2LCLA

Solution structure of rfah carboxyterminal domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
b'GAMGPKDIVDPATPYPGDKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKNTEFRKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional activator rfaH
molecule tags Transcription
source organism Escherichia coli
publication title An alpha helix to beta barrel domain switch transforms the transcription factor RfaH into a translation factor.
pubmed doi rcsb
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lclA00
4CRIA 1VQ5T 1KC8C 1KD1C 1KQSA 4YTLA 1VQ8T 3HKSA 1YI2T 1W2BA 1YI2A 2OTLT 2OTLA 1VQ9A 3LGLA 1NPPA 3OYYA 5HY6A 5LL6S 1W2BS 1VQ8A 1EIFA 3CCUT 2OTJT 1VQ4A 2EIFA 3CCLA 1YITA 3PIPA 4X34A 5J3BA 3I56A 1KD1U 2E70A 3CD6A 1KQSS 1YITT 1VQMT 1SSFA 3CXCA 3ER0A 3CCUA 1YIJA 1QVGA 1X6OA 2MWPA 1YJWT 3G71A 3LH0A 1M1KU 3G4SA 1M1GA 1VQPA 1Q81C 4ZN3A 1NJIC 4QQDA 3CCVA 4RG2A 1YHQA 1Q7YC 1UEBA 3CC7A 3CCVT 1XNIA 2E6ZA 3JAME 1VQPT 3G4ST 1VQ6T 2LCLA 1K73U 3G71T 1N8RC 3CPWA 2MI6A 2MWOA 3CC4T 1S72T 1YIJT 3G6ET 5IAYA 3OW2A 3J81E 1VQKA 3I55A 1K73C 1VQLT 3CXCS 3DB4A 3CCJA 1IZ6A 1VQ4T 3CCET 1JJ2S 2G3RA 1VQ9T 3CCMT 3CCEA 1KHIA 2JVVA 5A2QE 3CMEA 1M1KC 5DLQE 1VQ5A 3I55T 1VQOT 1VQ7T 3KBGA 1QVFS 1VQNT 1Q7YU 3CC2A 3DLLA 2JOYA 1XTDA 2QA4T 1M90U 1K9MC 2CKKA 3CMAA 1NJIU 1Q81U 2KVQG 3A5ZB 3CMAT 1BKBA 1YJNT 5DM7R 1YJ9T 2QEXT 2KDSA 1QVFA 2LVMA 1VQOA 1VQ7A 4ZN1A 1M90C 1K9MU 1RL2A 3J7AF 2L3RA 1YJNA 3PIOA 3CCJT 1KC8U 3CCQA 3CD6T 3CC2T 1VQKT 1VQNA 1K8AC 3G6EA 1NPRA 2JNGA 3OW2S 2DO3A 3CCLT 1YBYA 3CCQT 1QVGS 3CMET 1Q82C 1JJ2A 3CC4A 1N8RU 2OTJA 1Q86C 3CPWS 3CCMA 4TVRA 2IG0A 2JUFA 5FLXE 1NZ9A 3CC7T 1VQLA 2QA4A 3CPFA 5IT9E 1YHQT 1Q82U 2XHCA 3CCRA 2QEXA 2LQ8A 1YJ9A 3CCSA 1K8AU 1S72A 1YJWA 1VQ6A 1Q86U 3J80E 3CCST 1VQMA 3P8BB 3TREA 3CCRT 3I56T 3LGFA 5J26A 3DB3A
chains in the Genus database with same CATH superfamily
2DX1A 3FEOA 5GANf 3CC7Q 3ASKA 2KRNA 5GANd 1YI2T 5CIUA 4RTUA 4DBRA 1D3BA 2LQWA 1SSHA 1K8AR 3H6ZA 1OEBA 4FIBA 1QLYA 3CXCA 2O9VA 3M9QA 4LDUA 3OS1A 5LJ3e 2MCNA 1G3YA 1HXDA 3JCMJ 2A7YA 2XU8A 4HCKA 4FT2A 2K5LA 4HT9A 2QI2A 3C0CA 3NTKA 3UDCA 4ZGEB 3SD4A 2K3XA 4DOWA 4R0KA 2FO0A 3EGDA 2XDBA 2A0FB 3OYIA 1G5VA 4M7DA 1NYGA 1Y7XA 2D8HA 5LJ3h 2EQUA 3CCMT 3ZEHA 4BY6B 3N5BB 4J6YA 2PQWA 2ZPGB 1JJ2P 3H8ZA 1M1FA 3OYFA 4XU3A 1AWXA 4X9DA 4LDWA 1XOVA 4A63B 1MNDA 3ZL7C 3OQ5A 4F7UG 2KDSA 1M27C 1Y0MA 3VS3A 3A8GB 2EPDA 1V76A 2E1HA 3JCMc 3M58A 5KYWA 2E65A 4XTXA 1IXDA 3CC2T 4EMKC 2RI3A 1K1ZA 2ZGWA 2HEQA 4N4IA 4BDYA 3CCUQ 1WFWA 3MEVA 1Q86C 4C92B 3M56A 2JUFA 1NLPC 1QMCA 4AFZC 3A8LB 1X2QA 2EJFA 3CPFA 1WXUA 1SEMA 1M3AA 2RQUA 4LE9A 4MMLA 3M54A 3LWHA 1OPKA 1V1CA 2RNAA 1QVGP 4J9IA 4Z02A 2VGMA 3FRNA 2WSEE 2PUOB 4M77A 2BZ8A 2VASA 3RBBB 4J8OA 2ESWA 1M5Q1 2CZ1B 3GIBA 3OYYA 4AG1C 3CCUT 1WGSA 3PIPA 3EFOB 3OYEA 2E70A 3CD6A 3M0PA 3GP8A 2KRSA 5HCKA 1M1KU 3JCMe 2O01E 1ARKA 2RK2A 5GAN6 3RNJA 3CCVA 1M30A 2QQRA 2LJ3A 2IVWA 3TCJA 3QYHB 1VA7A 3O8VA 3G71T 5IHKA 2FL7A 1BBZA 4XTYA 1WYXA 9ATCB 1BCOA 2MYSA 4M7DE 3FDRA 1JEGA 2YUQA 2AKLA 2DYBA 3FLGA 3CCMQ 2CH4A 4BI8B 5A2QE 3EGXB 5DLQE 1VQ5Q 1FYNA 2ZPEB 4C8QC 1QVFS 1IB8A 1N5ZA 4L5GA 1OX8A 1NJIU 4FT4A 4D8DA 1Z9ZA 4HT8A 1H3ZA 1U06A 2QEXT 4NL2A 2RPNA 2HAXA 3RKYA 2DA9A 1VYVA 2NYSA 3GBQA 3UA6A 2YLBA 1OX9A 4JJBA 5IN1A 2COZA 3QYGB 4RKUE 4XTZA 1K8AC 1QVGS 3LLRA 3OSVA 2WACA 3OYHA 3E9FA 4JJDA 2YRCA 3CCRQ 2LQNA 2HSPA 4MZTA 5GMKe 2QTXA 4ELZC 1OU8A 1PKTA 2P4TA 2QA4T 3M0TA 4QVDA 2DEUA 2E3IA 1K76A 1WXBA 2YRDA 2CGHA 1YI2A 1B3QA 5DLOA 4IUPA 5D6WA 2M0YA 2Y90A 4M75D 1RADB 4C8QE 1W1FA 4A4EA 4JRKA 4X34A 5J3BA 3QWYA 2O2OA 1B7TA 4KRTA 2EQMA 1Q7YC 1LPLA 1T3SA 1VIFA 4NOYA 2L5QA 2K9GA 3META 2MI6A 3G6ET 3QPHA 2DZCA 3A1PA 2DXUA 1TUCA 1VQ9Q 5GAOm 2DTHA 1HYOA 3NHNA 5CAIA 1BB9A 1WHLA 4PLLA 1KFZA 4FYWB 1WPYA 2O9SA 1E7OA 3I5SA 4DQ2A 1NJIR 4N4HA 3U23A 1X43A 2XI9A 3JB9G 4PJOC 5D6YA 5CR2A 2DF6A 5HK3A 3VV0A 3SFMA 2EQKA 4PKCC 1VQMQ 3CCQA 2QDLA 1OU9A 2H8HA 1E6HA 1W2BP 3LYIA 2FYKA 2H3JA 4E7HA 1Y71A 2AT1B 1YBYA 2CZ0B 3CMET 1GCQC 3VS6A 2CYZB 1WX6A 2Y4XA 2VB6A 3M0RA 3BFMA 2P0KA 5L8RE 2RD1A 2RHXA 5FU7B 4M7DB 1O9SA 2VGNA 2M02A 2QAZA 3J80E 3T9NA 1IREB 1TG0A 1Y57A 2RB6A 2YRVA 1RI9A 3MHXA 1H3HA 3HKSA 1HJDA 2OTLA 3P8HA 4GLMA 2KR3A 1OOTA 1UGSB 3OYNA 1WLPB 1H8KA 1YFNA 4M77G 3GNGA 1SG5A 2QTVA 1X6GA 1D3BB 1MMGA 2RQTA 4J9EA 4M7AG 1AWJA 2KAFA 1QCOA 4A53A 2X4WA 2E6ZA 5GAMd 1D0YA 3MPUB 3X26B 2QK0A 5LJ5f 5GMKi 2EYZA 3CC4T 4E7KA 3FIFA 1Q95G 1YITQ 1LNXA 1OQKA 1VQKA 2JZ2A 1HSQA 5GANh 3JCMW 3H0FA 5I11A 5FW9A 2EQIA 4LD9K 4A4KA 1QCFA 4ELYC 2DL8A 2MPXC 1IGQA 2F2VA 1OZ2A 3CMAA 3DLMA 3MEAA 4GLKA 2RQWA 3VUZA 2XG8D 4PJLA 4Y92A 1ZHIA 1WHMA 4BB7A 5KYYB 2JTEA 4PLIA 1C6VX 4GBQA 4M77D 4FSSA 3X28B 3CCJT 3CD6T 3LX7A 4DEXA 2CSQA 4HVVA 2QDYB 1UECA 1NPRA 3M55A 4BD3A 3CBPA 3V8JA 2E12A 1N8RU 2EGAA 1OULA 2E4HA 2YSQA 1ZUYA 2LT4A 3HP9A 1X01A 1NLOC 5GAMf 3OBYA 1KD1R 3CCSA 2DRMA 2QGGA 3EG0A 1U3OA 2C0IA 1NEGA 2CH4W 2F2WA 2JJ9A 4WF2A 3OMGA 4DA4A 2JTFA 4IURA 3QKJA 1UGQB 1QP2A 2ABLA 2PUKB 4CRIA 1VQ7Q 3VYGA 2ZAEA 5IHNA 1TH7A 3PTAA 3JB9H 2DXTA 3GPLA 1SSFA 2XK0A 3G1JA 3V8LA 2MIOA 1EX4A 1N27A 2LZ6B 1U5SA 4RG8A 5IH2A 3CC7A 1XJWB 4M77F 4J6WA 1VQ6T 4OP0A 2EJ9A 2H3EB 3CPWA 4M7AF 2EVRA 1AZGB 3J81E 2V8KA 4BUGA 1K9MR 2DL4A 2NLUA 2LMJA 5GAOr 1M8MA 1Z9QA 2QASA 2GF7A 1TWBA 2DFUA 2FHDA 2XD0A 2KVQG 1PM3A 4RTXA 1BK2A 2HQHA 3CMAT 4EDUA 3OBWA 1QVFA 1IGUA 4PJNA 3EFRA 4OMLA 4M77B 1SRMA 3SWNC 4CI0C 3MKDA 1IO6A 2K2VA 4M75G 1VQKT 3EGUA 1IRXA 3M57A 4J9DA 3CC2Q 3JRZA 4KGZB 1T0HA 5AYFA 2E5KA 4C8QA 2A36A 4OMPA 1VQLA 4CC4B 1VQLQ 4C8QB 1YHQT 5GAN5 2EYXA 2XHCA 2GCXA 1A0NB 4JLIA 2FPEA 4LUDA 2YWWA 1PCXA 5I2MA 2YXYA 3LH5A 5CKEA 2VC8A 1KC8C 3VS0A 1MMNA 2GTOA 2JM8A 3EFOA 1VQ9A 3M0SA 3LGLA 1W2BS 3HTRA 5LL6S 1ZX6A 4FW2A 4M7DC 4EMKB 4M75F 2PVDB 1KC8R 2RJDA 1ZA2B 3ME9A 3JCMh 3C94A 1JU5C 5M9OA 1QKWA 4V2SA 1PD1A 4KULA 2FG0A 3BDUA 4MMKA 2FB7A 2DM1A 1K9AA 4XTWA 5I2SA 3SWNB 1NEBA 5KYWB 1U8RA 2MMPA 2CZ6B 2K3YA 4A4FA 3CCJA 4E7ZA 4FW1A 3S3NA 1I81A 3RMQA 1WHKA 2VYTA 1M8VA 1YI2Q 1NM7A 4JDSA 3EH1A 3M4GA 1S72Q 2PNIA 1YN8A 5KE2A 4BDZA 4Z8AA 2L3PA 4ORZA 1LVKA 3ULRB 1WHJA 3OYLA 1ZA1B 2M0OA 2IIMA 3OYCA 1UE9A 1B07A 1C0MA 3DKMA 1YP5A 4C92F 3OW2S 4OB1B 1AWWA 3ZBDA 1X2KA 5D6XA 4HA8A 2QA4A 2DJQA 3A98A 1BI2A 2ROTA 1RI0A 3UWNA 3L42A 3PGGA 3REAB 2JMAA 2KNBB 2KROA 1VQNQ 4A54A 3SWNA 4FM4B 1ABOA 5KCOA 4Y91A 2FPDA 1VUBA 2KK4A 1UHCA 5LJ3j 3EG9A 2K4YA 2JMCA 4BI4A 1MGQA 2KRMA 1QVGA 1X6OA 1OI1A 4E6RA 2RI5A 4LXCA 3QSUA 2E5QA 1QP3A 3JCMb 4RG2A 2DIGA 1YHQA 4O5VA 3CCVT 2F5TX 2EFIA 1GRIA 1K73U 1BIBA 2COYA 3CQTA 4E47A 1YIJT 3JSCA 4C0DB 1Q7YR 5GANg 3I55A 3I55Q 5FRNA 1ABQA 2EKOA 1D1BA 4C8QG 1JJ2S 1MUZA 4OMFB 5I21A 3CCEA 2JVVA 3IQLA 3V7RA 4QVZA 4KUDK 2EQJA 4QKUA 1Q7YU 1I1JA 5AT1B 2F5KA 2V8IA 2FVUA 4KUIA 2GQIA 3G71Q 2OAUA 1BKBA 1GBRA 2RH2A 2NUTB 2KE9A 5A0GA 3UT1A 3JCMP 1M90C 3OYMA 1YWOA 2XDDA 2I0NA 2E41A 3HL8A 1O75A 2K3BA 4VUBA 2VV5A 4J5YA 2K7AA 4M7DD 2DILA 1D1AA 2DYIA 2Z0WA 4M78D 3G6EA 1VQKQ 4B6MA 1WHHA 4E2FB 2RHZA 4QVCA 2V26A 1BIAA 3L2UA 5LJ5d 7AT1B 3CMAQ 1QKXA 3OYKA 4RUGA 3UF4A 1RAAB 4JS5A 1PWTA 2V1QA 1ZBJA 3EGXA 3LGFA 4JJCA 2CDTA 2M9UA 3NPFA 2RMOA 5KYXA 1C1AA 2OTJT 5HY6A 4OB2B 1YITA 5CKHA 5GMKj 2RO0A 1RAHB 1VQMT 2V8JA 1PSFA 4PJOD 3R6NA 2DPPB 4OGEA 1VQ6Q 3EHQA 4KGXB 2DERA 4O6JA 1UGVA 3TSZA 2ED0A 3JCMd 2VUBA 4PJMA 2A37A 2X3XD 2J6OA 1JXMA 2DK3A 5GAN2 2VKNA 3OW2A 4F17A 2D6FA 3PT9A 5FU6C 4FYXB 1BCMA 2O4XA 4M77E 2DVJA 2O31A 4HXJA 5KH6A 1G83A 1FMWA 2DRKA 4MZMA 2KSSA 1VQ7T 4ZNXA 3SEMA 4II1A 2RHYA 3I9QA 3G6EQ 1XTDA 2HDAA 1HD3A 2L2PA 4M78C 3G4SQ 3PVQA 1YJ9T 1T0JA 3CBOA 2J7IA 2R58A 3TSWA 1U1SA 4F14A 1VQ7A 1K9MU 3VS1A 4EMHA 2OAWA 3JB9F 1G3TA 4M78B 1KC8U 2BE7D 2F2XA 3I5RA 3LWIA 3CCQT 3CC4A 2OTJA 2BZXA 2L8DA 4OVAA 1NZ9A 3CC7T 3CPWP 1VYUA 4M7DF 2VXEA 5FROA 3MP6A 3QXEB 1UUEA 3SB2A 2CP3A 3CCSQ 3QWXX 4GY5A 1Q86U 1R0CB 6AT1B 1VOMA 5J26A 1X69A 1RABB 1SHFA 3CEYA 5GJWB 2VXFA 2DJZA 3HFOA 1KD1C 4D6WA 4ZGDB 2BTTA 3RUXA 3BDLA 2P4RA 3L2RA 1GCPA 4KGVB 2KT8A 1KD1U 2MAMA 1TUDA 1YITT 3PFSA 3NTIA 4M75A 1Q82R 3CC4Q 1WJRA 1UTIA 3QZ5B 5LJ3g 1AHJB 2E3HA 2PVOB 1UEBA 4E7JA 3FJPA 2CT4A 1H641 2MK5A 8AT1B 3G4ST 2E64A 3V8KA 1PSEA 1UB4A 2BZYA 2RQVA 3BE3A 5KYYA 3NTHA 2PZ1A 3FB9A 2HD0A 2EBPA 2X3WD 3QJ6A 1W70A 2QQSA 2NUPA 4AFUC 4F04B 3KXTA 1VQ5A 2KMTA 1AEYA 2DVEA 3X24B 4KBMB 1K9MC 5A0DA 2A3LA 1KJWA 3VS7A 1Y96B 2JN0A 2VVKA 2FZGB 3H41A 3H9NA 5GANe 1RAEB 4JRIA 4XTVA 1Q81R 1RUWA 1Y96A 4M78F 3E1SA 4CC2A 4ZN1A 4NL3A 1M3BA 4N4GA 1VIEA 4N0AC 4XAXB 2SEMA 3OSSC 2QYZA 3CMEQ 1TXQA 1N9RA 3RMSA 3VKIA 3M5AA 1QCNA 1UFFA 4IUVA 5IXBA 3JCMQ 2XDPA 4HKEA 2A28A 3QBYA 3KUFA 1YNZA 2QEXA 1MNEA 3TVTA 1YJ9A 1S72A 2CP0A 4KT0E 1YJWA 1MMAA 1U1TA 1PRMC 2ZPHB 1V29B 4X1VA 2D8JA 3VUBA 2LRQA 4M75E 3M53A 2OTLT 5GJVB 5FWBA 4JPBW 1X27A 2NUTA 2EJGA 1KIKA 1XQHA 2EAYA 3QDFA 2JW4A 2D1XA 2JS2A 3CCUA 4QQGA 3G71A 3LH0A 3INZA 3QIIA 4AMCA 1GXIE 4QQDA 1WZOA 5FRMA 4M7AC 3MO8A 4M78G 2HBWA 4XU2A 1I0CA 2MWOA 2FRYA 1M9SA 2I2LA 2BIVA 3NGPA 4E7IA 4HCCA 2NUZA 4OMNA 3TQ7P 1D09B 2AHJB 1WQWA 4J7FA 4M75C 1VQ8Q 3CMEA 2B86A 1ZSZB 2DEQA 3OS2A 2QA4Q 3CC2A 2CUBA 2JT4A 5GAOl 2D0NA 1WXTA 1OYXA 4LDXA 5DM7R 2JM9A 3OYGA 4LUEA 1OPLA 4C5GA 3L2WA 4M7AB 1RL2A 3V7CA 1WQ7A 4MDWA 1X6BA 2GNCA 3OYDA 4JS4A 2LX7A 3L2VA 3CBMA 2EW3A 4QW2A 5FU7C 2G6FX 3GNFB 1AZEA 3CCMA 5GAOp 3M59A 2X51A 1LCKA 3MEWA 2RF0A 3M0QA 2JXBA 2DKGA 2QEXQ 1KG1A 2RJEA 4OB3B 2ATCB 3CCST 1QWFA 4FU6A 3OYJA 3PVLA 4RTWA 1MMDA 1ZLMA 2KXDA 3DB3A 1KQ2A 3GOXA 2KYMA 1ZUUA 3UPUA 1AVZC 2AZVA 1R77A 4C0ZA 1TOVA 3RERA 1VQ8A 1EIFA 2KXCA 3H0HA 3JV3A 2DL5A 2XMFA 3MCAB 2LCSA 3A8MB 3MP1A 2R5AA 2LTOA 1GL5A 1M2OA 1Y07A 1FMKA 1NE8A 2YHTA 3BW1A 3QUIA 5FWCA 1YJ9Q 1XNIA 4XU0A 2CSIA 1YJNQ 4J7IA 4KH1B 2X4JA 2X4YA 4M77C 1N8RC 1S72T 1KQ1A 4HCBA 4XU1A 1P92A 2JS0A 2DBMA 3EG1A 4C92G 2LP5A 3L2ZA 2C0TA 3WVEB 2YT6A 1RLQC 4JJNK 2EYYA 3PMTA 2OTLQ 1N8RR 2AIRB 3HPWA 3CCEQ 2CUDA 4L59A 2GBQA 1UJYA 1J3TA 4J9HA 2HL3A 3FJ5A 3I56Q 3JCMV 2RHIA 2LT1A 2YUOA 2CT3A 2HL5C 2CKKA 1G2BA 2RQRA 2CZ7B 4EPCA 5GAOq 4M7AA 1W4SA 4DOVA 2A08A 3OB9A 4K11A 2RK1A 4Y28E 4FSXA 3RKWA 2GGRA 1LJOA 4C92E 4PFOA 1QWEA 4IKFA 3VJPA 2QQ9A 1VQNA 5LJ5e 3QHSA 3EH2A 2JNGA 4E7LA 1JJ2A 2R57A 2OTJQ 1UGPB 3REBB 2J6FA 2WSCE 2F69A 2O88A 2CP7A 2HNIA 4BI3A 3LW5E 4PFZA 1M1KR 4M78A 2EYWA 3CCRA 4Z88A 2K5IA 2ECZA 3QJYA 2ROLA 3CXCP 4PJOF 1VQMA 3I56T 3H0IA 2EKHA 1YHQQ 4PJOB 1I5OB 1FWZA 1RAIB 2LJ0A 3VRZA 4BE1A 1ZQ1A 2HMAA 4JRQA 2HKNA 4YTLA 1AOJA 1PD0A 4AFSC 2RJCA 2GFAA 2D0QB 2P84A 2DETA 3I56A 1UHFA 1KQSS 2DIQA 4E7SA 3M4YA 1YIJA 2MWPA 4EMGA 1JRIA 4HVWA 3G4SA 1NJIC 1PHTA 5EG2A 1GFCA 2RA2A 1K0SA 4J9BA 1QQJA 2KY9A 4RCBA 1R0BG 2ZPBB 3C4SA 3RR6A 2O4XB 2P0QA 2V1RA 1WDXA 2HQXA 4MDXA 2W0ZA 1B34B 2PU9B 3HFNA 1E6GA 1WI7A 3I55T 1KK7A 3S6WA 3RESA 4WCIA 4XTUA 5GAMg 5CKBA 1K4US 4IUTA 2ZZDA 2J05A 3PE0A 1PC0A 5C6SA 2C0OA 1UG1A 4RTYA 2CP2A 3QZ9B 5LJ5g 2L3RA 3PIOA 3OY9A 4F7UE 5CKDA 3EGDB 1M2VB 5CVIA 3CCQQ 1FXXA 2DD5A 5KYXB 2GFUA 2E6NA 5LJ3f 4LDYA 2YLCA 2SRCA 4TVRA 2DTIA 2FEIA 5GMKl 5FLXE 4Z89A 4L6V5 4OB0B 2BKDN 1GBQA 4LNPA 1WIEA 1K8AU 3KFVA 4PJOA 1I4K1 5GAN3 4N0AA 5EC7A 5L23A 1VQ5T 5KYUB 1VQ8T 5GAMj 4BACA 1VQ4A 4M7AE 1D1CA 4BE2A 5A0LA 2NUPB 4LN2A 4C92A 2L0AA 2KYBA 4C5IA 1Q86R 3TEEA 1BI0A 2ZPFB 5CQYA 4ZN3A 5CKFA 3WVDB 4PJOE 1M90R 1RAGB 4IUUA 4OMOA 4JZ4A 4FYVB 8ATCB 1JB0E 3JCMX 5GAN8 5ECAA 2FRWA 5IAYA 3MJXA 4A4GA 1IZ6A 1D0XA 3EAEA 2Y4YA 4OMQA 2W10A 4M7DG 1M1KC 2CS7A 3RDVA 2DTOA 3KBGA 1MV3A 2JOYA 3OS5A 4ZTJA 4AT1B 4WTOB 4PJOG 1ZSZA 4CC7A 3BY7A 1G3WA 1X75C 1ZBXA 1GFDA 3PMIA 1TSFA 2LVMA 5CCAA 1T3LA 3P8DA 4PJJA 4RTZA 1G3SA 1YJWQ 4HCZA 3VS5A 2DE0X 3JCMf 3G7ZA 3EG2A 5GAOn 3VRYA 5GMKh 3HSBA 2WSFE 4J9GA 2DNUA 1M3CA 4FL6A 2LQKA 1WJSA 1OZ3A 1K0XA 1KHCA 4OMMA 2YDLA 1N9SA 2QG9B 2DMOA 3HRTA 2DZ9A 2GQVA 2K2MA 4DBQA 4XQ3A 2LX9A 1RAFB 3MEUA 3P8BB 4RTTA 3TREA 1SPKA 2COWA 5KYNA 1N6AA 1VQLT 3HHTB 3SDZA 3SHWA 3Q1JA 2X9HA 2DAQA 1JXOA 2PVGB 2QQBA 4J83A 4C0FA 1W2BA 4IIMA 1QVFP 1AWOA 5IHIA 2L3QA 2LC4A 1VQ4Q 1S1NA 1SRLA 4X9CA 1VYTA 2XIDA 2CP5A 2ED1A 3OYBA 5D7UA 2RN8A 1YJWT 2HSEB 3F70A 5FU6B 2HZYA 3X25B 3CCVQ 3EG9B 1SF9A 1PKSA 4PNOA 1R8OB 1K73R 4RCCA 4OGCA 1AT1B 2LCLA 1I07A 1PNJA 4FCYA 1BYMA 4IUQA 4ME7A 1JBMA 4C0GA 3FC3A 1K73C 1ACMB 3CCET 2RJFA 4EMKA 3UA7A 1KHIA 2XKOC 4QT7A 1EFNA 4ATOA 4C92D 1I5LA 1RACB 4RTVA 1VQOT 1F1BB 3ZFJA 4C0DC 2FZKB 1OV3A 2MF2A 3A5ZB 2LDMA 1YJNT 3E19A 3JB9I 4C5EA 1VQOA 1JO8A 1TUGB 1KSWA 4RMOA 2ZCFB 2M1HA 1D0ZA 3CCLQ 4PK4A 1WJQA 1Q82C 2CREA 1I8FA 3CPWS 2BUDA 4ZGJB 4LDVA 3S3MA 1CKAA 1ZSZC 1Q82U 3L1AA 4R56A 4JRPA 2QXFA 3WXMB 4PL6A 4KH0B 1TS9A 4F7UF 4MZPA 1VQOQ 3VS2A 3E2UA 4AFQC 5GAN4 1KQSA 1ZUKA 2HKQB 1NPPA 1G8XA 2QQAA 5C0MA 4JZ3A 4A4HA 3CCLA 2DXCA 3HRSA 2D9TA 3JB9J 3CCJQ 1BI1A 4PFPA 2K79A 2DD4A 3AT1B 2K5FA 4HVUA 1YWPA 2OX7A 4M78E 2K6DA 1NYFA 1VQPQ 3AHUA 1VQPA 2X35A 1Q81C 1H92A 1NBEB 2LJ1A 2XICA 1M4ZA 2KT1A 4D8KA 2KI7A 4M75B 3JAME 4M4ZA 2X4XA 4C8QD 4F16A 3E9GA 2DXBA 3QDRB 2K57A 1JQQA 2KGTA 2E10A 2JTMA 2LCCA 3A8OB 3EG3A 1VQ4T 1TTHB 1YCYA 3A8HB 2IPOB 3M0UA 4IIOA 4QQ6A 4BE0A 5KE3A 4XK8E 1UGRB 1DJ7B 3QG1A 3DLLA 2KEAA 4C5HA 3GLXA 5KYUA 1Q81U 3R6OA 1HK9A 1RLPC 2EWNA 5CO7A 4ANJA 5I22A 5GAN7 5CK9A 5LJ5h 2EGCA 3OMCA 3J7AF 3OA6A 1YJNA 1SKUB 1AD5A 2C06A 1SHGA 3C95A 3OS0A 2DLPA 1TU0B 3VU3C 4NS5A 4UC4A 3URGA 3S3OA 1BU1A 2CP6A 2YUNA 3VYHB 2IG0A 1M2VA 4JLGA 2GTJA 5IT9E 2DL7A 2LQ8A 2P0PA 4J9CA 3HRUA 3JB9D 2FZCB 4P5NA 2J6KA 1VQ6A 2EGEA 5J39A 2L89A 3JCMg 2LNVA 1UDLA 4M7AD 1YCSB 4EIKA 5HKCA 1W6XA 4F7UB 4Q5WA 2HBPA 1WA7A 4C8QF 3TU4K 2EIFA 4JUVA 4F7UA 5LJ5j 3VS4A 1YIJQ 1QW1A 3ER0A 1WNLA 4DBFA 1M1GA 2AK5A 5LJ3d 1UJ0A 3QO3A 5GANj 2R5MA 2RHUA 1VQPT 1FMVA 2ZPIB 1WHGA 5HK0A 2VWFA 1B34A 2ENMA 2LNHB 4DBHA 1IHVA 2RM4A 1PG5B 3CXCS 2OI3A 3DB4A 1IHWA 4DEYA 1NG2A 3X20B 2G3RA 3RIRA 1VQ9T 5GAMe 4C92C 1GCQA 2MOXA 3D7SB 3C12A 1VQNT 2BE9B 4ZTFA 1LOJA 1M90U 2OJ2A 2M16A 1FX7A 3NMZC 5CQXA 2AZSA 2QGFB 4CC3A 4AG2C 2L3SA 4B9WA 5GAMh 5KCHA 3RKXA 3V7SA 4R55A 1KQSP 3UATA 2PTKA 1MHNA 2F1LA 3OYAA 2M51A 2RI2A 2AKKA 1CKBA 2HCKA 2KBTA 2FPFA 5DY9A 1QVPA 3EHRA 2NWMA 2KQWA 4FYYB 3THKA 3GF5A 2DL3A 2J06A 3PNWC 2DO3A 3CCLT 3EFSA 3CD6Q 4ESRA 2DBKA 1ZSGA 1CSKA 3NFCA 3OW2P 1MV0B 2EYQA 4BY6C 3L2QA 3I35A 1PRLC 3O5ZA 3MP8A 2B8AA 2YUPA 4J6XA 5IXFA 4J9FA 1EZZB 2HQEA 4B9XA 1BI3A 3CCRT 5GMKm 4LD6A 4OF1A
chains in the Genus database with same CATH topology
2PUKB 3FEOA 4CRIA 5GANf 3VYGA 3CEYA 3ASKA 1TH7A 2VXFA 2DJZA 3HFOA 1KD1C 1VQ5T 4D6WA 1VQ8T 5GAMj 5GANd 3PTAA 4ZGDB 1YI2T 3RUXA 3BDLA 5CIUA 3L2RA 4BACA 1VQ4A 4M7AE 3JB9H 1D3BA 4BE2A 5A0LA 4E7LA 1KD1U 3H6ZA 4FIBA 2MAMA 4C92A 2DXTA 3PFSA 3NTIA 4M75A 3GPLA 1YITT 1SSFA 3CXCA 3M9QA 2XK0A 4C5IA 3TEEA 4LDUA 1BI0A 3V8LA 1WJRA 3OS1A 5LJ3e 2ZPFB 3QZ5B 5LJ3g 5CQYA 4ZN3A 1AHJB 1G3YA 1N27A 5CKFA 3WVDB 1HXDA 3JCMJ 4RG8A 2PVOB 4PJOE 1UEBA 2A7YA 4E7JA 3FJPA 2XU8A 3CC7A 4M77F 4J6WA 4IUUA 4FT2A 1H641 3G4ST 2K5LA 1VQ6T 4HT9A 2QI2A 4OP0A 2EJ9A 2E64A 3NTKA 1PSEA 3UDCA 3V8KA 3SD4A 4ZGEB 2K3XA 1JB0E 1UB4A 3JCMX 5GAN8 4M7AF 4DOWA 3NTHA 3FB9A 2HD0A 5IAYA 3J81E 2XDBA 2V8KA 4A4GA 3QJ6A 4BUGA 3OYIA 1G5VA 1IZ6A 4M7DA 1Y7XA 2QQSA 2NLUA 5LJ3h 2EQUA 3CCMT 3EAEA 2Y4YA 3ZEHA 4BY6B 3N5BB 4J6YA 2PQWA 2ZPGB 5GAOr 4M7DG 1M1KC 2CS7A 3KXTA 3H8ZA 1VQ5A 2DTOA 2KMTA 1M1FA 3KBGA 2GF7A 3OYFA 2DVEA 3X24B 4KBMB 4XU3A 2JOYA 2FHDA 3OS5A 4X9DA 2A3LA 5A0DA 4ZTJA 1K9MC 2XD0A 4PJOG 1Y96B 2JN0A 2KVQG 4LDWA 1XOVA 3BY7A 1G3WA 3CMAT 4EDUA 4JRIA 4XTVA 5GANe 1X75C 1ZBXA 3OQ5A 1Y96A 4M78F 3OBWA 3PMIA 2KDSA 4F7UG 1QVFA 2LVMA 3E1SA 3A8GB 4ZN1A 5CCAA 4NL3A 3P8DA 4N4GA 3EFRA 1VIEA 2E1HA 4N0AC 4XAXB 4M77B 3JCMc 1G3SA 3SWNC 4CI0C 3M58A 3OSSC 2K2VA 2E65A 4XTXA 4HCZA 1N9RA 4M75G 3RMSA 3CC2T 1VQKT 3VKIA 3M57A 2RI3A 4EMKC 3JCMf 3JRZA 3M5AA 3G7ZA 2ZGWA 4N4IA 5GAOn 4IUVA 4BDYA 3JCMQ 5AYFA 5GMKh 2XDPA 3MEVA 1Q86C 4C8QA 4C92B 4HKEA 3HSBA 3M56A 2WSFE 2JUFA 3A8LB 4FL6A 2EJFA 1WJSA 2LQKA 1OZ3A 3CPFA 3QBYA 4C8QB 3KUFA 5GAN5 2XHCA 1YHQT 1KHCA 2QEXA 2GCXA 4JLIA 1YJ9A 1N9SA 3HRTA 3M54A 4MMLA 3LWHA 1S72A 2DZ9A 2GQVA 4KT0E 1YJWA 1U1TA 2ZPHB 4Z02A 2VGMA 3FRNA 4XQ3A 2WSEE 2LX9A 3MEUA 5I2MA 3P8BB 1V29B 3TREA 2PUOB 3VUBA 1N6AA 1VQLT 4M77A 3HHTB 3SDZA 3Q1JA 5CKEA 2VC8A 1KC8C 2LRQA 4J8OA 2DAQA 2PVGB 1M5Q1 2QQBA 4J83A 4M75E 2CZ1B 3M53A 4C0FA 1W2BA 2OTLT 3GIBA 1VQ9A 3LGLA 3OYYA 5LL6S 1W2BS 2LC4A 3CCUT 1WGSA 4M7DC 2EJGA 4X9CA 3PIPA 4EMKB 2XIDA 4M75F 3OYEA 2E70A 2PVDB 3OYBA 3CD6A 1XQHA 2RJDA 3ME9A 2EAYA 3JCMh 3GP8A 3C94A 3CCUA 1YJWT 4QQGA 3G71A 3LH0A 3JCMe 1M1KU 3F70A 2O01E 3INZA 2RK2A 5GAN6 5FU6B 3QIIA 5M9OA 1GXIE 4QQDA 3X25B 4V2SA 3CCVA 4KULA 2QQRA 4PNOA 5FRMA 3BDUA 4MMKA 2IVWA 1R8OB 4M7AC 3MO8A 4M78G 3TCJA 3QYHB 2FB7A 4RCCA 4XU2A 4OGCA 2LCLA 3O8VA 4XTWA 5I2SA 3SWNB 3G71T 2MWOA 1BYMA 1M9SA 2FL7A 2I2LA 2BIVA 4IUQA 4ME7A 4XTYA 1JBMA 4C0GA 3FC3A 1U8RA 4E7IA 2MMPA 2CZ6B 2K3YA 4A4FA 3CCJA 3FDRA 1K73C 4HCCA 4M7DE 3S3NA 3CCET 2RJFA 3FLGA 1I81A 3RMQA 1M8VA 2VYTA 2AHJB 4EMKA 1WQWA 1KHIA 2XKOC 4J7FA 4M75C 4BI8B 5A2QE 1VQLA 4C92D 3CMEA 1I5LA 5DLQE 4ATOA 2ZPEB 4JDSA 1VQOT 3M4GA 3ZFJA 2DEQA 3OS2A 4C8QC 1QVFS 3CC2A 4L5GA 4C0DC 1NJIU 4FT4A 5GAOl 2MF2A 1OYXA 2LDMA 3A5ZB 5KE2A 1YJNT 4HT8A 4LDXA 5DM7R 4BDZA 3E19A 1H3ZA 3OYGA 2QEXT 3JB9I 4C5GA 4C5EA 1VQOA 4NL2A 3L2WA 4M7AB 2HAXA 3RKYA 1RL2A 3V7CA 3OYLA 1WQ7A 4MDWA 4RMOA 2M0OA 2ZCFB 2YLBA 2M1HA 3OYDA 3OYCA 4JS4A 3L2VA 3CBMA 5IN1A 4QW2A 3DKMA 5FU7C 3QYGB 4RKUE 4XTZA 4C92F 3OW2S 1K8AC 4OB1B 1WJQA 1QVGS 1Q82C 3LLRA 3OSVA 3GNFB 1I8FA 3CPWS 3CCMA 5GAOp 3ZBDA 3M59A 2WACA 2BUDA 4ZGJB 4LDVA 3S3MA 3OYHA 3E9FA 3MEWA 5D6XA 4HA8A 2QA4A 2DKGA 1Q82U 1KG1A 3L1AA 4R56A 1BI2A 4JRPA 2QXFA 2RJEA 4OB3B 1RI0A 3WXMB 3UWNA 4PL6A 3L42A 3PGGA 4MZTA 5GMKe 2QTXA 4ELZC 3CCST 4F7UF 4FU6A 3OYJA 4MZPA 2P4TA 4A54A 3SWNA 4FM4B 2QA4T 3DB3A 5KCOA 4Y91A 4QVDA 1KQ2A 5GAN4 3GOXA 1KQSA 1VUBA 2KK4A 3UPUA 2CGHA 1YI2A 4C0ZA 5DLOA 1NPPA 5C0MA 2QQAA 4IUPA 1EIFA 5D6WA 1VQ8A 5LJ3j 3RERA 4A4HA 2Y90A 3CCLA 4M75D 2DXCA 3HRSA 4C8QE 4A4EA 4JRKA 2K4YA 4X34A 5J3BA 3MCAB 2D9TA 3JB9J 4BI4A 1MGQA 1BI1A 3A8MB 3MP1A 2DD4A 2R5AA 1QVGA 1X6OA 2LTOA 1OI1A 2EQMA 2K5FA 3AHUA 4M78E 1Y07A 1VQPA 2X35A 1Q81C 2RI5A 3QSUA 2XICA 1M4ZA 2E5QA 1QP3A 3JCMb 4RG2A 2DIGA 1NE8A 4O5VA 1YHQA 1Q7YC 2YHTA 3BW1A 3QUIA 3CCVT 1XNIA 2F5TX 4M75B 3JAME 4XU0A 2EFIA 2X4XA 1VIFA 4J7IA 2X4JA 4NOYA 3E9GA 2DXBA 2X4YA 2L5QA 2K57A 3QDRB 4M77C 4C8QD 1K73U 1N8RC 1BIBA 2MI6A 3META 4E47A 1S72T 1KQ1A 1YIJT 4XU1A 4HCBA 1P92A 3JSCA 4C0DB 2E10A 2JTMA 3G6ET 2LCCA 3QPHA 2DZCA 3L2ZA 4C92G 3A8OB 3WVEB 5GANg 3I55A 5FRNA 2DXUA 4JJNK 1VQ4T 2EKOA 1JJ2S 4C8QG 4OMFB 1YCYA 3PMTA 5I21A 3A8HB 5GAOm 3CCEA 3HPWA 2JVVA 4L59A 2DTHA 3V7RA 4QVZA 4QQ6A 4KUDK 4BE0A 5CAIA 2EQJA 5KE3A 4XK8E 1UGRB 1DJ7B 1Q7YU 4PLLA 2RHIA 2LT1A 3QG1A 3JCMV 3DLLA 4C5HA 3GLXA 2CKKA 2F5KA 2V8IA 2FVUA 1Q81U 3R6OA 4KUIA 1WPYA 1HK9A 2CZ7B 2EWNA 2OAUA 4EPCA 5GAOq 5CO7A 4M7AA 1BKBA 2RH2A 4DQ2A 4N4HA 5A0GA 1W4SA 3UT1A 4DOVA 5GAN7 3OB9A 5CK9A 5LJ5h 2RK1A 4Y28E 2XI9A 4FSXA 3RKWA 3JB9G 4PJOC 3OMCA 5D6YA 5CR2A 3JCMP 3OYMA 1M90C 2XDDA 3J7AF 3OA6A 1LJOA 5HK3A 3VV0A 4C92E 2E41A 3HL8A 1YJNA 3SFMA 1O75A 2EQKA 2C06A 4IKFA 3VJPA 4PKCC 4VUBA 3CCQA 2VV5A 2QQ9A 3C95A 4J5YA 3OS0A 3CPWA 5LJ5e 1VQNA 4M7DD 3QHSA 3VU3C 3LYIA 4M78D 2JNGA 2FYKA 2H3JA 4NS5A 4UC4A 1Y71A 2CZ0B 1YBYA 3G6EA 4E7HA 3CMET 1JJ2A 2R57A 3URGA 3S3OA 1UGPB 2CYZB 2F69A 2RHZA 2WSCE 3VYHB 2IG0A 2HNIA 4BI3A 4QVCA 2Y4XA 4JLGA 3LW5E 4M78A 1BIAA 3BFMA 3L2UA 5IT9E 3CCRA 2P0KA 5L8RE 2RD1A 2LQ8A 2K5IA 2P0PA 2RHXA 3HRUA 5LJ5d 3JB9D 5FU7B 4P5NA 4M7DB 1O9SA 2VGNA 3QJYA 3OYKA 1VQ6A 4JS5A 3J80E 3T9NA 4PJOF 1VQMA 1IREB 2RB6A 5J39A 2YRVA 3I56T 3LGFA 4PJOB 1FWZA 2L89A 4BE1A 1ZQ1A 3JCMg 4JRQA 2LNVA 4YTLA 2M9UA 3MHXA 4M7AD 3HKSA 5HKCA 2OTLA 4F7UB 3P8HA 2OTJT 4Q5WA 2HBPA 5HY6A 1UGSB 2RJCA 4C8QF 2EIFA 2GFAA 4OB2B 3TU4K 4JUVA 2D0QB 3OYNA 1YITA 4F7UA 3I56A 4M77G 5CKHA 3GNGA 5GMKj 5LJ5j 1KQSS 2DIQA 2RO0A 1VQMT 3M4YA 1QW1A 2V8JA 3ER0A 1D3BB 1PSFA 1YIJA 2MWPA 4PJOD 4EMGA 4M7AG 1JRIA 1WNLA 2DPPB 4OGEA 2KAFA 3G4SA 1M1GA 1NJIC 4A53A 5LJ3d 4O6JA 5EG2A 2RA2A 2X4WA 3QO3A 3JCMd 2E6ZA 5GAMd 5GANj 2R5MA 2VUBA 3X26B 2RHUA 1VQPT 2KY9A 2ZPIB 5LJ5f 5GMKi 4RCBA 3CC4T 5HK0A 4E7KA 3FIFA 2ZPBB 3C4SA 1B34A 1LNXA 2DK3A 5GAN2 3OW2A 2O4XB 2P0QA 1VQKA 2D6FA 2RM4A 3PT9A 5FU6C 3CXCS 3DB4A 2JZ2A 2HQXA 4MDXA 1B34B 2PU9B 3X20B 2G3RA 2O4XA 3HFNA 4M77E 3RIRA 5GAMe 5GANh 3JCMW 1VQ9T 4C92C 5KH6A 4MZMA 4LD9K 4A4KA 3I55T 3C12A 2KSSA 1VQ7T 4II1A 2RHYA 3RESA 3S6WA 1VQNT 4ELYC 4ZTFA 1LOJA 4XTUA 5GAMg 1XTDA 5CKBA 1M90U 2M16A 1FX7A 1OZ2A 4IUTA 2ZZDA 5CQXA 3CMAA 4M78C 3DLMA 3MEAA 4GLKA 4B9WA 5GAMh 5KCHA 3RKXA 3V7SA 4R55A 1YJ9T 3CBOA 1MHNA 2XG8D 3VUZA 5C6SA 2R58A 1VQ7A 1ZHIA 1U1SA 3OYAA 1K9MU 2RI2A 4EMHA 3QZ9B 5LJ5g 2L3RA 4BB7A 3PIOA 3OY9A 5DY9A 4F7UE 5CKDA 4PLIA 4M77D 3JB9F 1QVPA 3X28B 5CVIA 3CCJT 1G3TA 2KQWA 4M78B 1FXXA 2DD5A 3GF5A 3LX7A 2GFUA 1KC8U 3CD6T 2QDYB 2E6NA 1NPRA 3M55A 4LDYA 5LJ3f 3PNWC 2DO3A 4BD3A 3CBPA 3EFSA 3V8JA 3LWIA 3CCLT 2YLCA 2E12A 3CCQT 3CC4A 1N8RU 2OTJA 3NFCA 2LT4A 2EYQA 3HP9A 2L8DA 4TVRA 4BY6C 3L2QA 2DTIA 4OVAA 5GMKl 3MP8A 1X01A 5FLXE 1NZ9A 2B8AA 3CC7T 4L6V5 4OB0B 4M7DF 2BKDN 2VXEA 5GAMf 5FROA 4J6XA 3OBYA 3MP6A 3QXEB 3SB2A 1K8AU 3CCSA 2HQEA 4B9XA 4GY5A 4PJOA 1I4K1 4WF2A 3OMGA 4DA4A 1Q86U 5GAN3 2JTFA 4N0AA 4IURA 1BI3A 3QKJA 1UGQB 3CCRT 1QP2A 5GMKm 4LD6A 4OF1A 5J26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CRI A;  1VQ5 T;  1KC8 C;  1KD1 C;  1KQS A;  4YTL A;  1VQ8 T;  3HKS A;  1YI2 T;  1W2B A;  1YI2 A;  2OTL T;  2OTL A;  1VQ9 A;  3LGL A;  1NPP A;  3OYY A;  5HY6 A;  5LL6 S;  1W2B S;  1VQ8 A;  1EIF A;  3CCU T;  2OTJ T;  1VQ4 A;  2EIF A;  3CCL A;  1YIT A;  3PIP A;  4X34 A;  5J3B A;  3I56 A;  1KD1 U;  2E70 A;  3CD6 A;  1KQS S;  1YIT T;  1VQM T;  1SSF A;  3CXC A;  3ER0 A;  3CCU A;  1YIJ A;  1QVG A;  1X6O A;  2MWP A;  1YJW T;  3G71 A;  3LH0 A;  1M1K U;  3G4S A;  1M1G A;  1VQP A;  1Q81 C;  4ZN3 A;  1NJI C;  4QQD A;  3CCV A;  4RG2 A;  1YHQ A;  1Q7Y C;  1UEB A;  3CC7 A;  3CCV T;  1XNI A;  2E6Z A;  3JAM E;  1VQP T;  3G4S T;  1VQ6 T;  2LCL A;  1K73 U;  3G71 T;  1N8R C;  3CPW A;  2MI6 A;  2MWO A;  3CC4 T;  1S72 T;  1YIJ T;  3G6E T;  5IAY A;  3OW2 A;  3J81 E;  1VQK A;  3I55 A;  1K73 C;  1VQL T;  3CXC S;  3DB4 A;  3CCJ A;  1IZ6 A;  1VQ4 T;  3CCE T;  1JJ2 S;  2G3R A;  1VQ9 T;  3CCM T;  3CCE A;  1KHI A;  2JVV A;  5A2Q E;  3CME A;  1M1K C;  5DLQ E;  1VQ5 A;  3I55 T;  1VQO T;  1VQ7 T;  3KBG A;  1QVF S;  1VQN T;  1Q7Y U;  3CC2 A;  3DLL A;  2JOY A;  1XTD A;  2QA4 T;  1M90 U;  1K9M C;  2CKK A;  3CMA A;  1NJI U;  1Q81 U;  2KVQ G;  3A5Z B;  3CMA T;  1BKB A;  1YJN T;  5DM7 R;  1YJ9 T;  2QEX T;  2KDS A;  1QVF A;  2LVM A;  1VQO A;  1VQ7 A;  4ZN1 A;  1M90 C;  1K9M U;  1RL2 A;  3J7A F;  2L3R A;  1YJN A;  3PIO A;  3CCJ T;  1KC8 U;  3CCQ A;  3CD6 T;  3CC2 T;  1VQK T;  1VQN A;  1K8A C;  3G6E A;  1NPR A;  2JNG A;  3OW2 S;  2DO3 A;  3CCL T;  1YBY A;  3CCQ T;  1QVG S;  3CME T;  1Q82 C;  1JJ2 A;  3CC4 A;  1N8R U;  2OTJ A;  1Q86 C;  3CPW S;  3CCM A;  4TVR A;  2IG0 A;  2JUF A;  5FLX E;  1NZ9 A;  3CC7 T;  1VQL A;  2QA4 A;  3CPF A;  5IT9 E;  1YHQ T;  1Q82 U;  2XHC A;  3CCR A;  2QEX A;  2LQ8 A;  1YJ9 A;  3CCS A;  1K8A U;  1S72 A;  1YJW A;  1VQ6 A;  1Q86 U;  3J80 E;  3CCS T;  1VQM A;  3P8B B;  3TRE A;  3CCR T;  3I56 T;  3LGF A;  5J26 A;  3DB3 A; 
#chains in the Genus database with same CATH topology
 2DX1 A;  3FEO A;  5GAN f;  3CC7 Q;  3ASK A;  2KRN A;  5GAN d;  1YI2 T;  5CIU A;  4RTU A;  4DBR A;  1D3B A;  2LQW A;  1SSH A;  1K8A R;  3H6Z A;  1OEB A;  4FIB A;  1QLY A;  3CXC A;  2O9V A;  3M9Q A;  4LDU A;  3OS1 A;  5LJ3 e;  2MCN A;  1G3Y A;  1HXD A;  3JCM J;  2A7Y A;  2XU8 A;  4HCK A;  4FT2 A;  2K5L A;  4HT9 A;  2QI2 A;  3C0C A;  3NTK A;  3UDC A;  4ZGE B;  3SD4 A;  2K3X A;  4DOW A;  4R0K A;  2FO0 A;  3EGD A;  2XDB A;  2A0F B;  3OYI A;  1G5V A;  4M7D A;  1NYG A;  1Y7X A;  2D8H A;  5LJ3 h;  2EQU A;  3CCM T;  3ZEH A;  4BY6 B;  3N5B B;  4J6Y A;  2PQW A;  2ZPG B;  1JJ2 P;  3H8Z A;  1M1F A;  3OYF A;  4XU3 A;  1AWX A;  4X9D A;  4LDW A;  1XOV A;  4A63 B;  1MND A;  3ZL7 C;  3OQ5 A;  4F7U G;  2KDS A;  1M27 C;  1Y0M A;  3VS3 A;  3A8G B;  2EPD A;  1V76 A;  2E1H A;  3JCM c;  3M58 A;  5KYW A;  2E65 A;  4XTX A;  1IXD A;  3CC2 T;  4EMK C;  2RI3 A;  1K1Z A;  2ZGW A;  2HEQ A;  4N4I A;  4BDY A;  3CCU Q;  1WFW A;  3MEV A;  1Q86 C;  4C92 B;  3M56 A;  2JUF A;  1NLP C;  1QMC A;  4AFZ C;  3A8L B;  1X2Q A;  2EJF A;  3CPF A;  1WXU A;  1SEM A;  1M3A A;  2RQU A;  4LE9 A;  4MML A;  3M54 A;  3LWH A;  1OPK A;  1V1C A;  2RNA A;  1QVG P;  4J9I A;  4Z02 A;  2VGM A;  3FRN A;  2WSE E;  2PUO B;  4M77 A;  2BZ8 A;  2VAS A;  3RBB B;  4J8O A;  2ESW A;  1M5Q 1;  2CZ1 B;  3GIB A;  3OYY A;  4AG1 C;  3CCU T;  1WGS A;  3PIP A;  3EFO B;  3OYE A;  2E70 A;  3CD6 A;  3M0P A;  3GP8 A;  2KRS A;  5HCK A;  1M1K U;  3JCM e;  2O01 E;  1ARK A;  2RK2 A;  5GAN 6;  3RNJ A;  3CCV A;  1M30 A;  2QQR A;  2LJ3 A;  2IVW A;  3TCJ A;  3QYH B;  1VA7 A;  3O8V A;  3G71 T;  5IHK A;  2FL7 A;  1BBZ A;  4XTY A;  1WYX A;  9ATC B;  1BCO A;  2MYS A;  4M7D E;  3FDR A;  1JEG A;  2YUQ A;  2AKL A;  2DYB A;  3FLG A;  3CCM Q;  2CH4 A;  4BI8 B;  5A2Q E;  3EGX B;  5DLQ E;  1VQ5 Q;  1FYN A;  2ZPE B;  4C8Q C;  1QVF S;  1IB8 A;  1N5Z A;  4L5G A;  1OX8 A;  1NJI U;  4FT4 A;  4D8D A;  1Z9Z A;  4HT8 A;  1H3Z A;  1U06 A;  2QEX T;  4NL2 A;  2RPN A;  2HAX A;  3RKY A;  2DA9 A;  1VYV A;  2NYS A;  3GBQ A;  3UA6 A;  2YLB A;  1OX9 A;  4JJB A;  5IN1 A;  2COZ A;  3QYG B;  4RKU E;  4XTZ A;  1K8A C;  1QVG S;  3LLR A;  3OSV A;  2WAC A;  3OYH A;  3E9F A;  4JJD A;  2YRC A;  3CCR Q;  2LQN A;  2HSP A;  4MZT A;  5GMK e;  2QTX A;  4ELZ C;  1OU8 A;  1PKT A;  2P4T A;  2QA4 T;  3M0T A;  4QVD A;  2DEU A;  2E3I A;  1K76 A;  1WXB A;  2YRD A;  2CGH A;  1YI2 A;  1B3Q A;  5DLO A;  4IUP A;  5D6W A;  2M0Y A;  2Y90 A;  4M75 D;  1RAD B;  4C8Q E;  1W1F A;  4A4E A;  4JRK A;  4X34 A;  5J3B A;  3QWY A;  2O2O A;  1B7T A;  4KRT A;  2EQM A;  1Q7Y C;  1LPL A;  1T3S A;  1VIF A;  4NOY A;  2L5Q A;  2K9G A;  3MET A;  2MI6 A;  3G6E T;  3QPH A;  2DZC A;  3A1P A;  2DXU A;  1TUC A;  1VQ9 Q;  5GAO m;  2DTH A;  1HYO A;  3NHN A;  5CAI A;  1BB9 A;  1WHL A;  4PLL A;  1KFZ A;  4FYW B;  1WPY A;  2O9S A;  1E7O A;  3I5S A;  4DQ2 A;  1NJI R;  4N4H A;  3U23 A;  1X43 A;  2XI9 A;  3JB9 G;  4PJO C;  5D6Y A;  5CR2 A;  2DF6 A;  5HK3 A;  3VV0 A;  3SFM A;  2EQK A;  4PKC C;  1VQM Q;  3CCQ A;  2QDL A;  1OU9 A;  2H8H A;  1E6H A;  1W2B P;  3LYI A;  2FYK A;  2H3J A;  4E7H A;  1Y71 A;  2AT1 B;  1YBY A;  2CZ0 B;  3CME T;  1GCQ C;  3VS6 A;  2CYZ B;  1WX6 A;  2Y4X A;  2VB6 A;  3M0R A;  3BFM A;  2P0K A;  5L8R E;  2RD1 A;  2RHX A;  5FU7 B;  4M7D B;  1O9S A;  2VGN A;  2M02 A;  2QAZ A;  3J80 E;  3T9N A;  1IRE B;  1TG0 A;  1Y57 A;  2RB6 A;  2YRV A;  1RI9 A;  3MHX A;  1H3H A;  3HKS A;  1HJD A;  2OTL A;  3P8H A;  4GLM A;  2KR3 A;  1OOT A;  1UGS B;  3OYN A;  1WLP B;  1H8K A;  1YFN A;  4M77 G;  3GNG A;  1SG5 A;  2QTV A;  1X6G A;  1D3B B;  1MMG A;  2RQT A;  4J9E A;  4M7A G;  1AWJ A;  2KAF A;  1QCO A;  4A53 A;  2X4W A;  2E6Z A;  5GAM d;  1D0Y A;  3MPU B;  3X26 B;  2QK0 A;  5LJ5 f;  5GMK i;  2EYZ A;  3CC4 T;  4E7K A;  3FIF A;  1Q95 G;  1YIT Q;  1LNX A;  1OQK A;  1VQK A;  2JZ2 A;  1HSQ A;  5GAN h;  3JCM W;  3H0F A;  5I11 A;  5FW9 A;  2EQI A;  4LD9 K;  4A4K A;  1QCF A;  4ELY C;  2DL8 A;  2MPX C;  1IGQ A;  2F2V A;  1OZ2 A;  3CMA A;  3DLM A;  3MEA A;  4GLK A;  2RQW A;  3VUZ A;  2XG8 D;  4PJL A;  4Y92 A;  1ZHI A;  1WHM A;  4BB7 A;  5KYY B;  2JTE A;  4PLI A;  1C6V X;  4GBQ A;  4M77 D;  4FSS A;  3X28 B;  3CCJ T;  3CD6 T;  3LX7 A;  4DEX A;  2CSQ A;  4HVV A;  2QDY B;  1UEC A;  1NPR A;  3M55 A;  4BD3 A;  3CBP A;  3V8J A;  2E12 A;  1N8R U;  2EGA A;  1OUL A;  2E4H A;  2YSQ A;  1ZUY A;  2LT4 A;  3HP9 A;  1X01 A;  1NLO C;  5GAM f;  3OBY A;  1KD1 R;  3CCS A;  2DRM A;  2QGG A;  3EG0 A;  1U3O A;  2C0I A;  1NEG A;  2CH4 W;  2F2W A;  2JJ9 A;  4WF2 A;  3OMG A;  4DA4 A;  2JTF A;  4IUR A;  3QKJ A;  1UGQ B;  1QP2 A;  2ABL A;  2PUK B;  4CRI A;  1VQ7 Q;  3VYG A;  2ZAE A;  5IHN A;  1TH7 A;  3PTA A;  3JB9 H;  2DXT A;  3GPL A;  1SSF A;  2XK0 A;  3G1J A;  3V8L A;  2MIO A;  1EX4 A;  1N27 A;  2LZ6 B;  1U5S A;  4RG8 A;  5IH2 A;  3CC7 A;  1XJW B;  4M77 F;  4J6W A;  1VQ6 T;  4OP0 A;  2EJ9 A;  2H3E B;  3CPW A;  4M7A F;  2EVR A;  1AZG B;  3J81 E;  2V8K A;  4BUG A;  1K9M R;  2DL4 A;  2NLU A;  2LMJ A;  5GAO r;  1M8M A;  1Z9Q A;  2QAS A;  2GF7 A;  1TWB A;  2DFU A;  2FHD A;  2XD0 A;  2KVQ G;  1PM3 A;  4RTX A;  1BK2 A;  2HQH A;  3CMA T;  4EDU A;  3OBW A;  1QVF A;  1IGU A;  4PJN A;  3EFR A;  4OML A;  4M77 B;  1SRM A;  3SWN C;  4CI0 C;  3MKD A;  1IO6 A;  2K2V A;  4M75 G;  1VQK T;  3EGU A;  1IRX A;  3M57 A;  4J9D A;  3CC2 Q;  3JRZ A;  4KGZ B;  1T0H A;  5AYF A;  2E5K A;  4C8Q A;  2A36 A;  4OMP A;  1VQL A;  4CC4 B;  1VQL Q;  4C8Q B;  1YHQ T;  5GAN 5;  2EYX A;  2XHC A;  2GCX A;  1A0N B;  4JLI A;  2FPE A;  4LUD A;  2YWW A;  1PCX A;  5I2M A;  2YXY A;  3LH5 A;  5CKE A;  2VC8 A;  1KC8 C;  3VS0 A;  1MMN A;  2GTO A;  2JM8 A;  3EFO A;  1VQ9 A;  3M0S A;  3LGL A;  1W2B S;  3HTR A;  5LL6 S;  1ZX6 A;  4FW2 A;  4M7D C;  4EMK B;  4M75 F;  2PVD B;  1KC8 R;  2RJD A;  1ZA2 B;  3ME9 A;  3JCM h;  3C94 A;  1JU5 C;  5M9O A;  1QKW A;  4V2S A;  1PD1 A;  4KUL A;  2FG0 A;  3BDU A;  4MMK A;  2FB7 A;  2DM1 A;  1K9A A;  4XTW A;  5I2S A;  3SWN B;  1NEB A;  5KYW B;  1U8R A;  2MMP A;  2CZ6 B;  2K3Y A;  4A4F A;  3CCJ A;  4E7Z A;  4FW1 A;  3S3N A;  1I81 A;  3RMQ A;  1WHK A;  2VYT A;  1M8V A;  1YI2 Q;  1NM7 A;  4JDS A;  3EH1 A;  3M4G A;  1S72 Q;  2PNI A;  1YN8 A;  5KE2 A;  4BDZ A;  4Z8A A;  2L3P A;  4ORZ A;  1LVK A;  3ULR B;  1WHJ A;  3OYL A;  1ZA1 B;  2M0O A;  2IIM A;  3OYC A;  1UE9 A;  1B07 A;  1C0M A;  3DKM A;  1YP5 A;  4C92 F;  3OW2 S;  4OB1 B;  1AWW A;  3ZBD A;  1X2K A;  5D6X A;  4HA8 A;  2QA4 A;  2DJQ A;  3A98 A;  1BI2 A;  2ROT A;  1RI0 A;  3UWN A;  3L42 A;  3PGG A;  3REA B;  2JMA A;  2KNB B;  2KRO A;  1VQN Q;  4A54 A;  3SWN A;  4FM4 B;  1ABO A;  5KCO A;  4Y91 A;  2FPD A;  1VUB A;  2KK4 A;  1UHC A;  5LJ3 j;  3EG9 A;  2K4Y A;  2JMC A;  4BI4 A;  1MGQ A;  2KRM A;  1QVG A;  1X6O A;  1OI1 A;  4E6R A;  2RI5 A;  4LXC A;  3QSU A;  2E5Q A;  1QP3 A;  3JCM b;  4RG2 A;  2DIG A;  1YHQ A;  4O5V A;  3CCV T;  2F5T X;  2EFI A;  1GRI A;  1K73 U;  1BIB A;  2COY A;  3CQT A;  4E47 A;  1YIJ T;  3JSC A;  4C0D B;  1Q7Y R;  5GAN g;  3I55 A;  3I55 Q;  5FRN A;  1ABQ A;  2EKO A;  1D1B A;  4C8Q G;  1JJ2 S;  1MUZ A;  4OMF B;  5I21 A;  3CCE A;  2JVV A;  3IQL A;  3V7R A;  4QVZ A;  4KUD K;  2EQJ A;  4QKU A;  1Q7Y U;  1I1J A;  5AT1 B;  2F5K A;  2V8I A;  2FVU A;  4KUI A;  2GQI A;  3G71 Q;  2OAU A;  1BKB A;  1GBR A;  2RH2 A;  2NUT B;  2KE9 A;  5A0G A;  3UT1 A;  3JCM P;  1M90 C;  3OYM A;  1YWO A;  2XDD A;  2I0N A;  2E41 A;  3HL8 A;  1O75 A;  2K3B A;  4VUB A;  2VV5 A;  4J5Y A;  2K7A A;  4M7D D;  2DIL A;  1D1A A;  2DYI A;  2Z0W A;  4M78 D;  3G6E A;  1VQK Q;  4B6M A;  1WHH A;  4E2F B;  2RHZ A;  4QVC A;  2V26 A;  1BIA A;  3L2U A;  5LJ5 d;  7AT1 B;  3CMA Q;  1QKX A;  3OYK A;  4RUG A;  3UF4 A;  1RAA B;  4JS5 A;  1PWT A;  2V1Q A;  1ZBJ A;  3EGX A;  3LGF A;  4JJC A;  2CDT A;  2M9U A;  3NPF A;  2RMO A;  5KYX A;  1C1A A;  2OTJ T;  5HY6 A;  4OB2 B;  1YIT A;  5CKH A;  5GMK j;  2RO0 A;  1RAH B;  1VQM T;  2V8J A;  1PSF A;  4PJO D;  3R6N A;  2DPP B;  4OGE A;  1VQ6 Q;  3EHQ A;  4KGX B;  2DER A;  4O6J A;  1UGV A;  3TSZ A;  2ED0 A;  3JCM d;  2VUB A;  4PJM A;  2A37 A;  2X3X D;  2J6O A;  1JXM A;  2DK3 A;  5GAN 2;  2VKN A;  3OW2 A;  4F17 A;  2D6F A;  3PT9 A;  5FU6 C;  4FYX B;  1BCM A;  2O4X A;  4M77 E;  2DVJ A;  2O31 A;  4HXJ A;  5KH6 A;  1G83 A;  1FMW A;  2DRK A;  4MZM A;  2KSS A;  1VQ7 T;  4ZNX A;  3SEM A;  4II1 A;  2RHY A;  3I9Q A;  3G6E Q;  1XTD A;  2HDA A;  1HD3 A;  2L2P A;  4M78 C;  3G4S Q;  3PVQ A;  1YJ9 T;  1T0J A;  3CBO A;  2J7I A;  2R58 A;  3TSW A;  1U1S A;  4F14 A;  1VQ7 A;  1K9M U;  3VS1 A;  4EMH A;  2OAW A;  3JB9 F;  1G3T A;  4M78 B;  1KC8 U;  2BE7 D;  2F2X A;  3I5R A;  3LWI A;  3CCQ T;  3CC4 A;  2OTJ A;  2BZX A;  2L8D A;  4OVA A;  1NZ9 A;  3CC7 T;  3CPW P;  1VYU A;  4M7D F;  2VXE A;  5FRO A;  3MP6 A;  3QXE B;  1UUE A;  3SB2 A;  2CP3 A;  3CCS Q;  3QWX X;  4GY5 A;  1Q86 U;  1R0C B;  6AT1 B;  1VOM A;  5J26 A;  1X69 A;  1RAB B;  1SHF A;  3CEY A;  5GJW B;  2VXF A;  2DJZ A;  3HFO A;  1KD1 C;  4D6W A;  4ZGD B;  2BTT A;  3RUX A;  3BDL A;  2P4R A;  3L2R A;  1GCP A;  4KGV B;  2KT8 A;  1KD1 U;  2MAM A;  1TUD A;  1YIT T;  3PFS A;  3NTI A;  4M75 A;  1Q82 R;  3CC4 Q;  1WJR A;  1UTI A;  3QZ5 B;  5LJ3 g;  1AHJ B;  2E3H A;  2PVO B;  1UEB A;  4E7J A;  3FJP A;  2CT4 A;  1H64 1;  2MK5 A;  8AT1 B;  3G4S T;  2E64 A;  3V8K A;  1PSE A;  1UB4 A;  2BZY A;  2RQV A;  3BE3 A;  5KYY A;  3NTH A;  2PZ1 A;  3FB9 A;  2HD0 A;  2EBP A;  2X3W D;  3QJ6 A;  1W70 A;  2QQS A;  2NUP A;  4AFU C;  4F04 B;  3KXT A;  1VQ5 A;  2KMT A;  1AEY A;  2DVE A;  3X24 B;  4KBM B;  1K9M C;  5A0D A;  2A3L A;  1KJW A;  3VS7 A;  1Y96 B;  2JN0 A;  2VVK A;  2FZG B;  3H41 A;  3H9N A;  5GAN e;  1RAE B;  4JRI A;  4XTV A;  1Q81 R;  1RUW A;  1Y96 A;  4M78 F;  3E1S A;  4CC2 A;  4ZN1 A;  4NL3 A;  1M3B A;  4N4G A;  1VIE A;  4N0A C;  4XAX B;  2SEM A;  3OSS C;  2QYZ A;  3CME Q;  1TXQ A;  1N9R A;  3RMS A;  3VKI A;  3M5A A;  1QCN A;  1UFF A;  4IUV A;  5IXB A;  3JCM Q;  2XDP A;  4HKE A;  2A28 A;  3QBY A;  3KUF A;  1YNZ A;  2QEX A;  1MNE A;  3TVT A;  1YJ9 A;  1S72 A;  2CP0 A;  4KT0 E;  1YJW A;  1MMA A;  1U1T A;  1PRM C;  2ZPH B;  1V29 B;  4X1V A;  2D8J A;  3VUB A;  2LRQ A;  4M75 E;  3M53 A;  2OTL T;  5GJV B;  5FWB A;  4JPB W;  1X27 A;  2NUT A;  2EJG A;  1KIK A;  1XQH A;  2EAY A;  3QDF A;  2JW4 A;  2D1X A;  2JS2 A;  3CCU A;  4QQG A;  3G71 A;  3LH0 A;  3INZ A;  3QII A;  4AMC A;  1GXI E;  4QQD A;  1WZO A;  5FRM A;  4M7A C;  3MO8 A;  4M78 G;  2HBW A;  4XU2 A;  1I0C A;  2MWO A;  2FRY A;  1M9S A;  2I2L A;  2BIV A;  3NGP A;  4E7I A;  4HCC A;  2NUZ A;  4OMN A;  3TQ7 P;  1D09 B;  2AHJ B;  1WQW A;  4J7F A;  4M75 C;  1VQ8 Q;  3CME A;  2B86 A;  1ZSZ B;  2DEQ A;  3OS2 A;  2QA4 Q;  3CC2 A;  2CUB A;  2JT4 A;  5GAO l;  2D0N A;  1WXT A;  1OYX A;  4LDX A;  5DM7 R;  2JM9 A;  3OYG A;  4LUE A;  1OPL A;  4C5G A;  3L2W A;  4M7A B;  1RL2 A;  3V7C A;  1WQ7 A;  4MDW A;  1X6B A;  2GNC A;  3OYD A;  4JS4 A;  2LX7 A;  3L2V A;  3CBM A;  2EW3 A;  4QW2 A;  5FU7 C;  2G6F X;  3GNF B;  1AZE A;  3CCM A;  5GAO p;  3M59 A;  2X51 A;  1LCK A;  3MEW A;  2RF0 A;  3M0Q A;  2JXB A;  2DKG A;  2QEX Q;  1KG1 A;  2RJE A;  4OB3 B;  2ATC B;  3CCS T;  1QWF A;  4FU6 A;  3OYJ A;  3PVL A;  4RTW A;  1MMD A;  1ZLM A;  2KXD A;  3DB3 A;  1KQ2 A;  3GOX A;  2KYM A;  1ZUU A;  3UPU A;  1AVZ C;  2AZV A;  1R77 A;  4C0Z A;  1TOV A;  3RER A;  1VQ8 A;  1EIF A;  2KXC A;  3H0H A;  3JV3 A;  2DL5 A;  2XMF A;  3MCA B;  2LCS A;  3A8M B;  3MP1 A;  2R5A A;  2LTO A;  1GL5 A;  1M2O A;  1Y07 A;  1FMK A;  1NE8 A;  2YHT A;  3BW1 A;  3QUI A;  5FWC A;  1YJ9 Q;  1XNI A;  4XU0 A;  2CSI A;  1YJN Q;  4J7I A;  4KH1 B;  2X4J A;  2X4Y A;  4M77 C;  1N8R C;  1S72 T;  1KQ1 A;  4HCB A;  4XU1 A;  1P92 A;  2JS0 A;  2DBM A;  3EG1 A;  4C92 G;  2LP5 A;  3L2Z A;  2C0T A;  3WVE B;  2YT6 A;  1RLQ C;  4JJN K;  2EYY A;  3PMT A;  2OTL Q;  1N8R R;  2AIR B;  3HPW A;  3CCE Q;  2CUD A;  4L59 A;  2GBQ A;  1UJY A;  1J3T A;  4J9H A;  2HL3 A;  3FJ5 A;  3I56 Q;  3JCM V;  2RHI A;  2LT1 A;  2YUO A;  2CT3 A;  2HL5 C;  2CKK A;  1G2B A;  2RQR A;  2CZ7 B;  4EPC A;  5GAO q;  4M7A A;  1W4S A;  4DOV A;  2A08 A;  3OB9 A;  4K11 A;  2RK1 A;  4Y28 E;  4FSX A;  3RKW A;  2GGR A;  1LJO A;  4C92 E;  4PFO A;  1QWE A;  4IKF A;  3VJP A;  2QQ9 A;  1VQN A;  5LJ5 e;  3QHS A;  3EH2 A;  2JNG A;  4E7L A;  1JJ2 A;  2R57 A;  2OTJ Q;  1UGP B;  3REB B;  2J6F A;  2WSC E;  2F69 A;  2O88 A;  2CP7 A;  2HNI A;  4BI3 A;  3LW5 E;  4PFZ A;  1M1K R;  4M78 A;  2EYW A;  3CCR A;  4Z88 A;  2K5I A;  2ECZ A;  3QJY A;  2ROL A;  3CXC P;  4PJO F;  1VQM A;  3I56 T;  3H0I A;  2EKH A;  1YHQ Q;  4PJO B;  1I5O B;  1FWZ A;  1RAI B;  2LJ0 A;  3VRZ A;  4BE1 A;  1ZQ1 A;  2HMA A;  4JRQ A;  2HKN A;  4YTL A;  1AOJ A;  1PD0 A;  4AFS C;  2RJC A;  2GFA A;  2D0Q B;  2P84 A;  2DET A;  3I56 A;  1UHF A;  1KQS S;  2DIQ A;  4E7S A;  3M4Y A;  1YIJ A;  2MWP A;  4EMG A;  1JRI A;  4HVW A;  3G4S A;  1NJI C;  1PHT A;  5EG2 A;  1GFC A;  2RA2 A;  1K0S A;  4J9B A;  1QQJ A;  2KY9 A;  4RCB A;  1R0B G;  2ZPB B;  3C4S A;  3RR6 A;  2O4X B;  2P0Q A;  2V1R A;  1WDX A;  2HQX A;  4MDX A;  2W0Z A;  1B34 B;  2PU9 B;  3HFN A;  1E6G A;  1WI7 A;  3I55 T;  1KK7 A;  3S6W A;  3RES A;  4WCI A;  4XTU A;  5GAM g;  5CKB A;  1K4U S;  4IUT A;  2ZZD A;  2J05 A;  3PE0 A;  1PC0 A;  5C6S A;  2C0O A;  1UG1 A;  4RTY A;  2CP2 A;  3QZ9 B;  5LJ5 g;  2L3R A;  3PIO A;  3OY9 A;  4F7U E;  5CKD A;  3EGD B;  1M2V B;  5CVI A;  3CCQ Q;  1FXX A;  2DD5 A;  5KYX B;  2GFU A;  2E6N A;  5LJ3 f;  4LDY A;  2YLC A;  2SRC A;  4TVR A;  2DTI A;  2FEI A;  5GMK l;  5FLX E;  4Z89 A;  4L6V 5;  4OB0 B;  2BKD N;  1GBQ A;  4LNP A;  1WIE A;  1K8A U;  3KFV A;  4PJO A;  1I4K 1;  5GAN 3;  4N0A A;  5EC7 A;  5L23 A;  1VQ5 T;  5KYU B;  1VQ8 T;  5GAM j;  4BAC A;  1VQ4 A;  4M7A E;  1D1C A;  4BE2 A;  5A0L A;  2NUP B;  4LN2 A;  4C92 A;  2L0A A;  2KYB A;  4C5I A;  1Q86 R;  3TEE A;  1BI0 A;  2ZPF B;  5CQY A;  4ZN3 A;  5CKF A;  3WVD B;  4PJO E;  1M90 R;  1RAG B;  4IUU A;  4OMO A;  4JZ4 A;  4FYV B;  8ATC B;  1JB0 E;  3JCM X;  5GAN 8;  5ECA A;  2FRW A;  5IAY A;  3MJX A;  4A4G A;  1IZ6 A;  1D0X A;  3EAE A;  2Y4Y A;  4OMQ A;  2W10 A;  4M7D G;  1M1K C;  2CS7 A;  3RDV A;  2DTO A;  3KBG A;  1MV3 A;  2JOY A;  3OS5 A;  4ZTJ A;  4AT1 B;  4WTO B;  4PJO G;  1ZSZ A;  4CC7 A;  3BY7 A;  1G3W A;  1X75 C;  1ZBX A;  1GFD A;  3PMI A;  1TSF A;  2LVM A;  5CCA A;  1T3L A;  3P8D A;  4PJJ A;  4RTZ A;  1G3S A;  1YJW Q;  4HCZ A;  3VS5 A;  2DE0 X;  3JCM f;  3G7Z A;  3EG2 A;  5GAO n;  3VRY A;  5GMK h;  3HSB A;  2WSF E;  4J9G A;  2DNU A;  1M3C A;  4FL6 A;  2LQK A;  1WJS A;  1OZ3 A;  1K0X A;  1KHC A;  4OMM A;  2YDL A;  1N9S A;  2QG9 B;  2DMO A;  3HRT A;  2DZ9 A;  2GQV A;  2K2M A;  4DBQ A;  4XQ3 A;  2LX9 A;  1RAF B;  3MEU A;  3P8B B;  4RTT A;  3TRE A;  1SPK A;  2COW A;  5KYN A;  1N6A A;  1VQL T;  3HHT B;  3SDZ A;  3SHW A;  3Q1J A;  2X9H A;  2DAQ A;  1JXO A;  2PVG B;  2QQB A;  4J83 A;  4C0F A;  1W2B A;  4IIM A;  1QVF P;  1AWO A;  5IHI A;  2L3Q A;  2LC4 A;  1VQ4 Q;  1S1N A;  1SRL A;  4X9C A;  1VYT A;  2XID A;  2CP5 A;  2ED1 A;  3OYB A;  5D7U A;  2RN8 A;  1YJW T;  2HSE B;  3F70 A;  5FU6 B;  2HZY A;  3X25 B;  3CCV Q;  3EG9 B;  1SF9 A;  1PKS A;  4PNO A;  1R8O B;  1K73 R;  4RCC A;  4OGC A;  1AT1 B;  2LCL A;  1I07 A;  1PNJ A;  4FCY A;  1BYM A;  4IUQ A;  4ME7 A;  1JBM A;  4C0G A;  3FC3 A;  1K73 C;  1ACM B;  3CCE T;  2RJF A;  4EMK A;  3UA7 A;  1KHI A;  2XKO C;  4QT7 A;  1EFN A;  4ATO A;  4C92 D;  1I5L A;  1RAC B;  4RTV A;  1VQO T;  1F1B B;  3ZFJ A;  4C0D C;  2FZK B;  1OV3 A;  2MF2 A;  3A5Z B;  2LDM A;  1YJN T;  3E19 A;  3JB9 I;  4C5E A;  1VQO A;  1JO8 A;  1TUG B;  1KSW A;  4RMO A;  2ZCF B;  2M1H A;  1D0Z A;  3CCL Q;  4PK4 A;  1WJQ A;  1Q82 C;  2CRE A;  1I8F A;  3CPW S;  2BUD A;  4ZGJ B;  4LDV A;  3S3M A;  1CKA A;  1ZSZ C;  1Q82 U;  3L1A A;  4R56 A;  4JRP A;  2QXF A;  3WXM B;  4PL6 A;  4KH0 B;  1TS9 A;  4F7U F;  4MZP A;  1VQO Q;  3VS2 A;  3E2U A;  4AFQ C;  5GAN 4;  1KQS A;  1ZUK A;  2HKQ B;  1NPP A;  1G8X A;  2QQA A;  5C0M A;  4JZ3 A;  4A4H A;  3CCL A;  2DXC A;  3HRS A;  2D9T A;  3JB9 J;  3CCJ Q;  1BI1 A;  4PFP A;  2K79 A;  2DD4 A;  3AT1 B;  2K5F A;  4HVU A;  1YWP A;  2OX7 A;  4M78 E;  2K6D A;  1NYF A;  1VQP Q;  3AHU A;  1VQP A;  2X35 A;  1Q81 C;  1H92 A;  1NBE B;  2LJ1 A;  2XIC A;  1M4Z A;  2KT1 A;  4D8K A;  2KI7 A;  4M75 B;  3JAM E;  4M4Z A;  2X4X A;  4C8Q D;  4F16 A;  3E9G A;  2DXB A;  3QDR B;  2K57 A;  1JQQ A;  2KGT A;  2E10 A;  2JTM A;  2LCC A;  3A8O B;  3EG3 A;  1VQ4 T;  1TTH B;  1YCY A;  3A8H B;  2IPO B;  3M0U A;  4IIO A;  4QQ6 A;  4BE0 A;  5KE3 A;  4XK8 E;  1UGR B;  1DJ7 B;  3QG1 A;  3DLL A;  2KEA A;  4C5H A;  3GLX A;  5KYU A;  1Q81 U;  3R6O A;  1HK9 A;  1RLP C;  2EWN A;  5CO7 A;  4ANJ A;  5I22 A;  5GAN 7;  5CK9 A;  5LJ5 h;  2EGC A;  3OMC A;  3J7A F;  3OA6 A;  1YJN A;  1SKU B;  1AD5 A;  2C06 A;  1SHG A;  3C95 A;  3OS0 A;  2DLP A;  1TU0 B;  3VU3 C;  4NS5 A;  4UC4 A;  3URG A;  3S3O A;  1BU1 A;  2CP6 A;  2YUN A;  3VYH B;  2IG0 A;  1M2V A;  4JLG A;  2GTJ A;  5IT9 E;  2DL7 A;  2LQ8 A;  2P0P A;  4J9C A;  3HRU A;  3JB9 D;  2FZC B;  4P5N A;  2J6K A;  1VQ6 A;  2EGE A;  5J39 A;  2L89 A;  3JCM g;  2LNV A;  1UDL A;  4M7A D;  1YCS B;  4EIK A;  5HKC A;  1W6X A;  4F7U B;  4Q5W A;  2HBP A;  1WA7 A;  4C8Q F;  3TU4 K;  2EIF A;  4JUV A;  4F7U A;  5LJ5 j;  3VS4 A;  1YIJ Q;  1QW1 A;  3ER0 A;  1WNL A;  4DBF A;  1M1G A;  2AK5 A;  5LJ3 d;  1UJ0 A;  3QO3 A;  5GAN j;  2R5M A;  2RHU A;  1VQP T;  1FMV A;  2ZPI B;  1WHG A;  5HK0 A;  2VWF A;  1B34 A;  2ENM A;  2LNH B;  4DBH A;  1IHV A;  2RM4 A;  1PG5 B;  3CXC S;  2OI3 A;  3DB4 A;  1IHW A;  4DEY A;  1NG2 A;  3X20 B;  2G3R A;  3RIR A;  1VQ9 T;  5GAM e;  4C92 C;  1GCQ A;  2MOX A;  3D7S B;  3C12 A;  1VQN T;  2BE9 B;  4ZTF A;  1LOJ A;  1M90 U;  2OJ2 A;  2M16 A;  1FX7 A;  3NMZ C;  5CQX A;  2AZS A;  2QGF B;  4CC3 A;  4AG2 C;  2L3S A;  4B9W A;  5GAM h;  5KCH A;  3RKX A;  3V7S A;  4R55 A;  1KQS P;  3UAT A;  2PTK A;  1MHN A;  2F1L A;  3OYA A;  2M51 A;  2RI2 A;  2AKK A;  1CKB A;  2HCK A;  2KBT A;  2FPF A;  5DY9 A;  1QVP A;  3EHR A;  2NWM A;  2KQW A;  4FYY B;  3THK A;  3GF5 A;  2DL3 A;  2J06 A;  3PNW C;  2DO3 A;  3CCL T;  3EFS A;  3CD6 Q;  4ESR A;  2DBK A;  1ZSG A;  1CSK A;  3NFC A;  3OW2 P;  1MV0 B;  2EYQ A;  4BY6 C;  3L2Q A;  3I35 A;  1PRL C;  3O5Z A;  3MP8 A;  2B8A A;  2YUP A;  4J6X A;  5IXF A;  4J9F A;  1EZZ B;  2HQE A;  4B9X A;  1BI3 A;  3CCR T;  5GMK m;  4LD6 A;  4OF1 A; 
#chains in the Genus database with same CATH homology
 2PUK B;  3FEO A;  4CRI A;  5GAN f;  3VYG A;  3CEY A;  3ASK A;  1TH7 A;  2VXF A;  2DJZ A;  3HFO A;  1KD1 C;  1VQ5 T;  4D6W A;  1VQ8 T;  5GAM j;  5GAN d;  3PTA A;  4ZGD B;  1YI2 T;  3RUX A;  3BDL A;  5CIU A;  3L2R A;  4BAC A;  1VQ4 A;  4M7A E;  3JB9 H;  1D3B A;  4BE2 A;  5A0L A;  4E7L A;  1KD1 U;  3H6Z A;  4FIB A;  2MAM A;  4C92 A;  2DXT A;  3PFS A;  3NTI A;  4M75 A;  3GPL A;  1YIT T;  1SSF A;  3CXC A;  3M9Q A;  2XK0 A;  4C5I A;  3TEE A;  4LDU A;  1BI0 A;  3V8L A;  1WJR A;  3OS1 A;  5LJ3 e;  2ZPF B;  3QZ5 B;  5LJ3 g;  5CQY A;  4ZN3 A;  1AHJ B;  1G3Y A;  1N27 A;  5CKF A;  3WVD B;  1HXD A;  3JCM J;  4RG8 A;  2PVO B;  4PJO E;  1UEB A;  2A7Y A;  4E7J A;  3FJP A;  2XU8 A;  3CC7 A;  4M77 F;  4J6W A;  4IUU A;  4FT2 A;  1H64 1;  3G4S T;  2K5L A;  1VQ6 T;  4HT9 A;  2QI2 A;  4OP0 A;  2EJ9 A;  2E64 A;  3NTK A;  1PSE A;  3UDC A;  3V8K A;  3SD4 A;  4ZGE B;  2K3X A;  1JB0 E;  1UB4 A;  3JCM X;  5GAN 8;  4M7A F;  4DOW A;  3NTH A;  3FB9 A;  2HD0 A;  5IAY A;  3J81 E;  2XDB A;  2V8K A;  4A4G A;  3QJ6 A;  4BUG A;  3OYI A;  1G5V A;  1IZ6 A;  4M7D A;  1Y7X A;  2QQS A;  2NLU A;  5LJ3 h;  2EQU A;  3CCM T;  3EAE A;  2Y4Y A;  3ZEH A;  4BY6 B;  3N5B B;  4J6Y A;  2PQW A;  2ZPG B;  5GAO r;  4M7D G;  1M1K C;  2CS7 A;  3KXT A;  3H8Z A;  1VQ5 A;  2DTO A;  2KMT A;  1M1F A;  3KBG A;  2GF7 A;  3OYF A;  2DVE A;  3X24 B;  4KBM B;  4XU3 A;  2JOY A;  2FHD A;  3OS5 A;  4X9D A;  2A3L A;  5A0D A;  4ZTJ A;  1K9M C;  2XD0 A;  4PJO G;  1Y96 B;  2JN0 A;  2KVQ G;  4LDW A;  1XOV A;  3BY7 A;  1G3W A;  3CMA T;  4EDU A;  4JRI A;  4XTV A;  5GAN e;  1X75 C;  1ZBX A;  3OQ5 A;  1Y96 A;  4M78 F;  3OBW A;  3PMI A;  2KDS A;  4F7U G;  1QVF A;  2LVM A;  3E1S A;  3A8G B;  4ZN1 A;  5CCA A;  4NL3 A;  3P8D A;  4N4G A;  3EFR A;  1VIE A;  2E1H A;  4N0A C;  4XAX B;  4M77 B;  3JCM c;  1G3S A;  3SWN C;  4CI0 C;  3M58 A;  3OSS C;  2K2V A;  2E65 A;  4XTX A;  4HCZ A;  1N9R A;  4M75 G;  3RMS A;  3CC2 T;  1VQK T;  3VKI A;  3M57 A;  2RI3 A;  4EMK C;  3JCM f;  3JRZ A;  3M5A A;  3G7Z A;  2ZGW A;  4N4I A;  5GAO n;  4IUV A;  4BDY A;  3JCM Q;  5AYF A;  5GMK h;  2XDP A;  3MEV A;  1Q86 C;  4C8Q A;  4C92 B;  4HKE A;  3HSB A;  3M56 A;  2WSF E;  2JUF A;  3A8L B;  4FL6 A;  2EJF A;  1WJS A;  2LQK A;  1OZ3 A;  3CPF A;  3QBY A;  4C8Q B;  3KUF A;  5GAN 5;  2XHC A;  1YHQ T;  1KHC A;  2QEX A;  2GCX A;  4JLI A;  1YJ9 A;  1N9S A;  3HRT A;  3M54 A;  4MML A;  3LWH A;  1S72 A;  2DZ9 A;  2GQV A;  4KT0 E;  1YJW A;  1U1T A;  2ZPH B;  4Z02 A;  2VGM A;  3FRN A;  4XQ3 A;  2WSE E;  2LX9 A;  3MEU A;  5I2M A;  3P8B B;  1V29 B;  3TRE A;  2PUO B;  3VUB A;  1N6A A;  1VQL T;  4M77 A;  3HHT B;  3SDZ A;  3Q1J A;  5CKE A;  2VC8 A;  1KC8 C;  2LRQ A;  4J8O A;  2DAQ A;  2PVG B;  1M5Q 1;  2QQB A;  4J83 A;  4M75 E;  2CZ1 B;  3M53 A;  4C0F A;  1W2B A;  2OTL T;  3GIB A;  1VQ9 A;  3LGL A;  3OYY A;  5LL6 S;  1W2B S;  2LC4 A;  3CCU T;  1WGS A;  4M7D C;  2EJG A;  4X9C A;  3PIP A;  4EMK B;  2XID A;  4M75 F;  3OYE A;  2E70 A;  2PVD B;  3OYB A;  3CD6 A;  1XQH A;  2RJD A;  3ME9 A;  2EAY A;  3JCM h;  3GP8 A;  3C94 A;  3CCU A;  1YJW T;  4QQG A;  3G71 A;  3LH0 A;  3JCM e;  1M1K U;  3F70 A;  2O01 E;  3INZ A;  2RK2 A;  5GAN 6;  5FU6 B;  3QII A;  5M9O A;  1GXI E;  4QQD A;  3X25 B;  4V2S A;  3CCV A;  4KUL A;  2QQR A;  4PNO A;  5FRM A;  3BDU A;  4MMK A;  2IVW A;  1R8O B;  4M7A C;  3MO8 A;  4M78 G;  3TCJ A;  3QYH B;  2FB7 A;  4RCC A;  4XU2 A;  4OGC A;  2LCL A;  3O8V A;  4XTW A;  5I2S A;  3SWN B;  3G71 T;  2MWO A;  1BYM A;  1M9S A;  2FL7 A;  2I2L A;  2BIV A;  4IUQ A;  4ME7 A;  4XTY A;  1JBM A;  4C0G A;  3FC3 A;  1U8R A;  4E7I A;  2MMP A;  2CZ6 B;  2K3Y A;  4A4F A;  3CCJ A;  3FDR A;  1K73 C;  4HCC A;  4M7D E;  3S3N A;  3CCE T;  2RJF A;  3FLG A;  1I81 A;  3RMQ A;  1M8V A;  2VYT A;  2AHJ B;  4EMK A;  1WQW A;  1KHI A;  2XKO C;  4J7F A;  4M75 C;  4BI8 B;  5A2Q E;  1VQL A;  4C92 D;  3CME A;  1I5L A;  5DLQ E;  4ATO A;  2ZPE B;  4JDS A;  1VQO T;  3M4G A;  3ZFJ A;  2DEQ A;  3OS2 A;  4C8Q C;  1QVF S;  3CC2 A;  4L5G A;  4C0D C;  1NJI U;  4FT4 A;  5GAO l;  2MF2 A;  1OYX A;  2LDM A;  3A5Z B;  5KE2 A;  1YJN T;  4HT8 A;  4LDX A;  5DM7 R;  4BDZ A;  3E19 A;  1H3Z A;  3OYG A;  2QEX T;  3JB9 I;  4C5G A;  4C5E A;  1VQO A;  4NL2 A;  3L2W A;  4M7A B;  2HAX A;  3RKY A;  1RL2 A;  3V7C A;  3OYL A;  1WQ7 A;  4MDW A;  4RMO A;  2M0O A;  2ZCF B;  2YLB A;  2M1H A;  3OYD A;  3OYC A;  4JS4 A;  3L2V A;  3CBM A;  5IN1 A;  4QW2 A;  3DKM A;  5FU7 C;  3QYG B;  4RKU E;  4XTZ A;  4C92 F;  3OW2 S;  1K8A C;  4OB1 B;  1WJQ A;  1QVG S;  1Q82 C;  3LLR A;  3OSV A;  3GNF B;  1I8F A;  3CPW S;  3CCM A;  5GAO p;  3ZBD A;  3M59 A;  2WAC A;  2BUD A;  4ZGJ B;  4LDV A;  3S3M A;  3OYH A;  3E9F A;  3MEW A;  5D6X A;  4HA8 A;  2QA4 A;  2DKG A;  1Q82 U;  1KG1 A;  3L1A A;  4R56 A;  1BI2 A;  4JRP A;  2QXF A;  2RJE A;  4OB3 B;  1RI0 A;  3WXM B;  3UWN A;  4PL6 A;  3L42 A;  3PGG A;  4MZT A;  5GMK e;  2QTX A;  4ELZ C;  3CCS T;  4F7U F;  4FU6 A;  3OYJ A;  4MZP A;  2P4T A;  4A54 A;  3SWN A;  4FM4 B;  2QA4 T;  3DB3 A;  5KCO A;  4Y91 A;  4QVD A;  1KQ2 A;  5GAN 4;  3GOX A;  1KQS A;  1VUB A;  2KK4 A;  3UPU A;  2CGH A;  1YI2 A;  4C0Z A;  5DLO A;  1NPP A;  5C0M A;  2QQA A;  4IUP A;  1EIF A;  5D6W A;  1VQ8 A;  5LJ3 j;  3RER A;  4A4H A;  2Y90 A;  3CCL A;  4M75 D;  2DXC A;  3HRS A;  4C8Q E;  4A4E A;  4JRK A;  2K4Y A;  4X34 A;  5J3B A;  3MCA B;  2D9T A;  3JB9 J;  4BI4 A;  1MGQ A;  1BI1 A;  3A8M B;  3MP1 A;  2DD4 A;  2R5A A;  1QVG A;  1X6O A;  2LTO A;  1OI1 A;  2EQM A;  2K5F A;  3AHU A;  4M78 E;  1Y07 A;  1VQP A;  2X35 A;  1Q81 C;  2RI5 A;  3QSU A;  2XIC A;  1M4Z A;  2E5Q A;  1QP3 A;  3JCM b;  4RG2 A;  2DIG A;  1NE8 A;  4O5V A;  1YHQ A;  1Q7Y C;  2YHT A;  3BW1 A;  3QUI A;  3CCV T;  1XNI A;  2F5T X;  4M75 B;  3JAM E;  4XU0 A;  2EFI A;  2X4X A;  1VIF A;  4J7I A;  2X4J A;  4NOY A;  3E9G A;  2DXB A;  2X4Y A;  2L5Q A;  2K57 A;  3QDR B;  4M77 C;  4C8Q D;  1K73 U;  1N8R C;  1BIB A;  2MI6 A;  3MET A;  4E47 A;  1S72 T;  1KQ1 A;  1YIJ T;  4XU1 A;  4HCB A;  1P92 A;  3JSC A;  4C0D B;  2E10 A;  2JTM A;  3G6E T;  2LCC A;  3QPH A;  2DZC A;  3L2Z A;  4C92 G;  3A8O B;  3WVE B;  5GAN g;  3I55 A;  5FRN A;  2DXU A;  4JJN K;  1VQ4 T;  2EKO A;  1JJ2 S;  4C8Q G;  4OMF B;  1YCY A;  3PMT A;  5I21 A;  3A8H B;  5GAO m;  3CCE A;  3HPW A;  2JVV A;  4L59 A;  2DTH A;  3V7R A;  4QVZ A;  4QQ6 A;  4KUD K;  4BE0 A;  5CAI A;  2EQJ A;  5KE3 A;  4XK8 E;  1UGR B;  1DJ7 B;  1Q7Y U;  4PLL A;  2RHI A;  2LT1 A;  3QG1 A;  3JCM V;  3DLL A;  4C5H A;  3GLX A;  2CKK A;  2F5K A;  2V8I A;  2FVU A;  1Q81 U;  3R6O A;  4KUI A;  1WPY A;  1HK9 A;  2CZ7 B;  2EWN A;  2OAU A;  4EPC A;  5GAO q;  5CO7 A;  4M7A A;  1BKB A;  2RH2 A;  4DQ2 A;  4N4H A;  5A0G A;  1W4S A;  3UT1 A;  4DOV A;  5GAN 7;  3OB9 A;  5CK9 A;  5LJ5 h;  2RK1 A;  4Y28 E;  2XI9 A;  4FSX A;  3RKW A;  3JB9 G;  4PJO C;  3OMC A;  5D6Y A;  5CR2 A;  3JCM P;  3OYM A;  1M90 C;  2XDD A;  3J7A F;  3OA6 A;  1LJO A;  5HK3 A;  3VV0 A;  4C92 E;  2E41 A;  3HL8 A;  1YJN A;  3SFM A;  1O75 A;  2EQK A;  2C06 A;  4IKF A;  3VJP A;  4PKC C;  4VUB A;  3CCQ A;  2VV5 A;  2QQ9 A;  3C95 A;  4J5Y A;  3OS0 A;  3CPW A;  5LJ5 e;  1VQN A;  4M7D D;  3QHS A;  3VU3 C;  3LYI A;  4M78 D;  2JNG A;  2FYK A;  2H3J A;  4NS5 A;  4UC4 A;  1Y71 A;  2CZ0 B;  1YBY A;  3G6E A;  4E7H A;  3CME T;  1JJ2 A;  2R57 A;  3URG A;  3S3O A;  1UGP B;  2CYZ B;  2F69 A;  2RHZ A;  2WSC E;  3VYH B;  2IG0 A;  2HNI A;  4BI3 A;  4QVC A;  2Y4X A;  4JLG A;  3LW5 E;  4M78 A;  1BIA A;  3BFM A;  3L2U A;  5IT9 E;  3CCR A;  2P0K A;  5L8R E;  2RD1 A;  2LQ8 A;  2K5I A;  2P0P A;  2RHX A;  3HRU A;  5LJ5 d;  3JB9 D;  5FU7 B;  4P5N A;  4M7D B;  1O9S A;  2VGN A;  3QJY A;  3OYK A;  1VQ6 A;  4JS5 A;  3J80 E;  3T9N A;  4PJO F;  1VQM A;  1IRE B;  2RB6 A;  5J39 A;  2YRV A;  3I56 T;  3LGF A;  4PJO B;  1FWZ A;  2L89 A;  4BE1 A;  1ZQ1 A;  3JCM g;  4JRQ A;  2LNV A;  4YTL A;  2M9U A;  3MHX A;  4M7A D;  3HKS A;  5HKC A;  2OTL A;  4F7U B;  3P8H A;  2OTJ T;  4Q5W A;  2HBP A;  5HY6 A;  1UGS B;  2RJC A;  4C8Q F;  2EIF A;  2GFA A;  4OB2 B;  3TU4 K;  4JUV A;  2D0Q B;  3OYN A;  1YIT A;  4F7U A;  3I56 A;  4M77 G;  5CKH A;  3GNG A;  5GMK j;  5LJ5 j;  1KQS S;  2DIQ A;  2RO0 A;  1VQM T;  3M4Y A;  1QW1 A;  2V8J A;  3ER0 A;  1D3B B;  1PSF A;  1YIJ A;  2MWP A;  4PJO D;  4EMG A;  4M7A G;  1JRI A;  1WNL A;  2DPP B;  4OGE A;  2KAF A;  3G4S A;  1M1G A;  1NJI C;  4A53 A;  5LJ3 d;  4O6J A;  5EG2 A;  2RA2 A;  2X4W A;  3QO3 A;  3JCM d;  2E6Z A;  5GAM d;  5GAN j;  2R5M A;  2VUB A;  3X26 B;  2RHU A;  1VQP T;  2KY9 A;  2ZPI B;  5LJ5 f;  5GMK i;  4RCB A;  3CC4 T;  5HK0 A;  4E7K A;  3FIF A;  2ZPB B;  3C4S A;  1B34 A;  1LNX A;  2DK3 A;  5GAN 2;  3OW2 A;  2O4X B;  2P0Q A;  1VQK A;  2D6F A;  2RM4 A;  3PT9 A;  5FU6 C;  3CXC S;  3DB4 A;  2JZ2 A;  2HQX A;  4MDX A;  1B34 B;  2PU9 B;  3X20 B;  2G3R A;  2O4X A;  3HFN A;  4M77 E;  3RIR A;  5GAM e;  5GAN h;  3JCM W;  1VQ9 T;  4C92 C;  5KH6 A;  4MZM A;  4LD9 K;  4A4K A;  3I55 T;  3C12 A;  2KSS A;  1VQ7 T;  4II1 A;  2RHY A;  3RES A;  3S6W A;  1VQN T;  4ELY C;  4ZTF A;  1LOJ A;  4XTU A;  5GAM g;  1XTD A;  5CKB A;  1M90 U;  2M16 A;  1FX7 A;  1OZ2 A;  4IUT A;  2ZZD A;  5CQX A;  3CMA A;  4M78 C;  3DLM A;  3MEA A;  4GLK A;  4B9W A;  5GAM h;  5KCH A;  3RKX A;  3V7S A;  4R55 A;  1YJ9 T;  3CBO A;  1MHN A;  2XG8 D;  3VUZ A;  5C6S A;  2R58 A;  1VQ7 A;  1ZHI A;  1U1S A;  3OYA A;  1K9M U;  2RI2 A;  4EMH A;  3QZ9 B;  5LJ5 g;  2L3R A;  4BB7 A;  3PIO A;  3OY9 A;  5DY9 A;  4F7U E;  5CKD A;  4PLI A;  4M77 D;  3JB9 F;  1QVP A;  3X28 B;  5CVI A;  3CCJ T;  1G3T A;  2KQW A;  4M78 B;  1FXX A;  2DD5 A;  3GF5 A;  3LX7 A;  2GFU A;  1KC8 U;  3CD6 T;  2QDY B;  2E6N A;  1NPR A;  3M55 A;  4LDY A;  5LJ3 f;  3PNW C;  2DO3 A;  4BD3 A;  3CBP A;  3EFS A;  3V8J A;  3LWI A;  3CCL T;  2YLC A;  2E12 A;  3CCQ T;  3CC4 A;  1N8R U;  2OTJ A;  3NFC A;  2LT4 A;  2EYQ A;  3HP9 A;  2L8D A;  4TVR A;  4BY6 C;  3L2Q A;  2DTI A;  4OVA A;  5GMK l;  3MP8 A;  1X01 A;  5FLX E;  1NZ9 A;  2B8A A;  3CC7 T;  4L6V 5;  4OB0 B;  4M7D F;  2BKD N;  2VXE A;  5GAM f;  5FRO A;  4J6X A;  3OBY A;  3MP6 A;  3QXE B;  3SB2 A;  1K8A U;  3CCS A;  2HQE A;  4B9X A;  4GY5 A;  4PJO A;  1I4K 1;  4WF2 A;  3OMG A;  4DA4 A;  1Q86 U;  5GAN 3;  2JTF A;  4N0A A;  4IUR A;  1BI3 A;  3QKJ A;  1UGQ B;  3CCR T;  1QP2 A;  5GMK m;  4LD6 A;  4OF1 A;  5J26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...