KBT A;  5GMK m;  3G6E T;  3G1J A;  2XDD A;  1MGQ A;  1UJ0 A;  1EZZ B;  2RQU A;  1KQ1 A;  2KI7 A;  1Q82 U;  4XU2 A;  5FLX E;  3M57 A;  2VB6 A;  3G6E Q;  3VRZ A;  2D1X A;  2LX9 A;  3BDL A;  4HCB A;  2PVO B;  1KQS S;  2KRM A;  3OS2 A;  3MET A;  3I55 A;  2J6F A;  3DLL A;  4JPB W;  2K3X A;  3EFO A;  1QQJ A;  2A08 A;  4XQ3 A;  1K4U S;  1EFN A;  3FRN A;  4M75 D;  4M75 G;  2ZZD A;  1M2O A;  2DD4 A;  1WQ7 A;  2ZCF B;  1GFD A;  4OB1 B;  1QKX A;  4KT0 E;  5LJ3 e;  2OJ2 A;  4J6Y A;  4KUL A;  1R8O B;  1BI2 A;  5I2S A;  1JEG A;  2A3L A;  2LMJ A;  1D0X A;  1PRL C;  3RIR A;  2HL3 A;  3M5A A;  1MMD A;  4IUT A;  5D6W A;  2VV5 A;  1B34 A;  2OAU A;  2NUT B;  4B6M A;  2K9G A;  2F5T X;  4XU3 A;  1QCO A;  3JCM J;  3BDU A;  2C0T A;  2JS2 A;  2ESW A;  4DQ2 A;  2NUP A;  3T9N A;  2MI6 A;  2ZAE A;  2YT6 A;  4F7U G;  1I81 A;  3M59 A;  1YJ9 T;  4JZ4 A;  2ZPF B;  1H64 1;  2RO0 A;  1U1S A;  2CZ7 B;  1D3B A;  2RPN A;  4HCK A;  5KYU A;  4BAC A;  1R0B G;  1VYU A;  2LQW A;  1YJ9 Q;  1PRM C;  1QMC A;  1Y7X A;  2CSI A;  2EFI A;  4F7U F;  3HP9 A;  3JCM X;  5KYY B;  2HBP A;  3V8J A;  2HEQ A;  1M1K R;  2BZY A;  4M75 E;  2K57 A;  4D8K A;  1NYG A;  2RJF A;  1IGQ A;  3OW2 P;  5KYW B;  3BE3 A;  3EGX B;  1UGR B;  2WSE E;  3R6O A;  1Y0M A;  2RQR A;  3EGD B;  2KXC A;  1UHC A;  4KH1 B;  4PFO A;  3QWY A;  1N27 A;  3CME T;  4J9D A;  1JJ2 A;  4LXC A;  2DBM A;  1NBE B;  3JCM P;  2DZC A;  3CME Q;  2DPP B;  1VQP Q;  2EJF A;  1AZG B;  2EQI A;  1JBM A;  1YJN T;  3MEW A;  2FZG B;  2LQ8 A;  3CCQ T;  4JS5 A;  3TQ7 P;  3M4Y A;  4FYV B;  1Z9Z A;  4BB7 A;  4LUE A;  2RMO A;  3CCQ Q;  4F7U E;  3CC2 A;  2QQA A;  4EMH A;  3VYH B;  2K7A A;  4C92 B;  2BUD A;  2ZPH B;  3SWN B;  1Q86 U;  1NLO C;  1HJD A;  2P0P A;  2VC8 A;  2JT4 A;  4PJN A;  1G3Y A;  2EKH A;  3MPU B;  4OMN A;  2GFA A;  5CVI A;  3JCM g;  3JCM W;  3I9Q A;  3QDF A;  2WAC A;  1H3H A;  4M7A D;  4M7A G;  3CMA A;  1WJQ A;  4MZP A;  3OS0 A;  2ATC B;  1WXU A;  2JW4 A;  2DEU A;  1Q7Y C;  2NUZ A;  3SFM A;  4F16 A;  4J9H A;  2CP3 A;  1IXD A;  2J6K A;  1M9S A;  2A36 A;  5GJW B;  3NTH A;  3UT1 A;  5GAO p;  1FMV A;  2DTI A;  4RTW A;  2FRW A;  2CGH A;  3I35 A;  3VJP A;  2DXT A;  2KSS A;  5GMK e;  3J7A F;  1FMK A;  3L42 A;  2HKN A;  1MMA A;  2K2M A;  3HRU A;  1WHH A;  4PJL A;  5KCH A;  2QQR A;  3M0S A;  2LTO A;  4C0D C;  2CZ6 B;  5CQX A;  3FDR A;  1M5Q 1;  3A5Z B;  4M77 B;  1GCP A;  5LJ5 j;  2F1L A;  1TG0 A;  4RTY A;  4ELY C;  2HDA A;  4LN2 A;  2L3Q A;  3H9N A;  2DRM A;  2YSQ A;  3WVD B;  1K73 U;  1VQ9 T;  1AWX A;  1OEB A;  1PM3 A;  4M7A E;  4J9G A;  2LC4 A;  1MNE A;  4A4E A;  4Y28 E;  3SHW A;  1AT1 B;  4D8D A;  3PFS A;  5FU7 B;  2IPO B;  3LGL A;  4A4G A;  2JN0 A;  4UC4 A;  1ABQ A;  2WSF E;  3OYH A;  3BW1 A;  4C0G A;  1JB0 E;  1BIB A;  1PWT A;  4BI3 A;  1G3T A;  4LD9 K;  3CXC A;  3OBY A;  2BE9 B;  1T3L A;  1ZBX A;  4HCZ A;  3I55 T;  1UG1 A;  2MIO A;  1RAI B;  4RTX A;  4ELZ C;  5EC7 A;  1D09 B;  1YJW A;  3I55 Q;  1Q81 R;  3SEM A;  2VXF A;  1HD3 A;  2CZ0 B;  3OYF A;  4BY6 C;  4DEY A;  3OYN A;  3P8B B;  4M78 B;  2M0Y A;  1OI1 A;  2FO0 A;  2RI2 A;  2EKO A;  3A8G B;  1M90 C;  1I4K 1;  1LCK A;  3HHT B;  2K3Y A;  4XU1 A;  2Y90 A;  4PNO A;  3H8Z A;  4HT9 A;  2LQN A;  3THK A;  3E9G A;  4IIM A;  1KC8 U;  1PD1 A;  3RKW A;  2QA4 A;  3X20 B;  1Y71 A;  1QVG A;  2LQK A;  3PVQ A;  4A53 A;  2DL8 A;  1RAE B;  1TSF A;  2CUD A;  5IAY A;  1VQ6 A;  2JTM A;  3JCM c;  2HCK A;  2J06 A;  3A98 A;  1NEG A;  3LW5 E;  1GRI A;  3MHX A;  4ZN1 A;  3CCM A;  4OVA A;  4PJO D;  4PJO G;  3FEO A;  1YI2 A;  2DVJ A;  1WHJ A;  2H3E B;  1X6O A;  2EIF A;  2FPE A;  2KR3 A;  2RHU A;  1A0N B;  4PJO F;  4RCC A;  1N8R C;  2X4J A;  1JRI A;  4XK8 E;  4OGC A;  1WZO A;  1C6V X;  5I21 A;  5CKE A;  3V7C A;  4N4H A;  2V8K A;  2JZ2 A;  1QVP A;  2KVQ G;  4C8Q D;  4C8Q G;  4E7L A;  4J9E A;  5IHI A;  2NUT A;  3Q1J A;  1WQW A;  5GAM j;  1K9M U;  1ZBJ A;  1M2V B;  3C12 A;  3FJ5 A;  3A8H B;  4ZNX A;  1QP2 A;  2VYT A;  1GBR A;  5LJ3 d;  4FYW B;  4C8Q F;  2A0F B;  4LDX A;  2RHY A;  3INZ A;  1SF9 A;  2HQH A;  4E7K A;  3MP1 A;  3PMT A;  3PNW C;  4CC4 B;  2E6Z A;  5FRN A;  3JB9 J;  1WHG A;  4PJM A;  2DM1 A;  3UA7 A;  2E1H A;  3QWX X;  4LE9 A;  1ZSZ B;  3CC2 T;  4PJO E;  2CDT A;  4M7D G;  3CC2 Q;  1YCS B;  4ZGJ B;  2RM4 A;  3EGX A;  2DER A;  2E10 A;  1QKW A;  4X1V A;  2BE7 D;  4PFP A;  2RQV A;  3EGD A;  1KD1 R;  4M7D F;  4JS4 A;  4EIK A;  3JSC A;  1SKU B;  3CMA T;  1K0S A;  1WHL A;  4DOV A;  2EYY A;  4LDV A;  2QXF A;  1CKB A;  1K8A C;  4C8Q E;  4JJN K;  3CMA Q;  3E2U A;  1SPK A;  4C0F A;  2EYX A;  3GIB A;  5CKF A;  4XTU A;  3VV0 A;  2XI9 A;  4FYX B;  3RKY A;  2E5Q A;  3M0P A;  2JMC A;  2RH2 A;  2I0N A;  2E70 A;  3GP8 A;  3REA B;  1H8K A;  1SSH A;  2W10 A;  2RJE A;  4QQD A;  3MJX A;  3LGF A;  2LJ1 A;  3REB B;  4C92 A;  4VUB A;  1W2B P;  2JVV A;  1IZ6 A;  3MEU A;  1PKS A;  4BE1 A;  1NZ9 A;  4OMQ A;  4CI0 C;  2SEM A;  1D1A A;  2MWO A;  4LUD A;  1M90 U;  3QJY A;  2CP7 A;  2LCC A;  1WYX A;  2O01 E;  3RMQ A;  3CCU A;  4M7D E;  3RUX A;  2DD5 A;  1Q82 R;  2MOX A;  2BZ8 A;  3E19 A;  5DLO A;  2KGT A;  4CC3 A;  3RNJ A;  2D9T A;  2DYB A;  4OMP A;  1NE8 A;  2KRS A;  3PE0 A;  4ORZ A;  1QWF A;  3VS7 A;  1M1F A;  4GLK A;  1UTI A;  2HAX A;  2DRK A;  2X51 A;  2CSQ A;  1YBY A;  5FWB A;  1IRE B;  2QDL A;  3OYM A;  1E6H A;  1VQK A;  1NLP C;  2YLC A;  4RCB A;  5DLQ E;  4BDY A;  3CCR A;  2D8J A;  5GMK l;  3HFO A;  1Q95 G;  1FYN A;  4ME7 A;  3JB9 G;  1T0H A;  1NPP A;  4M77 A;  1YJW T;  5GAN 4;  2ROT A;  5LL6 S;  4V2S A;  1IHV A;  1YJW Q;  1WJS A;  3JB9 F;  2O31 A;  5M9O A;  3LLR A;  5KE2 A;  2LX7 A;  2OAW A;  4HXJ A;  1VQO Q;  1MV0 B;  4QVZ A;  1KG1 A;  5I22 A;  3KBG A;  4QQ6 A;  3A8L B;  4N4G A;  4C92 C;  2D0N A;  3S3M A;  3OB9 A;  3QZ9 B;  1RUW A;  1K76 A;  7AT1 B;  2QA4 T;  1VIE A;  5IHN A;  2PZ1 A;  1OZ3 A;  2YUP A;  2KE9 A;  3CXC S;  1NJI U;  2QA4 Q;  5CAI A;  1MMG A;  2L2P A;  3FLG A;  2YDL A;  2DXU A;  2DZ9 A;  5DY9 A;  2EYW A;  1PNJ A;  1VQ6 Q;  3JB9 H;  1FMW A;  3EHQ A;  1WHM A;  2QGF B;  1YI2 T;  2L5Q A;  8AT1 B;  1WXB A;  3CCM Q;  2CT4 A;  3CCS Q;  4M78 A;  1YI2 Q;  2JJ9 A;  3QUI A;  1XTD A;  2AKL A;  2L3S A;  4DBH A;  2I2L A;  4R55 A;  2CP2 A;  4DOW A;  3RDV A;  2O9S A;  4ZGD B;  4J9B A;  1H92 A;  3QJ6 A;  1K9A A;  4XTY A;  1CSK A;  5GAO n;  1UGQ B;  2BIV A;  2VGM A;  5ECA A;  4C5I A;  2QQB A;  1OV3 A;  3OS5 A;  3OS1 A;  1M1G A;  3LH0 A;  4ZTF A;  1Q86 R;  2PUO B;  3L2V A;  2DAQ A;  4M77 C;  2VGN A;  2JXB A;  1RAD B;  2CP0 A;  4IUV A;  5L23 A;  2G3R A;  1VQ5 T;  2PVG B;  1X2Q A;  3ZEH A;  4PFZ A;  4X9C A;  4M75 F;  2R58 A;  3LYI A;  4RTU A;  2XD0 A;  3ER0 A;  1VQ7 A;  3DB3 A;  2QDY B;  5EG2 A;  5FU7 C;  3ME9 A;  2EWN A;  2RHI A;  4KGZ B;  2E12 A;  4E2F B;  2YLB A;  5LJ3 h;  1I1J A;  2COY A;  3HRT A;  3GNG A;  2YRC A;  3QO3 A;  4Q5W A;  2LRQ A;  1B7T A;  2KQW A;  5LJ3 f;  4MZT A;  2RHZ A;  1OQK A;  2FVU A;  2JOY A;  1VQN A;  3EHR A;  4IUU A;  3HFN A;  4OMF B;  4AFQ C;  4FL6 A;  2A7Y A;  3OSV A;  1M1K C;  1N6A A;  2FEI A;  3L2U A;  4M78 C;  2LT1 A;  4DA4 A;  2SRC A;  4E6R A;  3JCM e;  4II1 A;  3CXC P;  2KAF A;  1ZSZ A;  4K11 A;  4ZTJ A;  1QVF A;  4MMK A;  3HKS A;  2CH4 W;  1K73 R;  1H3Z A;  4JJB A;  3CD6 A;  1RI0 A;  4QQG A;  3CBP A;  3VKI A;  4DBF A;  3FJP A;  2DYI A;  1XJW B;  3M54 A;  4RKU E;  2QTX A;  3LH5 A;  3VS5 A;  4JDS A;  1QCN A;  4BI8 B;  2QGG A;  1MUZ A;  5IH2 A;  2O88 A;  3CCU T;  2EQU A;  4E7Z A;  2KRO A;  4A4H A;  1OPL A;  4XTZ A;  3RES A;  4IIO A;  3VS1 A;  3CPW A;  3OYK A;  2K5F A;  2EAY A;  4A63 B;  2L3P A;  4RG8 A;  1FXX A;  1ZSG A;  2PU9 B;  1HSQ A;  3EG9 B;  2QQ9 A;  1YJN Q;  2ED0 A;  1IGU A;  1AWO A;  5GAN 3;  3V8K A;  1KQS P;  4J7F A;  2BZX A;  3UDC A;  4N4I A;  4CC2 A;  1I07 A;  2AT1 B;  3QSU A;  2F69 A;  3PT9 A;  4F04 B;  5C6S A;  1WGS A;  3VUB A;  1M8V A;  3MP6 A;  2IG0 A;  5GAN 6;  1VQK T;  2DXC A;  1G3S A;  3CCR T;  1B3Q A;  2LVM A;  5GAN e;  1VOM A;  3J80 E;  3RMS A;  1W6X A;  2MMP A;  2LCS A;  3CCR Q;  1KC8 R;  4JJC A;  5IN1 A;  2M0O A;  2QEX A;  5D7U A;  4M7A F;  5LJ5 e;  2VAS A;  3M53 A;  3CBM A;  4Y92 A;  2QTV A;  1ARK A;  4C5G A;  2E6N A;  2MPX C;  3VYG A;  1TUD A;  5GAN h;  3H0F A;  3QKJ A;  4LDW A;  1ZSZ C;  2M9U A;  4FYY B;  3G4S A;  4DBR A;  4P5N A;  3P8D A;  2KDS A;  2YWW A;  2DBK A;  1X01 A;  1Z9Q A;  4L59 A;  4M7D B;  3UWN A;  3OYG A;  3R6N A;  1C0M A;  2EJG A;  4MZM A;  1SEM A;  2VWF A;  2HMA A;  1WLP B;  1UUE A;  3OYY A;  5GMK h;  1MHN A;  1NYF A;  4JRQ A;  3P8H A;  1YHQ A;  1K9M R;  5CO7 A;  1YWP A;  5AYF A;  1KFZ A;  1TH7 A;  2K5I A;  1S72 A;  3U23 A;  3ULR B;  2MCN A;  1VQ8 T;  4N0A A;  4JLI A;  1VA7 A;  4GBQ A;  2V1Q A;  3M56 A;  3QHS A;  3ZBD A;  1FWZ A;  1VQ9 Q;  3ZL7 C;  3M0T A;  4HCC A;  5I11 A;  4PK4 A;  1G83 A;  3C4S A;  4FT2 A;  3PGG A;  4HT8 A;  2CH4 A;  3SDZ A;  1M30 A;  1YP5 A;  1N5Z A;  2KT8 A;  3L2Q A;  1SRM A;  2YXY A;  3V8L A;  1TXQ A;  4PJJ A;  3QBY A;  2RB6 A;  1D1C A;  1Q81 C;  2C0O A;  2DVE A;  4KGV B;  2YUQ A;  2HSE B;  1BYM A;  1MV3 A;  3VS0 A;  2X4W A;  1EX4 A;  1JXM A;  3CC4 A;  2FHD A;  4JRI A;  2NLU A;  5J26 A;  1ZQ1 A;  4WF2 A;  2DL7 A;  3SB2 A;  2FRY A;  1VQ7 T;  1F1B B;  4RTT A; 
#chains in the Genus database with same CATH homology
 3NHN A;  3REA B;  2PTK A;  1H8K A;  1OPK A;  2F2V A;  1SSH A;  1KJW A;  2EPD A;  2W10 A;  1AVZ C;  1RLP C;  1E6G A;  2LJ1 A;  3REB B;  2AKK A;  2CRE A;  1QLY A;  2VVK A;  1GCQ A;  2EGA A;  4AFZ C;  3M0U A;  1NM7 A;  2KBT A;  1PKS A;  4OMQ A;  1UJ0 A;  2RQU A;  2SEM A;  4LUD A;  2H8H A;  1WYX A;  3VRZ A;  3UF4 A;  3VS3 A;  2D1X A;  4J9C A;  2DNU A;  5IHK A;  1WFW A;  3NMZ C;  2KRM A;  2MOX A;  2A37 A;  2BZ8 A;  2J6F A;  2O9V A;  2KGT A;  2X3X D;  4CC3 A;  2YUN A;  4JPB W;  3RNJ A;  1BBZ A;  2DYB A;  1UHF A;  4OMP A;  2A08 A;  1K4U S;  1EFN A;  2BTT A;  2IIM A;  2KRS A;  3PE0 A;  4ORZ A;  1QWF A;  1GFD A;  1QKX A;  3VS7 A;  2OJ2 A;  2P4R A;  3H41 A;  1UTI A;  4JZ3 A;  2B86 A;  1CKA A;  1GFC A;  2DRK A;  1JEG A;  2DIL A;  2CSQ A;  2JS0 A;  2LMJ A;  1PRL C;  5FWB A;  1V1C A;  1JXO A;  2QDL A;  1AEY A;  4AG1 C;  1E6H A;  3EG0 A;  1NLP C;  4F14 A;  1PKT A;  2K9G A;  4OMM A;  2F2W A;  2LJ0 A;  3JV3 A;  3KFV A;  2D8J A;  2DMO A;  3O5Z A;  2DE0 X;  1BU1 A;  3NGP A;  3UAT A;  2C0T A;  1FYN A;  5GJV B;  2JS2 A;  3EG2 A;  1T0H A;  2ESW A;  2VKN A;  2A28 A;  2ROT A;  2YT6 A;  2DLP A;  1WX6 A;  2AK5 A;  4JZ4 A;  2EBP A;  1B07 A;  3H0I A;  3TSW A;  2RPN A;  4HCK A;  3VS2 A;  2O31 A;  4AG2 C;  1VYU A;  2LQW A;  1PRM C;  2CSI A;  2LX7 A;  2OAW A;  4HXJ A;  3UA6 A;  2C0I A;  1MV0 B;  5I22 A;  2HEQ A;  1X43 A;  1GL5 A;  4WCI A;  2CT3 A;  2AZS A;  2D0N A;  2BZY A;  1GCQ C;  2E5K A;  1U06 A;  4D8K A;  1NYG A;  2DF6 A;  1RUW A;  1K76 A;  1SHG A;  2DL4 A;  4RTZ A;  5IHN A;  1U5S A;  4OMO A;  2F2X A;  2PZ1 A;  2YUP A;  2KE9 A;  4R0K A;  1VYT A;  1GBQ A;  2V1R A;  1Y0M A;  2RQR A;  2KXC A;  2NWM A;  1UHC A;  2L2P A;  3QWY A;  2YDL A;  1UJY A;  2EYW A;  1PNJ A;  1RLQ C;  4J9D A;  2DBM A;  3EHQ A;  1KIK A;  1WXB A;  4DEX A;  2CT4 A;  1S1N A;  3NPF A;  2EQI A;  1AZG B;  2YUO A;  1ZLM A;  1X69 A;  2AKL A;  2DL5 A;  1BK2 A;  2L3S A;  5FWC A;  1W1F A;  2LNH B;  1Z9Z A;  4LUE A;  2RMO A;  2LZ6 B;  3PVL A;  4AFU C;  2K79 A;  2O9S A;  4J9B A;  2K7A A;  1H92 A;  2L0A A;  1K9A A;  1G2B A;  1NLO C;  1OOT A;  1HJD A;  1WA7 A;  2JT4 A;  1CSK A;  2O2O A;  2EKH A;  3C0C A;  4HVW A;  5ECA A;  1XOV A;  4OMN A;  1ZUK A;  4RUG A;  1AWW A;  1OV3 A;  1YN8 A;  2GNC A;  2OI3 A;  3I9Q A;  1T0J A;  1H3H A;  2JXB A;  1M3C A;  1UE9 A;  1WIE A;  1WXU A;  2JW4 A;  5L23 A;  1YNZ A;  3EGU A;  2NUZ A;  1VYV A;  2ECZ A;  4F16 A;  4J9H A;  1X2Q A;  1NEB A;  2J6K A;  4RTU A;  2XMF A;  1M8M A;  2A36 A;  2GGR A;  5GJW B;  4RTW A;  2FRW A;  2DX1 A;  3I35 A;  1I1J A;  2RQT A;  2KYM A;  2FPD A;  1X2K A;  1UEC A;  1FMK A;  2K2M A;  1X6G A;  1PHT A;  2JM8 A;  2K6D A;  3M0S A;  3EHR A;  2JMA A;  1GCP A;  4JJD A;  1TG0 A;  2KRN A;  4RTY A;  4AFQ C;  2HDA A;  4LN2 A;  2FEI A;  2L3Q A;  1BB9 A;  2CUB A;  2DRM A;  1KSW A;  2YSQ A;  2J7I A;  4GLM A;  2KT1 A;  2SRC A;  4E6R A;  2GQI A;  2HBW A;  2KNB B;  1AWX A;  1OEB A;  4J9G A;  2EW3 A;  4K11 A;  1JQQ A;  3SHW A;  2ROL A;  4D8D A;  2CH4 W;  4KRT A;  4HVV A;  1SRL A;  4JJB A;  2RF0 A;  1ZUY A;  2EGE A;  1ABQ A;  1SHF A;  3VS5 A;  1WDX A;  3LH5 A;  1PWT A;  1MUZ A;  5IH2 A;  2KEA A;  1UDL A;  2O88 A;  4Z8A A;  4AFS C;  1T3L A;  2KRO A;  1OPL A;  1X27 A;  1T3S A;  1UG1 A;  2DL3 A;  4IIO A;  5IXB A;  2MIO A;  3TSZ A;  3VS1 A;  4RTX A;  4A63 B;  5EC7 A;  2L3P A;  4ESR A;  3H0H A;  2D8H A;  1ZSG A;  3SEM A;  1HD3 A;  1HSQ A;  4DEY A;  3IQL A;  2ED0 A;  2M0Y A;  1AWO A;  2LP5 A;  4Z88 A;  2FO0 A;  2GTO A;  4Z89 A;  2EVR A;  2PNI A;  1Y57 A;  2BZX A;  1LCK A;  4CC2 A;  1I07 A;  2LQN A;  2DA9 A;  2J05 A;  3M0Q A;  1WXT A;  3THK A;  3VRY A;  2GTJ A;  4IIM A;  2RQW A;  1B3Q A;  1J3T A;  1X6B A;  3PVQ A;  2DL8 A;  1W6X A;  2LCS A;  2CUD A;  1WI7 A;  3VS4 A;  4JJC A;  1U3O A;  2HCK A;  2J06 A;  3A98 A;  2RNA A;  1NEG A;  1GRI A;  2AZV A;  1JO8 A;  4OML A;  2DJQ A;  2DVJ A;  2HSP A;  4Y92 A;  4HVU A;  1QWE A;  1ARK A;  5IXF A;  1TUD A;  5HCK A;  3H0F A;  1K0X A;  2FPE A;  2KR3 A;  1A0N B;  2J6O A;  2ENM A;  2X3W D;  1JU5 C;  1RI9 A;  2DBK A;  4F17 A;  2K3B A;  1Z9Q A;  2M51 A;  4J9E A;  5IHI A;  1M3A A;  3R6N A;  1SEM A;  1ZBJ A;  2VWF A;  3RBB B;  1AOJ A;  3FJ5 A;  4FSS A;  1WLP B;  4ZNX A;  1UUE A;  1AZE A;  1GBR A;  2RN8 A;  2FPF A;  3VS6 A;  2EGC A;  1NYF A;  2ED1 A;  2JTE A;  3I5S A;  4M4Z A;  1YWP A;  3TVT A;  3CQT A;  1KFZ A;  4CC4 B;  3U23 A;  3ULR B;  2MCN A;  4CC7 A;  2GBQ A;  1VA7 A;  4GBQ A;  1TUC A;  1AWJ A;  2V1Q A;  2DM1 A;  3UA7 A;  3I5R A;  3M0R A;  1E7O A;  1ZUU A;  3QWX X;  1UGV A;  2ABL A;  2LJ3 A;  3ZL7 C;  3M0T A;  4LE9 A;  5I11 A;  1G83 A;  1ABO A;  1AD5 A;  2W0Z A;  2CDT A;  2CH4 A;  1M30 A;  1YP5 A;  1QCF A;  2EYZ A;  3GBQ A;  4RTV A;  3EG3 A;  1N5Z A;  1YCS B;  2KXD A;  2KT8 A;  1SRM A;  1QKW A;  4X1V A;  2G6F X;  3EG1 A;  2RQV A;  2C0O A;  2YUQ A;  2JM9 A;  2FG0 A;  4EIK A;  1MV3 A;  4J9F A;  3VS0 A;  1K0S A;  2EYY A;  1JXM A;  2KYB A;  1CKB A;  1I0C A;  1M3B A;  1NG2 A;  5FW9 A;  1K1Z A;  1SPK A;  4LNP A;  1ZX6 A;  2EYX A;  4QT7 A;  1YWO A;  2DL7 A;  4J9I A;  1UFF A;  1M27 C;  2FRY A;  1W70 A;  3M0P A;  1IO6 A;  2JMC A;  2I0N A;  4RTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...