2M0YA

Solution structure of the sh3 domain of dock180
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIFPASYIHLKEAIVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of DOCK180.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
molecule keywords Dedicator of cytokinesis protein 1
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2012-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2m0yA00
1UFFA 3R6NA 5IHKA 1WDXA 1QKXA 2KYMA 1QCFA 4QT7A 2JM9A 1QKWA 1RLQC 2SRCA 2AZSA 2F2VA 1EFNA 1PKSA 2BZ8A 5HCKA 3PVLA 5IHIA 2DILA 2GQIA 2CT4A 1ABQA 1M3BA 4D8KA 2KYBA 1X43A 1Z9ZA 2BZYA 2C0OA 2M51A 2ROLA 1X6BA 2KRMA 1E6GA 2EYWA 1X2KA 2RQUA 2HSPA 2KEAA 1A0NB 3VS6A 2F2WA 1YCSB 2RQRA 2JTEA 3SEMA 2DLPA 4AG2C 4IIOA 4ORZA 2FRWA 2OI3A 1CSKA 1U5SA 3H0HA 2QDLA 2LQWA 5FW9A 2CH4A 1E6HA 2EBPA 2W10A 2J6OA 2GTJA 4JJDA 2PZ1A 1NEGA 1U3OA 1JXMA 1Y57A 2SEMA 3UA6A 1NEBA 2CREA 2RF0A 3FJ5A 2KR3A 1FYNA 2GGRA 1YNZA 1K1ZA 3I35A 4F14A 2JT4A 2DBKA 4OMOA 1J3TA 1NYGA 4CC2A 2EW3A 1SEMA 1UECA 2CT3A 2DA9A 4HXJA 1GFDA 4GBQA 1WXTA 2EGAA 2FPEA 2VVKA 1X27A 1WIEA 5IHNA 1YWPA 3A98A 2DMOA 4RTYA 4D8DA 4FSSA 1BBZA 5I22A 1GRIA 2V1RA 4J9FA 1PHTA 1TUDA 1KFZA 1UHCA 2K7AA 1QWFA 1ZUKA 1JQQA 1W6XA 3EG0A 2LP5A 1OOTA 3M0SA 3EG2A 2DNUA 1GCQA 1PRMC 5FWBA 4LUEA 2ED0A 4DEXA 2YUNA 3IQLA 1MUZA 4J9CA 3H0FA 2DRKA 1NYFA 3SHWA 3VS4A 3EG1A 4OMLA 2EGEA 4WCIA 4CC3A 3REBB 3REAB 2GTOA 1OPLA 2A37A 2CUBA 3ZL7C 3M0TA 3QWXX 1JO8A 1W1FA 2ENMA 3U23A 1AZEA 4DEYA 2ECZA 4Z88A 1WFWA 1HD3A 4K11A 1CKBA 2FRYA 1UJYA 1I0CA 2PNIA 4Z8AA 4EIKA 2JMCA 2EGCA 4OMMA 1UDLA 2DM1A 1UHFA 2D0NA 1WXUA 3EHRA 1AEYA 2YSQA 1ZUYA 4J9GA 4E6RA 1M8MA 2FPFA 1RUWA 3NGPA 3M0QA 1X69A 5I11A 2EYYA 2OAWA 2DX1A 2DE0X 1ZSGA 2ESWA 1AWWA 2A28A 2DRMA 2O2OA 1HSQA 4A63B 1W70A 3H0IA 2JM8A 4RTUA 4F17A 1GFCA 1UJ0A 2V1QA 2YDLA 3TSZA 1T3LA 2HDAA 2EKHA 1UG1A 3NMZC 3TVTA 1GBRA 3RBBB 2G6FX 4JJBA 1JXOA 2LZ6B 3UF4A 1YP5A 2O31A 4HVWA 1MV3A 1LCKA 2F2XA 1TUCA 1GCPA 2K9GA 1ABOA 2CH4W 2LJ0A 2I0NA 4LUDA 4CC4B 1AD5A 1Y0MA 1ARKA 1GBQA 2CSQA 1QLYA 1KSWA 2EYXA 2FPDA 2PTKA 2W0ZA 2KRNA 1TG0A 2DYBA 4RUGA 1OV3A 4OMNA 2ROTA 4J9IA 2J06A 3C0CA 2YT6A 3JV3A 4HCKA 2LMJA 2K2MA 1T0HA 4AFSC 1M30A 2HEQA 1CKAA 2EPDA 2CSIA 1BK2A 4R0KA 1WYXA 2A08A 2MIOA 2YUQA 2AKLA 2L3PA 3PE0A 4Y92A 5EC7A 2RQWA 3EG3A 1KJWA 2DVJA 2JW4A 2L0AA 1B3QA 1AWOA 1PNJA 2DL7A 1H3HA 2B86A 3NHNA 1K0XA 1SPKA 3VS7A 1N5ZA 1AWXA 1T3SA 2K6DA 2D8JA 2L3SA 2P4RA 1SRMA 4J9HA 2KT1A 2X3XD 2BZXA 1AWJA 2EVRA 1JEGA 2KGTA 2DL5A 4X1VA 2KXCA 2M0YA 1PWTA 2AZVA 2YUOA 1AZGB 4F16A 2HBWA 2D1XA 2O9SA 1M3CA 3VS1A 4ZNXA 1M3AA 1V1CA 1RI9A 1H92A 2JMAA 1AOJA 2CUDA 2RQVA 2ABLA 1SSHA 1K0SA 4M4ZA 1FMKA 4Z89A 1I1JA 1WXBA 4CC7A 2GBQA 3O5ZA 3VS3A 1G83A 2VWFA 2H8HA 1NLOC 1UE9A 5IH2A 4J9BA 1JU5C 1HJDA 1OEBA 1UGVA 2A36A 3M0UA 2MOXA 3UATA 1ZBJA 1YWOA 2KE9A 1Z9QA 1SHFA 4J9DA 2C0TA 5GJVB 1NM7A 2NUZA 1I07A 2LNHB 3H41A 2LCSA 1X2QA 4JPBW 1QWEA 1WX6A 1T0JA 4JZ3A 2L2PA 4GLMA 1NG2A 5ECAA 1VYUA 5IXFA 2KBTA 2CDTA 1H8KA 3GBQA 2XMFA 2JXBA 1ZUUA 2FO0A 1YN8A 2RMOA 4JJCA 1WI7A 4HVUA 1X6GA 1NLPC 2LJ1A 3RNJA 1M27C 4AFQC 3I5SA 5GJWB 2D8HA 4LNPA 3VS5A 1PRLC 1K76A 1BU1A 3VS2A 3M0PA 3CQTA 1SRLA 2DL8A 3VRYA 4RTWA 2AK5A 2JS2A 4RTTA 1GCQC 4ESRA 1SHGA 2RQTA 2LJ3A 4HVVA 2MCNA 3VRZA 1VYVA 2YUPA 3LH5A 2LX7A 2FG0A 2HCKA 1E7OA 2DBMA 2RNAA 2X3WD 2JS0A 3QWYA 1MV0B 2RPNA 2DL4A 2C0IA 2J6KA 2IIMA 4KRTA 3I9QA 2GNCA 4IIMA 1PKTA 2FEIA 1UTIA 3NPFA 1K4US 5L23A 1OPKA 1U06A 4LN2A 1UUEA 2EQIA 5FWCA 1GL5A 1WA7A 4JZ4A 1K9AA 2J6FA 3M0RA 4RTVA 5IXBA 3KFVA 2DL3A 2LQNA 3THKA 2KNBB 2KT8A 4OMPA 1RLPC 2KRSA 4OMQA 2J7IA 1BB9A 1B07A 1VA7A 3ULRB 2L3QA 3I5RA 1KIKA 1ZLMA 1XOVA 2OJ2A 1G2BA 2ED1A 4AFZC 4LE9A 3TSWA 2E5KA 3PVQA 4AFUC 2KROA 4AG1C 2DJQA 2NWMA 1AVZC 2J05A 3EHQA 2RN8A 2BTTA 2DF6A 2VKNA 4RTXA 1S1NA 1WLPB 1IO6A 2K79A 3VS0A 4J9EA 2O88A 2K3BA 2KXDA 3UA7A 2O9VA 1ZX6A 2EYZA 4RTZA 3EGUA 2AKKA 1VYTA
chains in the Genus database with same CATH superfamily
3R6NA 2DXTA 5IHKA 3PT9A 3JB9I 4JLIA 2KAFA 2QQSA 1QKWA 2O01E 4HCZA 1RLQC 2SRCA 2AZSA 2VXFA 5CAIA 5EG2A 3X20B 2VUBA 3VKIA 4M75C 3PVLA 1N8RU 3QBYA 2DYIA 2YRCA 2GQIA 4OB2B 2CT4A 4A4GA 4D8KA 1Z9ZA 2BZYA 2L89A 1UEBA 2C0OA 2JTFA 4RMOA 1X6BA 2KRMA 2GF7A 4PKCC 2HSPA 2RQUA 1A0NB 3A8GB 5AYFA 1ZBXA 1Y96A 1W2BS 3OMCA 1QVFS 2RQRA 4BDYA 2XU8A 2DLPA 4AG2C 2EKOA 4PJLA 3OBWA 4M78G 2X4WA 4XTUA 3CMET 2CH4A 3H8ZA 3CBOA 3SWNC 5C0MA 4C5HA 1WHMA 2Y4YA 4RCCA 2PUKB 4PJNA 4M77E 1NEBA 1R0BG 2M16A 1YNZA 5GAMe 5D7UA 2JT4A 1UGRB 1J3TA 3OYJA 4PJOD 2BE9B 5D6WA 2RI5A 3C12A 3CCVT 1YWPA 3J80E 2X35A 2DMOA 3VJPA 3JCMW 1IHVA 3LW5E 3OYMA 1BI2A 2V1RA 3LGFA 3UT1A 2E10A 3MP8A 3EG9B 1Q7YC 1QWFA 1ZUKA 1W6XA 3E19A 3EG0A 4Y28E 3M54A 4OGEA 1OOTA 3M0SA 3EG2A 1EIFA 1GCQA 1PRMC 5KYYA 2MWPA 5FWBA 5KYWB 1YJ9Q 4LUEA 3QZ5B 3MEUA 1MUZA 1VOMA 1U8RA 3EG1A 4M77F 4KBMB 2E65A 3D7SB 3QWXX 1YJWQ 2PVOB 3PIOA 1YHQA 1AZEA 2BKDN 3ZBDA 1XNIA 4DEYA 2ECZA 1K73C 2E6NA 4M7DF 2AHJB 3CXCA 1I4K1 4HCCA 2PNIA 4B9XA 4EIKA 1IRXA 4MZTA 2BUDA 4OMMA 4J6YA 2QGFB 5LJ5h 5CQXA 4E6RA 2AIRB 3TCJA 2VGMA 1TOVA 1X69A 2LVMA 2EYYA 1OZ2A 2K57A 1K8AR 2KQWA 2DE0X 2ESWA 2EJFA 3JCMh 2A28A 1D1CA 2QASA 1W70A 4LDUA 1UJ0A 5CO7A 3OS2A 1M9SA 5KYXA 1VQOA 1P92A 2HDAA 2RB6A 3M55A 1LPLA 2CZ1B 3LH0A 1UG1A 3NMZC 2XDDA 2OTLT 1MMGA 1GBRA 4C0GA 1YP5A 3PIPA 2CZ6B 2CP7A 3V7CA 2LJ0A 2I0NA 4E7HA 4LUDA 3CCLT 1ZSZC 4BD3A 3CCVQ 1RAGB 2W0ZA 1TG0A 2DYBA 1D1BA 3L2WA 1VQMA 2CS7A 5LJ3g 3CCMA 2OAUA 2HQXA 1TWBA 4HCKA 3G6ET 2P0QA 2HEQA 2P0KA 4J6WA 1CKAA 2EPDA 4XU3A 1BK2A 3RKWA 1KC8U 2MIOA 4Y92A 2AKLA 1S72Q 2JW4A 2L0AA 2OTLA 1H3HA 1O75A 1K0XA 2K2VA 1VQ5A 1T3SA 2D8JA 2QQRA 2L3SA 4ME7A 5KYNA 3OW2A 2X3XD 4GY5A 2EVRA 3G4SA 1BYMA 4M75G 3HP9A 3PFSA 1PWTA 2YUOA 2D1XA 4ZNXA 1V76A 1RI9A 4M75A 3DLLA 2JMAA 1AOJA 2NUTB 4JRKA 1K0SA 1FMKA 5LJ3h 2HNIA 3CCST 4OF1A 4CC7A 2LCLA 2GBQA 3O5ZA 5HK0A 3EGDB 3VS3A 1YCYA 2VWFA 3F70A 5GAN7 3GF5A 1VIEA 1QVPA 1HJDA 5J26A 4C0FA 5GMKe 3QZ9B 2EYQA 4FCYA 4J9DA 2KDSA 2V8IA 1Q95G 4M77A 1NJIU 3RESA 3CMEA 2FB7A 3CC4T 4C92C 2NUZA 3CC2T 2RHUA 2LNHB 3H41A 2LCSA 1X2QA 3NTIA 3CPWA 3P8HA 1RABB 4JDSA 5ECAA 2GQVA 3CCLQ 5DY9A 1G3WA 2LT1A 4II1A 1D0ZA 1YITT 4ELZC 1YN8A 2RMOA 5CKDA 4JJCA 5LJ3j 4PK4A 3CXCP 1VQ7T 1X6GA 2LJ1A 4AFQC 1LOJA 2D8HA 3DB3A 4C8QE 3MP1A 5KCHA 2XI9A 3EFRA 3VS2A 3G6EQ 4C8QC 3CCRA 5FRNA 1C1AA 5CKFA 1OX9A 1GCQC 4ZTJA 3S3MA 3FB9A 3MEAA 4M7AG 1VQ7A 3S3NA 1I8FA 5A0GA 2FZCB 3QWYA 3ZEHA 2E5QA 2J6KA 3QSUA 1D0YA 3X24B 3I9QA 3JB9D 3X28B 3QUIA 2FEIA 4M75E 1ZQ1A 4LN2A 2LDMA 4PJOF 5KE2A 1WHGA 4OVAA 4P5NA 3M0RA 4RTVA 4M75D 2X51A 3THKA 4OB1B 4OMQA 4FL6A 3QG1A 2L3QA 1SKUB 4PFPA 5FU6C 3I5RA 1KIKA 4J7IA 3RERA 2OJ2A 4LE9A 3TSWA 3HRTA 3SB2A 2E5KA 3E9GA 1KQSS 1UB4A 5CQYA 2D0QB 4MZPA 4MZMA 2IPOB 4TVRA 3EGDA 2NWMA 1AVZC 2MWOA 2DF6A 2QXFA 3CCMQ 5GMKj 4FT4A 1WLPB 4M77B 5GANh 3OYFA 2JNGA 4C8QG 2XG8D 4M77G 4OP0A 2GCXA 3LYIA 2CP0A 2MYSA 2HQEA 5D6XA 1S72T 1WDXA 1QKXA 2YXYA 2RO0A 4KH0B 1QCFA 3VYGA 4M7DG 2EQMA 4XTYA 4KULA 4DA4A 3CC7T 1YITQ 3RKXA 1M5Q1 4PJOG 3I56T 3ASKA 3DKMA 3TEEA 4EMHA 5HCKA 3HRSA 2RHIA 3H6ZA 4NL3A 4N4HA 2X4YA 1E6GA 1BKBA 3HFOA 4JS4A 2A3LA 2KEAA 1KQSA 1Y71A 3SEMA 4IIOA 4ORZA 4DBRA 1VQLT 1CSKA 3G7ZA 2F5TX 5D6YA 5LJ5g 1K8AC 4ZN1A 2W10A 2RK1A 2RJEA 3OA6A 5GAMf 4KT0E 2VB6A 3M57A 2XIDA 2RF0A 3G4ST 1FYNA 2GGRA 2HAXA 2EIFA 5GAN5 3X26B 4ANJA 2QQBA 3HRUA 4OMOA 4QQGA 1UECA 3A8OB 4ZGEB 1D0XA 2EQKA 3TU4K 5GAN2 4HXJA 1XTDA 4M78D 3CC4Q 4XU1A 2EGAA 2KVQG 2V8KA 2L5QA 5I2SA 2VVKA 5IHNA 3A98A 1SG5A 3OW2S 3OYKA 4D8DA 2NUTA 4FYXB 3X25B 4FSSA 1C6VX 4J9FA 1PHTA 4LXCA 3QJ6A 4DBQA 1M1GA 2VGNA 7AT1B 1UHCA 1WHLA 3OQ5A 1JQQA 2DFUA 2WSEE 2WSFE 3OYDA 3MO8A 2E3IA 1VQ7Q 4PFZA 4FYYB 2DNUA 2M1HA 1D3BA 3IQLA 3H0FA 2DRKA 4LD6A 1ZA1B 4OMLA 3REBB 3MKDA 1MGQA 5GAN3 3OYHA 2A37A 5HKCA 1VQ8A 3ZL7C 3M0TA 4N4GA 2E70A 4UC4A 1XJWB 1M1KU 3OYLA 2DK3A 1KD1C 1IZ6A 3U23A 1NPRA 2EJGA 2GFAA 4E7KA 4J5YA 3CMAA 3QPHA 4M7DC 4K11A 1TSFA 5CVIA 2NUPA 3L2RA 4EMKA 4Z8AA 3FJPA 1UDLA 1UHFA 4DBFA 3JCMe 5GANj 1WXUA 1ZA2B 1AEYA 4M78B 3CMAQ 1M8MA 5A2QE 2FPFA 3TQ7P 1RUWA 2DZCA 1OI1A 5FROA 1JRIA 3M0QA 1LVKA 2HD0A 4C8QD 2OAWA 3OBYA 1ZSGA 1Q86U 2DTHA 4MMKA 1PG5B 4FYVB 1MNDA 3OYNA 4E7IA 5LJ5j 1FWZA 4IUTA 4LDWA 4VUBA 2WSCE 3RBBB 2R5AA 4BUGA 1YHQT 3RMSA 4X9DA 2O31A 1RADB 1QVGP 1MV3A 1GCPA 1KK7A 1B34B 2M0OA 3OYIA 1IHWA 3CXCS 3CD6A 4B6MA 2LCCA 2DPPB 1AD5A 2AT1B 3G71Q 5DM7R 2CSQA 3QKJA 4C0DB 1QLYA 2EYXA 3CD6Q 5CIUA 4QQ6A 4ZN3A 2KK4A 1VQOT 2V26A 4J9IA 1KHCA 3CC7Q 4QW2A 2HBPA 2DKGA 3VUZA 2DAQA 1XQHA 4O5VA 3QO3A 2CSIA 4M7AD 3ZFJA 3MJXA 3PE0A 5EC7A 3CEYA 1KJWA 1PNJA 4BI8B 1NJIC 3M53A 2B86A 4M7AE 3JSCA 3BDLA 3VS7A 8AT1B 2K6DA 3URGA 4BE2A 1JEGA 4M75F 1VQMQ 5GAN6 2BE7D 2RH2A 2KGTA 1HK9A 3I55T 3CCUQ 1YI2Q 2K3XA 4JRPA 5CKHA 1AZGB 2HBWA 3SDZA 1M3CA 5GANg 3VS1A 2F5KA 1V1CA 3G4SQ 3E2UA 2CUDA 1PM3A 2RQVA 4EMKB 1SSHA 2DTOA 3I56A 2KSSA 5KCOA 4OB3B 1QW1A 4J83A 3CC4A 1SF9A 2XKOC 1VQ5Q 4WTOB 5GAN4 3S3OA 2EWNA 2E41A 1UE9A 4J6XA 1ACMB 3CCQT 1Q86R 4F7UA 4MMLA 5GAMj 3E1SA 2R5MA 2COYA 1ZBJA 1YWOA 3VV0A 4JRQA 4BDZA 1Z9QA 4E7LA 4DQ2A 2QI2A 2E4HA 2HKQB 2VYTA 3CCET 3ER0A 5GJVB 4L6V5 2FYKA 4BB7A 5GAN8 1WHJA 3SWNB 2L2PA 1OQKA 1WQWA 2RHXA 2MF2A 4IUUA 4M77D 2R58A 5LJ5d 1H8KA 1KC8C 1M1KR 1ZUUA 4ATOA 1B34A 4JS5A 2EQJA 5GAOn 2RHZA 1WI7A 1I5LA 2A0FB 2QQAA 1NLPC 4C92F 1BCMA 3CBPA 3I5SA 4LNPA 3G1JA 1QCOA 3VS5A 1K76A 2MI6A 4FYWB 3BW1A 3M0PA 4L5GA 1SRLA 2E6ZA 9ATCB 2DL8A 1W2BP 1YIJA 1QVFP 3VRYA 4RTWA 2AK5A 2JS2A 2LX9A 2CKKA 1SHGA 2RQTA 4HVVA 2MMPA 3VRZA 1PCXA 1OZ3A 2YUPA 2ZPFB 3EGXA 3LWHA 1WQ7A 3LH5A 1TXQA 3FIFA 1AHJB 2F1LA 2JS0A 1MNEA 3EFOA 4KRTA 2CGHA 1WJQA 4X34A 3GLXA 1BIAA 4IIMA 3VYHB 1WPYA 1PKTA 3NPFA 3V8JA 3L42A 2P0PA 2RM4A 5L23A 3GIBA 1UUEA 1OU8A 1D3BB 1U1TA 1WJSA 4FM4B 1G8XA 1K9AA 2J6FA 4EPCA 4XAXB 3PGGA 3CCEA 3KFVA 2DL3A 1Y96B 4OB0B 1RLPC 2KRSA 1YHQQ 1BB9A 1IREB 3HPWA 1B07A 4BY6C 1ZLMA 2ED1A 3A1PA 2K5LA 1K8AU 4JUVA 4QQDA 3OYBA 4F7UB 4AFUC 3G71T 2YHTA 4IUPA 4PJMA 3CCQQ 5LJ3f 1VQPQ 2RN8A 1S1NA 1MMNA 1IO6A 4PJOE 2K79A 1YJ9T 4C5EA 5IN1A 4FW1A 3UA7A 1JBMA 2O9VA 3EGUA 3CBMA 2AKKA 2DZ9A 1UFFA 1VQ8T 1QQJA 4C92G 1VQ9T 4M7DD 4QT7A 2JM9A 3CPWP 3A8MB 3A5ZB 2E3HA 4XK8E 1N6AA 6AT1B 1EFNA 1PKSA 2DXUA 5GAOm 2ZPIB 1JB0E 1OULA 4L59A 2DILA 3CCLA 1ABQA 1M3BA 2Z0WA 4M7AB 2KYBA 2L3RA 1X43A 2M51A 2ROLA 3OS1A 3L2VA 4E7JA 3JCMf 1JJ2S 3EFSA 3QXEB 3VS6A 2XDBA 1BIBA 2VXEA 1LNXA 1X6OA 4BI4A 3M4YA 2FRWA 2OI3A 1U5SA 5GAOl 4PNOA 2QDLA 1QCNA 3WVDB 2LQWA 2ZPHB 1E6HA 3OYCA 3UWNA 2GTJA 1S72A 4JJDA 1NEGA 1U3OA 4CI0C 1JXMA 2RJDA 1Y57A 2CP6A 2SEMA 1JJ2P 2CREA 1VQKT 3E9FA 2IVWA 5GAOp 4F14A 4RG8A 1NYGA 4CC2A 2EW3A 2FZKB 1D09B 2CT3A 2O4XB 4LD9K 4WF2A 4GBQA 3RUXA 1GFDA 3M5AA 4BE1A 2XHCA 4FIBA 5I22A 3BE3A 1GRIA 1WGSA 2QTXA 3OSVA 5FRMA 1KFZA 2DEQA 2B8AA 1OU9A 2X9HA 1G5VA 3JB9G 4M7DB 1YIJT 2M9UA 4PFOA 3M58A 3FLGA 4PJOB 2ED0A 4XU0A 4DEXA 2YUNA 2QGGA 3RIRA 3SHWA 1TH7A 3REAB 5CR2A 5GMKm 1OPLA 1NE8A 5GANf 1QMCA 3DB4A 3JCMQ 3M9QA 3GNFB 1MMAA 3MEVA 1Q82C 4EMKC 4BE0A 3I55A 3EAEA 1KQ2A 1WFWA 1HD3A 2WACA 3GPLA 4C0ZA 2P4TA 1UJYA 1W2BA 1QVFA 5KYWA 3LLRA 3CCSA 1M90C 2QTVA 2DM1A 2CYZB 1NJIR 4RKUE 4N4IA 3EHRA 3HFNA 2YSQA 1ZUYA 4M78F 4IKFA 5GANd 2FL7A 3BFMA 4HT8A 5I11A 1ZHIA 1VQKA 2A7YA 2DIGA 1NZ9A 5CK9A 1AWWA 1UGQB 5LJ3d 1VQNA 1HSQA 2DERA 3H0IA 1YJWA 2JM8A 3OS5A 1EX4A 4FSXA 1VQPA 1KD1R 1I5OB 1RL2A 1T3LA 1RAHB 5LJ5f 4NL2A 2CZ7B 3OB9A 3PMTA 1VQPT 3V8KA 3VUBA 1JXOA 2QA4A 3CC2Q 3RDVA 3EH2A 4HVWA 4QKUA 1LCKA 2F2XA 2JUFA 4N0AC 1U1SA 1ABOA 2CH4W 2MAMA 1PSEA 4C0DC 1Y7XA 2RD1A 2KMTA 4CC4B 3HHTB 4A4FA 1GBQA 1VQ8Q 1ARKA 3P8BB 2JN0A 1KSWA 2PTKA 3CCRQ 2KRNA 1FXXA 4EMGA 1R0CB 1GXIE 4MDXA 5A0DA 1OV3A 2ROTA 3JV3A 2BIVA 1YJNA 4D6WA 1KC8R 4M78C 4IUQA 1IGUA 2K4YA 3JCMP 4XTVA 3TREA 1WYXA 1NPPA 2YUQA 2L3PA 2RQWA 3EG3A 3JCMc 2DVJA 3CCQA 5C6SA 1AWOA 4LDYA 1Q81R 1QP3A 4F7UF 1SPKA 1M1FA 1AWXA 4C5GA 1WHKA 1SRMA 2PVDB 3I56Q 5DLOA 1IXDA 1M4ZA 2HQHA 2KT1A 1YJWT 2BZXA 1ZSZA 4M77C 1UGSB 2OTJA 4X1VA 2KXCA 4M7DE 2AZVA 2HL3A 5M9OA 2O9SA 1M3AA 2LC4A 2DXCA 1H92A 2F69A 3DLMA 3OW2P 2RA2A 1K9MC 3OY9A 1VQ4A 3JCMd 4Z89A 1K9MR 1M2OA 3HTRA 3HSBA 2RK2A 1KHIA 3SWNA 2ZPEB 4J9BA 3V8LA 1JU5C 3JB9H 2LT4A 2A36A 2MOXA 3QYGB 4R55A 1PD0A 3QDFA 3CCJQ 2YWWA 2KE9A 3HKSA 2RI3A 1YJ9A 3INZA 2VC8A 4F04B 2HL5C 4PLIA 4F7UG 2C0TA 5I2MA 2COWA 5LL6S 1I07A 2LRQA 5FU7C 3J81E 1FMVA 4JPBW 3H9NA 1T0JA 4JZ3A 3NTHA 5KYYB 2EAYA 1VYUA 5IXFA 2KBTA 2CDTA 1RAFB 3A8HB 3QHSA 2XMFA 5LJ3e 2JXBA 2O4XA 1M2VA 2ZPBB 2FO0A 2DD4A 1K73R 4HVUA 4C92B 2KY9A 2E1HA 1M27C 3NFCA 2X4JA 3CCJA 5KE3A 3CCUA 4E2FB 2C06A 1PRLC 3M59A 2D6FA 3C4SA 2QK0A 4DBHA 1VQ9A 2KI7A 1VQLQ 1VQ6A 4ESRA 2LJ3A 2JJ9A 5GAMd 2MCNA 2DIQA 3L2UA 2FG0A 4HT9A 2HCKA 1E7OA 4C8QF 2DBMA 1OYXA 2OTJT 2RNAA 4XQ3A 1MV0B 2DL4A 2P84A 8ATCB 2GNCA 4Q5WA 5GANe 4HA8A 1G3TA 1G3YA 1UTIA 1U06A 1TTHB 5FWCA 4PJOA 1GL5A 1WA7A 4XTZA 3PTAA 2KNBB 2KT8A 4B9WA 3OS0A 2V8JA 1VA7A 3ULRB 1IB8A 1RAIB 1G2BA 3CCSQ 5A0LA 3JCMJ 3PVQA 4ELYC 3JCMV 4A53A 4PLLA 4KGVB 3CCVA 2KROA 4KUDK 1AT1B 5FU6B 3CCRT 1YJNQ 3ME9A 3SD4A 2DJQA 2DETA 2J05A 3EHQA 4C92E 2BTTA 3AT1B 4EDUA 3CCJT 5AT1B 3S6WA 3L2QA 2ZPGB 3EG9A 2KXDA 1KQ1A 3LWIA 4PJJA 2EYZA 5FLXE 1N8RR 2RHYA 4RTZA 3GP8A 3A8LB 1VYTA 1IGQA 2QEXQ 2KYMA 4E47A 4N0AA 5IAYA 4ZGDB 4PL6A 3QYHB 2QQ9A 4Z02A 4RG2A 3G71A 2F2VA 2PVGB 2ZAEA 2BZ8A 1Q82U 1FX7A 1X01A 2CP5A 5IHIA 4C5IA 2XK0A 1B7TA 3FC3A 4MDWA 3OYAA 1TUGB 4C8QA 2EYWA 4HKEA 1VQNQ 1X2KA 2LTOA 3L1AA 2ZCFB 2F2WA 1YCSB 3R6OA 2RJCA 2COZA 2I2LA 2JTEA 2Y90A 1SSFA 1TU0B 3H0HA 1BI0A 3NTKA 2K5FA 5FW9A 3META 2EBPA 2JZ2A 1M90R 2J6OA 1RAAB 5KYUA 3SFMA 3I55Q 3CCUT 2OTJQ 1N9SA 2PZ1A 3JRZA 1PD1A 3UA6A 3FJ5A 1EZZB 3OYGA 2KR3A 4M78E 2DTIA 1K1ZA 2YLBA 3I35A 2QAZA 4XU2A 2DBKA 1SEMA 1R77A 2DA9A 4F7UE 1WXTA 2FPEA 1VQ5T 2HZYA 2CZ0B 1X27A 1WIEA 1R8OB 2QDYB 4ZGJB 1LJOA 4RTYA 1MHNA 5GAMh 3Q1JA 1BBZA 1BCOA 3CD6T 4QVDA 4BI3A 2E12A 1TUDA 5GMKl 1VQOQ 2K7AA 3N5BB 1YJNT 2QG9B 3CPFA 2JOYA 2X4XA 3GOXA 2LP5A 3OMGA 2L8DA 3VU3C 2LQ8A 3CCMT 4FT2A 3M56A 2NYSA 1VQLA 1VQ6Q 1BI1A 4J9CA 1NYFA 1PC0A 3VS4A 5KH6A 4IUVA 4WCIA 2EGEA 2HMAA 4CC3A 2GTOA 3LGLA 2QEXT 2CUBA 4GLKA 1OX8A 1TS9A 1M1KC 1JO8A 3KUFA 2EFIA 4M7AA 1Q81C 1W1FA 2ENMA 4JLGA 4XTXA 3OSSC 1YI2T 4Z88A 2YRDA 1CKBA 2FRYA 3MEWA 2YRVA 5J39A 1I0CA 1M2VB 2RJFA 2JMCA 5IT9E 2EGCA 3BY7A 2DO3A 2D0NA 4KH1B 4C92A 2DVEA 3EFOB 1MMDA 4J9GA 2DEUA 3EH1A 4NS5A 1M8VA 1VQNT 3NGPA 4M75B 4OGCA 1HXDA 2DX1A 4A4EA 2DRMA 2O2OA 4A63B 1W4SA 5KYUB 5LJ5e 4F17A 4RTUA 4Y91A 1GFCA 2V1QA 3JAME 4A54A 2YDLA 3TSZA 1H3ZA 2Y4XA 2EKHA 3GNGA 1Q7YR 3TVTA 2H3EB 3CCEQ 1C0MA 2GFUA 3JCMb 2G6FX 4JJBA 4NOYA 4M7DA 2LZ6B 3UF4A 4QVZA 3C95A 4C8QB 1V29B 1VQ4Q 4V2SA 1TUCA 2PU9B 4R56A 2K9GA 5DLQE 2JVVA 5GAMg 1Y0MA 4RCBA 5HK3A 3L2ZA 2G3RA 2FPDA 4DOWA 5CKEA 4RUGA 2IG0A 3RR6A 3FEOA 3CC2A 1D1AA 4KUIA 1X75C 4OMNA 2J06A 3C0CA 2YT6A 1KQSP 2LMJA 2K2MA 1T0HA 4AFSC 1HYOA 1M30A 2MPXC 5FU7B 2YLCA 1N9RA 3JCMg 4R0KA 1K73U 2A08A 3C94A 2QEXA 1VQ6T 4J7FA 1B3QA 3PNWC 2VASA 2DL7A 4C92D 3NHNA 2HSEB 2OX7A 2MK5A 1N5ZA 2LQKA 2RI2A 3M4GA 4OMFB 1H641 2FZGB 2P4RA 4J9HA 3JCMX 5CCAA 4X9CA 3V7SA 2K3YA 1AWJA 1WHHA 2DL5A 4QVCA 1YITA 2M0YA 4IURA 4F16A 4PJOC 4E7ZA 2FVUA 2ATCB 2QA4T 1QVGA 1NBEB 1FMWA 1UGPB 4A4HA 1Q7YU 1O9SA 4LDXA 2ABLA 3OYYA 4M4ZA 3RKYA 1I1JA 1VUBA 1WXBA 2EJ9A 5GAOq 3CMEQ 1N8RC 4KGXB 1G83A 1K9MU 1YI2A 2CP3A 3QIIA 4CRIA 3WXMB 2H8HA 1NLOC 3MCAB 5J3BA 5IH2A 2NLUA 3BDUA 1OEBA 1UGVA 1QP2A 3M0UA 1VQKQ 3QDRB 2XICA 3UATA 2LNVA 1SHFA 1YBYA 2JTMA 3JB9F 3G6EA 1QVGS 5KYXB 3HL8A 5GMKi 1NM7A 3KBGA 4DOVA 5GMKh 2CP2A 1WJRA 1VQ9Q 1QWEA 1WX6A 1VQ4T 1KG1A 4GLMA 1NG2A 4FU6A 3UDCA 2D9TA 1Q81U 2E64A 3CPWS 2K5IA 3GBQA 2H3JA 3OYEA 3P8DA 5L8RE 5CKBA 4LDVA 3RNJA 1ZSZB 1YIJQ 2DXBA 5GJWB 2PUOB 1BU1A 2DJZA 3MHXA 1RI0A 3CQTA 4HCBA 3T9NA 4JJNK 3V7RA 1N27A 1WNLA 2NUPB 4RTTA 3O8VA 3CMAT 4FW2A 4ZTFA 3FRNA 4XTWA 1VYVA 2LX7A 3PMIA 4BACA 2ZGWA 5I21A 4M7AF 1VIFA 5HY6A 2X3WD 3JB9J 4J8OA 2RPNA 1PSFA 2C0IA 1YFNA 2IIMA 1RAEB 4YTLA 1VQMT 3RMQA 4M7AC 1K4US 1OPKA 3J7AF 4BY6B 2EQIA 3QJYA 4A4KA 4JZ4A 2QYZA 4M78A 2R57A 1DJ7B 1G3SA 5IXBA 2LQNA 1Y07A 3FDRA 2VV5A 2PQWA 1KD1U 2M02A 2QA4Q 4OMPA 2EQUA 2J7IA 3MP6A 3EGXB 1BI3A 5GAOr 1XOVA 2FHDA 4AFZC 1I81A 4JRIA 1M90U 2XDPA 3KXTA 4O6JA 4AMCA 3WVEB 2XD0A 3LX7A 3CC7A 1JJ2A 1RACB 2OTLQ 4AG1C 4E7SA 2HKNA 2VKNA 4AT1B 1WZOA 4RTXA 3AHUA 1Q86C 3VS0A 4J9EA 2O88A 2K3BA 2ZZDA 1F1BB 3MPUB 1ZX6A 3UPUA 4KGZB 2DD5A 1Q82R
chains in the Genus database with same CATH topology
1UFFA 3R6NA 5IHKA 1WDXA 1QKXA 2KYMA 1QCFA 4QT7A 2JM9A 1QKWA 1RLQC 2SRCA 2AZSA 2F2VA 1EFNA 1PKSA 2BZ8A 5HCKA 3PVLA 5IHIA 2DILA 2GQIA 2CT4A 1ABQA 1M3BA 4D8KA 2KYBA 1X43A 1Z9ZA 2BZYA 2C0OA 2M51A 2ROLA 1X6BA 2KRMA 1E6GA 2EYWA 1X2KA 2RQUA 2HSPA 2KEAA 1A0NB 3VS6A 2F2WA 1YCSB 2RQRA 2JTEA 3SEMA 2DLPA 4AG2C 4IIOA 4ORZA 2FRWA 2OI3A 1CSKA 1U5SA 3H0HA 2QDLA 2LQWA 5FW9A 2CH4A 1E6HA 2EBPA 2W10A 2J6OA 2GTJA 4JJDA 2PZ1A 1NEGA 1U3OA 1JXMA 1Y57A 2SEMA 3UA6A 1NEBA 2CREA 2RF0A 3FJ5A 2KR3A 1FYNA 2GGRA 1YNZA 1K1ZA 3I35A 4F14A 2JT4A 2DBKA 4OMOA 1J3TA 1NYGA 4CC2A 2EW3A 1SEMA 1UECA 2CT3A 2DA9A 4HXJA 1GFDA 4GBQA 1WXTA 2EGAA 2FPEA 2VVKA 1X27A 1WIEA 5IHNA 1YWPA 3A98A 2DMOA 4RTYA 4D8DA 4FSSA 1BBZA 5I22A 1GRIA 2V1RA 4J9FA 1PHTA 1TUDA 1KFZA 1UHCA 2K7AA 1QWFA 1ZUKA 1JQQA 1W6XA 3EG0A 2LP5A 1OOTA 3M0SA 3EG2A 2DNUA 1GCQA 1PRMC 5FWBA 4LUEA 2ED0A 4DEXA 2YUNA 3IQLA 1MUZA 4J9CA 3H0FA 2DRKA 1NYFA 3SHWA 3VS4A 3EG1A 4OMLA 2EGEA 4WCIA 4CC3A 3REBB 3REAB 2GTOA 1OPLA 2A37A 2CUBA 3ZL7C 3M0TA 3QWXX 1JO8A 1W1FA 2ENMA 3U23A 1AZEA 4DEYA 2ECZA 4Z88A 1WFWA 1HD3A 4K11A 1CKBA 2FRYA 1UJYA 1I0CA 2PNIA 4Z8AA 4EIKA 2JMCA 2EGCA 4OMMA 1UDLA 2DM1A 1UHFA 2D0NA 1WXUA 3EHRA 1AEYA 2YSQA 1ZUYA 4J9GA 4E6RA 1M8MA 2FPFA 1RUWA 3NGPA 3M0QA 1X69A 5I11A 2EYYA 2OAWA 2DX1A 2DE0X 1ZSGA 2ESWA 1AWWA 2A28A 2DRMA 2O2OA 1HSQA 4A63B 1W70A 3H0IA 2JM8A 4RTUA 4F17A 1GFCA 1UJ0A 2V1QA 2YDLA 3TSZA 1T3LA 2HDAA 2EKHA 1UG1A 3NMZC 3TVTA 1GBRA 3RBBB 2G6FX 4JJBA 1JXOA 2LZ6B 3UF4A 1YP5A 2O31A 4HVWA 1MV3A 1LCKA 2F2XA 1TUCA 1GCPA 2K9GA 1ABOA 2CH4W 2LJ0A 2I0NA 4LUDA 4CC4B 1AD5A 1Y0MA 1ARKA 1GBQA 2CSQA 1QLYA 1KSWA 2EYXA 2FPDA 2PTKA 2W0ZA 2KRNA 1TG0A 2DYBA 4RUGA 1OV3A 4OMNA 2ROTA 4J9IA 2J06A 3C0CA 2YT6A 3JV3A 4HCKA 2LMJA 2K2MA 1T0HA 4AFSC 1M30A 2HEQA 1CKAA 2EPDA 2CSIA 1BK2A 4R0KA 1WYXA 2A08A 2MIOA 2YUQA 2AKLA 2L3PA 3PE0A 4Y92A 5EC7A 2RQWA 3EG3A 1KJWA 2DVJA 2JW4A 2L0AA 1B3QA 1AWOA 1PNJA 2DL7A 1H3HA 2B86A 3NHNA 1K0XA 1SPKA 3VS7A 1N5ZA 1AWXA 1T3SA 2K6DA 2D8JA 2L3SA 2P4RA 1SRMA 4J9HA 2KT1A 2X3XD 2BZXA 1AWJA 2EVRA 1JEGA 2KGTA 2DL5A 4X1VA 2KXCA 2M0YA 1PWTA 2AZVA 2YUOA 1AZGB 4F16A 2HBWA 2D1XA 2O9SA 1M3CA 3VS1A 4ZNXA 1M3AA 1V1CA 1RI9A 1H92A 2JMAA 1AOJA 2CUDA 2RQVA 2ABLA 1SSHA 1K0SA 4M4ZA 1FMKA 4Z89A 1I1JA 1WXBA 4CC7A 2GBQA 3O5ZA 3VS3A 1G83A 2VWFA 2H8HA 1NLOC 1UE9A 5IH2A 4J9BA 1JU5C 1HJDA 1OEBA 1UGVA 2A36A 3M0UA 2MOXA 3UATA 1ZBJA 1YWOA 2KE9A 1Z9QA 1SHFA 4J9DA 2C0TA 5GJVB 1NM7A 2NUZA 1I07A 2LNHB 3H41A 2LCSA 1X2QA 4JPBW 1QWEA 1WX6A 1T0JA 4JZ3A 2L2PA 4GLMA 1NG2A 5ECAA 1VYUA 5IXFA 2KBTA 2CDTA 1H8KA 3GBQA 2XMFA 2JXBA 1ZUUA 2FO0A 1YN8A 2RMOA 4JJCA 1WI7A 4HVUA 1X6GA 1NLPC 2LJ1A 3RNJA 1M27C 4AFQC 3I5SA 5GJWB 2D8HA 4LNPA 3VS5A 1PRLC 1K76A 1BU1A 3VS2A 3M0PA 3CQTA 1SRLA 2DL8A 3VRYA 4RTWA 2AK5A 2JS2A 4RTTA 1GCQC 4ESRA 1SHGA 2RQTA 2LJ3A 4HVVA 2MCNA 3VRZA 1VYVA 2YUPA 3LH5A 2LX7A 2FG0A 2HCKA 1E7OA 2DBMA 2RNAA 2X3WD 2JS0A 3QWYA 1MV0B 2RPNA 2DL4A 2C0IA 2J6KA 2IIMA 4KRTA 3I9QA 2GNCA 4IIMA 1PKTA 2FEIA 1UTIA 3NPFA 1K4US 5L23A 1OPKA 1U06A 4LN2A 1UUEA 2EQIA 5FWCA 1GL5A 1WA7A 4JZ4A 1K9AA 2J6FA 3M0RA 4RTVA 5IXBA 3KFVA 2DL3A 2LQNA 3THKA 2KNBB 2KT8A 4OMPA 1RLPC 2KRSA 4OMQA 2J7IA 1BB9A 1B07A 1VA7A 3ULRB 2L3QA 3I5RA 1KIKA 1ZLMA 1XOVA 2OJ2A 1G2BA 2ED1A 4AFZC 4LE9A 3TSWA 2E5KA 3PVQA 4AFUC 2KROA 4AG1C 2DJQA 2NWMA 1AVZC 2J05A 3EHQA 2RN8A 2BTTA 2DF6A 2VKNA 4RTXA 1S1NA 1WLPB 1IO6A 2K79A 3VS0A 4J9EA 2O88A 2K3BA 2KXDA 3UA7A 2O9VA 1ZX6A 2EYZA 4RTZA 3EGUA 2AKKA 1VYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFF A;  3R6N A;  5IHK A;  1WDX A;  1QKX A;  2KYM A;  1QCF A;  4QT7 A;  2JM9 A;  1QKW A;  1RLQ C;  2SRC A;  2AZS A;  2F2V A;  1EFN A;  1PKS A;  2BZ8 A;  5HCK A;  3PVL A;  5IHI A;  2DIL A;  2GQI A;  2CT4 A;  1ABQ A;  1M3B A;  4D8K A;  2KYB A;  1X43 A;  1Z9Z A;  2BZY A;  2C0O A;  2M51 A;  2ROL A;  1X6B A;  2KRM A;  1E6G A;  2EYW A;  1X2K A;  2RQU A;  2HSP A;  2KEA A;  1A0N B;  3VS6 A;  2F2W A;  1YCS B;  2RQR A;  2JTE A;  3SEM A;  2DLP A;  4AG2 C;  4IIO A;  4ORZ A;  2FRW A;  2OI3 A;  1CSK A;  1U5S A;  3H0H A;  2QDL A;  2LQW A;  5FW9 A;  2CH4 A;  1E6H A;  2EBP A;  2W10 A;  2J6O A;  2GTJ A;  4JJD A;  2PZ1 A;  1NEG A;  1U3O A;  1JXM A;  1Y57 A;  2SEM A;  3UA6 A;  1NEB A;  2CRE A;  2RF0 A;  3FJ5 A;  2KR3 A;  1FYN A;  2GGR A;  1YNZ A;  1K1Z A;  3I35 A;  4F14 A;  2JT4 A;  2DBK A;  4OMO A;  1J3T A;  1NYG A;  4CC2 A;  2EW3 A;  1SEM A;  1UEC A;  2CT3 A;  2DA9 A;  4HXJ A;  1GFD A;  4GBQ A;  1WXT A;  2EGA A;  2FPE A;  2VVK A;  1X27 A;  1WIE A;  5IHN A;  1YWP A;  3A98 A;  2DMO A;  4RTY A;  4D8D A;  4FSS A;  1BBZ A;  5I22 A;  1GRI A;  2V1R A;  4J9F A;  1PHT A;  1TUD A;  1KFZ A;  1UHC A;  2K7A A;  1QWF A;  1ZUK A;  1JQQ A;  1W6X A;  3EG0 A;  2LP5 A;  1OOT A;  3M0S A;  3EG2 A;  2DNU A;  1GCQ A;  1PRM C;  5FWB A;  4LUE A;  2ED0 A;  4DEX A;  2YUN A;  3IQL A;  1MUZ A;  4J9C A;  3H0F A;  2DRK A;  1NYF A;  3SHW A;  3VS4 A;  3EG1 A;  4OML A;  2EGE A;  4WCI A;  4CC3 A;  3REB B;  3REA B;  2GTO A;  1OPL A;  2A37 A;  2CUB A;  3ZL7 C;  3M0T A;  3QWX X;  1JO8 A;  1W1F A;  2ENM A;  3U23 A;  1AZE A;  4DEY A;  2ECZ A;  4Z88 A;  1WFW A;  1HD3 A;  4K11 A;  1CKB A;  2FRY A;  1UJY A;  1I0C A;  2PNI A;  4Z8A A;  4EIK A;  2JMC A;  2EGC A;  4OMM A;  1UDL A;  2DM1 A;  1UHF A;  2D0N A;  1WXU A;  3EHR A;  1AEY A;  2YSQ A;  1ZUY A;  4J9G A;  4E6R A;  1M8M A;  2FPF A;  1RUW A;  3NGP A;  3M0Q A;  1X69 A;  5I11 A;  2EYY A;  2OAW A;  2DX1 A;  2DE0 X;  1ZSG A;  2ESW A;  1AWW A;  2A28 A;  2DRM A;  2O2O A;  1HSQ A;  4A63 B;  1W70 A;  3H0I A;  2JM8 A;  4RTU A;  4F17 A;  1GFC A;  1UJ0 A;  2V1Q A;  2YDL A;  3TSZ A;  1T3L A;  2HDA A;  2EKH A;  1UG1 A;  3NMZ C;  3TVT A;  1GBR A;  3RBB B;  2G6F X;  4JJB A;  1JXO A;  2LZ6 B;  3UF4 A;  1YP5 A;  2O31 A;  4HVW A;  1MV3 A;  1LCK A;  2F2X A;  1TUC A;  1GCP A;  2K9G A;  1ABO A;  2CH4 W;  2LJ0 A;  2I0N A;  4LUD A;  4CC4 B;  1AD5 A;  1Y0M A;  1ARK A;  1GBQ A;  2CSQ A;  1QLY A;  1KSW A;  2EYX A;  2FPD A;  2PTK A;  2W0Z A;  2KRN A;  1TG0 A;  2DYB A;  4RUG A;  1OV3 A;  4OMN A;  2ROT A;  4J9I A;  2J06 A;  3C0C A;  2YT6 A;  3JV3 A;  4HCK A;  2LMJ A;  2K2M A;  1T0H A;  4AFS C;  1M30 A;  2HEQ A;  1CKA A;  2EPD A;  2CSI A;  1BK2 A;  4R0K A;  1WYX A;  2A08 A;  2MIO A;  2YUQ A;  2AKL A;  2L3P A;  3PE0 A;  4Y92 A;  5EC7 A;  2RQW A;  3EG3 A;  1KJW A;  2DVJ A;  2JW4 A;  2L0A A;  1B3Q A;  1AWO A;  1PNJ A;  2DL7 A;  1H3H A;  2B86 A;  3NHN A;  1K0X A;  1SPK A;  3VS7 A;  1N5Z A;  1AWX A;  1T3S A;  2K6D A;  2D8J A;  2L3S A;  2P4R A;  1SRM A;  4J9H A;  2KT1 A;  2X3X D;  2BZX A;  1AWJ A;  2EVR A;  1JEG A;  2KGT A;  2DL5 A;  4X1V A;  2KXC A;  2M0Y A;  1PWT A;  2AZV A;  2YUO A;  1AZG B;  4F16 A;  2HBW A;  2D1X A;  2O9S A;  1M3C A;  3VS1 A;  4ZNX A;  1M3A A;  1V1C A;  1RI9 A;  1H92 A;  2JMA A;  1AOJ A;  2CUD A;  2RQV A;  2ABL A;  1SSH A;  1K0S A;  4M4Z A;  1FMK A;  4Z89 A;  1I1J A;  1WXB A;  4CC7 A;  2GBQ A;  3O5Z A;  3VS3 A;  1G83 A;  2VWF A;  2H8H A;  1NLO C;  1UE9 A;  5IH2 A;  4J9B A;  1JU5 C;  1HJD A;  1OEB A;  1UGV A;  2A36 A;  3M0U A;  2MOX A;  3UAT A;  1ZBJ A;  1YWO A;  2KE9 A;  1Z9Q A;  1SHF A;  4J9D A;  2C0T A;  5GJV B;  1NM7 A;  2NUZ A;  1I07 A;  2LNH B;  3H41 A;  2LCS A;  1X2Q A;  4JPB W;  1QWE A;  1WX6 A;  1T0J A;  4JZ3 A;  2L2P A;  4GLM A;  1NG2 A;  5ECA A;  1VYU A;  5IXF A;  2KBT A;  2CDT A;  1H8K A;  3GBQ A;  2XMF A;  2JXB A;  1ZUU A;  2FO0 A;  1YN8 A;  2RMO A;  4JJC A;  1WI7 A;  4HVU A;  1X6G A;  1NLP C;  2LJ1 A;  3RNJ A;  1M27 C;  4AFQ C;  3I5S A;  5GJW B;  2D8H A;  4LNP A;  3VS5 A;  1PRL C;  1K76 A;  1BU1 A;  3VS2 A;  3M0P A;  3CQT A;  1SRL A;  2DL8 A;  3VRY A;  4RTW A;  2AK5 A;  2JS2 A;  4RTT A;  1GCQ C;  4ESR A;  1SHG A;  2RQT A;  2LJ3 A;  4HVV A;  2MCN A;  3VRZ A;  1VYV A;  2YUP A;  3LH5 A;  2LX7 A;  2FG0 A;  2HCK A;  1E7O A;  2DBM A;  2RNA A;  2X3W D;  2JS0 A;  3QWY A;  1MV0 B;  2RPN A;  2DL4 A;  2C0I A;  2J6K A;  2IIM A;  4KRT A;  3I9Q A;  2GNC A;  4IIM A;  1PKT A;  2FEI A;  1UTI A;  3NPF A;  1K4U S;  5L23 A;  1OPK A;  1U06 A;  4LN2 A;  1UUE A;  2EQI A;  5FWC A;  1GL5 A;  1WA7 A;  4JZ4 A;  1K9A A;  2J6F A;  3M0R A;  4RTV A;  5IXB A;  3KFV A;  2DL3 A;  2LQN A;  3THK A;  2KNB B;  2KT8 A;  4OMP A;  1RLP C;  2KRS A;  4OMQ A;  2J7I A;  1BB9 A;  1B07 A;  1VA7 A;  3ULR B;  2L3Q A;  3I5R A;  1KIK A;  1ZLM A;  1XOV A;  2OJ2 A;  1G2B A;  2ED1 A;  4AFZ C;  4LE9 A;  3TSW A;  2E5K A;  3PVQ A;  4AFU C;  2KRO A;  4AG1 C;  2DJQ A;  2NWM A;  1AVZ C;  2J05 A;  3EHQ A;  2RN8 A;  2BTT A;  2DF6 A;  2VKN A;  4RTX A;  1S1N A;  1WLP B;  1IO6 A;  2K79 A;  3VS0 A;  4J9E A;  2O88 A;  2K3B A;  2KXD A;  3UA7 A;  2O9V A;  1ZX6 A;  2EYZ A;  4RTZ A;  3EGU A;  2AKK A;  1VYT A; 
#chains in the Genus database with same CATH topology
 3R6N A;  2DXT A;  5IHK A;  3PT9 A;  3JB9 I;  4JLI A;  2KAF A;  2QQS A;  1QKW A;  2O01 E;  4HCZ A;  1RLQ C;  2SRC A;  2AZS A;  2VXF A;  5CAI A;  5EG2 A;  3X20 B;  2VUB A;  3VKI A;  4M75 C;  3PVL A;  1N8R U;  3QBY A;  2DYI A;  2YRC A;  2GQI A;  4OB2 B;  2CT4 A;  4A4G A;  4D8K A;  1Z9Z A;  2BZY A;  2L89 A;  1UEB A;  2C0O A;  2JTF A;  4RMO A;  1X6B A;  2KRM A;  2GF7 A;  4PKC C;  2HSP A;  2RQU A;  1A0N B;  3A8G B;  5AYF A;  1ZBX A;  1Y96 A;  1W2B S;  3OMC A;  1QVF S;  2RQR A;  4BDY A;  2XU8 A;  2DLP A;  4AG2 C;  2EKO A;  4PJL A;  3OBW A;  4M78 G;  2X4W A;  4XTU A;  3CME T;  2CH4 A;  3H8Z A;  3CBO A;  3SWN C;  5C0M A;  4C5H A;  1WHM A;  2Y4Y A;  4RCC A;  2PUK B;  4PJN A;  4M77 E;  1NEB A;  1R0B G;  2M16 A;  1YNZ A;  5GAM e;  5D7U A;  2JT4 A;  1UGR B;  1J3T A;  3OYJ A;  4PJO D;  2BE9 B;  5D6W A;  2RI5 A;  3C12 A;  3CCV T;  1YWP A;  3J80 E;  2X35 A;  2DMO A;  3VJP A;  3JCM W;  1IHV A;  3LW5 E;  3OYM A;  1BI2 A;  2V1R A;  3LGF A;  3UT1 A;  2E10 A;  3MP8 A;  3EG9 B;  1Q7Y C;  1QWF A;  1ZUK A;  1W6X A;  3E19 A;  3EG0 A;  4Y28 E;  3M54 A;  4OGE A;  1OOT A;  3M0S A;  3EG2 A;  1EIF A;  1GCQ A;  1PRM C;  5KYY A;  2MWP A;  5FWB A;  5KYW B;  1YJ9 Q;  4LUE A;  3QZ5 B;  3MEU A;  1MUZ A;  1VOM A;  1U8R A;  3EG1 A;  4M77 F;  4KBM B;  2E65 A;  3D7S B;  3QWX X;  1YJW Q;  2PVO B;  3PIO A;  1YHQ A;  1AZE A;  2BKD N;  3ZBD A;  1XNI A;  4DEY A;  2ECZ A;  1K73 C;  2E6N A;  4M7D F;  2AHJ B;  3CXC A;  1I4K 1;  4HCC A;  2PNI A;  4B9X A;  4EIK A;  1IRX A;  4MZT A;  2BUD A;  4OMM A;  4J6Y A;  2QGF B;  5LJ5 h;  5CQX A;  4E6R A;  2AIR B;  3TCJ A;  2VGM A;  1TOV A;  1X69 A;  2LVM A;  2EYY A;  1OZ2 A;  2K57 A;  1K8A R;  2KQW A;  2DE0 X;  2ESW A;  2EJF A;  3JCM h;  2A28 A;  1D1C A;  2QAS A;  1W70 A;  4LDU A;  1UJ0 A;  5CO7 A;  3OS2 A;  1M9S A;  5KYX A;  1VQO A;  1P92 A;  2HDA A;  2RB6 A;  3M55 A;  1LPL A;  2CZ1 B;  3LH0 A;  1UG1 A;  3NMZ C;  2XDD A;  2OTL T;  1MMG A;  1GBR A;  4C0G A;  1YP5 A;  3PIP A;  2CZ6 B;  2CP7 A;  3V7C A;  2LJ0 A;  2I0N A;  4E7H A;  4LUD A;  3CCL T;  1ZSZ C;  4BD3 A;  3CCV Q;  1RAG B;  2W0Z A;  1TG0 A;  2DYB A;  1D1B A;  3L2W A;  1VQM A;  2CS7 A;  5LJ3 g;  3CCM A;  2OAU A;  2HQX A;  1TWB A;  4HCK A;  3G6E T;  2P0Q A;  2HEQ A;  2P0K A;  4J6W A;  1CKA A;  2EPD A;  4XU3 A;  1BK2 A;  3RKW A;  1KC8 U;  2MIO A;  4Y92 A;  2AKL A;  1S72 Q;  2JW4 A;  2L0A A;  2OTL A;  1H3H A;  1O75 A;  1K0X A;  2K2V A;  1VQ5 A;  1T3S A;  2D8J A;  2QQR A;  2L3S A;  4ME7 A;  5KYN A;  3OW2 A;  2X3X D;  4GY5 A;  2EVR A;  3G4S A;  1BYM A;  4M75 G;  3HP9 A;  3PFS A;  1PWT A;  2YUO A;  2D1X A;  4ZNX A;  1V76 A;  1RI9 A;  4M75 A;  3DLL A;  2JMA A;  1AOJ A;  2NUT B;  4JRK A;  1K0S A;  1FMK A;  5LJ3 h;  2HNI A;  3CCS T;  4OF1 A;  4CC7 A;  2LCL A;  2GBQ A;  3O5Z A;  5HK0 A;  3EGD B;  3VS3 A;  1YCY A;  2VWF A;  3F70 A;  5GAN 7;  3GF5 A;  1VIE A;  1QVP A;  1HJD A;  5J26 A;  4C0F A;  5GMK e;  3QZ9 B;  2EYQ A;  4FCY A;  4J9D A;  2KDS A;  2V8I A;  1Q95 G;  4M77 A;  1NJI U;  3RES A;  3CME A;  2FB7 A;  3CC4 T;  4C92 C;  2NUZ A;  3CC2 T;  2RHU A;  2LNH B;  3H41 A;  2LCS A;  1X2Q A;  3NTI A;  3CPW A;  3P8H A;  1RAB B;  4JDS A;  5ECA A;  2GQV A;  3CCL Q;  5DY9 A;  1G3W A;  2LT1 A;  4II1 A;  1D0Z A;  1YIT T;  4ELZ C;  1YN8 A;  2RMO A;  5CKD A;  4JJC A;  5LJ3 j;  4PK4 A;  3CXC P;  1VQ7 T;  1X6G A;  2LJ1 A;  4AFQ C;  1LOJ A;  2D8H A;  3DB3 A;  4C8Q E;  3MP1 A;  5KCH A;  2XI9 A;  3EFR A;  3VS2 A;  3G6E Q;  4C8Q C;  3CCR A;  5FRN A;  1C1A A;  5CKF A;  1OX9 A;  1GCQ C;  4ZTJ A;  3S3M A;  3FB9 A;  3MEA A;  4M7A G;  1VQ7 A;  3S3N A;  1I8F A;  5A0G A;  2FZC B;  3QWY A;  3ZEH A;  2E5Q A;  2J6K A;  3QSU A;  1D0Y A;  3X24 B;  3I9Q A;  3JB9 D;  3X28 B;  3QUI A;  2FEI A;  4M75 E;  1ZQ1 A;  4LN2 A;  2LDM A;  4PJO F;  5KE2 A;  1WHG A;  4OVA A;  4P5N A;  3M0R A;  4RTV A;  4M75 D;  2X51 A;  3THK A;  4OB1 B;  4OMQ A;  4FL6 A;  3QG1 A;  2L3Q A;  1SKU B;  4PFP A;  5FU6 C;  3I5R A;  1KIK A;  4J7I A;  3RER A;  2OJ2 A;  4LE9 A;  3TSW A;  3HRT A;  3SB2 A;  2E5K A;  3E9G A;  1KQS S;  1UB4 A;  5CQY A;  2D0Q B;  4MZP A;  4MZM A;  2IPO B;  4TVR A;  3EGD A;  2NWM A;  1AVZ C;  2MWO A;  2DF6 A;  2QXF A;  3CCM Q;  5GMK j;  4FT4 A;  1WLP B;  4M77 B;  5GAN h;  3OYF A;  2JNG A;  4C8Q G;  2XG8 D;  4M77 G;  4OP0 A;  2GCX A;  3LYI A;  2CP0 A;  2MYS A;  2HQE A;  5D6X A;  1S72 T;  1WDX A;  1QKX A;  2YXY A;  2RO0 A;  4KH0 B;  1QCF A;  3VYG A;  4M7D G;  2EQM A;  4XTY A;  4KUL A;  4DA4 A;  3CC7 T;  1YIT Q;  3RKX A;  1M5Q 1;  4PJO G;  3I56 T;  3ASK A;  3DKM A;  3TEE A;  4EMH A;  5HCK A;  3HRS A;  2RHI A;  3H6Z A;  4NL3 A;  4N4H A;  2X4Y A;  1E6G A;  1BKB A;  3HFO A;  4JS4 A;  2A3L A;  2KEA A;  1KQS A;  1Y71 A;  3SEM A;  4IIO A;  4ORZ A;  4DBR A;  1VQL T;  1CSK A;  3G7Z A;  2F5T X;  5D6Y A;  5LJ5 g;  1K8A C;  4ZN1 A;  2W10 A;  2RK1 A;  2RJE A;  3OA6 A;  5GAM f;  4KT0 E;  2VB6 A;  3M57 A;  2XID A;  2RF0 A;  3G4S T;  1FYN A;  2GGR A;  2HAX A;  2EIF A;  5GAN 5;  3X26 B;  4ANJ A;  2QQB A;  3HRU A;  4OMO A;  4QQG A;  1UEC A;  3A8O B;  4ZGE B;  1D0X A;  2EQK A;  3TU4 K;  5GAN 2;  4HXJ A;  1XTD A;  4M78 D;  3CC4 Q;  4XU1 A;  2EGA A;  2KVQ G;  2V8K A;  2L5Q A;  5I2S A;  2VVK A;  5IHN A;  3A98 A;  1SG5 A;  3OW2 S;  3OYK A;  4D8D A;  2NUT A;  4FYX B;  3X25 B;  4FSS A;  1C6V X;  4J9F A;  1PHT A;  4LXC A;  3QJ6 A;  4DBQ A;  1M1G A;  2VGN A;  7AT1 B;  1UHC A;  1WHL A;  3OQ5 A;  1JQQ A;  2DFU A;  2WSE E;  2WSF E;  3OYD A;  3MO8 A;  2E3I A;  1VQ7 Q;  4PFZ A;  4FYY B;  2DNU A;  2M1H A;  1D3B A;  3IQL A;  3H0F A;  2DRK A;  4LD6 A;  1ZA1 B;  4OML A;  3REB B;  3MKD A;  1MGQ A;  5GAN 3;  3OYH A;  2A37 A;  5HKC A;  1VQ8 A;  3ZL7 C;  3M0T A;  4N4G A;  2E70 A;  4UC4 A;  1XJW B;  1M1K U;  3OYL A;  2DK3 A;  1KD1 C;  1IZ6 A;  3U23 A;  1NPR A;  2EJG A;  2GFA A;  4E7K A;  4J5Y A;  3CMA A;  3QPH A;  4M7D C;  4K11 A;  1TSF A;  5CVI A;  2NUP A;  3L2R A;  4EMK A;  4Z8A A;  3FJP A;  1UDL A;  1UHF A;  4DBF A;  3JCM e;  5GAN j;  1WXU A;  1ZA2 B;  1AEY A;  4M78 B;  3CMA Q;  1M8M A;  5A2Q E;  2FPF A;  3TQ7 P;  1RUW A;  2DZC A;  1OI1 A;  5FRO A;  1JRI A;  3M0Q A;  1LVK A;  2HD0 A;  4C8Q D;  2OAW A;  3OBY A;  1ZSG A;  1Q86 U;  2DTH A;  4MMK A;  1PG5 B;  4FYV B;  1MND A;  3OYN A;  4E7I A;  5LJ5 j;  1FWZ A;  4IUT A;  4LDW A;  4VUB A;  2WSC E;  3RBB B;  2R5A A;  4BUG A;  1YHQ T;  3RMS A;  4X9D A;  2O31 A;  1RAD B;  1QVG P;  1MV3 A;  1GCP A;  1KK7 A;  1B34 B;  2M0O A;  3OYI A;  1IHW A;  3CXC S;  3CD6 A;  4B6M A;  2LCC A;  2DPP B;  1AD5 A;  2AT1 B;  3G71 Q;  5DM7 R;  2CSQ A;  3QKJ A;  4C0D B;  1QLY A;  2EYX A;  3CD6 Q;  5CIU A;  4QQ6 A;  4ZN3 A;  2KK4 A;  1VQO T;  2V26 A;  4J9I A;  1KHC A;  3CC7 Q;  4QW2 A;  2HBP A;  2DKG A;  3VUZ A;  2DAQ A;  1XQH A;  4O5V A;  3QO3 A;  2CSI A;  4M7A D;  3ZFJ A;  3MJX A;  3PE0 A;  5EC7 A;  3CEY A;  1KJW A;  1PNJ A;  4BI8 B;  1NJI C;  3M53 A;  2B86 A;  4M7A E;  3JSC A;  3BDL A;  3VS7 A;  8AT1 B;  2K6D A;  3URG A;  4BE2 A;  1JEG A;  4M75 F;  1VQM Q;  5GAN 6;  2BE7 D;  2RH2 A;  2KGT A;  1HK9 A;  3I55 T;  3CCU Q;  1YI2 Q;  2K3X A;  4JRP A;  5CKH A;  1AZG B;  2HBW A;  3SDZ A;  1M3C A;  5GAN g;  3VS1 A;  2F5K A;  1V1C A;  3G4S Q;  3E2U A;  2CUD A;  1PM3 A;  2RQV A;  4EMK B;  1SSH A;  2DTO A;  3I56 A;  2KSS A;  5KCO A;  4OB3 B;  1QW1 A;  4J83 A;  3CC4 A;  1SF9 A;  2XKO C;  1VQ5 Q;  4WTO B;  5GAN 4;  3S3O A;  2EWN A;  2E41 A;  1UE9 A;  4J6X A;  1ACM B;  3CCQ T;  1Q86 R;  4F7U A;  4MML A;  5GAM j;  3E1S A;  2R5M A;  2COY A;  1ZBJ A;  1YWO A;  3VV0 A;  4JRQ A;  4BDZ A;  1Z9Q A;  4E7L A;  4DQ2 A;  2QI2 A;  2E4H A;  2HKQ B;  2VYT A;  3CCE T;  3ER0 A;  5GJV B;  4L6V 5;  2FYK A;  4BB7 A;  5GAN 8;  1WHJ A;  3SWN B;  2L2P A;  1OQK A;  1WQW A;  2RHX A;  2MF2 A;  4IUU A;  4M77 D;  2R58 A;  5LJ5 d;  1H8K A;  1KC8 C;  1M1K R;  1ZUU A;  4ATO A;  1B34 A;  4JS5 A;  2EQJ A;  5GAO n;  2RHZ A;  1WI7 A;  1I5L A;  2A0F B;  2QQA A;  1NLP C;  4C92 F;  1BCM A;  3CBP A;  3I5S A;  4LNP A;  3G1J A;  1QCO A;  3VS5 A;  1K76 A;  2MI6 A;  4FYW B;  3BW1 A;  3M0P A;  4L5G A;  1SRL A;  2E6Z A;  9ATC B;  2DL8 A;  1W2B P;  1YIJ A;  1QVF P;  3VRY A;  4RTW A;  2AK5 A;  2JS2 A;  2LX9 A;  2CKK A;  1SHG A;  2RQT A;  4HVV A;  2MMP A;  3VRZ A;  1PCX A;  1OZ3 A;  2YUP A;  2ZPF B;  3EGX A;  3LWH A;  1WQ7 A;  3LH5 A;  1TXQ A;  3FIF A;  1AHJ B;  2F1L A;  2JS0 A;  1MNE A;  3EFO A;  4KRT A;  2CGH A;  1WJQ A;  4X34 A;  3GLX A;  1BIA A;  4IIM A;  3VYH B;  1WPY A;  1PKT A;  3NPF A;  3V8J A;  3L42 A;  2P0P A;  2RM4 A;  5L23 A;  3GIB A;  1UUE A;  1OU8 A;  1D3B B;  1U1T A;  1WJS A;  4FM4 B;  1G8X A;  1K9A A;  2J6F A;  4EPC A;  4XAX B;  3PGG A;  3CCE A;  3KFV A;  2DL3 A;  1Y96 B;  4OB0 B;  1RLP C;  2KRS A;  1YHQ Q;  1BB9 A;  1IRE B;  3HPW A;  1B07 A;  4BY6 C;  1ZLM A;  2ED1 A;  3A1P A;  2K5L A;  1K8A U;  4JUV A;  4QQD A;  3OYB A;  4F7U B;  4AFU C;  3G71 T;  2YHT A;  4IUP A;  4PJM A;  3CCQ Q;  5LJ3 f;  1VQP Q;  2RN8 A;  1S1N A;  1MMN A;  1IO6 A;  4PJO E;  2K79 A;  1YJ9 T;  4C5E A;  5IN1 A;  4FW1 A;  3UA7 A;  1JBM A;  2O9V A;  3EGU A;  3CBM A;  2AKK A;  2DZ9 A;  1UFF A;  1VQ8 T;  1QQJ A;  4C92 G;  1VQ9 T;  4M7D D;  4QT7 A;  2JM9 A;  3CPW P;  3A8M B;  3A5Z B;  2E3H A;  4XK8 E;  1N6A A;  6AT1 B;  1EFN A;  1PKS A;  2DXU A;  5GAO m;  2ZPI B;  1JB0 E;  1OUL A;  4L59 A;  2DIL A;  3CCL A;  1ABQ A;  1M3B A;  2Z0W A;  4M7A B;  2KYB A;  2L3R A;  1X43 A;  2M51 A;  2ROL A;  3OS1 A;  3L2V A;  4E7J A;  3JCM f;  1JJ2 S;  3EFS A;  3QXE B;  3VS6 A;  2XDB A;  1BIB A;  2VXE A;  1LNX A;  1X6O A;  4BI4 A;  3M4Y A;  2FRW A;  2OI3 A;  1U5S A;  5GAO l;  4PNO A;  2QDL A;  1QCN A;  3WVD B;  2LQW A;  2ZPH B;  1E6H A;  3OYC A;  3UWN A;  2GTJ A;  1S72 A;  4JJD A;  1NEG A;  1U3O A;  4CI0 C;  1JXM A;  2RJD A;  1Y57 A;  2CP6 A;  2SEM A;  1JJ2 P;  2CRE A;  1VQK T;  3E9F A;  2IVW A;  5GAO p;  4F14 A;  4RG8 A;  1NYG A;  4CC2 A;  2EW3 A;  2FZK B;  1D09 B;  2CT3 A;  2O4X B;  4LD9 K;  4WF2 A;  4GBQ A;  3RUX A;  1GFD A;  3M5A A;  4BE1 A;  2XHC A;  4FIB A;  5I22 A;  3BE3 A;  1GRI A;  1WGS A;  2QTX A;  3OSV A;  5FRM A;  1KFZ A;  2DEQ A;  2B8A A;  1OU9 A;  2X9H A;  1G5V A;  3JB9 G;  4M7D B;  1YIJ T;  2M9U A;  4PFO A;  3M58 A;  3FLG A;  4PJO B;  2ED0 A;  4XU0 A;  4DEX A;  2YUN A;  2QGG A;  3RIR A;  3SHW A;  1TH7 A;  3REA B;  5CR2 A;  5GMK m;  1OPL A;  1NE8 A;  5GAN f;  1QMC A;  3DB4 A;  3JCM Q;  3M9Q A;  3GNF B;  1MMA A;  3MEV A;  1Q82 C;  4EMK C;  4BE0 A;  3I55 A;  3EAE A;  1KQ2 A;  1WFW A;  1HD3 A;  2WAC A;  3GPL A;  4C0Z A;  2P4T A;  1UJY A;  1W2B A;  1QVF A;  5KYW A;  3LLR A;  3CCS A;  1M90 C;  2QTV A;  2DM1 A;  2CYZ B;  1NJI R;  4RKU E;  4N4I A;  3EHR A;  3HFN A;  2YSQ A;  1ZUY A;  4M78 F;  4IKF A;  5GAN d;  2FL7 A;  3BFM A;  4HT8 A;  5I11 A;  1ZHI A;  1VQK A;  2A7Y A;  2DIG A;  1NZ9 A;  5CK9 A;  1AWW A;  1UGQ B;  5LJ3 d;  1VQN A;  1HSQ A;  2DER A;  3H0I A;  1YJW A;  2JM8 A;  3OS5 A;  1EX4 A;  4FSX A;  1VQP A;  1KD1 R;  1I5O B;  1RL2 A;  1T3L A;  1RAH B;  5LJ5 f;  4NL2 A;  2CZ7 B;  3OB9 A;  3PMT A;  1VQP T;  3V8K A;  3VUB A;  1JXO A;  2QA4 A;  3CC2 Q;  3RDV A;  3EH2 A;  4HVW A;  4QKU A;  1LCK A;  2F2X A;  2JUF A;  4N0A C;  1U1S A;  1ABO A;  2CH4 W;  2MAM A;  1PSE A;  4C0D C;  1Y7X A;  2RD1 A;  2KMT A;  4CC4 B;  3HHT B;  4A4F A;  1GBQ A;  1VQ8 Q;  1ARK A;  3P8B B;  2JN0 A;  1KSW A;  2PTK A;  3CCR Q;  2KRN A;  1FXX A;  4EMG A;  1R0C B;  1GXI E;  4MDX A;  5A0D A;  1OV3 A;  2ROT A;  3JV3 A;  2BIV A;  1YJN A;  4D6W A;  1KC8 R;  4M78 C;  4IUQ A;  1IGU A;  2K4Y A;  3JCM P;  4XTV A;  3TRE A;  1WYX A;  1NPP A;  2YUQ A;  2L3P A;  2RQW A;  3EG3 A;  3JCM c;  2DVJ A;  3CCQ A;  5C6S A;  1AWO A;  4LDY A;  1Q81 R;  1QP3 A;  4F7U F;  1SPK A;  1M1F A;  1AWX A;  4C5G A;  1WHK A;  1SRM A;  2PVD B;  3I56 Q;  5DLO A;  1IXD A;  1M4Z A;  2HQH A;  2KT1 A;  1YJW T;  2BZX A;  1ZSZ A;  4M77 C;  1UGS B;  2OTJ A;  4X1V A;  2KXC A;  4M7D E;  2AZV A;  2HL3 A;  5M9O A;  2O9S A;  1M3A A;  2LC4 A;  2DXC A;  1H92 A;  2F69 A;  3DLM A;  3OW2 P;  2RA2 A;  1K9M C;  3OY9 A;  1VQ4 A;  3JCM d;  4Z89 A;  1K9M R;  1M2O A;  3HTR A;  3HSB A;  2RK2 A;  1KHI A;  3SWN A;  2ZPE B;  4J9B A;  3V8L A;  1JU5 C;  3JB9 H;  2LT4 A;  2A36 A;  2MOX A;  3QYG B;  4R55 A;  1PD0 A;  3QDF A;  3CCJ Q;  2YWW A;  2KE9 A;  3HKS A;  2RI3 A;  1YJ9 A;  3INZ A;  2VC8 A;  4F04 B;  2HL5 C;  4PLI A;  4F7U G;  2C0T A;  5I2M A;  2COW A;  5LL6 S;  1I07 A;  2LRQ A;  5FU7 C;  3J81 E;  1FMV A;  4JPB W;  3H9N A;  1T0J A;  4JZ3 A;  3NTH A;  5KYY B;  2EAY A;  1VYU A;  5IXF A;  2KBT A;  2CDT A;  1RAF B;  3A8H B;  3QHS A;  2XMF A;  5LJ3 e;  2JXB A;  2O4X A;  1M2V A;  2ZPB B;  2FO0 A;  2DD4 A;  1K73 R;  4HVU A;  4C92 B;  2KY9 A;  2E1H A;  1M27 C;  3NFC A;  2X4J A;  3CCJ A;  5KE3 A;  3CCU A;  4E2F B;  2C06 A;  1PRL C;  3M59 A;  2D6F A;  3C4S A;  2QK0 A;  4DBH A;  1VQ9 A;  2KI7 A;  1VQL Q;  1VQ6 A;  4ESR A;  2LJ3 A;  2JJ9 A;  5GAM d;  2MCN A;  2DIQ A;  3L2U A;  2FG0 A;  4HT9 A;  2HCK A;  1E7O A;  4C8Q F;  2DBM A;  1OYX A;  2OTJ T;  2RNA A;  4XQ3 A;  1MV0 B;  2DL4 A;  2P84 A;  8ATC B;  2GNC A;  4Q5W A;  5GAN e;  4HA8 A;  1G3T A;  1G3Y A;  1UTI A;  1U06 A;  1TTH B;  5FWC A;  4PJO A;  1GL5 A;  1WA7 A;  4XTZ A;  3PTA A;  2KNB B;  2KT8 A;  4B9W A;  3OS0 A;  2V8J A;  1VA7 A;  3ULR B;  1IB8 A;  1RAI B;  1G2B A;  3CCS Q;  5A0L A;  3JCM J;  3PVQ A;  4ELY C;  3JCM V;  4A53 A;  4PLL A;  4KGV B;  3CCV A;  2KRO A;  4KUD K;  1AT1 B;  5FU6 B;  3CCR T;  1YJN Q;  3ME9 A;  3SD4 A;  2DJQ A;  2DET A;  2J05 A;  3EHQ A;  4C92 E;  2BTT A;  3AT1 B;  4EDU A;  3CCJ T;  5AT1 B;  3S6W A;  3L2Q A;  2ZPG B;  3EG9 A;  2KXD A;  1KQ1 A;  3LWI A;  4PJJ A;  2EYZ A;  5FLX E;  1N8R R;  2RHY A;  4RTZ A;  3GP8 A;  3A8L B;  1VYT A;  1IGQ A;  2QEX Q;  2KYM A;  4E47 A;  4N0A A;  5IAY A;  4ZGD B;  4PL6 A;  3QYH B;  2QQ9 A;  4Z02 A;  4RG2 A;  3G71 A;  2F2V A;  2PVG B;  2ZAE A;  2BZ8 A;  1Q82 U;  1FX7 A;  1X01 A;  2CP5 A;  5IHI A;  4C5I A;  2XK0 A;  1B7T A;  3FC3 A;  4MDW A;  3OYA A;  1TUG B;  4C8Q A;  2EYW A;  4HKE A;  1VQN Q;  1X2K A;  2LTO A;  3L1A A;  2ZCF B;  2F2W A;  1YCS B;  3R6O A;  2RJC A;  2COZ A;  2I2L A;  2JTE A;  2Y90 A;  1SSF A;  1TU0 B;  3H0H A;  1BI0 A;  3NTK A;  2K5F A;  5FW9 A;  3MET A;  2EBP A;  2JZ2 A;  1M90 R;  2J6O A;  1RAA B;  5KYU A;  3SFM A;  3I55 Q;  3CCU T;  2OTJ Q;  1N9S A;  2PZ1 A;  3JRZ A;  1PD1 A;  3UA6 A;  3FJ5 A;  1EZZ B;  3OYG A;  2KR3 A;  4M78 E;  2DTI A;  1K1Z A;  2YLB A;  3I35 A;  2QAZ A;  4XU2 A;  2DBK A;  1SEM A;  1R77 A;  2DA9 A;  4F7U E;  1WXT A;  2FPE A;  1VQ5 T;  2HZY A;  2CZ0 B;  1X27 A;  1WIE A;  1R8O B;  2QDY B;  4ZGJ B;  1LJO A;  4RTY A;  1MHN A;  5GAM h;  3Q1J A;  1BBZ A;  1BCO A;  3CD6 T;  4QVD A;  4BI3 A;  2E12 A;  1TUD A;  5GMK l;  1VQO Q;  2K7A A;  3N5B B;  1YJN T;  2QG9 B;  3CPF A;  2JOY A;  2X4X A;  3GOX A;  2LP5 A;  3OMG A;  2L8D A;  3VU3 C;  2LQ8 A;  3CCM T;  4FT2 A;  3M56 A;  2NYS A;  1VQL A;  1VQ6 Q;  1BI1 A;  4J9C A;  1NYF A;  1PC0 A;  3VS4 A;  5KH6 A;  4IUV A;  4WCI A;  2EGE A;  2HMA A;  4CC3 A;  2GTO A;  3LGL A;  2QEX T;  2CUB A;  4GLK A;  1OX8 A;  1TS9 A;  1M1K C;  1JO8 A;  3KUF A;  2EFI A;  4M7A A;  1Q81 C;  1W1F A;  2ENM A;  4JLG A;  4XTX A;  3OSS C;  1YI2 T;  4Z88 A;  2YRD A;  1CKB A;  2FRY A;  3MEW A;  2YRV A;  5J39 A;  1I0C A;  1M2V B;  2RJF A;  2JMC A;  5IT9 E;  2EGC A;  3BY7 A;  2DO3 A;  2D0N A;  4KH1 B;  4C92 A;  2DVE A;  3EFO B;  1MMD A;  4J9G A;  2DEU A;  3EH1 A;  4NS5 A;  1M8V A;  1VQN T;  3NGP A;  4M75 B;  4OGC A;  1HXD A;  2DX1 A;  4A4E A;  2DRM A;  2O2O A;  4A63 B;  1W4S A;  5KYU B;  5LJ5 e;  4F17 A;  4RTU A;  4Y91 A;  1GFC A;  2V1Q A;  3JAM E;  4A54 A;  2YDL A;  3TSZ A;  1H3Z A;  2Y4X A;  2EKH A;  3GNG A;  1Q7Y R;  3TVT A;  2H3E B;  3CCE Q;  1C0M A;  2GFU A;  3JCM b;  2G6F X;  4JJB A;  4NOY A;  4M7D A;  2LZ6 B;  3UF4 A;  4QVZ A;  3C95 A;  4C8Q B;  1V29 B;  1VQ4 Q;  4V2S A;  1TUC A;  2PU9 B;  4R56 A;  2K9G A;  5DLQ E;  2JVV A;  5GAM g;  1Y0M A;  4RCB A;  5HK3 A;  3L2Z A;  2G3R A;  2FPD A;  4DOW A;  5CKE A;  4RUG A;  2IG0 A;  3RR6 A;  3FEO A;  3CC2 A;  1D1A A;  4KUI A;  1X75 C;  4OMN A;  2J06 A;  3C0C A;  2YT6 A;  1KQS P;  2LMJ A;  2K2M A;  1T0H A;  4AFS C;  1HYO A;  1M30 A;  2MPX C;  5FU7 B;  2YLC A;  1N9R A;  3JCM g;  4R0K A;  1K73 U;  2A08 A;  3C94 A;  2QEX A;  1VQ6 T;  4J7F A;  1B3Q A;  3PNW C;  2VAS A;  2DL7 A;  4C92 D;  3NHN A;  2HSE B;  2OX7 A;  2MK5 A;  1N5Z A;  2LQK A;  2RI2 A;  3M4G A;  4OMF B;  1H64 1;  2FZG B;  2P4R A;  4J9H A;  3JCM X;  5CCA A;  4X9C A;  3V7S A;  2K3Y A;  1AWJ A;  1WHH A;  2DL5 A;  4QVC A;  1YIT A;  2M0Y A;  4IUR A;  4F16 A;  4PJO C;  4E7Z A;  2FVU A;  2ATC B;  2QA4 T;  1QVG A;  1NBE B;  1FMW A;  1UGP B;  4A4H A;  1Q7Y U;  1O9S A;  4LDX A;  2ABL A;  3OYY A;  4M4Z A;  3RKY A;  1I1J A;  1VUB A;  1WXB A;  2EJ9 A;  5GAO q;  3CME Q;  1N8R C;  4KGX B;  1G83 A;  1K9M U;  1YI2 A;  2CP3 A;  3QII A;  4CRI A;  3WXM B;  2H8H A;  1NLO C;  3MCA B;  5J3B A;  5IH2 A;  2NLU A;  3BDU A;  1OEB A;  1UGV A;  1QP2 A;  3M0U A;  1VQK Q;  3QDR B;  2XIC A;  3UAT A;  2LNV A;  1SHF A;  1YBY A;  2JTM A;  3JB9 F;  3G6E A;  1QVG S;  5KYX B;  3HL8 A;  5GMK i;  1NM7 A;  3KBG A;  4DOV A;  5GMK h;  2CP2 A;  1WJR A;  1VQ9 Q;  1QWE A;  1WX6 A;  1VQ4 T;  1KG1 A;  4GLM A;  1NG2 A;  4FU6 A;  3UDC A;  2D9T A;  1Q81 U;  2E64 A;  3CPW S;  2K5I A;  3GBQ A;  2H3J A;  3OYE A;  3P8D A;  5L8R E;  5CKB A;  4LDV A;  3RNJ A;  1ZSZ B;  1YIJ Q;  2DXB A;  5GJW B;  2PUO B;  1BU1 A;  2DJZ A;  3MHX A;  1RI0 A;  3CQT A;  4HCB A;  3T9N A;  4JJN K;  3V7R A;  1N27 A;  1WNL A;  2NUP B;  4RTT A;  3O8V A;  3CMA T;  4FW2 A;  4ZTF A;  3FRN A;  4XTW A;  1VYV A;  2LX7 A;  3PMI A;  4BAC A;  2ZGW A;  5I21 A;  4M7A F;  1VIF A;  5HY6 A;  2X3W D;  3JB9 J;  4J8O A;  2RPN A;  1PSF A;  2C0I A;  1YFN A;  2IIM A;  1RAE B;  4YTL A;  1VQM T;  3RMQ A;  4M7A C;  1K4U S;  1OPK A;  3J7A F;  4BY6 B;  2EQI A;  3QJY A;  4A4K A;  4JZ4 A;  2QYZ A;  4M78 A;  2R57 A;  1DJ7 B;  1G3S A;  5IXB A;  2LQN A;  1Y07 A;  3FDR A;  2VV5 A;  2PQW A;  1KD1 U;  2M02 A;  2QA4 Q;  4OMP A;  2EQU A;  2J7I A;  3MP6 A;  3EGX B;  1BI3 A;  5GAO r;  1XOV A;  2FHD A;  4AFZ C;  1I81 A;  4JRI A;  1M90 U;  2XDP A;  3KXT A;  4O6J A;  4AMC A;  3WVE B;  2XD0 A;  3LX7 A;  3CC7 A;  1JJ2 A;  1RAC B;  2OTL Q;  4AG1 C;  4E7S A;  2HKN A;  2VKN A;  4AT1 B;  1WZO A;  4RTX A;  3AHU A;  1Q86 C;  3VS0 A;  4J9E A;  2O88 A;  2K3B A;  2ZZD A;  1F1B B;  3MPU B;  1ZX6 A;  3UPU A;  4KGZ B;  2DD5 A;  1Q82 R; 
#chains in the Genus database with same CATH homology
 1UFF A;  3R6N A;  5IHK A;  1WDX A;  1QKX A;  2KYM A;  1QCF A;  4QT7 A;  2JM9 A;  1QKW A;  1RLQ C;  2SRC A;  2AZS A;  2F2V A;  1EFN A;  1PKS A;  2BZ8 A;  5HCK A;  3PVL A;  5IHI A;  2DIL A;  2GQI A;  2CT4 A;  1ABQ A;  1M3B A;  4D8K A;  2KYB A;  1X43 A;  1Z9Z A;  2BZY A;  2C0O A;  2M51 A;  2ROL A;  1X6B A;  2KRM A;  1E6G A;  2EYW A;  1X2K A;  2RQU A;  2HSP A;  2KEA A;  1A0N B;  3VS6 A;  2F2W A;  1YCS B;  2RQR A;  2JTE A;  3SEM A;  2DLP A;  4AG2 C;  4IIO A;  4ORZ A;  2FRW A;  2OI3 A;  1CSK A;  1U5S A;  3H0H A;  2QDL A;  2LQW A;  5FW9 A;  2CH4 A;  1E6H A;  2EBP A;  2W10 A;  2J6O A;  2GTJ A;  4JJD A;  2PZ1 A;  1NEG A;  1U3O A;  1JXM A;  1Y57 A;  2SEM A;  3UA6 A;  1NEB A;  2CRE A;  2RF0 A;  3FJ5 A;  2KR3 A;  1FYN A;  2GGR A;  1YNZ A;  1K1Z A;  3I35 A;  4F14 A;  2JT4 A;  2DBK A;  4OMO A;  1J3T A;  1NYG A;  4CC2 A;  2EW3 A;  1SEM A;  1UEC A;  2CT3 A;  2DA9 A;  4HXJ A;  1GFD A;  4GBQ A;  1WXT A;  2EGA A;  2FPE A;  2VVK A;  1X27 A;  1WIE A;  5IHN A;  1YWP A;  3A98 A;  2DMO A;  4RTY A;  4D8D A;  4FSS A;  1BBZ A;  5I22 A;  1GRI A;  2V1R A;  4J9F A;  1PHT A;  1TUD A;  1KFZ A;  1UHC A;  2K7A A;  1QWF A;  1ZUK A;  1JQQ A;  1W6X A;  3EG0 A;  2LP5 A;  1OOT A;  3M0S A;  3EG2 A;  2DNU A;  1GCQ A;  1PRM C;  5FWB A;  4LUE A;  2ED0 A;  4DEX A;  2YUN A;  3IQL A;  1MUZ A;  4J9C A;  3H0F A;  2DRK A;  1NYF A;  3SHW A;  3VS4 A;  3EG1 A;  4OML A;  2EGE A;  4WCI A;  4CC3 A;  3REB B;  3REA B;  2GTO A;  1OPL A;  2A37 A;  2CUB A;  3ZL7 C;  3M0T A;  3QWX X;  1JO8 A;  1W1F A;  2ENM A;  3U23 A;  1AZE A;  4DEY A;  2ECZ A;  4Z88 A;  1WFW A;  1HD3 A;  4K11 A;  1CKB A;  2FRY A;  1UJY A;  1I0C A;  2PNI A;  4Z8A A;  4EIK A;  2JMC A;  2EGC A;  4OMM A;  1UDL A;  2DM1 A;  1UHF A;  2D0N A;  1WXU A;  3EHR A;  1AEY A;  2YSQ A;  1ZUY A;  4J9G A;  4E6R A;  1M8M A;  2FPF A;  1RUW A;  3NGP A;  3M0Q A;  1X69 A;  5I11 A;  2EYY A;  2OAW A;  2DX1 A;  2DE0 X;  1ZSG A;  2ESW A;  1AWW A;  2A28 A;  2DRM A;  2O2O A;  1HSQ A;  4A63 B;  1W70 A;  3H0I A;  2JM8 A;  4RTU A;  4F17 A;  1GFC A;  1UJ0 A;  2V1Q A;  2YDL A;  3TSZ A;  1T3L A;  2HDA A;  2EKH A;  1UG1 A;  3NMZ C;  3TVT A;  1GBR A;  3RBB B;  2G6F X;  4JJB A;  1JXO A;  2LZ6 B;  3UF4 A;  1YP5 A;  2O31 A;  4HVW A;  1MV3 A;  1LCK A;  2F2X A;  1TUC A;  1GCP A;  2K9G A;  1ABO A;  2CH4 W;  2LJ0 A;  2I0N A;  4LUD A;  4CC4 B;  1AD5 A;  1Y0M A;  1ARK A;  1GBQ A;  2CSQ A;  1QLY A;  1KSW A;  2EYX A;  2FPD A;  2PTK A;  2W0Z A;  2KRN A;  1TG0 A;  2DYB A;  4RUG A;  1OV3 A;  4OMN A;  2ROT A;  4J9I A;  2J06 A;  3C0C A;  2YT6 A;  3JV3 A;  4HCK A;  2LMJ A;  2K2M A;  1T0H A;  4AFS C;  1M30 A;  2HEQ A;  1CKA A;  2EPD A;  2CSI A;  1BK2 A;  4R0K A;  1WYX A;  2A08 A;  2MIO A;  2YUQ A;  2AKL A;  2L3P A;  3PE0 A;  4Y92 A;  5EC7 A;  2RQW A;  3EG3 A;  1KJW A;  2DVJ A;  2JW4 A;  2L0A A;  1B3Q A;  1AWO A;  1PNJ A;  2DL7 A;  1H3H A;  2B86 A;  3NHN A;  1K0X A;  1SPK A;  3VS7 A;  1N5Z A;  1AWX A;  1T3S A;  2K6D A;  2D8J A;  2L3S A;  2P4R A;  1SRM A;  4J9H A;  2KT1 A;  2X3X D;  2BZX A;  1AWJ A;  2EVR A;  1JEG A;  2KGT A;  2DL5 A;  4X1V A;  2KXC A;  2M0Y A;  1PWT A;  2AZV A;  2YUO A;  1AZG B;  4F16 A;  2HBW A;  2D1X A;  2O9S A;  1M3C A;  3VS1 A;  4ZNX A;  1M3A A;  1V1C A;  1RI9 A;  1H92 A;  2JMA A;  1AOJ A;  2CUD A;  2RQV A;  2ABL A;  1SSH A;  1K0S A;  4M4Z A;  1FMK A;  4Z89 A;  1I1J A;  1WXB A;  4CC7 A;  2GBQ A;  3O5Z A;  3VS3 A;  1G83 A;  2VWF A;  2H8H A;  1NLO C;  1UE9 A;  5IH2 A;  4J9B A;  1JU5 C;  1HJD A;  1OEB A;  1UGV A;  2A36 A;  3M0U A;  2MOX A;  3UAT A;  1ZBJ A;  1YWO A;  2KE9 A;  1Z9Q A;  1SHF A;  4J9D A;  2C0T A;  5GJV B;  1NM7 A;  2NUZ A;  1I07 A;  2LNH B;  3H41 A;  2LCS A;  1X2Q A;  4JPB W;  1QWE A;  1WX6 A;  1T0J A;  4JZ3 A;  2L2P A;  4GLM A;  1NG2 A;  5ECA A;  1VYU A;  5IXF A;  2KBT A;  2CDT A;  1H8K A;  3GBQ A;  2XMF A;  2JXB A;  1ZUU A;  2FO0 A;  1YN8 A;  2RMO A;  4JJC A;  1WI7 A;  4HVU A;  1X6G A;  1NLP C;  2LJ1 A;  3RNJ A;  1M27 C;  4AFQ C;  3I5S A;  5GJW B;  2D8H A;  4LNP A;  3VS5 A;  1PRL C;  1K76 A;  1BU1 A;  3VS2 A;  3M0P A;  3CQT A;  1SRL A;  2DL8 A;  3VRY A;  4RTW A;  2AK5 A;  2JS2 A;  4RTT A;  1GCQ C;  4ESR A;  1SHG A;  2RQT A;  2LJ3 A;  4HVV A;  2MCN A;  3VRZ A;  1VYV A;  2YUP A;  3LH5 A;  2LX7 A;  2FG0 A;  2HCK A;  1E7O A;  2DBM A;  2RNA A;  2X3W D;  2JS0 A;  3QWY A;  1MV0 B;  2RPN A;  2DL4 A;  2C0I A;  2J6K A;  2IIM A;  4KRT A;  3I9Q A;  2GNC A;  4IIM A;  1PKT A;  2FEI A;  1UTI A;  3NPF A;  1K4U S;  5L23 A;  1OPK A;  1U06 A;  4LN2 A;  1UUE A;  2EQI A;  5FWC A;  1GL5 A;  1WA7 A;  4JZ4 A;  1K9A A;  2J6F A;  3M0R A;  4RTV A;  5IXB A;  3KFV A;  2DL3 A;  2LQN A;  3THK A;  2KNB B;  2KT8 A;  4OMP A;  1RLP C;  2KRS A;  4OMQ A;  2J7I A;  1BB9 A;  1B07 A;  1VA7 A;  3ULR B;  2L3Q A;  3I5R A;  1KIK A;  1ZLM A;  1XOV A;  2OJ2 A;  1G2B A;  2ED1 A;  4AFZ C;  4LE9 A;  3TSW A;  2E5K A;  3PVQ A;  4AFU C;  2KRO A;  4AG1 C;  2DJQ A;  2NWM A;  1AVZ C;  2J05 A;  3EHQ A;  2RN8 A;  2BTT A;  2DF6 A;  2VKN A;  4RTX A;  1S1N A;  1WLP B;  1IO6 A;  2K79 A;  3VS0 A;  4J9E A;  2O88 A;  2K3B A;  2KXD A;  3UA7 A;  2O9V A;  1ZX6 A;  2EYZ A;  4RTZ A;  3EGU A;  2AKK A;  1VYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...