2M0YA

Solution structure of the sh3 domain of dock180
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIFPASYIHLKEAIVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dedicator of cytokinesis protein 1
publication title Solution structure of the SH3 domain of DOCK180.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2012-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2m0yA00
2L3SA 2K2MA 3TVTA 3U23A 2RQUA 1T3LA 2W0ZA 2EYZA 2K9GA 1ABOA 4M4ZA 1WDXA 2I0NA 2GBQA 3H0IA 5IHKA 4RTXA 1I07A 1AWJA 4ESRA 1HD3A 2KEAA 4CC2A 3NMZC 1WI7A 4DEXA 2A28A 1AZGB 2P4RA 2JS0A 3PVLA 2AK5A 2ED1A 2DBMA 4CC4B 3SEMA 4WCIA 3EHRA 1ARKA 2W10A 4J9FA 2D8HA 2X3WD 3VS0A 1NYFA 1SHGA 5FWCA 2O88A 1VYVA 1VYUA 1OV3A 2GQIA 2KT8A 4Z8AA 1M3BA 2J6FA 2K6DA 2DRKA 2K3BA 4JJDA 4FSSA 1SSHA 2KXCA 1X27A 2A36A 2JTEA 2X3XD 2SRCA 2QDLA 2GTJA 3I5RA 1WFWA 1E7OA 2DM1A 1Y57A 4OMQA 1WYXA 3VS4A 2KYBA 1PRMC 2C0OA 2FRWA 4IIMA 3NGPA 2FPFA 2SEMA 5IHIA 4K11A 1MV3A 1BB9A 2L2PA 3EHQA 2EQIA 2K7AA 2HCKA 3NPFA 1OEBA 1G83A 1S1NA 2CDTA 1E6GA 1B3QA 4DEYA 2ABLA 1XOVA 1YWPA 1X69A 2JMCA 1Z9QA 2F2VA 1GCPA 2V1QA 2D0NA 5EC7A 2J6KA 2YDLA 3UA6A 2KRSA 2DA9A 4Z88A 2EGAA 2DF6A 2LJ3A 4RTUA 1YNZA 3M0QA 2KR3A 2VWFA 3JV3A 1SHFA 1GL5A 4J9GA 2D1XA 1T0JA 4LE9A 2ROLA 1KFZA 2JS2A 5FWBA 2MCNA 1OOTA 4HXJA 4J9CA 2DE0X 2KGTA 1CSKA 2EYWA 2CSIA 2KYMA 1PNJA 1KJWA 1NEBA 4D8KA 1X2KA 2ED0A 2J06A 1GFCA 1PWTA 1X6BA 4J9EA 1NM7A 2DVJA 2J6OA 1HSQA 1T3SA 2LJ0A 1M30A 1RLQC 2RF0A 4HCKA 2D8JA 2O9SA 1FMKA 2HDAA 2DYBA 3PVQA 4R0KA 3TSWA 2ENMA 2YT6A 4IIOA 2AKLA 1JXMA 1QKXA 1TUDA 1UJ0A 2LJ1A 2EYYA 1FYNA 2JM9A 3TSZA 2J05A 1X6GA 3LH5A 1M27C 2BZYA 2RN8A 2GNCA 2YUPA 1H8KA 1YP5A 2J7IA 2EPDA 4X1VA 5ECAA 3EG2A 1QKWA 2RMOA 2BTTA 3I9QA 5FW9A 2GTOA 2M0YA 3I35A 2JT4A 3VS6A 1WXTA 1SPKA 1PRLC 1J3TA 1ZSGA 1VA7A 4HVVA 2CH4A 1WX6A 3VS5A 4GLMA 1K76A 2KT1A 1X43A 1GBRA 1K0SA 1RLPC 1UECA 1GCQA 1YWOA 1GCQC 3CQTA 2MOXA 4HVWA 1OPKA 3EG1A 1QLYA 4CC7A 4LUDA 1AD5A 2A37A 1ZUYA 4EIKA 2CH4W 2AZSA 2EW3A 1I1JA 3QWYA 2EBPA 3UF4A 1W70A 1NLPC 2DMOA 2MIOA 4D8DA 1M3CA 1QWFA 3C0CA 3A98A 3THKA 3VS1A 4LN2A 4AFZC 2ESWA 1CKBA 1GRIA 1VYTA 2DNUA 3R6NA 2CUBA 1V1CA 2EGEA 1UHCA 1NEGA 3H41A 3EG3A 4RTZA 1PKSA 3VS3A 2HEQA 1AVZC 2A08A 2DBKA 1UJYA 1ZX6A 2IIMA 2PZ1A 2FPDA 2DL3A 2FPEA 1AOJA 1SRMA 2G6FX 2ROTA 3EGUA 1HJDA 2LQNA 2O31A 3REBB 1ZLMA 1Y0MA 1WXBA 1G2BA 1H92A 2LCSA 1YN8A 1E6HA 2LZ6B 2JMAA 4RUGA 3VS7A 1U5SA 3M0RA 2CUDA 3VS2A 3KFVA 1ZUUA 2DL4A 4J9DA 2XMFA 4RTYA 2C0IA 2E5KA 4JZ4A 1AWXA 4LNPA 4ORZA 2LQWA 5IH2A 2KRNA 1AWOA 1JQQA 1K4US 5IXFA 1ABQA 2O2OA 4RTWA 3UATA 1WXUA 1NG2A 2DJQA 1SRLA 4OMLA 4J9HA 1K0XA 4AFSC 2KRMA 1BK2A 4ZNXA 1X2QA 3IQLA 2PTKA 4AFQC 3GBQA 2HBWA 4GBQA 1NYGA 1N5ZA 1PKTA 2KNBB 4JJBA 1UFFA 2CSQA 1B07A 5IHNA 3RBBB 2FG0A 1JXOA 2YUOA 2EKHA 3M0TA 4OMPA 1CKAA 1QWEA 1WA7A 1UUEA 2O9VA 2NWMA 3QWXX 3REAB 3EG0A 1UGVA 2FRYA 2HSPA 2RQRA 2RNAA 1IO6A 4JPBW 3H0HA 3VRYA 3PE0A 3UA7A 2FEIA 1TUCA 1PHTA 1WIEA 1W1FA 2AKKA 1M8MA 4F17A 1NLOC 4KRTA 2RPNA 2B86A 2DLPA 3VRZA 2V1RA 1YCSB 2CT3A 3FJ5A 4JZ3A 4RTTA 5HCKA 1UTIA 4OMMA 3ULRB 4Y92A 4OMOA 1EFNA 1GFDA 3RNJA 5I11A 1K9AA 4OMNA 1GBQA 1JU5C 2KROA 4Z89A 2KBTA 2DX1A 2RQWA 2DL7A 4AG2C 1M3AA 2DL5A 1Z9ZA 4LUEA 5IXBA 4F16A 1LCKA 2L3QA 1RUWA 1ZUKA 2NUZA 2F2XA 2EGCA 4RTVA 1A0NB 1T0HA 2DILA 2LNHB 2FO0A 1H3HA 2EVRA 1UDLA 1KIKA 3M0PA 4JJCA 1KSWA 3NHNA 4CC3A 2KXDA 1MV0B 2RQTA 2JW4A 2EYXA 2OAWA 2LMJA 4J9IA 5GJVB 3ZL7C 2KE9A 3O5ZA 4A63B 1ZBJA 4QT7A 2L3PA 1K1ZA 2PNIA 1UE9A 1JEGA 4J9BA 1TG0A 1OPLA 1MUZA 1AEYA 1U3OA 1QCFA 4F14A 2LP5A 2L0AA 2GGRA 1RI9A 2F2WA 3SHWA 2LX7A 5GJWB 2VKNA 1UG1A 2YSQA 1AZEA 5I22A 2M51A 3H0FA 1W6XA 1JO8A 2K79A 2VVKA 2OJ2A 3M0SA 4HVUA 2BZXA 3I5SA 2JM8A 2AZVA 1BU1A 2CREA 2CT4A 2RQVA 2YUQA 3M0UA 4AG1C 2JXBA 1WLPB 2BZ8A 2YUNA 1SEMA 2DRMA 1AWWA 1UHFA 2OI3A 2H8HA 1BBZA 4E6RA 1I0CA 1U06A 4AFUC 5L23A 2ECZA 2C0TA 2DL8A
chains in the Genus database with same CATH superfamily
2DXTA 3L1AA 2MK5A 4FW2A 1K8AR 2MI6A 3VU3C 4V2SA 3OMGA 3J80E 3OYDA 4JRKA 4CI0C 5CR2A 4BE0A 2QYZA 1WDXA 3BDLA 1JJ2A 2GBQA 2OTLQ 4NS5A 4RTXA 3HSBA 1YI2T 3G71Q 1HD3A 4M75A 1VQMT 3CD6A 3MCAB 3NMZC 1G3SA 1AZGB 4M75C 3JB9D 2RHIA 3MJXA 2P4RA 3SDZA 4NL3A 2JS0A 1WJQA 3EFOB 3UDCA 3PVLA 2AK5A 2CZ0B 4RKUE 2QDYB 3SEMA 1UB4A 4N4HA 3EHRA 2LQKA 4J9FA 5GANj 1SHGA 2YWWA 1PM3A 1RACB 1VYUA 4PNOA 2J6FA 3CD6Q 3JB9H 3EGXA 2K3BA 4LDUA 2M0OA 4M7AD 1KD1U 2X3XD 2YXYA 5GMKl 4M7AB 1WFWA 3QZ5B 3PMTA 1Y57A 4C5GA 1HYOA 1NJIR 1K73C 1M5Q1 4ZTFA 3OYBA 4IIMA 4XTXA 3L2RA 3S3MA 1RL2A 5IHIA 3KBGA 4QQGA 1BCOA 4M78A 3OYNA 2HCKA 3JB9I 1OEBA 4OGCA 2Y4XA 1Q7YU 4M78C 1B3QA 3M55A 4ME7A 4JRIA 2DD5A 3LX7A 1XOVA 5GAOr 4FT4A 2XDPA 4FYXB 1Z9QA 1QW1A 1YIJT 2F2VA 3RKWA 1GCPA 2V1QA 3RERA 5EC7A 1H641 2J6KA 3CXCP 3UA6A 2KRSA 2DA9A 3A8MB 4Z88A 4BUGA 1KQSS 1RADB 1KK7A 1Y71A 2VXFA 1YNZA 3C94A 2MPXC 3C95A 2KR3A 2NUTA 1N8RR 4J9GA 3A8OB 2RI5A 2K5LA 1KFZA 2DPPB 2ZAEA 2JS2A 2MCNA 1GXIE 3JCMf 2KGTA 1CSKA 2CSIA 2ZPFB 5GAMe 1KJWA 4D8KA 1X2KA 5GAN7 1K8AU 4JS5A 1T3SA 4HCKA 3OB9A 3OYMA 2YRDA 5LJ5d 3L2QA 2LT4A 3HL8A 4Y91A 3L2UA 2E3HA 1TUDA 1UJ0A 3E1SA 4M7DE 3QIIA 2V26A 2J05A 1LPLA 1X6GA 3QZ9B 3TSZA 3X20B 3CCEA 1U1SA 5EG2A 2YUPA 3JRZA 5J3BA 2J7IA 2QI2A 4A4HA 3ASKA 3EG2A 2EWNA 5FW9A 2M0YA 1Q82C 4C8QE 3VS6A 5DY9A 3SWNB 2K3XA 4ELYC 4XTUA 5FU7B 3RMQA 1K0SA 1UECA 1GCQA 3CCEQ 3LWIA 3JCMP 2D6FA 2OAUA 1GCQC 3JAME 1B7TA 3EG1A 1NJIU 2DERA 1AD5A 1ZA2B 2F69A 1I1JA 3QWYA 2XICA 1M1GA 4M7DF 3OYIA 2LRQA 4C5EA 5KYWA 1YITA 1QWFA 4ZN1A 3A98A 5LJ3f 1CKBA 3QJ6A 4C8QF 1V29B 1PKSA 3VS3A 2HEQA 1XQHA 1AVZC 2JOYA 3V7RA 4MMLA 3AHUA 1UJYA 1ZX6A 2PZ1A 2FPDA 5DLQE 3CCVT 1SRMA 3X25B 5GAOp 2ROTA 3G7ZA 2HQHA 1YITQ 5GAOn 3CCMA 1EZZB 2YHTA 1VQ5A 1X6OA 1M1KC 2GF7A 1D1AA 1E6HA 4X9CA 4GY5A 2JMAA 2DZ9A 1VQKT 2DL4A 2R57A 2COZA 2C0IA 1M1FA 2EAYA 3CCMQ 3N5BB 4LNPA 3V8JA 4ORZA 5IH2A 1VQ5Q 1G3WA 2BKDN 2VYTA 5KH6A 1YI2A 4HT8A 5FU6C 2RHYA 1X01A 1IRXA 1BI2A 5IXFA 4RTWA 3UATA 4KH1B 1NG2A 2DJQA 4OMLA 4JLGA 1K0XA 5D6WA 4AFSC 2RI2A 2KRMA 3G6EA 4ZNXA 3MEVA 1VIEA 4L5GA 1W4SA 5CK9A 1PKTA 2KNBB 4OP0A 1R0BG 4EMKA 1YI2Q 5IHNA 4EMKC 5J39A 2YUOA 2EJFA 1SF9A 4BB7A 2F5TX 2O9VA 3LW5E 4HCZA 1M90C 3G6EQ 2ZGWA 2ZPHB 4JPBW 4C92D 1W2BP 2FEIA 1W1FA 4M75E 2AKKA 2EIFA 2Z0WA 5GANg 4C92B 2L89A 3VRZA 4PJOD 5HY6A 1YCSB 4JZ3A 5LJ5e 2MF2A 4M77A 4IUTA 4OMMA 1YIJA 1OU9A 2HL3A 1EFNA 4M77C 4PJOB 1GFDA 1K9AA 2KROA 1Q81R 2KBTA 1WHGA 3TREA 2LTOA 5HKCA 4A53A 2DKGA 2JNGA 3DLMA 2IG0A 3QYHB 3CXCS 2RHXA 3KUFA 5KCOA 4BY6B 1YIJQ 3DB4A 1TSFA 1ZSZB 3MEUA 4RTVA 1A0NB 2RJEA 4B9XA 4E7SA 3FDRA 4M75F 1C1AA 4JJCA 2NLUA 2XDDA 1IHWA 3OYEA 4OB3B 2KXDA 4M78E 3CMAT 2RQTA 4C8QD 4WF2A 2KE9A 3OS1A 1ZBJA 4QT7A 3CCUT 2L3PA 3ME9A 2PNIA 1JEGA 1TG0A 2HQXA 4ZGJB 3EFSA 4C8QB 2RHZA 1AHJB 5LJ5f 2KMTA 5CQXA 1QCNA 1ZBXA 3DKMA 1AZEA 1JJ2P 3A8LB 4KGVB 2I2LA 1JO8A 2OJ2A 3MPUB 4J6XA 1KC8C 1Q7YC 2QQAA 2JM8A 2AZVA 4C5IA 2YUQA 3M0UA 2JXBA 4M7DA 2ZPBB 3RKYA 1TUGB 1Q86R 2DEQA 1QCOA 4M7DC 2DRMA 4MDXA 1G3YA 1B34A 6AT1B 2PVGB 4XU1A 4M78F 4PFZA 2M16A 4OB0B 5HK3A 4OMFB 2QTVA 4VUBA 2BE7D 1IZ6A 4LDWA 3RESA 2LC4A 3EH2A 2HNIA 2QQSA 2L3RA 1FMWA 3LLRA 4D6WA 1DJ7B 3OYJA 2I0NA 3H0IA 1K8AC 1I07A 2EJGA 2KEAA 3LWHA 4CC2A 5GAOq 1X75C 2RJFA 1R0CB 5KYYA 5CKFA 3QBYA 4E7KA 1Q81U 3I55T 3QDRB 2DBMA 2CGHA 4CC4B 2OTJT 2LVMA 3CCVA 3CPWS 4DBQA 1QVFP 1ARKA 2X3WD 2E12A 5FWCA 1OV3A 2QGGA 2KT8A 5KYUA 2K6DA 2DRKA 3UWNA 2KAFA 2KXCA 5GAN4 3PIOA 2RO0A 1D09B 4J6WA 1VQKA 2QTXA 2QDLA 3SD4A 4MZTA 3I5RA 3CCVQ 3GIBA 1JRIA 4OMQA 4XU0A 2KYBA 4J7FA 2L5QA 2FB7A 3OA6A 1OYXA 4KGXB 2JTMA 2FPFA 4II1A 1Y07A 5C6SA 4DOVA 1NJIC 4PKCC 3NPFA 2QQRA 5LJ3d 2CP0A 4C0GA 4DOWA 1OU8A 1VQKQ 1OZ3A 1YWPA 1X69A 5FROA 1MMNA 3VUZA 2DK3A 3VV0A 5LJ3j 3QHSA 3HPWA 2NUPA 3PFSA 4BI8B 2DVEA 4C0DC 4M75D 5D6YA 4C0ZA 1PG5B 2VWFA 1Q86U 3JV3A 3JCMW 1VQ9T 3PMIA 4IUVA 2VUBA 4LE9A 2ROLA 1D0YA 5FWBA 4M75B 1OOTA 2M1HA 2DE0X 4IURA 3CMET 2XIDA 2RM4A 2CYZB 2FHDA 2FVUA 5KYNA 2ATCB 4N0AA 4RG2A 1NEBA 2J06A 4N0AC 3CCLT 3WVEB 1IXDA 2LJ0A 5GAN2 3CCST 2D8JA 2JUFA 2DYBA 3PVQA 2ENMA 2YT6A 1W2BS 4IIOA 5I21A 1QKXA 3EGXB 3VKIA 2EYYA 2JM9A 3P8BB 4QVZA 2BZYA 4JUVA 1KHIA 4E7JA 1UGPB 2XKOC 1QKWA 2RMOA 2MWPA 3I9QA 2BE9B 2GTOA 1WXTA 1SPKA 4MDWA 4M78D 2EJ9A 2R5AA 3MP8A 2KDSA 1ZSGA 1VA7A 2O4XA 4HVVA 3VS5A 3A8GB 1K76A 3TCJA 4HA8A 3BFMA 4M78B 4B6MA 4C0FA 1FXXA 1YJNT 5IN1A 1KQSA 3CQTA 5IT9E 1QLYA 5KYXB 4X34A 3OMCA 1M9SA 3JCMe 2A37A 1BI0A 1OX9A 4EIKA 3OYHA 3CCUA 2B8AA 1W70A 3D7SB 4M77E 4F7UG 1Y96B 2NUTB 3M58A 3S6WA 2ZCFB 2ESWA 1Y7XA 4QQDA 3R6NA 4KBMB 3CCRT 2XI9A 4RTZA 4E7IA 2OX7A 1VIFA 4ATOA 5IAYA 2HD0A 3PNWC 3CCUQ 3GF5A 2DL3A 4FIBA 3EAEA 1BI3A 2LQNA 3MEAA 3GOXA 5DLOA 2R5MA 1WXBA 1G2BA 3V7CA 4LD9K 2LT1A 2XHCA 2LCSA 1YN8A 1KQ1A 3OW2P 1U5SA 1TXQA 1I5LA 2F1LA 1ZUUA 3KFVA 5M9OA 2L8DA 3J81E 4M77F 1MMDA 4RTYA 5FRNA 1PD0A 3JB9G 4O6JA 2RK2A 1NBEB 4DQ2A 2X4YA 4N4IA 4MZPA 3A8HB 1K4US 2P0PA 4LD6A 4FM4B 3I55A 2YLCA 2QXFA 1OX8A 2OTJA 2CP6A 5LJ3e 4BE2A 2X51A 1C0MA 2HKQB 3IQLA 4M7AG 2PTKA 4AFQC 3ZBDA 4IKFA 3JCMX 5LJ5j 2QQ9A 1YJWA 3CCJT 4L59A 5KYWB 2GQVA 3URGA 1QVFS 2FL7A 3I55Q 3TU4K 3QWXX 2OTJQ 2HQEA 2VB6A 2DZCA 3OYGA 3H9NA 1TUCA 2Y4YA 3A5ZB 3CBOA 3LGFA 1WIEA 3MEWA 5LL6S 4J5YA 2QEXT 1YJWQ 1M8MA 1M8VA 1QVGS 1VQLT 5CQYA 1BIAA 3E19A 3RUXA 1NLOC 4E7HA 4E47A 3OBYA 3QDFA 2K5IA 1BKBA 1O75A 1S72T 1UTIA 2K57A 1FX7A 2DAQA 4NL2A 3RNJA 1JU5C 2Y90A 1VQ8T 3J7AF 2DX1A 2DL7A 1K73R 1I8FA 2DXUA 2DL5A 2HKNA 1VQ9A 5FU6B 5IXBA 1LCKA 1RUWA 2XDBA 4C5HA 5GAMg 3CMEA 2F2XA 3H8ZA 1T0HA 5KCHA 2PU9B 3SWNA 1VQ4T 1N8RU 3SWNC 3CCLA 2EVRA 1KIKA 2HAXA 1XJWB 3NHNA 5GAMh 1WZOA 3A1PA 3CCSA 3EH1A 1HK9A 1VQ9Q 2EYXA 2OAWA 3JSCA 4J9IA 3ZL7C 1I4K1 1D0ZA 2QQBA 2DTOA 5GAN6 1UE9A 2DTHA 3CCQT 2CZ7B 1OPLA 3HP9A 1MUZA 3CMEQ 1AEYA 5J26A 2E4HA 4F14A 4FYWB 1VQNT 3HHTB 2L0AA 2GGRA 5A2QE 2F2WA 2K4YA 3SHWA 3CCLQ 5GJWB 4R55A 2X35A 4DBRA 4XQ3A 1VQMA 5I22A 2QK0A 3NTHA 3CCSQ 3H0FA 5GAOm 2HMAA 1V76A 2K79A 2A0FB 1KHCA 1N6AA 1UEBA 1YJ9T 4EPCA 2BZXA 4AG1C 4BD3A 2CT4A 4OGEA 4M77D 2DIGA 5KE3A 1OQKA 4KH0B 2OI3A 1BBZA 3EG9A 3TEEA 1I0CA 1U06A 4M77B 5L23A 1VQMQ 2AHJB 2LDMA 5CKBA 2V8IA 1PSEA 1TS9A 3M4YA 2ZPEB 3R6OA 4HT9A 3U23A 3DLLA 1T3LA 1IHVA 2K9GA 1Q82R 3E9GA 4UC4A 5I2MA 4XTZA 1N9RA 1ABOA 1OULA 2DXCA 1WHKA 5IHKA 3M9QA 1AWJA 3CCRA 4OB1B 4LDVA 1WI7A 4DEXA 2A28A 2D9TA 2XD0A 3EFRA 3HRUA 3CC7T 2PUKB 1WQ7A 2ED1A 5GMKe 1IB8A 2KK4A 4WCIA 2EQJA 1M2VB 2D8HA 5GANh 2CKKA 3VS0A 3LH0A 1NYFA 2O88A 1D3BB 1VYVA 3CC2T 5D6XA 4Z8AA 3CCRQ 1SSHA 2A36A 2JTEA 3KXTA 2YRCA 4HKEA 1IGQA 3ZFJA 2QG9B 1PCXA 1WNLA 4EMGA 1O9SA 2EQUA 2GTJA 3HKSA 3X28B 3DB3A 1YHQT 3OS2A 2E1HA 3VS4A 1LVKA 4M7DD 3EGDA 2VASA 1PRMC 2C0OA 2FRWA 3OW2S 5CCAA 3NGPA 3GNGA 3P8HA 2SEMA 4QQ6A 1MV3A 3BY7A 1BB9A 4M7DB 3EHQA 2EQIA 4LDYA 4O5VA 2K7AA 1G83A 3PTAA 2CDTA 2RD1A 1KD1C 1M1KR 4DEYA 2COYA 2ABLA 1B34B 2X4WA 4KUIA 4EMHA 2WACA 4FU6A 2FZCB 2VXEA 3C4SA 2QGFB 4A4GA 4EDUA 2PQWA 2DF6A 2LJ3A 3CCJA 3M0QA 3BW1A 5HK0A 4ZGEB 4PJOA 4OVAA 1SHFA 4C92G 1T0JA 3OS0A 4J9CA 2YRVA 3CPWA 2PUOB 2CP7A 2KVQG 4DA4A 1PNJA 5KYYB 1VQOT 4PJOG 1PWTA 2DVJA 1HSQA 1VQLA 1RLQC 2RF0A 3FJPA 3VYGA 1M2OA 5CIUA 4R0KA 2KI7A 3TSWA 5LJ5g 2PVDB 4TVRA 1JXMA 3PGGA 1S72A 4BDZA 1FYNA 2EQMA 3LH5A 1M27C 2LQ8A 2RN8A 2GNCA 2HBPA 1H8KA 1YP5A 2EPDA 1N27A 5ECAA 1VQ8A 1VQLQ 3V8KA 4FW1A 1I5OB 2E64A 2JJ9A 1NZ9A 1UGRB 1WX6A 2KT1A 1X43A 1S72Q 2P0KA 2EYQA 1RLPC 2A7YA 2CP5A 4C8QG 1YWOA 4E7ZA 4RCBA 5CKEA 4M7AF 2ZPGB 4HVWA 2HZYA 1OPKA 1VQ8Q 3QO3A 2E6ZA 4CC7A 2P84A 5CKDA 4BACA 2CH4W 2EQKA 1QP3A 4C0DB 3UF4A 2NUPB 2MIOA 3CCQA 1M3CA 1RAGB 1K9MR 3C0CA 3THKA 1VQNA 1M1KU 4LN2A 1Q95G 1VYTA 2DNUA 3QXEB 3M53A 5A0LA 3GLXA 3G1JA 4XAXB 2EGEA 4QVDA 1UHCA 3O8VA 1MNDA 1WJRA 2RJDA 1MNEA 2A08A 3QUIA 2DBKA 7AT1B 5KE2A 2IIMA 1YJ9A 1W2BA 4JRPA 5GAMd 2FPEA 2DJZA 3CCQQ 2G6FX 1HJDA 3EGUA 1ZLMA 4XU2A 1VQNQ 1Y0MA 2CP3A 2GCXA 3WVDB 1ZHIA 3NTIA 4RUGA 3M0RA 4R56A 2CUDA 1LNXA 5I2SA 1YJ9Q 3BDUA 4CRIA 3CC4T 4A4KA 3MHXA 2XMFA 2IVWA 2E5KA 1RAFB 5GAN8 4JZ4A 1KC8R 1Q7YR 1N8RC 1H3ZA 4J8OA 2KRNA 2O4XB 2O01E 1JQQA 4PJMA 2O2OA 2DYIA 4KGZB 1SRLA 3CC7A 4J9HA 2DETA 2DD4A 4JLIA 1ZQ1A 1BK2A 2DTIA 4NOYA 2V8KA 2DO3A 2BUDA 8ATCB 4GBQA 1NYGA 3CC2A 1UFFA 2CSQA 2GFUA 4LXCA 3RBBB 5CO7A 3CEYA 3LYIA 4OMPA 4FYVB 1WA7A 1UUEA 3WXMB 3CC7Q 2NWMA 4DBFA 1IREB 1R77A 1JBMA 3EG0A 1G5VA 3M59A 1R8OB 1UGVA 3JCMV 1YHQA 2FZKB 1QVPA 3VRYA 3H0HA 2E41A 2KQWA 3PE0A 1XNIA 3CC2Q 1C6VX 3GPLA 1FWZA 5GANd 4F17A 4F7UA 1K9MU 2RK1A 1SG5A 3CMAA 1MMGA 2B86A 3JCMJ 2V1RA 3G6ET 2RH2A 4M75G 4OMOA 1YHQQ 3PT9A 4A4EA 1VUBA 2JTFA 2DEUA 5I11A 4OMNA 1GBQA 1LJOA 4KUDK 4J83A 4AG2C 4RG8A 1M3AA 1Z9ZA 4LUEA 3CMAQ 1PSFA 4DBHA 1WHJA 1RAAB 2L3QA 5DM7R 1BYMA 4KT0E 2C06A 4JDSA 1VOMA 3VUBA 4ZGDB 3C12A 4PFOA 2EGCA 3GNFB 3M4GA 3OQ5A 3EFOA 4IUUA 4B9WA 3I56T 1VQOA 1JJ2S 3T9NA 2LNHB 1EX4A 1PC0A 1H3HA 1U8RA 4CC3A 1KC8U 2G3RA 1QVFA 4PLLA 2MMPA 4A63B 3M57A 2CP2A 5KYXA 4AMCA 4ANJA 4C92E 1U3OA 2CZ6B 4E2FB 2ZPIB 3QKJA 4M78G 2LP5A 1VQPT 1VQOQ 1RI9A 2LX7A 3OYLA 1U1TA 1VQ7T 2VV5A 4M7AA 1LOJA 1QVGA 2LCLA 1Y96A 4M7AC 2V8JA 2M51A 4PJOE 3OYAA 3CPFA 3RMSA 2M9UA 2K5FA 3I5SA 4YTLA 1I81A 1BU1A 3G4ST 3S3OA 1WLPB 2BZ8A 5GAOl 1RABB 5GMKj 1AWWA 1UHFA 3INZA 2JVVA 2E3IA 3JCMg 1XTDA 4AFUC 2CZ1B 2DL8A 1HXDA 2IPOB 4JRQA 2QA4T 4A54A 1AT1B 2L3SA 2K2MA 3TVTA 1WGSA 2RQUA 4C92F 2AT1B 2W0ZA 2DIQA 2EYZA 1N9SA 3H6ZA 3JCMh 3SFMA 5A0DA 4M4ZA 3L42A 2E6NA 2X4XA 3X24B 4ESRA 1NPRA 4BI3A 4PJOF 4IUPA 2K2VA 2QAZA 1TU0B 1TH7A 1QMCA 2KY9A 4HCCA 2MWOA 2K3YA 3L2VA 1TOVA 2DXBA 2A3LA 2W10A 5CKHA 1RAIB 2WSEE 4GLKA 5GMKm 4Z02A 2RB6A 2GQIA 1M3BA 1EIFA 5GAMf 4JJDA 4FSSA 3UPUA 4JJNK 1X27A 2HL5C 3HRSA 1ZA1B 2SRCA 3VJPA 4PJJA 1Q81C 2YLBA 3CC4A 1E7OA 2DM1A 3FB9A 3OYYA 2RA2A 4P5NA 4FL6A 1WYXA 3JCMb 2DFUA 3CPWP 4WTOB 5AYFA 2RHUA 4FCYA 4K11A 4HCBA 5FU7C 1WHHA 1NPPA 2MAMA 2L2PA 5GANe 1S1NA 1UGQB 1E6GA 5LJ3g 4EMKB 4RMOA 1FMVA 1IGUA 2LCCA 3EG9B 4LDXA 4J6YA 2JMCA 3CC4Q 1PD1A 2E65A 3M54A 2E5QA 3CBPA 2D0NA 2YDLA 1YCYA 2EGAA 5LJ3h 4RTUA 2MYSA 3PIPA 1OI1A 1MMAA 3GP8A 1GL5A 4X9DA 2D1XA 1NE8A 2VGNA 3MP6A 4HXJA 2EYWA 3MKDA 1M4ZA 2KYMA 2WSFE 4QKUA 2ED0A 5AT1B 1YJNA 1GFCA 1X6BA 4J9EA 1NM7A 2J6OA 3P8DA 1M30A 4L6V5 2O9SA 1FMKA 4ELZC 2HDAA 4FYYB 1Q86C 5FRMA 2AKLA 4A4FA 1KG1A 1SKUB 3CXCA 2LJ1A 5GANf 5GMKi 1VQ6T 3UT1A 1YJNQ 3OW2A 2VC8A 3FLGA 1BIBA 4X1VA 4F04B 2BTTA 2M02A 3I35A 2JT4A 3L2ZA 3EGDB 1PRLC 3MO8A 1J3TA 5CAIA 3JCMc 2CH4A 1RAEB 4GLMA 3QSUA 3M5AA 1K73U 1GBRA 1RAHB 3TQ7P 3RKXA 2R58A 3I56A 4PK4A 2OTLT 4OF1A 3JB9J 3G71T 2MOXA 2RJCA 4F7UE 4LUDA 2LX9A 1ZUYA 2AZSA 2EW3A 4AT1B 2EBPA 3RR6A 4RCCA 1NLPC 2DMOA 2FZGB 3E9FA 4D8DA 1F1BB 3HFOA 4ZN3A 1P92A 3VS1A 4AFZC 3I56Q 1VQPA 1GRIA 1VQ7A 2CUBA 4Y28E 3CD6T 1WPYA 1V1CA 3RDVA 4XTWA 1NEGA 2HSEB 3EG3A 3H41A 4M77G 1K9MC 3HRTA 2NYSA 4XTVA 4JS4A 1AOJA 3G4SA 2O31A 5D7UA 4J7IA 3REBB 4C92A 3META 8AT1B 4C92C 1VQPQ 1D0XA 1SSFA 1WQWA 3V8LA 1VQ7Q 1H92A 4F7UF 3AT1B 3OBWA 2LZ6B 1M2VA 3VS7A 1D3BA 4N4GA 4XTYA 3NTKA 4BDYA 3QJYA 3VS2A 2QA4A 1TTHB 4PJOC 3OS5A 2VGMA 3X26B 2XK0A 4J9DA 2KSSA 3JCMQ 4XU3A 3G4SQ 1MHNA 1BI1A 1AWXA 2BIVA 1MGQA 2LQWA 5FLXE 1AWOA 1G3TA 2QEXA 4M7AE 2EKOA 1Q82U 1ABQA 3CCJQ 1WXUA 1ZSZA 4BI4A 1D1BA 1KQSP 4BY6C 1OZ2A 2XU8A 1ZSZC 2QA4Q 5KYUB 3OYFA 1X2QA 5CVIA 3VYHB 3GBQA 2HBWA 2JZ2A 1N5ZA 2E70A 1M90R 4JJBA 5GMKh 3JCMd 1B07A 5A0GA 5LJ5h 2FG0A 3JB9F 4QVCA 1JXOA 3M0TA 2EKHA 2QEXQ 1CKAA 3LGLA 1QWEA 4C8QA 2CS7A 4M7DG 4FSXA 4C8QC 3QYGB 3OY9A 2F5KA 3ZEHA 3REAB 4PFPA 3RIRA 4BE1A 2FRYA 2GFAA 2HSPA 2RQRA 2RI3A 2RNAA 1IO6A 3UA7A 4KULA 1VQ4A 1PHTA 4PLIA 4PJNA 2EFIA 3FIFA 2COWA 1D1CA 4KRTA 4PJLA 2RPNA 2DLPA 4IUQA 3SB2A 4Q5WA 2CT3A 3FJ5A 2H3JA 4RTTA 3F70A 3Q1JA 5HCKA 3ULRB 4Y92A 3HTRA 2XG8D 1QP2A 1WHLA 2LNVA 4QW2A 3CCET 1VQ4Q 3CBMA 1KQ2A 4Z89A 5C0MA 1YJWT 4MMKA 2X9HA 3L2WA 9ATCB 2RQWA 2FYKA 1TWBA 3NFCA 2E10A 2JN0A 3QPHA 1QVGP 4F16A 3M56A 3HFNA 4FT2A 5L8RE 1ZUKA 1BCMA 2NUZA 1RI0A 1JB0E 1KD1R 3QG1A 2ZZDA 2QASA 3BE3A 2DILA 1G8XA 2FO0A 4ZTJA 1UDLA 3M0PA 1YBYA 2X4JA 1KSWA 5GAMj 1MV0B 1UGSB 2JW4A 3OYCA 2LMJA 4PL6A 5GJVB 3O5ZA 3S3NA 4MZMA 2PVOB 1K1ZA 2P4TA 4J9BA 3E2UA 5GAN3 3FRNA 1YITT 1VQ6A 1QCFA 2AIRB 2D0QB 3FC3A 2VKNA 1UG1A 1WJSA 2YSQA 1ACMB 1W6XA 2VVKA 3M0SA 1M90U 3OYKA 4HVUA 3OSSC 3FEOA 3ER0A 4F7UB 2CREA 2RQVA 1WHMA 2H3EB 2YUNA 1SEMA 1VQ6Q 3CCMT 4XK8E 1YFNA 2WSCE 1VQ5T 3V7SA 2OTLA 4OB2B 3G71A 2H8HA 3OSVA 4E6RA 5GAN5 3MP1A 2P0QA 2ECZA 1QQJA 2C0TA 4E7LA
chains in the Genus database with same CATH topology
2L3SA 2K2MA 3TVTA 3U23A 2RQUA 1T3LA 2W0ZA 2EYZA 2K9GA 1ABOA 4M4ZA 1WDXA 2I0NA 2GBQA 3H0IA 5IHKA 4RTXA 1I07A 1AWJA 4ESRA 1HD3A 2KEAA 4CC2A 3NMZC 1WI7A 4DEXA 2A28A 1AZGB 2P4RA 2JS0A 3PVLA 2AK5A 2ED1A 2DBMA 4CC4B 3SEMA 4WCIA 3EHRA 1ARKA 2W10A 4J9FA 2D8HA 2X3WD 3VS0A 1NYFA 1SHGA 5FWCA 2O88A 1VYVA 1VYUA 1OV3A 2GQIA 2KT8A 4Z8AA 1M3BA 2J6FA 2K6DA 2DRKA 2K3BA 4JJDA 4FSSA 1SSHA 2KXCA 1X27A 2A36A 2JTEA 2X3XD 2SRCA 2QDLA 2GTJA 3I5RA 1WFWA 1E7OA 2DM1A 1Y57A 4OMQA 1WYXA 3VS4A 2KYBA 1PRMC 2C0OA 2FRWA 4IIMA 3NGPA 2FPFA 2SEMA 5IHIA 4K11A 1MV3A 1BB9A 2L2PA 3EHQA 2EQIA 2K7AA 2HCKA 3NPFA 1OEBA 1G83A 1S1NA 2CDTA 1E6GA 1B3QA 4DEYA 2ABLA 1XOVA 1YWPA 1X69A 2JMCA 1Z9QA 2F2VA 1GCPA 2V1QA 2D0NA 5EC7A 2J6KA 2YDLA 3UA6A 2KRSA 2DA9A 4Z88A 2EGAA 2DF6A 2LJ3A 4RTUA 1YNZA 3M0QA 2KR3A 2VWFA 3JV3A 1SHFA 1GL5A 4J9GA 2D1XA 1T0JA 4LE9A 2ROLA 1KFZA 2JS2A 5FWBA 2MCNA 1OOTA 4HXJA 4J9CA 2DE0X 2KGTA 1CSKA 2EYWA 2CSIA 2KYMA 1PNJA 1KJWA 1NEBA 4D8KA 1X2KA 2ED0A 2J06A 1GFCA 1PWTA 1X6BA 4J9EA 1NM7A 2DVJA 2J6OA 1HSQA 1T3SA 2LJ0A 1M30A 1RLQC 2RF0A 4HCKA 2D8JA 2O9SA 1FMKA 2HDAA 2DYBA 3PVQA 4R0KA 3TSWA 2ENMA 2YT6A 4IIOA 2AKLA 1JXMA 1QKXA 1TUDA 1UJ0A 2LJ1A 2EYYA 1FYNA 2JM9A 3TSZA 2J05A 1X6GA 3LH5A 1M27C 2BZYA 2RN8A 2GNCA 2YUPA 1H8KA 1YP5A 2J7IA 2EPDA 4X1VA 5ECAA 3EG2A 1QKWA 2RMOA 2BTTA 3I9QA 5FW9A 2GTOA 2M0YA 3I35A 2JT4A 3VS6A 1WXTA 1SPKA 1PRLC 1J3TA 1ZSGA 1VA7A 4HVVA 2CH4A 1WX6A 3VS5A 4GLMA 1K76A 2KT1A 1X43A 1GBRA 1K0SA 1RLPC 1UECA 1GCQA 1YWOA 1GCQC 3CQTA 2MOXA 4HVWA 1OPKA 3EG1A 1QLYA 4CC7A 4LUDA 1AD5A 2A37A 1ZUYA 4EIKA 2CH4W 2AZSA 2EW3A 1I1JA 3QWYA 2EBPA 3UF4A 1W70A 1NLPC 2DMOA 2MIOA 4D8DA 1M3CA 1QWFA 3C0CA 3A98A 3THKA 3VS1A 4LN2A 4AFZC 2ESWA 1CKBA 1GRIA 1VYTA 2DNUA 3R6NA 2CUBA 1V1CA 2EGEA 1UHCA 1NEGA 3H41A 3EG3A 4RTZA 1PKSA 3VS3A 2HEQA 1AVZC 2A08A 2DBKA 1UJYA 1ZX6A 2IIMA 2PZ1A 2FPDA 2DL3A 2FPEA 1AOJA 1SRMA 2G6FX 2ROTA 3EGUA 1HJDA 2LQNA 2O31A 3REBB 1ZLMA 1Y0MA 1WXBA 1G2BA 1H92A 2LCSA 1YN8A 1E6HA 2LZ6B 2JMAA 4RUGA 3VS7A 1U5SA 3M0RA 2CUDA 3VS2A 3KFVA 1ZUUA 2DL4A 4J9DA 2XMFA 4RTYA 2C0IA 2E5KA 4JZ4A 1AWXA 4LNPA 4ORZA 2LQWA 5IH2A 2KRNA 1AWOA 1JQQA 1K4US 5IXFA 1ABQA 2O2OA 4RTWA 3UATA 1WXUA 1NG2A 2DJQA 1SRLA 4OMLA 4J9HA 1K0XA 4AFSC 2KRMA 1BK2A 4ZNXA 1X2QA 3IQLA 2PTKA 4AFQC 3GBQA 2HBWA 4GBQA 1NYGA 1N5ZA 1PKTA 2KNBB 4JJBA 1UFFA 2CSQA 1B07A 5IHNA 3RBBB 2FG0A 1JXOA 2YUOA 2EKHA 3M0TA 4OMPA 1CKAA 1QWEA 1WA7A 1UUEA 2O9VA 2NWMA 3QWXX 3REAB 3EG0A 1UGVA 2FRYA 2HSPA 2RQRA 2RNAA 1IO6A 4JPBW 3H0HA 3VRYA 3PE0A 3UA7A 2FEIA 1TUCA 1PHTA 1WIEA 1W1FA 2AKKA 1M8MA 4F17A 1NLOC 4KRTA 2RPNA 2B86A 2DLPA 3VRZA 2V1RA 1YCSB 2CT3A 3FJ5A 4JZ3A 4RTTA 5HCKA 1UTIA 4OMMA 3ULRB 4Y92A 4OMOA 1EFNA 1GFDA 3RNJA 5I11A 1K9AA 4OMNA 1GBQA 1JU5C 2KROA 4Z89A 2KBTA 2DX1A 2RQWA 2DL7A 4AG2C 1M3AA 2DL5A 1Z9ZA 4LUEA 5IXBA 4F16A 1LCKA 2L3QA 1RUWA 1ZUKA 2NUZA 2F2XA 2EGCA 4RTVA 1A0NB 1T0HA 2DILA 2LNHB 2FO0A 1H3HA 2EVRA 1UDLA 1KIKA 3M0PA 4JJCA 1KSWA 3NHNA 4CC3A 2KXDA 1MV0B 2RQTA 2JW4A 2EYXA 2OAWA 2LMJA 4J9IA 5GJVB 3ZL7C 2KE9A 3O5ZA 4A63B 1ZBJA 4QT7A 2L3PA 1K1ZA 2PNIA 1UE9A 1JEGA 4J9BA 1TG0A 1OPLA 1MUZA 1AEYA 1U3OA 1QCFA 4F14A 2LP5A 2L0AA 2GGRA 1RI9A 2F2WA 3SHWA 2LX7A 5GJWB 2VKNA 1UG1A 2YSQA 1AZEA 5I22A 2M51A 3H0FA 1W6XA 1JO8A 2K79A 2VVKA 2OJ2A 3M0SA 4HVUA 2BZXA 3I5SA 2JM8A 2AZVA 1BU1A 2CREA 2CT4A 2RQVA 2YUQA 3M0UA 4AG1C 2JXBA 1WLPB 2BZ8A 2YUNA 1SEMA 2DRMA 1AWWA 1UHFA 2OI3A 2H8HA 1BBZA 4E6RA 1I0CA 1U06A 4AFUC 5L23A 2ECZA 2C0TA 2DL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3S A;  2K2M A;  3TVT A;  3U23 A;  2RQU A;  1T3L A;  2W0Z A;  2EYZ A;  2K9G A;  1ABO A;  4M4Z A;  1WDX A;  2I0N A;  2GBQ A;  3H0I A;  5IHK A;  4RTX A;  1I07 A;  1AWJ A;  4ESR A;  1HD3 A;  2KEA A;  4CC2 A;  3NMZ C;  1WI7 A;  4DEX A;  2A28 A;  1AZG B;  2P4R A;  2JS0 A;  3PVL A;  2AK5 A;  2ED1 A;  2DBM A;  4CC4 B;  3SEM A;  4WCI A;  3EHR A;  1ARK A;  2W10 A;  4J9F A;  2D8H A;  2X3W D;  3VS0 A;  1NYF A;  1SHG A;  5FWC A;  2O88 A;  1VYV A;  1VYU A;  1OV3 A;  2GQI A;  2KT8 A;  4Z8A A;  1M3B A;  2J6F A;  2K6D A;  2DRK A;  2K3B A;  4JJD A;  4FSS A;  1SSH A;  2KXC A;  1X27 A;  2A36 A;  2JTE A;  2X3X D;  2SRC A;  2QDL A;  2GTJ A;  3I5R A;  1WFW A;  1E7O A;  2DM1 A;  1Y57 A;  4OMQ A;  1WYX A;  3VS4 A;  2KYB A;  1PRM C;  2C0O A;  2FRW A;  4IIM A;  3NGP A;  2FPF A;  2SEM A;  5IHI A;  4K11 A;  1MV3 A;  1BB9 A;  2L2P A;  3EHQ A;  2EQI A;  2K7A A;  2HCK A;  3NPF A;  1OEB A;  1G83 A;  1S1N A;  2CDT A;  1E6G A;  1B3Q A;  4DEY A;  2ABL A;  1XOV A;  1YWP A;  1X69 A;  2JMC A;  1Z9Q A;  2F2V A;  1GCP A;  2V1Q A;  2D0N A;  5EC7 A;  2J6K A;  2YDL A;  3UA6 A;  2KRS A;  2DA9 A;  4Z88 A;  2EGA A;  2DF6 A;  2LJ3 A;  4RTU A;  1YNZ A;  3M0Q A;  2KR3 A;  2VWF A;  3JV3 A;  1SHF A;  1GL5 A;  4J9G A;  2D1X A;  1T0J A;  4LE9 A;  2ROL A;  1KFZ A;  2JS2 A;  5FWB A;  2MCN A;  1OOT A;  4HXJ A;  4J9C A;  2DE0 X;  2KGT A;  1CSK A;  2EYW A;  2CSI A;  2KYM A;  1PNJ A;  1KJW A;  1NEB A;  4D8K A;  1X2K A;  2ED0 A;  2J06 A;  1GFC A;  1PWT A;  1X6B A;  4J9E A;  1NM7 A;  2DVJ A;  2J6O A;  1HSQ A;  1T3S A;  2LJ0 A;  1M30 A;  1RLQ C;  2RF0 A;  4HCK A;  2D8J A;  2O9S A;  1FMK A;  2HDA A;  2DYB A;  3PVQ A;  4R0K A;  3TSW A;  2ENM A;  2YT6 A;  4IIO A;  2AKL A;  1JXM A;  1QKX A;  1TUD A;  1UJ0 A;  2LJ1 A;  2EYY A;  1FYN A;  2JM9 A;  3TSZ A;  2J05 A;  1X6G A;  3LH5 A;  1M27 C;  2BZY A;  2RN8 A;  2GNC A;  2YUP A;  1H8K A;  1YP5 A;  2J7I A;  2EPD A;  4X1V A;  5ECA A;  3EG2 A;  1QKW A;  2RMO A;  2BTT A;  3I9Q A;  5FW9 A;  2GTO A;  2M0Y A;  3I35 A;  2JT4 A;  3VS6 A;  1WXT A;  1SPK A;  1PRL C;  1J3T A;  1ZSG A;  1VA7 A;  4HVV A;  2CH4 A;  1WX6 A;  3VS5 A;  4GLM A;  1K76 A;  2KT1 A;  1X43 A;  1GBR A;  1K0S A;  1RLP C;  1UEC A;  1GCQ A;  1YWO A;  1GCQ C;  3CQT A;  2MOX A;  4HVW A;  1OPK A;  3EG1 A;  1QLY A;  4CC7 A;  4LUD A;  1AD5 A;  2A37 A;  1ZUY A;  4EIK A;  2CH4 W;  2AZS A;  2EW3 A;  1I1J A;  3QWY A;  2EBP A;  3UF4 A;  1W70 A;  1NLP C;  2DMO A;  2MIO A;  4D8D A;  1M3C A;  1QWF A;  3C0C A;  3A98 A;  3THK A;  3VS1 A;  4LN2 A;  4AFZ C;  2ESW A;  1CKB A;  1GRI A;  1VYT A;  2DNU A;  3R6N A;  2CUB A;  1V1C A;  2EGE A;  1UHC A;  1NEG A;  3H41 A;  3EG3 A;  4RTZ A;  1PKS A;  3VS3 A;  2HEQ A;  1AVZ C;  2A08 A;  2DBK A;  1UJY A;  1ZX6 A;  2IIM A;  2PZ1 A;  2FPD A;  2DL3 A;  2FPE A;  1AOJ A;  1SRM A;  2G6F X;  2ROT A;  3EGU A;  1HJD A;  2LQN A;  2O31 A;  3REB B;  1ZLM A;  1Y0M A;  1WXB A;  1G2B A;  1H92 A;  2LCS A;  1YN8 A;  1E6H A;  2LZ6 B;  2JMA A;  4RUG A;  3VS7 A;  1U5S A;  3M0R A;  2CUD A;  3VS2 A;  3KFV A;  1ZUU A;  2DL4 A;  4J9D A;  2XMF A;  4RTY A;  2C0I A;  2E5K A;  4JZ4 A;  1AWX A;  4LNP A;  4ORZ A;  2LQW A;  5IH2 A;  2KRN A;  1AWO A;  1JQQ A;  1K4U S;  5IXF A;  1ABQ A;  2O2O A;  4RTW A;  3UAT A;  1WXU A;  1NG2 A;  2DJQ A;  1SRL A;  4OML A;  4J9H A;  1K0X A;  4AFS C;  2KRM A;  1BK2 A;  4ZNX A;  1X2Q A;  3IQL A;  2PTK A;  4AFQ C;  3GBQ A;  2HBW A;  4GBQ A;  1NYG A;  1N5Z A;  1PKT A;  2KNB B;  4JJB A;  1UFF A;  2CSQ A;  1B07 A;  5IHN A;  3RBB B;  2FG0 A;  1JXO A;  2YUO A;  2EKH A;  3M0T A;  4OMP A;  1CKA A;  1QWE A;  1WA7 A;  1UUE A;  2O9V A;  2NWM A;  3QWX X;  3REA B;  3EG0 A;  1UGV A;  2FRY A;  2HSP A;  2RQR A;  2RNA A;  1IO6 A;  4JPB W;  3H0H A;  3VRY A;  3PE0 A;  3UA7 A;  2FEI A;  1TUC A;  1PHT A;  1WIE A;  1W1F A;  2AKK A;  1M8M A;  4F17 A;  1NLO C;  4KRT A;  2RPN A;  2B86 A;  2DLP A;  3VRZ A;  2V1R A;  1YCS B;  2CT3 A;  3FJ5 A;  4JZ3 A;  4RTT A;  5HCK A;  1UTI A;  4OMM A;  3ULR B;  4Y92 A;  4OMO A;  1EFN A;  1GFD A;  3RNJ A;  5I11 A;  1K9A A;  4OMN A;  1GBQ A;  1JU5 C;  2KRO A;  4Z89 A;  2KBT A;  2DX1 A;  2RQW A;  2DL7 A;  4AG2 C;  1M3A A;  2DL5 A;  1Z9Z A;  4LUE A;  5IXB A;  4F16 A;  1LCK A;  2L3Q A;  1RUW A;  1ZUK A;  2NUZ A;  2F2X A;  2EGC A;  4RTV A;  1A0N B;  1T0H A;  2DIL A;  2LNH B;  2FO0 A;  1H3H A;  2EVR A;  1UDL A;  1KIK A;  3M0P A;  4JJC A;  1KSW A;  3NHN A;  4CC3 A;  2KXD A;  1MV0 B;  2RQT A;  2JW4 A;  2EYX A;  2OAW A;  2LMJ A;  4J9I A;  5GJV B;  3ZL7 C;  2KE9 A;  3O5Z A;  4A63 B;  1ZBJ A;  4QT7 A;  2L3P A;  1K1Z A;  2PNI A;  1UE9 A;  1JEG A;  4J9B A;  1TG0 A;  1OPL A;  1MUZ A;  1AEY A;  1U3O A;  1QCF A;  4F14 A;  2LP5 A;  2L0A A;  2GGR A;  1RI9 A;  2F2W A;  3SHW A;  2LX7 A;  5GJW B;  2VKN A;  1UG1 A;  2YSQ A;  1AZE A;  5I22 A;  2M51 A;  3H0F A;  1W6X A;  1JO8 A;  2K79 A;  2VVK A;  2OJ2 A;  3M0S A;  4HVU A;  2BZX A;  3I5S A;  2JM8 A;  2AZV A;  1BU1 A;  2CRE A;  2CT4 A;  2RQV A;  2YUQ A;  3M0U A;  4AG1 C;  2JXB A;  1WLP B;  2BZ8 A;  2YUN A;  1SEM A;  2DRM A;  1AWW A;  1UHF A;  2OI3 A;  2H8H A;  1BBZ A;  4E6R A;  1I0C A;  1U06 A;  4AFU C;  5L23 A;  2ECZ A;  2C0T A;  2DL8 A; 
#chains in the Genus database with same CATH topology
 2DXT A;  3L1A A;  2MK5 A;  4FW2 A;  1K8A R;  2MI6 A;  3VU3 C;  4V2S A;  3OMG A;  3J80 E;  3OYD A;  4JRK A;  4CI0 C;  5CR2 A;  4BE0 A;  2QYZ A;  1WDX A;  3BDL A;  1JJ2 A;  2GBQ A;  2OTL Q;  4NS5 A;  4RTX A;  3HSB A;  1YI2 T;  3G71 Q;  1HD3 A;  4M75 A;  1VQM T;  3CD6 A;  3MCA B;  3NMZ C;  1G3S A;  1AZG B;  4M75 C;  3JB9 D;  2RHI A;  3MJX A;  2P4R A;  3SDZ A;  4NL3 A;  2JS0 A;  1WJQ A;  3EFO B;  3UDC A;  3PVL A;  2AK5 A;  2CZ0 B;  4RKU E;  2QDY B;  3SEM A;  1UB4 A;  4N4H A;  3EHR A;  2LQK A;  4J9F A;  5GAN j;  1SHG A;  2YWW A;  1PM3 A;  1RAC B;  1VYU A;  4PNO A;  2J6F A;  3CD6 Q;  3JB9 H;  3EGX A;  2K3B A;  4LDU A;  2M0O A;  4M7A D;  1KD1 U;  2X3X D;  2YXY A;  5GMK l;  4M7A B;  1WFW A;  3QZ5 B;  3PMT A;  1Y57 A;  4C5G A;  1HYO A;  1NJI R;  1K73 C;  1M5Q 1;  4ZTF A;  3OYB A;  4IIM A;  4XTX A;  3L2R A;  3S3M A;  1RL2 A;  5IHI A;  3KBG A;  4QQG A;  1BCO A;  4M78 A;  3OYN A;  2HCK A;  3JB9 I;  1OEB A;  4OGC A;  2Y4X A;  1Q7Y U;  4M78 C;  1B3Q A;  3M55 A;  4ME7 A;  4JRI A;  2DD5 A;  3LX7 A;  1XOV A;  5GAO r;  4FT4 A;  2XDP A;  4FYX B;  1Z9Q A;  1QW1 A;  1YIJ T;  2F2V A;  3RKW A;  1GCP A;  2V1Q A;  3RER A;  5EC7 A;  1H64 1;  2J6K A;  3CXC P;  3UA6 A;  2KRS A;  2DA9 A;  3A8M B;  4Z88 A;  4BUG A;  1KQS S;  1RAD B;  1KK7 A;  1Y71 A;  2VXF A;  1YNZ A;  3C94 A;  2MPX C;  3C95 A;  2KR3 A;  2NUT A;  1N8R R;  4J9G A;  3A8O B;  2RI5 A;  2K5L A;  1KFZ A;  2DPP B;  2ZAE A;  2JS2 A;  2MCN A;  1GXI E;  3JCM f;  2KGT A;  1CSK A;  2CSI A;  2ZPF B;  5GAM e;  1KJW A;  4D8K A;  1X2K A;  5GAN 7;  1K8A U;  4JS5 A;  1T3S A;  4HCK A;  3OB9 A;  3OYM A;  2YRD A;  5LJ5 d;  3L2Q A;  2LT4 A;  3HL8 A;  4Y91 A;  3L2U A;  2E3H A;  1TUD A;  1UJ0 A;  3E1S A;  4M7D E;  3QII A;  2V26 A;  2J05 A;  1LPL A;  1X6G A;  3QZ9 B;  3TSZ A;  3X20 B;  3CCE A;  1U1S A;  5EG2 A;  2YUP A;  3JRZ A;  5J3B A;  2J7I A;  2QI2 A;  4A4H A;  3ASK A;  3EG2 A;  2EWN A;  5FW9 A;  2M0Y A;  1Q82 C;  4C8Q E;  3VS6 A;  5DY9 A;  3SWN B;  2K3X A;  4ELY C;  4XTU A;  5FU7 B;  3RMQ A;  1K0S A;  1UEC A;  1GCQ A;  3CCE Q;  3LWI A;  3JCM P;  2D6F A;  2OAU A;  1GCQ C;  3JAM E;  1B7T A;  3EG1 A;  1NJI U;  2DER A;  1AD5 A;  1ZA2 B;  2F69 A;  1I1J A;  3QWY A;  2XIC A;  1M1G A;  4M7D F;  3OYI A;  2LRQ A;  4C5E A;  5KYW A;  1YIT A;  1QWF A;  4ZN1 A;  3A98 A;  5LJ3 f;  1CKB A;  3QJ6 A;  4C8Q F;  1V29 B;  1PKS A;  3VS3 A;  2HEQ A;  1XQH A;  1AVZ C;  2JOY A;  3V7R A;  4MML A;  3AHU A;  1UJY A;  1ZX6 A;  2PZ1 A;  2FPD A;  5DLQ E;  3CCV T;  1SRM A;  3X25 B;  5GAO p;  2ROT A;  3G7Z A;  2HQH A;  1YIT Q;  5GAO n;  3CCM A;  1EZZ B;  2YHT A;  1VQ5 A;  1X6O A;  1M1K C;  2GF7 A;  1D1A A;  1E6H A;  4X9C A;  4GY5 A;  2JMA A;  2DZ9 A;  1VQK T;  2DL4 A;  2R57 A;  2COZ A;  2C0I A;  1M1F A;  2EAY A;  3CCM Q;  3N5B B;  4LNP A;  3V8J A;  4ORZ A;  5IH2 A;  1VQ5 Q;  1G3W A;  2BKD N;  2VYT A;  5KH6 A;  1YI2 A;  4HT8 A;  5FU6 C;  2RHY A;  1X01 A;  1IRX A;  1BI2 A;  5IXF A;  4RTW A;  3UAT A;  4KH1 B;  1NG2 A;  2DJQ A;  4OML A;  4JLG A;  1K0X A;  5D6W A;  4AFS C;  2RI2 A;  2KRM A;  3G6E A;  4ZNX A;  3MEV A;  1VIE A;  4L5G A;  1W4S A;  5CK9 A;  1PKT A;  2KNB B;  4OP0 A;  1R0B G;  4EMK A;  1YI2 Q;  5IHN A;  4EMK C;  5J39 A;  2YUO A;  2EJF A;  1SF9 A;  4BB7 A;  2F5T X;  2O9V A;  3LW5 E;  4HCZ A;  1M90 C;  3G6E Q;  2ZGW A;  2ZPH B;  4JPB W;  4C92 D;  1W2B P;  2FEI A;  1W1F A;  4M75 E;  2AKK A;  2EIF A;  2Z0W A;  5GAN g;  4C92 B;  2L89 A;  3VRZ A;  4PJO D;  5HY6 A;  1YCS B;  4JZ3 A;  5LJ5 e;  2MF2 A;  4M77 A;  4IUT A;  4OMM A;  1YIJ A;  1OU9 A;  2HL3 A;  1EFN A;  4M77 C;  4PJO B;  1GFD A;  1K9A A;  2KRO A;  1Q81 R;  2KBT A;  1WHG A;  3TRE A;  2LTO A;  5HKC A;  4A53 A;  2DKG A;  2JNG A;  3DLM A;  2IG0 A;  3QYH B;  3CXC S;  2RHX A;  3KUF A;  5KCO A;  4BY6 B;  1YIJ Q;  3DB4 A;  1TSF A;  1ZSZ B;  3MEU A;  4RTV A;  1A0N B;  2RJE A;  4B9X A;  4E7S A;  3FDR A;  4M75 F;  1C1A A;  4JJC A;  2NLU A;  2XDD A;  1IHW A;  3OYE A;  4OB3 B;  2KXD A;  4M78 E;  3CMA T;  2RQT A;  4C8Q D;  4WF2 A;  2KE9 A;  3OS1 A;  1ZBJ A;  4QT7 A;  3CCU T;  2L3P A;  3ME9 A;  2PNI A;  1JEG A;  1TG0 A;  2HQX A;  4ZGJ B;  3EFS A;  4C8Q B;  2RHZ A;  1AHJ B;  5LJ5 f;  2KMT A;  5CQX A;  1QCN A;  1ZBX A;  3DKM A;  1AZE A;  1JJ2 P;  3A8L B;  4KGV B;  2I2L A;  1JO8 A;  2OJ2 A;  3MPU B;  4J6X A;  1KC8 C;  1Q7Y C;  2QQA A;  2JM8 A;  2AZV A;  4C5I A;  2YUQ A;  3M0U A;  2JXB A;  4M7D A;  2ZPB B;  3RKY A;  1TUG B;  1Q86 R;  2DEQ A;  1QCO A;  4M7D C;  2DRM A;  4MDX A;  1G3Y A;  1B34 A;  6AT1 B;  2PVG B;  4XU1 A;  4M78 F;  4PFZ A;  2M16 A;  4OB0 B;  5HK3 A;  4OMF B;  2QTV A;  4VUB A;  2BE7 D;  1IZ6 A;  4LDW A;  3RES A;  2LC4 A;  3EH2 A;  2HNI A;  2QQS A;  2L3R A;  1FMW A;  3LLR A;  4D6W A;  1DJ7 B;  3OYJ A;  2I0N A;  3H0I A;  1K8A C;  1I07 A;  2EJG A;  2KEA A;  3LWH A;  4CC2 A;  5GAO q;  1X75 C;  2RJF A;  1R0C B;  5KYY A;  5CKF A;  3QBY A;  4E7K A;  1Q81 U;  3I55 T;  3QDR B;  2DBM A;  2CGH A;  4CC4 B;  2OTJ T;  2LVM A;  3CCV A;  3CPW S;  4DBQ A;  1QVF P;  1ARK A;  2X3W D;  2E12 A;  5FWC A;  1OV3 A;  2QGG A;  2KT8 A;  5KYU A;  2K6D A;  2DRK A;  3UWN A;  2KAF A;  2KXC A;  5GAN 4;  3PIO A;  2RO0 A;  1D09 B;  4J6W A;  1VQK A;  2QTX A;  2QDL A;  3SD4 A;  4MZT A;  3I5R A;  3CCV Q;  3GIB A;  1JRI A;  4OMQ A;  4XU0 A;  2KYB A;  4J7F A;  2L5Q A;  2FB7 A;  3OA6 A;  1OYX A;  4KGX B;  2JTM A;  2FPF A;  4II1 A;  1Y07 A;  5C6S A;  4DOV A;  1NJI C;  4PKC C;  3NPF A;  2QQR A;  5LJ3 d;  2CP0 A;  4C0G A;  4DOW A;  1OU8 A;  1VQK Q;  1OZ3 A;  1YWP A;  1X69 A;  5FRO A;  1MMN A;  3VUZ A;  2DK3 A;  3VV0 A;  5LJ3 j;  3QHS A;  3HPW A;  2NUP A;  3PFS A;  4BI8 B;  2DVE A;  4C0D C;  4M75 D;  5D6Y A;  4C0Z A;  1PG5 B;  2VWF A;  1Q86 U;  3JV3 A;  3JCM W;  1VQ9 T;  3PMI A;  4IUV A;  2VUB A;  4LE9 A;  2ROL A;  1D0Y A;  5FWB A;  4M75 B;  1OOT A;  2M1H A;  2DE0 X;  4IUR A;  3CME T;  2XID A;  2RM4 A;  2CYZ B;  2FHD A;  2FVU A;  5KYN A;  2ATC B;  4N0A A;  4RG2 A;  1NEB A;  2J06 A;  4N0A C;  3CCL T;  3WVE B;  1IXD A;  2LJ0 A;  5GAN 2;  3CCS T;  2D8J A;  2JUF A;  2DYB A;  3PVQ A;  2ENM A;  2YT6 A;  1W2B S;  4IIO A;  5I21 A;  1QKX A;  3EGX B;  3VKI A;  2EYY A;  2JM9 A;  3P8B B;  4QVZ A;  2BZY A;  4JUV A;  1KHI A;  4E7J A;  1UGP B;  2XKO C;  1QKW A;  2RMO A;  2MWP A;  3I9Q A;  2BE9 B;  2GTO A;  1WXT A;  1SPK A;  4MDW A;  4M78 D;  2EJ9 A;  2R5A A;  3MP8 A;  2KDS A;  1ZSG A;  1VA7 A;  2O4X A;  4HVV A;  3VS5 A;  3A8G B;  1K76 A;  3TCJ A;  4HA8 A;  3BFM A;  4M78 B;  4B6M A;  4C0F A;  1FXX A;  1YJN T;  5IN1 A;  1KQS A;  3CQT A;  5IT9 E;  1QLY A;  5KYX B;  4X34 A;  3OMC A;  1M9S A;  3JCM e;  2A37 A;  1BI0 A;  1OX9 A;  4EIK A;  3OYH A;  3CCU A;  2B8A A;  1W70 A;  3D7S B;  4M77 E;  4F7U G;  1Y96 B;  2NUT B;  3M58 A;  3S6W A;  2ZCF B;  2ESW A;  1Y7X A;  4QQD A;  3R6N A;  4KBM B;  3CCR T;  2XI9 A;  4RTZ A;  4E7I A;  2OX7 A;  1VIF A;  4ATO A;  5IAY A;  2HD0 A;  3PNW C;  3CCU Q;  3GF5 A;  2DL3 A;  4FIB A;  3EAE A;  1BI3 A;  2LQN A;  3MEA A;  3GOX A;  5DLO A;  2R5M A;  1WXB A;  1G2B A;  3V7C A;  4LD9 K;  2LT1 A;  2XHC A;  2LCS A;  1YN8 A;  1KQ1 A;  3OW2 P;  1U5S A;  1TXQ A;  1I5L A;  2F1L A;  1ZUU A;  3KFV A;  5M9O A;  2L8D A;  3J81 E;  4M77 F;  1MMD A;  4RTY A;  5FRN A;  1PD0 A;  3JB9 G;  4O6J A;  2RK2 A;  1NBE B;  4DQ2 A;  2X4Y A;  4N4I A;  4MZP A;  3A8H B;  1K4U S;  2P0P A;  4LD6 A;  4FM4 B;  3I55 A;  2YLC A;  2QXF A;  1OX8 A;  2OTJ A;  2CP6 A;  5LJ3 e;  4BE2 A;  2X51 A;  1C0M A;  2HKQ B;  3IQL A;  4M7A G;  2PTK A;  4AFQ C;  3ZBD A;  4IKF A;  3JCM X;  5LJ5 j;  2QQ9 A;  1YJW A;  3CCJ T;  4L59 A;  5KYW B;  2GQV A;  3URG A;  1QVF S;  2FL7 A;  3I55 Q;  3TU4 K;  3QWX X;  2OTJ Q;  2HQE A;  2VB6 A;  2DZC A;  3OYG A;  3H9N A;  1TUC A;  2Y4Y A;  3A5Z B;  3CBO A;  3LGF A;  1WIE A;  3MEW A;  5LL6 S;  4J5Y A;  2QEX T;  1YJW Q;  1M8M A;  1M8V A;  1QVG S;  1VQL T;  5CQY A;  1BIA A;  3E19 A;  3RUX A;  1NLO C;  4E7H A;  4E47 A;  3OBY A;  3QDF A;  2K5I A;  1BKB A;  1O75 A;  1S72 T;  1UTI A;  2K57 A;  1FX7 A;  2DAQ A;  4NL2 A;  3RNJ A;  1JU5 C;  2Y90 A;  1VQ8 T;  3J7A F;  2DX1 A;  2DL7 A;  1K73 R;  1I8F A;  2DXU A;  2DL5 A;  2HKN A;  1VQ9 A;  5FU6 B;  5IXB A;  1LCK A;  1RUW A;  2XDB A;  4C5H A;  5GAM g;  3CME A;  2F2X A;  3H8Z A;  1T0H A;  5KCH A;  2PU9 B;  3SWN A;  1VQ4 T;  1N8R U;  3SWN C;  3CCL A;  2EVR A;  1KIK A;  2HAX A;  1XJW B;  3NHN A;  5GAM h;  1WZO A;  3A1P A;  3CCS A;  3EH1 A;  1HK9 A;  1VQ9 Q;  2EYX A;  2OAW A;  3JSC A;  4J9I A;  3ZL7 C;  1I4K 1;  1D0Z A;  2QQB A;  2DTO A;  5GAN 6;  1UE9 A;  2DTH A;  3CCQ T;  2CZ7 B;  1OPL A;  3HP9 A;  1MUZ A;  3CME Q;  1AEY A;  5J26 A;  2E4H A;  4F14 A;  4FYW B;  1VQN T;  3HHT B;  2L0A A;  2GGR A;  5A2Q E;  2F2W A;  2K4Y A;  3SHW A;  3CCL Q;  5GJW B;  4R55 A;  2X35 A;  4DBR A;  4XQ3 A;  1VQM A;  5I22 A;  2QK0 A;  3NTH A;  3CCS Q;  3H0F A;  5GAO m;  2HMA A;  1V76 A;  2K79 A;  2A0F B;  1KHC A;  1N6A A;  1UEB A;  1YJ9 T;  4EPC A;  2BZX A;  4AG1 C;  4BD3 A;  2CT4 A;  4OGE A;  4M77 D;  2DIG A;  5KE3 A;  1OQK A;  4KH0 B;  2OI3 A;  1BBZ A;  3EG9 A;  3TEE A;  1I0C A;  1U06 A;  4M77 B;  5L23 A;  1VQM Q;  2AHJ B;  2LDM A;  5CKB A;  2V8I A;  1PSE A;  1TS9 A;  3M4Y A;  2ZPE B;  3R6O A;  4HT9 A;  3U23 A;  3DLL A;  1T3L A;  1IHV A;  2K9G A;  1Q82 R;  3E9G A;  4UC4 A;  5I2M A;  4XTZ A;  1N9R A;  1ABO A;  1OUL A;  2DXC A;  1WHK A;  5IHK A;  3M9Q A;  1AWJ A;  3CCR A;  4OB1 B;  4LDV A;  1WI7 A;  4DEX A;  2A28 A;  2D9T A;  2XD0 A;  3EFR A;  3HRU A;  3CC7 T;  2PUK B;  1WQ7 A;  2ED1 A;  5GMK e;  1IB8 A;  2KK4 A;  4WCI A;  2EQJ A;  1M2V B;  2D8H A;  5GAN h;  2CKK A;  3VS0 A;  3LH0 A;  1NYF A;  2O88 A;  1D3B B;  1VYV A;  3CC2 T;  5D6X A;  4Z8A A;  3CCR Q;  1SSH A;  2A36 A;  2JTE A;  3KXT A;  2YRC A;  4HKE A;  1IGQ A;  3ZFJ A;  2QG9 B;  1PCX A;  1WNL A;  4EMG A;  1O9S A;  2EQU A;  2GTJ A;  3HKS A;  3X28 B;  3DB3 A;  1YHQ T;  3OS2 A;  2E1H A;  3VS4 A;  1LVK A;  4M7D D;  3EGD A;  2VAS A;  1PRM C;  2C0O A;  2FRW A;  3OW2 S;  5CCA A;  3NGP A;  3GNG A;  3P8H A;  2SEM A;  4QQ6 A;  1MV3 A;  3BY7 A;  1BB9 A;  4M7D B;  3EHQ A;  2EQI A;  4LDY A;  4O5V A;  2K7A A;  1G83 A;  3PTA A;  2CDT A;  2RD1 A;  1KD1 C;  1M1K R;  4DEY A;  2COY A;  2ABL A;  1B34 B;  2X4W A;  4KUI A;  4EMH A;  2WAC A;  4FU6 A;  2FZC B;  2VXE A;  3C4S A;  2QGF B;  4A4G A;  4EDU A;  2PQW A;  2DF6 A;  2LJ3 A;  3CCJ A;  3M0Q A;  3BW1 A;  5HK0 A;  4ZGE B;  4PJO A;  4OVA A;  1SHF A;  4C92 G;  1T0J A;  3OS0 A;  4J9C A;  2YRV A;  3CPW A;  2PUO B;  2CP7 A;  2KVQ G;  4DA4 A;  1PNJ A;  5KYY B;  1VQO T;  4PJO G;  1PWT A;  2DVJ A;  1HSQ A;  1VQL A;  1RLQ C;  2RF0 A;  3FJP A;  3VYG A;  1M2O A;  5CIU A;  4R0K A;  2KI7 A;  3TSW A;  5LJ5 g;  2PVD B;  4TVR A;  1JXM A;  3PGG A;  1S72 A;  4BDZ A;  1FYN A;  2EQM A;  3LH5 A;  1M27 C;  2LQ8 A;  2RN8 A;  2GNC A;  2HBP A;  1H8K A;  1YP5 A;  2EPD A;  1N27 A;  5ECA A;  1VQ8 A;  1VQL Q;  3V8K A;  4FW1 A;  1I5O B;  2E64 A;  2JJ9 A;  1NZ9 A;  1UGR B;  1WX6 A;  2KT1 A;  1X43 A;  1S72 Q;  2P0K A;  2EYQ A;  1RLP C;  2A7Y A;  2CP5 A;  4C8Q G;  1YWO A;  4E7Z A;  4RCB A;  5CKE A;  4M7A F;  2ZPG B;  4HVW A;  2HZY A;  1OPK A;  1VQ8 Q;  3QO3 A;  2E6Z A;  4CC7 A;  2P84 A;  5CKD A;  4BAC A;  2CH4 W;  2EQK A;  1QP3 A;  4C0D B;  3UF4 A;  2NUP B;  2MIO A;  3CCQ A;  1M3C A;  1RAG B;  1K9M R;  3C0C A;  3THK A;  1VQN A;  1M1K U;  4LN2 A;  1Q95 G;  1VYT A;  2DNU A;  3QXE B;  3M53 A;  5A0L A;  3GLX A;  3G1J A;  4XAX B;  2EGE A;  4QVD A;  1UHC A;  3O8V A;  1MND A;  1WJR A;  2RJD A;  1MNE A;  2A08 A;  3QUI A;  2DBK A;  7AT1 B;  5KE2 A;  2IIM A;  1YJ9 A;  1W2B A;  4JRP A;  5GAM d;  2FPE A;  2DJZ A;  3CCQ Q;  2G6F X;  1HJD A;  3EGU A;  1ZLM A;  4XU2 A;  1VQN Q;  1Y0M A;  2CP3 A;  2GCX A;  3WVD B;  1ZHI A;  3NTI A;  4RUG A;  3M0R A;  4R56 A;  2CUD A;  1LNX A;  5I2S A;  1YJ9 Q;  3BDU A;  4CRI A;  3CC4 T;  4A4K A;  3MHX A;  2XMF A;  2IVW A;  2E5K A;  1RAF B;  5GAN 8;  4JZ4 A;  1KC8 R;  1Q7Y R;  1N8R C;  1H3Z A;  4J8O A;  2KRN A;  2O4X B;  2O01 E;  1JQQ A;  4PJM A;  2O2O A;  2DYI A;  4KGZ B;  1SRL A;  3CC7 A;  4J9H A;  2DET A;  2DD4 A;  4JLI A;  1ZQ1 A;  1BK2 A;  2DTI A;  4NOY A;  2V8K A;  2DO3 A;  2BUD A;  8ATC B;  4GBQ A;  1NYG A;  3CC2 A;  1UFF A;  2CSQ A;  2GFU A;  4LXC A;  3RBB B;  5CO7 A;  3CEY A;  3LYI A;  4OMP A;  4FYV B;  1WA7 A;  1UUE A;  3WXM B;  3CC7 Q;  2NWM A;  4DBF A;  1IRE B;  1R77 A;  1JBM A;  3EG0 A;  1G5V A;  3M59 A;  1R8O B;  1UGV A;  3JCM V;  1YHQ A;  2FZK B;  1QVP A;  3VRY A;  3H0H A;  2E41 A;  2KQW A;  3PE0 A;  1XNI A;  3CC2 Q;  1C6V X;  3GPL A;  1FWZ A;  5GAN d;  4F17 A;  4F7U A;  1K9M U;  2RK1 A;  1SG5 A;  3CMA A;  1MMG A;  2B86 A;  3JCM J;  2V1R A;  3G6E T;  2RH2 A;  4M75 G;  4OMO A;  1YHQ Q;  3PT9 A;  4A4E A;  1VUB A;  2JTF A;  2DEU A;  5I11 A;  4OMN A;  1GBQ A;  1LJO A;  4KUD K;  4J83 A;  4AG2 C;  4RG8 A;  1M3A A;  1Z9Z A;  4LUE A;  3CMA Q;  1PSF A;  4DBH A;  1WHJ A;  1RAA B;  2L3Q A;  5DM7 R;  1BYM A;  4KT0 E;  2C06 A;  4JDS A;  1VOM A;  3VUB A;  4ZGD B;  3C12 A;  4PFO A;  2EGC A;  3GNF B;  3M4G A;  3OQ5 A;  3EFO A;  4IUU A;  4B9W A;  3I56 T;  1VQO A;  1JJ2 S;  3T9N A;  2LNH B;  1EX4 A;  1PC0 A;  1H3H A;  1U8R A;  4CC3 A;  1KC8 U;  2G3R A;  1QVF A;  4PLL A;  2MMP A;  4A63 B;  3M57 A;  2CP2 A;  5KYX A;  4AMC A;  4ANJ A;  4C92 E;  1U3O A;  2CZ6 B;  4E2F B;  2ZPI B;  3QKJ A;  4M78 G;  2LP5 A;  1VQP T;  1VQO Q;  1RI9 A;  2LX7 A;  3OYL A;  1U1T A;  1VQ7 T;  2VV5 A;  4M7A A;  1LOJ A;  1QVG A;  2LCL A;  1Y96 A;  4M7A C;  2V8J A;  2M51 A;  4PJO E;  3OYA A;  3CPF A;  3RMS A;  2M9U A;  2K5F A;  3I5S A;  4YTL A;  1I81 A;  1BU1 A;  3G4S T;  3S3O A;  1WLP B;  2BZ8 A;  5GAO l;  1RAB B;  5GMK j;  1AWW A;  1UHF A;  3INZ A;  2JVV A;  2E3I A;  3JCM g;  1XTD A;  4AFU C;  2CZ1 B;  2DL8 A;  1HXD A;  2IPO B;  4JRQ A;  2QA4 T;  4A54 A;  1AT1 B;  2L3S A;  2K2M A;  3TVT A;  1WGS A;  2RQU A;  4C92 F;  2AT1 B;  2W0Z A;  2DIQ A;  2EYZ A;  1N9S A;  3H6Z A;  3JCM h;  3SFM A;  5A0D A;  4M4Z A;  3L42 A;  2E6N A;  2X4X A;  3X24 B;  4ESR A;  1NPR A;  4BI3 A;  4PJO F;  4IUP A;  2K2V A;  2QAZ A;  1TU0 B;  1TH7 A;  1QMC A;  2KY9 A;  4HCC A;  2MWO A;  2K3Y A;  3L2V A;  1TOV A;  2DXB A;  2A3L A;  2W10 A;  5CKH A;  1RAI B;  2WSE E;  4GLK A;  5GMK m;  4Z02 A;  2RB6 A;  2GQI A;  1M3B A;  1EIF A;  5GAM f;  4JJD A;  4FSS A;  3UPU A;  4JJN K;  1X27 A;  2HL5 C;  3HRS A;  1ZA1 B;  2SRC A;  3VJP A;  4PJJ A;  1Q81 C;  2YLB A;  3CC4 A;  1E7O A;  2DM1 A;  3FB9 A;  3OYY A;  2RA2 A;  4P5N A;  4FL6 A;  1WYX A;  3JCM b;  2DFU A;  3CPW P;  4WTO B;  5AYF A;  2RHU A;  4FCY A;  4K11 A;  4HCB A;  5FU7 C;  1WHH A;  1NPP A;  2MAM A;  2L2P A;  5GAN e;  1S1N A;  1UGQ B;  1E6G A;  5LJ3 g;  4EMK B;  4RMO A;  1FMV A;  1IGU A;  2LCC A;  3EG9 B;  4LDX A;  4J6Y A;  2JMC A;  3CC4 Q;  1PD1 A;  2E65 A;  3M54 A;  2E5Q A;  3CBP A;  2D0N A;  2YDL A;  1YCY A;  2EGA A;  5LJ3 h;  4RTU A;  2MYS A;  3PIP A;  1OI1 A;  1MMA A;  3GP8 A;  1GL5 A;  4X9D A;  2D1X A;  1NE8 A;  2VGN A;  3MP6 A;  4HXJ A;  2EYW A;  3MKD A;  1M4Z A;  2KYM A;  2WSF E;  4QKU A;  2ED0 A;  5AT1 B;  1YJN A;  1GFC A;  1X6B A;  4J9E A;  1NM7 A;  2J6O A;  3P8D A;  1M30 A;  4L6V 5;  2O9S A;  1FMK A;  4ELZ C;  2HDA A;  4FYY B;  1Q86 C;  5FRM A;  2AKL A;  4A4F A;  1KG1 A;  1SKU B;  3CXC A;  2LJ1 A;  5GAN f;  5GMK i;  1VQ6 T;  3UT1 A;  1YJN Q;  3OW2 A;  2VC8 A;  3FLG A;  1BIB A;  4X1V A;  4F04 B;  2BTT A;  2M02 A;  3I35 A;  2JT4 A;  3L2Z A;  3EGD B;  1PRL C;  3MO8 A;  1J3T A;  5CAI A;  3JCM c;  2CH4 A;  1RAE B;  4GLM A;  3QSU A;  3M5A A;  1K73 U;  1GBR A;  1RAH B;  3TQ7 P;  3RKX A;  2R58 A;  3I56 A;  4PK4 A;  2OTL T;  4OF1 A;  3JB9 J;  3G71 T;  2MOX A;  2RJC A;  4F7U E;  4LUD A;  2LX9 A;  1ZUY A;  2AZS A;  2EW3 A;  4AT1 B;  2EBP A;  3RR6 A;  4RCC A;  1NLP C;  2DMO A;  2FZG B;  3E9F A;  4D8D A;  1F1B B;  3HFO A;  4ZN3 A;  1P92 A;  3VS1 A;  4AFZ C;  3I56 Q;  1VQP A;  1GRI A;  1VQ7 A;  2CUB A;  4Y28 E;  3CD6 T;  1WPY A;  1V1C A;  3RDV A;  4XTW A;  1NEG A;  2HSE B;  3EG3 A;  3H41 A;  4M77 G;  1K9M C;  3HRT A;  2NYS A;  4XTV A;  4JS4 A;  1AOJ A;  3G4S A;  2O31 A;  5D7U A;  4J7I A;  3REB B;  4C92 A;  3MET A;  8AT1 B;  4C92 C;  1VQP Q;  1D0X A;  1SSF A;  1WQW A;  3V8L A;  1VQ7 Q;  1H92 A;  4F7U F;  3AT1 B;  3OBW A;  2LZ6 B;  1M2V A;  3VS7 A;  1D3B A;  4N4G A;  4XTY A;  3NTK A;  4BDY A;  3QJY A;  3VS2 A;  2QA4 A;  1TTH B;  4PJO C;  3OS5 A;  2VGM A;  3X26 B;  2XK0 A;  4J9D A;  2KSS A;  3JCM Q;  4XU3 A;  3G4S Q;  1MHN A;  1BI1 A;  1AWX A;  2BIV A;  1MGQ A;  2LQW A;  5FLX E;  1AWO A;  1G3T A;  2QEX A;  4M7A E;  2EKO A;  1Q82 U;  1ABQ A;  3CCJ Q;  1WXU A;  1ZSZ A;  4BI4 A;  1D1B A;  1KQS P;  4BY6 C;  1OZ2 A;  2XU8 A;  1ZSZ C;  2QA4 Q;  5KYU B;  3OYF A;  1X2Q A;  5CVI A;  3VYH B;  3GBQ A;  2HBW A;  2JZ2 A;  1N5Z A;  2E70 A;  1M90 R;  4JJB A;  5GMK h;  3JCM d;  1B07 A;  5A0G A;  5LJ5 h;  2FG0 A;  3JB9 F;  4QVC A;  1JXO A;  3M0T A;  2EKH A;  2QEX Q;  1CKA A;  3LGL A;  1QWE A;  4C8Q A;  2CS7 A;  4M7D G;  4FSX A;  4C8Q C;  3QYG B;  3OY9 A;  2F5K A;  3ZEH A;  3REA B;  4PFP A;  3RIR A;  4BE1 A;  2FRY A;  2GFA A;  2HSP A;  2RQR A;  2RI3 A;  2RNA A;  1IO6 A;  3UA7 A;  4KUL A;  1VQ4 A;  1PHT A;  4PLI A;  4PJN A;  2EFI A;  3FIF A;  2COW A;  1D1C A;  4KRT A;  4PJL A;  2RPN A;  2DLP A;  4IUQ A;  3SB2 A;  4Q5W A;  2CT3 A;  3FJ5 A;  2H3J A;  4RTT A;  3F70 A;  3Q1J A;  5HCK A;  3ULR B;  4Y92 A;  3HTR A;  2XG8 D;  1QP2 A;  1WHL A;  2LNV A;  4QW2 A;  3CCE T;  1VQ4 Q;  3CBM A;  1KQ2 A;  4Z89 A;  5C0M A;  1YJW T;  4MMK A;  2X9H A;  3L2W A;  9ATC B;  2RQW A;  2FYK A;  1TWB A;  3NFC A;  2E10 A;  2JN0 A;  3QPH A;  1QVG P;  4F16 A;  3M56 A;  3HFN A;  4FT2 A;  5L8R E;  1ZUK A;  1BCM A;  2NUZ A;  1RI0 A;  1JB0 E;  1KD1 R;  3QG1 A;  2ZZD A;  2QAS A;  3BE3 A;  2DIL A;  1G8X A;  2FO0 A;  4ZTJ A;  1UDL A;  3M0P A;  1YBY A;  2X4J A;  1KSW A;  5GAM j;  1MV0 B;  1UGS B;  2JW4 A;  3OYC A;  2LMJ A;  4PL6 A;  5GJV B;  3O5Z A;  3S3N A;  4MZM A;  2PVO B;  1K1Z A;  2P4T A;  4J9B A;  3E2U A;  5GAN 3;  3FRN A;  1YIT T;  1VQ6 A;  1QCF A;  2AIR B;  2D0Q B;  3FC3 A;  2VKN A;  1UG1 A;  1WJS A;  2YSQ A;  1ACM B;  1W6X A;  2VVK A;  3M0S A;  1M90 U;  3OYK A;  4HVU A;  3OSS C;  3FEO A;  3ER0 A;  4F7U B;  2CRE A;  2RQV A;  1WHM A;  2H3E B;  2YUN A;  1SEM A;  1VQ6 Q;  3CCM T;  4XK8 E;  1YFN A;  2WSC E;  1VQ5 T;  3V7S A;  2OTL A;  4OB2 B;  3G71 A;  2H8H A;  3OSV A;  4E6R A;  5GAN 5;  3MP1 A;  2P0Q A;  2ECZ A;  1QQJ A;  2C0T A;  4E7L A; 
#chains in the Genus database with same CATH homology
 2L3S A;  2K2M A;  3TVT A;  3U23 A;  2RQU A;  1T3L A;  2W0Z A;  2EYZ A;  2K9G A;  1ABO A;  4M4Z A;  1WDX A;  2I0N A;  2GBQ A;  3H0I A;  5IHK A;  4RTX A;  1I07 A;  1AWJ A;  4ESR A;  1HD3 A;  2KEA A;  4CC2 A;  3NMZ C;  1WI7 A;  4DEX A;  2A28 A;  1AZG B;  2P4R A;  2JS0 A;  3PVL A;  2AK5 A;  2ED1 A;  2DBM A;  4CC4 B;  3SEM A;  4WCI A;  3EHR A;  1ARK A;  2W10 A;  4J9F A;  2D8H A;  2X3W D;  3VS0 A;  1NYF A;  1SHG A;  5FWC A;  2O88 A;  1VYV A;  1VYU A;  1OV3 A;  2GQI A;  2KT8 A;  4Z8A A;  1M3B A;  2J6F A;  2K6D A;  2DRK A;  2K3B A;  4JJD A;  4FSS A;  1SSH A;  2KXC A;  1X27 A;  2A36 A;  2JTE A;  2X3X D;  2SRC A;  2QDL A;  2GTJ A;  3I5R A;  1WFW A;  1E7O A;  2DM1 A;  1Y57 A;  4OMQ A;  1WYX A;  3VS4 A;  2KYB A;  1PRM C;  2C0O A;  2FRW A;  4IIM A;  3NGP A;  2FPF A;  2SEM A;  5IHI A;  4K11 A;  1MV3 A;  1BB9 A;  2L2P A;  3EHQ A;  2EQI A;  2K7A A;  2HCK A;  3NPF A;  1OEB A;  1G83 A;  1S1N A;  2CDT A;  1E6G A;  1B3Q A;  4DEY A;  2ABL A;  1XOV A;  1YWP A;  1X69 A;  2JMC A;  1Z9Q A;  2F2V A;  1GCP A;  2V1Q A;  2D0N A;  5EC7 A;  2J6K A;  2YDL A;  3UA6 A;  2KRS A;  2DA9 A;  4Z88 A;  2EGA A;  2DF6 A;  2LJ3 A;  4RTU A;  1YNZ A;  3M0Q A;  2KR3 A;  2VWF A;  3JV3 A;  1SHF A;  1GL5 A;  4J9G A;  2D1X A;  1T0J A;  4LE9 A;  2ROL A;  1KFZ A;  2JS2 A;  5FWB A;  2MCN A;  1OOT A;  4HXJ A;  4J9C A;  2DE0 X;  2KGT A;  1CSK A;  2EYW A;  2CSI A;  2KYM A;  1PNJ A;  1KJW A;  1NEB A;  4D8K A;  1X2K A;  2ED0 A;  2J06 A;  1GFC A;  1PWT A;  1X6B A;  4J9E A;  1NM7 A;  2DVJ A;  2J6O A;  1HSQ A;  1T3S A;  2LJ0 A;  1M30 A;  1RLQ C;  2RF0 A;  4HCK A;  2D8J A;  2O9S A;  1FMK A;  2HDA A;  2DYB A;  3PVQ A;  4R0K A;  3TSW A;  2ENM A;  2YT6 A;  4IIO A;  2AKL A;  1JXM A;  1QKX A;  1TUD A;  1UJ0 A;  2LJ1 A;  2EYY A;  1FYN A;  2JM9 A;  3TSZ A;  2J05 A;  1X6G A;  3LH5 A;  1M27 C;  2BZY A;  2RN8 A;  2GNC A;  2YUP A;  1H8K A;  1YP5 A;  2J7I A;  2EPD A;  4X1V A;  5ECA A;  3EG2 A;  1QKW A;  2RMO A;  2BTT A;  3I9Q A;  5FW9 A;  2GTO A;  2M0Y A;  3I35 A;  2JT4 A;  3VS6 A;  1WXT A;  1SPK A;  1PRL C;  1J3T A;  1ZSG A;  1VA7 A;  4HVV A;  2CH4 A;  1WX6 A;  3VS5 A;  4GLM A;  1K76 A;  2KT1 A;  1X43 A;  1GBR A;  1K0S A;  1RLP C;  1UEC A;  1GCQ A;  1YWO A;  1GCQ C;  3CQT A;  2MOX A;  4HVW A;  1OPK A;  3EG1 A;  1QLY A;  4CC7 A;  4LUD A;  1AD5 A;  2A37 A;  1ZUY A;  4EIK A;  2CH4 W;  2AZS A;  2EW3 A;  1I1J A;  3QWY A;  2EBP A;  3UF4 A;  1W70 A;  1NLP C;  2DMO A;  2MIO A;  4D8D A;  1M3C A;  1QWF A;  3C0C A;  3A98 A;  3THK A;  3VS1 A;  4LN2 A;  4AFZ C;  2ESW A;  1CKB A;  1GRI A;  1VYT A;  2DNU A;  3R6N A;  2CUB A;  1V1C A;  2EGE A;  1UHC A;  1NEG A;  3H41 A;  3EG3 A;  4RTZ A;  1PKS A;  3VS3 A;  2HEQ A;  1AVZ C;  2A08 A;  2DBK A;  1UJY A;  1ZX6 A;  2IIM A;  2PZ1 A;  2FPD A;  2DL3 A;  2FPE A;  1AOJ A;  1SRM A;  2G6F X;  2ROT A;  3EGU A;  1HJD A;  2LQN A;  2O31 A;  3REB B;  1ZLM A;  1Y0M A;  1WXB A;  1G2B A;  1H92 A;  2LCS A;  1YN8 A;  1E6H A;  2LZ6 B;  2JMA A;  4RUG A;  3VS7 A;  1U5S A;  3M0R A;  2CUD A;  3VS2 A;  3KFV A;  1ZUU A;  2DL4 A;  4J9D A;  2XMF A;  4RTY A;  2C0I A;  2E5K A;  4JZ4 A;  1AWX A;  4LNP A;  4ORZ A;  2LQW A;  5IH2 A;  2KRN A;  1AWO A;  1JQQ A;  1K4U S;  5IXF A;  1ABQ A;  2O2O A;  4RTW A;  3UAT A;  1WXU A;  1NG2 A;  2DJQ A;  1SRL A;  4OML A;  4J9H A;  1K0X A;  4AFS C;  2KRM A;  1BK2 A;  4ZNX A;  1X2Q A;  3IQL A;  2PTK A;  4AFQ C;  3GBQ A;  2HBW A;  4GBQ A;  1NYG A;  1N5Z A;  1PKT A;  2KNB B;  4JJB A;  1UFF A;  2CSQ A;  1B07 A;  5IHN A;  3RBB B;  2FG0 A;  1JXO A;  2YUO A;  2EKH A;  3M0T A;  4OMP A;  1CKA A;  1QWE A;  1WA7 A;  1UUE A;  2O9V A;  2NWM A;  3QWX X;  3REA B;  3EG0 A;  1UGV A;  2FRY A;  2HSP A;  2RQR A;  2RNA A;  1IO6 A;  4JPB W;  3H0H A;  3VRY A;  3PE0 A;  3UA7 A;  2FEI A;  1TUC A;  1PHT A;  1WIE A;  1W1F A;  2AKK A;  1M8M A;  4F17 A;  1NLO C;  4KRT A;  2RPN A;  2B86 A;  2DLP A;  3VRZ A;  2V1R A;  1YCS B;  2CT3 A;  3FJ5 A;  4JZ3 A;  4RTT A;  5HCK A;  1UTI A;  4OMM A;  3ULR B;  4Y92 A;  4OMO A;  1EFN A;  1GFD A;  3RNJ A;  5I11 A;  1K9A A;  4OMN A;  1GBQ A;  1JU5 C;  2KRO A;  4Z89 A;  2KBT A;  2DX1 A;  2RQW A;  2DL7 A;  4AG2 C;  1M3A A;  2DL5 A;  1Z9Z A;  4LUE A;  5IXB A;  4F16 A;  1LCK A;  2L3Q A;  1RUW A;  1ZUK A;  2NUZ A;  2F2X A;  2EGC A;  4RTV A;  1A0N B;  1T0H A;  2DIL A;  2LNH B;  2FO0 A;  1H3H A;  2EVR A;  1UDL A;  1KIK A;  3M0P A;  4JJC A;  1KSW A;  3NHN A;  4CC3 A;  2KXD A;  1MV0 B;  2RQT A;  2JW4 A;  2EYX A;  2OAW A;  2LMJ A;  4J9I A;  5GJV B;  3ZL7 C;  2KE9 A;  3O5Z A;  4A63 B;  1ZBJ A;  4QT7 A;  2L3P A;  1K1Z A;  2PNI A;  1UE9 A;  1JEG A;  4J9B A;  1TG0 A;  1OPL A;  1MUZ A;  1AEY A;  1U3O A;  1QCF A;  4F14 A;  2LP5 A;  2L0A A;  2GGR A;  1RI9 A;  2F2W A;  3SHW A;  2LX7 A;  5GJW B;  2VKN A;  1UG1 A;  2YSQ A;  1AZE A;  5I22 A;  2M51 A;  3H0F A;  1W6X A;  1JO8 A;  2K79 A;  2VVK A;  2OJ2 A;  3M0S A;  4HVU A;  2BZX A;  3I5S A;  2JM8 A;  2AZV A;  1BU1 A;  2CRE A;  2CT4 A;  2RQV A;  2YUQ A;  3M0U A;  4AG1 C;  2JXB A;  1WLP B;  2BZ8 A;  2YUN A;  1SEM A;  2DRM A;  1AWW A;  1UHF A;  2OI3 A;  2H8H A;  1BBZ A;  4E6R A;  1I0C A;  1U06 A;  4AFU C;  5L23 A;  2ECZ A;  2C0T A;  2DL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...