4M7AE

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
75
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDNEKVMQHHGRMLLSGNNIAILVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 12
structure length 75
sequence length 81
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aE00
4A54A 5GAN4 4M7DF 3BFMA 1D3BA 1I8FA 1WPYA 2QTXA 4C8QG 3QUIA 4DQ2A 5LJ3j 5LJ5g 5GANh 1JRIA 4M77A 1BIAA 1U1TA 4M75E 2DTHA 4M75D 4QVDA 4M7AG 1MGQA 4C92A 4MMKA 1KQ2A 5GAN7 4M7AC 3JCMe 2DJZA 3HSBA 3V7SA 5GMKe 1N9SA 3HFNA 5GANj 2DXUA 4M75F 1LNXA 4M77E 4M78D 1KQ1A 1TH7A 5GAMh 1Y96B 2RM4A 4C92E 1HK9A 4M7AA 4JRKA 2JN0A 4PJOE 3EFRA 3V8JA 4PJOD 4M78F 4HA8A 2EJGA 2I2LA 4C8QE 4HT8A 4J6WA 4XTYA 4C8QD 2E10A 5LJ3h 3V8LA 5GAN3 2CGHA 2HNIA 2EJFA 3EFSA 4NL3A 4HT9A 4M7AE 4PJOF 3JCMf 1H641 5CAIA 5GAN5 3JB9J 4M7AD 5GAOn 4RCCA 2E41A 2YLCA 1WNLA 4C8QF 4J6YA 4EMKB 2YHTA 3BY7A 4NOYA 1Y96A 3FJPA 4N0AA 3V8KA 4A53A 5LJ5f 2DEQA 2FYKA 4XTVA 2K57A 1BIBA 1N9RA 4EMKC 4F7UB 3PGGA 2DVEA 5GMKi 5GAN8 2DXTA 1I81A 1YCYA 4M77D 5GMKl 4JLIA 5GAMg 5GANe 4X9CA 3QHSA 4PNOA 4C92D 4EMKA 3JCMd 3AHUA 3RERA 1B34B 4M7DB 5GMKh 2EAYA 3L1AA 3V7RA 4M77F 4XTUA 3JB9H 4N0AC 4X9DA 3QO3A 5LJ5d 5LJ5h 4C92F 4F7UA 5GAOm 5LJ3g 3GIBA 4J6XA 4XTXA 3RESA 4EMHA 3JB9I 4OP0A 3RKYA 5GAMe 5GMKj 4XTWA 1M5Q1 3JCMc 3JCMJ 2DZCA 5GAOq 4M75B 3HFOA 4XTZA 5LJ5j 2VXEA 5GANg 5DY9A 5GAOr 4JUVA 3JB9G 5GANf 4M7AF 4M7DA 1LOJA 4WF2A 1D3BB 3SWNB 2EJ9A 4RCBA 1JBMA 5LJ3e 4XU0A 1WQWA 4M78B 5GAOp 3INZA 4Y91A 5I21A 3RUXA 1X01A 4C92B 4F7UG 5GMKm 3SWNC 1M8VA 3L2ZA 3V7CA 2EWNA 4PJOB 4M78G 4M78C 2RD1A 3JCMh 2DKGA 5GAMf 2RA2A 4M75A 4C8QB 3JCMb 4PJOC 3BW1A 4M7AB 4XU3A 3SWNA 2DTOA 3BDUA 5GANd 3JB9D 4M7DC 4C8QC 5LJ3f 2DZ9A 4M78A 4M7DG 4NL2A 2RB6A 3RKXA 5GAN2 2VXFA 1HXDA 4MMLA 3FIFA 4XU2A 3VU3C 3JCMV 3JCMW 3JB9F 4PJOA 1WQ7A 4F7UE 5GAN6 3QSUA 1B34A 4J5YA 2ZGWA 4M78E 4XQ3A 4C8QA 3JCMX 3FB9A 5GAMd 4M75G 5LJ5e 4XU1A 4M75C 2DTIA 4M77B 2VC8A 1LJOA 2E1HA 2FB7A 4F7UF 4QVCA 2YLBA 3RIRA 2Y90A 4JRIA 3JCMQ 3JCMP 1U1SA 1I5LA 4M7DE 4M7DD 1I4K1 4M77G 3M4GA 5LJ3d 4M77C 5GAMj 4V2SA 3RKWA 3JCMg 5GAOl 4C92G 2E65A 4C92C 4EMGA 3SB2A 2E64A 4PJOG
chains in the Genus database with same CATH superfamily
1Q95G 3VS4A 2FZCB 1I8FA 3J7AF 3PIOA 3S6WA 1TXQA 4AG1C 2HMAA 1AWJA 3MO8A 2O2OA 2X4YA 5GANj 3S3MA 3VS3A 1RAEB 3NTHA 2Z0WA 1WXBA 2A0FB 2WSFE 2JMCA 3FRNA 1W2BP 4HT9A 2BZ8A 2CP6A 5GAN5 3EGXA 4CRIA 2RJDA 2YHTA 3M4YA 4FSXA 1X27A 4RTUA 4A4EA 4JPBW 2I0NA 2AIRB 2RQTA 3EHQA 5KYWA 2SRCA 4DOWA 2O9SA 1YFNA 2FPEA 3MP1A 2XKOC 1CKAA 4C5IA 4KRTA 1UGSB 2DBMA 4RUGA 4OMFB 3JB9I 1K73U 3HFOA 3CCRT 5DY9A 2HL5C 1KC8C 1KC8R 2F2VA 1NBEB 1IZ6A 4F17A 1M2OA 1Z9QA 4M78C 4KUDK 4M75A 4OB1B 3ASKA 4HCKA 2JUFA 2W0ZA 4XU2A 1YP5A 1MHNA 3JCMW 3JB9F 4KH1B 4DA4A 3EGXB 4FIBA 4XQ3A 4MDWA 3UF4A 2HL3A 2A28A 2L3SA 4ATOA 2E1HA 2VYTA 2EYQA 2DL8A 4OVAA 3RKWA 3JCMg 2VVKA 2RNAA 2DL3A 2PNIA 1UJ0A 4ELYC 2EQIA 3DLMA 4M7AG 3HRUA 2WACA 2LZ6B 1OZ3A 4PJMA 1RAGB 4A63B 1FMVA 1E6HA 1TH7A 4A4HA 3LX7A 2XMFA 1HK9A 3QWXX 5C6SA 4PFZA 4J6WA 5LJ3h 2B86A 3EH1A 2M51A 5A2QE 4AG2C 5FU7B 2P0KA 1MNEA 5KCHA 3I55T 2D1XA 4OB3B 3DLLA 3EFOA 3VS0A 2EVRA 3M0PA 4PJNA 1ZUYA 2FRWA 1VQ5A 2C0TA 2AK5A 1AOJA 3VRZA 4OB0B 5FU6B 2HD0A 3AHUA 1J3TA 2DPPB 4J7IA 5IN1A 4QQDA 4OMLA 4AFSC 1X6BA 1RL2A 4GY5A 5EG2A 1PWTA 1GBQA 3GIBA 2JS2A 2KRSA 5CQXA 1WA7A 1M5Q1 1D1AA 1OPKA 1RAIB 1QP3A 1BI0A 3OYNA 4D8KA 3CC7T 4MDXA 3C4SA 3OQ5A 5KYUB 2NUZA 2DLPA 3N5BB 1H3ZA 3X24B 2FZKB 3EG0A 2GCXA 3OYDA 4KT0E 3SWNA 1AZGB 2DILA 2FEIA 1ARKA 3CC2A 2MI6A 3QWYA 1S1NA 1UE9A 5FRMA 5GAN6 5KYXA 2ZGWA 2EBPA 3UA6A 3NHNA 1KQSA 4M75C 4F7UF 1YBYA 1YI2A 4KBMB 1QCNA 3OYLA 3A8LB 4BY6B 4C92C 5L8RE 3ZFJA 4OMQA 4ZGEB 3E9GA 1QLYA 5GAN4 4ZTFA 3PVLA 4DQ2A 4C8QG 3CC2Q 3CCEA 1R8OB 3H0HA 2DXCA 1MGQA 3X28B 1KQ2A 2A37A 3HFNA 2JOYA 3IQLA 1YI2Q 3X20B 1UECA 3E19A 1VQ9T 4OGCA 3C94A 1R0CB 1AVZC 4HVWA 3CPWP 4RCCA 3CCEQ 3CMAT 4EMKB 4NOYA 2QI2A 2RJFA 2DEQA 3PNWC 4Y92A 2EIFA 3X26B 3MCAB 2LQWA 1JXMA 4IUPA 2DX1A 2F5KA 1AD5A 1X6GA 1I5OB 2X35A 3U23A 2X4XA 1YHQT 4CC4B 1GBRA 4B9WA 2KDSA 3EGDA 3M53A 1K9AA 2HKNA 2BKDN 5HK0A 4KH0B 3PTAA 5LJ3e 1C6VX 1UGRB 2JVVA 3RR6A 4JJBA 3H8ZA 3QYGB 4FYWB 2CSQA 1M3AA 4ZTJA 5GAMf 2J6OA 4CC3A 2XD0A 2KI7A 3JCMb 3BW1A 3S3OA 1KD1U 1PKTA 1T3LA 2DTOA 5GANd 4M7DG 1NG2A 4E7ZA 5DM7R 3JCMV 2LNVA 4ZGJB 4YTLA 2X4WA 1QVFA 1B7TA 2DBKA 4JS4A 1LCKA 2OAUA 3RBBB 1VQ6T 2LT1A 4IUTA 4JRIA 1UEBA 2GTOA 4M77C 1C0MA 1IGQA 3PIPA 2RH2A 3CEYA 1G2BA 4PJOG 3OA6A 1NYGA 5KH6A 3FDRA 2YT6A 1VQKA 1G83A 1WGSA 1IREB 4L5GA 3GP8A 4O5VA 2KY9A 4M75F 1UJYA 4M78D 1VA7A 1KJWA 1T0HA 1ZSZA 4HCCA 2VV5A 2OTLQ 2ZPBB 1F1BB 1SPKA 2EGEA 1MMDA 1GCQC 1WHHA 4XTYA 5IHIA 4BB7A 2E4HA 2HBWA 4E47A 1YJ9T 3QBYA 4F16A 2MYSA 3LH0A 1YNZA 1MMAA 1Y96A 3FJPA 4N0AA 3QIIA 2QK0A 2EGCA 2K57A 3G7ZA 1QKWA 2H3EB 3VS2A 1RLPC 3E1SA 3JSCA 3O8VA 4WCIA 5GMKi 2K7AA 4J7FA 4JRPA 2HCKA 3GNGA 2DYBA 2KXDA 3CCJA 2QYZA 2QXFA 2PVGB 2VWFA 2OTJT 2F1LA 1HD3A 1VOMA 1YWOA 3CMEA 4C0GA 2M1HA 1EZZB 3DKMA 2MWPA 2LP5A 2ZAEA 5FWCA 2AZSA 1WQWA 2E70A 1M30A 2JZ2A 1BKBA 1X01A 1JJ2A 3D7SB 2X9HA 2L2PA 4MZTA 3ZBDA 2ECZA 3CCJQ 2JJ9A 2F5TX 2R5AA 5CCAA 3HL8A 4C8QC 2RHZA 3CMEQ 4E7HA 3VU3C 2RI3A 4F7UE 3QJYA 1V29B 1WXUA 1JXOA 1M2VA 4M78E 4BE2A 4F04B 2YXYA 2DTIA 2FB7A 2V8KA 1SRMA 4PFOA 3SDZA 3REBB 2KE9A 1VQ7T 1RAHB 2NUTB 3M0SA 3P8HA 2G6FX 3WVDB 1GL5A 3BFMA 2QEXT 1K76A 1X69A 2KT8A 2X3XD 2RQVA 4BE1A 1UFFA 2DXUA 3J80E 1OU9A 2P84A 3FJ5A 1G5VA 3PMIA 5D6YA 1G3TA 2JN0A 3F70A 1XQHA 3VS7A 2KRNA 4KGZB 4J83A 1H3HA 1T3SA 5GAN3 2KK4A 2RJCA 4IUQA 2CT4A 2K2MA 2KSSA 2YUOA 1BI3A 3L2QA 4PKCC 1KFZA 3NMZC 4DBFA 2AHJB 3I55A 1VQLA 3MKDA 4WTOB 2K9GA 4X9CA 4C92D 2LCLA 5DLQE 3G4ST 3CCST 2BE7D 2GF7A 4N0AC 2HZYA 2BZYA 1X43A 2D0QB 4EMHA 1BU1A 4PJLA 2FHDA 1DJ7B 7AT1B 2E6ZA 1QMCA 4TVRA 2DFUA 3I55Q 1VQLQ 4LDXA 1NEBA 1Q7YU 2QDYB 3LGLA 2QA4T 1T0JA 1B07A 2KVQG 2JM8A 4PJOC 3KXTA 3OYCA 2FL7A 3VYHB 3NTKA 5CK9A 4M78A 4P5NA 2RB6A 1HXDA 4N4IA 2KAFA 4E7IA 3GOXA 4E7LA 1VQ8T 2DRMA 1NLOC 4XU1A 1Q86U 2MCNA 3A8GB 3KBGA 3CC7Q 2K5LA 5KE2A 2XDPA 1VQ4T 1VQOT 1NPRA 3CCQA 2DXBA 3L2WA 3QUIA 3TVTA 4J9FA 1BCMA 4M75E 1KD1R 1KD1C 1OYXA 3M58A 4FL6A 1TUDA 1LNXA 1TS9A 3HRTA 4C92E 3I56T 3M56A 1V76A 2GBQA 2CP0A 2LQKA 1OOTA 5C0MA 2LC4A 1MNDA 3AT1B 4M7AD 3CCQQ 3OSVA 1YN8A 2NWMA 2YSQA 3HKSA 3QJ6A 2E6NA 4RG8A 4F7UB 1OV3A 1NJIC 1NJIR 1O75A 2LJ1A 6AT1B 1NM7A 4M77D 2YUPA 1VYTA 2HAXA 3QHSA 1PKSA 1ZSGA 2RPNA 2EYZA 1PM3A 2GFUA 3L2RA 3LLRA 4R55A 4QW2A 5IXFA 3OYYA 2KNBB 4OP0A 3GLXA 1OX8A 2A36A 5GANf 1YHQA 2PUOB 4C0ZA 5GAOp 3OYIA 3MP6A 3RUXA 1I0CA 3Q1JA 2QG9B 2CREA 3CCVT 3JCMh 3OYKA 1K9MU 2D6FA 2DRKA 3VV0A 3HRSA 2EQUA 1JU5C 1KSWA 3BDLA 4MMLA 1WLPB 4D8DA 1YHQQ 4J8OA 1WQ7A 4FU6A 2EQMA 1M90U 1V1CA 2XU8A 4KGXB 2PU9B 2DETA 1OX9A 4DOVA 2Y90A 4JZ4A 1AHJB 5LJ3d 2RI5A 3OYHA 3CD6A 1VQ6A 4A54A 4PFPA 1D3BA 1JRIA 3CXCA 4DBHA 2K2VA 2MF2A 2L3PA 3PFSA 3UDCA 3CCLT 1VQMA 2DYIA 4C92A 5D6XA 4Z02A 8ATCB 2LVMA 3V7SA 2QASA 4AT1B 4M77E 4K11A 3OBYA 4JRKA 5DLOA 2OX7A 1TUGB 2GGRA 2EJGA 3ULRB 3CD6Q 2M9UA 4QQGA 4C8QD 5KYWB 1M1KU 1P92A 2QTVA 1M3BA 1VQ6Q 1VQNT 1K0XA 2IPOB 3FC3A 4PL6A 5CR2A 1R0BG 2FZGB 2L3QA 3ER0A 1KHIA 3QPHA 4X34A 1MUZA 1VQMQ 2ROLA 2K3YA 2EKHA 2LX9A 3E9FA 1I81A 3M9QA 2RHYA 5CKEA 1YITT 5GAMg 1UUEA 1YIJA 4HCZA 2K6DA 1WZOA 2LNHB 3P8DA 3VS6A 1RACB 4J6XA 2A08A 2L0AA 4J9CA 1VYVA 2C0IA 3HHTB 3MEWA 4M75B 3MEUA 4E2FB 4RMOA 5CKHA 4WF2A 1D3BB 1JBMA 3UT1A 2LRQA 1GXIE 2KEAA 3L2VA 1WJSA 4C92B 3LGFA 1YIJQ 1B3QA 2EQKA 2EWNA 1NE8A 2KT1A 1KQSS 1QCOA 1M1FA 4J9EA 4F14A 2VXFA 1YJWA 1WDXA 2RQWA 1WX6A 5GJWB 3QSUA 1B34A 4J5YA 1K0SA 1QKXA 2LJ3A 4EPCA 3T9NA 3JCMP 1BI2A 4DEYA 1RAAB 2MWOA 4M7DD 3CBMA 1Q7YR 2O4XA 3CBOA 4JDSA 1UTIA 5A0GA 2V8JA 1W4SA 1OEBA 3HTRA 1UG1A 2VB6A 3TREA 2QQSA 3VKIA 1WPYA 2FO0A 2BTTA 4M77A 5HY6A 1YJWQ 2RN8A 3META 1I1JA 1ZLMA 5I2SA 1Q81C 1Q81R 3JCMe 2QEXA 2P4TA 1OU8A 2P0PA 4BI8B 2GQVA 2DIGA 3EFOB 1KG1A 3M0TA 3ZL7C 4PJOD 1Q86C 1Q86R 1D09B 4M78F 3CCUT 1Y57A 4R0KA 4NL3A 2J06A 4FYYB 4LUDA 1YJNT 3VS5A 5GAOn 2L5QA 2V8IA 1GCQA 3V8KA 4A4KA 3OBWA 2PVDB 3THKA 4AFUC 3WVEB 2QEXQ 2YUNA 2NUPA 2DXTA 5GJVB 2ZCFB 1B34B 1QP2A 2A7YA 2ROTA 3CCMA 1N8RC 1N8RR 3JB9H 3C0CA 2DD5A 2MMPA 5LJ5d 5FU6C 2FRYA 1SEMA 3GBQA 2O4XB 4XTZA 2AZVA 1GFDA 2F2XA 1QW1A 3SWNB 2ZPIB 2X51A 1H92A 1G3SA 3INZA 2PZ1A 4GLMA 1FMKA 1QVGP 3OW2P 3CCMQ 4OGEA 2DKGA 2PQWA 5KYXB 4VUBA 1WHMA 4ESRA 2A3LA 3TEEA 1QVFS 4ZGDB 2K5FA 3QDFA 3G4SQ 4NS5A 4FT4A 2LCSA 2YRVA 4LUEA 2RQRA 2GFAA 2DK3A 4C8QA 4FCYA 4CC7A 4ME7A 3TCJA 1I07A 1K1ZA 3MEVA 3MHXA 3CC4A 1VQ8A 2ZPHB 5GAMj 2RHXA 2K3BA 4C5GA 2RJEA 1W2BA 4HVUA 2QQ9A 1K9MR 1K9MC 1RAFB 1C1AA 5D6WA 5KCOA 2WSEE 2L3RA 3JAME 4BY6C 5L23A 2ZPGB 1VQ4A 4M7AC 5CKBA 1K73C 1K73R 2CZ6B 3SEMA 4IIOA 2LT4A 1PNJA 3GNFB 2DE0X 1IGUA 3SD4A 2D9TA 3FEOA 3SFMA 3CC4Q 1VQ8Q 3A1PA 2CZ1B 4HA8A 1NLPC 5CKFA 2E10A 2OTLA 4KGVB 2KGTA 2ZPFB 5CKDA 4CC2A 2DF6A 2LQNA 1VQ4Q 2KMTA 2VKNA 2CZ7B 2HQEA 4XTVA 1AEYA 5HK3A 1G3YA 3EG2A 4EMKC 5CVIA 2RHUA 1BI1A 3EGDB 3H41A 3VUZA 3OMCA 2DVEA 5GAN8 1YCYA 2KYBA 3PVQA 5IAYA 5GMKh 4J9GA 2D8JA 4C92F 4BI4A 2VUBA 2EKOA 1JJ2S 1QWEA 1UDLA 5GAOr 3JB9G 4JUVA 4M7DA 4HVVA 1LOJA 2XI9A 2F2WA 4R56A 4Q5WA 3M57A 1ZQ1A 1KK7A 4UC4A 1YCSB 1PG5B 3MP8A 3NGPA 1WHJA 2DERA 5LJ3f 1ZUUA 3CCVA 3OS0A 3FIFA 2RO0A 5EC7A 4PJOA 2LX7A 1X2QA 2QQAA 4DBRA 2IG0A 1ZX6A 2CP5A 4C0DC 2BUDA 1K8AU 4PJJA 5IHKA 2WSCE 3RIRA 3CCRA 1WHGA 1U1SA 4QQ6A 2RQUA 4LN2A 1JQQA 3X25B 1SSHA 5GAOl 1VQ5T 1JEGA 1ZSZB 3CCVQ 2CP7A 3UATA 2QTXA 3H0IA 3UA7A 3CQTA 4AFZC 1KC8U 1LVKA 1K4US 4FYXB 2DJZA 1IB8A 2KYMA 1FWZA 5CQYA 2XDDA 1WHKA 1Y96B 3PE0A 3CCRQ 2LTOA 2RM4A 3QXEB 2DL4A 1WI7A 2RK1A 5J39A 4PLLA 2HNIA 4J9IA 2HEQA 1D0ZA 2QGFB 2NLUA 5A0DA 1VQNA 4J9HA 4II1A 1N9RA 2D8HA 3S3NA 3PGGA 2FG0A 2IVWA 3CCLQ 3EGUA 1TU0B 2VGMA 1RUWA 1AWXA 4M77F 4AFQC 4LE9A 1U3OA 1M27C 4M4ZA 1BK2A 2XK0A 1VQNQ 5KE3A 2COYA 1D0XA 1M3CA 2GTJA 1TOVA 5HCKA 2AKKA 3BE3A 3JRZA 4RCBA 3J81E 1GRIA 1XTDA 4Y91A 2CH4A 1TUCA 4F7UG 4BI3A 1SF9A 3CCET 4M78G 1X75C 1PSFA 2RD1A 3FLGA 1M2VB 5KYNA 2H3JA 4RTXA 1AT1B 4M7DC 4B9XA 2DZ9A 2KRMA 5M9OA 3EH2A 3E2UA 2QGGA 2DL5A 1MMGA 4O6JA 2JTEA 4BDZA 2HBPA 4MZMA 3FB9A 5FW9A 1M1GA 2VC8A 4IURA 4C0FA 4HXJA 1FYNA 1TTHB 3M4GA 2EQJA 3URGA 3CC7A 1RI0A 3MPUB 3OS5A 1NZ9A 4J9BA 4ORZA 5I2MA 3CPWA 2COZA 5FWBA 5GAN7 2O9VA 3HSBA 1QQJA 1Y7XA 1KQSP 2G3RA 2DL7A 3I5RA 4IUVA 4KULA 3VRYA 4HT8A 1PRMC 3EFSA 5CAIA 1OPLA 3A8OB 3OS1A 4C8QF 1WNLA 3LYIA 5D7UA 4HKEA 2JMAA 5LJ5f 3G1JA 3QDRB 2CKKA 4GLKA 3OMGA 2CUDA 3R6NA 1W6XA 2YDLA 4BE0A 1MV0B 2HSEB 4E7SA 1ZA1B 1VIEA 3JCMd 3R6OA 3RERA 3A5ZB 2YUQA 1RLQC 1U5SA 4OMMA 3OYJA 4IKFA 2V1RA 3UWNA 1RADB 5GMKj 3CCUQ 4QVZA 5GAOq 1VQ9A 3M0RA 3NFCA 4JZ3A 1PCXA 4EIKA 3CMAA 4M78B 3RMSA 2EW3A 2ENMA 2XICA 1M8VA 1VQKT 1XNIA 3QYHB 3TSZA 4RTZA 4L59A 4HCBA 5IXBA 2JS0A 4RTYA 1VQ9Q 2PVOB 2HQHA 2V1QA 2J05A 2O31A 2NYSA 1ZHIA 5J26A 3CMAQ 3EAEA 3OS2A 1YWPA 4M75G 1OZ2A 5CIUA 4D6WA 2QAZA 4Z89A 3CXCS 5ECAA 1G3WA 5HKCA 1VUBA 1RABB 2DVJA 4C92G 2E65A 4ELZC 2KR3A 4M7DF 1SHFA 2DTHA 1VQPT 2XIDA 3EG3A 3OYMA 1GFCA 1IHWA 1VYUA 1KHCA 1FXXA 1QVFP 3CCJT 1QWFA 1N9SA 2K5IA 3OYAA 2QQRA 4FT2A 5GAMh 1XOVA 1NYFA 2BE9B 2JXBA 4Y28E 1SHGA 1K8AR 1K8AC 3CMET 2HKQB 2DO3A 4PLIA 1G8XA 4M7AE 4PJOF 3M54A 3JB9J 1OQKA 1SRLA 4N4GA 2ESWA 4QT7A 4PK4A 1UGPB 2FPDA 2DNUA 2AKLA 3L2UA 2CZ0B 1PRLC 1NPPA 4PNOA 5FRNA 2E12A 2M0YA 5I22A 1N27A 1OI1A 2OI3A 4XTXA 2RK2A 4LD9K 3JCMJ 3QG1A 3G6ET 2YRDA 2EJ9A 5IHNA 1YJ9A 4XU0A 4RTTA 2KBTA 3G71T 3L2ZA 1TSFA 2KXCA 2DJQA 4OMPA 3H6ZA 3M55A 3P8BB 3EHRA 1VIFA 1W1FA 1ZBJA 4Z8AA 2RI2A 2CH4W 2M16A 1HJDA 1WHLA 5KYUA 3OYFA 1YJ9Q 3JCMX 2OTJA 1JJ2P 4EDUA 5J3BA 2YLBA 1BCOA 4M77G 4OB2B 2D0NA 1N5ZA 4J9DA 2ABLA 3RMQA 1VQLT 1BIAA 3M59A 2CS7A 2XHCA 1UHFA 4MMKA 1BB9A 2MOXA 3I5SA 2R5MA 2OTJQ 4MZPA 1S72T 1LPLA 4M7AA 2AT1B 1M9SA 5IH2A 1SKUB 4C8QE 2BZXA 1Q7YC 2EJFA 2RHIA 4BUGA 4C5HA 2X3WD 2FVUA 3HPWA 2J6KA 1VQ5Q 1UB4A 2E3HA 3VJPA 1VQ7A 2ATCB 1PC0A 1IXDA 3ME9A 1EX4A 4JLIA 4LNPA 4EMKA 2QQBA 1SG5A 1WIEA 1AWWA 4X9DA 1TWBA 2O01E 2R58A 1R77A 4KUIA 2LQ8A 5LJ3g 5GAOm 2L89A 4Z88A 5GAMe 1VQ7Q 2DM1A 5FU7C 3MJXA 1IO6A 1WFWA 3QKJA 1Z9ZA 2RF0A 3CCQT 2VGNA 2DAQA 2RA2A 2LCCA 1GCPA 1N6AA 4N4HA 4M7AB 3BDUA 3JB9D 3G4SA 3CCSA 4JJDA 2EYWA 4X1VA 3OYGA 1OULA 1KIKA 1IRXA 2C0OA 2HSPA 4IUUA 4DBQA 3EG1A 2J7IA 1W2BS 3LH5A 4OMOA 9ATCB 1EIFA 2GNCA 4M77B 1Y07A 1MV3A 2IIMA 1I5LA 4M7DE 3I9QA 3C95A 4V2SA 2LDMA 2RMOA 4ZN3A 1U8RA 2ED1A 3CCSQ 1AZEA 1U1TA 1EFNA 2QA4A 1D1BA 4QVDA 5A0LA 2QDLA 1CSKA 1H8KA 4CI0C 1CKBA 4E7JA 2O88A 1BBZA 4PJOE 3EFRA 1WJRA 2KQWA 2CUBA 3V8LA 4OMNA 4BDYA 2NUPB 2R57A 2CP3A 3JCMf 1H641 1UHCA 1IHVA 1WYXA 2QA4Q 3H9NA 2JT4A 4A53A 2JW4A 1Q82U 3DB3A 3OYEA 1BYMA 1VQOA 2KROA 3A98A 2Y4YA 1M90C 1M90R 2E5KA 3V7RA 1WJQA 3QO3A 1WXTA 5LJ5h 2PTKA 3I56A 3RKYA 2HQXA 2OJ2A 4C0DB 4JS5A 2VXEA 2OAWA 2W10A 3VYGA 1VQOQ 4LDYA 1RI9A 4RG2A 3CD6T 1JO8A 3M0UA 2F69A 5GMKm 3SWNC 1SSFA 2DEUA 3OB9A 4C8QB 1VQMT 2V26A 2GQIA 2ED0A 4BACA 2EYYA 4XU3A 3I56Q 3I35A 3KFVA 2CP2A 4LDVA 1M1KC 1M1KR 2XG8D 3RKXA 5GAN2 4FYVB 1NJIU 2LMJA 2FPFA 4XAXB 2YWWA 4LDUA 5KYYA 2L8DA 4QVCA 4E7KA 2EFIA 4GBQA 4LXCA 2ZZDA 1D1CA 3EG9A 4LDWA 3SB2A 4EMGA 1VQKQ 1M8MA 2ZPEB 1QCFA 3O5ZA 4RTWA 5LJ5g 5GANh 5LJ3j 2P0QA 2H8HA 1YIJT 2NUTA 1KQ1A 2K3XA 1VQPA 4ZN1A 2I2LA 5IT9E 1X6OA 2BIVA 2CGHA 2XDBA 2MIOA 1ZA2B 3CXCP 4BD3A 4FSSA 1MMNA 3VS1A 4RKUE 1BIBA 2CT3A 2MK5A 2EPDA 1VQPQ 3LW5E 4XK8E 2CYZB 3CCLA 2JM9A 4M7DB 4FW1A 3CPFA 3A8MB 3HP9A 1ABQA 3L1AA 5I11A 1YJWT 3CBPA 4JJCA 3M0QA 1NEGA 5KYYB 1ABOA 3RESA 3A8HB 4L6V5 3JCMc 3TSWA 3EG9B 2B8AA 5GANg 4M7AF 1E7OA 1UGVA 1XJWB 3PMTA 2DD4A 3RNJA 3G6EA 3PT9A 4PJOB 4DEXA 3CC2T 3OYBA 3QZ9B 3LWIA 2Y4XA 1X2KA 1ZBXA 3G71A 1YITA 4JJNK 1HSQA 2VASA 1YI2T 2SEMA 1JB0E 5FLXE 3OY9A 3G6EQ 5LJ5e 2C06A 1AWOA 4C5EA 3CPWS 1LJOA 1TG0A 3JCMQ 4ANJA 4LD6A 4A4GA 3DB4A 1I4K1 2X4JA 1HYOA 1U06A 2COWA 3G71Q 1YITQ 2E64A 3TQ7P 4E6RA 1A0NB 1QVGS 1UGQB 3OW2S 4M75D 4B6MA 1O9SA 1ZSZC 2MPXC 3CCMT 5GMKe 4QKUA 3KUFA 3M5AA 4IIMA 2LJ0A 1FX7A 3REAB 8AT1B 3GPLA 3V8JA 4JRQA 1S72A 3RDVA 1D0YA 4FW2A 3GF5A 2E41A 2YLCA 4FM4B 4J6YA 3BY7A 2M0OA 2FYKA 2JTMA 2P4RA 2YRCA 4ZNXA 2JNGA 2PUKB 1ACMB 5GMKl 5GANe 4JLGA 3QZ5B 2MAMA 5CO7A 1QVGA 3OW2A 3L42A 3ZEHA 2EAYA 5LL6S 1Y71A 5AT1B 1S72Q 4XTUA 1PHTA 4F7UA 2DMOA 2K4YA 1Q81U 3C12A 4XTWA 3UPUA 2DZCA 1PD1A 4A4FA 5LJ5j 3CCUA 3CC4T 2M02A 3LWHA 2DIQA 1YJNA 3TU4K 4RTVA 1W70A 4AMCA 3VUBA 5I21A 1Q82C 1Q82R 2EGAA 5AYFA 2JTFA 2DA9A 1ZUKA 3V7CA 2J6FA 2CSIA 2CDTA 3NTIA 1QVPA 2K79A 2EYXA 3SHWA 4NL2A 4OF1A 3JV3A 1YJNQ 5FROA 1M4ZA 2OTLT 1PSEA 1E6GA 3OSSC 5GAMd 1N8RU 3H0FA 3NPFA 2E3IA 1FMWA 2E5QA 1PD0A 3MEAA 2HDAA 3WXMB 1Y0MA
chains in the Genus database with same CATH topology
3WVDB 3BFMA 3RMQA 1I8FA 2QEXT 5D6WA 5KCOA 1VQLT 2WSEE 2L3RA 3S6WA 3PIOA 3J7AF 3JAME 1BIAA 3M59A 4BY6C 2CS7A 2XHCA 2ZPGB 4BE1A 4MMKA 1VQ4A 4M7AC 1VQ6A 3MO8A 5CKBA 1K73C 2R5MA 2X4YA 2CZ6B 5GANj 3S3MA 2DXUA 2LT4A 3J80E 4MZPA 1S72T 3GNFB 3SD4A 2D9TA 3FEOA 3NTHA 3SFMA 1G5VA 3PMIA 5D6YA 1G3TA 1M9SA 4M7AA 2JN0A 3F70A 2CZ1B 1XQHA 4HA8A 4J83A 2WSFE 4C8QE 5CKFA 2E10A 5GAN3 2OTLA 1Q7YC 3FRNA 2EJFA 2KK4A 2RHIA 2RJCA 4BUGA 4HT9A 4IUQA 5GAN5 2ZPFB 5CKDA 4C5HA 2RJDA 2YHTA 2FVUA 3HPWA 3M4YA 2KSSA 4FSXA 4CRIA 2KMTA 1BI3A 1UB4A 2CZ7B 2HQEA 4XTVA 3VJPA 4A4EA 5HK3A 3L2QA 1VQ7A 1G3YA 4EMKC 5CVIA 2RHUA 4PKCC 1BI1A 4DOWA 3VUZA 3OMCA 2DVEA 5GAN8 2AHJB 3ME9A 1YCYA 3I55A 1VQLA 4JLIA 3MP1A 4X9CA 2LCLA 2XKOC 5DLQE 4C92D 2QQBA 4EMKA 3G4ST 3CCST 5IAYA 5GMKh 4C5IA 2GF7A 4N0AC 4X9DA 1UGSB 2O01E 2R58A 4C92F 4KUIA 2LQ8A 4BI4A 5LJ3g 2L89A 2VUBA 5GAOm 4OMFB 2D0QB 4EMHA 3JB9I 2EKOA 5GAMe 1JJ2S 1K73U 3HFOA 2FHDA 3CCRT 1DJ7B 5DY9A 2E6ZA 4JUVA 5FU7C 5GAOr 3JB9G 4M7DA 1LOJA 2XI9A 4TVRA 1KC8C 3QKJA 1IZ6A 4R56A 4LDXA 4Q5WA 1Q7YU 3M57A 3CCQT 1ZQ1A 2QDYB 4UC4A 4M78C 3LGLA 2QA4T 2VGNA 2DAQA 2RA2A 4M75A 4KUDK 2KVQG 4OB1B 2LCCA 3ASKA 3MP8A 4PJOC 1N6AA 2JUFA 4N4HA 4M7AB 3KXTA 3OYCA 2FL7A 3VYHB 3BDUA 3NTKA 3JB9D 5LJ3f 4M78A 5CK9A 4P5NA 3CCVA 2RB6A 3G4SA 3CCSA 1HXDA 4N4IA 3OS0A 3FIFA 4XU2A 3OYGA 2RO0A 1MHNA 2KAFA 4E7IA 3JCMW 3JB9F 3GOXA 4PJOA 4E7LA 4DA4A 2QQAA 4IUUA 1VQ8T 4FIBA 4XQ3A 2IG0A 4MDWA 1W2BS 4XU1A 1Q86U 1EIFA 3A8GB 4C0DC 2BUDA 4M77B 1K8AU 4ATOA 1Y07A 2E1HA 2VYTA 3KBGA 2WSCE 3RIRA 3CCRA 1I5LA 1U1SA 2K5LA 4M7DE 2EYQA 3C95A 4OVAA 4QQ6A 2LDMA 3X25B 3RKWA 5KE2A 4V2SA 3JCMg 2XDPA 5GAOl 1VQ4T 1VQ5T 4ZN3A 1U8RA 1VQOT 1NPRA 3CCQA 2DXBA 2QTXA 3QUIA 4ELYC 3L2WA 1KC8U 1U1TA 3DLMA 4M75E 1KD1C 2QA4A 4QVDA 4M7AG 5A0LA 3HRUA 2WACA 1OZ3A 2DJZA 1OYXA 3M58A 1FWZA 4FL6A 1LNXA 5CQYA 2XDDA 4CI0C 1TH7A 4A4HA 1Y96B 3LX7A 2LTOA 2RM4A 3HRTA 1HK9A 4C92E 4E7JA 3QXEB 3I56T 3M56A 4PJOE 3EFRA 5C6SA 1WJRA 2KQWA 4J6WA 2LQKA 2RK1A 5LJ3h 3V8LA 5J39A 2R57A 4PLLA 2HNIA 5C0MA 4BDYA 2LC4A 5A2QE 5FU7B 3JCMf 1H641 4M7AD 2P0KA 3OSVA 5KCHA 3I55T 2NLUA 5A0DA 4OB3B 4A53A 3DLLA 1VQNA 3HKSA 3QJ6A 4II1A 2E6NA 4RG8A 1VQ5A 1N9RA 4F7UB 3S3NA 3DB3A 1Q82U 3OYEA 3PGGA 1NJIC 1BYMA 1O75A 2IVWA 1VQOA 4M77D 2Y4YA 2HAXA 2VGMA 4OB0B 5FU6B 2HD0A 1M90C 3QHSA 3AHUA 2DPPB 4J7IA 5IN1A 4QQDA 3V7RA 1WJQA 4M77F 1RL2A 4GY5A 5EG2A 3QO3A 5LJ5h 2GFUA 3L2RA 3LLRA 3GIBA 4R55A 4QW2A 3OYYA 3I56A 4OP0A 3RKYA 2HQXA 2XK0A 5CQXA 1M5Q1 3GLXA 5KE3A 1QP3A 4C0DB 1BI0A 4JS5A 2VXEA 3OYNA 5GANf 1YHQA 3VYGA 2PUOB 3JRZA 4LDYA 4RCBA 3J81E 3CC7T 1XTDA 4RG2A 4C0ZA 5GAOp 3CD6T 4MDXA 3OYIA 3MP6A 3C4SA 4Y91A 3OQ5A 3RUXA 3Q1JA 2F69A 4F7UG 5GMKm 3SWNC 4BI3A 1SSFA 3CCET 4M78G 1X75C 1PSFA 3N5BB 2RD1A 3JCMh 3FLGA 3OYKA 3CCVT 3OB9A 3X24B 4C8QB 1K9MU 2D6FA 1VQMT 1H3ZA 3VV0A 2GCXA 2H3JA 3HRSA 3OYDA 4XU3A 4KT0E 4BACA 3SWNA 4M7DC 4B9XA 2DZ9A 4LDVA 5M9OA 1M1KC 2EQUA 2XG8D 3RKXA 5GAN2 1NJIU 3BDLA 3CC2A 4MMLA 2MI6A 4J8OA 1WQ7A 4O6JA 5FRMA 4FU6A 5GAN6 2EQMA 4XAXB 4BDZA 2HBPA 1M90U 2ZGWA 2XU8A 4MZMA 2PU9B 3FB9A 1KQSA 4M75C 1M1GA 4LDUA 2VC8A 2L8DA 4IURA 4F7UF 4QVCA 4DOVA 1YBYA 2EFIA 4C0FA 2Y90A 4E7KA 1YI2A 4KBMB 1AHJB 2ZZDA 5LJ3d 3M4GA 3A8LB 2RI5A 3OYLA 2EQJA 3URGA 3CC7A 1RI0A 3OYHA 3CD6A 4BY6B 3OS5A 4C92C 1NZ9A 4LDWA 5L8RE 3SB2A 3ZFJA 4EMGA 3E9GA 4ZGEB 4A54A 5GAN4 5I2MA 4ZTFA 2ZPEB 1D3BA 4DQ2A 4C8QG 5LJ5g 5GANh 5LJ3j 3CPWA 3CCEA 1JRIA 3CXCA 1R8OB 2K2VA 2P0QA 2MF2A 3PFSA 3CCLT 3UDCA 2DXCA 1MGQA 3X28B 4C92A 1VQMA 5GAN7 1YIJT 1KQ2A 5D6XA 4Z02A 3HSBA 2LVMA 1Y7XA 3V7SA 3HFNA 2JOYA 2G3RA 4M77E 1KQ1A 2K3XA 1VQPA 3OBYA 4JRKA 5DLOA 3X20B 4ZN1A 4IUVA 4KULA 2EJGA 2I2LA 5IT9E 3E19A 4HT8A 2M9UA 4QQGA 4C8QD 1X6OA 1VQ9T 1P92A 2BIVA 1M1KU 2CGHA 1VQNT 2XDBA 4OGCA 3EFSA 3C94A 5CAIA 3FC3A 4PL6A 5CR2A 4RCCA 3A8OB 3CMAT 3ER0A 3OS1A 4C8QF 1KHIA 1WNLA 3LYIA 4BD3A 4EMKB 4HKEA 4NOYA 3QPHA 2QI2A 4X34A 5LJ5f 2RJFA 2DEQA 2K3YA 3QDRB 2CKKA 2LX9A 3E9FA 4GLKA 3PNWC 4RKUE 1BIBA 3OMGA 2EIFA 3X26B 3MCAB 4IUPA 2F5KA 3LW5E 4XK8E 1I81A 2CYZB 4BE0A 3M9QA 2RHYA 5CKEA 1YITT 3CCLA 5GAMg 1VIEA 3JCMd 1YIJA 3R6OA 3RERA 3A5ZB 3A8MB 3CPFA 3HP9A 2X35A 3L1AA 4M7DB 2X4XA 4HCZA 3CBPA 1YJWT 3P8DA 3OYJA 4IKFA 1YHQT 4B9WA 2KDSA 3M53A 4J6XA 3RESA 3UWNA 5GMKj 3A8HB 4QVZA 4L6V5 3JCMc 5GAOq 3HHTB 3MEWA 4M75B 3MEUA 1VQ9A 2B8AA 2BKDN 3NFCA 5HK0A 5GANg 4M7AF 4RMOA 5CKHA 3PTAA 4WF2A 1D3BB 3PMTA 5LJ3e 1JBMA 1UGRB 2DD4A 3UT1A 3CMAA 2JVVA 2LRQA 4M78B 1GXIE 3RMSA 3L2VA 3G6EA 1WJSA 3H8ZA 4C92B 3LGFA 3PT9A 3QYGB 2XICA 1M8VA 1VQKT 1XNIA 2EQKA 2EWNA 3QYHB 4ZTJA 4PJOB 5GAMf 1NE8A 4L59A 4HCBA 3CC2T 3OYBA 3QZ9B 2XD0A 3LWIA 3JCMb 3BW1A 3S3OA 2Y4XA 1KD1U 1ZBXA 1KQSS 2DTOA 5GANd 3G71A 4M7DG 1YITA 1M1FA 4JJNK 2VXFA 2PVOB 5DM7R 1YJWA 3JCMV 2LNVA 4ZGJB 1YI2T 4YTLA 2X4WA 1JB0E 1ZHIA 5J26A 5FLXE 3OY9A 3QSUA 1B34A 4J5YA 3EAEA 1QVFA 4JS4A 3OS2A 4M75G 2OAUA 5LJ5e 4EPCA 1OZ2A 3T9NA 2LT1A 5CIUA 1VQ6T 4D6WA 2C06A 4C5EA 3CPWS 1LJOA 4IUTA 3CXCS 3JCMQ 4JRIA 1G3WA 4LD6A 1BI2A 1UEBA 3JCMP 4A4GA 2MWOA 3DB4A 4M7DD 1I4K1 2X4JA 3CBMA 4M77C 2O4XA 5HKCA 1VUBA 3CBOA 4JDSA 5A0GA 4C92G 2V8JA 2E65A 2RH2A 1W4SA 3CEYA 4ELZC 3PIPA 2E64A 4PJOG 3OA6A 3TREA 4M7DF 2QQSA 3VKIA 5KH6A 3FDRA 1WPYA 1VQKA 4M77A 5HY6A 1QVGS 1UGQB 2DTHA 3OW2S 4M75D 2XIDA 1VQPT 1O9SA 3META 5I2SA 3OYMA 1Q81C 1WGSA 3JCMe 1KHCA 1IREB 4L5GA 1FXXA 3CCMT 3GP8A 5GMKe 3CCJT 5FRNA 1N9SA 4O5VA 2K5IA 2KY9A 2P4TA 4M75F 2QEXA 2P0PA 4M78D 4BI8B 2QQRA 2GQVA 4FT2A 5GAMh 3OYAA 1XOVA 2DIGA 3KUFA 3M5AA 1FX7A 3GPLA 4HCCA 1KG1A 3V8JA 4JRQA 2VV5A 4Y28E 2ZPBB 1Q86C 4PJOD 4M78F 1K8AC 3CMET 4XTYA 3CCUT 2DO3A 4BB7A 1S72A 4PLIA 4NL3A 1YJNT 4M7AE 4PJOF 4E47A 3M54A 3JB9J 1YJ9T 3QBYA 5GAOn 2L5QA 2E41A 2V8IA 2YLCA 3GF5A 3LH0A 4FM4B 4J6YA 3BY7A 4N4GA 1Y96A 3FJPA 4N0AA 3QIIA 3V8KA 2M0OA 2FYKA 4A4KA 1UGPB 2K57A 3G7ZA 2JTMA 2PVDB 3OBWA 3WVEB 3E1SA 2JNGA 3JSCA 3O8VA 2PUKB 5GMKi 2DXTA 3L2UA 2CZ0B 4J7FA 1NPPA 4JRPA 5GMKl 5GANe 4JLGA 3GNGA 2ZCFB 3QZ5B 4PNOA 2MAMA 5CO7A 1QVGA 1B34B 3L42A 3ZEHA 3OW2A 2EAYA 5LL6S 1QP2A 1Y71A 2A7YA 2E12A 3CCMA 4XTUA 3CCJA 1N8RC 3JB9H 2DD5A 2MMPA 5LJ5d 2QXFA 5FU6C 2PVGB 4F7UA 1N27A 1OI1A 2K4YA 4XTXA 1Q81U 2OTJT 3C12A 4XTWA 2RK2A 3UPUA 4LD9K 3JCMJ 2DZCA 2O4XB 3QG1A 3G6ET 4A4FA 4XTZA 5LJ5j 3CMEA 4C0GA 3CCUA 3CC4T 3LWHA 2M1HA 2DIQA 1QW1A 3DKMA 2MWPA 3TU4K 3SWNB 1YJNA 2EJ9A 2ZPIB 1YJ9A 4XU0A 1WQWA 1G3SA 3INZA 2E70A 2JZ2A 3VUBA 1BKBA 5I21A 1Q82C 1X01A 1JJ2A 5AYFA 2JTFA 3G71T 3L2ZA 4MZTA 3V7CA 3ZBDA 4OGEA 2DKGA 2PQWA 3H6ZA 3M55A 3NTIA 4VUBA 3P8BB 1QVPA 1VIFA 2F5TX 2A3LA 3TEEA 1K9MC 2RI2A 2K5FA 4ZGDB 1QVFS 2R5AA 5CCAA 4NS5A 3HL8A 4C8QC 2RHZA 4FT4A 4NL2A 2M16A 4E7HA 4OF1A 2RI3A 2YRVA 3VU3C 3OYFA 5FROA 4F7UE 3QJYA 1V29B 2GFAA 1M4ZA 2DK3A 4M78E 4C8QA 1PSEA 3JCMX 3OSSC 4BE2A 5GAMd 2OTLT 4ME7A 2OTJA 2DTIA 1N8RU 3TCJA 4EDUA 2FB7A 5J3BA 2YLBA 3MEVA 3MHXA 2E5QA 2V8KA 3CC4A 1VQ8A 3SDZA 3MEAA 2ZPHB 4M77G 4OB2B 2RHXA 5GAMj 1VQ7T 4C5GA 3WXMB 2RJEA 1W2BA 3P8HA 2QQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A54 A;  5GAN 4;  4M7D F;  3BFM A;  1D3B A;  1I8F A;  1WPY A;  2QTX A;  4C8Q G;  3QUI A;  4DQ2 A;  5LJ3 j;  5LJ5 g;  5GAN h;  1JRI A;  4M77 A;  1BIA A;  1U1T A;  4M75 E;  2DTH A;  4M75 D;  4QVD A;  4M7A G;  1MGQ A;  4C92 A;  4MMK A;  1KQ2 A;  5GAN 7;  4M7A C;  3JCM e;  2DJZ A;  3HSB A;  3V7S A;  5GMK e;  1N9S A;  3HFN A;  5GAN j;  2DXU A;  4M75 F;  1LNX A;  4M77 E;  4M78 D;  1KQ1 A;  1TH7 A;  5GAM h;  1Y96 B;  2RM4 A;  4C92 E;  1HK9 A;  4M7A A;  4JRK A;  2JN0 A;  4PJO E;  3EFR A;  3V8J A;  4PJO D;  4M78 F;  4HA8 A;  2EJG A;  2I2L A;  4C8Q E;  4HT8 A;  4J6W A;  4XTY A;  4C8Q D;  2E10 A;  5LJ3 h;  3V8L A;  5GAN 3;  2CGH A;  2HNI A;  2EJF A;  3EFS A;  4NL3 A;  4HT9 A;  4M7A E;  4PJO F;  3JCM f;  1H64 1;  5CAI A;  5GAN 5;  3JB9 J;  4M7A D;  5GAO n;  4RCC A;  2E41 A;  2YLC A;  1WNL A;  4C8Q F;  4J6Y A;  4EMK B;  2YHT A;  3BY7 A;  4NOY A;  1Y96 A;  3FJP A;  4N0A A;  3V8K A;  4A53 A;  5LJ5 f;  2DEQ A;  2FYK A;  4XTV A;  2K57 A;  1BIB A;  1N9R A;  4EMK C;  4F7U B;  3PGG A;  2DVE A;  5GMK i;  5GAN 8;  2DXT A;  1I81 A;  1YCY A;  4M77 D;  5GMK l;  4JLI A;  5GAM g;  5GAN e;  4X9C A;  3QHS A;  4PNO A;  4C92 D;  4EMK A;  3JCM d;  3AHU A;  3RER A;  1B34 B;  4M7D B;  5GMK h;  2EAY A;  3L1A A;  3V7R A;  4M77 F;  4XTU A;  3JB9 H;  4N0A C;  4X9D A;  3QO3 A;  5LJ5 d;  5LJ5 h;  4C92 F;  4F7U A;  5GAO m;  5LJ3 g;  3GIB A;  4J6X A;  4XTX A;  3RES A;  4EMH A;  3JB9 I;  4OP0 A;  3RKY A;  5GAM e;  5GMK j;  4XTW A;  1M5Q 1;  3JCM c;  3JCM J;  2DZC A;  5GAO q;  4M75 B;  3HFO A;  4XTZ A;  5LJ5 j;  2VXE A;  5GAN g;  5DY9 A;  5GAO r;  4JUV A;  3JB9 G;  5GAN f;  4M7A F;  4M7D A;  1LOJ A;  4WF2 A;  1D3B B;  3SWN B;  2EJ9 A;  4RCB A;  1JBM A;  5LJ3 e;  4XU0 A;  1WQW A;  4M78 B;  5GAO p;  3INZ A;  4Y91 A;  5I21 A;  3RUX A;  1X01 A;  4C92 B;  4F7U G;  5GMK m;  3SWN C;  1M8V A;  3L2Z A;  3V7C A;  2EWN A;  4PJO B;  4M78 G;  4M78 C;  2RD1 A;  3JCM h;  2DKG A;  5GAM f;  2RA2 A;  4M75 A;  4C8Q B;  3JCM b;  4PJO C;  3BW1 A;  4M7A B;  4XU3 A;  3SWN A;  2DTO A;  3BDU A;  5GAN d;  3JB9 D;  4M7D C;  4C8Q C;  5LJ3 f;  2DZ9 A;  4M78 A;  4M7D G;  4NL2 A;  2RB6 A;  3RKX A;  5GAN 2;  2VXF A;  1HXD A;  4MML A;  3FIF A;  4XU2 A;  3VU3 C;  3JCM V;  3JCM W;  3JB9 F;  4PJO A;  1WQ7 A;  4F7U E;  5GAN 6;  3QSU A;  1B34 A;  4J5Y A;  2ZGW A;  4M78 E;  4XQ3 A;  4C8Q A;  3JCM X;  3FB9 A;  5GAM d;  4M75 G;  5LJ5 e;  4XU1 A;  4M75 C;  2DTI A;  4M77 B;  2VC8 A;  1LJO A;  2E1H A;  2FB7 A;  4F7U F;  4QVC A;  2YLB A;  3RIR A;  2Y90 A;  4JRI A;  3JCM Q;  3JCM P;  1U1S A;  1I5L A;  4M7D E;  4M7D D;  1I4K 1;  4M77 G;  3M4G A;  5LJ3 d;  4M77 C;  5GAM j;  4V2S A;  3RKW A;  3JCM g;  5GAO l;  4C92 G;  2E65 A;  4C92 C;  4EMG A;  3SB2 A;  2E64 A;  4PJO G; 
#chains in the Genus database with same CATH topology
 1Q95 G;  3VS4 A;  2FZC B;  1I8F A;  3J7A F;  3PIO A;  3S6W A;  1TXQ A;  4AG1 C;  2HMA A;  1AWJ A;  3MO8 A;  2O2O A;  2X4Y A;  5GAN j;  3S3M A;  3VS3 A;  1RAE B;  3NTH A;  2Z0W A;  1WXB A;  2A0F B;  2WSF E;  2JMC A;  3FRN A;  1W2B P;  4HT9 A;  2BZ8 A;  2CP6 A;  5GAN 5;  3EGX A;  4CRI A;  2RJD A;  2YHT A;  3M4Y A;  4FSX A;  1X27 A;  4RTU A;  4A4E A;  4JPB W;  2I0N A;  2AIR B;  2RQT A;  3EHQ A;  5KYW A;  2SRC A;  4DOW A;  2O9S A;  1YFN A;  2FPE A;  3MP1 A;  2XKO C;  1CKA A;  4C5I A;  4KRT A;  1UGS B;  2DBM A;  4RUG A;  4OMF B;  3JB9 I;  1K73 U;  3HFO A;  3CCR T;  5DY9 A;  2HL5 C;  1KC8 C;  1KC8 R;  2F2V A;  1NBE B;  1IZ6 A;  4F17 A;  1M2O A;  1Z9Q A;  4M78 C;  4KUD K;  4M75 A;  4OB1 B;  3ASK A;  4HCK A;  2JUF A;  2W0Z A;  4XU2 A;  1YP5 A;  1MHN A;  3JCM W;  3JB9 F;  4KH1 B;  4DA4 A;  3EGX B;  4FIB A;  4XQ3 A;  4MDW A;  3UF4 A;  2HL3 A;  2A28 A;  2L3S A;  4ATO A;  2E1H A;  2VYT A;  2EYQ A;  2DL8 A;  4OVA A;  3RKW A;  3JCM g;  2VVK A;  2RNA A;  2DL3 A;  2PNI A;  1UJ0 A;  4ELY C;  2EQI A;  3DLM A;  4M7A G;  3HRU A;  2WAC A;  2LZ6 B;  1OZ3 A;  4PJM A;  1RAG B;  4A63 B;  1FMV A;  1E6H A;  1TH7 A;  4A4H A;  3LX7 A;  2XMF A;  1HK9 A;  3QWX X;  5C6S A;  4PFZ A;  4J6W A;  5LJ3 h;  2B86 A;  3EH1 A;  2M51 A;  5A2Q E;  4AG2 C;  5FU7 B;  2P0K A;  1MNE A;  5KCH A;  3I55 T;  2D1X A;  4OB3 B;  3DLL A;  3EFO A;  3VS0 A;  2EVR A;  3M0P A;  4PJN A;  1ZUY A;  2FRW A;  1VQ5 A;  2C0T A;  2AK5 A;  1AOJ A;  3VRZ A;  4OB0 B;  5FU6 B;  2HD0 A;  3AHU A;  1J3T A;  2DPP B;  4J7I A;  5IN1 A;  4QQD A;  4OML A;  4AFS C;  1X6B A;  1RL2 A;  4GY5 A;  5EG2 A;  1PWT A;  1GBQ A;  3GIB A;  2JS2 A;  2KRS A;  5CQX A;  1WA7 A;  1M5Q 1;  1D1A A;  1OPK A;  1RAI B;  1QP3 A;  1BI0 A;  3OYN A;  4D8K A;  3CC7 T;  4MDX A;  3C4S A;  3OQ5 A;  5KYU B;  2NUZ A;  2DLP A;  3N5B B;  1H3Z A;  3X24 B;  2FZK B;  3EG0 A;  2GCX A;  3OYD A;  4KT0 E;  3SWN A;  1AZG B;  2DIL A;  2FEI A;  1ARK A;  3CC2 A;  2MI6 A;  3QWY A;  1S1N A;  1UE9 A;  5FRM A;  5GAN 6;  5KYX A;  2ZGW A;  2EBP A;  3UA6 A;  3NHN A;  1KQS A;  4M75 C;  4F7U F;  1YBY A;  1YI2 A;  4KBM B;  1QCN A;  3OYL A;  3A8L B;  4BY6 B;  4C92 C;  5L8R E;  3ZFJ A;  4OMQ A;  4ZGE B;  3E9G A;  1QLY A;  5GAN 4;  4ZTF A;  3PVL A;  4DQ2 A;  4C8Q G;  3CC2 Q;  3CCE A;  1R8O B;  3H0H A;  2DXC A;  1MGQ A;  3X28 B;  1KQ2 A;  2A37 A;  3HFN A;  2JOY A;  3IQL A;  1YI2 Q;  3X20 B;  1UEC A;  3E19 A;  1VQ9 T;  4OGC A;  3C94 A;  1R0C B;  1AVZ C;  4HVW A;  3CPW P;  4RCC A;  3CCE Q;  3CMA T;  4EMK B;  4NOY A;  2QI2 A;  2RJF A;  2DEQ A;  3PNW C;  4Y92 A;  2EIF A;  3X26 B;  3MCA B;  2LQW A;  1JXM A;  4IUP A;  2DX1 A;  2F5K A;  1AD5 A;  1X6G A;  1I5O B;  2X35 A;  3U23 A;  2X4X A;  1YHQ T;  4CC4 B;  1GBR A;  4B9W A;  2KDS A;  3EGD A;  3M53 A;  1K9A A;  2HKN A;  2BKD N;  5HK0 A;  4KH0 B;  3PTA A;  5LJ3 e;  1C6V X;  1UGR B;  2JVV A;  3RR6 A;  4JJB A;  3H8Z A;  3QYG B;  4FYW B;  2CSQ A;  1M3A A;  4ZTJ A;  5GAM f;  2J6O A;  4CC3 A;  2XD0 A;  2KI7 A;  3JCM b;  3BW1 A;  3S3O A;  1KD1 U;  1PKT A;  1T3L A;  2DTO A;  5GAN d;  4M7D G;  1NG2 A;  4E7Z A;  5DM7 R;  3JCM V;  2LNV A;  4ZGJ B;  4YTL A;  2X4W A;  1QVF A;  1B7T A;  2DBK A;  4JS4 A;  1LCK A;  2OAU A;  3RBB B;  1VQ6 T;  2LT1 A;  4IUT A;  4JRI A;  1UEB A;  2GTO A;  4M77 C;  1C0M A;  1IGQ A;  3PIP A;  2RH2 A;  3CEY A;  1G2B A;  4PJO G;  3OA6 A;  1NYG A;  5KH6 A;  3FDR A;  2YT6 A;  1VQK A;  1G83 A;  1WGS A;  1IRE B;  4L5G A;  3GP8 A;  4O5V A;  2KY9 A;  4M75 F;  1UJY A;  4M78 D;  1VA7 A;  1KJW A;  1T0H A;  1ZSZ A;  4HCC A;  2VV5 A;  2OTL Q;  2ZPB B;  1F1B B;  1SPK A;  2EGE A;  1MMD A;  1GCQ C;  1WHH A;  4XTY A;  5IHI A;  4BB7 A;  2E4H A;  2HBW A;  4E47 A;  1YJ9 T;  3QBY A;  4F16 A;  2MYS A;  3LH0 A;  1YNZ A;  1MMA A;  1Y96 A;  3FJP A;  4N0A A;  3QII A;  2QK0 A;  2EGC A;  2K57 A;  3G7Z A;  1QKW A;  2H3E B;  3VS2 A;  1RLP C;  3E1S A;  3JSC A;  3O8V A;  4WCI A;  5GMK i;  2K7A A;  4J7F A;  4JRP A;  2HCK A;  3GNG A;  2DYB A;  2KXD A;  3CCJ A;  2QYZ A;  2QXF A;  2PVG B;  2VWF A;  2OTJ T;  2F1L A;  1HD3 A;  1VOM A;  1YWO A;  3CME A;  4C0G A;  2M1H A;  1EZZ B;  3DKM A;  2MWP A;  2LP5 A;  2ZAE A;  5FWC A;  2AZS A;  1WQW A;  2E70 A;  1M30 A;  2JZ2 A;  1BKB A;  1X01 A;  1JJ2 A;  3D7S B;  2X9H A;  2L2P A;  4MZT A;  3ZBD A;  2ECZ A;  3CCJ Q;  2JJ9 A;  2F5T X;  2R5A A;  5CCA A;  3HL8 A;  4C8Q C;  2RHZ A;  3CME Q;  4E7H A;  3VU3 C;  2RI3 A;  4F7U E;  3QJY A;  1V29 B;  1WXU A;  1JXO A;  1M2V A;  4M78 E;  4BE2 A;  4F04 B;  2YXY A;  2DTI A;  2FB7 A;  2V8K A;  1SRM A;  4PFO A;  3SDZ A;  3REB B;  2KE9 A;  1VQ7 T;  1RAH B;  2NUT B;  3M0S A;  3P8H A;  2G6F X;  3WVD B;  1GL5 A;  3BFM A;  2QEX T;  1K76 A;  1X69 A;  2KT8 A;  2X3X D;  2RQV A;  4BE1 A;  1UFF A;  2DXU A;  3J80 E;  1OU9 A;  2P84 A;  3FJ5 A;  1G5V A;  3PMI A;  5D6Y A;  1G3T A;  2JN0 A;  3F70 A;  1XQH A;  3VS7 A;  2KRN A;  4KGZ B;  4J83 A;  1H3H A;  1T3S A;  5GAN 3;  2KK4 A;  2RJC A;  4IUQ A;  2CT4 A;  2K2M A;  2KSS A;  2YUO A;  1BI3 A;  3L2Q A;  4PKC C;  1KFZ A;  3NMZ C;  4DBF A;  2AHJ B;  3I55 A;  1VQL A;  3MKD A;  4WTO B;  2K9G A;  4X9C A;  4C92 D;  2LCL A;  5DLQ E;  3G4S T;  3CCS T;  2BE7 D;  2GF7 A;  4N0A C;  2HZY A;  2BZY A;  1X43 A;  2D0Q B;  4EMH A;  1BU1 A;  4PJL A;  2FHD A;  1DJ7 B;  7AT1 B;  2E6Z A;  1QMC A;  4TVR A;  2DFU A;  3I55 Q;  1VQL Q;  4LDX A;  1NEB A;  1Q7Y U;  2QDY B;  3LGL A;  2QA4 T;  1T0J A;  1B07 A;  2KVQ G;  2JM8 A;  4PJO C;  3KXT A;  3OYC A;  2FL7 A;  3VYH B;  3NTK A;  5CK9 A;  4M78 A;  4P5N A;  2RB6 A;  1HXD A;  4N4I A;  2KAF A;  4E7I A;  3GOX A;  4E7L A;  1VQ8 T;  2DRM A;  1NLO C;  4XU1 A;  1Q86 U;  2MCN A;  3A8G B;  3KBG A;  3CC7 Q;  2K5L A;  5KE2 A;  2XDP A;  1VQ4 T;  1VQO T;  1NPR A;  3CCQ A;  2DXB A;  3L2W A;  3QUI A;  3TVT A;  4J9F A;  1BCM A;  4M75 E;  1KD1 R;  1KD1 C;  1OYX A;  3M58 A;  4FL6 A;  1TUD A;  1LNX A;  1TS9 A;  3HRT A;  4C92 E;  3I56 T;  3M56 A;  1V76 A;  2GBQ A;  2CP0 A;  2LQK A;  1OOT A;  5C0M A;  2LC4 A;  1MND A;  3AT1 B;  4M7A D;  3CCQ Q;  3OSV A;  1YN8 A;  2NWM A;  2YSQ A;  3HKS A;  3QJ6 A;  2E6N A;  4RG8 A;  4F7U B;  1OV3 A;  1NJI C;  1NJI R;  1O75 A;  2LJ1 A;  6AT1 B;  1NM7 A;  4M77 D;  2YUP A;  1VYT A;  2HAX A;  3QHS A;  1PKS A;  1ZSG A;  2RPN A;  2EYZ A;  1PM3 A;  2GFU A;  3L2R A;  3LLR A;  4R55 A;  4QW2 A;  5IXF A;  3OYY A;  2KNB B;  4OP0 A;  3GLX A;  1OX8 A;  2A36 A;  5GAN f;  1YHQ A;  2PUO B;  4C0Z A;  5GAO p;  3OYI A;  3MP6 A;  3RUX A;  1I0C A;  3Q1J A;  2QG9 B;  2CRE A;  3CCV T;  3JCM h;  3OYK A;  1K9M U;  2D6F A;  2DRK A;  3VV0 A;  3HRS A;  2EQU A;  1JU5 C;  1KSW A;  3BDL A;  4MML A;  1WLP B;  4D8D A;  1YHQ Q;  4J8O A;  1WQ7 A;  4FU6 A;  2EQM A;  1M90 U;  1V1C A;  2XU8 A;  4KGX B;  2PU9 B;  2DET A;  1OX9 A;  4DOV A;  2Y90 A;  4JZ4 A;  1AHJ B;  5LJ3 d;  2RI5 A;  3OYH A;  3CD6 A;  1VQ6 A;  4A54 A;  4PFP A;  1D3B A;  1JRI A;  3CXC A;  4DBH A;  2K2V A;  2MF2 A;  2L3P A;  3PFS A;  3UDC A;  3CCL T;  1VQM A;  2DYI A;  4C92 A;  5D6X A;  4Z02 A;  8ATC B;  2LVM A;  3V7S A;  2QAS A;  4AT1 B;  4M77 E;  4K11 A;  3OBY A;  4JRK A;  5DLO A;  2OX7 A;  1TUG B;  2GGR A;  2EJG A;  3ULR B;  3CD6 Q;  2M9U A;  4QQG A;  4C8Q D;  5KYW B;  1M1K U;  1P92 A;  2QTV A;  1M3B A;  1VQ6 Q;  1VQN T;  1K0X A;  2IPO B;  3FC3 A;  4PL6 A;  5CR2 A;  1R0B G;  2FZG B;  2L3Q A;  3ER0 A;  1KHI A;  3QPH A;  4X34 A;  1MUZ A;  1VQM Q;  2ROL A;  2K3Y A;  2EKH A;  2LX9 A;  3E9F A;  1I81 A;  3M9Q A;  2RHY A;  5CKE A;  1YIT T;  5GAM g;  1UUE A;  1YIJ A;  4HCZ A;  2K6D A;  1WZO A;  2LNH B;  3P8D A;  3VS6 A;  1RAC B;  4J6X A;  2A08 A;  2L0A A;  4J9C A;  1VYV A;  2C0I A;  3HHT B;  3MEW A;  4M75 B;  3MEU A;  4E2F B;  4RMO A;  5CKH A;  4WF2 A;  1D3B B;  1JBM A;  3UT1 A;  2LRQ A;  1GXI E;  2KEA A;  3L2V A;  1WJS A;  4C92 B;  3LGF A;  1YIJ Q;  1B3Q A;  2EQK A;  2EWN A;  1NE8 A;  2KT1 A;  1KQS S;  1QCO A;  1M1F A;  4J9E A;  4F14 A;  2VXF A;  1YJW A;  1WDX A;  2RQW A;  1WX6 A;  5GJW B;  3QSU A;  1B34 A;  4J5Y A;  1K0S A;  1QKX A;  2LJ3 A;  4EPC A;  3T9N A;  3JCM P;  1BI2 A;  4DEY A;  1RAA B;  2MWO A;  4M7D D;  3CBM A;  1Q7Y R;  2O4X A;  3CBO A;  4JDS A;  1UTI A;  5A0G A;  2V8J A;  1W4S A;  1OEB A;  3HTR A;  1UG1 A;  2VB6 A;  3TRE A;  2QQS A;  3VKI A;  1WPY A;  2FO0 A;  2BTT A;  4M77 A;  5HY6 A;  1YJW Q;  2RN8 A;  3MET A;  1I1J A;  1ZLM A;  5I2S A;  1Q81 C;  1Q81 R;  3JCM e;  2QEX A;  2P4T A;  1OU8 A;  2P0P A;  4BI8 B;  2GQV A;  2DIG A;  3EFO B;  1KG1 A;  3M0T A;  3ZL7 C;  4PJO D;  1Q86 C;  1Q86 R;  1D09 B;  4M78 F;  3CCU T;  1Y57 A;  4R0K A;  4NL3 A;  2J06 A;  4FYY B;  4LUD A;  1YJN T;  3VS5 A;  5GAO n;  2L5Q A;  2V8I A;  1GCQ A;  3V8K A;  4A4K A;  3OBW A;  2PVD B;  3THK A;  4AFU C;  3WVE B;  2QEX Q;  2YUN A;  2NUP A;  2DXT A;  5GJV B;  2ZCF B;  1B34 B;  1QP2 A;  2A7Y A;  2ROT A;  3CCM A;  1N8R C;  1N8R R;  3JB9 H;  3C0C A;  2DD5 A;  2MMP A;  5LJ5 d;  5FU6 C;  2FRY A;  1SEM A;  3GBQ A;  2O4X B;  4XTZ A;  2AZV A;  1GFD A;  2F2X A;  1QW1 A;  3SWN B;  2ZPI B;  2X51 A;  1H92 A;  1G3S A;  3INZ A;  2PZ1 A;  4GLM A;  1FMK A;  1QVG P;  3OW2 P;  3CCM Q;  4OGE A;  2DKG A;  2PQW A;  5KYX B;  4VUB A;  1WHM A;  4ESR A;  2A3L A;  3TEE A;  1QVF S;  4ZGD B;  2K5F A;  3QDF A;  3G4S Q;  4NS5 A;  4FT4 A;  2LCS A;  2YRV A;  4LUE A;  2RQR A;  2GFA A;  2DK3 A;  4C8Q A;  4FCY A;  4CC7 A;  4ME7 A;  3TCJ A;  1I07 A;  1K1Z A;  3MEV A;  3MHX A;  3CC4 A;  1VQ8 A;  2ZPH B;  5GAM j;  2RHX A;  2K3B A;  4C5G A;  2RJE A;  1W2B A;  4HVU A;  2QQ9 A;  1K9M R;  1K9M C;  1RAF B;  1C1A A;  5D6W A;  5KCO A;  2WSE E;  2L3R A;  3JAM E;  4BY6 C;  5L23 A;  2ZPG B;  1VQ4 A;  4M7A C;  5CKB A;  1K73 C;  1K73 R;  2CZ6 B;  3SEM A;  4IIO A;  2LT4 A;  1PNJ A;  3GNF B;  2DE0 X;  1IGU A;  3SD4 A;  2D9T A;  3FEO A;  3SFM A;  3CC4 Q;  1VQ8 Q;  3A1P A;  2CZ1 B;  4HA8 A;  1NLP C;  5CKF A;  2E10 A;  2OTL A;  4KGV B;  2KGT A;  2ZPF B;  5CKD A;  4CC2 A;  2DF6 A;  2LQN A;  1VQ4 Q;  2KMT A;  2VKN A;  2CZ7 B;  2HQE A;  4XTV A;  1AEY A;  5HK3 A;  1G3Y A;  3EG2 A;  4EMK C;  5CVI A;  2RHU A;  1BI1 A;  3EGD B;  3H41 A;  3VUZ A;  3OMC A;  2DVE A;  5GAN 8;  1YCY A;  2KYB A;  3PVQ A;  5IAY A;  5GMK h;  4J9G A;  2D8J A;  4C92 F;  4BI4 A;  2VUB A;  2EKO A;  1JJ2 S;  1QWE A;  1UDL A;  5GAO r;  3JB9 G;  4JUV A;  4M7D A;  4HVV A;  1LOJ A;  2XI9 A;  2F2W A;  4R56 A;  4Q5W A;  3M57 A;  1ZQ1 A;  1KK7 A;  4UC4 A;  1YCS B;  1PG5 B;  3MP8 A;  3NGP A;  1WHJ A;  2DER A;  5LJ3 f;  1ZUU A;  3CCV A;  3OS0 A;  3FIF A;  2RO0 A;  5EC7 A;  4PJO A;  2LX7 A;  1X2Q A;  2QQA A;  4DBR A;  2IG0 A;  1ZX6 A;  2CP5 A;  4C0D C;  2BUD A;  1K8A U;  4PJJ A;  5IHK A;  2WSC E;  3RIR A;  3CCR A;  1WHG A;  1U1S A;  4QQ6 A;  2RQU A;  4LN2 A;  1JQQ A;  3X25 B;  1SSH A;  5GAO l;  1VQ5 T;  1JEG A;  1ZSZ B;  3CCV Q;  2CP7 A;  3UAT A;  2QTX A;  3H0I A;  3UA7 A;  3CQT A;  4AFZ C;  1KC8 U;  1LVK A;  1K4U S;  4FYX B;  2DJZ A;  1IB8 A;  2KYM A;  1FWZ A;  5CQY A;  2XDD A;  1WHK A;  1Y96 B;  3PE0 A;  3CCR Q;  2LTO A;  2RM4 A;  3QXE B;  2DL4 A;  1WI7 A;  2RK1 A;  5J39 A;  4PLL A;  2HNI A;  4J9I A;  2HEQ A;  1D0Z A;  2QGF B;  2NLU A;  5A0D A;  1VQN A;  4J9H A;  4II1 A;  1N9R A;  2D8H A;  3S3N A;  3PGG A;  2FG0 A;  2IVW A;  3CCL Q;  3EGU A;  1TU0 B;  2VGM A;  1RUW A;  1AWX A;  4M77 F;  4AFQ C;  4LE9 A;  1U3O A;  1M27 C;  4M4Z A;  1BK2 A;  2XK0 A;  1VQN Q;  5KE3 A;  2COY A;  1D0X A;  1M3C A;  2GTJ A;  1TOV A;  5HCK A;  2AKK A;  3BE3 A;  3JRZ A;  4RCB A;  3J81 E;  1GRI A;  1XTD A;  4Y91 A;  2CH4 A;  1TUC A;  4F7U G;  4BI3 A;  1SF9 A;  3CCE T;  4M78 G;  1X75 C;  1PSF A;  2RD1 A;  3FLG A;  1M2V B;  5KYN A;  2H3J A;  4RTX A;  1AT1 B;  4M7D C;  4B9X A;  2DZ9 A;  2KRM A;  5M9O A;  3EH2 A;  3E2U A;  2QGG A;  2DL5 A;  1MMG A;  4O6J A;  2JTE A;  4BDZ A;  2HBP A;  4MZM A;  3FB9 A;  5FW9 A;  1M1G A;  2VC8 A;  4IUR A;  4C0F A;  4HXJ A;  1FYN A;  1TTH B;  3M4G A;  2EQJ A;  3URG A;  3CC7 A;  1RI0 A;  3MPU B;  3OS5 A;  1NZ9 A;  4J9B A;  4ORZ A;  5I2M A;  3CPW A;  2COZ A;  5FWB A;  5GAN 7;  2O9V A;  3HSB A;  1QQJ A;  1Y7X A;  1KQS P;  2G3R A;  2DL7 A;  3I5R A;  4IUV A;  4KUL A;  3VRY A;  4HT8 A;  1PRM C;  3EFS A;  5CAI A;  1OPL A;  3A8O B;  3OS1 A;  4C8Q F;  1WNL A;  3LYI A;  5D7U A;  4HKE A;  2JMA A;  5LJ5 f;  3G1J A;  3QDR B;  2CKK A;  4GLK A;  3OMG A;  2CUD A;  3R6N A;  1W6X A;  2YDL A;  4BE0 A;  1MV0 B;  2HSE B;  4E7S A;  1ZA1 B;  1VIE A;  3JCM d;  3R6O A;  3RER A;  3A5Z B;  2YUQ A;  1RLQ C;  1U5S A;  4OMM A;  3OYJ A;  4IKF A;  2V1R A;  3UWN A;  1RAD B;  5GMK j;  3CCU Q;  4QVZ A;  5GAO q;  1VQ9 A;  3M0R A;  3NFC A;  4JZ3 A;  1PCX A;  4EIK A;  3CMA A;  4M78 B;  3RMS A;  2EW3 A;  2ENM A;  2XIC A;  1M8V A;  1VQK T;  1XNI A;  3QYH B;  3TSZ A;  4RTZ A;  4L59 A;  4HCB A;  5IXB A;  2JS0 A;  4RTY A;  1VQ9 Q;  2PVO B;  2HQH A;  2V1Q A;  2J05 A;  2O31 A;  2NYS A;  1ZHI A;  5J26 A;  3CMA Q;  3EAE A;  3OS2 A;  1YWP A;  4M75 G;  1OZ2 A;  5CIU A;  4D6W A;  2QAZ A;  4Z89 A;  3CXC S;  5ECA A;  1G3W A;  5HKC A;  1VUB A;  1RAB B;  2DVJ A;  4C92 G;  2E65 A;  4ELZ C;  2KR3 A;  4M7D F;  1SHF A;  2DTH A;  1VQP T;  2XID A;  3EG3 A;  3OYM A;  1GFC A;  1IHW A;  1VYU A;  1KHC A;  1FXX A;  1QVF P;  3CCJ T;  1QWF A;  1N9S A;  2K5I A;  3OYA A;  2QQR A;  4FT2 A;  5GAM h;  1XOV A;  1NYF A;  2BE9 B;  2JXB A;  4Y28 E;  1SHG A;  1K8A R;  1K8A C;  3CME T;  2HKQ B;  2DO3 A;  4PLI A;  1G8X A;  4M7A E;  4PJO F;  3M54 A;  3JB9 J;  1OQK A;  1SRL A;  4N4G A;  2ESW A;  4QT7 A;  4PK4 A;  1UGP B;  2FPD A;  2DNU A;  2AKL A;  3L2U A;  2CZ0 B;  1PRL C;  1NPP A;  4PNO A;  5FRN A;  2E12 A;  2M0Y A;  5I22 A;  1N27 A;  1OI1 A;  2OI3 A;  4XTX A;  2RK2 A;  4LD9 K;  3JCM J;  3QG1 A;  3G6E T;  2YRD A;  2EJ9 A;  5IHN A;  1YJ9 A;  4XU0 A;  4RTT A;  2KBT A;  3G71 T;  3L2Z A;  1TSF A;  2KXC A;  2DJQ A;  4OMP A;  3H6Z A;  3M55 A;  3P8B B;  3EHR A;  1VIF A;  1W1F A;  1ZBJ A;  4Z8A A;  2RI2 A;  2CH4 W;  2M16 A;  1HJD A;  1WHL A;  5KYU A;  3OYF A;  1YJ9 Q;  3JCM X;  2OTJ A;  1JJ2 P;  4EDU A;  5J3B A;  2YLB A;  1BCO A;  4M77 G;  4OB2 B;  2D0N A;  1N5Z A;  4J9D A;  2ABL A;  3RMQ A;  1VQL T;  1BIA A;  3M59 A;  2CS7 A;  2XHC A;  1UHF A;  4MMK A;  1BB9 A;  2MOX A;  3I5S A;  2R5M A;  2OTJ Q;  4MZP A;  1S72 T;  1LPL A;  4M7A A;  2AT1 B;  1M9S A;  5IH2 A;  1SKU B;  4C8Q E;  2BZX A;  1Q7Y C;  2EJF A;  2RHI A;  4BUG A;  4C5H A;  2X3W D;  2FVU A;  3HPW A;  2J6K A;  1VQ5 Q;  1UB4 A;  2E3H A;  3VJP A;  1VQ7 A;  2ATC B;  1PC0 A;  1IXD A;  3ME9 A;  1EX4 A;  4JLI A;  4LNP A;  4EMK A;  2QQB A;  1SG5 A;  1WIE A;  1AWW A;  4X9D A;  1TWB A;  2O01 E;  2R58 A;  1R77 A;  4KUI A;  2LQ8 A;  5LJ3 g;  5GAO m;  2L89 A;  4Z88 A;  5GAM e;  1VQ7 Q;  2DM1 A;  5FU7 C;  3MJX A;  1IO6 A;  1WFW A;  3QKJ A;  1Z9Z A;  2RF0 A;  3CCQ T;  2VGN A;  2DAQ A;  2RA2 A;  2LCC A;  1GCP A;  1N6A A;  4N4H A;  4M7A B;  3BDU A;  3JB9 D;  3G4S A;  3CCS A;  4JJD A;  2EYW A;  4X1V A;  3OYG A;  1OUL A;  1KIK A;  1IRX A;  2C0O A;  2HSP A;  4IUU A;  4DBQ A;  3EG1 A;  2J7I A;  1W2B S;  3LH5 A;  4OMO A;  9ATC B;  1EIF A;  2GNC A;  4M77 B;  1Y07 A;  1MV3 A;  2IIM A;  1I5L A;  4M7D E;  3I9Q A;  3C95 A;  4V2S A;  2LDM A;  2RMO A;  4ZN3 A;  1U8R A;  2ED1 A;  3CCS Q;  1AZE A;  1U1T A;  1EFN A;  2QA4 A;  1D1B A;  4QVD A;  5A0L A;  2QDL A;  1CSK A;  1H8K A;  4CI0 C;  1CKB A;  4E7J A;  2O88 A;  1BBZ A;  4PJO E;  3EFR A;  1WJR A;  2KQW A;  2CUB A;  3V8L A;  4OMN A;  4BDY A;  2NUP B;  2R57 A;  2CP3 A;  3JCM f;  1H64 1;  1UHC A;  1IHV A;  1WYX A;  2QA4 Q;  3H9N A;  2JT4 A;  4A53 A;  2JW4 A;  1Q82 U;  3DB3 A;  3OYE A;  1BYM A;  1VQO A;  2KRO A;  3A98 A;  2Y4Y A;  1M90 C;  1M90 R;  2E5K A;  3V7R A;  1WJQ A;  3QO3 A;  1WXT A;  5LJ5 h;  2PTK A;  3I56 A;  3RKY A;  2HQX A;  2OJ2 A;  4C0D B;  4JS5 A;  2VXE A;  2OAW A;  2W10 A;  3VYG A;  1VQO Q;  4LDY A;  1RI9 A;  4RG2 A;  3CD6 T;  1JO8 A;  3M0U A;  2F69 A;  5GMK m;  3SWN C;  1SSF A;  2DEU A;  3OB9 A;  4C8Q B;  1VQM T;  2V26 A;  2GQI A;  2ED0 A;  4BAC A;  2EYY A;  4XU3 A;  3I56 Q;  3I35 A;  3KFV A;  2CP2 A;  4LDV A;  1M1K C;  1M1K R;  2XG8 D;  3RKX A;  5GAN 2;  4FYV B;  1NJI U;  2LMJ A;  2FPF A;  4XAX B;  2YWW A;  4LDU A;  5KYY A;  2L8D A;  4QVC A;  4E7K A;  2EFI A;  4GBQ A;  4LXC A;  2ZZD A;  1D1C A;  3EG9 A;  4LDW A;  3SB2 A;  4EMG A;  1VQK Q;  1M8M A;  2ZPE B;  1QCF A;  3O5Z A;  4RTW A;  5LJ5 g;  5GAN h;  5LJ3 j;  2P0Q A;  2H8H A;  1YIJ T;  2NUT A;  1KQ1 A;  2K3X A;  1VQP A;  4ZN1 A;  2I2L A;  5IT9 E;  1X6O A;  2BIV A;  2CGH A;  2XDB A;  2MIO A;  1ZA2 B;  3CXC P;  4BD3 A;  4FSS A;  1MMN A;  3VS1 A;  4RKU E;  1BIB A;  2CT3 A;  2MK5 A;  2EPD A;  1VQP Q;  3LW5 E;  4XK8 E;  2CYZ B;  3CCL A;  2JM9 A;  4M7D B;  4FW1 A;  3CPF A;  3A8M B;  3HP9 A;  1ABQ A;  3L1A A;  5I11 A;  1YJW T;  3CBP A;  4JJC A;  3M0Q A;  1NEG A;  5KYY B;  1ABO A;  3RES A;  3A8H B;  4L6V 5;  3JCM c;  3TSW A;  3EG9 B;  2B8A A;  5GAN g;  4M7A F;  1E7O A;  1UGV A;  1XJW B;  3PMT A;  2DD4 A;  3RNJ A;  3G6E A;  3PT9 A;  4PJO B;  4DEX A;  3CC2 T;  3OYB A;  3QZ9 B;  3LWI A;  2Y4X A;  1X2K A;  1ZBX A;  3G71 A;  1YIT A;  4JJN K;  1HSQ A;  2VAS A;  1YI2 T;  2SEM A;  1JB0 E;  5FLX E;  3OY9 A;  3G6E Q;  5LJ5 e;  2C06 A;  1AWO A;  4C5E A;  3CPW S;  1LJO A;  1TG0 A;  3JCM Q;  4ANJ A;  4LD6 A;  4A4G A;  3DB4 A;  1I4K 1;  2X4J A;  1HYO A;  1U06 A;  2COW A;  3G71 Q;  1YIT Q;  2E64 A;  3TQ7 P;  4E6R A;  1A0N B;  1QVG S;  1UGQ B;  3OW2 S;  4M75 D;  4B6M A;  1O9S A;  1ZSZ C;  2MPX C;  3CCM T;  5GMK e;  4QKU A;  3KUF A;  3M5A A;  4IIM A;  2LJ0 A;  1FX7 A;  3REA B;  8AT1 B;  3GPL A;  3V8J A;  4JRQ A;  1S72 A;  3RDV A;  1D0Y A;  4FW2 A;  3GF5 A;  2E41 A;  2YLC A;  4FM4 B;  4J6Y A;  3BY7 A;  2M0O A;  2FYK A;  2JTM A;  2P4R A;  2YRC A;  4ZNX A;  2JNG A;  2PUK B;  1ACM B;  5GMK l;  5GAN e;  4JLG A;  3QZ5 B;  2MAM A;  5CO7 A;  1QVG A;  3OW2 A;  3L42 A;  3ZEH A;  2EAY A;  5LL6 S;  1Y71 A;  5AT1 B;  1S72 Q;  4XTU A;  1PHT A;  4F7U A;  2DMO A;  2K4Y A;  1Q81 U;  3C12 A;  4XTW A;  3UPU A;  2DZC A;  1PD1 A;  4A4F A;  5LJ5 j;  3CCU A;  3CC4 T;  2M02 A;  3LWH A;  2DIQ A;  1YJN A;  3TU4 K;  4RTV A;  1W70 A;  4AMC A;  3VUB A;  5I21 A;  1Q82 C;  1Q82 R;  2EGA A;  5AYF A;  2JTF A;  2DA9 A;  1ZUK A;  3V7C A;  2J6F A;  2CSI A;  2CDT A;  3NTI A;  1QVP A;  2K79 A;  2EYX A;  3SHW A;  4NL2 A;  4OF1 A;  3JV3 A;  1YJN Q;  5FRO A;  1M4Z A;  2OTL T;  1PSE A;  1E6G A;  3OSS C;  5GAM d;  1N8R U;  3H0F A;  3NPF A;  2E3I A;  1FMW A;  2E5Q A;  1PD0 A;  3MEA A;  2HDA A;  3WXM B;  1Y0M A; 
#chains in the Genus database with same CATH homology
 3WVD B;  3BFM A;  3RMQ A;  1I8F A;  2QEX T;  5D6W A;  5KCO A;  1VQL T;  2WSE E;  2L3R A;  3S6W A;  3PIO A;  3J7A F;  3JAM E;  1BIA A;  3M59 A;  4BY6 C;  2CS7 A;  2XHC A;  2ZPG B;  4BE1 A;  4MMK A;  1VQ4 A;  4M7A C;  1VQ6 A;  3MO8 A;  5CKB A;  1K73 C;  2R5M A;  2X4Y A;  2CZ6 B;  5GAN j;  3S3M A;  2DXU A;  2LT4 A;  3J80 E;  4MZP A;  1S72 T;  3GNF B;  3SD4 A;  2D9T A;  3FEO A;  3NTH A;  3SFM A;  1G5V A;  3PMI A;  5D6Y A;  1G3T A;  1M9S A;  4M7A A;  2JN0 A;  3F70 A;  2CZ1 B;  1XQH A;  4HA8 A;  4J83 A;  2WSF E;  4C8Q E;  5CKF A;  2E10 A;  5GAN 3;  2OTL A;  1Q7Y C;  3FRN A;  2EJF A;  2KK4 A;  2RHI A;  2RJC A;  4BUG A;  4HT9 A;  4IUQ A;  5GAN 5;  2ZPF B;  5CKD A;  4C5H A;  2RJD A;  2YHT A;  2FVU A;  3HPW A;  3M4Y A;  2KSS A;  4FSX A;  4CRI A;  2KMT A;  1BI3 A;  1UB4 A;  2CZ7 B;  2HQE A;  4XTV A;  3VJP A;  4A4E A;  5HK3 A;  3L2Q A;  1VQ7 A;  1G3Y A;  4EMK C;  5CVI A;  2RHU A;  4PKC C;  1BI1 A;  4DOW A;  3VUZ A;  3OMC A;  2DVE A;  5GAN 8;  2AHJ B;  3ME9 A;  1YCY A;  3I55 A;  1VQL A;  4JLI A;  3MP1 A;  4X9C A;  2LCL A;  2XKO C;  5DLQ E;  4C92 D;  2QQB A;  4EMK A;  3G4S T;  3CCS T;  5IAY A;  5GMK h;  4C5I A;  2GF7 A;  4N0A C;  4X9D A;  1UGS B;  2O01 E;  2R58 A;  4C92 F;  4KUI A;  2LQ8 A;  4BI4 A;  5LJ3 g;  2L89 A;  2VUB A;  5GAO m;  4OMF B;  2D0Q B;  4EMH A;  3JB9 I;  2EKO A;  5GAM e;  1JJ2 S;  1K73 U;  3HFO A;  2FHD A;  3CCR T;  1DJ7 B;  5DY9 A;  2E6Z A;  4JUV A;  5FU7 C;  5GAO r;  3JB9 G;  4M7D A;  1LOJ A;  2XI9 A;  4TVR A;  1KC8 C;  3QKJ A;  1IZ6 A;  4R56 A;  4LDX A;  4Q5W A;  1Q7Y U;  3M57 A;  3CCQ T;  1ZQ1 A;  2QDY B;  4UC4 A;  4M78 C;  3LGL A;  2QA4 T;  2VGN A;  2DAQ A;  2RA2 A;  4M75 A;  4KUD K;  2KVQ G;  4OB1 B;  2LCC A;  3ASK A;  3MP8 A;  4PJO C;  1N6A A;  2JUF A;  4N4H A;  4M7A B;  3KXT A;  3OYC A;  2FL7 A;  3VYH B;  3BDU A;  3NTK A;  3JB9 D;  5LJ3 f;  4M78 A;  5CK9 A;  4P5N A;  3CCV A;  2RB6 A;  3G4S A;  3CCS A;  1HXD A;  4N4I A;  3OS0 A;  3FIF A;  4XU2 A;  3OYG A;  2RO0 A;  1MHN A;  2KAF A;  4E7I A;  3JCM W;  3JB9 F;  3GOX A;  4PJO A;  4E7L A;  4DA4 A;  2QQA A;  4IUU A;  1VQ8 T;  4FIB A;  4XQ3 A;  2IG0 A;  4MDW A;  1W2B S;  4XU1 A;  1Q86 U;  1EIF A;  3A8G B;  4C0D C;  2BUD A;  4M77 B;  1K8A U;  4ATO A;  1Y07 A;  2E1H A;  2VYT A;  3KBG A;  2WSC E;  3RIR A;  3CCR A;  1I5L A;  1U1S A;  2K5L A;  4M7D E;  2EYQ A;  3C95 A;  4OVA A;  4QQ6 A;  2LDM A;  3X25 B;  3RKW A;  5KE2 A;  4V2S A;  3JCM g;  2XDP A;  5GAO l;  1VQ4 T;  1VQ5 T;  4ZN3 A;  1U8R A;  1VQO T;  1NPR A;  3CCQ A;  2DXB A;  2QTX A;  3QUI A;  4ELY C;  3L2W A;  1KC8 U;  1U1T A;  3DLM A;  4M75 E;  1KD1 C;  2QA4 A;  4QVD A;  4M7A G;  5A0L A;  3HRU A;  2WAC A;  1OZ3 A;  2DJZ A;  1OYX A;  3M58 A;  1FWZ A;  4FL6 A;  1LNX A;  5CQY A;  2XDD A;  4CI0 C;  1TH7 A;  4A4H A;  1Y96 B;  3LX7 A;  2LTO A;  2RM4 A;  3HRT A;  1HK9 A;  4C92 E;  4E7J A;  3QXE B;  3I56 T;  3M56 A;  4PJO E;  3EFR A;  5C6S A;  1WJR A;  2KQW A;  4J6W A;  2LQK A;  2RK1 A;  5LJ3 h;  3V8L A;  5J39 A;  2R57 A;  4PLL A;  2HNI A;  5C0M A;  4BDY A;  2LC4 A;  5A2Q E;  5FU7 B;  3JCM f;  1H64 1;  4M7A D;  2P0K A;  3OSV A;  5KCH A;  3I55 T;  2NLU A;  5A0D A;  4OB3 B;  4A53 A;  3DLL A;  1VQN A;  3HKS A;  3QJ6 A;  4II1 A;  2E6N A;  4RG8 A;  1VQ5 A;  1N9R A;  4F7U B;  3S3N A;  3DB3 A;  1Q82 U;  3OYE A;  3PGG A;  1NJI C;  1BYM A;  1O75 A;  2IVW A;  1VQO A;  4M77 D;  2Y4Y A;  2HAX A;  2VGM A;  4OB0 B;  5FU6 B;  2HD0 A;  1M90 C;  3QHS A;  3AHU A;  2DPP B;  4J7I A;  5IN1 A;  4QQD A;  3V7R A;  1WJQ A;  4M77 F;  1RL2 A;  4GY5 A;  5EG2 A;  3QO3 A;  5LJ5 h;  2GFU A;  3L2R A;  3LLR A;  3GIB A;  4R55 A;  4QW2 A;  3OYY A;  3I56 A;  4OP0 A;  3RKY A;  2HQX A;  2XK0 A;  5CQX A;  1M5Q 1;  3GLX A;  5KE3 A;  1QP3 A;  4C0D B;  1BI0 A;  4JS5 A;  2VXE A;  3OYN A;  5GAN f;  1YHQ A;  3VYG A;  2PUO B;  3JRZ A;  4LDY A;  4RCB A;  3J81 E;  3CC7 T;  1XTD A;  4RG2 A;  4C0Z A;  5GAO p;  3CD6 T;  4MDX A;  3OYI A;  3MP6 A;  3C4S A;  4Y91 A;  3OQ5 A;  3RUX A;  3Q1J A;  2F69 A;  4F7U G;  5GMK m;  3SWN C;  4BI3 A;  1SSF A;  3CCE T;  4M78 G;  1X75 C;  1PSF A;  3N5B B;  2RD1 A;  3JCM h;  3FLG A;  3OYK A;  3CCV T;  3OB9 A;  3X24 B;  4C8Q B;  1K9M U;  2D6F A;  1VQM T;  1H3Z A;  3VV0 A;  2GCX A;  2H3J A;  3HRS A;  3OYD A;  4XU3 A;  4KT0 E;  4BAC A;  3SWN A;  4M7D C;  4B9X A;  2DZ9 A;  4LDV A;  5M9O A;  1M1K C;  2EQU A;  2XG8 D;  3RKX A;  5GAN 2;  1NJI U;  3BDL A;  3CC2 A;  4MML A;  2MI6 A;  4J8O A;  1WQ7 A;  4O6J A;  5FRM A;  4FU6 A;  5GAN 6;  2EQM A;  4XAX B;  4BDZ A;  2HBP A;  1M90 U;  2ZGW A;  2XU8 A;  4MZM A;  2PU9 B;  3FB9 A;  1KQS A;  4M75 C;  1M1G A;  4LDU A;  2VC8 A;  2L8D A;  4IUR A;  4F7U F;  4QVC A;  4DOV A;  1YBY A;  2EFI A;  4C0F A;  2Y90 A;  4E7K A;  1YI2 A;  4KBM B;  1AHJ B;  2ZZD A;  5LJ3 d;  3M4G A;  3A8L B;  2RI5 A;  3OYL A;  2EQJ A;  3URG A;  3CC7 A;  1RI0 A;  3OYH A;  3CD6 A;  4BY6 B;  3OS5 A;  4C92 C;  1NZ9 A;  4LDW A;  5L8R E;  3SB2 A;  3ZFJ A;  4EMG A;  3E9G A;  4ZGE B;  4A54 A;  5GAN 4;  5I2M A;  4ZTF A;  2ZPE B;  1D3B A;  4DQ2 A;  4C8Q G;  5LJ5 g;  5GAN h;  5LJ3 j;  3CPW A;  3CCE A;  1JRI A;  3CXC A;  1R8O B;  2K2V A;  2P0Q A;  2MF2 A;  3PFS A;  3CCL T;  3UDC A;  2DXC A;  1MGQ A;  3X28 B;  4C92 A;  1VQM A;  5GAN 7;  1YIJ T;  1KQ2 A;  5D6X A;  4Z02 A;  3HSB A;  2LVM A;  1Y7X A;  3V7S A;  3HFN A;  2JOY A;  2G3R A;  4M77 E;  1KQ1 A;  2K3X A;  1VQP A;  3OBY A;  4JRK A;  5DLO A;  3X20 B;  4ZN1 A;  4IUV A;  4KUL A;  2EJG A;  2I2L A;  5IT9 E;  3E19 A;  4HT8 A;  2M9U A;  4QQG A;  4C8Q D;  1X6O A;  1VQ9 T;  1P92 A;  2BIV A;  1M1K U;  2CGH A;  1VQN T;  2XDB A;  4OGC A;  3EFS A;  3C94 A;  5CAI A;  3FC3 A;  4PL6 A;  5CR2 A;  4RCC A;  3A8O B;  3CMA T;  3ER0 A;  3OS1 A;  4C8Q F;  1KHI A;  1WNL A;  3LYI A;  4BD3 A;  4EMK B;  4HKE A;  4NOY A;  3QPH A;  2QI2 A;  4X34 A;  5LJ5 f;  2RJF A;  2DEQ A;  2K3Y A;  3QDR B;  2CKK A;  2LX9 A;  3E9F A;  4GLK A;  3PNW C;  4RKU E;  1BIB A;  3OMG A;  2EIF A;  3X26 B;  3MCA B;  4IUP A;  2F5K A;  3LW5 E;  4XK8 E;  1I81 A;  2CYZ B;  4BE0 A;  3M9Q A;  2RHY A;  5CKE A;  1YIT T;  3CCL A;  5GAM g;  1VIE A;  3JCM d;  1YIJ A;  3R6O A;  3RER A;  3A5Z B;  3A8M B;  3CPF A;  3HP9 A;  2X35 A;  3L1A A;  4M7D B;  2X4X A;  4HCZ A;  3CBP A;  1YJW T;  3P8D A;  3OYJ A;  4IKF A;  1YHQ T;  4B9W A;  2KDS A;  3M53 A;  4J6X A;  3RES A;  3UWN A;  5GMK j;  3A8H B;  4QVZ A;  4L6V 5;  3JCM c;  5GAO q;  3HHT B;  3MEW A;  4M75 B;  3MEU A;  1VQ9 A;  2B8A A;  2BKD N;  3NFC A;  5HK0 A;  5GAN g;  4M7A F;  4RMO A;  5CKH A;  3PTA A;  4WF2 A;  1D3B B;  3PMT A;  5LJ3 e;  1JBM A;  1UGR B;  2DD4 A;  3UT1 A;  3CMA A;  2JVV A;  2LRQ A;  4M78 B;  1GXI E;  3RMS A;  3L2V A;  3G6E A;  1WJS A;  3H8Z A;  4C92 B;  3LGF A;  3PT9 A;  3QYG B;  2XIC A;  1M8V A;  1VQK T;  1XNI A;  2EQK A;  2EWN A;  3QYH B;  4ZTJ A;  4PJO B;  5GAM f;  1NE8 A;  4L59 A;  4HCB A;  3CC2 T;  3OYB A;  3QZ9 B;  2XD0 A;  3LWI A;  3JCM b;  3BW1 A;  3S3O A;  2Y4X A;  1KD1 U;  1ZBX A;  1KQS S;  2DTO A;  5GAN d;  3G71 A;  4M7D G;  1YIT A;  1M1F A;  4JJN K;  2VXF A;  2PVO B;  5DM7 R;  1YJW A;  3JCM V;  2LNV A;  4ZGJ B;  1YI2 T;  4YTL A;  2X4W A;  1JB0 E;  1ZHI A;  5J26 A;  5FLX E;  3OY9 A;  3QSU A;  1B34 A;  4J5Y A;  3EAE A;  1QVF A;  4JS4 A;  3OS2 A;  4M75 G;  2OAU A;  5LJ5 e;  4EPC A;  1OZ2 A;  3T9N A;  2LT1 A;  5CIU A;  1VQ6 T;  4D6W A;  2C06 A;  4C5E A;  3CPW S;  1LJO A;  4IUT A;  3CXC S;  3JCM Q;  4JRI A;  1G3W A;  4LD6 A;  1BI2 A;  1UEB A;  3JCM P;  4A4G A;  2MWO A;  3DB4 A;  4M7D D;  1I4K 1;  2X4J A;  3CBM A;  4M77 C;  2O4X A;  5HKC A;  1VUB A;  3CBO A;  4JDS A;  5A0G A;  4C92 G;  2V8J A;  2E65 A;  2RH2 A;  1W4S A;  3CEY A;  4ELZ C;  3PIP A;  2E64 A;  4PJO G;  3OA6 A;  3TRE A;  4M7D F;  2QQS A;  3VKI A;  5KH6 A;  3FDR A;  1WPY A;  1VQK A;  4M77 A;  5HY6 A;  1QVG S;  1UGQ B;  2DTH A;  3OW2 S;  4M75 D;  2XID A;  1VQP T;  1O9S A;  3MET A;  5I2S A;  3OYM A;  1Q81 C;  1WGS A;  3JCM e;  1KHC A;  1IRE B;  4L5G A;  1FXX A;  3CCM T;  3GP8 A;  5GMK e;  3CCJ T;  5FRN A;  1N9S A;  4O5V A;  2K5I A;  2KY9 A;  2P4T A;  4M75 F;  2QEX A;  2P0P A;  4M78 D;  4BI8 B;  2QQR A;  2GQV A;  4FT2 A;  5GAM h;  3OYA A;  1XOV A;  2DIG A;  3KUF A;  3M5A A;  1FX7 A;  3GPL A;  4HCC A;  1KG1 A;  3V8J A;  4JRQ A;  2VV5 A;  4Y28 E;  2ZPB B;  1Q86 C;  4PJO D;  4M78 F;  1K8A C;  3CME T;  4XTY A;  3CCU T;  2DO3 A;  4BB7 A;  1S72 A;  4PLI A;  4NL3 A;  1YJN T;  4M7A E;  4PJO F;  4E47 A;  3M54 A;  3JB9 J;  1YJ9 T;  3QBY A;  5GAO n;  2L5Q A;  2E41 A;  2V8I A;  2YLC A;  3GF5 A;  3LH0 A;  4FM4 B;  4J6Y A;  3BY7 A;  4N4G A;  1Y96 A;  3FJP A;  4N0A A;  3QII A;  3V8K A;  2M0O A;  2FYK A;  4A4K A;  1UGP B;  2K57 A;  3G7Z A;  2JTM A;  2PVD B;  3OBW A;  3WVE B;  3E1S A;  2JNG A;  3JSC A;  3O8V A;  2PUK B;  5GMK i;  2DXT A;  3L2U A;  2CZ0 B;  4J7F A;  1NPP A;  4JRP A;  5GMK l;  5GAN e;  4JLG A;  3GNG A;  2ZCF B;  3QZ5 B;  4PNO A;  2MAM A;  5CO7 A;  1QVG A;  1B34 B;  3L42 A;  3ZEH A;  3OW2 A;  2EAY A;  5LL6 S;  1QP2 A;  1Y71 A;  2A7Y A;  2E12 A;  3CCM A;  4XTU A;  3CCJ A;  1N8R C;  3JB9 H;  2DD5 A;  2MMP A;  5LJ5 d;  2QXF A;  5FU6 C;  2PVG B;  4F7U A;  1N27 A;  1OI1 A;  2K4Y A;  4XTX A;  1Q81 U;  2OTJ T;  3C12 A;  4XTW A;  2RK2 A;  3UPU A;  4LD9 K;  3JCM J;  2DZC A;  2O4X B;  3QG1 A;  3G6E T;  4A4F A;  4XTZ A;  5LJ5 j;  3CME A;  4C0G A;  3CCU A;  3CC4 T;  3LWH A;  2M1H A;  2DIQ A;  1QW1 A;  3DKM A;  2MWP A;  3TU4 K;  3SWN B;  1YJN A;  2EJ9 A;  2ZPI B;  1YJ9 A;  4XU0 A;  1WQW A;  1G3S A;  3INZ A;  2E70 A;  2JZ2 A;  3VUB A;  1BKB A;  5I21 A;  1Q82 C;  1X01 A;  1JJ2 A;  5AYF A;  2JTF A;  3G71 T;  3L2Z A;  4MZT A;  3V7C A;  3ZBD A;  4OGE A;  2DKG A;  2PQW A;  3H6Z A;  3M55 A;  3NTI A;  4VUB A;  3P8B B;  1QVP A;  1VIF A;  2F5T X;  2A3L A;  3TEE A;  1K9M C;  2RI2 A;  2K5F A;  4ZGD B;  1QVF S;  2R5A A;  5CCA A;  4NS5 A;  3HL8 A;  4C8Q C;  2RHZ A;  4FT4 A;  4NL2 A;  2M16 A;  4E7H A;  4OF1 A;  2RI3 A;  2YRV A;  3VU3 C;  3OYF A;  5FRO A;  4F7U E;  3QJY A;  1V29 B;  2GFA A;  1M4Z A;  2DK3 A;  4M78 E;  4C8Q A;  1PSE A;  3JCM X;  3OSS C;  4BE2 A;  5GAM d;  2OTL T;  4ME7 A;  2OTJ A;  2DTI A;  1N8R U;  3TCJ A;  4EDU A;  2FB7 A;  5J3B A;  2YLB A;  3MEV A;  3MHX A;  2E5Q A;  2V8K A;  3CC4 A;  1VQ8 A;  3SDZ A;  3MEA A;  2ZPH B;  4M77 G;  4OB2 B;  2RHX A;  5GAM j;  1VQ7 T;  4C5G A;  3WXM B;  2RJE A;  1W2B A;  3P8H A;  2QQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...