2M0YA

Solution structure of the sh3 domain of dock180
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
b'MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIFPASYIHLKEAIVEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dedicator of cytokinesis protein 1
molecule tags Apoptosis
source organism Mus musculus
publication title Solution structure of the SH3 domain of DOCK180.
pubmed doi rcsb
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2012-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2m0yA00
4HVUA 4RTUA 3I5RA 4FSSA 1ZSGA 2EGAA 2C0IA 3UF4A 4Z89A 1G83A 1NLPC 2JS0A 2OAWA 1JXMA 1WDXA 2DM1A 1E6HA 1WA7A 2A08A 2JT4A 2RQRA 2YUPA 2PNIA 2RQWA 2AKKA 2JXBA 2DNUA 4DEXA 2FRYA 2O88A 2G6FX 3M0TA 3REAB 2JM8A 1K4US 1W70A 3M0UA 5HCKA 2ED0A 4J9EA 1UDLA 3H0FA 2L0AA 1MUZA 2KBTA 2QDLA 2X3WD 1NG2A 4QT7A 1J3TA 1JU5C 4Z8AA 1GBRA 1KSWA 4X1VA 5IH2A 4JJCA 1RLQC 1E6GA 3LH5A 2FEIA 4LE9A 1N5ZA 2YUOA 2YUQA 2F2WA 2YDLA 4AG2C 3EG2A 3VRYA 3PVQA 2L3PA 3R6NA 1UGVA 1TUCA 1AEYA 4RUGA 2DMOA 3CQTA 1ZX6A 2DL5A 4J9FA 3SHWA 2GQIA 3VS0A 1W1FA 1ZUUA 1VYUA 1AWWA 3O5ZA 1K0SA 1GFDA 2KNBB 5FWBA 1SEMA 1Z9ZA 4IIMA 1CKAA 1T3LA 1X69A 4DEYA 2M0YA 2XMFA 1WI7A 2O9SA 1NYFA 2L2PA 3SEMA 1AWOA 1AOJA 1PHTA 4OMLA 1AWJA 4RTTA 4LUEA 4HVWA 1GCPA 2JTEA 4J9DA 2CH4W 5IHNA 2GTOA 2VKNA 3M0RA 2LQNA 1UE9A 1JO8A 2OJ2A 3PE0A 4RTXA 2BZYA 2FRWA 4J9CA 4OMPA 4Z88A 1T0JA 4OMMA 2DL8A 2EKHA 3NGPA 2DRKA 1PWTA 2V1RA 5GJWB 3I35A 4RTWA 3THKA 2DX1A 1YWOA 2LZ6B 2HBWA 4OMOA 2CSQA 2CDTA 2J6FA 2DJQA 1GCQA 1UTIA 3C0CA 2YT6A 2RQVA 2KGTA 2SRCA 5EC7A 1OEBA 2LMJA 2CUDA 1PKSA 1IO6A 1YP5A 1PNJA 1E7OA 1WIEA 2EYXA 2FPEA 1ABQA 4ZNXA 2GTJA 3VS4A 1GL5A 2YSQA 1WXBA 1QWEA 2A36A 2J7IA 3VS2A 5IXBA 2DRMA 5IHKA 2EBPA 1K76A 1MV3A 1AZGB 2DE0X 1NM7A 4M4ZA 1BU1A 1UJ0A 2ESWA 1B07A 1NLOC 2L3SA 1ZUYA 3REBB 2NWMA 1YWPA 2VVKA 3ULRB 1FYNA 2LQWA 2DL3A 1SRLA 2JM9A 3H0HA 4RTYA 4AFSC 3EHRA 3ZL7C 3M0SA 5ECAA 1S1NA 1X6GA 3M0PA 2K2MA 3VS1A 1I07A 3KFVA 2ROTA 4CC4B 4EIKA 2FPDA 1VA7A 3EGUA 2O2OA 2GNCA 2K6DA 2EQIA 2LJ1A 3TSZA 1AZEA 1G2BA 2RN8A 2ED1A 4JJDA 1JXOA 2PZ1A 2DVJA 1OOTA 1T0HA 1ZBJA 1WFWA 4RTZA 2J05A 4AG1C 2H8HA 1H8KA 2HDAA 1VYTA 1K1ZA 3M0QA 2A28A 1X2QA 2O9VA 3PVLA 3H41A 1RUWA 1GFCA 1MV0B 4CC7A 2DL4A 2EYYA 1H3HA 2RF0A 3TSWA 1JQQA 1YNZA 1M3CA 2D0NA 4F17A 2F2VA 1AVZC 1KFZA 1SRMA 1BBZA 2FPFA 2K7AA 1NYGA 2AKLA 1LCKA 2HEQA 4ESRA 2LJ3A 1EFNA 2DLPA 2KT1A 1GBQA 4GBQA 2KYBA 3JV3A 1B3QA 2GBQA 1Y57A 1SHFA 3TVTA 2CH4A 2CT4A 2HCKA 5IXFA 4J9GA 1BK2A 4K11A 4D8KA 2KE9A 3NHNA 2K79A 1FMKA 4HXJA 3H0IA 1PKTA 4AFQC 1A0NB 2EGCA 2DL7A 2V1QA 2VWFA 3VS3A 3NPFA 4A63B 2KYMA 2MCNA 1I0CA 2EPDA 3FJ5A 2B86A 2X3XD 1SHGA 4IIOA 1XOVA 3IQLA 1GRIA 2RPNA 1AD5A 3EG0A 2SEMA 1K9AA 2LJ0A 1M8MA 2D8JA 1X27A 4R0KA 4AFZC 2KEAA 1M30A 4CC3A 3EG3A 2EYZA 2ROLA 1ZLMA 2YUNA 2W0ZA 1NEBA 3RBBB 1ZUKA 3UATA 2AZVA 1U3OA 4OMQA 1QWFA 2E5KA 2CT3A 3QWYA 1SPKA 3VS5A 5I11A 2O31A 2KRMA 2MOXA 1KIKA 1UECA 2CREA 1U06A 1ARKA 3NMZC 1TG0A 1UHCA 2CUBA 3RNJA 2BZ8A 2J6KA 5FW9A 2NUZA 1GCQC 1I1JA 4WCIA 1QKWA 4GLMA 4Y92A 1QLYA 2IIMA 2JS2A 2OI3A 2W10A 2C0TA 2EVRA 4LNPA 2BZXA 1QCFA 1M27C 2EW3A 2ABLA 2LCSA 5FWCA 4J9IA 3VRZA 2KROA 1PRLC 2D1XA 2ENMA 1YCSB 4JZ3A 4J9HA 1V1CA 2MIOA 4D8DA 1W6XA 4LN2A 1WLPB 2JW4A 3GBQA 4KRTA 2PTKA 2RQTA 2DBKA 2JMAA 1WXUA 3EG1A 2J6OA 1AWXA 1M3BA 2KXCA 3A98A 5I22A 2D8HA 2KXDA 2P4RA 5GJVB 3EHQA 1CKBA 1UFFA 1UHFA 3U23A 1ABOA 1RI9A 1PRMC 1HJDA 4JZ4A 2DBMA 1M3AA 1KJWA 4HVVA 4JJBA 2DA9A 1HD3A 1Y0MA 2M51A 1YN8A 2KT8A 3VS7A 2DYBA 4CC2A 2KRSA 4F14A 2A37A 2FO0A 2K9GA 3VS6A 1UG1A 3QWXX 1HSQA 1SSHA 1BB9A 4OMNA 1UJYA 4E6RA 4F16A 2BTTA 4JPBW 2JMCA 2EYWA 2FG0A 2KRNA 1WX6A 2L3QA 2DF6A 5IHIA 2HSPA 1CSKA 2ECZA 4ORZA 4RTVA 1RLPC 2EGEA 1TUDA 1Z9QA 3UA7A 2F2XA 1UUEA 2DILA 2LNHB 4AFUC 2K3BA 2GGRA 4LUDA 1K0XA 1OPKA 1OV3A 1WYXA 1U5SA 2CSIA 2RQUA 1WXTA 1H92A 1T3SA 2LP5A 1X6BA 2C0OA 4HCKA 1NEGA 1QKXA 2RMOA 3I5SA 2AK5A 2I0NA 2KR3A 2RNAA 1VYVA 1X2KA 1X43A 2AZSA 3UA6A 3I9QA 1JEGA 1OPLA 2LX7A 2J06A 4J9BA 5L23A
chains in the Genus database with same CATH superfamily
4HVUA 4M78G 5GMKl 4FSSA 2V8IA 3MEUA 3UF4A 2C0IA 1W2BS 2JS0A 2F5TX 4BD3A 2GFUA 2A08A 3CCET 3OS1A 2L5QA 2RQWA 1Q95G 1YJ9T 1RAHB 1Q7YR 2AKKA 1M2VA 4FL6A 2O88A 3EGXA 2GQVA 3HTRA 1S72A 3DLLA 5GANf 1N8RR 3OS2A 1R77A 5HCKA 5IN1A 3URGA 3H0FA 1MUZA 2KBTA 2QDLA 1M1GA 3JCMW 1J3TA 3E1SA 3PMIA 2FL7A 4X1VA 4M75A 5IH2A 3M58A 1ZA2B 3EAEA 4FYWB 1E6GA 3G71Q 5KYWA 2XIDA 4LE9A 4PKCC 1N5ZA 2I2LA 3OYBA 5GAN7 2YUQA 3CMEQ 2YDLA 4AG2C 2X4WA 3OW2P 3VRYA 3PVQA 1QVPA 1VIEA 3R6NA 5GAMe 3CQTA 4M7AA 1ZX6A 4J6XA 2JVVA 2COYA 3SWNC 3G71A 3CCJA 3SHWA 3VJPA 3OA6A 1ZUUA 3M56A 3X28B 5FWBA 1SEMA 4QVCA 4IIMA 1CKAA 2YXYA 3FDRA 5I21A 2XKOC 1G3TA 3L1AA 1WPYA 1WHGA 2B8AA 3SEMA 4FYYB 2E64A 4OMLA 4RTTA 1HXDA 1LOJA 4PLIA 1WJSA 1TWBA 4PFZA 1ZSZC 4LDUA 1UE9A 2RJFA 2GF7A 3PE0A 2BZYA 4E7SA 1QP3A 4FM4B 4OMPA 4Z88A 4QQGA 5AYFA 3WXMB 3NGPA 5AT1B 3V7RA 2ZPGB 2KY9A 3UDCA 2V1RA 4KT0E 4XTXA 4TVRA 2XHCA 4JLGA 3CPWP 2CSQA 2DJQA 1UTIA 3JCMf 5LJ5e 1XTDA 2RHUA 2M16A 2KGTA 4C8QF 5EC7A 4LDYA 3BDLA 2LMJA 2X4XA 2CUDA 2QEXT 1PKSA 4DBHA 3QHSA 1YP5A 3RUXA 1WIEA 2EYXA 3QJYA 2GTJA 2CKKA 3VS4A 4BY6C 4M7DC 1GL5A 5LJ3j 2QTXA 2NUTA 1WXBA 1QWEA 2R5MA 4J5YA 5IXBA 5I2MA 3PNWC 5IHKA 2QG9B 1YITA 2QQ9A 3OYCA 2DE0X 4M4ZA 3FEOA 1BU1A 1W4SA 4D6WA 3CBOA 1VQMA 4A4HA 4C5EA 1ZUYA 1RAFB 2FYKA 4WTOB 2NWMA 3EFOB 2G3RA 4QW2A 1W2BA 1RL2A 2FHDA 4C92G 4RTYA 4AFSC 3ZL7C 3A8MB 4C0FA 1PM3A 2DXCA 1I07A 1NPRA 4CC4B 3EGUA 3L2WA 4OF1A 2YRDA 2GNCA 4UC4A 4EMKB 4C8QC 4PJLA 2LJ1A 2QQAA 2CGHA 2RK1A 1UGPB 1LNXA 3TSZA 3F70A 1AZEA 2RN8A 4ZN3A 3HSBA 1VQ6T 1KC8U 4HCBA 5L8RE 4R55A 4BE2A 2O9VA 3O8VA 2QASA 1N27A 4GY5A 3HKSA 1F1BB 2EJGA 4J7FA 3PMTA 3BY7A 2BUDA 1YNZA 2EKOA 4YTLA 2D0NA 1KFZA 1KC8R 2FPFA 2VYTA 3V8KA 2VXEA 2CZ6B 2DLPA 2KT1A 1GBQA 4V2SA 2GBQA 3TVTA 1QP2A 1Y7XA 2E70A 4BB7A 4M77A 2IPOB 2X4YA 2ZPIB 2DTOA 4M7DE 4E47A 2LDMA 3EFOA 3H0IA 1UEBA 1BIAA 2HQXA 2KI7A 2RA2A 1PKTA 1RI0A 4MMKA 2DL7A 1OULA 3N5BB 4F7UE 4C5IA 4M77D 1WHJA 3M57A 2Z0WA 3C12A 3FC3A 1IHWA 1AD5A 4VUBA 4A4GA 1K9AA 2LJ0A 2D8JA 4Y28E 3CPWS 4CC3A 5GMKi 2ZPHB 3EG3A 2EYZA 3FB9A 3C4SA 1VQ9Q 2CYZB 4M78A 1BI2A 1QWFA 1UGQB 4CI0C 2OTJT 3QWYA 4J83A 4M77C 3VS5A 2QEXQ 3QPHA 1KIKA 4KGXB 3HL8A 3NMZC 1RAAB 3CCVA 1C1AA 1IHVA 1TG0A 1VQ4T 1VQ8T 1QVFA 4MMLA 1QKWA 1ZSZB 4GLMA 1KQSP 4Y92A 3A8LB 3QYHB 1M4ZA 1ZBXA 4LNPA 2BZXA 2QGGA 1IZ6A 2VASA 1Q86U 3VRZA 1PRLC 2HL5C 1YI2T 5GMKm 4JZ3A 2GCXA 4BI3A 3S3OA 4C8QD 2RI2A 3CCVT 2PTKA 2DBKA 3MP1A 2JMAA 2EQJA 1PD0A 1WXUA 3OYLA 2EQKA 2E5QA 1QMCA 2F69A 2XDBA 3HRUA 3A98A 3E2UA 1UFFA 4OB1B 1PRMC 3OYIA 2CP0A 3QO3A 1EIFA 1HD3A 1HYOA 1Y0MA 2BIVA 2DZCA 1YN8A 3C94A 4CC2A 5D6WA 1IRXA 2K3XA 3P8DA 5IT9E 3QWXX 1OU9A 4DBQA 2PUOB 1HSQA 1SSHA 4FYVB 1YCYA 3JCMV 3FLGA 1W2BP 2BTTA 4HCZA 2BE9B 2JMCA 3H9NA 3I55Q 3RKWA 4M78F 5LJ5g 1TH7A 2Y4YA 1VQ5Q 2Y4XA 5DY9A 3GIBA 1CSKA 4ORZA 5HY6A 1RLPC 2CP6A 2EGEA 4Q5WA 4QKUA 1Z9QA 2DILA 2E4HA 4AFUC 2K3BA 5LL6S 5J39A 2GGRA 1OPKA 1OV3A 1WHHA 2RQUA 1VQ5T 4C92D 1T3SA 2C0OA 2PQWA 1Q7YC 1NJIC 2V26A 1Q82U 4LDWA 4ZGDB 4ZTFA 3CPWA 4A53A 2K3YA 2I0NA 4FT4A 2KR3A 4EDUA 1NE8A 1X43A 4DBFA 3I9QA 3CD6T 3JB9H 1XQHA 4M75B 1NLPC 2OAWA 1JXMA 5GAOr 4N4IA 3CEYA 3CCMT 2DM1A 2YUPA 2CZ7B 2PNIA 3VYHB 4R56A 4C5GA 2DNUA 2DTIA 2FRYA 2F5KA 4DEXA 2QXFA 1IREB 5KE3A 4J9EA 1VQNA 2DPPB 1UDLA 1LPLA 4QT7A 4MZPA 1JU5C 4BI8B 1B34B 2RJCA 4ZGEB 1GBRA 4J8OA 3ZEHA 1D1BA 4N0AC 3LH5A 2KQWA 3KUFA 2F2WA 2RI3A 3LGFA 3HRSA 5GAN5 4FCYA 2DYIA 2L3PA 3S6WA 1UGVA 4F7UF 2HD0A 1O75A 2EAYA 4O6JA 1OQKA 3OYJA 3MP6A 2HL3A 4LD9K 1D3BB 1JJ2A 1Z9ZA 3SWNB 1QVFS 4BDYA 4DEYA 1NYFA 5FRMA 5D7UA 1VQNQ 3JAME 3J7AF 2D0QB 2QQBA 1G8XA 1VQPT 1IB8A 2KK4A 1GCPA 1YBYA 4B6MA 2CH4W 4ZN1A 4X9CA 3FJPA 2VKNA 2L8DA 2V8JA 2MMPA 1UB4A 2PVGB 3JCMe 4RTXA 3OS5A 3FIFA 3CCRA 4M75F 5GAN4 1T0JA 1K9MU 2DRKA 5FLXE 4B9WA 1YJWA 1PWTA 4M7AE 5GJWB 3I35A 4RTWA 4EMHA 5KCHA 2PUKB 3THKA 4OMOA 2CDTA 3MP8A 1H3ZA 2YT6A 2SRCA 1BI0A 4F7UB 4M78B 4J6YA 4C92F 5FU7C 1PSEA 5LJ5h 4M75G 1PNJA 1Y96A 1ABQA 5CKBA 1X01A 4PJOD 4OP0A 3HRTA 2J7IA 1R0BG 3G1JA 1KD1C 3GNGA 1X75C 1K76A 2E65A 1M90C 1NM7A 1UJ0A 2ESWA 4JRIA 1B07A 2DXBA 4PLLA 2YWWA 2DXUA 2L3SA 3QXEB 5GAOq 5GANj 3VUZA 2HNIA 3REBB 2E12A 1S72T 5CQXA 2CZ0B 3EGDB 3ULRB 1B34A 1N9RA 3V7CA 3H0HA 3JCMJ 3M0SA 4OB2B 5ECAA 5LJ3h 3VUBA 3JB9G 3M0PA 5FROA 2LT4A 1K73C 3T9NA 1MNDA 2FPDA 1M90U 2EYQA 2RM4A 2K6DA 2KDSA 1Q81R 3JB9I 2VB6A 3CPFA 3ZBDA 2X9HA 4KBMB 1PC0A 2AHJB 4QQDA 3I56A 4O5VA 1QQJA 2PZ1A 1OOTA 1WFWA 3M54A 4RTZA 4AG1C 1Y96B 4ELZC 1H8KA 2M9UA 3P8HA 1WGSA 5J26A 2XDDA 3OMGA 5GMKj 4CC7A 5GANh 5DLOA 5CR2A 2XG8D 3WVDB 6AT1B 1YFNA 1H3HA 2JOYA 3QJ6A 1M3CA 1QVGS 3OW2A 1AVZC 5KYUB 1LCKA 3CCUT 4GBQA 1Q86C 1Y57A 4PFOA 1SHFA 1QVGA 1VQLQ 2CH4A 4ZTJA 3CCLT 1YITT 1I5OB 3DKMA 5IXFA 5GANg 4K11A 1JJ2S 2KE9A 2HZYA 1FMKA 2QAZA 1G3SA 2P4TA 4NS5A 5A0LA 1WHMA 2HQHA 4JS5A 4KULA 4KH1B 4AFQC 3LLRA 3NTKA 1M5Q1 2EGCA 4FYXB 2V1QA 2D6FA 3NPFA 4A54A 4A63B 2HSEB 2DEUA 1B7TA 1YI2A 2MCNA 1UGRB 2HMAA 4XU0A 3FJ5A 1M1KR 2B86A 2LVMA 2Y90A 4HCCA 2SEMA 3MO8A 3CC2A 3OSSC 4Y91A 4XU1A 1M30A 1VQKA 2MYSA 2ROLA 3JCMX 4KGZB 2E6ZA 3RBBB 3UATA 2X4JA 4OMQA 3CC2T 1VQPA 4IUUA 4Z02A 1ACMB 2KRMA 5CKDA 4M7DA 2F1LA 1N8RC 1ARKA 4XQ3A 3A8HB 1YIJT 1YHQQ 4IUVA 3CC7T 3VV0A 3RNJA 2YRVA 5GAN3 5FW9A 2NUZA 1V76A 4F7UA 3TU4K 2HQEA 4ELYC 2MI6A 1KQ2A 2JS2A 2OI3A 2A0FB 5EG2A 2W10A 2EVRA 1Q82R 2XDPA 2DKGA 2QEXA 1M27C 4MZMA 1YIJQ 4NOYA 5LJ3g 2FZCB 2NUTB 4J9IA 3G6EA 2D1XA 1IXDA 2ENMA 4A4FA 1V1CA 1KHIA 2MIOA 1TTHB 4D8DA 1NJIU 3SB2A 3G7ZA 4M78E 3OQ5A 4KRTA 3G71T 4DBRA 5HK0A 4E7HA 4ZGJB 4BI4A 1M2VB 3QKJA 4GLKA 1RAGB 3LWIA 2DAQA 3JCMb 4X9DA 4IUTA 1KQSA 2P4RA 5GJVB 1M1KC 1UHFA 2DJZA 4JZ4A 2DBMA 1M3AA 4HVVA 4JJBA 3EH2A 3JCMh 3CCEQ 1K8AC 3CCJQ 2DETA 4C92B 1M90R 2K9GA 3VS6A 2OTLT 4E6RA 2ZGWA 1VOMA 4F16A 3VKIA 2FG0A 2KRNA 1M1KU 1OYXA 5GAOp 1VQLT 2VC8A 2VUBA 1M1FA 3HFOA 2DF6A 3DB4A 5IHIA 2ECZA 2WACA 4JJNK 3UA7A 2F2XA 1VIFA 3L2UA 3OW2S 3PTAA 4E7KA 2CSIA 1Q7YU 1H92A 1VQ7A 3LW5E 3V7SA 1GXIE 1NEGA 1I4K1 3L2RA 4M77F 2RMOA 5M9OA 2EQMA 4M7DG 2AK5A 4C0GA 4IKFA 1VYVA 2RNAA 1VQ7T 4N4HA 1VQMT 1MGQA 1JEGA 2LX7A 2X51A 3I56Q 2YLBA 3I5RA 2EGAA 3X20B 4Z89A 3CBMA 1EX4A 1WDXA 5GAMj 3E9FA 2LCLA 3TREA 1N9SA 4XK8E 3KBGA 2JXBA 3JCMc 1KHCA 3RMSA 1VQ6A 3X26B 2WSCE 2QTVA 3REAB 4M7AD 1LJOA 1W70A 2ED0A 5GMKe 3ME9A 4LXCA 1KK7A 2X3WD 1NG2A 1RAIB 3SD4A 1C0MA 2COZA 4QQ6A 2JUFA 3AT1B 4C0ZA 1KSWA 4M7DB 1OI1A 5CAIA 2FEIA 2YUOA 1RADB 4OB3B 2XD0A 3INZA 5GAOm 3EG9B 3CMEA 4IURA 5HKCA 3OY9A 1S72Q 2M02A 1TUCA 1AEYA 1UGSB 4RUGA 2DMOA 1TU0B 3OYAA 3QDRB 3CMAA 4J9FA 4BE0A 2GQIA 1W1FA 3VYGA 1VYUA 4DA4A 3G6EQ 3O5ZA 4XU3A 1GFDA 2KNBB 2E3HA 2MF2A 1YJWT 1BYMA 3CCQQ 1X69A 2M0YA 1SF9A 3CCST 2EFIA 2XMFA 3CMAT 2O9SA 4MDXA 2L2PA 3R6OA 1BKBA 4FW2A 4JRPA 2K5IA 1OZ3A 1WJRA 1AOJA 1VQOT 1AWJA 2JJ9A 4LUEA 1JB0E 1OZ2A 1U1TA 3MPUB 4M78D 3M4GA 2JTEA 4J9DA 1NPPA 1RABB 4IUQA 3CC4T 3RERA 2K5LA 3J81E 2LQNA 3CMAQ 3CCSQ 1YJNT 1D0ZA 2FRWA 2RD1A 1VQOA 1H641 4OMMA 2EQUA 2RO0A 2EKHA 5GAMg 4E7IA 2PVOB 5KYWB 3PT9A 1YWOA 2HBWA 2LZ6B 3H6ZA 1Q81U 2J6FA 3M55A 2P84A 1GCQA 3C0CA 3RDVA 2QI2A 2LRQA 1OEBA 2ZPFB 2KVQG 4C92C 4OGEA 5J3BA 1IO6A 4MDWA 3EGDA 5KYNA 5KYYA 1G3WA 2FPEA 3M5AA 3GPLA 2YSQA 1VQ8A 4M7AG 1WHKA 5GAMh 1XJWB 2DRMA 1MV3A 1AZGB 1FX7A 2VXFA 2DFUA 1QCNA 3M59A 4XTUA 3MJXA 1FMWA 2QA4T 5A0GA 5KYXB 2JTFA 2NYSA 2IVWA 5KYUA 3CCEA 2DXTA 1FYNA 4M7AF 4PJOA 5LJ5j 1ZA1B 2DL3A 4FT2A 1YJNA 4M77G 1TS9A 2QYZA 3A8GB 1VQ7Q 2O01E 1PG5B 1X6GA 1LVKA 2KAFA 4C5HA 5CKEA 2LCCA 3S3NA 3VS1A 3KFVA 3C95A 3EG9A 1AT1B 5LJ3e 2H3JA 3HP9A 1RAEB 2EQIA 3SFMA 3GP8A 4L6V5 1IGUA 2EWNA 1G2BA 2ED1A 1KG1A 1SG5A 1ZBJA 3CCMQ 4E7LA 1K9MR 1MMGA 1MHNA 4XU2A 3X25B 2GFAA 1K1ZA 3M0QA 2A28A 4PJOF 2CZ1B 3PVLA 3H41A 4RG8A 3KXTA 1GFCA 1SSFA 1JBMA 2XICA 2OTLQ 3LH0A 2DL4A 3EGXB 2NUPB 1JJ2P 3L2ZA 2EYYA 1PD1A 3M53A 3A1PA 2RF0A 2DO3A 4F17A 2F2VA 2K7AA 3QBYA 4M75C 1NYGA 4HT8A 4ESRA 2LJ3A 1R0CB 3LWHA 1FMVA 1U8RA 3MCAB 3JV3A 4RCCA 1B3QA 3LGLA 4XTYA 2MK5A 1IGQA 5CO7A 1I81A 2CT4A 3I55T 3TCJA 1BK2A 2FVUA 3NHNA 4M7AB 3A5ZB 5A0DA 3OYNA 4MZTA 3BE3A 2E3IA 4WF2A 2DZ9A 4XTVA 1R8OB 2VWFA 3VS3A 3SWNA 2EPDA 2OX7A 2EJFA 2LT1A 4DQ2A 2QA4Q 4IIOA 2DERA 3IQLA 1GRIA 3EG0A 5FU6C 1NJIR 4BY6B 2O4XA 1M8MA 5DLQE 5CK9A 4R0KA 4AFZC 1WHLA 3QZ9B 5KYXA 4HA8A 3QG1A 3VU3C 3CC7Q 2W0ZA 1NEBA 1YHQT 1U3OA 7AT1B 4JLIA 2E5KA 2XK0A 4M78C 5I11A 2MOXA 2K57A 1Y71A 3P8BB 1U06A 3RESA 3CC2Q 4RKUE 1VQ4A 3BW1A 4ATOA 1UHCA 3RKYA 2NUPA 2FZGB 2CUBA 2BZ8A 1D1CA 4NL3A 4PJMA 1VQKT 1I1JA 2YLCA 2HAXA 3ZFJA 2RJDA 4PJOE 2IIMA 3GOXA 1KQ1A 2RHYA 5GANd 2QDYB 2C0TA 2YHTA 2LX9A 1YJNQ 1VQ8Q 1VQ4Q 1WQWA 2DIGA 2EW3A 2ABLA 5FWCA 4PK4A 1TUGB 4LDVA 2BKDN 2QK0A 3CC4Q 1YCSB 3JB9J 1VQ9A 4J9HA 2COWA 2HKQB 1VQOQ 1W6XA 4LN2A 1WLPB 3OYFA 4E2FB 4JS4A 2OTJQ 1ZQ1A 2ZPBB 4PJNA 3HFNA 1VQ9T 2A7YA 3CCQT 3OBWA 1D09B 1YJWQ 4A4EA 1YITQ 4DOVA 1AWXA 3CBPA 5I22A 3G6ET 3CCMA 2IG0A 4PJJA 3L42A 1HJDA 1G5VA 4L5GA 3CCQA 4BACA 4E7ZA 2LTOA 5HK3A 2VGNA 1KJWA 3GF5A 2DA9A 3QUIA 2M51A 2DYBA 4F14A 1C6VX 3JCMQ 2A37A 2FO0A 3PGGA 3OMCA 3NTIA 2E1HA 3CCRT 4XTWA 2JTMA 1BB9A 1K9MC 2NLUA 1WZOA 4EMKC 2LNVA 1UJYA 3OYGA 2LQ8A 1NZ9A 1WX6A 2H3EB 5IAYA 9ATCB 1D3BA 3UPUA 4RTVA 2E6NA 1TUDA 1DJ7B 4NL2A 2LNHB 4XAXB 1K73R 3OYYA 3CXCP 4LUDA 1WYXA 1M8VA 4M75E 4HCKA 1VQ5A 3I56T 5CIUA 4LDXA 5KYYB 2JNGA 2P0QA 1BI3A 3I5SA 1K8AU 2ZZDA 3CCRQ 2AZSA 2RK2A 3UA6A 1YJ9A 2OAUA 4RMOA 1OPLA 1Q82C 2J06A 4J9BA 4RTUA 1ZSGA 4X34A 3EFRA 1G83A 1E6HA 1WA7A 2RQRA 2JT4A 4N0AA 4BUGA 4C8QG 3BFMA 4OB0B 2G6FX 1KD1R 3OSVA 1KD1U 3M0TA 2AT1B 2JM8A 3HPWA 3JB9F 1OX8A 2VV5A 1K4US 3RMQA 2AIRB 3M0UA 2L0AA 4HT9A 2QA4A 4PL6A 1M2OA 4Z8AA 4M7DF 4C8QA 3OYDA 4JJCA 1RLQC 2DVEA 1WJQA 4KH0B 4ME7A 4EMKA 2FZKB 4M75D 4A4KA 3RKXA 1YHQA 3CCJT 4HKEA 3BDUA 3EG2A 2CS7A 4EPCA 5A2QE 2DD4A 2DL5A 2DEQA 3V8JA 3OYMA 3VS0A 3UT1A 1AWWA 2L3RA 4IUPA 1K0SA 2RJEA 3E19A 1VQKQ 3MHXA 1T3LA 2E41A 3DLMA 5CQYA 4PNOA 1WI7A 4C92E 3OS0A 3GNFB 1OU8A 4F7UG 4FSXA 4J6WA 1AWOA 1PHTA 2V8KA 1MMDA 5CVIA 4HVWA 5IHNA 2EJ9A 2GTOA 5LJ3f 3M0RA 5GAN2 1JO8A 2OJ2A 3AHUA 5GAMf 2D9TA 1Y07A 1OX9A 4J9CA 4M7AC 2RB6A 2DL8A 3MEVA 1RACB 5I2SA 2XI9A 3CCUA 4L59A 3OYEA 2DX1A 5GAOl 3M4YA 1MMNA 3LX7A 2LQKA 3RR6A 1AHJB 1XNIA 1TXQA 2RQVA 1WQ7A 5LJ3d 2R5AA 1VUBA 3LYIA 2BE7D 3QYGB 1K8AR 4AMCA 1PSFA 5GANe 1E7OA 3CXCA 1PCXA 3E9GA 4ZNXA 2DD5A 2A36A 3VS2A 4JRKA 2A3LA 1FWZA 2EBPA 3J80E 8AT1B 3Q1JA 1NLOC 4AT1B 3FRNA 3HHTB 2MPXC 2K2VA 4BDZA 2P0PA 4OMFB 4FW1A 1YWPA 2VVKA 2OTJA 1BI1A 3CMET 2LQWA 2M0OA 1SRLA 2JM9A 3EHRA 4PFPA 1S1NA 1QVGP 2K2MA 5LJ5d 5GAOn 1D1AA 2ROTA 4EIKA 1VA7A 3CD6A 2O2OA 4QVZA 2QGFB 2RHZA 3CCLQ 5GAMd 3MEAA 4JUVA 5CKFA 2OTLA 3TQ7P 1FXXA 4KUIA 5FU6B 3MEWA 4B9XA 3CCUQ 4JJDA 1JXOA 1YJ9Q 2DVJA 4C0DB 1T0HA 4RCBA 2JZ2A 2QQRA 2J05A 3CC4A 2H8HA 2RH2A 3G4SA 5KCOA 2HDAA 1VYTA 5LJ5f 1X2QA 3I55A 3DB3A 1RUWA 1MV0B 2P0KA 1HK9A 3CXCS 4JDSA 3CCLA 2MAMA 5GAN6 3RIRA 2L89A 2DK3A 3TSWA 1JQQA 2K4YA 1QCOA 1SRMA 3ER0A 1BBZA 1YIJA 2AKLA 3EFSA 2HEQA 4OVAA 1EFNA 4FU6A 2KYBA 1G3YA 2CP7A 1I8FA 3QIIA 3G4ST 2WSFE 1SKUB 2HCKA 2LC4A 4J9GA 4D8KA 2O4XB 2K79A 3JCMd 1BCMA 4HXJA 5GAN8 3CCVQ 2ATCB 4PJOB 1MMAA 2XU8A 1A0NB 1U1SA 2EIFA 2ZAEA 3JSCA 1YI2Q 2KYMA 1I0CA 4F04B 1Q86R 2DTHA 2X3XD 1SHGA 2RHXA 4C8QB 5FU7B 4PJOC 1XOVA 2CP5A 5KE2A 2CP3A 2RPNA 4JRQA 1NBEB 5C6SA 3A8OB 5C0MA 2K5FA 1V29B 1X27A 2HBPA 2KEAA 1ZLMA 2YUNA 3MKDA 3X24B 4E7JA 5FRNA 1VQLA 1ZUKA 5D6YA 2AZVA 1N8RU 1D0YA 3WVEB 1KC8C 3D7SB 3OB9A 2CT3A 2C06A 1SPKA 2HKNA 2YRCA 2O31A 2ZPEB 3NTHA 1N6AA 1QW1A 2VGMA 3QDFA 1UECA 2CREA 4KUDK 3PFSA 5CKHA 1KQSS 4C92A 1M9SA 4P5NA 5GMKh 2J6KA 1K73U 3UWNA 1GCQC 1I5LA 2RHIA 4WCIA 1BIBA 3EH1A 4FIBA 1P92A 1QLYA 3S3MA 2DIQA 2X35A 4ANJA 4XTZA 1QVFP 1QCFA 3L2VA 2M1HA 4CRIA 2LCSA 2KROA 4C8QE 2QQSA 4J7IA 3PIOA 4M77B 3CC7A 3M9QA 2PU9B 1VQPQ 2WSEE 2JN0A 4M7DD 2JW4A 3GBQA 2RQTA 1VQNT 1EZZB 2R58A 3GLXA 4DOWA 1TOVA 4PJOG 3EG1A 1ZHIA 2J6OA 1M3BA 2FB7A 2KXCA 2D8HA 2RI5A 2KXDA 5KH6A 3JCMP 3EHQA 3V8LA 2KSSA 1CKBA 4QVDA 3U23A 2E10A 1ABOA 1RI9A 1JRIA 3META 4OGCA 4BE1A 3JRZA 3OYKA 4N4GA 2R57A 4C0DC 3ASKA 2KT8A 4M77E 3VS7A 2MWOA 2KRSA 5D6XA 2CP2A 1VQMQ 4II1A 3OYHA 1UG1A 1WNLA 4RG2A 3OBYA 5CCAA 1BCOA 1ZSZA 2KMTA 4OMNA 1X6OA 4JPBW 3SDZA 2EYWA 4LD6A 3G4SQ 2L3QA 1MNEA 1VQ6Q 3PIPA 2HSPA 2MWPA 4EMGA 1Q81C 1O9SA 1UUEA 2ZCFB 3L2QA 3JB9D 2PVDB 8ATCB 1D0XA 3NFCA 1K0XA 1TSFA 1U5SA 1WXTA 3TEEA 2LP5A 1X6BA 3JCMg 3CD6Q 1QKXA 3CCSA 1X2KA 3H8ZA 5DM7R 3QSUA 4KGVB 3QZ5B 5L23A
chains in the Genus database with same CATH topology
4HVUA 4RTUA 3I5RA 4FSSA 1ZSGA 2EGAA 2C0IA 3UF4A 4Z89A 1G83A 1NLPC 2JS0A 2OAWA 1JXMA 1WDXA 2DM1A 1E6HA 1WA7A 2A08A 2JT4A 2RQRA 2YUPA 2PNIA 2RQWA 2AKKA 2JXBA 2DNUA 4DEXA 2FRYA 2O88A 2G6FX 3M0TA 3REAB 2JM8A 1K4US 1W70A 3M0UA 5HCKA 2ED0A 4J9EA 1UDLA 3H0FA 2L0AA 1MUZA 2KBTA 2QDLA 2X3WD 1NG2A 4QT7A 1J3TA 1JU5C 4Z8AA 1GBRA 1KSWA 4X1VA 5IH2A 4JJCA 1RLQC 1E6GA 3LH5A 2FEIA 4LE9A 1N5ZA 2YUOA 2YUQA 2F2WA 2YDLA 4AG2C 3EG2A 3VRYA 3PVQA 2L3PA 3R6NA 1UGVA 1TUCA 1AEYA 4RUGA 2DMOA 3CQTA 1ZX6A 2DL5A 4J9FA 3SHWA 2GQIA 3VS0A 1W1FA 1ZUUA 1VYUA 1AWWA 3O5ZA 1K0SA 1GFDA 2KNBB 5FWBA 1SEMA 1Z9ZA 4IIMA 1CKAA 1T3LA 1X69A 4DEYA 2M0YA 2XMFA 1WI7A 2O9SA 1NYFA 2L2PA 3SEMA 1AWOA 1AOJA 1PHTA 4OMLA 1AWJA 4RTTA 4LUEA 4HVWA 1GCPA 2JTEA 4J9DA 2CH4W 5IHNA 2GTOA 2VKNA 3M0RA 2LQNA 1UE9A 1JO8A 2OJ2A 3PE0A 4RTXA 2BZYA 2FRWA 4J9CA 4OMPA 4Z88A 1T0JA 4OMMA 2DL8A 2EKHA 3NGPA 2DRKA 1PWTA 2V1RA 5GJWB 3I35A 4RTWA 3THKA 2DX1A 1YWOA 2LZ6B 2HBWA 4OMOA 2CSQA 2CDTA 2J6FA 2DJQA 1GCQA 1UTIA 3C0CA 2YT6A 2RQVA 2KGTA 2SRCA 5EC7A 1OEBA 2LMJA 2CUDA 1PKSA 1IO6A 1YP5A 1PNJA 1E7OA 1WIEA 2EYXA 2FPEA 1ABQA 4ZNXA 2GTJA 3VS4A 1GL5A 2YSQA 1WXBA 1QWEA 2A36A 2J7IA 3VS2A 5IXBA 2DRMA 5IHKA 2EBPA 1K76A 1MV3A 1AZGB 2DE0X 1NM7A 4M4ZA 1BU1A 1UJ0A 2ESWA 1B07A 1NLOC 2L3SA 1ZUYA 3REBB 2NWMA 1YWPA 2VVKA 3ULRB 1FYNA 2LQWA 2DL3A 1SRLA 2JM9A 3H0HA 4RTYA 4AFSC 3EHRA 3ZL7C 3M0SA 5ECAA 1S1NA 1X6GA 3M0PA 2K2MA 3VS1A 1I07A 3KFVA 2ROTA 4CC4B 4EIKA 2FPDA 1VA7A 3EGUA 2O2OA 2GNCA 2K6DA 2EQIA 2LJ1A 3TSZA 1AZEA 1G2BA 2RN8A 2ED1A 4JJDA 1JXOA 2PZ1A 2DVJA 1OOTA 1T0HA 1ZBJA 1WFWA 4RTZA 2J05A 4AG1C 2H8HA 1H8KA 2HDAA 1VYTA 1K1ZA 3M0QA 2A28A 1X2QA 2O9VA 3PVLA 3H41A 1RUWA 1GFCA 1MV0B 4CC7A 2DL4A 2EYYA 1H3HA 2RF0A 3TSWA 1JQQA 1YNZA 1M3CA 2D0NA 4F17A 2F2VA 1AVZC 1KFZA 1SRMA 1BBZA 2FPFA 2K7AA 1NYGA 2AKLA 1LCKA 2HEQA 4ESRA 2LJ3A 1EFNA 2DLPA 2KT1A 1GBQA 4GBQA 2KYBA 3JV3A 1B3QA 2GBQA 1Y57A 1SHFA 3TVTA 2CH4A 2CT4A 2HCKA 5IXFA 4J9GA 1BK2A 4K11A 4D8KA 2KE9A 3NHNA 2K79A 1FMKA 4HXJA 3H0IA 1PKTA 4AFQC 1A0NB 2EGCA 2DL7A 2V1QA 2VWFA 3VS3A 3NPFA 4A63B 2KYMA 2MCNA 1I0CA 2EPDA 3FJ5A 2B86A 2X3XD 1SHGA 4IIOA 1XOVA 3IQLA 1GRIA 2RPNA 1AD5A 3EG0A 2SEMA 1K9AA 2LJ0A 1M8MA 2D8JA 1X27A 4R0KA 4AFZC 2KEAA 1M30A 4CC3A 3EG3A 2EYZA 2ROLA 1ZLMA 2YUNA 2W0ZA 1NEBA 3RBBB 1ZUKA 3UATA 2AZVA 1U3OA 4OMQA 1QWFA 2E5KA 2CT3A 3QWYA 1SPKA 3VS5A 5I11A 2O31A 2KRMA 2MOXA 1KIKA 1UECA 2CREA 1U06A 1ARKA 3NMZC 1TG0A 1UHCA 2CUBA 3RNJA 2BZ8A 2J6KA 5FW9A 2NUZA 1GCQC 1I1JA 4WCIA 1QKWA 4GLMA 4Y92A 1QLYA 2IIMA 2JS2A 2OI3A 2W10A 2C0TA 2EVRA 4LNPA 2BZXA 1QCFA 1M27C 2EW3A 2ABLA 2LCSA 5FWCA 4J9IA 3VRZA 2KROA 1PRLC 2D1XA 2ENMA 1YCSB 4JZ3A 4J9HA 1V1CA 2MIOA 4D8DA 1W6XA 4LN2A 1WLPB 2JW4A 3GBQA 4KRTA 2PTKA 2RQTA 2DBKA 2JMAA 1WXUA 3EG1A 2J6OA 1AWXA 1M3BA 2KXCA 3A98A 5I22A 2D8HA 2KXDA 2P4RA 5GJVB 3EHQA 1CKBA 1UFFA 1UHFA 3U23A 1ABOA 1RI9A 1PRMC 1HJDA 4JZ4A 2DBMA 1M3AA 1KJWA 4HVVA 4JJBA 2DA9A 1HD3A 1Y0MA 2M51A 1YN8A 2KT8A 3VS7A 2DYBA 4CC2A 2KRSA 4F14A 2A37A 2FO0A 2K9GA 3VS6A 1UG1A 3QWXX 1HSQA 1SSHA 1BB9A 4OMNA 1UJYA 4E6RA 4F16A 2BTTA 4JPBW 2JMCA 2EYWA 2FG0A 2KRNA 1WX6A 2L3QA 2DF6A 5IHIA 2HSPA 1CSKA 2ECZA 4ORZA 4RTVA 1RLPC 2EGEA 1TUDA 1Z9QA 3UA7A 2F2XA 1UUEA 2DILA 2LNHB 4AFUC 2K3BA 2GGRA 4LUDA 1K0XA 1OPKA 1OV3A 1WYXA 1U5SA 2CSIA 2RQUA 1WXTA 1H92A 1T3SA 2LP5A 1X6BA 2C0OA 4HCKA 1NEGA 1QKXA 2RMOA 3I5SA 2AK5A 2I0NA 2KR3A 2RNAA 1VYVA 1X2KA 1X43A 2AZSA 3UA6A 3I9QA 1JEGA 1OPLA 2LX7A 2J06A 4J9BA 5L23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVU A;  4RTU A;  3I5R A;  4FSS A;  1ZSG A;  2EGA A;  2C0I A;  3UF4 A;  4Z89 A;  1G83 A;  1NLP C;  2JS0 A;  2OAW A;  1JXM A;  1WDX A;  2DM1 A;  1E6H A;  1WA7 A;  2A08 A;  2JT4 A;  2RQR A;  2YUP A;  2PNI A;  2RQW A;  2AKK A;  2JXB A;  2DNU A;  4DEX A;  2FRY A;  2O88 A;  2G6F X;  3M0T A;  3REA B;  2JM8 A;  1K4U S;  1W70 A;  3M0U A;  5HCK A;  2ED0 A;  4J9E A;  1UDL A;  3H0F A;  2L0A A;  1MUZ A;  2KBT A;  2QDL A;  2X3W D;  1NG2 A;  4QT7 A;  1J3T A;  1JU5 C;  4Z8A A;  1GBR A;  1KSW A;  4X1V A;  5IH2 A;  4JJC A;  1RLQ C;  1E6G A;  3LH5 A;  2FEI A;  4LE9 A;  1N5Z A;  2YUO A;  2YUQ A;  2F2W A;  2YDL A;  4AG2 C;  3EG2 A;  3VRY A;  3PVQ A;  2L3P A;  3R6N A;  1UGV A;  1TUC A;  1AEY A;  4RUG A;  2DMO A;  3CQT A;  1ZX6 A;  2DL5 A;  4J9F A;  3SHW A;  2GQI A;  3VS0 A;  1W1F A;  1ZUU A;  1VYU A;  1AWW A;  3O5Z A;  1K0S A;  1GFD A;  2KNB B;  5FWB A;  1SEM A;  1Z9Z A;  4IIM A;  1CKA A;  1T3L A;  1X69 A;  4DEY A;  2M0Y A;  2XMF A;  1WI7 A;  2O9S A;  1NYF A;  2L2P A;  3SEM A;  1AWO A;  1AOJ A;  1PHT A;  4OML A;  1AWJ A;  4RTT A;  4LUE A;  4HVW A;  1GCP A;  2JTE A;  4J9D A;  2CH4 W;  5IHN A;  2GTO A;  2VKN A;  3M0R A;  2LQN A;  1UE9 A;  1JO8 A;  2OJ2 A;  3PE0 A;  4RTX A;  2BZY A;  2FRW A;  4J9C A;  4OMP A;  4Z88 A;  1T0J A;  4OMM A;  2DL8 A;  2EKH A;  3NGP A;  2DRK A;  1PWT A;  2V1R A;  5GJW B;  3I35 A;  4RTW A;  3THK A;  2DX1 A;  1YWO A;  2LZ6 B;  2HBW A;  4OMO A;  2CSQ A;  2CDT A;  2J6F A;  2DJQ A;  1GCQ A;  1UTI A;  3C0C A;  2YT6 A;  2RQV A;  2KGT A;  2SRC A;  5EC7 A;  1OEB A;  2LMJ A;  2CUD A;  1PKS A;  1IO6 A;  1YP5 A;  1PNJ A;  1E7O A;  1WIE A;  2EYX A;  2FPE A;  1ABQ A;  4ZNX A;  2GTJ A;  3VS4 A;  1GL5 A;  2YSQ A;  1WXB A;  1QWE A;  2A36 A;  2J7I A;  3VS2 A;  5IXB A;  2DRM A;  5IHK A;  2EBP A;  1K76 A;  1MV3 A;  1AZG B;  2DE0 X;  1NM7 A;  4M4Z A;  1BU1 A;  1UJ0 A;  2ESW A;  1B07 A;  1NLO C;  2L3S A;  1ZUY A;  3REB B;  2NWM A;  1YWP A;  2VVK A;  3ULR B;  1FYN A;  2LQW A;  2DL3 A;  1SRL A;  2JM9 A;  3H0H A;  4RTY A;  4AFS C;  3EHR A;  3ZL7 C;  3M0S A;  5ECA A;  1S1N A;  1X6G A;  3M0P A;  2K2M A;  3VS1 A;  1I07 A;  3KFV A;  2ROT A;  4CC4 B;  4EIK A;  2FPD A;  1VA7 A;  3EGU A;  2O2O A;  2GNC A;  2K6D A;  2EQI A;  2LJ1 A;  3TSZ A;  1AZE A;  1G2B A;  2RN8 A;  2ED1 A;  4JJD A;  1JXO A;  2PZ1 A;  2DVJ A;  1OOT A;  1T0H A;  1ZBJ A;  1WFW A;  4RTZ A;  2J05 A;  4AG1 C;  2H8H A;  1H8K A;  2HDA A;  1VYT A;  1K1Z A;  3M0Q A;  2A28 A;  1X2Q A;  2O9V A;  3PVL A;  3H41 A;  1RUW A;  1GFC A;  1MV0 B;  4CC7 A;  2DL4 A;  2EYY A;  1H3H A;  2RF0 A;  3TSW A;  1JQQ A;  1YNZ A;  1M3C A;  2D0N A;  4F17 A;  2F2V A;  1AVZ C;  1KFZ A;  1SRM A;  1BBZ A;  2FPF A;  2K7A A;  1NYG A;  2AKL A;  1LCK A;  2HEQ A;  4ESR A;  2LJ3 A;  1EFN A;  2DLP A;  2KT1 A;  1GBQ A;  4GBQ A;  2KYB A;  3JV3 A;  1B3Q A;  2GBQ A;  1Y57 A;  1SHF A;  3TVT A;  2CH4 A;  2CT4 A;  2HCK A;  5IXF A;  4J9G A;  1BK2 A;  4K11 A;  4D8K A;  2KE9 A;  3NHN A;  2K79 A;  1FMK A;  4HXJ A;  3H0I A;  1PKT A;  4AFQ C;  1A0N B;  2EGC A;  2DL7 A;  2V1Q A;  2VWF A;  3VS3 A;  3NPF A;  4A63 B;  2KYM A;  2MCN A;  1I0C A;  2EPD A;  3FJ5 A;  2B86 A;  2X3X D;  1SHG A;  4IIO A;  1XOV A;  3IQL A;  1GRI A;  2RPN A;  1AD5 A;  3EG0 A;  2SEM A;  1K9A A;  2LJ0 A;  1M8M A;  2D8J A;  1X27 A;  4R0K A;  4AFZ C;  2KEA A;  1M30 A;  4CC3 A;  3EG3 A;  2EYZ A;  2ROL A;  1ZLM A;  2YUN A;  2W0Z A;  1NEB A;  3RBB B;  1ZUK A;  3UAT A;  2AZV A;  1U3O A;  4OMQ A;  1QWF A;  2E5K A;  2CT3 A;  3QWY A;  1SPK A;  3VS5 A;  5I11 A;  2O31 A;  2KRM A;  2MOX A;  1KIK A;  1UEC A;  2CRE A;  1U06 A;  1ARK A;  3NMZ C;  1TG0 A;  1UHC A;  2CUB A;  3RNJ A;  2BZ8 A;  2J6K A;  5FW9 A;  2NUZ A;  1GCQ C;  1I1J A;  4WCI A;  1QKW A;  4GLM A;  4Y92 A;  1QLY A;  2IIM A;  2JS2 A;  2OI3 A;  2W10 A;  2C0T A;  2EVR A;  4LNP A;  2BZX A;  1QCF A;  1M27 C;  2EW3 A;  2ABL A;  2LCS A;  5FWC A;  4J9I A;  3VRZ A;  2KRO A;  1PRL C;  2D1X A;  2ENM A;  1YCS B;  4JZ3 A;  4J9H A;  1V1C A;  2MIO A;  4D8D A;  1W6X A;  4LN2 A;  1WLP B;  2JW4 A;  3GBQ A;  4KRT A;  2PTK A;  2RQT A;  2DBK A;  2JMA A;  1WXU A;  3EG1 A;  2J6O A;  1AWX A;  1M3B A;  2KXC A;  3A98 A;  5I22 A;  2D8H A;  2KXD A;  2P4R A;  5GJV B;  3EHQ A;  1CKB A;  1UFF A;  1UHF A;  3U23 A;  1ABO A;  1RI9 A;  1PRM C;  1HJD A;  4JZ4 A;  2DBM A;  1M3A A;  1KJW A;  4HVV A;  4JJB A;  2DA9 A;  1HD3 A;  1Y0M A;  2M51 A;  1YN8 A;  2KT8 A;  3VS7 A;  2DYB A;  4CC2 A;  2KRS A;  4F14 A;  2A37 A;  2FO0 A;  2K9G A;  3VS6 A;  1UG1 A;  3QWX X;  1HSQ A;  1SSH A;  1BB9 A;  4OMN A;  1UJY A;  4E6R A;  4F16 A;  2BTT A;  4JPB W;  2JMC A;  2EYW A;  2FG0 A;  2KRN A;  1WX6 A;  2L3Q A;  2DF6 A;  5IHI A;  2HSP A;  1CSK A;  2ECZ A;  4ORZ A;  4RTV A;  1RLP C;  2EGE A;  1TUD A;  1Z9Q A;  3UA7 A;  2F2X A;  1UUE A;  2DIL A;  2LNH B;  4AFU C;  2K3B A;  2GGR A;  4LUD A;  1K0X A;  1OPK A;  1OV3 A;  1WYX A;  1U5S A;  2CSI A;  2RQU A;  1WXT A;  1H92 A;  1T3S A;  2LP5 A;  1X6B A;  2C0O A;  4HCK A;  1NEG A;  1QKX A;  2RMO A;  3I5S A;  2AK5 A;  2I0N A;  2KR3 A;  2RNA A;  1VYV A;  1X2K A;  1X43 A;  2AZS A;  3UA6 A;  3I9Q A;  1JEG A;  1OPL A;  2LX7 A;  2J06 A;  4J9B A;  5L23 A; 
#chains in the Genus database with same CATH topology
 4HVU A;  4M78 G;  5GMK l;  4FSS A;  2V8I A;  3MEU A;  3UF4 A;  2C0I A;  1W2B S;  2JS0 A;  2F5T X;  4BD3 A;  2GFU A;  2A08 A;  3CCE T;  3OS1 A;  2L5Q A;  2RQW A;  1Q95 G;  1YJ9 T;  1RAH B;  1Q7Y R;  2AKK A;  1M2V A;  4FL6 A;  2O88 A;  3EGX A;  2GQV A;  3HTR A;  1S72 A;  3DLL A;  5GAN f;  1N8R R;  3OS2 A;  1R77 A;  5HCK A;  5IN1 A;  3URG A;  3H0F A;  1MUZ A;  2KBT A;  2QDL A;  1M1G A;  3JCM W;  1J3T A;  3E1S A;  3PMI A;  2FL7 A;  4X1V A;  4M75 A;  5IH2 A;  3M58 A;  1ZA2 B;  3EAE A;  4FYW B;  1E6G A;  3G71 Q;  5KYW A;  2XID A;  4LE9 A;  4PKC C;  1N5Z A;  2I2L A;  3OYB A;  5GAN 7;  2YUQ A;  3CME Q;  2YDL A;  4AG2 C;  2X4W A;  3OW2 P;  3VRY A;  3PVQ A;  1QVP A;  1VIE A;  3R6N A;  5GAM e;  3CQT A;  4M7A A;  1ZX6 A;  4J6X A;  2JVV A;  2COY A;  3SWN C;  3G71 A;  3CCJ A;  3SHW A;  3VJP A;  3OA6 A;  1ZUU A;  3M56 A;  3X28 B;  5FWB A;  1SEM A;  4QVC A;  4IIM A;  1CKA A;  2YXY A;  3FDR A;  5I21 A;  2XKO C;  1G3T A;  3L1A A;  1WPY A;  1WHG A;  2B8A A;  3SEM A;  4FYY B;  2E64 A;  4OML A;  4RTT A;  1HXD A;  1LOJ A;  4PLI A;  1WJS A;  1TWB A;  4PFZ A;  1ZSZ C;  4LDU A;  1UE9 A;  2RJF A;  2GF7 A;  3PE0 A;  2BZY A;  4E7S A;  1QP3 A;  4FM4 B;  4OMP A;  4Z88 A;  4QQG A;  5AYF A;  3WXM B;  3NGP A;  5AT1 B;  3V7R A;  2ZPG B;  2KY9 A;  3UDC A;  2V1R A;  4KT0 E;  4XTX A;  4TVR A;  2XHC A;  4JLG A;  3CPW P;  2CSQ A;  2DJQ A;  1UTI A;  3JCM f;  5LJ5 e;  1XTD A;  2RHU A;  2M16 A;  2KGT A;  4C8Q F;  5EC7 A;  4LDY A;  3BDL A;  2LMJ A;  2X4X A;  2CUD A;  2QEX T;  1PKS A;  4DBH A;  3QHS A;  1YP5 A;  3RUX A;  1WIE A;  2EYX A;  3QJY A;  2GTJ A;  2CKK A;  3VS4 A;  4BY6 C;  4M7D C;  1GL5 A;  5LJ3 j;  2QTX A;  2NUT A;  1WXB A;  1QWE A;  2R5M A;  4J5Y A;  5IXB A;  5I2M A;  3PNW C;  5IHK A;  2QG9 B;  1YIT A;  2QQ9 A;  3OYC A;  2DE0 X;  4M4Z A;  3FEO A;  1BU1 A;  1W4S A;  4D6W A;  3CBO A;  1VQM A;  4A4H A;  4C5E A;  1ZUY A;  1RAF B;  2FYK A;  4WTO B;  2NWM A;  3EFO B;  2G3R A;  4QW2 A;  1W2B A;  1RL2 A;  2FHD A;  4C92 G;  4RTY A;  4AFS C;  3ZL7 C;  3A8M B;  4C0F A;  1PM3 A;  2DXC A;  1I07 A;  1NPR A;  4CC4 B;  3EGU A;  3L2W A;  4OF1 A;  2YRD A;  2GNC A;  4UC4 A;  4EMK B;  4C8Q C;  4PJL A;  2LJ1 A;  2QQA A;  2CGH A;  2RK1 A;  1UGP B;  1LNX A;  3TSZ A;  3F70 A;  1AZE A;  2RN8 A;  4ZN3 A;  3HSB A;  1VQ6 T;  1KC8 U;  4HCB A;  5L8R E;  4R55 A;  4BE2 A;  2O9V A;  3O8V A;  2QAS A;  1N27 A;  4GY5 A;  3HKS A;  1F1B B;  2EJG A;  4J7F A;  3PMT A;  3BY7 A;  2BUD A;  1YNZ A;  2EKO A;  4YTL A;  2D0N A;  1KFZ A;  1KC8 R;  2FPF A;  2VYT A;  3V8K A;  2VXE A;  2CZ6 B;  2DLP A;  2KT1 A;  1GBQ A;  4V2S A;  2GBQ A;  3TVT A;  1QP2 A;  1Y7X A;  2E70 A;  4BB7 A;  4M77 A;  2IPO B;  2X4Y A;  2ZPI B;  2DTO A;  4M7D E;  4E47 A;  2LDM A;  3EFO A;  3H0I A;  1UEB A;  1BIA A;  2HQX A;  2KI7 A;  2RA2 A;  1PKT A;  1RI0 A;  4MMK A;  2DL7 A;  1OUL A;  3N5B B;  4F7U E;  4C5I A;  4M77 D;  1WHJ A;  3M57 A;  2Z0W A;  3C12 A;  3FC3 A;  1IHW A;  1AD5 A;  4VUB A;  4A4G A;  1K9A A;  2LJ0 A;  2D8J A;  4Y28 E;  3CPW S;  4CC3 A;  5GMK i;  2ZPH B;  3EG3 A;  2EYZ A;  3FB9 A;  3C4S A;  1VQ9 Q;  2CYZ B;  4M78 A;  1BI2 A;  1QWF A;  1UGQ B;  4CI0 C;  2OTJ T;  3QWY A;  4J83 A;  4M77 C;  3VS5 A;  2QEX Q;  3QPH A;  1KIK A;  4KGX B;  3HL8 A;  3NMZ C;  1RAA B;  3CCV A;  1C1A A;  1IHV A;  1TG0 A;  1VQ4 T;  1VQ8 T;  1QVF A;  4MML A;  1QKW A;  1ZSZ B;  4GLM A;  1KQS P;  4Y92 A;  3A8L B;  3QYH B;  1M4Z A;  1ZBX A;  4LNP A;  2BZX A;  2QGG A;  1IZ6 A;  2VAS A;  1Q86 U;  3VRZ A;  1PRL C;  2HL5 C;  1YI2 T;  5GMK m;  4JZ3 A;  2GCX A;  4BI3 A;  3S3O A;  4C8Q D;  2RI2 A;  3CCV T;  2PTK A;  2DBK A;  3MP1 A;  2JMA A;  2EQJ A;  1PD0 A;  1WXU A;  3OYL A;  2EQK A;  2E5Q A;  1QMC A;  2F69 A;  2XDB A;  3HRU A;  3A98 A;  3E2U A;  1UFF A;  4OB1 B;  1PRM C;  3OYI A;  2CP0 A;  3QO3 A;  1EIF A;  1HD3 A;  1HYO A;  1Y0M A;  2BIV A;  2DZC A;  1YN8 A;  3C94 A;  4CC2 A;  5D6W A;  1IRX A;  2K3X A;  3P8D A;  5IT9 E;  3QWX X;  1OU9 A;  4DBQ A;  2PUO B;  1HSQ A;  1SSH A;  4FYV B;  1YCY A;  3JCM V;  3FLG A;  1W2B P;  2BTT A;  4HCZ A;  2BE9 B;  2JMC A;  3H9N A;  3I55 Q;  3RKW A;  4M78 F;  5LJ5 g;  1TH7 A;  2Y4Y A;  1VQ5 Q;  2Y4X A;  5DY9 A;  3GIB A;  1CSK A;  4ORZ A;  5HY6 A;  1RLP C;  2CP6 A;  2EGE A;  4Q5W A;  4QKU A;  1Z9Q A;  2DIL A;  2E4H A;  4AFU C;  2K3B A;  5LL6 S;  5J39 A;  2GGR A;  1OPK A;  1OV3 A;  1WHH A;  2RQU A;  1VQ5 T;  4C92 D;  1T3S A;  2C0O A;  2PQW A;  1Q7Y C;  1NJI C;  2V26 A;  1Q82 U;  4LDW A;  4ZGD B;  4ZTF A;  3CPW A;  4A53 A;  2K3Y A;  2I0N A;  4FT4 A;  2KR3 A;  4EDU A;  1NE8 A;  1X43 A;  4DBF A;  3I9Q A;  3CD6 T;  3JB9 H;  1XQH A;  4M75 B;  1NLP C;  2OAW A;  1JXM A;  5GAO r;  4N4I A;  3CEY A;  3CCM T;  2DM1 A;  2YUP A;  2CZ7 B;  2PNI A;  3VYH B;  4R56 A;  4C5G A;  2DNU A;  2DTI A;  2FRY A;  2F5K A;  4DEX A;  2QXF A;  1IRE B;  5KE3 A;  4J9E A;  1VQN A;  2DPP B;  1UDL A;  1LPL A;  4QT7 A;  4MZP A;  1JU5 C;  4BI8 B;  1B34 B;  2RJC A;  4ZGE B;  1GBR A;  4J8O A;  3ZEH A;  1D1B A;  4N0A C;  3LH5 A;  2KQW A;  3KUF A;  2F2W A;  2RI3 A;  3LGF A;  3HRS A;  5GAN 5;  4FCY A;  2DYI A;  2L3P A;  3S6W A;  1UGV A;  4F7U F;  2HD0 A;  1O75 A;  2EAY A;  4O6J A;  1OQK A;  3OYJ A;  3MP6 A;  2HL3 A;  4LD9 K;  1D3B B;  1JJ2 A;  1Z9Z A;  3SWN B;  1QVF S;  4BDY A;  4DEY A;  1NYF A;  5FRM A;  5D7U A;  1VQN Q;  3JAM E;  3J7A F;  2D0Q B;  2QQB A;  1G8X A;  1VQP T;  1IB8 A;  2KK4 A;  1GCP A;  1YBY A;  4B6M A;  2CH4 W;  4ZN1 A;  4X9C A;  3FJP A;  2VKN A;  2L8D A;  2V8J A;  2MMP A;  1UB4 A;  2PVG B;  3JCM e;  4RTX A;  3OS5 A;  3FIF A;  3CCR A;  4M75 F;  5GAN 4;  1T0J A;  1K9M U;  2DRK A;  5FLX E;  4B9W A;  1YJW A;  1PWT A;  4M7A E;  5GJW B;  3I35 A;  4RTW A;  4EMH A;  5KCH A;  2PUK B;  3THK A;  4OMO A;  2CDT A;  3MP8 A;  1H3Z A;  2YT6 A;  2SRC A;  1BI0 A;  4F7U B;  4M78 B;  4J6Y A;  4C92 F;  5FU7 C;  1PSE A;  5LJ5 h;  4M75 G;  1PNJ A;  1Y96 A;  1ABQ A;  5CKB A;  1X01 A;  4PJO D;  4OP0 A;  3HRT A;  2J7I A;  1R0B G;  3G1J A;  1KD1 C;  3GNG A;  1X75 C;  1K76 A;  2E65 A;  1M90 C;  1NM7 A;  1UJ0 A;  2ESW A;  4JRI A;  1B07 A;  2DXB A;  4PLL A;  2YWW A;  2DXU A;  2L3S A;  3QXE B;  5GAO q;  5GAN j;  3VUZ A;  2HNI A;  3REB B;  2E12 A;  1S72 T;  5CQX A;  2CZ0 B;  3EGD B;  3ULR B;  1B34 A;  1N9R A;  3V7C A;  3H0H A;  3JCM J;  3M0S A;  4OB2 B;  5ECA A;  5LJ3 h;  3VUB A;  3JB9 G;  3M0P A;  5FRO A;  2LT4 A;  1K73 C;  3T9N A;  1MND A;  2FPD A;  1M90 U;  2EYQ A;  2RM4 A;  2K6D A;  2KDS A;  1Q81 R;  3JB9 I;  2VB6 A;  3CPF A;  3ZBD A;  2X9H A;  4KBM B;  1PC0 A;  2AHJ B;  4QQD A;  3I56 A;  4O5V A;  1QQJ A;  2PZ1 A;  1OOT A;  1WFW A;  3M54 A;  4RTZ A;  4AG1 C;  1Y96 B;  4ELZ C;  1H8K A;  2M9U A;  3P8H A;  1WGS A;  5J26 A;  2XDD A;  3OMG A;  5GMK j;  4CC7 A;  5GAN h;  5DLO A;  5CR2 A;  2XG8 D;  3WVD B;  6AT1 B;  1YFN A;  1H3H A;  2JOY A;  3QJ6 A;  1M3C A;  1QVG S;  3OW2 A;  1AVZ C;  5KYU B;  1LCK A;  3CCU T;  4GBQ A;  1Q86 C;  1Y57 A;  4PFO A;  1SHF A;  1QVG A;  1VQL Q;  2CH4 A;  4ZTJ A;  3CCL T;  1YIT T;  1I5O B;  3DKM A;  5IXF A;  5GAN g;  4K11 A;  1JJ2 S;  2KE9 A;  2HZY A;  1FMK A;  2QAZ A;  1G3S A;  2P4T A;  4NS5 A;  5A0L A;  1WHM A;  2HQH A;  4JS5 A;  4KUL A;  4KH1 B;  4AFQ C;  3LLR A;  3NTK A;  1M5Q 1;  2EGC A;  4FYX B;  2V1Q A;  2D6F A;  3NPF A;  4A54 A;  4A63 B;  2HSE B;  2DEU A;  1B7T A;  1YI2 A;  2MCN A;  1UGR B;  2HMA A;  4XU0 A;  3FJ5 A;  1M1K R;  2B86 A;  2LVM A;  2Y90 A;  4HCC A;  2SEM A;  3MO8 A;  3CC2 A;  3OSS C;  4Y91 A;  4XU1 A;  1M30 A;  1VQK A;  2MYS A;  2ROL A;  3JCM X;  4KGZ B;  2E6Z A;  3RBB B;  3UAT A;  2X4J A;  4OMQ A;  3CC2 T;  1VQP A;  4IUU A;  4Z02 A;  1ACM B;  2KRM A;  5CKD A;  4M7D A;  2F1L A;  1N8R C;  1ARK A;  4XQ3 A;  3A8H B;  1YIJ T;  1YHQ Q;  4IUV A;  3CC7 T;  3VV0 A;  3RNJ A;  2YRV A;  5GAN 3;  5FW9 A;  2NUZ A;  1V76 A;  4F7U A;  3TU4 K;  2HQE A;  4ELY C;  2MI6 A;  1KQ2 A;  2JS2 A;  2OI3 A;  2A0F B;  5EG2 A;  2W10 A;  2EVR A;  1Q82 R;  2XDP A;  2DKG A;  2QEX A;  1M27 C;  4MZM A;  1YIJ Q;  4NOY A;  5LJ3 g;  2FZC B;  2NUT B;  4J9I A;  3G6E A;  2D1X A;  1IXD A;  2ENM A;  4A4F A;  1V1C A;  1KHI A;  2MIO A;  1TTH B;  4D8D A;  1NJI U;  3SB2 A;  3G7Z A;  4M78 E;  3OQ5 A;  4KRT A;  3G71 T;  4DBR A;  5HK0 A;  4E7H A;  4ZGJ B;  4BI4 A;  1M2V B;  3QKJ A;  4GLK A;  1RAG B;  3LWI A;  2DAQ A;  3JCM b;  4X9D A;  4IUT A;  1KQS A;  2P4R A;  5GJV B;  1M1K C;  1UHF A;  2DJZ A;  4JZ4 A;  2DBM A;  1M3A A;  4HVV A;  4JJB A;  3EH2 A;  3JCM h;  3CCE Q;  1K8A C;  3CCJ Q;  2DET A;  4C92 B;  1M90 R;  2K9G A;  3VS6 A;  2OTL T;  4E6R A;  2ZGW A;  1VOM A;  4F16 A;  3VKI A;  2FG0 A;  2KRN A;  1M1K U;  1OYX A;  5GAO p;  1VQL T;  2VC8 A;  2VUB A;  1M1F A;  3HFO A;  2DF6 A;  3DB4 A;  5IHI A;  2ECZ A;  2WAC A;  4JJN K;  3UA7 A;  2F2X A;  1VIF A;  3L2U A;  3OW2 S;  3PTA A;  4E7K A;  2CSI A;  1Q7Y U;  1H92 A;  1VQ7 A;  3LW5 E;  3V7S A;  1GXI E;  1NEG A;  1I4K 1;  3L2R A;  4M77 F;  2RMO A;  5M9O A;  2EQM A;  4M7D G;  2AK5 A;  4C0G A;  4IKF A;  1VYV A;  2RNA A;  1VQ7 T;  4N4H A;  1VQM T;  1MGQ A;  1JEG A;  2LX7 A;  2X51 A;  3I56 Q;  2YLB A;  3I5R A;  2EGA A;  3X20 B;  4Z89 A;  3CBM A;  1EX4 A;  1WDX A;  5GAM j;  3E9F A;  2LCL A;  3TRE A;  1N9S A;  4XK8 E;  3KBG A;  2JXB A;  3JCM c;  1KHC A;  3RMS A;  1VQ6 A;  3X26 B;  2WSC E;  2QTV A;  3REA B;  4M7A D;  1LJO A;  1W70 A;  2ED0 A;  5GMK e;  3ME9 A;  4LXC A;  1KK7 A;  2X3W D;  1NG2 A;  1RAI B;  3SD4 A;  1C0M A;  2COZ A;  4QQ6 A;  2JUF A;  3AT1 B;  4C0Z A;  1KSW A;  4M7D B;  1OI1 A;  5CAI A;  2FEI A;  2YUO A;  1RAD B;  4OB3 B;  2XD0 A;  3INZ A;  5GAO m;  3EG9 B;  3CME A;  4IUR A;  5HKC A;  3OY9 A;  1S72 Q;  2M02 A;  1TUC A;  1AEY A;  1UGS B;  4RUG A;  2DMO A;  1TU0 B;  3OYA A;  3QDR B;  3CMA A;  4J9F A;  4BE0 A;  2GQI A;  1W1F A;  3VYG A;  1VYU A;  4DA4 A;  3G6E Q;  3O5Z A;  4XU3 A;  1GFD A;  2KNB B;  2E3H A;  2MF2 A;  1YJW T;  1BYM A;  3CCQ Q;  1X69 A;  2M0Y A;  1SF9 A;  3CCS T;  2EFI A;  2XMF A;  3CMA T;  2O9S A;  4MDX A;  2L2P A;  3R6O A;  1BKB A;  4FW2 A;  4JRP A;  2K5I A;  1OZ3 A;  1WJR A;  1AOJ A;  1VQO T;  1AWJ A;  2JJ9 A;  4LUE A;  1JB0 E;  1OZ2 A;  1U1T A;  3MPU B;  4M78 D;  3M4G A;  2JTE A;  4J9D A;  1NPP A;  1RAB B;  4IUQ A;  3CC4 T;  3RER A;  2K5L A;  3J81 E;  2LQN A;  3CMA Q;  3CCS Q;  1YJN T;  1D0Z A;  2FRW A;  2RD1 A;  1VQO A;  1H64 1;  4OMM A;  2EQU A;  2RO0 A;  2EKH A;  5GAM g;  4E7I A;  2PVO B;  5KYW B;  3PT9 A;  1YWO A;  2HBW A;  2LZ6 B;  3H6Z A;  1Q81 U;  2J6F A;  3M55 A;  2P84 A;  1GCQ A;  3C0C A;  3RDV A;  2QI2 A;  2LRQ A;  1OEB A;  2ZPF B;  2KVQ G;  4C92 C;  4OGE A;  5J3B A;  1IO6 A;  4MDW A;  3EGD A;  5KYN A;  5KYY A;  1G3W A;  2FPE A;  3M5A A;  3GPL A;  2YSQ A;  1VQ8 A;  4M7A G;  1WHK A;  5GAM h;  1XJW B;  2DRM A;  1MV3 A;  1AZG B;  1FX7 A;  2VXF A;  2DFU A;  1QCN A;  3M59 A;  4XTU A;  3MJX A;  1FMW A;  2QA4 T;  5A0G A;  5KYX B;  2JTF A;  2NYS A;  2IVW A;  5KYU A;  3CCE A;  2DXT A;  1FYN A;  4M7A F;  4PJO A;  5LJ5 j;  1ZA1 B;  2DL3 A;  4FT2 A;  1YJN A;  4M77 G;  1TS9 A;  2QYZ A;  3A8G B;  1VQ7 Q;  2O01 E;  1PG5 B;  1X6G A;  1LVK A;  2KAF A;  4C5H A;  5CKE A;  2LCC A;  3S3N A;  3VS1 A;  3KFV A;  3C95 A;  3EG9 A;  1AT1 B;  5LJ3 e;  2H3J A;  3HP9 A;  1RAE B;  2EQI A;  3SFM A;  3GP8 A;  4L6V 5;  1IGU A;  2EWN A;  1G2B A;  2ED1 A;  1KG1 A;  1SG5 A;  1ZBJ A;  3CCM Q;  4E7L A;  1K9M R;  1MMG A;  1MHN A;  4XU2 A;  3X25 B;  2GFA A;  1K1Z A;  3M0Q A;  2A28 A;  4PJO F;  2CZ1 B;  3PVL A;  3H41 A;  4RG8 A;  3KXT A;  1GFC A;  1SSF A;  1JBM A;  2XIC A;  2OTL Q;  3LH0 A;  2DL4 A;  3EGX B;  2NUP B;  1JJ2 P;  3L2Z A;  2EYY A;  1PD1 A;  3M53 A;  3A1P A;  2RF0 A;  2DO3 A;  4F17 A;  2F2V A;  2K7A A;  3QBY A;  4M75 C;  1NYG A;  4HT8 A;  4ESR A;  2LJ3 A;  1R0C B;  3LWH A;  1FMV A;  1U8R A;  3MCA B;  3JV3 A;  4RCC A;  1B3Q A;  3LGL A;  4XTY A;  2MK5 A;  1IGQ A;  5CO7 A;  1I81 A;  2CT4 A;  3I55 T;  3TCJ A;  1BK2 A;  2FVU A;  3NHN A;  4M7A B;  3A5Z B;  5A0D A;  3OYN A;  4MZT A;  3BE3 A;  2E3I A;  4WF2 A;  2DZ9 A;  4XTV A;  1R8O B;  2VWF A;  3VS3 A;  3SWN A;  2EPD A;  2OX7 A;  2EJF A;  2LT1 A;  4DQ2 A;  2QA4 Q;  4IIO A;  2DER A;  3IQL A;  1GRI A;  3EG0 A;  5FU6 C;  1NJI R;  4BY6 B;  2O4X A;  1M8M A;  5DLQ E;  5CK9 A;  4R0K A;  4AFZ C;  1WHL A;  3QZ9 B;  5KYX A;  4HA8 A;  3QG1 A;  3VU3 C;  3CC7 Q;  2W0Z A;  1NEB A;  1YHQ T;  1U3O A;  7AT1 B;  4JLI A;  2E5K A;  2XK0 A;  4M78 C;  5I11 A;  2MOX A;  2K57 A;  1Y71 A;  3P8B B;  1U06 A;  3RES A;  3CC2 Q;  4RKU E;  1VQ4 A;  3BW1 A;  4ATO A;  1UHC A;  3RKY A;  2NUP A;  2FZG B;  2CUB A;  2BZ8 A;  1D1C A;  4NL3 A;  4PJM A;  1VQK T;  1I1J A;  2YLC A;  2HAX A;  3ZFJ A;  2RJD A;  4PJO E;  2IIM A;  3GOX A;  1KQ1 A;  2RHY A;  5GAN d;  2QDY B;  2C0T A;  2YHT A;  2LX9 A;  1YJN Q;  1VQ8 Q;  1VQ4 Q;  1WQW A;  2DIG A;  2EW3 A;  2ABL A;  5FWC A;  4PK4 A;  1TUG B;  4LDV A;  2BKD N;  2QK0 A;  3CC4 Q;  1YCS B;  3JB9 J;  1VQ9 A;  4J9H A;  2COW A;  2HKQ B;  1VQO Q;  1W6X A;  4LN2 A;  1WLP B;  3OYF A;  4E2F B;  4JS4 A;  2OTJ Q;  1ZQ1 A;  2ZPB B;  4PJN A;  3HFN A;  1VQ9 T;  2A7Y A;  3CCQ T;  3OBW A;  1D09 B;  1YJW Q;  4A4E A;  1YIT Q;  4DOV A;  1AWX A;  3CBP A;  5I22 A;  3G6E T;  3CCM A;  2IG0 A;  4PJJ A;  3L42 A;  1HJD A;  1G5V A;  4L5G A;  3CCQ A;  4BAC A;  4E7Z A;  2LTO A;  5HK3 A;  2VGN A;  1KJW A;  3GF5 A;  2DA9 A;  3QUI A;  2M51 A;  2DYB A;  4F14 A;  1C6V X;  3JCM Q;  2A37 A;  2FO0 A;  3PGG A;  3OMC A;  3NTI A;  2E1H A;  3CCR T;  4XTW A;  2JTM A;  1BB9 A;  1K9M C;  2NLU A;  1WZO A;  4EMK C;  2LNV A;  1UJY A;  3OYG A;  2LQ8 A;  1NZ9 A;  1WX6 A;  2H3E B;  5IAY A;  9ATC B;  1D3B A;  3UPU A;  4RTV A;  2E6N A;  1TUD A;  1DJ7 B;  4NL2 A;  2LNH B;  4XAX B;  1K73 R;  3OYY A;  3CXC P;  4LUD A;  1WYX A;  1M8V A;  4M75 E;  4HCK A;  1VQ5 A;  3I56 T;  5CIU A;  4LDX A;  5KYY B;  2JNG A;  2P0Q A;  1BI3 A;  3I5S A;  1K8A U;  2ZZD A;  3CCR Q;  2AZS A;  2RK2 A;  3UA6 A;  1YJ9 A;  2OAU A;  4RMO A;  1OPL A;  1Q82 C;  2J06 A;  4J9B A;  4RTU A;  1ZSG A;  4X34 A;  3EFR A;  1G83 A;  1E6H A;  1WA7 A;  2RQR A;  2JT4 A;  4N0A A;  4BUG A;  4C8Q G;  3BFM A;  4OB0 B;  2G6F X;  1KD1 R;  3OSV A;  1KD1 U;  3M0T A;  2AT1 B;  2JM8 A;  3HPW A;  3JB9 F;  1OX8 A;  2VV5 A;  1K4U S;  3RMQ A;  2AIR B;  3M0U A;  2L0A A;  4HT9 A;  2QA4 A;  4PL6 A;  1M2O A;  4Z8A A;  4M7D F;  4C8Q A;  3OYD A;  4JJC A;  1RLQ C;  2DVE A;  1WJQ A;  4KH0 B;  4ME7 A;  4EMK A;  2FZK B;  4M75 D;  4A4K A;  3RKX A;  1YHQ A;  3CCJ T;  4HKE A;  3BDU A;  3EG2 A;  2CS7 A;  4EPC A;  5A2Q E;  2DD4 A;  2DL5 A;  2DEQ A;  3V8J A;  3OYM A;  3VS0 A;  3UT1 A;  1AWW A;  2L3R A;  4IUP A;  1K0S A;  2RJE A;  3E19 A;  1VQK Q;  3MHX A;  1T3L A;  2E41 A;  3DLM A;  5CQY A;  4PNO A;  1WI7 A;  4C92 E;  3OS0 A;  3GNF B;  1OU8 A;  4F7U G;  4FSX A;  4J6W A;  1AWO A;  1PHT A;  2V8K A;  1MMD A;  5CVI A;  4HVW A;  5IHN A;  2EJ9 A;  2GTO A;  5LJ3 f;  3M0R A;  5GAN 2;  1JO8 A;  2OJ2 A;  3AHU A;  5GAM f;  2D9T A;  1Y07 A;  1OX9 A;  4J9C A;  4M7A C;  2RB6 A;  2DL8 A;  3MEV A;  1RAC B;  5I2S A;  2XI9 A;  3CCU A;  4L59 A;  3OYE A;  2DX1 A;  5GAO l;  3M4Y A;  1MMN A;  3LX7 A;  2LQK A;  3RR6 A;  1AHJ B;  1XNI A;  1TXQ A;  2RQV A;  1WQ7 A;  5LJ3 d;  2R5A A;  1VUB A;  3LYI A;  2BE7 D;  3QYG B;  1K8A R;  4AMC A;  1PSF A;  5GAN e;  1E7O A;  3CXC A;  1PCX A;  3E9G A;  4ZNX A;  2DD5 A;  2A36 A;  3VS2 A;  4JRK A;  2A3L A;  1FWZ A;  2EBP A;  3J80 E;  8AT1 B;  3Q1J A;  1NLO C;  4AT1 B;  3FRN A;  3HHT B;  2MPX C;  2K2V A;  4BDZ A;  2P0P A;  4OMF B;  4FW1 A;  1YWP A;  2VVK A;  2OTJ A;  1BI1 A;  3CME T;  2LQW A;  2M0O A;  1SRL A;  2JM9 A;  3EHR A;  4PFP A;  1S1N A;  1QVG P;  2K2M A;  5LJ5 d;  5GAO n;  1D1A A;  2ROT A;  4EIK A;  1VA7 A;  3CD6 A;  2O2O A;  4QVZ A;  2QGF B;  2RHZ A;  3CCL Q;  5GAM d;  3MEA A;  4JUV A;  5CKF A;  2OTL A;  3TQ7 P;  1FXX A;  4KUI A;  5FU6 B;  3MEW A;  4B9X A;  3CCU Q;  4JJD A;  1JXO A;  1YJ9 Q;  2DVJ A;  4C0D B;  1T0H A;  4RCB A;  2JZ2 A;  2QQR A;  2J05 A;  3CC4 A;  2H8H A;  2RH2 A;  3G4S A;  5KCO A;  2HDA A;  1VYT A;  5LJ5 f;  1X2Q A;  3I55 A;  3DB3 A;  1RUW A;  1MV0 B;  2P0K A;  1HK9 A;  3CXC S;  4JDS A;  3CCL A;  2MAM A;  5GAN 6;  3RIR A;  2L89 A;  2DK3 A;  3TSW A;  1JQQ A;  2K4Y A;  1QCO A;  1SRM A;  3ER0 A;  1BBZ A;  1YIJ A;  2AKL A;  3EFS A;  2HEQ A;  4OVA A;  1EFN A;  4FU6 A;  2KYB A;  1G3Y A;  2CP7 A;  1I8F A;  3QII A;  3G4S T;  2WSF E;  1SKU B;  2HCK A;  2LC4 A;  4J9G A;  4D8K A;  2O4X B;  2K79 A;  3JCM d;  1BCM A;  4HXJ A;  5GAN 8;  3CCV Q;  2ATC B;  4PJO B;  1MMA A;  2XU8 A;  1A0N B;  1U1S A;  2EIF A;  2ZAE A;  3JSC A;  1YI2 Q;  2KYM A;  1I0C A;  4F04 B;  1Q86 R;  2DTH A;  2X3X D;  1SHG A;  2RHX A;  4C8Q B;  5FU7 B;  4PJO C;  1XOV A;  2CP5 A;  5KE2 A;  2CP3 A;  2RPN A;  4JRQ A;  1NBE B;  5C6S A;  3A8O B;  5C0M A;  2K5F A;  1V29 B;  1X27 A;  2HBP A;  2KEA A;  1ZLM A;  2YUN A;  3MKD A;  3X24 B;  4E7J A;  5FRN A;  1VQL A;  1ZUK A;  5D6Y A;  2AZV A;  1N8R U;  1D0Y A;  3WVE B;  1KC8 C;  3D7S B;  3OB9 A;  2CT3 A;  2C06 A;  1SPK A;  2HKN A;  2YRC A;  2O31 A;  2ZPE B;  3NTH A;  1N6A A;  1QW1 A;  2VGM A;  3QDF A;  1UEC A;  2CRE A;  4KUD K;  3PFS A;  5CKH A;  1KQS S;  4C92 A;  1M9S A;  4P5N A;  5GMK h;  2J6K A;  1K73 U;  3UWN A;  1GCQ C;  1I5L A;  2RHI A;  4WCI A;  1BIB A;  3EH1 A;  4FIB A;  1P92 A;  1QLY A;  3S3M A;  2DIQ A;  2X35 A;  4ANJ A;  4XTZ A;  1QVF P;  1QCF A;  3L2V A;  2M1H A;  4CRI A;  2LCS A;  2KRO A;  4C8Q E;  2QQS A;  4J7I A;  3PIO A;  4M77 B;  3CC7 A;  3M9Q A;  2PU9 B;  1VQP Q;  2WSE E;  2JN0 A;  4M7D D;  2JW4 A;  3GBQ A;  2RQT A;  1VQN T;  1EZZ B;  2R58 A;  3GLX A;  4DOW A;  1TOV A;  4PJO G;  3EG1 A;  1ZHI A;  2J6O A;  1M3B A;  2FB7 A;  2KXC A;  2D8H A;  2RI5 A;  2KXD A;  5KH6 A;  3JCM P;  3EHQ A;  3V8L A;  2KSS A;  1CKB A;  4QVD A;  3U23 A;  2E10 A;  1ABO A;  1RI9 A;  1JRI A;  3MET A;  4OGC A;  4BE1 A;  3JRZ A;  3OYK A;  4N4G A;  2R57 A;  4C0D C;  3ASK A;  2KT8 A;  4M77 E;  3VS7 A;  2MWO A;  2KRS A;  5D6X A;  2CP2 A;  1VQM Q;  4II1 A;  3OYH A;  1UG1 A;  1WNL A;  4RG2 A;  3OBY A;  5CCA A;  1BCO A;  1ZSZ A;  2KMT A;  4OMN A;  1X6O A;  4JPB W;  3SDZ A;  2EYW A;  4LD6 A;  3G4S Q;  2L3Q A;  1MNE A;  1VQ6 Q;  3PIP A;  2HSP A;  2MWP A;  4EMG A;  1Q81 C;  1O9S A;  1UUE A;  2ZCF B;  3L2Q A;  3JB9 D;  2PVD B;  8ATC B;  1D0X A;  3NFC A;  1K0X A;  1TSF A;  1U5S A;  1WXT A;  3TEE A;  2LP5 A;  1X6B A;  3JCM g;  3CD6 Q;  1QKX A;  3CCS A;  1X2K A;  3H8Z A;  5DM7 R;  3QSU A;  4KGV B;  3QZ5 B;  5L23 A; 
#chains in the Genus database with same CATH homology
 4HVU A;  4RTU A;  3I5R A;  4FSS A;  1ZSG A;  2EGA A;  2C0I A;  3UF4 A;  4Z89 A;  1G83 A;  1NLP C;  2JS0 A;  2OAW A;  1JXM A;  1WDX A;  2DM1 A;  1E6H A;  1WA7 A;  2A08 A;  2JT4 A;  2RQR A;  2YUP A;  2PNI A;  2RQW A;  2AKK A;  2JXB A;  2DNU A;  4DEX A;  2FRY A;  2O88 A;  2G6F X;  3M0T A;  3REA B;  2JM8 A;  1K4U S;  1W70 A;  3M0U A;  5HCK A;  2ED0 A;  4J9E A;  1UDL A;  3H0F A;  2L0A A;  1MUZ A;  2KBT A;  2QDL A;  2X3W D;  1NG2 A;  4QT7 A;  1J3T A;  1JU5 C;  4Z8A A;  1GBR A;  1KSW A;  4X1V A;  5IH2 A;  4JJC A;  1RLQ C;  1E6G A;  3LH5 A;  2FEI A;  4LE9 A;  1N5Z A;  2YUO A;  2YUQ A;  2F2W A;  2YDL A;  4AG2 C;  3EG2 A;  3VRY A;  3PVQ A;  2L3P A;  3R6N A;  1UGV A;  1TUC A;  1AEY A;  4RUG A;  2DMO A;  3CQT A;  1ZX6 A;  2DL5 A;  4J9F A;  3SHW A;  2GQI A;  3VS0 A;  1W1F A;  1ZUU A;  1VYU A;  1AWW A;  3O5Z A;  1K0S A;  1GFD A;  2KNB B;  5FWB A;  1SEM A;  1Z9Z A;  4IIM A;  1CKA A;  1T3L A;  1X69 A;  4DEY A;  2M0Y A;  2XMF A;  1WI7 A;  2O9S A;  1NYF A;  2L2P A;  3SEM A;  1AWO A;  1AOJ A;  1PHT A;  4OML A;  1AWJ A;  4RTT A;  4LUE A;  4HVW A;  1GCP A;  2JTE A;  4J9D A;  2CH4 W;  5IHN A;  2GTO A;  2VKN A;  3M0R A;  2LQN A;  1UE9 A;  1JO8 A;  2OJ2 A;  3PE0 A;  4RTX A;  2BZY A;  2FRW A;  4J9C A;  4OMP A;  4Z88 A;  1T0J A;  4OMM A;  2DL8 A;  2EKH A;  3NGP A;  2DRK A;  1PWT A;  2V1R A;  5GJW B;  3I35 A;  4RTW A;  3THK A;  2DX1 A;  1YWO A;  2LZ6 B;  2HBW A;  4OMO A;  2CSQ A;  2CDT A;  2J6F A;  2DJQ A;  1GCQ A;  1UTI A;  3C0C A;  2YT6 A;  2RQV A;  2KGT A;  2SRC A;  5EC7 A;  1OEB A;  2LMJ A;  2CUD A;  1PKS A;  1IO6 A;  1YP5 A;  1PNJ A;  1E7O A;  1WIE A;  2EYX A;  2FPE A;  1ABQ A;  4ZNX A;  2GTJ A;  3VS4 A;  1GL5 A;  2YSQ A;  1WXB A;  1QWE A;  2A36 A;  2J7I A;  3VS2 A;  5IXB A;  2DRM A;  5IHK A;  2EBP A;  1K76 A;  1MV3 A;  1AZG B;  2DE0 X;  1NM7 A;  4M4Z A;  1BU1 A;  1UJ0 A;  2ESW A;  1B07 A;  1NLO C;  2L3S A;  1ZUY A;  3REB B;  2NWM A;  1YWP A;  2VVK A;  3ULR B;  1FYN A;  2LQW A;  2DL3 A;  1SRL A;  2JM9 A;  3H0H A;  4RTY A;  4AFS C;  3EHR A;  3ZL7 C;  3M0S A;  5ECA A;  1S1N A;  1X6G A;  3M0P A;  2K2M A;  3VS1 A;  1I07 A;  3KFV A;  2ROT A;  4CC4 B;  4EIK A;  2FPD A;  1VA7 A;  3EGU A;  2O2O A;  2GNC A;  2K6D A;  2EQI A;  2LJ1 A;  3TSZ A;  1AZE A;  1G2B A;  2RN8 A;  2ED1 A;  4JJD A;  1JXO A;  2PZ1 A;  2DVJ A;  1OOT A;  1T0H A;  1ZBJ A;  1WFW A;  4RTZ A;  2J05 A;  4AG1 C;  2H8H A;  1H8K A;  2HDA A;  1VYT A;  1K1Z A;  3M0Q A;  2A28 A;  1X2Q A;  2O9V A;  3PVL A;  3H41 A;  1RUW A;  1GFC A;  1MV0 B;  4CC7 A;  2DL4 A;  2EYY A;  1H3H A;  2RF0 A;  3TSW A;  1JQQ A;  1YNZ A;  1M3C A;  2D0N A;  4F17 A;  2F2V A;  1AVZ C;  1KFZ A;  1SRM A;  1BBZ A;  2FPF A;  2K7A A;  1NYG A;  2AKL A;  1LCK A;  2HEQ A;  4ESR A;  2LJ3 A;  1EFN A;  2DLP A;  2KT1 A;  1GBQ A;  4GBQ A;  2KYB A;  3JV3 A;  1B3Q A;  2GBQ A;  1Y57 A;  1SHF A;  3TVT A;  2CH4 A;  2CT4 A;  2HCK A;  5IXF A;  4J9G A;  1BK2 A;  4K11 A;  4D8K A;  2KE9 A;  3NHN A;  2K79 A;  1FMK A;  4HXJ A;  3H0I A;  1PKT A;  4AFQ C;  1A0N B;  2EGC A;  2DL7 A;  2V1Q A;  2VWF A;  3VS3 A;  3NPF A;  4A63 B;  2KYM A;  2MCN A;  1I0C A;  2EPD A;  3FJ5 A;  2B86 A;  2X3X D;  1SHG A;  4IIO A;  1XOV A;  3IQL A;  1GRI A;  2RPN A;  1AD5 A;  3EG0 A;  2SEM A;  1K9A A;  2LJ0 A;  1M8M A;  2D8J A;  1X27 A;  4R0K A;  4AFZ C;  2KEA A;  1M30 A;  4CC3 A;  3EG3 A;  2EYZ A;  2ROL A;  1ZLM A;  2YUN A;  2W0Z A;  1NEB A;  3RBB B;  1ZUK A;  3UAT A;  2AZV A;  1U3O A;  4OMQ A;  1QWF A;  2E5K A;  2CT3 A;  3QWY A;  1SPK A;  3VS5 A;  5I11 A;  2O31 A;  2KRM A;  2MOX A;  1KIK A;  1UEC A;  2CRE A;  1U06 A;  1ARK A;  3NMZ C;  1TG0 A;  1UHC A;  2CUB A;  3RNJ A;  2BZ8 A;  2J6K A;  5FW9 A;  2NUZ A;  1GCQ C;  1I1J A;  4WCI A;  1QKW A;  4GLM A;  4Y92 A;  1QLY A;  2IIM A;  2JS2 A;  2OI3 A;  2W10 A;  2C0T A;  2EVR A;  4LNP A;  2BZX A;  1QCF A;  1M27 C;  2EW3 A;  2ABL A;  2LCS A;  5FWC A;  4J9I A;  3VRZ A;  2KRO A;  1PRL C;  2D1X A;  2ENM A;  1YCS B;  4JZ3 A;  4J9H A;  1V1C A;  2MIO A;  4D8D A;  1W6X A;  4LN2 A;  1WLP B;  2JW4 A;  3GBQ A;  4KRT A;  2PTK A;  2RQT A;  2DBK A;  2JMA A;  1WXU A;  3EG1 A;  2J6O A;  1AWX A;  1M3B A;  2KXC A;  3A98 A;  5I22 A;  2D8H A;  2KXD A;  2P4R A;  5GJV B;  3EHQ A;  1CKB A;  1UFF A;  1UHF A;  3U23 A;  1ABO A;  1RI9 A;  1PRM C;  1HJD A;  4JZ4 A;  2DBM A;  1M3A A;  1KJW A;  4HVV A;  4JJB A;  2DA9 A;  1HD3 A;  1Y0M A;  2M51 A;  1YN8 A;  2KT8 A;  3VS7 A;  2DYB A;  4CC2 A;  2KRS A;  4F14 A;  2A37 A;  2FO0 A;  2K9G A;  3VS6 A;  1UG1 A;  3QWX X;  1HSQ A;  1SSH A;  1BB9 A;  4OMN A;  1UJY A;  4E6R A;  4F16 A;  2BTT A;  4JPB W;  2JMC A;  2EYW A;  2FG0 A;  2KRN A;  1WX6 A;  2L3Q A;  2DF6 A;  5IHI A;  2HSP A;  1CSK A;  2ECZ A;  4ORZ A;  4RTV A;  1RLP C;  2EGE A;  1TUD A;  1Z9Q A;  3UA7 A;  2F2X A;  1UUE A;  2DIL A;  2LNH B;  4AFU C;  2K3B A;  2GGR A;  4LUD A;  1K0X A;  1OPK A;  1OV3 A;  1WYX A;  1U5S A;  2CSI A;  2RQU A;  1WXT A;  1H92 A;  1T3S A;  2LP5 A;  1X6B A;  2C0O A;  4HCK A;  1NEG A;  1QKX A;  2RMO A;  3I5S A;  2AK5 A;  2I0N A;  2KR3 A;  2RNA A;  1VYV A;  1X2K A;  1X43 A;  2AZS A;  3UA6 A;  3I9Q A;  1JEG A;  1OPL A;  2LX7 A;  2J06 A;  4J9B A;  5L23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...