1UUEA

A-spectrin sh3 domain (v44t, d48g mutant)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKTEVNGRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solvation in Protein Folding Analysis: Combination of Theoretical and Experimental Approaches
pubmed doi rcsb
source organism Gallus gallus
molecule tags Sh3-domain
molecule keywords SPECTRIN ALPHA CHAIN
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uueA00
1ZSGA 2LJ0A 1VA7A 2DM1A 2EPDA 3ZL7C 2J6FA 3VS6A 2E5KA 2PZ1A 1MUZA 1SHGA 1SEMA 3CQTA 3VS3A 1K76A 2BTTA 1WX6A 1G83A 2L2PA 4AFSC 1JO8A 1RUWA 1YCSB 5FWBA 4CC3A 2FPDA 1GBQA 2LZ6B 2EBPA 1OOTA 3EG2A 2MIOA 1S1NA 2PNIA 4R0KA 2F2XA 1UHFA 4X1VA 1SHFA 1WXUA 2BZYA 4JZ4A 2EYWA 1CKAA 4DEXA 2D1XA 2LJ3A 2FEIA 2KXCA 1TUCA 1AWXA 2HBWA 2CUBA 2FO0A 2LP5A 4A63B 2KT8A 4RUGA 1VYVA 1AEYA 1M3AA 2DRKA 4J9EA 1UE9A 1PHTA 1IO6A 1GFDA 2ED1A 4OMQA 2DMOA 4J9FA 1U5SA 1A0NB 1X2KA 1W70A 2RF0A 1BU1A 1UHCA 1B3QA 3M0QA 3UA6A 1SRLA 4RTTA 4M4ZA 2KE9A 1AWJA 1AD5A 5IH2A 2M51A 3H0HA 4KRTA 1FYNA 4CC7A 2M0YA 2DRMA 2HDAA 1AWWA 2GQIA 2K3BA 2V1RA 1AOJA 5FWCA 2K6DA 2L3SA 3FJ5A 1TG0A 2DL3A 1T3LA 1QWEA 1ZBJA 2X3XD 1WA7A 4JZ3A 2KEAA 2FRWA 1QKWA 4J9IA 3PVQA 5HCKA 1GL5A 1E6GA 2RNAA 2OAWA 1ZUKA 1OEBA 1XOVA 1UG1A 2JMAA 4ZNXA 4HXJA 1JQQA 1YNZA 2JTEA 3PE0A 2BZXA 2LCSA 5I22A 3A98A 3VRZA 2X3WD 3JV3A 3RBBB 2JMCA 4OMLA 4OMOA 4Z89A 1M30A 2H8HA 1GRIA 1VYTA 1UFFA 2CSQA 2D0NA 2LQWA 1H92A 2OI3A 1AVZC 4Z88A 4GBQA 2DVJA 2ABLA 3GBQA 2YDLA 2O88A 2GGRA 2EW3A 1K0XA 1WIEA 1MV3A 1K0SA 2DF6A 2O31A 2FRYA 2JW4A 3VS7A 2RQRA 1HD3A 2EYZA 2L0AA 4HVUA 2KYMA 4AFUC 2C0IA 3PVLA 3REBB 1T0JA 2AK5A 2J06A 2JS0A 3LH5A 1YWPA 3I9QA 2IIMA 2YUPA 5IXFA 3TSWA 4LN2A 1NEBA 4CC2A 4LUDA 1X69A 4JJDA 2HCKA 4J9DA 2CSIA 3EG0A 4HVWA 1GFCA 1T3SA 1NLPC 4RTUA 1BBZA 2EGCA 2RN8A 2EGEA 2GBQA 1I0CA 5EC7A 2KNBB 4ORZA 2J05A 3M0PA 3I5RA 2MCNA 2LJ1A 1KIKA 1NYGA 2YSQA 2DL5A 3M0TA 1Y0MA 2EVRA 4DEYA 1JU5C 2VKNA 1WLPB 4OMPA 4RTXA 1G2BA 2JS2A 2JXBA 3I35A 2DJQA 2YT6A 1NYFA 2V1QA 2CT3A 1VYUA 2KT1A 1YP5A 2KYBA 1ARKA 2G6FX 2J7IA 2LMJA 1UECA 4RTVA 2K79A 2JT4A 1YWOA 1M27C 4F14A 2KBTA 4F17A 4J9HA 1N5ZA 2A36A 2ENMA 1K4US 1WDXA 2D8JA 2CREA 2DBKA 4OMMA 2K7AA 1AZEA 1CSKA 4HVVA 4WCIA 4EIKA 3U23A 1H3HA 2CH4W 1QKXA 4AFZC 4E6RA 1UTIA 3SHWA 1JEGA 2DL4A 5L23A 1E7OA 1KSWA 2L3PA 2HEQA 4IIMA 2VWFA 2FPFA 4LE9A 4D8DA 1ABQA 1OPKA 1E6HA 2DBMA 2PTKA 1KFZA 3REAB 1AZGB 2D8HA 3EHRA 5GJWB 1WI7A 2K2MA 3QWXX 1RLQC 4IIOA 2JM9A 1FMKA 3H0IA 3H0FA 2P4RA 2EYXA 2W0ZA 3EG1A 2F2VA 2A28A 2SEMA 2MOXA 1Y57A 3NPFA 2RQVA 1SSHA 1X43A 3EG3A 1JXMA 3UA7A 3M0UA 4QT7A 2NWMA 1X2QA 2DILA 4JJBA 2LNHB 2L3QA 4J9CA 1WFWA 2OJ2A 3VRYA 2EGAA 1LCKA 3QWYA 1GCQC 4CC4B 4AG2C 4LUEA 2K9GA 4Z8AA 2ROLA 3H41A 2HSPA 1QWFA 2DL7A 4F16A 1GCQA 1OV3A 2GTJA 2W10A 3O5ZA 1HJDA 2CH4A 1ZLMA 1U06A 1QCFA 1K9AA 1M3BA 1PKSA 2CUDA 2RQUA 1NG2A 1T0HA 2LQNA 2AZSA 1WXTA 2A37A 2KR3A 2ED0A 2FPEA 5GJVB 1BK2A 2FG0A 1SPKA 3NMZC 3UF4A 3EHQA 2KROA 1YN8A 1TUDA 2RPNA 4FSSA 2BZ8A 2DE0X 1UJ0A 2GNCA 3R6NA 3C0CA 1ZX6A 2CT4A 2C0OA 3TSZA 2XMFA 4RTZA 1Z9ZA 2C0TA 3TVTA 4GLMA 5IHNA 1PNJA 1PKTA 2AKKA 1K1ZA 4J9GA 2ECZA 1JXOA 1OPLA 4Y92A 1X6BA 2O9VA 1PRMC 1MV0B 3VS5A 4K11A 3VS2A 2DLPA 2NUZA 5I11A 1ZUYA 4RTWA 2DL8A 2YUQA 5ECAA 2EQIA 1NM7A 1J3TA 2RQWA 1NEGA 1U3OA 3ULRB 2CDTA 1KJWA 3VS4A 2AKLA 1M3CA 2KRMA 1BB9A 1RI9A 4LNPA 2RMOA 3UATA 1PRLC 1ZUUA 2KRNA 2ROTA 4RTYA 1X27A 2KRSA 2O9SA 2A08A 1QLYA 4JPBW 4OMNA 4AFQC 1GBRA 2ESWA 5IHIA 5IXBA 3M0RA 1H8KA 2EYYA 3SEMA 2KGTA 5IHKA 1UJYA 3M0SA 2I0NA 2VVKA 1PWTA 1M8MA 1CKBA 1NLOC 1V1CA 2SRCA 1W6XA 1Z9QA 1HSQA 2KXDA 2LX7A 2B86A 5FW9A 4HCKA 2RQTA 1WYXA 4D8KA 1AWOA 4ESRA 2DNUA 1W1FA 1ABOA 2DX1A 3VS0A 3IQLA 2DYBA 2EKHA 1SRMA 2QDLA 2J6KA 2GTOA 1WXBA 3VS1A 1UDLA 1X6GA 2F2WA 2J6OA 4JJCA 3EGUA 3RNJA 3NGPA 1UUEA 3NHNA 1UGVA 1RLPC 3THKA 1B07A 2JM8A 2YUNA 4J9BA 4AG1C 2DA9A 1GCPA 1EFNA 1I1JA 1I07A 3I5SA 3KFVA 2O2OA 2AZVA 2YUOA
chains in the Genus database with same CATH superfamily
1VIEA 3RMSA 2DM1A 2EPDA 4FT4A 3ZL7C 4OB3B 4QVDA 2DERA 4EMKC 2QEXT 1QVGP 2L2PA 4MDWA 3S3OA 3UDCA 3OYBA 5FWBA 4CC3A 4OB1B 5D6WA 3EG2A 1IHWA 4M77C 5C6SA 4FSXA 2XDBA 3MJXA 2QDYB 3JCMP 1B7TA 2DJZA 2X4YA 2FZKB 2WSCE 1JJ2A 2DXCA 1CKAA 2MWOA 2PUKB 3M5AA 2LJ3A 5GAN2 1YHQQ 1Q86U 2WSFE 4XTWA 3SWNA 1G3SA 3OMGA 2RJCA 4A63B 1NJIC 2K5FA 3CC2Q 5A0GA 4CRIA 4ZGJB 2DRKA 3UPUA 1IO6A 3DLMA 5GANd 3SD4A 1PM3A 4OMQA 1X2KA 3QDRB 5D6YA 2RF0A 3I56A 3OYMA 2OX7A 4L6V5 1UHCA 2LCCA 3MEUA 1QP3A 2M1HA 1VQ8A 4MZPA 3UA6A 2KE9A 1YJWQ 1AWWA 3QG1A 2DEUA 1LVKA 2DKGA 2V1RA 3QPHA 4FYVB 1T3LA 1I5LA 2KEAA 4XU2A 4M75A 4FIBA 1KQSA 5GAOm 1M5Q1 3CBMA 3MCAB 4PJOD 3URGA 1OEBA 5J3BA 2JMAA 4HXJA 1KD1U 2E65A 1YJNQ 1PD0A 4PJOG 4ANJA 1BYMA 3PE0A 2BZXA 4C0FA 2VB6A 5KH6A 2X3WD 1M1FA 1D3BA 2JMCA 4OMLA 1NJIU 1RAAB 1M30A 1UGQB 1G5VA 3M53A 4ELYC 1H92A 5KYYA 3RUXA 3OW2S 2ABLA 3OS0A 2O88A 2GGRA 2EW3A 2RM4A 2F1LA 4RMOA 2A7YA 3VKIA 4C92F 3S3NA 3VS7A 1HD3A 5CVIA 3I55T 3A8LB 3NTKA 3KXTA 1VIFA 3LLRA 2K2VA 2C0IA 3L2UA 3P8DA 1VQ9T 3M58A 3M56A 4YTLA 2RI3A 4IKFA 3HFOA 4B9WA 5IXFA 4KH0B 2QQBA 1RAIB 3VU3C 3CCMQ 4PJOA 2ZPBB 4LUDA 2NYSA 4M78D 2HCKA 5FU6B 1PC0A 4M75B 3EG0A 4M7DE 3V8JA 1NLPC 1YBYA 4J6XA 1K73C 2EGEA 3OS1A 5GMKh 1RABB 4M78G 2ZPFB 4ORZA 5HKCA 3JCMb 1W4SA 2MCNA 1NYGA 2YSQA 3L42A 3M0TA 3CCSQ 4DEYA 1Q82U 2CZ7B 1WLPB 4NL3A 4OMPA 4BE2A 1Q82R 1TSFA 1I8FA 2DJQA 5AYFA 2YT6A 1WZOA 2VGNA 2CT3A 2XI9A 5LJ3g 3BE3A 2P84A 5KCOA 3META 5KYYB 1YWOA 5HK0A 3PIPA 3CD6A 1M27C 5I2SA 4J9HA 1V76A 4OVAA 3SFMA 4M7DC 2O01E 4FW1A 2QA4A 2RHYA 1ZHIA 3V7RA 3BDLA 2D0QB 2CREA 4OMMA 2IPOB 3HP9A 3OYEA 3MP8A 1H3HA 1BCMA 4AFZC 4E6RA 2LVMA 4E7KA 3CD6Q 5L23A 1E7OA 3AHUA 1JB0E 2L3PA 4IIMA 1SSFA 3PIOA 4D8DA 1RL2A 4E7IA 1KFZA 1AZGB 2P4TA 1VQPA 3HHTB 5GAMh 1YCYA 4Q5WA 4O5VA 2HL5C 2L5QA 4OP0A 1IHVA 2CKKA 4AT1B 2E6NA 2SEMA 2OTLQ 1WJQA 3GOXA 4DBFA 2EQKA 5KYUA 5GAN3 2Z0WA 1KD1C 3QUIA 2LT4A 3CXCP 2RK1A 1MMNA 2PVGB 4M78E 4M7AA 1D1AA 4ZGDB 2I2LA 1X2QA 2DILA 2RI2A 2MPXC 4J9CA 3HSBA 5GAOr 1Q95G 2EGAA 1LCKA 1GCQC 4C8QA 4AG2C 4LUEA 1D1BA 1HXDA 2EQUA 1N8RU 1OV3A 2CH4A 5L8RE 3CCMT 1OZ3A 2MMPA 1UGSB 3GNGA 1T0HA 1ZBXA 4J7FA 1VQ4Q 2LQNA 2XDPA 1WXTA 2A37A 3MEVA 3QSUA 1O75A 3OB9A 2FG0A 4KH1B 3EHQA 4BI8B 1YN8A 4MZTA 3CBPA 3I55Q 4EDUA 2BZ8A 3A8MB 1UJ0A 2M02A 1EX4A 4QKUA 4JLGA 2HQHA 4NS5A 2HKQB 2CT4A 4HCCA 2XMFA 2CZ1B 1OX9A 5LJ5g 2RI5A 3SDZA 4QVCA 2QXFA 5GAMg 3V8LA 4LD6A 2AKKA 5LJ5e 2L3RA 2MI6A 1OPLA 1PG5B 2O9VA 4PL6A 4A4KA 4F7UG 3VS2A 2DLPA 4RG2A 3G4SA 2DL8A 4M78F 2EQIA 2DETA 1QVFP 5KYUB 1NEGA 1XTDA 2RD1A 5GMKi 2CDTA 2QQ9A 1OULA 2AKLA 3CCUQ 3G4ST 2HNIA 4LNPA 4GY5A 3BDUA 5CAIA 1VQMQ 3JCMV 2YRCA 2A08A 3FRNA 1QLYA 1GBRA 2BE7D 1NE8A 2R5MA 4OGCA 4KGVB 4ZGEB 2EYYA 5GMKe 3EFSA 4XU0A 2KGTA 2JN0A 2EQMA 3MHXA 5DLOA 1PWTA 1M4ZA 1M8MA 1NLOC 4D8KA 4ESRA 2K4YA 2DX1A 2EKHA 1X6GA 2DEQA 2HD0A 3L1AA 3EGUA 1IREB 4C92E 1UUEA 2X9HA 2RHUA 5GMKm 3H8ZA 2YHTA 1GXIE 4E7LA 3ER0A 1GCPA 1EFNA 2BE9B 3CC2T 2ATCB 3I5SA 3CPFA 3KFVA 2PVDB 1VOMA 2LJ0A 2R5AA 3CCSA 3RKWA 2XK0A 4JUVA 4XAXB 2CP2A 1Y96B 3VS6A 2JUFA 1MUZA 1VQ7T 1SEMA 3ASKA 3OYHA 3CCQQ 1VQPT 2NUTA 1QVFS 4N4IA 1JO8A 1RUWA 2E6ZA 5LJ5h 3CC4A 2YRDA 2DZCA 3OYCA 3CCUT 2DXTA 4WF2A 2RK2A 2QEXQ 2F2XA 1UHFA 2OTLA 1SHFA 2PQWA 2YLBA 2NUPB 1WXUA 2ZAEA 5LJ5d 4JZ4A 2K57A 1RAHB 1NJIR 4DEXA 3JB9D 1C6VX 2FEIA 5GANf 1RI0A 2CGHA 1UB4A 4C92C 2FO0A 2RO0A 1R8OB 1TUGB 2LP5A 4J83A 2QYZA 1VYVA 1YI2Q 1UE9A 1VQLT 1PHTA 2ED1A 3EGXA 4TVRA 2K3XA 1U5SA 3JCMg 1TXQA 3X24B 2LTOA 3TU4K 2JTFA 1KK7A 1WHJA 1YITT 3NFCA 4J6YA 4RTTA 1AWJA 1AD5A 4JJNK 1R0CB 3CBOA 1Q82C 2DRMA 2QGFB 1YJWA 3OYIA 1Y96A 3V7CA 5FWCA 1YJNA 2L3SA 3FJ5A 1TG0A 1U1TA 4JZ3A 2FRWA 4C92B 1VQ6Q 2QK0A 3Q1JA 1K8AR 1GL5A 1M8VA 2EKOA 1ZUKA 1XOVA 4PFPA 1IXDA 1JQQA 1YNZA 2K5IA 2QQSA 3V7SA 1YJ9T 2RJDA 2OTLT 1H641 2LCSA 1JBMA 4XTUA 3S6WA 4BE1A 3VRZA 2WACA 3RBBB 5KYXA 4FM4B 4Z89A 2FZCB 3LH0A 2RHIA 1BI2A 1GRIA 9ATCB 3CMAA 3VV0A 2BUDA 3CCEA 4J7IA 1MMDA 2QASA 2HAXA 1KQ2A 3CC2A 3ME9A 2YDLA 5KE3A 2JOYA 2HSEB 1K0XA 1N8RR 2O31A 2O4XA 4KULA 2JW4A 4MDXA 3QYGB 5GAOl 4OGEA 1I4K1 4AFUC 2K5LA 3PVLA 3REBB 5GAMe 3GPLA 3LH5A 1Q81C 1YWPA 1I5OB 2YUPA 2KK4A 1W2BP 3TSWA 5KCHA 3CXCA 1WJSA 1QCNA 4C92A 4QQDA 1GFCA 5CK9A 4RTUA 1I0CA 1M9SA 2KNBB 3I5RA 4XTYA 3MPUB 1IGQA 2C06A 1Y0MA 3EFOA 3CPWP 4BI4A 1K9MR 1JU5C 2E10A 2VKNA 1KD1R 2DO3A 5FU7C 2JXBA 1VQ6A 1VQ9A 1XNIA 4PJOC 4HA8A 5KYXB 3DB4A 1ARKA 2J7IA 1N6AA 3INZA 4RTVA 1YIJA 3HTRA 1X6OA 2E3HA 1AHJB 4LXCA 2KBTA 3EH1A 1KC8U 3JAME 1VQNQ 4ATOA 1VQ9Q 1PD1A 4ZN1A 3G6ET 4LDYA 2E70A 2KQWA 1N9RA 1WDXA 3CCLA 1LOJA 2D8JA 2K7AA 2OTJA 3OYKA 3JCMc 2MYSA 1Q86C 2R58A 4UC4A 3TQ7P 3OW2A 2DD5A 3SHWA 2DL4A 1EIFA 2E3IA 3FC3A 1VQLA 3J81E 4HKEA 4JRQA 4LDWA 2FPFA 4OMFB 1ABQA 1PSEA 1M2VA 2MWPA 2PUOB 1E6HA 3X28B 2PTKA 2RA2A 2D8HA 2EYQA 1WI7A 4PJOB 1QMCA 1K8AU 3QWXX 3JB9F 1C0MA 3JCMW 1VQ5T 1TTHB 3H0FA 2P4RA 2EYXA 2W0ZA 3CCRQ 1OI1A 2F2VA 3TEEA 2QEXA 2XICA 3G6EA 2JTMA 3NPFA 4FCYA 1Q7YU 5GAN6 4RCCA 3CCJT 3CCQT 3EG3A 4E2FB 1YJNT 2DD4A 1JXMA 1TS9A 3O8VA 3EFOB 4M78C 3QYHB 3I56T 3M0UA 2VUBA 5AT1B 4M7AC 2L3QA 1OU8A 2R57A 3GP8A 4DA4A 1X01A 4CC4B 2DIQA 3HRSA 4Z8AA 2K9GA 1MNEA 5GAMd 1ZSZA 1VQKT 2GTJA 3QJ6A 1HJDA 1VQ5A 2HQEA 1G3YA 1BI0A 1QCFA 3QHSA 2GQVA 1K9AA 3A8OB 4BACA 2RQUA 4C0ZA 4BD3A 4M78A 2KR3A 2ED0A 2VGMA 5GJVB 1BK2A 1TUDA 4C5IA 1D0ZA 2RPNA 4ZTJA 5CKBA 1M1KU 4QQ6A 2JVVA 2GFAA 3TSZA 4RTZA 1JJ2P 1Z9ZA 3VYGA 3RKXA 5IHNA 3RDVA 3QIIA 1MMGA 2E4HA 4N0AA 3D7SB 1TH7A 1Y7XA 2HL3A 2ZPIB 5CKEA 1R0BG 1PRMC 3KUFA 4M7DA 4F7UB 3G4SQ 1YIJQ 5GAMj 5I11A 2NUZA 2HMAA 5CQXA 1IRXA 4M77F 3NTIA 4OB2B 3CCJA 1G3WA 1NM7A 3OYGA 3M4YA 2RQWA 1UGRB 2CP3A 2YXYA 3P8BB 2RJEA 1KJWA 4OB0B 1S72T 1RI9A 1BI1A 5FROA 7AT1B 5GAN8 2O9SA 3QKJA 3NTHA 1BCOA 2ESWA 4V2SA 1B34B 2CZ0B 1M90U 3M0RA 1H8KA 5LJ3f 4M75D 4BB7A 4MMKA 1CKBA 1V1CA 1W6XA 4E7SA 2IVWA 4HCKA 1AWOA 1W1FA 1ABOA 2CS7A 3IQLA 4F7UF 2DYBA 1SRMA 2GTOA 3VS1A 2F2WA 4JJCA 4EMKB 3HL8A 3OQ5A 3OBYA 2JZ2A 2H3EB 1UGVA 4M77E 2JNGA 1HK9A 2JM8A 4A4EA 5DM7R 4J9BA 4M7DF 2M16A 2DA9A 1I07A 2ZPEB 4DBRA 1VA7A 3OYJA 3EFRA 3M57A 1MMAA 6AT1B 2J6FA 2PZ1A 1SHGA 1RAFB 2F5TX 5CR2A 1WX6A 4JS5A 2E1HA 1YCSB 3JCMd 2CP5A 2X51A 5GMKj 4EPCA 1IGUA 5KE2A 2LZ6B 2EBPA 1I81A 2MIOA 3OYYA 2V8IA 1S1NA 3M59A 5J26A 3M54A 4X1VA 2BZYA 2P0KA 2EYWA 3L2RA 3JCMQ 2KDSA 2D1XA 1K9MU 1D3BB 5LJ3j 3CPWS 3LWIA 3VUBA 1TUCA 1U8RA 2CUBA 4RG8A 2QQAA 2QI2A 4M7AF 2KAFA 2KT8A 4RUGA 2X4WA 3E1SA 5CIUA 3TREA 1GFDA 2BKDN 2DMOA 4J9FA 4PJOF 1A0NB 1OX8A 3QZ9B 3MO8A 1KC8C 5GMKl 5D6XA 1BU1A 2FVUA 1VQ8Q 2ZGWA 3M0QA 3JB9J 3PMTA 3C95A 2AHJB 4C5EA 5IAYA 4M4ZA 5IH2A 1YI2A 1VQ6T 3OSSC 3H0HA 4KRTA 1FYNA 3HKSA 4CC7A 2M0YA 2HDAA 3FB9A 4ZTFA 1HYOA 2GQIA 1RACB 1Y07A 3C12A 2DTHA 2K3BA 1AOJA 4X34A 1D1CA 3MKDA 2HBPA 2HKNA 4KUIA 2X3XD 2EWNA 3CPWA 1QKWA 4ME7A 4PJNA 1YITQ 2DFUA 1TWBA 4PNOA 4A4GA 1ZQ1A 3C94A 2JTEA 1Q86R 1C1AA 3UT1A 2NUPA 5I22A 2EJFA 3G71T 1YI2T 2CYZB 1VUBA 3SWNC 1YITA 4OMOA 3CCEQ 1UFFA 2CSQA 2LQWA 4Z88A 1QVPA 5GANg 2DVJA 5CO7A 3GBQA 1K9MC 3OW2P 3S3MA 5FRNA 4PFOA 1WIEA 2VXFA 1K0SA 3VYHB 1UGPB 4C92D 1QVGA 2K3YA 1XJWB 2KI7A 1S72A 2EYZA 1QCOA 4RKUE 2LC4A 1IB8A 2COYA 2KYMA 3EAEA 1T0JA 2AK5A 1M2VB 2J06A 2JS0A 4VUBA 1YJ9A 4CC2A 3GLXA 1NPPA 3H6ZA 5IT9E 1KQSS 3OYFA 4JJDA 3G71A 1VQOQ 3CCLT 1QP2A 2EGCA 2YWWA 4QQGA 4FYXB 2COZA 5EC7A 3LX7A 2J05A 1KIKA 3JB9I 2DL5A 2EVRA 4Y28E 2F5KA 2Y4YA 4C0GA 4RTXA 1YJWT 2H3JA 3JCMf 5LJ5j 2QA4Q 3CMEA 3J80E 2FB7A 4PFZA 5LJ3d 1NYFA 2V1QA 2AIRB 2MK5A 4F04B 1VYUA 5FU6C 2QA4T 2KYBA 2XDDA 4JRPA 1ZSZB 2K79A 2JT4A 5I21A 4PLLA 3RESA 1N5ZA 2A36A 2ENMA 1NZ9A 1QVGS 5GAN5 1K4US 3CEYA 4IUTA 2L8DA 1VQOT 3QJYA 3RMQA 2DBKA 1PCXA 4HVVA 4N4HA 1VQMT 5HK3A 1W2BS 1D0XA 4IUPA 4E7JA 3EG9A 1JEGA 1KSWA 4LE9A 3MEWA 2DBMA 4X9CA 4D6WA 3DB3A 1QW1A 1UEBA 1XQHA 2XIDA 3REAB 5GJWB 2V26A 3TCJA 2RB6A 3VUZA 1RLQC 4IIOA 3ZFJA 2RHZA 5HY6A 3MP1A 3H0IA 4F7UA 3MEAA 2X4XA 1BIAA 4PLIA 1MGQA 2FZGB 2ZPGB 4PJJA 1Y57A 3V8KA 2RQVA 1SSHA 1X43A 3AT1B 5CKFA 2NWMA 4JJBA 2CP7A 4M7AE 1WFWA 2OJ2A 1M1KC 1ZA2B 4XTZA 3G71Q 3CCLQ 3JCMJ 3BFMA 2ROLA 3H41A 1P92A 2DL7A 3KBGA 3UWNA 2LCLA 1GCQA 4C8QC 1ZLMA 1M3BA 3CCJQ 1PKSA 3QDFA 1VQNA 5DLQE 3JB9G 4BY6C 1M2OA 4C8QG 3NMZC 3UF4A 4E47A 4PJMA 2VYTA 5FU7B 4E7HA 4R56A 2IG0A 5FLXE 1TU0B 3A8GB 1VQ5Q 3E19A 2EAYA 2XKOC 1X75C 2GNCA 4EMKA 2OTJT 3C0CA 4XU3A 3HPWA 2C0OA 1EZZB 3M55A 3TVTA 1K1ZA 1Q7YC 2ECZA 1N27A 5LL6S 1JXOA 4L5GA 4Y92A 4B6MA 1X6BA 4LDVA 1MV0B 3VS5A 2X4JA 1RAEB 4K11A 3OA6A 1WQWA 2D9TA 2YLCA 3CCET 1ZUYA 2DXBA 4RTWA 2YUQA 4NOYA 4PK4A 1K73R 3GIBA 3CCQA 1K8AC 1KQ1A 1Q81R 2EJGA 1VQ4A 3G6EQ 3ULRB 2NUTB 3L2VA 3VS4A 1YHQA 4DQ2A 2Y90A 4M7AB 1M3CA 3H9NA 2RMOA 1D09B 2XU8A 2V8KA 1ZUUA 3CMAT 4HT8A 4RTYA 2KRSA 3JCMh 3ZEHA 4R55A 3QZ5B 1RADB 4AFQC 1KC8R 4J6WA 3QO3A 4EMHA 5IHIA 1IZ6A 4M7AD 1ZA1B 2CP6A 3SEMA 4A4FA 5IHKA 3M0SA 2M0OA 1V29B 2VVKA 4BUGA 1FWZA 3MP6A 1VQKA 4M78B 1HSQA 2HQXA 2B86A 5FW9A 3SWNB 3LYIA 1Y71A 2RQTA 2DNUA 1FX7A 4M75G 2DVEA 2QDLA 5EG2A 1UDLA 1VQ8T 3RNJA 2VV5A 2LDMA 4IURA 2E5QA 3NHNA 3THKA 4N4GA 1RLPC 2LX9A 4FU6A 3JCMe 3CCST 2GF7A 3RKYA 3WXMB 4C92G 3OMCA 5CKHA 2DIGA 2O2OA 3VJPA 2AZVA 1ZSGA 1FMVA 2FL7A 1M90C 2QTXA 3CCVT 4ELZC 2E5KA 1SKUB 3BW1A 1ZSZC 3CQTA 3QXEB 1AT1B 1LNXA 3VS3A 1K76A 3CXCS 5A0DA 2BTTA 1Q81U 1G83A 4C0DB 4AFSC 3CMET 5IN1A 3QBYA 2FPDA 4KUDK 2HZYA 1GBQA 4NL2A 1OOTA 3WVDB 3EGDB 1VQMA 2PNIA 4PKCC 4B9XA 4R0KA 1W2BA 1B34A 5LJ3h 5KYNA 2KXCA 1AWXA 4J5YA 2HBWA 3RIRA 4A4HA 4JRIA 3OYAA 1KHIA 5KYWB 1S72Q 4BE0A 3CC7Q 1AEYA 1M3AA 4J9EA 4LDUA 4JDSA 4M77B 4DBHA 4M75E 1QVFA 4M75C 4DOWA 1W70A 2O4XB 1WPYA 1WJRA 1B3QA 2OAUA 2WSEE 3JB9H 1SRLA 1QQJA 4L59A 4QW2A 4AMCA 2P0QA 2M51A 5CQYA 3CC4Q 4II1A 2L89A 5DY9A 2DYIA 2ZPHB 3RR6A 2K6DA 2EIFA 5LJ5f 2F69A 5GANe 2DL3A 1QWEA 1ZBJA 1WA7A 3G1JA 2DZ9A 5GAOn 4BDYA 1NPRA 3PTAA 1NBEB 4J9IA 3PVQA 5HCKA 2QGGA 3FLGA 1E6GA 2RNAA 2OAWA 2PU9B 3EGDA 1UG1A 4ZNXA 4OF1A 5GANh 3LWHA 1KHCA 2LNVA 2DTOA 3A98A 3PFSA 3T9NA 1BKBA 2EJ9A 3JV3A 1G8XA 4MMLA 2FYKA 1YIJT 2H8HA 1TOVA 4KBMB 2E41A 1VYTA 2D0NA 1OYXA 3GNFB 5KYWA 1OU9A 2OI3A 1AVZC 5I2MA 1YHQT 4GBQA 4M75F 4PJOE 3X26B 1D0YA 1VQPQ 1PSFA 1MV3A 3G7ZA 1VQ7Q 2DF6A 4LD9K 3CCRT 1OZ2A 2BIVA 4DBQA 3CCVA 1H3ZA 2CZ6B 4N0AC 2FRYA 8ATCB 2RQRA 2L0AA 4HVUA 3DLLA 3HRTA 4DOVA 2QTVA 3JRZA 3I9QA 4A53A 5M9OA 1M1KR 2IIMA 2QG9B 4LN2A 1NEBA 3DKMA 5LJ3e 2MAMA 1VQKQ 2ZCFB 4CI0C 1X69A 5GAOp 4J9DA 2CSIA 4FL6A 1WHMA 4HVWA 2D6FA 1T3SA 4JRKA 5GAMf 1BBZA 4X9DA 1SG5A 2RN8A 2GBQA 8AT1B 1VQNT 3M0PA 2LJ1A 3OBWA 3CCMA 1WHKA 1OQKA 3I56Q 3PNWC 1KQSP 3CC4T 4C8QD 1G2BA 2JS2A 3OYDA 4A54A 3I35A 2LT1A 4XK8E 3F70A 3HFNA 1FMWA 4M7DG 1F1BB 5C0MA 4M7AG 1WHLA 3WVEB 1YP5A 2KT1A 4LDXA 1KG1A 2G6FX 2LMJA 1UECA 4JS4A 4F14A 2MF2A 4F17A 2XG8D 2NLUA 3LW5E 4P5NA 4WTOB 3OY9A 2A3LA 5FRMA 4BDZA 2CP0A 3CC7T 2VXEA 3M9QA 1AZEA 2JJ9A 1CSKA 2E12A 1WGSA 4WCIA 2LQKA 4EIKA 1O9SA 2DK3A 3U23A 3PT9A 2CH4W 1QKXA 3N5BB 2DXUA 1UTIA 1ACMB 2PVOB 4XU1A 4FT2A 2HEQA 2VWFA 3A1PA 1OPKA 3BY7A 3CC7A 3FJPA 3L2QA 3EHRA 2LQ8A 3R6OA 5CKDA 2K2MA 1JJ2S 2KY9A 4M77D 1VQ7A 4C8QE 4M7DB 2JM9A 1WQ7A 1FMKA 1DJ7B 3A8HB 2GFUA 3GF5A 3CMEQ 3PGGA 1BI3A 4HT9A 3L2ZA 3EG1A 1LPLA 2A28A 1R77A 2MOXA 4KGZB 4Z02A 2FHDA 2DPPB 5GAN4 1VQ4T 1FXXA 1MNDA 3CCUA 1WNLA 3UA7A 4BY6B 3CCVQ 2KMTA 3OSVA 2VASA 1Q7YR 1WHGA 4QT7A 4XTXA 2AT1B 2ZZDA 2LNHB 1VQOA 2V8JA 3VRYA 4RCBA 2QQRA 4KGXB 5CCAA 1BIBA 3QWYA 4E7ZA 4J8OA 2HSPA 1QWFA 1YJ9Q 4F16A 4XQ3A 5D7UA 2YRVA 5GAN7 4BI3A 3O5ZA 2W10A 3FDRA 4EMGA 1N9SA 4IUQA 3A5ZB 3C4SA 3ZBDA 1U06A 4PJLA 2KSSA 2CUDA 1YFNA 1NG2A 2RH2A 2AZSA 1M90R 1N8RC 2FPEA 2QAZA 1MHNA 1SPKA 2EQJA 2Y4XA 4Y91A 1U1SA 3L2WA 2KROA 5A0LA 4JLIA 4FSSA 2DE0X 4M7DD 3EG9B 5GANj 3X25B 3OS2A 3R6NA 4QVZA 1ZX6A 2C0TA 4MZMA 1LJOA 2M9UA 4GLMA 1PNJA 3FIFA 4FYYB 1PKTA 3OYNA 4J9GA 2RJFA 3P8HA 4FW2A 3I55A 2P0PA 3CMAQ 2DAQA 3CD6T 2X35A 3LGFA 5J39A 2LRQA 3PMIA 5ECAA 1RAGB 1SF9A 1VQLQ 1J3TA 3FEOA 1U3OA 2B8AA 3LGLA 2COWA 4XTVA 3OS5A 4O6JA 2KRMA 1BB9A 3EH2A 3HRUA 2EFIA 3CCRA 3UATA 3E9GA 1PRLC 2KVQG 2GCXA 4FYWB 2KRNA 2ROTA 4IUUA 2VC8A 4C8QF 1X27A 1G3TA 4ZN3A 4HCBA 3SB2A 2E64A 4JPBW 4OMNA 2XHCA 4C8QB 3OYLA 4HCZA 5IXBA 5GAOq 2OTJQ 1UJYA 1JRIA 2G3RA 2DTIA 2I0NA 4IUVA 3X20B 4KT0E 3E9FA 2SRCA 3JSCA 1Z9QA 2KXDA 2LX7A 1WYXA 3VS0A 3E2UA 3RERA 2J6KA 4M77G 1WXBA 4C5GA 3EGXB 2J6OA 4M77A 4C0DC 3NGPA 3M4GA 1M1GA 3J7AF 3JCMX 1B07A 2XD0A 5A2QE 2YUNA 1WHHA 4C5HA 4AG1C 4F7UE 1I1JA 2A0FB 2RHXA 4GLKA 1K73U 2YUOA
chains in the Genus database with same CATH topology
1ZSGA 2LJ0A 1VA7A 2DM1A 2EPDA 3ZL7C 2J6FA 3VS6A 2E5KA 2PZ1A 1MUZA 1SHGA 1SEMA 3CQTA 3VS3A 1K76A 2BTTA 1WX6A 1G83A 2L2PA 4AFSC 1JO8A 1RUWA 1YCSB 5FWBA 4CC3A 2FPDA 1GBQA 2LZ6B 2EBPA 1OOTA 3EG2A 2MIOA 1S1NA 2PNIA 4R0KA 2F2XA 1UHFA 4X1VA 1SHFA 1WXUA 2BZYA 4JZ4A 2EYWA 1CKAA 4DEXA 2D1XA 2LJ3A 2FEIA 2KXCA 1TUCA 1AWXA 2HBWA 2CUBA 2FO0A 2LP5A 4A63B 2KT8A 4RUGA 1VYVA 1AEYA 1M3AA 2DRKA 4J9EA 1UE9A 1PHTA 1IO6A 1GFDA 2ED1A 4OMQA 2DMOA 4J9FA 1U5SA 1A0NB 1X2KA 1W70A 2RF0A 1BU1A 1UHCA 1B3QA 3M0QA 3UA6A 1SRLA 4RTTA 4M4ZA 2KE9A 1AWJA 1AD5A 5IH2A 2M51A 3H0HA 4KRTA 1FYNA 4CC7A 2M0YA 2DRMA 2HDAA 1AWWA 2GQIA 2K3BA 2V1RA 1AOJA 5FWCA 2K6DA 2L3SA 3FJ5A 1TG0A 2DL3A 1T3LA 1QWEA 1ZBJA 2X3XD 1WA7A 4JZ3A 2KEAA 2FRWA 1QKWA 4J9IA 3PVQA 5HCKA 1GL5A 1E6GA 2RNAA 2OAWA 1ZUKA 1OEBA 1XOVA 1UG1A 2JMAA 4ZNXA 4HXJA 1JQQA 1YNZA 2JTEA 3PE0A 2BZXA 2LCSA 5I22A 3A98A 3VRZA 2X3WD 3JV3A 3RBBB 2JMCA 4OMLA 4OMOA 4Z89A 1M30A 2H8HA 1GRIA 1VYTA 1UFFA 2CSQA 2D0NA 2LQWA 1H92A 2OI3A 1AVZC 4Z88A 4GBQA 2DVJA 2ABLA 3GBQA 2YDLA 2O88A 2GGRA 2EW3A 1K0XA 1WIEA 1MV3A 1K0SA 2DF6A 2O31A 2FRYA 2JW4A 3VS7A 2RQRA 1HD3A 2EYZA 2L0AA 4HVUA 2KYMA 4AFUC 2C0IA 3PVLA 3REBB 1T0JA 2AK5A 2J06A 2JS0A 3LH5A 1YWPA 3I9QA 2IIMA 2YUPA 5IXFA 3TSWA 4LN2A 1NEBA 4CC2A 4LUDA 1X69A 4JJDA 2HCKA 4J9DA 2CSIA 3EG0A 4HVWA 1GFCA 1T3SA 1NLPC 4RTUA 1BBZA 2EGCA 2RN8A 2EGEA 2GBQA 1I0CA 5EC7A 2KNBB 4ORZA 2J05A 3M0PA 3I5RA 2MCNA 2LJ1A 1KIKA 1NYGA 2YSQA 2DL5A 3M0TA 1Y0MA 2EVRA 4DEYA 1JU5C 2VKNA 1WLPB 4OMPA 4RTXA 1G2BA 2JS2A 2JXBA 3I35A 2DJQA 2YT6A 1NYFA 2V1QA 2CT3A 1VYUA 2KT1A 1YP5A 2KYBA 1ARKA 2G6FX 2J7IA 2LMJA 1UECA 4RTVA 2K79A 2JT4A 1YWOA 1M27C 4F14A 2KBTA 4F17A 4J9HA 1N5ZA 2A36A 2ENMA 1K4US 1WDXA 2D8JA 2CREA 2DBKA 4OMMA 2K7AA 1AZEA 1CSKA 4HVVA 4WCIA 4EIKA 3U23A 1H3HA 2CH4W 1QKXA 4AFZC 4E6RA 1UTIA 3SHWA 1JEGA 2DL4A 5L23A 1E7OA 1KSWA 2L3PA 2HEQA 4IIMA 2VWFA 2FPFA 4LE9A 4D8DA 1ABQA 1OPKA 1E6HA 2DBMA 2PTKA 1KFZA 3REAB 1AZGB 2D8HA 3EHRA 5GJWB 1WI7A 2K2MA 3QWXX 1RLQC 4IIOA 2JM9A 1FMKA 3H0IA 3H0FA 2P4RA 2EYXA 2W0ZA 3EG1A 2F2VA 2A28A 2SEMA 2MOXA 1Y57A 3NPFA 2RQVA 1SSHA 1X43A 3EG3A 1JXMA 3UA7A 3M0UA 4QT7A 2NWMA 1X2QA 2DILA 4JJBA 2LNHB 2L3QA 4J9CA 1WFWA 2OJ2A 3VRYA 2EGAA 1LCKA 3QWYA 1GCQC 4CC4B 4AG2C 4LUEA 2K9GA 4Z8AA 2ROLA 3H41A 2HSPA 1QWFA 2DL7A 4F16A 1GCQA 1OV3A 2GTJA 2W10A 3O5ZA 1HJDA 2CH4A 1ZLMA 1U06A 1QCFA 1K9AA 1M3BA 1PKSA 2CUDA 2RQUA 1NG2A 1T0HA 2LQNA 2AZSA 1WXTA 2A37A 2KR3A 2ED0A 2FPEA 5GJVB 1BK2A 2FG0A 1SPKA 3NMZC 3UF4A 3EHQA 2KROA 1YN8A 1TUDA 2RPNA 4FSSA 2BZ8A 2DE0X 1UJ0A 2GNCA 3R6NA 3C0CA 1ZX6A 2CT4A 2C0OA 3TSZA 2XMFA 4RTZA 1Z9ZA 2C0TA 3TVTA 4GLMA 5IHNA 1PNJA 1PKTA 2AKKA 1K1ZA 4J9GA 2ECZA 1JXOA 1OPLA 4Y92A 1X6BA 2O9VA 1PRMC 1MV0B 3VS5A 4K11A 3VS2A 2DLPA 2NUZA 5I11A 1ZUYA 4RTWA 2DL8A 2YUQA 5ECAA 2EQIA 1NM7A 1J3TA 2RQWA 1NEGA 1U3OA 3ULRB 2CDTA 1KJWA 3VS4A 2AKLA 1M3CA 2KRMA 1BB9A 1RI9A 4LNPA 2RMOA 3UATA 1PRLC 1ZUUA 2KRNA 2ROTA 4RTYA 1X27A 2KRSA 2O9SA 2A08A 1QLYA 4JPBW 4OMNA 4AFQC 1GBRA 2ESWA 5IHIA 5IXBA 3M0RA 1H8KA 2EYYA 3SEMA 2KGTA 5IHKA 1UJYA 3M0SA 2I0NA 2VVKA 1PWTA 1M8MA 1CKBA 1NLOC 1V1CA 2SRCA 1W6XA 1Z9QA 1HSQA 2KXDA 2LX7A 2B86A 5FW9A 4HCKA 2RQTA 1WYXA 4D8KA 1AWOA 4ESRA 2DNUA 1W1FA 1ABOA 2DX1A 3VS0A 3IQLA 2DYBA 2EKHA 1SRMA 2QDLA 2J6KA 2GTOA 1WXBA 3VS1A 1UDLA 1X6GA 2F2WA 2J6OA 4JJCA 3EGUA 3RNJA 3NGPA 1UUEA 3NHNA 1UGVA 1RLPC 3THKA 1B07A 2JM8A 2YUNA 4J9BA 4AG1C 2DA9A 1GCPA 1EFNA 1I1JA 1I07A 3I5SA 3KFVA 2O2OA 2AZVA 2YUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZSG A;  2LJ0 A;  1VA7 A;  2DM1 A;  2EPD A;  3ZL7 C;  2J6F A;  3VS6 A;  2E5K A;  2PZ1 A;  1MUZ A;  1SHG A;  1SEM A;  3CQT A;  3VS3 A;  1K76 A;  2BTT A;  1WX6 A;  1G83 A;  2L2P A;  4AFS C;  1JO8 A;  1RUW A;  1YCS B;  5FWB A;  4CC3 A;  2FPD A;  1GBQ A;  2LZ6 B;  2EBP A;  1OOT A;  3EG2 A;  2MIO A;  1S1N A;  2PNI A;  4R0K A;  2F2X A;  1UHF A;  4X1V A;  1SHF A;  1WXU A;  2BZY A;  4JZ4 A;  2EYW A;  1CKA A;  4DEX A;  2D1X A;  2LJ3 A;  2FEI A;  2KXC A;  1TUC A;  1AWX A;  2HBW A;  2CUB A;  2FO0 A;  2LP5 A;  4A63 B;  2KT8 A;  4RUG A;  1VYV A;  1AEY A;  1M3A A;  2DRK A;  4J9E A;  1UE9 A;  1PHT A;  1IO6 A;  1GFD A;  2ED1 A;  4OMQ A;  2DMO A;  4J9F A;  1U5S A;  1A0N B;  1X2K A;  1W70 A;  2RF0 A;  1BU1 A;  1UHC A;  1B3Q A;  3M0Q A;  3UA6 A;  1SRL A;  4RTT A;  4M4Z A;  2KE9 A;  1AWJ A;  1AD5 A;  5IH2 A;  2M51 A;  3H0H A;  4KRT A;  1FYN A;  4CC7 A;  2M0Y A;  2DRM A;  2HDA A;  1AWW A;  2GQI A;  2K3B A;  2V1R A;  1AOJ A;  5FWC A;  2K6D A;  2L3S A;  3FJ5 A;  1TG0 A;  2DL3 A;  1T3L A;  1QWE A;  1ZBJ A;  2X3X D;  1WA7 A;  4JZ3 A;  2KEA A;  2FRW A;  1QKW A;  4J9I A;  3PVQ A;  5HCK A;  1GL5 A;  1E6G A;  2RNA A;  2OAW A;  1ZUK A;  1OEB A;  1XOV A;  1UG1 A;  2JMA A;  4ZNX A;  4HXJ A;  1JQQ A;  1YNZ A;  2JTE A;  3PE0 A;  2BZX A;  2LCS A;  5I22 A;  3A98 A;  3VRZ A;  2X3W D;  3JV3 A;  3RBB B;  2JMC A;  4OML A;  4OMO A;  4Z89 A;  1M30 A;  2H8H A;  1GRI A;  1VYT A;  1UFF A;  2CSQ A;  2D0N A;  2LQW A;  1H92 A;  2OI3 A;  1AVZ C;  4Z88 A;  4GBQ A;  2DVJ A;  2ABL A;  3GBQ A;  2YDL A;  2O88 A;  2GGR A;  2EW3 A;  1K0X A;  1WIE A;  1MV3 A;  1K0S A;  2DF6 A;  2O31 A;  2FRY A;  2JW4 A;  3VS7 A;  2RQR A;  1HD3 A;  2EYZ A;  2L0A A;  4HVU A;  2KYM A;  4AFU C;  2C0I A;  3PVL A;  3REB B;  1T0J A;  2AK5 A;  2J06 A;  2JS0 A;  3LH5 A;  1YWP A;  3I9Q A;  2IIM A;  2YUP A;  5IXF A;  3TSW A;  4LN2 A;  1NEB A;  4CC2 A;  4LUD A;  1X69 A;  4JJD A;  2HCK A;  4J9D A;  2CSI A;  3EG0 A;  4HVW A;  1GFC A;  1T3S A;  1NLP C;  4RTU A;  1BBZ A;  2EGC A;  2RN8 A;  2EGE A;  2GBQ A;  1I0C A;  5EC7 A;  2KNB B;  4ORZ A;  2J05 A;  3M0P A;  3I5R A;  2MCN A;  2LJ1 A;  1KIK A;  1NYG A;  2YSQ A;  2DL5 A;  3M0T A;  1Y0M A;  2EVR A;  4DEY A;  1JU5 C;  2VKN A;  1WLP B;  4OMP A;  4RTX A;  1G2B A;  2JS2 A;  2JXB A;  3I35 A;  2DJQ A;  2YT6 A;  1NYF A;  2V1Q A;  2CT3 A;  1VYU A;  2KT1 A;  1YP5 A;  2KYB A;  1ARK A;  2G6F X;  2J7I A;  2LMJ A;  1UEC A;  4RTV A;  2K79 A;  2JT4 A;  1YWO A;  1M27 C;  4F14 A;  2KBT A;  4F17 A;  4J9H A;  1N5Z A;  2A36 A;  2ENM A;  1K4U S;  1WDX A;  2D8J A;  2CRE A;  2DBK A;  4OMM A;  2K7A A;  1AZE A;  1CSK A;  4HVV A;  4WCI A;  4EIK A;  3U23 A;  1H3H A;  2CH4 W;  1QKX A;  4AFZ C;  4E6R A;  1UTI A;  3SHW A;  1JEG A;  2DL4 A;  5L23 A;  1E7O A;  1KSW A;  2L3P A;  2HEQ A;  4IIM A;  2VWF A;  2FPF A;  4LE9 A;  4D8D A;  1ABQ A;  1OPK A;  1E6H A;  2DBM A;  2PTK A;  1KFZ A;  3REA B;  1AZG B;  2D8H A;  3EHR A;  5GJW B;  1WI7 A;  2K2M A;  3QWX X;  1RLQ C;  4IIO A;  2JM9 A;  1FMK A;  3H0I A;  3H0F A;  2P4R A;  2EYX A;  2W0Z A;  3EG1 A;  2F2V A;  2A28 A;  2SEM A;  2MOX A;  1Y57 A;  3NPF A;  2RQV A;  1SSH A;  1X43 A;  3EG3 A;  1JXM A;  3UA7 A;  3M0U A;  4QT7 A;  2NWM A;  1X2Q A;  2DIL A;  4JJB A;  2LNH B;  2L3Q A;  4J9C A;  1WFW A;  2OJ2 A;  3VRY A;  2EGA A;  1LCK A;  3QWY A;  1GCQ C;  4CC4 B;  4AG2 C;  4LUE A;  2K9G A;  4Z8A A;  2ROL A;  3H41 A;  2HSP A;  1QWF A;  2DL7 A;  4F16 A;  1GCQ A;  1OV3 A;  2GTJ A;  2W10 A;  3O5Z A;  1HJD A;  2CH4 A;  1ZLM A;  1U06 A;  1QCF A;  1K9A A;  1M3B A;  1PKS A;  2CUD A;  2RQU A;  1NG2 A;  1T0H A;  2LQN A;  2AZS A;  1WXT A;  2A37 A;  2KR3 A;  2ED0 A;  2FPE A;  5GJV B;  1BK2 A;  2FG0 A;  1SPK A;  3NMZ C;  3UF4 A;  3EHQ A;  2KRO A;  1YN8 A;  1TUD A;  2RPN A;  4FSS A;  2BZ8 A;  2DE0 X;  1UJ0 A;  2GNC A;  3R6N A;  3C0C A;  1ZX6 A;  2CT4 A;  2C0O A;  3TSZ A;  2XMF A;  4RTZ A;  1Z9Z A;  2C0T A;  3TVT A;  4GLM A;  5IHN A;  1PNJ A;  1PKT A;  2AKK A;  1K1Z A;  4J9G A;  2ECZ A;  1JXO A;  1OPL A;  4Y92 A;  1X6B A;  2O9V A;  1PRM C;  1MV0 B;  3VS5 A;  4K11 A;  3VS2 A;  2DLP A;  2NUZ A;  5I11 A;  1ZUY A;  4RTW A;  2DL8 A;  2YUQ A;  5ECA A;  2EQI A;  1NM7 A;  1J3T A;  2RQW A;  1NEG A;  1U3O A;  3ULR B;  2CDT A;  1KJW A;  3VS4 A;  2AKL A;  1M3C A;  2KRM A;  1BB9 A;  1RI9 A;  4LNP A;  2RMO A;  3UAT A;  1PRL C;  1ZUU A;  2KRN A;  2ROT A;  4RTY A;  1X27 A;  2KRS A;  2O9S A;  2A08 A;  1QLY A;  4JPB W;  4OMN A;  4AFQ C;  1GBR A;  2ESW A;  5IHI A;  5IXB A;  3M0R A;  1H8K A;  2EYY A;  3SEM A;  2KGT A;  5IHK A;  1UJY A;  3M0S A;  2I0N A;  2VVK A;  1PWT A;  1M8M A;  1CKB A;  1NLO C;  1V1C A;  2SRC A;  1W6X A;  1Z9Q A;  1HSQ A;  2KXD A;  2LX7 A;  2B86 A;  5FW9 A;  4HCK A;  2RQT A;  1WYX A;  4D8K A;  1AWO A;  4ESR A;  2DNU A;  1W1F A;  1ABO A;  2DX1 A;  3VS0 A;  3IQL A;  2DYB A;  2EKH A;  1SRM A;  2QDL A;  2J6K A;  2GTO A;  1WXB A;  3VS1 A;  1UDL A;  1X6G A;  2F2W A;  2J6O A;  4JJC A;  3EGU A;  3RNJ A;  3NGP A;  1UUE A;  3NHN A;  1UGV A;  1RLP C;  3THK A;  1B07 A;  2JM8 A;  2YUN A;  4J9B A;  4AG1 C;  2DA9 A;  1GCP A;  1EFN A;  1I1J A;  1I07 A;  3I5S A;  3KFV A;  2O2O A;  2AZV A;  2YUO A; 
#chains in the Genus database with same CATH topology
 1VIE A;  3RMS A;  2DM1 A;  2EPD A;  4FT4 A;  3ZL7 C;  4OB3 B;  4QVD A;  2DER A;  4EMK C;  2QEX T;  1QVG P;  2L2P A;  4MDW A;  3S3O A;  3UDC A;  3OYB A;  5FWB A;  4CC3 A;  4OB1 B;  5D6W A;  3EG2 A;  1IHW A;  4M77 C;  5C6S A;  4FSX A;  2XDB A;  3MJX A;  2QDY B;  3JCM P;  1B7T A;  2DJZ A;  2X4Y A;  2FZK B;  2WSC E;  1JJ2 A;  2DXC A;  1CKA A;  2MWO A;  2PUK B;  3M5A A;  2LJ3 A;  5GAN 2;  1YHQ Q;  1Q86 U;  2WSF E;  4XTW A;  3SWN A;  1G3S A;  3OMG A;  2RJC A;  4A63 B;  1NJI C;  2K5F A;  3CC2 Q;  5A0G A;  4CRI A;  4ZGJ B;  2DRK A;  3UPU A;  1IO6 A;  3DLM A;  5GAN d;  3SD4 A;  1PM3 A;  4OMQ A;  1X2K A;  3QDR B;  5D6Y A;  2RF0 A;  3I56 A;  3OYM A;  2OX7 A;  4L6V 5;  1UHC A;  2LCC A;  3MEU A;  1QP3 A;  2M1H A;  1VQ8 A;  4MZP A;  3UA6 A;  2KE9 A;  1YJW Q;  1AWW A;  3QG1 A;  2DEU A;  1LVK A;  2DKG A;  2V1R A;  3QPH A;  4FYV B;  1T3L A;  1I5L A;  2KEA A;  4XU2 A;  4M75 A;  4FIB A;  1KQS A;  5GAO m;  1M5Q 1;  3CBM A;  3MCA B;  4PJO D;  3URG A;  1OEB A;  5J3B A;  2JMA A;  4HXJ A;  1KD1 U;  2E65 A;  1YJN Q;  1PD0 A;  4PJO G;  4ANJ A;  1BYM A;  3PE0 A;  2BZX A;  4C0F A;  2VB6 A;  5KH6 A;  2X3W D;  1M1F A;  1D3B A;  2JMC A;  4OML A;  1NJI U;  1RAA B;  1M30 A;  1UGQ B;  1G5V A;  3M53 A;  4ELY C;  1H92 A;  5KYY A;  3RUX A;  3OW2 S;  2ABL A;  3OS0 A;  2O88 A;  2GGR A;  2EW3 A;  2RM4 A;  2F1L A;  4RMO A;  2A7Y A;  3VKI A;  4C92 F;  3S3N A;  3VS7 A;  1HD3 A;  5CVI A;  3I55 T;  3A8L B;  3NTK A;  3KXT A;  1VIF A;  3LLR A;  2K2V A;  2C0I A;  3L2U A;  3P8D A;  1VQ9 T;  3M58 A;  3M56 A;  4YTL A;  2RI3 A;  4IKF A;  3HFO A;  4B9W A;  5IXF A;  4KH0 B;  2QQB A;  1RAI B;  3VU3 C;  3CCM Q;  4PJO A;  2ZPB B;  4LUD A;  2NYS A;  4M78 D;  2HCK A;  5FU6 B;  1PC0 A;  4M75 B;  3EG0 A;  4M7D E;  3V8J A;  1NLP C;  1YBY A;  4J6X A;  1K73 C;  2EGE A;  3OS1 A;  5GMK h;  1RAB B;  4M78 G;  2ZPF B;  4ORZ A;  5HKC A;  3JCM b;  1W4S A;  2MCN A;  1NYG A;  2YSQ A;  3L42 A;  3M0T A;  3CCS Q;  4DEY A;  1Q82 U;  2CZ7 B;  1WLP B;  4NL3 A;  4OMP A;  4BE2 A;  1Q82 R;  1TSF A;  1I8F A;  2DJQ A;  5AYF A;  2YT6 A;  1WZO A;  2VGN A;  2CT3 A;  2XI9 A;  5LJ3 g;  3BE3 A;  2P84 A;  5KCO A;  3MET A;  5KYY B;  1YWO A;  5HK0 A;  3PIP A;  3CD6 A;  1M27 C;  5I2S A;  4J9H A;  1V76 A;  4OVA A;  3SFM A;  4M7D C;  2O01 E;  4FW1 A;  2QA4 A;  2RHY A;  1ZHI A;  3V7R A;  3BDL A;  2D0Q B;  2CRE A;  4OMM A;  2IPO B;  3HP9 A;  3OYE A;  3MP8 A;  1H3H A;  1BCM A;  4AFZ C;  4E6R A;  2LVM A;  4E7K A;  3CD6 Q;  5L23 A;  1E7O A;  3AHU A;  1JB0 E;  2L3P A;  4IIM A;  1SSF A;  3PIO A;  4D8D A;  1RL2 A;  4E7I A;  1KFZ A;  1AZG B;  2P4T A;  1VQP A;  3HHT B;  5GAM h;  1YCY A;  4Q5W A;  4O5V A;  2HL5 C;  2L5Q A;  4OP0 A;  1IHV A;  2CKK A;  4AT1 B;  2E6N A;  2SEM A;  2OTL Q;  1WJQ A;  3GOX A;  4DBF A;  2EQK A;  5KYU A;  5GAN 3;  2Z0W A;  1KD1 C;  3QUI A;  2LT4 A;  3CXC P;  2RK1 A;  1MMN A;  2PVG B;  4M78 E;  4M7A A;  1D1A A;  4ZGD B;  2I2L A;  1X2Q A;  2DIL A;  2RI2 A;  2MPX C;  4J9C A;  3HSB A;  5GAO r;  1Q95 G;  2EGA A;  1LCK A;  1GCQ C;  4C8Q A;  4AG2 C;  4LUE A;  1D1B A;  1HXD A;  2EQU A;  1N8R U;  1OV3 A;  2CH4 A;  5L8R E;  3CCM T;  1OZ3 A;  2MMP A;  1UGS B;  3GNG A;  1T0H A;  1ZBX A;  4J7F A;  1VQ4 Q;  2LQN A;  2XDP A;  1WXT A;  2A37 A;  3MEV A;  3QSU A;  1O75 A;  3OB9 A;  2FG0 A;  4KH1 B;  3EHQ A;  4BI8 B;  1YN8 A;  4MZT A;  3CBP A;  3I55 Q;  4EDU A;  2BZ8 A;  3A8M B;  1UJ0 A;  2M02 A;  1EX4 A;  4QKU A;  4JLG A;  2HQH A;  4NS5 A;  2HKQ B;  2CT4 A;  4HCC A;  2XMF A;  2CZ1 B;  1OX9 A;  5LJ5 g;  2RI5 A;  3SDZ A;  4QVC A;  2QXF A;  5GAM g;  3V8L A;  4LD6 A;  2AKK A;  5LJ5 e;  2L3R A;  2MI6 A;  1OPL A;  1PG5 B;  2O9V A;  4PL6 A;  4A4K A;  4F7U G;  3VS2 A;  2DLP A;  4RG2 A;  3G4S A;  2DL8 A;  4M78 F;  2EQI A;  2DET A;  1QVF P;  5KYU B;  1NEG A;  1XTD A;  2RD1 A;  5GMK i;  2CDT A;  2QQ9 A;  1OUL A;  2AKL A;  3CCU Q;  3G4S T;  2HNI A;  4LNP A;  4GY5 A;  3BDU A;  5CAI A;  1VQM Q;  3JCM V;  2YRC A;  2A08 A;  3FRN A;  1QLY A;  1GBR A;  2BE7 D;  1NE8 A;  2R5M A;  4OGC A;  4KGV B;  4ZGE B;  2EYY A;  5GMK e;  3EFS A;  4XU0 A;  2KGT A;  2JN0 A;  2EQM A;  3MHX A;  5DLO A;  1PWT A;  1M4Z A;  1M8M A;  1NLO C;  4D8K A;  4ESR A;  2K4Y A;  2DX1 A;  2EKH A;  1X6G A;  2DEQ A;  2HD0 A;  3L1A A;  3EGU A;  1IRE B;  4C92 E;  1UUE A;  2X9H A;  2RHU A;  5GMK m;  3H8Z A;  2YHT A;  1GXI E;  4E7L A;  3ER0 A;  1GCP A;  1EFN A;  2BE9 B;  3CC2 T;  2ATC B;  3I5S A;  3CPF A;  3KFV A;  2PVD B;  1VOM A;  2LJ0 A;  2R5A A;  3CCS A;  3RKW A;  2XK0 A;  4JUV A;  4XAX B;  2CP2 A;  1Y96 B;  3VS6 A;  2JUF A;  1MUZ A;  1VQ7 T;  1SEM A;  3ASK A;  3OYH A;  3CCQ Q;  1VQP T;  2NUT A;  1QVF S;  4N4I A;  1JO8 A;  1RUW A;  2E6Z A;  5LJ5 h;  3CC4 A;  2YRD A;  2DZC A;  3OYC A;  3CCU T;  2DXT A;  4WF2 A;  2RK2 A;  2QEX Q;  2F2X A;  1UHF A;  2OTL A;  1SHF A;  2PQW A;  2YLB A;  2NUP B;  1WXU A;  2ZAE A;  5LJ5 d;  4JZ4 A;  2K57 A;  1RAH B;  1NJI R;  4DEX A;  3JB9 D;  1C6V X;  2FEI A;  5GAN f;  1RI0 A;  2CGH A;  1UB4 A;  4C92 C;  2FO0 A;  2RO0 A;  1R8O B;  1TUG B;  2LP5 A;  4J83 A;  2QYZ A;  1VYV A;  1YI2 Q;  1UE9 A;  1VQL T;  1PHT A;  2ED1 A;  3EGX A;  4TVR A;  2K3X A;  1U5S A;  3JCM g;  1TXQ A;  3X24 B;  2LTO A;  3TU4 K;  2JTF A;  1KK7 A;  1WHJ A;  1YIT T;  3NFC A;  4J6Y A;  4RTT A;  1AWJ A;  1AD5 A;  4JJN K;  1R0C B;  3CBO A;  1Q82 C;  2DRM A;  2QGF B;  1YJW A;  3OYI A;  1Y96 A;  3V7C A;  5FWC A;  1YJN A;  2L3S A;  3FJ5 A;  1TG0 A;  1U1T A;  4JZ3 A;  2FRW A;  4C92 B;  1VQ6 Q;  2QK0 A;  3Q1J A;  1K8A R;  1GL5 A;  1M8V A;  2EKO A;  1ZUK A;  1XOV A;  4PFP A;  1IXD A;  1JQQ A;  1YNZ A;  2K5I A;  2QQS A;  3V7S A;  1YJ9 T;  2RJD A;  2OTL T;  1H64 1;  2LCS A;  1JBM A;  4XTU A;  3S6W A;  4BE1 A;  3VRZ A;  2WAC A;  3RBB B;  5KYX A;  4FM4 B;  4Z89 A;  2FZC B;  3LH0 A;  2RHI A;  1BI2 A;  1GRI A;  9ATC B;  3CMA A;  3VV0 A;  2BUD A;  3CCE A;  4J7I A;  1MMD A;  2QAS A;  2HAX A;  1KQ2 A;  3CC2 A;  3ME9 A;  2YDL A;  5KE3 A;  2JOY A;  2HSE B;  1K0X A;  1N8R R;  2O31 A;  2O4X A;  4KUL A;  2JW4 A;  4MDX A;  3QYG B;  5GAO l;  4OGE A;  1I4K 1;  4AFU C;  2K5L A;  3PVL A;  3REB B;  5GAM e;  3GPL A;  3LH5 A;  1Q81 C;  1YWP A;  1I5O B;  2YUP A;  2KK4 A;  1W2B P;  3TSW A;  5KCH A;  3CXC A;  1WJS A;  1QCN A;  4C92 A;  4QQD A;  1GFC A;  5CK9 A;  4RTU A;  1I0C A;  1M9S A;  2KNB B;  3I5R A;  4XTY A;  3MPU B;  1IGQ A;  2C06 A;  1Y0M A;  3EFO A;  3CPW P;  4BI4 A;  1K9M R;  1JU5 C;  2E10 A;  2VKN A;  1KD1 R;  2DO3 A;  5FU7 C;  2JXB A;  1VQ6 A;  1VQ9 A;  1XNI A;  4PJO C;  4HA8 A;  5KYX B;  3DB4 A;  1ARK A;  2J7I A;  1N6A A;  3INZ A;  4RTV A;  1YIJ A;  3HTR A;  1X6O A;  2E3H A;  1AHJ B;  4LXC A;  2KBT A;  3EH1 A;  1KC8 U;  3JAM E;  1VQN Q;  4ATO A;  1VQ9 Q;  1PD1 A;  4ZN1 A;  3G6E T;  4LDY A;  2E70 A;  2KQW A;  1N9R A;  1WDX A;  3CCL A;  1LOJ A;  2D8J A;  2K7A A;  2OTJ A;  3OYK A;  3JCM c;  2MYS A;  1Q86 C;  2R58 A;  4UC4 A;  3TQ7 P;  3OW2 A;  2DD5 A;  3SHW A;  2DL4 A;  1EIF A;  2E3I A;  3FC3 A;  1VQL A;  3J81 E;  4HKE A;  4JRQ A;  4LDW A;  2FPF A;  4OMF B;  1ABQ A;  1PSE A;  1M2V A;  2MWP A;  2PUO B;  1E6H A;  3X28 B;  2PTK A;  2RA2 A;  2D8H A;  2EYQ A;  1WI7 A;  4PJO B;  1QMC A;  1K8A U;  3QWX X;  3JB9 F;  1C0M A;  3JCM W;  1VQ5 T;  1TTH B;  3H0F A;  2P4R A;  2EYX A;  2W0Z A;  3CCR Q;  1OI1 A;  2F2V A;  3TEE A;  2QEX A;  2XIC A;  3G6E A;  2JTM A;  3NPF A;  4FCY A;  1Q7Y U;  5GAN 6;  4RCC A;  3CCJ T;  3CCQ T;  3EG3 A;  4E2F B;  1YJN T;  2DD4 A;  1JXM A;  1TS9 A;  3O8V A;  3EFO B;  4M78 C;  3QYH B;  3I56 T;  3M0U A;  2VUB A;  5AT1 B;  4M7A C;  2L3Q A;  1OU8 A;  2R57 A;  3GP8 A;  4DA4 A;  1X01 A;  4CC4 B;  2DIQ A;  3HRS A;  4Z8A A;  2K9G A;  1MNE A;  5GAM d;  1ZSZ A;  1VQK T;  2GTJ A;  3QJ6 A;  1HJD A;  1VQ5 A;  2HQE A;  1G3Y A;  1BI0 A;  1QCF A;  3QHS A;  2GQV A;  1K9A A;  3A8O B;  4BAC A;  2RQU A;  4C0Z A;  4BD3 A;  4M78 A;  2KR3 A;  2ED0 A;  2VGM A;  5GJV B;  1BK2 A;  1TUD A;  4C5I A;  1D0Z A;  2RPN A;  4ZTJ A;  5CKB A;  1M1K U;  4QQ6 A;  2JVV A;  2GFA A;  3TSZ A;  4RTZ A;  1JJ2 P;  1Z9Z A;  3VYG A;  3RKX A;  5IHN A;  3RDV A;  3QII A;  1MMG A;  2E4H A;  4N0A A;  3D7S B;  1TH7 A;  1Y7X A;  2HL3 A;  2ZPI B;  5CKE A;  1R0B G;  1PRM C;  3KUF A;  4M7D A;  4F7U B;  3G4S Q;  1YIJ Q;  5GAM j;  5I11 A;  2NUZ A;  2HMA A;  5CQX A;  1IRX A;  4M77 F;  3NTI A;  4OB2 B;  3CCJ A;  1G3W A;  1NM7 A;  3OYG A;  3M4Y A;  2RQW A;  1UGR B;  2CP3 A;  2YXY A;  3P8B B;  2RJE A;  1KJW A;  4OB0 B;  1S72 T;  1RI9 A;  1BI1 A;  5FRO A;  7AT1 B;  5GAN 8;  2O9S A;  3QKJ A;  3NTH A;  1BCO A;  2ESW A;  4V2S A;  1B34 B;  2CZ0 B;  1M90 U;  3M0R A;  1H8K A;  5LJ3 f;  4M75 D;  4BB7 A;  4MMK A;  1CKB A;  1V1C A;  1W6X A;  4E7S A;  2IVW A;  4HCK A;  1AWO A;  1W1F A;  1ABO A;  2CS7 A;  3IQL A;  4F7U F;  2DYB A;  1SRM A;  2GTO A;  3VS1 A;  2F2W A;  4JJC A;  4EMK B;  3HL8 A;  3OQ5 A;  3OBY A;  2JZ2 A;  2H3E B;  1UGV A;  4M77 E;  2JNG A;  1HK9 A;  2JM8 A;  4A4E A;  5DM7 R;  4J9B A;  4M7D F;  2M16 A;  2DA9 A;  1I07 A;  2ZPE B;  4DBR A;  1VA7 A;  3OYJ A;  3EFR A;  3M57 A;  1MMA A;  6AT1 B;  2J6F A;  2PZ1 A;  1SHG A;  1RAF B;  2F5T X;  5CR2 A;  1WX6 A;  4JS5 A;  2E1H A;  1YCS B;  3JCM d;  2CP5 A;  2X51 A;  5GMK j;  4EPC A;  1IGU A;  5KE2 A;  2LZ6 B;  2EBP A;  1I81 A;  2MIO A;  3OYY A;  2V8I A;  1S1N A;  3M59 A;  5J26 A;  3M54 A;  4X1V A;  2BZY A;  2P0K A;  2EYW A;  3L2R A;  3JCM Q;  2KDS A;  2D1X A;  1K9M U;  1D3B B;  5LJ3 j;  3CPW S;  3LWI A;  3VUB A;  1TUC A;  1U8R A;  2CUB A;  4RG8 A;  2QQA A;  2QI2 A;  4M7A F;  2KAF A;  2KT8 A;  4RUG A;  2X4W A;  3E1S A;  5CIU A;  3TRE A;  1GFD A;  2BKD N;  2DMO A;  4J9F A;  4PJO F;  1A0N B;  1OX8 A;  3QZ9 B;  3MO8 A;  1KC8 C;  5GMK l;  5D6X A;  1BU1 A;  2FVU A;  1VQ8 Q;  2ZGW A;  3M0Q A;  3JB9 J;  3PMT A;  3C95 A;  2AHJ B;  4C5E A;  5IAY A;  4M4Z A;  5IH2 A;  1YI2 A;  1VQ6 T;  3OSS C;  3H0H A;  4KRT A;  1FYN A;  3HKS A;  4CC7 A;  2M0Y A;  2HDA A;  3FB9 A;  4ZTF A;  1HYO A;  2GQI A;  1RAC B;  1Y07 A;  3C12 A;  2DTH A;  2K3B A;  1AOJ A;  4X34 A;  1D1C A;  3MKD A;  2HBP A;  2HKN A;  4KUI A;  2X3X D;  2EWN A;  3CPW A;  1QKW A;  4ME7 A;  4PJN A;  1YIT Q;  2DFU A;  1TWB A;  4PNO A;  4A4G A;  1ZQ1 A;  3C94 A;  2JTE A;  1Q86 R;  1C1A A;  3UT1 A;  2NUP A;  5I22 A;  2EJF A;  3G71 T;  1YI2 T;  2CYZ B;  1VUB A;  3SWN C;  1YIT A;  4OMO A;  3CCE Q;  1UFF A;  2CSQ A;  2LQW A;  4Z88 A;  1QVP A;  5GAN g;  2DVJ A;  5CO7 A;  3GBQ A;  1K9M C;  3OW2 P;  3S3M A;  5FRN A;  4PFO A;  1WIE A;  2VXF A;  1K0S A;  3VYH B;  1UGP B;  4C92 D;  1QVG A;  2K3Y A;  1XJW B;  2KI7 A;  1S72 A;  2EYZ A;  1QCO A;  4RKU E;  2LC4 A;  1IB8 A;  2COY A;  2KYM A;  3EAE A;  1T0J A;  2AK5 A;  1M2V B;  2J06 A;  2JS0 A;  4VUB A;  1YJ9 A;  4CC2 A;  3GLX A;  1NPP A;  3H6Z A;  5IT9 E;  1KQS S;  3OYF A;  4JJD A;  3G71 A;  1VQO Q;  3CCL T;  1QP2 A;  2EGC A;  2YWW A;  4QQG A;  4FYX B;  2COZ A;  5EC7 A;  3LX7 A;  2J05 A;  1KIK A;  3JB9 I;  2DL5 A;  2EVR A;  4Y28 E;  2F5K A;  2Y4Y A;  4C0G A;  4RTX A;  1YJW T;  2H3J A;  3JCM f;  5LJ5 j;  2QA4 Q;  3CME A;  3J80 E;  2FB7 A;  4PFZ A;  5LJ3 d;  1NYF A;  2V1Q A;  2AIR B;  2MK5 A;  4F04 B;  1VYU A;  5FU6 C;  2QA4 T;  2KYB A;  2XDD A;  4JRP A;  1ZSZ B;  2K79 A;  2JT4 A;  5I21 A;  4PLL A;  3RES A;  1N5Z A;  2A36 A;  2ENM A;  1NZ9 A;  1QVG S;  5GAN 5;  1K4U S;  3CEY A;  4IUT A;  2L8D A;  1VQO T;  3QJY A;  3RMQ A;  2DBK A;  1PCX A;  4HVV A;  4N4H A;  1VQM T;  5HK3 A;  1W2B S;  1D0X A;  4IUP A;  4E7J A;  3EG9 A;  1JEG A;  1KSW A;  4LE9 A;  3MEW A;  2DBM A;  4X9C A;  4D6W A;  3DB3 A;  1QW1 A;  1UEB A;  1XQH A;  2XID A;  3REA B;  5GJW B;  2V26 A;  3TCJ A;  2RB6 A;  3VUZ A;  1RLQ C;  4IIO A;  3ZFJ A;  2RHZ A;  5HY6 A;  3MP1 A;  3H0I A;  4F7U A;  3MEA A;  2X4X A;  1BIA A;  4PLI A;  1MGQ A;  2FZG B;  2ZPG B;  4PJJ A;  1Y57 A;  3V8K A;  2RQV A;  1SSH A;  1X43 A;  3AT1 B;  5CKF A;  2NWM A;  4JJB A;  2CP7 A;  4M7A E;  1WFW A;  2OJ2 A;  1M1K C;  1ZA2 B;  4XTZ A;  3G71 Q;  3CCL Q;  3JCM J;  3BFM A;  2ROL A;  3H41 A;  1P92 A;  2DL7 A;  3KBG A;  3UWN A;  2LCL A;  1GCQ A;  4C8Q C;  1ZLM A;  1M3B A;  3CCJ Q;  1PKS A;  3QDF A;  1VQN A;  5DLQ E;  3JB9 G;  4BY6 C;  1M2O A;  4C8Q G;  3NMZ C;  3UF4 A;  4E47 A;  4PJM A;  2VYT A;  5FU7 B;  4E7H A;  4R56 A;  2IG0 A;  5FLX E;  1TU0 B;  3A8G B;  1VQ5 Q;  3E19 A;  2EAY A;  2XKO C;  1X75 C;  2GNC A;  4EMK A;  2OTJ T;  3C0C A;  4XU3 A;  3HPW A;  2C0O A;  1EZZ B;  3M55 A;  3TVT A;  1K1Z A;  1Q7Y C;  2ECZ A;  1N27 A;  5LL6 S;  1JXO A;  4L5G A;  4Y92 A;  4B6M A;  1X6B A;  4LDV A;  1MV0 B;  3VS5 A;  2X4J A;  1RAE B;  4K11 A;  3OA6 A;  1WQW A;  2D9T A;  2YLC A;  3CCE T;  1ZUY A;  2DXB A;  4RTW A;  2YUQ A;  4NOY A;  4PK4 A;  1K73 R;  3GIB A;  3CCQ A;  1K8A C;  1KQ1 A;  1Q81 R;  2EJG A;  1VQ4 A;  3G6E Q;  3ULR B;  2NUT B;  3L2V A;  3VS4 A;  1YHQ A;  4DQ2 A;  2Y90 A;  4M7A B;  1M3C A;  3H9N A;  2RMO A;  1D09 B;  2XU8 A;  2V8K A;  1ZUU A;  3CMA T;  4HT8 A;  4RTY A;  2KRS A;  3JCM h;  3ZEH A;  4R55 A;  3QZ5 B;  1RAD B;  4AFQ C;  1KC8 R;  4J6W A;  3QO3 A;  4EMH A;  5IHI A;  1IZ6 A;  4M7A D;  1ZA1 B;  2CP6 A;  3SEM A;  4A4F A;  5IHK A;  3M0S A;  2M0O A;  1V29 B;  2VVK A;  4BUG A;  1FWZ A;  3MP6 A;  1VQK A;  4M78 B;  1HSQ A;  2HQX A;  2B86 A;  5FW9 A;  3SWN B;  3LYI A;  1Y71 A;  2RQT A;  2DNU A;  1FX7 A;  4M75 G;  2DVE A;  2QDL A;  5EG2 A;  1UDL A;  1VQ8 T;  3RNJ A;  2VV5 A;  2LDM A;  4IUR A;  2E5Q A;  3NHN A;  3THK A;  4N4G A;  1RLP C;  2LX9 A;  4FU6 A;  3JCM e;  3CCS T;  2GF7 A;  3RKY A;  3WXM B;  4C92 G;  3OMC A;  5CKH A;  2DIG A;  2O2O A;  3VJP A;  2AZV A;  1ZSG A;  1FMV A;  2FL7 A;  1M90 C;  2QTX A;  3CCV T;  4ELZ C;  2E5K A;  1SKU B;  3BW1 A;  1ZSZ C;  3CQT A;  3QXE B;  1AT1 B;  1LNX A;  3VS3 A;  1K76 A;  3CXC S;  5A0D A;  2BTT A;  1Q81 U;  1G83 A;  4C0D B;  4AFS C;  3CME T;  5IN1 A;  3QBY A;  2FPD A;  4KUD K;  2HZY A;  1GBQ A;  4NL2 A;  1OOT A;  3WVD B;  3EGD B;  1VQM A;  2PNI A;  4PKC C;  4B9X A;  4R0K A;  1W2B A;  1B34 A;  5LJ3 h;  5KYN A;  2KXC A;  1AWX A;  4J5Y A;  2HBW A;  3RIR A;  4A4H A;  4JRI A;  3OYA A;  1KHI A;  5KYW B;  1S72 Q;  4BE0 A;  3CC7 Q;  1AEY A;  1M3A A;  4J9E A;  4LDU A;  4JDS A;  4M77 B;  4DBH A;  4M75 E;  1QVF A;  4M75 C;  4DOW A;  1W70 A;  2O4X B;  1WPY A;  1WJR A;  1B3Q A;  2OAU A;  2WSE E;  3JB9 H;  1SRL A;  1QQJ A;  4L59 A;  4QW2 A;  4AMC A;  2P0Q A;  2M51 A;  5CQY A;  3CC4 Q;  4II1 A;  2L89 A;  5DY9 A;  2DYI A;  2ZPH B;  3RR6 A;  2K6D A;  2EIF A;  5LJ5 f;  2F69 A;  5GAN e;  2DL3 A;  1QWE A;  1ZBJ A;  1WA7 A;  3G1J A;  2DZ9 A;  5GAO n;  4BDY A;  1NPR A;  3PTA A;  1NBE B;  4J9I A;  3PVQ A;  5HCK A;  2QGG A;  3FLG A;  1E6G A;  2RNA A;  2OAW A;  2PU9 B;  3EGD A;  1UG1 A;  4ZNX A;  4OF1 A;  5GAN h;  3LWH A;  1KHC A;  2LNV A;  2DTO A;  3A98 A;  3PFS A;  3T9N A;  1BKB A;  2EJ9 A;  3JV3 A;  1G8X A;  4MML A;  2FYK A;  1YIJ T;  2H8H A;  1TOV A;  4KBM B;  2E41 A;  1VYT A;  2D0N A;  1OYX A;  3GNF B;  5KYW A;  1OU9 A;  2OI3 A;  1AVZ C;  5I2M A;  1YHQ T;  4GBQ A;  4M75 F;  4PJO E;  3X26 B;  1D0Y A;  1VQP Q;  1PSF A;  1MV3 A;  3G7Z A;  1VQ7 Q;  2DF6 A;  4LD9 K;  3CCR T;  1OZ2 A;  2BIV A;  4DBQ A;  3CCV A;  1H3Z A;  2CZ6 B;  4N0A C;  2FRY A;  8ATC B;  2RQR A;  2L0A A;  4HVU A;  3DLL A;  3HRT A;  4DOV A;  2QTV A;  3JRZ A;  3I9Q A;  4A53 A;  5M9O A;  1M1K R;  2IIM A;  2QG9 B;  4LN2 A;  1NEB A;  3DKM A;  5LJ3 e;  2MAM A;  1VQK Q;  2ZCF B;  4CI0 C;  1X69 A;  5GAO p;  4J9D A;  2CSI A;  4FL6 A;  1WHM A;  4HVW A;  2D6F A;  1T3S A;  4JRK A;  5GAM f;  1BBZ A;  4X9D A;  1SG5 A;  2RN8 A;  2GBQ A;  8AT1 B;  1VQN T;  3M0P A;  2LJ1 A;  3OBW A;  3CCM A;  1WHK A;  1OQK A;  3I56 Q;  3PNW C;  1KQS P;  3CC4 T;  4C8Q D;  1G2B A;  2JS2 A;  3OYD A;  4A54 A;  3I35 A;  2LT1 A;  4XK8 E;  3F70 A;  3HFN A;  1FMW A;  4M7D G;  1F1B B;  5C0M A;  4M7A G;  1WHL A;  3WVE B;  1YP5 A;  2KT1 A;  4LDX A;  1KG1 A;  2G6F X;  2LMJ A;  1UEC A;  4JS4 A;  4F14 A;  2MF2 A;  4F17 A;  2XG8 D;  2NLU A;  3LW5 E;  4P5N A;  4WTO B;  3OY9 A;  2A3L A;  5FRM A;  4BDZ A;  2CP0 A;  3CC7 T;  2VXE A;  3M9Q A;  1AZE A;  2JJ9 A;  1CSK A;  2E12 A;  1WGS A;  4WCI A;  2LQK A;  4EIK A;  1O9S A;  2DK3 A;  3U23 A;  3PT9 A;  2CH4 W;  1QKX A;  3N5B B;  2DXU A;  1UTI A;  1ACM B;  2PVO B;  4XU1 A;  4FT2 A;  2HEQ A;  2VWF A;  3A1P A;  1OPK A;  3BY7 A;  3CC7 A;  3FJP A;  3L2Q A;  3EHR A;  2LQ8 A;  3R6O A;  5CKD A;  2K2M A;  1JJ2 S;  2KY9 A;  4M77 D;  1VQ7 A;  4C8Q E;  4M7D B;  2JM9 A;  1WQ7 A;  1FMK A;  1DJ7 B;  3A8H B;  2GFU A;  3GF5 A;  3CME Q;  3PGG A;  1BI3 A;  4HT9 A;  3L2Z A;  3EG1 A;  1LPL A;  2A28 A;  1R77 A;  2MOX A;  4KGZ B;  4Z02 A;  2FHD A;  2DPP B;  5GAN 4;  1VQ4 T;  1FXX A;  1MND A;  3CCU A;  1WNL A;  3UA7 A;  4BY6 B;  3CCV Q;  2KMT A;  3OSV A;  2VAS A;  1Q7Y R;  1WHG A;  4QT7 A;  4XTX A;  2AT1 B;  2ZZD A;  2LNH B;  1VQO A;  2V8J A;  3VRY A;  4RCB A;  2QQR A;  4KGX B;  5CCA A;  1BIB A;  3QWY A;  4E7Z A;  4J8O A;  2HSP A;  1QWF A;  1YJ9 Q;  4F16 A;  4XQ3 A;  5D7U A;  2YRV A;  5GAN 7;  4BI3 A;  3O5Z A;  2W10 A;  3FDR A;  4EMG A;  1N9S A;  4IUQ A;  3A5Z B;  3C4S A;  3ZBD A;  1U06 A;  4PJL A;  2KSS A;  2CUD A;  1YFN A;  1NG2 A;  2RH2 A;  2AZS A;  1M90 R;  1N8R C;  2FPE A;  2QAZ A;  1MHN A;  1SPK A;  2EQJ A;  2Y4X A;  4Y91 A;  1U1S A;  3L2W A;  2KRO A;  5A0L A;  4JLI A;  4FSS A;  2DE0 X;  4M7D D;  3EG9 B;  5GAN j;  3X25 B;  3OS2 A;  3R6N A;  4QVZ A;  1ZX6 A;  2C0T A;  4MZM A;  1LJO A;  2M9U A;  4GLM A;  1PNJ A;  3FIF A;  4FYY B;  1PKT A;  3OYN A;  4J9G A;  2RJF A;  3P8H A;  4FW2 A;  3I55 A;  2P0P A;  3CMA Q;  2DAQ A;  3CD6 T;  2X35 A;  3LGF A;  5J39 A;  2LRQ A;  3PMI A;  5ECA A;  1RAG B;  1SF9 A;  1VQL Q;  1J3T A;  3FEO A;  1U3O A;  2B8A A;  3LGL A;  2COW A;  4XTV A;  3OS5 A;  4O6J A;  2KRM A;  1BB9 A;  3EH2 A;  3HRU A;  2EFI A;  3CCR A;  3UAT A;  3E9G A;  1PRL C;  2KVQ G;  2GCX A;  4FYW B;  2KRN A;  2ROT A;  4IUU A;  2VC8 A;  4C8Q F;  1X27 A;  1G3T A;  4ZN3 A;  4HCB A;  3SB2 A;  2E64 A;  4JPB W;  4OMN A;  2XHC A;  4C8Q B;  3OYL A;  4HCZ A;  5IXB A;  5GAO q;  2OTJ Q;  1UJY A;  1JRI A;  2G3R A;  2DTI A;  2I0N A;  4IUV A;  3X20 B;  4KT0 E;  3E9F A;  2SRC A;  3JSC A;  1Z9Q A;  2KXD A;  2LX7 A;  1WYX A;  3VS0 A;  3E2U A;  3RER A;  2J6K A;  4M77 G;  1WXB A;  4C5G A;  3EGX B;  2J6O A;  4M77 A;  4C0D C;  3NGP A;  3M4G A;  1M1G A;  3J7A F;  3JCM X;  1B07 A;  2XD0 A;  5A2Q E;  2YUN A;  1WHH A;  4C5H A;  4AG1 C;  4F7U E;  1I1J A;  2A0F B;  2RHX A;  4GLK A;  1K73 U;  2YUO A; 
#chains in the Genus database with same CATH homology
 1ZSG A;  2LJ0 A;  1VA7 A;  2DM1 A;  2EPD A;  3ZL7 C;  2J6F A;  3VS6 A;  2E5K A;  2PZ1 A;  1MUZ A;  1SHG A;  1SEM A;  3CQT A;  3VS3 A;  1K76 A;  2BTT A;  1WX6 A;  1G83 A;  2L2P A;  4AFS C;  1JO8 A;  1RUW A;  1YCS B;  5FWB A;  4CC3 A;  2FPD A;  1GBQ A;  2LZ6 B;  2EBP A;  1OOT A;  3EG2 A;  2MIO A;  1S1N A;  2PNI A;  4R0K A;  2F2X A;  1UHF A;  4X1V A;  1SHF A;  1WXU A;  2BZY A;  4JZ4 A;  2EYW A;  1CKA A;  4DEX A;  2D1X A;  2LJ3 A;  2FEI A;  2KXC A;  1TUC A;  1AWX A;  2HBW A;  2CUB A;  2FO0 A;  2LP5 A;  4A63 B;  2KT8 A;  4RUG A;  1VYV A;  1AEY A;  1M3A A;  2DRK A;  4J9E A;  1UE9 A;  1PHT A;  1IO6 A;  1GFD A;  2ED1 A;  4OMQ A;  2DMO A;  4J9F A;  1U5S A;  1A0N B;  1X2K A;  1W70 A;  2RF0 A;  1BU1 A;  1UHC A;  1B3Q A;  3M0Q A;  3UA6 A;  1SRL A;  4RTT A;  4M4Z A;  2KE9 A;  1AWJ A;  1AD5 A;  5IH2 A;  2M51 A;  3H0H A;  4KRT A;  1FYN A;  4CC7 A;  2M0Y A;  2DRM A;  2HDA A;  1AWW A;  2GQI A;  2K3B A;  2V1R A;  1AOJ A;  5FWC A;  2K6D A;  2L3S A;  3FJ5 A;  1TG0 A;  2DL3 A;  1T3L A;  1QWE A;  1ZBJ A;  2X3X D;  1WA7 A;  4JZ3 A;  2KEA A;  2FRW A;  1QKW A;  4J9I A;  3PVQ A;  5HCK A;  1GL5 A;  1E6G A;  2RNA A;  2OAW A;  1ZUK A;  1OEB A;  1XOV A;  1UG1 A;  2JMA A;  4ZNX A;  4HXJ A;  1JQQ A;  1YNZ A;  2JTE A;  3PE0 A;  2BZX A;  2LCS A;  5I22 A;  3A98 A;  3VRZ A;  2X3W D;  3JV3 A;  3RBB B;  2JMC A;  4OML A;  4OMO A;  4Z89 A;  1M30 A;  2H8H A;  1GRI A;  1VYT A;  1UFF A;  2CSQ A;  2D0N A;  2LQW A;  1H92 A;  2OI3 A;  1AVZ C;  4Z88 A;  4GBQ A;  2DVJ A;  2ABL A;  3GBQ A;  2YDL A;  2O88 A;  2GGR A;  2EW3 A;  1K0X A;  1WIE A;  1MV3 A;  1K0S A;  2DF6 A;  2O31 A;  2FRY A;  2JW4 A;  3VS7 A;  2RQR A;  1HD3 A;  2EYZ A;  2L0A A;  4HVU A;  2KYM A;  4AFU C;  2C0I A;  3PVL A;  3REB B;  1T0J A;  2AK5 A;  2J06 A;  2JS0 A;  3LH5 A;  1YWP A;  3I9Q A;  2IIM A;  2YUP A;  5IXF A;  3TSW A;  4LN2 A;  1NEB A;  4CC2 A;  4LUD A;  1X69 A;  4JJD A;  2HCK A;  4J9D A;  2CSI A;  3EG0 A;  4HVW A;  1GFC A;  1T3S A;  1NLP C;  4RTU A;  1BBZ A;  2EGC A;  2RN8 A;  2EGE A;  2GBQ A;  1I0C A;  5EC7 A;  2KNB B;  4ORZ A;  2J05 A;  3M0P A;  3I5R A;  2MCN A;  2LJ1 A;  1KIK A;  1NYG A;  2YSQ A;  2DL5 A;  3M0T A;  1Y0M A;  2EVR A;  4DEY A;  1JU5 C;  2VKN A;  1WLP B;  4OMP A;  4RTX A;  1G2B A;  2JS2 A;  2JXB A;  3I35 A;  2DJQ A;  2YT6 A;  1NYF A;  2V1Q A;  2CT3 A;  1VYU A;  2KT1 A;  1YP5 A;  2KYB A;  1ARK A;  2G6F X;  2J7I A;  2LMJ A;  1UEC A;  4RTV A;  2K79 A;  2JT4 A;  1YWO A;  1M27 C;  4F14 A;  2KBT A;  4F17 A;  4J9H A;  1N5Z A;  2A36 A;  2ENM A;  1K4U S;  1WDX A;  2D8J A;  2CRE A;  2DBK A;  4OMM A;  2K7A A;  1AZE A;  1CSK A;  4HVV A;  4WCI A;  4EIK A;  3U23 A;  1H3H A;  2CH4 W;  1QKX A;  4AFZ C;  4E6R A;  1UTI A;  3SHW A;  1JEG A;  2DL4 A;  5L23 A;  1E7O A;  1KSW A;  2L3P A;  2HEQ A;  4IIM A;  2VWF A;  2FPF A;  4LE9 A;  4D8D A;  1ABQ A;  1OPK A;  1E6H A;  2DBM A;  2PTK A;  1KFZ A;  3REA B;  1AZG B;  2D8H A;  3EHR A;  5GJW B;  1WI7 A;  2K2M A;  3QWX X;  1RLQ C;  4IIO A;  2JM9 A;  1FMK A;  3H0I A;  3H0F A;  2P4R A;  2EYX A;  2W0Z A;  3EG1 A;  2F2V A;  2A28 A;  2SEM A;  2MOX A;  1Y57 A;  3NPF A;  2RQV A;  1SSH A;  1X43 A;  3EG3 A;  1JXM A;  3UA7 A;  3M0U A;  4QT7 A;  2NWM A;  1X2Q A;  2DIL A;  4JJB A;  2LNH B;  2L3Q A;  4J9C A;  1WFW A;  2OJ2 A;  3VRY A;  2EGA A;  1LCK A;  3QWY A;  1GCQ C;  4CC4 B;  4AG2 C;  4LUE A;  2K9G A;  4Z8A A;  2ROL A;  3H41 A;  2HSP A;  1QWF A;  2DL7 A;  4F16 A;  1GCQ A;  1OV3 A;  2GTJ A;  2W10 A;  3O5Z A;  1HJD A;  2CH4 A;  1ZLM A;  1U06 A;  1QCF A;  1K9A A;  1M3B A;  1PKS A;  2CUD A;  2RQU A;  1NG2 A;  1T0H A;  2LQN A;  2AZS A;  1WXT A;  2A37 A;  2KR3 A;  2ED0 A;  2FPE A;  5GJV B;  1BK2 A;  2FG0 A;  1SPK A;  3NMZ C;  3UF4 A;  3EHQ A;  2KRO A;  1YN8 A;  1TUD A;  2RPN A;  4FSS A;  2BZ8 A;  2DE0 X;  1UJ0 A;  2GNC A;  3R6N A;  3C0C A;  1ZX6 A;  2CT4 A;  2C0O A;  3TSZ A;  2XMF A;  4RTZ A;  1Z9Z A;  2C0T A;  3TVT A;  4GLM A;  5IHN A;  1PNJ A;  1PKT A;  2AKK A;  1K1Z A;  4J9G A;  2ECZ A;  1JXO A;  1OPL A;  4Y92 A;  1X6B A;  2O9V A;  1PRM C;  1MV0 B;  3VS5 A;  4K11 A;  3VS2 A;  2DLP A;  2NUZ A;  5I11 A;  1ZUY A;  4RTW A;  2DL8 A;  2YUQ A;  5ECA A;  2EQI A;  1NM7 A;  1J3T A;  2RQW A;  1NEG A;  1U3O A;  3ULR B;  2CDT A;  1KJW A;  3VS4 A;  2AKL A;  1M3C A;  2KRM A;  1BB9 A;  1RI9 A;  4LNP A;  2RMO A;  3UAT A;  1PRL C;  1ZUU A;  2KRN A;  2ROT A;  4RTY A;  1X27 A;  2KRS A;  2O9S A;  2A08 A;  1QLY A;  4JPB W;  4OMN A;  4AFQ C;  1GBR A;  2ESW A;  5IHI A;  5IXB A;  3M0R A;  1H8K A;  2EYY A;  3SEM A;  2KGT A;  5IHK A;  1UJY A;  3M0S A;  2I0N A;  2VVK A;  1PWT A;  1M8M A;  1CKB A;  1NLO C;  1V1C A;  2SRC A;  1W6X A;  1Z9Q A;  1HSQ A;  2KXD A;  2LX7 A;  2B86 A;  5FW9 A;  4HCK A;  2RQT A;  1WYX A;  4D8K A;  1AWO A;  4ESR A;  2DNU A;  1W1F A;  1ABO A;  2DX1 A;  3VS0 A;  3IQL A;  2DYB A;  2EKH A;  1SRM A;  2QDL A;  2J6K A;  2GTO A;  1WXB A;  3VS1 A;  1UDL A;  1X6G A;  2F2W A;  2J6O A;  4JJC A;  3EGU A;  3RNJ A;  3NGP A;  1UUE A;  3NHN A;  1UGV A;  1RLP C;  3THK A;  1B07 A;  2JM8 A;  2YUN A;  4J9B A;  4AG1 C;  2DA9 A;  1GCP A;  1EFN A;  1I1J A;  1I07 A;  3I5S A;  3KFV A;  2O2O A;  2AZV A;  2YUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...