2LCLA

Solution structure of rfah carboxyterminal domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
GAMGPKDIVDPATPYPGDKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKNTEFRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcriptional activator rfaH
publication title An alpha helix to beta barrel domain switch transforms the transcription factor RfaH into a translation factor.
pubmed doi rcsb
source organism Escherichia coli
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lclA00
1VQ9A 5J26A 2JNGA 1N8RU 2IG0A 1YJNA 4ZN1A 2KVQG 2QA4T 1KHIA 2JVVA 3PIPA 3G71T 1YBYA 2JUFA 1VQPT 1KC8C 1K8AC 2XHCA 1N8RC 2QA4A 1YJWT 3G71A 1M1KU 1VQPA 1VQ4T 1K9MU 1QVFS 1UEBA 1YJWA 3CCET 2E6ZA 1VQ4A 2OTJT 1YI2A 1K73U 1NJIC 1M1KC 1QVGA 1VQ7T 1VQKT 1K9MC 3CMET 3CCEA 1YJ9T 2OTJA 1VQLT 1KC8U 1K8AU 1VQ7A 5IT9E 1VQ8T 1VQKA 3CMEA 3G6ET 3ER0A 2QEXT 3CCUT 1K73C 1VQ6T 1YJ9A 2MWPA 1VQLA 3J81E 1NPPA 3A5ZB 1VQ8A 3CCUA 3G6EA 2MI6A 2QEXA 3CCST 1VQ6A 1KD1C 3P8BB 1JJ2A 5J3BA 3CCSA 1NJIU 3LGFA 2OTLT 1W2BS 1W2BA 3CMAT 3DB4A 1VQMA 3CCLT 4YTLA 3LH0A 1Q82U 1BKBA 2OTLA 2DO3A 3OYYA 3CMAA 1QVGS 3CCLA 5HY6A 3CCMT 2LCLA 1EIFA 5DM7R 3CXCS 3CXCA 3I56T 1KQSA 5LL6S 1Q82C 1KD1U 3CCMA 1XTDA 1M1GA 3JAME 2KDSA 3I56A 3J80E 1M90C 1Q86C 3PIOA 1YIJT 3G4ST 1VQOT 1JJ2S 5A2QE 3OW2S 1VQMT 3OW2A 4TVRA 3I55T 1YIJA 3DLLA 3G4SA 3CC4T 1Q7YC 1RL2A 4RG2A 1VQOA 2LQ8A 3CPFA 5FLXE 1VQNT 3I55A 3CCQT 1NZ9A 2CKKA 3CC4A 1XNIA 5DLQE 1SSFA 2JOYA 3LGLA 5IAYA 2G3RA 1VQNA 3CCQA 1Q81C 1Q86U 1M90U 1KQSS 4ZN3A 3CCVT 3DB3A 3TREA 3CD6T 3CCJT 1X6OA 3CC2T 1S72T 1Q7YU 2E70A 3CCVA 2LVMA 4X34A 3HKSA 3KBGA 3CC7T 3CD6A 3CCJA 1VQ5T 3CC2A 1S72A 1QVFA 3J7AF 2L3RA 1YHQT 3CPWS 3CPWA 3CCRT 3CC7A 1VQ5A 1YITT 1Q81U 1YI2T 1NPRA 2MWOA 1VQ9T 1YHQA 2EIFA 3CCRA 4QQDA 1YJNT 1YITA 1IZ6A 4CRIA
chains in the Genus database with same CATH superfamily
2JNGA 3M0UA 2GF7A 3CCQQ 1D3BA 1K9MR 2KT1A 2ENMA 2KRSA 4XU0A 1N8RC 1JBMA 2J6KA 3EG1A 4AMCA 4OMNA 4JRQA 1RAHB 3MJXA 4JRIA 4OMOA 2L8DA 2QDYB 3BDUA 1C0MA 1Z9QA 1BI2A 2JMAA 2X3XD 3OYHA 2E12A 2JW4A 3A5ZB 1I0CA 1WXBA 2K2MA 2MYSA 4JZ4A 1YJNQ 2EJFA 2XI9A 4LE9A 4IURA 3VUBA 4BI3A 2AKKA 3MPUB 4FSXA 4LDVA 2D1XA 1R0CB 4EMKC 2HQEA 2Z0WA 2RA2A 3JCMJ 4C0GA 3S3OA 1AVZC 5LJ5e 2EWNA 4J9EA 3M5AA 2WSCE 4C8QB 4ME7A 3INZA 2QEXQ 1OYXA 2E6NA 2QGGA 3CPFA 1VYUA 1NZ9A 4AFSC 2KT8A 1FXXA 2YRCA 1UJYA 1ZSZB 3TSWA 3LGLA 4RTUA 2JT4A 4BY6C 2DL3A 2GFUA 1D3BB 2CSQA 5IXFA 3SWNA 3TQ7P 2M9UA 2EYXA 3PVQA 2X51A 1QKXA 3HKSA 5KE3A 3GBQA 3CC7T 3BE3A 1XQHA 2V26A 1S72A 3D7SB 3J7AF 4M77C 3HHTB 1PG5B 2M16A 2ZZDA 1JXOA 1WJRA 3QKJA 2CREA 3CCRA 2YLCA 3QWXX 1NG2A 1IZ6A 4JPBW 1LNXA 2LCCA 4M78G 1BCMA 1KQ1A 1N8RU 4M77A 2LP5A 2FG0A 3A8HB 2KVQG 4RTYA 5LJ5g 1KC8C 1VQPT 2A0FB 1AHJB 4XU1A 3EFOA 5GAMh 4HVVA 4CC3A 3OYNA 2QDLA 2RK2A 1VQ4A 2QGFB 3PFSA 1QVGA 1QWEA 2FZCB 3CCEA 1H8KA 2E1HA 1YJ9T 4DQ2A 2MF2A 3E19A 3FDRA 3FRNA 1VQ6T 1C6VX 5KYYA 2YUQA 2CDTA 1T3SA 3OYEA 3JB9I 1KFZA 1KK7A 3OSVA 2F5KA 3OYLA 3O8VA 1TXQA 4KBMB 2DRMA 2A7YA 4J9DA 3CCLA 2P0QA 1VQ5Q 2X9HA 2KYMA 2HD0A 2B8AA 4A4GA 5HCKA 2EQJA 2RHYA 3I5SA 3SWNB 1IGQA 2K6DA 1YI2Q 5LJ3h 1ZUKA 4J9GA 5C0MA 3P8HA 4MZPA 3JCMd 1GCQC 3META 4F7UA 1ACMB 5KH6A 2JM9A 2DVEA 1Q7YC 4RG2A 4Y91A 1B07A 2FEIA 4WCIA 3UA7A 4BE1A 4E2FB 1M5Q1 2QQ9A 2Y90A 4E7ZA 1BI1A 3RUXA 1IB8A 1Q7YR 2DBKA 2O31A 4HXJA 2EYZA 4M77B 2YUNA 2HSEB 2KE9A 2QG9B 1EFNA 1HXDA 3EFOB 3VYHB 3UA6A 1RADB 3RKYA 3ZL7C 1X27A 2JTEA 1MMGA 1WHJA 1K8AR 2A08A 5FU7C 4KRTA 1QWFA 1XTDA 6AT1B 1M1KR 1RABB 1NJIR 4AG1C 2C0OA 5KYYB 2V1QA 1RAAB 5IH2A 1J3TA 2VC8A 4MDXA 2X4WA 1ZA1B 4EMGA 5GAOl 2HEQA 2VWFA 1PSFA 5GAN3 4XTWA 4BUGA 1Y57A 2CUDA 2K2VA 1F1BB 3L2VA 1YN8A 4J9HA 3A8OB 3H0FA 4LXCA 5I11A 2GTOA 1AT1B 3A98A 4JDSA 1Z9ZA 4JJDA 5CVIA 2CH4W 1VQ7A 4ATOA 1QMCA 2C0IA 3FIFA 1VQLA 3LLRA 4RTZA 4MMLA 1KD1C 4F7UB 1X2QA 1C1AA 3CCSA 3MEWA 4F7UE 2CP5A 2OTLT 2PUOB 2J05A 1GFCA 2E5QA 1KD1R 3EFRA 1QP3A 1QVGS 1T0JA 2D8HA 3I56T 1GXIE 3T9NA 3REBB 1B34A 2J6FA 3NMZC 4A53A 3M57A 3JAME 4R56A 1I5LA 2LDMA 1IREB 1D0ZA 2DK3A 2MIOA 4J83A 2BIVA 4M7AC 1PC0A 3G71Q 3QJ6A 1X69A 2DPPB 4R55A 4LUEA 1N5ZA 1WNLA 1YFNA 2HNIA 2Y4YA 3JRZA 1QP2A 4KUIA 2VB6A 2P0PA 2YRVA 3H41A 1WQ7A 5FU7B 3R6NA 4J6WA 3KBGA 2PUKB 1VQ5T 2X4YA 4KH0B 1XJWB 1B7TA 2HBWA 1G3TA 1SF9A 3ZBDA 2DAQA 1PRMC 4M78C 2VV5A 5KYWA 4N0AC 1YI2T 1Q81U 1YIJQ 3RIRA 1TG0A 2GQIA 2KSSA 3H9NA 3I35A 4C92A 1YITA 1UECA 2DEQA 2KRNA 3QIIA 5GANj 2I2LA 4M78A 2QASA 5D6YA 5GMKi 3EGUA 1YBYA 2JUFA 3M0TA 5CAIA 2QA4A 2LCSA 5J39A 2DRKA 2E6ZA 2JTFA 1QKWA 1D0YA 3OYJA 2KNBB 1PWTA 1B34B 1E6HA 3NHNA 4DEXA 1D1AA 4E7LA 4ANJA 1VQ8A 3M56A 2E3HA 4GLKA 4OMPA 1W70A 2A37A 4LNPA 4JJNK 3CMAT 3CCVQ 3JB9F 2ZAEA 1BKBA 3JCMV 4UC4A 3GNGA 4C0DB 3A1PA 4FYXB 1VYVA 2CZ1B 2ZPIB 2A28A 3CXCS 2KGTA 2RPNA 5GMKj 2C06A 2OX7A 2L3SA 4F17A 2QQBA 4LDWA 1T3LA 3U23A 3G6EQ 2DTOA 4Z89A 3TSZA 1MV0B 1SRMA 5KYWB 4RKUE 3FJPA 2DL8A 3JCMe 4C92B 1ZBJA 4XTUA 2EVRA 2EYQA 5CQXA 1HD3A 4C92E 3JCMP 4JUVA 4ZN3A 1FX7A 4M78B 2FO0A 4M78E 3CCMQ 2LT1A 3HSBA 4X34A 3CD6A 2G6FX 3CCUQ 2L3RA 1V29B 3CPWS 4E47A 4Z02A 1GFDA 2LQKA 5LJ5f 4DA4A 2PVOB 4WTOB 4IUUA 3ME9A 1JO8A 2FPFA 3VKIA 3G71T 1QVGP 4C92D 3VS5A 1AOJA 1M1FA 2BZXA 2ROLA 2ZCFB 1M30A 3JCMg 4PFPA 2OTJT 1BIAA 2C0TA 2O9VA 2OAWA 2X4XA 4J9IA 1YHQQ 5IT9E 5GANh 1NEBA 1K73C 1I1JA 1PKSA 2CT4A 2DYIA 1ZLMA 2HBPA 4A54A 3OY9A 2DIQA 1WQWA 4BE0A 1Q86R 2DA9A 2JS0A 2JN0A 3CCJQ 4J7FA 1GCPA 1ZX6A 3VRYA 5KCOA 2LCLA 3M4GA 5LL6S 3QZ9B 2L3PA 4XAXB 1WPYA 2LNHB 4PJOD 2EKHA 1TH7A 3QSUA 1M3AA 4RTVA 1WHMA 2P4TA 1WXTA 3OYAA 2D0NA 2KXCA 3QDFA 4BACA 2FPEA 1PD1A 3E2UA 4PFOA 3C0CA 2RQWA 5GMKh 3VS4A 3MHXA 1K4US 5IHNA 1UHCA 3CCVT 1M2VA 3V7SA 3X24B 5A0LA 2E70A 4F7UG 3L1AA 4FYYB 2L0AA 2QXFA 1FMVA 1OPLA 3CC7A 1WHHA 7AT1B 1VQOQ 2GCXA 2MAMA 1VQMQ 2E5KA 1WX6A 1QCFA 2D8JA 4N4HA 1A0NB 2CZ7B 3OBWA 4E7KA 2XHCA 3OYIA 4GBQA 4L59A 1YJWT 1ZSZC 1FYNA 3GOXA 3CXCP 1VQPA 1VOMA 4IUTA 2L89A 2EGCA 2RHIA 1TS9A 2KRMA 4BI4A 2BZYA 5GANd 1K73U 4LDUA 1UGVA 1K9MC 3VYGA 4CC2A 4MZMA 2GGRA 1RACB 3CCUT 2DZ9A 4KUDK 1YJ9A 1ARKA 4OMQA 4KGZB 1VQ6A 2LJ3A 2K5LA 4PJOF 3G1JA 2DZCA 2DILA 2ZGWA 1TWBA 2DIGA 4BD3A 4FT4A 4YTLA 5HK3A 2SRCA 2DO3A 1OULA 1N27A 2RJCA 3L2ZA 4PJNA 2BZ8A 4KULA 3LWHA 1M2VB 3CPWP 1MGQA 3CQTA 1X2KA 2M0YA 5LJ3j 4JS5A 5A2QE 4ZGEB 4HCBA 1SKUB 1QCOA 5ECAA 4EMHA 5IAYA 1WGSA 2KI7A 2D0QB 5I22A 3MCAB 3OYMA 2M0OA 3S6WA 1E7OA 3ZEHA 4PJMA 2RI5A 3CCJT 2FZKB 1VQKQ 4BDZA 2K5FA 2R57A 5I2MA 2ECZA 5CR2A 5CKBA 1NYFA 3M0SA 3PMIA 4JRPA 2KYBA 3SWNC 3OMGA 2DFUA 3REAB 4IUPA 2RQVA 2RHXA 3PNWC 4HVWA 4PFZA 1W1FA 3EH2A 1NEGA 1OZ2A 2WSFE 3VU3C 5KYXA 1U1SA 2RJDA 1E6GA 4Z8AA 2JVVA 2P0KA 2YXYA 1X01A 1SRLA 2EFIA 3EHRA 1FMWA 2RD1A 2COZA 1WIEA 1K9MU 5CCAA 4JRKA 4K11A 3JCMb 2QQRA 3V8LA 4C92G 1LOJA 1HSQA 2AHJB 2GNCA 4LDXA 2A3LA 2IIMA 3CC4Q 4MMKA 2MWPA 3OA6A 5IHKA 2YWWA 2WACA 3VRZA 1U1TA 4ZGDB 1JJ2A 2E10A 4NOYA 2DX1A 2P4RA 4HT8A 3V7RA 3DB4A 2RO0A 3CBOA 3LH0A 4XU2A 2OTLA 3SEMA 3JB9J 4OP0A 2NYSA 3G7ZA 3AHUA 1VQ4Q 2IVWA 3CCEQ 3SD4A 2DD5A 1O9SA 3I56A 4Y28E 2GTJA 3SB2A 3OW2S 1VA7A 2QI2A 2DXBA 2OI3A 2XK0A 4PJOG 4ZGJB 5GAN4 3CCQT 5FWCA 3M0QA 3C95A 1AZEA 5FRNA 1SSFA 1WHKA 5KCHA 4D8KA 3VS2A 2KR3A 5KYXB 3CCLQ 2KXDA 3DB3A 2O9SA 2XDBA 2L3QA 3CMEQ 3L42A 4OB3B 3N5BB 5FU6B 2FHDA 3M4YA 4D6WA 2E64A 3A8MB 5HK0A 5GAN5 2ED1A 4FSSA 1VQ5A 3GPLA 1YJNT 2DERA 3H8ZA 2DETA 4FT2A 1YI2A 4N4GA 2KK4A 3QPHA 2GQVA 2DNUA 4FIBA 2HDAA 2QQAA 2PVGB 2J7IA 1OI1A 1H3HA 4E7IA 1GBQA 8AT1B 1K8AC 5GAN7 2EJGA 3JCMf 4ZTFA 2DJQA 3CEYA 1M1KC 4ELYC 1NJIC 3M0RA 1VQKT 2EYWA 3A8GB 2PTKA 3I55Q 1KC8U 2QEXT 1TSFA 3VS1A 3RESA 1I4K1 1VQNQ 5GAMd 5GAN2 2MI6A 5IN1A 1WZOA 4PJLA 2XMFA 4KT0E 2K9GA 4M75F 2R5AA 8ATCB 1PRLC 3CC2Q 3CMAA 1YCYA 4RCCA 3QHSA 1WXUA 2RI2A 5HY6A 2BUDA 3CXCA 3H0HA 1KQSA 1SPKA 1Y71A 3HRUA 3OMCA 1VQ9Q 1NLPC 1LVKA 1M90C 1K1ZA 1Q81R 1N9RA 1RI9A 3OS1A 4C5EA 3FB9A 4B6MA 1JJ2S 4OGEA 4QVCA 1TU0B 1G3YA 1YCSB 1ZBXA 1LCKA 1RL2A 3CC4T 1M90R 3CCSQ 2NLUA 2CKKA 4JJBA 1G5VA 3M53A 2DTIA 2VGNA 3MP6A 5LJ3d 2JZ2A 2RB6A 1M4ZA 4LUDA 3C12A 1G83A 3NPFA 4HCZA 5KYUA 2EPDA 1Q7YU 2DEUA 4C0DC 4FW2A 1OOTA 2KEAA 1BIBA 4XK8E 2RQTA 3WVEB 2HSPA 3CPWA 3JB9D 2MOXA 2K79A 4FL6A 3TVTA 4OB0B 4J9BA 4OGCA 3C4SA 4JS4A 5I21A 5J26A 1UFFA 2YHTA 4IKFA 1K0XA 2V8JA 5FRMA 1V1CA 1VIEA 4MDWA 3WVDB 2RMOA 4PK4A 4C92C 3G71A 1M1KU 3VV0A 4QQGA 3KUFA 1UEBA 2RN8A 2PZ1A 2EAYA 2X35A 4IIMA 2BKDN 1I5OB 3MO8A 3QZ5B 2Y4XA 3G4SQ 3CMET 1M8VA 2EQKA 2OTJA 3UT1A 1TOVA 3OW2P 2AZSA 3EGDA 2X4JA 3RMQA 5LJ5h 3OYCA 2LQWA 2W0ZA 1UGRB 2RQRA 2DF6A 1QQJA 3QXEB 3QJYA 5J3BA 3URGA 2XG8D 3VS6A 2QA4Q 4ZTJA 4ELZC 3OYYA 2XU8A 5EC7A 2RH2A 1KD1U 1N9SA 5GMKl 1IHWA 2AIRB 4DBQA 5KYUB 2NUTA 2LTOA 1VQ8Q 3I55T 2VXFA 3DLLA 2COYA 3A8LB 2YLBA 3OQ5A 1T0HA 1VQNT 1K76A 2H8HA 3TCJA 1XNIA 5DLQE 4PJOA 1LPLA 2LX7A 4RMOA 2G3RA 3QWYA 1KQSS 1KQ2A 2NUPA 4CC7A 5KE2A 3CC2T 3RBBB 4DBHA 3CCVA 4BI8B 1WI7A 4EIKA 2HMAA 1Y96A 1JXMA 5L23A 1RAFB 2DM1A 1M8MA 4L5GA 1WJSA 2HCKA 1VQ9T 2OJ2A 2HL5C 1HYOA 3EGDB 1D0XA 2DL4A 5C6SA 2IG0A 4ZN1A 1BK2A 2DE0X 4E7JA 4C5GA 1ABQA 3OS5A 4IIOA 2M1HA 1SG5A 5IHIA 4FU6A 1YJWA 1VIFA 3MKDA 4OMMA 1M9SA 4A4HA 1XOVA 2J06A 5AYFA 1JJ2P 3L2WA 5KYNA 4HVUA 4MZTA 1NPPA 1UB4A 3CCUA 2NUTB 2HQXA 1Q82R 2VVKA 1MNDA 3LGFA 5GAMe 4M7AD 4F04B 3Q1JA 3EG9A 4PJOB 1GBRA 2FPDA 2CUBA 4PJOE 4KH1B 4E7HA 2EQUA 1ZQ1A 2CT3A 2NUPB 5DY9A 2DJZA 1M1GA 2F2VA 1AWWA 1R8OB 4Q5WA 3JCMc 1Q86C 2CYZB 1YIJT 3G4ST 1U8RA 2RF0A 1Y96B 4NL2A 4XTZA 4TVRA 3DKMA 2V1RA 1UHFA 2LNVA 2LQ8A 4Y92A 2PNIA 4Z88A 4FW1A 2QTXA 2CSIA 3OBYA 1CKAA 2MPXC 4C5IA 1ZSGA 3OB9A 4ORZA 3UF4A 4M7DD 1YWPA 3HRTA 2PU9B 2L5QA 2L2PA 5GAOn 2LVMA 5LJ3e 2CP3A 3V8KA 1RUWA 3CCJA 4EPCA 3OS2A 5GAMg 4CI0C 4RTXA 4PLIA 1YP5A 5CQYA 2HQHA 2JOYA 3JB9G 3RNJA 1OZ3A 2ZPGB 3VS7A 3E1SA 3PIPA 1WYXA 3S3MA 4BB7A 1EX4A 3HL8A 4RG8A 3EG9B 4M7AF 2COWA 1KIKA 4KGXB 4F16A 3CC7Q 5CKDA 3SFMA 1M2OA 1D09B 2KAFA 3G6ET 1B3QA 4PLLA 3MEUA 2GBQA 1MMNA 4PL6A 5LJ3g 3P8BB 4QT7A 1X6BA 1KQSP 2XDDA 1VQMA 3KFVA 4IUVA 1VQPQ 2RNAA 1TTHB 2CH4A 2FYKA 3UATA 3CCMT 2F1LA 1PSEA 2QAZA 1UJ0A 3VS0A 3QYGB 5GJWB 3L2RA 3I5RA 4KGVB 3MEAA 2K3BA 5L8RE 3OSSC 4M7DF 4DBRA 1AEYA 1YJ9Q 2CS7A 5CK9A 1MV3A 5D7UA 3OW2A 3QO3A 1JEGA 1M3BA 3KXTA 1SEMA 5FLXE 1FWZA 4IUQA 3OYDA 1NLOC 1O75A 5GANf 4FM4B 4M75A 1JU5C 2CZ6B 2HKQB 3CCQA 1CKBA 4XTXA 3RERA 2ROTA 2KBTA 2BTTA 1W6XA 3OYFA 1AZGB 2MCNA 1I07A 1G8XA 3JB9H 1RAEB 2K3YA 1K9AA 1QVFA 1W4SA 2EJ9A 3GF5A 1YHQT 4J9CA 3QYHB 1PNJA 2P84A 1ABOA 2MK5A 4XTYA 1N8RR 3P8DA 2E3IA 3FEOA 2RQUA 5GMKm 4CRIA 3M0PA 1YJNA 2VASA 3M55A 2LRQA 2RHUA 1WHGA 3M59A 4RTWA 1PHTA 2ZPEB 5GAN8 3MP1A 2DLPA 1MMDA 3H6ZA 3MEVA 5D6WA 3S3NA 2K3XA 3BY7A 2OAUA 4J9FA 1WJQA 2CGHA 4WF2A 5FU6C 4VUBA 1VQKA 3BW1A 3AT1B 3ER0A 3V7CA 1UE9A 3PT9A 3MP8A 2DL5A 1QCNA 1Y0MA 2QEXA 1WA7A 3QBYA 4NS5A 1UG1A 3THKA 4EMKA 2K4YA 4C8QE 1NM7A 4LN2A 1W2BS 2DKGA 3EG2A 3JCMh 1OX8A 1TUDA 2F69A 2SEMA 4C5HA 1G3SA 3E9GA 3JCMQ 1S72Q 1RLQC 4M75B 1JQQA 2CP0A 4M7AG 4M75E 4X9DA 3CCRQ 4AG2C 1OX9A 3NTIA 3PIOA 1I8FA 1VQOT 1X43A 1VQMT 1IGUA 2EQMA 3EH1A 3M58A 4E6RA 2K7AA 5CO7A 3CC4A 3SHWA 4C8QD 3VS3A 2OTLQ 4C0FA 4X9CA 2HZYA 1BBZA 4A4KA 1R77A 4OB1B 3ZFJA 3SDZA 4XQ3A 1YWOA 4M75D 1BYMA 3I56Q 1UGSB 2FL7A 1KJWA 4M7DG 3V8JA 1QW1A 3NFCA 5FWBA 2KMTA 1KC8R 2CP2A 4JLGA 1G2BA 2MMPA 3HTRA 5I2SA 4OMFB 4RTTA 3LW5E 2PVDB 4EMKB 2E65A 2ZPBB 1QVFS 1BU1A 2E41A 2QQSA 4HCKA 1PM3A 3CBMA 2EGAA 2GFAA 2J6OA 3GLXA 3EAEA 4LDYA 3CMEA 1WFWA 2QK0A 2HL3A 2DXTA 2QTVA 2EKOA 5LJ5j 4AFUC 2ABLA 1AWJA 2E4HA 4BY6B 1N6AA 2VGMA 3R6OA 3OYBA 2YT6A 2K5IA 1UGPB 4LD9K 2RI3A 1GCQA 4B9XA 4C8QF 2JJ9A 3EGXA 2VXEA 2O01E 5GANe 4M77E 2KROA 4CC4B 2RJFA 4XU3A 3WXMB 3CBPA 2JMCA 2O88A 1KG1A 3TU4K 3X20B 1OU8A 3PVLA 3BDLA 3HFNA 3I55A 1OEBA 4OB2B 2LZ6B 2WSEE 1VQNA 1Q81C 2LX9A 3CMAQ 2PQWA 4AFQC 2V8IA 1RLPC 2DMOA 1RAGB 3C94A 1X6OA 5GAMf 1S72T 1VQ7Q 4J7IA 5M9OA 3FC3A 5GAOq 1VQLQ 3CC2A 4M77D 4RUGA 3CCRT 2AK5A 2EIFA 2VKNA 4QQDA 1VQ9A 1Y7XA 3RR6A 1W2BP 5GMKe 5GANg 1JRIA 4R0KA 3GP8A 4ESRA 1OQKA 2EQIA 3TEEA 1SHGA 1MUZA 4OVAA 1BB9A 1D1CA 4GLMA 2DYBA 4HCCA 4DEYA 1VQ4T 2HAXA 3X25B 5AT1B 3CCET 2XD0A 1NE8A 3EHQA 1CSKA 4L6V5 1BCOA 2DXCA 1UDLA 3EGXB 1K8AU 1JB0E 4BE2A 3RMSA 4C0ZA 5LJ3f 4PNOA 2ATCB 1V76A 3X26B 4FYVB 4DBFA 2AZVA 3E9FA 1NJIU 2VUBA 2JTMA 1GRIA 5CKEA 3CCLT 2EBPA 3LH5A 2YSQA 1WDXA 1RI0A 1H92A 4HKEA 2DTHA 2VYTA 4FYWB 1H641 4DOVA 4M7AA 1HK9A 2LJ1A 1YITQ 3ULRB 2OTJQ 1OV3A 3VUZA 3LYIA 2RHZA 4PKCC 4RCBA 2I0NA 3JV3A 3PGGA 3HP9A 3QUIA 2NWMA 1D1BA 2YUOA 3EG0A 2JM8A 2ESWA 3G4SA 2RJEA 1YIJA 3NGPA 4QVDA 4M77F 5GAOp 1UTIA 1S1NA 1R0BG 5CKFA 3UWNA 3HRSA 2M51A 1AD5A 1Q95G 1UUEA 1M90U 2XKOC 3PE0A 4EDUA 5FROA 1X6GA 2FRWA 1QVFP 1QVPA 1TUGB 4E7SA 4M7DC 2QYZA 4N0AA 1U3OA 4C8QG 1IO6A 3HFOA 3BFMA 4PJOC 2DD4A 4OMLA 3LX7A 2YRDA 4M7DA 1GL5A 1VYTA 3JCMW 2F5TX 1H3ZA 4HT9A 2H3JA 3FLGA 4M75G 2MWOA 4F14A 2RM4A 1M27C 5DLOA 2AT1B 3O5ZA 1BI0A 2XIDA 4QVZA 2D6FA 3FJ5A 3I9QA 2FVUA 4QW2A 1KHIA 1OPKA 4D8DA 5GJVB 1SSHA 1EZZB 2K57A 2KY9A 1P92A 3EFSA 1PD0A 1HJDA 1NYGA 3RKXA 1VQ7T 1KSWA 3OYGA 3OS0A 1VQLT 4M7AB 4F7UF 2ZPHB 4FCYA 4J6YA 4M7AE 2XICA 3J81E 4J8OA 3G6EA 2R58A 1KHCA 3RDVA 3CCST 4ZNXA 5EG2A 3RKWA 1X75C 1IXDA 5IXBA 3M54A 2A36A 1ZA2B 2DXUA 3CD6Q 2EGEA 1YJWQ 4V2SA 1Y07A 1PKTA 5LJ5d 1EIFA 5DM7R 3M9QA 1WHLA 2R5MA 1Q82C 5D6XA 9ATCB 3UPUA 1NBEB 3CCMA 2F2XA 3NTKA 2D9TA 4HA8A 2W10A 5CKHA 2LT4A 3ASKA 3NTHA 4M7DB 4M7DE 5HKCA 1TUCA 1U5SA 2FB7A 3HPWA 1K0SA 4B9WA 1U06A 2CP6A 2O4XA 3TREA 3GNFB 4LD6A 4N4IA 1PCXA 3UDCA 3L2UA 5A0DA 3PMTA 4J5YA 1DJ7B 4JJCA 2LQNA 4M78D 1G3WA 1YITT 1UGQB 2FZGB 4A4FA 1NPRA 1YHQA 2DBMA 3EG3A 4M77G 4PJJA 2QA4T 1ZHIA 3LWIA 1QLYA 2X3WD 2CZ0B 2DVJA 4A4EA 1K73R 2BE7D 3QDRB 3H0IA 2IPOB 5FW9A 4M4ZA 5CIUA 1MHNA 4O6JA 2LMJA 1ZUUA 1SHFA 4A63B 1VQ8T 2RK1A 2ED0A 5GAOm 1IHVA 2O2OA 2AKLA 4J6XA 3IQLA 2EW3A 3F70A 2V8KA 1YNZA 1RAIB 3DLMA 4NL3A 1W2BA 1Q82U 3VJPA 3X28B 1OU9A 2EYYA 2JXBA 4JZ3A 2O4XB 2KDSA 4AT1B 5A0GA 1LJOA 3J80E 5GAOr 1IRXA 2FRYA 1MMAA 3L2QA 4BDYA 2YUPA 2M02A 4C92F 1BI3A 4GY5A 4DOWA 1MNEA 1ZUYA 2NUZA 4II1A 1VQOA 1AWXA 1I81A 2BE9B 4M78F 1FMKA 1VUBA 2B86A 2KQWA 2JS2A 2H3EB 4C8QC 2F2WA 3JCMX 2YDLA 1Q86U 1M3CA 3OYKA 4X1VA 1AWOA 4QKUA 5GAN6 2XDPA 3CD6T 4OF1A 4QQ6A 2ZPFB 2HKNA 3PTAA 4M75C 4AFZC 4C8QA 3QG1A 3GIBA 1WLPB 4P5NA 5GAMj 2DL7A 1VQ6Q 4XTVA 3JSCA 2CP7A 2LC4A 2LJ0A 4JLIA 4O5VA 1ZSZA
chains in the Genus database with same CATH topology
5I21A 5LJ5f 4OMFB 4DA4A 2PVOB 2JNGA 5J26A 4IUUA 3ME9A 2YHTA 4IKFA 2GF7A 1D3BA 2V8JA 5FRMA 3VKIA 3LW5E 3G71T 1VIEA 4MDWA 3WVDB 4XU0A 2PVDB 4EMKB 2E65A 4C92C 4C92D 1N8RC 3G71A 2ZPBB 1M1KU 1M1FA 3VV0A 1JBMA 4QQGA 1QVFS 3KUFA 1UEBA 2E41A 2ZCFB 2QQSA 2EAYA 4JRQA 3JCMg 2X35A 2OTJT 2BKDN 1BIAA 3CBMA 4JRIA 3MO8A 3QZ5B 2Y4XA 3CMET 2GFAA 2X4XA 1M8VA 3GLXA 2EQKA 2OTJA 2L8DA 2QDYB 3EAEA 3UT1A 5IT9E 5GANh 3BDUA 2X4JA 4LDYA 3RMQA 3CMEA 1K73C 1BI2A 5LJ5h 3OYCA 3OYHA 2DXTA 2E12A 3A5ZB 1UGRB 2EKOA 5I2SA 5LJ5j 2EJFA 2XI9A 4BY6B 3QXEB 3QJYA 4IURA 3VUBA 4BI3A 1N6AA 5J3BA 2HBPA 4A54A 3URGA 2VGMA 3OY9A 2XG8D 4FSXA 2DIQA 1WQWA 3R6OA 4LDVA 4ELZC 3OYBA 4BE0A 4ZTJA 2K5IA 1UGPB 4LD9K 2JN0A 3OYYA 4J7FA 2XU8A 2RI3A 5KCOA 2LCLA 3M4GA 2RH2A 4EMKC 4B9XA 4C8QF 5LL6S 1KD1U 2VXEA 1N9SA 3QZ9B 2O01E 2HQEA 2RA2A 4XAXB 4M77E 5GANe 4C0GA 5GMKl 3JCMJ 3S3OA 5LJ5e 2EWNA 1WPYA 3M5AA 2WSCE 4PJOD 4C8QB 1TH7A 4ME7A 2RJFA 2LTOA 3INZA 4XU3A 3WXMB 3CBPA 1OYXA 3I55T 3QSUA 1KG1A 2VXFA 3DLLA 3TU4K 2E6NA 3A8LB 3X20B 3CPFA 3BDLA 2YLBA 2P4TA 3HFNA 3OQ5A 3I55A 1NZ9A 3OYAA 1VQNT 3TCJA 1FXXA 4BACA 1XNIA 5DLQE 4OB2B 4RMOA 4PJOA 3LGLA 2G3RA 2WSEE 1VQNA 4BY6C 1Q81C 2LX9A 5GMKh 1KQSS 2PQWA 2GFUA 3MHXA 2V8IA 1D3BB 1KQ2A 3CCVT 3SWNA 3V7SA 2M9UA 3X24B 3C94A 5KE2A 1X6OA 5GAMf 5A0LA 1S72T 3CC2T 4J7IA 2E70A 5M9OA 4F7UG 3FC3A 3CCVA 3L1AA 5GAOq 3HKSA 5KE3A 4BI8B 3CC7T 1XQHA 1VQ5A 3CC2A 1S72A 1Y96A 3J7AF 2QXFA 4M77D 4M77C 3HHTB 3CCRT 3CC7A 4L5GA 2M16A 1WJSA 2ZZDA 1WJRA 3QKJA 1VQ9T 2EIFA 3CCRA 2GCXA 2YLCA 2MAMA 4QQDA 1IZ6A 1LNXA 2LCCA 1VQ9A 1Y7XA 4M78G 1KQ1A 5C6SA 1N8RU 2IG0A 4M77A 5GMKe 4ZN1A 1JRIA 3A8HB 5GANg 2KVQG 4N4HA 3GP8A 4E7JA 5LJ5g 4C5GA 2CZ7B 1VQPT 1KC8C 3OBWA 3OS5A 4E7KA 2XHCA 3OYIA 1AHJB 4L59A 3TEEA 4OVAA 4XU1A 1YJWT 5GAMh 3GOXA 2M1HA 4HCCA 1VQPA 4IUTA 1VQ4T 2L89A 2HAXA 2RHIA 3X25B 3OYNA 4FU6A 1YJWA 3CCET 2RK2A 2XD0A 1NE8A 4BI4A 1VQ4A 4L6V5 1VIFA 5GANd 1K73U 4A4HA 1M9SA 3PFSA 4LDUA 1QVGA 1K9MC 3CCEA 1XOVA 2E1HA 3VYGA 2DXCA 5AYFA 4DQ2A 1YJ9T 2MF2A 4MZMA 1K8AU 1JB0E 4BE2A 3RMSA 3E19A 3CCUT 3L2WA 2DZ9A 3FDRA 5LJ3f 3FRNA 4C0ZA 4KUDK 4PNOA 1VQ6T 1YJ9A 3X26B 4MZTA 1NPPA 1UB4A 3CCUA 1VQ6A 2HQXA 2K5LA 4PJOF 3OYEA 3E9FA 3JB9I 2DZCA 1NJIU 2VUBA 3LGFA 2JTMA 2F5KA 2ZGWA 3OSVA 5GAMe 3O8VA 3OYLA 4M7AD 3Q1JA 5CKEA 3CCLT 2DIGA 4BD3A 4FT4A 4YTLA 5HK3A 4KBMB 2DO3A 4PJOB 2A7YA 1RI0A 3CCLA 1N27A 2P0QA 2RJCA 3L2ZA 4HKEA 4PJOE 2DTHA 4E7HA 2VYTA 2EQUA 2HD0A 1H641 2B8AA 4KULA 1HK9A 1ZQ1A 4A4GA 4DOVA 4M7AA 3LWHA 2EQJA 2RHYA 3SWNB 5DY9A 1MGQA 1M1GA 2DJZA 1R8OB 4Q5WA 3JCMc 3VUZA 5LJ3h 1Q86C 3LYIA 2CYZB 1YIJT 5C0MA 2RHZA 3P8HA 4MZPA 4PKCC 4RCBA 5LJ3j 3G4ST 3PGGA 3JCMd 3META 4F7UA 3HP9A 4JS5A 3QUIA 1Y96B 4NL2A 4XTZA 5A2QE 4TVRA 3DKMA 4ZGEB 5KH6A 3G4SA 1YIJA 2RJEA 2DVEA 1Q7YC 4RG2A 2LNVA 4HCBA 2LQ8A 4Y91A 4QVDA 4M77F 5GAOp 2QTXA 4BE1A 5CKFA 3OBYA 3UWNA 3HRSA 1M5Q1 2QQ9A 4EMHA 2Y90A 5IAYA 1BI1A 3RUXA 4C5IA 1WGSA 2D0QB 1M90U 2XKOC 3OB9A 4EDUA 4M77B 5FROA 3MCAB 3OYMA 1QVPA 2M0OA 4M7DC 4M7DD 3HRTA 3S6WA 2PU9B 4N0AA 2L5QA 3ZEHA 2RI5A 3CCJT 5GAOn 4C8QG 1HXDA 2LVMA 3VYHB 3HFOA 5LJ3e 3BFMA 4PJOC 3V8KA 3RKYA 2DD4A 3CCJA 4BDZA 4EPCA 3LX7A 3OS2A 2K5FA 5GAMg 2R57A 5I2MA 4CI0C 5CR2A 5CKBA 4M7DA 3JCMW 3PMIA 2F5TX 4PLIA 4JRPA 1H3ZA 4HT9A 2H3JA 3FLGA 3OMGA 3SWNC 4M75G 2MWOA 4IUPA 5CQYA 2RHXA 5FU7C 3PNWC 2JOYA 2RM4A 1XTDA 5DLOA 3JB9G 1BI0A 2XIDA 4QVZA 1OZ2A 2WSFE 1OZ3A 3VU3C 2D6FA 1U1SA 2FVUA 2ZPGB 1KHIA 2RJDA 4QW2A 2JVVA 3E1SA 3PIPA 2P0KA 1X01A 2VC8A 2EFIA 4MDXA 2RD1A 2X4WA 3S3MA 4BB7A 3HL8A 1K9MU 4EMGA 4RG8A 5CCAA 5GAOl 2K57A 2KY9A 5GAN3 1PSFA 1P92A 4XTWA 4BUGA 4JRKA 4M7AF 2K2VA 3EFSA 3JCMb 3L2VA 2QQRA 3A8OB 3V8LA 4C92G 3RKXA 1LOJA 1VQ7T 4JDSA 5CKDA 3OYGA 5CVIA 2AHJB 3SFMA 3OS0A 1VQLT 4M7AB 4F7UF 1VQ7A 4LDXA 2A3LA 3G6ET 2KAFA 2ZPHB 4ATOA 4MMKA 4PLLA 2MWPA 4J6YA 3MEUA 1VQLA 3FIFA 3OA6A 4M7AE 2XICA 3J81E 3LLRA 2WACA 4J8OA 4PL6A 2R58A 3G6EA 1KHCA 3CCST 4MMLA 1KD1C 5LJ3g 3P8BB 1U1TA 4F7UB 5EG2A 4ZGDB 1JJ2A 2E10A 4NOYA 3RKWA 3CCSA 3MEWA 4F7UE 2OTLT 4HT8A 2PUOB 1X75C 3V7RA 2XDDA 3DB4A 2RO0A 3M54A 1VQMA 2E5QA 3CBOA 4IUVA 2DXUA 3LH0A 4XU2A 2OTLA 3EFRA 3JB9J 1QP3A 2FYKA 4OP0A 1QVGS 4V2SA 1Y07A 3G7ZA 3CCMT 3AHUA 5LJ5d 1EIFA 5DM7R 1PSEA 3M9QA 3I56T 3QYGB 1GXIE 3L2RA 2R5MA 2IVWA 1Q82C 5D6XA 3T9NA 3SD4A 2DD5A 1B34A 3CCMA 3MEAA 3UPUA 3NTKA 5L8RE 1O9SA 3M57A 3OSSC 4A53A 3JAME 4R56A 2LDMA 3I56A 1I5LA 1IREB 4M7DF 4Y28E 2DK3A 2D9TA 2CS7A 4HA8A 5CK9A 5CKHA 3SB2A 3OW2A 2QI2A 3QO3A 4J83A 3OW2S 2DXBA 2LT4A 2XK0A 3ASKA 3NTHA 4M7DB 2BIVA 4M7AC 3KXTA 5FLXE 1FWZA 4IUQA 4PJOG 4ZGJB 5GAN4 3QJ6A 3OYDA 1O75A 3CCQT 3C95A 4M7DE 2DPPB 5GANf 5HKCA 5FRNA 4FM4B 4M75A 1SSFA 4R55A 2CZ6B 3CCQA 5KCHA 1WNLA 2FB7A 3HPWA 4XTXA 4B9WA 2HNIA 3RERA 2Y4YA 3JRZA 1QP2A 4KUIA 2P0PA 2YRVA 3DB3A 1WQ7A 2O4XA 3TREA 3GNFB 3OYFA 4LD6A 5FU7B 2XDBA 4N4IA 3JB9H 3L2UA 3L42A 4OB3B 4J6WA 2K3YA 3N5BB 3PMTA 5FU6B 3UDCA 5A0DA 4J5YA 3KBGA 2PUKB 1VQ5T 2X4YA 1QVFA 2FHDA 1DJ7B 1W4SA 1G3TA 2EJ9A 3GF5A 1YHQT 3M4YA 3QYHB 2E64A 2DAQA 3A8MB 3ZBDA 4D6WA 5HK0A 4XTYA 4M78C 4M78D 1G3WA 2VV5A 5GAN5 1YITT 1UGQB 4N0AC 1YI2T 1Q81U 4A4FA 3P8DA 1NPRA 3RIRA 1YHQA 2KSSA 3FEOA 4C92A 3GPLA 5GMKm 1YJNT 1YITA 3H8ZA 4FT2A 4CRIA 1YI2A 4N4GA 2KK4A 4M77G 3QPHA 2DEQA 2GQVA 4FIBA 1YJNA 3QIIA 5GANj 2QQAA 2I2LA 2PVGB 1OI1A 2LRQA 2RHUA 3M55A 4M78A 5D6YA 5GMKi 2QA4T 1ZHIA 3LWIA 3M59A 1YBYA 4E7IA 2JUFA 1K8AC 2CZ0B 2ZPEB 5CAIA 2QA4A 4A4EA 5GAN8 5GAN7 3MP1A 3H6ZA 2EJGA 3JCMf 3QDRB 3MEVA 5J39A 5D6WA 5CIUA 4ZTFA 3S3NA 2E6ZA 1MHNA 2JTFA 2K3XA 4O6JA 3CEYA 1M1KC 3BY7A 4ELYC 1NJIC 1VQKT 2OAUA 1WJQA 3OYJA 2CGHA 3A8GB 4WF2A 5FU6C 4VUBA 1KC8U 1VQ8T 1VQKA 2RK1A 3BW1A 1B34B 3ER0A 3V7CA 2QEXT 3RESA 1I4K1 3PT9A 4E7LA 5GAOm 5GAMd 3MP8A 1VQ8A 3M56A 2MI6A 4GLKA 4J6XA 5GAN2 5IN1A 2QEXA 3F70A 2V8KA 3QBYA 4KT0E 1U8RA 4NS5A 4M75F 3DLMA 4EMKA 2K4YA 4C8QE 2R5AA 4JJNK 4NL3A 1W2BS 2DKGA 1W2BA 3CMAT 3JCMh 2F69A 3JB9F 4C5HA 1G3SA 3E9GA 3JCMQ 1Q82U 1BKBA 3JCMV 4UC4A 3GNGA 4C0DB 4M75B 3VJPA 3CMAA 1YCYA 4RCCA 3X28B 2RI2A 2CZ1B 3QHSA 5HY6A 4M7AG 2BUDA 2ZPIB 4M75E 3CXCS 3CXCA 4X9DA 1KQSA 1Y71A 5GMKj 2C06A 2O4XB 2KDSA 5A0GA 1LJOA 3HRUA 3NTIA 3OMCA 3J80E 5GAOr 1M90C 3PIOA 2QQBA 1N9RA 3L2QA 3OS1A 4BDYA 1I8FA 4LDWA 4C5EA 3FB9A 1VQOT 4C92F 1JJ2S 4OGEA 1VQMT 1BI3A 2DTOA 4QVCA 4GY5A 4DOWA 1G3YA 1ZBXA 4II1A 1RL2A 3CC4T 1VQOA 2EQMA 3M58A 4RKUE 3FJPA 1I81A 3JCMe 5CO7A 4M78F 2NLUA 2CKKA 3CC4A 4C92B 1VUBA 4XTUA 2KQWA 2EYQA 1G5VA 4C8QD 4C8QC 5CQXA 4C92E 3JCMX 3M53A 2DTIA 2VGNA 3MP6A 3JCMP 1Q86U 5LJ3d 4JUVA 4C0FA 4X9CA 4ZN3A 2JZ2A 3OYKA 2RB6A 1FX7A 4M78B 1M4ZA 5GAN6 2XDPA 3CD6T 4A4KA 4OF1A 3C12A 4M78E 2ZPFB 4HCZA 4OB1B 4QQ6A 3SDZA 4XQ3A 3ZFJA 3PTAA 2LT1A 1Q7YU 4C0DC 3HSBA 4X34A 4M75D 4M75C 4C8QA 3QG1A 3GIBA 1BYMA 1UGSB 4P5NA 3CD6A 2FL7A 4M7DG 3V8JA 5GAMj 1QW1A 2L3RA 1BIBA 3NFCA 4XK8E 1V29B 3CPWS 3WVEB 4E47A 2KMTA 3CPWA 3JB9D 4XTVA 4Z02A 3JSCA 4FL6A 4JLGA 2MMPA 4OB0B 2LC4A 2LQKA 4JLIA 4OGCA 4O5VA 3C4SA 4JS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 A;  5J26 A;  2JNG A;  1N8R U;  2IG0 A;  1YJN A;  4ZN1 A;  2KVQ G;  2QA4 T;  1KHI A;  2JVV A;  3PIP A;  3G71 T;  1YBY A;  2JUF A;  1VQP T;  1KC8 C;  1K8A C;  2XHC A;  1N8R C;  2QA4 A;  1YJW T;  3G71 A;  1M1K U;  1VQP A;  1VQ4 T;  1K9M U;  1QVF S;  1UEB A;  1YJW A;  3CCE T;  2E6Z A;  1VQ4 A;  2OTJ T;  1YI2 A;  1K73 U;  1NJI C;  1M1K C;  1QVG A;  1VQ7 T;  1VQK T;  1K9M C;  3CME T;  3CCE A;  1YJ9 T;  2OTJ A;  1VQL T;  1KC8 U;  1K8A U;  1VQ7 A;  5IT9 E;  1VQ8 T;  1VQK A;  3CME A;  3G6E T;  3ER0 A;  2QEX T;  3CCU T;  1K73 C;  1VQ6 T;  1YJ9 A;  2MWP A;  1VQL A;  3J81 E;  1NPP A;  3A5Z B;  1VQ8 A;  3CCU A;  3G6E A;  2MI6 A;  2QEX A;  3CCS T;  1VQ6 A;  1KD1 C;  3P8B B;  1JJ2 A;  5J3B A;  3CCS A;  1NJI U;  3LGF A;  2OTL T;  1W2B S;  1W2B A;  3CMA T;  3DB4 A;  1VQM A;  3CCL T;  4YTL A;  3LH0 A;  1Q82 U;  1BKB A;  2OTL A;  2DO3 A;  3OYY A;  3CMA A;  1QVG S;  3CCL A;  5HY6 A;  3CCM T;  2LCL A;  1EIF A;  5DM7 R;  3CXC S;  3CXC A;  3I56 T;  1KQS A;  5LL6 S;  1Q82 C;  1KD1 U;  3CCM A;  1XTD A;  1M1G A;  3JAM E;  2KDS A;  3I56 A;  3J80 E;  1M90 C;  1Q86 C;  3PIO A;  1YIJ T;  3G4S T;  1VQO T;  1JJ2 S;  5A2Q E;  3OW2 S;  1VQM T;  3OW2 A;  4TVR A;  3I55 T;  1YIJ A;  3DLL A;  3G4S A;  3CC4 T;  1Q7Y C;  1RL2 A;  4RG2 A;  1VQO A;  2LQ8 A;  3CPF A;  5FLX E;  1VQN T;  3I55 A;  3CCQ T;  1NZ9 A;  2CKK A;  3CC4 A;  1XNI A;  5DLQ E;  1SSF A;  2JOY A;  3LGL A;  5IAY A;  2G3R A;  1VQN A;  3CCQ A;  1Q81 C;  1Q86 U;  1M90 U;  1KQS S;  4ZN3 A;  3CCV T;  3DB3 A;  3TRE A;  3CD6 T;  3CCJ T;  1X6O A;  3CC2 T;  1S72 T;  1Q7Y U;  2E70 A;  3CCV A;  2LVM A;  4X34 A;  3HKS A;  3KBG A;  3CC7 T;  3CD6 A;  3CCJ A;  1VQ5 T;  3CC2 A;  1S72 A;  1QVF A;  3J7A F;  2L3R A;  1YHQ T;  3CPW S;  3CPW A;  3CCR T;  3CC7 A;  1VQ5 A;  1YIT T;  1Q81 U;  1YI2 T;  1NPR A;  2MWO A;  1VQ9 T;  1YHQ A;  2EIF A;  3CCR A;  4QQD A;  1YJN T;  1YIT A;  1IZ6 A;  4CRI A; 
#chains in the Genus database with same CATH topology
 2JNG A;  3M0U A;  2GF7 A;  3CCQ Q;  1D3B A;  1K9M R;  2KT1 A;  2ENM A;  2KRS A;  4XU0 A;  1N8R C;  1JBM A;  2J6K A;  3EG1 A;  4AMC A;  4OMN A;  4JRQ A;  1RAH B;  3MJX A;  4JRI A;  4OMO A;  2L8D A;  2QDY B;  3BDU A;  1C0M A;  1Z9Q A;  1BI2 A;  2JMA A;  2X3X D;  3OYH A;  2E12 A;  2JW4 A;  3A5Z B;  1I0C A;  1WXB A;  2K2M A;  2MYS A;  4JZ4 A;  1YJN Q;  2EJF A;  2XI9 A;  4LE9 A;  4IUR A;  3VUB A;  4BI3 A;  2AKK A;  3MPU B;  4FSX A;  4LDV A;  2D1X A;  1R0C B;  4EMK C;  2HQE A;  2Z0W A;  2RA2 A;  3JCM J;  4C0G A;  3S3O A;  1AVZ C;  5LJ5 e;  2EWN A;  4J9E A;  3M5A A;  2WSC E;  4C8Q B;  4ME7 A;  3INZ A;  2QEX Q;  1OYX A;  2E6N A;  2QGG A;  3CPF A;  1VYU A;  1NZ9 A;  4AFS C;  2KT8 A;  1FXX A;  2YRC A;  1UJY A;  1ZSZ B;  3TSW A;  3LGL A;  4RTU A;  2JT4 A;  4BY6 C;  2DL3 A;  2GFU A;  1D3B B;  2CSQ A;  5IXF A;  3SWN A;  3TQ7 P;  2M9U A;  2EYX A;  3PVQ A;  2X51 A;  1QKX A;  3HKS A;  5KE3 A;  3GBQ A;  3CC7 T;  3BE3 A;  1XQH A;  2V26 A;  1S72 A;  3D7S B;  3J7A F;  4M77 C;  3HHT B;  1PG5 B;  2M16 A;  2ZZD A;  1JXO A;  1WJR A;  3QKJ A;  2CRE A;  3CCR A;  2YLC A;  3QWX X;  1NG2 A;  1IZ6 A;  4JPB W;  1LNX A;  2LCC A;  4M78 G;  1BCM A;  1KQ1 A;  1N8R U;  4M77 A;  2LP5 A;  2FG0 A;  3A8H B;  2KVQ G;  4RTY A;  5LJ5 g;  1KC8 C;  1VQP T;  2A0F B;  1AHJ B;  4XU1 A;  3EFO A;  5GAM h;  4HVV A;  4CC3 A;  3OYN A;  2QDL A;  2RK2 A;  1VQ4 A;  2QGF B;  3PFS A;  1QVG A;  1QWE A;  2FZC B;  3CCE A;  1H8K A;  2E1H A;  1YJ9 T;  4DQ2 A;  2MF2 A;  3E19 A;  3FDR A;  3FRN A;  1VQ6 T;  1C6V X;  5KYY A;  2YUQ A;  2CDT A;  1T3S A;  3OYE A;  3JB9 I;  1KFZ A;  1KK7 A;  3OSV A;  2F5K A;  3OYL A;  3O8V A;  1TXQ A;  4KBM B;  2DRM A;  2A7Y A;  4J9D A;  3CCL A;  2P0Q A;  1VQ5 Q;  2X9H A;  2KYM A;  2HD0 A;  2B8A A;  4A4G A;  5HCK A;  2EQJ A;  2RHY A;  3I5S A;  3SWN B;  1IGQ A;  2K6D A;  1YI2 Q;  5LJ3 h;  1ZUK A;  4J9G A;  5C0M A;  3P8H A;  4MZP A;  3JCM d;  1GCQ C;  3MET A;  4F7U A;  1ACM B;  5KH6 A;  2JM9 A;  2DVE A;  1Q7Y C;  4RG2 A;  4Y91 A;  1B07 A;  2FEI A;  4WCI A;  3UA7 A;  4BE1 A;  4E2F B;  1M5Q 1;  2QQ9 A;  2Y90 A;  4E7Z A;  1BI1 A;  3RUX A;  1IB8 A;  1Q7Y R;  2DBK A;  2O31 A;  4HXJ A;  2EYZ A;  4M77 B;  2YUN A;  2HSE B;  2KE9 A;  2QG9 B;  1EFN A;  1HXD A;  3EFO B;  3VYH B;  3UA6 A;  1RAD B;  3RKY A;  3ZL7 C;  1X27 A;  2JTE A;  1MMG A;  1WHJ A;  1K8A R;  2A08 A;  5FU7 C;  4KRT A;  1QWF A;  1XTD A;  6AT1 B;  1M1K R;  1RAB B;  1NJI R;  4AG1 C;  2C0O A;  5KYY B;  2V1Q A;  1RAA B;  5IH2 A;  1J3T A;  2VC8 A;  4MDX A;  2X4W A;  1ZA1 B;  4EMG A;  5GAO l;  2HEQ A;  2VWF A;  1PSF A;  5GAN 3;  4XTW A;  4BUG A;  1Y57 A;  2CUD A;  2K2V A;  1F1B B;  3L2V A;  1YN8 A;  4J9H A;  3A8O B;  3H0F A;  4LXC A;  5I11 A;  2GTO A;  1AT1 B;  3A98 A;  4JDS A;  1Z9Z A;  4JJD A;  5CVI A;  2CH4 W;  1VQ7 A;  4ATO A;  1QMC A;  2C0I A;  3FIF A;  1VQL A;  3LLR A;  4RTZ A;  4MML A;  1KD1 C;  4F7U B;  1X2Q A;  1C1A A;  3CCS A;  3MEW A;  4F7U E;  2CP5 A;  2OTL T;  2PUO B;  2J05 A;  1GFC A;  2E5Q A;  1KD1 R;  3EFR A;  1QP3 A;  1QVG S;  1T0J A;  2D8H A;  3I56 T;  1GXI E;  3T9N A;  3REB B;  1B34 A;  2J6F A;  3NMZ C;  4A53 A;  3M57 A;  3JAM E;  4R56 A;  1I5L A;  2LDM A;  1IRE B;  1D0Z A;  2DK3 A;  2MIO A;  4J83 A;  2BIV A;  4M7A C;  1PC0 A;  3G71 Q;  3QJ6 A;  1X69 A;  2DPP B;  4R55 A;  4LUE A;  1N5Z A;  1WNL A;  1YFN A;  2HNI A;  2Y4Y A;  3JRZ A;  1QP2 A;  4KUI A;  2VB6 A;  2P0P A;  2YRV A;  3H41 A;  1WQ7 A;  5FU7 B;  3R6N A;  4J6W A;  3KBG A;  2PUK B;  1VQ5 T;  2X4Y A;  4KH0 B;  1XJW B;  1B7T A;  2HBW A;  1G3T A;  1SF9 A;  3ZBD A;  2DAQ A;  1PRM C;  4M78 C;  2VV5 A;  5KYW A;  4N0A C;  1YI2 T;  1Q81 U;  1YIJ Q;  3RIR A;  1TG0 A;  2GQI A;  2KSS A;  3H9N A;  3I35 A;  4C92 A;  1YIT A;  1UEC A;  2DEQ A;  2KRN A;  3QII A;  5GAN j;  2I2L A;  4M78 A;  2QAS A;  5D6Y A;  5GMK i;  3EGU A;  1YBY A;  2JUF A;  3M0T A;  5CAI A;  2QA4 A;  2LCS A;  5J39 A;  2DRK A;  2E6Z A;  2JTF A;  1QKW A;  1D0Y A;  3OYJ A;  2KNB B;  1PWT A;  1B34 B;  1E6H A;  3NHN A;  4DEX A;  1D1A A;  4E7L A;  4ANJ A;  1VQ8 A;  3M56 A;  2E3H A;  4GLK A;  4OMP A;  1W70 A;  2A37 A;  4LNP A;  4JJN K;  3CMA T;  3CCV Q;  3JB9 F;  2ZAE A;  1BKB A;  3JCM V;  4UC4 A;  3GNG A;  4C0D B;  3A1P A;  4FYX B;  1VYV A;  2CZ1 B;  2ZPI B;  2A28 A;  3CXC S;  2KGT A;  2RPN A;  5GMK j;  2C06 A;  2OX7 A;  2L3S A;  4F17 A;  2QQB A;  4LDW A;  1T3L A;  3U23 A;  3G6E Q;  2DTO A;  4Z89 A;  3TSZ A;  1MV0 B;  1SRM A;  5KYW B;  4RKU E;  3FJP A;  2DL8 A;  3JCM e;  4C92 B;  1ZBJ A;  4XTU A;  2EVR A;  2EYQ A;  5CQX A;  1HD3 A;  4C92 E;  3JCM P;  4JUV A;  4ZN3 A;  1FX7 A;  4M78 B;  2FO0 A;  4M78 E;  3CCM Q;  2LT1 A;  3HSB A;  4X34 A;  3CD6 A;  2G6F X;  3CCU Q;  2L3R A;  1V29 B;  3CPW S;  4E47 A;  4Z02 A;  1GFD A;  2LQK A;  5LJ5 f;  4DA4 A;  2PVO B;  4WTO B;  4IUU A;  3ME9 A;  1JO8 A;  2FPF A;  3VKI A;  3G71 T;  1QVG P;  4C92 D;  3VS5 A;  1AOJ A;  1M1F A;  2BZX A;  2ROL A;  2ZCF B;  1M30 A;  3JCM g;  4PFP A;  2OTJ T;  1BIA A;  2C0T A;  2O9V A;  2OAW A;  2X4X A;  4J9I A;  1YHQ Q;  5IT9 E;  5GAN h;  1NEB A;  1K73 C;  1I1J A;  1PKS A;  2CT4 A;  2DYI A;  1ZLM A;  2HBP A;  4A54 A;  3OY9 A;  2DIQ A;  1WQW A;  4BE0 A;  1Q86 R;  2DA9 A;  2JS0 A;  2JN0 A;  3CCJ Q;  4J7F A;  1GCP A;  1ZX6 A;  3VRY A;  5KCO A;  2LCL A;  3M4G A;  5LL6 S;  3QZ9 B;  2L3P A;  4XAX B;  1WPY A;  2LNH B;  4PJO D;  2EKH A;  1TH7 A;  3QSU A;  1M3A A;  4RTV A;  1WHM A;  2P4T A;  1WXT A;  3OYA A;  2D0N A;  2KXC A;  3QDF A;  4BAC A;  2FPE A;  1PD1 A;  3E2U A;  4PFO A;  3C0C A;  2RQW A;  5GMK h;  3VS4 A;  3MHX A;  1K4U S;  5IHN A;  1UHC A;  3CCV T;  1M2V A;  3V7S A;  3X24 B;  5A0L A;  2E70 A;  4F7U G;  3L1A A;  4FYY B;  2L0A A;  2QXF A;  1FMV A;  1OPL A;  3CC7 A;  1WHH A;  7AT1 B;  1VQO Q;  2GCX A;  2MAM A;  1VQM Q;  2E5K A;  1WX6 A;  1QCF A;  2D8J A;  4N4H A;  1A0N B;  2CZ7 B;  3OBW A;  4E7K A;  2XHC A;  3OYI A;  4GBQ A;  4L59 A;  1YJW T;  1ZSZ C;  1FYN A;  3GOX A;  3CXC P;  1VQP A;  1VOM A;  4IUT A;  2L89 A;  2EGC A;  2RHI A;  1TS9 A;  2KRM A;  4BI4 A;  2BZY A;  5GAN d;  1K73 U;  4LDU A;  1UGV A;  1K9M C;  3VYG A;  4CC2 A;  4MZM A;  2GGR A;  1RAC B;  3CCU T;  2DZ9 A;  4KUD K;  1YJ9 A;  1ARK A;  4OMQ A;  4KGZ B;  1VQ6 A;  2LJ3 A;  2K5L A;  4PJO F;  3G1J A;  2DZC A;  2DIL A;  2ZGW A;  1TWB A;  2DIG A;  4BD3 A;  4FT4 A;  4YTL A;  5HK3 A;  2SRC A;  2DO3 A;  1OUL A;  1N27 A;  2RJC A;  3L2Z A;  4PJN A;  2BZ8 A;  4KUL A;  3LWH A;  1M2V B;  3CPW P;  1MGQ A;  3CQT A;  1X2K A;  2M0Y A;  5LJ3 j;  4JS5 A;  5A2Q E;  4ZGE B;  4HCB A;  1SKU B;  1QCO A;  5ECA A;  4EMH A;  5IAY A;  1WGS A;  2KI7 A;  2D0Q B;  5I22 A;  3MCA B;  3OYM A;  2M0O A;  3S6W A;  1E7O A;  3ZEH A;  4PJM A;  2RI5 A;  3CCJ T;  2FZK B;  1VQK Q;  4BDZ A;  2K5F A;  2R57 A;  5I2M A;  2ECZ A;  5CR2 A;  5CKB A;  1NYF A;  3M0S A;  3PMI A;  4JRP A;  2KYB A;  3SWN C;  3OMG A;  2DFU A;  3REA B;  4IUP A;  2RQV A;  2RHX A;  3PNW C;  4HVW A;  4PFZ A;  1W1F A;  3EH2 A;  1NEG A;  1OZ2 A;  2WSF E;  3VU3 C;  5KYX A;  1U1S A;  2RJD A;  1E6G A;  4Z8A A;  2JVV A;  2P0K A;  2YXY A;  1X01 A;  1SRL A;  2EFI A;  3EHR A;  1FMW A;  2RD1 A;  2COZ A;  1WIE A;  1K9M U;  5CCA A;  4JRK A;  4K11 A;  3JCM b;  2QQR A;  3V8L A;  4C92 G;  1LOJ A;  1HSQ A;  2AHJ B;  2GNC A;  4LDX A;  2A3L A;  2IIM A;  3CC4 Q;  4MMK A;  2MWP A;  3OA6 A;  5IHK A;  2YWW A;  2WAC A;  3VRZ A;  1U1T A;  4ZGD B;  1JJ2 A;  2E10 A;  4NOY A;  2DX1 A;  2P4R A;  4HT8 A;  3V7R A;  3DB4 A;  2RO0 A;  3CBO A;  3LH0 A;  4XU2 A;  2OTL A;  3SEM A;  3JB9 J;  4OP0 A;  2NYS A;  3G7Z A;  3AHU A;  1VQ4 Q;  2IVW A;  3CCE Q;  3SD4 A;  2DD5 A;  1O9S A;  3I56 A;  4Y28 E;  2GTJ A;  3SB2 A;  3OW2 S;  1VA7 A;  2QI2 A;  2DXB A;  2OI3 A;  2XK0 A;  4PJO G;  4ZGJ B;  5GAN 4;  3CCQ T;  5FWC A;  3M0Q A;  3C95 A;  1AZE A;  5FRN A;  1SSF A;  1WHK A;  5KCH A;  4D8K A;  3VS2 A;  2KR3 A;  5KYX B;  3CCL Q;  2KXD A;  3DB3 A;  2O9S A;  2XDB A;  2L3Q A;  3CME Q;  3L42 A;  4OB3 B;  3N5B B;  5FU6 B;  2FHD A;  3M4Y A;  4D6W A;  2E64 A;  3A8M B;  5HK0 A;  5GAN 5;  2ED1 A;  4FSS A;  1VQ5 A;  3GPL A;  1YJN T;  2DER A;  3H8Z A;  2DET A;  4FT2 A;  1YI2 A;  4N4G A;  2KK4 A;  3QPH A;  2GQV A;  2DNU A;  4FIB A;  2HDA A;  2QQA A;  2PVG B;  2J7I A;  1OI1 A;  1H3H A;  4E7I A;  1GBQ A;  8AT1 B;  1K8A C;  5GAN 7;  2EJG A;  3JCM f;  4ZTF A;  2DJQ A;  3CEY A;  1M1K C;  4ELY C;  1NJI C;  3M0R A;  1VQK T;  2EYW A;  3A8G B;  2PTK A;  3I55 Q;  1KC8 U;  2QEX T;  1TSF A;  3VS1 A;  3RES A;  1I4K 1;  1VQN Q;  5GAM d;  5GAN 2;  2MI6 A;  5IN1 A;  1WZO A;  4PJL A;  2XMF A;  4KT0 E;  2K9G A;  4M75 F;  2R5A A;  8ATC B;  1PRL C;  3CC2 Q;  3CMA A;  1YCY A;  4RCC A;  3QHS A;  1WXU A;  2RI2 A;  5HY6 A;  2BUD A;  3CXC A;  3H0H A;  1KQS A;  1SPK A;  1Y71 A;  3HRU A;  3OMC A;  1VQ9 Q;  1NLP C;  1LVK A;  1M90 C;  1K1Z A;  1Q81 R;  1N9R A;  1RI9 A;  3OS1 A;  4C5E A;  3FB9 A;  4B6M A;  1JJ2 S;  4OGE A;  4QVC A;  1TU0 B;  1G3Y A;  1YCS B;  1ZBX A;  1LCK A;  1RL2 A;  3CC4 T;  1M90 R;  3CCS Q;  2NLU A;  2CKK A;  4JJB A;  1G5V A;  3M53 A;  2DTI A;  2VGN A;  3MP6 A;  5LJ3 d;  2JZ2 A;  2RB6 A;  1M4Z A;  4LUD A;  3C12 A;  1G83 A;  3NPF A;  4HCZ A;  5KYU A;  2EPD A;  1Q7Y U;  2DEU A;  4C0D C;  4FW2 A;  1OOT A;  2KEA A;  1BIB A;  4XK8 E;  2RQT A;  3WVE B;  2HSP A;  3CPW A;  3JB9 D;  2MOX A;  2K79 A;  4FL6 A;  3TVT A;  4OB0 B;  4J9B A;  4OGC A;  3C4S A;  4JS4 A;  5I21 A;  5J26 A;  1UFF A;  2YHT A;  4IKF A;  1K0X A;  2V8J A;  5FRM A;  1V1C A;  1VIE A;  4MDW A;  3WVD B;  2RMO A;  4PK4 A;  4C92 C;  3G71 A;  1M1K U;  3VV0 A;  4QQG A;  3KUF A;  1UEB A;  2RN8 A;  2PZ1 A;  2EAY A;  2X35 A;  4IIM A;  2BKD N;  1I5O B;  3MO8 A;  3QZ5 B;  2Y4X A;  3G4S Q;  3CME T;  1M8V A;  2EQK A;  2OTJ A;  3UT1 A;  1TOV A;  3OW2 P;  2AZS A;  3EGD A;  2X4J A;  3RMQ A;  5LJ5 h;  3OYC A;  2LQW A;  2W0Z A;  1UGR B;  2RQR A;  2DF6 A;  1QQJ A;  3QXE B;  3QJY A;  5J3B A;  3URG A;  2XG8 D;  3VS6 A;  2QA4 Q;  4ZTJ A;  4ELZ C;  3OYY A;  2XU8 A;  5EC7 A;  2RH2 A;  1KD1 U;  1N9S A;  5GMK l;  1IHW A;  2AIR B;  4DBQ A;  5KYU B;  2NUT A;  2LTO A;  1VQ8 Q;  3I55 T;  2VXF A;  3DLL A;  2COY A;  3A8L B;  2YLB A;  3OQ5 A;  1T0H A;  1VQN T;  1K76 A;  2H8H A;  3TCJ A;  1XNI A;  5DLQ E;  4PJO A;  1LPL A;  2LX7 A;  4RMO A;  2G3R A;  3QWY A;  1KQS S;  1KQ2 A;  2NUP A;  4CC7 A;  5KE2 A;  3CC2 T;  3RBB B;  4DBH A;  3CCV A;  4BI8 B;  1WI7 A;  4EIK A;  2HMA A;  1Y96 A;  1JXM A;  5L23 A;  1RAF B;  2DM1 A;  1M8M A;  4L5G A;  1WJS A;  2HCK A;  1VQ9 T;  2OJ2 A;  2HL5 C;  1HYO A;  3EGD B;  1D0X A;  2DL4 A;  5C6S A;  2IG0 A;  4ZN1 A;  1BK2 A;  2DE0 X;  4E7J A;  4C5G A;  1ABQ A;  3OS5 A;  4IIO A;  2M1H A;  1SG5 A;  5IHI A;  4FU6 A;  1YJW A;  1VIF A;  3MKD A;  4OMM A;  1M9S A;  4A4H A;  1XOV A;  2J06 A;  5AYF A;  1JJ2 P;  3L2W A;  5KYN A;  4HVU A;  4MZT A;  1NPP A;  1UB4 A;  3CCU A;  2NUT B;  2HQX A;  1Q82 R;  2VVK A;  1MND A;  3LGF A;  5GAM e;  4M7A D;  4F04 B;  3Q1J A;  3EG9 A;  4PJO B;  1GBR A;  2FPD A;  2CUB A;  4PJO E;  4KH1 B;  4E7H A;  2EQU A;  1ZQ1 A;  2CT3 A;  2NUP B;  5DY9 A;  2DJZ A;  1M1G A;  2F2V A;  1AWW A;  1R8O B;  4Q5W A;  3JCM c;  1Q86 C;  2CYZ B;  1YIJ T;  3G4S T;  1U8R A;  2RF0 A;  1Y96 B;  4NL2 A;  4XTZ A;  4TVR A;  3DKM A;  2V1R A;  1UHF A;  2LNV A;  2LQ8 A;  4Y92 A;  2PNI A;  4Z88 A;  4FW1 A;  2QTX A;  2CSI A;  3OBY A;  1CKA A;  2MPX C;  4C5I A;  1ZSG A;  3OB9 A;  4ORZ A;  3UF4 A;  4M7D D;  1YWP A;  3HRT A;  2PU9 B;  2L5Q A;  2L2P A;  5GAO n;  2LVM A;  5LJ3 e;  2CP3 A;  3V8K A;  1RUW A;  3CCJ A;  4EPC A;  3OS2 A;  5GAM g;  4CI0 C;  4RTX A;  4PLI A;  1YP5 A;  5CQY A;  2HQH A;  2JOY A;  3JB9 G;  3RNJ A;  1OZ3 A;  2ZPG B;  3VS7 A;  3E1S A;  3PIP A;  1WYX A;  3S3M A;  4BB7 A;  1EX4 A;  3HL8 A;  4RG8 A;  3EG9 B;  4M7A F;  2COW A;  1KIK A;  4KGX B;  4F16 A;  3CC7 Q;  5CKD A;  3SFM A;  1M2O A;  1D09 B;  2KAF A;  3G6E T;  1B3Q A;  4PLL A;  3MEU A;  2GBQ A;  1MMN A;  4PL6 A;  5LJ3 g;  3P8B B;  4QT7 A;  1X6B A;  1KQS P;  2XDD A;  1VQM A;  3KFV A;  4IUV A;  1VQP Q;  2RNA A;  1TTH B;  2CH4 A;  2FYK A;  3UAT A;  3CCM T;  2F1L A;  1PSE A;  2QAZ A;  1UJ0 A;  3VS0 A;  3QYG B;  5GJW B;  3L2R A;  3I5R A;  4KGV B;  3MEA A;  2K3B A;  5L8R E;  3OSS C;  4M7D F;  4DBR A;  1AEY A;  1YJ9 Q;  2CS7 A;  5CK9 A;  1MV3 A;  5D7U A;  3OW2 A;  3QO3 A;  1JEG A;  1M3B A;  3KXT A;  1SEM A;  5FLX E;  1FWZ A;  4IUQ A;  3OYD A;  1NLO C;  1O75 A;  5GAN f;  4FM4 B;  4M75 A;  1JU5 C;  2CZ6 B;  2HKQ B;  3CCQ A;  1CKB A;  4XTX A;  3RER A;  2ROT A;  2KBT A;  2BTT A;  1W6X A;  3OYF A;  1AZG B;  2MCN A;  1I07 A;  1G8X A;  3JB9 H;  1RAE B;  2K3Y A;  1K9A A;  1QVF A;  1W4S A;  2EJ9 A;  3GF5 A;  1YHQ T;  4J9C A;  3QYH B;  1PNJ A;  2P84 A;  1ABO A;  2MK5 A;  4XTY A;  1N8R R;  3P8D A;  2E3I A;  3FEO A;  2RQU A;  5GMK m;  4CRI A;  3M0P A;  1YJN A;  2VAS A;  3M55 A;  2LRQ A;  2RHU A;  1WHG A;  3M59 A;  4RTW A;  1PHT A;  2ZPE B;  5GAN 8;  3MP1 A;  2DLP A;  1MMD A;  3H6Z A;  3MEV A;  5D6W A;  3S3N A;  2K3X A;  3BY7 A;  2OAU A;  4J9F A;  1WJQ A;  2CGH A;  4WF2 A;  5FU6 C;  4VUB A;  1VQK A;  3BW1 A;  3AT1 B;  3ER0 A;  3V7C A;  1UE9 A;  3PT9 A;  3MP8 A;  2DL5 A;  1QCN A;  1Y0M A;  2QEX A;  1WA7 A;  3QBY A;  4NS5 A;  1UG1 A;  3THK A;  4EMK A;  2K4Y A;  4C8Q E;  1NM7 A;  4LN2 A;  1W2B S;  2DKG A;  3EG2 A;  3JCM h;  1OX8 A;  1TUD A;  2F69 A;  2SEM A;  4C5H A;  1G3S A;  3E9G A;  3JCM Q;  1S72 Q;  1RLQ C;  4M75 B;  1JQQ A;  2CP0 A;  4M7A G;  4M75 E;  4X9D A;  3CCR Q;  4AG2 C;  1OX9 A;  3NTI A;  3PIO A;  1I8F A;  1VQO T;  1X43 A;  1VQM T;  1IGU A;  2EQM A;  3EH1 A;  3M58 A;  4E6R A;  2K7A A;  5CO7 A;  3CC4 A;  3SHW A;  4C8Q D;  3VS3 A;  2OTL Q;  4C0F A;  4X9C A;  2HZY A;  1BBZ A;  4A4K A;  1R77 A;  4OB1 B;  3ZFJ A;  3SDZ A;  4XQ3 A;  1YWO A;  4M75 D;  1BYM A;  3I56 Q;  1UGS B;  2FL7 A;  1KJW A;  4M7D G;  3V8J A;  1QW1 A;  3NFC A;  5FWB A;  2KMT A;  1KC8 R;  2CP2 A;  4JLG A;  1G2B A;  2MMP A;  3HTR A;  5I2S A;  4OMF B;  4RTT A;  3LW5 E;  2PVD B;  4EMK B;  2E65 A;  2ZPB B;  1QVF S;  1BU1 A;  2E41 A;  2QQS A;  4HCK A;  1PM3 A;  3CBM A;  2EGA A;  2GFA A;  2J6O A;  3GLX A;  3EAE A;  4LDY A;  3CME A;  1WFW A;  2QK0 A;  2HL3 A;  2DXT A;  2QTV A;  2EKO A;  5LJ5 j;  4AFU C;  2ABL A;  1AWJ A;  2E4H A;  4BY6 B;  1N6A A;  2VGM A;  3R6O A;  3OYB A;  2YT6 A;  2K5I A;  1UGP B;  4LD9 K;  2RI3 A;  1GCQ A;  4B9X A;  4C8Q F;  2JJ9 A;  3EGX A;  2VXE A;  2O01 E;  5GAN e;  4M77 E;  2KRO A;  4CC4 B;  2RJF A;  4XU3 A;  3WXM B;  3CBP A;  2JMC A;  2O88 A;  1KG1 A;  3TU4 K;  3X20 B;  1OU8 A;  3PVL A;  3BDL A;  3HFN A;  3I55 A;  1OEB A;  4OB2 B;  2LZ6 B;  2WSE E;  1VQN A;  1Q81 C;  2LX9 A;  3CMA Q;  2PQW A;  4AFQ C;  2V8I A;  1RLP C;  2DMO A;  1RAG B;  3C94 A;  1X6O A;  5GAM f;  1S72 T;  1VQ7 Q;  4J7I A;  5M9O A;  3FC3 A;  5GAO q;  1VQL Q;  3CC2 A;  4M77 D;  4RUG A;  3CCR T;  2AK5 A;  2EIF A;  2VKN A;  4QQD A;  1VQ9 A;  1Y7X A;  3RR6 A;  1W2B P;  5GMK e;  5GAN g;  1JRI A;  4R0K A;  3GP8 A;  4ESR A;  1OQK A;  2EQI A;  3TEE A;  1SHG A;  1MUZ A;  4OVA A;  1BB9 A;  1D1C A;  4GLM A;  2DYB A;  4HCC A;  4DEY A;  1VQ4 T;  2HAX A;  3X25 B;  5AT1 B;  3CCE T;  2XD0 A;  1NE8 A;  3EHQ A;  1CSK A;  4L6V 5;  1BCO A;  2DXC A;  1UDL A;  3EGX B;  1K8A U;  1JB0 E;  4BE2 A;  3RMS A;  4C0Z A;  5LJ3 f;  4PNO A;  2ATC B;  1V76 A;  3X26 B;  4FYV B;  4DBF A;  2AZV A;  3E9F A;  1NJI U;  2VUB A;  2JTM A;  1GRI A;  5CKE A;  3CCL T;  2EBP A;  3LH5 A;  2YSQ A;  1WDX A;  1RI0 A;  1H92 A;  4HKE A;  2DTH A;  2VYT A;  4FYW B;  1H64 1;  4DOV A;  4M7A A;  1HK9 A;  2LJ1 A;  1YIT Q;  3ULR B;  2OTJ Q;  1OV3 A;  3VUZ A;  3LYI A;  2RHZ A;  4PKC C;  4RCB A;  2I0N A;  3JV3 A;  3PGG A;  3HP9 A;  3QUI A;  2NWM A;  1D1B A;  2YUO A;  3EG0 A;  2JM8 A;  2ESW A;  3G4S A;  2RJE A;  1YIJ A;  3NGP A;  4QVD A;  4M77 F;  5GAO p;  1UTI A;  1S1N A;  1R0B G;  5CKF A;  3UWN A;  3HRS A;  2M51 A;  1AD5 A;  1Q95 G;  1UUE A;  1M90 U;  2XKO C;  3PE0 A;  4EDU A;  5FRO A;  1X6G A;  2FRW A;  1QVF P;  1QVP A;  1TUG B;  4E7S A;  4M7D C;  2QYZ A;  4N0A A;  1U3O A;  4C8Q G;  1IO6 A;  3HFO A;  3BFM A;  4PJO C;  2DD4 A;  4OML A;  3LX7 A;  2YRD A;  4M7D A;  1GL5 A;  1VYT A;  3JCM W;  2F5T X;  1H3Z A;  4HT9 A;  2H3J A;  3FLG A;  4M75 G;  2MWO A;  4F14 A;  2RM4 A;  1M27 C;  5DLO A;  2AT1 B;  3O5Z A;  1BI0 A;  2XID A;  4QVZ A;  2D6F A;  3FJ5 A;  3I9Q A;  2FVU A;  4QW2 A;  1KHI A;  1OPK A;  4D8D A;  5GJV B;  1SSH A;  1EZZ B;  2K57 A;  2KY9 A;  1P92 A;  3EFS A;  1PD0 A;  1HJD A;  1NYG A;  3RKX A;  1VQ7 T;  1KSW A;  3OYG A;  3OS0 A;  1VQL T;  4M7A B;  4F7U F;  2ZPH B;  4FCY A;  4J6Y A;  4M7A E;  2XIC A;  3J81 E;  4J8O A;  3G6E A;  2R58 A;  1KHC A;  3RDV A;  3CCS T;  4ZNX A;  5EG2 A;  3RKW A;  1X75 C;  1IXD A;  5IXB A;  3M54 A;  2A36 A;  1ZA2 B;  2DXU A;  3CD6 Q;  2EGE A;  1YJW Q;  4V2S A;  1Y07 A;  1PKT A;  5LJ5 d;  1EIF A;  5DM7 R;  3M9Q A;  1WHL A;  2R5M A;  1Q82 C;  5D6X A;  9ATC B;  3UPU A;  1NBE B;  3CCM A;  2F2X A;  3NTK A;  2D9T A;  4HA8 A;  2W10 A;  5CKH A;  2LT4 A;  3ASK A;  3NTH A;  4M7D B;  4M7D E;  5HKC A;  1TUC A;  1U5S A;  2FB7 A;  3HPW A;  1K0S A;  4B9W A;  1U06 A;  2CP6 A;  2O4X A;  3TRE A;  3GNF B;  4LD6 A;  4N4I A;  1PCX A;  3UDC A;  3L2U A;  5A0D A;  3PMT A;  4J5Y A;  1DJ7 B;  4JJC A;  2LQN A;  4M78 D;  1G3W A;  1YIT T;  1UGQ B;  2FZG B;  4A4F A;  1NPR A;  1YHQ A;  2DBM A;  3EG3 A;  4M77 G;  4PJJ A;  2QA4 T;  1ZHI A;  3LWI A;  1QLY A;  2X3W D;  2CZ0 B;  2DVJ A;  4A4E A;  1K73 R;  2BE7 D;  3QDR B;  3H0I A;  2IPO B;  5FW9 A;  4M4Z A;  5CIU A;  1MHN A;  4O6J A;  2LMJ A;  1ZUU A;  1SHF A;  4A63 B;  1VQ8 T;  2RK1 A;  2ED0 A;  5GAO m;  1IHV A;  2O2O A;  2AKL A;  4J6X A;  3IQL A;  2EW3 A;  3F70 A;  2V8K A;  1YNZ A;  1RAI B;  3DLM A;  4NL3 A;  1W2B A;  1Q82 U;  3VJP A;  3X28 B;  1OU9 A;  2EYY A;  2JXB A;  4JZ3 A;  2O4X B;  2KDS A;  4AT1 B;  5A0G A;  1LJO A;  3J80 E;  5GAO r;  1IRX A;  2FRY A;  1MMA A;  3L2Q A;  4BDY A;  2YUP A;  2M02 A;  4C92 F;  1BI3 A;  4GY5 A;  4DOW A;  1MNE A;  1ZUY A;  2NUZ A;  4II1 A;  1VQO A;  1AWX A;  1I81 A;  2BE9 B;  4M78 F;  1FMK A;  1VUB A;  2B86 A;  2KQW A;  2JS2 A;  2H3E B;  4C8Q C;  2F2W A;  3JCM X;  2YDL A;  1Q86 U;  1M3C A;  3OYK A;  4X1V A;  1AWO A;  4QKU A;  5GAN 6;  2XDP A;  3CD6 T;  4OF1 A;  4QQ6 A;  2ZPF B;  2HKN A;  3PTA A;  4M75 C;  4AFZ C;  4C8Q A;  3QG1 A;  3GIB A;  1WLP B;  4P5N A;  5GAM j;  2DL7 A;  1VQ6 Q;  4XTV A;  3JSC A;  2CP7 A;  2LC4 A;  2LJ0 A;  4JLI A;  4O5V A;  1ZSZ A; 
#chains in the Genus database with same CATH homology
 5I21 A;  5LJ5 f;  4OMF B;  4DA4 A;  2PVO B;  2JNG A;  5J26 A;  4IUU A;  3ME9 A;  2YHT A;  4IKF A;  2GF7 A;  1D3B A;  2V8J A;  5FRM A;  3VKI A;  3LW5 E;  3G71 T;  1VIE A;  4MDW A;  3WVD B;  4XU0 A;  2PVD B;  4EMK B;  2E65 A;  4C92 C;  4C92 D;  1N8R C;  3G71 A;  2ZPB B;  1M1K U;  1M1F A;  3VV0 A;  1JBM A;  4QQG A;  1QVF S;  3KUF A;  1UEB A;  2E41 A;  2ZCF B;  2QQS A;  2EAY A;  4JRQ A;  3JCM g;  2X35 A;  2OTJ T;  2BKD N;  1BIA A;  3CBM A;  4JRI A;  3MO8 A;  3QZ5 B;  2Y4X A;  3CME T;  2GFA A;  2X4X A;  1M8V A;  3GLX A;  2EQK A;  2OTJ A;  2L8D A;  2QDY B;  3EAE A;  3UT1 A;  5IT9 E;  5GAN h;  3BDU A;  2X4J A;  4LDY A;  3RMQ A;  3CME A;  1K73 C;  1BI2 A;  5LJ5 h;  3OYC A;  3OYH A;  2DXT A;  2E12 A;  3A5Z B;  1UGR B;  2EKO A;  5I2S A;  5LJ5 j;  2EJF A;  2XI9 A;  4BY6 B;  3QXE B;  3QJY A;  4IUR A;  3VUB A;  4BI3 A;  1N6A A;  5J3B A;  2HBP A;  4A54 A;  3URG A;  2VGM A;  3OY9 A;  2XG8 D;  4FSX A;  2DIQ A;  1WQW A;  3R6O A;  4LDV A;  4ELZ C;  3OYB A;  4BE0 A;  4ZTJ A;  2K5I A;  1UGP B;  4LD9 K;  2JN0 A;  3OYY A;  4J7F A;  2XU8 A;  2RI3 A;  5KCO A;  2LCL A;  3M4G A;  2RH2 A;  4EMK C;  4B9X A;  4C8Q F;  5LL6 S;  1KD1 U;  2VXE A;  1N9S A;  3QZ9 B;  2O01 E;  2HQE A;  2RA2 A;  4XAX B;  4M77 E;  5GAN e;  4C0G A;  5GMK l;  3JCM J;  3S3O A;  5LJ5 e;  2EWN A;  1WPY A;  3M5A A;  2WSC E;  4PJO D;  4C8Q B;  1TH7 A;  4ME7 A;  2RJF A;  2LTO A;  3INZ A;  4XU3 A;  3WXM B;  3CBP A;  1OYX A;  3I55 T;  3QSU A;  1KG1 A;  2VXF A;  3DLL A;  3TU4 K;  2E6N A;  3A8L B;  3X20 B;  3CPF A;  3BDL A;  2YLB A;  2P4T A;  3HFN A;  3OQ5 A;  3I55 A;  1NZ9 A;  3OYA A;  1VQN T;  3TCJ A;  1FXX A;  4BAC A;  1XNI A;  5DLQ E;  4OB2 B;  4RMO A;  4PJO A;  3LGL A;  2G3R A;  2WSE E;  1VQN A;  4BY6 C;  1Q81 C;  2LX9 A;  5GMK h;  1KQS S;  2PQW A;  2GFU A;  3MHX A;  2V8I A;  1D3B B;  1KQ2 A;  3CCV T;  3SWN A;  3V7S A;  2M9U A;  3X24 B;  3C94 A;  5KE2 A;  1X6O A;  5GAM f;  5A0L A;  1S72 T;  3CC2 T;  4J7I A;  2E70 A;  5M9O A;  4F7U G;  3FC3 A;  3CCV A;  3L1A A;  5GAO q;  3HKS A;  5KE3 A;  4BI8 B;  3CC7 T;  1XQH A;  1VQ5 A;  3CC2 A;  1S72 A;  1Y96 A;  3J7A F;  2QXF A;  4M77 D;  4M77 C;  3HHT B;  3CCR T;  3CC7 A;  4L5G A;  2M16 A;  1WJS A;  2ZZD A;  1WJR A;  3QKJ A;  1VQ9 T;  2EIF A;  3CCR A;  2GCX A;  2YLC A;  2MAM A;  4QQD A;  1IZ6 A;  1LNX A;  2LCC A;  1VQ9 A;  1Y7X A;  4M78 G;  1KQ1 A;  5C6S A;  1N8R U;  2IG0 A;  4M77 A;  5GMK e;  4ZN1 A;  1JRI A;  3A8H B;  5GAN g;  2KVQ G;  4N4H A;  3GP8 A;  4E7J A;  5LJ5 g;  4C5G A;  2CZ7 B;  1VQP T;  1KC8 C;  3OBW A;  3OS5 A;  4E7K A;  2XHC A;  3OYI A;  1AHJ B;  4L59 A;  3TEE A;  4OVA A;  4XU1 A;  1YJW T;  5GAM h;  3GOX A;  2M1H A;  4HCC A;  1VQP A;  4IUT A;  1VQ4 T;  2L89 A;  2HAX A;  2RHI A;  3X25 B;  3OYN A;  4FU6 A;  1YJW A;  3CCE T;  2RK2 A;  2XD0 A;  1NE8 A;  4BI4 A;  1VQ4 A;  4L6V 5;  1VIF A;  5GAN d;  1K73 U;  4A4H A;  1M9S A;  3PFS A;  4LDU A;  1QVG A;  1K9M C;  3CCE A;  1XOV A;  2E1H A;  3VYG A;  2DXC A;  5AYF A;  4DQ2 A;  1YJ9 T;  2MF2 A;  4MZM A;  1K8A U;  1JB0 E;  4BE2 A;  3RMS A;  3E19 A;  3CCU T;  3L2W A;  2DZ9 A;  3FDR A;  5LJ3 f;  3FRN A;  4C0Z A;  4KUD K;  4PNO A;  1VQ6 T;  1YJ9 A;  3X26 B;  4MZT A;  1NPP A;  1UB4 A;  3CCU A;  1VQ6 A;  2HQX A;  2K5L A;  4PJO F;  3OYE A;  3E9F A;  3JB9 I;  2DZC A;  1NJI U;  2VUB A;  3LGF A;  2JTM A;  2F5K A;  2ZGW A;  3OSV A;  5GAM e;  3O8V A;  3OYL A;  4M7A D;  3Q1J A;  5CKE A;  3CCL T;  2DIG A;  4BD3 A;  4FT4 A;  4YTL A;  5HK3 A;  4KBM B;  2DO3 A;  4PJO B;  2A7Y A;  1RI0 A;  3CCL A;  1N27 A;  2P0Q A;  2RJC A;  3L2Z A;  4HKE A;  4PJO E;  2DTH A;  4E7H A;  2VYT A;  2EQU A;  2HD0 A;  1H64 1;  2B8A A;  4KUL A;  1HK9 A;  1ZQ1 A;  4A4G A;  4DOV A;  4M7A A;  3LWH A;  2EQJ A;  2RHY A;  3SWN B;  5DY9 A;  1MGQ A;  1M1G A;  2DJZ A;  1R8O B;  4Q5W A;  3JCM c;  3VUZ A;  5LJ3 h;  1Q86 C;  3LYI A;  2CYZ B;  1YIJ T;  5C0M A;  2RHZ A;  3P8H A;  4MZP A;  4PKC C;  4RCB A;  5LJ3 j;  3G4S T;  3PGG A;  3JCM d;  3MET A;  4F7U A;  3HP9 A;  4JS5 A;  3QUI A;  1Y96 B;  4NL2 A;  4XTZ A;  5A2Q E;  4TVR A;  3DKM A;  4ZGE B;  5KH6 A;  3G4S A;  1YIJ A;  2RJE A;  2DVE A;  1Q7Y C;  4RG2 A;  2LNV A;  4HCB A;  2LQ8 A;  4Y91 A;  4QVD A;  4M77 F;  5GAO p;  2QTX A;  4BE1 A;  5CKF A;  3OBY A;  3UWN A;  3HRS A;  1M5Q 1;  2QQ9 A;  4EMH A;  2Y90 A;  5IAY A;  1BI1 A;  3RUX A;  4C5I A;  1WGS A;  2D0Q B;  1M90 U;  2XKO C;  3OB9 A;  4EDU A;  4M77 B;  5FRO A;  3MCA B;  3OYM A;  1QVP A;  2M0O A;  4M7D C;  4M7D D;  3HRT A;  3S6W A;  2PU9 B;  4N0A A;  2L5Q A;  3ZEH A;  2RI5 A;  3CCJ T;  5GAO n;  4C8Q G;  1HXD A;  2LVM A;  3VYH B;  3HFO A;  5LJ3 e;  3BFM A;  4PJO C;  3V8K A;  3RKY A;  2DD4 A;  3CCJ A;  4BDZ A;  4EPC A;  3LX7 A;  3OS2 A;  2K5F A;  5GAM g;  2R57 A;  5I2M A;  4CI0 C;  5CR2 A;  5CKB A;  4M7D A;  3JCM W;  3PMI A;  2F5T X;  4PLI A;  4JRP A;  1H3Z A;  4HT9 A;  2H3J A;  3FLG A;  3OMG A;  3SWN C;  4M75 G;  2MWO A;  4IUP A;  5CQY A;  2RHX A;  5FU7 C;  3PNW C;  2JOY A;  2RM4 A;  1XTD A;  5DLO A;  3JB9 G;  1BI0 A;  2XID A;  4QVZ A;  1OZ2 A;  2WSF E;  1OZ3 A;  3VU3 C;  2D6F A;  1U1S A;  2FVU A;  2ZPG B;  1KHI A;  2RJD A;  4QW2 A;  2JVV A;  3E1S A;  3PIP A;  2P0K A;  1X01 A;  2VC8 A;  2EFI A;  4MDX A;  2RD1 A;  2X4W A;  3S3M A;  4BB7 A;  3HL8 A;  1K9M U;  4EMG A;  4RG8 A;  5CCA A;  5GAO l;  2K57 A;  2KY9 A;  5GAN 3;  1PSF A;  1P92 A;  4XTW A;  4BUG A;  4JRK A;  4M7A F;  2K2V A;  3EFS A;  3JCM b;  3L2V A;  2QQR A;  3A8O B;  3V8L A;  4C92 G;  3RKX A;  1LOJ A;  1VQ7 T;  4JDS A;  5CKD A;  3OYG A;  5CVI A;  2AHJ B;  3SFM A;  3OS0 A;  1VQL T;  4M7A B;  4F7U F;  1VQ7 A;  4LDX A;  2A3L A;  3G6E T;  2KAF A;  2ZPH B;  4ATO A;  4MMK A;  4PLL A;  2MWP A;  4J6Y A;  3MEU A;  1VQL A;  3FIF A;  3OA6 A;  4M7A E;  2XIC A;  3J81 E;  3LLR A;  2WAC A;  4J8O A;  4PL6 A;  2R58 A;  3G6E A;  1KHC A;  3CCS T;  4MML A;  1KD1 C;  5LJ3 g;  3P8B B;  1U1T A;  4F7U B;  5EG2 A;  4ZGD B;  1JJ2 A;  2E10 A;  4NOY A;  3RKW A;  3CCS A;  3MEW A;  4F7U E;  2OTL T;  4HT8 A;  2PUO B;  1X75 C;  3V7R A;  2XDD A;  3DB4 A;  2RO0 A;  3M54 A;  1VQM A;  2E5Q A;  3CBO A;  4IUV A;  2DXU A;  3LH0 A;  4XU2 A;  2OTL A;  3EFR A;  3JB9 J;  1QP3 A;  2FYK A;  4OP0 A;  1QVG S;  4V2S A;  1Y07 A;  3G7Z A;  3CCM T;  3AHU A;  5LJ5 d;  1EIF A;  5DM7 R;  1PSE A;  3M9Q A;  3I56 T;  3QYG B;  1GXI E;  3L2R A;  2R5M A;  2IVW A;  1Q82 C;  5D6X A;  3T9N A;  3SD4 A;  2DD5 A;  1B34 A;  3CCM A;  3MEA A;  3UPU A;  3NTK A;  5L8R E;  1O9S A;  3M57 A;  3OSS C;  4A53 A;  3JAM E;  4R56 A;  2LDM A;  3I56 A;  1I5L A;  1IRE B;  4M7D F;  4Y28 E;  2DK3 A;  2D9T A;  2CS7 A;  4HA8 A;  5CK9 A;  5CKH A;  3SB2 A;  3OW2 A;  2QI2 A;  3QO3 A;  4J83 A;  3OW2 S;  2DXB A;  2LT4 A;  2XK0 A;  3ASK A;  3NTH A;  4M7D B;  2BIV A;  4M7A C;  3KXT A;  5FLX E;  1FWZ A;  4IUQ A;  4PJO G;  4ZGJ B;  5GAN 4;  3QJ6 A;  3OYD A;  1O75 A;  3CCQ T;  3C95 A;  4M7D E;  2DPP B;  5GAN f;  5HKC A;  5FRN A;  4FM4 B;  4M75 A;  1SSF A;  4R55 A;  2CZ6 B;  3CCQ A;  5KCH A;  1WNL A;  2FB7 A;  3HPW A;  4XTX A;  4B9W A;  2HNI A;  3RER A;  2Y4Y A;  3JRZ A;  1QP2 A;  4KUI A;  2P0P A;  2YRV A;  3DB3 A;  1WQ7 A;  2O4X A;  3TRE A;  3GNF B;  3OYF A;  4LD6 A;  5FU7 B;  2XDB A;  4N4I A;  3JB9 H;  3L2U A;  3L42 A;  4OB3 B;  4J6W A;  2K3Y A;  3N5B B;  3PMT A;  5FU6 B;  3UDC A;  5A0D A;  4J5Y A;  3KBG A;  2PUK B;  1VQ5 T;  2X4Y A;  1QVF A;  2FHD A;  1DJ7 B;  1W4S A;  1G3T A;  2EJ9 A;  3GF5 A;  1YHQ T;  3M4Y A;  3QYH B;  2E64 A;  2DAQ A;  3A8M B;  3ZBD A;  4D6W A;  5HK0 A;  4XTY A;  4M78 C;  4M78 D;  1G3W A;  2VV5 A;  5GAN 5;  1YIT T;  1UGQ B;  4N0A C;  1YI2 T;  1Q81 U;  4A4F A;  3P8D A;  1NPR A;  3RIR A;  1YHQ A;  2KSS A;  3FEO A;  4C92 A;  3GPL A;  5GMK m;  1YJN T;  1YIT A;  3H8Z A;  4FT2 A;  4CRI A;  1YI2 A;  4N4G A;  2KK4 A;  4M77 G;  3QPH A;  2DEQ A;  2GQV A;  4FIB A;  1YJN A;  3QII A;  5GAN j;  2QQA A;  2I2L A;  2PVG B;  1OI1 A;  2LRQ A;  2RHU A;  3M55 A;  4M78 A;  5D6Y A;  5GMK i;  2QA4 T;  1ZHI A;  3LWI A;  3M59 A;  1YBY A;  4E7I A;  2JUF A;  1K8A C;  2CZ0 B;  2ZPE B;  5CAI A;  2QA4 A;  4A4E A;  5GAN 8;  5GAN 7;  3MP1 A;  3H6Z A;  2EJG A;  3JCM f;  3QDR B;  3MEV A;  5J39 A;  5D6W A;  5CIU A;  4ZTF A;  3S3N A;  2E6Z A;  1MHN A;  2JTF A;  2K3X A;  4O6J A;  3CEY A;  1M1K C;  3BY7 A;  4ELY C;  1NJI C;  1VQK T;  2OAU A;  1WJQ A;  3OYJ A;  2CGH A;  3A8G B;  4WF2 A;  5FU6 C;  4VUB A;  1KC8 U;  1VQ8 T;  1VQK A;  2RK1 A;  3BW1 A;  1B34 B;  3ER0 A;  3V7C A;  2QEX T;  3RES A;  1I4K 1;  3PT9 A;  4E7L A;  5GAO m;  5GAM d;  3MP8 A;  1VQ8 A;  3M56 A;  2MI6 A;  4GLK A;  4J6X A;  5GAN 2;  5IN1 A;  2QEX A;  3F70 A;  2V8K A;  3QBY A;  4KT0 E;  1U8R A;  4NS5 A;  4M75 F;  3DLM A;  4EMK A;  2K4Y A;  4C8Q E;  2R5A A;  4JJN K;  4NL3 A;  1W2B S;  2DKG A;  1W2B A;  3CMA T;  3JCM h;  2F69 A;  3JB9 F;  4C5H A;  1G3S A;  3E9G A;  3JCM Q;  1Q82 U;  1BKB A;  3JCM V;  4UC4 A;  3GNG A;  4C0D B;  4M75 B;  3VJP A;  3CMA A;  1YCY A;  4RCC A;  3X28 B;  2RI2 A;  2CZ1 B;  3QHS A;  5HY6 A;  4M7A G;  2BUD A;  2ZPI B;  4M75 E;  3CXC S;  3CXC A;  4X9D A;  1KQS A;  1Y71 A;  5GMK j;  2C06 A;  2O4X B;  2KDS A;  5A0G A;  1LJO A;  3HRU A;  3NTI A;  3OMC A;  3J80 E;  5GAO r;  1M90 C;  3PIO A;  2QQB A;  1N9R A;  3L2Q A;  3OS1 A;  4BDY A;  1I8F A;  4LDW A;  4C5E A;  3FB9 A;  1VQO T;  4C92 F;  1JJ2 S;  4OGE A;  1VQM T;  1BI3 A;  2DTO A;  4QVC A;  4GY5 A;  4DOW A;  1G3Y A;  1ZBX A;  4II1 A;  1RL2 A;  3CC4 T;  1VQO A;  2EQM A;  3M58 A;  4RKU E;  3FJP A;  1I81 A;  3JCM e;  5CO7 A;  4M78 F;  2NLU A;  2CKK A;  3CC4 A;  4C92 B;  1VUB A;  4XTU A;  2KQW A;  2EYQ A;  1G5V A;  4C8Q D;  4C8Q C;  5CQX A;  4C92 E;  3JCM X;  3M53 A;  2DTI A;  2VGN A;  3MP6 A;  3JCM P;  1Q86 U;  5LJ3 d;  4JUV A;  4C0F A;  4X9C A;  4ZN3 A;  2JZ2 A;  3OYK A;  2RB6 A;  1FX7 A;  4M78 B;  1M4Z A;  5GAN 6;  2XDP A;  3CD6 T;  4A4K A;  4OF1 A;  3C12 A;  4M78 E;  2ZPF B;  4HCZ A;  4OB1 B;  4QQ6 A;  3SDZ A;  4XQ3 A;  3ZFJ A;  3PTA A;  2LT1 A;  1Q7Y U;  4C0D C;  3HSB A;  4X34 A;  4M75 D;  4M75 C;  4C8Q A;  3QG1 A;  3GIB A;  1BYM A;  1UGS B;  4P5N A;  3CD6 A;  2FL7 A;  4M7D G;  3V8J A;  5GAM j;  1QW1 A;  2L3R A;  1BIB A;  3NFC A;  4XK8 E;  1V29 B;  3CPW S;  3WVE B;  4E47 A;  2KMT A;  3CPW A;  3JB9 D;  4XTV A;  4Z02 A;  3JSC A;  4FL6 A;  4JLG A;  2MMP A;  4OB0 B;  2LC4 A;  2LQK A;  4JLI A;  4OGC A;  4O5V A;  3C4S A;  4JS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...