4M7AE

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
75
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDNEKVMQHHGRMLLSGNNIAILVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 12
structure length 75
sequence length 81
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aE00
1JRIA 5GAOq 3RKWA 1B34B 1HK9A 2E1HA 3RUXA 4M7DC 1U1TA 3QUIA 1N9SA 3RKYA 3V7RA 4PNOA 1JBMA 1Y96A 3SWNB 4M75E 5LJ3h 3JCMV 5GAMf 4M77B 3BFMA 3SWNC 4WF2A 4QVDA 4F7UE 2EAYA 5GAMd 4C8QB 5GAMg 4XQ3A 5GANd 4F7UF 5GAOn 1KQ2A 3JCMJ 4PJOE 3V8JA 4M77C 3JCMh 4XU3A 2ZGWA 4M7DA 4C8QC 4QVCA 1B34A 2YLCA 4M7DB 4XTXA 4J6WA 1Y96B 1M5Q1 3BY7A 3BDUA 4PJOG 1WQ7A 2Y90A 4J5YA 4XU1A 4M7DF 4M7AF 2RM4A 1X01A 4J6XA 4M78G 4M78A 4XTUA 3AHUA 5LJ5j 5GAN4 5GAOm 4M7AD 4M75B 3RESA 4C8QA 4A54A 3JB9G 4NL3A 1I8FA 1BIAA 4JRIA 2DXTA 1KQ1A 4PJOB 4C92A 5LJ5e 4C92G 4MMLA 2FB7A 4M78B 3JB9H 3JCMe 4JRKA 2DZ9A 2DKGA 2DTOA 2EJGA 2JN0A 2EJFA 2VXFA 1LNXA 4JLIA 4M78C 2E10A 4M77F 3L1AA 4M75A 4NOYA 4M75G 3EFSA 3JCMc 5GAN8 4JUVA 4M77D 4C92B 2CGHA 4F7UA 4F7UG 4A53A 5LJ5f 5LJ5g 5GAN2 5LJ5d 4M7AE 1YCYA 5LJ3j 4PJOA 3JCMf 4C92C 3JCMg 3BW1A 5GANh 1N9RA 1LJOA 3EFRA 5GAMh 4EMKB 4RCCA 2HNIA 4M7AG 1TH7A 4N0AA 1WPYA 3FIFA 3FJPA 1D3BA 3HFOA 4J6YA 4M75C 4F7UB 5LJ3e 3JCMP 4XTWA 5GAOl 5I21A 3JB9J 2FYKA 3QO3A 2QTXA 5CAIA 3JCMQ 4M7DD 4X9DA 5GMKm 4RCBA 5GAOr 4PJOC 5GANj 1I81A 3V7CA 4M78F 3GIBA 4M7AB 4M77E 4XTVA 2DJZA 2EWNA 4EMKA 3QSUA 1HXDA 5LJ3f 1D3BB 2YHTA 4C8QF 5LJ3g 4M78D 2DTHA 5LJ3d 3JCMW 4MMKA 4N0AC 4XTZA 3RERA 4EMHA 5DY9A 2EJ9A 5GANe 4C8QD 3RKXA 2DEQA 2RA2A 5GMKh 4V2SA 3PGGA 4X9CA 4C92F 2E41A 4XU2A 3JCMd 4EMGA 1WQWA 4DQ2A 5GAN6 2DVEA 2K57A 1BIBA 1U1SA 4C92D 4XU0A 4HT9A 4Y91A 4M7AA 3QHSA 3V8LA 5GAN3 5GAOp 4M7DE 4EMKC 4M75F 3FB9A 5GANf 4NL2A 3RIRA 5GANg 5LJ5h 3V7SA 2DZCA 2E64A 2VC8A 3VU3C 4M75D 5GMKj 3JB9I 3HSBA 2RB6A 1I5LA 4M7DG 2DXUA 4OP0A 2RD1A 4PJOF 4M78E 2I2LA 5GAMj 3M4GA 3JCMb 3SB2A 1M8VA 1I4K1 3L2ZA 3V8KA 4HT8A 1LOJA 4C8QE 4PJOD 1H641 5GAN5 5GMKe 3INZA 3SWNA 5GMKi 3JCMX 5GMKl 1MGQA 3JB9F 4M7AC 2YLBA 4XTYA 3HFNA 1WNLA 4M77A 5GAMe 4M77G 2DTIA 4C92E 2VXEA 5GAN7 3JB9D 4HA8A 4C8QG 2E65A
chains in the Genus database with same CATH superfamily
1UFFA 1DJ7B 1WHMA 1D0ZA 4M7DC 2RN8A 3EGXA 3GNGA 2YDLA 4BY6B 2QGGA 1MV3A 3JCMV 1Q7YC 2P0PA 5GAMg 1PSEA 3I9QA 3M0PA 5I2SA 2GFAA 1YJ9Q 2FL7A 5FLXE 4OF1A 4JJCA 1W4SA 4QVCA 1JJ2S 1JO8A 3H0FA 5IT9E 1ZUKA 4XTUA 2KSSA 1IGUA 1X2KA 3QZ9B 4J9IA 4D8DA 2O2OA 1YITQ 1IRXA 3CPFA 4RMOA 4C5EA 2QTVA 2DXTA 4C92A 4E7KA 2RK1A 4LNPA 4PLIA 4CC3A 2JN0A 2RHZA 1QQJA 1Q82U 4M77F 1UUEA 3E9GA 3EFSA 2PU9B 4F7UA 4RUGA 5LJ3j 4OB0B 4L59A 3QDFA 1IXDA 3HKSA 5KYWB 3VS0A 3FJPA 1PNJA 4A63B 2NUZA 5FU6B 5GAOl 4FSXA 3CCLT 1E6HA 2BZYA 1TSFA 3V7CA 1FMKA 3EH1A 4R55A 1VQLQ 2LQWA 2HAXA 1ZSZB 1RL2A 4FT2A 1KG1A 1OOTA 1XQHA 5AT1B 4Z89A 2LJ1A 2RA2A 3EAEA 2E5QA 1PRLC 2K57A 1UJ0A 4KH0B 1T0JA 1XTDA 3EFOA 1NE8A 4WTOB 2K5IA 4OB1B 1LVKA 2EQJA 2QQRA 3M0QA 1SRMA 3M9QA 4QW2A 2Y4YA 3MP8A 1UTIA 4R0KA 1B34B 3A8LB 3VV0A 3OMGA 3OA6A 4DOWA 3SDZA 2DO3A 1QKXA 3M4YA 4ZGEB 1G3YA 2MOXA 2QA4T 1IREB 1NLOC 3C94A 4KUIA 2EYWA 4PJOE 1ZSGA 3E2UA 3REBB 4ATOA 2FPDA 3NGPA 1MMNA 1IGQA 2L2PA 1N8RR 1WQ7A 2KRNA 2RM4A 1NYFA 4QQ6A 1OPLA 4LDXA 4M75B 1YWOA 3RESA 3CC2A 4JRIA 1VQNA 3M53A 4X34A 2MIOA 2JUFA 3H41A 3EGDB 3H6ZA 3QWYA 4C0ZA 3OYBA 5CQYA 1G3WA 2X51A 4FCYA 5LJ5f 2LCCA 1ZQ1A 1NEGA 4PKCC 3G6ET 1LPLA 2O01E 3MHXA 4EMKB 2RJCA 5HK0A 1W1FA 1WPYA 2PUKB 2X4XA 2A36A 2JM8A 1U5SA 1S72T 2K79A 2CP6A 2QDLA 3JCMQ 3CMEQ 1ZBJA 2ZZDA 4X9DA 2CZ6B 4CI0C 4OMOA 4J8OA 4KBMB 1AWJA 4TVRA 5GMKh 5C6SA 4RTVA 4V2SA 1IO6A 5GAN6 2JS2A 2DVEA 2XD0A 1R0CB 3CCSA 3I5RA 5GAOp 4ZN3A 1AD5A 3QXEB 2M0OA 5KYUB 2RMOA 1NJIU 5LJ5h 5GMKj 2RPNA 3JB9I 2CUBA 1VOMA 1UE9A 4LDUA 1V76A 1FMVA 4LUEA 4XK8E 1BCMA 2KROA 4M77G 2MAMA 2OTJQ 4AG2C 2RI5A 1AWXA 2VV5A 3L2VA 1NYGA 1CSKA 2IG0A 3OYYA 5GAMf 5GANd 3V8JA 4XU3A 3EGXB 4GY5A 4N4HA 3OS2A 2XDBA 2R57A 1J3TA 3BDUA 2ROTA 1VQMT 4M7AD 2YSQA 3PTAA 1UECA 1QVGP 3G1JA 2RQVA 3SFMA 3PE0A 5CIUA 2ABLA 5KH6A 4C92B 2ZPBB 1N8RC 5KYYB 3G71A 1YIJQ 2FZGB 4J9DA 2MF2A 4LDYA 2KXDA 5GAMh 4FYXB 4ORZA 1M1FA 4C5IA 2JJ9A 5J3BA 3FIFA 4FIBA 4J6YA 4F7UB 1HSQA 1NEBA 1W2BP 3G7ZA 2LJ0A 4M7DD 1KJWA 3JSCA 3VS6A 4PJOC 2JZ2A 1Q82R 3CBPA 3M59A 4C8QF 3TCJA 3U23A 2LNHB 5A2QE 1PD1A 2IIMA 2EJ9A 4IKFA 2HKQB 3VJPA 3OS1A 4XU2A 3G4SQ 3VRZA 3GOXA 1YJNA 4JRPA 3CC2T 3RIRA 1VQNT 1RLQC 2E64A 3L42A 2L3RA 2DXUA 2L3PA 2I2LA 3M4GA 1YHQQ 3M55A 3CCUQ 4LDVA 1QCNA 4XTYA 4PFOA 3M0SA 3CCRA 2RI2A 2FO0A 2VXEA 3CCEA 4ANJA 3SD4A 2M0YA 4A4FA 1M1KU 2LNVA 2HQHA 2M16A 3C95A 4FW2A 4PNOA 2VUBA 2JM9A 2SEMA 2VWFA 1MMAA 3MO8A 2HKNA 4B9XA 3JCMh 2ZGWA 4C8QC 3C0CA 5I22A 3PVLA 1TOVA 1K0SA 4K11A 1M5Q1 3A8OB 2NWMA 1WHGA 2E6NA 2CZ7B 3OYHA 3ME9A 5GJVB 1VIEA 4F04B 5CK9A 1V1CA 2PVOB 1M2OA 1XJWB 3CCST 1X27A 2EJGA 1AHJB 1YJWQ 3L1AA 1E6GA 2GNCA 2EQKA 3TSZA 4M77D 1QVFA 1Y57A 4M7AE 1OQKA 3UATA 2W0ZA 3N5BB 4EIKA 4C0DB 3PIOA 2HDAA 2HNIA 1BKBA 2ZPGB 4N0AA 2QXFA 2D8HA 3M54A 4XTWA 3CCMQ 2FYKA 1X6GA 2LQ8A 3QYGB 2GCXA 3META 4DEYA 2F69A 1VQ6Q 3MPUB 2V8JA 2XU8A 1I07A 3QSUA 1RAAB 4JPBW 5FU7C 2P0QA 4JJBA 2EQMA 1KQSA 1GCPA 4XU0A 3PVQA 1G5VA 4M7DE 1ZSZA 2G6FX 3FB9A 1VQ4Q 1VQ5A 3HRSA 1YFNA 1VQOA 1BYMA 1Q82C 2PZ1A 3JAME 2V1RA 3VS4A 2B8AA 1OZ3A 2RF0A 3CMAQ 2PVDB 3MEAA 2ROLA 3JCMX 4DEXA 1B07A 5ECAA 2OTLA 5FROA 1BU1A 1YP5A 3G71T 3VS3A 4OMLA 4E6RA 3DLLA 1T3SA 4LN2A 1FX7A 2LRQA 5CQXA 4FT4A 1NJIR 4OMMA 1UGQB 3SWNC 2EAYA 2ED1A 1QWFA 1B34A 5D6XA 3NTIA 4PK4A 2J06A 1N6AA 3J7AF 3KUFA 3UDCA 4FW1A 4JZ3A 5EC7A 2J7IA 3JV3A 3EG2A 1YJNT 4AFSC 2DX1A 2MI6A 2O88A 3MP6A 2X4JA 4M75A 2AIRB 2DA9A 3JCMc 4MDWA 3VS7A 1BI3A 2CGHA 1YN8A 2DNUA 2P84A 3LGFA 3CCRT 3CCET 2ZPIB 1JEGA 2CDTA 1Y7XA 5I21A 3QO3A 2F2XA 1PHTA 2CP0A 3LW5E 2D0NA 4M77E 4HVWA 2DJZA 4EMKA 3JCMW 4C0FA 2ZAEA 1SRLA 4LXCA 2F2WA 4B6MA 2QQSA 1OULA 2QYZA 1GFCA 1D1BA 1MNEA 5GANe 1AZEA 1YITA 8ATCB 4C92F 4EPCA 4KUDK 1TUDA 4J9CA 2DM1A 4Z8AA 2WSFE 2JS0A 3TU4K 4KH1B 2NUTA 2EQUA 1ZUUA 5CKHA 1VQ9T 2YUQA 2DMOA 2V26A 2YRCA 3F70A 1GBQA 3AT1B 3URGA 3A98A 1ZA1B 3FDRA 3CBMA 3CC7Q 3OYDA 4M7AC 2YLBA 1HJDA 4PJJA 1OPKA 5CKEA 2IPOB 1X43A 3OYFA 1C6VX 2ZPHB 3QIIA 2CSIA 3HTRA 1VQLA 3GPLA 2GQIA 1WGSA 1UGRB 4XU1A 4J5YA 4J9FA 4M78A 1X01A 3AHUA 1HD3A 2OAUA 1VYVA 2X4YA 4BE1A 4DBRA 2YWWA 1M1KR 3RNJA 1BIAA 2KK4A 1ZX6A 2DL5A 2DBKA 5L8RE 2GTOA 3I55A 1NJIC 3DKMA 4PJOB 5GJWB 2GBQA 3DB4A 2KGTA 2EIFA 2GTJA 2LP5A 4HKEA 3OS0A 3CCJA 2K2MA 2CH4W 2XDDA 1D1CA 4KRTA 4A53A 5GAN2 5LJ5d 2J05A 2FVUA 3X28B 1UHFA 2OTLT 1GCQA 4RCCA 1PRMC 2LMJA 1RABB 3M0UA 1CKAA 1D3BA 1PD0A 4BE2A 3OYEA 5IHIA 5CAIA 2I0NA 5KYYA 1YI2A 3UWNA 4E7LA 1OYXA 4LD6A 2KYBA 3OW2A 4FSSA 1U06A 1NLPC 4A4KA 1SF9A 4C8QD 1WFWA 2CZ0B 3VS2A 6AT1B 2C0IA 2LJ3A 5GAN3 2XG8D 2A08A 2QA4Q 2O9SA 2DZCA 4E2FB 3VU3C 1NPPA 2RB6A 2RHYA 3GNFB 1JU5C 3A5ZB 3L2UA 3CCVA 1GBRA 1MUZA 1KK7A 1ACMB 3L2RA 3X25B 1R77A 1JJ2A 1EX4A 2ZPFB 2MK5A 3KBGA 2BE7D 3RUXA 3QUIA 1K9AA 1X6OA 3CMEA 1HYOA 2COWA 3A1PA 3SHWA 5GAMd 1PKTA 4M77C 1X69A 2JTMA 4ESRA 4J9GA 1IHVA 2R5AA 3J80E 2RJDA 1BK2A 2X35A 4BI4A 2K6DA 2BUDA 3R6OA 1FXXA 2QEXA 3S3OA 1S72Q 1KQ1A 4C92G 4IURA 4Z88A 5AYFA 5FU7B 3TQ7P 4JS4A 3CC4Q 4F7UG 4JRQA 2OTJA 2CP5A 2YUOA 5I2MA 2OX7A 1LJOA 1N9RA 5IN1A 2QG9B 3I56A 3CXCA 1M1KC 1VQ8A 4BACA 2Y4XA 2A0FB 5LJ3e 3QPHA 2MMPA 2LX7A 3EG0A 2MWPA 1A0NB 1BI0A 2HEQA 1B3QA 1VQLT 2C0OA 2RQRA 2DTHA 1Q81R 4XTZA 1C1AA 3FRNA 4BI3A 1QVPA 2XK0A 3WVDB 1RAIB 3JCMd 4PLLA 4OMPA 1RUWA 2EVRA 2DD4A 3UA7A 3QZ5B 1U1SA 3QHSA 3V8LA 4MDXA 4GLKA 5D6YA 1I0CA 2HZYA 2CH4A 2KR3A 4NL2A 5GANg 5DM7R 3I55T 3QJ6A 3X20B 4JLGA 2E4HA 1I5LA 4BDYA 3A8MB 3REAB 2NUTB 3L2ZA 4C8QE 1H641 2ZCFB 1YIJA 3RR6A 3CCJT 1VQMQ 2BKDN 1JRIA 2K5FA 3EH2A 3ZL7C 2AK5A 3BDLA 4D6WA 2AZVA 3BFMA 4II1A 2E3HA 3M5AA 1YI2T 1VYTA 3OQ5A 3P8BB 1WA7A 4OGCA 3FEOA 4J9EA 5C0MA 5IXBA 5LJ5j 3G4SA 4Z02A 3JB9G 4NL3A 4M4ZA 3CD6A 4KT0E 1VIFA 2EFIA 4CC2A 2O9VA 1WX6A 2HBWA 5FRMA 4M78B 2XDPA 1YHQA 3OBYA 3CCUA 2W10A 2YXYA 3NTKA 1NG2A 3CCVT 2K2VA 2P4TA 4N4IA 2O4XB 3HP9A 2LZ6B 2LTOA 3ULRB 3CMET 5GAOr 1SEMA 4ZNXA 4M7AB 4AFQC 1M8MA 1D3BB 1XNIA 4LE9A 4E7ZA 2JOYA 1Z9ZA 1UGVA 1SHGA 4AFUC 3M57A 2DEQA 2E12A 1WXUA 2PUOB 3S3NA 4C92D 2D8JA 2QEXT 2FRYA 2LVMA 1QP2A 4PJNA 4E7JA 1K73R 2D0QB 2BZXA 1YJWA 4ZN1A 5GAMj 2DRMA 1Q95G 1M8VA 1WHJA 2COYA 1RACB 1Q81C 1NPRA 5GMKe 1KD1R 3OYNA 2KEAA 3NMZC 4M7DB 2V8IA 4HA8A 2JW4A 2ESWA 5GAOq 1HK9A 4ELZC 3I56T 1VQ8T 1UEBA 2BIVA 1N9SA 3CCMA 2KY9A 2H8HA 4BY6C 4WF2A 2KRSA 1VQ6A 2CT3A 5HKCA 4Y28E 1KC8U 2COZA 1B7TA 2KQWA 4FYVB 1X2QA 1VA7A 2FPEA 4B9WA 4KULA 1VQ4A 3CPWA 1RAHB 1I5OB 5FW9A 2ECZA 2DZ9A 1W70A 2EYQA 3CMAA 4OB3B 4FL6A 2XIDA 3CQTA 4XAXB 1YCYA 4PJOA 3VS5A 2QI2A 1IB8A 2A3LA 4PFZA 1BI1A 1AEYA 4A4EA 5KE2A 3D7SB 1D1AA 1RAGB 2DEUA 5CO7A 3FJ5A 5FU6C 2DJQA 1I81A 1KQSS 2BTTA 3P8DA 1UGSB 4OVAA 3QDRB 4ZGJB 5LJ3g 2QASA 1ZSZC 2EGCA 3PGGA 3CXCP 3CCQQ 2KAFA 3G4ST 4D8KA 3P8HA 2HMAA 4PJMA 1VQ7Q 1VQKQ 1RAEB 4M75F 3CD6T 5GANf 1G3TA 3H9NA 3UA6A 1Y07A 3C12A 2ENMA 1GFDA 3HSBA 4OP0A 1NZ9A 2HSEB 2XICA 3RMQA 1ZUYA 1O75A 4IIMA 3LGLA 3CCUT 1EZZB 2KBTA 1LOJA 3V8KA 5GAN5 1QMCA 4BDZA 4QT7A 2F1LA 2KT1A 1QWEA 4E47A 3H8ZA 3MJXA 3A8HB 4C92E 4F14A 4ZTJA 5FWBA 4J9BA 1EFNA 4DBFA 1U1TA 2V1QA 3NPFA 2VB6A 3RKYA 5EG2A 1Y0MA 3PMIA 3LYIA 2PQWA 1KIKA 2DAQA 4PL6A 5HY6A 4CC4B 4F7UE 3OYAA 1GL5A 1RAFB 4J6WA 1KD1C 3O8VA 1K76A 4PJOG 2FRWA 2CKKA 3ZFJA 3LWIA 4A54A 5KYXB 4HXJA 3A8GB 5I11A 3JCMe 2PTKA 1K9MR 2YUNA 4J83A 3CC7A 1YJWT 1WDXA 2EGEA 2EBPA 3ASKA 5GAN8 4E7SA 2GFUA 2DF6A 4JUVA 3LWHA 3X26B 3GLXA 1W6XA 3EHQA 5IXFA 1PSFA 2VASA 1VQ9Q 2K4YA 1M3BA 2KE9A 2K5LA 2CYZB 2EKOA 3CCMT 1MHNA 2VVKA 4BB7A 4VUBA 3S6WA 3LX7A 1WXTA 3QWXX 4M78F 3GIBA 1VQ6T 2EYXA 5J26A 3CEYA 3OB9A 1H3ZA 1QKWA 4MMKA 5HK3A 4PFPA 1M30A 2VGNA 1Q81U 2BE9B 1IZ6A 1QP3A 4X9CA 2E41A 1VQPQ 4EMGA 1WQWA 4ELYC 2AHJB 2KMTA 1K8AU 2VKNA 4HT9A 4Y91A 4BI8B 2RQUA 2C06A 1E7OA 1BB9A 1UB4A 1SPKA 3PNWC 1YJ9A 3M56A 2KYMA 1ZA2B 2RQWA 3OSSC 1I4K1 3CMAT 1M3AA 2K3BA 2GQVA 2GF7A 3SWNA 3HFNA 4GLMA 2E65A 1OX9A 1U8RA 4WCIA 3X24B 3NFCA 3EG9A 1T0HA 1WHLA 3S3MA 4XQ3A 4F7UF 3JCMJ 2LT1A 3CBOA 1OEBA 2X3XD 3I35A 1QW1A 4QQGA 1TXQA 3LH5A 4IUVA 2OTLQ 1ABQA 2ED0A 2EKHA 2CP7A 2G3RA 4ZGDB 2L0AA 2K3YA 3OMCA 2BZ8A 2KXCA 3EG1A 2OAWA 5J39A 2WACA 5DLOA 2LQKA 2QA4A 2JT4A 2DRKA 2NLUA 3HPWA 2F5TX 2DKGA 4LUDA 2DE0X 4JLIA 1M90R 2A7YA 4M75G 3FLGA 2LT4A 2MCNA 1KC8R 2RK2A 1K0XA 2JTEA 4C92C 2K7AA 1ZHIA 4HVVA 1FWZA 4A4HA 1H8KA 3CPWP 3CCLQ 1PC0A 3JB9J 1R8OB 4RG8A 4AFZC 2L89A 3OYKA 3M0TA 5GMKm 1K9MC 1AVZC 2E5KA 2FG0A 1VQ5T 1VQOT 1Y71A 5LJ3f 1CKBA 2HBPA 2YHTA 8AT1B 4QQDA 3QKJA 2O4XA 2RI3A 1Q86U 2RHXA 2E3IA 3UPUA 1S72A 4M7AA 3MP1A 2RO0A 1KHCA 3TEEA 3VYHB 3THKA 1QVGA 1M2VB 3V7SA 9ATCB 4FM4B 1K73U 1S1NA 3JCMb 2KT8A 2RHUA 2Z0WA 4O5VA 3OYMA 3CC4A 1QVFP 3INZA 4F16A 3CC7T 2C0TA 3ER0A 3JB9F 3NTHA 1KD1U 2QAZA 2DIQA 2QGFB 2EGAA 5HCKA 2P4RA 3H0HA 2CP2A 4RTYA 4BD3A 5LJ3h 1W2BA 2DILA 4QVDA 4NS5A 4C8QB 2DXBA 4DOVA 1UGPB 4JS5A 4DA4A 4M7DA 4RG2A 4DBHA 3DB3A 2IVWA 1M4ZA 1H92A 3C4SA 4J6XA 4M78G 1LCKA 5LL6S 3VYGA 5GAOm 1KQSP 1G8XA 1D0XA 1RADB 4N4GA 2LQNA 3MEUA 2PVGB 4MMLA 3JB9H 2QQ9A 3FC3A 1WIEA 2E70A 4JRKA 3PIPA 4ZTFA 2VXFA 2CUDA 3CXCS 1YJ9T 1VQMA 3VUZA 3JCMg 3G6EQ 1C0MA 2CREA 1YITT 4M7AG 4JDSA 3MCAB 4C0DC 3ZBDA 2AKKA 2A37A 3I55Q 1JXOA 3E19A 2FZCB 4RCBA 1UG1A 1M90C 4LD9K 5KCOA 2NUPB 3CCJQ 5CCAA 1KC8C 1SKUB 1BBZA 3HRTA 3I5SA 4DQ2A 3L2WA 4RTZA 5D7UA 1BIBA 2DD5A 3LH0A 1TS9A 5CVIA 5IH2A 4M75D 2KVQG 1EIFA 1YI2Q 4M7DG 4RTTA 2QK0A 3VS1A 2VYTA 2LCSA 2CSQA 2DL4A 1MGQA 1QCOA 2MPXC 4M77A 2DTIA 1QCFA 2RQTA 2B86A 1SHFA 1QLYA 1K8AR 2QDYB 3KFVA 1JQQA 1JBMA 3SWNB 2XHCA 2XMFA 1G83A 5GAOn 1FMWA 2CZ1B 2CP3A 2XKOC 3Q1JA 1PWTA 4XTXA 4FYYB 3M0RA 3CCVQ 4JJDA 3EG9B 2Y90A 2M1HA 2X4WA 2CT4A 1NBEB 2HD0A 5A0LA 1I8FA 2X3WD 2F5KA 2LCLA 1M1GA 2YUPA 2FHDA 2EJFA 2RHIA 1RI9A 3IQLA 4IUQA 4OMFB 1K9MU 2R5MA 5KYXA 3OYJA 4HCBA 3CC4T 1X6BA 4IUTA 5KCHA 1KHIA 3GF5A 2JXBA 4IIOA 5D6WA 4JJNK 2LDMA 5CKDA 1ABOA 5CKFA 2QEXQ 2RH2A 3HRUA 2KRMA 1O9SA 4L5GA 1Q7YU 1R0BG 2JVVA 1KSWA 3E9FA 1TWBA 2HSPA 2WSCE 1HXDA 2QQBA 5IHNA 4J7FA 4M78D 1Z9QA 5DY9A 1WJSA 1SG5A 1ZBXA 2HL5C 3I56Q 1VQ8Q 4A4GA 1WJRA 2DXCA 4F17A 5FRNA 3CC2Q 1VQNQ 2H3EB 2P0KA 2DLPA 4J9HA 2RJFA 2HQXA 4PJOF 1D0YA 4UC4A 3SB2A 5A0GA 4Q5WA 5FWCA 1AWOA 5GMKi 1XOVA 1Q86R 1TG0A 2M9UA 4MZPA 1VYUA 2DVJA 4OMQA 2OI3A 2VGMA 3OYGA 2WSEE 1Y96A 4QVZA 4M75E 2JTFA 3MKDA 1JB0E 1YWPA 1PM3A 2JNGA 1IHWA 1AOJA 4RTWA 4YTLA 3OYCA 3OW2P 3CPWS 3QYHB 2MWOA 3BY7A 3L2QA 3CCQA 7AT1B 5A0DA 1K8AC 4OB2B 2AKLA 2OTJT 1VQ7A 1VQKA 5CR2A 4KGVB 2HQEA 3CCSQ 5LJ5e 1OU8A 1M9SA 1TUGB 4IUUA 4LDWA 3J81E 4NOYA 1YCSB 1M90U 2AZSA 4HCZA 2D9TA 1K4US 1YNZA 1MNDA 1YBYA 3OSVA 1GRIA 3JRZA 3TREA 3JCMf 3OYIA 1D09B 1I1JA 1MV0B 1UJYA 3NHNA 1UHCA 1JJ2P 3KXTA 4E7IA 2DL8A 2FZKB 2JMAA 2DYBA 2ZPEB 3CD6Q 2DBMA 2L3SA 3HFOA 4AT1B 3RBBB 3JCMP 1QVFS 2QTXA 1X75C 2L3QA 2OJ2A 5CKBA 1AT1B 5IAYA 4XTVA 3EFOB 1AZGB 1M27C 4N0AC 3RERA 1N27A 3VRYA 3E1SA 1YIJT 1U3OA 2KDSA 1WHHA 2QQAA 1MMGA 2DERA 2VC8A 4MZTA 3UT1A 4C5GA 3DLMA 3TSWA 4M78E 2V8KA 1WYXA 1M3CA 2KNBB 4HT8A 1SSFA 1PG5B 3LLRA 4IUPA 5GAMe 5GAN7 3G71Q 3JB9D 1M2VA 1F1BB 2EPDA 1VQ9A 2E1HA 4RTXA 1G2BA 3TVTA 3OS5A 4GBQA 1OZ2A 2YRDA 2M51A 4M77B 3UF4A 2AT1B 1KQ2A 2FEIA 2E6ZA 1N5ZA 1TTHB 1YHQT 2XI9A 3WVEB 1Q86C 2DL7A 4L6V5 1VQPA 1WLPB 5GAN4 4HCKA 3RMSA 4C8QA 2YT6A 4JZ4A 3PFSA 2FB7A 1MMDA 3RDVA 1YJNQ 4QKUA 4HVUA 1K73C 2EQIA 2DIGA 2R58A 1WI7A 2SRCA 2KI7A 5KYWA 5KYNA 4CC7A 1ZLMA 5GANh 3EFRA 5M9OA 3CCRQ 4C0GA 3CCEQ 4M75C 1AWWA 2EW3A 3R6NA 4O6JA 4CRIA 3VUBA 2NYSA 4C5HA 5GANj 1WXBA 3OY9A 2MYSA 3SEMA 1BI2A 1K1ZA 5LJ3d 3M58A 2X9HA 2HL3A 4HCCA 3CCQT 3O5ZA 1FYNA 2LX9A 2M02A 1JXMA 4EMKC 1VQ7T 2NUPA 1VQKT 2RJEA 2EYZA 1Q7YR 2DYIA 2RD1A 1RLPC 4BUGA 1SSHA 1G3SA 4RTUA 1N8RU 4ME7A 3H0IA 2J6KA 4C8QG 3RKWA 1V29B 1P92A 4EDUA 3MEVA 3V7RA 3CCLA 4DBQA 1OU9A 1VQ4T 1KFZA 4P5NA 1PKSA 1GXIE 1WZOA 4FYWB 2YLCA 3GP8A 2EYYA 4AG1C 1Y96B 4M7AF 3QBYA 3EGDA 2PNIA 2D6FA 4AMCA 5DLQE 1OX8A 2D1XA 2DTOA 4M78C 1VQ5Q 1LNXA 1VQOQ 2DK3A 2E10A 4FU6A 3VKIA 1UDLA 2FPFA 3OBWA 5LJ5g 2L5QA 4Y92A 3MEWA 3BW1A 3EG3A 4R56A 1NM7A 1TH7A 2JMCA 1BCOA 1H3HA 4M7DF 2K9GA 2RNAA 3ZEHA 2YRVA 1PCXA 4PJLA 4J7IA 2H3JA 3EGUA 2L8DA 3HL8A 5L23A 1TUCA 2DFUA 4E7HA 2O31A 2A28A 4RKUE 3PMTA 2EWNA 1GCQC 1OV3A 2GGRA 3QG1A 3WXMB 1WHKA 2J6FA 4EMHA 2LC4A 5KE3A 5KYUA 1VUBA 3RKXA 4MZMA 1QVGS 2DL3A 2HCKA 3BE3A 4KGZB 1VQPT 1ARKA 1OI1A 1RI0A 2CS7A 1WJQA 2F2VA 3EHRA 3QJYA 2DETA 4BE0A 3OYLA 3HHTB 3OW2S 4KGXB 1TU0B 4OGEA 4OMNA 3PT9A 2ATCB 3GBQA 3T9NA 4PJOD 5IHKA 4X1VA 2K3XA 5GMKl 2DPPB 3G6EA 1W2BS 1WNLA 1T3LA 2J6OA
chains in the Genus database with same CATH topology
5GAOq 1DJ7B 1HK9A 4M7DC 3DLLA 4ELZC 3I56T 2QDYB 1UEBA 3GNGA 1VQ8T 2BIVA 1N9SA 4BY6B 3CCMA 1FX7A 1JBMA 3SWNB 2LRQA 5CQXA 4FT4A 3JCMV 2KY9A 4BY6C 2XHCA 1UGQB 3SWNC 1Q7YC 2P0PA 4WF2A 5GAMg 1PSEA 2EAYA 1VQ6A 5I2SA 2GFAA 5HKCA 5GAOn 2CZ1B 2FL7A 5FLXE 4OF1A 4QVCA 1W4SA 2XKOC 1JJ2S 3Q1JA 1B34A 5D6XA 4XTXA 3NTIA 4Y28E 5IT9E 1KC8U 2Y90A 2M1HA 2KQWA 1N6AA 4XTUA 2KSSA 3QZ9B 3KUFA 3J7AF 2X4WA 2HD0A 3UDCA 4B9WA 3CPFA 4RMOA 5A0LA 4C5EA 1I8FA 4KULA 1VQ4A 3CPWA 2DXTA 2F5KA 2LCLA 4C92A 4E7KA 2RK1A 1M1GA 1YJNT 2MI6A 2DZ9A 2FHDA 4PLIA 3MP6A 2RHZA 2EJFA 2JN0A 2X4JA 2RHIA 2EYQA 3CMAA 1Q82U 4M77F 3E9GA 4IUQA 4M75A 4OMFB 4OB3B 4FL6A 2XIDA 1K9MU 3EFSA 3JCMc 2R5MA 4MDWA 2PU9B 3OYJA 1BI3A 2CGHA 4XAXB 4F7UA 4HCBA 3CC4T 1YCYA 5LJ3j 4PJOA 2QI2A 4IUTA 2A3LA 4OB0B 4L59A 1KHIA 5KCHA 3GF5A 3HKSA 3LGFA 5D6WA 3CCRT 4JJNK 1BI1A 2LDMA 5CKDA 3CCET 5CKFA 4A4EA 2ZPIB 5KE2A 2RH2A 3FJPA 3HRUA 5FU6B 5GAOl 1Y7XA 4FSXA 5CO7A 5I21A 3QO3A 1O9SA 4L5GA 3CCLT 5FU6C 1Q7YU 3LW5E 1I81A 3V7CA 4R55A 1KQSS 2JVVA 4M77E 2HAXA 3E9FA 3P8DA 2DJZA 2WSCE 1RL2A 1UGSB 1HXDA 4OVAA 3QDRB 2QQBA 4EMKA 4ZGJB 4FT2A 4J7FA 4C0FA 4M78D 5LJ3g 3JCMW 1KG1A 2QQSA 1XQHA 5DY9A 5GANe 1WJSA 1ZBXA 2RA2A 3EAEA 1YITA 3PGGA 4C92F 2E5QA 4EPCA 2KAFA 4KUDK 2K57A 2WSFE 4A4GA 3G4ST 1WJRA 1XTDA 2DXCA 3TU4K 3P8HA 3JB9I 5FRNA 2EQUA 1NE8A 4M75F 5CKHA 2K5IA 1VQ9T 3CD6T 5GANf 1G3TA 4OB1B 1Y07A 2EQJA 2P0KA 2QQRA 3C12A 3F70A 3HSBA 2RJFA 2HQXA 4PJOF 4OP0A 1NZ9A 2XICA 4UC4A 3RMQA 3M9QA 3URGA 1O75A 3SB2A 4QW2A 5A0GA 3FDRA 4Q5WA 3LGLA 3CCUT 3V8KA 1LOJA 3CBMA 5GAN5 3OYDA 5GMKi 4M7AC 2Y4YA 4BDZA 1XOVA 2YLBA 3MP8A 2M9UA 4MZPA 4E47A 3H8ZA 5CKEA 3A8HB 4C92E 4ZTJA 2VGMA 1B34B 3A8LB 3VV0A 3OMGA 3OYGA 3OA6A 1U1TA 3OYFA 4DOWA 3SDZA 2DO3A 2WSEE 3RKYA 3M4YA 5EG2A 1Y96A 4QVZA 4M75E 3PMIA 2JTFA 2ZPHB 3LYIA 2PQWA 3QIIA 2DAQA 4PL6A 5HY6A 1JB0E 4ZGEB 1G3YA 4F7UE 2QA4T 1VQLA 1IREB 2JNGA 3C94A 3OYAA 4KUIA 4PJOE 4YTLA 3GPLA 3OYCA 4ATOA 1WGSA 4J6WA 1KD1C 3CPWS 3QYHB 2MWOA 3O8VA 3BY7A 4PJOG 1UGRB 1WQ7A 4XU1A 4J5YA 3L2QA 3CCQA 2RM4A 1X01A 4M78A 3AHUA 5A0DA 2CKKA 4QQ6A 2OAUA 1K8AC 2X4YA 4OB2B 4M75B 3ZFJA 3RESA 3LWIA 4BE1A 4LDXA 4A54A 2OTJT 1VQ7A 1VQKA 5CR2A 3CC2A 1BIAA 2KK4A 4JRIA 1VQNA 2HQEA 5L8RE 3I55A 1NJIC 3M53A 3DKMA 4PJOB 5LJ5e 3A8GB 4X34A 3DB4A 2JUFA 3H6ZA 3OYBA 4C0ZA 1M9SA 3JCMe 4IUUA 2EIFA 4LDWA 4HKEA 3J81E 3OS0A 4J83A 4NOYA 1G3WA 5CQYA 3CC7A 1YJWT 3CCJA 1M90U 4HCZA 2D9TA 3ASKA 5GAN8 2XDDA 2GFUA 3LWHA 4JUVA 5LJ5f 2LCCA 1YBYA 3OSVA 3X26B 4A53A 5GAN2 1ZQ1A 5LJ5d 3JRZA 3TREA 3JCMf 3GLXA 4PKCC 3OYIA 2FVUA 3X28B 3G6ET 3MHXA 2O01E 4EMKB 3KXTA 4E7IA 2OTLT 4RCCA 1PSFA 2RJCA 5HK0A 2ZPEB 1WPYA 2PUKB 3HFOA 1D3BA 2K4YA 2X4XA 1YHQA 4BE2A 3JCMP 1S72T 3OYEA 1QVFS 2QTXA 1X75C 2K5LA 2CYZB 2EKOA 5CAIA 2ZZDA 4X9DA 1MHNA 3JCMQ 3CCMT 2CZ6B 1YI2A 5CKBA 3UWNA 4VUBA 4BB7A 3S6WA 4CI0C 4E7LA 3LX7A 4M78F 3GIBA 5IAYA 4XTVA 1VQ6T 5J26A 1OYXA 4J8OA 3CEYA 3OB9A 4LD6A 1VQ8A 1H3ZA 3OW2A 4KBMB 4MMKA 4N0AC 4TVRA 5HK3A 3RERA 4A4KA 2VGNA 1N27A 4C8QD 5GMKh 5C6SA 1Q81U 4V2SA 1IZ6A 1QP3A 4X9CA 2E41A 3E1SA 1YIJT 4EMGA 2CZ0B 1WQWA 5GAN6 4ELYC 2AHJB 2DVEA 2KDSA 2KMTA 1K8AU 2XD0A 4HT9A 3CCSA 4Y91A 2QQAA 5GAN3 5GAOp 2XG8D 4BI8B 4ZN3A 3QXEB 2C06A 2M0OA 1UB4A 1NJIU 5LJ5h 2DZCA 2VC8A 3VU3C 4MZTA 5GMKj 3PNWC 1NPPA 3UT1A 2RB6A 4C5GA 3M56A 2RHYA 3GNFB 1YJ9A 3DLMA 4M78E 2V8KA 3OSSC 4LDUA 1I4K1 3A5ZB 4HT8A 3CMAT 1SSFA 3L2UA 3CCVA 2GQVA 2GF7A 3SWNA 3LLRA 3HFNA 4XK8E 4IUPA 5GAMe 5GAN7 4M77G 2MAMA 3X25B 3L2RA 3JB9D 1JJ2A 2E65A 2ZPFB 2RI5A 1VQ9A 3KBGA 1U8RA 2E1HA 3RUXA 2VV5A 3QUIA 3OS5A 3X24B 3NFCA 1OZ2A 3L2VA 1X6OA 3CMEA 2IG0A 3OYYA 5GAMf 4M77B 5GANd 5GAMd 3S3MA 4XQ3A 1KQ2A 4F7UF 3JCMJ 2LT1A 3CBOA 4M77C 4XU3A 3V8JA 4GY5A 4N4HA 2E6ZA 3OS2A 2XDBA 2JTMA 1QW1A 2R57A 1YHQT 2XI9A 3WVEB 4QQGA 2R5AA 1Q86C 3J80E 3BDUA 2RJDA 4IUVA 4L6V5 1VQPA 2X35A 1VQMT 5GAN4 2G3RA 4BI4A 4ZGDB 4M7AD 2K3YA 3OMCA 3RMSA 2BUDA 4C8QA 3R6OA 1FXXA 5J39A 2QEXA 3S3OA 2WACA 3PTAA 5DLOA 2LQKA 2QA4A 1KQ1A 4C92G 3PFSA 2FB7A 4IURA 2NLUA 1K73C 3HPWA 2F5TX 2DKGA 4JLIA 5AYFA 5CIUA 2A7YA 3SFMA 5FU7B 2DIGA 2R58A 4M75G 3FLGA 2LT4A 4JS4A 5KH6A 4C92B 2ZPBB 4F7UG 1N8RC 4JRQA 3G71A 2RK2A 2OTJA 4C92C 2MF2A 5I2MA 4LDYA 1ZHIA 5GANh 1N9RA 1LJOA 3EFRA 5IN1A 5M9OA 5GAMh 1FWZA 3I56A 4A4HA 4C0GA 3CXCA 4BACA 1M1KC 1M1FA 4C5IA 2Y4XA 5J3BA 3FIFA 3QPHA 4FIBA 4J6YA 4M75C 4F7UB 5LJ3e 4O6JA 3G7ZA 2MMPA 4CRIA 3JB9J 1R8OB 3VUBA 2MWPA 4RG8A 4M7DD 2L89A 3JSCA 1BI0A 3OYKA 5GMKm 4PJOC 4C5HA 5GANj 1K9MC 2JZ2A 1VQLT 1VQ5T 3CBPA 1VQOT 3OY9A 1Y71A 5LJ3f 2HBPA 2YHTA 3M59A 4C8QF 4QQDA 1BI2A 2DTHA 5LJ3d 3TCJA 5A2QE 4XTZA 3QKJA 2O4XA 2EJ9A 3M58A 4IKFA 3FRNA 2RI3A 4BI3A 3VJPA 1QVPA 2RHXA 1Q86U 2XK0A 3WVDB 4XU2A 3OS1A 3UPUA 3JCMd 4HCCA 4PLLA 3CCQT 2DD4A 2LX9A 1U1SA 3QZ5B 1S72A 4M7AA 3QHSA 3V8LA 3MP1A 4GLKA 3GOXA 4MDXA 5D6YA 4EMKC 1YJNA 2RO0A 1KHCA 1VQ7T 1VQKT 2RJEA 4JRPA 3CC2T 4NL2A 3RIRA 1VQNT 3TEEA 3VYHB 5DM7R 5GANg 1QVGA 3V7SA 3I55T 2E64A 3QJ6A 3L42A 3X20B 4JLGA 1I5LA 2L3RA 2DXUA 4FM4B 2RD1A 1K73U 2I2LA 3M4GA 3JCMb 3M55A 2RHUA 4BDYA 3A8MB 4O5VA 4BUGA 3OYMA 3L2ZA 3CC4A 1G3SA 4C8QE 1H641 2ZCFB 4LDVA 1YIJA 3INZA 3CC7T 3JB9F 3ER0A 3CCJT 4XTYA 3NTHA 1N8RU 4ME7A 2BKDN 3CCRA 1KD1U 2RI2A 2DIQA 2VXEA 3CCEA 4M7AG 4C8QG 3SD4A 1JRIA 3RKWA 1V29B 1P92A 4EDUA 4A4FA 2K5FA 1M1KU 3MEVA 2LNVA 2M16A 3V7RA 3C95A 4PNOA 3CCLA 2VUBA 3BDLA 4BD3A 4D6WA 5LJ3h 1W2BA 4QVDA 3BFMA 1VQ4T 4NS5A 3MO8A 4II1A 2DXBA 4P5NA 4C8QB 4DOVA 1UGPB 1GXIE 4B9XA 3JCMh 4JS5A 4DA4A 2ZGWA 4M7DA 3M5AA 4RG2A 4C8QC 1YI2T 3P8BB 3OQ5A 2YLCA 3GP8A 3DB3A 1Y96B 2IVWA 1M5Q1 4OGCA 3A8OB 3FEOA 5C0MA 4M7AF 1M4ZA 2E6NA 3C4SA 4J6XA 2CZ7B 3QBYA 4M78G 3ME9A 5LL6S 3VYGA 5LJ5j 5GAOm 3OYHA 3G4SA 4Z02A 1VIEA 4N4GA 3JB9G 4NL3A 3CD6A 4KT0E 1VIFA 2EFIA 5CK9A 3MEUA 5FRMA 2PVOB 2PVGB 2D6FA 3CCST 4MMLA 4M78B 2QQ9A 3FC3A 3JB9H 2E70A 5DLQE 4JRKA 3PIPA 4ZTFA 2VXFA 2DTOA 2XDPA 2EJGA 3OBYA 4M78C 3CCUA 1LNXA 1AHJB 3CXCS 2DK3A 2E10A 3L1AA 3NTKA 4FU6A 1YJ9T 3VKIA 2EQKA 1VQMA 4M77D 3OBWA 1QVFA 5LJ5g 2L5QA 3VUZA 4M7AE 3CCVT 3JCMg 3MEWA 3BW1A 2K2VA 4R56A 3N5BB 4C0DB 3PIOA 2HNIA 1YITT 1TH7A 2P4TA 1BKBA 2ZPGB 4N0AA 4N4IA 2QXFA 4JDSA 3MCAB 4M7DF 2O4XB 3ZBDA 3ZEHA 4C0DC 2YRVA 3HP9A 3M54A 4XTWA 4J7IA 2FYKA 2LTOA 2H3JA 2L8DA 3HL8A 2LQ8A 3E19A 3QYGB 4RCBA 3CMET 2GCXA 5GAOr 3META 1M90C 2F69A 4E7HA 4LD9K 2V8JA 4M7AB 2XU8A 4RKUE 3PMTA 2EWNA 3QSUA 5KCOA 1D3BB 1XNIA 5CCAA 1KC8C 2JOYA 3QG1A 5FU7C 3WXMB 5KE3A 2P0QA 2LC4A 4EMHA 3M57A 1VUBA 2DEQA 3RKXA 2E12A 4MZMA 3HRTA 1QVGS 2EQMA 1KQSA 4DQ2A 1VQPT 3L2WA 1BIBA 2PUOB 1OI1A 1RI0A 2CS7A 4XU0A 1WJQA 4C92D 2DD5A 3LH0A 3S3NA 1G5VA 3QJYA 4BE0A 3OYLA 4M7DE 5CVIA 3HHTB 3FB9A 2QEXT 3OW2S 2LVMA 4OGEA 1QP2A 1VQ5A 3HRSA 4E7JA 4M75D 2KVQG 1VQOA 2D0QB 3PT9A 1Q82C 1EIFA 3JAME 1YJWA 4M7DG 1BYMA 4ZN1A 5GAMj 2B8AA 1OZ3A 1M8VA 2PVDB 2VYTA 3T9NA 3MEAA 4PJOD 1Q81C 1NPRA 5GMKe 2K3XA 3JCMX 5GMKl 1MGQA 3OYNA 2DPPB 3G6EA 1W2BS 2OTLA 5FROA 1WNLA 4M77A 2DTIA 4M7DB 2V8IA 3G71T 4HA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRI A;  5GAO q;  3RKW A;  1B34 B;  1HK9 A;  2E1H A;  3RUX A;  4M7D C;  1U1T A;  3QUI A;  1N9S A;  3RKY A;  3V7R A;  4PNO A;  1JBM A;  1Y96 A;  3SWN B;  4M75 E;  5LJ3 h;  3JCM V;  5GAM f;  4M77 B;  3BFM A;  3SWN C;  4WF2 A;  4QVD A;  4F7U E;  2EAY A;  5GAM d;  4C8Q B;  5GAM g;  4XQ3 A;  5GAN d;  4F7U F;  5GAO n;  1KQ2 A;  3JCM J;  4PJO E;  3V8J A;  4M77 C;  3JCM h;  4XU3 A;  2ZGW A;  4M7D A;  4C8Q C;  4QVC A;  1B34 A;  2YLC A;  4M7D B;  4XTX A;  4J6W A;  1Y96 B;  1M5Q 1;  3BY7 A;  3BDU A;  4PJO G;  1WQ7 A;  2Y90 A;  4J5Y A;  4XU1 A;  4M7D F;  4M7A F;  2RM4 A;  1X01 A;  4J6X A;  4M78 G;  4M78 A;  4XTU A;  3AHU A;  5LJ5 j;  5GAN 4;  5GAO m;  4M7A D;  4M75 B;  3RES A;  4C8Q A;  4A54 A;  3JB9 G;  4NL3 A;  1I8F A;  1BIA A;  4JRI A;  2DXT A;  1KQ1 A;  4PJO B;  4C92 A;  5LJ5 e;  4C92 G;  4MML A;  2FB7 A;  4M78 B;  3JB9 H;  3JCM e;  4JRK A;  2DZ9 A;  2DKG A;  2DTO A;  2EJG A;  2JN0 A;  2EJF A;  2VXF A;  1LNX A;  4JLI A;  4M78 C;  2E10 A;  4M77 F;  3L1A A;  4M75 A;  4NOY A;  4M75 G;  3EFS A;  3JCM c;  5GAN 8;  4JUV A;  4M77 D;  4C92 B;  2CGH A;  4F7U A;  4F7U G;  4A53 A;  5LJ5 f;  5LJ5 g;  5GAN 2;  5LJ5 d;  4M7A E;  1YCY A;  5LJ3 j;  4PJO A;  3JCM f;  4C92 C;  3JCM g;  3BW1 A;  5GAN h;  1N9R A;  1LJO A;  3EFR A;  5GAM h;  4EMK B;  4RCC A;  2HNI A;  4M7A G;  1TH7 A;  4N0A A;  1WPY A;  3FIF A;  3FJP A;  1D3B A;  3HFO A;  4J6Y A;  4M75 C;  4F7U B;  5LJ3 e;  3JCM P;  4XTW A;  5GAO l;  5I21 A;  3JB9 J;  2FYK A;  3QO3 A;  2QTX A;  5CAI A;  3JCM Q;  4M7D D;  4X9D A;  5GMK m;  4RCB A;  5GAO r;  4PJO C;  5GAN j;  1I81 A;  3V7C A;  4M78 F;  3GIB A;  4M7A B;  4M77 E;  4XTV A;  2DJZ A;  2EWN A;  4EMK A;  3QSU A;  1HXD A;  5LJ3 f;  1D3B B;  2YHT A;  4C8Q F;  5LJ3 g;  4M78 D;  2DTH A;  5LJ3 d;  3JCM W;  4MMK A;  4N0A C;  4XTZ A;  3RER A;  4EMH A;  5DY9 A;  2EJ9 A;  5GAN e;  4C8Q D;  3RKX A;  2DEQ A;  2RA2 A;  5GMK h;  4V2S A;  3PGG A;  4X9C A;  4C92 F;  2E41 A;  4XU2 A;  3JCM d;  4EMG A;  1WQW A;  4DQ2 A;  5GAN 6;  2DVE A;  2K57 A;  1BIB A;  1U1S A;  4C92 D;  4XU0 A;  4HT9 A;  4Y91 A;  4M7A A;  3QHS A;  3V8L A;  5GAN 3;  5GAO p;  4M7D E;  4EMK C;  4M75 F;  3FB9 A;  5GAN f;  4NL2 A;  3RIR A;  5GAN g;  5LJ5 h;  3V7S A;  2DZC A;  2E64 A;  2VC8 A;  3VU3 C;  4M75 D;  5GMK j;  3JB9 I;  3HSB A;  2RB6 A;  1I5L A;  4M7D G;  2DXU A;  4OP0 A;  2RD1 A;  4PJO F;  4M78 E;  2I2L A;  5GAM j;  3M4G A;  3JCM b;  3SB2 A;  1M8V A;  1I4K 1;  3L2Z A;  3V8K A;  4HT8 A;  1LOJ A;  4C8Q E;  4PJO D;  1H64 1;  5GAN 5;  5GMK e;  3INZ A;  3SWN A;  5GMK i;  3JCM X;  5GMK l;  1MGQ A;  3JB9 F;  4M7A C;  2YLB A;  4XTY A;  3HFN A;  1WNL A;  4M77 A;  5GAM e;  4M77 G;  2DTI A;  4C92 E;  2VXE A;  5GAN 7;  3JB9 D;  4HA8 A;  4C8Q G;  2E65 A; 
#chains in the Genus database with same CATH topology
 1UFF A;  1DJ7 B;  1WHM A;  1D0Z A;  4M7D C;  2RN8 A;  3EGX A;  3GNG A;  2YDL A;  4BY6 B;  2QGG A;  1MV3 A;  3JCM V;  1Q7Y C;  2P0P A;  5GAM g;  1PSE A;  3I9Q A;  3M0P A;  5I2S A;  2GFA A;  1YJ9 Q;  2FL7 A;  5FLX E;  4OF1 A;  4JJC A;  1W4S A;  4QVC A;  1JJ2 S;  1JO8 A;  3H0F A;  5IT9 E;  1ZUK A;  4XTU A;  2KSS A;  1IGU A;  1X2K A;  3QZ9 B;  4J9I A;  4D8D A;  2O2O A;  1YIT Q;  1IRX A;  3CPF A;  4RMO A;  4C5E A;  2QTV A;  2DXT A;  4C92 A;  4E7K A;  2RK1 A;  4LNP A;  4PLI A;  4CC3 A;  2JN0 A;  2RHZ A;  1QQJ A;  1Q82 U;  4M77 F;  1UUE A;  3E9G A;  3EFS A;  2PU9 B;  4F7U A;  4RUG A;  5LJ3 j;  4OB0 B;  4L59 A;  3QDF A;  1IXD A;  3HKS A;  5KYW B;  3VS0 A;  3FJP A;  1PNJ A;  4A63 B;  2NUZ A;  5FU6 B;  5GAO l;  4FSX A;  3CCL T;  1E6H A;  2BZY A;  1TSF A;  3V7C A;  1FMK A;  3EH1 A;  4R55 A;  1VQL Q;  2LQW A;  2HAX A;  1ZSZ B;  1RL2 A;  4FT2 A;  1KG1 A;  1OOT A;  1XQH A;  5AT1 B;  4Z89 A;  2LJ1 A;  2RA2 A;  3EAE A;  2E5Q A;  1PRL C;  2K57 A;  1UJ0 A;  4KH0 B;  1T0J A;  1XTD A;  3EFO A;  1NE8 A;  4WTO B;  2K5I A;  4OB1 B;  1LVK A;  2EQJ A;  2QQR A;  3M0Q A;  1SRM A;  3M9Q A;  4QW2 A;  2Y4Y A;  3MP8 A;  1UTI A;  4R0K A;  1B34 B;  3A8L B;  3VV0 A;  3OMG A;  3OA6 A;  4DOW A;  3SDZ A;  2DO3 A;  1QKX A;  3M4Y A;  4ZGE B;  1G3Y A;  2MOX A;  2QA4 T;  1IRE B;  1NLO C;  3C94 A;  4KUI A;  2EYW A;  4PJO E;  1ZSG A;  3E2U A;  3REB B;  4ATO A;  2FPD A;  3NGP A;  1MMN A;  1IGQ A;  2L2P A;  1N8R R;  1WQ7 A;  2KRN A;  2RM4 A;  1NYF A;  4QQ6 A;  1OPL A;  4LDX A;  4M75 B;  1YWO A;  3RES A;  3CC2 A;  4JRI A;  1VQN A;  3M53 A;  4X34 A;  2MIO A;  2JUF A;  3H41 A;  3EGD B;  3H6Z A;  3QWY A;  4C0Z A;  3OYB A;  5CQY A;  1G3W A;  2X51 A;  4FCY A;  5LJ5 f;  2LCC A;  1ZQ1 A;  1NEG A;  4PKC C;  3G6E T;  1LPL A;  2O01 E;  3MHX A;  4EMK B;  2RJC A;  5HK0 A;  1W1F A;  1WPY A;  2PUK B;  2X4X A;  2A36 A;  2JM8 A;  1U5S A;  1S72 T;  2K79 A;  2CP6 A;  2QDL A;  3JCM Q;  3CME Q;  1ZBJ A;  2ZZD A;  4X9D A;  2CZ6 B;  4CI0 C;  4OMO A;  4J8O A;  4KBM B;  1AWJ A;  4TVR A;  5GMK h;  5C6S A;  4RTV A;  4V2S A;  1IO6 A;  5GAN 6;  2JS2 A;  2DVE A;  2XD0 A;  1R0C B;  3CCS A;  3I5R A;  5GAO p;  4ZN3 A;  1AD5 A;  3QXE B;  2M0O A;  5KYU B;  2RMO A;  1NJI U;  5LJ5 h;  5GMK j;  2RPN A;  3JB9 I;  2CUB A;  1VOM A;  1UE9 A;  4LDU A;  1V76 A;  1FMV A;  4LUE A;  4XK8 E;  1BCM A;  2KRO A;  4M77 G;  2MAM A;  2OTJ Q;  4AG2 C;  2RI5 A;  1AWX A;  2VV5 A;  3L2V A;  1NYG A;  1CSK A;  2IG0 A;  3OYY A;  5GAM f;  5GAN d;  3V8J A;  4XU3 A;  3EGX B;  4GY5 A;  4N4H A;  3OS2 A;  2XDB A;  2R57 A;  1J3T A;  3BDU A;  2ROT A;  1VQM T;  4M7A D;  2YSQ A;  3PTA A;  1UEC A;  1QVG P;  3G1J A;  2RQV A;  3SFM A;  3PE0 A;  5CIU A;  2ABL A;  5KH6 A;  4C92 B;  2ZPB B;  1N8R C;  5KYY B;  3G71 A;  1YIJ Q;  2FZG B;  4J9D A;  2MF2 A;  4LDY A;  2KXD A;  5GAM h;  4FYX B;  4ORZ A;  1M1F A;  4C5I A;  2JJ9 A;  5J3B A;  3FIF A;  4FIB A;  4J6Y A;  4F7U B;  1HSQ A;  1NEB A;  1W2B P;  3G7Z A;  2LJ0 A;  4M7D D;  1KJW A;  3JSC A;  3VS6 A;  4PJO C;  2JZ2 A;  1Q82 R;  3CBP A;  3M59 A;  4C8Q F;  3TCJ A;  3U23 A;  2LNH B;  5A2Q E;  1PD1 A;  2IIM A;  2EJ9 A;  4IKF A;  2HKQ B;  3VJP A;  3OS1 A;  4XU2 A;  3G4S Q;  3VRZ A;  3GOX A;  1YJN A;  4JRP A;  3CC2 T;  3RIR A;  1VQN T;  1RLQ C;  2E64 A;  3L42 A;  2L3R A;  2DXU A;  2L3P A;  2I2L A;  3M4G A;  1YHQ Q;  3M55 A;  3CCU Q;  4LDV A;  1QCN A;  4XTY A;  4PFO A;  3M0S A;  3CCR A;  2RI2 A;  2FO0 A;  2VXE A;  3CCE A;  4ANJ A;  3SD4 A;  2M0Y A;  4A4F A;  1M1K U;  2LNV A;  2HQH A;  2M16 A;  3C95 A;  4FW2 A;  4PNO A;  2VUB A;  2JM9 A;  2SEM A;  2VWF A;  1MMA A;  3MO8 A;  2HKN A;  4B9X A;  3JCM h;  2ZGW A;  4C8Q C;  3C0C A;  5I22 A;  3PVL A;  1TOV A;  1K0S A;  4K11 A;  1M5Q 1;  3A8O B;  2NWM A;  1WHG A;  2E6N A;  2CZ7 B;  3OYH A;  3ME9 A;  5GJV B;  1VIE A;  4F04 B;  5CK9 A;  1V1C A;  2PVO B;  1M2O A;  1XJW B;  3CCS T;  1X27 A;  2EJG A;  1AHJ B;  1YJW Q;  3L1A A;  1E6G A;  2GNC A;  2EQK A;  3TSZ A;  4M77 D;  1QVF A;  1Y57 A;  4M7A E;  1OQK A;  3UAT A;  2W0Z A;  3N5B B;  4EIK A;  4C0D B;  3PIO A;  2HDA A;  2HNI A;  1BKB A;  2ZPG B;  4N0A A;  2QXF A;  2D8H A;  3M54 A;  4XTW A;  3CCM Q;  2FYK A;  1X6G A;  2LQ8 A;  3QYG B;  2GCX A;  3MET A;  4DEY A;  2F69 A;  1VQ6 Q;  3MPU B;  2V8J A;  2XU8 A;  1I07 A;  3QSU A;  1RAA B;  4JPB W;  5FU7 C;  2P0Q A;  4JJB A;  2EQM A;  1KQS A;  1GCP A;  4XU0 A;  3PVQ A;  1G5V A;  4M7D E;  1ZSZ A;  2G6F X;  3FB9 A;  1VQ4 Q;  1VQ5 A;  3HRS A;  1YFN A;  1VQO A;  1BYM A;  1Q82 C;  2PZ1 A;  3JAM E;  2V1R A;  3VS4 A;  2B8A A;  1OZ3 A;  2RF0 A;  3CMA Q;  2PVD B;  3MEA A;  2ROL A;  3JCM X;  4DEX A;  1B07 A;  5ECA A;  2OTL A;  5FRO A;  1BU1 A;  1YP5 A;  3G71 T;  3VS3 A;  4OML A;  4E6R A;  3DLL A;  1T3S A;  4LN2 A;  1FX7 A;  2LRQ A;  5CQX A;  4FT4 A;  1NJI R;  4OMM A;  1UGQ B;  3SWN C;  2EAY A;  2ED1 A;  1QWF A;  1B34 A;  5D6X A;  3NTI A;  4PK4 A;  2J06 A;  1N6A A;  3J7A F;  3KUF A;  3UDC A;  4FW1 A;  4JZ3 A;  5EC7 A;  2J7I A;  3JV3 A;  3EG2 A;  1YJN T;  4AFS C;  2DX1 A;  2MI6 A;  2O88 A;  3MP6 A;  2X4J A;  4M75 A;  2AIR B;  2DA9 A;  3JCM c;  4MDW A;  3VS7 A;  1BI3 A;  2CGH A;  1YN8 A;  2DNU A;  2P84 A;  3LGF A;  3CCR T;  3CCE T;  2ZPI B;  1JEG A;  2CDT A;  1Y7X A;  5I21 A;  3QO3 A;  2F2X A;  1PHT A;  2CP0 A;  3LW5 E;  2D0N A;  4M77 E;  4HVW A;  2DJZ A;  4EMK A;  3JCM W;  4C0F A;  2ZAE A;  1SRL A;  4LXC A;  2F2W A;  4B6M A;  2QQS A;  1OUL A;  2QYZ A;  1GFC A;  1D1B A;  1MNE A;  5GAN e;  1AZE A;  1YIT A;  8ATC B;  4C92 F;  4EPC A;  4KUD K;  1TUD A;  4J9C A;  2DM1 A;  4Z8A A;  2WSF E;  2JS0 A;  3TU4 K;  4KH1 B;  2NUT A;  2EQU A;  1ZUU A;  5CKH A;  1VQ9 T;  2YUQ A;  2DMO A;  2V26 A;  2YRC A;  3F70 A;  1GBQ A;  3AT1 B;  3URG A;  3A98 A;  1ZA1 B;  3FDR A;  3CBM A;  3CC7 Q;  3OYD A;  4M7A C;  2YLB A;  1HJD A;  4PJJ A;  1OPK A;  5CKE A;  2IPO B;  1X43 A;  3OYF A;  1C6V X;  2ZPH B;  3QII A;  2CSI A;  3HTR A;  1VQL A;  3GPL A;  2GQI A;  1WGS A;  1UGR B;  4XU1 A;  4J5Y A;  4J9F A;  4M78 A;  1X01 A;  3AHU A;  1HD3 A;  2OAU A;  1VYV A;  2X4Y A;  4BE1 A;  4DBR A;  2YWW A;  1M1K R;  3RNJ A;  1BIA A;  2KK4 A;  1ZX6 A;  2DL5 A;  2DBK A;  5L8R E;  2GTO A;  3I55 A;  1NJI C;  3DKM A;  4PJO B;  5GJW B;  2GBQ A;  3DB4 A;  2KGT A;  2EIF A;  2GTJ A;  2LP5 A;  4HKE A;  3OS0 A;  3CCJ A;  2K2M A;  2CH4 W;  2XDD A;  1D1C A;  4KRT A;  4A53 A;  5GAN 2;  5LJ5 d;  2J05 A;  2FVU A;  3X28 B;  1UHF A;  2OTL T;  1GCQ A;  4RCC A;  1PRM C;  2LMJ A;  1RAB B;  3M0U A;  1CKA A;  1D3B A;  1PD0 A;  4BE2 A;  3OYE A;  5IHI A;  5CAI A;  2I0N A;  5KYY A;  1YI2 A;  3UWN A;  4E7L A;  1OYX A;  4LD6 A;  2KYB A;  3OW2 A;  4FSS A;  1U06 A;  1NLP C;  4A4K A;  1SF9 A;  4C8Q D;  1WFW A;  2CZ0 B;  3VS2 A;  6AT1 B;  2C0I A;  2LJ3 A;  5GAN 3;  2XG8 D;  2A08 A;  2QA4 Q;  2O9S A;  2DZC A;  4E2F B;  3VU3 C;  1NPP A;  2RB6 A;  2RHY A;  3GNF B;  1JU5 C;  3A5Z B;  3L2U A;  3CCV A;  1GBR A;  1MUZ A;  1KK7 A;  1ACM B;  3L2R A;  3X25 B;  1R77 A;  1JJ2 A;  1EX4 A;  2ZPF B;  2MK5 A;  3KBG A;  2BE7 D;  3RUX A;  3QUI A;  1K9A A;  1X6O A;  3CME A;  1HYO A;  2COW A;  3A1P A;  3SHW A;  5GAM d;  1PKT A;  4M77 C;  1X69 A;  2JTM A;  4ESR A;  4J9G A;  1IHV A;  2R5A A;  3J80 E;  2RJD A;  1BK2 A;  2X35 A;  4BI4 A;  2K6D A;  2BUD A;  3R6O A;  1FXX A;  2QEX A;  3S3O A;  1S72 Q;  1KQ1 A;  4C92 G;  4IUR A;  4Z88 A;  5AYF A;  5FU7 B;  3TQ7 P;  4JS4 A;  3CC4 Q;  4F7U G;  4JRQ A;  2OTJ A;  2CP5 A;  2YUO A;  5I2M A;  2OX7 A;  1LJO A;  1N9R A;  5IN1 A;  2QG9 B;  3I56 A;  3CXC A;  1M1K C;  1VQ8 A;  4BAC A;  2Y4X A;  2A0F B;  5LJ3 e;  3QPH A;  2MMP A;  2LX7 A;  3EG0 A;  2MWP A;  1A0N B;  1BI0 A;  2HEQ A;  1B3Q A;  1VQL T;  2C0O A;  2RQR A;  2DTH A;  1Q81 R;  4XTZ A;  1C1A A;  3FRN A;  4BI3 A;  1QVP A;  2XK0 A;  3WVD B;  1RAI B;  3JCM d;  4PLL A;  4OMP A;  1RUW A;  2EVR A;  2DD4 A;  3UA7 A;  3QZ5 B;  1U1S A;  3QHS A;  3V8L A;  4MDX A;  4GLK A;  5D6Y A;  1I0C A;  2HZY A;  2CH4 A;  2KR3 A;  4NL2 A;  5GAN g;  5DM7 R;  3I55 T;  3QJ6 A;  3X20 B;  4JLG A;  2E4H A;  1I5L A;  4BDY A;  3A8M B;  3REA B;  2NUT B;  3L2Z A;  4C8Q E;  1H64 1;  2ZCF B;  1YIJ A;  3RR6 A;  3CCJ T;  1VQM Q;  2BKD N;  1JRI A;  2K5F A;  3EH2 A;  3ZL7 C;  2AK5 A;  3BDL A;  4D6W A;  2AZV A;  3BFM A;  4II1 A;  2E3H A;  3M5A A;  1YI2 T;  1VYT A;  3OQ5 A;  3P8B B;  1WA7 A;  4OGC A;  3FEO A;  4J9E A;  5C0M A;  5IXB A;  5LJ5 j;  3G4S A;  4Z02 A;  3JB9 G;  4NL3 A;  4M4Z A;  3CD6 A;  4KT0 E;  1VIF A;  2EFI A;  4CC2 A;  2O9V A;  1WX6 A;  2HBW A;  5FRM A;  4M78 B;  2XDP A;  1YHQ A;  3OBY A;  3CCU A;  2W10 A;  2YXY A;  3NTK A;  1NG2 A;  3CCV T;  2K2V A;  2P4T A;  4N4I A;  2O4X B;  3HP9 A;  2LZ6 B;  2LTO A;  3ULR B;  3CME T;  5GAO r;  1SEM A;  4ZNX A;  4M7A B;  4AFQ C;  1M8M A;  1D3B B;  1XNI A;  4LE9 A;  4E7Z A;  2JOY A;  1Z9Z A;  1UGV A;  1SHG A;  4AFU C;  3M57 A;  2DEQ A;  2E12 A;  1WXU A;  2PUO B;  3S3N A;  4C92 D;  2D8J A;  2QEX T;  2FRY A;  2LVM A;  1QP2 A;  4PJN A;  4E7J A;  1K73 R;  2D0Q B;  2BZX A;  1YJW A;  4ZN1 A;  5GAM j;  2DRM A;  1Q95 G;  1M8V A;  1WHJ A;  2COY A;  1RAC B;  1Q81 C;  1NPR A;  5GMK e;  1KD1 R;  3OYN A;  2KEA A;  3NMZ C;  4M7D B;  2V8I A;  4HA8 A;  2JW4 A;  2ESW A;  5GAO q;  1HK9 A;  4ELZ C;  3I56 T;  1VQ8 T;  1UEB A;  2BIV A;  1N9S A;  3CCM A;  2KY9 A;  2H8H A;  4BY6 C;  4WF2 A;  2KRS A;  1VQ6 A;  2CT3 A;  5HKC A;  4Y28 E;  1KC8 U;  2COZ A;  1B7T A;  2KQW A;  4FYV B;  1X2Q A;  1VA7 A;  2FPE A;  4B9W A;  4KUL A;  1VQ4 A;  3CPW A;  1RAH B;  1I5O B;  5FW9 A;  2ECZ A;  2DZ9 A;  1W70 A;  2EYQ A;  3CMA A;  4OB3 B;  4FL6 A;  2XID A;  3CQT A;  4XAX B;  1YCY A;  4PJO A;  3VS5 A;  2QI2 A;  1IB8 A;  2A3L A;  4PFZ A;  1BI1 A;  1AEY A;  4A4E A;  5KE2 A;  3D7S B;  1D1A A;  1RAG B;  2DEU A;  5CO7 A;  3FJ5 A;  5FU6 C;  2DJQ A;  1I81 A;  1KQS S;  2BTT A;  3P8D A;  1UGS B;  4OVA A;  3QDR B;  4ZGJ B;  5LJ3 g;  2QAS A;  1ZSZ C;  2EGC A;  3PGG A;  3CXC P;  3CCQ Q;  2KAF A;  3G4S T;  4D8K A;  3P8H A;  2HMA A;  4PJM A;  1VQ7 Q;  1VQK Q;  1RAE B;  4M75 F;  3CD6 T;  5GAN f;  1G3T A;  3H9N A;  3UA6 A;  1Y07 A;  3C12 A;  2ENM A;  1GFD A;  3HSB A;  4OP0 A;  1NZ9 A;  2HSE B;  2XIC A;  3RMQ A;  1ZUY A;  1O75 A;  4IIM A;  3LGL A;  3CCU T;  1EZZ B;  2KBT A;  1LOJ A;  3V8K A;  5GAN 5;  1QMC A;  4BDZ A;  4QT7 A;  2F1L A;  2KT1 A;  1QWE A;  4E47 A;  3H8Z A;  3MJX A;  3A8H B;  4C92 E;  4F14 A;  4ZTJ A;  5FWB A;  4J9B A;  1EFN A;  4DBF A;  1U1T A;  2V1Q A;  3NPF A;  2VB6 A;  3RKY A;  5EG2 A;  1Y0M A;  3PMI A;  3LYI A;  2PQW A;  1KIK A;  2DAQ A;  4PL6 A;  5HY6 A;  4CC4 B;  4F7U E;  3OYA A;  1GL5 A;  1RAF B;  4J6W A;  1KD1 C;  3O8V A;  1K76 A;  4PJO G;  2FRW A;  2CKK A;  3ZFJ A;  3LWI A;  4A54 A;  5KYX B;  4HXJ A;  3A8G B;  5I11 A;  3JCM e;  2PTK A;  1K9M R;  2YUN A;  4J83 A;  3CC7 A;  1YJW T;  1WDX A;  2EGE A;  2EBP A;  3ASK A;  5GAN 8;  4E7S A;  2GFU A;  2DF6 A;  4JUV A;  3LWH A;  3X26 B;  3GLX A;  1W6X A;  3EHQ A;  5IXF A;  1PSF A;  2VAS A;  1VQ9 Q;  2K4Y A;  1M3B A;  2KE9 A;  2K5L A;  2CYZ B;  2EKO A;  3CCM T;  1MHN A;  2VVK A;  4BB7 A;  4VUB A;  3S6W A;  3LX7 A;  1WXT A;  3QWX X;  4M78 F;  3GIB A;  1VQ6 T;  2EYX A;  5J26 A;  3CEY A;  3OB9 A;  1H3Z A;  1QKW A;  4MMK A;  5HK3 A;  4PFP A;  1M30 A;  2VGN A;  1Q81 U;  2BE9 B;  1IZ6 A;  1QP3 A;  4X9C A;  2E41 A;  1VQP Q;  4EMG A;  1WQW A;  4ELY C;  2AHJ B;  2KMT A;  1K8A U;  2VKN A;  4HT9 A;  4Y91 A;  4BI8 B;  2RQU A;  2C06 A;  1E7O A;  1BB9 A;  1UB4 A;  1SPK A;  3PNW C;  1YJ9 A;  3M56 A;  2KYM A;  1ZA2 B;  2RQW A;  3OSS C;  1I4K 1;  3CMA T;  1M3A A;  2K3B A;  2GQV A;  2GF7 A;  3SWN A;  3HFN A;  4GLM A;  2E65 A;  1OX9 A;  1U8R A;  4WCI A;  3X24 B;  3NFC A;  3EG9 A;  1T0H A;  1WHL A;  3S3M A;  4XQ3 A;  4F7U F;  3JCM J;  2LT1 A;  3CBO A;  1OEB A;  2X3X D;  3I35 A;  1QW1 A;  4QQG A;  1TXQ A;  3LH5 A;  4IUV A;  2OTL Q;  1ABQ A;  2ED0 A;  2EKH A;  2CP7 A;  2G3R A;  4ZGD B;  2L0A A;  2K3Y A;  3OMC A;  2BZ8 A;  2KXC A;  3EG1 A;  2OAW A;  5J39 A;  2WAC A;  5DLO A;  2LQK A;  2QA4 A;  2JT4 A;  2DRK A;  2NLU A;  3HPW A;  2F5T X;  2DKG A;  4LUD A;  2DE0 X;  4JLI A;  1M90 R;  2A7Y A;  4M75 G;  3FLG A;  2LT4 A;  2MCN A;  1KC8 R;  2RK2 A;  1K0X A;  2JTE A;  4C92 C;  2K7A A;  1ZHI A;  4HVV A;  1FWZ A;  4A4H A;  1H8K A;  3CPW P;  3CCL Q;  1PC0 A;  3JB9 J;  1R8O B;  4RG8 A;  4AFZ C;  2L89 A;  3OYK A;  3M0T A;  5GMK m;  1K9M C;  1AVZ C;  2E5K A;  2FG0 A;  1VQ5 T;  1VQO T;  1Y71 A;  5LJ3 f;  1CKB A;  2HBP A;  2YHT A;  8AT1 B;  4QQD A;  3QKJ A;  2O4X A;  2RI3 A;  1Q86 U;  2RHX A;  2E3I A;  3UPU A;  1S72 A;  4M7A A;  3MP1 A;  2RO0 A;  1KHC A;  3TEE A;  3VYH B;  3THK A;  1QVG A;  1M2V B;  3V7S A;  9ATC B;  4FM4 B;  1K73 U;  1S1N A;  3JCM b;  2KT8 A;  2RHU A;  2Z0W A;  4O5V A;  3OYM A;  3CC4 A;  1QVF P;  3INZ A;  4F16 A;  3CC7 T;  2C0T A;  3ER0 A;  3JB9 F;  3NTH A;  1KD1 U;  2QAZ A;  2DIQ A;  2QGF B;  2EGA A;  5HCK A;  2P4R A;  3H0H A;  2CP2 A;  4RTY A;  4BD3 A;  5LJ3 h;  1W2B A;  2DIL A;  4QVD A;  4NS5 A;  4C8Q B;  2DXB A;  4DOV A;  1UGP B;  4JS5 A;  4DA4 A;  4M7D A;  4RG2 A;  4DBH A;  3DB3 A;  2IVW A;  1M4Z A;  1H92 A;  3C4S A;  4J6X A;  4M78 G;  1LCK A;  5LL6 S;  3VYG A;  5GAO m;  1KQS P;  1G8X A;  1D0X A;  1RAD B;  4N4G A;  2LQN A;  3MEU A;  2PVG B;  4MML A;  3JB9 H;  2QQ9 A;  3FC3 A;  1WIE A;  2E70 A;  4JRK A;  3PIP A;  4ZTF A;  2VXF A;  2CUD A;  3CXC S;  1YJ9 T;  1VQM A;  3VUZ A;  3JCM g;  3G6E Q;  1C0M A;  2CRE A;  1YIT T;  4M7A G;  4JDS A;  3MCA B;  4C0D C;  3ZBD A;  2AKK A;  2A37 A;  3I55 Q;  1JXO A;  3E19 A;  2FZC B;  4RCB A;  1UG1 A;  1M90 C;  4LD9 K;  5KCO A;  2NUP B;  3CCJ Q;  5CCA A;  1KC8 C;  1SKU B;  1BBZ A;  3HRT A;  3I5S A;  4DQ2 A;  3L2W A;  4RTZ A;  5D7U A;  1BIB A;  2DD5 A;  3LH0 A;  1TS9 A;  5CVI A;  5IH2 A;  4M75 D;  2KVQ G;  1EIF A;  1YI2 Q;  4M7D G;  4RTT A;  2QK0 A;  3VS1 A;  2VYT A;  2LCS A;  2CSQ A;  2DL4 A;  1MGQ A;  1QCO A;  2MPX C;  4M77 A;  2DTI A;  1QCF A;  2RQT A;  2B86 A;  1SHF A;  1QLY A;  1K8A R;  2QDY B;  3KFV A;  1JQQ A;  1JBM A;  3SWN B;  2XHC A;  2XMF A;  1G83 A;  5GAO n;  1FMW A;  2CZ1 B;  2CP3 A;  2XKO C;  3Q1J A;  1PWT A;  4XTX A;  4FYY B;  3M0R A;  3CCV Q;  4JJD A;  3EG9 B;  2Y90 A;  2M1H A;  2X4W A;  2CT4 A;  1NBE B;  2HD0 A;  5A0L A;  1I8F A;  2X3W D;  2F5K A;  2LCL A;  1M1G A;  2YUP A;  2FHD A;  2EJF A;  2RHI A;  1RI9 A;  3IQL A;  4IUQ A;  4OMF B;  1K9M U;  2R5M A;  5KYX A;  3OYJ A;  4HCB A;  3CC4 T;  1X6B A;  4IUT A;  5KCH A;  1KHI A;  3GF5 A;  2JXB A;  4IIO A;  5D6W A;  4JJN K;  2LDM A;  5CKD A;  1ABO A;  5CKF A;  2QEX Q;  2RH2 A;  3HRU A;  2KRM A;  1O9S A;  4L5G A;  1Q7Y U;  1R0B G;  2JVV A;  1KSW A;  3E9F A;  1TWB A;  2HSP A;  2WSC E;  1HXD A;  2QQB A;  5IHN A;  4J7F A;  4M78 D;  1Z9Q A;  5DY9 A;  1WJS A;  1SG5 A;  1ZBX A;  2HL5 C;  3I56 Q;  1VQ8 Q;  4A4G A;  1WJR A;  2DXC A;  4F17 A;  5FRN A;  3CC2 Q;  1VQN Q;  2H3E B;  2P0K A;  2DLP A;  4J9H A;  2RJF A;  2HQX A;  4PJO F;  1D0Y A;  4UC4 A;  3SB2 A;  5A0G A;  4Q5W A;  5FWC A;  1AWO A;  5GMK i;  1XOV A;  1Q86 R;  1TG0 A;  2M9U A;  4MZP A;  1VYU A;  2DVJ A;  4OMQ A;  2OI3 A;  2VGM A;  3OYG A;  2WSE E;  1Y96 A;  4QVZ A;  4M75 E;  2JTF A;  3MKD A;  1JB0 E;  1YWP A;  1PM3 A;  2JNG A;  1IHW A;  1AOJ A;  4RTW A;  4YTL A;  3OYC A;  3OW2 P;  3CPW S;  3QYH B;  2MWO A;  3BY7 A;  3L2Q A;  3CCQ A;  7AT1 B;  5A0D A;  1K8A C;  4OB2 B;  2AKL A;  2OTJ T;  1VQ7 A;  1VQK A;  5CR2 A;  4KGV B;  2HQE A;  3CCS Q;  5LJ5 e;  1OU8 A;  1M9S A;  1TUG B;  4IUU A;  4LDW A;  3J81 E;  4NOY A;  1YCS B;  1M90 U;  2AZS A;  4HCZ A;  2D9T A;  1K4U S;  1YNZ A;  1MND A;  1YBY A;  3OSV A;  1GRI A;  3JRZ A;  3TRE A;  3JCM f;  3OYI A;  1D09 B;  1I1J A;  1MV0 B;  1UJY A;  3NHN A;  1UHC A;  1JJ2 P;  3KXT A;  4E7I A;  2DL8 A;  2FZK B;  2JMA A;  2DYB A;  2ZPE B;  3CD6 Q;  2DBM A;  2L3S A;  3HFO A;  4AT1 B;  3RBB B;  3JCM P;  1QVF S;  2QTX A;  1X75 C;  2L3Q A;  2OJ2 A;  5CKB A;  1AT1 B;  5IAY A;  4XTV A;  3EFO B;  1AZG B;  1M27 C;  4N0A C;  3RER A;  1N27 A;  3VRY A;  3E1S A;  1YIJ T;  1U3O A;  2KDS A;  1WHH A;  2QQA A;  1MMG A;  2DER A;  2VC8 A;  4MZT A;  3UT1 A;  4C5G A;  3DLM A;  3TSW A;  4M78 E;  2V8K A;  1WYX A;  1M3C A;  2KNB B;  4HT8 A;  1SSF A;  1PG5 B;  3LLR A;  4IUP A;  5GAM e;  5GAN 7;  3G71 Q;  3JB9 D;  1M2V A;  1F1B B;  2EPD A;  1VQ9 A;  2E1H A;  4RTX A;  1G2B A;  3TVT A;  3OS5 A;  4GBQ A;  1OZ2 A;  2YRD A;  2M51 A;  4M77 B;  3UF4 A;  2AT1 B;  1KQ2 A;  2FEI A;  2E6Z A;  1N5Z A;  1TTH B;  1YHQ T;  2XI9 A;  3WVE B;  1Q86 C;  2DL7 A;  4L6V 5;  1VQP A;  1WLP B;  5GAN 4;  4HCK A;  3RMS A;  4C8Q A;  2YT6 A;  4JZ4 A;  3PFS A;  2FB7 A;  1MMD A;  3RDV A;  1YJN Q;  4QKU A;  4HVU A;  1K73 C;  2EQI A;  2DIG A;  2R58 A;  1WI7 A;  2SRC A;  2KI7 A;  5KYW A;  5KYN A;  4CC7 A;  1ZLM A;  5GAN h;  3EFR A;  5M9O A;  3CCR Q;  4C0G A;  3CCE Q;  4M75 C;  1AWW A;  2EW3 A;  3R6N A;  4O6J A;  4CRI A;  3VUB A;  2NYS A;  4C5H A;  5GAN j;  1WXB A;  3OY9 A;  2MYS A;  3SEM A;  1BI2 A;  1K1Z A;  5LJ3 d;  3M58 A;  2X9H A;  2HL3 A;  4HCC A;  3CCQ T;  3O5Z A;  1FYN A;  2LX9 A;  2M02 A;  1JXM A;  4EMK C;  1VQ7 T;  2NUP A;  1VQK T;  2RJE A;  2EYZ A;  1Q7Y R;  2DYI A;  2RD1 A;  1RLP C;  4BUG A;  1SSH A;  1G3S A;  4RTU A;  1N8R U;  4ME7 A;  3H0I A;  2J6K A;  4C8Q G;  3RKW A;  1V29 B;  1P92 A;  4EDU A;  3MEV A;  3V7R A;  3CCL A;  4DBQ A;  1OU9 A;  1VQ4 T;  1KFZ A;  4P5N A;  1PKS A;  1GXI E;  1WZO A;  4FYW B;  2YLC A;  3GP8 A;  2EYY A;  4AG1 C;  1Y96 B;  4M7A F;  3QBY A;  3EGD A;  2PNI A;  2D6F A;  4AMC A;  5DLQ E;  1OX8 A;  2D1X A;  2DTO A;  4M78 C;  1VQ5 Q;  1LNX A;  1VQO Q;  2DK3 A;  2E10 A;  4FU6 A;  3VKI A;  1UDL A;  2FPF A;  3OBW A;  5LJ5 g;  2L5Q A;  4Y92 A;  3MEW A;  3BW1 A;  3EG3 A;  4R56 A;  1NM7 A;  1TH7 A;  2JMC A;  1BCO A;  1H3H A;  4M7D F;  2K9G A;  2RNA A;  3ZEH A;  2YRV A;  1PCX A;  4PJL A;  4J7I A;  2H3J A;  3EGU A;  2L8D A;  3HL8 A;  5L23 A;  1TUC A;  2DFU A;  4E7H A;  2O31 A;  2A28 A;  4RKU E;  3PMT A;  2EWN A;  1GCQ C;  1OV3 A;  2GGR A;  3QG1 A;  3WXM B;  1WHK A;  2J6F A;  4EMH A;  2LC4 A;  5KE3 A;  5KYU A;  1VUB A;  3RKX A;  4MZM A;  1QVG S;  2DL3 A;  2HCK A;  3BE3 A;  4KGZ B;  1VQP T;  1ARK A;  1OI1 A;  1RI0 A;  2CS7 A;  1WJQ A;  2F2V A;  3EHR A;  3QJY A;  2DET A;  4BE0 A;  3OYL A;  3HHT B;  3OW2 S;  4KGX B;  1TU0 B;  4OGE A;  4OMN A;  3PT9 A;  2ATC B;  3GBQ A;  3T9N A;  4PJO D;  5IHK A;  4X1V A;  2K3X A;  5GMK l;  2DPP B;  3G6E A;  1W2B S;  1WNL A;  1T3L A;  2J6O A; 
#chains in the Genus database with same CATH homology
 5GAO q;  1DJ7 B;  1HK9 A;  4M7D C;  3DLL A;  4ELZ C;  3I56 T;  2QDY B;  1UEB A;  3GNG A;  1VQ8 T;  2BIV A;  1N9S A;  4BY6 B;  3CCM A;  1FX7 A;  1JBM A;  3SWN B;  2LRQ A;  5CQX A;  4FT4 A;  3JCM V;  2KY9 A;  4BY6 C;  2XHC A;  1UGQ B;  3SWN C;  1Q7Y C;  2P0P A;  4WF2 A;  5GAM g;  1PSE A;  2EAY A;  1VQ6 A;  5I2S A;  2GFA A;  5HKC A;  5GAO n;  2CZ1 B;  2FL7 A;  5FLX E;  4OF1 A;  4QVC A;  1W4S A;  2XKO C;  1JJ2 S;  3Q1J A;  1B34 A;  5D6X A;  4XTX A;  3NTI A;  4Y28 E;  5IT9 E;  1KC8 U;  2Y90 A;  2M1H A;  2KQW A;  1N6A A;  4XTU A;  2KSS A;  3QZ9 B;  3KUF A;  3J7A F;  2X4W A;  2HD0 A;  3UDC A;  4B9W A;  3CPF A;  4RMO A;  5A0L A;  4C5E A;  1I8F A;  4KUL A;  1VQ4 A;  3CPW A;  2DXT A;  2F5K A;  2LCL A;  4C92 A;  4E7K A;  2RK1 A;  1M1G A;  1YJN T;  2MI6 A;  2DZ9 A;  2FHD A;  4PLI A;  3MP6 A;  2RHZ A;  2EJF A;  2JN0 A;  2X4J A;  2RHI A;  2EYQ A;  3CMA A;  1Q82 U;  4M77 F;  3E9G A;  4IUQ A;  4M75 A;  4OMF B;  4OB3 B;  4FL6 A;  2XID A;  1K9M U;  3EFS A;  3JCM c;  2R5M A;  4MDW A;  2PU9 B;  3OYJ A;  1BI3 A;  2CGH A;  4XAX B;  4F7U A;  4HCB A;  3CC4 T;  1YCY A;  5LJ3 j;  4PJO A;  2QI2 A;  4IUT A;  2A3L A;  4OB0 B;  4L59 A;  1KHI A;  5KCH A;  3GF5 A;  3HKS A;  3LGF A;  5D6W A;  3CCR T;  4JJN K;  1BI1 A;  2LDM A;  5CKD A;  3CCE T;  5CKF A;  4A4E A;  2ZPI B;  5KE2 A;  2RH2 A;  3FJP A;  3HRU A;  5FU6 B;  5GAO l;  1Y7X A;  4FSX A;  5CO7 A;  5I21 A;  3QO3 A;  1O9S A;  4L5G A;  3CCL T;  5FU6 C;  1Q7Y U;  3LW5 E;  1I81 A;  3V7C A;  4R55 A;  1KQS S;  2JVV A;  4M77 E;  2HAX A;  3E9F A;  3P8D A;  2DJZ A;  2WSC E;  1RL2 A;  1UGS B;  1HXD A;  4OVA A;  3QDR B;  2QQB A;  4EMK A;  4ZGJ B;  4FT2 A;  4J7F A;  4C0F A;  4M78 D;  5LJ3 g;  3JCM W;  1KG1 A;  2QQS A;  1XQH A;  5DY9 A;  5GAN e;  1WJS A;  1ZBX A;  2RA2 A;  3EAE A;  1YIT A;  3PGG A;  4C92 F;  2E5Q A;  4EPC A;  2KAF A;  4KUD K;  2K57 A;  2WSF E;  4A4G A;  3G4S T;  1WJR A;  1XTD A;  2DXC A;  3TU4 K;  3P8H A;  3JB9 I;  5FRN A;  2EQU A;  1NE8 A;  4M75 F;  5CKH A;  2K5I A;  1VQ9 T;  3CD6 T;  5GAN f;  1G3T A;  4OB1 B;  1Y07 A;  2EQJ A;  2P0K A;  2QQR A;  3C12 A;  3F70 A;  3HSB A;  2RJF A;  2HQX A;  4PJO F;  4OP0 A;  1NZ9 A;  2XIC A;  4UC4 A;  3RMQ A;  3M9Q A;  3URG A;  1O75 A;  3SB2 A;  4QW2 A;  5A0G A;  3FDR A;  4Q5W A;  3LGL A;  3CCU T;  3V8K A;  1LOJ A;  3CBM A;  5GAN 5;  3OYD A;  5GMK i;  4M7A C;  2Y4Y A;  4BDZ A;  1XOV A;  2YLB A;  3MP8 A;  2M9U A;  4MZP A;  4E47 A;  3H8Z A;  5CKE A;  3A8H B;  4C92 E;  4ZTJ A;  2VGM A;  1B34 B;  3A8L B;  3VV0 A;  3OMG A;  3OYG A;  3OA6 A;  1U1T A;  3OYF A;  4DOW A;  3SDZ A;  2DO3 A;  2WSE E;  3RKY A;  3M4Y A;  5EG2 A;  1Y96 A;  4QVZ A;  4M75 E;  3PMI A;  2JTF A;  2ZPH B;  3LYI A;  2PQW A;  3QII A;  2DAQ A;  4PL6 A;  5HY6 A;  1JB0 E;  4ZGE B;  1G3Y A;  4F7U E;  2QA4 T;  1VQL A;  1IRE B;  2JNG A;  3C94 A;  3OYA A;  4KUI A;  4PJO E;  4YTL A;  3GPL A;  3OYC A;  4ATO A;  1WGS A;  4J6W A;  1KD1 C;  3CPW S;  3QYH B;  2MWO A;  3O8V A;  3BY7 A;  4PJO G;  1UGR B;  1WQ7 A;  4XU1 A;  4J5Y A;  3L2Q A;  3CCQ A;  2RM4 A;  1X01 A;  4M78 A;  3AHU A;  5A0D A;  2CKK A;  4QQ6 A;  2OAU A;  1K8A C;  2X4Y A;  4OB2 B;  4M75 B;  3ZFJ A;  3RES A;  3LWI A;  4BE1 A;  4LDX A;  4A54 A;  2OTJ T;  1VQ7 A;  1VQK A;  5CR2 A;  3CC2 A;  1BIA A;  2KK4 A;  4JRI A;  1VQN A;  2HQE A;  5L8R E;  3I55 A;  1NJI C;  3M53 A;  3DKM A;  4PJO B;  5LJ5 e;  3A8G B;  4X34 A;  3DB4 A;  2JUF A;  3H6Z A;  3OYB A;  4C0Z A;  1M9S A;  3JCM e;  4IUU A;  2EIF A;  4LDW A;  4HKE A;  3J81 E;  3OS0 A;  4J83 A;  4NOY A;  1G3W A;  5CQY A;  3CC7 A;  1YJW T;  3CCJ A;  1M90 U;  4HCZ A;  2D9T A;  3ASK A;  5GAN 8;  2XDD A;  2GFU A;  3LWH A;  4JUV A;  5LJ5 f;  2LCC A;  1YBY A;  3OSV A;  3X26 B;  4A53 A;  5GAN 2;  1ZQ1 A;  5LJ5 d;  3JRZ A;  3TRE A;  3JCM f;  3GLX A;  4PKC C;  3OYI A;  2FVU A;  3X28 B;  3G6E T;  3MHX A;  2O01 E;  4EMK B;  3KXT A;  4E7I A;  2OTL T;  4RCC A;  1PSF A;  2RJC A;  5HK0 A;  2ZPE B;  1WPY A;  2PUK B;  3HFO A;  1D3B A;  2K4Y A;  2X4X A;  1YHQ A;  4BE2 A;  3JCM P;  1S72 T;  3OYE A;  1QVF S;  2QTX A;  1X75 C;  2K5L A;  2CYZ B;  2EKO A;  5CAI A;  2ZZD A;  4X9D A;  1MHN A;  3JCM Q;  3CCM T;  2CZ6 B;  1YI2 A;  5CKB A;  3UWN A;  4VUB A;  4BB7 A;  3S6W A;  4CI0 C;  4E7L A;  3LX7 A;  4M78 F;  3GIB A;  5IAY A;  4XTV A;  1VQ6 T;  5J26 A;  1OYX A;  4J8O A;  3CEY A;  3OB9 A;  4LD6 A;  1VQ8 A;  1H3Z A;  3OW2 A;  4KBM B;  4MMK A;  4N0A C;  4TVR A;  5HK3 A;  3RER A;  4A4K A;  2VGN A;  1N27 A;  4C8Q D;  5GMK h;  5C6S A;  1Q81 U;  4V2S A;  1IZ6 A;  1QP3 A;  4X9C A;  2E41 A;  3E1S A;  1YIJ T;  4EMG A;  2CZ0 B;  1WQW A;  5GAN 6;  4ELY C;  2AHJ B;  2DVE A;  2KDS A;  2KMT A;  1K8A U;  2XD0 A;  4HT9 A;  3CCS A;  4Y91 A;  2QQA A;  5GAN 3;  5GAO p;  2XG8 D;  4BI8 B;  4ZN3 A;  3QXE B;  2C06 A;  2M0O A;  1UB4 A;  1NJI U;  5LJ5 h;  2DZC A;  2VC8 A;  3VU3 C;  4MZT A;  5GMK j;  3PNW C;  1NPP A;  3UT1 A;  2RB6 A;  4C5G A;  3M56 A;  2RHY A;  3GNF B;  1YJ9 A;  3DLM A;  4M78 E;  2V8K A;  3OSS C;  4LDU A;  1I4K 1;  3A5Z B;  4HT8 A;  3CMA T;  1SSF A;  3L2U A;  3CCV A;  2GQV A;  2GF7 A;  3SWN A;  3LLR A;  3HFN A;  4XK8 E;  4IUP A;  5GAM e;  5GAN 7;  4M77 G;  2MAM A;  3X25 B;  3L2R A;  3JB9 D;  1JJ2 A;  2E65 A;  2ZPF B;  2RI5 A;  1VQ9 A;  3KBG A;  1U8R A;  2E1H A;  3RUX A;  2VV5 A;  3QUI A;  3OS5 A;  3X24 B;  3NFC A;  1OZ2 A;  3L2V A;  1X6O A;  3CME A;  2IG0 A;  3OYY A;  5GAM f;  4M77 B;  5GAN d;  5GAM d;  3S3M A;  4XQ3 A;  1KQ2 A;  4F7U F;  3JCM J;  2LT1 A;  3CBO A;  4M77 C;  4XU3 A;  3V8J A;  4GY5 A;  4N4H A;  2E6Z A;  3OS2 A;  2XDB A;  2JTM A;  1QW1 A;  2R57 A;  1YHQ T;  2XI9 A;  3WVE B;  4QQG A;  2R5A A;  1Q86 C;  3J80 E;  3BDU A;  2RJD A;  4IUV A;  4L6V 5;  1VQP A;  2X35 A;  1VQM T;  5GAN 4;  2G3R A;  4BI4 A;  4ZGD B;  4M7A D;  2K3Y A;  3OMC A;  3RMS A;  2BUD A;  4C8Q A;  3R6O A;  1FXX A;  5J39 A;  2QEX A;  3S3O A;  2WAC A;  3PTA A;  5DLO A;  2LQK A;  2QA4 A;  1KQ1 A;  4C92 G;  3PFS A;  2FB7 A;  4IUR A;  2NLU A;  1K73 C;  3HPW A;  2F5T X;  2DKG A;  4JLI A;  5AYF A;  5CIU A;  2A7Y A;  3SFM A;  5FU7 B;  2DIG A;  2R58 A;  4M75 G;  3FLG A;  2LT4 A;  4JS4 A;  5KH6 A;  4C92 B;  2ZPB B;  4F7U G;  1N8R C;  4JRQ A;  3G71 A;  2RK2 A;  2OTJ A;  4C92 C;  2MF2 A;  5I2M A;  4LDY A;  1ZHI A;  5GAN h;  1N9R A;  1LJO A;  3EFR A;  5IN1 A;  5M9O A;  5GAM h;  1FWZ A;  3I56 A;  4A4H A;  4C0G A;  3CXC A;  4BAC A;  1M1K C;  1M1F A;  4C5I A;  2Y4X A;  5J3B A;  3FIF A;  3QPH A;  4FIB A;  4J6Y A;  4M75 C;  4F7U B;  5LJ3 e;  4O6J A;  3G7Z A;  2MMP A;  4CRI A;  3JB9 J;  1R8O B;  3VUB A;  2MWP A;  4RG8 A;  4M7D D;  2L89 A;  3JSC A;  1BI0 A;  3OYK A;  5GMK m;  4PJO C;  4C5H A;  5GAN j;  1K9M C;  2JZ2 A;  1VQL T;  1VQ5 T;  3CBP A;  1VQO T;  3OY9 A;  1Y71 A;  5LJ3 f;  2HBP A;  2YHT A;  3M59 A;  4C8Q F;  4QQD A;  1BI2 A;  2DTH A;  5LJ3 d;  3TCJ A;  5A2Q E;  4XTZ A;  3QKJ A;  2O4X A;  2EJ9 A;  3M58 A;  4IKF A;  3FRN A;  2RI3 A;  4BI3 A;  3VJP A;  1QVP A;  2RHX A;  1Q86 U;  2XK0 A;  3WVD B;  4XU2 A;  3OS1 A;  3UPU A;  3JCM d;  4HCC A;  4PLL A;  3CCQ T;  2DD4 A;  2LX9 A;  1U1S A;  3QZ5 B;  1S72 A;  4M7A A;  3QHS A;  3V8L A;  3MP1 A;  4GLK A;  3GOX A;  4MDX A;  5D6Y A;  4EMK C;  1YJN A;  2RO0 A;  1KHC A;  1VQ7 T;  1VQK T;  2RJE A;  4JRP A;  3CC2 T;  4NL2 A;  3RIR A;  1VQN T;  3TEE A;  3VYH B;  5DM7 R;  5GAN g;  1QVG A;  3V7S A;  3I55 T;  2E64 A;  3QJ6 A;  3L42 A;  3X20 B;  4JLG A;  1I5L A;  2L3R A;  2DXU A;  4FM4 B;  2RD1 A;  1K73 U;  2I2L A;  3M4G A;  3JCM b;  3M55 A;  2RHU A;  4BDY A;  3A8M B;  4O5V A;  4BUG A;  3OYM A;  3L2Z A;  3CC4 A;  1G3S A;  4C8Q E;  1H64 1;  2ZCF B;  4LDV A;  1YIJ A;  3INZ A;  3CC7 T;  3JB9 F;  3ER0 A;  3CCJ T;  4XTY A;  3NTH A;  1N8R U;  4ME7 A;  2BKD N;  3CCR A;  1KD1 U;  2RI2 A;  2DIQ A;  2VXE A;  3CCE A;  4M7A G;  4C8Q G;  3SD4 A;  1JRI A;  3RKW A;  1V29 B;  1P92 A;  4EDU A;  4A4F A;  2K5F A;  1M1K U;  3MEV A;  2LNV A;  2M16 A;  3V7R A;  3C95 A;  4PNO A;  3CCL A;  2VUB A;  3BDL A;  4BD3 A;  4D6W A;  5LJ3 h;  1W2B A;  4QVD A;  3BFM A;  1VQ4 T;  4NS5 A;  3MO8 A;  4II1 A;  2DXB A;  4P5N A;  4C8Q B;  4DOV A;  1UGP B;  1GXI E;  4B9X A;  3JCM h;  4JS5 A;  4DA4 A;  2ZGW A;  4M7D A;  3M5A A;  4RG2 A;  4C8Q C;  1YI2 T;  3P8B B;  3OQ5 A;  2YLC A;  3GP8 A;  3DB3 A;  1Y96 B;  2IVW A;  1M5Q 1;  4OGC A;  3A8O B;  3FEO A;  5C0M A;  4M7A F;  1M4Z A;  2E6N A;  3C4S A;  4J6X A;  2CZ7 B;  3QBY A;  4M78 G;  3ME9 A;  5LL6 S;  3VYG A;  5LJ5 j;  5GAO m;  3OYH A;  3G4S A;  4Z02 A;  1VIE A;  4N4G A;  3JB9 G;  4NL3 A;  3CD6 A;  4KT0 E;  1VIF A;  2EFI A;  5CK9 A;  3MEU A;  5FRM A;  2PVO B;  2PVG B;  2D6F A;  3CCS T;  4MML A;  4M78 B;  2QQ9 A;  3FC3 A;  3JB9 H;  2E70 A;  5DLQ E;  4JRK A;  3PIP A;  4ZTF A;  2VXF A;  2DTO A;  2XDP A;  2EJG A;  3OBY A;  4M78 C;  3CCU A;  1LNX A;  1AHJ B;  3CXC S;  2DK3 A;  2E10 A;  3L1A A;  3NTK A;  4FU6 A;  1YJ9 T;  3VKI A;  2EQK A;  1VQM A;  4M77 D;  3OBW A;  1QVF A;  5LJ5 g;  2L5Q A;  3VUZ A;  4M7A E;  3CCV T;  3JCM g;  3MEW A;  3BW1 A;  2K2V A;  4R56 A;  3N5B B;  4C0D B;  3PIO A;  2HNI A;  1YIT T;  1TH7 A;  2P4T A;  1BKB A;  2ZPG B;  4N0A A;  4N4I A;  2QXF A;  4JDS A;  3MCA B;  4M7D F;  2O4X B;  3ZBD A;  3ZEH A;  4C0D C;  2YRV A;  3HP9 A;  3M54 A;  4XTW A;  4J7I A;  2FYK A;  2LTO A;  2H3J A;  2L8D A;  3HL8 A;  2LQ8 A;  3E19 A;  3QYG B;  4RCB A;  3CME T;  2GCX A;  5GAO r;  3MET A;  1M90 C;  2F69 A;  4E7H A;  4LD9 K;  2V8J A;  4M7A B;  2XU8 A;  4RKU E;  3PMT A;  2EWN A;  3QSU A;  5KCO A;  1D3B B;  1XNI A;  5CCA A;  1KC8 C;  2JOY A;  3QG1 A;  5FU7 C;  3WXM B;  5KE3 A;  2P0Q A;  2LC4 A;  4EMH A;  3M57 A;  1VUB A;  2DEQ A;  3RKX A;  2E12 A;  4MZM A;  3HRT A;  1QVG S;  2EQM A;  1KQS A;  4DQ2 A;  1VQP T;  3L2W A;  1BIB A;  2PUO B;  1OI1 A;  1RI0 A;  2CS7 A;  4XU0 A;  1WJQ A;  4C92 D;  2DD5 A;  3LH0 A;  3S3N A;  1G5V A;  3QJY A;  4BE0 A;  3OYL A;  4M7D E;  5CVI A;  3HHT B;  3FB9 A;  2QEX T;  3OW2 S;  2LVM A;  4OGE A;  1QP2 A;  1VQ5 A;  3HRS A;  4E7J A;  4M75 D;  2KVQ G;  1VQO A;  2D0Q B;  3PT9 A;  1Q82 C;  1EIF A;  3JAM E;  1YJW A;  4M7D G;  1BYM A;  4ZN1 A;  5GAM j;  2B8A A;  1OZ3 A;  1M8V A;  2PVD B;  2VYT A;  3T9N A;  3MEA A;  4PJO D;  1Q81 C;  1NPR A;  5GMK e;  2K3X A;  3JCM X;  5GMK l;  1MGQ A;  3OYN A;  2DPP B;  3G6E A;  1W2B S;  2OTL A;  5FRO A;  1WNL A;  4M77 A;  2DTI A;  4M7D B;  2V8I A;  3G71 T;  4HA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...