2LCLA

Solution structure of rfah carboxyterminal domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
GAMGPKDIVDPATPYPGDKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKNTEFRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An alpha helix to beta barrel domain switch transforms the transcription factor RfaH into a translation factor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Transcriptional activator rfaH
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lclA00
1EIFA 2LCLA 2MWPA 1YI2T 3HKSA 1VQ9A 4QQDA 1VQ7A 1M1KC 1YJ9T 1K8AC 1YITT 1NZ9A 3LGLA 3J7AF 1QVFS 3CC7A 4ZN1A 3CPWA 3CCQA 3CCRT 1KC8U 3G71T 2QA4A 1VQNT 3KBGA 3P8BB 1X6OA 3CCJA 3CMET 3TREA 3DB3A 3CD6A 3I56T 1KQSA 3CCRA 2IG0A 2EIFA 2DO3A 3CXCA 4TVRA 1K73C 1VQKT 1M90U 3I55A 4ZN3A 3OW2S 1YJ9A 3CD6T 1YHQA 3DB4A 3CCUA 3CCMT 2MWOA 1VQ4A 2LQ8A 1QVGS 1RL2A 1YITA 1VQLT 1K8AU 3PIPA 1VQ9T 5J3BA 1NPPA 1K9MC 3LGFA 3G4SA 1M1KU 1Q81U 2QEXA 1YHQT 1VQMT 2QEXT 3CCMA 3CCET 2XHCA 3ER0A 1YBYA 1VQOA 1UEBA 3J81E 3CMAA 3LH0A 3DLLA 1NJIU 2JVVA 1K73U 1S72T 2OTLT 3OYYA 5FLXE 5HY6A 1KC8C 2JNGA 1IZ6A 1N8RC 2JUFA 1BKBA 1Q7YC 1M90C 4RG2A 1YIJA 1JJ2A 2E6ZA 3JAME 3G4ST 2LVMA 3I55T 1VQPT 3CMAT 1VQ6T 3CMEA 1NJIC 3CCEA 1YI2A 2G3RA 1W2BA 3A5ZB 5J26A 1VQOT 1XNIA 2JOYA 1M1GA 1KQSS 1Q81C 3G6ET 1Q7YU 1KD1C 1VQ8A 2MI6A 1K9MU 5A2QE 3CC4T 1S72A 1VQ6A 3CCJT 3G6EA 1NPRA 1VQMA 1QVFA 3CC2A 1VQ5A 3PIOA 3CXCS 3CCVA 1XTDA 3CPWS 4X34A 4CRIA 3CC2T 1KD1U 2QA4T 2E70A 2OTJA 3CCLT 1VQ7T 1VQ5T 1YIJT 1Q86C 2OTJT 2OTLA 3I56A 3CC4A 1Q82C 5LL6S 5DLQE 1VQKA 1VQ4T 1KHIA 1YJWT 3CCSA 5IT9E 3OW2A 3G71A 1VQNA 5IAYA 1YJWA 3CC7T 1N8RU 2CKKA 3CCUT 3CCVT 1JJ2S 1SSFA 1VQPA 1QVGA 3CCST 4YTLA 5DM7R 2L3RA 1YJNA 1Q86U 1VQLA 1Q82U 3CCLA 1YJNT 3J80E 1W2BS 2KDSA 3CCQT 1VQ8T 2KVQG 3CPFA
chains in the Genus database with same CATH superfamily
3JRZA 4MDWA 3CXCP 4F17A 3H6ZA 1M5Q1 1VQ7A 3THKA 3M5AA 3RBBB 2OJ2A 2CZ1B 4PLIA 5LJ3e 3M0QA 1C1AA 1R0BG 1WYXA 3QPHA 4RCCA 1KC8U 3TREA 4N0AA 4C92F 1LCKA 3M0TA 2H8HA 4LE9A 3G7ZA 3OW2S 1I4K1 3DKMA 1S72Q 1WI7A 1G83A 1NEBA 4DEXA 3QHSA 1AZGB 2HKQB 1I8FA 1M1KU 4FW1A 2QEXT 1D3BA 4BUGA 3JCMd 1U8RA 3IQLA 3PE0A 4EMKC 3CMEQ 1I1JA 1TG0A 2O9VA 1QCFA 1BU1A 5ECAA 5D6WA 3WVEB 3JB9G 4OVAA 1W2BP 2CSIA 1KC8R 4B9WA 2ZCFB 3NGPA 3PNWC 1VOMA 2HBPA 1Y96A 1LJOA 2FZCB 3X25B 1YHQQ 3PIOA 2LCSA 1XTDA 4RCBA 3PVQA 2C06A 3CC2T 2ZPFB 2XDDA 2F2VA 2KXCA 2FEIA 3JCMX 2C0OA 5I2SA 2OTJT 1G3SA 4OMNA 2CUDA 1BB9A 1KHIA 1M3BA 1KG1A 3FJ5A 1FMWA 3EGUA 2HQHA 1R8OB 2L3RA 3EG2A 1VIEA 2E6NA 1IXDA 1D09B 3QYGB 2P4TA 2RJCA 3SWNA 2EAYA 3VUZA 1AZEA 2KVQG 4R55A 1KHCA 1YIJQ 3OSVA 5IXFA 3OYMA 3ZBDA 2D0NA 1RAFB 4KUIA 3GNGA 3VS4A 1B34A 3PFSA 3CEYA 3QG1A 1UECA 2P84A 4BE1A 1JRIA 2CS7A 1UFFA 4C0ZA 1U3OA 2EIFA 3EHRA 4PJOA 4C5EA 2MOXA 4X9CA 5GJWB 4L5GA 1VQLT 3PIPA 1BI0A 2XU8A 4WTOB 3JV3A 2DL3A 1K73R 1YITQ 1K8AR 3S3MA 1IREB 2SRCA 3HL8A 2DL7A 2E65A 2YXYA 5GANg 1ZLMA 1H8KA 3FLGA 1S72T 1VQ5Q 2X4YA 1A0NB 1K1ZA 1WXUA 4RG2A 1IGQA 1IGUA 1P92A 1RI0A 3EG0A 3O8VA 4X9DA 2CH4W 4KH0B 4OMMA 4ELZC 1AOJA 5KH6A 1NJIC 2F5TX 5FW9A 1GRIA 4M78F 2QEXQ 1WXTA 5L8RE 2HSPA 2LQWA 3JCMc 1Q7YU 2AT1B 2VYTA 2BIVA 5LJ3f 4VUBA 2K2MA 1JB0E 3I35A 3GPLA 1VQ5A 2O2OA 4F14A 2KNBB 4NS5A 1FWZA 2DRMA 2LTOA 5LL6S 2DMOA 3SWNC 1Y96B 2K4YA 1W6XA 3P8DA 1YJWA 3V7RA 2RHIA 3CCST 1TUGB 2DXCA 1K76A 2D9TA 2KDSA 3CC2Q 3L2VA 1E7OA 1G2BA 2AKKA 2B8AA 4F7UF 1T0HA 2COYA 2OTJQ 1TUDA 4FCYA 3HPWA 3AT1B 3LGLA 2DE0X 4RTUA 1W70A 4FIBA 1TOVA 2JTMA 3NHNA 3T9NA 2RF0A 3H8ZA 2CP0A 5GMKe 2J06A 4HCBA 1NG2A 2EYXA 4M7DE 2CP6A 1ZSZA 2MCNA 5LJ5d 2KROA 1QVGS 4M75A 2M51A 5FRNA 5GAN2 1TH7A 3ULRB 1WX6A 2DVJA 2FVUA 4D6WA 1YBYA 2EQKA 4RTVA 2RPNA 5FU6C 2RO0A 2FRWA 5FLXE 2DLPA 2M02A 3O5ZA 4XTUA 2VXFA 4J9GA 2YT6A 1M2VB 3SHWA 2KT1A 1W2BA 4HA8A 2X3XD 2HKNA 3EG3A 2QDLA 4IUUA 1OX8A 4J9CA 1WDXA 1YI2Q 3C94A 3H0HA 2LZ6B 3LWHA 3CXCS 2QQRA 3OSSC 4RTZA 4A53A 2QA4T 4E6RA 4M4ZA 3JCMb 2JMCA 3I56A 1Q82C 1N9RA 2WSFE 5HK3A 2DTIA 3OQ5A 2A37A 2O9SA 2EJGA 4HT8A 3CC7T 4KH1B 3S3NA 2O4XA 3M9QA 3GNFB 4PK4A 1SRLA 2EKOA 2GF7A 3C95A 1VYTA 4JZ3A 1R77A 3M56A 2EW3A 2ZPGB 5GAMj 1IHVA 4OP0A 4F16A 2A08A 2HBWA 2DX1A 4QQGA 1D0XA 3DLMA 3OMGA 5A0LA 3EG9A 4EMKA 4C5GA 4XK8E 4A4FA 2DO3A 4ZN3A 2I0NA 3JCMQ 3BDUA 3CD6T 2MIOA 3G4SQ 4PNOA 3C4SA 1TTHB 4IUQA 3TCJA 4LN2A 3A98A 2PU9B 2J7IA 1T3SA 2GTOA 2CSQA 5KYNA 4RTTA 3OS1A 5FU7B 4LUEA 1K0XA 4B6MA 3ZEHA 4OMFB 3QXEB 4Z89A 2OTLT 1E6GA 4CC2A 2LNVA 2O01E 2JW4A 2QAZA 2E3IA 3N5BB 4OMPA 3H9NA 5GMKm 2HMAA 5CQYA 1BCOA 1XNIA 3CPWP 1K9MU 1FMVA 1WA7A 4DBHA 1X6GA 1QVFP 2GQIA 5LJ3h 4ATOA 1NEGA 2AKLA 2FHDA 2VXEA 3M59A 3NTIA 4WF2A 1D1AA 4X34A 4CRIA 2BZYA 2F1LA 1M3AA 2ESWA 2X4XA 4HT9A 1ACMB 2IIMA 4XTWA 3OBWA 3BDLA 5I21A 1KK7A 2VVKA 1JJ2S 1SSFA 4EDUA 2KGTA 1KQ1A 4AFZC 1W1FA 1Q82U 3G6EQ 3J80E 2ZPHB 2L8DA 1X27A 1H3ZA 4GBQA 5AYFA 2QTVA 1H92A 4F7UG 4MMKA 1BI1A 3J7AF 4C8QF 1QP3A 2DF6A 2CP3A 1HYOA 2QASA 2QQBA 3CMET 4R0KA 3E19A 2FG0A 4M77C 4LNPA 2O88A 4RG8A 5IHNA 1WHKA 3OS2A 2IVWA 3MEUA 4MMLA 1PKSA 3EFSA 2PVGB 2LP5A 2X9HA 3RIRA 1NYFA 2KMTA 1SG5A 1OULA 5KYUA 2YLCA 2OX7A 1YHQT 3FJPA 1QQJA 3ER0A 2E64A 4DOWA 4J6YA 2RH2A 3QJ6A 3SB2A 4M78G 2EQIA 4C92C 4EMGA 1IZ6A 1D0YA 2O31A 2RHYA 3VJPA 3MP1A 3MEWA 2KBTA 1E6HA 2RI5A 1X2QA 2V8IA 1VQPT 4EPCA 4PJOB 2OAWA 1N27A 4C8QD 4J9EA 1UGQB 3CC4T 3EH2A 2GFAA 2EPDA 1VQMA 1D3BB 4V2SA 3V8JA 2AZSA 1RACB 4DQ2A 3BY7A 3OBYA 4C8QE 1BCMA 1ZUYA 2NUPA 4QVCA 4PJNA 2PQWA 5IN1A 4A4HA 5DM7R 3OYNA 3CCLA 1WIEA 3C12A 3CCJQ 1MNDA 2MF2A 3OB9A 4FM4B 4E47A 1GFDA 4J9FA 3CBMA 1YITT 1QVFS 4BE0A 4LDWA 5CKEA 3CCQA 2LJ3A 5I22A 4ME7A 1VQNT 4M77B 2Y4XA 1FYNA 1MV3A 4PJLA 2P0QA 4J6WA 1YJWQ 3QWYA 4O5VA 2VGMA 4HKEA 2CGHA 9ATCB 1WJSA 3MEVA 1M2OA 3I55A 5I11A 3QDRB 5GAMd 4LDVA 2ABLA 4FL6A 4KUDK 2RQRA 1NYGA 2ZGWA 4PJJA 4A4KA 3X28B 1SPKA 2DJZA 1QVPA 3JCMW 4KULA 3HTRA 1PKTA 1OOTA 2LMJA 1F1BB 4Z02A 2KAFA 3DLLA 1VIFA 1M30A 2AHJB 2KXDA 1JO8A 2RN8A 8AT1B 2JNGA 1TS9A 4GY5A 2D8JA 2JS0A 1OYXA 4PJOF 1H3HA 4FW2A 1I81A 2FB7A 2HD0A 3CCSQ 3URGA 1KQSS 1V29B 1YWPA 1Q82R 2RB6A 2ZZDA 4CC3A 4HCCA 2CZ7B 3M58A 2ED1A 3GLXA 4IURA 2HEQA 3VKIA 2ROLA 3CPWS 2ROTA 4CI0C 5GAOl 2CP7A 1VQPQ 2RI2A 3HRTA 2QYZA 3SD4A 3SWNB 2HDAA 2F2XA 3JB9J 5J39A 1SKUB 1TUCA 3CC4Q 5FU7C 1K0SA 1NLPC 4C92G 3TU4K 4YTLA 1MGQA 1RAGB 5GAOm 3M53A 2EGEA 2QQAA 4L59A 2DIGA 1UUEA 1YCSB 4KT0E 3RMSA 5M9OA 2MWPA 2RM4A 2BZXA 2M16A 4C0DB 4PJMA 2K7AA 4JUVA 2DBMA 1UTIA 1BIBA 1MV0B 1RUWA 1Z9ZA 4MDXA 3CCRA 1UGSB 2L3PA 5GAOq 3OYJA 5I2MA 4JJNK 2P0PA 1KQSP 2WSCE 4ZTJA 1MMNA 4Y28E 3V8KA 2LQNA 2JJ9A 2MWOA 2QQ9A 1K4US 3ME9A 3EGDB 3TVTA 3CQTA 3TEEA 1B7TA 4GLMA 1VQNQ 3A8MB 2V1QA 3RMQA 4M7AC 1MHNA 2R5MA 3J81E 1G8XA 4KBMB 1WJRA 2JZ2A 1OX9A 2QA4Q 1UJYA 3JCMg 5HY6A 2FPFA 1FXXA 3V7CA 1LPLA 4J9IA 4Y91A 4AG1C 1PRLC 5GMKj 2LC4A 4ZGDB 4F7UB 3CMEA 2DL4A 3CCEA 1YI2A 4DBQA 1WHLA 3LWIA 2JOYA 1M1GA 2A0FB 1BYMA 3JCMP 3M4GA 3MPUB 1T3LA 1I07A 4OMLA 2DZCA 2LDMA 2LJ1A 3QSUA 4FYVB 1PD0A 2KRNA 4RTXA 1AWOA 3Q1JA 3JB9F 2QXFA 1PC0A 1N5ZA 1CKAA 4DBFA 3VS6A 5D7UA 4F7UA 1VQKA 1J3TA 5IT9E 5LJ5f 1RAEB 3CMAQ 1ABQA 6AT1B 3FIFA 3CD6Q 4M77E 3RESA 5CKFA 1YJNT 3HP9A 2KK4A 4XTZA 4DBRA 3NMZC 1GBRA 2P4RA 3G71T 1GCPA 3P8BB 3UDCA 5HCKA 2OTLQ 1WXBA 2RNAA 1PSFA 2EGAA 4C92A 4BI3A 3EH1A 3WVDB 3BE3A 1AD5A 1JQQA 3CCUA 2KYMA 4IKFA 1U06A 3VU3C 4E7JA 1V76A 3OW2P 1YNZA 1LVKA 1K9MC 3ASKA 3SEMA 5CO7A 1ZUKA 2E4HA 4QVDA 2QEXA 2YRCA 1MUZA 2E10A 2YDLA 5CCAA 4ANJA 2GTJA 3EFOB 1UEBA 3CMAA 2XICA 2PNIA 4F7UE 4JRPA 1UG1A 2L2PA 4JLGA 1HJDA 2XI9A 4O6JA 4D8KA 4HVVA 1BIAA 1M90C 2L0AA 1JU5C 1YIJA 1M3CA 1JEGA 4M75C 2RQVA 3GBQA 2E12A 1Q86R 3G6ET 2K3XA 4AFSC 1AWXA 2NUTB 3E9GA 4M77D 2V26A 4IUPA 1YN8A 1ZUUA 5FU6B 3C0CA 3CCEQ 3CC2A 1QMCA 1U1TA 5A0DA 4QKUA 2R58A 3RKXA 3F70A 2DM1A 2RK1A 2W0ZA 2X4WA 3TQ7P 1Q86C 2FPEA 1VQ4T 3OW2A 2QI2A 3U23A 3M0SA 4M7AD 2DXBA 2X35A 1UB4A 3VYHB 4JPBW 1VQLA 2DEUA 3REBB 3G1JA 4ZNXA 3CPFA 3NPFA 2COZA 1S1NA 2BE7D 1Y0MA 3HKSA 4JJBA 5FROA 1PRMC 2DKGA 2KRMA 2DNUA 3VS5A 1O9SA 4PFPA 2ATCB 1KQ2A 2F5KA 4LDYA 2RQWA 2NUPB 3VRZA 1NJIR 4LD9K 4QT7A 3M0RA 4RKUE 2LNHB 2EJ9A 1ZQ1A 4OB2B 1IO6A 3G71Q 3I9QA 1I0CA 2JMAA 1D1BA 1EFNA 4NL2A 1BBZA 2YUQA 2RI3A 2WACA 4AFUC 1N8RR 4C8QA 4K11A 2JVVA 1K73U 4FSSA 4BDZA 2PVDB 1MNEA 3I56Q 3MJXA 4PJOG 2K5LA 2JUFA 4M7DB 2CREA 3A8HB 1ZBXA 3OA6A 1FMKA 5GMKh 2EYWA 4NOYA 1RAHB 1NLOC 1VQOT 3NFCA 2A36A 1QKWA 2K57A 5GANe 4C8QB 4Z88A 3CCJT 4OF1A 1QVFA 4ZGJB 4J6XA 2VUBA 3OYFA 2RA2A 1ABOA 1PCXA 2QGFB 2ZAEA 2YHTA 1D1CA 1YJWT 5LJ5h 1OEBA 3CCRQ 2ECZA 1O75A 5KCOA 2RD1A 2EYZA 1RLQC 1VQKQ 4F04B 5GAMe 5IXBA 2YUPA 3QWXX 1ZA1B 3EG9B 4EMKB 1VQ4A 3EHQA 3OS5A 2DRKA 1MMDA 4M75F 1VQ9A 4Z8AA 2KSSA 1NE8A 1OU9A 1VQ4Q 1NZ9A 4M7DD 2KY9A 2LX7A 1M2VA 1B34B 3V8LA 3BW1A 1X6OA 2YUOA 4JDSA 1YWOA 1AWJA 3UT1A 2C0TA 3QYHB 1K73C 4DOVA 4HCZA 2KE9A 1PWTA 3LW5E 1YJ9A 3I5SA 4D8DA 2E5QA 1NM7A 2GQVA 2LQ8A 4AMCA 3RR6A 1V1CA 3VS3A 4CC7A 2JTFA 3QZ5B 2QTXA 1X75C 4JLIA 2EWNA 3RUXA 2XG8D 5D6YA 1SRMA 2GNCA 2HL3A 3LH0A 1WQWA 2VB6A 4KGXB 5EG2A 2K79A 4M78E 4E7SA 2EKHA 5L23A 1BKBA 2KQWA 4J7FA 1JXMA 3QO3A 1Y71A 2CZ0B 2K5IA 1GXIE 3L1AA 2CP2A 3GF5A 4A4GA 3L2RA 1AVZC 2JN0A 1QKXA 4XU1A 5CR2A 5KYXA 3HRSA 4FSXA 2W10A 1JXOA 5GAN6 2VWFA 1G3TA 4OB0B 4MZPA 2MAMA 1KD1U 4E7LA 3UA6A 1OPKA 2RQUA 3H0FA 3OYKA 5GAOr 7AT1B 1UGRB 2DXUA 4JRQA 3L2QA 2XD0A 3META 5IAYA 1M1KR 3VS1A 3CCUT 1ZHIA 3EGXB 3S6WA 5GANh 1G5VA 2EGCA 1X69A 2DILA 1IB8A 1M1KC 2NLUA 4C5IA 4M7DF 4JRKA 4J8OA 3CCRT 1VQ7Q 4PJOC 2QA4A 2PUKB 3MP8A 2YRVA 3CBPA 3DB3A 4A54A 2DTOA 1YFNA 3HFOA 1VQKT 4HXJA 3CXCA 5IHKA 4FT4A 2K2VA 3UF4A 1KD1R 4FT2A 1YHQA 2GGRA 2XDPA 1M9SA 1YITA 2DZ9A 2ZPEB 1K8AU 2HQXA 2M0OA 4J5YA 3R6NA 4M7AF 3G4SA 3M54A 1M90R 2QQSA 2QDYB 4M78C 3MP6A 5CKBA 1CKBA 2QGGA 2FZKB 2DTHA 3FEOA 2HZYA 2M1HA 2QG9B 4M7AB 4IIMA 3LH5A 1HSQA 4XQ3A 2FO0A 1B07A 2LX9A 2J6KA 2QK0A 2ZPIB 4ZGEB 3JAME 4IUTA 2LVMA 5HK0A 3OYIA 3CMAT 1VQ6T 2SEMA 1RABB 2MMPA 3A5ZB 1UDLA 3L2ZA 1K9AA 5C6SA 1YJNQ 2JS2A 1AEYA 5GAOn 1IRXA 4PL6A 3CCVQ 1S72A 4MZMA 5EC7A 1VQ6A 2NYSA 3JCMJ 2FRYA 5GJVB 3E9FA 2BTTA 2DD5A 3OYBA 1WQ7A 2VASA 2DPPB 3M0PA 1QLYA 2MPXC 3SDZA 5CAIA 4OGCA 1I5LA 3QKJA 2H3JA 2DA9A 4NL3A 2YUNA 2XDBA 3VV0A 3G71A 4M75D 4MZTA 3OS0A 2FPDA 3MEAA 2EBPA 2LQKA 1BI3A 5CVIA 4JJDA 3V7SA 3CCQT 4C92D 2IPOB 3QJYA 3FC3A 1EIFA 4JJCA 2KT8A 2CH4A 3INZA 4QQDA 1PSEA 1UHCA 4AFQC 4M7AE 1N6AA 2LCCA 3M0UA 1R0CB 2HQEA 4C8QC 1ZSZC 2DERA 3CD6A 4PLLA 2K3YA 2VKNA 2DVEA 2RJEA 4C8QG 4PJOE 3CCMT 4BY6B 5GAN8 3PGGA 1VQ9T 4M78B 2RHUA 1NPPA 4ELYC 3PMTA 5DLOA 3PT9A 3I55Q 4Q5WA 4E7HA 2L3SA 8ATCB 3RERA 5GANj 1VQMT 2P0KA 3CCET 1T0JA 2M0YA 1Z9QA 2LRQA 1WPYA 4BI8B 1TXQA 4WCIA 5KYWA 1JJ2A 3QIIA 1C0MA 3JCMe 4HCKA 3MCAB 1ZA2B 2JXBA 1JJ2P 5AT1B 4E7KA 2J6OA 1VQ8A 1PM3A 1PD1A 1X01A 1H641 5LJ5e 4M7AA 1VYUA 4HVWA 5C0MA 4BACA 3EFOA 5GAN5 3VYGA 3HRUA 2YRDA 3CC4A 1PHTA 5DLQE 2XIDA 3UA7A 1ARKA 1SEMA 4XTXA 4KRTA 1KFZA 3GOXA 3CCVT 1VQPA 2R57A 1QVGA 2RMOA 1OZ2A 4N4GA 1Q86U 2JT4A 3VS7A 5HKCA 4BB7A 5GANf 2V8JA 2NUTA 2RHZA 1C6VX 3VS2A 1YJ9T 5KYYB 4DA4A 2GFUA 2Y4YA 1HK9A 3CC7A 3CPWA 1EZZB 4BD3A 2DL8A 3OY9A 4C0GA 1Y57A 3I56T 1Q95G 2AK5A 2PVOB 1FX7A 1M90U 3PTAA 3CCQQ 4KGVB 1RI9A 1GFCA 4M75E 2DEQA 1LNXA 1VQOQ 5J3BA 5CK9A 1WGSA 5KYUB 2BKDN 2AZVA 3LX7A 4KGZB 1XOVA 2G6FX 2K3BA 1UGPB 3JCMf 2EFIA 3JB9D 1UGVA 4N4HA 1HD3A 1NJIU 4XU2A 4A63B 1JBMA 3MHXA 3CBOA 1U1SA 3QUIA 4A4EA 1RLPC 1X43A 1VQ9Q 1TWBA 1WHMA 4RUGA 2V8KA 2E6ZA 2FZGB 3I55T 2FL7A 3OYHA 1G3YA 2BE9B 2HL5C 2LT4A 1VQMQ 2G3RA 4E7IA 2F69A 4PJOD 4PKCC 1RADB 1IHWA 1TU0B 2MI6A 2H3EB 5IH2A 1QWEA 2HSEB 5GAN4 2DD4A 2KYBA 3RNJA 2X51A 1WHHA 1QP2A 2E41A 4AG2C 2E70A 3KFVA 2A3LA 3HFNA 2CUBA 2OTLA 2NUZA 1GCQC 2DYIA 1CSKA 2K5FA 1HXDA 2EQJA 1GL5A 1QCNA 4IIOA 4FYYB 4XU3A 3JCMV 1VQNA 2YSQA 4M7DA 1N8RU 3EAEA 5FWBA 5KCHA 1WNLA 3JSCA 2V1RA 2VC8A 3OMCA 2KI7A 4RTYA 3KXTA 3NTKA 2Z0WA 2HAXA 1UE9A 3PMIA 4M7AG 3JB9H 4II1A 3ZFJA 2E3HA 2X4JA 2EVRA 2LCLA 5KYXB 2D1XA 4C92B 1K8AC 2E1HA 4E7ZA 4M77A 4PFOA 3M57A 4ZN1A 5KE3A 2L3QA 3QZ9B 3ZL7C 3KBGA 4EIKA 3CCJA 4ESRA 2GBQA 2EJFA 4TVRA 1MMGA 4M7DG 3BFMA 2HCKA 4XAXB 5GAN7 2XMFA 3FRNA 1B3QA 2AIRB 1RL2A 4JS4A 3QBYA 1XQHA 4XTYA 2RK2A 3EGXA 4EMHA 5LJ3d 3OYAA 5GAOp 1Q81U 1RAIB 2PUOB 1VYVA 2XHCA 1VQOA 3RKWA 2A7YA 4N4IA 4N0AC 2ZPBB 1G3WA 2EYYA 2CT4A 1BI2A 1OPLA 4E2FB 1N8RC 1OZ3A 3RDVA 2BZ8A 4DEYA 3CCUQ 2MK5A 4OB3B 2CDTA 1ZX6A 1VQLQ 3M55A 2HNIA 1Q81C 1SSHA 3FB9A 1EX4A 5GAMh 4ZTFA 4P5NA 3LYIA 1QW1A 3P8HA 3OYCA 1NPRA 2DK3A 4JRIA 1GCQA 3AHUA 1WJQA 4LDUA 3KUFA 1U5SA 4JS5A 2CP5A 2DYBA 1VQ8Q 3MO8A 4BE2A 3CCLT 4M7DC 2OTJA 5LJ5g 1VQ7T 1VQ5T 2DFUA 1Q81R 2KR3A 2EQUA 4M78D 1OQKA 3GP8A 5CIUA 2CKKA 1UJ0A 1ZSZB 4FYWB 4C0FA 3JB9I 4OMOA 3S3OA 2RQTA 1YJNA 3RKYA 4J7IA 1UHFA 4OGEA 2XK0A 1TSFA 5FWCA 1MMAA 3REAB 2DETA 3H41A 2DXTA 1GBQA 3L42A 2JTEA 4C5HA 2R5AA 3E2UA 4ORZA 1KQSA 3OYDA 2IG0A 1SHFA 2F2WA 1KSWA 2KRSA 3VUBA 3A8LB 1PNJA 2MYSA 3EFRA 1VQ6Q 4M77G 4L6V5 3TSWA 2VV5A 1N9SA 3EGDA 4J9HA 1YP5A 5GAMg 5CKHA 2DBKA 3OYEA 1ZBJA 1AWWA 1M1FA 2NWMA 3L2UA 1OI1A 3L2WA 3M4YA 3JCMh 1Y7XA 3OYLA 5DY9A 4FU6A 2LT1A 1KC8C 1RAAB 2DL5A 2L5QA 2ENMA 2OI3A 3FDRA 3TSZA 3A1PA 2FYKA 1QWFA 1WHJA 2Y90A 1VA7A 4QQ6A 1X2KA 4OB1B 1WFWA 2DAQA 4C0DC 5GMKl 1KD1C 5FRMA 4RMOA 2EYQA 1DJ7B 2RJFA 1BK2A 1W4SA 3NTHA 4LUDA 3CCVA 5GANd 1QCOA 1WLPB 4Y92A 2KEAA 1WHGA 4GLKA 5CKDA 2X3WD 1ZSGA 4HVUA 1I5OB 2LJ0A 4AT1B 4J83A 5KYWB 1PG5B 3I5RA 2CYZB 3VS0A 2RJDA 4M75B 3CCMQ 4JZ4A 3GIBA 3EG1A 1W2BS 3SFMA 1VQ8T 1OU8A 1LOJA 3CCLQ 4LXCA 4M75G 1YCYA 3WXMB 2GCXA 1YI2T 4M77F 2XKOC 2PZ1A 2M9UA 2I2LA 2J05A 5CQXA 2PTKA 1WZOA 3X24B 3HHTB 1NBEB 3CC7Q 4CC4B 2DJQA 2EQMA 5LJ3g 5KE2A 5A0GA 2E5KA 1Y07A 3DB4A 2JM8A 3R6OA 5IHIA 1QVGP 4R56A 4LDXA 3A8OB 2DIQA 3E1SA 4BY6C 3LGFA 3A8GB 1Q7YR 1XJWB 1KJWA 3CCMA 5D6XA 4C92E 2OAUA 2RHXA 2A28A 1D0ZA 4UC4A 5KYYA 3UPUA 2CT3A 2CZ6B 3UWNA 3OYYA 2D6FA 5LJ5j 3PVLA 3UATA 4LD6A 1K9MR 4RTWA 2YLBA 1M8VA 2BUDA 4BDYA 1Q7YC 2O4XB 2WSEE 5LJ3j 2D8HA 3LLRA 3QDFA 3G4ST 2JM9A 2VGNA 2COWA 2YWWA 4J9DA 1KIKA 1M4ZA 3H0IA 5J26A 4J9BA 5GAMf 5A2QE 4M78A 4X1VA 3MKDA 3X26B 3G6EA 3X20B 3VRYA 2C0IA 2ED0A 1YJ9Q 4OMQA 2D0QB 1M8MA 4XU0A 4BI4A 1OV3A 2K9GA 2B86A 1YIJT 4IUVA 2K6DA 3OYGA 2L89A 1VUBA 4B9XA 1AT1B 3D7SB 3CCSA 1M27C 1AHJB 5GAN3 4QW2A 4PFZA 2J6FA 4QVZA 4XTVA 5GMKi 1SF9A 4FYXB 1SHGA 1X6BA 3HSBA
chains in the Genus database with same CATH topology
3JRZA 2V8JA 4MDWA 1H3ZA 3H6ZA 5AYFA 1M5Q1 2RHZA 3HKSA 1VQ7A 4F7UG 1YJ9T 4MMKA 5FROA 4DA4A 2GFUA 1BI1A 3M5AA 2CZ1B 2Y4YA 3J7AF 1HK9A 4PLIA 4C8QF 5LJ3e 1QP3A 2DKGA 3CC7A 3CPWA 3QPHA 4RCCA 1KC8U 4BD3A 2QQBA 3OY9A 3TREA 3CMET 4C0GA 4N0AA 4C92F 3I56T 1O9SA 3E19A 2PVOB 1FX7A 4M77C 1M90U 1KQ2A 3PTAA 3G7ZA 2F5KA 4LDYA 3OW2S 1I4K1 3DKMA 4RG8A 3OS2A 2IVWA 4M75E 2DEQA 4LD9K 1LNXA 3MEUA 3QHSA 3EFSA 4MMLA 4RKUE 2PVGB 3RIRA 5J3BA 5CK9A 1WGSA 2EJ9A 1ZQ1A 2KMTA 4OB2B 1I8FA 2BKDN 1M1KU 2YLCA 1YHQT 3LX7A 2QEXT 3FJPA 1D3BA 4NL2A 4BUGA 1XOVA 2RI3A 3ER0A 1UGPB 3JCMf 2E64A 2EFIA 2WACA 3JB9D 4N4HA 1U8RA 4DOWA 4J6YA 1NJIU 4EMKC 2RH2A 3QJ6A 4XU2A 3SB2A 4C8QA 1JBMA 2JVVA 3MHXA 4M78G 1K73U 3CBOA 1U1SA 4C92C 4BDZA 3QUIA 2PVDB 4EMGA 1IZ6A 4A4EA 4PJOG 2K5LA 2JUFA 2RHYA 5D6WA 3VJPA 3MP1A 4M7DB 3WVEB 3MEWA 3A8HB 3JB9G 2V8KA 2RI5A 1ZBXA 2E6ZA 4OVAA 3OA6A 3I55T 2V8IA 1VQPT 2FL7A 4EPCA 4B9WA 2ZCFB 5GMKh 3OYHA 4PJOB 1G3YA 2LT4A 2G3RA 4NOYA 4E7IA 3PNWC 1N27A 2HBPA 1Y96A 1VQOT 2F69A 3NFCA 1LJOA 4PKCC 4C8QD 4PJOD 1UGQB 2MI6A 2K57A 3X25B 5GANe 3CC4T 5GAN4 4C8QB 3CCJT 2DD4A 2GFAA 4OF1A 1VQMA 1QVFA 3PIOA 4ZGJB 4J6XA 1XTDA 1D3BB 4RCBA 2C06A 3CC2T 2VUBA 4V2SA 2ZPFB 3OYFA 1QP2A 2E41A 2RA2A 2XDDA 2E70A 2A3LA 3V8JA 3JCMX 3HFNA 5I2SA 4DQ2A 2OTJT 1G3SA 3BY7A 2OTLA 2YHTA 2K5FA 1HXDA 1KHIA 3OBYA 1KG1A 2EQJA 1YJWT 4XU3A 4C8QE 3JCMV 5LJ5h 1VQNA 4M7DA 4QVCA 1N8RU 3EAEA 1O75A 5KCOA 5KCHA 2RD1A 1WNLA 2PQWA 5IN1A 4A4HA 3JCMd 1R8OB 2VC8A 2L3RA 3JSCA 3OMCA 5DM7R 1VIEA 2E6NA 3OYNA 3KXTA 3CCLA 3QYGB 3NTKA 2P4TA 2RJCA 3SWNA 5GAMe 2HAXA 2EAYA 3PMIA 3C12A 3VUZA 4M7AG 3JB9H 4II1A 2KVQG 4EMKB 3ZFJA 2X4JA 4R55A 1VQ4A 1KHCA 2LCLA 2MF2A 3OB9A 3OS5A 3OSVA 4FM4B 4E47A 3OYMA 4M75F 3ZBDA 4C92B 1VQ9A 2KSSA 1K8AC 1NE8A 3CBMA 1YITT 1NZ9A 4M7DD 1QVFS 2E1HA 2KY9A 4BE0A 4LDWA 5CKEA 1B34B 4M77A 3M57A 3V8LA 4KUIA 4ME7A 3QZ9B 3GNGA 4ZN1A 1B34A 2Y4XA 4M77B 3PFSA 3KBGA 1VQNT 3BW1A 1X6OA 3CEYA 3QG1A 3CCJA 2P0QA 4JDSA 1JRIA 2CS7A 4BE1A 4J6WA 4C0ZA 4O5VA 2EJFA 2VGMA 2EIFA 2CGHA 3QYHB 4HKEA 4TVRA 3UT1A 1K73C 1WJSA 3MEVA 4HCZA 4DOVA 4PJOA 4M7DG 3I55A 3LW5E 1YJ9A 3BFMA 4C5EA 3QDRB 5GAMd 4LDVA 4FL6A 4XAXB 2E5QA 4KUDK 5GAN7 3FRNA 2GQVA 4X9CA 2LQ8A 1RL2A 4JS4A 3QBYA 1XQHA 4L5GA 1VQLT 2ZGWA 4XTYA 3PIPA 2RK2A 4A4KA 4EMHA 1BI0A 2XU8A 5LJ3d 3X28B 2JTFA 3OYAA 3QZ5B 5GAOp 2QTXA 1X75C 1Q81U 2DJZA 1QVPA 4JLIA 3JCMW 2EWNA 2PUOB 4KULA 3RUXA 3S3MA 2XHCA 1IREB 2XG8D 3HL8A 1VQOA 5D6YA 2KAFA 4Z02A 2E65A 3LH0A 3RKWA 3DLLA 5GANg 2A7YA 4N4IA 1VIFA 1WQWA 4N0AC 2ZPBB 1G3WA 2AHJB 3FLGA 5EG2A 1S72T 4M78E 1BI2A 2JNGA 2X4YA 1N8RC 4GY5A 1BKBA 2KQWA 4J7FA 3QO3A 1OZ3A 1P92A 1Y71A 2CZ0B 1RI0A 3O8VA 4RG2A 2K5IA 4X9DA 1GXIE 1OYXA 4PJOF 3L1AA 4ELZC 3GF5A 4A4GA 4OB3B 1I81A 2F5TX 2FB7A 5KH6A 2HD0A 3L2RA 4M78F 1NJIC 3M55A 5L8RE 2HNIA 2JN0A 3URGA 1KQSS 1V29B 1Q81C 3JCMc 3FB9A 4XU1A 4ZTFA 5CR2A 5GAMh 1Q7YU 2RB6A 2VYTA 2ZZDA 2BIVA 4P5NA 5LJ3f 4HCCA 4VUBA 2CZ7B 3LYIA 1JB0E 1QW1A 3M58A 3P8HA 3HRSA 3OYCA 4FSXA 3GLXA 4IURA 1NPRA 2DK3A 3VKIA 5GAN6 4JRIA 3AHUA 1VQ5A 1G3TA 1WJQA 3KUFA 4LDUA 4OB0B 3GPLA 4JS5A 4MZPA 3CPWS 2MAMA 4CI0C 1KD1U 4NS5A 4E7LA 1FWZA 3MO8A 4BE2A 3CCLT 5GAOl 4M7DC 5LJ5g 2OTJA 1VQ7T 1VQ5T 2LTOA 3OYKA 5GAOr 2RI2A 3HRTA 3SD4A 3SWNB 1UGRB 5LL6S 2DXUA 3JB9J 4JRQA 3L2QA 2XD0A 2EQUA 4M78D 1Y96B 2K4YA 3META 3P8DA 3SWNC 5J39A 5IAYA 1YJWA 3GP8A 5CIUA 5FU7C 2CKKA 4C0FA 3JB9I 3CCUT 4C92G 3TU4K 3V7RA 1ZHIA 2RHIA 3CCST 3S3OA 4YTLA 1MGQA 2DXCA 1YJNA 3RKYA 5GAOm 2D9TA 3M53A 4J7IA 2QQAA 3S6WA 2KDSA 4OGEA 5GANh 3L2VA 2XK0A 4L59A 2DIGA 1G5VA 4F7UF 2B8AA 4KT0E 3RMSA 5M9OA 2MWPA 2RM4A 2M16A 1M1KC 4C0DB 2DXTA 4JUVA 3HPWA 3LGLA 2NLUA 4C5IA 3L42A 4M7DF 4JRKA 4J8OA 1BIBA 4FIBA 4C5HA 3CCRT 4PJOC 2JTMA 2R5AA 2QA4A 2PUKB 3MP8A 2YRVA 3T9NA 3H8ZA 3CBPA 3DB3A 4A54A 4MDXA 5GMKe 1KQSA 3CCRA 1UGSB 2DTOA 3OYDA 2IG0A 3HFOA 5GAOq 3CCQA 1VQKT 4HCBA 3OYJA 3CXCA 5I2MA 4JJNK 4FT4A 2K2VA 3VUBA 3A8LB 2P0PA 4FT2A 2WSCE 4ZTJA 3EFRA 4M7DE 4Y28E 1YHQA 3V8KA 2MWOA 2QQ9A 2XDPA 4L6V5 4M77G 5LJ5d 3ME9A 1M9SA 2VV5A 1YITA 1QVGS 2DZ9A 2ZPEB 1K8AU 1N9SA 2HQXA 4M75A 2M0OA 4J5YA 5FRNA 3TEEA 5GAN2 5GAMg 1TH7A 5CKHA 4M7AF 3G4SA 3M54A 3OYEA 3A8MB 1M1FA 2QQSA 3L2UA 1OI1A 2QDYB 3L2WA 4M78C 2FVUA 3M4YA 3MP6A 5CKBA 4D6WA 1Y7XA 1YBYA 2EQKA 3RMQA 1MHNA 2DTHA 2R5MA 3JCMh 3J81E 3OYLA 4M7AC 3FEOA 2M1HA 4KBMB 5FU6C 1WJRA 2JZ2A 4M7AB 5KE3A 2RO0A 5DY9A 4FU6A 4XQ3A 3JCMg 5FLXE 5HY6A 1FXXA 2LT1A 1KC8C 3V7CA 4XTUA 2VXFA 2LX9A 4Y91A 2ZPIB 4ZGEB 2L5QA 3FDRA 3JAME 4IUTA 2FYKA 2LVMA 5HK0A 3OYIA 3CMAT 5GMKj 2LC4A 4ZGDB 1VQ6T 4F7UB 3CMEA 2Y90A 3CCEA 1YI2A 4QQ6A 1W2BA 2MMPA 3A5ZB 4OB1B 2JOYA 3LWIA 1M1GA 2DAQA 3L2ZA 4C0DC 4HA8A 5C6SA 1BYMA 5GMKl 1KD1C 3JCMP 5GAOn 3M4GA 4PL6A 5FRMA 1S72A 4RMOA 4MZMA 2DZCA 2LDMA 2EYQA 1DJ7B 4IUUA 1VQ6A 3QSUA 2RJFA 1W4SA 3JCMJ 3NTHA 3C94A 3LWHA 3CXCS 2QQRA 3E9FA 3CCVA 3OSSC 2DD5A 3OYBA 4A53A 1WQ7A 3Q1JA 5GANd 2DPPB 3JB9F 2QA4T 2QXFA 3SDZA 5CAIA 4GLKA 4OGCA 1I5LA 5CKDA 3JCMb 3QKJA 2H3JA 3I56A 1Q82C 1N9RA 2WSFE 5HK3A 4NL3A 1VQKA 4F7UA 2DTIA 3OQ5A 2XDBA 3VV0A 5IT9E 3G71A 2EJGA 5LJ5f 4HT8A 4M75D 4J83A 3CC7T 3S3NA 2O4XA 3FIFA 4M77E 4MZTA 2CYZB 3RESA 3OS0A 3M9QA 3GNFB 2RJDA 5CKFA 4M75B 2EKOA 3MEAA 3GIBA 2GF7A 2LQKA 3C95A 1YJNT 1W2BS 1BI3A 2KK4A 3HP9A 5CVIA 3SFMA 3V7SA 3CCQT 4C92D 3M56A 1VQ8T 1LOJA 2ZPGB 3QJYA 5GAMj 4M75G 3FC3A 1EIFA 4OP0A 1YCYA 3WXMB 2GCXA 4XTZA 1YI2T 4M77F 3INZA 4QQDA 1PSEA 2XKOC 4QQGA 2M9UA 2I2LA 4M7AE 3DLMA 1N6AA 3OMGA 2LCCA 5A0LA 3G71T 5CQXA 3P8BB 2HQEA 3UDCA 4EMKA 4C8QC 4C5GA 3X24B 4PLLA 4XK8E 3CD6A 3HHTB 4A4FA 1PSFA 2K3YA 2DO3A 4C92A 4BI3A 2DVEA 2RJEA 2EQMA 3WVDB 4ZN3A 4C8QG 3BDUA 5LJ3g 3JCMQ 3CD6T 4PNOA 3C4SA 5A0GA 3DB4A 1Y07A 5KE2A 3CCUA 3R6OA 4IUQA 4PJOE 4R56A 3TCJA 3CCMT 4IKFA 4LDXA 3A8OB 3VU3C 2PU9B 4BY6B 4E7JA 2DIQA 5GAN8 3E1SA 3PGGA 1VQ9T 4M78B 2RHUA 1NPPA 4BY6C 4ELYC 1K9MC 3LGFA 3PMTA 3A8GB 3ASKA 3PT9A 4Q5WA 5DLOA 5CO7A 4E7HA 4QVDA 2QEXA 3RERA 5GANj 1VQMT 2P0KA 2E10A 3CCMA 5D6XA 4C92E 5CCAA 3CCET 2OAUA 2RHXA 3OS1A 1UEBA 3CMAA 2XICA 4F7UE 4UC4A 5FU7B 4JRPA 2LRQA 4JLGA 3ZEHA 4OMFB 3QXEB 2XI9A 3UPUA 1WPYA 4BI8B 2OTLT 2CZ6B 3UWNA 3OYYA 2D6FA 5LJ5j 4O6JA 4LD6A 1BIAA 2YLBA 1M8VA 2LNVA 2BUDA 4BDYA 1Q7YC 2O01E 2O4XB 2WSEE 1M90C 5LJ3j 1YIJA 1JJ2A 3LLRA 3G4ST 3QIIA 2VGNA 3N5BB 3JCMe 4M75C 5GMKm 3MCAB 1M4ZA 5CQYA 5J26A 2E12A 1XNIA 4E7KA 3G6ET 2K3XA 5GAMf 1VQ8A 1K9MU 5A2QE 4M78A 1X01A 1H641 3E9GA 4M77D 5LJ3h 5LJ5e 4ATOA 4M7AA 4IUPA 5FU6B 3X26B 3G6EA 3X20B 2FHDA 2VXEA 3M59A 3NTIA 3CC2A 1U1TA 4WF2A 5C0MA 5A0DA 4BACA 4X34A 2D0QB 2R58A 3RKXA 4CRIA 3F70A 2RK1A 4XU0A 5GAN5 3VYGA 4BI4A 2X4WA 3HRUA 1YIJT 2X4XA 1Q86C 4HT9A 4IUVA 3CC4A 3OYGA 4XTWA 2L89A 1VUBA 3OBWA 2XIDA 3BDLA 5DLQE 4B9XA 5I21A 1VQ4T 3CCSA 4XTXA 3OW2A 2QI2A 1AHJB 3GOXA 5GAN3 4QW2A 4M7AD 2DXBA 3CCVT 2X35A 1UB4A 1JJ2S 1SSFA 1VQPA 2R57A 1QVGA 4QVZA 4N4GA 1OZ2A 4EDUA 1Q86U 1KQ1A 4XTVA 3VYHB 1VQLA 1Q82U 5GMKi 5HKCA 3J80E 4BB7A 2ZPHB 5GANf 2L8DA 3HSBA 3CPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EIF A;  2LCL A;  2MWP A;  1YI2 T;  3HKS A;  1VQ9 A;  4QQD A;  1VQ7 A;  1M1K C;  1YJ9 T;  1K8A C;  1YIT T;  1NZ9 A;  3LGL A;  3J7A F;  1QVF S;  3CC7 A;  4ZN1 A;  3CPW A;  3CCQ A;  3CCR T;  1KC8 U;  3G71 T;  2QA4 A;  1VQN T;  3KBG A;  3P8B B;  1X6O A;  3CCJ A;  3CME T;  3TRE A;  3DB3 A;  3CD6 A;  3I56 T;  1KQS A;  3CCR A;  2IG0 A;  2EIF A;  2DO3 A;  3CXC A;  4TVR A;  1K73 C;  1VQK T;  1M90 U;  3I55 A;  4ZN3 A;  3OW2 S;  1YJ9 A;  3CD6 T;  1YHQ A;  3DB4 A;  3CCU A;  3CCM T;  2MWO A;  1VQ4 A;  2LQ8 A;  1QVG S;  1RL2 A;  1YIT A;  1VQL T;  1K8A U;  3PIP A;  1VQ9 T;  5J3B A;  1NPP A;  1K9M C;  3LGF A;  3G4S A;  1M1K U;  1Q81 U;  2QEX A;  1YHQ T;  1VQM T;  2QEX T;  3CCM A;  3CCE T;  2XHC A;  3ER0 A;  1YBY A;  1VQO A;  1UEB A;  3J81 E;  3CMA A;  3LH0 A;  3DLL A;  1NJI U;  2JVV A;  1K73 U;  1S72 T;  2OTL T;  3OYY A;  5FLX E;  5HY6 A;  1KC8 C;  2JNG A;  1IZ6 A;  1N8R C;  2JUF A;  1BKB A;  1Q7Y C;  1M90 C;  4RG2 A;  1YIJ A;  1JJ2 A;  2E6Z A;  3JAM E;  3G4S T;  2LVM A;  3I55 T;  1VQP T;  3CMA T;  1VQ6 T;  3CME A;  1NJI C;  3CCE A;  1YI2 A;  2G3R A;  1W2B A;  3A5Z B;  5J26 A;  1VQO T;  1XNI A;  2JOY A;  1M1G A;  1KQS S;  1Q81 C;  3G6E T;  1Q7Y U;  1KD1 C;  1VQ8 A;  2MI6 A;  1K9M U;  5A2Q E;  3CC4 T;  1S72 A;  1VQ6 A;  3CCJ T;  3G6E A;  1NPR A;  1VQM A;  1QVF A;  3CC2 A;  1VQ5 A;  3PIO A;  3CXC S;  3CCV A;  1XTD A;  3CPW S;  4X34 A;  4CRI A;  3CC2 T;  1KD1 U;  2QA4 T;  2E70 A;  2OTJ A;  3CCL T;  1VQ7 T;  1VQ5 T;  1YIJ T;  1Q86 C;  2OTJ T;  2OTL A;  3I56 A;  3CC4 A;  1Q82 C;  5LL6 S;  5DLQ E;  1VQK A;  1VQ4 T;  1KHI A;  1YJW T;  3CCS A;  5IT9 E;  3OW2 A;  3G71 A;  1VQN A;  5IAY A;  1YJW A;  3CC7 T;  1N8R U;  2CKK A;  3CCU T;  3CCV T;  1JJ2 S;  1SSF A;  1VQP A;  1QVG A;  3CCS T;  4YTL A;  5DM7 R;  2L3R A;  1YJN A;  1Q86 U;  1VQL A;  1Q82 U;  3CCL A;  1YJN T;  3J80 E;  1W2B S;  2KDS A;  3CCQ T;  1VQ8 T;  2KVQ G;  3CPF A; 
#chains in the Genus database with same CATH topology
 3JRZ A;  4MDW A;  3CXC P;  4F17 A;  3H6Z A;  1M5Q 1;  1VQ7 A;  3THK A;  3M5A A;  3RBB B;  2OJ2 A;  2CZ1 B;  4PLI A;  5LJ3 e;  3M0Q A;  1C1A A;  1R0B G;  1WYX A;  3QPH A;  4RCC A;  1KC8 U;  3TRE A;  4N0A A;  4C92 F;  1LCK A;  3M0T A;  2H8H A;  4LE9 A;  3G7Z A;  3OW2 S;  1I4K 1;  3DKM A;  1S72 Q;  1WI7 A;  1G83 A;  1NEB A;  4DEX A;  3QHS A;  1AZG B;  2HKQ B;  1I8F A;  1M1K U;  4FW1 A;  2QEX T;  1D3B A;  4BUG A;  3JCM d;  1U8R A;  3IQL A;  3PE0 A;  4EMK C;  3CME Q;  1I1J A;  1TG0 A;  2O9V A;  1QCF A;  1BU1 A;  5ECA A;  5D6W A;  3WVE B;  3JB9 G;  4OVA A;  1W2B P;  2CSI A;  1KC8 R;  4B9W A;  2ZCF B;  3NGP A;  3PNW C;  1VOM A;  2HBP A;  1Y96 A;  1LJO A;  2FZC B;  3X25 B;  1YHQ Q;  3PIO A;  2LCS A;  1XTD A;  4RCB A;  3PVQ A;  2C06 A;  3CC2 T;  2ZPF B;  2XDD A;  2F2V A;  2KXC A;  2FEI A;  3JCM X;  2C0O A;  5I2S A;  2OTJ T;  1G3S A;  4OMN A;  2CUD A;  1BB9 A;  1KHI A;  1M3B A;  1KG1 A;  3FJ5 A;  1FMW A;  3EGU A;  2HQH A;  1R8O B;  2L3R A;  3EG2 A;  1VIE A;  2E6N A;  1IXD A;  1D09 B;  3QYG B;  2P4T A;  2RJC A;  3SWN A;  2EAY A;  3VUZ A;  1AZE A;  2KVQ G;  4R55 A;  1KHC A;  1YIJ Q;  3OSV A;  5IXF A;  3OYM A;  3ZBD A;  2D0N A;  1RAF B;  4KUI A;  3GNG A;  3VS4 A;  1B34 A;  3PFS A;  3CEY A;  3QG1 A;  1UEC A;  2P84 A;  4BE1 A;  1JRI A;  2CS7 A;  1UFF A;  4C0Z A;  1U3O A;  2EIF A;  3EHR A;  4PJO A;  4C5E A;  2MOX A;  4X9C A;  5GJW B;  4L5G A;  1VQL T;  3PIP A;  1BI0 A;  2XU8 A;  4WTO B;  3JV3 A;  2DL3 A;  1K73 R;  1YIT Q;  1K8A R;  3S3M A;  1IRE B;  2SRC A;  3HL8 A;  2DL7 A;  2E65 A;  2YXY A;  5GAN g;  1ZLM A;  1H8K A;  3FLG A;  1S72 T;  1VQ5 Q;  2X4Y A;  1A0N B;  1K1Z A;  1WXU A;  4RG2 A;  1IGQ A;  1IGU A;  1P92 A;  1RI0 A;  3EG0 A;  3O8V A;  4X9D A;  2CH4 W;  4KH0 B;  4OMM A;  4ELZ C;  1AOJ A;  5KH6 A;  1NJI C;  2F5T X;  5FW9 A;  1GRI A;  4M78 F;  2QEX Q;  1WXT A;  5L8R E;  2HSP A;  2LQW A;  3JCM c;  1Q7Y U;  2AT1 B;  2VYT A;  2BIV A;  5LJ3 f;  4VUB A;  2K2M A;  1JB0 E;  3I35 A;  3GPL A;  1VQ5 A;  2O2O A;  4F14 A;  2KNB B;  4NS5 A;  1FWZ A;  2DRM A;  2LTO A;  5LL6 S;  2DMO A;  3SWN C;  1Y96 B;  2K4Y A;  1W6X A;  3P8D A;  1YJW A;  3V7R A;  2RHI A;  3CCS T;  1TUG B;  2DXC A;  1K76 A;  2D9T A;  2KDS A;  3CC2 Q;  3L2V A;  1E7O A;  1G2B A;  2AKK A;  2B8A A;  4F7U F;  1T0H A;  2COY A;  2OTJ Q;  1TUD A;  4FCY A;  3HPW A;  3AT1 B;  3LGL A;  2DE0 X;  4RTU A;  1W70 A;  4FIB A;  1TOV A;  2JTM A;  3NHN A;  3T9N A;  2RF0 A;  3H8Z A;  2CP0 A;  5GMK e;  2J06 A;  4HCB A;  1NG2 A;  2EYX A;  4M7D E;  2CP6 A;  1ZSZ A;  2MCN A;  5LJ5 d;  2KRO A;  1QVG S;  4M75 A;  2M51 A;  5FRN A;  5GAN 2;  1TH7 A;  3ULR B;  1WX6 A;  2DVJ A;  2FVU A;  4D6W A;  1YBY A;  2EQK A;  4RTV A;  2RPN A;  5FU6 C;  2RO0 A;  2FRW A;  5FLX E;  2DLP A;  2M02 A;  3O5Z A;  4XTU A;  2VXF A;  4J9G A;  2YT6 A;  1M2V B;  3SHW A;  2KT1 A;  1W2B A;  4HA8 A;  2X3X D;  2HKN A;  3EG3 A;  2QDL A;  4IUU A;  1OX8 A;  4J9C A;  1WDX A;  1YI2 Q;  3C94 A;  3H0H A;  2LZ6 B;  3LWH A;  3CXC S;  2QQR A;  3OSS C;  4RTZ A;  4A53 A;  2QA4 T;  4E6R A;  4M4Z A;  3JCM b;  2JMC A;  3I56 A;  1Q82 C;  1N9R A;  2WSF E;  5HK3 A;  2DTI A;  3OQ5 A;  2A37 A;  2O9S A;  2EJG A;  4HT8 A;  3CC7 T;  4KH1 B;  3S3N A;  2O4X A;  3M9Q A;  3GNF B;  4PK4 A;  1SRL A;  2EKO A;  2GF7 A;  3C95 A;  1VYT A;  4JZ3 A;  1R77 A;  3M56 A;  2EW3 A;  2ZPG B;  5GAM j;  1IHV A;  4OP0 A;  4F16 A;  2A08 A;  2HBW A;  2DX1 A;  4QQG A;  1D0X A;  3DLM A;  3OMG A;  5A0L A;  3EG9 A;  4EMK A;  4C5G A;  4XK8 E;  4A4F A;  2DO3 A;  4ZN3 A;  2I0N A;  3JCM Q;  3BDU A;  3CD6 T;  2MIO A;  3G4S Q;  4PNO A;  3C4S A;  1TTH B;  4IUQ A;  3TCJ A;  4LN2 A;  3A98 A;  2PU9 B;  2J7I A;  1T3S A;  2GTO A;  2CSQ A;  5KYN A;  4RTT A;  3OS1 A;  5FU7 B;  4LUE A;  1K0X A;  4B6M A;  3ZEH A;  4OMF B;  3QXE B;  4Z89 A;  2OTL T;  1E6G A;  4CC2 A;  2LNV A;  2O01 E;  2JW4 A;  2QAZ A;  2E3I A;  3N5B B;  4OMP A;  3H9N A;  5GMK m;  2HMA A;  5CQY A;  1BCO A;  1XNI A;  3CPW P;  1K9M U;  1FMV A;  1WA7 A;  4DBH A;  1X6G A;  1QVF P;  2GQI A;  5LJ3 h;  4ATO A;  1NEG A;  2AKL A;  2FHD A;  2VXE A;  3M59 A;  3NTI A;  4WF2 A;  1D1A A;  4X34 A;  4CRI A;  2BZY A;  2F1L A;  1M3A A;  2ESW A;  2X4X A;  4HT9 A;  1ACM B;  2IIM A;  4XTW A;  3OBW A;  3BDL A;  5I21 A;  1KK7 A;  2VVK A;  1JJ2 S;  1SSF A;  4EDU A;  2KGT A;  1KQ1 A;  4AFZ C;  1W1F A;  1Q82 U;  3G6E Q;  3J80 E;  2ZPH B;  2L8D A;  1X27 A;  1H3Z A;  4GBQ A;  5AYF A;  2QTV A;  1H92 A;  4F7U G;  4MMK A;  1BI1 A;  3J7A F;  4C8Q F;  1QP3 A;  2DF6 A;  2CP3 A;  1HYO A;  2QAS A;  2QQB A;  3CME T;  4R0K A;  3E19 A;  2FG0 A;  4M77 C;  4LNP A;  2O88 A;  4RG8 A;  5IHN A;  1WHK A;  3OS2 A;  2IVW A;  3MEU A;  4MML A;  1PKS A;  3EFS A;  2PVG B;  2LP5 A;  2X9H A;  3RIR A;  1NYF A;  2KMT A;  1SG5 A;  1OUL A;  5KYU A;  2YLC A;  2OX7 A;  1YHQ T;  3FJP A;  1QQJ A;  3ER0 A;  2E64 A;  4DOW A;  4J6Y A;  2RH2 A;  3QJ6 A;  3SB2 A;  4M78 G;  2EQI A;  4C92 C;  4EMG A;  1IZ6 A;  1D0Y A;  2O31 A;  2RHY A;  3VJP A;  3MP1 A;  3MEW A;  2KBT A;  1E6H A;  2RI5 A;  1X2Q A;  2V8I A;  1VQP T;  4EPC A;  4PJO B;  2OAW A;  1N27 A;  4C8Q D;  4J9E A;  1UGQ B;  3CC4 T;  3EH2 A;  2GFA A;  2EPD A;  1VQM A;  1D3B B;  4V2S A;  3V8J A;  2AZS A;  1RAC B;  4DQ2 A;  3BY7 A;  3OBY A;  4C8Q E;  1BCM A;  1ZUY A;  2NUP A;  4QVC A;  4PJN A;  2PQW A;  5IN1 A;  4A4H A;  5DM7 R;  3OYN A;  3CCL A;  1WIE A;  3C12 A;  3CCJ Q;  1MND A;  2MF2 A;  3OB9 A;  4FM4 B;  4E47 A;  1GFD A;  4J9F A;  3CBM A;  1YIT T;  1QVF S;  4BE0 A;  4LDW A;  5CKE A;  3CCQ A;  2LJ3 A;  5I22 A;  4ME7 A;  1VQN T;  4M77 B;  2Y4X A;  1FYN A;  1MV3 A;  4PJL A;  2P0Q A;  4J6W A;  1YJW Q;  3QWY A;  4O5V A;  2VGM A;  4HKE A;  2CGH A;  9ATC B;  1WJS A;  3MEV A;  1M2O A;  3I55 A;  5I11 A;  3QDR B;  5GAM d;  4LDV A;  2ABL A;  4FL6 A;  4KUD K;  2RQR A;  1NYG A;  2ZGW A;  4PJJ A;  4A4K A;  3X28 B;  1SPK A;  2DJZ A;  1QVP A;  3JCM W;  4KUL A;  3HTR A;  1PKT A;  1OOT A;  2LMJ A;  1F1B B;  4Z02 A;  2KAF A;  3DLL A;  1VIF A;  1M30 A;  2AHJ B;  2KXD A;  1JO8 A;  2RN8 A;  8AT1 B;  2JNG A;  1TS9 A;  4GY5 A;  2D8J A;  2JS0 A;  1OYX A;  4PJO F;  1H3H A;  4FW2 A;  1I81 A;  2FB7 A;  2HD0 A;  3CCS Q;  3URG A;  1KQS S;  1V29 B;  1YWP A;  1Q82 R;  2RB6 A;  2ZZD A;  4CC3 A;  4HCC A;  2CZ7 B;  3M58 A;  2ED1 A;  3GLX A;  4IUR A;  2HEQ A;  3VKI A;  2ROL A;  3CPW S;  2ROT A;  4CI0 C;  5GAO l;  2CP7 A;  1VQP Q;  2RI2 A;  3HRT A;  2QYZ A;  3SD4 A;  3SWN B;  2HDA A;  2F2X A;  3JB9 J;  5J39 A;  1SKU B;  1TUC A;  3CC4 Q;  5FU7 C;  1K0S A;  1NLP C;  4C92 G;  3TU4 K;  4YTL A;  1MGQ A;  1RAG B;  5GAO m;  3M53 A;  2EGE A;  2QQA A;  4L59 A;  2DIG A;  1UUE A;  1YCS B;  4KT0 E;  3RMS A;  5M9O A;  2MWP A;  2RM4 A;  2BZX A;  2M16 A;  4C0D B;  4PJM A;  2K7A A;  4JUV A;  2DBM A;  1UTI A;  1BIB A;  1MV0 B;  1RUW A;  1Z9Z A;  4MDX A;  3CCR A;  1UGS B;  2L3P A;  5GAO q;  3OYJ A;  5I2M A;  4JJN K;  2P0P A;  1KQS P;  2WSC E;  4ZTJ A;  1MMN A;  4Y28 E;  3V8K A;  2LQN A;  2JJ9 A;  2MWO A;  2QQ9 A;  1K4U S;  3ME9 A;  3EGD B;  3TVT A;  3CQT A;  3TEE A;  1B7T A;  4GLM A;  1VQN Q;  3A8M B;  2V1Q A;  3RMQ A;  4M7A C;  1MHN A;  2R5M A;  3J81 E;  1G8X A;  4KBM B;  1WJR A;  2JZ2 A;  1OX9 A;  2QA4 Q;  1UJY A;  3JCM g;  5HY6 A;  2FPF A;  1FXX A;  3V7C A;  1LPL A;  4J9I A;  4Y91 A;  4AG1 C;  1PRL C;  5GMK j;  2LC4 A;  4ZGD B;  4F7U B;  3CME A;  2DL4 A;  3CCE A;  1YI2 A;  4DBQ A;  1WHL A;  3LWI A;  2JOY A;  1M1G A;  2A0F B;  1BYM A;  3JCM P;  3M4G A;  3MPU B;  1T3L A;  1I07 A;  4OML A;  2DZC A;  2LDM A;  2LJ1 A;  3QSU A;  4FYV B;  1PD0 A;  2KRN A;  4RTX A;  1AWO A;  3Q1J A;  3JB9 F;  2QXF A;  1PC0 A;  1N5Z A;  1CKA A;  4DBF A;  3VS6 A;  5D7U A;  4F7U A;  1VQK A;  1J3T A;  5IT9 E;  5LJ5 f;  1RAE B;  3CMA Q;  1ABQ A;  6AT1 B;  3FIF A;  3CD6 Q;  4M77 E;  3RES A;  5CKF A;  1YJN T;  3HP9 A;  2KK4 A;  4XTZ A;  4DBR A;  3NMZ C;  1GBR A;  2P4R A;  3G71 T;  1GCP A;  3P8B B;  3UDC A;  5HCK A;  2OTL Q;  1WXB A;  2RNA A;  1PSF A;  2EGA A;  4C92 A;  4BI3 A;  3EH1 A;  3WVD B;  3BE3 A;  1AD5 A;  1JQQ A;  3CCU A;  2KYM A;  4IKF A;  1U06 A;  3VU3 C;  4E7J A;  1V76 A;  3OW2 P;  1YNZ A;  1LVK A;  1K9M C;  3ASK A;  3SEM A;  5CO7 A;  1ZUK A;  2E4H A;  4QVD A;  2QEX A;  2YRC A;  1MUZ A;  2E10 A;  2YDL A;  5CCA A;  4ANJ A;  2GTJ A;  3EFO B;  1UEB A;  3CMA A;  2XIC A;  2PNI A;  4F7U E;  4JRP A;  1UG1 A;  2L2P A;  4JLG A;  1HJD A;  2XI9 A;  4O6J A;  4D8K A;  4HVV A;  1BIA A;  1M90 C;  2L0A A;  1JU5 C;  1YIJ A;  1M3C A;  1JEG A;  4M75 C;  2RQV A;  3GBQ A;  2E12 A;  1Q86 R;  3G6E T;  2K3X A;  4AFS C;  1AWX A;  2NUT B;  3E9G A;  4M77 D;  2V26 A;  4IUP A;  1YN8 A;  1ZUU A;  5FU6 B;  3C0C A;  3CCE Q;  3CC2 A;  1QMC A;  1U1T A;  5A0D A;  4QKU A;  2R58 A;  3RKX A;  3F70 A;  2DM1 A;  2RK1 A;  2W0Z A;  2X4W A;  3TQ7 P;  1Q86 C;  2FPE A;  1VQ4 T;  3OW2 A;  2QI2 A;  3U23 A;  3M0S A;  4M7A D;  2DXB A;  2X35 A;  1UB4 A;  3VYH B;  4JPB W;  1VQL A;  2DEU A;  3REB B;  3G1J A;  4ZNX A;  3CPF A;  3NPF A;  2COZ A;  1S1N A;  2BE7 D;  1Y0M A;  3HKS A;  4JJB A;  5FRO A;  1PRM C;  2DKG A;  2KRM A;  2DNU A;  3VS5 A;  1O9S A;  4PFP A;  2ATC B;  1KQ2 A;  2F5K A;  4LDY A;  2RQW A;  2NUP B;  3VRZ A;  1NJI R;  4LD9 K;  4QT7 A;  3M0R A;  4RKU E;  2LNH B;  2EJ9 A;  1ZQ1 A;  4OB2 B;  1IO6 A;  3G71 Q;  3I9Q A;  1I0C A;  2JMA A;  1D1B A;  1EFN A;  4NL2 A;  1BBZ A;  2YUQ A;  2RI3 A;  2WAC A;  4AFU C;  1N8R R;  4C8Q A;  4K11 A;  2JVV A;  1K73 U;  4FSS A;  4BDZ A;  2PVD B;  1MNE A;  3I56 Q;  3MJX A;  4PJO G;  2K5L A;  2JUF A;  4M7D B;  2CRE A;  3A8H B;  1ZBX A;  3OA6 A;  1FMK A;  5GMK h;  2EYW A;  4NOY A;  1RAH B;  1NLO C;  1VQO T;  3NFC A;  2A36 A;  1QKW A;  2K57 A;  5GAN e;  4C8Q B;  4Z88 A;  3CCJ T;  4OF1 A;  1QVF A;  4ZGJ B;  4J6X A;  2VUB A;  3OYF A;  2RA2 A;  1ABO A;  1PCX A;  2QGF B;  2ZAE A;  2YHT A;  1D1C A;  1YJW T;  5LJ5 h;  1OEB A;  3CCR Q;  2ECZ A;  1O75 A;  5KCO A;  2RD1 A;  2EYZ A;  1RLQ C;  1VQK Q;  4F04 B;  5GAM e;  5IXB A;  2YUP A;  3QWX X;  1ZA1 B;  3EG9 B;  4EMK B;  1VQ4 A;  3EHQ A;  3OS5 A;  2DRK A;  1MMD A;  4M75 F;  1VQ9 A;  4Z8A A;  2KSS A;  1NE8 A;  1OU9 A;  1VQ4 Q;  1NZ9 A;  4M7D D;  2KY9 A;  2LX7 A;  1M2V A;  1B34 B;  3V8L A;  3BW1 A;  1X6O A;  2YUO A;  4JDS A;  1YWO A;  1AWJ A;  3UT1 A;  2C0T A;  3QYH B;  1K73 C;  4DOV A;  4HCZ A;  2KE9 A;  1PWT A;  3LW5 E;  1YJ9 A;  3I5S A;  4D8D A;  2E5Q A;  1NM7 A;  2GQV A;  2LQ8 A;  4AMC A;  3RR6 A;  1V1C A;  3VS3 A;  4CC7 A;  2JTF A;  3QZ5 B;  2QTX A;  1X75 C;  4JLI A;  2EWN A;  3RUX A;  2XG8 D;  5D6Y A;  1SRM A;  2GNC A;  2HL3 A;  3LH0 A;  1WQW A;  2VB6 A;  4KGX B;  5EG2 A;  2K79 A;  4M78 E;  4E7S A;  2EKH A;  5L23 A;  1BKB A;  2KQW A;  4J7F A;  1JXM A;  3QO3 A;  1Y71 A;  2CZ0 B;  2K5I A;  1GXI E;  3L1A A;  2CP2 A;  3GF5 A;  4A4G A;  3L2R A;  1AVZ C;  2JN0 A;  1QKX A;  4XU1 A;  5CR2 A;  5KYX A;  3HRS A;  4FSX A;  2W10 A;  1JXO A;  5GAN 6;  2VWF A;  1G3T A;  4OB0 B;  4MZP A;  2MAM A;  1KD1 U;  4E7L A;  3UA6 A;  1OPK A;  2RQU A;  3H0F A;  3OYK A;  5GAO r;  7AT1 B;  1UGR B;  2DXU A;  4JRQ A;  3L2Q A;  2XD0 A;  3MET A;  5IAY A;  1M1K R;  3VS1 A;  3CCU T;  1ZHI A;  3EGX B;  3S6W A;  5GAN h;  1G5V A;  2EGC A;  1X69 A;  2DIL A;  1IB8 A;  1M1K C;  2NLU A;  4C5I A;  4M7D F;  4JRK A;  4J8O A;  3CCR T;  1VQ7 Q;  4PJO C;  2QA4 A;  2PUK B;  3MP8 A;  2YRV A;  3CBP A;  3DB3 A;  4A54 A;  2DTO A;  1YFN A;  3HFO A;  1VQK T;  4HXJ A;  3CXC A;  5IHK A;  4FT4 A;  2K2V A;  3UF4 A;  1KD1 R;  4FT2 A;  1YHQ A;  2GGR A;  2XDP A;  1M9S A;  1YIT A;  2DZ9 A;  2ZPE B;  1K8A U;  2HQX A;  2M0O A;  4J5Y A;  3R6N A;  4M7A F;  3G4S A;  3M54 A;  1M90 R;  2QQS A;  2QDY B;  4M78 C;  3MP6 A;  5CKB A;  1CKB A;  2QGG A;  2FZK B;  2DTH A;  3FEO A;  2HZY A;  2M1H A;  2QG9 B;  4M7A B;  4IIM A;  3LH5 A;  1HSQ A;  4XQ3 A;  2FO0 A;  1B07 A;  2LX9 A;  2J6K A;  2QK0 A;  2ZPI B;  4ZGE B;  3JAM E;  4IUT A;  2LVM A;  5HK0 A;  3OYI A;  3CMA T;  1VQ6 T;  2SEM A;  1RAB B;  2MMP A;  3A5Z B;  1UDL A;  3L2Z A;  1K9A A;  5C6S A;  1YJN Q;  2JS2 A;  1AEY A;  5GAO n;  1IRX A;  4PL6 A;  3CCV Q;  1S72 A;  4MZM A;  5EC7 A;  1VQ6 A;  2NYS A;  3JCM J;  2FRY A;  5GJV B;  3E9F A;  2BTT A;  2DD5 A;  3OYB A;  1WQ7 A;  2VAS A;  2DPP B;  3M0P A;  1QLY A;  2MPX C;  3SDZ A;  5CAI A;  4OGC A;  1I5L A;  3QKJ A;  2H3J A;  2DA9 A;  4NL3 A;  2YUN A;  2XDB A;  3VV0 A;  3G71 A;  4M75 D;  4MZT A;  3OS0 A;  2FPD A;  3MEA A;  2EBP A;  2LQK A;  1BI3 A;  5CVI A;  4JJD A;  3V7S A;  3CCQ T;  4C92 D;  2IPO B;  3QJY A;  3FC3 A;  1EIF A;  4JJC A;  2KT8 A;  2CH4 A;  3INZ A;  4QQD A;  1PSE A;  1UHC A;  4AFQ C;  4M7A E;  1N6A A;  2LCC A;  3M0U A;  1R0C B;  2HQE A;  4C8Q C;  1ZSZ C;  2DER A;  3CD6 A;  4PLL A;  2K3Y A;  2VKN A;  2DVE A;  2RJE A;  4C8Q G;  4PJO E;  3CCM T;  4BY6 B;  5GAN 8;  3PGG A;  1VQ9 T;  4M78 B;  2RHU A;  1NPP A;  4ELY C;  3PMT A;  5DLO A;  3PT9 A;  3I55 Q;  4Q5W A;  4E7H A;  2L3S A;  8ATC B;  3RER A;  5GAN j;  1VQM T;  2P0K A;  3CCE T;  1T0J A;  2M0Y A;  1Z9Q A;  2LRQ A;  1WPY A;  4BI8 B;  1TXQ A;  4WCI A;  5KYW A;  1JJ2 A;  3QII A;  1C0M A;  3JCM e;  4HCK A;  3MCA B;  1ZA2 B;  2JXB A;  1JJ2 P;  5AT1 B;  4E7K A;  2J6O A;  1VQ8 A;  1PM3 A;  1PD1 A;  1X01 A;  1H64 1;  5LJ5 e;  4M7A A;  1VYU A;  4HVW A;  5C0M A;  4BAC A;  3EFO A;  5GAN 5;  3VYG A;  3HRU A;  2YRD A;  3CC4 A;  1PHT A;  5DLQ E;  2XID A;  3UA7 A;  1ARK A;  1SEM A;  4XTX A;  4KRT A;  1KFZ A;  3GOX A;  3CCV T;  1VQP A;  2R57 A;  1QVG A;  2RMO A;  1OZ2 A;  4N4G A;  1Q86 U;  2JT4 A;  3VS7 A;  5HKC A;  4BB7 A;  5GAN f;  2V8J A;  2NUT A;  2RHZ A;  1C6V X;  3VS2 A;  1YJ9 T;  5KYY B;  4DA4 A;  2GFU A;  2Y4Y A;  1HK9 A;  3CC7 A;  3CPW A;  1EZZ B;  4BD3 A;  2DL8 A;  3OY9 A;  4C0G A;  1Y57 A;  3I56 T;  1Q95 G;  2AK5 A;  2PVO B;  1FX7 A;  1M90 U;  3PTA A;  3CCQ Q;  4KGV B;  1RI9 A;  1GFC A;  4M75 E;  2DEQ A;  1LNX A;  1VQO Q;  5J3B A;  5CK9 A;  1WGS A;  5KYU B;  2BKD N;  2AZV A;  3LX7 A;  4KGZ B;  1XOV A;  2G6F X;  2K3B A;  1UGP B;  3JCM f;  2EFI A;  3JB9 D;  1UGV A;  4N4H A;  1HD3 A;  1NJI U;  4XU2 A;  4A63 B;  1JBM A;  3MHX A;  3CBO A;  1U1S A;  3QUI A;  4A4E A;  1RLP C;  1X43 A;  1VQ9 Q;  1TWB A;  1WHM A;  4RUG A;  2V8K A;  2E6Z A;  2FZG B;  3I55 T;  2FL7 A;  3OYH A;  1G3Y A;  2BE9 B;  2HL5 C;  2LT4 A;  1VQM Q;  2G3R A;  4E7I A;  2F69 A;  4PJO D;  4PKC C;  1RAD B;  1IHW A;  1TU0 B;  2MI6 A;  2H3E B;  5IH2 A;  1QWE A;  2HSE B;  5GAN 4;  2DD4 A;  2KYB A;  3RNJ A;  2X51 A;  1WHH A;  1QP2 A;  2E41 A;  4AG2 C;  2E70 A;  3KFV A;  2A3L A;  3HFN A;  2CUB A;  2OTL A;  2NUZ A;  1GCQ C;  2DYI A;  1CSK A;  2K5F A;  1HXD A;  2EQJ A;  1GL5 A;  1QCN A;  4IIO A;  4FYY B;  4XU3 A;  3JCM V;  1VQN A;  2YSQ A;  4M7D A;  1N8R U;  3EAE A;  5FWB A;  5KCH A;  1WNL A;  3JSC A;  2V1R A;  2VC8 A;  3OMC A;  2KI7 A;  4RTY A;  3KXT A;  3NTK A;  2Z0W A;  2HAX A;  1UE9 A;  3PMI A;  4M7A G;  3JB9 H;  4II1 A;  3ZFJ A;  2E3H A;  2X4J A;  2EVR A;  2LCL A;  5KYX B;  2D1X A;  4C92 B;  1K8A C;  2E1H A;  4E7Z A;  4M77 A;  4PFO A;  3M57 A;  4ZN1 A;  5KE3 A;  2L3Q A;  3QZ9 B;  3ZL7 C;  3KBG A;  4EIK A;  3CCJ A;  4ESR A;  2GBQ A;  2EJF A;  4TVR A;  1MMG A;  4M7D G;  3BFM A;  2HCK A;  4XAX B;  5GAN 7;  2XMF A;  3FRN A;  1B3Q A;  2AIR B;  1RL2 A;  4JS4 A;  3QBY A;  1XQH A;  4XTY A;  2RK2 A;  3EGX A;  4EMH A;  5LJ3 d;  3OYA A;  5GAO p;  1Q81 U;  1RAI B;  2PUO B;  1VYV A;  2XHC A;  1VQO A;  3RKW A;  2A7Y A;  4N4I A;  4N0A C;  2ZPB B;  1G3W A;  2EYY A;  2CT4 A;  1BI2 A;  1OPL A;  4E2F B;  1N8R C;  1OZ3 A;  3RDV A;  2BZ8 A;  4DEY A;  3CCU Q;  2MK5 A;  4OB3 B;  2CDT A;  1ZX6 A;  1VQL Q;  3M55 A;  2HNI A;  1Q81 C;  1SSH A;  3FB9 A;  1EX4 A;  5GAM h;  4ZTF A;  4P5N A;  3LYI A;  1QW1 A;  3P8H A;  3OYC A;  1NPR A;  2DK3 A;  4JRI A;  1GCQ A;  3AHU A;  1WJQ A;  4LDU A;  3KUF A;  1U5S A;  4JS5 A;  2CP5 A;  2DYB A;  1VQ8 Q;  3MO8 A;  4BE2 A;  3CCL T;  4M7D C;  2OTJ A;  5LJ5 g;  1VQ7 T;  1VQ5 T;  2DFU A;  1Q81 R;  2KR3 A;  2EQU A;  4M78 D;  1OQK A;  3GP8 A;  5CIU A;  2CKK A;  1UJ0 A;  1ZSZ B;  4FYW B;  4C0F A;  3JB9 I;  4OMO A;  3S3O A;  2RQT A;  1YJN A;  3RKY A;  4J7I A;  1UHF A;  4OGE A;  2XK0 A;  1TSF A;  5FWC A;  1MMA A;  3REA B;  2DET A;  3H41 A;  2DXT A;  1GBQ A;  3L42 A;  2JTE A;  4C5H A;  2R5A A;  3E2U A;  4ORZ A;  1KQS A;  3OYD A;  2IG0 A;  1SHF A;  2F2W A;  1KSW A;  2KRS A;  3VUB A;  3A8L B;  1PNJ A;  2MYS A;  3EFR A;  1VQ6 Q;  4M77 G;  4L6V 5;  3TSW A;  2VV5 A;  1N9S A;  3EGD A;  4J9H A;  1YP5 A;  5GAM g;  5CKH A;  2DBK A;  3OYE A;  1ZBJ A;  1AWW A;  1M1F A;  2NWM A;  3L2U A;  1OI1 A;  3L2W A;  3M4Y A;  3JCM h;  1Y7X A;  3OYL A;  5DY9 A;  4FU6 A;  2LT1 A;  1KC8 C;  1RAA B;  2DL5 A;  2L5Q A;  2ENM A;  2OI3 A;  3FDR A;  3TSZ A;  3A1P A;  2FYK A;  1QWF A;  1WHJ A;  2Y90 A;  1VA7 A;  4QQ6 A;  1X2K A;  4OB1 B;  1WFW A;  2DAQ A;  4C0D C;  5GMK l;  1KD1 C;  5FRM A;  4RMO A;  2EYQ A;  1DJ7 B;  2RJF A;  1BK2 A;  1W4S A;  3NTH A;  4LUD A;  3CCV A;  5GAN d;  1QCO A;  1WLP B;  4Y92 A;  2KEA A;  1WHG A;  4GLK A;  5CKD A;  2X3W D;  1ZSG A;  4HVU A;  1I5O B;  2LJ0 A;  4AT1 B;  4J83 A;  5KYW B;  1PG5 B;  3I5R A;  2CYZ B;  3VS0 A;  2RJD A;  4M75 B;  3CCM Q;  4JZ4 A;  3GIB A;  3EG1 A;  1W2B S;  3SFM A;  1VQ8 T;  1OU8 A;  1LOJ A;  3CCL Q;  4LXC A;  4M75 G;  1YCY A;  3WXM B;  2GCX A;  1YI2 T;  4M77 F;  2XKO C;  2PZ1 A;  2M9U A;  2I2L A;  2J05 A;  5CQX A;  2PTK A;  1WZO A;  3X24 B;  3HHT B;  1NBE B;  3CC7 Q;  4CC4 B;  2DJQ A;  2EQM A;  5LJ3 g;  5KE2 A;  5A0G A;  2E5K A;  1Y07 A;  3DB4 A;  2JM8 A;  3R6O A;  5IHI A;  1QVG P;  4R56 A;  4LDX A;  3A8O B;  2DIQ A;  3E1S A;  4BY6 C;  3LGF A;  3A8G B;  1Q7Y R;  1XJW B;  1KJW A;  3CCM A;  5D6X A;  4C92 E;  2OAU A;  2RHX A;  2A28 A;  1D0Z A;  4UC4 A;  5KYY A;  3UPU A;  2CT3 A;  2CZ6 B;  3UWN A;  3OYY A;  2D6F A;  5LJ5 j;  3PVL A;  3UAT A;  4LD6 A;  1K9M R;  4RTW A;  2YLB A;  1M8V A;  2BUD A;  4BDY A;  1Q7Y C;  2O4X B;  2WSE E;  5LJ3 j;  2D8H A;  3LLR A;  3QDF A;  3G4S T;  2JM9 A;  2VGN A;  2COW A;  2YWW A;  4J9D A;  1KIK A;  1M4Z A;  3H0I A;  5J26 A;  4J9B A;  5GAM f;  5A2Q E;  4M78 A;  4X1V A;  3MKD A;  3X26 B;  3G6E A;  3X20 B;  3VRY A;  2C0I A;  2ED0 A;  1YJ9 Q;  4OMQ A;  2D0Q B;  1M8M A;  4XU0 A;  4BI4 A;  1OV3 A;  2K9G A;  2B86 A;  1YIJ T;  4IUV A;  2K6D A;  3OYG A;  2L89 A;  1VUB A;  4B9X A;  1AT1 B;  3D7S B;  3CCS A;  1M27 C;  1AHJ B;  5GAN 3;  4QW2 A;  4PFZ A;  2J6F A;  4QVZ A;  4XTV A;  5GMK i;  1SF9 A;  4FYX B;  1SHG A;  1X6B A;  3HSB A; 
#chains in the Genus database with same CATH homology
 3JRZ A;  2V8J A;  4MDW A;  1H3Z A;  3H6Z A;  5AYF A;  1M5Q 1;  2RHZ A;  3HKS A;  1VQ7 A;  4F7U G;  1YJ9 T;  4MMK A;  5FRO A;  4DA4 A;  2GFU A;  1BI1 A;  3M5A A;  2CZ1 B;  2Y4Y A;  3J7A F;  1HK9 A;  4PLI A;  4C8Q F;  5LJ3 e;  1QP3 A;  2DKG A;  3CC7 A;  3CPW A;  3QPH A;  4RCC A;  1KC8 U;  4BD3 A;  2QQB A;  3OY9 A;  3TRE A;  3CME T;  4C0G A;  4N0A A;  4C92 F;  3I56 T;  1O9S A;  3E19 A;  2PVO B;  1FX7 A;  4M77 C;  1M90 U;  1KQ2 A;  3PTA A;  3G7Z A;  2F5K A;  4LDY A;  3OW2 S;  1I4K 1;  3DKM A;  4RG8 A;  3OS2 A;  2IVW A;  4M75 E;  2DEQ A;  4LD9 K;  1LNX A;  3MEU A;  3QHS A;  3EFS A;  4MML A;  4RKU E;  2PVG B;  3RIR A;  5J3B A;  5CK9 A;  1WGS A;  2EJ9 A;  1ZQ1 A;  2KMT A;  4OB2 B;  1I8F A;  2BKD N;  1M1K U;  2YLC A;  1YHQ T;  3LX7 A;  2QEX T;  3FJP A;  1D3B A;  4NL2 A;  4BUG A;  1XOV A;  2RI3 A;  3ER0 A;  1UGP B;  3JCM f;  2E64 A;  2EFI A;  2WAC A;  3JB9 D;  4N4H A;  1U8R A;  4DOW A;  4J6Y A;  1NJI U;  4EMK C;  2RH2 A;  3QJ6 A;  4XU2 A;  3SB2 A;  4C8Q A;  1JBM A;  2JVV A;  3MHX A;  4M78 G;  1K73 U;  3CBO A;  1U1S A;  4C92 C;  4BDZ A;  3QUI A;  2PVD B;  4EMG A;  1IZ6 A;  4A4E A;  4PJO G;  2K5L A;  2JUF A;  2RHY A;  5D6W A;  3VJP A;  3MP1 A;  4M7D B;  3WVE B;  3MEW A;  3A8H B;  3JB9 G;  2V8K A;  2RI5 A;  1ZBX A;  2E6Z A;  4OVA A;  3OA6 A;  3I55 T;  2V8I A;  1VQP T;  2FL7 A;  4EPC A;  4B9W A;  2ZCF B;  5GMK h;  3OYH A;  4PJO B;  1G3Y A;  2LT4 A;  2G3R A;  4NOY A;  4E7I A;  3PNW C;  1N27 A;  2HBP A;  1Y96 A;  1VQO T;  2F69 A;  3NFC A;  1LJO A;  4PKC C;  4C8Q D;  4PJO D;  1UGQ B;  2MI6 A;  2K57 A;  3X25 B;  5GAN e;  3CC4 T;  5GAN 4;  4C8Q B;  3CCJ T;  2DD4 A;  2GFA A;  4OF1 A;  1VQM A;  1QVF A;  3PIO A;  4ZGJ B;  4J6X A;  1XTD A;  1D3B B;  4RCB A;  2C06 A;  3CC2 T;  2VUB A;  4V2S A;  2ZPF B;  3OYF A;  1QP2 A;  2E41 A;  2RA2 A;  2XDD A;  2E70 A;  2A3L A;  3V8J A;  3JCM X;  3HFN A;  5I2S A;  4DQ2 A;  2OTJ T;  1G3S A;  3BY7 A;  2OTL A;  2YHT A;  2K5F A;  1HXD A;  1KHI A;  3OBY A;  1KG1 A;  2EQJ A;  1YJW T;  4XU3 A;  4C8Q E;  3JCM V;  5LJ5 h;  1VQN A;  4M7D A;  4QVC A;  1N8R U;  3EAE A;  1O75 A;  5KCO A;  5KCH A;  2RD1 A;  1WNL A;  2PQW A;  5IN1 A;  4A4H A;  3JCM d;  1R8O B;  2VC8 A;  2L3R A;  3JSC A;  3OMC A;  5DM7 R;  1VIE A;  2E6N A;  3OYN A;  3KXT A;  3CCL A;  3QYG B;  3NTK A;  2P4T A;  2RJC A;  3SWN A;  5GAM e;  2HAX A;  2EAY A;  3PMI A;  3C12 A;  3VUZ A;  4M7A G;  3JB9 H;  4II1 A;  2KVQ G;  4EMK B;  3ZFJ A;  2X4J A;  4R55 A;  1VQ4 A;  1KHC A;  2LCL A;  2MF2 A;  3OB9 A;  3OS5 A;  3OSV A;  4FM4 B;  4E47 A;  3OYM A;  4M75 F;  3ZBD A;  4C92 B;  1VQ9 A;  2KSS A;  1K8A C;  1NE8 A;  3CBM A;  1YIT T;  1NZ9 A;  4M7D D;  1QVF S;  2E1H A;  2KY9 A;  4BE0 A;  4LDW A;  5CKE A;  1B34 B;  4M77 A;  3M57 A;  3V8L A;  4KUI A;  4ME7 A;  3QZ9 B;  3GNG A;  4ZN1 A;  1B34 A;  2Y4X A;  4M77 B;  3PFS A;  3KBG A;  1VQN T;  3BW1 A;  1X6O A;  3CEY A;  3QG1 A;  3CCJ A;  2P0Q A;  4JDS A;  1JRI A;  2CS7 A;  4BE1 A;  4J6W A;  4C0Z A;  4O5V A;  2EJF A;  2VGM A;  2EIF A;  2CGH A;  3QYH B;  4HKE A;  4TVR A;  3UT1 A;  1K73 C;  1WJS A;  3MEV A;  4HCZ A;  4DOV A;  4PJO A;  4M7D G;  3I55 A;  3LW5 E;  1YJ9 A;  3BFM A;  4C5E A;  3QDR B;  5GAM d;  4LDV A;  4FL6 A;  4XAX B;  2E5Q A;  4KUD K;  5GAN 7;  3FRN A;  2GQV A;  4X9C A;  2LQ8 A;  1RL2 A;  4JS4 A;  3QBY A;  1XQH A;  4L5G A;  1VQL T;  2ZGW A;  4XTY A;  3PIP A;  2RK2 A;  4A4K A;  4EMH A;  1BI0 A;  2XU8 A;  5LJ3 d;  3X28 B;  2JTF A;  3OYA A;  3QZ5 B;  5GAO p;  2QTX A;  1X75 C;  1Q81 U;  2DJZ A;  1QVP A;  4JLI A;  3JCM W;  2EWN A;  2PUO B;  4KUL A;  3RUX A;  3S3M A;  2XHC A;  1IRE B;  2XG8 D;  3HL8 A;  1VQO A;  5D6Y A;  2KAF A;  4Z02 A;  2E65 A;  3LH0 A;  3RKW A;  3DLL A;  5GAN g;  2A7Y A;  4N4I A;  1VIF A;  1WQW A;  4N0A C;  2ZPB B;  1G3W A;  2AHJ B;  3FLG A;  5EG2 A;  1S72 T;  4M78 E;  1BI2 A;  2JNG A;  2X4Y A;  1N8R C;  4GY5 A;  1BKB A;  2KQW A;  4J7F A;  3QO3 A;  1OZ3 A;  1P92 A;  1Y71 A;  2CZ0 B;  1RI0 A;  3O8V A;  4RG2 A;  2K5I A;  4X9D A;  1GXI E;  1OYX A;  4PJO F;  3L1A A;  4ELZ C;  3GF5 A;  4A4G A;  4OB3 B;  1I81 A;  2F5T X;  2FB7 A;  5KH6 A;  2HD0 A;  3L2R A;  4M78 F;  1NJI C;  3M55 A;  5L8R E;  2HNI A;  2JN0 A;  3URG A;  1KQS S;  1V29 B;  1Q81 C;  3JCM c;  3FB9 A;  4XU1 A;  4ZTF A;  5CR2 A;  5GAM h;  1Q7Y U;  2RB6 A;  2VYT A;  2ZZD A;  2BIV A;  4P5N A;  5LJ3 f;  4HCC A;  4VUB A;  2CZ7 B;  3LYI A;  1JB0 E;  1QW1 A;  3M58 A;  3P8H A;  3HRS A;  3OYC A;  4FSX A;  3GLX A;  4IUR A;  1NPR A;  2DK3 A;  3VKI A;  5GAN 6;  4JRI A;  3AHU A;  1VQ5 A;  1G3T A;  1WJQ A;  3KUF A;  4LDU A;  4OB0 B;  3GPL A;  4JS5 A;  4MZP A;  3CPW S;  2MAM A;  4CI0 C;  1KD1 U;  4NS5 A;  4E7L A;  1FWZ A;  3MO8 A;  4BE2 A;  3CCL T;  5GAO l;  4M7D C;  5LJ5 g;  2OTJ A;  1VQ7 T;  1VQ5 T;  2LTO A;  3OYK A;  5GAO r;  2RI2 A;  3HRT A;  3SD4 A;  3SWN B;  1UGR B;  5LL6 S;  2DXU A;  3JB9 J;  4JRQ A;  3L2Q A;  2XD0 A;  2EQU A;  4M78 D;  1Y96 B;  2K4Y A;  3MET A;  3P8D A;  3SWN C;  5J39 A;  5IAY A;  1YJW A;  3GP8 A;  5CIU A;  5FU7 C;  2CKK A;  4C0F A;  3JB9 I;  3CCU T;  4C92 G;  3TU4 K;  3V7R A;  1ZHI A;  2RHI A;  3CCS T;  3S3O A;  4YTL A;  1MGQ A;  2DXC A;  1YJN A;  3RKY A;  5GAO m;  2D9T A;  3M53 A;  4J7I A;  2QQA A;  3S6W A;  2KDS A;  4OGE A;  5GAN h;  3L2V A;  2XK0 A;  4L59 A;  2DIG A;  1G5V A;  4F7U F;  2B8A A;  4KT0 E;  3RMS A;  5M9O A;  2MWP A;  2RM4 A;  2M16 A;  1M1K C;  4C0D B;  2DXT A;  4JUV A;  3HPW A;  3LGL A;  2NLU A;  4C5I A;  3L42 A;  4M7D F;  4JRK A;  4J8O A;  1BIB A;  4FIB A;  4C5H A;  3CCR T;  4PJO C;  2JTM A;  2R5A A;  2QA4 A;  2PUK B;  3MP8 A;  2YRV A;  3T9N A;  3H8Z A;  3CBP A;  3DB3 A;  4A54 A;  4MDX A;  5GMK e;  1KQS A;  3CCR A;  1UGS B;  2DTO A;  3OYD A;  2IG0 A;  3HFO A;  5GAO q;  3CCQ A;  1VQK T;  4HCB A;  3OYJ A;  3CXC A;  5I2M A;  4JJN K;  4FT4 A;  2K2V A;  3VUB A;  3A8L B;  2P0P A;  4FT2 A;  2WSC E;  4ZTJ A;  3EFR A;  4M7D E;  4Y28 E;  1YHQ A;  3V8K A;  2MWO A;  2QQ9 A;  2XDP A;  4L6V 5;  4M77 G;  5LJ5 d;  3ME9 A;  1M9S A;  2VV5 A;  1YIT A;  1QVG S;  2DZ9 A;  2ZPE B;  1K8A U;  1N9S A;  2HQX A;  4M75 A;  2M0O A;  4J5Y A;  5FRN A;  3TEE A;  5GAN 2;  5GAM g;  1TH7 A;  5CKH A;  4M7A F;  3G4S A;  3M54 A;  3OYE A;  3A8M B;  1M1F A;  2QQS A;  3L2U A;  1OI1 A;  2QDY B;  3L2W A;  4M78 C;  2FVU A;  3M4Y A;  3MP6 A;  5CKB A;  4D6W A;  1Y7X A;  1YBY A;  2EQK A;  3RMQ A;  1MHN A;  2DTH A;  2R5M A;  3JCM h;  3J81 E;  3OYL A;  4M7A C;  3FEO A;  2M1H A;  4KBM B;  5FU6 C;  1WJR A;  2JZ2 A;  4M7A B;  5KE3 A;  2RO0 A;  5DY9 A;  4FU6 A;  4XQ3 A;  3JCM g;  5FLX E;  5HY6 A;  1FXX A;  2LT1 A;  1KC8 C;  3V7C A;  4XTU A;  2VXF A;  2LX9 A;  4Y91 A;  2ZPI B;  4ZGE B;  2L5Q A;  3FDR A;  3JAM E;  4IUT A;  2FYK A;  2LVM A;  5HK0 A;  3OYI A;  3CMA T;  5GMK j;  2LC4 A;  4ZGD B;  1VQ6 T;  4F7U B;  3CME A;  2Y90 A;  3CCE A;  1YI2 A;  4QQ6 A;  1W2B A;  2MMP A;  3A5Z B;  4OB1 B;  2JOY A;  3LWI A;  1M1G A;  2DAQ A;  3L2Z A;  4C0D C;  4HA8 A;  5C6S A;  1BYM A;  5GMK l;  1KD1 C;  3JCM P;  5GAO n;  3M4G A;  4PL6 A;  5FRM A;  1S72 A;  4RMO A;  4MZM A;  2DZC A;  2LDM A;  2EYQ A;  1DJ7 B;  4IUU A;  1VQ6 A;  3QSU A;  2RJF A;  1W4S A;  3JCM J;  3NTH A;  3C94 A;  3LWH A;  3CXC S;  2QQR A;  3E9F A;  3CCV A;  3OSS C;  2DD5 A;  3OYB A;  4A53 A;  1WQ7 A;  3Q1J A;  5GAN d;  2DPP B;  3JB9 F;  2QA4 T;  2QXF A;  3SDZ A;  5CAI A;  4GLK A;  4OGC A;  1I5L A;  5CKD A;  3JCM b;  3QKJ A;  2H3J A;  3I56 A;  1Q82 C;  1N9R A;  2WSF E;  5HK3 A;  4NL3 A;  1VQK A;  4F7U A;  2DTI A;  3OQ5 A;  2XDB A;  3VV0 A;  5IT9 E;  3G71 A;  2EJG A;  5LJ5 f;  4HT8 A;  4M75 D;  4J83 A;  3CC7 T;  3S3N A;  2O4X A;  3FIF A;  4M77 E;  4MZT A;  2CYZ B;  3RES A;  3OS0 A;  3M9Q A;  3GNF B;  2RJD A;  5CKF A;  4M75 B;  2EKO A;  3MEA A;  3GIB A;  2GF7 A;  2LQK A;  3C95 A;  1YJN T;  1W2B S;  1BI3 A;  2KK4 A;  3HP9 A;  5CVI A;  3SFM A;  3V7S A;  3CCQ T;  4C92 D;  3M56 A;  1VQ8 T;  1LOJ A;  2ZPG B;  3QJY A;  5GAM j;  4M75 G;  3FC3 A;  1EIF A;  4OP0 A;  1YCY A;  3WXM B;  2GCX A;  4XTZ A;  1YI2 T;  4M77 F;  3INZ A;  4QQD A;  1PSE A;  2XKO C;  4QQG A;  2M9U A;  2I2L A;  4M7A E;  3DLM A;  1N6A A;  3OMG A;  2LCC A;  5A0L A;  3G71 T;  5CQX A;  3P8B B;  2HQE A;  3UDC A;  4EMK A;  4C8Q C;  4C5G A;  3X24 B;  4PLL A;  4XK8 E;  3CD6 A;  3HHT B;  4A4F A;  1PSF A;  2K3Y A;  2DO3 A;  4C92 A;  4BI3 A;  2DVE A;  2RJE A;  2EQM A;  3WVD B;  4ZN3 A;  4C8Q G;  3BDU A;  5LJ3 g;  3JCM Q;  3CD6 T;  4PNO A;  3C4S A;  5A0G A;  3DB4 A;  1Y07 A;  5KE2 A;  3CCU A;  3R6O A;  4IUQ A;  4PJO E;  4R56 A;  3TCJ A;  3CCM T;  4IKF A;  4LDX A;  3A8O B;  3VU3 C;  2PU9 B;  4BY6 B;  4E7J A;  2DIQ A;  5GAN 8;  3E1S A;  3PGG A;  1VQ9 T;  4M78 B;  2RHU A;  1NPP A;  4BY6 C;  4ELY C;  1K9M C;  3LGF A;  3PMT A;  3A8G B;  3ASK A;  3PT9 A;  4Q5W A;  5DLO A;  5CO7 A;  4E7H A;  4QVD A;  2QEX A;  3RER A;  5GAN j;  1VQM T;  2P0K A;  2E10 A;  3CCM A;  5D6X A;  4C92 E;  5CCA A;  3CCE T;  2OAU A;  2RHX A;  3OS1 A;  1UEB A;  3CMA A;  2XIC A;  4F7U E;  4UC4 A;  5FU7 B;  4JRP A;  2LRQ A;  4JLG A;  3ZEH A;  4OMF B;  3QXE B;  2XI9 A;  3UPU A;  1WPY A;  4BI8 B;  2OTL T;  2CZ6 B;  3UWN A;  3OYY A;  2D6F A;  5LJ5 j;  4O6J A;  4LD6 A;  1BIA A;  2YLB A;  1M8V A;  2LNV A;  2BUD A;  4BDY A;  1Q7Y C;  2O01 E;  2O4X B;  2WSE E;  1M90 C;  5LJ3 j;  1YIJ A;  1JJ2 A;  3LLR A;  3G4S T;  3QII A;  2VGN A;  3N5B B;  3JCM e;  4M75 C;  5GMK m;  3MCA B;  1M4Z A;  5CQY A;  5J26 A;  2E12 A;  1XNI A;  4E7K A;  3G6E T;  2K3X A;  5GAM f;  1VQ8 A;  1K9M U;  5A2Q E;  4M78 A;  1X01 A;  1H64 1;  3E9G A;  4M77 D;  5LJ3 h;  5LJ5 e;  4ATO A;  4M7A A;  4IUP A;  5FU6 B;  3X26 B;  3G6E A;  3X20 B;  2FHD A;  2VXE A;  3M59 A;  3NTI A;  3CC2 A;  1U1T A;  4WF2 A;  5C0M A;  5A0D A;  4BAC A;  4X34 A;  2D0Q B;  2R58 A;  3RKX A;  4CRI A;  3F70 A;  2RK1 A;  4XU0 A;  5GAN 5;  3VYG A;  4BI4 A;  2X4W A;  3HRU A;  1YIJ T;  2X4X A;  1Q86 C;  4HT9 A;  4IUV A;  3CC4 A;  3OYG A;  4XTW A;  2L89 A;  1VUB A;  3OBW A;  2XID A;  3BDL A;  5DLQ E;  4B9X A;  5I21 A;  1VQ4 T;  3CCS A;  4XTX A;  3OW2 A;  2QI2 A;  1AHJ B;  3GOX A;  5GAN 3;  4QW2 A;  4M7A D;  2DXB A;  3CCV T;  2X35 A;  1UB4 A;  1JJ2 S;  1SSF A;  1VQP A;  2R57 A;  1QVG A;  4QVZ A;  4N4G A;  1OZ2 A;  4EDU A;  1Q86 U;  1KQ1 A;  4XTV A;  3VYH B;  1VQL A;  1Q82 U;  5GMK i;  5HKC A;  3J80 E;  4BB7 A;  2ZPH B;  5GAN f;  2L8D A;  3HSB A;  3CPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...