3S6WA

Crystal structure of tudor domain of human tdrd3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
52
Chain Sequence
b'MWKPGDECFALYWEDNKFYRAEVEALSGMTAVVKFIDYGNYEEVLLSNIKPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tudor domain-containing protein 3
molecule tags Transcription
source organism Homo sapiens
publication title Crystal structure of TDRD3 and methyl-arginine binding characterization of TDRD3, SMN and SPF30
pubmed doi rcsb
total genus 10
structure length 52
sequence length 54
ec nomenclature
pdb deposition date 2011-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s6wA00
2LDMA 4QW2A 2M0OA 3PMTA 5D6YA 1RI0A 2R57A 2RHYA 4QQ6A 3OYNA 3OA6A 4Q5WA 3NTHA 3QJ6A 4E7JA 3NTIA 5KH6A 2P0KA 4RG2A 4PLIA 4II1A 3H6ZA 4QQDA 3MEVA 3OYLA 3PFSA 3ME9A 1OZ2A 2LCCA 2DAQA 2RHIA 3OYGA 4IUQA 5C6SA 2LRQA 2BKDN 3PMIA 2X35A 4N4IA 3L42A 4OVAA 4C5IA 3LX7A 5FRNA 2JTFA 3H8ZA 1OYXA 2BIVA 2D9TA 4IUUA 3OYCA 3L2QA 2LVMA 2RI3A 4Z02A 4BE2A 2IG0A 2RI5A 4IUPA 2M1HA 4E7LA 2DIQA 2FHDA 4NS5A 3ASKA 3BDLA 3LYIA 5D6XA 3L2RA 2CKKA 4UC4A 1MHNA 3O8VA 2E5QA 3LLRA 2EQJA 1WJRA 2RHUA 3OMCA 2EQKA 4PL6A 5FRMA 4LD6A 3MP8A 2QQRA 3OYIA 3OS2A 3E9GA 1N27A 2E6NA 4C5GA 3OS0A 2R58A 4IKFA 3CEYA 4B9XA 3OY9A 2GFUA 2VYTA 3OB9A 3OS1A 3S3MA 2O4XB 3OQ5A 5IN1A 2X4YA 3OYAA 4L59A 2X4XA 2RHZA 3Q1JA 3P8HA 5KCOA 3MO8A 3P8DA 1WGSA 1OI1A 4A4GA 3OYJA 4HCZA 3C4SA 3LGLA 3FDRA 2DIGA 1OZ3A 2JZ2A 3EAEA 4N4HA 3F70A 3UWNA 2F5KA 4IUVA 5J39A 3OYHA 3DB4A 5KE3A 2NLUA 3GOXA 3MEUA 3MP6A 4PLLA 3SD4A 3OYKA 3ZEHA 1H3ZA 3MEWA 5CIUA 1WJSA 2GFAA 2MWOA 3S3OA 1XNIA 2RO0A 3QBYA 4QVZA 3OYFA 2K3YA 3FEOA 3KUFA 2L89A 3QIIA 3OYMA 3S3NA 2RJCA 4X34A 4EDUA 3MEAA 4FL6A 5KCHA 2XDPA 5C0MA 2L3RA 4BD3A 4E7HA 3LH0A 1SSFA 2RJDA 4BDZA 3DB3A 2BUDA 2G3RA 5FROA 3L2WA 4IUTA 2EQUA 3E9FA 3M9QA 4ZTFA 2R5AA 1G5VA 4B9WA 3PNWC 5M9OA 2WACA 5J26A 2X4WA 2GF7A 4A4FA 2QQSA 3QKJA 2K3XA 3OYBA 3OYDA 4BE1A 4ZTJA 2RI2A 3NTKA 4BDYA 3FC3A 4BACA 4E7IA 1WJQA 2EFIA 2MWPA 3LGFA 4BE0A 3MP1A 2XK0A 3L2UA 2EQMA 2HQXA 4A4EA 2R5MA 4IURA 2EKOA 2O4XA 3META 2L8DA 3UT1A 4CRIA 4E7KA 2PQWA 4GY5A 2LTOA 5IAYA 2HQEA 2RJFA 3DLMA 2YRVA 2RHXA 4QQGA 5KE2A 3L2VA 4N4GA 1KHCA 3FLGA 4C5HA 3OYEA 4A4HA 4C5EA 2M16A 4FU6A 3S6WA 2RJEA 5D6WA 3OMGA 2B8AA
chains in the Genus database with same CATH superfamily
5FLXE 2JNGA 4F7UG 2HKNA 2EW3A 2JVVA 3M59A 3EH2A 2KI7A 4WTOB 2EYWA 1M9SA 4EMKA 2CH4W 2DAQA 3EFOB 2YXYA 4F7UF 2YLBA 2KEAA 1TS9A 1VQ4Q 4IIOA 3I56A 3UATA 4J9DA 1QVGP 2CKKA 4UC4A 2COWA 2XDBA 1ZX6A 2AZSA 2VGMA 3SB2A 2QTXA 2NYSA 3OS2A 1WLPB 5GMKh 3CMEA 2FYKA 2MF2A 2PZ1A 4KBMB 1PHTA 2DXCA 3FJPA 3X25B 1Q7YU 4RCCA 4M7DE 4O6JA 1JXMA 2QQAA 2DL7A 3HRUA 2V8KA 5GAN8 4QVCA 1VQ6A 1S72T 1SSHA 2SEMA 1GRIA 2CSQA 2K7AA 5LJ3g 5EC7A 4M77G 1UGSB 4PJLA 3S3OA 3THKA 3OYMA 3OSVA 4M7DF 2CUDA 1WI7A 4JDSA 1WXUA 4BD3A 1YITQ 2HBPA 2X9HA 2YRCA 1YJ9Q 1TH7A 3T9NA 3OYDA 2ZCFB 4F14A 1T0HA 1VQ9T 2DXBA 2ZPFB 1WJQA 1WZOA 2QGFB 2R5MA 4RTYA 4CRIA 1D0YA 1IREB 1M1FA 1VQPA 3VYHB 2DBMA 2RK1A 4M75B 1UUEA 2DBKA 2YHTA 4A4HA 4M7AB 2X4JA 3OYNA 4JS5A 2M0OA 2EAYA 2JS0A 1M4ZA 2DXTA 4IIMA 2QA4T 1R77A 2C0TA 3CXCP 4II1A 2DVEA 4F7UE 4BUGA 2LC4A 2DJZA 2CP2A 1B34B 2HKQB 2QDYB 4J9FA 1VQLQ 2AKKA 2CZ1B 4PNOA 2VB6A 2IG0A 3CCMA 2ZPHB 3CCQA 4OMQA 4RTXA 3CCRQ 2QXFA 3QYHB 1BI1A 1K1ZA 1UTIA 1V29B 3CCVT 3X26B 4PJOA 1YIJT 3OS1A 2X4YA 2K9GA 4LUDA 5CCAA 3P8DA 5FU6B 6AT1B 2JM9A 3EG1A 2RH2A 4KRTA 3RBBB 3F70A 5GAN5 1MNDA 2ENMA 4J9GA 1QCNA 4XU3A 4C92F 3MJXA 1WJSA 4HT9A 2D8HA 3QBYA 2K3YA 3CCVA 4C0FA 3I56Q 3PT9A 2RJDA 3G71Q 2ZPBB 5KYWA 2LQWA 3CC4A 1OV3A 3JCMP 2O9SA 1VQOQ 2YT6A 1YHQQ 2HAXA 2VXEA 2QQ9A 2E41A 4ZTJA 2FPFA 4FT4A 1G83A 5LJ5f 1YJWQ 1RAHB 3CCLT 4RTWA 2A0FB 4AFSC 2EFIA 1SF9A 3TEEA 3QWYA 2CT3A 4E7KA 2J06A 2QTVA 2D6FA 2LTOA 5GMKm 1C1AA 2PVDB 2RHXA 4DBHA 5I22A 3VS5A 4KULA 3VS2A 5GAN7 3S6WA 1M90U 3OMGA 2PUOB 1KHIA 3A8OB 4D8KA 2Y4YA 1PD0A 1RAAB 2OAWA 4M78A 1QVFS 4X9DA 3HHTB 2P84A 4M77B 1X75C 4M75E 4CC2A 2F2WA 1YJ9T 2LRQA 2LT4A 2JT4A 1KIKA 2CUBA 2F5TX 1K0SA 3CCJQ 1VYUA 3TSWA 1FMVA 2CP3A 1AZGB 3QYGB 4NS5A 1XOVA 3A8MB 1RI9A 1ZSZB 3I55Q 3LLRA 4CC7A 4E7ZA 1N6AA 5GMKe 1JXOA 3MP8A 2JN0A 5J3BA 1X2KA 4J83A 5GJVB 3REBB 2E6ZA 1QW1A 4J7FA 4D6WA 4ESRA 5LJ3e 1NYGA 2BZ8A 1G3WA 2QG9B 1YI2A 1WHHA 1C0MA 4C0DC 3RKXA 1NLOC 4ATOA 2O31A 3PVQA 1VQ4A 4XU2A 1ZSZC 2FPDA 1MUZA 4LXCA 1Q95G 2DTIA 1KD1U 3BFMA 2RA2A 5FROA 3M9QA 3I5SA 5M9OA 5LJ3j 3VKIA 4A53A 1YI2T 3QKJA 1Q82C 1WHMA 2PVOB 1D0XA 3REAB 3M58A 3ER0A 2I2LA 3I9QA 1AWXA 4J9IA 2JM8A 3PTAA 1WQ7A 1JO8A 2E10A 4E47A 2LNVA 3R6OA 5IH2A 2EKHA 5LJ3f 3CC4T 4PJOG 4C5EA 2M16A 4FU6A 1W6XA 1UHCA 4OMOA 4OF1A 2EGEA 2ZGWA 2J6FA 3KBGA 1NE8A 1ZUYA 2LNHB 4QQDA 5LL6S 4BI4A 5IHNA 1OZ2A 2KRNA 3PMIA 1ZQ1A 3L42A 1OULA 2KAFA 2W10A 2DF6A 3LWIA 2COYA 2E3IA 4JJBA 3GNGA 2EJ9A 4WF2A 2CP6A 3JCMJ 3KFVA 3M57A 4Y91A 1KSWA 3QHSA 1WHJA 1N27A 1G2BA 1VQ5A 2Y4XA 4NL2A 1QQJA 4M78E 1X69A 4EIKA 5KYXA 1M30A 2IIMA 2GNCA 4L59A 3G6ET 4JRIA 1SHFA 1BBZA 7AT1B 2LZ6B 2KE9A 2LCLA 1JEGA 4E7IA 2NLUA 4RTVA 4A54A 4LD9K 4PK4A 3OYYA 3OW2P 1Q81R 2LQ8A 4E6RA 1VQ5T 4KH1B 1D0ZA 3SEMA 1N9RA 4XAXB 4LDYA 3PIOA 1YP5A 1YN8A 2L3SA 3CCSQ 3CCRT 1UGRB 2L2PA 1SKUB 1H92A 2F2XA 3LH5A 2XD0A 3G4SA 2P4RA 2RI2A 3OBWA 2DA9A 1IGUA 2NUTA 3HTRA 3CCJA 1WFWA 2CREA 1MMAA 2I0NA 4JUVA 1X6GA 1VQLT 1AZEA 4N0AC 2KROA 4M78G 2E4HA 5A0DA 1HJDA 1JRIA 5IAYA 4K11A 2RQUA 3URGA 1PRMC 3UF4A 1RAIB 4OB1B 3EFSA 3OYEA 3V7SA 8ATCB 3QG1A 1U3OA 2J7IA 2K5IA 1QP2A 5A2QE 2XIDA 4Q5WA 4E7JA 2DYIA 3CC2A 1BK2A 3G71A 2P0KA 1WHKA 4OB2B 3VRZA 3CBMA 1BIBA 2ECZA 4J6XA 2DL3A 2F2VA 1VQPT 4KUDK 1W70A 2C0IA 2JTFA 5GAMe 4C92D 4BI3A 5EG2A 2LVMA 2DEUA 1TOVA 1VQ7Q 3WVEB 3SFMA 3O8VA 1Y96B 3U23A 4QT7A 1O9SA 3JSCA 4C92C 2CT4A 2NUPB 4F17A 5CQXA 3E9GA 3CD6A 1YCSB 2MI6A 3A98A 3UDCA 1M2OA 1AEYA 4JJCA 4J6WA 3OB9A 1LNXA 4C8QC 3CCET 5I11A 2QK0A 3CCUA 1VYTA 1Y0MA 1R0CB 3JCMe 2HNIA 5GAN6 3HFNA 4RTTA 4RMOA 2QI2A 2WSCE 4M7AF 1FWZA 5GAOp 5CIUA 1D3BA 4X9CA 3OYFA 2RQTA 2L89A 1FMWA 2KVQG 4C0GA 2A36A 4EDUA 5KCHA 1IHWA 4JJNK 1W2BP 3HPWA 2CGHA 4KGVB 4LNPA 1EZZB 4JZ4A 4OB0B 2O88A 2K3XA 4WCIA 1YCYA 4BDYA 1ABQA 2DRMA 5KYYB 5GANf 2GGRA 4FW2A 2JW4A 5FW9A 3RDVA 3M54A 3GF5A 1YBYA 2B86A 4KGZB 2JOYA 1VQ6Q 3L2VA 1MMGA 3H0IA 4M7DA 2E64A 2JJ9A 1I81A 5FRNA 3FJ5A 4RUGA 2M0YA 4MDXA 2OAUA 3NTIA 5CQYA 3D7SB 2CZ0B 1K73C 1M90C 2KT1A 5I2MA 1S1NA 2DTHA 1SEMA 2CS7A 1BCOA 1KG1A 2EJFA 1XQHA 1G3YA 2BIVA 2RD1A 2KNBB 1E7OA 4Z8AA 3JB9H 1PKSA 3GLXA 3BDLA 5FWCA 5ECAA 4AMCA 3NGPA 3NMZC 4PL6A 4LD6A 3M56A 2DETA 2XKOC 1ZUUA 2E6NA 1K9MC 1RUWA 3H0FA 5A0GA 1WHLA 4C8QG 4VUBA 3JCMV 3QZ9B 4XK8E 3V7RA 1PRLC 2RHZA 3P8HA 4GLKA 3JCMh 1OI1A 3G4ST 3HL8A 1OX9A 5DLQE 2YWWA 3EAEA 5GAOq 2GQIA 5AYFA 5KYUB 1I4K1 2EBPA 3C12A 4QVZA 2PU9B 2K79A 1Q86R 2RJCA 1WIEA 2MMPA 3CCMQ 4L5GA 3CMAA 2G3RA 4EMKB 2R5AA 1OPLA 4PJOD 2LX9A 4A4FA 3RNJA 1B7TA 3CD6Q 1M8MA 5GAMj 4BY6C 1K9MR 1VQ5Q 1KC8C 4BACA 2ZZDA 1VQNQ 1GCQC 5CKEA 1HXDA 3G71T 3L2UA 1IB8A 4PFOA 1XJWB 4JRPA 1QVFA 2A3LA 3CCUQ 1I0CA 4PJOC 3A8GB 2DTOA 3VUZA 2RJFA 2GCXA 2YRVA 3VS4A 5IHKA 5KYWB 5GAMf 4EPCA 4F16A 1Q81U 4C5HA 5IXFA 3JAME 4A63B 2KYMA 2OTLQ 3DLLA 4XTXA 1VQOT 1K9MU 1K8AR 4ZGJB 3OS5A 3MEVA 2RPNA 3CCSA 4BY6B 1BI3A 1ZBXA 5GJWB 1TTHB 1LCKA 1V76A 2X35A 4C5IA 3LX7A 4V2SA 3SWNA 2ROLA 3GIBA 2MOXA 2XI9A 2XU8A 3QJYA 3CBOA 2GTJA 3I5RA 4M75D 1OU9A 2K6DA 1BB9A 1VQOA 2EQKA 2VVKA 5CAIA 2V1QA 3H41A 4X1VA 2DK3A 2AKLA 1ZSGA 4FCYA 2CH4A 2DZ9A 4ZGDB 1MMNA 3M5AA 2KK4A 2CYZB 4M75C 5IN1A 4ELZC 3JV3A 5AT1B 1Z9ZA 3CC2Q 1K0XA 3LWHA 2EWNA 1Z9QA 3OYJA 3A1PA 4JRKA 5GAMh 1EFNA 2EGCA 2VASA 2EPDA 3GOXA 3OYHA 4PJOE 3OYKA 3QDRB 3MEWA 2GFAA 1PNJA 1TWBA 2EYQA 3JCMb 2DX1A 5HK3A 1PCXA 1WDXA 5GAN3 1NYFA 4MDWA 3VS7A 3X20B 4J9BA 2L3RA 2JMCA 1SSFA 4J5YA 4KH0B 3R6NA 5LJ5g 1PSEA 2EQUA 1K73R 3QWXX 1AWWA 3G6EA 3OW2S 2WACA 3J81E 3M4YA 2WSEE 2WSFE 1TUDA 1SRLA 5DLOA 2D1XA 1E6HA 3JCMf 4DA4A 1M27C 3LGFA 1IRXA 1IO6A 4A4EA 3OBYA 1BCMA 4F7UA 1WNLA 2AHJB 2PQWA 1M1GA 4QQGA 2L3PA 3E1SA 4PJOB 2SRCA 2RJEA 5KYYA 1BKBA 1CSKA 3CCVQ 3OA6A 1TSFA 1U06A 4E7SA 4HKEA 4ZN1A 3TVTA 1RABB 1Q7YC 4EMKC 3AT1B 1RL2A 3OYCA 4Z02A 4BE2A 2QQBA 5LJ5d 4HA8A 2FHDA 2E70A 1IXDA 1IGQA 3RR6A 4AT1B 2K2VA 5I2SA 2E5QA 2DFUA 5HK0A 3M0TA 1CKBA 5DM7R 1T3SA 2ATCB 1UJ0A 2DXUA 5CKDA 4J9CA 2OTJA 1VQNA 1QKXA 2GFUA 2VYTA 2DL4A 1VQ8A 3EG3A 1Q82U 2X3XD 1VQKA 4DEXA 2PTKA 1WXBA 4HCZA 1C6VX 3JCMd 2KYBA 1YFNA 1VQ6T 3MEUA 3GPLA 2LMJA 1VQNT 4X34A 1G3SA 4RG8A 4E7HA 3L1AA 1QWEA 1VQ8T 5L8RE 2BUDA 4FT2A 4JJDA 5CKFA 3CCUT 3VS1A 4LDWA 3M4GA 5J26A 2G6FX 3OYBA 1YITT 4XTZA 3FC3A 2KSSA 1N9SA 2KQWA 5GAN4 2PUKB 2VV5A 4M7AA 2E12A 1IZ6A 2VUBA 3UT1A 1X6BA 3C0CA 3TCJA 4GY5A 2HQEA 3DLMA 4KGXB 5KYNA 1FYNA 2FVUA 1TU0B 1RACB 4M4ZA 2DZCA 2RMOA 4XTVA 3NHNA 2YUPA 4QW2A 3ULRB 2JMAA 1WX6A 2RHYA 3PVLA 4RG2A 4PLIA 3JCMg 1CKAA 2LX7A 1BU1A 2DM1A 4AFZC 3EH1A 2A08A 3A8HB 1UE9A 2VKNA 3QO3A 2A28A 3MHXA 4C0ZA 2MPXC 2P0QA 1VQ9A 2P4TA 1K4US 1MHNA 1K9AA 1LVKA 2DL5A 2ROTA 1UB4A 1D1AA 5LJ5e 3IQLA 4MMKA 2E5KA 3ZL7C 1VIFA 4D8DA 3RERA 2DNUA 1VQMQ 1UG1A 1I07A 1Y57A 2OTLT 4QKUA 4C0DB 3DKMA 3C4SA 1SPKA 1GL5A 1KQSS 2F5KA 2QDLA 3MP6A 2M02A 3SD4A 1Y96A 4JZ3A 2RO0A 3P8BB 3FEOA 3WXMB 2K5LA 4C92E 3L2WA 1OQKA 2KY9A 4C8QE 2O9VA 4DQ2A 4L6V5 2OTJQ 1QCOA 3QZ5B 2H8HA 5CKBA 1MMDA 2EKOA 2O4XA 1P92A 4C8QF 4FYYB 3I35A 1RAFB 1MV0B 4HVVA 5GAOn 4IUUA 3M0SA 3CPWP 4FSSA 4AG1C 2K2MA 4JRQA 3INZA 3TREA 2R57A 3NTHA 1OEBA 2DLPA 3QJ6A 1M90R 1YWPA 3RMSA 2CP7A 3A5ZB 3CC4Q 5LJ5h 3OYLA 3BE3A 2JTEA 5CR2A 1M5Q1 1YJ9A 2BE9B 4HCCA 1PD1A 3I56T 3EHRA 1NBEB 3WVDB 1GCPA 3ASKA 4LUEA 3CCJT 2EQJA 3BDUA 2HD0A 1QWFA 1OU8A 2QASA 3CCST 1J3TA 5CO7A 2VGNA 2DERA 4C5GA 1SHGA 1QVGS 3FRNA 3EFOA 4JPBW 1PSFA 2V8JA 1OX8A 1B34A 2LP5A 1V1CA 2FRWA 5LJ3h 1HSQA 5HCKA 4A4GA 2JUFA 3N5BB 2J6OA 2NUZA 1LOJA 3JB9I 3A8LB 9ATCB 1WPYA 4KUIA 4XTUA 5KE3A 1T3LA 4PLLA 1W2BS 1M2VA 1XNIA 3M53A 3JCMQ 1ARKA 4M77D 4DOVA 4FL6A 4M7AE 1NJIU 3EGUA 3ZBDA 3H0HA 3E9FA 2FL7A 1VQ7A 3VJPA 4FSXA 1M3BA 4M77C 3CCQT 1NEGA 2NWMA 1VQLA 3RKWA 1N8RU 1PC0A 3RESA 4M75A 5HY6A 3MCAB 4MZMA 1IHVA 1NZ9A 3CBPA 3UPUA 2L8DA 2ABLA 1VQKQ 5D7UA 3M0QA 4P5NA 1Q7YR 2QEXQ 1UECA 2DMOA 4LDXA 5LJ5j 2DD5A 4OMFB 2COZA 4C92B 1SRMA 2B8AA 1ZSZA 3QUIA 2DPPB 2E3HA 1M8VA 2KT8A 2W0ZA 1FMKA 3ZFJA 2XMFA 3BW1A 2ESWA 4PJJA 2LT1A 3X28B 4N4IA 2BTTA 1RADB 2DL8A 1OYXA 2K5FA 1VUBA 2FO0A 4AFUC 4J8OA 1BI2A 3CMAQ 5GMKi 3L2RA 5D6XA 3EG9A 4M75F 1Y71A 3AHUA 2YRDA 3OS0A 4HVWA 2M51A 2H3EB 3M0PA 2K3BA 3JCMX 1NG2A 3CEYA 1YIJA 2RK2A 5FU6C 2J05A 4M75G 2F69A 3Q1JA 4M77E 3TSZA 3SWNC 4O5VA 2MYSA 1N8RC 4J9HA 4Y28E 2EGAA 3DB4A 1Y07A 4C8QB 4M7DG 1QVGA 4Z88A 8AT1B 2OTJT 4OMLA 4M7AG 4M77F 3QSUA 4PJMA 3VV0A 2QAZA 2PVGB 4XTWA 3CCLQ 3FIFA 4ZTFA 1QP3A 4ME7A 2VXFA 2JTMA 1HK9A 1Q86U 1T0JA 5GMKj 2P0PA 4RTZA 1JJ2S 4LE9A 3VRYA 2GTOA 2OI3A 3M55A 1PM3A 2YSQA 1Q86C 1G8XA 1GCQA 1VQMA 1S72Q 1K8AC 5GAMg 3C94A 1YI2Q 4HVUA 4DBQA 3VS3A 4JLIA 2RM4A 4XQ3A 2A7YA 3CMEQ 3FLGA 1GFDA 4FIBA 4RKUE 1D1CA 2HZYA 2KDSA 1SG5A 1X2QA 3MPUB 5IHIA 1I5OB 5IXBA 3G1JA 4FYWB 1LPLA 5CK9A 4CC3A 2L3QA 3OYGA 2BKDN 3G4SQ 4NL3A 1AWOA 2FZGB 2RQVA 4C8QA 1UGQB 1Q81C 1BYMA 3CC7T 5FRMA 3FB9A 2RB6A 4CI0C 1WXTA 2AK5A 1M1KU 4KT0E 3RIRA 2OX7A 4ZNXA 1D1BA 3S3MA 3CQTA 1U8RA 5GAMd 1VYVA 3JB9G 2V8IA 2GQVA 3JCMc 1TUGB 3JB9J 2EYZA 3J80E 2CZ6B 5CKHA 3VUBA 5J39A 3UA6A 3CC2T 4J9EA 2QA4A 1PG5B 3M0UA 1TXQA 3ZEHA 2X51A 1GFCA 4C92G 1YJWT 2FZKB 5C0MA 4EMGA 4BDZA 3DB3A 1B3QA 2KRMA 3PNWC 2IPOB 1A0NB 3LW5E 4BE1A 1K8AU 2BZYA 1M2VB 4HT8A 4MZPA 3V8JA 2C0OA 3QXEB 1VQ8Q 1U1SA 2JXBA 2C06A 1RLPC 3RKYA 1X01A 1WA7A 1H3HA 1QCFA 4PFPA 3CCEA 4M78D 3O5ZA 1NJIC 1GBQA 2AZVA 4OB3B 2FB7A 2IVWA 5L23A 1ZHIA 1ZA2B 3CXCS 4MMLA 1X43A 1K76A 5GMKl 1U1TA 4ELYC 2CP0A 2DEQA 4M78C 3EG9B 4LDVA 4M7DB 4F04B 3H9NA 5DY9A 2RHIA 5GANh 1TUCA 1ABOA 2VWFA 3RMQA 1KC8R 5IT9E 2D9TA 2FEIA 4FW1A 1KFZA 1M1KC 3LYIA 5GANg 1UDLA 3CCLA 3V8KA 1X27A 2RHUA 3OMCA 1YHQA 1E6GA 3HSBA 2YUOA 2DRKA 2H3JA 2KMTA 2BE7D 1VIEA 3X24B 1D09B 3HKSA 2QYZA 5GAOm 4OGEA 5FU7C 1WQWA 4YTLA 3OYAA 4CC4B 2X4XA 4BI8B 1UEBA 3G7ZA 1VQPQ 3PE0A 1KK7A 2KR3A 4PFZA 1VQMT 5GANe 4DBRA 3KUFA 3J7AF 2LQNA 3SWNB 2E65A 1YWOA 2CP5A 1JJ2P 2D0QB 3I55T 3MEAA 1NEBA 2ZPEB 2YLCA 3CMAT 4IUTA 1KQSP 2HL3A 2CSIA 3CCRA 5CVIA 4B9WA 3VU3C 2Z0WA 2YUNA 1RAEB 2HCKA 3SDZA 1R0BG 4N0AA 4HCBA 4M78B 4XTYA 2MWPA 4C92A 2JS2A 5GANd 1YJNT 2OJ2A 4IURA 3EGDB 4FM4B 4B6MA 2K4YA 2XICA 5KE2A 4FYVB 1EX4A 3VYGA 2LJ3A 1NM7A 1W4SA 4ANJA 1KQ2A 1I5LA 3JCMW 5GANj 2HSPA 3EHQA 3GP8A 5HKCA 1RI0A 2O01E 1JU5C 2NUTB 3NPFA 2RQRA 2HDAA 1NPPA 4LDUA 1VQ4T 3ME9A 3CC7Q 4OMPA 5FU7B 5LJ3d 2KGTA 1M3CA 4IUQA 3CMET 3CPWS 2HSEB 4OVAA 1YJNQ 4M7AD 4R56A 3TQ7P 3L2ZA 4E7LA 3OW2A 2DE0X 1I8FA 1WJRA 4M7AC 4J7IA 3CD6T 3E2UA 2R58A 1YJWA 1BIAA 1ZA1B 2XG8D 3V8LA 2MK5A 3OQ5A 3MO8A 2EIFA 1MV3A 1WGSA 2LJ1A 3CCEQ 2ED1A 2Y90A 4ZGEB 2NUPA 3LGLA 4AFQC 2DIGA 1HYOA 4N4HA 4IUVA 4J6YA 4M78F 1PKTA 1KD1C 4OMMA 4A4KA 1Q82R 1O75A 2FRYA 2MIOA 3LH0A 4BB7A 2O2OA 1KD1R 1XTDA 4FYXB 2KXCA 4GBQA 2X4WA 2GF7A 2ED0A 2QQSA 2EJGA 1D3BB 4R55A 2M9UA 2AT1B 4R0KA 1H8KA 1JBMA 4AG2C 4QVDA 3MKDA 1JB0E 4OMNA 5KYXB 1MGQA 3META 3PGGA 3I55A 4DOWA 3HRSA 3V7CA 2EVRA 2YUQA 4N4GA 2D8JA 1QMCA 2RN8A 3EG2A 2HBWA 5D6WA 2LDMA 2GBQA 5D6YA 1GBRA 2VC8A 5GAN2 1YHQT 3GBQA 3H6ZA 3RUXA 2QEXT 1HD3A 3E19A 3PFSA 2LCCA 1N5ZA 3NFCA 1W1FA 1UJYA 3EG0A 2DYBA 3H8ZA 2ZAEA 2LJ0A 1JQQA 4DBFA 2FZCB 2RI3A 1ACMB 2RI5A 4IUPA 2XHCA 3JRZA 2QGGA 4PKCC 2KBTA 1PWTA 1AVZC 2QEXA 1UFFA 4HXJA 2F1LA 3GNFB 1W2BA 4IKFA 1WHGA 3OSSC 1QVPA 4B9XA 2FPEA 3CXCA 3OY9A 1K73U 1VOMA 3QDFA 2LQKA 2O4XB 1TG0A 4OP0A 1I1JA 4DEYA 2V1RA 2OTLA 2YDLA 1RAGB 3KXTA 5KCOA 3VS0A 2L5QA 3BY7A 1VQKT 2L0AA 1AT1B 2DD4A 1UHFA 2DILA 3CC7A 3FDRA 5A0LA 1OZ3A 2JZ2A 3UWNA 3JB9D 1G3TA 1H3ZA 5GAOl 2K57A 1OPKA 4Z89A 2MWOA 1YJNA 3QIIA 3M0RA 2XDPA 1DJ7B 4HCKA 2ZPGB 1R8OB 1QKWA 2D0NA 3HRTA 4PJNA 1U5SA 2HQHA 1NPRA 4LN2A 5KYUA 3TU4K 1OOTA 2BZXA 5FWBA 4MZTA 4TVRA 2X3WD 4BE0A 2XK0A 2EQMA 2HQXA 4Y92A 3CCQQ 2CDTA 1H641 1KC8U 4E2FB 2V26A 4ORZA 2HMAA 4RCBA 3HFOA 3JB9F 1ZLMA 1YNZA 1AD5A 3HP9A 1KHCA 1ZBJA 1YIJQ 4M77A 1M1KR 2KRSA 1MNEA 3PMTA 4QQ6A 2RQWA 5I21A 2LCSA 5KH6A 1UGPB 3G6EQ 2MAMA 1WYXA 5C6SA 2EYXA 1AHJB 3C95A 1QVFP 4NOYA 4XU1A 1LJOA 1VA7A 2DJQA 1VQ7T 1RLQC 3L2QA 2MCNA 2M1HA 1YITA 2DIQA 2RNAA 1BI0A 1S72A 4OGCA 1X6OA 4EMHA 1JJ2A 2QQRA 3OYIA 2FG0A 4JS4A 3EGXA 1KJWA 1FXXA 1FX7A 1AWJA 1KQSA 3CPFA 1F1BB 3EFRA 2EQIA 4RTUA 2EYYA 2E1HA 4ZN3A 3SHWA 4PJOF 1AOJA 1Y7XA 2A37A 1QLYA 4JLGA 3S3NA 2ZPIB 2HEQA 4M7DD 4GLMA 1VQ9Q 5GAOr 4C8QD 2AIRB 2RF0A 3CPWA 3QPHA 4XU0A 1G5VA 1GXIE 1M3AA 1ZUKA 3PIPA 4F7UB 3UA7A 1N8RR 2PNIA 3NTKA 4M7DC 2DKGA 2DVJA 3VS6A 3MP1A 1UGVA 2KXDA 2HL5C 2XDDA 1EIFA 2DO3A 1NJIR 2CZ7B 1NLPC 2QA4Q 1B07A 1KQ1A 2J6KA 3CCMT 3EGDA 3EGXB
chains in the Genus database with same CATH topology
5FLXE 1QP2A 4QW2A 5A2QE 2RHYA 2JNGA 2XIDA 4F7UG 4Q5WA 1U1TA 5GMKl 4E7JA 2JVVA 4ELYC 3CC2A 3G71A 2DEQA 2P0KA 3M59A 4M78C 4OB2B 4PLIA 4RG2A 3JCMg 4LDVA 3CBMA 1M9SA 4M7DB 4EMKA 1BIBA 5DY9A 2DAQA 2RHIA 4J6XA 5GANh 3A8HB 1VQPT 4KUDK 2JTFA 3QO3A 4F7UF 5GAMe 2YLBA 4C92D 3RMQA 4BI3A 5IT9E 2D9TA 5EG2A 2LVMA 3I56A 3MHXA 4C0ZA 1M1KC 2P0QA 1VQ9A 2P4TA 3LYIA 5GANg 3CCLA 2CKKA 4UC4A 1MHNA 3WVEB 3V8KA 3SFMA 3O8VA 1Y96B 2XDBA 2VGMA 2RHUA 3OMCA 3SB2A 1YHQA 1O9SA 2QTXA 3JSCA 4C92C 3HSBA 2H3JA 1UB4A 3OS2A 5CQXA 3E9GA 3CD6A 2MI6A 2KMTA 3UDCA 5GMKh 3CMEA 5LJ5e 1VIEA 2FYKA 3X24B 4MMKA 2MF2A 3HKSA 5GAOm 4J6WA 3OB9A 1LNXA 4KBMB 2DXCA 4OGEA 5FU7C 1VIFA 4C8QC 3CCET 1WQWA 4YTLA 3FJPA 3X25B 1Q7YU 3RERA 3OYAA 2X4XA 2OTLT 4RCCA 3CCUA 4M7DE 4BI8B 3JCMe 2HNIA 4O6JA 1UEBA 3G7ZA 3HRUA 2QQAA 4C0DB 5GAN8 2V8KA 5GAN6 3DKMA 4QVCA 3C4SA 1VQ6A 1S72T 3HFNA 1KQSS 2F5KA 4RMOA 2QI2A 2WSCE 3MP6A 3SD4A 1FWZA 5LJ3g 4M7AF 5GAOp 1Y96A 4M77G 1UGSB 1D3BA 5CIUA 5GANe 3S3OA 2RO0A 1VQMT 4X9CA 3P8BB 3OYFA 3FEOA 3KUFA 2L89A 2KVQG 3SWNB 2E65A 2K5LA 3OSVA 3WXMB 4C0GA 3OYMA 3J7AF 2D0QB 4EDUA 3I55T 3MEAA 4M7DF 5KCHA 4C92E 2ZPEB 2YLCA 4JDSA 4BD3A 2HBPA 4JJNK 3CMAT 3L2WA 4IUTA 3HPWA 3CCRA 5CVIA 2CGHA 2KY9A 3VU3C 4B9WA 4OB0B 4C8QE 1TH7A 2K3XA 3T9NA 3OYDA 2ZCFB 3SDZA 1YCYA 4DQ2A 1VQ9T 4L6V5 4BDYA 2DXBA 4N0AA 2ZPFB 4HCBA 3QZ5B 1WJQA 4M78B 5GANf 4XTYA 2MWPA 4C92A 1I5LA 5GANd 2R5MA 1YJNT 5CKBA 4IURA 2EKOA 2O4XA 4CRIA 1P92A 3M54A 4FM4B 1IREB 2K4YA 1YBYA 1M1FA 3GF5A 4C8QF 3VYHB 1VQPA 2JOYA 2XICA 5KE2A 2RK1A 3L2VA 4M75B 3VYGA 2YHTA 5GAOn 4A4HA 1W4SA 1KQ2A 4M7DA 4IUUA 4M7AB 3JCMW 2X4JA 2E64A 4JRQA 1I81A 5GANj 3OYNA 3INZA 3TREA 5HKCA 3GP8A 4JS5A 2M0OA 5FRNA 1RI0A 2O01E 2R57A 2EAYA 1M4ZA 4MDXA 2DXTA 2OAUA 3NTHA 3NTIA 3QJ6A 5CQYA 2QA4T 1NPPA 3RMSA 4II1A 3A5ZB 5LJ5h 2CZ0B 4LDUA 2DVEA 4F7UE 3OYLA 1VQ4T 1K73C 5CR2A 3ME9A 1M90C 5FU7B 5I2MA 5LJ3d 1M5Q1 3CMET 4IUQA 1YJ9A 2DTHA 3CPWS 4BUGA 4OVAA 2LC4A 4HCCA 2CS7A 2DJZA 1KG1A 1B34B 2EJFA 1XQHA 1G3YA 2BIVA 2QDYB 2RD1A 4R56A 4M7AD 2CZ1B 3I56T 4PNOA 3L2ZA 3JB9H 2IG0A 4E7LA 3CCMA 2ZPHB 3WVDB 3ASKA 3GLXA 3BDLA 3CCQA 3OW2A 3CCJT 1I8FA 2EQJA 1WJRA 4PL6A 3BDUA 1K73U 2HD0A 4LD6A 4M7AC 2QXFA 3M56A 2XKOC 4J7IA 3CCST 5CO7A 3QYHB 2VGNA 3CD6T 1BI1A 2E6NA 4C5GA 1K9MC 2R58A 1YJWA 5A0GA 1V29B 3CCVT 1QVGS 1BIAA 2XG8D 3X26B 3FRNA 4PJOA 1YIJT 3OS1A 3V8LA 4C8QG 4VUBA 3JCMV 1PSFA 2V8JA 3OQ5A 3QZ9B 4XK8E 3V7RA 2X4YA 1B34A 2RHZA 5LJ3h 3P8HA 4GLKA 5CCAA 3JCMh 3MO8A 2EIFA 3P8DA 5FU6B 1WGSA 1OI1A 3G4ST 3HL8A 4A4GA 2JUFA 3N5BB 1LOJA 2Y90A 4ZGEB 5DLQE 3LGLA 3A8LB 3JB9I 2DIGA 1WPYA 2RH2A 3EAEA 4N4HA 3F70A 5GAN5 5GAOq 4IUVA 4J6YA 4KUIA 4M78F 4XTUA 4XU3A 5AYFA 4PLLA 4C92F 1I4K1 5KE3A 1W2BS 1KD1C 1WJSA 4HT9A 1XNIA 3C12A 3M53A 3QBYA 4QVZA 4A4KA 3JCMQ 2K3YA 2PU9B 3CCVA 1O75A 4M77D 2RJCA 4DOVA 4C0FA 4FL6A 3PT9A 4M7AE 2MMPA 3LH0A 2RJDA 4L5GA 4BB7A 3CMAA 2ZPBB 1NJIU 2G3RA 3ZBDA 4EMKB 3CC4A 3E9FA 2FL7A 1VQ7A 2R5AA 1XTDA 3JCMP 3VJPA 4FSXA 2HAXA 4PJOD 2LX9A 2GF7A 2VXEA 2X4WA 4A4FA 2QQ9A 2QQSA 2E41A 4ZTJA 2EJGA 4FT4A 1D3BB 5LJ5f 4M77C 4BY6C 5GAMj 4R55A 2M9UA 3CCQT 4BACA 2ZZDA 1KC8C 3CCLT 1VQLA 5CKEA 1HXDA 3RKWA 3G71T 1N8RU 2EFIA 1JBMA 3RESA 4QVDA 3L2UA 1JB0E 4M75A 3MCAB 4MZMA 5HY6A 1NZ9A 2A3LA 3CBPA 4JRPA 1QVFA 1MGQA 3TEEA 3META 3UPUA 2L8DA 4PJOC 3A8GB 2DTOA 3PGGA 3I55A 4E7KA 4DOWA 2D6FA 3HRSA 4P5NA 2LTOA 3VUZA 5GMKm 2RJFA 2PVDB 2GCXA 2YRVA 2RHXA 3V7CA 4LDXA 4N4GA 5GAMf 4EPCA 2DD5A 4KULA 4OMFB 5LJ5j 1Q81U 4C5HA 5GAN7 3S6WA 4C92B 1M90U 5D6WA 3OMGA 3JAME 2B8AA 2LDMA 2PUOB 1KHIA 3A8OB 3QUIA 2DPPB 5D6YA 3DLLA 2VC8A 5GAN2 2Y4YA 4XTXA 1YHQT 1M8VA 1VQOT 3ZFJA 4M78A 1K9MU 1QVFS 4X9DA 3H6ZA 4ZGJB 3RUXA 3OS5A 3HHTB 3BW1A 3MEVA 2QEXT 3CCSA 4M77B 4BY6B 3E19A 1BI3A 1X75C 1ZBXA 3PFSA 4M75E 2LT1A 2LCCA 3X28B 1YJ9T 2LRQA 2LT4A 4N4IA 2X35A 3NFCA 4C5IA 3LX7A 3H8ZA 4V2SA 3SWNA 3GIBA 2F5TX 1OYXA 2K5FA 1VUBA 2XI9A 2XU8A 3QJYA 2RI3A 4J8OA 1BI2A 3CBOA 2RI5A 4IUPA 2XHCA 3QYGB 4NS5A 5GMKi 1XOVA 3A8MB 3L2RA 5D6XA 4M75D 3JRZA 4M75F 4PKCC 1VQOA 3LLRA 2EQKA 1N6AA 5CAIA 5GMKe 2QEXA 3MP8A 1Y71A 2DK3A 3AHUA 3GNFB 2JN0A 1W2BA 4IKFA 3OS0A 5J3BA 3OSSC 3JCMX 1QVPA 3CEYA 4B9XA 3CXCA 4ZGDB 2DZ9A 4J83A 3OY9A 2RK2A 5FU6C 1YIJA 3M5AA 2KK4A 2CYZB 2LQKA 4M75G 2O4XB 4M75C 4OP0A 5IN1A 4ELZC 2E6ZA 2F69A 2OTLA 1QW1A 4J7FA 3Q1JA 4M77E 3KXTA 3SWNC 4O5VA 5KCOA 4D6WA 5LJ3e 2L5QA 3BY7A 3LWHA 2EWNA 1G3WA 1YI2A 3OYJA 2DD4A 4JRKA 1VQKT 5GAMh 3CC7A 1N8RC 3FDRA 5A0LA 1OZ3A 2JZ2A 4Y28E 4C0DC 3UWNA 3GOXA 1G3TA 3JB9D 3OYHA 3DB4A 1H3ZA 1Y07A 5GAOl 4PJOE 4C8QB 2K57A 3OYKA 3RKXA 3QDRB 3MEWA 4M7DG 1YJNA 2GFAA 2MWOA 1QVGA 4ATOA 2EYQA 2OTJT 3JCMb 3QIIA 5HK3A 1VQ4A 4XU2A 4M7AG 5GAN3 4M77F 4MDWA 3X20B 3QSUA 2XDPA 2L3RA 1DJ7B 3VV0A 1SSFA 4J5YA 2DTIA 1KD1U 3BFMA 2RA2A 2PVGB 5LJ5g 5FROA 1PSEA 4XTWA 2EQUA 3M9QA 2ZPGB 3FIFA 1R8OB 1QP3A 4ME7A 2VXFA 3G6EA 2JTMA 3OW2S 4ZTFA 1HK9A 5M9OA 2WACA 5LJ3j 3HRTA 3VKIA 4A53A 3J81E 1Q86U 3M4YA 5GMKj 1NPRA 3QKJA 2WSEE 2WSFE 1YI2T 1Q82C 2P0PA 2PVOB 3TU4K 3M58A 1JJ2S 5DLOA 3ER0A 2I2LA 4MZTA 3JCMf 4DA4A 4TVRA 3LGFA 3M55A 4BE0A 2XK0A 1Q86C 3PTAA 1WQ7A 2EQMA 2HQXA 4A4EA 3OBYA 1VQMA 4F7UA 1WNLA 1K8AC 5GAMg 2E10A 4E47A 1KC8U 1H641 2LNVA 3R6OA 2AHJB 2PQWA 1M1GA 3C94A 5LJ3f 4RCBA 3HFOA 4QQGA 3JB9F 4JLIA 3E1SA 3CC4T 2RM4A 4PJOB 4XQ3A 2A7YA 3HP9A 1KHCA 3FLGA 4PJOG 4C5EA 2M16A 4FU6A 4M77A 2RJEA 4FIBA 4RKUE 1BKBA 2KDSA 3PMTA 3OA6A 4OF1A 4QQ6A 2ZGWA 3KBGA 4HKEA 5I21A 5KH6A 1NE8A 4ZN1A 1UGPB 4QQDA 5LL6S 4BI4A 2MAMA 1OZ2A 5CK9A 3OYGA 5C6SA 3C95A 1AHJB 2BKDN 3PMIA 1ZQ1A 1Q7YC 3L42A 4EMKC 2KAFA 4NL3A 4NOYA 4XU1A 1LJOA 1RL2A 3LWIA 1VQ7T 3OYCA 3L2QA 4Z02A 1UGQB 4C8QA 4BE2A 2QQBA 2EJ9A 3GNGA 4WF2A 5LJ5d 2M1HA 4HA8A 2DIQA 1YITA 2FHDA 2E70A 3JCMJ 1BI0A 1Q81C 1S72A 1BYMA 4OGCA 1X6OA 4EMHA 3CC7T 2K2VA 5I2SA 3M57A 2E5QA 5FRMA 4Y91A 5HK0A 3FB9A 5DM7R 1JJ2A 2RB6A 4CI0C 2QQRA 3OYIA 3QHSA 1M1KU 4JS4A 2DXUA 1N27A 1FXXA 5CKDA 1VQ5A 1FX7A 2OTJA 2Y4XA 4NL2A 1KQSA 1VQNA 3CPFA 4KT0E 4M78E 3RIRA 3EFRA 2GFUA 2VYTA 3S3MA 1VQ8A 1U8RA 5GAMd 3JB9G 2E1HA 4L59A 3G6ET 2V8IA 1Q82U 4JRIA 4ZN3A 4PJOF 2GQVA 3JCMc 1VQKA 1Y7XA 3JB9J 4HCZA 3JCMd 3J80E 2CZ6B 2LCLA 5CKHA 3VUBA 1VQ6T 5J39A 4E7IA 3CC2T 2QA4A 2NLUA 3MEUA 3GPLA 3ZEHA 4A54A 4LD9K 3OYYA 4JLGA 2LQ8A 1VQ5T 3S3NA 2ZPIB 1N9RA 4C92G 1VQNT 4XAXB 4X34A 1G3SA 4LDYA 1YJWT 4RG8A 4M7DD 4E7HA 5C0MA 3L1AA 3PIOA 4EMGA 4BDZA 5GAOr 1VQ8T 4C8QD 3DB3A 5L8RE 2BUDA 4FT2A 3CPWA 5CKFA 3QPHA 3CCUT 4XU0A 1G5VA 1GXIE 3PNWC 4LDWA 3CCRT 1UGRB 3M4GA 5J26A 3LW5E 3PIPA 4F7UB 4BE1A 3OYBA 3G4SA 2XD0A 1YITT 2RI2A 3OBWA 1K8AU 3NTKA 4M7DC 4XTZA 3FC3A 3CCJA 2KSSA 2DKGA 4HT8A 1N9SA 2KQWA 5GAN4 2PUKB 4JUVA 4MZPA 2VV5A 3QXEB 3V8JA 1VQLT 4M7AA 3MP1A 2E12A 1U1SA 1IZ6A 2VUBA 4N0AC 2C06A 3RKYA 1X01A 4M78G 3UT1A 5A0DA 1JRIA 2XDDA 1EIFA 3TCJA 2DO3A 4GY5A 5IAYA 3CCEA 2HQEA 2CZ7B 3DLMA 3URGA 4M78D 1NJIC 4OB3B 1KQ1A 2FB7A 2FVUA 2IVWA 3EFSA 1ZHIA 4OB1B 3V7SA 3QG1A 3OYEA 3CXCS 3CCMT 2DZCA 4MMLA 2K5IA 4XTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LDM A;  4QW2 A;  2M0O A;  3PMT A;  5D6Y A;  1RI0 A;  2R57 A;  2RHY A;  4QQ6 A;  3OYN A;  3OA6 A;  4Q5W A;  3NTH A;  3QJ6 A;  4E7J A;  3NTI A;  5KH6 A;  2P0K A;  4RG2 A;  4PLI A;  4II1 A;  3H6Z A;  4QQD A;  3MEV A;  3OYL A;  3PFS A;  3ME9 A;  1OZ2 A;  2LCC A;  2DAQ A;  2RHI A;  3OYG A;  4IUQ A;  5C6S A;  2LRQ A;  2BKD N;  3PMI A;  2X35 A;  4N4I A;  3L42 A;  4OVA A;  4C5I A;  3LX7 A;  5FRN A;  2JTF A;  3H8Z A;  1OYX A;  2BIV A;  2D9T A;  4IUU A;  3OYC A;  3L2Q A;  2LVM A;  2RI3 A;  4Z02 A;  4BE2 A;  2IG0 A;  2RI5 A;  4IUP A;  2M1H A;  4E7L A;  2DIQ A;  2FHD A;  4NS5 A;  3ASK A;  3BDL A;  3LYI A;  5D6X A;  3L2R A;  2CKK A;  4UC4 A;  1MHN A;  3O8V A;  2E5Q A;  3LLR A;  2EQJ A;  1WJR A;  2RHU A;  3OMC A;  2EQK A;  4PL6 A;  5FRM A;  4LD6 A;  3MP8 A;  2QQR A;  3OYI A;  3OS2 A;  3E9G A;  1N27 A;  2E6N A;  4C5G A;  3OS0 A;  2R58 A;  4IKF A;  3CEY A;  4B9X A;  3OY9 A;  2GFU A;  2VYT A;  3OB9 A;  3OS1 A;  3S3M A;  2O4X B;  3OQ5 A;  5IN1 A;  2X4Y A;  3OYA A;  4L59 A;  2X4X A;  2RHZ A;  3Q1J A;  3P8H A;  5KCO A;  3MO8 A;  3P8D A;  1WGS A;  1OI1 A;  4A4G A;  3OYJ A;  4HCZ A;  3C4S A;  3LGL A;  3FDR A;  2DIG A;  1OZ3 A;  2JZ2 A;  3EAE A;  4N4H A;  3F70 A;  3UWN A;  2F5K A;  4IUV A;  5J39 A;  3OYH A;  3DB4 A;  5KE3 A;  2NLU A;  3GOX A;  3MEU A;  3MP6 A;  4PLL A;  3SD4 A;  3OYK A;  3ZEH A;  1H3Z A;  3MEW A;  5CIU A;  1WJS A;  2GFA A;  2MWO A;  3S3O A;  1XNI A;  2RO0 A;  3QBY A;  4QVZ A;  3OYF A;  2K3Y A;  3FEO A;  3KUF A;  2L89 A;  3QII A;  3OYM A;  3S3N A;  2RJC A;  4X34 A;  4EDU A;  3MEA A;  4FL6 A;  5KCH A;  2XDP A;  5C0M A;  2L3R A;  4BD3 A;  4E7H A;  3LH0 A;  1SSF A;  2RJD A;  4BDZ A;  3DB3 A;  2BUD A;  2G3R A;  5FRO A;  3L2W A;  4IUT A;  2EQU A;  3E9F A;  3M9Q A;  4ZTF A;  2R5A A;  1G5V A;  4B9W A;  3PNW C;  5M9O A;  2WAC A;  5J26 A;  2X4W A;  2GF7 A;  4A4F A;  2QQS A;  3QKJ A;  2K3X A;  3OYB A;  3OYD A;  4BE1 A;  4ZTJ A;  2RI2 A;  3NTK A;  4BDY A;  3FC3 A;  4BAC A;  4E7I A;  1WJQ A;  2EFI A;  2MWP A;  3LGF A;  4BE0 A;  3MP1 A;  2XK0 A;  3L2U A;  2EQM A;  2HQX A;  4A4E A;  2R5M A;  4IUR A;  2EKO A;  2O4X A;  3MET A;  2L8D A;  3UT1 A;  4CRI A;  4E7K A;  2PQW A;  4GY5 A;  2LTO A;  5IAY A;  2HQE A;  2RJF A;  3DLM A;  2YRV A;  2RHX A;  4QQG A;  5KE2 A;  3L2V A;  4N4G A;  1KHC A;  3FLG A;  4C5H A;  3OYE A;  4A4H A;  4C5E A;  2M16 A;  4FU6 A;  3S6W A;  2RJE A;  5D6W A;  3OMG A;  2B8A A; 
#chains in the Genus database with same CATH topology
 5FLX E;  2JNG A;  4F7U G;  2HKN A;  2EW3 A;  2JVV A;  3M59 A;  3EH2 A;  2KI7 A;  4WTO B;  2EYW A;  1M9S A;  4EMK A;  2CH4 W;  2DAQ A;  3EFO B;  2YXY A;  4F7U F;  2YLB A;  2KEA A;  1TS9 A;  1VQ4 Q;  4IIO A;  3I56 A;  3UAT A;  4J9D A;  1QVG P;  2CKK A;  4UC4 A;  2COW A;  2XDB A;  1ZX6 A;  2AZS A;  2VGM A;  3SB2 A;  2QTX A;  2NYS A;  3OS2 A;  1WLP B;  5GMK h;  3CME A;  2FYK A;  2MF2 A;  2PZ1 A;  4KBM B;  1PHT A;  2DXC A;  3FJP A;  3X25 B;  1Q7Y U;  4RCC A;  4M7D E;  4O6J A;  1JXM A;  2QQA A;  2DL7 A;  3HRU A;  2V8K A;  5GAN 8;  4QVC A;  1VQ6 A;  1S72 T;  1SSH A;  2SEM A;  1GRI A;  2CSQ A;  2K7A A;  5LJ3 g;  5EC7 A;  4M77 G;  1UGS B;  4PJL A;  3S3O A;  3THK A;  3OYM A;  3OSV A;  4M7D F;  2CUD A;  1WI7 A;  4JDS A;  1WXU A;  4BD3 A;  1YIT Q;  2HBP A;  2X9H A;  2YRC A;  1YJ9 Q;  1TH7 A;  3T9N A;  3OYD A;  2ZCF B;  4F14 A;  1T0H A;  1VQ9 T;  2DXB A;  2ZPF B;  1WJQ A;  1WZO A;  2QGF B;  2R5M A;  4RTY A;  4CRI A;  1D0Y A;  1IRE B;  1M1F A;  1VQP A;  3VYH B;  2DBM A;  2RK1 A;  4M75 B;  1UUE A;  2DBK A;  2YHT A;  4A4H A;  4M7A B;  2X4J A;  3OYN A;  4JS5 A;  2M0O A;  2EAY A;  2JS0 A;  1M4Z A;  2DXT A;  4IIM A;  2QA4 T;  1R77 A;  2C0T A;  3CXC P;  4II1 A;  2DVE A;  4F7U E;  4BUG A;  2LC4 A;  2DJZ A;  2CP2 A;  1B34 B;  2HKQ B;  2QDY B;  4J9F A;  1VQL Q;  2AKK A;  2CZ1 B;  4PNO A;  2VB6 A;  2IG0 A;  3CCM A;  2ZPH B;  3CCQ A;  4OMQ A;  4RTX A;  3CCR Q;  2QXF A;  3QYH B;  1BI1 A;  1K1Z A;  1UTI A;  1V29 B;  3CCV T;  3X26 B;  4PJO A;  1YIJ T;  3OS1 A;  2X4Y A;  2K9G A;  4LUD A;  5CCA A;  3P8D A;  5FU6 B;  6AT1 B;  2JM9 A;  3EG1 A;  2RH2 A;  4KRT A;  3RBB B;  3F70 A;  5GAN 5;  1MND A;  2ENM A;  4J9G A;  1QCN A;  4XU3 A;  4C92 F;  3MJX A;  1WJS A;  4HT9 A;  2D8H A;  3QBY A;  2K3Y A;  3CCV A;  4C0F A;  3I56 Q;  3PT9 A;  2RJD A;  3G71 Q;  2ZPB B;  5KYW A;  2LQW A;  3CC4 A;  1OV3 A;  3JCM P;  2O9S A;  1VQO Q;  2YT6 A;  1YHQ Q;  2HAX A;  2VXE A;  2QQ9 A;  2E41 A;  4ZTJ A;  2FPF A;  4FT4 A;  1G83 A;  5LJ5 f;  1YJW Q;  1RAH B;  3CCL T;  4RTW A;  2A0F B;  4AFS C;  2EFI A;  1SF9 A;  3TEE A;  3QWY A;  2CT3 A;  4E7K A;  2J06 A;  2QTV A;  2D6F A;  2LTO A;  5GMK m;  1C1A A;  2PVD B;  2RHX A;  4DBH A;  5I22 A;  3VS5 A;  4KUL A;  3VS2 A;  5GAN 7;  3S6W A;  1M90 U;  3OMG A;  2PUO B;  1KHI A;  3A8O B;  4D8K A;  2Y4Y A;  1PD0 A;  1RAA B;  2OAW A;  4M78 A;  1QVF S;  4X9D A;  3HHT B;  2P84 A;  4M77 B;  1X75 C;  4M75 E;  4CC2 A;  2F2W A;  1YJ9 T;  2LRQ A;  2LT4 A;  2JT4 A;  1KIK A;  2CUB A;  2F5T X;  1K0S A;  3CCJ Q;  1VYU A;  3TSW A;  1FMV A;  2CP3 A;  1AZG B;  3QYG B;  4NS5 A;  1XOV A;  3A8M B;  1RI9 A;  1ZSZ B;  3I55 Q;  3LLR A;  4CC7 A;  4E7Z A;  1N6A A;  5GMK e;  1JXO A;  3MP8 A;  2JN0 A;  5J3B A;  1X2K A;  4J83 A;  5GJV B;  3REB B;  2E6Z A;  1QW1 A;  4J7F A;  4D6W A;  4ESR A;  5LJ3 e;  1NYG A;  2BZ8 A;  1G3W A;  2QG9 B;  1YI2 A;  1WHH A;  1C0M A;  4C0D C;  3RKX A;  1NLO C;  4ATO A;  2O31 A;  3PVQ A;  1VQ4 A;  4XU2 A;  1ZSZ C;  2FPD A;  1MUZ A;  4LXC A;  1Q95 G;  2DTI A;  1KD1 U;  3BFM A;  2RA2 A;  5FRO A;  3M9Q A;  3I5S A;  5M9O A;  5LJ3 j;  3VKI A;  4A53 A;  1YI2 T;  3QKJ A;  1Q82 C;  1WHM A;  2PVO B;  1D0X A;  3REA B;  3M58 A;  3ER0 A;  2I2L A;  3I9Q A;  1AWX A;  4J9I A;  2JM8 A;  3PTA A;  1WQ7 A;  1JO8 A;  2E10 A;  4E47 A;  2LNV A;  3R6O A;  5IH2 A;  2EKH A;  5LJ3 f;  3CC4 T;  4PJO G;  4C5E A;  2M16 A;  4FU6 A;  1W6X A;  1UHC A;  4OMO A;  4OF1 A;  2EGE A;  2ZGW A;  2J6F A;  3KBG A;  1NE8 A;  1ZUY A;  2LNH B;  4QQD A;  5LL6 S;  4BI4 A;  5IHN A;  1OZ2 A;  2KRN A;  3PMI A;  1ZQ1 A;  3L42 A;  1OUL A;  2KAF A;  2W10 A;  2DF6 A;  3LWI A;  2COY A;  2E3I A;  4JJB A;  3GNG A;  2EJ9 A;  4WF2 A;  2CP6 A;  3JCM J;  3KFV A;  3M57 A;  4Y91 A;  1KSW A;  3QHS A;  1WHJ A;  1N27 A;  1G2B A;  1VQ5 A;  2Y4X A;  4NL2 A;  1QQJ A;  4M78 E;  1X69 A;  4EIK A;  5KYX A;  1M30 A;  2IIM A;  2GNC A;  4L59 A;  3G6E T;  4JRI A;  1SHF A;  1BBZ A;  7AT1 B;  2LZ6 B;  2KE9 A;  2LCL A;  1JEG A;  4E7I A;  2NLU A;  4RTV A;  4A54 A;  4LD9 K;  4PK4 A;  3OYY A;  3OW2 P;  1Q81 R;  2LQ8 A;  4E6R A;  1VQ5 T;  4KH1 B;  1D0Z A;  3SEM A;  1N9R A;  4XAX B;  4LDY A;  3PIO A;  1YP5 A;  1YN8 A;  2L3S A;  3CCS Q;  3CCR T;  1UGR B;  2L2P A;  1SKU B;  1H92 A;  2F2X A;  3LH5 A;  2XD0 A;  3G4S A;  2P4R A;  2RI2 A;  3OBW A;  2DA9 A;  1IGU A;  2NUT A;  3HTR A;  3CCJ A;  1WFW A;  2CRE A;  1MMA A;  2I0N A;  4JUV A;  1X6G A;  1VQL T;  1AZE A;  4N0A C;  2KRO A;  4M78 G;  2E4H A;  5A0D A;  1HJD A;  1JRI A;  5IAY A;  4K11 A;  2RQU A;  3URG A;  1PRM C;  3UF4 A;  1RAI B;  4OB1 B;  3EFS A;  3OYE A;  3V7S A;  8ATC B;  3QG1 A;  1U3O A;  2J7I A;  2K5I A;  1QP2 A;  5A2Q E;  2XID A;  4Q5W A;  4E7J A;  2DYI A;  3CC2 A;  1BK2 A;  3G71 A;  2P0K A;  1WHK A;  4OB2 B;  3VRZ A;  3CBM A;  1BIB A;  2ECZ A;  4J6X A;  2DL3 A;  2F2V A;  1VQP T;  4KUD K;  1W70 A;  2C0I A;  2JTF A;  5GAM e;  4C92 D;  4BI3 A;  5EG2 A;  2LVM A;  2DEU A;  1TOV A;  1VQ7 Q;  3WVE B;  3SFM A;  3O8V A;  1Y96 B;  3U23 A;  4QT7 A;  1O9S A;  3JSC A;  4C92 C;  2CT4 A;  2NUP B;  4F17 A;  5CQX A;  3E9G A;  3CD6 A;  1YCS B;  2MI6 A;  3A98 A;  3UDC A;  1M2O A;  1AEY A;  4JJC A;  4J6W A;  3OB9 A;  1LNX A;  4C8Q C;  3CCE T;  5I11 A;  2QK0 A;  3CCU A;  1VYT A;  1Y0M A;  1R0C B;  3JCM e;  2HNI A;  5GAN 6;  3HFN A;  4RTT A;  4RMO A;  2QI2 A;  2WSC E;  4M7A F;  1FWZ A;  5GAO p;  5CIU A;  1D3B A;  4X9C A;  3OYF A;  2RQT A;  2L89 A;  1FMW A;  2KVQ G;  4C0G A;  2A36 A;  4EDU A;  5KCH A;  1IHW A;  4JJN K;  1W2B P;  3HPW A;  2CGH A;  4KGV B;  4LNP A;  1EZZ B;  4JZ4 A;  4OB0 B;  2O88 A;  2K3X A;  4WCI A;  1YCY A;  4BDY A;  1ABQ A;  2DRM A;  5KYY B;  5GAN f;  2GGR A;  4FW2 A;  2JW4 A;  5FW9 A;  3RDV A;  3M54 A;  3GF5 A;  1YBY A;  2B86 A;  4KGZ B;  2JOY A;  1VQ6 Q;  3L2V A;  1MMG A;  3H0I A;  4M7D A;  2E64 A;  2JJ9 A;  1I81 A;  5FRN A;  3FJ5 A;  4RUG A;  2M0Y A;  4MDX A;  2OAU A;  3NTI A;  5CQY A;  3D7S B;  2CZ0 B;  1K73 C;  1M90 C;  2KT1 A;  5I2M A;  1S1N A;  2DTH A;  1SEM A;  2CS7 A;  1BCO A;  1KG1 A;  2EJF A;  1XQH A;  1G3Y A;  2BIV A;  2RD1 A;  2KNB B;  1E7O A;  4Z8A A;  3JB9 H;  1PKS A;  3GLX A;  3BDL A;  5FWC A;  5ECA A;  4AMC A;  3NGP A;  3NMZ C;  4PL6 A;  4LD6 A;  3M56 A;  2DET A;  2XKO C;  1ZUU A;  2E6N A;  1K9M C;  1RUW A;  3H0F A;  5A0G A;  1WHL A;  4C8Q G;  4VUB A;  3JCM V;  3QZ9 B;  4XK8 E;  3V7R A;  1PRL C;  2RHZ A;  3P8H A;  4GLK A;  3JCM h;  1OI1 A;  3G4S T;  3HL8 A;  1OX9 A;  5DLQ E;  2YWW A;  3EAE A;  5GAO q;  2GQI A;  5AYF A;  5KYU B;  1I4K 1;  2EBP A;  3C12 A;  4QVZ A;  2PU9 B;  2K79 A;  1Q86 R;  2RJC A;  1WIE A;  2MMP A;  3CCM Q;  4L5G A;  3CMA A;  2G3R A;  4EMK B;  2R5A A;  1OPL A;  4PJO D;  2LX9 A;  4A4F A;  3RNJ A;  1B7T A;  3CD6 Q;  1M8M A;  5GAM j;  4BY6 C;  1K9M R;  1VQ5 Q;  1KC8 C;  4BAC A;  2ZZD A;  1VQN Q;  1GCQ C;  5CKE A;  1HXD A;  3G71 T;  3L2U A;  1IB8 A;  4PFO A;  1XJW B;  4JRP A;  1QVF A;  2A3L A;  3CCU Q;  1I0C A;  4PJO C;  3A8G B;  2DTO A;  3VUZ A;  2RJF A;  2GCX A;  2YRV A;  3VS4 A;  5IHK A;  5KYW B;  5GAM f;  4EPC A;  4F16 A;  1Q81 U;  4C5H A;  5IXF A;  3JAM E;  4A63 B;  2KYM A;  2OTL Q;  3DLL A;  4XTX A;  1VQO T;  1K9M U;  1K8A R;  4ZGJ B;  3OS5 A;  3MEV A;  2RPN A;  3CCS A;  4BY6 B;  1BI3 A;  1ZBX A;  5GJW B;  1TTH B;  1LCK A;  1V76 A;  2X35 A;  4C5I A;  3LX7 A;  4V2S A;  3SWN A;  2ROL A;  3GIB A;  2MOX A;  2XI9 A;  2XU8 A;  3QJY A;  3CBO A;  2GTJ A;  3I5R A;  4M75 D;  1OU9 A;  2K6D A;  1BB9 A;  1VQO A;  2EQK A;  2VVK A;  5CAI A;  2V1Q A;  3H41 A;  4X1V A;  2DK3 A;  2AKL A;  1ZSG A;  4FCY A;  2CH4 A;  2DZ9 A;  4ZGD B;  1MMN A;  3M5A A;  2KK4 A;  2CYZ B;  4M75 C;  5IN1 A;  4ELZ C;  3JV3 A;  5AT1 B;  1Z9Z A;  3CC2 Q;  1K0X A;  3LWH A;  2EWN A;  1Z9Q A;  3OYJ A;  3A1P A;  4JRK A;  5GAM h;  1EFN A;  2EGC A;  2VAS A;  2EPD A;  3GOX A;  3OYH A;  4PJO E;  3OYK A;  3QDR B;  3MEW A;  2GFA A;  1PNJ A;  1TWB A;  2EYQ A;  3JCM b;  2DX1 A;  5HK3 A;  1PCX A;  1WDX A;  5GAN 3;  1NYF A;  4MDW A;  3VS7 A;  3X20 B;  4J9B A;  2L3R A;  2JMC A;  1SSF A;  4J5Y A;  4KH0 B;  3R6N A;  5LJ5 g;  1PSE A;  2EQU A;  1K73 R;  3QWX X;  1AWW A;  3G6E A;  3OW2 S;  2WAC A;  3J81 E;  3M4Y A;  2WSE E;  2WSF E;  1TUD A;  1SRL A;  5DLO A;  2D1X A;  1E6H A;  3JCM f;  4DA4 A;  1M27 C;  3LGF A;  1IRX A;  1IO6 A;  4A4E A;  3OBY A;  1BCM A;  4F7U A;  1WNL A;  2AHJ B;  2PQW A;  1M1G A;  4QQG A;  2L3P A;  3E1S A;  4PJO B;  2SRC A;  2RJE A;  5KYY A;  1BKB A;  1CSK A;  3CCV Q;  3OA6 A;  1TSF A;  1U06 A;  4E7S A;  4HKE A;  4ZN1 A;  3TVT A;  1RAB B;  1Q7Y C;  4EMK C;  3AT1 B;  1RL2 A;  3OYC A;  4Z02 A;  4BE2 A;  2QQB A;  5LJ5 d;  4HA8 A;  2FHD A;  2E70 A;  1IXD A;  1IGQ A;  3RR6 A;  4AT1 B;  2K2V A;  5I2S A;  2E5Q A;  2DFU A;  5HK0 A;  3M0T A;  1CKB A;  5DM7 R;  1T3S A;  2ATC B;  1UJ0 A;  2DXU A;  5CKD A;  4J9C A;  2OTJ A;  1VQN A;  1QKX A;  2GFU A;  2VYT A;  2DL4 A;  1VQ8 A;  3EG3 A;  1Q82 U;  2X3X D;  1VQK A;  4DEX A;  2PTK A;  1WXB A;  4HCZ A;  1C6V X;  3JCM d;  2KYB A;  1YFN A;  1VQ6 T;  3MEU A;  3GPL A;  2LMJ A;  1VQN T;  4X34 A;  1G3S A;  4RG8 A;  4E7H A;  3L1A A;  1QWE A;  1VQ8 T;  5L8R E;  2BUD A;  4FT2 A;  4JJD A;  5CKF A;  3CCU T;  3VS1 A;  4LDW A;  3M4G A;  5J26 A;  2G6F X;  3OYB A;  1YIT T;  4XTZ A;  3FC3 A;  2KSS A;  1N9S A;  2KQW A;  5GAN 4;  2PUK B;  2VV5 A;  4M7A A;  2E12 A;  1IZ6 A;  2VUB A;  3UT1 A;  1X6B A;  3C0C A;  3TCJ A;  4GY5 A;  2HQE A;  3DLM A;  4KGX B;  5KYN A;  1FYN A;  2FVU A;  1TU0 B;  1RAC B;  4M4Z A;  2DZC A;  2RMO A;  4XTV A;  3NHN A;  2YUP A;  4QW2 A;  3ULR B;  2JMA A;  1WX6 A;  2RHY A;  3PVL A;  4RG2 A;  4PLI A;  3JCM g;  1CKA A;  2LX7 A;  1BU1 A;  2DM1 A;  4AFZ C;  3EH1 A;  2A08 A;  3A8H B;  1UE9 A;  2VKN A;  3QO3 A;  2A28 A;  3MHX A;  4C0Z A;  2MPX C;  2P0Q A;  1VQ9 A;  2P4T A;  1K4U S;  1MHN A;  1K9A A;  1LVK A;  2DL5 A;  2ROT A;  1UB4 A;  1D1A A;  5LJ5 e;  3IQL A;  4MMK A;  2E5K A;  3ZL7 C;  1VIF A;  4D8D A;  3RER A;  2DNU A;  1VQM Q;  1UG1 A;  1I07 A;  1Y57 A;  2OTL T;  4QKU A;  4C0D B;  3DKM A;  3C4S A;  1SPK A;  1GL5 A;  1KQS S;  2F5K A;  2QDL A;  3MP6 A;  2M02 A;  3SD4 A;  1Y96 A;  4JZ3 A;  2RO0 A;  3P8B B;  3FEO A;  3WXM B;  2K5L A;  4C92 E;  3L2W A;  1OQK A;  2KY9 A;  4C8Q E;  2O9V A;  4DQ2 A;  4L6V 5;  2OTJ Q;  1QCO A;  3QZ5 B;  2H8H A;  5CKB A;  1MMD A;  2EKO A;  2O4X A;  1P92 A;  4C8Q F;  4FYY B;  3I35 A;  1RAF B;  1MV0 B;  4HVV A;  5GAO n;  4IUU A;  3M0S A;  3CPW P;  4FSS A;  4AG1 C;  2K2M A;  4JRQ A;  3INZ A;  3TRE A;  2R57 A;  3NTH A;  1OEB A;  2DLP A;  3QJ6 A;  1M90 R;  1YWP A;  3RMS A;  2CP7 A;  3A5Z B;  3CC4 Q;  5LJ5 h;  3OYL A;  3BE3 A;  2JTE A;  5CR2 A;  1M5Q 1;  1YJ9 A;  2BE9 B;  4HCC A;  1PD1 A;  3I56 T;  3EHR A;  1NBE B;  3WVD B;  1GCP A;  3ASK A;  4LUE A;  3CCJ T;  2EQJ A;  3BDU A;  2HD0 A;  1QWF A;  1OU8 A;  2QAS A;  3CCS T;  1J3T A;  5CO7 A;  2VGN A;  2DER A;  4C5G A;  1SHG A;  1QVG S;  3FRN A;  3EFO A;  4JPB W;  1PSF A;  2V8J A;  1OX8 A;  1B34 A;  2LP5 A;  1V1C A;  2FRW A;  5LJ3 h;  1HSQ A;  5HCK A;  4A4G A;  2JUF A;  3N5B B;  2J6O A;  2NUZ A;  1LOJ A;  3JB9 I;  3A8L B;  9ATC B;  1WPY A;  4KUI A;  4XTU A;  5KE3 A;  1T3L A;  4PLL A;  1W2B S;  1M2V A;  1XNI A;  3M53 A;  3JCM Q;  1ARK A;  4M77 D;  4DOV A;  4FL6 A;  4M7A E;  1NJI U;  3EGU A;  3ZBD A;  3H0H A;  3E9F A;  2FL7 A;  1VQ7 A;  3VJP A;  4FSX A;  1M3B A;  4M77 C;  3CCQ T;  1NEG A;  2NWM A;  1VQL A;  3RKW A;  1N8R U;  1PC0 A;  3RES A;  4M75 A;  5HY6 A;  3MCA B;  4MZM A;  1IHV A;  1NZ9 A;  3CBP A;  3UPU A;  2L8D A;  2ABL A;  1VQK Q;  5D7U A;  3M0Q A;  4P5N A;  1Q7Y R;  2QEX Q;  1UEC A;  2DMO A;  4LDX A;  5LJ5 j;  2DD5 A;  4OMF B;  2COZ A;  4C92 B;  1SRM A;  2B8A A;  1ZSZ A;  3QUI A;  2DPP B;  2E3H A;  1M8V A;  2KT8 A;  2W0Z A;  1FMK A;  3ZFJ A;  2XMF A;  3BW1 A;  2ESW A;  4PJJ A;  2LT1 A;  3X28 B;  4N4I A;  2BTT A;  1RAD B;  2DL8 A;  1OYX A;  2K5F A;  1VUB A;  2FO0 A;  4AFU C;  4J8O A;  1BI2 A;  3CMA Q;  5GMK i;  3L2R A;  5D6X A;  3EG9 A;  4M75 F;  1Y71 A;  3AHU A;  2YRD A;  3OS0 A;  4HVW A;  2M51 A;  2H3E B;  3M0P A;  2K3B A;  3JCM X;  1NG2 A;  3CEY A;  1YIJ A;  2RK2 A;  5FU6 C;  2J05 A;  4M75 G;  2F69 A;  3Q1J A;  4M77 E;  3TSZ A;  3SWN C;  4O5V A;  2MYS A;  1N8R C;  4J9H A;  4Y28 E;  2EGA A;  3DB4 A;  1Y07 A;  4C8Q B;  4M7D G;  1QVG A;  4Z88 A;  8AT1 B;  2OTJ T;  4OML A;  4M7A G;  4M77 F;  3QSU A;  4PJM A;  3VV0 A;  2QAZ A;  2PVG B;  4XTW A;  3CCL Q;  3FIF A;  4ZTF A;  1QP3 A;  4ME7 A;  2VXF A;  2JTM A;  1HK9 A;  1Q86 U;  1T0J A;  5GMK j;  2P0P A;  4RTZ A;  1JJ2 S;  4LE9 A;  3VRY A;  2GTO A;  2OI3 A;  3M55 A;  1PM3 A;  2YSQ A;  1Q86 C;  1G8X A;  1GCQ A;  1VQM A;  1S72 Q;  1K8A C;  5GAM g;  3C94 A;  1YI2 Q;  4HVU A;  4DBQ A;  3VS3 A;  4JLI A;  2RM4 A;  4XQ3 A;  2A7Y A;  3CME Q;  3FLG A;  1GFD A;  4FIB A;  4RKU E;  1D1C A;  2HZY A;  2KDS A;  1SG5 A;  1X2Q A;  3MPU B;  5IHI A;  1I5O B;  5IXB A;  3G1J A;  4FYW B;  1LPL A;  5CK9 A;  4CC3 A;  2L3Q A;  3OYG A;  2BKD N;  3G4S Q;  4NL3 A;  1AWO A;  2FZG B;  2RQV A;  4C8Q A;  1UGQ B;  1Q81 C;  1BYM A;  3CC7 T;  5FRM A;  3FB9 A;  2RB6 A;  4CI0 C;  1WXT A;  2AK5 A;  1M1K U;  4KT0 E;  3RIR A;  2OX7 A;  4ZNX A;  1D1B A;  3S3M A;  3CQT A;  1U8R A;  5GAM d;  1VYV A;  3JB9 G;  2V8I A;  2GQV A;  3JCM c;  1TUG B;  3JB9 J;  2EYZ A;  3J80 E;  2CZ6 B;  5CKH A;  3VUB A;  5J39 A;  3UA6 A;  3CC2 T;  4J9E A;  2QA4 A;  1PG5 B;  3M0U A;  1TXQ A;  3ZEH A;  2X51 A;  1GFC A;  4C92 G;  1YJW T;  2FZK B;  5C0M A;  4EMG A;  4BDZ A;  3DB3 A;  1B3Q A;  2KRM A;  3PNW C;  2IPO B;  1A0N B;  3LW5 E;  4BE1 A;  1K8A U;  2BZY A;  1M2V B;  4HT8 A;  4MZP A;  3V8J A;  2C0O A;  3QXE B;  1VQ8 Q;  1U1S A;  2JXB A;  2C06 A;  1RLP C;  3RKY A;  1X01 A;  1WA7 A;  1H3H A;  1QCF A;  4PFP A;  3CCE A;  4M78 D;  3O5Z A;  1NJI C;  1GBQ A;  2AZV A;  4OB3 B;  2FB7 A;  2IVW A;  5L23 A;  1ZHI A;  1ZA2 B;  3CXC S;  4MML A;  1X43 A;  1K76 A;  5GMK l;  1U1T A;  4ELY C;  2CP0 A;  2DEQ A;  4M78 C;  3EG9 B;  4LDV A;  4M7D B;  4F04 B;  3H9N A;  5DY9 A;  2RHI A;  5GAN h;  1TUC A;  1ABO A;  2VWF A;  3RMQ A;  1KC8 R;  5IT9 E;  2D9T A;  2FEI A;  4FW1 A;  1KFZ A;  1M1K C;  3LYI A;  5GAN g;  1UDL A;  3CCL A;  3V8K A;  1X27 A;  2RHU A;  3OMC A;  1YHQ A;  1E6G A;  3HSB A;  2YUO A;  2DRK A;  2H3J A;  2KMT A;  2BE7 D;  1VIE A;  3X24 B;  1D09 B;  3HKS A;  2QYZ A;  5GAO m;  4OGE A;  5FU7 C;  1WQW A;  4YTL A;  3OYA A;  4CC4 B;  2X4X A;  4BI8 B;  1UEB A;  3G7Z A;  1VQP Q;  3PE0 A;  1KK7 A;  2KR3 A;  4PFZ A;  1VQM T;  5GAN e;  4DBR A;  3KUF A;  3J7A F;  2LQN A;  3SWN B;  2E65 A;  1YWO A;  2CP5 A;  1JJ2 P;  2D0Q B;  3I55 T;  3MEA A;  1NEB A;  2ZPE B;  2YLC A;  3CMA T;  4IUT A;  1KQS P;  2HL3 A;  2CSI A;  3CCR A;  5CVI A;  4B9W A;  3VU3 C;  2Z0W A;  2YUN A;  1RAE B;  2HCK A;  3SDZ A;  1R0B G;  4N0A A;  4HCB A;  4M78 B;  4XTY A;  2MWP A;  4C92 A;  2JS2 A;  5GAN d;  1YJN T;  2OJ2 A;  4IUR A;  3EGD B;  4FM4 B;  4B6M A;  2K4Y A;  2XIC A;  5KE2 A;  4FYV B;  1EX4 A;  3VYG A;  2LJ3 A;  1NM7 A;  1W4S A;  4ANJ A;  1KQ2 A;  1I5L A;  3JCM W;  5GAN j;  2HSP A;  3EHQ A;  3GP8 A;  5HKC A;  1RI0 A;  2O01 E;  1JU5 C;  2NUT B;  3NPF A;  2RQR A;  2HDA A;  1NPP A;  4LDU A;  1VQ4 T;  3ME9 A;  3CC7 Q;  4OMP A;  5FU7 B;  5LJ3 d;  2KGT A;  1M3C A;  4IUQ A;  3CME T;  3CPW S;  2HSE B;  4OVA A;  1YJN Q;  4M7A D;  4R56 A;  3TQ7 P;  3L2Z A;  4E7L A;  3OW2 A;  2DE0 X;  1I8F A;  1WJR A;  4M7A C;  4J7I A;  3CD6 T;  3E2U A;  2R58 A;  1YJW A;  1BIA A;  1ZA1 B;  2XG8 D;  3V8L A;  2MK5 A;  3OQ5 A;  3MO8 A;  2EIF A;  1MV3 A;  1WGS A;  2LJ1 A;  3CCE Q;  2ED1 A;  2Y90 A;  4ZGE B;  2NUP A;  3LGL A;  4AFQ C;  2DIG A;  1HYO A;  4N4H A;  4IUV A;  4J6Y A;  4M78 F;  1PKT A;  1KD1 C;  4OMM A;  4A4K A;  1Q82 R;  1O75 A;  2FRY A;  2MIO A;  3LH0 A;  4BB7 A;  2O2O A;  1KD1 R;  1XTD A;  4FYX B;  2KXC A;  4GBQ A;  2X4W A;  2GF7 A;  2ED0 A;  2QQS A;  2EJG A;  1D3B B;  4R55 A;  2M9U A;  2AT1 B;  4R0K A;  1H8K A;  1JBM A;  4AG2 C;  4QVD A;  3MKD A;  1JB0 E;  4OMN A;  5KYX B;  1MGQ A;  3MET A;  3PGG A;  3I55 A;  4DOW A;  3HRS A;  3V7C A;  2EVR A;  2YUQ A;  4N4G A;  2D8J A;  1QMC A;  2RN8 A;  3EG2 A;  2HBW A;  5D6W A;  2LDM A;  2GBQ A;  5D6Y A;  1GBR A;  2VC8 A;  5GAN 2;  1YHQ T;  3GBQ A;  3H6Z A;  3RUX A;  2QEX T;  1HD3 A;  3E19 A;  3PFS A;  2LCC A;  1N5Z A;  3NFC A;  1W1F A;  1UJY A;  3EG0 A;  2DYB A;  3H8Z A;  2ZAE A;  2LJ0 A;  1JQQ A;  4DBF A;  2FZC B;  2RI3 A;  1ACM B;  2RI5 A;  4IUP A;  2XHC A;  3JRZ A;  2QGG A;  4PKC C;  2KBT A;  1PWT A;  1AVZ C;  2QEX A;  1UFF A;  4HXJ A;  2F1L A;  3GNF B;  1W2B A;  4IKF A;  1WHG A;  3OSS C;  1QVP A;  4B9X A;  2FPE A;  3CXC A;  3OY9 A;  1K73 U;  1VOM A;  3QDF A;  2LQK A;  2O4X B;  1TG0 A;  4OP0 A;  1I1J A;  4DEY A;  2V1R A;  2OTL A;  2YDL A;  1RAG B;  3KXT A;  5KCO A;  3VS0 A;  2L5Q A;  3BY7 A;  1VQK T;  2L0A A;  1AT1 B;  2DD4 A;  1UHF A;  2DIL A;  3CC7 A;  3FDR A;  5A0L A;  1OZ3 A;  2JZ2 A;  3UWN A;  3JB9 D;  1G3T A;  1H3Z A;  5GAO l;  2K57 A;  1OPK A;  4Z89 A;  2MWO A;  1YJN A;  3QII A;  3M0R A;  2XDP A;  1DJ7 B;  4HCK A;  2ZPG B;  1R8O B;  1QKW A;  2D0N A;  3HRT A;  4PJN A;  1U5S A;  2HQH A;  1NPR A;  4LN2 A;  5KYU A;  3TU4 K;  1OOT A;  2BZX A;  5FWB A;  4MZT A;  4TVR A;  2X3W D;  4BE0 A;  2XK0 A;  2EQM A;  2HQX A;  4Y92 A;  3CCQ Q;  2CDT A;  1H64 1;  1KC8 U;  4E2F B;  2V26 A;  4ORZ A;  2HMA A;  4RCB A;  3HFO A;  3JB9 F;  1ZLM A;  1YNZ A;  1AD5 A;  3HP9 A;  1KHC A;  1ZBJ A;  1YIJ Q;  4M77 A;  1M1K R;  2KRS A;  1MNE A;  3PMT A;  4QQ6 A;  2RQW A;  5I21 A;  2LCS A;  5KH6 A;  1UGP B;  3G6E Q;  2MAM A;  1WYX A;  5C6S A;  2EYX A;  1AHJ B;  3C95 A;  1QVF P;  4NOY A;  4XU1 A;  1LJO A;  1VA7 A;  2DJQ A;  1VQ7 T;  1RLQ C;  3L2Q A;  2MCN A;  2M1H A;  1YIT A;  2DIQ A;  2RNA A;  1BI0 A;  1S72 A;  4OGC A;  1X6O A;  4EMH A;  1JJ2 A;  2QQR A;  3OYI A;  2FG0 A;  4JS4 A;  3EGX A;  1KJW A;  1FXX A;  1FX7 A;  1AWJ A;  1KQS A;  3CPF A;  1F1B B;  3EFR A;  2EQI A;  4RTU A;  2EYY A;  2E1H A;  4ZN3 A;  3SHW A;  4PJO F;  1AOJ A;  1Y7X A;  2A37 A;  1QLY A;  4JLG A;  3S3N A;  2ZPI B;  2HEQ A;  4M7D D;  4GLM A;  1VQ9 Q;  5GAO r;  4C8Q D;  2AIR B;  2RF0 A;  3CPW A;  3QPH A;  4XU0 A;  1G5V A;  1GXI E;  1M3A A;  1ZUK A;  3PIP A;  4F7U B;  3UA7 A;  1N8R R;  2PNI A;  3NTK A;  4M7D C;  2DKG A;  2DVJ A;  3VS6 A;  3MP1 A;  1UGV A;  2KXD A;  2HL5 C;  2XDD A;  1EIF A;  2DO3 A;  1NJI R;  2CZ7 B;  1NLP C;  2QA4 Q;  1B07 A;  1KQ1 A;  2J6K A;  3CCM T;  3EGD A;  3EGX B; 
#chains in the Genus database with same CATH homology
 5FLX E;  1QP2 A;  4QW2 A;  5A2Q E;  2RHY A;  2JNG A;  2XID A;  4F7U G;  4Q5W A;  1U1T A;  5GMK l;  4E7J A;  2JVV A;  4ELY C;  3CC2 A;  3G71 A;  2DEQ A;  2P0K A;  3M59 A;  4M78 C;  4OB2 B;  4PLI A;  4RG2 A;  3JCM g;  4LDV A;  3CBM A;  1M9S A;  4M7D B;  4EMK A;  1BIB A;  5DY9 A;  2DAQ A;  2RHI A;  4J6X A;  5GAN h;  3A8H B;  1VQP T;  4KUD K;  2JTF A;  3QO3 A;  4F7U F;  5GAM e;  2YLB A;  4C92 D;  3RMQ A;  4BI3 A;  5IT9 E;  2D9T A;  5EG2 A;  2LVM A;  3I56 A;  3MHX A;  4C0Z A;  1M1K C;  2P0Q A;  1VQ9 A;  2P4T A;  3LYI A;  5GAN g;  3CCL A;  2CKK A;  4UC4 A;  1MHN A;  3WVE B;  3V8K A;  3SFM A;  3O8V A;  1Y96 B;  2XDB A;  2VGM A;  2RHU A;  3OMC A;  3SB2 A;  1YHQ A;  1O9S A;  2QTX A;  3JSC A;  4C92 C;  3HSB A;  2H3J A;  1UB4 A;  3OS2 A;  5CQX A;  3E9G A;  3CD6 A;  2MI6 A;  2KMT A;  3UDC A;  5GMK h;  3CME A;  5LJ5 e;  1VIE A;  2FYK A;  3X24 B;  4MMK A;  2MF2 A;  3HKS A;  5GAO m;  4J6W A;  3OB9 A;  1LNX A;  4KBM B;  2DXC A;  4OGE A;  5FU7 C;  1VIF A;  4C8Q C;  3CCE T;  1WQW A;  4YTL A;  3FJP A;  3X25 B;  1Q7Y U;  3RER A;  3OYA A;  2X4X A;  2OTL T;  4RCC A;  3CCU A;  4M7D E;  4BI8 B;  3JCM e;  2HNI A;  4O6J A;  1UEB A;  3G7Z A;  3HRU A;  2QQA A;  4C0D B;  5GAN 8;  2V8K A;  5GAN 6;  3DKM A;  4QVC A;  3C4S A;  1VQ6 A;  1S72 T;  3HFN A;  1KQS S;  2F5K A;  4RMO A;  2QI2 A;  2WSC E;  3MP6 A;  3SD4 A;  1FWZ A;  5LJ3 g;  4M7A F;  5GAO p;  1Y96 A;  4M77 G;  1UGS B;  1D3B A;  5CIU A;  5GAN e;  3S3O A;  2RO0 A;  1VQM T;  4X9C A;  3P8B B;  3OYF A;  3FEO A;  3KUF A;  2L89 A;  2KVQ G;  3SWN B;  2E65 A;  2K5L A;  3OSV A;  3WXM B;  4C0G A;  3OYM A;  3J7A F;  2D0Q B;  4EDU A;  3I55 T;  3MEA A;  4M7D F;  5KCH A;  4C92 E;  2ZPE B;  2YLC A;  4JDS A;  4BD3 A;  2HBP A;  4JJN K;  3CMA T;  3L2W A;  4IUT A;  3HPW A;  3CCR A;  5CVI A;  2CGH A;  2KY9 A;  3VU3 C;  4B9W A;  4OB0 B;  4C8Q E;  1TH7 A;  2K3X A;  3T9N A;  3OYD A;  2ZCF B;  3SDZ A;  1YCY A;  4DQ2 A;  1VQ9 T;  4L6V 5;  4BDY A;  2DXB A;  4N0A A;  2ZPF B;  4HCB A;  3QZ5 B;  1WJQ A;  4M78 B;  5GAN f;  4XTY A;  2MWP A;  4C92 A;  1I5L A;  5GAN d;  2R5M A;  1YJN T;  5CKB A;  4IUR A;  2EKO A;  2O4X A;  4CRI A;  1P92 A;  3M54 A;  4FM4 B;  1IRE B;  2K4Y A;  1YBY A;  1M1F A;  3GF5 A;  4C8Q F;  3VYH B;  1VQP A;  2JOY A;  2XIC A;  5KE2 A;  2RK1 A;  3L2V A;  4M75 B;  3VYG A;  2YHT A;  5GAO n;  4A4H A;  1W4S A;  1KQ2 A;  4M7D A;  4IUU A;  4M7A B;  3JCM W;  2X4J A;  2E64 A;  4JRQ A;  1I81 A;  5GAN j;  3OYN A;  3INZ A;  3TRE A;  5HKC A;  3GP8 A;  4JS5 A;  2M0O A;  5FRN A;  1RI0 A;  2O01 E;  2R57 A;  2EAY A;  1M4Z A;  4MDX A;  2DXT A;  2OAU A;  3NTH A;  3NTI A;  3QJ6 A;  5CQY A;  2QA4 T;  1NPP A;  3RMS A;  4II1 A;  3A5Z B;  5LJ5 h;  2CZ0 B;  4LDU A;  2DVE A;  4F7U E;  3OYL A;  1VQ4 T;  1K73 C;  5CR2 A;  3ME9 A;  1M90 C;  5FU7 B;  5I2M A;  5LJ3 d;  1M5Q 1;  3CME T;  4IUQ A;  1YJ9 A;  2DTH A;  3CPW S;  4BUG A;  4OVA A;  2LC4 A;  4HCC A;  2CS7 A;  2DJZ A;  1KG1 A;  1B34 B;  2EJF A;  1XQH A;  1G3Y A;  2BIV A;  2QDY B;  2RD1 A;  4R56 A;  4M7A D;  2CZ1 B;  3I56 T;  4PNO A;  3L2Z A;  3JB9 H;  2IG0 A;  4E7L A;  3CCM A;  2ZPH B;  3WVD B;  3ASK A;  3GLX A;  3BDL A;  3CCQ A;  3OW2 A;  3CCJ T;  1I8F A;  2EQJ A;  1WJR A;  4PL6 A;  3BDU A;  1K73 U;  2HD0 A;  4LD6 A;  4M7A C;  2QXF A;  3M56 A;  2XKO C;  4J7I A;  3CCS T;  5CO7 A;  3QYH B;  2VGN A;  3CD6 T;  1BI1 A;  2E6N A;  4C5G A;  1K9M C;  2R58 A;  1YJW A;  5A0G A;  1V29 B;  3CCV T;  1QVG S;  1BIA A;  2XG8 D;  3X26 B;  3FRN A;  4PJO A;  1YIJ T;  3OS1 A;  3V8L A;  4C8Q G;  4VUB A;  3JCM V;  1PSF A;  2V8J A;  3OQ5 A;  3QZ9 B;  4XK8 E;  3V7R A;  2X4Y A;  1B34 A;  2RHZ A;  5LJ3 h;  3P8H A;  4GLK A;  5CCA A;  3JCM h;  3MO8 A;  2EIF A;  3P8D A;  5FU6 B;  1WGS A;  1OI1 A;  3G4S T;  3HL8 A;  4A4G A;  2JUF A;  3N5B B;  1LOJ A;  2Y90 A;  4ZGE B;  5DLQ E;  3LGL A;  3A8L B;  3JB9 I;  2DIG A;  1WPY A;  2RH2 A;  3EAE A;  4N4H A;  3F70 A;  5GAN 5;  5GAO q;  4IUV A;  4J6Y A;  4KUI A;  4M78 F;  4XTU A;  4XU3 A;  5AYF A;  4PLL A;  4C92 F;  1I4K 1;  5KE3 A;  1W2B S;  1KD1 C;  1WJS A;  4HT9 A;  1XNI A;  3C12 A;  3M53 A;  3QBY A;  4QVZ A;  4A4K A;  3JCM Q;  2K3Y A;  2PU9 B;  3CCV A;  1O75 A;  4M77 D;  2RJC A;  4DOV A;  4C0F A;  4FL6 A;  3PT9 A;  4M7A E;  2MMP A;  3LH0 A;  2RJD A;  4L5G A;  4BB7 A;  3CMA A;  2ZPB B;  1NJI U;  2G3R A;  3ZBD A;  4EMK B;  3CC4 A;  3E9F A;  2FL7 A;  1VQ7 A;  2R5A A;  1XTD A;  3JCM P;  3VJP A;  4FSX A;  2HAX A;  4PJO D;  2LX9 A;  2GF7 A;  2VXE A;  2X4W A;  4A4F A;  2QQ9 A;  2QQS A;  2E41 A;  4ZTJ A;  2EJG A;  4FT4 A;  1D3B B;  5LJ5 f;  4M77 C;  4BY6 C;  5GAM j;  4R55 A;  2M9U A;  3CCQ T;  4BAC A;  2ZZD A;  1KC8 C;  3CCL T;  1VQL A;  5CKE A;  1HXD A;  3RKW A;  3G71 T;  1N8R U;  2EFI A;  1JBM A;  3RES A;  4QVD A;  3L2U A;  1JB0 E;  4M75 A;  3MCA B;  4MZM A;  5HY6 A;  1NZ9 A;  2A3L A;  3CBP A;  4JRP A;  1QVF A;  1MGQ A;  3TEE A;  3MET A;  3UPU A;  2L8D A;  4PJO C;  3A8G B;  2DTO A;  3PGG A;  3I55 A;  4E7K A;  4DOW A;  2D6F A;  3HRS A;  4P5N A;  2LTO A;  3VUZ A;  5GMK m;  2RJF A;  2PVD B;  2GCX A;  2YRV A;  2RHX A;  3V7C A;  4LDX A;  4N4G A;  5GAM f;  4EPC A;  2DD5 A;  4KUL A;  4OMF B;  5LJ5 j;  1Q81 U;  4C5H A;  5GAN 7;  3S6W A;  4C92 B;  1M90 U;  5D6W A;  3OMG A;  3JAM E;  2B8A A;  2LDM A;  2PUO B;  1KHI A;  3A8O B;  3QUI A;  2DPP B;  5D6Y A;  3DLL A;  2VC8 A;  5GAN 2;  2Y4Y A;  4XTX A;  1YHQ T;  1M8V A;  1VQO T;  3ZFJ A;  4M78 A;  1K9M U;  1QVF S;  4X9D A;  3H6Z A;  4ZGJ B;  3RUX A;  3OS5 A;  3HHT B;  3BW1 A;  3MEV A;  2QEX T;  3CCS A;  4M77 B;  4BY6 B;  3E19 A;  1BI3 A;  1X75 C;  1ZBX A;  3PFS A;  4M75 E;  2LT1 A;  2LCC A;  3X28 B;  1YJ9 T;  2LRQ A;  2LT4 A;  4N4I A;  2X35 A;  3NFC A;  4C5I A;  3LX7 A;  3H8Z A;  4V2S A;  3SWN A;  3GIB A;  2F5T X;  1OYX A;  2K5F A;  1VUB A;  2XI9 A;  2XU8 A;  3QJY A;  2RI3 A;  4J8O A;  1BI2 A;  3CBO A;  2RI5 A;  4IUP A;  2XHC A;  3QYG B;  4NS5 A;  5GMK i;  1XOV A;  3A8M B;  3L2R A;  5D6X A;  4M75 D;  3JRZ A;  4M75 F;  4PKC C;  1VQO A;  3LLR A;  2EQK A;  1N6A A;  5CAI A;  5GMK e;  2QEX A;  3MP8 A;  1Y71 A;  2DK3 A;  3AHU A;  3GNF B;  2JN0 A;  1W2B A;  4IKF A;  3OS0 A;  5J3B A;  3OSS C;  3JCM X;  1QVP A;  3CEY A;  4B9X A;  3CXC A;  4ZGD B;  2DZ9 A;  4J83 A;  3OY9 A;  2RK2 A;  5FU6 C;  1YIJ A;  3M5A A;  2KK4 A;  2CYZ B;  2LQK A;  4M75 G;  2O4X B;  4M75 C;  4OP0 A;  5IN1 A;  4ELZ C;  2E6Z A;  2F69 A;  2OTL A;  1QW1 A;  4J7F A;  3Q1J A;  4M77 E;  3KXT A;  3SWN C;  4O5V A;  5KCO A;  4D6W A;  5LJ3 e;  2L5Q A;  3BY7 A;  3LWH A;  2EWN A;  1G3W A;  1YI2 A;  3OYJ A;  2DD4 A;  4JRK A;  1VQK T;  5GAM h;  3CC7 A;  1N8R C;  3FDR A;  5A0L A;  1OZ3 A;  2JZ2 A;  4Y28 E;  4C0D C;  3UWN A;  3GOX A;  1G3T A;  3JB9 D;  3OYH A;  3DB4 A;  1H3Z A;  1Y07 A;  5GAO l;  4PJO E;  4C8Q B;  2K57 A;  3OYK A;  3RKX A;  3QDR B;  3MEW A;  4M7D G;  1YJN A;  2GFA A;  2MWO A;  1QVG A;  4ATO A;  2EYQ A;  2OTJ T;  3JCM b;  3QII A;  5HK3 A;  1VQ4 A;  4XU2 A;  4M7A G;  5GAN 3;  4M77 F;  4MDW A;  3X20 B;  3QSU A;  2XDP A;  2L3R A;  1DJ7 B;  3VV0 A;  1SSF A;  4J5Y A;  2DTI A;  1KD1 U;  3BFM A;  2RA2 A;  2PVG B;  5LJ5 g;  5FRO A;  1PSE A;  4XTW A;  2EQU A;  3M9Q A;  2ZPG B;  3FIF A;  1R8O B;  1QP3 A;  4ME7 A;  2VXF A;  3G6E A;  2JTM A;  3OW2 S;  4ZTF A;  1HK9 A;  5M9O A;  2WAC A;  5LJ3 j;  3HRT A;  3VKI A;  4A53 A;  3J81 E;  1Q86 U;  3M4Y A;  5GMK j;  1NPR A;  3QKJ A;  2WSE E;  2WSF E;  1YI2 T;  1Q82 C;  2P0P A;  2PVO B;  3TU4 K;  3M58 A;  1JJ2 S;  5DLO A;  3ER0 A;  2I2L A;  4MZT A;  3JCM f;  4DA4 A;  4TVR A;  3LGF A;  3M55 A;  4BE0 A;  2XK0 A;  1Q86 C;  3PTA A;  1WQ7 A;  2EQM A;  2HQX A;  4A4E A;  3OBY A;  1VQM A;  4F7U A;  1WNL A;  1K8A C;  5GAM g;  2E10 A;  4E47 A;  1KC8 U;  1H64 1;  2LNV A;  3R6O A;  2AHJ B;  2PQW A;  1M1G A;  3C94 A;  5LJ3 f;  4RCB A;  3HFO A;  4QQG A;  3JB9 F;  4JLI A;  3E1S A;  3CC4 T;  2RM4 A;  4PJO B;  4XQ3 A;  2A7Y A;  3HP9 A;  1KHC A;  3FLG A;  4PJO G;  4C5E A;  2M16 A;  4FU6 A;  4M77 A;  2RJE A;  4FIB A;  4RKU E;  1BKB A;  2KDS A;  3PMT A;  3OA6 A;  4OF1 A;  4QQ6 A;  2ZGW A;  3KBG A;  4HKE A;  5I21 A;  5KH6 A;  1NE8 A;  4ZN1 A;  1UGP B;  4QQD A;  5LL6 S;  4BI4 A;  2MAM A;  1OZ2 A;  5CK9 A;  3OYG A;  5C6S A;  3C95 A;  1AHJ B;  2BKD N;  3PMI A;  1ZQ1 A;  1Q7Y C;  3L42 A;  4EMK C;  2KAF A;  4NL3 A;  4NOY A;  4XU1 A;  1LJO A;  1RL2 A;  3LWI A;  1VQ7 T;  3OYC A;  3L2Q A;  4Z02 A;  1UGQ B;  4C8Q A;  4BE2 A;  2QQB A;  2EJ9 A;  3GNG A;  4WF2 A;  5LJ5 d;  2M1H A;  4HA8 A;  2DIQ A;  1YIT A;  2FHD A;  2E70 A;  3JCM J;  1BI0 A;  1Q81 C;  1S72 A;  1BYM A;  4OGC A;  1X6O A;  4EMH A;  3CC7 T;  2K2V A;  5I2S A;  3M57 A;  2E5Q A;  5FRM A;  4Y91 A;  5HK0 A;  3FB9 A;  5DM7 R;  1JJ2 A;  2RB6 A;  4CI0 C;  2QQR A;  3OYI A;  3QHS A;  1M1K U;  4JS4 A;  2DXU A;  1N27 A;  1FXX A;  5CKD A;  1VQ5 A;  1FX7 A;  2OTJ A;  2Y4X A;  4NL2 A;  1KQS A;  1VQN A;  3CPF A;  4KT0 E;  4M78 E;  3RIR A;  3EFR A;  2GFU A;  2VYT A;  3S3M A;  1VQ8 A;  1U8R A;  5GAM d;  3JB9 G;  2E1H A;  4L59 A;  3G6E T;  2V8I A;  1Q82 U;  4JRI A;  4ZN3 A;  4PJO F;  2GQV A;  3JCM c;  1VQK A;  1Y7X A;  3JB9 J;  4HCZ A;  3JCM d;  3J80 E;  2CZ6 B;  2LCL A;  5CKH A;  3VUB A;  1VQ6 T;  5J39 A;  4E7I A;  3CC2 T;  2QA4 A;  2NLU A;  3MEU A;  3GPL A;  3ZEH A;  4A54 A;  4LD9 K;  3OYY A;  4JLG A;  2LQ8 A;  1VQ5 T;  3S3N A;  2ZPI B;  1N9R A;  4C92 G;  1VQN T;  4XAX B;  4X34 A;  1G3S A;  4LDY A;  1YJW T;  4RG8 A;  4M7D D;  4E7H A;  5C0M A;  3L1A A;  3PIO A;  4EMG A;  4BDZ A;  5GAO r;  1VQ8 T;  4C8Q D;  3DB3 A;  5L8R E;  2BUD A;  4FT2 A;  3CPW A;  5CKF A;  3QPH A;  3CCU T;  4XU0 A;  1G5V A;  1GXI E;  3PNW C;  4LDW A;  3CCR T;  1UGR B;  3M4G A;  5J26 A;  3LW5 E;  3PIP A;  4F7U B;  4BE1 A;  3OYB A;  3G4S A;  2XD0 A;  1YIT T;  2RI2 A;  3OBW A;  1K8A U;  3NTK A;  4M7D C;  4XTZ A;  3FC3 A;  3CCJ A;  2KSS A;  2DKG A;  4HT8 A;  1N9S A;  2KQW A;  5GAN 4;  2PUK B;  4JUV A;  4MZP A;  2VV5 A;  3QXE B;  3V8J A;  1VQL T;  4M7A A;  3MP1 A;  2E12 A;  1U1S A;  1IZ6 A;  2VUB A;  4N0A C;  2C06 A;  3RKY A;  1X01 A;  4M78 G;  3UT1 A;  5A0D A;  1JRI A;  2XDD A;  1EIF A;  3TCJ A;  2DO3 A;  4GY5 A;  5IAY A;  3CCE A;  2HQE A;  2CZ7 B;  3DLM A;  3URG A;  4M78 D;  1NJI C;  4OB3 B;  1KQ1 A;  2FB7 A;  2FVU A;  2IVW A;  3EFS A;  1ZHI A;  4OB1 B;  3V7S A;  3QG1 A;  3OYE A;  3CXC S;  3CCM T;  2DZC A;  4MML A;  2K5I A;  4XTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...