3S6WA

Crystal structure of tudor domain of human tdrd3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
52
Chain Sequence
MWKPGDECFALYWEDNKFYRAEVEALSGMTAVVKFIDYGNYEEVLLSNIKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tudor domain-containing protein 3
publication title Crystal structure of TDRD3 and methyl-arginine binding characterization of TDRD3, SMN and SPF30
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 52
sequence length 54
ec nomenclature
pdb deposition date 2011-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s6wA00
2RI5A 3FLGA 4NS5A 1WJQA 2EQMA 1WJRA 3OQ5A 3LH0A 4QQDA 4BDZA 2PQWA 3OYJA 3BDLA 3QJ6A 5FRNA 4E7JA 3MEWA 2EKOA 4II1A 2EFIA 2F5KA 2RJDA 4N4HA 4PL6A 4QW2A 3ME9A 4BE0A 4E7LA 5CIUA 3F70A 3P8DA 3LYIA 4X34A 4E7KA 5D6WA 3MEUA 2M1HA 3OYAA 3E9FA 3DLMA 3OS1A 5J26A 4IURA 1WGSA 2K3YA 4QQGA 1KHCA 3NTIA 2RO0A 1WJSA 4EDUA 5KE2A 2GFUA 2X4WA 3QIIA 2R57A 4B9XA 5D6XA 4L59A 3L2RA 4A4HA 4FL6A 2RHYA 4A4EA 3L2VA 3CEYA 4ZTJA 2HQXA 2P0KA 2O4XB 4N4IA 2GF7A 3MP8A 2M0OA 2EQUA 3DB3A 5FROA 4C5EA 3MEAA 3GOXA 2RI2A 4IKFA 3C4SA 2LDMA 2X4XA 2E6NA 2EQKA 3FDRA 3PMTA 5C6SA 2RHXA 5J39A 2RJEA 2GFAA 2LCCA 5KCOA 3OS0A 3OYCA 2E5QA 1OZ2A 5FRMA 4BE1A 3OA6A 3OMGA 4BD3A 2LVMA 2DIGA 4C5HA 2YRVA 5M9OA 3M9QA 3OYFA 3OYEA 1XNIA 4IUVA 3FC3A 2FHDA 4OVAA 2L3RA 2EQJA 4UC4A 4IUTA 3PFSA 2RHUA 3MO8A 4E7HA 2G3RA 3OYKA 2M16A 3NTKA 3H8ZA 3OB9A 4C5GA 4BDYA 1SSFA 5KH6A 3OYHA 3L2QA 4IUPA 2QQRA 3KUFA 4IUUA 2BUDA 2IG0A 4QVZA 2JZ2A 3OY9A 2WACA 3S3NA 4B9WA 4PLIA 2R5MA 4BE2A 2XK0A 2HQEA 3MP6A 3UWNA 3O8VA 4CRIA 2DIQA 2R58A 5C0MA 3OYNA 3MEVA 4HCZA 3SD4A 1G5VA 2B8AA 3OYMA 2JTFA 3S3OA 2BIVA 4A4GA 1H3ZA 2BKDN 1OI1A 3OS2A 4LD6A 3ZEHA 3S3MA 4RG2A 3H6ZA 5D6YA 4QQ6A 4A4FA 3NTHA 3FEOA 2L8DA 2MWPA 2X35A 3OYGA 4BACA 4N4GA 2LRQA 5KCHA 2X4YA 2XDPA 2K3XA 3ASKA 3OMCA 2NLUA 3S6WA 3L42A 3P8HA 3Q1JA 4Z02A 3L2UA 3QBYA 4Q5WA 4ZTFA 2R5AA 2D9TA 1OZ3A 4GY5A 3UT1A 2LTOA 3LX7A 2RJFA 3META 3OYLA 3L2WA 5IN1A 3OYDA 4IUQA 1RI0A 2MWOA 1N27A 2CKKA 3PNWC 5IAYA 1MHNA 3DB4A 2DAQA 2RI3A 3PMIA 4PLLA 2RHZA 3OYBA 4C5IA 3LGFA 3LLRA 3QKJA 2QQSA 2O4XA 2RHIA 2VYTA 3E9GA 5KE3A 4E7IA 1OYXA 3LGLA 2RJCA 3OYIA 3MP1A 4FU6A 3EAEA 2L89A
chains in the Genus database with same CATH superfamily
3PTAA 2DLPA 5FRNA 5KYYA 1UECA 1YITT 1VQ7Q 5DM7R 2CSIA 2MOXA 4PK4A 1N8RC 3TEEA 1YITQ 3LH5A 1WJSA 2E3HA 4D8DA 1LOJA 3M53A 2W0ZA 3CCUT 2QG9B 3TREA 4JRKA 4FW2A 3JCMh 2V26A 4M4ZA 1M1KC 3BE3A 1WQ7A 3DB3A 4D6WA 4J7IA 2DTHA 3VS1A 3CCUQ 2OAWA 1KC8U 4XU2A 1Q86U 5GANj 4PJOA 5J39A 1I81A 4J9FA 2PUOB 1YP5A 4AT1B 3QJYA 2DETA 1GRIA 1EIFA 3H8ZA 4DEYA 2A08A 3QDFA 1QVFA 2YLCA 3JCMd 2JVVA 4M7DA 1YFNA 2JW4A 4LN2A 3S3OA 4A4GA 4JLGA 2K5IA 5GAN5 3QYHB 2Y90A 4XTZA 1OEBA 4PJOG 2L8DA 3O5ZA 3OYGA 4BACA 5KCHA 3S6WA 2YWWA 5GMKi 2FPDA 3HKSA 2LP5A 5KYUA 1Y96B 1JXMA 2HL3A 3EFOB 1K0SA 1VQ6T 2CZ6B 5LL6S 4M7DG 4ZGEB 1TUGB 4F17A 3LLRA 4PJOF 2MYSA 5DLQE 2JN0A 1VQ6Q 1WJRA 3ZFJA 4ZGDB 5GAOp 1QVFS 4AG2C 4E7KA 1IREB 4F16A 3TVTA 1D3BA 3JCMW 4DQ2A 4M75C 3V8KA 2DYBA 4M7DF 2EJ9A 4OB2B 1VQ8A 2HAXA 1IXDA 1X69A 3JCMb 1LNXA 3SWNA 4C0GA 1SEMA 3M57A 1S72A 2Y4YA 1K1ZA 4F04B 4VUBA 2RI2A 3WVDB 1BCOA 3MCAB 1M1GA 1UJYA 2MCNA 2K6DA 2RHXA 9ATCB 1OZ2A 2KK4A 2HMAA 3JCMc 2C06A 5M9OA 3CQTA 3EG9B 1HJDA 5IHKA 2L3RA 3LWHA 3X28B 5CR2A 5LJ3e 4L5GA 2WSEE 4ZGJB 2H8HA 2NWMA 5A0DA 3CD6A 2J06A 1DJ7B 1BYMA 4PLIA 2HCKA 2DFUA 1X43A 1RI9A 4HCKA 2KEAA 2C0TA 4RTWA 1G3TA 5KYXA 3DLLA 1IRXA 1QCNA 3TQ7P 2D1XA 2CS7A 2JTEA 2X4YA 2FEIA 2K3XA 1MV0B 1AWJA 3P8HA 3Q1JA 4Q5WA 4ZTFA 2XICA 3QWXX 3H0FA 2XMFA 4M77A 1RAIB 5GANf 4JZ4A 4XU3A 2YUQA 3EGDA 4KULA 2HBPA 3LGFA 3R6NA 2AZSA 1UEBA 2YRDA 3RERA 3A8OB 4M78A 2XHCA 2DRKA 4HVWA 4PNOA 3VUZA 1VQ9A 4PL6A 4A54A 4N4HA 3OW2A 4C0ZA 3P8DA 2EQIA 4EMKA 5I2MA 3URGA 1VQMA 1KQSS 2MI6A 2LX9A 1AWOA 4MMKA 5FWBA 2KAFA 3A8LB 1SSHA 1WNLA 2COWA 2E41A 4MDWA 3CEYA 2HQXA 1RAFB 2DPPB 3M0UA 2EQUA 2DL8A 5GAN4 1JU5C 3CCLT 3GOXA 1T0JA 2LDMA 3A8MB 1JRIA 5GAN3 4PFPA 1JJ2S 1D09B 5KCOA 2FVUA 6AT1B 5KYWB 1WFWA 2W10A 1LVKA 3CCLQ 1WPYA 3HRSA 4O6JA 2QI2A 3EH2A 2OTLT 4M77F 3M9QA 3FC3A 1KIKA 2F2WA 3VS3A 1EX4A 4MDXA 1QVGA 1ZUKA 2RD1A 5GAOl 2OTLQ 4M78F 3OY9A 4B9WA 3OW2S 2FZGB 3LW5E 2ROTA 5LJ5h 4C8QB 5GAMh 2XDDA 2GQIA 2BKDN 3H9NA 3N5BB 3S3MA 3H6ZA 1MGQA 4WF2A 1QVFP 3QDRB 4J9IA 2CUBA 4M77D 1W2BS 4M7AC 4F7UB 1UGQB 1X75C 3JAME 1WHMA 3MJXA 3THKA 3RKXA 4M78D 2WSFE 1Y0MA 2KYBA 1Q81R 1PCXA 2KY9A 3PNWC 3UA6A 5LJ5d 1ZLMA 4LDXA 4C8QE 1ABQA 5GAMd 4XTYA 2XI9A 4JJBA 4KRTA 1TXQA 4OB0B 2JTMA 1BBZA 1ABOA 1UE9A 3MEWA 2LJ3A 5D7UA 4F7UE 2K79A 3UATA 2OAUA 3HRTA 2MK5A 3JB9J 2M9UA 5L23A 3VYGA 4P5NA 1RLQC 2E10A 3DLMA 4XK8E 1TUCA 3PIOA 3TCJA 1WGSA 1I5OB 1WI7A 2DVJA 1BI1A 2RQRA 1BIAA 2HQHA 2K4YA 3E2UA 5I2SA 2DTOA 1V76A 3KXTA 1Y96A 4RKUE 1YI2T 4C92C 3EFOA 2D0NA 2KT1A 3JB9H 4AFQC 1T3LA 3CPFA 4RTZA 4J7FA 3NGPA 2GFAA 4HT8A 2K9GA 1YI2Q 1N9RA 2H3EB 4BE1A 2HD0A 3AT1B 2D8HA 2LJ0A 3OYEA 1YCYA 4ANJA 4OVAA 1AWXA 3NTKA 3QUIA 2DXCA 3SFMA 5GMKl 3CCST 2AKLA 5FLXE 2JZ2A 3VS0A 1VQ8T 1X27A 2XK0A 4Y28E 2P0PA 1WHGA 3CCSQ 1PD0A 2PVGB 1H3ZA 1NZ9A 2NUZA 1OULA 1VQ8Q 3VRYA 1WHHA 1PRMC 2MWPA 2XDPA 1BK2A 1FX7A 1KQSP 1BIBA 4J5YA 2DJQA 3SEMA 3PVLA 4Y92A 1PRLC 2JS2A 1IB8A 2MWOA 2DM1A 3CD6T 5GAN7 4C5IA 1NJIR 2QQSA 2O9VA 8ATCB 3E9GA 2I2LA 1W4SA 3NFCA 4M7AD 4PKCC 3CD6Q 3BDLA 1JJ2P 4XU0A 3MPUB 2P84A 2RJDA 1Z9ZA 4EMHA 3VJPA 1OPKA 3A1PA 4LE9A 2VC8A 4R55A 4Y91A 1KD1R 3EH1A 1MNDA 1JBMA 1N9SA 2DEUA 2HEQA 3QIIA 4J6YA 3OW2P 4JJNK 3L2RA 1EFNA 1B7TA 4A4HA 2EYWA 3M54A 4X9CA 1X2KA 3CPWA 5LJ3g 3MP8A 5FROA 1TH7A 2QEXA 5CKEA 1UGVA 3QG1A 5IHIA 5GAMf 3OS0A 2DL4A 4M75B 4CC4B 1KC8C 3ZBDA 1VQ9T 5A0LA 2ABLA 1Q86C 2LVMA 4R0KA 5HKCA 2DJZA 1Q7YR 2F2XA 3PGGA 3C94A 1VQMT 3JCMP 1K8AC 2LMJA 1FYNA 2BE7D 4FT4A 1VQ9Q 4JRQA 3KFVA 2I0NA 2BUDA 2L3SA 2F69A 2K5FA 2LZ6B 3E19A 3EFRA 1VQMQ 5IHNA 3CC2T 3GNGA 2V1QA 2EGCA 1I8FA 1QVGP 4M75E 3CC2Q 3X26B 2KT8A 1AOJA 4FT2A 2NLUA 2DE0X 1UTIA 2RK1A 1Y57A 1X6OA 3L2UA 3CPWS 1WDXA 1T3SA 2LJ1A 2LQNA 2EYXA 1VQ5T 1UHCA 5KYWA 2XD0A 2YXYA 3QHSA 2ZPIB 2J7IA 2CYZB 1RAGB 2EKHA 3TSZA 1VQ5Q 2DAQA 1WA7A 1ZSZC 2NUTB 2WSCE 5I22A 1W6XA 2FRYA 1AZEA 4Z88A 2RQVA 4WTOB 2LQWA 1KG1A 4C8QA 2EFIA 1J3TA 3CCQA 2M51A 3ULRB 5LJ3j 3VKIA 2EJFA 1SRMA 3NPFA 4F7UA 3EGXA 1H3HA 1WXBA 2P4TA 2RK2A 1UDLA 4PJNA 3SB2A 5CKBA 3H41A 2KI7A 3QYGB 2M0YA 2ZZDA 1K73C 2CZ7B 4IKFA 3CCVA 4BB7A 2KROA 1GL5A 4C8QG 1SHGA 3RKWA 1I07A 1PWTA 2C0IA 3G71A 3WVEB 5GANh 4BI4A 4FYWB 2QQAA 4PJOC 4IUVA 2JJ9A 5GAOm 4JLIA 4F7UG 2NUPB 3ER0A 2AK5A 2BZYA 3GNFB 3G4ST 1IZ6A 1Z9QA 2HQEA 1RACB 2XU8A 4C8QF 1X6GA 2JTFA 3EHQA 4RTXA 3I9QA 3G4SQ 3CBPA 1OU9A 4DOVA 4XU1A 1K8AU 5GANd 5D6YA 4M7DC 3I55A 1RUWA 4DBHA 2FZCB 4F7UF 3CMAA 2CZ1B 1K9MC 2G6FX 4Z02A 3RUXA 3UT1A 1OZ3A 2VXFA 1BI2A 1M8MA 3M0PA 3WXMB 1VOMA 2HNIA 3GF5A 1PG5B 4C8QD 2BZXA 2VYTA 5GMKe 1OQKA 4MMLA 1AHJB 2GQVA 4M7AB 2KSSA 2PQWA 1AD5A 4OMFB 4E7LA 3ZL7C 3CMEA 2L2PA 2HSPA 5CKFA 2J6KA 2YT6A 1U1SA 1IHVA 1M1FA 2GFUA 5CO7A 1TTHB 2IIMA 1QCOA 4RTVA 2FL7A 4J9GA 1VQLA 1PD1A 1Y07A 2M02A 3EG0A 1VQKT 1NLPC 7AT1B 2CP6A 4M7AE 2YLBA 1H92A 1E6HA 1YJ9A 1MMDA 1D0YA 1Q82R 1PHTA 1VQKQ 4L6V5 5C6SA 1AT1B 1D1BA 1UUEA 1KQ1A 2RH2A 2V1RA 2VUBA 1NLOC 4DBQA 5AT1B 3CPWP 5GMKm 2DXBA 4R56A 1K73U 1HYOA 3UDCA 3CCEA 1QVPA 4C92B 1PNJA 1YHQA 1NYGA 3JV3A 4ATOA 3PT9A 4BE2A 2QA4T 2IPOB 2RB6A 4LDUA 1N8RR 5LJ3f 1FWZA 1QWFA 1B07A 3HP9A 3G6EA 1VYTA 2QEXT 2QA4Q 3GIBA 2HSEB 3V8LA 2K57A 2QEXQ 3PE0A 1M1KR 4RTUA 4M75A 4C92E 1BB9A 4LDYA 4KGVB 2OI3A 1RI0A 2DVEA 1KQSA 1N27A 1I0CA 2JS0A 4EIKA 3J80E 3QXEB 2O4XA 4YTLA 2QQBA 1K9MU 4F14A 1X6BA 1K76A 4NS5A 2EQMA 4RUGA 1GCPA 2E4HA 2J6FA 4C0DC 2JM9A 2DBKA 3ME9A 2D0QB 2HDAA 4JRPA 1YIJA 3I56T 4M75G 1JJ2A 1N5ZA 1SG5A 1NPRA 3A98A 3HFNA 1GFCA 3NMZC 3I56Q 1KQ2A 2RHYA 1QMCA 4A4EA 4HCBA 4LDWA 3GLXA 4RTYA 3VS5A 1G8XA 2ED0A 4QVDA 3FDRA 2VKNA 1HK9A 2RJEA 1ZHIA 1TUDA 3OYCA 4M75F 4J83A 1D1AA 4PFZA 1OX8A 4M77G 3CCQT 1U8RA 2YRCA 1SPKA 1S1NA 2X3WD 1W2BA 1PSFA 4BDYA 2CP2A 2DF6A 1CSKA 2ZAEA 3CC4A 4KGZB 4M78G 1M4ZA 1R77A 4IIOA 3UF4A 1PM3A 3CCQQ 4DOWA 3MKDA 4LD9K 3QPHA 1AWWA 3OYNA 1U3OA 2LT4A 4B6MA 4E7ZA 3HFOA 3OS5A 3JCMe 2O31A 2CP3A 1GCQA 4M75D 5I11A 3JCMX 1X01A 3CCVT 2VGMA 5I21A 1PC0A 4JUVA 3G71T 2XIDA 1SHFA 1FMVA 4J6WA 1SRLA 1BKBA 3CCVQ 3VS4A 1E6GA 2E65A 3G71Q 4RG8A 1ZX6A 1RADB 3CXCA 1UHFA 3DB4A 1VQ4A 1TU0B 2RI3A 4ME7A 3UA7A 3TU4K 2CSQA 5KE3A 2RJCA 1KFZA 4LXCA 5GAOn 1B34B 3CCJA 3FLGA 3GP8A 1GBQA 1MMAA 4OGEA 2KDSA 3I5SA 2FRWA 3I55T 3LYIA 4X34A 1W70A 3OYAA 2MMPA 4LDVA 3HHTB 1ZSZB 2F2VA 3I55Q 1K0XA 4EDUA 4N0AC 3CCRA 2DL7A 1M2VB 3OSVA 1T0HA 2EYZA 4LUDA 2RPNA 3HPWA 2LCCA 3CXCS 4M7AA 3C12A 1HXDA 1ZBJA 2PVDB 3CMET 3PFSA 2B86A 3R6OA 5A2QE 1RAAB 3L2QA 4IUPA 2ENMA 3LWIA 3TSWA 4V2SA 3CMEQ 4MZTA 2R5MA 1M2OA 1D1CA 1RAHB 2DO3A 1HD3A 1WHJA 1YJ9T 1X2QA 4PJOB 2LT1A 5KYNA 3JSCA 4M7AG 4JJDA 1YJ9Q 1ZA2B 3V7CA 2ZPHB 4J9EA 5GJVB 1YN8A 1TG0A 1M90C 2LTOA 2RJFA 2JMAA 3OBYA 1BI3A 1VIFA 2JXBA 2ZGWA 5CQXA 4X9DA 5DLOA 2QGFB 5IAYA 1SKUB 4PLLA 4M7DB 2GNCA 1YHQT 2EGAA 1WXUA 1S72T 4C92A 4EMGA 3J81E 2VB6A 4PJOE 3V7SA 4M7AF 3P8BB 3JCMV 1M3BA 4QT7A 1YHQQ 5CK9A 1S72Q 3G6ET 4LUEA 5CIUA 3F70A 3VV0A 5GAN8 3KBGA 3UPUA 1C6VX 5D6WA 2M1HA 1NYFA 2JM8A 2ZPEB 3G6EQ 3EG9A 2KMTA 2QGGA 5KYUB 3M5AA 1VQOA 4DEXA 2RNAA 3QO3A 5KE2A 4ESRA 2OTJA 2PVOB 4M7DE 2FG0A 4L59A 2YHTA 3BDUA 4FL6A 1ACMB 4ZTJA 3RKYA 4C92G 1VQ6A 4N4IA 4HXJA 1YWOA 1H8KA 3EGUA 2QAZA 5GMKh 2RN8A 2E6NA 5GAOr 3M4GA 1M30A 1WHKA 2O01E 1NJIU 4DBFA 2E5QA 5FRMA 2NYSA 2RMOA 1D3BB 3CBMA 2DL3A 1YIJT 1QCFA 3FRNA 4RTTA 1PKSA 2K2MA 2OJ2A 4C92F 2QQRA 3JB9I 4NL2A 5GMKj 1YIJQ 2CZ0B 2DA9A 4XTUA 1M3AA 3BY7A 4CRIA 1I4K1 2COZA 1M5Q1 5FW9A 1ZBXA 2KVQG 1W2BP 1O75A 4E2FB 3QZ9B 4J9BA 1MV3A 4IIMA 4RG2A 1I5LA 4FW1A 4QQ6A 2A0FB 3FEOA 3PVQA 3CC7A 1PSEA 4FYXB 1MNEA 2RA2A 8AT1B 2EJGA 2DK3A 3QBYA 2R5AA 3SDZA 4C92D 5CKHA 2O9SA 1XJWB 4QVCA 1MMNA 5EG2A 1Q7YU 4E47A 1Y71A 3FJPA 1VIEA 3CC4T 3PMIA 3PIPA 1WQWA 1OOTA 4BI8B 5LJ5e 4BUGA 3EAEA 1QKWA 5GAMe 4D8KA 5KYXB 1GFDA 3CC4Q 4QQDA 1M90U 2GGRA 1RABB 5CAIA 3CXCP 2A3LA 3JCMQ 3EFSA 1AVZC 5IH2A 2L5QA 5GJWB 5CCAA 1QP2A 1R8OB 3E1SA 5LJ3h 2SRCA 1AEYA 2RO0A 4FYYB 1H641 2R57A 2CP5A 4AFSC 4FSXA 4C0DB 3A8GB 1VQ4T 2MAMA 4KBMB 2ROLA 2KE9A 2CT3A 4BI3A 3REBB 2V8IA 1VQ4Q 2ECZA 1B34A 4BY6C 3OMGA 3JCMg 3H0HA 1V1CA 1BI0A 2YRVA 5LJ3d 1JEGA 2LQKA 2DXUA 5A0GA 5L8RE 2VVKA 1TWBA 3NHNA 3OB9A 3I35A 5KH6A 1I1JA 2CH4W 4PJJA 4XTXA 2DEQA 3SD4A 2RQWA 1IGQA 2B8AA 2CUDA 1NBEB 4OF1A 2X51A 4PFOA 4KT0E 2GTJA 2C0OA 3X20B 3CCLA 1M2VA 1LCKA 1VYVA 3T9NA 4J6XA 2DX1A 4ZN3A 2LQ8A 4N4GA 4GLKA 1FMWA 3JB9D 2HL5C 2A7YA 3L42A 2A37A 2DYIA 2D9TA 2OTLA 1M9SA 2F1LA 5IN1A 4AMCA 4PJLA 4IUQA 1G3YA 1KK7A 4ORZA 3D7SB 2FYKA 3CBOA 1KC8R 1Q86R 4XAXB 3OYBA 1HSQA 4LNPA 2RHIA 1K9AA 2DERA 3CCMA 3LGLA 3C95A 2ATCB 1K8AR 1WJQA 2X9HA 3VYHB 3OYJA 5DY9A 4FIBA 2AKKA 2EKOA 4OP0A 2JUFA 2GTOA 2PNIA 1A0NB 1WLPB 3E9FA 2JOYA 1UGRB 5J26A 4ZNXA 2RF0A 2GCXA 4OMNA 2QYZA 2AT1B 1WZOA 5D6XA 2X3XD 2EAYA 3FB9A 1WX6A 4JS5A 2KNBB 4OGCA 3VS2A 3MEAA 2DKGA 1RLPC 3A8HB 4ELYC 2X4XA 2XKOC 2H3JA 1VUBA 2AZVA 1UFFA 5IXBA 1IHWA 1XQHA 2LC4A 3GBQA 2RQUA 2Z0WA 3U23A 2DD4A 3HSBA 2EQJA 1FMKA 2SEMA 1NE8A 2KRNA 2HBWA 3DKMA 3JCMJ 1MMGA 1VQOT 4XQ3A 2PZ1A 1YJNA 2OTJT 1WIEA 3G1JA 3M56A 3SWNC 2E5KA 1IGUA 3EHRA 2IVWA 1OPLA 1VQOQ 2BZ8A 1YI2A 1M3CA 2OTJQ 4RMOA 5IT9E 2ED1A 2F5TX 2CP0A 2X35A 2VXEA 2LRQA 2CH4A 1Q82U 3OMCA 4XTVA 1JQQA 4OB1B 3VUBA 1TOVA 4XTWA 1TSFA 1K73R 4OMPA 5HY6A 4JDSA 2ZPFB 2KXDA 2P0QA 4FYVB 5FWCA 3L2WA 4DA4A 2A36A 5GAOq 1WYXA 2EGEA 2V8JA 3M0RA 1MHNA 3CCSA 3AHUA 4E6RA 1YNZA 1PKTA 1B3QA 4PJOD 1YBYA 2DNUA 4HT9A 2VASA 2O88A 4NL3A 4WCIA 4II1A 2F5KA 4QW2A 1N8RU 3CC7T 1WHLA 4E7SA 3MEUA 2EIFA 5IXFA 3OS1A 4IURA 5AYFA 1M8VA 1AZGB 3CC7Q 1CKAA 4M7DD 3RMQA 4M77C 4J8OA 1M1KU 4JPBW 3VU3C 3L2VA 1K9MR 4HVUA 3L2ZA 2J6OA 1N6AA 4ZN1A 4M78C 3X25B 2A28A 1D0XA 2EQKA 3I5RA 5HCKA 2LNVA 1Q81C 1VQNA 2KXCA 1C0MA 2RM4A 3HL8A 3OA6A 1ZQ1A 1YJWA 4C5HA 2ZCFB 4EMKC 2E1HA 1VQPA 3BW1A 1CKBA 4UC4A 4IUTA 2BE9B 3MO8A 4E7HA 4K11A 2M16A 1NEBA 2QTXA 5FU7B 2EWNA 1SSFA 1KJWA 1F1BB 4J9CA 4KUDK 1YWPA 4JRIA 3VS7A 4QVZA 2WACA 3MHXA 3UWNA 4TVRA 5EC7A 2NUTA 3VRZA 2VWFA 2JNGA 5FU6C 3OS2A 1NG2A 2KQWA 2MF2A 1NPPA 2Y4XA 5GANe 5LJ5g 3JCMf 1GCQC 2YUOA 5GAMg 1YCSB 3LX7A 1TS9A 3QSUA 3M4YA 2DXTA 1QW1A 2RHZA 4CC2A 3CC2A 1C1AA 2J05A 4QKUA 3M55A 5CQYA 3QJ6A 2KRSA 3X24B 1OX9A 4HCCA 2XDBA 4JJCA 4GLMA 1Q95G 1ZUUA 3IQLA 2K3YA 4QQGA 1VQ5A 3EG2A 1R0BG 2NUPA 2LCSA 2QTVA 1UGSB 3FIFA 1G3WA 4FCYA 2OX7A 4KH1B 1D0ZA 1U1TA 4C5EA 3SHWA 3CCMT 2MPXC 1JO8A 1BCMA 4OMQA 4RCCA 4RCBA 3CMAT 2V8KA 4CI0C 3RBBB 5J3BA 4J9DA 2DIGA 3CCMQ 4HVVA 2K3BA 1NJIC 3OYFA 1XNIA 2K7AA 2LX7A 1JXOA 1P92A 2E70A 3OYYA 4OB3B 1M27C 1OU8A 3CMAQ 1MUZA 3OYKA 3EGXB 2CDTA 2DL5A 4X1VA 3KUFA 4IUUA 5ECAA 2IG0A 2P4RA 4C0FA 2DZCA 5LJ5j 1Q81U 1QKXA 1VQ7A 5KYYB 3MP6A 5GAMj 2R58A 3MEVA 1RAEB 2AIRB 3INZA 2FZKB 4BY6B 2EYYA 1ZA1B 1OI1A 1KD1C 1YITA 3ZEHA 2KRMA 4DBRA 4A4FA 1KSWA 1XOVA 2JT4A 2QXFA 3A5ZB 3M0QA 2ZPGB 1GBRA 1QVGS 2EW3A 2RQTA 4AG1C 3RNJA 4NOYA 2BTTA 2DBMA 4N0AA 3OYLA 2YSQA 4MZMA 2E12A 3CCUA 1VQLT 3OYDA 1Y7XA 4A53A 3J7AF 2K2VA 1YJNT 3RR6A 3G4SA 1VQLQ 1Q7YC 2O2OA 2L89A 4ELZC 3OQ5A 1NEGA 1RL2A 1YJNQ 4E7JA 2EVRA 4BE0A 4OMLA 1W1FA 1QQJA 2FB7A 3CCET 4Z89A 4HKEA 1ZUYA 1KHCA 3NTIA 4A4KA 3EG1A 1OV3A 2X4WA 4B9XA 3M0TA 2AHJB 2EPDA 3CCEQ 2HZYA 2HKNA 2GF7A 3V8JA 5HK3A 4KGXB 3C4SA 2X4JA 1O9SA 3RIRA 1UG1A 1IO6A 1ZSGA 3PMTA 2CGHA 1E7OA 2ESWA 4GBQA 4PJMA 3QZ5B 4BD3A 4FSSA 1UB4A 1G2BA 3HRUA 2EBPA 1VA7A 2DZ9A 2VV5A 3C0CA 1VYUA 5FU7C 3S3NA 2L3QA 4KH0B 2DIQA 1VQKA 3OYMA 1FXXA 3M0SA 3JRZA 2LCLA 3EG3A 4OMOA 4EPCA 4LD6A 1QP3A 3RESA 1ARKA 2L0AA 3OBWA 1V29B 1U06A 1VQNT 3RMSA 2KYMA 3GPLA 1XTDA 3G7ZA 1YJWT 1QWEA 1VQPT 4AFUC 2ZPBB 1BU1A 3SWNB 1VQNQ 2KBTA 1KD1U 2DMOA 2YDLA 1LJOA 1K4US 1YJWQ 4CC3A 3BFMA 3M59A 1VQPQ 4Z8AA 5CVIA 2E3IA 2QA4A 1GXIE 3QKJA 2RI5A 4JZ3A 4BDZA 3LH0A 3V7RA 2KR3A 2CP7A 2L3PA 4FM4B 2KGTA 5LJ5f 2LNHB 1LPLA 1EZZB 2QQ9A 3H0IA 2QDLA 3VS6A 2QDYB 2COYA 3FJ5A 2FPEA 3M58A 2P0KA 3REAB 2O4XB 1U5SA 2M0OA 4MZPA 2PU9B 1M90R 2DTIA 2QK0A 2DRMA 2HKQB 5GAN6 2K5LA 1UGPB 2PUKB 1UJ0A 4C8QC 2QASA 3HTRA 4KUIA 1G83A 2YUPA 4M77B 4JS4A 2FHDA 3JB9G 3I56A 2RHUA 2G3RA 3RDVA 1SF9A 3EGDB 4C5GA 3OYHA 2PTKA 5GANg 4O5VA 2FPFA 3QWYA 4M78B 2D6FA 1R0CB 2VGNA 3O8VA 5C0MA 4A63B 4HCZA 3CCJT 2E64A 1G5VA 2XG8D 2GBQA 2BIVA 2D8JA 2MIOA 2CT4A 2JMCA 2DILA 2EYQA 4J9HA 4EMKB 2FO0A 4CC7A 2DD5A 3NTHA 3CCJQ 2E6ZA 1G3SA 3JB9F 3L1AA 4M77E 1JB0E 3ASKA 4HA8A 1NM7A 4OMMA 5GAN2 4GY5A 5HK0A 1Q82C 4AFZC 1ZSZA 3META 4M78E 2YUNA 1WXTA 3OSSC 3CCRT 5FU6B 2CKKA 1KHIA 2CREA 1QLYA 5CKDA 1VQ7T 4E7IA 1OYXA 3CCRQ 3OYIA 3MP1A 4FU6A
chains in the Genus database with same CATH topology
3FLGA 3PTAA 1W4SA 3NFCA 4M7AD 4PKCC 3GP8A 4NL3A 5FRNA 3BDLA 4XU0A 4II1A 2F5KA 2RJDA 4OGEA 1YITT 2KDSA 4QW2A 1N8RU 3I55T 5DM7R 3LYIA 3CC7T 4EMHA 4X34A 3VJPA 3MEUA 3OYAA 2EIFA 2MMPA 3OS1A 4LDVA 1N8RC 3HHTB 2VC8A 3TEEA 4R55A 4IURA 4Y91A 5AYFA 1M8VA 1JBMA 1N9SA 4EDUA 1WJSA 4N0AC 4M7DD 1LOJA 3QIIA 3M53A 4J6YA 4M77C 3RMQA 4J8OA 3CCUT 4JJNK 1M1KU 3TREA 4JRKA 3L2RA 1Q86C 4A4HA 3CCRA 3VU3C 3L2VA 3M54A 4X9CA 3JCMh 3L2ZA 3CPWA 5LJ3g 3MP8A 1M1KC 1N6AA 1WQ7A 3DB3A 3OSVA 4J7IA 2DTHA 5FROA 1TH7A 4M78C 4D6WA 5CKEA 2QEXA 1KC8U 4XU2A 1Q86U 3X25B 3QG1A 3HPWA 2EQKA 5GANj 4PJOA 5J39A 1I81A 2LNVA 2LCCA 5GAMf 3OS0A 3CXCS 1Q81C 4M75B 1VQNA 1KC8C 4M7AA 3C12A 3ZBDA 1VQ9T 5A0LA 2PUOB 1HXDA 2RM4A 3HL8A 1ZQ1A 3OA6A 2LVMA 1YJWA 3QJYA 4C5HA 2ZCFB 5HKCA 2PVDB 2DJZA 4EMKC 2E1HA 1VQPA 3CMET 3BW1A 3PGGA 3C94A 4UC4A 4IUTA 3PFSA 3JCMP 1VQMT 3MO8A 4E7HA 4FT4A 1K8AC 2M16A 2QTXA 3R6OA 1EIFA 3H8ZA 5FU7B 5A2QE 2EWNA 1SSFA 3L2QA 4IUPA 4JRQA 4KUDK 3LWIA 4JRIA 2BUDA 4V2SA 2F69A 4QVZA 1QVFA 2K5FA 2WACA 2YLCA 3MHXA 3E19A 4MZTA 3EFRA 3JCMd 2R5MA 2JVVA 3CC2T 3UWNA 4M7DA 4TVRA 2DO3A 3GNGA 3S3OA 4A4GA 4JLGA 1I8FA 2JNGA 2K5IA 3QYHB 5FU6C 5GAN5 2Y90A 3OS2A 1YJ9T 4XTZA 4PJOB 2LT1A 4M75E 4PJOG 2KQWA 3JSCA 2L8DA 2MF2A 4M7AG 3X26B 1NPPA 3OYGA 2Y4XA 4BACA 5GANe 5KCHA 5LJ5g 4FT2A 3JCMf 3S6WA 2NLUA 5GAMg 2RK1A 1X6OA 3L2UA 3V7CA 3CPWS 2ZPHB 5GMKi 1VQ5T 2XD0A 1M90C 2LTOA 3LX7A 2RJFA 3HKSA 3QHSA 3OBYA 1BI3A 2ZPIB 1VIFA 1Y96B 2ZGWA 5CQXA 2CYZB 3QSUA 3M4YA 4X9DA 5DLOA 2DXTA 5IAYA 1VQ6T 1QW1A 2CZ6B 2DAQA 4PLLA 3OYIA 5LL6S 1YHQT 4M7DG 4M7DB 2RHZA 1S72T 4ZGEB 2WSCE 3LLRA 4C92A 4PJOF 4EMGA 3J81E 3CC2A 4PJOE 3V7SA 4M7AF 3P8BB 3JCMV 5DLQE 2JN0A 3M55A 1WJRA 5CQYA 5CK9A 3QJ6A 3G6ET 3ZFJA 1KG1A 4C8QA 3X24B 2EFIA 4ZGDB 5GAOp 1QVFS 5CIUA 3F70A 4HCCA 3VV0A 5GAN8 3KBGA 2XDBA 3UPUA 4E7KA 3CCQA 5D6WA 1IREB 5LJ3j 2M1HA 3VKIA 2ZPEB 2EJFA 1D3BA 3JCMW 2KMTA 4DQ2A 3M5AA 4M75C 2K3YA 4QQGA 3V8KA 4F7UA 1VQOA 1VQ5A 3QO3A 4M7DF 5KE2A 2P4TA 2RK2A 2OTJA 2PVOB 2EJ9A 4M7DE 4OB2B 3SB2A 1VQ8A 2HAXA 4L59A 2YHTA 1UGSB 3BDUA 4FL6A 3JCMb 5CKBA 4ZTJA 3FIFA 1G3WA 1LNXA 3RKYA 3SWNA 4C0GA 4C92G 1VQ6A 3M57A 4N4IA 3QYGB 1S72A 2ZZDA 1U1TA 2Y4YA 1K73C 4C5EA 4VUBA 2RI2A 2CZ7B 3CCMT 4IKFA 3WVDB 5GMKh 2E6NA 3MCAB 3M4GA 4BB7A 1M1GA 3CCVA 5GAOr 4C8QG 2RHXA 2O01E 3RKWA 4RCCA 1NJIU 3G71A 4RCBA 2E5QA 2V8KA 3WVEB 1OZ2A 4CI0C 5GANh 3CMAT 5FRMA 5J3BA 2KK4A 3JCMc 4BI4A 2DIGA 2C06A 2QQAA 5M9OA 1D3BB 3OYFA 1XNIA 3CBMA 4IUVA 1NJIC 4PJOC 1P92A 3OYYA 2E70A 2L3RA 4OB3B 5GAOm 4JLIA 3LWHA 1YIJT 3X28B 4F7UG 3FRNA 5CR2A 3OYKA 5LJ3e 4L5GA 2WSEE 3ER0A 4ZGJB 4C92F 2QQRA 3KUFA 3GNFB 4IUUA 5A0DA 3JB9I 2IG0A 3CD6A 4NL2A 4C0FA 5GMKj 2DZCA 1IZ6A 5LJ5j 1DJ7B 3G4ST 1Q81U 4PLIA 1VQ7A 1BYMA 2CZ0B 2HQEA 3MP6A 4XTUA 5GAMj 3BY7A 4CRIA 1I4K1 2R58A 2XU8A 3MEVA 1M5Q1 4C8QF 3INZA 4BY6B 2JTFA 1ZBXA 2KVQG 1O75A 1OI1A 3QZ9B 1G3TA 3CBPA 1KD1C 1YITA 3ZEHA 3DLLA 4RG2A 4XU1A 4DOVA 5GANd 5D6YA 1K8AU 1I5LA 3I55A 4M7DC 4QQ6A 4A4FA 3FEOA 3CC7A 1PSEA 1XOVA 2QXFA 3A5ZB 2RA2A 2ZPGB 2CS7A 1QVGS 2X4YA 4F7UF 2K3XA 3CMAA 2CZ1B 1K9MC 3P8HA 3Q1JA 2EJGA 4Z02A 2DK3A 4NOYA 3QBYA 4Q5WA 4ZTFA 2R5AA 3RUXA 3SDZA 1OZ3A 2VXFA 3UT1A 4C92D 2XICA 5CKHA 4N0AA 1BI2A 4MZMA 3OYLA 2E12A 3CCUA 1VQLT 4QVCA 3OYDA 4M77A 1Y7XA 5GANf 3WXMB 4A53A 5EG2A 1Q7YU 4XU3A 4E47A 2HNIA 1Y71A 3GF5A 3J7AF 3FJPA 1VIEA 4C8QD 3CC4T 3PMIA 3PIPA 2K2VA 1WQWA 1YJNT 4KULA 3G4SA 4BI8B 2HBPA 3LGFA 2VYTA 5GMKe 1Q7YC 1UEBA 3RERA 5LJ5e 4MMLA 1AHJB 2GQVA 3A8OB 4M78A 4BUGA 3EAEA 4M7AB 2XHCA 2L89A 5GAMe 2KSSA 4ELZC 3OQ5A 4QQDA 1M90U 2PQWA 1RL2A 4E7JA 4PNOA 5CAIA 3VUZA 1VQ9A 4OMFB 4PL6A 2A3LA 4A54A 4N4HA 3JCMQ 3EFSA 4BE0A 3OW2A 4E7LA 4C0ZA 3P8DA 2L5QA 4EMKA 5I2MA 3CMEA 3URGA 1VQMA 5CCAA 1QP2A 2MI6A 2FB7A 1KQSS 1R8OB 3E1SA 5CKFA 3CCET 5LJ3h 2LX9A 4HKEA 1KHCA 3NTIA 1U1SA 2RO0A 4A4KA 1M1FA 2GFUA 5CO7A 1H641 2X4WA 2R57A 4MMKA 4B9XA 2FL7A 2KAFA 2AHJB 3A8LB 1VQLA 1Y07A 1WNLA 2E41A 1VQKT 4MDWA 3CEYA 2HQXA 4FSXA 4C0DB 3A8GB 2YLBA 1VQ4T 4M7AE 2DPPB 2GF7A 3V8JA 2MAMA 4KBMB 1YJ9A 2EQUA 5GAN4 3CCLT 5HK3A 3GOXA 3C4SA 2LDMA 2X4JA 4L6V5 1O9SA 3RIRA 3A8MB 3PMTA 1JRIA 5C6SA 5GAN3 2CGHA 4BI3A 2V8IA 1JJ2S 5KCOA 2FVUA 1KQ1A 2RH2A 2VUBA 1B34A 3QZ5B 4BY6C 1WPYA 3HRSA 3OMGA 3JCMg 4O6JA 4BD3A 1UB4A 1BI0A 2YRVA 2QI2A 5LJ3d 4M77F 3M9QA 3FC3A 2OTLT 2LQKA 2DXUA 5A0GA 3HRUA 5L8RE 5GMKm 2DXBA 4MDXA 4R56A 1K73U 1QVGA 3UDCA 3OB9A 3CCEA 2DZ9A 1QVPA 2VV5A 5KH6A 2RD1A 4C92B 5GAOl 5FU7C 4M78F 1YHQA 3OY9A 3S3NA 4B9WA 3OW2S 4ATOA 3PT9A 4BE2A 4XTXA 3LW5E 2QA4T 2DEQA 2DIQA 1VQKA 5LJ5h 2RB6A 3SD4A 4LDUA 4C8QB 2B8AA 4OF1A 5LJ3f 5GAMh 1FXXA 2XDDA 3OYMA 1FWZA 4KT0E 3JRZA 2LCLA 2BKDN 3HP9A 4EPCA 3G6EA 3X20B 3CCLA 3N5BB 4LD6A 3S3MA 1QP3A 3H6ZA 1MGQA 3RESA 2QEXT 3GIBA 4WF2A 3T9NA 3QDRB 3OBWA 4J6XA 4M77D 1W2BS 4ZN3A 2LQ8A 1V29B 4N4GA 4GLKA 4M7AC 3V8LA 4F7UB 1UGQB 1X75C 2K57A 3RMSA 3JAME 3GPLA 3JB9D 1VQNT 1XTDA 2A7YA 3L42A 1YBYA 3G7ZA 1YJWT 3RKXA 4M75A 2D9TA 2OTLA 4C92E 1VQPT 1M9SA 4M78D 2WSFE 2ZPBB 3SWNB 4LDYA 5IN1A 1KD1U 4IUQA 1G3YA 1RI0A 2DVEA 1LJOA 2FYKA 2KY9A 3CBOA 1N27A 3PNWC 1KQSA 5LJ5d 4LDXA 3BFMA 4C8QE 3M59A 4XAXB 5CVIA 5GAMd 3J80E 4XTYA 3QXEB 3OYBA 2XI9A 2O4XA 2RHIA 4YTLA 2QQBA 3CCMA 2QA4A 1K9MU 3LGLA 3C95A 1GXIE 3QKJA 2RI5A 4NS5A 1WJQA 2EQMA 4OB0B 3VYHB 4BDZA 3LH0A 2JTMA 3V7RA 3OYJA 5DY9A 4FIBA 3MEWA 4C0DC 2EKOA 4F7UE 4OP0A 3ME9A 4FM4B 2JUFA 2OAUA 3HRTA 2D0QB 3JB9J 2M9UA 5LJ5f 3VYGA 4P5NA 4JRPA 1YIJA 3I56T 2QQ9A 3E9FA 2E10A 3DLMA 4M75G 2JOYA 1JJ2A 1UGRB 4XK8E 5J26A 3PIOA 1NPRA 2QDYB 3TCJA 1WGSA 2GCXA 3HFNA 1BI1A 1BIAA 2K4YA 5D6XA 5I2SA 3M58A 1KQ2A 2DTOA 2RHYA 4A4EA 2EAYA 3FB9A 2P0KA 2O4XB 3KXTA 4JS5A 4HCBA 4LDWA 1Y96A 4RKUE 1YI2T 3GLXA 4C92C 2M0OA 4OGCA 3JB9H 4MZPA 2PU9B 3MEAA 2DKGA 2DTIA 4QVDA 5GAN6 3A8HB 3CPFA 2X4XA 2XKOC 4ELYC 2H3JA 2K5LA 1UGPB 3FDRA 4J7FA 1VUBA 1HK9A 2PUKB 2RJEA 2GFAA 1ZHIA 4HT8A 3OYCA 4M75F 4J83A 4C8QC 1N9RA 1XQHA 4BE1A 2HD0A 2LC4A 4KUIA 4M77B 4JS4A 4M77G 3OYEA 1YCYA 2DD4A 3CCQT 2FHDA 3JB9G 4OVAA 1U8RA 3I56A 3HSBA 2EQJA 1NE8A 2RHUA 1W2BA 2G3RA 3NTKA 3QUIA 3DKMA 1PSFA 4C5GA 2DXCA 4BDYA 3OYHA 3SFMA 3JCMJ 5GMKl 5GANg 4O5VA 1VQOT 3CC4A 4XQ3A 4M78B 3CCST 4M78G 1M4ZA 5FLXE 2D6FA 2JZ2A 1YJNA 2OTJT 4DOWA 1VQ8T 2XK0A 2VGNA 3O8VA 3QPHA 4Y28E 5C0MA 3M56A 3OYNA 3SWNC 4LD9K 2P0PA 4HCZA 3CCJT 2E64A 2LT4A 1G5VA 3JCMe 2IVWA 3HFOA 3OS5A 2XG8D 2BIVA 2PVGB 1H3ZA 1NZ9A 1YI2A 4RMOA 4EMKB 2EYQA 5IT9E 4M75D 3JCMX 1X01A 2DD5A 3NTHA 2F5TX 3CCVT 2E6ZA 1G3SA 2MWPA 2VGMA 2X35A 5I21A 2VXEA 3JB9F 3L1AA 4M77E 2LRQA 4JUVA 1Q82U 2XDPA 3G71T 1JB0E 1FX7A 2XIDA 3ASKA 3OMCA 4HA8A 4J6WA 4XTVA 4OB1B 3VUBA 1BKBA 4XTWA 5GAN2 1BIBA 5HY6A 4GY5A 5HK0A 4JDSA 2ZPFB 1Q82C 2P0QA 3META 3L2WA 4DA4A 4M78E 2E65A 4J5YA 5GAOq 4HT9A 3OSSC 3CCRT 4RG8A 2MWOA 3CXCA 5FU6B 2CKKA 1KHIA 2V8JA 1MHNA 3DB4A 1VQ4A 2RI3A 3CCSA 4ME7A 5CKDA 3CD6T 3TU4K 5GAN7 3AHUA 4C5IA 2QQSA 5KE3A 1VQ7T 3E9GA 4E7IA 1OYXA 4ZN1A 4PJOD 2RJCA 2I2LA 3MP1A 4FU6A 5GAOn 1B34B 3CCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI5 A;  3FLG A;  4NS5 A;  1WJQ A;  2EQM A;  1WJR A;  3OQ5 A;  3LH0 A;  4QQD A;  4BDZ A;  2PQW A;  3OYJ A;  3BDL A;  3QJ6 A;  5FRN A;  4E7J A;  3MEW A;  2EKO A;  4II1 A;  2EFI A;  2F5K A;  2RJD A;  4N4H A;  4PL6 A;  4QW2 A;  3ME9 A;  4BE0 A;  4E7L A;  5CIU A;  3F70 A;  3P8D A;  3LYI A;  4X34 A;  4E7K A;  5D6W A;  3MEU A;  2M1H A;  3OYA A;  3E9F A;  3DLM A;  3OS1 A;  5J26 A;  4IUR A;  1WGS A;  2K3Y A;  4QQG A;  1KHC A;  3NTI A;  2RO0 A;  1WJS A;  4EDU A;  5KE2 A;  2GFU A;  2X4W A;  3QII A;  2R57 A;  4B9X A;  5D6X A;  4L59 A;  3L2R A;  4A4H A;  4FL6 A;  2RHY A;  4A4E A;  3L2V A;  3CEY A;  4ZTJ A;  2HQX A;  2P0K A;  2O4X B;  4N4I A;  2GF7 A;  3MP8 A;  2M0O A;  2EQU A;  3DB3 A;  5FRO A;  4C5E A;  3MEA A;  3GOX A;  2RI2 A;  4IKF A;  3C4S A;  2LDM A;  2X4X A;  2E6N A;  2EQK A;  3FDR A;  3PMT A;  5C6S A;  2RHX A;  5J39 A;  2RJE A;  2GFA A;  2LCC A;  5KCO A;  3OS0 A;  3OYC A;  2E5Q A;  1OZ2 A;  5FRM A;  4BE1 A;  3OA6 A;  3OMG A;  4BD3 A;  2LVM A;  2DIG A;  4C5H A;  2YRV A;  5M9O A;  3M9Q A;  3OYF A;  3OYE A;  1XNI A;  4IUV A;  3FC3 A;  2FHD A;  4OVA A;  2L3R A;  2EQJ A;  4UC4 A;  4IUT A;  3PFS A;  2RHU A;  3MO8 A;  4E7H A;  2G3R A;  3OYK A;  2M16 A;  3NTK A;  3H8Z A;  3OB9 A;  4C5G A;  4BDY A;  1SSF A;  5KH6 A;  3OYH A;  3L2Q A;  4IUP A;  2QQR A;  3KUF A;  4IUU A;  2BUD A;  2IG0 A;  4QVZ A;  2JZ2 A;  3OY9 A;  2WAC A;  3S3N A;  4B9W A;  4PLI A;  2R5M A;  4BE2 A;  2XK0 A;  2HQE A;  3MP6 A;  3UWN A;  3O8V A;  4CRI A;  2DIQ A;  2R58 A;  5C0M A;  3OYN A;  3MEV A;  4HCZ A;  3SD4 A;  1G5V A;  2B8A A;  3OYM A;  2JTF A;  3S3O A;  2BIV A;  4A4G A;  1H3Z A;  2BKD N;  1OI1 A;  3OS2 A;  4LD6 A;  3ZEH A;  3S3M A;  4RG2 A;  3H6Z A;  5D6Y A;  4QQ6 A;  4A4F A;  3NTH A;  3FEO A;  2L8D A;  2MWP A;  2X35 A;  3OYG A;  4BAC A;  4N4G A;  2LRQ A;  5KCH A;  2X4Y A;  2XDP A;  2K3X A;  3ASK A;  3OMC A;  2NLU A;  3S6W A;  3L42 A;  3P8H A;  3Q1J A;  4Z02 A;  3L2U A;  3QBY A;  4Q5W A;  4ZTF A;  2R5A A;  2D9T A;  1OZ3 A;  4GY5 A;  3UT1 A;  2LTO A;  3LX7 A;  2RJF A;  3MET A;  3OYL A;  3L2W A;  5IN1 A;  3OYD A;  4IUQ A;  1RI0 A;  2MWO A;  1N27 A;  2CKK A;  3PNW C;  5IAY A;  1MHN A;  3DB4 A;  2DAQ A;  2RI3 A;  3PMI A;  4PLL A;  2RHZ A;  3OYB A;  4C5I A;  3LGF A;  3LLR A;  3QKJ A;  2QQS A;  2O4X A;  2RHI A;  2VYT A;  3E9G A;  5KE3 A;  4E7I A;  1OYX A;  3LGL A;  2RJC A;  3OYI A;  3MP1 A;  4FU6 A;  3EAE A;  2L89 A; 
#chains in the Genus database with same CATH topology
 3PTA A;  2DLP A;  5FRN A;  5KYY A;  1UEC A;  1YIT T;  1VQ7 Q;  5DM7 R;  2CSI A;  2MOX A;  4PK4 A;  1N8R C;  3TEE A;  1YIT Q;  3LH5 A;  1WJS A;  2E3H A;  4D8D A;  1LOJ A;  3M53 A;  2W0Z A;  3CCU T;  2QG9 B;  3TRE A;  4JRK A;  4FW2 A;  3JCM h;  2V26 A;  4M4Z A;  1M1K C;  3BE3 A;  1WQ7 A;  3DB3 A;  4D6W A;  4J7I A;  2DTH A;  3VS1 A;  3CCU Q;  2OAW A;  1KC8 U;  4XU2 A;  1Q86 U;  5GAN j;  4PJO A;  5J39 A;  1I81 A;  4J9F A;  2PUO B;  1YP5 A;  4AT1 B;  3QJY A;  2DET A;  1GRI A;  1EIF A;  3H8Z A;  4DEY A;  2A08 A;  3QDF A;  1QVF A;  2YLC A;  3JCM d;  2JVV A;  4M7D A;  1YFN A;  2JW4 A;  4LN2 A;  3S3O A;  4A4G A;  4JLG A;  2K5I A;  5GAN 5;  3QYH B;  2Y90 A;  4XTZ A;  1OEB A;  4PJO G;  2L8D A;  3O5Z A;  3OYG A;  4BAC A;  5KCH A;  3S6W A;  2YWW A;  5GMK i;  2FPD A;  3HKS A;  2LP5 A;  5KYU A;  1Y96 B;  1JXM A;  2HL3 A;  3EFO B;  1K0S A;  1VQ6 T;  2CZ6 B;  5LL6 S;  4M7D G;  4ZGE B;  1TUG B;  4F17 A;  3LLR A;  4PJO F;  2MYS A;  5DLQ E;  2JN0 A;  1VQ6 Q;  1WJR A;  3ZFJ A;  4ZGD B;  5GAO p;  1QVF S;  4AG2 C;  4E7K A;  1IRE B;  4F16 A;  3TVT A;  1D3B A;  3JCM W;  4DQ2 A;  4M75 C;  3V8K A;  2DYB A;  4M7D F;  2EJ9 A;  4OB2 B;  1VQ8 A;  2HAX A;  1IXD A;  1X69 A;  3JCM b;  1LNX A;  3SWN A;  4C0G A;  1SEM A;  3M57 A;  1S72 A;  2Y4Y A;  1K1Z A;  4F04 B;  4VUB A;  2RI2 A;  3WVD B;  1BCO A;  3MCA B;  1M1G A;  1UJY A;  2MCN A;  2K6D A;  2RHX A;  9ATC B;  1OZ2 A;  2KK4 A;  2HMA A;  3JCM c;  2C06 A;  5M9O A;  3CQT A;  3EG9 B;  1HJD A;  5IHK A;  2L3R A;  3LWH A;  3X28 B;  5CR2 A;  5LJ3 e;  4L5G A;  2WSE E;  4ZGJ B;  2H8H A;  2NWM A;  5A0D A;  3CD6 A;  2J06 A;  1DJ7 B;  1BYM A;  4PLI A;  2HCK A;  2DFU A;  1X43 A;  1RI9 A;  4HCK A;  2KEA A;  2C0T A;  4RTW A;  1G3T A;  5KYX A;  3DLL A;  1IRX A;  1QCN A;  3TQ7 P;  2D1X A;  2CS7 A;  2JTE A;  2X4Y A;  2FEI A;  2K3X A;  1MV0 B;  1AWJ A;  3P8H A;  3Q1J A;  4Q5W A;  4ZTF A;  2XIC A;  3QWX X;  3H0F A;  2XMF A;  4M77 A;  1RAI B;  5GAN f;  4JZ4 A;  4XU3 A;  2YUQ A;  3EGD A;  4KUL A;  2HBP A;  3LGF A;  3R6N A;  2AZS A;  1UEB A;  2YRD A;  3RER A;  3A8O B;  4M78 A;  2XHC A;  2DRK A;  4HVW A;  4PNO A;  3VUZ A;  1VQ9 A;  4PL6 A;  4A54 A;  4N4H A;  3OW2 A;  4C0Z A;  3P8D A;  2EQI A;  4EMK A;  5I2M A;  3URG A;  1VQM A;  1KQS S;  2MI6 A;  2LX9 A;  1AWO A;  4MMK A;  5FWB A;  2KAF A;  3A8L B;  1SSH A;  1WNL A;  2COW A;  2E41 A;  4MDW A;  3CEY A;  2HQX A;  1RAF B;  2DPP B;  3M0U A;  2EQU A;  2DL8 A;  5GAN 4;  1JU5 C;  3CCL T;  3GOX A;  1T0J A;  2LDM A;  3A8M B;  1JRI A;  5GAN 3;  4PFP A;  1JJ2 S;  1D09 B;  5KCO A;  2FVU A;  6AT1 B;  5KYW B;  1WFW A;  2W10 A;  1LVK A;  3CCL Q;  1WPY A;  3HRS A;  4O6J A;  2QI2 A;  3EH2 A;  2OTL T;  4M77 F;  3M9Q A;  3FC3 A;  1KIK A;  2F2W A;  3VS3 A;  1EX4 A;  4MDX A;  1QVG A;  1ZUK A;  2RD1 A;  5GAO l;  2OTL Q;  4M78 F;  3OY9 A;  4B9W A;  3OW2 S;  2FZG B;  3LW5 E;  2ROT A;  5LJ5 h;  4C8Q B;  5GAM h;  2XDD A;  2GQI A;  2BKD N;  3H9N A;  3N5B B;  3S3M A;  3H6Z A;  1MGQ A;  4WF2 A;  1QVF P;  3QDR B;  4J9I A;  2CUB A;  4M77 D;  1W2B S;  4M7A C;  4F7U B;  1UGQ B;  1X75 C;  3JAM E;  1WHM A;  3MJX A;  3THK A;  3RKX A;  4M78 D;  2WSF E;  1Y0M A;  2KYB A;  1Q81 R;  1PCX A;  2KY9 A;  3PNW C;  3UA6 A;  5LJ5 d;  1ZLM A;  4LDX A;  4C8Q E;  1ABQ A;  5GAM d;  4XTY A;  2XI9 A;  4JJB A;  4KRT A;  1TXQ A;  4OB0 B;  2JTM A;  1BBZ A;  1ABO A;  1UE9 A;  3MEW A;  2LJ3 A;  5D7U A;  4F7U E;  2K79 A;  3UAT A;  2OAU A;  3HRT A;  2MK5 A;  3JB9 J;  2M9U A;  5L23 A;  3VYG A;  4P5N A;  1RLQ C;  2E10 A;  3DLM A;  4XK8 E;  1TUC A;  3PIO A;  3TCJ A;  1WGS A;  1I5O B;  1WI7 A;  2DVJ A;  1BI1 A;  2RQR A;  1BIA A;  2HQH A;  2K4Y A;  3E2U A;  5I2S A;  2DTO A;  1V76 A;  3KXT A;  1Y96 A;  4RKU E;  1YI2 T;  4C92 C;  3EFO A;  2D0N A;  2KT1 A;  3JB9 H;  4AFQ C;  1T3L A;  3CPF A;  4RTZ A;  4J7F A;  3NGP A;  2GFA A;  4HT8 A;  2K9G A;  1YI2 Q;  1N9R A;  2H3E B;  4BE1 A;  2HD0 A;  3AT1 B;  2D8H A;  2LJ0 A;  3OYE A;  1YCY A;  4ANJ A;  4OVA A;  1AWX A;  3NTK A;  3QUI A;  2DXC A;  3SFM A;  5GMK l;  3CCS T;  2AKL A;  5FLX E;  2JZ2 A;  3VS0 A;  1VQ8 T;  1X27 A;  2XK0 A;  4Y28 E;  2P0P A;  1WHG A;  3CCS Q;  1PD0 A;  2PVG B;  1H3Z A;  1NZ9 A;  2NUZ A;  1OUL A;  1VQ8 Q;  3VRY A;  1WHH A;  1PRM C;  2MWP A;  2XDP A;  1BK2 A;  1FX7 A;  1KQS P;  1BIB A;  4J5Y A;  2DJQ A;  3SEM A;  3PVL A;  4Y92 A;  1PRL C;  2JS2 A;  1IB8 A;  2MWO A;  2DM1 A;  3CD6 T;  5GAN 7;  4C5I A;  1NJI R;  2QQS A;  2O9V A;  8ATC B;  3E9G A;  2I2L A;  1W4S A;  3NFC A;  4M7A D;  4PKC C;  3CD6 Q;  3BDL A;  1JJ2 P;  4XU0 A;  3MPU B;  2P84 A;  2RJD A;  1Z9Z A;  4EMH A;  3VJP A;  1OPK A;  3A1P A;  4LE9 A;  2VC8 A;  4R55 A;  4Y91 A;  1KD1 R;  3EH1 A;  1MND A;  1JBM A;  1N9S A;  2DEU A;  2HEQ A;  3QII A;  4J6Y A;  3OW2 P;  4JJN K;  3L2R A;  1EFN A;  1B7T A;  4A4H A;  2EYW A;  3M54 A;  4X9C A;  1X2K A;  3CPW A;  5LJ3 g;  3MP8 A;  5FRO A;  1TH7 A;  2QEX A;  5CKE A;  1UGV A;  3QG1 A;  5IHI A;  5GAM f;  3OS0 A;  2DL4 A;  4M75 B;  4CC4 B;  1KC8 C;  3ZBD A;  1VQ9 T;  5A0L A;  2ABL A;  1Q86 C;  2LVM A;  4R0K A;  5HKC A;  2DJZ A;  1Q7Y R;  2F2X A;  3PGG A;  3C94 A;  1VQM T;  3JCM P;  1K8A C;  2LMJ A;  1FYN A;  2BE7 D;  4FT4 A;  1VQ9 Q;  4JRQ A;  3KFV A;  2I0N A;  2BUD A;  2L3S A;  2F69 A;  2K5F A;  2LZ6 B;  3E19 A;  3EFR A;  1VQM Q;  5IHN A;  3CC2 T;  3GNG A;  2V1Q A;  2EGC A;  1I8F A;  1QVG P;  4M75 E;  3CC2 Q;  3X26 B;  2KT8 A;  1AOJ A;  4FT2 A;  2NLU A;  2DE0 X;  1UTI A;  2RK1 A;  1Y57 A;  1X6O A;  3L2U A;  3CPW S;  1WDX A;  1T3S A;  2LJ1 A;  2LQN A;  2EYX A;  1VQ5 T;  1UHC A;  5KYW A;  2XD0 A;  2YXY A;  3QHS A;  2ZPI B;  2J7I A;  2CYZ B;  1RAG B;  2EKH A;  3TSZ A;  1VQ5 Q;  2DAQ A;  1WA7 A;  1ZSZ C;  2NUT B;  2WSC E;  5I22 A;  1W6X A;  2FRY A;  1AZE A;  4Z88 A;  2RQV A;  4WTO B;  2LQW A;  1KG1 A;  4C8Q A;  2EFI A;  1J3T A;  3CCQ A;  2M51 A;  3ULR B;  5LJ3 j;  3VKI A;  2EJF A;  1SRM A;  3NPF A;  4F7U A;  3EGX A;  1H3H A;  1WXB A;  2P4T A;  2RK2 A;  1UDL A;  4PJN A;  3SB2 A;  5CKB A;  3H41 A;  2KI7 A;  3QYG B;  2M0Y A;  2ZZD A;  1K73 C;  2CZ7 B;  4IKF A;  3CCV A;  4BB7 A;  2KRO A;  1GL5 A;  4C8Q G;  1SHG A;  3RKW A;  1I07 A;  1PWT A;  2C0I A;  3G71 A;  3WVE B;  5GAN h;  4BI4 A;  4FYW B;  2QQA A;  4PJO C;  4IUV A;  2JJ9 A;  5GAO m;  4JLI A;  4F7U G;  2NUP B;  3ER0 A;  2AK5 A;  2BZY A;  3GNF B;  3G4S T;  1IZ6 A;  1Z9Q A;  2HQE A;  1RAC B;  2XU8 A;  4C8Q F;  1X6G A;  2JTF A;  3EHQ A;  4RTX A;  3I9Q A;  3G4S Q;  3CBP A;  1OU9 A;  4DOV A;  4XU1 A;  1K8A U;  5GAN d;  5D6Y A;  4M7D C;  3I55 A;  1RUW A;  4DBH A;  2FZC B;  4F7U F;  3CMA A;  2CZ1 B;  1K9M C;  2G6F X;  4Z02 A;  3RUX A;  3UT1 A;  1OZ3 A;  2VXF A;  1BI2 A;  1M8M A;  3M0P A;  3WXM B;  1VOM A;  2HNI A;  3GF5 A;  1PG5 B;  4C8Q D;  2BZX A;  2VYT A;  5GMK e;  1OQK A;  4MML A;  1AHJ B;  2GQV A;  4M7A B;  2KSS A;  2PQW A;  1AD5 A;  4OMF B;  4E7L A;  3ZL7 C;  3CME A;  2L2P A;  2HSP A;  5CKF A;  2J6K A;  2YT6 A;  1U1S A;  1IHV A;  1M1F A;  2GFU A;  5CO7 A;  1TTH B;  2IIM A;  1QCO A;  4RTV A;  2FL7 A;  4J9G A;  1VQL A;  1PD1 A;  1Y07 A;  2M02 A;  3EG0 A;  1VQK T;  1NLP C;  7AT1 B;  2CP6 A;  4M7A E;  2YLB A;  1H92 A;  1E6H A;  1YJ9 A;  1MMD A;  1D0Y A;  1Q82 R;  1PHT A;  1VQK Q;  4L6V 5;  5C6S A;  1AT1 B;  1D1B A;  1UUE A;  1KQ1 A;  2RH2 A;  2V1R A;  2VUB A;  1NLO C;  4DBQ A;  5AT1 B;  3CPW P;  5GMK m;  2DXB A;  4R56 A;  1K73 U;  1HYO A;  3UDC A;  3CCE A;  1QVP A;  4C92 B;  1PNJ A;  1YHQ A;  1NYG A;  3JV3 A;  4ATO A;  3PT9 A;  4BE2 A;  2QA4 T;  2IPO B;  2RB6 A;  4LDU A;  1N8R R;  5LJ3 f;  1FWZ A;  1QWF A;  1B07 A;  3HP9 A;  3G6E A;  1VYT A;  2QEX T;  2QA4 Q;  3GIB A;  2HSE B;  3V8L A;  2K57 A;  2QEX Q;  3PE0 A;  1M1K R;  4RTU A;  4M75 A;  4C92 E;  1BB9 A;  4LDY A;  4KGV B;  2OI3 A;  1RI0 A;  2DVE A;  1KQS A;  1N27 A;  1I0C A;  2JS0 A;  4EIK A;  3J80 E;  3QXE B;  2O4X A;  4YTL A;  2QQB A;  1K9M U;  4F14 A;  1X6B A;  1K76 A;  4NS5 A;  2EQM A;  4RUG A;  1GCP A;  2E4H A;  2J6F A;  4C0D C;  2JM9 A;  2DBK A;  3ME9 A;  2D0Q B;  2HDA A;  4JRP A;  1YIJ A;  3I56 T;  4M75 G;  1JJ2 A;  1N5Z A;  1SG5 A;  1NPR A;  3A98 A;  3HFN A;  1GFC A;  3NMZ C;  3I56 Q;  1KQ2 A;  2RHY A;  1QMC A;  4A4E A;  4HCB A;  4LDW A;  3GLX A;  4RTY A;  3VS5 A;  1G8X A;  2ED0 A;  4QVD A;  3FDR A;  2VKN A;  1HK9 A;  2RJE A;  1ZHI A;  1TUD A;  3OYC A;  4M75 F;  4J83 A;  1D1A A;  4PFZ A;  1OX8 A;  4M77 G;  3CCQ T;  1U8R A;  2YRC A;  1SPK A;  1S1N A;  2X3W D;  1W2B A;  1PSF A;  4BDY A;  2CP2 A;  2DF6 A;  1CSK A;  2ZAE A;  3CC4 A;  4KGZ B;  4M78 G;  1M4Z A;  1R77 A;  4IIO A;  3UF4 A;  1PM3 A;  3CCQ Q;  4DOW A;  3MKD A;  4LD9 K;  3QPH A;  1AWW A;  3OYN A;  1U3O A;  2LT4 A;  4B6M A;  4E7Z A;  3HFO A;  3OS5 A;  3JCM e;  2O31 A;  2CP3 A;  1GCQ A;  4M75 D;  5I11 A;  3JCM X;  1X01 A;  3CCV T;  2VGM A;  5I21 A;  1PC0 A;  4JUV A;  3G71 T;  2XID A;  1SHF A;  1FMV A;  4J6W A;  1SRL A;  1BKB A;  3CCV Q;  3VS4 A;  1E6G A;  2E65 A;  3G71 Q;  4RG8 A;  1ZX6 A;  1RAD B;  3CXC A;  1UHF A;  3DB4 A;  1VQ4 A;  1TU0 B;  2RI3 A;  4ME7 A;  3UA7 A;  3TU4 K;  2CSQ A;  5KE3 A;  2RJC A;  1KFZ A;  4LXC A;  5GAO n;  1B34 B;  3CCJ A;  3FLG A;  3GP8 A;  1GBQ A;  1MMA A;  4OGE A;  2KDS A;  3I5S A;  2FRW A;  3I55 T;  3LYI A;  4X34 A;  1W70 A;  3OYA A;  2MMP A;  4LDV A;  3HHT B;  1ZSZ B;  2F2V A;  3I55 Q;  1K0X A;  4EDU A;  4N0A C;  3CCR A;  2DL7 A;  1M2V B;  3OSV A;  1T0H A;  2EYZ A;  4LUD A;  2RPN A;  3HPW A;  2LCC A;  3CXC S;  4M7A A;  3C12 A;  1HXD A;  1ZBJ A;  2PVD B;  3CME T;  3PFS A;  2B86 A;  3R6O A;  5A2Q E;  1RAA B;  3L2Q A;  4IUP A;  2ENM A;  3LWI A;  3TSW A;  4V2S A;  3CME Q;  4MZT A;  2R5M A;  1M2O A;  1D1C A;  1RAH B;  2DO3 A;  1HD3 A;  1WHJ A;  1YJ9 T;  1X2Q A;  4PJO B;  2LT1 A;  5KYN A;  3JSC A;  4M7A G;  4JJD A;  1YJ9 Q;  1ZA2 B;  3V7C A;  2ZPH B;  4J9E A;  5GJV B;  1YN8 A;  1TG0 A;  1M90 C;  2LTO A;  2RJF A;  2JMA A;  3OBY A;  1BI3 A;  1VIF A;  2JXB A;  2ZGW A;  5CQX A;  4X9D A;  5DLO A;  2QGF B;  5IAY A;  1SKU B;  4PLL A;  4M7D B;  2GNC A;  1YHQ T;  2EGA A;  1WXU A;  1S72 T;  4C92 A;  4EMG A;  3J81 E;  2VB6 A;  4PJO E;  3V7S A;  4M7A F;  3P8B B;  3JCM V;  1M3B A;  4QT7 A;  1YHQ Q;  5CK9 A;  1S72 Q;  3G6E T;  4LUE A;  5CIU A;  3F70 A;  3VV0 A;  5GAN 8;  3KBG A;  3UPU A;  1C6V X;  5D6W A;  2M1H A;  1NYF A;  2JM8 A;  2ZPE B;  3G6E Q;  3EG9 A;  2KMT A;  2QGG A;  5KYU B;  3M5A A;  1VQO A;  4DEX A;  2RNA A;  3QO3 A;  5KE2 A;  4ESR A;  2OTJ A;  2PVO B;  4M7D E;  2FG0 A;  4L59 A;  2YHT A;  3BDU A;  4FL6 A;  1ACM B;  4ZTJ A;  3RKY A;  4C92 G;  1VQ6 A;  4N4I A;  4HXJ A;  1YWO A;  1H8K A;  3EGU A;  2QAZ A;  5GMK h;  2RN8 A;  2E6N A;  5GAO r;  3M4G A;  1M30 A;  1WHK A;  2O01 E;  1NJI U;  4DBF A;  2E5Q A;  5FRM A;  2NYS A;  2RMO A;  1D3B B;  3CBM A;  2DL3 A;  1YIJ T;  1QCF A;  3FRN A;  4RTT A;  1PKS A;  2K2M A;  2OJ2 A;  4C92 F;  2QQR A;  3JB9 I;  4NL2 A;  5GMK j;  1YIJ Q;  2CZ0 B;  2DA9 A;  4XTU A;  1M3A A;  3BY7 A;  4CRI A;  1I4K 1;  2COZ A;  1M5Q 1;  5FW9 A;  1ZBX A;  2KVQ G;  1W2B P;  1O75 A;  4E2F B;  3QZ9 B;  4J9B A;  1MV3 A;  4IIM A;  4RG2 A;  1I5L A;  4FW1 A;  4QQ6 A;  2A0F B;  3FEO A;  3PVQ A;  3CC7 A;  1PSE A;  4FYX B;  1MNE A;  2RA2 A;  8AT1 B;  2EJG A;  2DK3 A;  3QBY A;  2R5A A;  3SDZ A;  4C92 D;  5CKH A;  2O9S A;  1XJW B;  4QVC A;  1MMN A;  5EG2 A;  1Q7Y U;  4E47 A;  1Y71 A;  3FJP A;  1VIE A;  3CC4 T;  3PMI A;  3PIP A;  1WQW A;  1OOT A;  4BI8 B;  5LJ5 e;  4BUG A;  3EAE A;  1QKW A;  5GAM e;  4D8K A;  5KYX B;  1GFD A;  3CC4 Q;  4QQD A;  1M90 U;  2GGR A;  1RAB B;  5CAI A;  3CXC P;  2A3L A;  3JCM Q;  3EFS A;  1AVZ C;  5IH2 A;  2L5Q A;  5GJW B;  5CCA A;  1QP2 A;  1R8O B;  3E1S A;  5LJ3 h;  2SRC A;  1AEY A;  2RO0 A;  4FYY B;  1H64 1;  2R57 A;  2CP5 A;  4AFS C;  4FSX A;  4C0D B;  3A8G B;  1VQ4 T;  2MAM A;  4KBM B;  2ROL A;  2KE9 A;  2CT3 A;  4BI3 A;  3REB B;  2V8I A;  1VQ4 Q;  2ECZ A;  1B34 A;  4BY6 C;  3OMG A;  3JCM g;  3H0H A;  1V1C A;  1BI0 A;  2YRV A;  5LJ3 d;  1JEG A;  2LQK A;  2DXU A;  5A0G A;  5L8R E;  2VVK A;  1TWB A;  3NHN A;  3OB9 A;  3I35 A;  5KH6 A;  1I1J A;  2CH4 W;  4PJJ A;  4XTX A;  2DEQ A;  3SD4 A;  2RQW A;  1IGQ A;  2B8A A;  2CUD A;  1NBE B;  4OF1 A;  2X51 A;  4PFO A;  4KT0 E;  2GTJ A;  2C0O A;  3X20 B;  3CCL A;  1M2V A;  1LCK A;  1VYV A;  3T9N A;  4J6X A;  2DX1 A;  4ZN3 A;  2LQ8 A;  4N4G A;  4GLK A;  1FMW A;  3JB9 D;  2HL5 C;  2A7Y A;  3L42 A;  2A37 A;  2DYI A;  2D9T A;  2OTL A;  1M9S A;  2F1L A;  5IN1 A;  4AMC A;  4PJL A;  4IUQ A;  1G3Y A;  1KK7 A;  4ORZ A;  3D7S B;  2FYK A;  3CBO A;  1KC8 R;  1Q86 R;  4XAX B;  3OYB A;  1HSQ A;  4LNP A;  2RHI A;  1K9A A;  2DER A;  3CCM A;  3LGL A;  3C95 A;  2ATC B;  1K8A R;  1WJQ A;  2X9H A;  3VYH B;  3OYJ A;  5DY9 A;  4FIB A;  2AKK A;  2EKO A;  4OP0 A;  2JUF A;  2GTO A;  2PNI A;  1A0N B;  1WLP B;  3E9F A;  2JOY A;  1UGR B;  5J26 A;  4ZNX A;  2RF0 A;  2GCX A;  4OMN A;  2QYZ A;  2AT1 B;  1WZO A;  5D6X A;  2X3X D;  2EAY A;  3FB9 A;  1WX6 A;  4JS5 A;  2KNB B;  4OGC A;  3VS2 A;  3MEA A;  2DKG A;  1RLP C;  3A8H B;  4ELY C;  2X4X A;  2XKO C;  2H3J A;  1VUB A;  2AZV A;  1UFF A;  5IXB A;  1IHW A;  1XQH A;  2LC4 A;  3GBQ A;  2RQU A;  2Z0W A;  3U23 A;  2DD4 A;  3HSB A;  2EQJ A;  1FMK A;  2SEM A;  1NE8 A;  2KRN A;  2HBW A;  3DKM A;  3JCM J;  1MMG A;  1VQO T;  4XQ3 A;  2PZ1 A;  1YJN A;  2OTJ T;  1WIE A;  3G1J A;  3M56 A;  3SWN C;  2E5K A;  1IGU A;  3EHR A;  2IVW A;  1OPL A;  1VQO Q;  2BZ8 A;  1YI2 A;  1M3C A;  2OTJ Q;  4RMO A;  5IT9 E;  2ED1 A;  2F5T X;  2CP0 A;  2X35 A;  2VXE A;  2LRQ A;  2CH4 A;  1Q82 U;  3OMC A;  4XTV A;  1JQQ A;  4OB1 B;  3VUB A;  1TOV A;  4XTW A;  1TSF A;  1K73 R;  4OMP A;  5HY6 A;  4JDS A;  2ZPF B;  2KXD A;  2P0Q A;  4FYV B;  5FWC A;  3L2W A;  4DA4 A;  2A36 A;  5GAO q;  1WYX A;  2EGE A;  2V8J A;  3M0R A;  1MHN A;  3CCS A;  3AHU A;  4E6R A;  1YNZ A;  1PKT A;  1B3Q A;  4PJO D;  1YBY A;  2DNU A;  4HT9 A;  2VAS A;  2O88 A;  4NL3 A;  4WCI A;  4II1 A;  2F5K A;  4QW2 A;  1N8R U;  3CC7 T;  1WHL A;  4E7S A;  3MEU A;  2EIF A;  5IXF A;  3OS1 A;  4IUR A;  5AYF A;  1M8V A;  1AZG B;  3CC7 Q;  1CKA A;  4M7D D;  3RMQ A;  4M77 C;  4J8O A;  1M1K U;  4JPB W;  3VU3 C;  3L2V A;  1K9M R;  4HVU A;  3L2Z A;  2J6O A;  1N6A A;  4ZN1 A;  4M78 C;  3X25 B;  2A28 A;  1D0X A;  2EQK A;  3I5R A;  5HCK A;  2LNV A;  1Q81 C;  1VQN A;  2KXC A;  1C0M A;  2RM4 A;  3HL8 A;  3OA6 A;  1ZQ1 A;  1YJW A;  4C5H A;  2ZCF B;  4EMK C;  2E1H A;  1VQP A;  3BW1 A;  1CKB A;  4UC4 A;  4IUT A;  2BE9 B;  3MO8 A;  4E7H A;  4K11 A;  2M16 A;  1NEB A;  2QTX A;  5FU7 B;  2EWN A;  1SSF A;  1KJW A;  1F1B B;  4J9C A;  4KUD K;  1YWP A;  4JRI A;  3VS7 A;  4QVZ A;  2WAC A;  3MHX A;  3UWN A;  4TVR A;  5EC7 A;  2NUT A;  3VRZ A;  2VWF A;  2JNG A;  5FU6 C;  3OS2 A;  1NG2 A;  2KQW A;  2MF2 A;  1NPP A;  2Y4X A;  5GAN e;  5LJ5 g;  3JCM f;  1GCQ C;  2YUO A;  5GAM g;  1YCS B;  3LX7 A;  1TS9 A;  3QSU A;  3M4Y A;  2DXT A;  1QW1 A;  2RHZ A;  4CC2 A;  3CC2 A;  1C1A A;  2J05 A;  4QKU A;  3M55 A;  5CQY A;  3QJ6 A;  2KRS A;  3X24 B;  1OX9 A;  4HCC A;  2XDB A;  4JJC A;  4GLM A;  1Q95 G;  1ZUU A;  3IQL A;  2K3Y A;  4QQG A;  1VQ5 A;  3EG2 A;  1R0B G;  2NUP A;  2LCS A;  2QTV A;  1UGS B;  3FIF A;  1G3W A;  4FCY A;  2OX7 A;  4KH1 B;  1D0Z A;  1U1T A;  4C5E A;  3SHW A;  3CCM T;  2MPX C;  1JO8 A;  1BCM A;  4OMQ A;  4RCC A;  4RCB A;  3CMA T;  2V8K A;  4CI0 C;  3RBB B;  5J3B A;  4J9D A;  2DIG A;  3CCM Q;  4HVV A;  2K3B A;  1NJI C;  3OYF A;  1XNI A;  2K7A A;  2LX7 A;  1JXO A;  1P92 A;  2E70 A;  3OYY A;  4OB3 B;  1M27 C;  1OU8 A;  3CMA Q;  1MUZ A;  3OYK A;  3EGX B;  2CDT A;  2DL5 A;  4X1V A;  3KUF A;  4IUU A;  5ECA A;  2IG0 A;  2P4R A;  4C0F A;  2DZC A;  5LJ5 j;  1Q81 U;  1QKX A;  1VQ7 A;  5KYY B;  3MP6 A;  5GAM j;  2R58 A;  3MEV A;  1RAE B;  2AIR B;  3INZ A;  2FZK B;  4BY6 B;  2EYY A;  1ZA1 B;  1OI1 A;  1KD1 C;  1YIT A;  3ZEH A;  2KRM A;  4DBR A;  4A4F A;  1KSW A;  1XOV A;  2JT4 A;  2QXF A;  3A5Z B;  3M0Q A;  2ZPG B;  1GBR A;  1QVG S;  2EW3 A;  2RQT A;  4AG1 C;  3RNJ A;  4NOY A;  2BTT A;  2DBM A;  4N0A A;  3OYL A;  2YSQ A;  4MZM A;  2E12 A;  3CCU A;  1VQL T;  3OYD A;  1Y7X A;  4A53 A;  3J7A F;  2K2V A;  1YJN T;  3RR6 A;  3G4S A;  1VQL Q;  1Q7Y C;  2O2O A;  2L89 A;  4ELZ C;  3OQ5 A;  1NEG A;  1RL2 A;  1YJN Q;  4E7J A;  2EVR A;  4BE0 A;  4OML A;  1W1F A;  1QQJ A;  2FB7 A;  3CCE T;  4Z89 A;  4HKE A;  1ZUY A;  1KHC A;  3NTI A;  4A4K A;  3EG1 A;  1OV3 A;  2X4W A;  4B9X A;  3M0T A;  2AHJ B;  2EPD A;  3CCE Q;  2HZY A;  2HKN A;  2GF7 A;  3V8J A;  5HK3 A;  4KGX B;  3C4S A;  2X4J A;  1O9S A;  3RIR A;  1UG1 A;  1IO6 A;  1ZSG A;  3PMT A;  2CGH A;  1E7O A;  2ESW A;  4GBQ A;  4PJM A;  3QZ5 B;  4BD3 A;  4FSS A;  1UB4 A;  1G2B A;  3HRU A;  2EBP A;  1VA7 A;  2DZ9 A;  2VV5 A;  3C0C A;  1VYU A;  5FU7 C;  3S3N A;  2L3Q A;  4KH0 B;  2DIQ A;  1VQK A;  3OYM A;  1FXX A;  3M0S A;  3JRZ A;  2LCL A;  3EG3 A;  4OMO A;  4EPC A;  4LD6 A;  1QP3 A;  3RES A;  1ARK A;  2L0A A;  3OBW A;  1V29 B;  1U06 A;  1VQN T;  3RMS A;  2KYM A;  3GPL A;  1XTD A;  3G7Z A;  1YJW T;  1QWE A;  1VQP T;  4AFU C;  2ZPB B;  1BU1 A;  3SWN B;  1VQN Q;  2KBT A;  1KD1 U;  2DMO A;  2YDL A;  1LJO A;  1K4U S;  1YJW Q;  4CC3 A;  3BFM A;  3M59 A;  1VQP Q;  4Z8A A;  5CVI A;  2E3I A;  2QA4 A;  1GXI E;  3QKJ A;  2RI5 A;  4JZ3 A;  4BDZ A;  3LH0 A;  3V7R A;  2KR3 A;  2CP7 A;  2L3P A;  4FM4 B;  2KGT A;  5LJ5 f;  2LNH B;  1LPL A;  1EZZ B;  2QQ9 A;  3H0I A;  2QDL A;  3VS6 A;  2QDY B;  2COY A;  3FJ5 A;  2FPE A;  3M58 A;  2P0K A;  3REA B;  2O4X B;  1U5S A;  2M0O A;  4MZP A;  2PU9 B;  1M90 R;  2DTI A;  2QK0 A;  2DRM A;  2HKQ B;  5GAN 6;  2K5L A;  1UGP B;  2PUK B;  1UJ0 A;  4C8Q C;  2QAS A;  3HTR A;  4KUI A;  1G83 A;  2YUP A;  4M77 B;  4JS4 A;  2FHD A;  3JB9 G;  3I56 A;  2RHU A;  2G3R A;  3RDV A;  1SF9 A;  3EGD B;  4C5G A;  3OYH A;  2PTK A;  5GAN g;  4O5V A;  2FPF A;  3QWY A;  4M78 B;  2D6F A;  1R0C B;  2VGN A;  3O8V A;  5C0M A;  4A63 B;  4HCZ A;  3CCJ T;  2E64 A;  1G5V A;  2XG8 D;  2GBQ A;  2BIV A;  2D8J A;  2MIO A;  2CT4 A;  2JMC A;  2DIL A;  2EYQ A;  4J9H A;  4EMK B;  2FO0 A;  4CC7 A;  2DD5 A;  3NTH A;  3CCJ Q;  2E6Z A;  1G3S A;  3JB9 F;  3L1A A;  4M77 E;  1JB0 E;  3ASK A;  4HA8 A;  1NM7 A;  4OMM A;  5GAN 2;  4GY5 A;  5HK0 A;  1Q82 C;  4AFZ C;  1ZSZ A;  3MET A;  4M78 E;  2YUN A;  1WXT A;  3OSS C;  3CCR T;  5FU6 B;  2CKK A;  1KHI A;  2CRE A;  1QLY A;  5CKD A;  1VQ7 T;  4E7I A;  1OYX A;  3CCR Q;  3OYI A;  3MP1 A;  4FU6 A; 
#chains in the Genus database with same CATH homology
 3FLG A;  3PTA A;  1W4S A;  3NFC A;  4M7A D;  4PKC C;  3GP8 A;  4NL3 A;  5FRN A;  3BDL A;  4XU0 A;  4II1 A;  2F5K A;  2RJD A;  4OGE A;  1YIT T;  2KDS A;  4QW2 A;  1N8R U;  3I55 T;  5DM7 R;  3LYI A;  3CC7 T;  4EMH A;  4X34 A;  3VJP A;  3MEU A;  3OYA A;  2EIF A;  2MMP A;  3OS1 A;  4LDV A;  1N8R C;  3HHT B;  2VC8 A;  3TEE A;  4R55 A;  4IUR A;  4Y91 A;  5AYF A;  1M8V A;  1JBM A;  1N9S A;  4EDU A;  1WJS A;  4N0A C;  4M7D D;  1LOJ A;  3QII A;  3M53 A;  4J6Y A;  4M77 C;  3RMQ A;  4J8O A;  3CCU T;  4JJN K;  1M1K U;  3TRE A;  4JRK A;  3L2R A;  1Q86 C;  4A4H A;  3CCR A;  3VU3 C;  3L2V A;  3M54 A;  4X9C A;  3JCM h;  3L2Z A;  3CPW A;  5LJ3 g;  3MP8 A;  1M1K C;  1N6A A;  1WQ7 A;  3DB3 A;  3OSV A;  4J7I A;  2DTH A;  5FRO A;  1TH7 A;  4M78 C;  4D6W A;  5CKE A;  2QEX A;  1KC8 U;  4XU2 A;  1Q86 U;  3X25 B;  3QG1 A;  3HPW A;  2EQK A;  5GAN j;  4PJO A;  5J39 A;  1I81 A;  2LNV A;  2LCC A;  5GAM f;  3OS0 A;  3CXC S;  1Q81 C;  4M75 B;  1VQN A;  1KC8 C;  4M7A A;  3C12 A;  3ZBD A;  1VQ9 T;  5A0L A;  2PUO B;  1HXD A;  2RM4 A;  3HL8 A;  1ZQ1 A;  3OA6 A;  2LVM A;  1YJW A;  3QJY A;  4C5H A;  2ZCF B;  5HKC A;  2PVD B;  2DJZ A;  4EMK C;  2E1H A;  1VQP A;  3CME T;  3BW1 A;  3PGG A;  3C94 A;  4UC4 A;  4IUT A;  3PFS A;  3JCM P;  1VQM T;  3MO8 A;  4E7H A;  4FT4 A;  1K8A C;  2M16 A;  2QTX A;  3R6O A;  1EIF A;  3H8Z A;  5FU7 B;  5A2Q E;  2EWN A;  1SSF A;  3L2Q A;  4IUP A;  4JRQ A;  4KUD K;  3LWI A;  4JRI A;  2BUD A;  4V2S A;  2F69 A;  4QVZ A;  1QVF A;  2K5F A;  2WAC A;  2YLC A;  3MHX A;  3E19 A;  4MZT A;  3EFR A;  3JCM d;  2R5M A;  2JVV A;  3CC2 T;  3UWN A;  4M7D A;  4TVR A;  2DO3 A;  3GNG A;  3S3O A;  4A4G A;  4JLG A;  1I8F A;  2JNG A;  2K5I A;  3QYH B;  5FU6 C;  5GAN 5;  2Y90 A;  3OS2 A;  1YJ9 T;  4XTZ A;  4PJO B;  2LT1 A;  4M75 E;  4PJO G;  2KQW A;  3JSC A;  2L8D A;  2MF2 A;  4M7A G;  3X26 B;  1NPP A;  3OYG A;  2Y4X A;  4BAC A;  5GAN e;  5KCH A;  5LJ5 g;  4FT2 A;  3JCM f;  3S6W A;  2NLU A;  5GAM g;  2RK1 A;  1X6O A;  3L2U A;  3V7C A;  3CPW S;  2ZPH B;  5GMK i;  1VQ5 T;  2XD0 A;  1M90 C;  2LTO A;  3LX7 A;  2RJF A;  3HKS A;  3QHS A;  3OBY A;  1BI3 A;  2ZPI B;  1VIF A;  1Y96 B;  2ZGW A;  5CQX A;  2CYZ B;  3QSU A;  3M4Y A;  4X9D A;  5DLO A;  2DXT A;  5IAY A;  1VQ6 T;  1QW1 A;  2CZ6 B;  2DAQ A;  4PLL A;  3OYI A;  5LL6 S;  1YHQ T;  4M7D G;  4M7D B;  2RHZ A;  1S72 T;  4ZGE B;  2WSC E;  3LLR A;  4C92 A;  4PJO F;  4EMG A;  3J81 E;  3CC2 A;  4PJO E;  3V7S A;  4M7A F;  3P8B B;  3JCM V;  5DLQ E;  2JN0 A;  3M55 A;  1WJR A;  5CQY A;  5CK9 A;  3QJ6 A;  3G6E T;  3ZFJ A;  1KG1 A;  4C8Q A;  3X24 B;  2EFI A;  4ZGD B;  5GAO p;  1QVF S;  5CIU A;  3F70 A;  4HCC A;  3VV0 A;  5GAN 8;  3KBG A;  2XDB A;  3UPU A;  4E7K A;  3CCQ A;  5D6W A;  1IRE B;  5LJ3 j;  2M1H A;  3VKI A;  2ZPE B;  2EJF A;  1D3B A;  3JCM W;  2KMT A;  4DQ2 A;  3M5A A;  4M75 C;  2K3Y A;  4QQG A;  3V8K A;  4F7U A;  1VQO A;  1VQ5 A;  3QO3 A;  4M7D F;  5KE2 A;  2P4T A;  2RK2 A;  2OTJ A;  2PVO B;  2EJ9 A;  4M7D E;  4OB2 B;  3SB2 A;  1VQ8 A;  2HAX A;  4L59 A;  2YHT A;  1UGS B;  3BDU A;  4FL6 A;  3JCM b;  5CKB A;  4ZTJ A;  3FIF A;  1G3W A;  1LNX A;  3RKY A;  3SWN A;  4C0G A;  4C92 G;  1VQ6 A;  3M57 A;  4N4I A;  3QYG B;  1S72 A;  2ZZD A;  1U1T A;  2Y4Y A;  1K73 C;  4C5E A;  4VUB A;  2RI2 A;  2CZ7 B;  3CCM T;  4IKF A;  3WVD B;  5GMK h;  2E6N A;  3MCA B;  3M4G A;  4BB7 A;  1M1G A;  3CCV A;  5GAO r;  4C8Q G;  2RHX A;  2O01 E;  3RKW A;  4RCC A;  1NJI U;  3G71 A;  4RCB A;  2E5Q A;  2V8K A;  3WVE B;  1OZ2 A;  4CI0 C;  5GAN h;  3CMA T;  5FRM A;  5J3B A;  2KK4 A;  3JCM c;  4BI4 A;  2DIG A;  2C06 A;  2QQA A;  5M9O A;  1D3B B;  3OYF A;  1XNI A;  3CBM A;  4IUV A;  1NJI C;  4PJO C;  1P92 A;  3OYY A;  2E70 A;  2L3R A;  4OB3 B;  5GAO m;  4JLI A;  3LWH A;  1YIJ T;  3X28 B;  4F7U G;  3FRN A;  5CR2 A;  3OYK A;  5LJ3 e;  4L5G A;  2WSE E;  3ER0 A;  4ZGJ B;  4C92 F;  2QQR A;  3KUF A;  3GNF B;  4IUU A;  5A0D A;  3JB9 I;  2IG0 A;  3CD6 A;  4NL2 A;  4C0F A;  5GMK j;  2DZC A;  1IZ6 A;  5LJ5 j;  1DJ7 B;  3G4S T;  1Q81 U;  4PLI A;  1VQ7 A;  1BYM A;  2CZ0 B;  2HQE A;  3MP6 A;  4XTU A;  5GAM j;  3BY7 A;  4CRI A;  1I4K 1;  2R58 A;  2XU8 A;  3MEV A;  1M5Q 1;  4C8Q F;  3INZ A;  4BY6 B;  2JTF A;  1ZBX A;  2KVQ G;  1O75 A;  1OI1 A;  3QZ9 B;  1G3T A;  3CBP A;  1KD1 C;  1YIT A;  3ZEH A;  3DLL A;  4RG2 A;  4XU1 A;  4DOV A;  5GAN d;  5D6Y A;  1K8A U;  1I5L A;  3I55 A;  4M7D C;  4QQ6 A;  4A4F A;  3FEO A;  3CC7 A;  1PSE A;  1XOV A;  2QXF A;  3A5Z B;  2RA2 A;  2ZPG B;  2CS7 A;  1QVG S;  2X4Y A;  4F7U F;  2K3X A;  3CMA A;  2CZ1 B;  1K9M C;  3P8H A;  3Q1J A;  2EJG A;  4Z02 A;  2DK3 A;  4NOY A;  3QBY A;  4Q5W A;  4ZTF A;  2R5A A;  3RUX A;  3SDZ A;  1OZ3 A;  2VXF A;  3UT1 A;  4C92 D;  2XIC A;  5CKH A;  4N0A A;  1BI2 A;  4MZM A;  3OYL A;  2E12 A;  3CCU A;  1VQL T;  4QVC A;  3OYD A;  4M77 A;  1Y7X A;  5GAN f;  3WXM B;  4A53 A;  5EG2 A;  1Q7Y U;  4XU3 A;  4E47 A;  2HNI A;  1Y71 A;  3GF5 A;  3J7A F;  3FJP A;  1VIE A;  4C8Q D;  3CC4 T;  3PMI A;  3PIP A;  2K2V A;  1WQW A;  1YJN T;  4KUL A;  3G4S A;  4BI8 B;  2HBP A;  3LGF A;  2VYT A;  5GMK e;  1Q7Y C;  1UEB A;  3RER A;  5LJ5 e;  4MML A;  1AHJ B;  2GQV A;  3A8O B;  4M78 A;  4BUG A;  3EAE A;  4M7A B;  2XHC A;  2L89 A;  5GAM e;  2KSS A;  4ELZ C;  3OQ5 A;  4QQD A;  1M90 U;  2PQW A;  1RL2 A;  4E7J A;  4PNO A;  5CAI A;  3VUZ A;  1VQ9 A;  4OMF B;  4PL6 A;  2A3L A;  4A54 A;  4N4H A;  3JCM Q;  3EFS A;  4BE0 A;  3OW2 A;  4E7L A;  4C0Z A;  3P8D A;  2L5Q A;  4EMK A;  5I2M A;  3CME A;  3URG A;  1VQM A;  5CCA A;  1QP2 A;  2MI6 A;  2FB7 A;  1KQS S;  1R8O B;  3E1S A;  5CKF A;  3CCE T;  5LJ3 h;  2LX9 A;  4HKE A;  1KHC A;  3NTI A;  1U1S A;  2RO0 A;  4A4K A;  1M1F A;  2GFU A;  5CO7 A;  1H64 1;  2X4W A;  2R57 A;  4MMK A;  4B9X A;  2FL7 A;  2KAF A;  2AHJ B;  3A8L B;  1VQL A;  1Y07 A;  1WNL A;  2E41 A;  1VQK T;  4MDW A;  3CEY A;  2HQX A;  4FSX A;  4C0D B;  3A8G B;  2YLB A;  1VQ4 T;  4M7A E;  2DPP B;  2GF7 A;  3V8J A;  2MAM A;  4KBM B;  1YJ9 A;  2EQU A;  5GAN 4;  3CCL T;  5HK3 A;  3GOX A;  3C4S A;  2LDM A;  2X4J A;  4L6V 5;  1O9S A;  3RIR A;  3A8M B;  3PMT A;  1JRI A;  5C6S A;  5GAN 3;  2CGH A;  4BI3 A;  2V8I A;  1JJ2 S;  5KCO A;  2FVU A;  1KQ1 A;  2RH2 A;  2VUB A;  1B34 A;  3QZ5 B;  4BY6 C;  1WPY A;  3HRS A;  3OMG A;  3JCM g;  4O6J A;  4BD3 A;  1UB4 A;  1BI0 A;  2YRV A;  2QI2 A;  5LJ3 d;  4M77 F;  3M9Q A;  3FC3 A;  2OTL T;  2LQK A;  2DXU A;  5A0G A;  3HRU A;  5L8R E;  5GMK m;  2DXB A;  4MDX A;  4R56 A;  1K73 U;  1QVG A;  3UDC A;  3OB9 A;  3CCE A;  2DZ9 A;  1QVP A;  2VV5 A;  5KH6 A;  2RD1 A;  4C92 B;  5GAO l;  5FU7 C;  4M78 F;  1YHQ A;  3OY9 A;  3S3N A;  4B9W A;  3OW2 S;  4ATO A;  3PT9 A;  4BE2 A;  4XTX A;  3LW5 E;  2QA4 T;  2DEQ A;  2DIQ A;  1VQK A;  5LJ5 h;  2RB6 A;  3SD4 A;  4LDU A;  4C8Q B;  2B8A A;  4OF1 A;  5LJ3 f;  5GAM h;  1FXX A;  2XDD A;  3OYM A;  1FWZ A;  4KT0 E;  3JRZ A;  2LCL A;  2BKD N;  3HP9 A;  4EPC A;  3G6E A;  3X20 B;  3CCL A;  3N5B B;  4LD6 A;  3S3M A;  1QP3 A;  3H6Z A;  1MGQ A;  3RES A;  2QEX T;  3GIB A;  4WF2 A;  3T9N A;  3QDR B;  3OBW A;  4J6X A;  4M77 D;  1W2B S;  4ZN3 A;  2LQ8 A;  1V29 B;  4N4G A;  4GLK A;  4M7A C;  3V8L A;  4F7U B;  1UGQ B;  1X75 C;  2K57 A;  3RMS A;  3JAM E;  3GPL A;  3JB9 D;  1VQN T;  1XTD A;  2A7Y A;  3L42 A;  1YBY A;  3G7Z A;  1YJW T;  3RKX A;  4M75 A;  2D9T A;  2OTL A;  4C92 E;  1VQP T;  1M9S A;  4M78 D;  2WSF E;  2ZPB B;  3SWN B;  4LDY A;  5IN1 A;  1KD1 U;  4IUQ A;  1G3Y A;  1RI0 A;  2DVE A;  1LJO A;  2FYK A;  2KY9 A;  3CBO A;  1N27 A;  3PNW C;  1KQS A;  5LJ5 d;  4LDX A;  3BFM A;  4C8Q E;  3M59 A;  4XAX B;  5CVI A;  5GAM d;  3J80 E;  4XTY A;  3QXE B;  3OYB A;  2XI9 A;  2O4X A;  2RHI A;  4YTL A;  2QQB A;  3CCM A;  2QA4 A;  1K9M U;  3LGL A;  3C95 A;  1GXI E;  3QKJ A;  2RI5 A;  4NS5 A;  1WJQ A;  2EQM A;  4OB0 B;  3VYH B;  4BDZ A;  3LH0 A;  2JTM A;  3V7R A;  3OYJ A;  5DY9 A;  4FIB A;  3MEW A;  4C0D C;  2EKO A;  4F7U E;  4OP0 A;  3ME9 A;  4FM4 B;  2JUF A;  2OAU A;  3HRT A;  2D0Q B;  3JB9 J;  2M9U A;  5LJ5 f;  3VYG A;  4P5N A;  4JRP A;  1YIJ A;  3I56 T;  2QQ9 A;  3E9F A;  2E10 A;  3DLM A;  4M75 G;  2JOY A;  1JJ2 A;  1UGR B;  4XK8 E;  5J26 A;  3PIO A;  1NPR A;  2QDY B;  3TCJ A;  1WGS A;  2GCX A;  3HFN A;  1BI1 A;  1BIA A;  2K4Y A;  5D6X A;  5I2S A;  3M58 A;  1KQ2 A;  2DTO A;  2RHY A;  4A4E A;  2EAY A;  3FB9 A;  2P0K A;  2O4X B;  3KXT A;  4JS5 A;  4HCB A;  4LDW A;  1Y96 A;  4RKU E;  1YI2 T;  3GLX A;  4C92 C;  2M0O A;  4OGC A;  3JB9 H;  4MZP A;  2PU9 B;  3MEA A;  2DKG A;  2DTI A;  4QVD A;  5GAN 6;  3A8H B;  3CPF A;  2X4X A;  2XKO C;  4ELY C;  2H3J A;  2K5L A;  1UGP B;  3FDR A;  4J7F A;  1VUB A;  1HK9 A;  2PUK B;  2RJE A;  2GFA A;  1ZHI A;  4HT8 A;  3OYC A;  4M75 F;  4J83 A;  4C8Q C;  1N9R A;  1XQH A;  4BE1 A;  2HD0 A;  2LC4 A;  4KUI A;  4M77 B;  4JS4 A;  4M77 G;  3OYE A;  1YCY A;  2DD4 A;  3CCQ T;  2FHD A;  3JB9 G;  4OVA A;  1U8R A;  3I56 A;  3HSB A;  2EQJ A;  1NE8 A;  2RHU A;  1W2B A;  2G3R A;  3NTK A;  3QUI A;  3DKM A;  1PSF A;  4C5G A;  2DXC A;  4BDY A;  3OYH A;  3SFM A;  3JCM J;  5GMK l;  5GAN g;  4O5V A;  1VQO T;  3CC4 A;  4XQ3 A;  4M78 B;  3CCS T;  4M78 G;  1M4Z A;  5FLX E;  2D6F A;  2JZ2 A;  1YJN A;  2OTJ T;  4DOW A;  1VQ8 T;  2XK0 A;  2VGN A;  3O8V A;  3QPH A;  4Y28 E;  5C0M A;  3M56 A;  3OYN A;  3SWN C;  4LD9 K;  2P0P A;  4HCZ A;  3CCJ T;  2E64 A;  2LT4 A;  1G5V A;  3JCM e;  2IVW A;  3HFO A;  3OS5 A;  2XG8 D;  2BIV A;  2PVG B;  1H3Z A;  1NZ9 A;  1YI2 A;  4RMO A;  4EMK B;  2EYQ A;  5IT9 E;  4M75 D;  3JCM X;  1X01 A;  2DD5 A;  3NTH A;  2F5T X;  3CCV T;  2E6Z A;  1G3S A;  2MWP A;  2VGM A;  2X35 A;  5I21 A;  2VXE A;  3JB9 F;  3L1A A;  4M77 E;  2LRQ A;  4JUV A;  1Q82 U;  2XDP A;  3G71 T;  1JB0 E;  1FX7 A;  2XID A;  3ASK A;  3OMC A;  4HA8 A;  4J6W A;  4XTV A;  4OB1 B;  3VUB A;  1BKB A;  4XTW A;  5GAN 2;  1BIB A;  5HY6 A;  4GY5 A;  5HK0 A;  4JDS A;  2ZPF B;  1Q82 C;  2P0Q A;  3MET A;  3L2W A;  4DA4 A;  4M78 E;  2E65 A;  4J5Y A;  5GAO q;  4HT9 A;  3OSS C;  3CCR T;  4RG8 A;  2MWO A;  3CXC A;  5FU6 B;  2CKK A;  1KHI A;  2V8J A;  1MHN A;  3DB4 A;  1VQ4 A;  2RI3 A;  3CCS A;  4ME7 A;  5CKD A;  3CD6 T;  3TU4 K;  5GAN 7;  3AHU A;  4C5I A;  2QQS A;  5KE3 A;  1VQ7 T;  3E9G A;  4E7I A;  1OYX A;  4ZN1 A;  4PJO D;  2RJC A;  2I2L A;  3MP1 A;  4FU6 A;  5GAO n;  1B34 B;  3CCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...