2LCLA

Solution structure of rfah carboxyterminal domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
GAMGPKDIVDPATPYPGDKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKNTEFRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional activator rfaH
publication title An alpha helix to beta barrel domain switch transforms the transcription factor RfaH into a translation factor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lclA00
3CPFA 3KBGA 3CCRA 5IT9E 3CCQA 1Q81C 3I56A 2JOYA 3HKSA 1VQLA 1M90U 2CKKA 3I55A 1VQNT 3CCUT 1UEBA 1Q7YU 3DB4A 1VQ4T 1YJWA 1VQMA 2JUFA 2XHCA 1YIJT 1W2BA 1Q82C 3CMET 3CCLA 1NJIC 3CCSA 3ER0A 1Q81U 1QVGA 3CCET 2IG0A 1YHQA 1YITA 5LL6S 1YHQT 2DO3A 1K8AC 1QVFA 1RL2A 3PIOA 3CCJA 2OTLT 1YJNT 1NPPA 1W2BS 2L3RA 1Q82U 3CPWA 1VQOA 1BKBA 1NJIU 3CCRT 1VQ5A 2JVVA 1QVGS 1XNIA 3CCQT 1SSFA 3I56T 3CMAA 3CD6A 1VQLT 3CXCA 3I55T 5HY6A 1M1GA 3CC2A 1QVFS 2QEXA 1KC8U 2G3RA 1K8AU 1YJWT 1VQMT 1KQSA 4X34A 1VQ8A 2OTJA 3LGFA 1S72A 3G71A 1VQ9A 3CPWS 5A2QE 1M1KC 3G4SA 3CCLT 3LH0A 3CC4A 4ZN3A 3CCST 3G4ST 3CC7A 2EIFA 3CXCS 2MI6A 1YITT 1YJ9A 5DLQE 1KQSS 5IAYA 1NPRA 3LGLA 1IZ6A 5J26A 3CCJT 2LVMA 3OW2A 3CCMA 3DB3A 1VQ7A 2E70A 3OYYA 1JJ2A 1M1KU 1VQOT 1KHIA 2JNGA 1NZ9A 3P8BB 2QA4A 1VQ5T 1VQPA 4CRIA 3CMAT 3CD6T 2MWOA 5DM7R 3CC2T 2QEXT 1VQKA 3CCVA 1VQ8T 4ZN1A 3OW2S 1KD1C 2OTJT 1S72T 1JJ2S 1VQ6A 3G71T 1N8RC 1VQ9T 4YTLA 5FLXE 1Q86U 3JAME 1YI2A 3CC4T 4TVRA 1K73U 3CC7T 2LQ8A 1EIFA 1VQNA 1YJ9T 3CCUA 1VQ4A 2KDSA 1KD1U 4RG2A 1Q86C 1N8RU 3CCMT 1VQ7T 1XTDA 1YIJA 3CMEA 3J7AF 1KC8C 1K9MC 1K73C 3A5ZB 2QA4T 2E6ZA 3CCEA 1VQPT 1YBYA 1M90C 3PIPA 3G6EA 1Q7YC 1VQKT 1X6OA 5J3BA 3CCVT 3DLLA 3G6ET 3J81E 2LCLA 2OTLA 1YJNA 1VQ6T 4QQDA 3J80E 3TREA 2MWPA 1K9MU 1YI2T 2KVQG
chains in the Genus database with same CATH superfamily
1U06A 3OB9A 3RERA 1N9RA 5GAN2 4FYYB 1WHMA 2GQIA 2K79A 2EGAA 1KSWA 4OMQA 5KYUA 3GIBA 2O4XB 5M9OA 2NUTA 3OYJA 4C5IA 5HK0A 1JO8A 2RJDA 4CC7A 1N8RR 1KHCA 3EH1A 3INZA 3GBQA 2FZGB 1YHQT 2FHDA 3EG3A 3CPWA 1BKBA 3HP9A 1TUCA 2BTTA 3CC2A 4ATOA 1HK9A 1N9SA 2A3LA 1BIAA 1Q7YR 3RMSA 3G4ST 4J9FA 5DLQE 1G3SA 1NPRA 3JB9D 1GCQC 3I55Q 4KUDK 1SF9A 3V8LA 1BI2A 1AWOA 1BYMA 1YJWQ 2H3JA 4P5NA 3P8BB 2GFAA 2CH4W 1CSKA 2EJ9A 1T0JA 1AWJA 3CQTA 3CC2T 3CCLQ 1KD1C 4DBFA 2ZPEB 3JCMJ 2RQWA 3E19A 4RTYA 5KH6A 2QGFB 3M5AA 4M7DF 1GCPA 4C92E 2EYQA 4R0KA 1VQ4A 4RTWA 4IUQA 4BDZA 3O5ZA 3X25B 5GMKh 2PVGB 1K9AA 3VUBA 2PQWA 3CCEA 2RQRA 3OYCA 3G6EA 1G3TA 1X6OA 8AT1B 1OZ2A 3H0HA 4OB1B 3OYMA 1TUDA 1OEBA 2NUZA 2EJGA 1EZZB 3I5SA 5IT9E 3KBGA 2D8HA 2K5FA 2M16A 2X35A 1VQ7Q 2BIVA 1QWFA 3M58A 1VQ4T 1VQMA 4PJOB 1I07A 1RACB 2HMAA 2FPFA 3L42A 3X26B 3SHWA 3CCSA 2EYZA 2X4YA 4RCCA 3CCET 1KQ2A 4Z02A 4HCZA 1YI2Q 2QQBA 1OU9A 2VYTA 5ECAA 1D1AA 4PJOF 5GAOn 3QXEB 1WJRA 1NPPA 1MNEA 2MCNA 3F70A 1OYXA 3SWNA 1XNIA 4D6WA 1Y71A 3CMAA 2CP3A 4A4GA 3CBMA 1UECA 5GANd 5HCKA 2LDMA 1K8AU 1VQMT 4AT1B 2JM9A 1HD3A 1VQ9A 1M90R 3OS1A 2HKQB 1K1ZA 1AZEA 1YHQQ 3FC3A 5KYUB 4V2SA 3CCST 3CC7A 3KFVA 2NUTB 3E1SA 1NLPC 2P0KA 4JRQA 5CO7A 3VS1A 5J26A 1BCMA 3HRUA 1WXBA 3SEMA 4C5EA 1M1KU 1M9SA 2YHTA 3I9QA 1JXOA 3VS0A 3CMAT 2CZ0B 2QTXA 2ED0A 1GBRA 3G4SQ 1AOJA 2KNBB 1VQ9T 1IO6A 3PNWC 3EGDA 2AZSA 3ZEHA 1BI1A 2COYA 2C06A 3CC7T 4F04B 3S3OA 3JRZA 2HSPA 2H8HA 4AFUC 5FW9A 2WACA 2YUQA 2HZYA 5GANg 3WVDB 3CC2Q 4OVAA 3CMEA 1ZUUA 4OB3B 5GMKl 3FJ5A 3OYEA 4Y91A 3AHUA 1V1CA 2KXDA 1MMDA 4RUGA 4XTVA 3CCRA 3RMQA 1NLOC 4LDUA 2KBTA 3MP1A 2DLPA 2XDPA 1U3OA 3JV3A 4F7UA 1K73R 4FW1A 4AG2C 1MUZA 4MDXA 3JCMP 4IIOA 3TQ7P 3CMET 1ARKA 2WSFE 3PVQA 3CCJA 4KBMB 2FG0A 1VQ4Q 3CCRT 1B07A 2B86A 3OS0A 2X4XA 2FRYA 2DILA 5HY6A 5GMKe 4ZTFA 3M9QA 2V8JA 1KC8R 5GANh 3L2RA 4KUIA 4MZMA 2YUPA 2RNAA 3CCEQ 4RTTA 4C0DC 4M7AG 5GANf 4JJCA 3CBOA 4FYXB 3G7ZA 1X69A 2KYMA 4HCBA 2EPDA 3A1PA 2V8KA 1KQSS 2CP5A 1ZUKA 3CCJT 5DLOA 3OYYA 4QKUA 1X2QA 2EAYA 1VQMQ 4HT8A 1GRIA 1V29B 3CCSQ 2JS2A 2A28A 1JJ2S 3QZ9B 2V1RA 1TOVA 1WQ7A 2JMAA 1G3WA 5GAMe 4M75A 2JN0A 3RDVA 1KD1U 2QQAA 3CMAQ 1XTDA 1T3LA 2SEMA 3A5ZB 3S3NA 1M5Q1 2JM8A 1VQ9Q 3CC7Q 8ATCB 2LP5A 2L3QA 2EJFA 3A8OB 3J80E 4NOYA 2VXEA 4FSXA 3H41A 5GAOq 2AKLA 4KH0B 2YT6A 2OJ2A 1ZBXA 2LC4A 3EGDB 2XI9A 3QWYA 2HCKA 3DB4A 2VKNA 4PKCC 1M3CA 1IREB 2FZKB 1XQHA 3EHRA 4M7AC 4OF1A 3UWNA 4PLIA 1NYFA 2ZPFB 1VQOA 2COWA 2E3IA 2GTOA 5L23A 2AZVA 4BE0A 3CMEQ 5GAN7 2DEUA 3UA6A 4FYWB 2CS7A 2OTJA 1QVFP 4F7UB 3CPWS 1AD5A 1UGPB 2K5LA 1UUEA 2YUOA 3LH0A 3JB9J 2L2PA 3MEVA 3CCRQ 2RJFA 3OW2A 3CCMA 2NWMA 2LJ0A 1ZUYA 1VQOT 2JNGA 3M0QA 3QYGB 5DM7R 3URGA 1BK2A 1NJIR 1NM7A 2A37A 2OTJT 3OBYA 1QP3A 1G8XA 3H0FA 1D0XA 2PUKB 2DXBA 1M8VA 3CCJQ 4LN2A 3OYAA 3EFOA 4F16A 1Z9ZA 2XKOC 1VQNA 3G1JA 2CZ6B 3ULRB 4J6YA 4JJNK 3FJPA 3CCMT 4JZ3A 2PUOB 4JUVA 4KT0E 1PSEA 4N4GA 2JJ9A 1D0ZA 4M77G 4GLMA 1C1AA 2RN8A 1PHTA 2P0QA 1YJNA 1AZGB 5I2SA 4KGXB 2O31A 2K2VA 2GGRA 3NMZC 3A98A 3I56A 1VQNT 4HT9A 2JTFA 4BACA 2CT4A 4M75B 2CSQA 4R55A 3VUZA 5A0DA 1G2BA 1Q82C 4M77E 3JCMX 4LDWA 3OYBA 2GF7A 1D0YA 1TTHB 4DEXA 1B3QA 2GTJA 1RL2A 4KGVB 5GJVB 2XICA 1YJNT 5KYWB 1A0NB 2OAWA 4FU6A 3VKIA 2LMJA 3ZL7C 1SSFA 3I56T 2ZCFB 3FLGA 3VS5A 3CXCA 2Y4XA 2MYSA 3HL8A 1KIKA 4X9DA 5FU6B 2C0IA 1ZQ1A 3RR6A 3VV0A 1RLQC 2CT3A 5CIUA 3UA7A 2RHZA 4PJMA 2DTIA 1T0HA 4LNPA 2M51A 3QUIA 4PNOA 4M7DA 5LJ3e 4QVCA 4C8QC 4AG1C 4XK8E 1DJ7B 2K2MA 2CZ1B 2KSSA 1QVGP 2MWOA 3QHSA 1YCSB 3P8DA 4CC2A 2BZXA 4M7AD 1MMAA 4PLLA 3QWXX 4E7SA 3OY9A 1Q86U 1HSQA 1Y96A 4BUGA 1OPLA 1IB8A 2LQ8A 1NEGA 1TSFA 3TCJA 1VQOQ 2J6FA 3C12A 4K11A 5CKFA 3NTKA 4E6RA 2KROA 5GAOm 1SRMA 1UJ0A 1K9MC 1WA7A 2E6ZA 2O88A 2OTJQ 2GFUA 5CKHA 5LJ5j 3U23A 4IUPA 3GNGA 2WSEE 1T3SA 2XIDA 1IRXA 1WZOA 1LPLA 2DTOA 2KVQG 1AWWA 1K0SA 3CCMQ 2CKKA 2EQKA 4F14A 3EFOB 3E2UA 1HXDA 3FB9A 1S1NA 1WHKA 4OMNA 3ME9A 2XD0A 4FT4A 3EFSA 4J7FA 1YHQA 2ZPHB 4M4ZA 1YITA 1RAIB 1WHGA 3M56A 3M55A 4E7JA 4E7ZA 1VQNQ 1ZSZC 3PMTA 2R58A 4GY5A 1VQ5A 3GF5A 1QKWA 5GAOl 3GP8A 3VS7A 1C6VX 1JRIA 3G71A 4M78G 1W1FA 2X4WA 3G4SA 4JLIA 1YJNQ 4C0GA 9ATCB 2L3PA 1Z9QA 5KYNA 2DM1A 1YITT 4DBQA 3EG1A 3QKJA 5GAMd 1MMGA 3I56Q 2V8IA 2VGMA 4M75E 2MPXC 1I5OB 2DVEA 1VQ5T 1QLYA 4M78E 1FX7A 1K0XA 2JZ2A 2E3HA 1R0BG 3EGXA 4MZTA 3G71T 2J6KA 4TVRA 4J9IA 1I4K1 4IKFA 4ME7A 1M2OA 4II1A 1BBZA 2D6FA 4C92G 4JDSA 1YIJA 5CKEA 5FRNA 4M7DB 2LNVA 2QASA 5GAN5 3OYHA 5KE3A 3BE3A 4EDUA 5GAMg 3ZFJA 1Y96B 1Q81C 4C8QD 1NE8A 2PVDB 1WHHA 1N6AA 2D0QB 4B6MA 2RI2A 1HJDA 1UGVA 1WFWA 1YIJT 1W2BA 1M27C 1R0CB 3R6OA 1TH7A 3A8HB 4M78C 4M77D 1QVGA 2IG0A 3C95A 2DJQA 1PC0A 1UGRB 1Q82U 4HXJA 4NL2A 3PVLA 2QAZA 5IHNA 3BDUA 4BB7A 3OYIA 1NBEB 3OBWA 5D6WA 2QEXA 1WDXA 2RHIA 2E12A 3PGGA 1M3BA 1BIBA 3EAEA 2GCXA 2HDAA 1SRLA 3SB2A 2IVWA 4C5HA 2DA9A 5IAYA 2OX7A 2O9VA 2RH2A 1BU1A 1QP2A 2Y4YA 5GAMh 4BI3A 1OV3A 4MMKA 4C92C 2EQMA 5GAMf 3QBYA 3L1AA 3OMGA 3M4GA 2YLCA 2K5IA 2BE7D 2QEXT 3BY7A 2VWFA 3OW2S 1YITQ 1Y7XA 3OYNA 5FLXE 4BE1A 2DL7A 1RLPC 2JXBA 1K8AR 4J9HA 6AT1B 2RPNA 3M0RA 1PKSA 2DIQA 4FL6A 5GMKj 3CCUA 3I35A 1VQ5Q 4M7AF 2RJCA 2KDSA 5CCAA 1J3TA 3EG2A 1QCNA 2RQUA 7AT1B 3OS5A 3ASKA 4JS4A 3G71Q 1M1KR 1I5LA 1G5VA 1VUBA 4BDYA 4ELZC 2DD4A 1TU0B 1LVKA 3EGXB 1K9MU 1I81A 3QJ6A 2LJ1A 3MO8A 3CCQA 2CREA 1WXUA 4NS5A 3CCUT 2YWWA 3TSZA 1UB4A 1OPKA 5KCOA 5J39A 2ESWA 2R57A 3JSCA 1RAEB 5GAMj 5FWBA 4QW2A 4MMLA 2QG9B 2GBQA 2DL3A 4Z8AA 2K3BA 4B9XA 5GAOr 4A4EA 4HVVA 2O01E 2HQXA 2L0AA 2M02A 3HRTA 1WLPB 4MZPA 3QDRB 5LJ3d 1D1BA 3CCQT 1E6HA 3HPWA 1YIJQ 1WHJA 2DIGA 3R6NA 2JTMA 5AT1B 2KI7A 2DZCA 5FU7B 3UATA 1WIEA 2CP2A 2DL4A 1TXQA 4ZN3A 3RBBB 2L8DA 3CXCS 4QQGA 2DNUA 2BZYA 4XU1A 4B9WA 3JCMe 1PD1A 2LX9A 3VS6A 4KULA 4RTUA 1N5ZA 4PJOG 2FEIA 2E1HA 2FVUA 4M78D 1UJYA 2YRDA 2K9GA 1PM3A 1VQ6A 1RADB 3X20B 2C0TA 3H9NA 3HRSA 5GMKi 4Y28E 4DQ2A 2DK3A 3PE0A 1FXXA 2EYXA 4PJOE 1Q86C 2ROTA 1RAFB 2QEXQ 3DKMA 5IH2A 2DMOA 2HBWA 1WYXA 3H6ZA 4LDXA 5A0LA 4XTXA 2HKNA 1PD0A 3JB9F 1GCQA 4JJDA 4JJBA 1VOMA 1PNJA 1M3AA 2LCLA 3M59A 4EIKA 2QGGA 1VQ6T 2XDBA 2LNHB 2YXYA 1QQJA 2MMPA 3MJXA 3IQLA 4C8QB 3OQ5A 1PCXA 4RCBA 4C92D 2CUDA 3WVEB 3QPHA 2BUDA 2AK5A 1ABOA 2LRQA 2F2WA 2QQSA 3ER0A 1Q81U 1KD1R 2K57A 5IN1A 4C8QF 1RABB 4JRIA 1QWEA 5KYWA 2LCSA 1U1SA 4HCCA 2CUBA 3KXTA 1OQKA 1H3ZA 1AWXA 1AHJB 4BE2A 3Q1JA 1OOTA 3CCUQ 5GANj 3TEEA 3QZ5B 5LJ3h 2VUBA 4PFZA 2XDDA 5LJ3f 4L6V5 1G83A 1VA7A 2A0FB 2G6FX 3T9NA 1IGQA 2VGNA 3MPUB 4FCYA 3A8MB 2D8JA 1K4US 4WCIA 2KGTA 1K76A 1YJ9A 1XJWB 2SRCA 2LQNA 3CCQQ 4A54A 2YUNA 1UFFA 3GNFB 1JB0E 4AFSC 3H8ZA 5HK3A 2YRCA 1VQPA 3MEAA 1MV3A 1YFNA 3LWIA 3C4SA 2DRKA 4HA8A 2DAQA 1UHCA 2DPPB 5CAIA 2AIRB 2M0YA 5D6XA 1UTIA 1SHFA 4IURA 5EC7A 1N8RC 2J06A 2W10A 1JJ2P 4FSSA 1GXIE 4HVUA 1TUGB 1YJ9T 4Y92A 2FYKA 3OSVA 2COZA 2KT8A 2VV5A 5FRMA 2J7IA 2J6OA 1VQPT 2JT4A 2QXFA 4IUTA 1KJWA 4OP0A 1Q7YC 4XTZA 1BCOA 3L2UA 4ANJA 4D8DA 1OX8A 1IHWA 1VIEA 1SSHA 3M0SA 2IIMA 3HFOA 1FMKA 3JB9H 4FW2A 3RKWA 2XHCA 3M54A 1SKUB 4GLKA 4X9CA 1VQ6Q 4ZNXA 2F5KA 3VS3A 4E47A 4BD3A 5GAN3 3PIOA 2CH4A 2KK4A 2L3RA 1W2BS 4LUDA 3UF4A 5CK9A 1QVGS 4BI4A 3RIRA 1OULA 5FROA 5AYFA 4PJNA 2O9SA 1WQWA 3PMIA 2EYYA 1AEYA 4J9DA 2HEQA 2QDYB 3LGLA 1Y0MA 1QVPA 2RB6A 2E70A 4RTZA 3VS4A 3VJPA 2CSIA 3KUFA 3MKDA 2D1XA 1NG2A 2ABLA 4J6XA 4JRKA 4A53A 4RG8A 1OZ3A 3GPLA 2HD0A 3JCMb 2DBKA 2DETA 5C6SA 4J9GA 4ZTJA 3JAME 4ZGJB 2YRVA 3L2WA 1M2VA 3VYHB 4KGZB 4Q5WA 5GJWB 1CKAA 2XMFA 5GAN6 1ZHIA 2EQUA 3OYLA 2RMOA 4PJOD 2EKHA 2PU9B 3HTRA 1BI3A 2DYBA 3J7AF 1B7TA 1P92A 3SWNC 1FYNA 4E7IA 2DRMA 1M90C 4F7UG 1E7OA 4VUBA 3LWHA 4M77C 1GFCA 1SEMA 1YJ9Q 1WXTA 1Q86R 1TWBA 1VQPQ 4FIBA 4F7UE 2Y90A 2QDLA 4OMOA 2R5MA 3LW5E 5HKCA 1ZX6A 4C92F 4QQ6A 4LUEA 1QVFA 1X75C 3LLRA 4RTXA 4X1VA 3JCMd 4J7IA 1O75A 2P4RA 2KR3A 3EH2A 5CVIA 4IUUA 1CKBA 1JU5C 4EMKC 2FRWA 4HCKA 2ZZDA 1ZSGA 2VVKA 2E65A 2MF2A 2KAFA 3TSWA 1PSFA 2HL3A 4LDVA 1TG0A 2A36A 4JLGA 4AFZC 3JCMQ 3VYGA 4CC4B 2MI6A 1U8RA 3BW1A 2E10A 2RHYA 3DLMA 4J9CA 1WGSA 3EGUA 2DXUA 2M9UA 3THKA 2QQRA 3VU3C 2P84A 4M7AA 2I2LA 2MAMA 4M75G 1B34A 4FYVB 3QDFA 3V8JA 5GAOp 3LYIA 2ENMA 2DKGA 2YSQA 3OSSC 4XU2A 4N0AC 4N4HA 3M53A 2W0ZA 2X4JA 2F5TX 3A8GB 3JCMg 4N4IA 4XU3A 1VYTA 2QK0A 1I0CA 1N8RU 2DFUA 1YP5A 1KC8C 5CKDA 1X6BA 3GOXA 3S6WA 2AT1B 3FDRA 2HL5C 2NYSA 4PFPA 5KE2A 4Z88A 2ZPBB 2MIOA 2RK1A 2A7YA 2EBPA 2RQVA 2FPEA 1XOVA 2RA2A 3JCMW 3REAB 1JXMA 1Q7YU 1M2VB 5KCHA 2M0OA 1D1CA 2CYZB 2X9HA 4C0DB 4OMPA 1YCYA 3MEUA 4E7LA 4LE9A 2XG8D 2K7AA 2LT1A 5LJ5e 4ESRA 2AHJB 3HSBA 2FL7A 1VYVA 2DEQA 2D0NA 3N5BB 3M0TA 1D3BB 3JCMh 1NYGA 2RHUA 4XTWA 2XK0A 4M75C 3JCMf 1VQ8A 1RAHB 2FO0A 3QYHB 2KT1A 1S72A 1VYUA 1UGQB 5GAN4 2BE9B 3VRYA 1Y57A 2EIFA 4LXCA 3EG9A 3SFMA 1ACMB 3TU4K 2EFIA 2BZ8A 2LVMA 2R5AA 4IUVA 2K3XA 3LH5A 3UDCA 1KHIA 3C0CA 2ZGWA 2GQVA 3QO3A 2LJ3A 1I1JA 1Q82R 2LQWA 2J05A 1WI7A 4PK4A 5FU6C 1VQ8T 4ZN1A 1D09B 1S72T 3OYKA 1RI0A 1VIFA 4OMLA 1M1FA 4A63B 4BY6C 1WJSA 2F2XA 4RG2A 2RI3A 3M57A 4PL6A 4A4HA 2CGHA 4WTOB 1OU8A 5A0GA 4M7AB 2F2VA 3C94A 1B34B 3EG0A 3EHQA 5J3BA 4DBHA 2HBPA 3G6ET 2HQHA 4C8QA 3L2QA 2ATCB 2CP6A 4RKUE 4QVZA 2HAXA 2DE0X 1H641 1AT1B 3HKSA 1M90U 2HQEA 1EFNA 4OGEA 1WNLA 2CP7A 4M77A 4DOVA 5EG2A 4XTUA 1X2KA 2QI2A 5GMKm 3O8VA 1NJIC 1R77A 1ZBJA 2QTVA 2EGEA 1KK7A 3NTHA 1ZA1B 1KFZA 2F69A 1U1TA 2JVVA 1RI9A 4XTYA 3M4YA 2DTHA 4OB2B 5CQXA 1K9MR 1QCOA 4M7DG 3LGFA 3V8KA 5IHKA 3CC4A 2DERA 3OMCA 4EMKA 1NEBA 3RKXA 4KH1B 2EQIA 2DF6A 4E2FB 2P4TA 2LQKA 1QKXA 4M7DE 3META 4PJJA 2QA4A 4XQ3A 4RTVA 2VC8A 3RUXA 4ELYC 2EW3A 2KEAA 1M4ZA 2MOXA 2M1HA 3CCVA 1ZSZA 4XAXB 4A4FA 3OW2P 5L8RE 3CC4T 4LD6A 1K73U 1EIFA 2DXTA 1YNZA 4PFOA 4GBQA 2RI5A 2PNIA 3EG9B 1O9SA 2RF0A 2EKOA 2CP0A 1JQQA 1WPYA 4M75D 4N0AA 4DBRA 4F17A 2QA4T 1VQ8Q 2E5QA 1S72Q 1ABQA 1YBYA 2KQWA 2JS0A 3ZBDA 3BDLA 3CCVT 3DLLA 3J81E 5I22A 3V7SA 2OTLA 2Z0WA 3OS2A 3X28B 1I8FA 4QQDA 1KC8U 1RAGB 3OYDA 2HNIA 5LJ3g 3E9FA 2RQTA 1UEBA 3UPUA 1RUWA 3RNJA 2NUPA 2JUFA 4J5YA 2JMCA 2X3XD 4M7DC 2DVJA 2X51A 2V26A 3G6EQ 5GAN8 4JPBW 4AFQC 2FB7A 5D6YA 1LCKA 5LL6S 2CDTA 1W6XA 3FEOA 2QQ9A 2OTLT 4C5GA 1JEGA 4DA4A 4FT2A 2VXFA 4J9EA 1SPKA 4O5VA 2YLBA 3CD6A 5CQYA 1C0MA 2KE9A 5KYXA 4M7AE 2DJZA 1QVFS 3SWNB 3I5RA 4XU0A 2K6DA 4M77B 4JS5A 1FWZA 2KYBA 2IPOB 1GBQA 4O6JA 3CXCP 1Q81R 2PTKA 3DB3A 5DY9A 3M0PA 3MEWA 4M77F 2LX7A 4M78A 3M0UA 1BI0A 1FMWA 1NZ9A 2RM4A 1V76A 1R8OB 3RESA 4PJOC 3CD6T 2ED1A 2E6NA 2CZ7B 3WXMB 1MV0B 1VQKA 5IXFA 3QG1A 1YN8A 4JZ4A 4DEYA 3PT9A 1PG5B 4OB0B 5FWCA 2RO0A 2ZPIB 1OX9A 3CBPA 2BKDN 1FMVA 5I11A 1KQSP 4EMKB 1SG5A 2EGCA 1WHLA 2RD1A 4D8KA 2OI3A 1UHFA 3NPFA 2X3WD 2KMTA 3CC4Q 1VQKT 5IHIA 1SHGA 3UT1A 1X27A 5LJ5d 3TREA 5CR2A 4C92A 1ZSZB 4A4KA 3P8HA 1IXDA 1Q95G 2DX1A 1VQLA 2OAUA 1N27A 2QA4Q 1G3YA 4CI0C 4L5GA 3L2ZA 4EPCA 3CCVQ 2LTOA 4OMMA 3VS2A 4E7HA 2K3YA 1W4SA 4RMOA 2DO3A 3QIIA 5LJ3j 1F1BB 3CEYA 3LX7A 2LZ6B 1TS9A 2FZCB 2XU8A 4BI8B 2NLUA 3JB9G 1NJIU 1KG1A 3OYGA 4F7UF 1LNXA 2PZ1A 5KYYA 1OI1A 2LCCA 2QYZA 1VQLT 2MK5A 1PWTA 4LDYA 1M1GA 1AVZC 2K4YA 2G3RA 2LT4A 5D7UA 3EFRA 2NUPB 3VRZA 5A2QE 2ZPGB 5LJ5g 2OTLQ 1H92A 4Z89A 2DYIA 1EX4A 2L3SA 3PFSA 2V1QA 1IZ6A 5I21A 3A8LB 4C8QG 3FRNA 1GFDA 4HVWA 2VB6A 1YWOA 4J6WA 1PRLC 5GANe 4EMHA 4M7DD 1YWPA 2GNCA 1M8MA 2P0PA 2E5KA 1Y07A 2EWNA 5FU7C 5KYXB 1E6GA 4C0ZA 1PKTA 4J83A 1X6GA 1QW1A 3MHXA 4AMCA 3CPWP 1MHNA 4UC4A 3V7RA 4CC3A 4C8QE 4EMGA 5C0MA 1BB9A 2O4XA 2D9TA 3OYFA 3CD6Q 2L5QA 3BFMA 2A08A 2KXCA 2KY9A 1MMNA 4JRPA 4M78B 2RK2A 2F1LA 3PIPA 4QT7A 3REBB 2PVOB 3AT1B 2EVRA 2ROLA 2JTEA 4J8OA 4M75F 1U5SA 5LJ5h 1ZLMA 2KRMA 3JB9I 3CPFA 1IHVA 1ZA2B 5I2MA 3JCMV 5LJ5f 2JOYA 4M78F 3I55A 3HHTB 4HKEA 1MGQA 2E41A 3NFCA 1JBMA 1YJWA 2H3EB 1UE9A 2YDLA 2C0OA 2WSCE 1VQKQ 3CCLA 2DL8A 4ZGDB 1X01A 4ZGEB 1H3HA 5IXBA 2I0NA 4QVDA 3TVTA 1K8AC 4BY6B 3MP8A 1D3BA 1KQ1A 2FPDA 1LOJA 1MNDA 3SD4A 4MDWA 1W2BP 3QSUA 2KRNA 4C92B 3S3MA 1PRMC 3I55T 1UG1A 1WX6A 1KQSA 3GLXA 1YJWT 1H8KA 2E4HA 4X34A 2O2OA 2VASA 2KRSA 4LD9K 1M1KC 3CCLT 1LJOA 3JCMc 4OMFB 1QCFA 4DOWA 4E7KA 1QMCA 1HYOA 4ORZA 1WJQA 1VQLQ 2EQJA 2AKKA 1VQ7A 3SDZA 4PJLA 1JJ2A 3NGPA 2ZAEA 4WF2A 3MCAB 4CRIA 1UDLA 1W70A 2DD5A 5KYYB 3OA6A 2EYWA 4R56A 4L59A 1X43A 3X24B 1GL5A 2B8AA 1IGUA 5CKBA 3H0IA 4YTLA 4IIMA 1YI2A 4NL3A 1RAAB 4OGCA 3NHNA 3PTAA 3FIFA 2JW4A 3HFNA 3D7SB 2HSEB 4PJOA 2E64A 2DZ9A 3NTIA 1VQ7T 1UGSB 2DXCA 1K73C 3L2VA 4J9BA 3V7CA 3MP6A 3E9GA 3QJYA 1M30A 2L89A 2DL5A 4C0FA 2RJEA 4KRTA 4FM4B 2DBMA 2RHXA 3RKYA 2ECZA 2MWPA 1YI2T
chains in the Genus database with same CATH topology
4QVZA 2MMPA 3OB9A 3RERA 1N9RA 4C8QB 5GAN2 2K2VA 1H641 3OQ5A 3HKSA 3I56A 2HAXA 1M90U 2HQEA 1VQNT 4RCBA 4C92D 4HT9A 4OGEA 2JTFA 4BACA 1WNLA 4M75B 3QPHA 3WVEB 2BUDA 4M77A 4DOVA 4R55A 5EG2A 3VUZA 5A0DA 4XTUA 1Q82C 2O4XB 2QI2A 4M77E 3GIBA 2LRQA 5GMKm 3O8VA 5M9OA 3OYJA 3JCMX 1NJIC 2QQSA 3ER0A 4C5IA 4LDWA 5HK0A 3OYBA 1Q81U 2K57A 2GF7A 2RJDA 5IN1A 4C8QF 1KHCA 3INZA 4JRIA 4HCCA 1U1SA 1YHQT 3NTHA 1RL2A 3KXTA 2XICA 1H3ZA 2FHDA 1YJNT 1AHJB 4BE2A 2F69A 3Q1JA 4FU6A 3CPWA 5GANj 3TEEA 1BKBA 3HP9A 3VKIA 1U1TA 2JVVA 3QZ5B 5LJ3h 1SSFA 4XTYA 2VUBA 2ZCFB 3FLGA 3I56T 3M4YA 3CXCA 2XDDA 2Y4XA 2DTHA 4OB2B 5CQXA 3HL8A 3CC2A 5LJ3f 4M7DG 4L6V5 4ATOA 4X9DA 5FU6B 1HK9A 1N9SA 1ZQ1A 3LGFA 3V8KA 2A3LA 3VV0A 1BIAA 3T9NA 5CIUA 2RHZA 3RMSA 3CC4A 2VGNA 3OMCA 3A8MB 3G4ST 4EMKA 1YJ9A 3RKXA 5DLQE 1G3SA 2DTIA 1NPRA 3JB9D 3QUIA 4PNOA 2P4TA 4A54A 5LJ3e 4M7DA 4QVCA 4KUDK 2LQKA 3V8LA 1BI2A 4C8QC 3GNFB 4M7DE 3META 1BYMA 2H3JA 1DJ7B 4P5NA 4XK8E 1JB0E 3P8BB 4XQ3A 2QA4A 2CZ1B 2GFAA 2KSSA 3H8ZA 2VC8A 3RUXA 5HK3A 1VQPA 2EJ9A 3MEAA 4ELYC 2MWOA 3QHSA 3P8DA 3LWIA 3C4SA 3CC2T 1M4ZA 2M1HA 2DAQA 2DPPB 4HA8A 4M7AD 3CCVA 5CAIA 4PLLA 5D6XA 1KD1C 2ZPEB 4IURA 1N8RC 3OY9A 3JCMJ 1Q86U 1Y96A 4XAXB 4A4FA 4BUGA 3E19A 5L8RE 3CC4T 4LD6A 5KH6A 3M5AA 1K73U 4M7DF 1EIFA 2LQ8A 2DXTA 1GXIE 4C92E 3TCJA 1YJ9T 2EYQA 2RI5A 1VQ4A 2FYKA 3OSVA 3C12A 1O9SA 2EKOA 5CKFA 3NTKA 4BDZA 4IUQA 1WPYA 4M75D 5GAOm 3X25B 5GMKh 4N0AA 2PVGB 2VV5A 1K9MC 2QA4T 2E6ZA 5FRMA 3VUBA 2PQWA 2E5QA 3CCEA 2GFUA 5CKHA 5LJ5j 1VQPT 1YBYA 2KQWA 2QXFA 4IUTA 4IUPA 3OYCA 3G6EA 3GNGA 1G3TA 2WSEE 4OP0A 4XTZA 3ZBDA 1Q7YC 1X6OA 3BDLA 3CCVT 3DLLA 1OZ2A 3J81E 3L2UA 3V7SA 2OTLA 4OB1B 3OS2A 3OYMA 3X28B 1I8FA 4QQDA 2XIDA 2EJGA 1VIEA 1KC8U 2KVQG 2DTOA 5IT9E 3KBGA 3OYDA 2K5FA 2M16A 2X35A 2HNIA 5LJ3g 2CKKA 2EQKA 2BIVA 3HFOA 3E9FA 1UEBA 3M58A 1VQ4T 1VQMA 4PJOB 3UPUA 1HXDA 3FB9A 3JB9H 2JUFA 4J5YA 4M7DC 3L42A 2XHCA 3RKWA 3X26B 3M54A 4GLKA 4X9CA 3ME9A 3CCSA 5GAN8 2X4YA 2XD0A 4FT4A 3EFSA 4RCCA 4J7FA 3CCET 1KQ2A 2F5KA 2FB7A 4E47A 5D6YA 2ZPHB 4HCZA 4Z02A 1YITA 1YHQA 5LL6S 4BD3A 3FEOA 5GAN3 3PIOA 2QQBA 2VYTA 5GAOn 4PJOF 2QQ9A 3M56A 3M55A 3QXEB 1WJRA 1NPPA 2KK4A 2L3RA 4C5GA 4E7JA 1W2BS 2OTLT 3PMTA 3F70A 4DA4A 4FT2A 1OYXA 2R58A 2VXFA 4GY5A 5CK9A 1VQ5A 3GF5A 3SWNA 1QVGS 1XNIA 4D6WA 4O5VA 1Y71A 3CMAA 4BI4A 3RIRA 2YLBA 4A4GA 3CD6A 5GAOl 5CQYA 3CBMA 5GANd 4M7AE 2DJZA 2LDMA 3SWNB 3GP8A 1K8AU 4XU0A 1VQMT 1QVFS 1JRIA 5FROA 4M78G 3G71A 4M77B 5AYFA 3OS1A 4JS5A 1VQ9A 2X4WA 3FC3A 3G4SA 4V2SA 1FWZA 4JLIA 1WQWA 3CCST 3PMIA 3CC7A 4C0GA 3E1SA 1YITT 4O6JA 2P0KA 4JRQA 3QKJA 5CO7A 5GAMd 2QDYB 3LGLA 5J26A 1QVPA 3HRUA 4C5EA 2V8IA 2VGMA 2RB6A 3DB3A 4M75E 2E70A 5DY9A 3MEWA 4M77F 1M9SA 1M1KU 4M78A 2YHTA 3VJPA 2DVEA 3KUFA 1BI0A 1NZ9A 2RM4A 1VQ5T 1R8OB 4M78E 2CZ0B 1FX7A 3RESA 3CMAT 3CD6T 4PJOC 2QTXA 2E6NA 2CZ7B 2JZ2A 4J6XA 3WXMB 4JRKA 1VQKA 3QG1A 4A53A 4RG8A 1OZ3A 3GPLA 2HD0A 4MZTA 3JCMb 5C6SA 3G71T 1VQ9T 3PT9A 4ZTJA 3JAME 4ZGJB 3PNWC 4OB0B 3ZEHA 2RO0A 1BI1A 4TVRA 2YRVA 2ZPIB 2C06A 3CC7T 3L2WA 1I4K1 3JRZA 3VYHB 3CBPA 4Q5WA 4ME7A 3S3OA 4IKFA 2BKDN 4II1A 5GAN6 2D6FA 4EMKB 1ZHIA 2EQUA 3OYLA 2WACA 4C92G 4JDSA 5GANg 2RD1A 3WVDB 5CKEA 1YIJA 4PJOD 2PU9B 5FRNA 4OVAA 1BI3A 3CMEA 3J7AF 4M7DB 2LNVA 4OB3B 1P92A 3SWNC 5GMKl 4E7IA 3OYEA 5GAN5 1M90C 4Y91A 4F7UG 4VUBA 2KMTA 3OYHA 3LWHA 4M77C 5KE3A 1VQKT 3AHUA 3UT1A 5LJ5d 3TREA 4EDUA 5CR2A 4C92A 5GAMg 4XTVA 4A4KA 3RMQA 3ZFJA 3CCRA 4LDUA 1Y96B 3P8HA 1Q81C 3MP1A 1VQLA 4C8QD 1NE8A 2OAUA 2PVDB 1N6AA 2D0QB 2XDPA 1N27A 1G3YA 4F7UA 2RI2A 4FIBA 1YIJT 1W2BA 4MDXA 4F7UE 3JCMP 4CI0C 3CMET 2Y90A 3R6OA 4L5GA 3L2ZA 4EPCA 1TH7A 3A8HB 4M78C 2LTOA 4M77D 4E7HA 2R5MA 3LW5E 5HKCA 1QVGA 2IG0A 2WSFE 2K3YA 3C95A 4C92F 1W4SA 4QQ6A 4RMOA 2DO3A 4M7AA 1UGRB 3QIIA 5LJ3j 1QVFA 3CEYA 3CCJA 3LX7A 1X75C 3LLRA 4KBMB 2XU8A 4NL2A 1Q82U 4BI8B 2NLUA 3JCMd 4BB7A 3BDUA 3JB9G 3CCRT 4J7IA 1O75A 3OYGA 4F7UF 1NJIU 1KG1A 1LNXA 5CVIA 3OYIA 4IUUA 1OI1A 3OBWA 2LCCA 4EMKC 3OS0A 2X4XA 1VQLT 2ZZDA 5D6WA 4LDYA 5HY6A 5GMKe 4ZTFA 1M1GA 2V8JA 3M9QA 2QEXA 2K4YA 2G3RA 2RHIA 5GANh 3L2RA 2LT4A 4KUIA 4MZMA 2E12A 2E65A 2MF2A 3EFRA 3PGGA 2KAFA 4C0DC 1PSFA 4M7AG 1BIBA 5GANf 5A2QE 3CBOA 3EAEA 4LDVA 2GCXA 2ZPGB 3G7ZA 5LJ5g 4HCBA 4JLGA 3JCMQ 3VYGA 3SB2A 2MI6A 2IVWA 2V8KA 3BW1A 2E10A 4C5HA 2RHYA 1U8RA 1KQSS 3DLMA 5IAYA 3PFSA 1WGSA 2RH2A 1QP2A 1IZ6A 2DXUA 2Y4YA 5GAMh 3CCJT 5I21A 5DLOA 2M9UA 4BI3A 3A8LB 2QQRA 3OYYA 3FRNA 4C8QG 3VU3C 4MMKA 4C92C 2EAYA 2EQMA 3QBYA 2I2LA 3L1AA 4J6WA 5GAMf 3OMGA 2MAMA 3M4GA 5GANe 2YLCA 4M75G 4EMHA 4HT8A 1B34A 4M7DD 2K5IA 3V8JA 5GAOp 1V29B 3LYIA 2QEXT 2P0PA 1Y07A 2DKGA 2EWNA 3BY7A 5FU7C 3OW2S 4C0ZA 1VQ7A 4J83A 1JJ2S 3QZ9B 1Y7XA 3OSSC 4XU2A 1QW1A 5FLXE 3MHXA 4N0AC 3OYNA 4BE1A 1MHNA 4UC4A 4N4HA 1WQ7A 3V7RA 1G3WA 3M53A 2X4JA 5GAMe 4C8QE 2F5TX 3A8GB 4M75A 3JCMg 2DIQA 2JN0A 4FL6A 4N4IA 4XU3A 4EMGA 5GMKj 5C0MA 3CCUA 4M7AF 2RJCA 2KDSA 5CCAA 2O4XA 1KD1U 2QQAA 2D9TA 3OYFA 3OS5A 1N8RU 1XTDA 2L5QA 3ASKA 3BFMA 2KY9A 1KC8C 3S3NA 3A5ZB 4JRPA 5CKDA 1M5Q1 4M78B 4JS4A 3GOXA 2RK2A 3S6WA 3FDRA 3PIPA 1I5LA 1G5VA 1VUBA 2PVOB 4BDYA 4ELZC 5KE2A 2DD4A 2EJFA 4J8OA 3A8OB 4M75F 2VXEA 4FSXA 2ZPBB 4NOYA 5LJ5h 5GAOq 3J80E 3JB9I 1K9MU 2RK1A 2A7YA 3CPFA 1I81A 3QJ6A 3MO8A 3CCQA 1ZBXA 2LC4A 1XOVA 5I2MA 3JCMV 2JOYA 2RA2A 5LJ5f 3JCMW 4M78F 3I55A 2XI9A 3HHTB 4HKEA 1MGQA 4NS5A 2E41A 3NFCA 1JBMA 3CCUT 1Q7YU 3DB4A 1YJWA 5KCHA 4PKCC 1UB4A 2M0OA 1IREB 1XQHA 2CYZB 5KCOA 5J39A 2WSCE 3CCLA 4C0DB 2R57A 4M7AC 3JSCA 4ZGDB 1X01A 1YCYA 3MEUA 4OF1A 5GAMj 4E7LA 2XG8D 4ZGEB 3UWNA 2LT1A 4QW2A 5LJ5e 4MMLA 4QVDA 4B9XA 2AHJB 5GAOr 1K8AC 3HSBA 2FL7A 4A4EA 4BY6B 1D3BA 3MP8A 2O01E 1KQ1A 2HQXA 1LOJA 2ZPFB 4PLIA 3SD4A 2DEQA 3HRTA 1VQOA 3N5BB 4MDWA 4MZPA 3QDRB 5LJ3d 1D3BB 3JCMh 3QSUA 4C92B 3S3MA 3CCQT 3HPWA 2RHUA 4XTWA 4BE0A 2XK0A 3I55T 4M75C 3JCMf 2DIGA 5GAN7 2JTMA 1KQSA 3GLXA 1YJWT 1VQ8A 4X34A 2CS7A 2OTJA 3QYHB 2DZCA 5FU7B 1S72A 4LD9K 4F7UB 3CPWS 1UGQB 1UGPB 2K5LA 1M1KC 5GAN4 3CCLT 1LJOA 3LH0A 4ZN3A 3JB9J 3MEVA 3JCMc 4OMFB 2L8DA 4E7KA 4DOWA 2EIFA 3CXCS 4QQGA 3SFMA 3TU4K 1WJQA 4XU1A 2EFIA 4B9WA 3JCMe 2RJFA 2LVMA 2EQJA 2LX9A 2K3XA 2R5AA 4IUVA 3SDZA 3CCMA 3OW2A 1JJ2A 4KULA 1VQOT 3UDCA 1KHIA 2JNGA 2ZGWA 2GQVA 4WF2A 3MCAB 3QO3A 4PJOG 4CRIA 2E1HA 3QYGB 2DD5A 5DM7R 3URGA 2FVUA 3OA6A 4M78D 5FU6C 4R56A 4L59A 3X24B 1VQ8T 2B8AA 5CKBA 4ZN1A 2OTJT 3OBYA 1S72T 1VQ6A 1QP3A 4YTLA 3X20B 3OYKA 1RI0A 2PUKB 2DXBA 4NL3A 1YI2A 1VIFA 1M8VA 4OGCA 3PTAA 1M1FA 3HRSA 3FIFA 5GMKi 3HFNA 4BY6C 3OYAA 2XKOC 1VQNA 4PJOA 4Y28E 4DQ2A 1WJSA 2DK3A 2CZ6B 2E64A 1FXXA 4PJOE 2DZ9A 4RG2A 2RI3A 4J6YA 3NTIA 4JJNK 1Q86C 1VQ7T 3FJPA 1UGSB 2DXCA 3M57A 2PUOB 3CCMT 4PL6A 4A4HA 2CGHA 4JUVA 4KT0E 1PSEA 3DKMA 4N4GA 3L2VA 3V7CA 1K73C 3H6ZA 3MP6A 3E9GA 5A0GA 3QJYA 4LDXA 5A0LA 2L89A 4M7AB 4XTXA 4C0FA 3C94A 2RJEA 1B34B 4M77G 3JB9F 4FM4B 5J3BA 2HBPA 3G6ET 2LCLA 2P0QA 1YJNA 2RHXA 3M59A 1VQ6T 2XDBA 3RKYA 4C8QA 5I2SA 2MWPA 3L2QA 1YI2T 4RKUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPF A;  3KBG A;  3CCR A;  5IT9 E;  3CCQ A;  1Q81 C;  3I56 A;  2JOY A;  3HKS A;  1VQL A;  1M90 U;  2CKK A;  3I55 A;  1VQN T;  3CCU T;  1UEB A;  1Q7Y U;  3DB4 A;  1VQ4 T;  1YJW A;  1VQM A;  2JUF A;  2XHC A;  1YIJ T;  1W2B A;  1Q82 C;  3CME T;  3CCL A;  1NJI C;  3CCS A;  3ER0 A;  1Q81 U;  1QVG A;  3CCE T;  2IG0 A;  1YHQ A;  1YIT A;  5LL6 S;  1YHQ T;  2DO3 A;  1K8A C;  1QVF A;  1RL2 A;  3PIO A;  3CCJ A;  2OTL T;  1YJN T;  1NPP A;  1W2B S;  2L3R A;  1Q82 U;  3CPW A;  1VQO A;  1BKB A;  1NJI U;  3CCR T;  1VQ5 A;  2JVV A;  1QVG S;  1XNI A;  3CCQ T;  1SSF A;  3I56 T;  3CMA A;  3CD6 A;  1VQL T;  3CXC A;  3I55 T;  5HY6 A;  1M1G A;  3CC2 A;  1QVF S;  2QEX A;  1KC8 U;  2G3R A;  1K8A U;  1YJW T;  1VQM T;  1KQS A;  4X34 A;  1VQ8 A;  2OTJ A;  3LGF A;  1S72 A;  3G71 A;  1VQ9 A;  3CPW S;  5A2Q E;  1M1K C;  3G4S A;  3CCL T;  3LH0 A;  3CC4 A;  4ZN3 A;  3CCS T;  3G4S T;  3CC7 A;  2EIF A;  3CXC S;  2MI6 A;  1YIT T;  1YJ9 A;  5DLQ E;  1KQS S;  5IAY A;  1NPR A;  3LGL A;  1IZ6 A;  5J26 A;  3CCJ T;  2LVM A;  3OW2 A;  3CCM A;  3DB3 A;  1VQ7 A;  2E70 A;  3OYY A;  1JJ2 A;  1M1K U;  1VQO T;  1KHI A;  2JNG A;  1NZ9 A;  3P8B B;  2QA4 A;  1VQ5 T;  1VQP A;  4CRI A;  3CMA T;  3CD6 T;  2MWO A;  5DM7 R;  3CC2 T;  2QEX T;  1VQK A;  3CCV A;  1VQ8 T;  4ZN1 A;  3OW2 S;  1KD1 C;  2OTJ T;  1S72 T;  1JJ2 S;  1VQ6 A;  3G71 T;  1N8R C;  1VQ9 T;  4YTL A;  5FLX E;  1Q86 U;  3JAM E;  1YI2 A;  3CC4 T;  4TVR A;  1K73 U;  3CC7 T;  2LQ8 A;  1EIF A;  1VQN A;  1YJ9 T;  3CCU A;  1VQ4 A;  2KDS A;  1KD1 U;  4RG2 A;  1Q86 C;  1N8R U;  3CCM T;  1VQ7 T;  1XTD A;  1YIJ A;  3CME A;  3J7A F;  1KC8 C;  1K9M C;  1K73 C;  3A5Z B;  2QA4 T;  2E6Z A;  3CCE A;  1VQP T;  1YBY A;  1M90 C;  3PIP A;  3G6E A;  1Q7Y C;  1VQK T;  1X6O A;  5J3B A;  3CCV T;  3DLL A;  3G6E T;  3J81 E;  2LCL A;  2OTL A;  1YJN A;  1VQ6 T;  4QQD A;  3J80 E;  3TRE A;  2MWP A;  1K9M U;  1YI2 T;  2KVQ G; 
#chains in the Genus database with same CATH topology
 1U06 A;  3OB9 A;  3RER A;  1N9R A;  5GAN 2;  4FYY B;  1WHM A;  2GQI A;  2K79 A;  2EGA A;  1KSW A;  4OMQ A;  5KYU A;  3GIB A;  2O4X B;  5M9O A;  2NUT A;  3OYJ A;  4C5I A;  5HK0 A;  1JO8 A;  2RJD A;  4CC7 A;  1N8R R;  1KHC A;  3EH1 A;  3INZ A;  3GBQ A;  2FZG B;  1YHQ T;  2FHD A;  3EG3 A;  3CPW A;  1BKB A;  3HP9 A;  1TUC A;  2BTT A;  3CC2 A;  4ATO A;  1HK9 A;  1N9S A;  2A3L A;  1BIA A;  1Q7Y R;  3RMS A;  3G4S T;  4J9F A;  5DLQ E;  1G3S A;  1NPR A;  3JB9 D;  1GCQ C;  3I55 Q;  4KUD K;  1SF9 A;  3V8L A;  1BI2 A;  1AWO A;  1BYM A;  1YJW Q;  2H3J A;  4P5N A;  3P8B B;  2GFA A;  2CH4 W;  1CSK A;  2EJ9 A;  1T0J A;  1AWJ A;  3CQT A;  3CC2 T;  3CCL Q;  1KD1 C;  4DBF A;  2ZPE B;  3JCM J;  2RQW A;  3E19 A;  4RTY A;  5KH6 A;  2QGF B;  3M5A A;  4M7D F;  1GCP A;  4C92 E;  2EYQ A;  4R0K A;  1VQ4 A;  4RTW A;  4IUQ A;  4BDZ A;  3O5Z A;  3X25 B;  5GMK h;  2PVG B;  1K9A A;  3VUB A;  2PQW A;  3CCE A;  2RQR A;  3OYC A;  3G6E A;  1G3T A;  1X6O A;  8AT1 B;  1OZ2 A;  3H0H A;  4OB1 B;  3OYM A;  1TUD A;  1OEB A;  2NUZ A;  2EJG A;  1EZZ B;  3I5S A;  5IT9 E;  3KBG A;  2D8H A;  2K5F A;  2M16 A;  2X35 A;  1VQ7 Q;  2BIV A;  1QWF A;  3M58 A;  1VQ4 T;  1VQM A;  4PJO B;  1I07 A;  1RAC B;  2HMA A;  2FPF A;  3L42 A;  3X26 B;  3SHW A;  3CCS A;  2EYZ A;  2X4Y A;  4RCC A;  3CCE T;  1KQ2 A;  4Z02 A;  4HCZ A;  1YI2 Q;  2QQB A;  1OU9 A;  2VYT A;  5ECA A;  1D1A A;  4PJO F;  5GAO n;  3QXE B;  1WJR A;  1NPP A;  1MNE A;  2MCN A;  3F70 A;  1OYX A;  3SWN A;  1XNI A;  4D6W A;  1Y71 A;  3CMA A;  2CP3 A;  4A4G A;  3CBM A;  1UEC A;  5GAN d;  5HCK A;  2LDM A;  1K8A U;  1VQM T;  4AT1 B;  2JM9 A;  1HD3 A;  1VQ9 A;  1M90 R;  3OS1 A;  2HKQ B;  1K1Z A;  1AZE A;  1YHQ Q;  3FC3 A;  5KYU B;  4V2S A;  3CCS T;  3CC7 A;  3KFV A;  2NUT B;  3E1S A;  1NLP C;  2P0K A;  4JRQ A;  5CO7 A;  3VS1 A;  5J26 A;  1BCM A;  3HRU A;  1WXB A;  3SEM A;  4C5E A;  1M1K U;  1M9S A;  2YHT A;  3I9Q A;  1JXO A;  3VS0 A;  3CMA T;  2CZ0 B;  2QTX A;  2ED0 A;  1GBR A;  3G4S Q;  1AOJ A;  2KNB B;  1VQ9 T;  1IO6 A;  3PNW C;  3EGD A;  2AZS A;  3ZEH A;  1BI1 A;  2COY A;  2C06 A;  3CC7 T;  4F04 B;  3S3O A;  3JRZ A;  2HSP A;  2H8H A;  4AFU C;  5FW9 A;  2WAC A;  2YUQ A;  2HZY A;  5GAN g;  3WVD B;  3CC2 Q;  4OVA A;  3CME A;  1ZUU A;  4OB3 B;  5GMK l;  3FJ5 A;  3OYE A;  4Y91 A;  3AHU A;  1V1C A;  2KXD A;  1MMD A;  4RUG A;  4XTV A;  3CCR A;  3RMQ A;  1NLO C;  4LDU A;  2KBT A;  3MP1 A;  2DLP A;  2XDP A;  1U3O A;  3JV3 A;  4F7U A;  1K73 R;  4FW1 A;  4AG2 C;  1MUZ A;  4MDX A;  3JCM P;  4IIO A;  3TQ7 P;  3CME T;  1ARK A;  2WSF E;  3PVQ A;  3CCJ A;  4KBM B;  2FG0 A;  1VQ4 Q;  3CCR T;  1B07 A;  2B86 A;  3OS0 A;  2X4X A;  2FRY A;  2DIL A;  5HY6 A;  5GMK e;  4ZTF A;  3M9Q A;  2V8J A;  1KC8 R;  5GAN h;  3L2R A;  4KUI A;  4MZM A;  2YUP A;  2RNA A;  3CCE Q;  4RTT A;  4C0D C;  4M7A G;  5GAN f;  4JJC A;  3CBO A;  4FYX B;  3G7Z A;  1X69 A;  2KYM A;  4HCB A;  2EPD A;  3A1P A;  2V8K A;  1KQS S;  2CP5 A;  1ZUK A;  3CCJ T;  5DLO A;  3OYY A;  4QKU A;  1X2Q A;  2EAY A;  1VQM Q;  4HT8 A;  1GRI A;  1V29 B;  3CCS Q;  2JS2 A;  2A28 A;  1JJ2 S;  3QZ9 B;  2V1R A;  1TOV A;  1WQ7 A;  2JMA A;  1G3W A;  5GAM e;  4M75 A;  2JN0 A;  3RDV A;  1KD1 U;  2QQA A;  3CMA Q;  1XTD A;  1T3L A;  2SEM A;  3A5Z B;  3S3N A;  1M5Q 1;  2JM8 A;  1VQ9 Q;  3CC7 Q;  8ATC B;  2LP5 A;  2L3Q A;  2EJF A;  3A8O B;  3J80 E;  4NOY A;  2VXE A;  4FSX A;  3H41 A;  5GAO q;  2AKL A;  4KH0 B;  2YT6 A;  2OJ2 A;  1ZBX A;  2LC4 A;  3EGD B;  2XI9 A;  3QWY A;  2HCK A;  3DB4 A;  2VKN A;  4PKC C;  1M3C A;  1IRE B;  2FZK B;  1XQH A;  3EHR A;  4M7A C;  4OF1 A;  3UWN A;  4PLI A;  1NYF A;  2ZPF B;  1VQO A;  2COW A;  2E3I A;  2GTO A;  5L23 A;  2AZV A;  4BE0 A;  3CME Q;  5GAN 7;  2DEU A;  3UA6 A;  4FYW B;  2CS7 A;  2OTJ A;  1QVF P;  4F7U B;  3CPW S;  1AD5 A;  1UGP B;  2K5L A;  1UUE A;  2YUO A;  3LH0 A;  3JB9 J;  2L2P A;  3MEV A;  3CCR Q;  2RJF A;  3OW2 A;  3CCM A;  2NWM A;  2LJ0 A;  1ZUY A;  1VQO T;  2JNG A;  3M0Q A;  3QYG B;  5DM7 R;  3URG A;  1BK2 A;  1NJI R;  1NM7 A;  2A37 A;  2OTJ T;  3OBY A;  1QP3 A;  1G8X A;  3H0F A;  1D0X A;  2PUK B;  2DXB A;  1M8V A;  3CCJ Q;  4LN2 A;  3OYA A;  3EFO A;  4F16 A;  1Z9Z A;  2XKO C;  1VQN A;  3G1J A;  2CZ6 B;  3ULR B;  4J6Y A;  4JJN K;  3FJP A;  3CCM T;  4JZ3 A;  2PUO B;  4JUV A;  4KT0 E;  1PSE A;  4N4G A;  2JJ9 A;  1D0Z A;  4M77 G;  4GLM A;  1C1A A;  2RN8 A;  1PHT A;  2P0Q A;  1YJN A;  1AZG B;  5I2S A;  4KGX B;  2O31 A;  2K2V A;  2GGR A;  3NMZ C;  3A98 A;  3I56 A;  1VQN T;  4HT9 A;  2JTF A;  4BAC A;  2CT4 A;  4M75 B;  2CSQ A;  4R55 A;  3VUZ A;  5A0D A;  1G2B A;  1Q82 C;  4M77 E;  3JCM X;  4LDW A;  3OYB A;  2GF7 A;  1D0Y A;  1TTH B;  4DEX A;  1B3Q A;  2GTJ A;  1RL2 A;  4KGV B;  5GJV B;  2XIC A;  1YJN T;  5KYW B;  1A0N B;  2OAW A;  4FU6 A;  3VKI A;  2LMJ A;  3ZL7 C;  1SSF A;  3I56 T;  2ZCF B;  3FLG A;  3VS5 A;  3CXC A;  2Y4X A;  2MYS A;  3HL8 A;  1KIK A;  4X9D A;  5FU6 B;  2C0I A;  1ZQ1 A;  3RR6 A;  3VV0 A;  1RLQ C;  2CT3 A;  5CIU A;  3UA7 A;  2RHZ A;  4PJM A;  2DTI A;  1T0H A;  4LNP A;  2M51 A;  3QUI A;  4PNO A;  4M7D A;  5LJ3 e;  4QVC A;  4C8Q C;  4AG1 C;  4XK8 E;  1DJ7 B;  2K2M A;  2CZ1 B;  2KSS A;  1QVG P;  2MWO A;  3QHS A;  1YCS B;  3P8D A;  4CC2 A;  2BZX A;  4M7A D;  1MMA A;  4PLL A;  3QWX X;  4E7S A;  3OY9 A;  1Q86 U;  1HSQ A;  1Y96 A;  4BUG A;  1OPL A;  1IB8 A;  2LQ8 A;  1NEG A;  1TSF A;  3TCJ A;  1VQO Q;  2J6F A;  3C12 A;  4K11 A;  5CKF A;  3NTK A;  4E6R A;  2KRO A;  5GAO m;  1SRM A;  1UJ0 A;  1K9M C;  1WA7 A;  2E6Z A;  2O88 A;  2OTJ Q;  2GFU A;  5CKH A;  5LJ5 j;  3U23 A;  4IUP A;  3GNG A;  2WSE E;  1T3S A;  2XID A;  1IRX A;  1WZO A;  1LPL A;  2DTO A;  2KVQ G;  1AWW A;  1K0S A;  3CCM Q;  2CKK A;  2EQK A;  4F14 A;  3EFO B;  3E2U A;  1HXD A;  3FB9 A;  1S1N A;  1WHK A;  4OMN A;  3ME9 A;  2XD0 A;  4FT4 A;  3EFS A;  4J7F A;  1YHQ A;  2ZPH B;  4M4Z A;  1YIT A;  1RAI B;  1WHG A;  3M56 A;  3M55 A;  4E7J A;  4E7Z A;  1VQN Q;  1ZSZ C;  3PMT A;  2R58 A;  4GY5 A;  1VQ5 A;  3GF5 A;  1QKW A;  5GAO l;  3GP8 A;  3VS7 A;  1C6V X;  1JRI A;  3G71 A;  4M78 G;  1W1F A;  2X4W A;  3G4S A;  4JLI A;  1YJN Q;  4C0G A;  9ATC B;  2L3P A;  1Z9Q A;  5KYN A;  2DM1 A;  1YIT T;  4DBQ A;  3EG1 A;  3QKJ A;  5GAM d;  1MMG A;  3I56 Q;  2V8I A;  2VGM A;  4M75 E;  2MPX C;  1I5O B;  2DVE A;  1VQ5 T;  1QLY A;  4M78 E;  1FX7 A;  1K0X A;  2JZ2 A;  2E3H A;  1R0B G;  3EGX A;  4MZT A;  3G71 T;  2J6K A;  4TVR A;  4J9I A;  1I4K 1;  4IKF A;  4ME7 A;  1M2O A;  4II1 A;  1BBZ A;  2D6F A;  4C92 G;  4JDS A;  1YIJ A;  5CKE A;  5FRN A;  4M7D B;  2LNV A;  2QAS A;  5GAN 5;  3OYH A;  5KE3 A;  3BE3 A;  4EDU A;  5GAM g;  3ZFJ A;  1Y96 B;  1Q81 C;  4C8Q D;  1NE8 A;  2PVD B;  1WHH A;  1N6A A;  2D0Q B;  4B6M A;  2RI2 A;  1HJD A;  1UGV A;  1WFW A;  1YIJ T;  1W2B A;  1M27 C;  1R0C B;  3R6O A;  1TH7 A;  3A8H B;  4M78 C;  4M77 D;  1QVG A;  2IG0 A;  3C95 A;  2DJQ A;  1PC0 A;  1UGR B;  1Q82 U;  4HXJ A;  4NL2 A;  3PVL A;  2QAZ A;  5IHN A;  3BDU A;  4BB7 A;  3OYI A;  1NBE B;  3OBW A;  5D6W A;  2QEX A;  1WDX A;  2RHI A;  2E12 A;  3PGG A;  1M3B A;  1BIB A;  3EAE A;  2GCX A;  2HDA A;  1SRL A;  3SB2 A;  2IVW A;  4C5H A;  2DA9 A;  5IAY A;  2OX7 A;  2O9V A;  2RH2 A;  1BU1 A;  1QP2 A;  2Y4Y A;  5GAM h;  4BI3 A;  1OV3 A;  4MMK A;  4C92 C;  2EQM A;  5GAM f;  3QBY A;  3L1A A;  3OMG A;  3M4G A;  2YLC A;  2K5I A;  2BE7 D;  2QEX T;  3BY7 A;  2VWF A;  3OW2 S;  1YIT Q;  1Y7X A;  3OYN A;  5FLX E;  4BE1 A;  2DL7 A;  1RLP C;  2JXB A;  1K8A R;  4J9H A;  6AT1 B;  2RPN A;  3M0R A;  1PKS A;  2DIQ A;  4FL6 A;  5GMK j;  3CCU A;  3I35 A;  1VQ5 Q;  4M7A F;  2RJC A;  2KDS A;  5CCA A;  1J3T A;  3EG2 A;  1QCN A;  2RQU A;  7AT1 B;  3OS5 A;  3ASK A;  4JS4 A;  3G71 Q;  1M1K R;  1I5L A;  1G5V A;  1VUB A;  4BDY A;  4ELZ C;  2DD4 A;  1TU0 B;  1LVK A;  3EGX B;  1K9M U;  1I81 A;  3QJ6 A;  2LJ1 A;  3MO8 A;  3CCQ A;  2CRE A;  1WXU A;  4NS5 A;  3CCU T;  2YWW A;  3TSZ A;  1UB4 A;  1OPK A;  5KCO A;  5J39 A;  2ESW A;  2R57 A;  3JSC A;  1RAE B;  5GAM j;  5FWB A;  4QW2 A;  4MML A;  2QG9 B;  2GBQ A;  2DL3 A;  4Z8A A;  2K3B A;  4B9X A;  5GAO r;  4A4E A;  4HVV A;  2O01 E;  2HQX A;  2L0A A;  2M02 A;  3HRT A;  1WLP B;  4MZP A;  3QDR B;  5LJ3 d;  1D1B A;  3CCQ T;  1E6H A;  3HPW A;  1YIJ Q;  1WHJ A;  2DIG A;  3R6N A;  2JTM A;  5AT1 B;  2KI7 A;  2DZC A;  5FU7 B;  3UAT A;  1WIE A;  2CP2 A;  2DL4 A;  1TXQ A;  4ZN3 A;  3RBB B;  2L8D A;  3CXC S;  4QQG A;  2DNU A;  2BZY A;  4XU1 A;  4B9W A;  3JCM e;  1PD1 A;  2LX9 A;  3VS6 A;  4KUL A;  4RTU A;  1N5Z A;  4PJO G;  2FEI A;  2E1H A;  2FVU A;  4M78 D;  1UJY A;  2YRD A;  2K9G A;  1PM3 A;  1VQ6 A;  1RAD B;  3X20 B;  2C0T A;  3H9N A;  3HRS A;  5GMK i;  4Y28 E;  4DQ2 A;  2DK3 A;  3PE0 A;  1FXX A;  2EYX A;  4PJO E;  1Q86 C;  2ROT A;  1RAF B;  2QEX Q;  3DKM A;  5IH2 A;  2DMO A;  2HBW A;  1WYX A;  3H6Z A;  4LDX A;  5A0L A;  4XTX A;  2HKN A;  1PD0 A;  3JB9 F;  1GCQ A;  4JJD A;  4JJB A;  1VOM A;  1PNJ A;  1M3A A;  2LCL A;  3M59 A;  4EIK A;  2QGG A;  1VQ6 T;  2XDB A;  2LNH B;  2YXY A;  1QQJ A;  2MMP A;  3MJX A;  3IQL A;  4C8Q B;  3OQ5 A;  1PCX A;  4RCB A;  4C92 D;  2CUD A;  3WVE B;  3QPH A;  2BUD A;  2AK5 A;  1ABO A;  2LRQ A;  2F2W A;  2QQS A;  3ER0 A;  1Q81 U;  1KD1 R;  2K57 A;  5IN1 A;  4C8Q F;  1RAB B;  4JRI A;  1QWE A;  5KYW A;  2LCS A;  1U1S A;  4HCC A;  2CUB A;  3KXT A;  1OQK A;  1H3Z A;  1AWX A;  1AHJ B;  4BE2 A;  3Q1J A;  1OOT A;  3CCU Q;  5GAN j;  3TEE A;  3QZ5 B;  5LJ3 h;  2VUB A;  4PFZ A;  2XDD A;  5LJ3 f;  4L6V 5;  1G83 A;  1VA7 A;  2A0F B;  2G6F X;  3T9N A;  1IGQ A;  2VGN A;  3MPU B;  4FCY A;  3A8M B;  2D8J A;  1K4U S;  4WCI A;  2KGT A;  1K76 A;  1YJ9 A;  1XJW B;  2SRC A;  2LQN A;  3CCQ Q;  4A54 A;  2YUN A;  1UFF A;  3GNF B;  1JB0 E;  4AFS C;  3H8Z A;  5HK3 A;  2YRC A;  1VQP A;  3MEA A;  1MV3 A;  1YFN A;  3LWI A;  3C4S A;  2DRK A;  4HA8 A;  2DAQ A;  1UHC A;  2DPP B;  5CAI A;  2AIR B;  2M0Y A;  5D6X A;  1UTI A;  1SHF A;  4IUR A;  5EC7 A;  1N8R C;  2J06 A;  2W10 A;  1JJ2 P;  4FSS A;  1GXI E;  4HVU A;  1TUG B;  1YJ9 T;  4Y92 A;  2FYK A;  3OSV A;  2COZ A;  2KT8 A;  2VV5 A;  5FRM A;  2J7I A;  2J6O A;  1VQP T;  2JT4 A;  2QXF A;  4IUT A;  1KJW A;  4OP0 A;  1Q7Y C;  4XTZ A;  1BCO A;  3L2U A;  4ANJ A;  4D8D A;  1OX8 A;  1IHW A;  1VIE A;  1SSH A;  3M0S A;  2IIM A;  3HFO A;  1FMK A;  3JB9 H;  4FW2 A;  3RKW A;  2XHC A;  3M54 A;  1SKU B;  4GLK A;  4X9C A;  1VQ6 Q;  4ZNX A;  2F5K A;  3VS3 A;  4E47 A;  4BD3 A;  5GAN 3;  3PIO A;  2CH4 A;  2KK4 A;  2L3R A;  1W2B S;  4LUD A;  3UF4 A;  5CK9 A;  1QVG S;  4BI4 A;  3RIR A;  1OUL A;  5FRO A;  5AYF A;  4PJN A;  2O9S A;  1WQW A;  3PMI A;  2EYY A;  1AEY A;  4J9D A;  2HEQ A;  2QDY B;  3LGL A;  1Y0M A;  1QVP A;  2RB6 A;  2E70 A;  4RTZ A;  3VS4 A;  3VJP A;  2CSI A;  3KUF A;  3MKD A;  2D1X A;  1NG2 A;  2ABL A;  4J6X A;  4JRK A;  4A53 A;  4RG8 A;  1OZ3 A;  3GPL A;  2HD0 A;  3JCM b;  2DBK A;  2DET A;  5C6S A;  4J9G A;  4ZTJ A;  3JAM E;  4ZGJ B;  2YRV A;  3L2W A;  1M2V A;  3VYH B;  4KGZ B;  4Q5W A;  5GJW B;  1CKA A;  2XMF A;  5GAN 6;  1ZHI A;  2EQU A;  3OYL A;  2RMO A;  4PJO D;  2EKH A;  2PU9 B;  3HTR A;  1BI3 A;  2DYB A;  3J7A F;  1B7T A;  1P92 A;  3SWN C;  1FYN A;  4E7I A;  2DRM A;  1M90 C;  4F7U G;  1E7O A;  4VUB A;  3LWH A;  4M77 C;  1GFC A;  1SEM A;  1YJ9 Q;  1WXT A;  1Q86 R;  1TWB A;  1VQP Q;  4FIB A;  4F7U E;  2Y90 A;  2QDL A;  4OMO A;  2R5M A;  3LW5 E;  5HKC A;  1ZX6 A;  4C92 F;  4QQ6 A;  4LUE A;  1QVF A;  1X75 C;  3LLR A;  4RTX A;  4X1V A;  3JCM d;  4J7I A;  1O75 A;  2P4R A;  2KR3 A;  3EH2 A;  5CVI A;  4IUU A;  1CKB A;  1JU5 C;  4EMK C;  2FRW A;  4HCK A;  2ZZD A;  1ZSG A;  2VVK A;  2E65 A;  2MF2 A;  2KAF A;  3TSW A;  1PSF A;  2HL3 A;  4LDV A;  1TG0 A;  2A36 A;  4JLG A;  4AFZ C;  3JCM Q;  3VYG A;  4CC4 B;  2MI6 A;  1U8R A;  3BW1 A;  2E10 A;  2RHY A;  3DLM A;  4J9C A;  1WGS A;  3EGU A;  2DXU A;  2M9U A;  3THK A;  2QQR A;  3VU3 C;  2P84 A;  4M7A A;  2I2L A;  2MAM A;  4M75 G;  1B34 A;  4FYV B;  3QDF A;  3V8J A;  5GAO p;  3LYI A;  2ENM A;  2DKG A;  2YSQ A;  3OSS C;  4XU2 A;  4N0A C;  4N4H A;  3M53 A;  2W0Z A;  2X4J A;  2F5T X;  3A8G B;  3JCM g;  4N4I A;  4XU3 A;  1VYT A;  2QK0 A;  1I0C A;  1N8R U;  2DFU A;  1YP5 A;  1KC8 C;  5CKD A;  1X6B A;  3GOX A;  3S6W A;  2AT1 B;  3FDR A;  2HL5 C;  2NYS A;  4PFP A;  5KE2 A;  4Z88 A;  2ZPB B;  2MIO A;  2RK1 A;  2A7Y A;  2EBP A;  2RQV A;  2FPE A;  1XOV A;  2RA2 A;  3JCM W;  3REA B;  1JXM A;  1Q7Y U;  1M2V B;  5KCH A;  2M0O A;  1D1C A;  2CYZ B;  2X9H A;  4C0D B;  4OMP A;  1YCY A;  3MEU A;  4E7L A;  4LE9 A;  2XG8 D;  2K7A A;  2LT1 A;  5LJ5 e;  4ESR A;  2AHJ B;  3HSB A;  2FL7 A;  1VYV A;  2DEQ A;  2D0N A;  3N5B B;  3M0T A;  1D3B B;  3JCM h;  1NYG A;  2RHU A;  4XTW A;  2XK0 A;  4M75 C;  3JCM f;  1VQ8 A;  1RAH B;  2FO0 A;  3QYH B;  2KT1 A;  1S72 A;  1VYU A;  1UGQ B;  5GAN 4;  2BE9 B;  3VRY A;  1Y57 A;  2EIF A;  4LXC A;  3EG9 A;  3SFM A;  1ACM B;  3TU4 K;  2EFI A;  2BZ8 A;  2LVM A;  2R5A A;  4IUV A;  2K3X A;  3LH5 A;  3UDC A;  1KHI A;  3C0C A;  2ZGW A;  2GQV A;  3QO3 A;  2LJ3 A;  1I1J A;  1Q82 R;  2LQW A;  2J05 A;  1WI7 A;  4PK4 A;  5FU6 C;  1VQ8 T;  4ZN1 A;  1D09 B;  1S72 T;  3OYK A;  1RI0 A;  1VIF A;  4OML A;  1M1F A;  4A63 B;  4BY6 C;  1WJS A;  2F2X A;  4RG2 A;  2RI3 A;  3M57 A;  4PL6 A;  4A4H A;  2CGH A;  4WTO B;  1OU8 A;  5A0G A;  4M7A B;  2F2V A;  3C94 A;  1B34 B;  3EG0 A;  3EHQ A;  5J3B A;  4DBH A;  2HBP A;  3G6E T;  2HQH A;  4C8Q A;  3L2Q A;  2ATC B;  2CP6 A;  4RKU E;  4QVZ A;  2HAX A;  2DE0 X;  1H64 1;  1AT1 B;  3HKS A;  1M90 U;  2HQE A;  1EFN A;  4OGE A;  1WNL A;  2CP7 A;  4M77 A;  4DOV A;  5EG2 A;  4XTU A;  1X2K A;  2QI2 A;  5GMK m;  3O8V A;  1NJI C;  1R77 A;  1ZBJ A;  2QTV A;  2EGE A;  1KK7 A;  3NTH A;  1ZA1 B;  1KFZ A;  2F69 A;  1U1T A;  2JVV A;  1RI9 A;  4XTY A;  3M4Y A;  2DTH A;  4OB2 B;  5CQX A;  1K9M R;  1QCO A;  4M7D G;  3LGF A;  3V8K A;  5IHK A;  3CC4 A;  2DER A;  3OMC A;  4EMK A;  1NEB A;  3RKX A;  4KH1 B;  2EQI A;  2DF6 A;  4E2F B;  2P4T A;  2LQK A;  1QKX A;  4M7D E;  3MET A;  4PJJ A;  2QA4 A;  4XQ3 A;  4RTV A;  2VC8 A;  3RUX A;  4ELY C;  2EW3 A;  2KEA A;  1M4Z A;  2MOX A;  2M1H A;  3CCV A;  1ZSZ A;  4XAX B;  4A4F A;  3OW2 P;  5L8R E;  3CC4 T;  4LD6 A;  1K73 U;  1EIF A;  2DXT A;  1YNZ A;  4PFO A;  4GBQ A;  2RI5 A;  2PNI A;  3EG9 B;  1O9S A;  2RF0 A;  2EKO A;  2CP0 A;  1JQQ A;  1WPY A;  4M75 D;  4N0A A;  4DBR A;  4F17 A;  2QA4 T;  1VQ8 Q;  2E5Q A;  1S72 Q;  1ABQ A;  1YBY A;  2KQW A;  2JS0 A;  3ZBD A;  3BDL A;  3CCV T;  3DLL A;  3J81 E;  5I22 A;  3V7S A;  2OTL A;  2Z0W A;  3OS2 A;  3X28 B;  1I8F A;  4QQD A;  1KC8 U;  1RAG B;  3OYD A;  2HNI A;  5LJ3 g;  3E9F A;  2RQT A;  1UEB A;  3UPU A;  1RUW A;  3RNJ A;  2NUP A;  2JUF A;  4J5Y A;  2JMC A;  2X3X D;  4M7D C;  2DVJ A;  2X51 A;  2V26 A;  3G6E Q;  5GAN 8;  4JPB W;  4AFQ C;  2FB7 A;  5D6Y A;  1LCK A;  5LL6 S;  2CDT A;  1W6X A;  3FEO A;  2QQ9 A;  2OTL T;  4C5G A;  1JEG A;  4DA4 A;  4FT2 A;  2VXF A;  4J9E A;  1SPK A;  4O5V A;  2YLB A;  3CD6 A;  5CQY A;  1C0M A;  2KE9 A;  5KYX A;  4M7A E;  2DJZ A;  1QVF S;  3SWN B;  3I5R A;  4XU0 A;  2K6D A;  4M77 B;  4JS5 A;  1FWZ A;  2KYB A;  2IPO B;  1GBQ A;  4O6J A;  3CXC P;  1Q81 R;  2PTK A;  3DB3 A;  5DY9 A;  3M0P A;  3MEW A;  4M77 F;  2LX7 A;  4M78 A;  3M0U A;  1BI0 A;  1FMW A;  1NZ9 A;  2RM4 A;  1V76 A;  1R8O B;  3RES A;  4PJO C;  3CD6 T;  2ED1 A;  2E6N A;  2CZ7 B;  3WXM B;  1MV0 B;  1VQK A;  5IXF A;  3QG1 A;  1YN8 A;  4JZ4 A;  4DEY A;  3PT9 A;  1PG5 B;  4OB0 B;  5FWC A;  2RO0 A;  2ZPI B;  1OX9 A;  3CBP A;  2BKD N;  1FMV A;  5I11 A;  1KQS P;  4EMK B;  1SG5 A;  2EGC A;  1WHL A;  2RD1 A;  4D8K A;  2OI3 A;  1UHF A;  3NPF A;  2X3W D;  2KMT A;  3CC4 Q;  1VQK T;  5IHI A;  1SHG A;  3UT1 A;  1X27 A;  5LJ5 d;  3TRE A;  5CR2 A;  4C92 A;  1ZSZ B;  4A4K A;  3P8H A;  1IXD A;  1Q95 G;  2DX1 A;  1VQL A;  2OAU A;  1N27 A;  2QA4 Q;  1G3Y A;  4CI0 C;  4L5G A;  3L2Z A;  4EPC A;  3CCV Q;  2LTO A;  4OMM A;  3VS2 A;  4E7H A;  2K3Y A;  1W4S A;  4RMO A;  2DO3 A;  3QII A;  5LJ3 j;  1F1B B;  3CEY A;  3LX7 A;  2LZ6 B;  1TS9 A;  2FZC B;  2XU8 A;  4BI8 B;  2NLU A;  3JB9 G;  1NJI U;  1KG1 A;  3OYG A;  4F7U F;  1LNX A;  2PZ1 A;  5KYY A;  1OI1 A;  2LCC A;  2QYZ A;  1VQL T;  2MK5 A;  1PWT A;  4LDY A;  1M1G A;  1AVZ C;  2K4Y A;  2G3R A;  2LT4 A;  5D7U A;  3EFR A;  2NUP B;  3VRZ A;  5A2Q E;  2ZPG B;  5LJ5 g;  2OTL Q;  1H92 A;  4Z89 A;  2DYI A;  1EX4 A;  2L3S A;  3PFS A;  2V1Q A;  1IZ6 A;  5I21 A;  3A8L B;  4C8Q G;  3FRN A;  1GFD A;  4HVW A;  2VB6 A;  1YWO A;  4J6W A;  1PRL C;  5GAN e;  4EMH A;  4M7D D;  1YWP A;  2GNC A;  1M8M A;  2P0P A;  2E5K A;  1Y07 A;  2EWN A;  5FU7 C;  5KYX B;  1E6G A;  4C0Z A;  1PKT A;  4J83 A;  1X6G A;  1QW1 A;  3MHX A;  4AMC A;  3CPW P;  1MHN A;  4UC4 A;  3V7R A;  4CC3 A;  4C8Q E;  4EMG A;  5C0M A;  1BB9 A;  2O4X A;  2D9T A;  3OYF A;  3CD6 Q;  2L5Q A;  3BFM A;  2A08 A;  2KXC A;  2KY9 A;  1MMN A;  4JRP A;  4M78 B;  2RK2 A;  2F1L A;  3PIP A;  4QT7 A;  3REB B;  2PVO B;  3AT1 B;  2EVR A;  2ROL A;  2JTE A;  4J8O A;  4M75 F;  1U5S A;  5LJ5 h;  1ZLM A;  2KRM A;  3JB9 I;  3CPF A;  1IHV A;  1ZA2 B;  5I2M A;  3JCM V;  5LJ5 f;  2JOY A;  4M78 F;  3I55 A;  3HHT B;  4HKE A;  1MGQ A;  2E41 A;  3NFC A;  1JBM A;  1YJW A;  2H3E B;  1UE9 A;  2YDL A;  2C0O A;  2WSC E;  1VQK Q;  3CCL A;  2DL8 A;  4ZGD B;  1X01 A;  4ZGE B;  1H3H A;  5IXB A;  2I0N A;  4QVD A;  3TVT A;  1K8A C;  4BY6 B;  3MP8 A;  1D3B A;  1KQ1 A;  2FPD A;  1LOJ A;  1MND A;  3SD4 A;  4MDW A;  1W2B P;  3QSU A;  2KRN A;  4C92 B;  3S3M A;  1PRM C;  3I55 T;  1UG1 A;  1WX6 A;  1KQS A;  3GLX A;  1YJW T;  1H8K A;  2E4H A;  4X34 A;  2O2O A;  2VAS A;  2KRS A;  4LD9 K;  1M1K C;  3CCL T;  1LJO A;  3JCM c;  4OMF B;  1QCF A;  4DOW A;  4E7K A;  1QMC A;  1HYO A;  4ORZ A;  1WJQ A;  1VQL Q;  2EQJ A;  2AKK A;  1VQ7 A;  3SDZ A;  4PJL A;  1JJ2 A;  3NGP A;  2ZAE A;  4WF2 A;  3MCA B;  4CRI A;  1UDL A;  1W70 A;  2DD5 A;  5KYY B;  3OA6 A;  2EYW A;  4R56 A;  4L59 A;  1X43 A;  3X24 B;  1GL5 A;  2B8A A;  1IGU A;  5CKB A;  3H0I A;  4YTL A;  4IIM A;  1YI2 A;  4NL3 A;  1RAA B;  4OGC A;  3NHN A;  3PTA A;  3FIF A;  2JW4 A;  3HFN A;  3D7S B;  2HSE B;  4PJO A;  2E64 A;  2DZ9 A;  3NTI A;  1VQ7 T;  1UGS B;  2DXC A;  1K73 C;  3L2V A;  4J9B A;  3V7C A;  3MP6 A;  3E9G A;  3QJY A;  1M30 A;  2L89 A;  2DL5 A;  4C0F A;  2RJE A;  4KRT A;  4FM4 B;  2DBM A;  2RHX A;  3RKY A;  2ECZ A;  2MWP A;  1YI2 T; 
#chains in the Genus database with same CATH homology
 4QVZ A;  2MMP A;  3OB9 A;  3RER A;  1N9R A;  4C8Q B;  5GAN 2;  2K2V A;  1H64 1;  3OQ5 A;  3HKS A;  3I56 A;  2HAX A;  1M90 U;  2HQE A;  1VQN T;  4RCB A;  4C92 D;  4HT9 A;  4OGE A;  2JTF A;  4BAC A;  1WNL A;  4M75 B;  3QPH A;  3WVE B;  2BUD A;  4M77 A;  4DOV A;  4R55 A;  5EG2 A;  3VUZ A;  5A0D A;  4XTU A;  1Q82 C;  2O4X B;  2QI2 A;  4M77 E;  3GIB A;  2LRQ A;  5GMK m;  3O8V A;  5M9O A;  3OYJ A;  3JCM X;  1NJI C;  2QQS A;  3ER0 A;  4C5I A;  4LDW A;  5HK0 A;  3OYB A;  1Q81 U;  2K57 A;  2GF7 A;  2RJD A;  5IN1 A;  4C8Q F;  1KHC A;  3INZ A;  4JRI A;  4HCC A;  1U1S A;  1YHQ T;  3NTH A;  1RL2 A;  3KXT A;  2XIC A;  1H3Z A;  2FHD A;  1YJN T;  1AHJ B;  4BE2 A;  2F69 A;  3Q1J A;  4FU6 A;  3CPW A;  5GAN j;  3TEE A;  1BKB A;  3HP9 A;  3VKI A;  1U1T A;  2JVV A;  3QZ5 B;  5LJ3 h;  1SSF A;  4XTY A;  2VUB A;  2ZCF B;  3FLG A;  3I56 T;  3M4Y A;  3CXC A;  2XDD A;  2Y4X A;  2DTH A;  4OB2 B;  5CQX A;  3HL8 A;  3CC2 A;  5LJ3 f;  4M7D G;  4L6V 5;  4ATO A;  4X9D A;  5FU6 B;  1HK9 A;  1N9S A;  1ZQ1 A;  3LGF A;  3V8K A;  2A3L A;  3VV0 A;  1BIA A;  3T9N A;  5CIU A;  2RHZ A;  3RMS A;  3CC4 A;  2VGN A;  3OMC A;  3A8M B;  3G4S T;  4EMK A;  1YJ9 A;  3RKX A;  5DLQ E;  1G3S A;  2DTI A;  1NPR A;  3JB9 D;  3QUI A;  4PNO A;  2P4T A;  4A54 A;  5LJ3 e;  4M7D A;  4QVC A;  4KUD K;  2LQK A;  3V8L A;  1BI2 A;  4C8Q C;  3GNF B;  4M7D E;  3MET A;  1BYM A;  2H3J A;  1DJ7 B;  4P5N A;  4XK8 E;  1JB0 E;  3P8B B;  4XQ3 A;  2QA4 A;  2CZ1 B;  2GFA A;  2KSS A;  3H8Z A;  2VC8 A;  3RUX A;  5HK3 A;  1VQP A;  2EJ9 A;  3MEA A;  4ELY C;  2MWO A;  3QHS A;  3P8D A;  3LWI A;  3C4S A;  3CC2 T;  1M4Z A;  2M1H A;  2DAQ A;  2DPP B;  4HA8 A;  4M7A D;  3CCV A;  5CAI A;  4PLL A;  5D6X A;  1KD1 C;  2ZPE B;  4IUR A;  1N8R C;  3OY9 A;  3JCM J;  1Q86 U;  1Y96 A;  4XAX B;  4A4F A;  4BUG A;  3E19 A;  5L8R E;  3CC4 T;  4LD6 A;  5KH6 A;  3M5A A;  1K73 U;  4M7D F;  1EIF A;  2LQ8 A;  2DXT A;  1GXI E;  4C92 E;  3TCJ A;  1YJ9 T;  2EYQ A;  2RI5 A;  1VQ4 A;  2FYK A;  3OSV A;  3C12 A;  1O9S A;  2EKO A;  5CKF A;  3NTK A;  4BDZ A;  4IUQ A;  1WPY A;  4M75 D;  5GAO m;  3X25 B;  5GMK h;  4N0A A;  2PVG B;  2VV5 A;  1K9M C;  2QA4 T;  2E6Z A;  5FRM A;  3VUB A;  2PQW A;  2E5Q A;  3CCE A;  2GFU A;  5CKH A;  5LJ5 j;  1VQP T;  1YBY A;  2KQW A;  2QXF A;  4IUT A;  4IUP A;  3OYC A;  3G6E A;  3GNG A;  1G3T A;  2WSE E;  4OP0 A;  4XTZ A;  3ZBD A;  1Q7Y C;  1X6O A;  3BDL A;  3CCV T;  3DLL A;  1OZ2 A;  3J81 E;  3L2U A;  3V7S A;  2OTL A;  4OB1 B;  3OS2 A;  3OYM A;  3X28 B;  1I8F A;  4QQD A;  2XID A;  2EJG A;  1VIE A;  1KC8 U;  2KVQ G;  2DTO A;  5IT9 E;  3KBG A;  3OYD A;  2K5F A;  2M16 A;  2X35 A;  2HNI A;  5LJ3 g;  2CKK A;  2EQK A;  2BIV A;  3HFO A;  3E9F A;  1UEB A;  3M58 A;  1VQ4 T;  1VQM A;  4PJO B;  3UPU A;  1HXD A;  3FB9 A;  3JB9 H;  2JUF A;  4J5Y A;  4M7D C;  3L42 A;  2XHC A;  3RKW A;  3X26 B;  3M54 A;  4GLK A;  4X9C A;  3ME9 A;  3CCS A;  5GAN 8;  2X4Y A;  2XD0 A;  4FT4 A;  3EFS A;  4RCC A;  4J7F A;  3CCE T;  1KQ2 A;  2F5K A;  2FB7 A;  4E47 A;  5D6Y A;  2ZPH B;  4HCZ A;  4Z02 A;  1YIT A;  1YHQ A;  5LL6 S;  4BD3 A;  3FEO A;  5GAN 3;  3PIO A;  2QQB A;  2VYT A;  5GAO n;  4PJO F;  2QQ9 A;  3M56 A;  3M55 A;  3QXE B;  1WJR A;  1NPP A;  2KK4 A;  2L3R A;  4C5G A;  4E7J A;  1W2B S;  2OTL T;  3PMT A;  3F70 A;  4DA4 A;  4FT2 A;  1OYX A;  2R58 A;  2VXF A;  4GY5 A;  5CK9 A;  1VQ5 A;  3GF5 A;  3SWN A;  1QVG S;  1XNI A;  4D6W A;  4O5V A;  1Y71 A;  3CMA A;  4BI4 A;  3RIR A;  2YLB A;  4A4G A;  3CD6 A;  5GAO l;  5CQY A;  3CBM A;  5GAN d;  4M7A E;  2DJZ A;  2LDM A;  3SWN B;  3GP8 A;  1K8A U;  4XU0 A;  1VQM T;  1QVF S;  1JRI A;  5FRO A;  4M78 G;  3G71 A;  4M77 B;  5AYF A;  3OS1 A;  4JS5 A;  1VQ9 A;  2X4W A;  3FC3 A;  3G4S A;  4V2S A;  1FWZ A;  4JLI A;  1WQW A;  3CCS T;  3PMI A;  3CC7 A;  4C0G A;  3E1S A;  1YIT T;  4O6J A;  2P0K A;  4JRQ A;  3QKJ A;  5CO7 A;  5GAM d;  2QDY B;  3LGL A;  5J26 A;  1QVP A;  3HRU A;  4C5E A;  2V8I A;  2VGM A;  2RB6 A;  3DB3 A;  4M75 E;  2E70 A;  5DY9 A;  3MEW A;  4M77 F;  1M9S A;  1M1K U;  4M78 A;  2YHT A;  3VJP A;  2DVE A;  3KUF A;  1BI0 A;  1NZ9 A;  2RM4 A;  1VQ5 T;  1R8O B;  4M78 E;  2CZ0 B;  1FX7 A;  3RES A;  3CMA T;  3CD6 T;  4PJO C;  2QTX A;  2E6N A;  2CZ7 B;  2JZ2 A;  4J6X A;  3WXM B;  4JRK A;  1VQK A;  3QG1 A;  4A53 A;  4RG8 A;  1OZ3 A;  3GPL A;  2HD0 A;  4MZT A;  3JCM b;  5C6S A;  3G71 T;  1VQ9 T;  3PT9 A;  4ZTJ A;  3JAM E;  4ZGJ B;  3PNW C;  4OB0 B;  3ZEH A;  2RO0 A;  1BI1 A;  4TVR A;  2YRV A;  2ZPI B;  2C06 A;  3CC7 T;  3L2W A;  1I4K 1;  3JRZ A;  3VYH B;  3CBP A;  4Q5W A;  4ME7 A;  3S3O A;  4IKF A;  2BKD N;  4II1 A;  5GAN 6;  2D6F A;  4EMK B;  1ZHI A;  2EQU A;  3OYL A;  2WAC A;  4C92 G;  4JDS A;  5GAN g;  2RD1 A;  3WVD B;  5CKE A;  1YIJ A;  4PJO D;  2PU9 B;  5FRN A;  4OVA A;  1BI3 A;  3CME A;  3J7A F;  4M7D B;  2LNV A;  4OB3 B;  1P92 A;  3SWN C;  5GMK l;  4E7I A;  3OYE A;  5GAN 5;  1M90 C;  4Y91 A;  4F7U G;  4VUB A;  2KMT A;  3OYH A;  3LWH A;  4M77 C;  5KE3 A;  1VQK T;  3AHU A;  3UT1 A;  5LJ5 d;  3TRE A;  4EDU A;  5CR2 A;  4C92 A;  5GAM g;  4XTV A;  4A4K A;  3RMQ A;  3ZFJ A;  3CCR A;  4LDU A;  1Y96 B;  3P8H A;  1Q81 C;  3MP1 A;  1VQL A;  4C8Q D;  1NE8 A;  2OAU A;  2PVD B;  1N6A A;  2D0Q B;  2XDP A;  1N27 A;  1G3Y A;  4F7U A;  2RI2 A;  4FIB A;  1YIJ T;  1W2B A;  4MDX A;  4F7U E;  3JCM P;  4CI0 C;  3CME T;  2Y90 A;  3R6O A;  4L5G A;  3L2Z A;  4EPC A;  1TH7 A;  3A8H B;  4M78 C;  2LTO A;  4M77 D;  4E7H A;  2R5M A;  3LW5 E;  5HKC A;  1QVG A;  2IG0 A;  2WSF E;  2K3Y A;  3C95 A;  4C92 F;  1W4S A;  4QQ6 A;  4RMO A;  2DO3 A;  4M7A A;  1UGR B;  3QII A;  5LJ3 j;  1QVF A;  3CEY A;  3CCJ A;  3LX7 A;  1X75 C;  3LLR A;  4KBM B;  2XU8 A;  4NL2 A;  1Q82 U;  4BI8 B;  2NLU A;  3JCM d;  4BB7 A;  3BDU A;  3JB9 G;  3CCR T;  4J7I A;  1O75 A;  3OYG A;  4F7U F;  1NJI U;  1KG1 A;  1LNX A;  5CVI A;  3OYI A;  4IUU A;  1OI1 A;  3OBW A;  2LCC A;  4EMK C;  3OS0 A;  2X4X A;  1VQL T;  2ZZD A;  5D6W A;  4LDY A;  5HY6 A;  5GMK e;  4ZTF A;  1M1G A;  2V8J A;  3M9Q A;  2QEX A;  2K4Y A;  2G3R A;  2RHI A;  5GAN h;  3L2R A;  2LT4 A;  4KUI A;  4MZM A;  2E12 A;  2E65 A;  2MF2 A;  3EFR A;  3PGG A;  2KAF A;  4C0D C;  1PSF A;  4M7A G;  1BIB A;  5GAN f;  5A2Q E;  3CBO A;  3EAE A;  4LDV A;  2GCX A;  2ZPG B;  3G7Z A;  5LJ5 g;  4HCB A;  4JLG A;  3JCM Q;  3VYG A;  3SB2 A;  2MI6 A;  2IVW A;  2V8K A;  3BW1 A;  2E10 A;  4C5H A;  2RHY A;  1U8R A;  1KQS S;  3DLM A;  5IAY A;  3PFS A;  1WGS A;  2RH2 A;  1QP2 A;  1IZ6 A;  2DXU A;  2Y4Y A;  5GAM h;  3CCJ T;  5I21 A;  5DLO A;  2M9U A;  4BI3 A;  3A8L B;  2QQR A;  3OYY A;  3FRN A;  4C8Q G;  3VU3 C;  4MMK A;  4C92 C;  2EAY A;  2EQM A;  3QBY A;  2I2L A;  3L1A A;  4J6W A;  5GAM f;  3OMG A;  2MAM A;  3M4G A;  5GAN e;  2YLC A;  4M75 G;  4EMH A;  4HT8 A;  1B34 A;  4M7D D;  2K5I A;  3V8J A;  5GAO p;  1V29 B;  3LYI A;  2QEX T;  2P0P A;  1Y07 A;  2DKG A;  2EWN A;  3BY7 A;  5FU7 C;  3OW2 S;  4C0Z A;  1VQ7 A;  4J83 A;  1JJ2 S;  3QZ9 B;  1Y7X A;  3OSS C;  4XU2 A;  1QW1 A;  5FLX E;  3MHX A;  4N0A C;  3OYN A;  4BE1 A;  1MHN A;  4UC4 A;  4N4H A;  1WQ7 A;  3V7R A;  1G3W A;  3M53 A;  2X4J A;  5GAM e;  4C8Q E;  2F5T X;  3A8G B;  4M75 A;  3JCM g;  2DIQ A;  2JN0 A;  4FL6 A;  4N4I A;  4XU3 A;  4EMG A;  5GMK j;  5C0M A;  3CCU A;  4M7A F;  2RJC A;  2KDS A;  5CCA A;  2O4X A;  1KD1 U;  2QQA A;  2D9T A;  3OYF A;  3OS5 A;  1N8R U;  1XTD A;  2L5Q A;  3ASK A;  3BFM A;  2KY9 A;  1KC8 C;  3S3N A;  3A5Z B;  4JRP A;  5CKD A;  1M5Q 1;  4M78 B;  4JS4 A;  3GOX A;  2RK2 A;  3S6W A;  3FDR A;  3PIP A;  1I5L A;  1G5V A;  1VUB A;  2PVO B;  4BDY A;  4ELZ C;  5KE2 A;  2DD4 A;  2EJF A;  4J8O A;  3A8O B;  4M75 F;  2VXE A;  4FSX A;  2ZPB B;  4NOY A;  5LJ5 h;  5GAO q;  3J80 E;  3JB9 I;  1K9M U;  2RK1 A;  2A7Y A;  3CPF A;  1I81 A;  3QJ6 A;  3MO8 A;  3CCQ A;  1ZBX A;  2LC4 A;  1XOV A;  5I2M A;  3JCM V;  2JOY A;  2RA2 A;  5LJ5 f;  3JCM W;  4M78 F;  3I55 A;  2XI9 A;  3HHT B;  4HKE A;  1MGQ A;  4NS5 A;  2E41 A;  3NFC A;  1JBM A;  3CCU T;  1Q7Y U;  3DB4 A;  1YJW A;  5KCH A;  4PKC C;  1UB4 A;  2M0O A;  1IRE B;  1XQH A;  2CYZ B;  5KCO A;  5J39 A;  2WSC E;  3CCL A;  4C0D B;  2R57 A;  4M7A C;  3JSC A;  4ZGD B;  1X01 A;  1YCY A;  3MEU A;  4OF1 A;  5GAM j;  4E7L A;  2XG8 D;  4ZGE B;  3UWN A;  2LT1 A;  4QW2 A;  5LJ5 e;  4MML A;  4QVD A;  4B9X A;  2AHJ B;  5GAO r;  1K8A C;  3HSB A;  2FL7 A;  4A4E A;  4BY6 B;  1D3B A;  3MP8 A;  2O01 E;  1KQ1 A;  2HQX A;  1LOJ A;  2ZPF B;  4PLI A;  3SD4 A;  2DEQ A;  3HRT A;  1VQO A;  3N5B B;  4MDW A;  4MZP A;  3QDR B;  5LJ3 d;  1D3B B;  3JCM h;  3QSU A;  4C92 B;  3S3M A;  3CCQ T;  3HPW A;  2RHU A;  4XTW A;  4BE0 A;  2XK0 A;  3I55 T;  4M75 C;  3JCM f;  2DIG A;  5GAN 7;  2JTM A;  1KQS A;  3GLX A;  1YJW T;  1VQ8 A;  4X34 A;  2CS7 A;  2OTJ A;  3QYH B;  2DZC A;  5FU7 B;  1S72 A;  4LD9 K;  4F7U B;  3CPW S;  1UGQ B;  1UGP B;  2K5L A;  1M1K C;  5GAN 4;  3CCL T;  1LJO A;  3LH0 A;  4ZN3 A;  3JB9 J;  3MEV A;  3JCM c;  4OMF B;  2L8D A;  4E7K A;  4DOW A;  2EIF A;  3CXC S;  4QQG A;  3SFM A;  3TU4 K;  1WJQ A;  4XU1 A;  2EFI A;  4B9W A;  3JCM e;  2RJF A;  2LVM A;  2EQJ A;  2LX9 A;  2K3X A;  2R5A A;  4IUV A;  3SDZ A;  3CCM A;  3OW2 A;  1JJ2 A;  4KUL A;  1VQO T;  3UDC A;  1KHI A;  2JNG A;  2ZGW A;  2GQV A;  4WF2 A;  3MCA B;  3QO3 A;  4PJO G;  4CRI A;  2E1H A;  3QYG B;  2DD5 A;  5DM7 R;  3URG A;  2FVU A;  3OA6 A;  4M78 D;  5FU6 C;  4R56 A;  4L59 A;  3X24 B;  1VQ8 T;  2B8A A;  5CKB A;  4ZN1 A;  2OTJ T;  3OBY A;  1S72 T;  1VQ6 A;  1QP3 A;  4YTL A;  3X20 B;  3OYK A;  1RI0 A;  2PUK B;  2DXB A;  4NL3 A;  1YI2 A;  1VIF A;  1M8V A;  4OGC A;  3PTA A;  1M1F A;  3HRS A;  3FIF A;  5GMK i;  3HFN A;  4BY6 C;  3OYA A;  2XKO C;  1VQN A;  4PJO A;  4Y28 E;  4DQ2 A;  1WJS A;  2DK3 A;  2CZ6 B;  2E64 A;  1FXX A;  4PJO E;  2DZ9 A;  4RG2 A;  2RI3 A;  4J6Y A;  3NTI A;  4JJN K;  1Q86 C;  1VQ7 T;  3FJP A;  1UGS B;  2DXC A;  3M57 A;  2PUO B;  3CCM T;  4PL6 A;  4A4H A;  2CGH A;  4JUV A;  4KT0 E;  1PSE A;  3DKM A;  4N4G A;  3L2V A;  3V7C A;  1K73 C;  3H6Z A;  3MP6 A;  3E9G A;  5A0G A;  3QJY A;  4LDX A;  5A0L A;  2L89 A;  4M7A B;  4XTX A;  4C0F A;  3C94 A;  2RJE A;  1B34 B;  4M77 G;  3JB9 F;  4FM4 B;  5J3B A;  2HBP A;  3G6E T;  2LCL A;  2P0Q A;  1YJN A;  2RHX A;  3M59 A;  1VQ6 T;  2XDB A;  3RKY A;  4C8Q A;  5I2S A;  2MWP A;  3L2Q A;  1YI2 T;  4RKU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...