3S6WA

Crystal structure of tudor domain of human tdrd3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
52
Chain Sequence
MWKPGDECFALYWEDNKFYRAEVEALSGMTAVVKFIDYGNYEEVLLSNIKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Tudor domain-containing protein 3
publication title Crystal structure of TDRD3 and methyl-arginine binding characterization of TDRD3, SMN and SPF30
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 52
sequence length 54
ec nomenclature
pdb deposition date 2011-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s6wA00
2RI2A 4IUUA 3OYIA 2CKKA 2RO0A 1OYXA 3MP1A 2M0OA 3FLGA 2RHIA 2XDPA 3NTHA 4QQGA 4QVZA 5KCOA 2D9TA 2WACA 5KE3A 3OYAA 2RHZA 4IKFA 3H8ZA 4E7JA 2GF7A 4A4GA 4C5EA 4C5HA 3LLRA 2LTOA 2F5KA 2MWPA 5C0MA 3OYDA 3PMTA 3OYFA 4BE0A 2K3YA 5J26A 3MP6A 3OYLA 3PNWC 5IAYA 2X35A 2R57A 1G5VA 4FU6A 4RG2A 3META 4IUVA 3S6WA 3QBYA 3LX7A 3OS2A 4IUPA 4PL6A 2LDMA 2RHUA 2O4XB 1WJQA 3MO8A 4II1A 5D6WA 5KE2A 3OS1A 3FEOA 3OYNA 3P8DA 2HQXA 2RI3A 3OYHA 3PMIA 4BE1A 4BE2A 2GFUA 3L2WA 2GFAA 3NTIA 1OI1A 4GY5A 2EQJA 4LD6A 3OYJA 4N4GA 3UWNA 2P0KA 3ME9A 2EKOA 3OYGA 4Z02A 1N27A 4B9WA 2DIQA 3LGFA 4QW2A 3L2QA 2QQRA 3MP8A 3SD4A 2DIGA 2RI5A 5FRMA 2BUDA 1OZ3A 4A4FA 2XK0A 2K3XA 2R58A 2X4WA 2L89A 3FDRA 2YRVA 4PLLA 4E7IA 5FRNA 2E6NA 5IN1A 2JTFA 4C5IA 2X4YA 2M1HA 3OS0A 3L2VA 2EFIA 4N4IA 3E9FA 4E7KA 4BDYA 4B9XA 3GOXA 2BKDN 3OQ5A 4X34A 1KHCA 3KUFA 3LGLA 4PLIA 5C6SA 4BD3A 2RJCA 3OYMA 3QJ6A 2DAQA 2HQEA 3CEYA 4L59A 2LRQA 3ASKA 1XNIA 3DLMA 3EAEA 4CRIA 3M9QA 3O8VA 3OYCA 3OYKA 3S3NA 2IG0A 2EQUA 4A4HA 2NLUA 2LCCA 3PFSA 4QQDA 5D6YA 3FC3A 3BDLA 3S3OA 4HCZA 3MEAA 5CIUA 1H3ZA 5FROA 2LVMA 3MEWA 4C5GA 3OYEA 2RHXA 3P8HA 5J39A 3S3MA 3DB3A 3L42A 1OZ2A 3L2UA 4N4HA 4FL6A 1WGSA 5M9OA 3DB4A 3ZEHA 4NS5A 2X4XA 3UT1A 3H6ZA 2JZ2A 2FHDA 3OYBA 3MEVA 4ZTJA 4IUTA 4EDUA 3QIIA 2E5QA 4QQ6A 2RHYA 2PQWA 3F70A 3NTKA 4OVAA 3L2RA 3E9GA 2VYTA 4ZTFA 3OMGA 3Q1JA 2EQMA 2L8DA 1WJSA 3LYIA 3OY9A 4IUQA 4BDZA 2M16A 2RJFA 3LH0A 5KCHA 1MHNA 5D6XA 2QQSA 2RJDA 2R5MA 3C4SA 1SSFA 4E7LA 3OMCA 3OB9A 4UC4A 2O4XA 4Q5WA 2R5AA 2G3RA 3QKJA 1WJRA 2EQKA 3MEUA 3OA6A 4IURA 1RI0A 4E7HA 2MWOA 2B8AA 2BIVA 4BACA 2L3RA 2RJEA 5KH6A 4A4EA
chains in the Genus database with same CATH superfamily
2RO0A 3MP1A 2D8JA 4J6YA 3FLGA 3PGGA 1Q81R 2QI2A 5GAN8 3CBMA 2CH4W 2RHZA 1HYOA 4E7JA 4LDYA 1VQOT 4F14A 2AK5A 1QCFA 5J26A 2P4TA 1M1KR 2RNAA 1WXUA 2JTMA 5LJ5h 3H9NA 1WLPB 1IO6A 3P8DA 5KYWB 4PJLA 1VQOA 3VS0A 3H0HA 2P4RA 3UWNA 3ME9A 3OW2S 3JSCA 2K5FA 5GAMe 4F04B 1M2VB 3M4YA 3OBYA 1Y96B 2DRKA 4MDWA 1LPLA 3PVLA 2JXBA 1Y07A 2QDLA 3UDCA 2KXDA 3I5RA 2VWFA 3M0QA 3CD6A 4NOYA 3PVQA 2RJCA 5LJ5d 4HVVA 2LQKA 2CREA 3X24B 4X1VA 2MOXA 2A28A 1VQ5Q 3JCMe 1M30A 5CQYA 3CCST 1Y7XA 1U5SA 2JT4A 3M0UA 1YFNA 3A8HB 4Y92A 5HCKA 1VQPT 3HL8A 3SWNC 1UUEA 1VQ6Q 2DEUA 1Y96A 3CCSA 2P84A 3RKWA 4XTYA 1TS9A 2OI3A 3OY9A 3JB9H 1UJ0A 1WHJA 2HAXA 2G6FX 1FXXA 4PJJA 2R5MA 1B34B 1SSFA 4M75B 3CMEA 4DBHA 1Z9QA 4FM4B 4ELZC 2KI7A 4A4EA 2X4JA 2V8KA 1T3LA 3JB9I 2QG9B 2RHIA 1UE9A 3REBB 4BY6C 1YIJT 2J6OA 1RAIB 2RA2A 2A7YA 1M27C 4JJNK 4QVCA 1YJ9A 1E7OA 3JRZA 3VS5A 2JVVA 3MKDA 1C6VX 4HCKA 3WVEB 4PL6A 2PNIA 3BDUA 3QYHB 1TUGB 1N9RA 2L0AA 1ZLMA 1B34A 2GFAA 4M78C 1OQKA 4FYYB 4M75A 1Q86C 1G3YA 1QCNA 2M0YA 5I21A 3ULRB 1SHFA 1PM3A 1YJWA 2CYZB 7AT1B 3CCJQ 5CKHA 3MP8A 4OF1A 2A0FB 4A4FA 2YRVA 3CCQQ 1VIEA 2FPDA 5GMKj 4GBQA 1X69A 1G3TA 2DM1A 2D8HA 3D7SB 1UHCA 1NEGA 2KR3A 3EGDB 4PLIA 3GF5A 3RESA 1FX7A 4C92D 1M8MA 2KRSA 3TSZA 4F7UE 2CP2A 4XU2A 1OOTA 5CIUA 5DY9A 2F1LA 3OYEA 3CPWA 2JN0A 4KGVB 2L3SA 3P8HA 3L42A 2QA4Q 4FL6A 1VQ8Q 3JCMW 4KH0B 4RTZA 3R6NA 2DL3A 3H6ZA 2F2XA 4M77F 5GAMg 4C92G 3AT1B 2HD0A 2E3IA 2VYTA 4ZTFA 2EWNA 3CCVT 4J9IA 3PTAA 1K8AC 4J6WA 1TWBA 2RJDA 1YJNA 1KQSA 5FW9A 4PNOA 3I55T 2ROTA 3OB9A 1WA7A 1ZUUA 3EGDA 4ZGEB 5IHKA 4M7DF 3VS7A 3N5BB 2NUZA 1Q81U 2VXEA 4QT7A 3GNFB 3CC7T 1YHQQ 3CCVA 3JV3A 3JCMg 1VQKQ 4IIMA 1UGQB 4AMCA 3CCLQ 2PTKA 3JCMJ 3I55A 1M1KU 4ZN3A 5DLOA 1W2BA 3H0IA 3IQLA 3M59A 3OYLA 5IAYA 2YUOA 4KUDK 2R57A 1KIKA 3VJPA 1QKWA 2QASA 2CP3A 1SKUB 3OS2A 5I22A 3JCMQ 4M7AB 1QKXA 3X20B 4II1A 3OYNA 2QEXT 2GFUA 3U23A 1WIEA 4OB1B 5GJVB 1TUDA 2EKOA 4CI0C 1MMDA 5IH2A 1AHJB 1VQLA 4BI3A 5KYYB 2L2PA 3NFCA 4WF2A 2KT1A 5AYFA 1WHGA 1OZ3A 4WTOB 4J5YA 5GANj 1K9MU 1U06A 3RMSA 2YUPA 2QEXA 5DM7R 2C0IA 3GOXA 2BKDN 2KE9A 2YSQA 4C0DC 3LGLA 2KNBB 2M9UA 4KH1B 1UGVA 2YRDA 3M9QA 2NLUA 3NPFA 3M4GA 2K57A 4M7AA 1AD5A 3S3MA 1QVGP 2KROA 1D0ZA 3TQ7P 3EGUA 2HQHA 1GL5A 4ZTJA 4QQ6A 3F70A 2K5IA 1YP5A 3URGA 4XTXA 1YI2T 2EQIA 2LX9A 4L6V5 3RR6A 2A08A 4HA8A 1M2OA 2EQKA 4MZTA 1JU5C 1W6XA 1JJ2A 2L3RA 2C06A 2H3JA 3NGPA 4J83A 1YI2A 5LJ3j 2VXFA 3V7CA 1WYXA 2RK1A 4JZ3A 1BI3A 1LVKA 2LJ1A 3PNWC 4M77C 1K73R 2DL4A 1IB8A 1WI7A 4J7IA 3G1JA 4XK8E 1NEBA 1WJQA 1N5ZA 2AKKA 2FO0A 2P0QA 3PMIA 2O9SA 1VQ7T 1W1FA 3CCUA 5GMKe 4M75F 2GBQA 4M7DC 4GY5A 4J6XA 4LXCA 1JQQA 1UTIA 3UATA 4ZGDB 1I8FA 4HCBA 1W70A 4QVDA 3G71Q 3H41A 3CBOA 1BU1A 2XK0A 4PLLA 2BE9B 5FU6C 3CCMT 2WSFE 1VQ7A 2EFIA 4E7KA 2EYQA 1I4K1 4M78E 5GAN4 2BZXA 2CUBA 4LDWA 2CSIA 3RUXA 5CKFA 2LQ8A 3ASKA 2YT6A 5I2SA 1I5OB 3CCMA 3QWXX 1VQKT 1IXDA 4C8QG 3L2UA 4JUVA 3EFSA 3QZ5B 5FWCA 4RCBA 1MV0B 3VUZA 2AT1B 2KRNA 1G3WA 4Y91A 4FW2A 3MCAB 2MI6A 2JM8A 3QIIA 2QAZA 2HZYA 3E19A 3JCMb 3PT9A 4TVRA 3GIBA 4OMOA 2QQSA 1OU8A 4JJDA 1IHWA 1FYNA 2DZ9A 2FRYA 2G3RA 3QKJA 1HSQA 2E5KA 3TEEA 1RAAB 4RCCA 1ZHIA 2K4YA 2AHJB 3KXTA 2ZPEB 1RACB 2ZPFB 2OTLT 1MMAA 1EZZB 1JBMA 1OPKA 2YXYA 3X28B 1T0HA 1AT1B 1R0CB 3VS2A 2E1HA 5D7UA 4BB7A 4D8DA 3CCET 2Z0WA 4PFOA 4LE9A 3CCRT 1WQWA 3LWIA 2OTLA 3FIFA 2RQRA 3ZFJA 2CT3A 3OYJA 4N4GA 1YCYA 3CCEA 1PRLC 1BB9A 1Q7YC 4DBFA 3OYYA 3CCRA 4EIKA 2FB7A 2DJQA 2DL7A 4FW1A 4LUEA 1WPYA 4AG1C 1JO8A 4M78D 5GAN6 1I5LA 1MUZA 4B9XA 1H641 2V1QA 2F5TX 4JLGA 4ANJA 3OYMA 3I9QA 1RAGB 3HRTA 1GFCA 1PD1A 3CMEQ 3BDLA 4HCZA 1OV3A 4M7AF 5GMKm 2OTJQ 4M75C 3OW2P 2LCLA 2DNUA 5GAMd 5IXBA 4RTTA 3HHTB 3CMAT 3INZA 4IUTA 2GTOA 2KEAA 1K76A 3JB9F 3GPLA 2HKNA 4IUQA 4BDZA 2M16A 4C0GA 1YJ9Q 2LMJA 2QQ9A 3HSBA 2CS7A 3OBWA 1UJYA 2QQAA 2X9HA 3BE3A 5LJ3e 1VQ4T 1MMGA 1W2BP 1OPLA 4F17A 1AEYA 1A0NB 2XKOC 4KT0E 1M8VA 3JCMd 5KYUA 1VQNT 2CGHA 2NYSA 1SG5A 3T9NA 1AWWA 3NMZC 1YITT 1N8RU 3H8ZA 1BBZA 3LLRA 1OX9A 4ATOA 1FMWA 1KJWA 1QVGA 1I1JA 2O31A 3I35A 2HNIA 1QWEA 3G7ZA 2EYXA 1VQNA 3L2ZA 4K11A 1YITA 1SRMA 4J9BA 4MMLA 4XU0A 1VQ9T 3MO8A 4B6MA 4C0ZA 1HK9A 2RM4A 8AT1B 4LD6A 2BTTA 4M77E 4C92B 1QVFA 2DETA 4HKEA 2FVUA 5KYXB 3GBQA 2D6FA 1VQ9A 2E6NA 1NJIC 5GAOp 2HSPA 3L2VA 1FMKA 1S1NA 4M7DE 4J9HA 1RLQC 3I56Q 1X6OA 5GAN7 2EJFA 1F1BB 4EMKB 1YJNQ 1NLOC 2KY9A 2LRQA 1XNIA 3REAB 2K7AA 4ELYC 4QQDA 2DFUA 1ZQ1A 4C5GA 2YHTA 5J39A 2FZCB 2Y4XA 5GANg 1G3SA 3OSVA 1K9MR 4J9CA 2X4XA 1I07A 2JZ2A 1JJ2P 3RMQA 4KUIA 4C92A 2O88A 2K3BA 5KYXA 3ER0A 1KQSS 3OMGA 2EYZA 2V26A 3CC4T 4JDSA 4PJNA 5L8RE 3HTRA 4FT4A 4HXJA 1VQMQ 3VRYA 5KYWA 3EH2A 3LWHA 3QXEB 1Z9ZA 2Y90A 2XU8A 4EMKA 1FMVA 2EYYA 2J06A 4DEYA 1KC8C 2RI2A 4M7AC 3OYIA 3KBGA 1M2VA 4LDVA 5KCOA 2D9TA 3CC4A 1VQLQ 1UFFA 1IZ6A 2M02A 3OYFA 2K3YA 1S72T 2YUNA 3QPHA 1OU9A 2DBKA 2PUOB 1ACMB 1VQPA 4PJOD 4OMLA 1VIFA 1WDXA 2PVDB 4DBRA 2HKQB 4J8OA 1KSWA 2FL7A 4RMOA 4DQ2A 4M77D 1S72A 5LJ3g 4B9WA 2JS2A 4E6RA 5IHNA 1M1GA 1UDLA 1GXIE 1Q82C 4PJOG 1M3AA 4O6JA 4KRTA 2HEQA 4E7IA 2L89A 5GJWB 1NG2A 2LQWA 2DL8A 2MMPA 2J7IA 3VUBA 4BI4A 4M7DD 2LJ3A 1YIJA 1IHVA 5CKEA 2RQVA 1WXTA 3A8OB 4C0FA 4MZMA 2IIMA 4OGCA 4D6WA 4JRIA 2JNGA 4JS5A 1Q95G 4J7FA 4HVWA 2I0NA 1Q86U 3QUIA 2MIOA 2COYA 3M56A 2KMTA 1CSKA 3MEVA 2AKLA 2VGMA 3R6OA 3CC2T 2E41A 3JCMP 2KVQG 2VUBA 4ZN1A 5HY6A 3VS4A 1UECA 4RTVA 4M75E 4FCYA 2RPNA 3A8GB 2RH2A 1KD1C 3A5ZB 2A3LA 1WFWA 3CCUQ 1VOMA 3M5AA 4J9DA 3OYAA 1NPRA 1GBRA 4DBQA 2MPXC 3V7RA 3PMTA 4AFSC 3I56T 3OW2A 2QGFB 3TVTA 1YNZA 1J3TA 4RTWA 1R8OB 6AT1B 4AT1B 3E1SA 2XI9A 1K8AU 3VU3C 2CSQA 4V2SA 5GAN2 4C8QB 1U3OA 2HQXA 5FU7B 3QJYA 3L2WA 3DKMA 1V76A 2DVEA 2SRCA 1M90C 3OYGA 1T0JA 4Z02A 5GMKh 2P0PA 3CBPA 1NLPC 1PWTA 2JOYA 3QDRB 5A0DA 2E4HA 2CZ1B 2OAUA 3WVDB 5IN1A 2KQWA 3CC7A 1VQ5T 4MZPA 4N4IA 1RABB 5IT9E 3M55A 4HT8A 1VQMT 1CKAA 3QJ6A 2DAQA 3QWYA 2GTJA 2WSEE 3RBBB 2QXFA 3HRSA 2B86A 2CH4A 1VQ6T 1JXOA 4JRQA 2RHXA 1VQ5A 3EG3A 4M4ZA 1YBYA 2RQUA 1YN8A 1YWOA 4C8QA 3I5SA 5GANf 1QMCA 4CC7A 2RQWA 3VYHB 2GQIA 1PC0A 4HT9A 1I81A 1TUCA 3UF4A 4C92F 2F69A 1RAEB 5HKCA 3QYGB 4JS4A 1VQ6A 4RG8A 2AZSA 2EBPA 4M75D 4RTXA 2KDSA 5ECAA 1MHNA 2DYBA 5I2MA 3C4SA 2ESWA 1BI2A 4EMGA 2EGAA 1SF9A 2FEIA 2VGNA 1WNLA 2AZVA 3UA7A 5CO7A 4E7ZA 1AZGB 1G2BA 1MNDA 3VRZA 1SSHA 2EYWA 4QQGA 4F7UG 1KHIA 5KYYA 5KE3A 2MYSA 1IGQA 4AFZC 5A0GA 1M3BA 2GF7A 1OEBA 2MWPA 2MK5A 4FIBA 2X35A 1RADB 2EJGA 4FU6A 4KGXB 1QVFP 2HBPA 1XQHA 4LNPA 4M7AE 1JB0E 4E47A 2RHUA 4KGZB 3CCJT 2VV5A 1VYUA 3E2UA 4JLIA 3CCQT 4E2FB 1OI1A 5LJ5g 5LJ3f 2K9GA 2ED0A 3LGFA 2HL3A 1N8RR 2RI5A 2CZ6B 3CCJA 2D0NA 1ZUYA 2ZZDA 1IREB 2F2WA 3UPUA 3CCQA 2QGGA 2HSEB 3M53A 2GCXA 4OMPA 2QA4T 1VQ8T 1M4ZA 4OB0B 2LNVA 3O8VA 4GLKA 1TTHB 3S3OA 4N0AA 1H3ZA 2JS0A 5GANd 1N6AA 5IXFA 3ZL7C 2XICA 3G6EQ 4N4HA 1NPPA 2QA4A 5HK3A 4CC2A 3RERA 4VUBA 1T3SA 3GLXA 4OMQA 3CXCS 3THKA 3JAME 2LNHB 1E6HA 4LD9K 2PUKB 3OS5A 1YHQT 3G4SQ 4E7LA 4UC4A 2KAFA 4EMHA 5J3BA 4IURA 3CCLT 1C1AA 2DTOA 4DA4A 4OGEA 2CUDA 2XDBA 2X3XD 2CKKA 3A8MB 4LDXA 1YHQA 2GQVA 2JM9A 1QVGS 4C5HA 5GAN5 1VQKA 3FRNA 2ABLA 2XMFA 3CCLA 2K5LA 4JZ4A 4C92C 2QYZA 1X27A 4M7AD 1VYVA 2DYIA 4KULA 4Z89A 1M1FA 2O4XB 1VQOQ 1GFDA 2RK2A 3OS1A 2PVOB 1H3HA 5LJ3d 2C0TA 1RL2A 1SRLA 4FYVB 2DLPA 1RI9A 2XG8D 1GCQA 2ED1A 4EMKC 3JB9D 1SPKA 3NHNA 1KC8R 2W0ZA 2DIGA 4ESRA 5FRMA 2BUDA 2DBMA 3FDRA 3PIOA 1HD3A 1X2KA 2JTFA 4C5IA 3CD6Q 3J7AF 4BDYA 2L5QA 2GNCA 5GANe 2ZAEA 1KQ2A 1D3BB 4L59A 4ZNXA 3S3NA 2IG0A 3EFRA 5D6YA 2LVMA 1RAHB 4C8QF 5GAMh 2E64A 2ENMA 4OP0A 1Q7YU 1DJ7B 5KYNA 1WHKA 2XIDA 2J6KA 2EGCA 3ZEHA 3J80E 2RD1A 3CCSQ 3RKYA 3JCMX 1M3CA 2YWWA 4EDUA 3VS3A 5DLQE 1WJSA 3AHUA 1VQPQ 4A54A 3P8BB 2DILA 3GNGA 4P5NA 4PJMA 1WJRA 3JCMh 1K4US 1UG1A 3M57A 1RI0A 2B8AA 4FYWB 1PD0A 2DE0X 4M78G 4OMFB 2DKGA 3SHWA 3SFMA 1UB4A 1Q86R 2KGTA 4PJOB 2E6ZA 3EFOB 1OYXA 2LP5A 4FSXA 1G8XA 3RIRA 2XDPA 2X3WD 2WACA 4XTUA 2D1XA 2VB6A 4A4GA 1U8RA 1H8KA 2DMOA 3MP6A 2GGRA 3BW1A 2H8HA 2K2VA 3A8LB 4FT2A 4RKUE 4IUVA 1WHLA 2DPPB 3CMAA 2A36A 4IUPA 2DD5A 3G71T 2LDMA 1EFNA 2XD0A 5KE2A 2H3EB 3C12A 1WQ7A 2COZA 2X51A 2QK0A 1CKBA 5LJ5j 5L23A 1HXDA 5LJ5f 1VQ4A 1YJWQ 2O9VA 5CKBA 4AG2C 5I11A 3X26B 4QW2A 3G71A 2DEQA 3EFOA 4Z88A 3HFOA 1D1CA 1NYGA 5CQXA 2AIRB 4ORZA 1E6GA 4JJBA 1K73C 1X01A 4F16A 1K8AR 4PFZA 4R56A 5GAOq 4Z8AA 1AWXA 2CP0A 3LH5A 1LNXA 3MHXA 3M0SA 2DZCA 5GAOn 4Y28E 4O5VA 2FPEA 1M90R 1ZSZB 5CCAA 3EG1A 4CC3A 4MMKA 1PNJA 1SHGA 1NJIU 4DOWA 3HRUA 2L3QA 3CPWS 3BFMA 3VS1A 2K2MA 1XTDA 2FYKA 4NL2A 5EC7A 2SEMA 1XOVA 2R5AA 1BK2A 3OA6A 4E7HA 2BIVA 4EPCA 2CP7A 3CCVQ 1JXMA 1I0CA 4C8QC 2VASA 3FJPA 3I55Q 5FU7C 3CD6T 4FSSA 2QTXA 4HCCA 1PRMC 4X9CA 2CZ0B 3A1PA 1YCSB 1ZSZA 1YWPA 2FRWA 4HVUA 4LN2A 1QLYA 1NZ9A 2DRMA 3CC7Q 1U1TA 4RG2A 2K79A 4WCIA 3S6WA 2DTIA 3RKXA 2DD4A 3MPUB 4BE1A 1W2BS 1EX4A 1QW1A 2LJ0A 1KC8U 2P0KA 5CKDA 4C92E 1NYFA 2DIQA 2J6FA 2VVKA 2ZGWA 3DLLA 2OX7A 3L1AA 2QEXQ 5AT1B 4J9GA 3CMET 1R0BG 2L3PA 2YUQA 2OTJT 1OX8A 5LL6S 5HK0A 2E12A 3EAEA 2KK4A 2XHCA 3QO3A 3J81E 1VA7A 2JMCA 3HP9A 4A4HA 3SDZA 2FG0A 2KYBA 4F7UB 3MEAA 3JB9J 3MEWA 2EKHA 1K9AA 4PKCC 3O5ZA 1ARKA 2OTJA 3QDFA 2LX7A 3C94A 3DB4A 1YJ9T 1ZBXA 2FZKB 2DVJA 1Q82U 2EPDA 1AWJA 4M77G 1QQJA 1ZSGA 3SB2A 4LDUA 3TU4K 2PQWA 4XAXB 4OVAA 1HJDA 3E9GA 3EHQA 4R0KA 2RJFA 3LH0A 2HMAA 3TSWA 2E3HA 3QSUA 4X9DA 5A0LA 4RTYA 1YJWT 2VKNA 3MEUA 2OAWA 2MWOA 4M7DG 2JTEA 3EGXB 1YI2Q 4N0AC 4KBMB 1FWZA 4F7UA 8ATCB 1BIBA 4IKFA 3TREA 1KQ1A 1ZBJA 2LTOA 2F5KA 2RQTA 2J05A 1ZA2B 1JJ2S 5FLXE 5LJ5e 1G5VA 3LW5E 5GMKi 3VKIA 1V1CA 3JCMV 3A98A 2KXCA 4J9EA 1WHMA 4A63B 2IPOB 4OMNA 3CC2A 2YLBA 4ZGJB 2KRMA 5GAOm 1KD1U 2DA9A 3H0FA 4D8KA 2CP6A 2Y4YA 3CQTA 3VYGA 3EGXA 4PJOF 3SD4A 1UEBA 3M0PA 1VQ7Q 2K3XA 1YJNT 3WXMB 2MAMA 4BUGA 4CC4B 3E9FA 2FZGB 1PSFA 3KUFA 1PKSA 4XU1A 2KYMA 1BI0A 2JUFA 1TXQA 3DLMA 3I56A 3V7SA 3CCMQ 2LT4A 3PFSA 1QWFA 5FROA 1Q81C 1M90U 2BZYA 5CVIA 1GCQC 2EIFA 1WGSA 1GCPA 1JRIA 1M1KC 3UT1A 2FHDA 1AVZC 1PG5B 3L2RA 2MF2A 2EQMA 2NUTB 3UA6A 3TCJA 4DEXA 5KCHA 3M0RA 4XTZA 4Q5WA 1VQLT 4OB2B 1MMNA 4XU3A 1VQMA 1ZUKA 3M54A 2RJEA 1K1ZA 3SWNB 5KH6A 2KT8A 3HFNA 2M0OA 1Q7YR 2ZCFB 3NTHA 1B3QA 1AOJA 1IRXA 2PVGB 1PCXA 2KBTA 5C0MA 1K9MC 3V8JA 3MJXA 4AFQC 4GLMA 3CXCP 1KG1A 3META 3EHRA 4BI8B 2OTLQ 3EH1A 1K0XA 1Y0MA 1MV3A 2YRCA 5GAN3 2COWA 4C8QE 2NUTA 4BY6B 1TSFA 4PK4A 2D0QB 3CCEQ 2E65A 4M75G 3CCRQ 3GP8A 2O01E 2OJ2A 4IIOA 2LCSA 3SWNA 4E7SA 1RLPC 4R55A 2HBWA 2DO3A 2VC8A 5GMKl 1X43A 1BKBA 2X4YA 1MNEA 2V1RA 2HCKA 4YTLA 1WXBA 3FB9A 2EGEA 4M78B 1D0YA 2HQEA 1ZA1B 2XDDA 2JW4A 2ROLA 3OYCA 2EVRA 5GANh 5CK9A 3OYKA 3X25B 2LCCA 3FC3A 1K0SA 1WHHA 2MCNA 3JCMc 2LC4A 5M9OA 3KFVA 2C0OA 2DERA 3HKSA 1KFZA 4PJOC 3CPFA 1RUWA 4AFUC 2CZ7B 1BI1A 2E5QA 2RHYA 3V8LA 1ZX6A 1M9SA 3NTKA 2BE7D 2L8DA 3PE0A 3VV0A 3CCUT 3PIPA 1XJWB 1KK7A 5FWBA 3CMAQ 3HPWA 1D0XA 1TU0B 1BCOA 4DOVA 2HL5C 4M78A 1Y57A 5EG2A 2DL5A 1SEMA 1D1BA 2IVWA 2QDYB 1U1SA 1VQ8A 1IGUA 4F7UF 2NUPB 1VQ4Q 2EW3A 2QQBA 4QVZA 2HDAA 5GAOr 1NJIR 4BE0A 1R77A 1GBQA 1NM7A 1TG0A 1VQNQ 2EAYA 1MGQA 1YITQ 4C8QD 2V8IA 1B07A 5LJ3h 3LX7A 3EG0A 4JRPA 4JPBW 2DF6A 5D6WA 2JMAA 2DXBA 1LJOA 3NTIA 2DK3A 2CT4A 3L2QA 2YLCA 2QQRA 2ZPIB 1VQ9Q 1D09B 1P92A 2X4WA 2NUPA 1VYTA 2ZPBB 1EIFA 5FRNA 3VS6A 1B7TA 1X6GA 3OS0A 1ZSZC 3QZ9B 2WSCE 5GAMj 3M58A 1V29B 4X34A 2K6DA 5GAMf 5C6SA 4BD3A 3ZBDA 1PHTA 2I2LA 1UGSB 1QVFS 1VUBA 4CRIA 1UHFA 1ABOA 4XTVA 1Y71A 4M7AG 2E10A 4LUDA 1TOVA 4RUGA 2E70A 2PZ1A 4C0DB 1X2QA 3OYBA 3JCMf 2A37A 3EG2A 2LQNA 3QG1A 3JB9G 3LYIA 5CAIA 4OB3B 4QKUA 1ABQA 1X75C 5D6XA 1C0MA 3C95A 1O9SA 2O4XA 4JRKA 1BIAA 2JJ9A 4IUUA 4ME7A 3CC4Q 1NE8A 3M0TA 1Q82R 4MDXA 4RTUA 2KSSA 4C5EA 3OYDA 2W10A 1QP3A 4L5GA 1N9SA 4J9FA 2RB6A 3CPWP 3QBYA 1UGRB 4PFPA 1TH7A 2DXUA 1D3BA 1O75A 1GRIA 5A2QE 3FEOA 1S72Q 1QVPA 2RI3A 3OYHA 3EG9B 4BE2A 4OMMA 1OULA 2DJZA 2EQJA 3RDVA 5KYUB 1N27A 9ATCB 2CP5A 4M77B 1W4SA 1LOJA 2RF0A 1WZOA 2R58A 1BCMA 1KQSP 2F2VA 2DXCA 1UGPB 3BY7A 2M1HA 1YIJQ 1RAFB 2BZ8A 2CDTA 1M5Q1 3FJ5A 1NBEB 2V8JA 1KHCA 3OQ5A 2ZPHB 3OSSC 3G6ET 2M51A 4A4KA 5IHIA 4M7DB 3CEYA 2ATCB 2ZPGB 1AWOA 2EQUA 1KD1R 3CXCA 2ECZA 5CR2A 1X6BA 2LZ6B 4PJOA 2DX1A 3DB3A 1OZ2A 3C0CA 3EG9A 5FU6B 3RNJA 1JEGA 4JJCA 1QP2A 4XTWA 1G83A 1D1AA 3G6EA 3G4ST 2EJ9A 1N8RC 4NS5A 2DTHA 4FYXB 1WX6A 1PSEA 2FPFA 2QTVA 4M77A 1PKTA 1BYMA 5GAOl 2PU9B 2LT1A 3V8KA 3Q1JA 4A53A 1K73U 2RN8A 1LCKA 4NL3A 1H92A 2DXTA 4XQ3A 2O2OA 1QCOA 3SEMA 1AZEA 3OMCA 3G4SA 4M78F 2RMOA 3CC2Q 2YDLA 4M7DA 2NWMA 3QHSA 4BACA 4PJOE
chains in the Genus database with same CATH topology
4RCCA 4KBMB 2RO0A 3MP1A 1ZHIA 2K4YA 2AHJB 3KXTA 4J6YA 1FWZA 3FLGA 2ZPEB 3PGGA 4QQGA 4F7UG 1KHIA 1BIBA 2QI2A 2ZPFB 3CBMA 5KE3A 5GAN8 2OTLT 2RHZA 4IKFA 3TREA 5A0GA 1JBMA 4E7JA 2GF7A 1KQ1A 4LDYA 2LTOA 2F5KA 2MWPA 1VQOT 3X28B 5J26A 2P4TA 4FIBA 2X35A 1JJ2S 2E1HA 5FLXE 2EJGA 5LJ5e 4BB7A 1G5VA 4FU6A 3CCET 3LW5E 5GMKi 3VKIA 2JTMA 2HBPA 1XQHA 5LJ5h 3JCMV 3CCRT 1WQWA 4M7AE 1JB0E 4E47A 2RHUA 3LWIA 2OTLA 3CCJT 2VV5A 3CC2A 2YLBA 4ZGJB 3FIFA 3P8DA 5GAOm 4JLIA 1VQOA 1KD1U 3CCQT 1OI1A 3ZFJA 5LJ5g 5LJ3f 3OYJA 4N4GA 3UWNA 1YCYA 3ME9A 3JSCA 2K5FA 3OW2S 5GAMe 3CCEA 2Y4YA 3M4YA 3LGFA 1Q7YC 3OBYA 3VYGA 1Y96B 4PJOF 3OYYA 3CCRA 3SD4A 2RI5A 4MDWA 2CZ6B 1UEBA 2FB7A 3CCJA 2K3XA 1YJNT 3WXMB 2MAMA 2ZZDA 1Y07A 3UDCA 1WPYA 4BUGA 5GAN6 1IREB 4M78D 3UPUA 1I5LA 3E9FA 3CCQA 4B9XA 3CD6A 4NOYA 1H641 1PSFA 3M53A 3KUFA 2GCXA 2F5TX 4JLGA 4XU1A 1BI0A 2RJCA 5LJ5d 2JUFA 3OYMA 2QA4T 1VQ8T 2LQKA 1M4ZA 4OB0B 3X24B 3DLMA 2LNVA 3V7SA 3I56A 3O8VA 3HRTA 2LT4A 3PFSA 3JCMe 4GLKA 5CQYA 3CCST 3BDLA 4N0AA 3S3OA 4HCZA 4M7AF 1H3ZA 5FROA 1Y7XA 5GMKm 1Q81C 5GANd 1M90U 1N6AA 5CVIA 2XICA 4M75C 4N4HA 2EIFA 1WGSA 2LCLA 3A8HB 1JRIA 1VQPT 3HL8A 5GAMd 1NPPA 2QA4A 1M1KC 3SWNC 5HK3A 3HHTB 3UT1A 2FHDA 3CMAT 3RERA 3INZA 4IUTA 4VUBA 1Y96A 3GLXA 3L2RA 3CCSA 3JB9F 3GPLA 3RKWA 3CXCS 4XTYA 3JAME 3JB9H 2MF2A 2EQMA 3OY9A 4LD9K 4IUQA 2PUKB 2M16A 4C0GA 4BDZA 3TCJA 2QQ9A 3OS5A 5KCHA 2HAXA 3HSBA 2CS7A 3OBWA 1YHQT 1FXXA 2QQAA 5LJ3e 1VQ4T 2R5MA 1B34B 4XTZA 1SSFA 4E7LA 4UC4A 4Q5WA 2KAFA 1VQLT 4M75B 4EMHA 3CMEA 5J3BA 4IURA 4OB2B 3CCLT 2DTOA 4FM4B 4ELZC 4XU3A 4DA4A 1VQMA 3M54A 2RJEA 4OGEA 3SWNB 5KH6A 4A4EA 2XDBA 2XKOC 2X4JA 4KT0E 2V8KA 1M8VA 3JCMd 2CKKA 3JB9I 1VQNT 3HFNA 2CGHA 2M0OA 3A8MB 3T9NA 2ZCFB 2RHIA 4LDXA 3NTHA 1YITT 4BY6C 1YHQA 1YIJT 2PVGB 2GQVA 2RA2A 1QVGS 1N8RU 2A7YA 3H8ZA 4C5HA 3LLRA 3V8JA 3FRNA 5C0MA 5GAN5 1K9MC 1VQKA 4JJNK 4ATOA 3CCLA 2K5LA 1QVGA 4C92C 4QVCA 1YJ9A 4M7AD 3JRZA 1KG1A 3META 4BI8B 2HNIA 3G7ZA 2JVVA 1VQNA 4KULA 3L2ZA 3WVEB 4PL6A 5GAN3 1YITA 4XU0A 4MMLA 1M1FA 2O4XB 4C8QE 1VQ9T 3MO8A 2RK2A 3BDUA 4C0ZA 3OS1A 3QYHB 2PVOB 5LJ3d 1N9RA 1RL2A 4BY6B 1HK9A 1B34A 2RM4A 2GFAA 2D0QB 4M78C 2XG8D 4M75A 4LD6A 2E65A 1Q86C 4M75G 1G3YA 4EMKC 3JB9D 5I21A 4M77E 3GP8A 1YJWA 2CYZB 2O01E 4C92B 1QVFA 3SWNA 5CKHA 3MP8A 4HKEA 4OF1A 4R55A 2DIGA 2DO3A 2FVUA 5FRMA 2D6FA 2BUDA 4A4FA 2VC8A 1VQ9A 5GMKl 3FDRA 3PIOA 2YRVA 1BKBA 2E6NA 1NJIC 2JTFA 1VIEA 4C5IA 5GAOp 2X4YA 5GMKj 3J7AF 3L2VA 4YTLA 1G3TA 4BDYA 3FB9A 2L5QA 4PLIA 5GANe 3GF5A 3RESA 4M7DE 4M78B 1X6OA 5GAN7 4F7UA 1FX7A 2HQEA 1KQ2A 1D3BB 2EJFA 2XDDA 4EMKB 4L59A 2KY9A 4C92D 2LRQA 3OYCA 1XNIA 5GANh 5CK9A 3OYKA 3S3NA 2IG0A 3EFRA 3X25B 2LCCA 5D6YA 4QQDA 4XU2A 4ELYC 4F7UE 3FC3A 5CIUA 5DY9A 1ZQ1A 2LVMA 4C5GA 3OYEA 3CPWA 4C8QF 2JN0A 2YHTA 5GAMh 3P8HA 5J39A 3L42A 2E64A 2Y4XA 4FL6A 3JCMc 5GANg 2LC4A 5M9OA 3JCMW 1G3SA 4OP0A 1Q7YU 1DJ7B 3OSVA 3ZEHA 2XIDA 3J80E 2RD1A 2X4XA 3HKSA 3H6ZA 3CPFA 2JZ2A 4M77F 3RKYA 4PJOC 5GAMg 3JCMX 3RMQA 4KUIA 4C92A 2CZ7B 4EDUA 1BI1A 4C92G 2E5QA 2HD0A 2RHYA 3V8LA 3NTKA 1M9SA 1KQSS 3ER0A 2VYTA 4ZTFA 2EWNA 3OMGA 3CCVT 2L8DA 5DLQE 1WJSA 3AHUA 3VV0A 3PTAA 3CCUT 3CC4T 1K8AC 4J6WA 2RJDA 4JDSA 4A54A 3PIPA 3P8BB 1YJNA 1KQSA 3GNGA 4PNOA 3I55T 5L8RE 3OB9A 3HPWA 4FT4A 4P5NA 1WJRA 3JCMh 4ZGEB 4DOVA 3M57A 1RI0A 2B8AA 4M7DF 4M78A 4M78G 4OMFB 2DKGA 3QXEB 3SFMA 2Y90A 3LWHA 2XU8A 1UB4A 4EMKA 5EG2A 3N5BB 1KC8C 1Q81U 2IVWA 2QDYB 2VXEA 1U1SA 2RI2A 2E6ZA 3GNFB 3OYIA 1VQ8A 1OYXA 3CC7T 3CCVA 4M7AC 4FSXA 4F7UF 3KBGA 4LDVA 3RIRA 3JCMg 2QQBA 2XDPA 4QVZA 5KCOA 2D9TA 2WACA 3CC4A 4XTUA 1UGQB 1M1KU 1IZ6A 3I55A 3JCMJ 4A4GA 4ZN3A 5GAOr 1U8RA 5DLOA 1W2BA 4BE0A 3OYFA 2K3YA 1S72T 3M59A 3MP6A 3OYLA 5IAYA 3QPHA 4KUDK 3BW1A 2PUOB 2R57A 3VJPA 2EAYA 2K2VA 3A8LB 1VQPA 4FT2A 1MGQA 4RKUE 4C8QD 4PJOD 2V8IA 4IUVA 5LJ3h 2DPPB 1VIFA 3LX7A 3CMAA 3OS2A 4IUPA 3JCMQ 2DD5A 3G71T 4JRPA 2LDMA 4M7AB 2PVDB 2XD0A 3X20B 4II1A 4J8OA 5D6WA 5KE2A 3OYNA 3C12A 2FL7A 1WQ7A 4RMOA 2DXBA 2GFUA 1LJOA 4DQ2A 2QEXT 4M77D 4OB1B 1S72A 5LJ3g 3NTIA 5LJ5j 1HXDA 5LJ5f 1VQ4A 2EKOA 5CKBA 3X26B 4CI0C 2DK3A 4B9WA 1AHJB 1VQLA 4BI3A 4QW2A 3L2QA 2YLCA 2QQRA 2ZPIB 1M1GA 3NFCA 1GXIE 1P92A 4WF2A 1Q82C 4PJOG 2DEQA 5AYFA 4O6JA 3G71A 1OZ3A 3HFOA 4J5YA 2X4WA 4E7IA 5GANj 2L89A 5CQXA 2ZPBB 1K9MU 1EIFA 5FRNA 3RMSA 2MMPA 3VUBA 2QEXA 3OS0A 4BI4A 5DM7R 4M7DD 3QZ9B 2WSCE 1X01A 1K73C 5GAMj 3M58A 3GOXA 2BKDN 1V29B 1YIJA 4X34A 4C0DC 3LGLA 5GAMf 4R56A 5C6SA 4BD3A 3ZBDA 5GAOq 5CKEA 2M9UA 2I2LA 1UGSB 1QVFS 3A8OB 4C0FA 1VUBA 4MZMA 4CRIA 3M9QA 4OGCA 4D6WA 2NLUA 4JRIA 3MHXA 1LNXA 3M4GA 2JNGA 4JS5A 4XTVA 1Y71A 2K57A 4M7AA 4M7AG 4J7FA 2DZCA 2E10A 5GAOn 1Q86U 3S3MA 4Y28E 4O5VA 3QUIA 2E70A 5CCAA 3M56A 2KMTA 4MMKA 4C0DB 3OYBA 3MEVA 4ZTJA 2VGMA 1NJIU 3JCMf 4QQ6A 3F70A 3R6OA 2K5IA 3CC2T 2E41A 3QG1A 3JCMP 2KVQG 3URGA 4DOWA 3JB9G 3HRUA 3LYIA 4XTXA 5CAIA 3CPWS 2VUBA 3BFMA 4OB3B 4ZN1A 1YI2T 4L6V5 2LX9A 1X75C 5D6XA 1XTDA 2FYKA 5HY6A 4NL2A 3C95A 1O9SA 4M75E 4HA8A 2O4XA 4JRKA 1XOVA 2R5AA 2EQKA 4MZTA 3OA6A 4E7HA 1BIAA 3A8GB 2BIVA 1JJ2A 4EPCA 2RH2A 1KD1C 2L3RA 3A5ZB 2C06A 2H3JA 2A3LA 4IUUA 4ME7A 4J83A 1NE8A 1YI2A 4C8QC 3M5AA 3FJPA 5LJ3j 3OYAA 1NPRA 2VXFA 5FU7C 3CD6T 4MDXA 2QTXA 3V7CA 4HCCA 2KSSA 2RK1A 4X9CA 3V7RA 4C5EA 3OYDA 2CZ0B 1BI3A 1QP3A 1N9SA 3PMTA 4L5GA 3PNWC 4M77C 3I56T 3OW2A 1NZ9A 1U1TA 4J7IA 2RB6A 4RG2A 1R8OB 3S6WA 4XK8E 3QBYA 1UGRB 2DTIA 2XI9A 3E1SA 3RKXA 1K8AU 3VU3C 1TH7A 2DXUA 1D3BA 1O75A 1WJQA 4V2SA 5A2QE 5GAN2 3FEOA 4C8QB 2P0QA 2DD4A 1QVPA 2HQXA 2RI3A 3OYHA 3PMIA 5FU7B 4BE1A 4BE2A 3QJYA 3L2WA 3DKMA 1VQ7T 2DVEA 1W2BS 2DJZA 5GMKe 1QW1A 4M75F 3CCUA 4GY5A 4J6XA 2EQJA 1M90C 4HCBA 1KC8U 4M7DC 4ZGDB 1I8FA 2P0KA 3OYGA 5CKDA 4Z02A 1N27A 4C92E 2DIQA 2ZGWA 2P0PA 4M77B 4QVDA 5GMKh 1W4SA 3CBPA 3DLLA 2JOYA 3QDRB 1LOJA 5A0DA 3CBOA 3L1AA 2CZ1B 2OAUA 2XK0A 2R58A 4PLLA 3WVDB 5IN1A 2DXCA 2KQWA 5FU6C 3CC7A 3CCMT 1UGPB 3BY7A 2M1HA 2WSFE 1VQ7A 1VQ5T 4MZPA 3CMET 2EFIA 4N4IA 5IT9E 4E7KA 2EYQA 3M55A 1M5Q1 4HT8A 2OTJT 1I4K1 2V8JA 3OQ5A 1KHCA 1VQMT 4M78E 5GAN4 2ZPHB 3OSSC 3G6ET 4LDWA 4A4KA 3QJ6A 2DAQA 4M7DB 3RUXA 5LL6S 5CKFA 5HK0A 2LQ8A 3CEYA 2E12A 2WSEE 2KK4A 2XHCA 3ASKA 3EAEA 3QO3A 3J81E 2ZPGB 3HP9A 2EQUA 2QXFA 3HRSA 3SDZA 4A4HA 5I2SA 3CXCA 4F7UB 1VQ6T 3MEAA 5CR2A 3MEWA 3CCMA 3JB9J 4JRQA 1VQKT 2RHXA 1VQ5A 1YBYA 4C8QA 4PJOA 4C8QG 3DB3A 1OZ2A 4PKCC 3L2UA 4JUVA 3EFSA 5FU6B 2OTJA 3QZ5B 1QP2A 3DB4A 3C94A 4RCBA 4XTWA 1ZBXA 5GANf 3G6EA 1YJ9T 3VUZA 3VYHB 3G4ST 2EJ9A 1N8RC 2DTHA 4NS5A 1Q82U 1G3WA 4HT9A 1I81A 1PSEA 4Y91A 4M77A 2F69A 4C92F 4M77G 4PJOB 3MCAB 2MI6A 3QIIA 1BYMA 5GAOl 5HKCA 2PU9B 3QYGB 4LDUA 3SB2A 2PQWA 3TU4K 4XAXB 4OVAA 2LT1A 4RG8A 3E19A 3E9GA 4JS4A 1VQ6A 3V8KA 3Q1JA 4A53A 3JCMb 3PT9A 1K73U 4M75D 4TVRA 4NL3A 2KDSA 2DXTA 2RJFA 1MHNA 3LH0A 4XQ3A 3GIBA 2QQSA 3QSUA 4X9DA 5I2MA 3C4SA 5A0LA 3OMCA 2DZ9A 1BI2A 2G3RA 3QKJA 4EMGA 3G4SA 3MEUA 1YJWT 2VGNA 1WNLA 4M78F 2MWOA 4M7DA 5CO7A 3QHSA 4BACA 4M7DG 3TEEA 4PJOE 4N0AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI2 A;  4IUU A;  3OYI A;  2CKK A;  2RO0 A;  1OYX A;  3MP1 A;  2M0O A;  3FLG A;  2RHI A;  2XDP A;  3NTH A;  4QQG A;  4QVZ A;  5KCO A;  2D9T A;  2WAC A;  5KE3 A;  3OYA A;  2RHZ A;  4IKF A;  3H8Z A;  4E7J A;  2GF7 A;  4A4G A;  4C5E A;  4C5H A;  3LLR A;  2LTO A;  2F5K A;  2MWP A;  5C0M A;  3OYD A;  3PMT A;  3OYF A;  4BE0 A;  2K3Y A;  5J26 A;  3MP6 A;  3OYL A;  3PNW C;  5IAY A;  2X35 A;  2R57 A;  1G5V A;  4FU6 A;  4RG2 A;  3MET A;  4IUV A;  3S6W A;  3QBY A;  3LX7 A;  3OS2 A;  4IUP A;  4PL6 A;  2LDM A;  2RHU A;  2O4X B;  1WJQ A;  3MO8 A;  4II1 A;  5D6W A;  5KE2 A;  3OS1 A;  3FEO A;  3OYN A;  3P8D A;  2HQX A;  2RI3 A;  3OYH A;  3PMI A;  4BE1 A;  4BE2 A;  2GFU A;  3L2W A;  2GFA A;  3NTI A;  1OI1 A;  4GY5 A;  2EQJ A;  4LD6 A;  3OYJ A;  4N4G A;  3UWN A;  2P0K A;  3ME9 A;  2EKO A;  3OYG A;  4Z02 A;  1N27 A;  4B9W A;  2DIQ A;  3LGF A;  4QW2 A;  3L2Q A;  2QQR A;  3MP8 A;  3SD4 A;  2DIG A;  2RI5 A;  5FRM A;  2BUD A;  1OZ3 A;  4A4F A;  2XK0 A;  2K3X A;  2R58 A;  2X4W A;  2L89 A;  3FDR A;  2YRV A;  4PLL A;  4E7I A;  5FRN A;  2E6N A;  5IN1 A;  2JTF A;  4C5I A;  2X4Y A;  2M1H A;  3OS0 A;  3L2V A;  2EFI A;  4N4I A;  3E9F A;  4E7K A;  4BDY A;  4B9X A;  3GOX A;  2BKD N;  3OQ5 A;  4X34 A;  1KHC A;  3KUF A;  3LGL A;  4PLI A;  5C6S A;  4BD3 A;  2RJC A;  3OYM A;  3QJ6 A;  2DAQ A;  2HQE A;  3CEY A;  4L59 A;  2LRQ A;  3ASK A;  1XNI A;  3DLM A;  3EAE A;  4CRI A;  3M9Q A;  3O8V A;  3OYC A;  3OYK A;  3S3N A;  2IG0 A;  2EQU A;  4A4H A;  2NLU A;  2LCC A;  3PFS A;  4QQD A;  5D6Y A;  3FC3 A;  3BDL A;  3S3O A;  4HCZ A;  3MEA A;  5CIU A;  1H3Z A;  5FRO A;  2LVM A;  3MEW A;  4C5G A;  3OYE A;  2RHX A;  3P8H A;  5J39 A;  3S3M A;  3DB3 A;  3L42 A;  1OZ2 A;  3L2U A;  4N4H A;  4FL6 A;  1WGS A;  5M9O A;  3DB4 A;  3ZEH A;  4NS5 A;  2X4X A;  3UT1 A;  3H6Z A;  2JZ2 A;  2FHD A;  3OYB A;  3MEV A;  4ZTJ A;  4IUT A;  4EDU A;  3QII A;  2E5Q A;  4QQ6 A;  2RHY A;  2PQW A;  3F70 A;  3NTK A;  4OVA A;  3L2R A;  3E9G A;  2VYT A;  4ZTF A;  3OMG A;  3Q1J A;  2EQM A;  2L8D A;  1WJS A;  3LYI A;  3OY9 A;  4IUQ A;  4BDZ A;  2M16 A;  2RJF A;  3LH0 A;  5KCH A;  1MHN A;  5D6X A;  2QQS A;  2RJD A;  2R5M A;  3C4S A;  1SSF A;  4E7L A;  3OMC A;  3OB9 A;  4UC4 A;  2O4X A;  4Q5W A;  2R5A A;  2G3R A;  3QKJ A;  1WJR A;  2EQK A;  3MEU A;  3OA6 A;  4IUR A;  1RI0 A;  4E7H A;  2MWO A;  2B8A A;  2BIV A;  4BAC A;  2L3R A;  2RJE A;  5KH6 A;  4A4E A; 
#chains in the Genus database with same CATH topology
 2RO0 A;  3MP1 A;  2D8J A;  4J6Y A;  3FLG A;  3PGG A;  1Q81 R;  2QI2 A;  5GAN 8;  3CBM A;  2CH4 W;  2RHZ A;  1HYO A;  4E7J A;  4LDY A;  1VQO T;  4F14 A;  2AK5 A;  1QCF A;  5J26 A;  2P4T A;  1M1K R;  2RNA A;  1WXU A;  2JTM A;  5LJ5 h;  3H9N A;  1WLP B;  1IO6 A;  3P8D A;  5KYW B;  4PJL A;  1VQO A;  3VS0 A;  3H0H A;  2P4R A;  3UWN A;  3ME9 A;  3OW2 S;  3JSC A;  2K5F A;  5GAM e;  4F04 B;  1M2V B;  3M4Y A;  3OBY A;  1Y96 B;  2DRK A;  4MDW A;  1LPL A;  3PVL A;  2JXB A;  1Y07 A;  2QDL A;  3UDC A;  2KXD A;  3I5R A;  2VWF A;  3M0Q A;  3CD6 A;  4NOY A;  3PVQ A;  2RJC A;  5LJ5 d;  4HVV A;  2LQK A;  2CRE A;  3X24 B;  4X1V A;  2MOX A;  2A28 A;  1VQ5 Q;  3JCM e;  1M30 A;  5CQY A;  3CCS T;  1Y7X A;  1U5S A;  2JT4 A;  3M0U A;  1YFN A;  3A8H B;  4Y92 A;  5HCK A;  1VQP T;  3HL8 A;  3SWN C;  1UUE A;  1VQ6 Q;  2DEU A;  1Y96 A;  3CCS A;  2P84 A;  3RKW A;  4XTY A;  1TS9 A;  2OI3 A;  3OY9 A;  3JB9 H;  1UJ0 A;  1WHJ A;  2HAX A;  2G6F X;  1FXX A;  4PJJ A;  2R5M A;  1B34 B;  1SSF A;  4M75 B;  3CME A;  4DBH A;  1Z9Q A;  4FM4 B;  4ELZ C;  2KI7 A;  4A4E A;  2X4J A;  2V8K A;  1T3L A;  3JB9 I;  2QG9 B;  2RHI A;  1UE9 A;  3REB B;  4BY6 C;  1YIJ T;  2J6O A;  1RAI B;  2RA2 A;  2A7Y A;  1M27 C;  4JJN K;  4QVC A;  1YJ9 A;  1E7O A;  3JRZ A;  3VS5 A;  2JVV A;  3MKD A;  1C6V X;  4HCK A;  3WVE B;  4PL6 A;  2PNI A;  3BDU A;  3QYH B;  1TUG B;  1N9R A;  2L0A A;  1ZLM A;  1B34 A;  2GFA A;  4M78 C;  1OQK A;  4FYY B;  4M75 A;  1Q86 C;  1G3Y A;  1QCN A;  2M0Y A;  5I21 A;  3ULR B;  1SHF A;  1PM3 A;  1YJW A;  2CYZ B;  7AT1 B;  3CCJ Q;  5CKH A;  3MP8 A;  4OF1 A;  2A0F B;  4A4F A;  2YRV A;  3CCQ Q;  1VIE A;  2FPD A;  5GMK j;  4GBQ A;  1X69 A;  1G3T A;  2DM1 A;  2D8H A;  3D7S B;  1UHC A;  1NEG A;  2KR3 A;  3EGD B;  4PLI A;  3GF5 A;  3RES A;  1FX7 A;  4C92 D;  1M8M A;  2KRS A;  3TSZ A;  4F7U E;  2CP2 A;  4XU2 A;  1OOT A;  5CIU A;  5DY9 A;  2F1L A;  3OYE A;  3CPW A;  2JN0 A;  4KGV B;  2L3S A;  3P8H A;  3L42 A;  2QA4 Q;  4FL6 A;  1VQ8 Q;  3JCM W;  4KH0 B;  4RTZ A;  3R6N A;  2DL3 A;  3H6Z A;  2F2X A;  4M77 F;  5GAM g;  4C92 G;  3AT1 B;  2HD0 A;  2E3I A;  2VYT A;  4ZTF A;  2EWN A;  3CCV T;  4J9I A;  3PTA A;  1K8A C;  4J6W A;  1TWB A;  2RJD A;  1YJN A;  1KQS A;  5FW9 A;  4PNO A;  3I55 T;  2ROT A;  3OB9 A;  1WA7 A;  1ZUU A;  3EGD A;  4ZGE B;  5IHK A;  4M7D F;  3VS7 A;  3N5B B;  2NUZ A;  1Q81 U;  2VXE A;  4QT7 A;  3GNF B;  3CC7 T;  1YHQ Q;  3CCV A;  3JV3 A;  3JCM g;  1VQK Q;  4IIM A;  1UGQ B;  4AMC A;  3CCL Q;  2PTK A;  3JCM J;  3I55 A;  1M1K U;  4ZN3 A;  5DLO A;  1W2B A;  3H0I A;  3IQL A;  3M59 A;  3OYL A;  5IAY A;  2YUO A;  4KUD K;  2R57 A;  1KIK A;  3VJP A;  1QKW A;  2QAS A;  2CP3 A;  1SKU B;  3OS2 A;  5I22 A;  3JCM Q;  4M7A B;  1QKX A;  3X20 B;  4II1 A;  3OYN A;  2QEX T;  2GFU A;  3U23 A;  1WIE A;  4OB1 B;  5GJV B;  1TUD A;  2EKO A;  4CI0 C;  1MMD A;  5IH2 A;  1AHJ B;  1VQL A;  4BI3 A;  5KYY B;  2L2P A;  3NFC A;  4WF2 A;  2KT1 A;  5AYF A;  1WHG A;  1OZ3 A;  4WTO B;  4J5Y A;  5GAN j;  1K9M U;  1U06 A;  3RMS A;  2YUP A;  2QEX A;  5DM7 R;  2C0I A;  3GOX A;  2BKD N;  2KE9 A;  2YSQ A;  4C0D C;  3LGL A;  2KNB B;  2M9U A;  4KH1 B;  1UGV A;  2YRD A;  3M9Q A;  2NLU A;  3NPF A;  3M4G A;  2K57 A;  4M7A A;  1AD5 A;  3S3M A;  1QVG P;  2KRO A;  1D0Z A;  3TQ7 P;  3EGU A;  2HQH A;  1GL5 A;  4ZTJ A;  4QQ6 A;  3F70 A;  2K5I A;  1YP5 A;  3URG A;  4XTX A;  1YI2 T;  2EQI A;  2LX9 A;  4L6V 5;  3RR6 A;  2A08 A;  4HA8 A;  1M2O A;  2EQK A;  4MZT A;  1JU5 C;  1W6X A;  1JJ2 A;  2L3R A;  2C06 A;  2H3J A;  3NGP A;  4J83 A;  1YI2 A;  5LJ3 j;  2VXF A;  3V7C A;  1WYX A;  2RK1 A;  4JZ3 A;  1BI3 A;  1LVK A;  2LJ1 A;  3PNW C;  4M77 C;  1K73 R;  2DL4 A;  1IB8 A;  1WI7 A;  4J7I A;  3G1J A;  4XK8 E;  1NEB A;  1WJQ A;  1N5Z A;  2AKK A;  2FO0 A;  2P0Q A;  3PMI A;  2O9S A;  1VQ7 T;  1W1F A;  3CCU A;  5GMK e;  4M75 F;  2GBQ A;  4M7D C;  4GY5 A;  4J6X A;  4LXC A;  1JQQ A;  1UTI A;  3UAT A;  4ZGD B;  1I8F A;  4HCB A;  1W70 A;  4QVD A;  3G71 Q;  3H41 A;  3CBO A;  1BU1 A;  2XK0 A;  4PLL A;  2BE9 B;  5FU6 C;  3CCM T;  2WSF E;  1VQ7 A;  2EFI A;  4E7K A;  2EYQ A;  1I4K 1;  4M78 E;  5GAN 4;  2BZX A;  2CUB A;  4LDW A;  2CSI A;  3RUX A;  5CKF A;  2LQ8 A;  3ASK A;  2YT6 A;  5I2S A;  1I5O B;  3CCM A;  3QWX X;  1VQK T;  1IXD A;  4C8Q G;  3L2U A;  4JUV A;  3EFS A;  3QZ5 B;  5FWC A;  4RCB A;  1MV0 B;  3VUZ A;  2AT1 B;  2KRN A;  1G3W A;  4Y91 A;  4FW2 A;  3MCA B;  2MI6 A;  2JM8 A;  3QII A;  2QAZ A;  2HZY A;  3E19 A;  3JCM b;  3PT9 A;  4TVR A;  3GIB A;  4OMO A;  2QQS A;  1OU8 A;  4JJD A;  1IHW A;  1FYN A;  2DZ9 A;  2FRY A;  2G3R A;  3QKJ A;  1HSQ A;  2E5K A;  3TEE A;  1RAA B;  4RCC A;  1ZHI A;  2K4Y A;  2AHJ B;  3KXT A;  2ZPE B;  1RAC B;  2ZPF B;  2OTL T;  1MMA A;  1EZZ B;  1JBM A;  1OPK A;  2YXY A;  3X28 B;  1T0H A;  1AT1 B;  1R0C B;  3VS2 A;  2E1H A;  5D7U A;  4BB7 A;  4D8D A;  3CCE T;  2Z0W A;  4PFO A;  4LE9 A;  3CCR T;  1WQW A;  3LWI A;  2OTL A;  3FIF A;  2RQR A;  3ZFJ A;  2CT3 A;  3OYJ A;  4N4G A;  1YCY A;  3CCE A;  1PRL C;  1BB9 A;  1Q7Y C;  4DBF A;  3OYY A;  3CCR A;  4EIK A;  2FB7 A;  2DJQ A;  2DL7 A;  4FW1 A;  4LUE A;  1WPY A;  4AG1 C;  1JO8 A;  4M78 D;  5GAN 6;  1I5L A;  1MUZ A;  4B9X A;  1H64 1;  2V1Q A;  2F5T X;  4JLG A;  4ANJ A;  3OYM A;  3I9Q A;  1RAG B;  3HRT A;  1GFC A;  1PD1 A;  3CME Q;  3BDL A;  4HCZ A;  1OV3 A;  4M7A F;  5GMK m;  2OTJ Q;  4M75 C;  3OW2 P;  2LCL A;  2DNU A;  5GAM d;  5IXB A;  4RTT A;  3HHT B;  3CMA T;  3INZ A;  4IUT A;  2GTO A;  2KEA A;  1K76 A;  3JB9 F;  3GPL A;  2HKN A;  4IUQ A;  4BDZ A;  2M16 A;  4C0G A;  1YJ9 Q;  2LMJ A;  2QQ9 A;  3HSB A;  2CS7 A;  3OBW A;  1UJY A;  2QQA A;  2X9H A;  3BE3 A;  5LJ3 e;  1VQ4 T;  1MMG A;  1W2B P;  1OPL A;  4F17 A;  1AEY A;  1A0N B;  2XKO C;  4KT0 E;  1M8V A;  3JCM d;  5KYU A;  1VQN T;  2CGH A;  2NYS A;  1SG5 A;  3T9N A;  1AWW A;  3NMZ C;  1YIT T;  1N8R U;  3H8Z A;  1BBZ A;  3LLR A;  1OX9 A;  4ATO A;  1FMW A;  1KJW A;  1QVG A;  1I1J A;  2O31 A;  3I35 A;  2HNI A;  1QWE A;  3G7Z A;  2EYX A;  1VQN A;  3L2Z A;  4K11 A;  1YIT A;  1SRM A;  4J9B A;  4MML A;  4XU0 A;  1VQ9 T;  3MO8 A;  4B6M A;  4C0Z A;  1HK9 A;  2RM4 A;  8AT1 B;  4LD6 A;  2BTT A;  4M77 E;  4C92 B;  1QVF A;  2DET A;  4HKE A;  2FVU A;  5KYX B;  3GBQ A;  2D6F A;  1VQ9 A;  2E6N A;  1NJI C;  5GAO p;  2HSP A;  3L2V A;  1FMK A;  1S1N A;  4M7D E;  4J9H A;  1RLQ C;  3I56 Q;  1X6O A;  5GAN 7;  2EJF A;  1F1B B;  4EMK B;  1YJN Q;  1NLO C;  2KY9 A;  2LRQ A;  1XNI A;  3REA B;  2K7A A;  4ELY C;  4QQD A;  2DFU A;  1ZQ1 A;  4C5G A;  2YHT A;  5J39 A;  2FZC B;  2Y4X A;  5GAN g;  1G3S A;  3OSV A;  1K9M R;  4J9C A;  2X4X A;  1I07 A;  2JZ2 A;  1JJ2 P;  3RMQ A;  4KUI A;  4C92 A;  2O88 A;  2K3B A;  5KYX A;  3ER0 A;  1KQS S;  3OMG A;  2EYZ A;  2V26 A;  3CC4 T;  4JDS A;  4PJN A;  5L8R E;  3HTR A;  4FT4 A;  4HXJ A;  1VQM Q;  3VRY A;  5KYW A;  3EH2 A;  3LWH A;  3QXE B;  1Z9Z A;  2Y90 A;  2XU8 A;  4EMK A;  1FMV A;  2EYY A;  2J06 A;  4DEY A;  1KC8 C;  2RI2 A;  4M7A C;  3OYI A;  3KBG A;  1M2V A;  4LDV A;  5KCO A;  2D9T A;  3CC4 A;  1VQL Q;  1UFF A;  1IZ6 A;  2M02 A;  3OYF A;  2K3Y A;  1S72 T;  2YUN A;  3QPH A;  1OU9 A;  2DBK A;  2PUO B;  1ACM B;  1VQP A;  4PJO D;  4OML A;  1VIF A;  1WDX A;  2PVD B;  4DBR A;  2HKQ B;  4J8O A;  1KSW A;  2FL7 A;  4RMO A;  4DQ2 A;  4M77 D;  1S72 A;  5LJ3 g;  4B9W A;  2JS2 A;  4E6R A;  5IHN A;  1M1G A;  1UDL A;  1GXI E;  1Q82 C;  4PJO G;  1M3A A;  4O6J A;  4KRT A;  2HEQ A;  4E7I A;  2L89 A;  5GJW B;  1NG2 A;  2LQW A;  2DL8 A;  2MMP A;  2J7I A;  3VUB A;  4BI4 A;  4M7D D;  2LJ3 A;  1YIJ A;  1IHV A;  5CKE A;  2RQV A;  1WXT A;  3A8O B;  4C0F A;  4MZM A;  2IIM A;  4OGC A;  4D6W A;  4JRI A;  2JNG A;  4JS5 A;  1Q95 G;  4J7F A;  4HVW A;  2I0N A;  1Q86 U;  3QUI A;  2MIO A;  2COY A;  3M56 A;  2KMT A;  1CSK A;  3MEV A;  2AKL A;  2VGM A;  3R6O A;  3CC2 T;  2E41 A;  3JCM P;  2KVQ G;  2VUB A;  4ZN1 A;  5HY6 A;  3VS4 A;  1UEC A;  4RTV A;  4M75 E;  4FCY A;  2RPN A;  3A8G B;  2RH2 A;  1KD1 C;  3A5Z B;  2A3L A;  1WFW A;  3CCU Q;  1VOM A;  3M5A A;  4J9D A;  3OYA A;  1NPR A;  1GBR A;  4DBQ A;  2MPX C;  3V7R A;  3PMT A;  4AFS C;  3I56 T;  3OW2 A;  2QGF B;  3TVT A;  1YNZ A;  1J3T A;  4RTW A;  1R8O B;  6AT1 B;  4AT1 B;  3E1S A;  2XI9 A;  1K8A U;  3VU3 C;  2CSQ A;  4V2S A;  5GAN 2;  4C8Q B;  1U3O A;  2HQX A;  5FU7 B;  3QJY A;  3L2W A;  3DKM A;  1V76 A;  2DVE A;  2SRC A;  1M90 C;  3OYG A;  1T0J A;  4Z02 A;  5GMK h;  2P0P A;  3CBP A;  1NLP C;  1PWT A;  2JOY A;  3QDR B;  5A0D A;  2E4H A;  2CZ1 B;  2OAU A;  3WVD B;  5IN1 A;  2KQW A;  3CC7 A;  1VQ5 T;  4MZP A;  4N4I A;  1RAB B;  5IT9 E;  3M55 A;  4HT8 A;  1VQM T;  1CKA A;  3QJ6 A;  2DAQ A;  3QWY A;  2GTJ A;  2WSE E;  3RBB B;  2QXF A;  3HRS A;  2B86 A;  2CH4 A;  1VQ6 T;  1JXO A;  4JRQ A;  2RHX A;  1VQ5 A;  3EG3 A;  4M4Z A;  1YBY A;  2RQU A;  1YN8 A;  1YWO A;  4C8Q A;  3I5S A;  5GAN f;  1QMC A;  4CC7 A;  2RQW A;  3VYH B;  2GQI A;  1PC0 A;  4HT9 A;  1I81 A;  1TUC A;  3UF4 A;  4C92 F;  2F69 A;  1RAE B;  5HKC A;  3QYG B;  4JS4 A;  1VQ6 A;  4RG8 A;  2AZS A;  2EBP A;  4M75 D;  4RTX A;  2KDS A;  5ECA A;  1MHN A;  2DYB A;  5I2M A;  3C4S A;  2ESW A;  1BI2 A;  4EMG A;  2EGA A;  1SF9 A;  2FEI A;  2VGN A;  1WNL A;  2AZV A;  3UA7 A;  5CO7 A;  4E7Z A;  1AZG B;  1G2B A;  1MND A;  3VRZ A;  1SSH A;  2EYW A;  4QQG A;  4F7U G;  1KHI A;  5KYY A;  5KE3 A;  2MYS A;  1IGQ A;  4AFZ C;  5A0G A;  1M3B A;  2GF7 A;  1OEB A;  2MWP A;  2MK5 A;  4FIB A;  2X35 A;  1RAD B;  2EJG A;  4FU6 A;  4KGX B;  1QVF P;  2HBP A;  1XQH A;  4LNP A;  4M7A E;  1JB0 E;  4E47 A;  2RHU A;  4KGZ B;  3CCJ T;  2VV5 A;  1VYU A;  3E2U A;  4JLI A;  3CCQ T;  4E2F B;  1OI1 A;  5LJ5 g;  5LJ3 f;  2K9G A;  2ED0 A;  3LGF A;  2HL3 A;  1N8R R;  2RI5 A;  2CZ6 B;  3CCJ A;  2D0N A;  1ZUY A;  2ZZD A;  1IRE B;  2F2W A;  3UPU A;  3CCQ A;  2QGG A;  2HSE B;  3M53 A;  2GCX A;  4OMP A;  2QA4 T;  1VQ8 T;  1M4Z A;  4OB0 B;  2LNV A;  3O8V A;  4GLK A;  1TTH B;  3S3O A;  4N0A A;  1H3Z A;  2JS0 A;  5GAN d;  1N6A A;  5IXF A;  3ZL7 C;  2XIC A;  3G6E Q;  4N4H A;  1NPP A;  2QA4 A;  5HK3 A;  4CC2 A;  3RER A;  4VUB A;  1T3S A;  3GLX A;  4OMQ A;  3CXC S;  3THK A;  3JAM E;  2LNH B;  1E6H A;  4LD9 K;  2PUK B;  3OS5 A;  1YHQ T;  3G4S Q;  4E7L A;  4UC4 A;  2KAF A;  4EMH A;  5J3B A;  4IUR A;  3CCL T;  1C1A A;  2DTO A;  4DA4 A;  4OGE A;  2CUD A;  2XDB A;  2X3X D;  2CKK A;  3A8M B;  4LDX A;  1YHQ A;  2GQV A;  2JM9 A;  1QVG S;  4C5H A;  5GAN 5;  1VQK A;  3FRN A;  2ABL A;  2XMF A;  3CCL A;  2K5L A;  4JZ4 A;  4C92 C;  2QYZ A;  1X27 A;  4M7A D;  1VYV A;  2DYI A;  4KUL A;  4Z89 A;  1M1F A;  2O4X B;  1VQO Q;  1GFD A;  2RK2 A;  3OS1 A;  2PVO B;  1H3H A;  5LJ3 d;  2C0T A;  1RL2 A;  1SRL A;  4FYV B;  2DLP A;  1RI9 A;  2XG8 D;  1GCQ A;  2ED1 A;  4EMK C;  3JB9 D;  1SPK A;  3NHN A;  1KC8 R;  2W0Z A;  2DIG A;  4ESR A;  5FRM A;  2BUD A;  2DBM A;  3FDR A;  3PIO A;  1HD3 A;  1X2K A;  2JTF A;  4C5I A;  3CD6 Q;  3J7A F;  4BDY A;  2L5Q A;  2GNC A;  5GAN e;  2ZAE A;  1KQ2 A;  1D3B B;  4L59 A;  4ZNX A;  3S3N A;  2IG0 A;  3EFR A;  5D6Y A;  2LVM A;  1RAH B;  4C8Q F;  5GAM h;  2E64 A;  2ENM A;  4OP0 A;  1Q7Y U;  1DJ7 B;  5KYN A;  1WHK A;  2XID A;  2J6K A;  2EGC A;  3ZEH A;  3J80 E;  2RD1 A;  3CCS Q;  3RKY A;  3JCM X;  1M3C A;  2YWW A;  4EDU A;  3VS3 A;  5DLQ E;  1WJS A;  3AHU A;  1VQP Q;  4A54 A;  3P8B B;  2DIL A;  3GNG A;  4P5N A;  4PJM A;  1WJR A;  3JCM h;  1K4U S;  1UG1 A;  3M57 A;  1RI0 A;  2B8A A;  4FYW B;  1PD0 A;  2DE0 X;  4M78 G;  4OMF B;  2DKG A;  3SHW A;  3SFM A;  1UB4 A;  1Q86 R;  2KGT A;  4PJO B;  2E6Z A;  3EFO B;  1OYX A;  2LP5 A;  4FSX A;  1G8X A;  3RIR A;  2XDP A;  2X3W D;  2WAC A;  4XTU A;  2D1X A;  2VB6 A;  4A4G A;  1U8R A;  1H8K A;  2DMO A;  3MP6 A;  2GGR A;  3BW1 A;  2H8H A;  2K2V A;  3A8L B;  4FT2 A;  4RKU E;  4IUV A;  1WHL A;  2DPP B;  3CMA A;  2A36 A;  4IUP A;  2DD5 A;  3G71 T;  2LDM A;  1EFN A;  2XD0 A;  5KE2 A;  2H3E B;  3C12 A;  1WQ7 A;  2COZ A;  2X51 A;  2QK0 A;  1CKB A;  5LJ5 j;  5L23 A;  1HXD A;  5LJ5 f;  1VQ4 A;  1YJW Q;  2O9V A;  5CKB A;  4AG2 C;  5I11 A;  3X26 B;  4QW2 A;  3G71 A;  2DEQ A;  3EFO A;  4Z88 A;  3HFO A;  1D1C A;  1NYG A;  5CQX A;  2AIR B;  4ORZ A;  1E6G A;  4JJB A;  1K73 C;  1X01 A;  4F16 A;  1K8A R;  4PFZ A;  4R56 A;  5GAO q;  4Z8A A;  1AWX A;  2CP0 A;  3LH5 A;  1LNX A;  3MHX A;  3M0S A;  2DZC A;  5GAO n;  4Y28 E;  4O5V A;  2FPE A;  1M90 R;  1ZSZ B;  5CCA A;  3EG1 A;  4CC3 A;  4MMK A;  1PNJ A;  1SHG A;  1NJI U;  4DOW A;  3HRU A;  2L3Q A;  3CPW S;  3BFM A;  3VS1 A;  2K2M A;  1XTD A;  2FYK A;  4NL2 A;  5EC7 A;  2SEM A;  1XOV A;  2R5A A;  1BK2 A;  3OA6 A;  4E7H A;  2BIV A;  4EPC A;  2CP7 A;  3CCV Q;  1JXM A;  1I0C A;  4C8Q C;  2VAS A;  3FJP A;  3I55 Q;  5FU7 C;  3CD6 T;  4FSS A;  2QTX A;  4HCC A;  1PRM C;  4X9C A;  2CZ0 B;  3A1P A;  1YCS B;  1ZSZ A;  1YWP A;  2FRW A;  4HVU A;  4LN2 A;  1QLY A;  1NZ9 A;  2DRM A;  3CC7 Q;  1U1T A;  4RG2 A;  2K79 A;  4WCI A;  3S6W A;  2DTI A;  3RKX A;  2DD4 A;  3MPU B;  4BE1 A;  1W2B S;  1EX4 A;  1QW1 A;  2LJ0 A;  1KC8 U;  2P0K A;  5CKD A;  4C92 E;  1NYF A;  2DIQ A;  2J6F A;  2VVK A;  2ZGW A;  3DLL A;  2OX7 A;  3L1A A;  2QEX Q;  5AT1 B;  4J9G A;  3CME T;  1R0B G;  2L3P A;  2YUQ A;  2OTJ T;  1OX8 A;  5LL6 S;  5HK0 A;  2E12 A;  3EAE A;  2KK4 A;  2XHC A;  3QO3 A;  3J81 E;  1VA7 A;  2JMC A;  3HP9 A;  4A4H A;  3SDZ A;  2FG0 A;  2KYB A;  4F7U B;  3MEA A;  3JB9 J;  3MEW A;  2EKH A;  1K9A A;  4PKC C;  3O5Z A;  1ARK A;  2OTJ A;  3QDF A;  2LX7 A;  3C94 A;  3DB4 A;  1YJ9 T;  1ZBX A;  2FZK B;  2DVJ A;  1Q82 U;  2EPD A;  1AWJ A;  4M77 G;  1QQJ A;  1ZSG A;  3SB2 A;  4LDU A;  3TU4 K;  2PQW A;  4XAX B;  4OVA A;  1HJD A;  3E9G A;  3EHQ A;  4R0K A;  2RJF A;  3LH0 A;  2HMA A;  3TSW A;  2E3H A;  3QSU A;  4X9D A;  5A0L A;  4RTY A;  1YJW T;  2VKN A;  3MEU A;  2OAW A;  2MWO A;  4M7D G;  2JTE A;  3EGX B;  1YI2 Q;  4N0A C;  4KBM B;  1FWZ A;  4F7U A;  8ATC B;  1BIB A;  4IKF A;  3TRE A;  1KQ1 A;  1ZBJ A;  2LTO A;  2F5K A;  2RQT A;  2J05 A;  1ZA2 B;  1JJ2 S;  5FLX E;  5LJ5 e;  1G5V A;  3LW5 E;  5GMK i;  3VKI A;  1V1C A;  3JCM V;  3A98 A;  2KXC A;  4J9E A;  1WHM A;  4A63 B;  2IPO B;  4OMN A;  3CC2 A;  2YLB A;  4ZGJ B;  2KRM A;  5GAO m;  1KD1 U;  2DA9 A;  3H0F A;  4D8K A;  2CP6 A;  2Y4Y A;  3CQT A;  3VYG A;  3EGX A;  4PJO F;  3SD4 A;  1UEB A;  3M0P A;  1VQ7 Q;  2K3X A;  1YJN T;  3WXM B;  2MAM A;  4BUG A;  4CC4 B;  3E9F A;  2FZG B;  1PSF A;  3KUF A;  1PKS A;  4XU1 A;  2KYM A;  1BI0 A;  2JUF A;  1TXQ A;  3DLM A;  3I56 A;  3V7S A;  3CCM Q;  2LT4 A;  3PFS A;  1QWF A;  5FRO A;  1Q81 C;  1M90 U;  2BZY A;  5CVI A;  1GCQ C;  2EIF A;  1WGS A;  1GCP A;  1JRI A;  1M1K C;  3UT1 A;  2FHD A;  1AVZ C;  1PG5 B;  3L2R A;  2MF2 A;  2EQM A;  2NUT B;  3UA6 A;  3TCJ A;  4DEX A;  5KCH A;  3M0R A;  4XTZ A;  4Q5W A;  1VQL T;  4OB2 B;  1MMN A;  4XU3 A;  1VQM A;  1ZUK A;  3M54 A;  2RJE A;  1K1Z A;  3SWN B;  5KH6 A;  2KT8 A;  3HFN A;  2M0O A;  1Q7Y R;  2ZCF B;  3NTH A;  1B3Q A;  1AOJ A;  1IRX A;  2PVG B;  1PCX A;  2KBT A;  5C0M A;  1K9M C;  3V8J A;  3MJX A;  4AFQ C;  4GLM A;  3CXC P;  1KG1 A;  3MET A;  3EHR A;  4BI8 B;  2OTL Q;  3EH1 A;  1K0X A;  1Y0M A;  1MV3 A;  2YRC A;  5GAN 3;  2COW A;  4C8Q E;  2NUT A;  4BY6 B;  1TSF A;  4PK4 A;  2D0Q B;  3CCE Q;  2E65 A;  4M75 G;  3CCR Q;  3GP8 A;  2O01 E;  2OJ2 A;  4IIO A;  2LCS A;  3SWN A;  4E7S A;  1RLP C;  4R55 A;  2HBW A;  2DO3 A;  2VC8 A;  5GMK l;  1X43 A;  1BKB A;  2X4Y A;  1MNE A;  2V1R A;  2HCK A;  4YTL A;  1WXB A;  3FB9 A;  2EGE A;  4M78 B;  1D0Y A;  2HQE A;  1ZA1 B;  2XDD A;  2JW4 A;  2ROL A;  3OYC A;  2EVR A;  5GAN h;  5CK9 A;  3OYK A;  3X25 B;  2LCC A;  3FC3 A;  1K0S A;  1WHH A;  2MCN A;  3JCM c;  2LC4 A;  5M9O A;  3KFV A;  2C0O A;  2DER A;  3HKS A;  1KFZ A;  4PJO C;  3CPF A;  1RUW A;  4AFU C;  2CZ7 B;  1BI1 A;  2E5Q A;  2RHY A;  3V8L A;  1ZX6 A;  1M9S A;  3NTK A;  2BE7 D;  2L8D A;  3PE0 A;  3VV0 A;  3CCU T;  3PIP A;  1XJW B;  1KK7 A;  5FWB A;  3CMA Q;  3HPW A;  1D0X A;  1TU0 B;  1BCO A;  4DOV A;  2HL5 C;  4M78 A;  1Y57 A;  5EG2 A;  2DL5 A;  1SEM A;  1D1B A;  2IVW A;  2QDY B;  1U1S A;  1VQ8 A;  1IGU A;  4F7U F;  2NUP B;  1VQ4 Q;  2EW3 A;  2QQB A;  4QVZ A;  2HDA A;  5GAO r;  1NJI R;  4BE0 A;  1R77 A;  1GBQ A;  1NM7 A;  1TG0 A;  1VQN Q;  2EAY A;  1MGQ A;  1YIT Q;  4C8Q D;  2V8I A;  1B07 A;  5LJ3 h;  3LX7 A;  3EG0 A;  4JRP A;  4JPB W;  2DF6 A;  5D6W A;  2JMA A;  2DXB A;  1LJO A;  3NTI A;  2DK3 A;  2CT4 A;  3L2Q A;  2YLC A;  2QQR A;  2ZPI B;  1VQ9 Q;  1D09 B;  1P92 A;  2X4W A;  2NUP A;  1VYT A;  2ZPB B;  1EIF A;  5FRN A;  3VS6 A;  1B7T A;  1X6G A;  3OS0 A;  1ZSZ C;  3QZ9 B;  2WSC E;  5GAM j;  3M58 A;  1V29 B;  4X34 A;  2K6D A;  5GAM f;  5C6S A;  4BD3 A;  3ZBD A;  1PHT A;  2I2L A;  1UGS B;  1QVF S;  1VUB A;  4CRI A;  1UHF A;  1ABO A;  4XTV A;  1Y71 A;  4M7A G;  2E10 A;  4LUD A;  1TOV A;  4RUG A;  2E70 A;  2PZ1 A;  4C0D B;  1X2Q A;  3OYB A;  3JCM f;  2A37 A;  3EG2 A;  2LQN A;  3QG1 A;  3JB9 G;  3LYI A;  5CAI A;  4OB3 B;  4QKU A;  1ABQ A;  1X75 C;  5D6X A;  1C0M A;  3C95 A;  1O9S A;  2O4X A;  4JRK A;  1BIA A;  2JJ9 A;  4IUU A;  4ME7 A;  3CC4 Q;  1NE8 A;  3M0T A;  1Q82 R;  4MDX A;  4RTU A;  2KSS A;  4C5E A;  3OYD A;  2W10 A;  1QP3 A;  4L5G A;  1N9S A;  4J9F A;  2RB6 A;  3CPW P;  3QBY A;  1UGR B;  4PFP A;  1TH7 A;  2DXU A;  1D3B A;  1O75 A;  1GRI A;  5A2Q E;  3FEO A;  1S72 Q;  1QVP A;  2RI3 A;  3OYH A;  3EG9 B;  4BE2 A;  4OMM A;  1OUL A;  2DJZ A;  2EQJ A;  3RDV A;  5KYU B;  1N27 A;  9ATC B;  2CP5 A;  4M77 B;  1W4S A;  1LOJ A;  2RF0 A;  1WZO A;  2R58 A;  1BCM A;  1KQS P;  2F2V A;  2DXC A;  1UGP B;  3BY7 A;  2M1H A;  1YIJ Q;  1RAF B;  2BZ8 A;  2CDT A;  1M5Q 1;  3FJ5 A;  1NBE B;  2V8J A;  1KHC A;  3OQ5 A;  2ZPH B;  3OSS C;  3G6E T;  2M51 A;  4A4K A;  5IHI A;  4M7D B;  3CEY A;  2ATC B;  2ZPG B;  1AWO A;  2EQU A;  1KD1 R;  3CXC A;  2ECZ A;  5CR2 A;  1X6B A;  2LZ6 B;  4PJO A;  2DX1 A;  3DB3 A;  1OZ2 A;  3C0C A;  3EG9 A;  5FU6 B;  3RNJ A;  1JEG A;  4JJC A;  1QP2 A;  4XTW A;  1G83 A;  1D1A A;  3G6E A;  3G4S T;  2EJ9 A;  1N8R C;  4NS5 A;  2DTH A;  4FYX B;  1WX6 A;  1PSE A;  2FPF A;  2QTV A;  4M77 A;  1PKT A;  1BYM A;  5GAO l;  2PU9 B;  2LT1 A;  3V8K A;  3Q1J A;  4A53 A;  1K73 U;  2RN8 A;  1LCK A;  4NL3 A;  1H92 A;  2DXT A;  4XQ3 A;  2O2O A;  1QCO A;  3SEM A;  1AZE A;  3OMC A;  3G4S A;  4M78 F;  2RMO A;  3CC2 Q;  2YDL A;  4M7D A;  2NWM A;  3QHS A;  4BAC A;  4PJO E; 
#chains in the Genus database with same CATH homology
 4RCC A;  4KBM B;  2RO0 A;  3MP1 A;  1ZHI A;  2K4Y A;  2AHJ B;  3KXT A;  4J6Y A;  1FWZ A;  3FLG A;  2ZPE B;  3PGG A;  4QQG A;  4F7U G;  1KHI A;  1BIB A;  2QI2 A;  2ZPF B;  3CBM A;  5KE3 A;  5GAN 8;  2OTL T;  2RHZ A;  4IKF A;  3TRE A;  5A0G A;  1JBM A;  4E7J A;  2GF7 A;  1KQ1 A;  4LDY A;  2LTO A;  2F5K A;  2MWP A;  1VQO T;  3X28 B;  5J26 A;  2P4T A;  4FIB A;  2X35 A;  1JJ2 S;  2E1H A;  5FLX E;  2EJG A;  5LJ5 e;  4BB7 A;  1G5V A;  4FU6 A;  3CCE T;  3LW5 E;  5GMK i;  3VKI A;  2JTM A;  2HBP A;  1XQH A;  5LJ5 h;  3JCM V;  3CCR T;  1WQW A;  4M7A E;  1JB0 E;  4E47 A;  2RHU A;  3LWI A;  2OTL A;  3CCJ T;  2VV5 A;  3CC2 A;  2YLB A;  4ZGJ B;  3FIF A;  3P8D A;  5GAO m;  4JLI A;  1VQO A;  1KD1 U;  3CCQ T;  1OI1 A;  3ZFJ A;  5LJ5 g;  5LJ3 f;  3OYJ A;  4N4G A;  3UWN A;  1YCY A;  3ME9 A;  3JSC A;  2K5F A;  3OW2 S;  5GAM e;  3CCE A;  2Y4Y A;  3M4Y A;  3LGF A;  1Q7Y C;  3OBY A;  3VYG A;  1Y96 B;  4PJO F;  3OYY A;  3CCR A;  3SD4 A;  2RI5 A;  4MDW A;  2CZ6 B;  1UEB A;  2FB7 A;  3CCJ A;  2K3X A;  1YJN T;  3WXM B;  2MAM A;  2ZZD A;  1Y07 A;  3UDC A;  1WPY A;  4BUG A;  5GAN 6;  1IRE B;  4M78 D;  3UPU A;  1I5L A;  3E9F A;  3CCQ A;  4B9X A;  3CD6 A;  4NOY A;  1H64 1;  1PSF A;  3M53 A;  3KUF A;  2GCX A;  2F5T X;  4JLG A;  4XU1 A;  1BI0 A;  2RJC A;  5LJ5 d;  2JUF A;  3OYM A;  2QA4 T;  1VQ8 T;  2LQK A;  1M4Z A;  4OB0 B;  3X24 B;  3DLM A;  2LNV A;  3V7S A;  3I56 A;  3O8V A;  3HRT A;  2LT4 A;  3PFS A;  3JCM e;  4GLK A;  5CQY A;  3CCS T;  3BDL A;  4N0A A;  3S3O A;  4HCZ A;  4M7A F;  1H3Z A;  5FRO A;  1Y7X A;  5GMK m;  1Q81 C;  5GAN d;  1M90 U;  1N6A A;  5CVI A;  2XIC A;  4M75 C;  4N4H A;  2EIF A;  1WGS A;  2LCL A;  3A8H B;  1JRI A;  1VQP T;  3HL8 A;  5GAM d;  1NPP A;  2QA4 A;  1M1K C;  3SWN C;  5HK3 A;  3HHT B;  3UT1 A;  2FHD A;  3CMA T;  3RER A;  3INZ A;  4IUT A;  4VUB A;  1Y96 A;  3GLX A;  3L2R A;  3CCS A;  3JB9 F;  3GPL A;  3RKW A;  3CXC S;  4XTY A;  3JAM E;  3JB9 H;  2MF2 A;  2EQM A;  3OY9 A;  4LD9 K;  4IUQ A;  2PUK B;  2M16 A;  4C0G A;  4BDZ A;  3TCJ A;  2QQ9 A;  3OS5 A;  5KCH A;  2HAX A;  3HSB A;  2CS7 A;  3OBW A;  1YHQ T;  1FXX A;  2QQA A;  5LJ3 e;  1VQ4 T;  2R5M A;  1B34 B;  4XTZ A;  1SSF A;  4E7L A;  4UC4 A;  4Q5W A;  2KAF A;  1VQL T;  4M75 B;  4EMH A;  3CME A;  5J3B A;  4IUR A;  4OB2 B;  3CCL T;  2DTO A;  4FM4 B;  4ELZ C;  4XU3 A;  4DA4 A;  1VQM A;  3M54 A;  2RJE A;  4OGE A;  3SWN B;  5KH6 A;  4A4E A;  2XDB A;  2XKO C;  2X4J A;  4KT0 E;  2V8K A;  1M8V A;  3JCM d;  2CKK A;  3JB9 I;  1VQN T;  3HFN A;  2CGH A;  2M0O A;  3A8M B;  3T9N A;  2ZCF B;  2RHI A;  4LDX A;  3NTH A;  1YIT T;  4BY6 C;  1YHQ A;  1YIJ T;  2PVG B;  2GQV A;  2RA2 A;  1QVG S;  1N8R U;  2A7Y A;  3H8Z A;  4C5H A;  3LLR A;  3V8J A;  3FRN A;  5C0M A;  5GAN 5;  1K9M C;  1VQK A;  4JJN K;  4ATO A;  3CCL A;  2K5L A;  1QVG A;  4C92 C;  4QVC A;  1YJ9 A;  4M7A D;  3JRZ A;  1KG1 A;  3MET A;  4BI8 B;  2HNI A;  3G7Z A;  2JVV A;  1VQN A;  4KUL A;  3L2Z A;  3WVE B;  4PL6 A;  5GAN 3;  1YIT A;  4XU0 A;  4MML A;  1M1F A;  2O4X B;  4C8Q E;  1VQ9 T;  3MO8 A;  2RK2 A;  3BDU A;  4C0Z A;  3OS1 A;  3QYH B;  2PVO B;  5LJ3 d;  1N9R A;  1RL2 A;  4BY6 B;  1HK9 A;  1B34 A;  2RM4 A;  2GFA A;  2D0Q B;  4M78 C;  2XG8 D;  4M75 A;  4LD6 A;  2E65 A;  1Q86 C;  4M75 G;  1G3Y A;  4EMK C;  3JB9 D;  5I21 A;  4M77 E;  3GP8 A;  1YJW A;  2CYZ B;  2O01 E;  4C92 B;  1QVF A;  3SWN A;  5CKH A;  3MP8 A;  4HKE A;  4OF1 A;  4R55 A;  2DIG A;  2DO3 A;  2FVU A;  5FRM A;  2D6F A;  2BUD A;  4A4F A;  2VC8 A;  1VQ9 A;  5GMK l;  3FDR A;  3PIO A;  2YRV A;  1BKB A;  2E6N A;  1NJI C;  2JTF A;  1VIE A;  4C5I A;  5GAO p;  2X4Y A;  5GMK j;  3J7A F;  3L2V A;  4YTL A;  1G3T A;  4BDY A;  3FB9 A;  2L5Q A;  4PLI A;  5GAN e;  3GF5 A;  3RES A;  4M7D E;  4M78 B;  1X6O A;  5GAN 7;  4F7U A;  1FX7 A;  2HQE A;  1KQ2 A;  1D3B B;  2EJF A;  2XDD A;  4EMK B;  4L59 A;  2KY9 A;  4C92 D;  2LRQ A;  3OYC A;  1XNI A;  5GAN h;  5CK9 A;  3OYK A;  3S3N A;  2IG0 A;  3EFR A;  3X25 B;  2LCC A;  5D6Y A;  4QQD A;  4XU2 A;  4ELY C;  4F7U E;  3FC3 A;  5CIU A;  5DY9 A;  1ZQ1 A;  2LVM A;  4C5G A;  3OYE A;  3CPW A;  4C8Q F;  2JN0 A;  2YHT A;  5GAM h;  3P8H A;  5J39 A;  3L42 A;  2E64 A;  2Y4X A;  4FL6 A;  3JCM c;  5GAN g;  2LC4 A;  5M9O A;  3JCM W;  1G3S A;  4OP0 A;  1Q7Y U;  1DJ7 B;  3OSV A;  3ZEH A;  2XID A;  3J80 E;  2RD1 A;  2X4X A;  3HKS A;  3H6Z A;  3CPF A;  2JZ2 A;  4M77 F;  3RKY A;  4PJO C;  5GAM g;  3JCM X;  3RMQ A;  4KUI A;  4C92 A;  2CZ7 B;  4EDU A;  1BI1 A;  4C92 G;  2E5Q A;  2HD0 A;  2RHY A;  3V8L A;  3NTK A;  1M9S A;  1KQS S;  3ER0 A;  2VYT A;  4ZTF A;  2EWN A;  3OMG A;  3CCV T;  2L8D A;  5DLQ E;  1WJS A;  3AHU A;  3VV0 A;  3PTA A;  3CCU T;  3CC4 T;  1K8A C;  4J6W A;  2RJD A;  4JDS A;  4A54 A;  3PIP A;  3P8B B;  1YJN A;  1KQS A;  3GNG A;  4PNO A;  3I55 T;  5L8R E;  3OB9 A;  3HPW A;  4FT4 A;  4P5N A;  1WJR A;  3JCM h;  4ZGE B;  4DOV A;  3M57 A;  1RI0 A;  2B8A A;  4M7D F;  4M78 A;  4M78 G;  4OMF B;  2DKG A;  3QXE B;  3SFM A;  2Y90 A;  3LWH A;  2XU8 A;  1UB4 A;  4EMK A;  5EG2 A;  3N5B B;  1KC8 C;  1Q81 U;  2IVW A;  2QDY B;  2VXE A;  1U1S A;  2RI2 A;  2E6Z A;  3GNF B;  3OYI A;  1VQ8 A;  1OYX A;  3CC7 T;  3CCV A;  4M7A C;  4FSX A;  4F7U F;  3KBG A;  4LDV A;  3RIR A;  3JCM g;  2QQB A;  2XDP A;  4QVZ A;  5KCO A;  2D9T A;  2WAC A;  3CC4 A;  4XTU A;  1UGQ B;  1M1K U;  1IZ6 A;  3I55 A;  3JCM J;  4A4G A;  4ZN3 A;  5GAO r;  1U8R A;  5DLO A;  1W2B A;  4BE0 A;  3OYF A;  2K3Y A;  1S72 T;  3M59 A;  3MP6 A;  3OYL A;  5IAY A;  3QPH A;  4KUD K;  3BW1 A;  2PUO B;  2R57 A;  3VJP A;  2EAY A;  2K2V A;  3A8L B;  1VQP A;  4FT2 A;  1MGQ A;  4RKU E;  4C8Q D;  4PJO D;  2V8I A;  4IUV A;  5LJ3 h;  2DPP B;  1VIF A;  3LX7 A;  3CMA A;  3OS2 A;  4IUP A;  3JCM Q;  2DD5 A;  3G71 T;  4JRP A;  2LDM A;  4M7A B;  2PVD B;  2XD0 A;  3X20 B;  4II1 A;  4J8O A;  5D6W A;  5KE2 A;  3OYN A;  3C12 A;  2FL7 A;  1WQ7 A;  4RMO A;  2DXB A;  2GFU A;  1LJO A;  4DQ2 A;  2QEX T;  4M77 D;  4OB1 B;  1S72 A;  5LJ3 g;  3NTI A;  5LJ5 j;  1HXD A;  5LJ5 f;  1VQ4 A;  2EKO A;  5CKB A;  3X26 B;  4CI0 C;  2DK3 A;  4B9W A;  1AHJ B;  1VQL A;  4BI3 A;  4QW2 A;  3L2Q A;  2YLC A;  2QQR A;  2ZPI B;  1M1G A;  3NFC A;  1GXI E;  1P92 A;  4WF2 A;  1Q82 C;  4PJO G;  2DEQ A;  5AYF A;  4O6J A;  3G71 A;  1OZ3 A;  3HFO A;  4J5Y A;  2X4W A;  4E7I A;  5GAN j;  2L89 A;  5CQX A;  2ZPB B;  1K9M U;  1EIF A;  5FRN A;  3RMS A;  2MMP A;  3VUB A;  2QEX A;  3OS0 A;  4BI4 A;  5DM7 R;  4M7D D;  3QZ9 B;  2WSC E;  1X01 A;  1K73 C;  5GAM j;  3M58 A;  3GOX A;  2BKD N;  1V29 B;  1YIJ A;  4X34 A;  4C0D C;  3LGL A;  5GAM f;  4R56 A;  5C6S A;  4BD3 A;  3ZBD A;  5GAO q;  5CKE A;  2M9U A;  2I2L A;  1UGS B;  1QVF S;  3A8O B;  4C0F A;  1VUB A;  4MZM A;  4CRI A;  3M9Q A;  4OGC A;  4D6W A;  2NLU A;  4JRI A;  3MHX A;  1LNX A;  3M4G A;  2JNG A;  4JS5 A;  4XTV A;  1Y71 A;  2K57 A;  4M7A A;  4M7A G;  4J7F A;  2DZC A;  2E10 A;  5GAO n;  1Q86 U;  3S3M A;  4Y28 E;  4O5V A;  3QUI A;  2E70 A;  5CCA A;  3M56 A;  2KMT A;  4MMK A;  4C0D B;  3OYB A;  3MEV A;  4ZTJ A;  2VGM A;  1NJI U;  3JCM f;  4QQ6 A;  3F70 A;  3R6O A;  2K5I A;  3CC2 T;  2E41 A;  3QG1 A;  3JCM P;  2KVQ G;  3URG A;  4DOW A;  3JB9 G;  3HRU A;  3LYI A;  4XTX A;  5CAI A;  3CPW S;  2VUB A;  3BFM A;  4OB3 B;  4ZN1 A;  1YI2 T;  4L6V 5;  2LX9 A;  1X75 C;  5D6X A;  1XTD A;  2FYK A;  5HY6 A;  4NL2 A;  3C95 A;  1O9S A;  4M75 E;  4HA8 A;  2O4X A;  4JRK A;  1XOV A;  2R5A A;  2EQK A;  4MZT A;  3OA6 A;  4E7H A;  1BIA A;  3A8G B;  2BIV A;  1JJ2 A;  4EPC A;  2RH2 A;  1KD1 C;  2L3R A;  3A5Z B;  2C06 A;  2H3J A;  2A3L A;  4IUU A;  4ME7 A;  4J83 A;  1NE8 A;  1YI2 A;  4C8Q C;  3M5A A;  3FJP A;  5LJ3 j;  3OYA A;  1NPR A;  2VXF A;  5FU7 C;  3CD6 T;  4MDX A;  2QTX A;  3V7C A;  4HCC A;  2KSS A;  2RK1 A;  4X9C A;  3V7R A;  4C5E A;  3OYD A;  2CZ0 B;  1BI3 A;  1QP3 A;  1N9S A;  3PMT A;  4L5G A;  3PNW C;  4M77 C;  3I56 T;  3OW2 A;  1NZ9 A;  1U1T A;  4J7I A;  2RB6 A;  4RG2 A;  1R8O B;  3S6W A;  4XK8 E;  3QBY A;  1UGR B;  2DTI A;  2XI9 A;  3E1S A;  3RKX A;  1K8A U;  3VU3 C;  1TH7 A;  2DXU A;  1D3B A;  1O75 A;  1WJQ A;  4V2S A;  5A2Q E;  5GAN 2;  3FEO A;  4C8Q B;  2P0Q A;  2DD4 A;  1QVP A;  2HQX A;  2RI3 A;  3OYH A;  3PMI A;  5FU7 B;  4BE1 A;  4BE2 A;  3QJY A;  3L2W A;  3DKM A;  1VQ7 T;  2DVE A;  1W2B S;  2DJZ A;  5GMK e;  1QW1 A;  4M75 F;  3CCU A;  4GY5 A;  4J6X A;  2EQJ A;  1M90 C;  4HCB A;  1KC8 U;  4M7D C;  4ZGD B;  1I8F A;  2P0K A;  3OYG A;  5CKD A;  4Z02 A;  1N27 A;  4C92 E;  2DIQ A;  2ZGW A;  2P0P A;  4M77 B;  4QVD A;  5GMK h;  1W4S A;  3CBP A;  3DLL A;  2JOY A;  3QDR B;  1LOJ A;  5A0D A;  3CBO A;  3L1A A;  2CZ1 B;  2OAU A;  2XK0 A;  2R58 A;  4PLL A;  3WVD B;  5IN1 A;  2DXC A;  2KQW A;  5FU6 C;  3CC7 A;  3CCM T;  1UGP B;  3BY7 A;  2M1H A;  2WSF E;  1VQ7 A;  1VQ5 T;  4MZP A;  3CME T;  2EFI A;  4N4I A;  5IT9 E;  4E7K A;  2EYQ A;  3M55 A;  1M5Q 1;  4HT8 A;  2OTJ T;  1I4K 1;  2V8J A;  3OQ5 A;  1KHC A;  1VQM T;  4M78 E;  5GAN 4;  2ZPH B;  3OSS C;  3G6E T;  4LDW A;  4A4K A;  3QJ6 A;  2DAQ A;  4M7D B;  3RUX A;  5LL6 S;  5CKF A;  5HK0 A;  2LQ8 A;  3CEY A;  2E12 A;  2WSE E;  2KK4 A;  2XHC A;  3ASK A;  3EAE A;  3QO3 A;  3J81 E;  2ZPG B;  3HP9 A;  2EQU A;  2QXF A;  3HRS A;  3SDZ A;  4A4H A;  5I2S A;  3CXC A;  4F7U B;  1VQ6 T;  3MEA A;  5CR2 A;  3MEW A;  3CCM A;  3JB9 J;  4JRQ A;  1VQK T;  2RHX A;  1VQ5 A;  1YBY A;  4C8Q A;  4PJO A;  4C8Q G;  3DB3 A;  1OZ2 A;  4PKC C;  3L2U A;  4JUV A;  3EFS A;  5FU6 B;  2OTJ A;  3QZ5 B;  1QP2 A;  3DB4 A;  3C94 A;  4RCB A;  4XTW A;  1ZBX A;  5GAN f;  3G6E A;  1YJ9 T;  3VUZ A;  3VYH B;  3G4S T;  2EJ9 A;  1N8R C;  2DTH A;  4NS5 A;  1Q82 U;  1G3W A;  4HT9 A;  1I81 A;  1PSE A;  4Y91 A;  4M77 A;  2F69 A;  4C92 F;  4M77 G;  4PJO B;  3MCA B;  2MI6 A;  3QII A;  1BYM A;  5GAO l;  5HKC A;  2PU9 B;  3QYG B;  4LDU A;  3SB2 A;  2PQW A;  3TU4 K;  4XAX B;  4OVA A;  2LT1 A;  4RG8 A;  3E19 A;  3E9G A;  4JS4 A;  1VQ6 A;  3V8K A;  3Q1J A;  4A53 A;  3JCM b;  3PT9 A;  1K73 U;  4M75 D;  4TVR A;  4NL3 A;  2KDS A;  2DXT A;  2RJF A;  1MHN A;  3LH0 A;  4XQ3 A;  3GIB A;  2QQS A;  3QSU A;  4X9D A;  5I2M A;  3C4S A;  5A0L A;  3OMC A;  2DZ9 A;  1BI2 A;  2G3R A;  3QKJ A;  4EMG A;  3G4S A;  3MEU A;  1YJW T;  2VGN A;  1WNL A;  4M78 F;  2MWO A;  4M7D A;  5CO7 A;  3QHS A;  4BAC A;  4M7D G;  3TEE A;  4PJO E;  4N0A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...