1UUEA

A-spectrin sh3 domain (v44t, d48g mutant)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKTEVNGRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sh3-domain
molecule keywords SPECTRIN ALPHA CHAIN
publication title Solvation in Protein Folding Analysis: Combination of Theoretical and Experimental Approaches
pubmed doi rcsb
source organism Gallus gallus
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uueA00
2DVJA 2KGTA 2DYBA 2FO0A 4JJBA 3SEMA 2O31A 2JMAA 2O9SA 2RQUA 2J6FA 4RTYA 1W6XA 4M4ZA 2CDTA 4OMOA 4AFUC 2LQWA 1TG0A 1GBRA 4GBQA 1YWOA 2HSPA 1X69A 3SHWA 4OMQA 2MOXA 1NEBA 2JM9A 2EYZA 4JPBW 3ZL7C 1ZBJA 1Y0MA 3PVQA 2KYMA 1KSWA 1SHGA 2OJ2A 1T0HA 1OPKA 3M0QA 1VYUA 2D8HA 3M0TA 2EGAA 2CSQA 5IH2A 1VA7A 2FPFA 2ABLA 2K6DA 2KR3A 1Z9ZA 3VS1A 1PWTA 2LJ1A 1UGVA 2B86A 5FWBA 5FWCA 1HJDA 2L3QA 2VKNA 1WA7A 2EVRA 1AWOA 1GRIA 1JXOA 2DA9A 4OMMA 2CT3A 2YSQA 2RN8A 1PRLC 1NM7A 2DL7A 1OV3A 2I0NA 1E6HA 1S1NA 2EPDA 1MV0B 1LCKA 4J9IA 3NMZC 1SPKA 1VYVA 1SHFA 1ZUYA 4CC2A 1YP5A 4Y92A 1K0SA 2D0NA 3REAB 2EQIA 2DRMA 1UHFA 1H92A 2KBTA 1X27A 1B3QA 1TUCA 1T3SA 2C0IA 1BU1A 1ARKA 1B07A 3QWXX 4LN2A 2J06A 3FJ5A 2RPNA 2JM8A 1M3BA 3H0FA 4OMNA 2X3XD 2DE0X 4LNPA 1H3HA 2PNIA 1SRMA 1Y57A 1BK2A 1NYFA 1U5SA 2L3SA 1U06A 1AVZC 2A36A 4KRTA 2F2XA 1JXMA 5IXBA 2KXCA 2O88A 2FG0A 4OMPA 1FMKA 3GBQA 3TSZA 1CKAA 2LJ3A 1WI7A 2JS2A 4Z8AA 1JO8A 1QCFA 1AWXA 2L0AA 2K3BA 1XOVA 1ZSGA 1WYXA 4RTVA 3H41A 1ZUUA 2PZ1A 4LE9A 1UFFA 4R0KA 2L3PA 3EG1A 2FRWA 2JXBA 4CC3A 4F16A 2KRSA 1X2KA 2RQWA 4F17A 2V1RA 2SEMA 2O9VA 2EKHA 5I22A 1JEGA 1OPLA 1OEBA 1AWJA 2EBPA 4ESRA 1M27C 1TUDA 1JQQA 3QWYA 4HCKA 2KRNA 2KT1A 3LH5A 2BTTA 1ZLMA 3EHQA 1Z9QA 1WFWA 1I07A 1NLOC 3VS5A 2X3WD 1AOJA 1OOTA 2C0OA 1T3LA 1YCSB 1BB9A 1PHTA 2GTJA 2KXDA 3H0IA 3UA6A 3UF4A 2CT4A 5FW9A 4EIKA 2FRYA 1JU5C 2BZXA 4RTXA 5HCKA 2ECZA 2D1XA 1UE9A 1UDLA 3RNJA 1K4US 3NPFA 1QKXA 2JMCA 2KROA 2DRKA 3UA7A 3TSWA 4CC4B 2GGRA 1HD3A 3PE0A 1E6GA 4ORZA 3RBBB 2DMOA 2LJ0A 5IHIA 2J6KA 5IHKA 2ROTA 2AZVA 2LMJA 3A98A 1AEYA 4J9HA 3VS0A 4D8DA 4J9BA 1GCQC 2J7IA 2MCNA 1N5ZA 4LUDA 2A28A 2CREA 3CQTA 1FYNA 2BZ8A 1M3CA 2MIOA 3TVTA 1EFNA 2KRMA 5I11A 2A08A 4AG2C 2OI3A 2K2MA 2C0TA 2EGCA 1WXUA 4Z88A 4Z89A 3VRYA 1KJWA 3EG3A 4F14A 4HVWA 1QLYA 4E6RA 1MUZA 2L2PA 2ROLA 2DJQA 1QWFA 2DLPA 2CUDA 1KFZA 1W1FA 2XMFA 2CH4W 4IIMA 3U23A 2KT8A 2PTKA 3VS6A 1I1JA 3O5ZA 3ULRB 2QDLA 1NEGA 2JTEA 1W70A 1NLPC 2CSIA 4RUGA 4AFSC 4A63B 3REBB 2GQIA 3I9QA 1AD5A 2VWFA 2HDAA 2LCSA 4JJCA 1UHCA 1X2QA 1IO6A 2CH4A 2JW4A 4RTTA 1SRLA 3VRZA 2BZYA 1HSQA 2NWMA 1ABQA 1I0CA 2IIMA 2RMOA 3M0RA 4JZ4A 1KIKA 1E7OA 4IIOA 3R6NA 2W10A 1K0XA 2DBKA 1AZGB 2LZ6B 4FSSA 4AFZC 3I5RA 1UTIA 2P4RA 1X43A 1AWWA 2EYYA 4HVVA 3VS7A 2D8JA 5GJWB 3M0PA 1VYTA 4JZ3A 4DEXA 1UJYA 2ESWA 2DL3A 4D8KA 4RTZA 2OAWA 3EGUA 2AKLA 2FEIA 2M0YA 1GFCA 3NGPA 5L23A 2H8HA 1PRMC 3H0HA 1MV3A 4X1VA 1UJ0A 2SRCA 1UUEA 2G6FX 2YUNA 4J9GA 1SEMA 1AZEA 3EG0A 3THKA 4ZNXA 2DL8A 4GLMA 2W0ZA 2EYWA 2F2VA 2EGEA 2JT4A 3EHRA 1YNZA 4HVUA 4LUEA 1T0JA 5IHNA 1X6GA 1K1ZA 3M0SA 2LNHB 1GCPA 1WIEA 5IXFA 1GCQA 1M3AA 1QKWA 1NG2A 2LX7A 2RQRA 4J9CA 2AZSA 4RTUA 2RF0A 1SSHA 3M0UA 2ED1A 2EYXA 2JS0A 1G2BA 4RTWA 4J9FA 2HCKA 4WCIA 5ECAA 2E5KA 1K76A 2LQNA 2HEQA 2CUBA 2YUOA 2RQTA 2RNAA 4OMLA 1RI9A 1J3TA 3PVLA 1RLPC 1K9AA 4JJDA 5GJVB 1RLQC 2DX1A 2DL4A 2RQVA 1U3OA 1CKBA 1BBZA 2GBQA 1NYGA 2DM1A 2ED0A 1WDXA 2GTOA 2KNBB 1H8KA 1WXBA 1ZUKA 2DF6A 1CSKA 2LP5A 2ENMA 2EW3A 1WX6A 1ABOA 1YWPA 2F2WA 2YDLA 2KE9A 3C0CA 3VS3A 2M51A 4J9EA 4HXJA 2DILA 3I35A 1V1CA 2YUPA 3KFVA 1GBQA 1WLPB 4AG1C 2J6OA 3I5SA 5EC7A 4QT7A 1G83A 2YUQA 2J05A 2K7AA 1A0NB 1PKTA 1GL5A 2AKKA 2V1QA 4J9DA 1M30A 1X6BA 2A37A 1WXTA 2DBMA 3VS2A 4DEYA 2VVKA 1ZX6A 3EG2A 3IQLA 4K11A 1QWEA 2YT6A 2K79A 2FPDA 3UATA 3NHNA 1GFDA 1PKSA 2DL5A 2NUZA 3JV3A 1UECA 2KYBA 2HBWA 4CC7A 1PNJA 2K9GA 2GNCA 1UG1A 3VS4A 4AFQC 2KEAA 1M8MA 1YN8A 2DNUA 2O2OA 2FPEA 2AK5A 1RUWA
chains in the Genus database with same CATH superfamily
2XHCA 5D6XA 5KCOA 4JJBA 5J39A 2RQUA 1IHVA 3PTAA 1YFNA 3H6ZA 4QVZA 3CMAA 4GBQA 1YWOA 5CQYA 1X69A 2OTJA 4OMQA 2CZ0B 2MOXA 2EYZA 2A3LA 3WVDB 1ZBJA 1YHQT 4YTLA 1UGRB 2KYMA 4OF1A 1SHGA 1T0HA 4KUIA 2CP0A 5GAOq 3P8HA 3M0TA 2EGAA 2C06A 4IUPA 4KGZB 1AHJB 2F5TX 2F1LA 4OMFB 1VQ4A 1RI0A 3VS1A 1YJNT 2LJ1A 2B86A 5FWBA 5FWCA 2A7YA 3PGGA 3CCLQ 4PJOC 1WA7A 4ANJA 3OYAA 4J7FA 2RI2A 2IVWA 1WHHA 4BDZA 3EFOA 2E70A 2NUPB 2RN8A 3PT9A 3J7AF 2DL7A 1OV3A 4RCCA 3QUIA 1S1NA 5KYYA 3NMZC 1ZSZA 4XTXA 1SPKA 1D3BA 2QTXA 4M75A 1ZUYA 3SWNC 4HT9A 3DKMA 4XQ3A 1UHFA 1X27A 1YHQA 3LX7A 2KY9A 2QA4T 1T3SA 5A2QE 4M7DE 3QWXX 4BE2A 3FJ5A 3JAME 3V8JA 4LDYA 3CCRQ 1VQMQ 4E7JA 3J81E 3JB9H 4LXCA 1YJNA 1OULA 2XU8A 1YBYA 1FMKA 1BIBA 2LJ3A 1WI7A 4PJOD 2ZGWA 2K3BA 1IGQA 1ZSGA 3GP8A 3H41A 1IXDA 1YJWQ 4M78C 4JUVA 3WVEB 6AT1B 4L6V5 5LJ3g 1XQHA 5A0GA 3GNFB 2X35A 2R57A 1OZ2A 2O9VA 3RKYA 5I22A 2DYIA 1TS9A 3MP6A 1QW1A 1M1KU 4C8QA 1OEBA 3OYIA 4IUUA 2DIQA 1VOMA 2QA4A 3META 1EX4A 2BTTA 2DAQA 1OX8A 1ZLMA 3EHQA 1WZOA 2QI2A 2X3WD 4HCZA 1OOTA 4E47A 5LJ5j 4JLGA 3QPHA 3C12A 3ZBDA 1EZZB 5L8RE 3G1JA 2CT4A 4B6MA 2YHTA 4EIKA 5FRMA 3OYEA 4BE0A 2FRYA 3J80E 1JU5C 5HCKA 3QIIA 3NPFA 3JCMJ 5FU7C 5GAOp 5CKBA 3GIBA 2RK1A 2LVMA 3ZEHA 1E6GA 4ORZA 1RAIB 5HK0A 2YLBA 4LDWA 1Q95G 3OYHA 2FZGB 2PQWA 3H9NA 1D1BA 2LMJA 1AEYA 2P0PA 4OGCA 4D8DA 3OW2S 3CCRT 2JUFA 1VQMT 1LNXA 4M77D 4Q5WA 4A53A 2BZ8A 3CCVQ 2KRMA 5I11A 1M1KC 2HKQB 1WXUA 4Z88A 4Z89A 3VRYA 1JBMA 3TQ7P 3X20B 4F14A 3MPUB 3OA6A 3LH0A 2DO3A 2QQSA 1YJWT 1ZQ1A 1RAGB 1Q82U 1VQ6Q 2XMFA 2CH4W 1JJ2A 3O5ZA 4FSXA 4M7DA 2QDLA 1NEGA 3CCQQ 4C92F 2CSIA 2GQIA 4PJOB 2IG0A 1AD5A 1HXDA 1UHCA 2CH4A 1IO6A 4IUQA 2GFUA 3EAEA 4MZPA 4Y91A 1I0CA 5D6WA 2RMOA 4JZ4A 2DZ9A 4ZTJA 1KIKA 2DXCA 1M8VA 1N9RA 3RKWA 3C95A 1K0XA 3CCRA 2DBKA 1VQMA 2MWOA 3HHTB 4FW1A 1M1KR 2I2LA 3E19A 4DEXA 1W2BA 2O01E 3JB9F 4JS5A 2HSEB 3VUZA 1GFCA 1HK9A 1NPPA 4HT8A 4DOVA 1VUBA 3NGPA 1YJWA 2H8HA 3RERA 3DB3A 3VU3C 2E41A 5D7UA 3L2VA 4F7UF 2BUDA 2G6FX 1B34A 1SKUB 5LJ5f 1VIFA 5GANj 2DL8A 1QVGS 2EYWA 1KC8U 2F2VA 3FIFA 4BACA 3JB9G 2RA2A 1YNZA 1T0JA 3OS1A 5J3BA 2RHZA 1D09B 2VASA 5FRNA 3CCMQ 4PK4A 1O9SA 3JRZA 1GCQA 3CBMA 3GF5A 2RQRA 3MHXA 4E2FB 1VQKQ 1VQ6T 1SF9A 3CBOA 3M0UA 3VYHB 2ED1A 3EGDB 1Q86U 4M75G 4M77B 4RTWA 1H3ZA 1ACMB 1Y71A 3CCQT 5ECAA 2YUOA 2VUBA 2VXFA 5A0LA 1RI9A 2CYZB 2KDSA 1LJOA 1RLPC 1K9AA 4PKCC 2WSCE 3JSCA 4QW2A 2NUTA 1Q7YU 4C92D 1U3OA 3QG1A 2ZZDA 2GBQA 4HCCA 2QGFB 2ED0A 4MZMA 1TU0B 5IAYA 5KYUA 2F2WA 2YDLA 1X6OA 3M5AA 1ZSZC 3I56Q 4RCBA 4LD9K 5CK9A 4QQDA 2YUPA 2LCLA 2YRCA 4RKUE 2XKOC 2JN0A 3RR6A 3OMGA 1VQ6A 1G83A 2VV5A 2LDMA 3ASKA 2YUQA 3C94A 5I2SA 2QAZA 1A0NB 1XJWB 2NYSA 2AKKA 4J9DA 1M30A 4XTUA 3OBWA 3CCQA 1FX7A 4C5IA 1Q86C 3QSUA 2R58A 3E1SA 3VS2A 4B9WA 3FEOA 3OYFA 3EG2A 3IQLA 4R56A 3CXCS 3HRTA 2DPPB 1RL2A 2YT6A 3CCMT 1M1FA 3JV3A 2KYBA 4J6YA 5IN1A 8AT1B 2X9HA 4GLKA 1RAAB 2DNUA 2QQBA 1Q7YC 2DVJA 2VC8A 2FO0A 2JMAA 4MMLA 5GAMj 2O9SA 2J6FA 3CC2T 3E9GA 2EWNA 1W6XA 4KT0E 4RTYA 3JCMf 1MMAA 2CDTA 5GANf 1BIAA 4OMOA 4AFUC 2D9TA 1TG0A 2FL7A 1K8AU 4NL3A 5D6YA 3PVQA 4LDUA 4BDYA 4LDXA 1Q86R 4M7AD 3M0QA 2G3RA 3HRSA 1VYUA 2D8HA 4L5GA 1NJIU 1WHLA 2BIVA 2K4YA 5CQXA 3OQ5A 4MMKA 3GNGA 2LNVA 5HY6A 3QHSA 3MEUA 2L3QA 3CCMA 4J5YA 4F7UE 2RJCA 3OYYA 3QZ5B 3I56T 5GAN3 1YCYA 3A8LB 4EMKB 1FXXA 2DA9A 3OBYA 1Q7YR 3FDRA 3URGA 4N4HA 4FT4A 4C92B 1WJRA 1UB4A 3CC7Q 1NBEB 1E6HA 1LCKA 3CC2A 4OB2B 4M7DG 3QBYA 1SHFA 2V8IA 5GAOl 2FZCB 4CC2A 3A8GB 3BY7A 2O4XA 2E10A 2D0NA 5CKEA 3REAB 2DRMA 3BFMA 5C0MA 1TUCA 4BI8B 3OYKA 1RAFB 2DVEA 1OZ3A 1ARKA 1FWZA 5KYXB 2JM8A 4NL2A 2RK2A 3MO8A 2PNIA 2L3SA 1AVZC 2A36A 3X24B 5IXBA 2K3YA 1TXQA 3EFRA 2FG0A 2CKKA 4X34A 2VB6A 3LGLA 4OP0A 3I56A 1BCMA 1G3YA 4C0FA 1Q81U 5GMKm 2JS2A 2EQUA 4Z8AA 1JO8A 2ATCB 4FCYA 1RABB 1QCFA 1AWXA 4EMHA 1SG5A 3BDLA 1UGPB 3CCUQ 2GF7A 4RTVA 5KYWA 1I4K1 3OW2P 1UFFA 3L2UA 4PJOF 3V7RA 2L3PA 5EG2A 2WSFE 2JXBA 2KRSA 3BE3A 4RG8A 3L42A 2V1RA 2XD0A 1KQ1A 2E65A 3MEAA 5GAMf 1PG5B 1KK7A 4N4GA 1IZ6A 1O75A 3AHUA 4DA4A 1Y96B 3A1PA 2EJGA 3LH5A 3O8VA 2KAFA 2QGGA 4A4KA 1S72T 1WNLA 4M7AB 4NOYA 1PHTA 2JNGA 5C6SA 2KXDA 3H0IA 4XU1A 3CC7T 1VQ7T 3UF4A 5FW9A 1I5LA 4IKFA 3NTKA 1R0CB 1DJ7B 1UDLA 1N6AA 1VQPQ 1K4US 2JMCA 4OB3B 2DRKA 3UA7A 5CCAA 1Q81C 5KE3A 1PCXA 4J6XA 1HD3A 1YIJT 4PJMA 1PSEA 4ATOA 5I2MA 3RBBB 3RMQA 4BD3A 1VIEA 2LJ0A 1V29B 2COYA 2J6KA 5IHKA 1KQSP 4F7UA 2ROTA 3OS2A 2AZVA 3QDRB 3A98A 5LJ5h 3EH1A 3VS0A 4J9BA 1GCQC 3LGFA 5DLOA 3QJ6A 2A28A 2CREA 2VXEA 4FM4B 1D0YA 4FYVB 1EFNA 2ZAEA 2P84A 4OGEA 2E6NA 4M77F 3PNWC 3RUXA 1QLYA 1S72A 2DD4A 1VQNQ 1MUZA 5HK3A 1MGQA 2M1HA 1MMGA 3CCUT 3JCMP 1MNDA 3CC7A 4A4EA 1KFZA 3CPFA 1VQ7A 4IIMA 1QVGP 2KT8A 4UC4A 2Y4YA 1WHJA 1I1JA 2EJFA 3M53A 1M2VB 5GAN6 2JTEA 1W70A 4JRQA 1LOJA 2VYTA 2K5LA 4A63B 3REBB 3VJPA 3SDZA 1YIJA 3CCJQ 3EG9B 4JJCA 4M77G 4ELZC 1X2QA 2JTFA 2ZPIB 4RTTA 3VRZA 4TVRA 1HSQA 1BI3A 1HYOA 3LLRA 1WQ7A 3M0RA 4MDXA 4FL6A 1E7OA 5KE2A 2W10A 2JVVA 1D1CA 2LZ6B 3RMSA 3I5RA 3FC3A 1UTIA 1X43A 3VV0A 2XDPA 4HVVA 1UJYA 5LJ3j 2NUPA 4J6WA 3EGUA 4E7IA 4KH0B 1C6VX 3CCUA 3HL8A 3CCLT 3HTRA 3H0HA 2QEXQ 1UUEA 2E6ZA 2LTOA 1AZEA 3EG0A 4ZNXA 2W0ZA 2M9UA 3NFCA 1FMVA 3EGXB 4X9DA 4HVUA 4ZGJB 1BI2A 1Y7XA 2KMTA 1KQ2A 1K1ZA 3P8BB 1G3TA 3JCMc 4PJOE 2LNHB 4OB1B 3ME9A 2MK5A 1VQNT 4JJNK 4JS4A 1NG2A 3RESA 3JCMQ 4M78D 1BYMA 1SSHA 4JDSA 2D0QB 4P5NA 4KGVB 2EQMA 2EYXA 3UT1A 1U1TA 3JCMh 3TEEA 4N0AA 3CXCP 1JJ2S 1FMWA 5GANh 4C5EA 2E5KA 4XTVA 2DXTA 5CKDA 2LQNA 3PFSA 5LJ5d 3CCLA 2DZCA 3CCJT 1OQKA 1J3TA 4C0ZA 1WHGA 3PMIA 4JJDA 2DX1A 4BB7A 2RM4A 2M0OA 1U1SA 2PUOB 2A0FB 1OU9A 4ZTFA 1MMNA 3JCMX 3HSBA 1IB8A 2AHJB 1ZUKA 2DF6A 2LP5A 2LQKA 1WX6A 4PJJA 1B34B 1M5Q1 1KD1U 2ZPEB 1R8OB 3C4SA 2HNIA 2ZPHB 4J9EA 1TOVA 1VQ8Q 4HXJA 3I35A 1V1CA 3OSSC 1VQNA 2X51A 2LC4A 2DKGA 2XDDA 1WLPB 3CPWA 2J6OA 2MPXC 4QT7A 3OW2A 2DIGA 2QYZA 3FLGA 2DERA 2J05A 2K7AA 4PNOA 3PIOA 1YI2Q 1N8RU 1PKTA 3FB9A 2CGHA 2V1QA 2JTMA 1K73U 4C92G 1KQSS 2D6FA 1WGSA 4M77E 2XIDA 2K3XA 1QMCA 3PIPA 3CCJA 3SWNB 3INZA 1KG1A 2CP6A 5LJ3f 1IREB 3UATA 2CP5A 1GFDA 2DL5A 2NUZA 2QQAA 4CC7A 2QG9B 2K9GA 5A0DA 3G71Q 2GNCA 3VS4A 2L89A 1YN8A 2KEAA 2O2OA 2FPEA 2KVQG 1RUWA 3QO3A 2KGTA 2DYBA 1Q82C 2O31A 2X4JA 4IUTA 3D7SB 3A8HB 2L3RA 4XTZA 2LQWA 3X25B 1KD1C 3G7ZA 2HSPA 3SHWA 2P0KA 3CCVT 1NEBA 5KYUB 3ZL7C 4KGXB 3BDUA 1RADB 4M78B 5J26A 3GLXA 1UGQB 4F7UG 3LWIA 1KSWA 2OJ2A 2RJFA 4PJOA 4E7KA 2CSQA 3JCMW 5IH2A 2ABLA 4BE1A 2K6DA 2KR3A 2PUKB 2XK0A 1Z9ZA 1PWTA 2MF2A 5GAMh 1K73C 4M7AF 1UGVA 4IURA 5GMKj 2KQWA 5LJ3e 1P92A 4DOWA 2VKNA 2EVRA 3JCMd 1VQ8T 4BY6C 1JXOA 2CT3A 5GANd 1Q82R 2H3JA 1PRLC 1NM7A 4ZGEB 2I0NA 2LCCA 2EPDA 3WXMB 4E7SA 1YI2T 4PLIA 3M58A 3OYMA 3E9FA 5LJ5e 1VQ5Q 4QQGA 3NTHA 2HKNA 1YJ9Q 1VYVA 1KD1R 4DBRA 4M7AG 4PJNA 5I21A 1YP5A 4Y92A 1K0SA 2E12A 5FU7B 4QKUA 4QVCA 5GAN8 1KC8C 2EQIA 3CCVA 2MMPA 2KBTA 3KXTA 1B3QA 4PJLA 2C0IA 4M75C 2OX7A 1B07A 4LN2A 4DQ2A 2J06A 2RPNA 4AMCA 3G71T 2X3XD 2DE0X 4AT1B 1BK2A 1NYFA 1U06A 4KRTA 4BI3A 2F2XA 2O88A 3L2QA 5CKHA 3GBQA 2Y4XA 1VQ8A 3M57A 2EFIA 1XOVA 4XU2A 3EGDA 4M77A 4FIBA 5DLQE 1ZUUA 2PZ1A 4PFPA 4LE9A 1YI2A 3G6EQ 1QVFS 3EG1A 4C92E 1VQKT 1KC8R 1X2KA 3TREA 2RQWA 2MYSA 1PD0A 1JEGA 1OPLA 3EH2A 2EBPA 1R77A 4ESRA 3AT1B 3SB2A 1K9MU 1M27C 2F5KA 2RJDA 4A4HA 1PD1A 1JQQA 3S6WA 5AYFA 3QWYA 4LD6A 2DD5A 3DLMA 4HCKA 2KT1A 4FU6A 2RO0A 2LT1A 1Z9QA 4M75D 1WFWA 1I07A 3MCAB 4BUGA 3G71A 2M16A 2C0OA 3KUFA 4C8QC 1T3LA 1M2OA 1YCSB 2DEQA 5CVIA 4BI4A 3UA6A 2RHUA 4O5VA 3CXCA 1VQ5T 2BZXA 4RTXA 2KK4A 1YJ9T 2ECZA 2D1XA 4ZGDB 2HQXA 5FROA 2VGNA 3TSWA 4CC4B 3P8DA 2GGRA 2CZ6B 3CEYA 1NE8A 2ZPBB 1VQ9Q 1IRXA 2DMOA 5GAMd 3NTIA 2EQJA 5IHIA 4X9CA 4C5HA 2MWPA 2DK3A 1VQKA 1N27A 4XTYA 2J7IA 2BKDN 1N5ZA 4LUDA 3JCMe 4DBHA 3CQTA 3V8LA 4A4FA 1FYNA 5GANe 1M3CA 2MIOA 4PLLA 4AG2C 4FW2A 2OI3A 2C0TA 1WHMA 2COZA 1K9MC 2WSEE 4HVWA 1V76A 3VYGA 2L2PA 1K8AC 1ZHIA 2DJQA 3TCJA 2CUDA 4C8QD 1W1FA 3CD6Q 2E64A 3HKSA 3G6ET 4M7AE 1VQ5A 2LRQA 2Z0WA 1YJ9A 3GOXA 5GAN7 2BE7D 2XG8D 1NLPC 1NJIC 4AFSC 1OYXA 4KUDK 4J8OA 2MI6A 4BY6B 2JW4A 1SRLA 2B8AA 2NWMA 5CAIA 4M7DC 4IIOA 3R6NA 3UDCA 2RJEA 1JJ2P 3TU4K 1AZGB 4FSSA 4AFZC 1AWWA 3QXEB 4ZN3A 1X75C 2HBPA 2V26A 2ZCFB 3EFOB 4EMKA 5GJWB 3M0PA 4JZ3A 4JRKA 2ESWA 2DL3A 4GY5A 2OAWA 2WACA 5FLXE 1G8XA 4C92A 2AKLA 3M59A 3CMEQ 1K8AR 5KYYB 1ZSZB 1D3BB 2EIFA 2YLCA 3OYNA 5FU6C 4M75B 4MDWA 3PMTA 1PRMC 3OYDA 1VQ9T 2DETA 2KSSA 1MV3A 4X1VA 4PJOG 4J9GA 1NJIR 3N5BB 2PU9B 1RAEB 2K5FA 3THKA 1W2BP 3HFNA 2CP3A 4E7ZA 2JT4A 4LUEA 3DB4A 5KYXA 4XAXB 4RG2A 5IHNA 1IGUA 5LJ3h 2RHYA 4HA8A 4XTWA 1GCPA 2FZKB 1KHCA 4M7DD 1QKWA 2X4WA 4J9CA 3JB9I 2V8KA 3OYJA 1QP2A 3OS5A 3CD6T 4XU0A 4EDUA 2QQRA 3DLLA 1BI0A 3QYGB 1RACB 5GMKi 2CS7A 2HCKA 2EQKA 3M55A 4F04B 4M78F 5GMKl 3OYCA 5GAMe 4C0DC 2GQVA 3QKJA 2HEQA 2HL3A 2CUBA 2DXBA 2RQTA 1MNEA 5CKFA 1VQ9A 3PVLA 5GJVB 3MEVA 1VQOQ 4C8QB 2PVDB 1BCOA 3S3MA 2L8DA 2DL4A 4V2SA 2RQVA 1CKBA 1BBZA 1Y96A 2DM1A 4VUBA 1WDXA 3OYBA 4M78G 2KNBB 1H8KA 1WXBA 3UPUA 2HZYA 1Q81R 1M4ZA 2EW3A 3MP8A 7AT1B 1ABOA 1PM3A 3G4SQ 4M7AA 2GCXA 3C0CA 3VS3A 3CMET 2M51A 1QQJA 1GBQA 4AG1C 1BI1A 3I5SA 3MEWA 5EC7A 3CD6A 2FHDA 1QP3A 4II1A 1X6BA 4XU3A 2QTVA 1AT1B 2PVOB 4DEYA 2XICA 1ZX6A 1LPLA 2FYKA 4OVAA 1VQPT 5LL6S 3S3OA 2K79A 2FPDA 3NHNA 3LYIA 4LDVA 2HQEA 4A4GA 1KHIA 3ER0A 1UECA 1TWBA 2HBWA 1PNJA 1M8MA 2L5QA 4D6WA 1I8FA 4MZTA 4M77C 3SEMA 1C0MA 5HKCA 3A5ZB 1ZA1B 4M4ZA 1IHWA 3CMEA 3X28B 3FJPA 2V8JA 1GBRA 5CO7A 1D0ZA 3MP1A 5LJ5g 2RI3A 4M7DB 2JM9A 4JPBW 3CCEQ 1Y0MA 2FB7A 1M2VA 1VQOT 4KBMB 5LJ3d 1OPKA 2GFAA 5M9OA 3EG9A 1OU8A 1VA7A 4Y28E 2FPFA 4OB0B 3M4GA 4PL6A 2LT4A 1VQPA 1HJDA 1B7TA 4L59A 2P4TA 3G4ST 1MHNA 5FU6B 1AWOA 4QVDA 3I55Q 1QVFP 1GRIA 1PSFA 4OMMA 2YSQA 2PVGB 3GPLA 3CPWS 4FYWB 3CCSQ 1MV0B 1UEBA 4J9IA 2AIRB 3QJYA 2OAUA 3CC4Q 2CZ1B 5IT9E 2LX9A 1H92A 1I81A 5GMKh 1W2BS 1VQOA 1BU1A 1C1AA 3EGXA 4RMOA 3JCMb 1M3BA 2RB6A 4PFZA 4M78E 3H0FA 3M4YA 4OMNA 4LNPA 2QEXT 2OTLQ 1H3HA 1SRMA 1Y57A 3RIRA 1U5SA 4J7IA 1YITQ 3ZFJA 1JXMA 2KXCA 3VKIA 3V8KA 3G4SA 9ATCB 4C0DB 4OMPA 1RAHB 1TTHB 3TSZA 1CKAA 4CI0C 4FYXB 2HQHA 3S3NA 1U8RA 2L0AA 2X4XA 5GAN2 2HAXA 2QASA 1R0BG 1WYXA 2R5MA 3CCET 4R0KA 1VQLQ 2RHXA 2FRWA 2JJ9A 4CC3A 4F16A 1QCOA 4C5GA 4F17A 2SEMA 3QDFA 2EKHA 3M54A 2NUTB 1AWJA 4EMGA 1TUDA 4WF2A 4Z02A 3OMCA 2KRNA 4R55A 1TSFA 2BE9B 4EMKC 3JCMg 3I55T 1NLOC 3VS5A 5GAOr 1LVKA 1TH7A 1AOJA 5GANg 4C92C 1WPYA 2QEXA 4WTOB 1BB9A 1KQSA 1EIFA 1OX9A 2GTJA 3CCST 3M9QA 3SFMA 1W4SA 4M75F 2VGMA 3L2RA 1N8RC 2CP7A 1UE9A 3RDVA 3RNJA 3CC4T 1QKXA 3QYHB 4A54A 2H3EB 3OB9A 3R6OA 2KROA 3JCMV 4DBFA 3H8ZA 4HKEA 3PE0A 3CCEA 3CBPA 2QK0A 2XDBA 3SWNA 5KH6A 2X4YA 4IUVA 1QVGA 5GAN4 3CC2Q 4J9HA 1G5VA 2OTLT 2EYQA 1QVPA 2MCNA 1YITT 4EPCA 4ZN1A 4QQ6A 3TVTA 3HRUA 2A08A 2K2MA 2EGCA 2CZ7B 4ELYC 3I55A 4E7LA 1KJWA 3EG3A 1WQWA 4E6RA 5CR2A 2DTIA 4N4IA 3OYLA 4NS5A 2ROLA 3CCSA 1N8RR 1QWFA 2DLPA 2QQ9A 1OI1A 3RKXA 3U23A 5KCHA 2PTKA 3HFOA 3VS6A 1VQLT 1H641 1K73R 2DJZA 3CC4A 1D0XA 3ULRB 3KBGA 4RUGA 4C8QF 4M78A 1BKBA 3I9QA 4KULA 2VWFA 2HDAA 2LCSA 2XI9A 2F69A 5GAOn 2BZYA 3OY9A 2QXFA 1ABQA 3V7SA 1M90U 2IIMA 4KH1B 1D1AA 1F1BB 5GAN5 4M7AC 1SSFA 3A8OB 2M02A 2OTLA 3JB9D 2P4RA 1YITA 3LW5E 4ME7A 2EYYA 4XK8E 3VS7A 2D8JA 3L1AA 4C0GA 4C8QG 5KYNA 1VYTA 1XNIA 2E1HA 2KI7A 1NPRA 4D8KA 4RTZA 5GAOm 2LQ8A 4J83A 5CIUA 2FEIA 2M0YA 3VUBA 3CMAQ 5AT1B 2OTJQ 5L23A 1Y07A 2HL5C 2O4XB 5GAMg 1ZBXA 1VQLA 1JRIA 1UJ0A 2SRCA 2YXYA 3HP9A 1WHKA 2YUNA 3X26B 1SEMA 1X01A 3JB9J 4CRIA 1WJQA 2FVUA 1UGSB 4GLMA 2HD0A 2E5QA 3MKDA 2EGEA 3EHRA 1VQ4Q 2YRVA 1TUGB 4HCBA 3A8MB 4JLIA 2IPOB 3F70A 1X6GA 3M0SA 2YWWA 1GXIE 2K2VA 1QVFA 3EFSA 1WIEA 2MAMA 1ZA2B 5IXFA 1M3AA 2LX7A 2ZPGB 1M90C 1XTDA 2AZSA 2ZPFB 4RTUA 3L2ZA 4JRPA 2RF0A 1M1GA 2EAYA 3UWNA 2RI5A 1N9SA 3T9NA 2JS0A 4M7DF 1G2BA 1QCNA 4J9FA 5KYWB 1G3WA 2QDYB 3FRNA 4WCIA 2DTOA 1NZ9A 2Y90A 1K76A 1PC0A 3M56A 2RNAA 3OYGA 4OMLA 1S72Q 1YHQQ 4N0AC 1RLQC 4M75E 3Q1JA 3LWHA 2DXUA 1VQ7Q 3QZ9B 2E3IA 3BW1A 2EKOA 1NYGA 2COWA 1I5OB 2GTOA 4E7HA 1YJNQ 1CSKA 4FYYB 2ENMA 3MJXA 4JRIA 4O6JA 1YWPA 2HMAA 5DY9A 4B9XA 2KE9A 1YIJQ 1M90R 2DFUA 2RD1A 2DILA 3CMAT 5GMKe 3KFVA 2RH2A 2R5AA 3OSVA 2OTJT 2K57A 2YRDA 2E4HA 1MMDA 3HPWA 2P0QA 1GL5A 2DEUA 2A37A 2DTHA 1M9SA 1WXTA 2DBMA 1WJSA 3OS0A 2EJ9A 2VVKA 4FT2A 1K9MR 4F7UB 3L2WA 1VQ4T 2JOYA 3SD4A 3E2UA 4K11A 1QWEA 2E3HA 4PFOA 1JB0E 2QA4Q 2NLUA 2JZ2A 3CPWP 1G3SA 3V7CA 2RHIA 4DBQA 5DM7R 1PKSA 2CP2A 8ATCB 1UG1A 4AFQC 2AT1B 3G6EA 4C8QE 2K5IA 2AK5A
chains in the Genus database with same CATH topology
2DVJA 2KGTA 2DYBA 2FO0A 4JJBA 3SEMA 2O31A 2JMAA 2O9SA 2RQUA 2J6FA 4RTYA 1W6XA 4M4ZA 2CDTA 4OMOA 4AFUC 2LQWA 1TG0A 1GBRA 4GBQA 1YWOA 2HSPA 1X69A 3SHWA 4OMQA 2MOXA 1NEBA 2JM9A 2EYZA 4JPBW 3ZL7C 1ZBJA 1Y0MA 3PVQA 2KYMA 1KSWA 1SHGA 2OJ2A 1T0HA 1OPKA 3M0QA 1VYUA 2D8HA 3M0TA 2EGAA 2CSQA 5IH2A 1VA7A 2FPFA 2ABLA 2K6DA 2KR3A 1Z9ZA 3VS1A 1PWTA 2LJ1A 1UGVA 2B86A 5FWBA 5FWCA 1HJDA 2L3QA 2VKNA 1WA7A 2EVRA 1AWOA 1GRIA 1JXOA 2DA9A 4OMMA 2CT3A 2YSQA 2RN8A 1PRLC 1NM7A 2DL7A 1OV3A 2I0NA 1E6HA 1S1NA 2EPDA 1MV0B 1LCKA 4J9IA 3NMZC 1SPKA 1VYVA 1SHFA 1ZUYA 4CC2A 1YP5A 4Y92A 1K0SA 2D0NA 3REAB 2EQIA 2DRMA 1UHFA 1H92A 2KBTA 1X27A 1B3QA 1TUCA 1T3SA 2C0IA 1BU1A 1ARKA 1B07A 3QWXX 4LN2A 2J06A 3FJ5A 2RPNA 2JM8A 1M3BA 3H0FA 4OMNA 2X3XD 2DE0X 4LNPA 1H3HA 2PNIA 1SRMA 1Y57A 1BK2A 1NYFA 1U5SA 2L3SA 1U06A 1AVZC 2A36A 4KRTA 2F2XA 1JXMA 5IXBA 2KXCA 2O88A 2FG0A 4OMPA 1FMKA 3GBQA 3TSZA 1CKAA 2LJ3A 1WI7A 2JS2A 4Z8AA 1JO8A 1QCFA 1AWXA 2L0AA 2K3BA 1XOVA 1ZSGA 1WYXA 4RTVA 3H41A 1ZUUA 2PZ1A 4LE9A 1UFFA 4R0KA 2L3PA 3EG1A 2FRWA 2JXBA 4CC3A 4F16A 2KRSA 1X2KA 2RQWA 4F17A 2V1RA 2SEMA 2O9VA 2EKHA 5I22A 1JEGA 1OPLA 1OEBA 1AWJA 2EBPA 4ESRA 1M27C 1TUDA 1JQQA 3QWYA 4HCKA 2KRNA 2KT1A 3LH5A 2BTTA 1ZLMA 3EHQA 1Z9QA 1WFWA 1I07A 1NLOC 3VS5A 2X3WD 1AOJA 1OOTA 2C0OA 1T3LA 1YCSB 1BB9A 1PHTA 2GTJA 2KXDA 3H0IA 3UA6A 3UF4A 2CT4A 5FW9A 4EIKA 2FRYA 1JU5C 2BZXA 4RTXA 5HCKA 2ECZA 2D1XA 1UE9A 1UDLA 3RNJA 1K4US 3NPFA 1QKXA 2JMCA 2KROA 2DRKA 3UA7A 3TSWA 4CC4B 2GGRA 1HD3A 3PE0A 1E6GA 4ORZA 3RBBB 2DMOA 2LJ0A 5IHIA 2J6KA 5IHKA 2ROTA 2AZVA 2LMJA 3A98A 1AEYA 4J9HA 3VS0A 4D8DA 4J9BA 1GCQC 2J7IA 2MCNA 1N5ZA 4LUDA 2A28A 2CREA 3CQTA 1FYNA 2BZ8A 1M3CA 2MIOA 3TVTA 1EFNA 2KRMA 5I11A 2A08A 4AG2C 2OI3A 2K2MA 2C0TA 2EGCA 1WXUA 4Z88A 4Z89A 3VRYA 1KJWA 3EG3A 4F14A 4HVWA 1QLYA 4E6RA 1MUZA 2L2PA 2ROLA 2DJQA 1QWFA 2DLPA 2CUDA 1KFZA 1W1FA 2XMFA 2CH4W 4IIMA 3U23A 2KT8A 2PTKA 3VS6A 1I1JA 3O5ZA 3ULRB 2QDLA 1NEGA 2JTEA 1W70A 1NLPC 2CSIA 4RUGA 4AFSC 4A63B 3REBB 2GQIA 3I9QA 1AD5A 2VWFA 2HDAA 2LCSA 4JJCA 1UHCA 1X2QA 1IO6A 2CH4A 2JW4A 4RTTA 1SRLA 3VRZA 2BZYA 1HSQA 2NWMA 1ABQA 1I0CA 2IIMA 2RMOA 3M0RA 4JZ4A 1KIKA 1E7OA 4IIOA 3R6NA 2W10A 1K0XA 2DBKA 1AZGB 2LZ6B 4FSSA 4AFZC 3I5RA 1UTIA 2P4RA 1X43A 1AWWA 2EYYA 4HVVA 3VS7A 2D8JA 5GJWB 3M0PA 1VYTA 4JZ3A 4DEXA 1UJYA 2ESWA 2DL3A 4D8KA 4RTZA 2OAWA 3EGUA 2AKLA 2FEIA 2M0YA 1GFCA 3NGPA 5L23A 2H8HA 1PRMC 3H0HA 1MV3A 4X1VA 1UJ0A 2SRCA 1UUEA 2G6FX 2YUNA 4J9GA 1SEMA 1AZEA 3EG0A 3THKA 4ZNXA 2DL8A 4GLMA 2W0ZA 2EYWA 2F2VA 2EGEA 2JT4A 3EHRA 1YNZA 4HVUA 4LUEA 1T0JA 5IHNA 1X6GA 1K1ZA 3M0SA 2LNHB 1GCPA 1WIEA 5IXFA 1GCQA 1M3AA 1QKWA 1NG2A 2LX7A 2RQRA 4J9CA 2AZSA 4RTUA 2RF0A 1SSHA 3M0UA 2ED1A 2EYXA 2JS0A 1G2BA 4RTWA 4J9FA 2HCKA 4WCIA 5ECAA 2E5KA 1K76A 2LQNA 2HEQA 2CUBA 2YUOA 2RQTA 2RNAA 4OMLA 1RI9A 1J3TA 3PVLA 1RLPC 1K9AA 4JJDA 5GJVB 1RLQC 2DX1A 2DL4A 2RQVA 1U3OA 1CKBA 1BBZA 2GBQA 1NYGA 2DM1A 2ED0A 1WDXA 2GTOA 2KNBB 1H8KA 1WXBA 1ZUKA 2DF6A 1CSKA 2LP5A 2ENMA 2EW3A 1WX6A 1ABOA 1YWPA 2F2WA 2YDLA 2KE9A 3C0CA 3VS3A 2M51A 4J9EA 4HXJA 2DILA 3I35A 1V1CA 2YUPA 3KFVA 1GBQA 1WLPB 4AG1C 2J6OA 3I5SA 5EC7A 4QT7A 1G83A 2YUQA 2J05A 2K7AA 1A0NB 1PKTA 1GL5A 2AKKA 2V1QA 4J9DA 1M30A 1X6BA 2A37A 1WXTA 2DBMA 3VS2A 4DEYA 2VVKA 1ZX6A 3EG2A 3IQLA 4K11A 1QWEA 2YT6A 2K79A 2FPDA 3UATA 3NHNA 1GFDA 1PKSA 2DL5A 2NUZA 3JV3A 1UECA 2KYBA 2HBWA 4CC7A 1PNJA 2K9GA 2GNCA 1UG1A 3VS4A 4AFQC 2KEAA 1M8MA 1YN8A 2DNUA 2O2OA 2FPEA 2AK5A 1RUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVJ A;  2KGT A;  2DYB A;  2FO0 A;  4JJB A;  3SEM A;  2O31 A;  2JMA A;  2O9S A;  2RQU A;  2J6F A;  4RTY A;  1W6X A;  4M4Z A;  2CDT A;  4OMO A;  4AFU C;  2LQW A;  1TG0 A;  1GBR A;  4GBQ A;  1YWO A;  2HSP A;  1X69 A;  3SHW A;  4OMQ A;  2MOX A;  1NEB A;  2JM9 A;  2EYZ A;  4JPB W;  3ZL7 C;  1ZBJ A;  1Y0M A;  3PVQ A;  2KYM A;  1KSW A;  1SHG A;  2OJ2 A;  1T0H A;  1OPK A;  3M0Q A;  1VYU A;  2D8H A;  3M0T A;  2EGA A;  2CSQ A;  5IH2 A;  1VA7 A;  2FPF A;  2ABL A;  2K6D A;  2KR3 A;  1Z9Z A;  3VS1 A;  1PWT A;  2LJ1 A;  1UGV A;  2B86 A;  5FWB A;  5FWC A;  1HJD A;  2L3Q A;  2VKN A;  1WA7 A;  2EVR A;  1AWO A;  1GRI A;  1JXO A;  2DA9 A;  4OMM A;  2CT3 A;  2YSQ A;  2RN8 A;  1PRL C;  1NM7 A;  2DL7 A;  1OV3 A;  2I0N A;  1E6H A;  1S1N A;  2EPD A;  1MV0 B;  1LCK A;  4J9I A;  3NMZ C;  1SPK A;  1VYV A;  1SHF A;  1ZUY A;  4CC2 A;  1YP5 A;  4Y92 A;  1K0S A;  2D0N A;  3REA B;  2EQI A;  2DRM A;  1UHF A;  1H92 A;  2KBT A;  1X27 A;  1B3Q A;  1TUC A;  1T3S A;  2C0I A;  1BU1 A;  1ARK A;  1B07 A;  3QWX X;  4LN2 A;  2J06 A;  3FJ5 A;  2RPN A;  2JM8 A;  1M3B A;  3H0F A;  4OMN A;  2X3X D;  2DE0 X;  4LNP A;  1H3H A;  2PNI A;  1SRM A;  1Y57 A;  1BK2 A;  1NYF A;  1U5S A;  2L3S A;  1U06 A;  1AVZ C;  2A36 A;  4KRT A;  2F2X A;  1JXM A;  5IXB A;  2KXC A;  2O88 A;  2FG0 A;  4OMP A;  1FMK A;  3GBQ A;  3TSZ A;  1CKA A;  2LJ3 A;  1WI7 A;  2JS2 A;  4Z8A A;  1JO8 A;  1QCF A;  1AWX A;  2L0A A;  2K3B A;  1XOV A;  1ZSG A;  1WYX A;  4RTV A;  3H41 A;  1ZUU A;  2PZ1 A;  4LE9 A;  1UFF A;  4R0K A;  2L3P A;  3EG1 A;  2FRW A;  2JXB A;  4CC3 A;  4F16 A;  2KRS A;  1X2K A;  2RQW A;  4F17 A;  2V1R A;  2SEM A;  2O9V A;  2EKH A;  5I22 A;  1JEG A;  1OPL A;  1OEB A;  1AWJ A;  2EBP A;  4ESR A;  1M27 C;  1TUD A;  1JQQ A;  3QWY A;  4HCK A;  2KRN A;  2KT1 A;  3LH5 A;  2BTT A;  1ZLM A;  3EHQ A;  1Z9Q A;  1WFW A;  1I07 A;  1NLO C;  3VS5 A;  2X3W D;  1AOJ A;  1OOT A;  2C0O A;  1T3L A;  1YCS B;  1BB9 A;  1PHT A;  2GTJ A;  2KXD A;  3H0I A;  3UA6 A;  3UF4 A;  2CT4 A;  5FW9 A;  4EIK A;  2FRY A;  1JU5 C;  2BZX A;  4RTX A;  5HCK A;  2ECZ A;  2D1X A;  1UE9 A;  1UDL A;  3RNJ A;  1K4U S;  3NPF A;  1QKX A;  2JMC A;  2KRO A;  2DRK A;  3UA7 A;  3TSW A;  4CC4 B;  2GGR A;  1HD3 A;  3PE0 A;  1E6G A;  4ORZ A;  3RBB B;  2DMO A;  2LJ0 A;  5IHI A;  2J6K A;  5IHK A;  2ROT A;  2AZV A;  2LMJ A;  3A98 A;  1AEY A;  4J9H A;  3VS0 A;  4D8D A;  4J9B A;  1GCQ C;  2J7I A;  2MCN A;  1N5Z A;  4LUD A;  2A28 A;  2CRE A;  3CQT A;  1FYN A;  2BZ8 A;  1M3C A;  2MIO A;  3TVT A;  1EFN A;  2KRM A;  5I11 A;  2A08 A;  4AG2 C;  2OI3 A;  2K2M A;  2C0T A;  2EGC A;  1WXU A;  4Z88 A;  4Z89 A;  3VRY A;  1KJW A;  3EG3 A;  4F14 A;  4HVW A;  1QLY A;  4E6R A;  1MUZ A;  2L2P A;  2ROL A;  2DJQ A;  1QWF A;  2DLP A;  2CUD A;  1KFZ A;  1W1F A;  2XMF A;  2CH4 W;  4IIM A;  3U23 A;  2KT8 A;  2PTK A;  3VS6 A;  1I1J A;  3O5Z A;  3ULR B;  2QDL A;  1NEG A;  2JTE A;  1W70 A;  1NLP C;  2CSI A;  4RUG A;  4AFS C;  4A63 B;  3REB B;  2GQI A;  3I9Q A;  1AD5 A;  2VWF A;  2HDA A;  2LCS A;  4JJC A;  1UHC A;  1X2Q A;  1IO6 A;  2CH4 A;  2JW4 A;  4RTT A;  1SRL A;  3VRZ A;  2BZY A;  1HSQ A;  2NWM A;  1ABQ A;  1I0C A;  2IIM A;  2RMO A;  3M0R A;  4JZ4 A;  1KIK A;  1E7O A;  4IIO A;  3R6N A;  2W10 A;  1K0X A;  2DBK A;  1AZG B;  2LZ6 B;  4FSS A;  4AFZ C;  3I5R A;  1UTI A;  2P4R A;  1X43 A;  1AWW A;  2EYY A;  4HVV A;  3VS7 A;  2D8J A;  5GJW B;  3M0P A;  1VYT A;  4JZ3 A;  4DEX A;  1UJY A;  2ESW A;  2DL3 A;  4D8K A;  4RTZ A;  2OAW A;  3EGU A;  2AKL A;  2FEI A;  2M0Y A;  1GFC A;  3NGP A;  5L23 A;  2H8H A;  1PRM C;  3H0H A;  1MV3 A;  4X1V A;  1UJ0 A;  2SRC A;  1UUE A;  2G6F X;  2YUN A;  4J9G A;  1SEM A;  1AZE A;  3EG0 A;  3THK A;  4ZNX A;  2DL8 A;  4GLM A;  2W0Z A;  2EYW A;  2F2V A;  2EGE A;  2JT4 A;  3EHR A;  1YNZ A;  4HVU A;  4LUE A;  1T0J A;  5IHN A;  1X6G A;  1K1Z A;  3M0S A;  2LNH B;  1GCP A;  1WIE A;  5IXF A;  1GCQ A;  1M3A A;  1QKW A;  1NG2 A;  2LX7 A;  2RQR A;  4J9C A;  2AZS A;  4RTU A;  2RF0 A;  1SSH A;  3M0U A;  2ED1 A;  2EYX A;  2JS0 A;  1G2B A;  4RTW A;  4J9F A;  2HCK A;  4WCI A;  5ECA A;  2E5K A;  1K76 A;  2LQN A;  2HEQ A;  2CUB A;  2YUO A;  2RQT A;  2RNA A;  4OML A;  1RI9 A;  1J3T A;  3PVL A;  1RLP C;  1K9A A;  4JJD A;  5GJV B;  1RLQ C;  2DX1 A;  2DL4 A;  2RQV A;  1U3O A;  1CKB A;  1BBZ A;  2GBQ A;  1NYG A;  2DM1 A;  2ED0 A;  1WDX A;  2GTO A;  2KNB B;  1H8K A;  1WXB A;  1ZUK A;  2DF6 A;  1CSK A;  2LP5 A;  2ENM A;  2EW3 A;  1WX6 A;  1ABO A;  1YWP A;  2F2W A;  2YDL A;  2KE9 A;  3C0C A;  3VS3 A;  2M51 A;  4J9E A;  4HXJ A;  2DIL A;  3I35 A;  1V1C A;  2YUP A;  3KFV A;  1GBQ A;  1WLP B;  4AG1 C;  2J6O A;  3I5S A;  5EC7 A;  4QT7 A;  1G83 A;  2YUQ A;  2J05 A;  2K7A A;  1A0N B;  1PKT A;  1GL5 A;  2AKK A;  2V1Q A;  4J9D A;  1M30 A;  1X6B A;  2A37 A;  1WXT A;  2DBM A;  3VS2 A;  4DEY A;  2VVK A;  1ZX6 A;  3EG2 A;  3IQL A;  4K11 A;  1QWE A;  2YT6 A;  2K79 A;  2FPD A;  3UAT A;  3NHN A;  1GFD A;  1PKS A;  2DL5 A;  2NUZ A;  3JV3 A;  1UEC A;  2KYB A;  2HBW A;  4CC7 A;  1PNJ A;  2K9G A;  2GNC A;  1UG1 A;  3VS4 A;  4AFQ C;  2KEA A;  1M8M A;  1YN8 A;  2DNU A;  2O2O A;  2FPE A;  2AK5 A;  1RUW A; 
#chains in the Genus database with same CATH topology
 2XHC A;  5D6X A;  5KCO A;  4JJB A;  5J39 A;  2RQU A;  1IHV A;  3PTA A;  1YFN A;  3H6Z A;  4QVZ A;  3CMA A;  4GBQ A;  1YWO A;  5CQY A;  1X69 A;  2OTJ A;  4OMQ A;  2CZ0 B;  2MOX A;  2EYZ A;  2A3L A;  3WVD B;  1ZBJ A;  1YHQ T;  4YTL A;  1UGR B;  2KYM A;  4OF1 A;  1SHG A;  1T0H A;  4KUI A;  2CP0 A;  5GAO q;  3P8H A;  3M0T A;  2EGA A;  2C06 A;  4IUP A;  4KGZ B;  1AHJ B;  2F5T X;  2F1L A;  4OMF B;  1VQ4 A;  1RI0 A;  3VS1 A;  1YJN T;  2LJ1 A;  2B86 A;  5FWB A;  5FWC A;  2A7Y A;  3PGG A;  3CCL Q;  4PJO C;  1WA7 A;  4ANJ A;  3OYA A;  4J7F A;  2RI2 A;  2IVW A;  1WHH A;  4BDZ A;  3EFO A;  2E70 A;  2NUP B;  2RN8 A;  3PT9 A;  3J7A F;  2DL7 A;  1OV3 A;  4RCC A;  3QUI A;  1S1N A;  5KYY A;  3NMZ C;  1ZSZ A;  4XTX A;  1SPK A;  1D3B A;  2QTX A;  4M75 A;  1ZUY A;  3SWN C;  4HT9 A;  3DKM A;  4XQ3 A;  1UHF A;  1X27 A;  1YHQ A;  3LX7 A;  2KY9 A;  2QA4 T;  1T3S A;  5A2Q E;  4M7D E;  3QWX X;  4BE2 A;  3FJ5 A;  3JAM E;  3V8J A;  4LDY A;  3CCR Q;  1VQM Q;  4E7J A;  3J81 E;  3JB9 H;  4LXC A;  1YJN A;  1OUL A;  2XU8 A;  1YBY A;  1FMK A;  1BIB A;  2LJ3 A;  1WI7 A;  4PJO D;  2ZGW A;  2K3B A;  1IGQ A;  1ZSG A;  3GP8 A;  3H41 A;  1IXD A;  1YJW Q;  4M78 C;  4JUV A;  3WVE B;  6AT1 B;  4L6V 5;  5LJ3 g;  1XQH A;  5A0G A;  3GNF B;  2X35 A;  2R57 A;  1OZ2 A;  2O9V A;  3RKY A;  5I22 A;  2DYI A;  1TS9 A;  3MP6 A;  1QW1 A;  1M1K U;  4C8Q A;  1OEB A;  3OYI A;  4IUU A;  2DIQ A;  1VOM A;  2QA4 A;  3MET A;  1EX4 A;  2BTT A;  2DAQ A;  1OX8 A;  1ZLM A;  3EHQ A;  1WZO A;  2QI2 A;  2X3W D;  4HCZ A;  1OOT A;  4E47 A;  5LJ5 j;  4JLG A;  3QPH A;  3C12 A;  3ZBD A;  1EZZ B;  5L8R E;  3G1J A;  2CT4 A;  4B6M A;  2YHT A;  4EIK A;  5FRM A;  3OYE A;  4BE0 A;  2FRY A;  3J80 E;  1JU5 C;  5HCK A;  3QII A;  3NPF A;  3JCM J;  5FU7 C;  5GAO p;  5CKB A;  3GIB A;  2RK1 A;  2LVM A;  3ZEH A;  1E6G A;  4ORZ A;  1RAI B;  5HK0 A;  2YLB A;  4LDW A;  1Q95 G;  3OYH A;  2FZG B;  2PQW A;  3H9N A;  1D1B A;  2LMJ A;  1AEY A;  2P0P A;  4OGC A;  4D8D A;  3OW2 S;  3CCR T;  2JUF A;  1VQM T;  1LNX A;  4M77 D;  4Q5W A;  4A53 A;  2BZ8 A;  3CCV Q;  2KRM A;  5I11 A;  1M1K C;  2HKQ B;  1WXU A;  4Z88 A;  4Z89 A;  3VRY A;  1JBM A;  3TQ7 P;  3X20 B;  4F14 A;  3MPU B;  3OA6 A;  3LH0 A;  2DO3 A;  2QQS A;  1YJW T;  1ZQ1 A;  1RAG B;  1Q82 U;  1VQ6 Q;  2XMF A;  2CH4 W;  1JJ2 A;  3O5Z A;  4FSX A;  4M7D A;  2QDL A;  1NEG A;  3CCQ Q;  4C92 F;  2CSI A;  2GQI A;  4PJO B;  2IG0 A;  1AD5 A;  1HXD A;  1UHC A;  2CH4 A;  1IO6 A;  4IUQ A;  2GFU A;  3EAE A;  4MZP A;  4Y91 A;  1I0C A;  5D6W A;  2RMO A;  4JZ4 A;  2DZ9 A;  4ZTJ A;  1KIK A;  2DXC A;  1M8V A;  1N9R A;  3RKW A;  3C95 A;  1K0X A;  3CCR A;  2DBK A;  1VQM A;  2MWO A;  3HHT B;  4FW1 A;  1M1K R;  2I2L A;  3E19 A;  4DEX A;  1W2B A;  2O01 E;  3JB9 F;  4JS5 A;  2HSE B;  3VUZ A;  1GFC A;  1HK9 A;  1NPP A;  4HT8 A;  4DOV A;  1VUB A;  3NGP A;  1YJW A;  2H8H A;  3RER A;  3DB3 A;  3VU3 C;  2E41 A;  5D7U A;  3L2V A;  4F7U F;  2BUD A;  2G6F X;  1B34 A;  1SKU B;  5LJ5 f;  1VIF A;  5GAN j;  2DL8 A;  1QVG S;  2EYW A;  1KC8 U;  2F2V A;  3FIF A;  4BAC A;  3JB9 G;  2RA2 A;  1YNZ A;  1T0J A;  3OS1 A;  5J3B A;  2RHZ A;  1D09 B;  2VAS A;  5FRN A;  3CCM Q;  4PK4 A;  1O9S A;  3JRZ A;  1GCQ A;  3CBM A;  3GF5 A;  2RQR A;  3MHX A;  4E2F B;  1VQK Q;  1VQ6 T;  1SF9 A;  3CBO A;  3M0U A;  3VYH B;  2ED1 A;  3EGD B;  1Q86 U;  4M75 G;  4M77 B;  4RTW A;  1H3Z A;  1ACM B;  1Y71 A;  3CCQ T;  5ECA A;  2YUO A;  2VUB A;  2VXF A;  5A0L A;  1RI9 A;  2CYZ B;  2KDS A;  1LJO A;  1RLP C;  1K9A A;  4PKC C;  2WSC E;  3JSC A;  4QW2 A;  2NUT A;  1Q7Y U;  4C92 D;  1U3O A;  3QG1 A;  2ZZD A;  2GBQ A;  4HCC A;  2QGF B;  2ED0 A;  4MZM A;  1TU0 B;  5IAY A;  5KYU A;  2F2W A;  2YDL A;  1X6O A;  3M5A A;  1ZSZ C;  3I56 Q;  4RCB A;  4LD9 K;  5CK9 A;  4QQD A;  2YUP A;  2LCL A;  2YRC A;  4RKU E;  2XKO C;  2JN0 A;  3RR6 A;  3OMG A;  1VQ6 A;  1G83 A;  2VV5 A;  2LDM A;  3ASK A;  2YUQ A;  3C94 A;  5I2S A;  2QAZ A;  1A0N B;  1XJW B;  2NYS A;  2AKK A;  4J9D A;  1M30 A;  4XTU A;  3OBW A;  3CCQ A;  1FX7 A;  4C5I A;  1Q86 C;  3QSU A;  2R58 A;  3E1S A;  3VS2 A;  4B9W A;  3FEO A;  3OYF A;  3EG2 A;  3IQL A;  4R56 A;  3CXC S;  3HRT A;  2DPP B;  1RL2 A;  2YT6 A;  3CCM T;  1M1F A;  3JV3 A;  2KYB A;  4J6Y A;  5IN1 A;  8AT1 B;  2X9H A;  4GLK A;  1RAA B;  2DNU A;  2QQB A;  1Q7Y C;  2DVJ A;  2VC8 A;  2FO0 A;  2JMA A;  4MML A;  5GAM j;  2O9S A;  2J6F A;  3CC2 T;  3E9G A;  2EWN A;  1W6X A;  4KT0 E;  4RTY A;  3JCM f;  1MMA A;  2CDT A;  5GAN f;  1BIA A;  4OMO A;  4AFU C;  2D9T A;  1TG0 A;  2FL7 A;  1K8A U;  4NL3 A;  5D6Y A;  3PVQ A;  4LDU A;  4BDY A;  4LDX A;  1Q86 R;  4M7A D;  3M0Q A;  2G3R A;  3HRS A;  1VYU A;  2D8H A;  4L5G A;  1NJI U;  1WHL A;  2BIV A;  2K4Y A;  5CQX A;  3OQ5 A;  4MMK A;  3GNG A;  2LNV A;  5HY6 A;  3QHS A;  3MEU A;  2L3Q A;  3CCM A;  4J5Y A;  4F7U E;  2RJC A;  3OYY A;  3QZ5 B;  3I56 T;  5GAN 3;  1YCY A;  3A8L B;  4EMK B;  1FXX A;  2DA9 A;  3OBY A;  1Q7Y R;  3FDR A;  3URG A;  4N4H A;  4FT4 A;  4C92 B;  1WJR A;  1UB4 A;  3CC7 Q;  1NBE B;  1E6H A;  1LCK A;  3CC2 A;  4OB2 B;  4M7D G;  3QBY A;  1SHF A;  2V8I A;  5GAO l;  2FZC B;  4CC2 A;  3A8G B;  3BY7 A;  2O4X A;  2E10 A;  2D0N A;  5CKE A;  3REA B;  2DRM A;  3BFM A;  5C0M A;  1TUC A;  4BI8 B;  3OYK A;  1RAF B;  2DVE A;  1OZ3 A;  1ARK A;  1FWZ A;  5KYX B;  2JM8 A;  4NL2 A;  2RK2 A;  3MO8 A;  2PNI A;  2L3S A;  1AVZ C;  2A36 A;  3X24 B;  5IXB A;  2K3Y A;  1TXQ A;  3EFR A;  2FG0 A;  2CKK A;  4X34 A;  2VB6 A;  3LGL A;  4OP0 A;  3I56 A;  1BCM A;  1G3Y A;  4C0F A;  1Q81 U;  5GMK m;  2JS2 A;  2EQU A;  4Z8A A;  1JO8 A;  2ATC B;  4FCY A;  1RAB B;  1QCF A;  1AWX A;  4EMH A;  1SG5 A;  3BDL A;  1UGP B;  3CCU Q;  2GF7 A;  4RTV A;  5KYW A;  1I4K 1;  3OW2 P;  1UFF A;  3L2U A;  4PJO F;  3V7R A;  2L3P A;  5EG2 A;  2WSF E;  2JXB A;  2KRS A;  3BE3 A;  4RG8 A;  3L42 A;  2V1R A;  2XD0 A;  1KQ1 A;  2E65 A;  3MEA A;  5GAM f;  1PG5 B;  1KK7 A;  4N4G A;  1IZ6 A;  1O75 A;  3AHU A;  4DA4 A;  1Y96 B;  3A1P A;  2EJG A;  3LH5 A;  3O8V A;  2KAF A;  2QGG A;  4A4K A;  1S72 T;  1WNL A;  4M7A B;  4NOY A;  1PHT A;  2JNG A;  5C6S A;  2KXD A;  3H0I A;  4XU1 A;  3CC7 T;  1VQ7 T;  3UF4 A;  5FW9 A;  1I5L A;  4IKF A;  3NTK A;  1R0C B;  1DJ7 B;  1UDL A;  1N6A A;  1VQP Q;  1K4U S;  2JMC A;  4OB3 B;  2DRK A;  3UA7 A;  5CCA A;  1Q81 C;  5KE3 A;  1PCX A;  4J6X A;  1HD3 A;  1YIJ T;  4PJM A;  1PSE A;  4ATO A;  5I2M A;  3RBB B;  3RMQ A;  4BD3 A;  1VIE A;  2LJ0 A;  1V29 B;  2COY A;  2J6K A;  5IHK A;  1KQS P;  4F7U A;  2ROT A;  3OS2 A;  2AZV A;  3QDR B;  3A98 A;  5LJ5 h;  3EH1 A;  3VS0 A;  4J9B A;  1GCQ C;  3LGF A;  5DLO A;  3QJ6 A;  2A28 A;  2CRE A;  2VXE A;  4FM4 B;  1D0Y A;  4FYV B;  1EFN A;  2ZAE A;  2P84 A;  4OGE A;  2E6N A;  4M77 F;  3PNW C;  3RUX A;  1QLY A;  1S72 A;  2DD4 A;  1VQN Q;  1MUZ A;  5HK3 A;  1MGQ A;  2M1H A;  1MMG A;  3CCU T;  3JCM P;  1MND A;  3CC7 A;  4A4E A;  1KFZ A;  3CPF A;  1VQ7 A;  4IIM A;  1QVG P;  2KT8 A;  4UC4 A;  2Y4Y A;  1WHJ A;  1I1J A;  2EJF A;  3M53 A;  1M2V B;  5GAN 6;  2JTE A;  1W70 A;  4JRQ A;  1LOJ A;  2VYT A;  2K5L A;  4A63 B;  3REB B;  3VJP A;  3SDZ A;  1YIJ A;  3CCJ Q;  3EG9 B;  4JJC A;  4M77 G;  4ELZ C;  1X2Q A;  2JTF A;  2ZPI B;  4RTT A;  3VRZ A;  4TVR A;  1HSQ A;  1BI3 A;  1HYO A;  3LLR A;  1WQ7 A;  3M0R A;  4MDX A;  4FL6 A;  1E7O A;  5KE2 A;  2W10 A;  2JVV A;  1D1C A;  2LZ6 B;  3RMS A;  3I5R A;  3FC3 A;  1UTI A;  1X43 A;  3VV0 A;  2XDP A;  4HVV A;  1UJY A;  5LJ3 j;  2NUP A;  4J6W A;  3EGU A;  4E7I A;  4KH0 B;  1C6V X;  3CCU A;  3HL8 A;  3CCL T;  3HTR A;  3H0H A;  2QEX Q;  1UUE A;  2E6Z A;  2LTO A;  1AZE A;  3EG0 A;  4ZNX A;  2W0Z A;  2M9U A;  3NFC A;  1FMV A;  3EGX B;  4X9D A;  4HVU A;  4ZGJ B;  1BI2 A;  1Y7X A;  2KMT A;  1KQ2 A;  1K1Z A;  3P8B B;  1G3T A;  3JCM c;  4PJO E;  2LNH B;  4OB1 B;  3ME9 A;  2MK5 A;  1VQN T;  4JJN K;  4JS4 A;  1NG2 A;  3RES A;  3JCM Q;  4M78 D;  1BYM A;  1SSH A;  4JDS A;  2D0Q B;  4P5N A;  4KGV B;  2EQM A;  2EYX A;  3UT1 A;  1U1T A;  3JCM h;  3TEE A;  4N0A A;  3CXC P;  1JJ2 S;  1FMW A;  5GAN h;  4C5E A;  2E5K A;  4XTV A;  2DXT A;  5CKD A;  2LQN A;  3PFS A;  5LJ5 d;  3CCL A;  2DZC A;  3CCJ T;  1OQK A;  1J3T A;  4C0Z A;  1WHG A;  3PMI A;  4JJD A;  2DX1 A;  4BB7 A;  2RM4 A;  2M0O A;  1U1S A;  2PUO B;  2A0F B;  1OU9 A;  4ZTF A;  1MMN A;  3JCM X;  3HSB A;  1IB8 A;  2AHJ B;  1ZUK A;  2DF6 A;  2LP5 A;  2LQK A;  1WX6 A;  4PJJ A;  1B34 B;  1M5Q 1;  1KD1 U;  2ZPE B;  1R8O B;  3C4S A;  2HNI A;  2ZPH B;  4J9E A;  1TOV A;  1VQ8 Q;  4HXJ A;  3I35 A;  1V1C A;  3OSS C;  1VQN A;  2X51 A;  2LC4 A;  2DKG A;  2XDD A;  1WLP B;  3CPW A;  2J6O A;  2MPX C;  4QT7 A;  3OW2 A;  2DIG A;  2QYZ A;  3FLG A;  2DER A;  2J05 A;  2K7A A;  4PNO A;  3PIO A;  1YI2 Q;  1N8R U;  1PKT A;  3FB9 A;  2CGH A;  2V1Q A;  2JTM A;  1K73 U;  4C92 G;  1KQS S;  2D6F A;  1WGS A;  4M77 E;  2XID A;  2K3X A;  1QMC A;  3PIP A;  3CCJ A;  3SWN B;  3INZ A;  1KG1 A;  2CP6 A;  5LJ3 f;  1IRE B;  3UAT A;  2CP5 A;  1GFD A;  2DL5 A;  2NUZ A;  2QQA A;  4CC7 A;  2QG9 B;  2K9G A;  5A0D A;  3G71 Q;  2GNC A;  3VS4 A;  2L89 A;  1YN8 A;  2KEA A;  2O2O A;  2FPE A;  2KVQ G;  1RUW A;  3QO3 A;  2KGT A;  2DYB A;  1Q82 C;  2O31 A;  2X4J A;  4IUT A;  3D7S B;  3A8H B;  2L3R A;  4XTZ A;  2LQW A;  3X25 B;  1KD1 C;  3G7Z A;  2HSP A;  3SHW A;  2P0K A;  3CCV T;  1NEB A;  5KYU B;  3ZL7 C;  4KGX B;  3BDU A;  1RAD B;  4M78 B;  5J26 A;  3GLX A;  1UGQ B;  4F7U G;  3LWI A;  1KSW A;  2OJ2 A;  2RJF A;  4PJO A;  4E7K A;  2CSQ A;  3JCM W;  5IH2 A;  2ABL A;  4BE1 A;  2K6D A;  2KR3 A;  2PUK B;  2XK0 A;  1Z9Z A;  1PWT A;  2MF2 A;  5GAM h;  1K73 C;  4M7A F;  1UGV A;  4IUR A;  5GMK j;  2KQW A;  5LJ3 e;  1P92 A;  4DOW A;  2VKN A;  2EVR A;  3JCM d;  1VQ8 T;  4BY6 C;  1JXO A;  2CT3 A;  5GAN d;  1Q82 R;  2H3J A;  1PRL C;  1NM7 A;  4ZGE B;  2I0N A;  2LCC A;  2EPD A;  3WXM B;  4E7S A;  1YI2 T;  4PLI A;  3M58 A;  3OYM A;  3E9F A;  5LJ5 e;  1VQ5 Q;  4QQG A;  3NTH A;  2HKN A;  1YJ9 Q;  1VYV A;  1KD1 R;  4DBR A;  4M7A G;  4PJN A;  5I21 A;  1YP5 A;  4Y92 A;  1K0S A;  2E12 A;  5FU7 B;  4QKU A;  4QVC A;  5GAN 8;  1KC8 C;  2EQI A;  3CCV A;  2MMP A;  2KBT A;  3KXT A;  1B3Q A;  4PJL A;  2C0I A;  4M75 C;  2OX7 A;  1B07 A;  4LN2 A;  4DQ2 A;  2J06 A;  2RPN A;  4AMC A;  3G71 T;  2X3X D;  2DE0 X;  4AT1 B;  1BK2 A;  1NYF A;  1U06 A;  4KRT A;  4BI3 A;  2F2X A;  2O88 A;  3L2Q A;  5CKH A;  3GBQ A;  2Y4X A;  1VQ8 A;  3M57 A;  2EFI A;  1XOV A;  4XU2 A;  3EGD A;  4M77 A;  4FIB A;  5DLQ E;  1ZUU A;  2PZ1 A;  4PFP A;  4LE9 A;  1YI2 A;  3G6E Q;  1QVF S;  3EG1 A;  4C92 E;  1VQK T;  1KC8 R;  1X2K A;  3TRE A;  2RQW A;  2MYS A;  1PD0 A;  1JEG A;  1OPL A;  3EH2 A;  2EBP A;  1R77 A;  4ESR A;  3AT1 B;  3SB2 A;  1K9M U;  1M27 C;  2F5K A;  2RJD A;  4A4H A;  1PD1 A;  1JQQ A;  3S6W A;  5AYF A;  3QWY A;  4LD6 A;  2DD5 A;  3DLM A;  4HCK A;  2KT1 A;  4FU6 A;  2RO0 A;  2LT1 A;  1Z9Q A;  4M75 D;  1WFW A;  1I07 A;  3MCA B;  4BUG A;  3G71 A;  2M16 A;  2C0O A;  3KUF A;  4C8Q C;  1T3L A;  1M2O A;  1YCS B;  2DEQ A;  5CVI A;  4BI4 A;  3UA6 A;  2RHU A;  4O5V A;  3CXC A;  1VQ5 T;  2BZX A;  4RTX A;  2KK4 A;  1YJ9 T;  2ECZ A;  2D1X A;  4ZGD B;  2HQX A;  5FRO A;  2VGN A;  3TSW A;  4CC4 B;  3P8D A;  2GGR A;  2CZ6 B;  3CEY A;  1NE8 A;  2ZPB B;  1VQ9 Q;  1IRX A;  2DMO A;  5GAM d;  3NTI A;  2EQJ A;  5IHI A;  4X9C A;  4C5H A;  2MWP A;  2DK3 A;  1VQK A;  1N27 A;  4XTY A;  2J7I A;  2BKD N;  1N5Z A;  4LUD A;  3JCM e;  4DBH A;  3CQT A;  3V8L A;  4A4F A;  1FYN A;  5GAN e;  1M3C A;  2MIO A;  4PLL A;  4AG2 C;  4FW2 A;  2OI3 A;  2C0T A;  1WHM A;  2COZ A;  1K9M C;  2WSE E;  4HVW A;  1V76 A;  3VYG A;  2L2P A;  1K8A C;  1ZHI A;  2DJQ A;  3TCJ A;  2CUD A;  4C8Q D;  1W1F A;  3CD6 Q;  2E64 A;  3HKS A;  3G6E T;  4M7A E;  1VQ5 A;  2LRQ A;  2Z0W A;  1YJ9 A;  3GOX A;  5GAN 7;  2BE7 D;  2XG8 D;  1NLP C;  1NJI C;  4AFS C;  1OYX A;  4KUD K;  4J8O A;  2MI6 A;  4BY6 B;  2JW4 A;  1SRL A;  2B8A A;  2NWM A;  5CAI A;  4M7D C;  4IIO A;  3R6N A;  3UDC A;  2RJE A;  1JJ2 P;  3TU4 K;  1AZG B;  4FSS A;  4AFZ C;  1AWW A;  3QXE B;  4ZN3 A;  1X75 C;  2HBP A;  2V26 A;  2ZCF B;  3EFO B;  4EMK A;  5GJW B;  3M0P A;  4JZ3 A;  4JRK A;  2ESW A;  2DL3 A;  4GY5 A;  2OAW A;  2WAC A;  5FLX E;  1G8X A;  4C92 A;  2AKL A;  3M59 A;  3CME Q;  1K8A R;  5KYY B;  1ZSZ B;  1D3B B;  2EIF A;  2YLC A;  3OYN A;  5FU6 C;  4M75 B;  4MDW A;  3PMT A;  1PRM C;  3OYD A;  1VQ9 T;  2DET A;  2KSS A;  1MV3 A;  4X1V A;  4PJO G;  4J9G A;  1NJI R;  3N5B B;  2PU9 B;  1RAE B;  2K5F A;  3THK A;  1W2B P;  3HFN A;  2CP3 A;  4E7Z A;  2JT4 A;  4LUE A;  3DB4 A;  5KYX A;  4XAX B;  4RG2 A;  5IHN A;  1IGU A;  5LJ3 h;  2RHY A;  4HA8 A;  4XTW A;  1GCP A;  2FZK B;  1KHC A;  4M7D D;  1QKW A;  2X4W A;  4J9C A;  3JB9 I;  2V8K A;  3OYJ A;  1QP2 A;  3OS5 A;  3CD6 T;  4XU0 A;  4EDU A;  2QQR A;  3DLL A;  1BI0 A;  3QYG B;  1RAC B;  5GMK i;  2CS7 A;  2HCK A;  2EQK A;  3M55 A;  4F04 B;  4M78 F;  5GMK l;  3OYC A;  5GAM e;  4C0D C;  2GQV A;  3QKJ A;  2HEQ A;  2HL3 A;  2CUB A;  2DXB A;  2RQT A;  1MNE A;  5CKF A;  1VQ9 A;  3PVL A;  5GJV B;  3MEV A;  1VQO Q;  4C8Q B;  2PVD B;  1BCO A;  3S3M A;  2L8D A;  2DL4 A;  4V2S A;  2RQV A;  1CKB A;  1BBZ A;  1Y96 A;  2DM1 A;  4VUB A;  1WDX A;  3OYB A;  4M78 G;  2KNB B;  1H8K A;  1WXB A;  3UPU A;  2HZY A;  1Q81 R;  1M4Z A;  2EW3 A;  3MP8 A;  7AT1 B;  1ABO A;  1PM3 A;  3G4S Q;  4M7A A;  2GCX A;  3C0C A;  3VS3 A;  3CME T;  2M51 A;  1QQJ A;  1GBQ A;  4AG1 C;  1BI1 A;  3I5S A;  3MEW A;  5EC7 A;  3CD6 A;  2FHD A;  1QP3 A;  4II1 A;  1X6B A;  4XU3 A;  2QTV A;  1AT1 B;  2PVO B;  4DEY A;  2XIC A;  1ZX6 A;  1LPL A;  2FYK A;  4OVA A;  1VQP T;  5LL6 S;  3S3O A;  2K79 A;  2FPD A;  3NHN A;  3LYI A;  4LDV A;  2HQE A;  4A4G A;  1KHI A;  3ER0 A;  1UEC A;  1TWB A;  2HBW A;  1PNJ A;  1M8M A;  2L5Q A;  4D6W A;  1I8F A;  4MZT A;  4M77 C;  3SEM A;  1C0M A;  5HKC A;  3A5Z B;  1ZA1 B;  4M4Z A;  1IHW A;  3CME A;  3X28 B;  3FJP A;  2V8J A;  1GBR A;  5CO7 A;  1D0Z A;  3MP1 A;  5LJ5 g;  2RI3 A;  4M7D B;  2JM9 A;  4JPB W;  3CCE Q;  1Y0M A;  2FB7 A;  1M2V A;  1VQO T;  4KBM B;  5LJ3 d;  1OPK A;  2GFA A;  5M9O A;  3EG9 A;  1OU8 A;  1VA7 A;  4Y28 E;  2FPF A;  4OB0 B;  3M4G A;  4PL6 A;  2LT4 A;  1VQP A;  1HJD A;  1B7T A;  4L59 A;  2P4T A;  3G4S T;  1MHN A;  5FU6 B;  1AWO A;  4QVD A;  3I55 Q;  1QVF P;  1GRI A;  1PSF A;  4OMM A;  2YSQ A;  2PVG B;  3GPL A;  3CPW S;  4FYW B;  3CCS Q;  1MV0 B;  1UEB A;  4J9I A;  2AIR B;  3QJY A;  2OAU A;  3CC4 Q;  2CZ1 B;  5IT9 E;  2LX9 A;  1H92 A;  1I81 A;  5GMK h;  1W2B S;  1VQO A;  1BU1 A;  1C1A A;  3EGX A;  4RMO A;  3JCM b;  1M3B A;  2RB6 A;  4PFZ A;  4M78 E;  3H0F A;  3M4Y A;  4OMN A;  4LNP A;  2QEX T;  2OTL Q;  1H3H A;  1SRM A;  1Y57 A;  3RIR A;  1U5S A;  4J7I A;  1YIT Q;  3ZFJ A;  1JXM A;  2KXC A;  3VKI A;  3V8K A;  3G4S A;  9ATC B;  4C0D B;  4OMP A;  1RAH B;  1TTH B;  3TSZ A;  1CKA A;  4CI0 C;  4FYX B;  2HQH A;  3S3N A;  1U8R A;  2L0A A;  2X4X A;  5GAN 2;  2HAX A;  2QAS A;  1R0B G;  1WYX A;  2R5M A;  3CCE T;  4R0K A;  1VQL Q;  2RHX A;  2FRW A;  2JJ9 A;  4CC3 A;  4F16 A;  1QCO A;  4C5G A;  4F17 A;  2SEM A;  3QDF A;  2EKH A;  3M54 A;  2NUT B;  1AWJ A;  4EMG A;  1TUD A;  4WF2 A;  4Z02 A;  3OMC A;  2KRN A;  4R55 A;  1TSF A;  2BE9 B;  4EMK C;  3JCM g;  3I55 T;  1NLO C;  3VS5 A;  5GAO r;  1LVK A;  1TH7 A;  1AOJ A;  5GAN g;  4C92 C;  1WPY A;  2QEX A;  4WTO B;  1BB9 A;  1KQS A;  1EIF A;  1OX9 A;  2GTJ A;  3CCS T;  3M9Q A;  3SFM A;  1W4S A;  4M75 F;  2VGM A;  3L2R A;  1N8R C;  2CP7 A;  1UE9 A;  3RDV A;  3RNJ A;  3CC4 T;  1QKX A;  3QYH B;  4A54 A;  2H3E B;  3OB9 A;  3R6O A;  2KRO A;  3JCM V;  4DBF A;  3H8Z A;  4HKE A;  3PE0 A;  3CCE A;  3CBP A;  2QK0 A;  2XDB A;  3SWN A;  5KH6 A;  2X4Y A;  4IUV A;  1QVG A;  5GAN 4;  3CC2 Q;  4J9H A;  1G5V A;  2OTL T;  2EYQ A;  1QVP A;  2MCN A;  1YIT T;  4EPC A;  4ZN1 A;  4QQ6 A;  3TVT A;  3HRU A;  2A08 A;  2K2M A;  2EGC A;  2CZ7 B;  4ELY C;  3I55 A;  4E7L A;  1KJW A;  3EG3 A;  1WQW A;  4E6R A;  5CR2 A;  2DTI A;  4N4I A;  3OYL A;  4NS5 A;  2ROL A;  3CCS A;  1N8R R;  1QWF A;  2DLP A;  2QQ9 A;  1OI1 A;  3RKX A;  3U23 A;  5KCH A;  2PTK A;  3HFO A;  3VS6 A;  1VQL T;  1H64 1;  1K73 R;  2DJZ A;  3CC4 A;  1D0X A;  3ULR B;  3KBG A;  4RUG A;  4C8Q F;  4M78 A;  1BKB A;  3I9Q A;  4KUL A;  2VWF A;  2HDA A;  2LCS A;  2XI9 A;  2F69 A;  5GAO n;  2BZY A;  3OY9 A;  2QXF A;  1ABQ A;  3V7S A;  1M90 U;  2IIM A;  4KH1 B;  1D1A A;  1F1B B;  5GAN 5;  4M7A C;  1SSF A;  3A8O B;  2M02 A;  2OTL A;  3JB9 D;  2P4R A;  1YIT A;  3LW5 E;  4ME7 A;  2EYY A;  4XK8 E;  3VS7 A;  2D8J A;  3L1A A;  4C0G A;  4C8Q G;  5KYN A;  1VYT A;  1XNI A;  2E1H A;  2KI7 A;  1NPR A;  4D8K A;  4RTZ A;  5GAO m;  2LQ8 A;  4J83 A;  5CIU A;  2FEI A;  2M0Y A;  3VUB A;  3CMA Q;  5AT1 B;  2OTJ Q;  5L23 A;  1Y07 A;  2HL5 C;  2O4X B;  5GAM g;  1ZBX A;  1VQL A;  1JRI A;  1UJ0 A;  2SRC A;  2YXY A;  3HP9 A;  1WHK A;  2YUN A;  3X26 B;  1SEM A;  1X01 A;  3JB9 J;  4CRI A;  1WJQ A;  2FVU A;  1UGS B;  4GLM A;  2HD0 A;  2E5Q A;  3MKD A;  2EGE A;  3EHR A;  1VQ4 Q;  2YRV A;  1TUG B;  4HCB A;  3A8M B;  4JLI A;  2IPO B;  3F70 A;  1X6G A;  3M0S A;  2YWW A;  1GXI E;  2K2V A;  1QVF A;  3EFS A;  1WIE A;  2MAM A;  1ZA2 B;  5IXF A;  1M3A A;  2LX7 A;  2ZPG B;  1M90 C;  1XTD A;  2AZS A;  2ZPF B;  4RTU A;  3L2Z A;  4JRP A;  2RF0 A;  1M1G A;  2EAY A;  3UWN A;  2RI5 A;  1N9S A;  3T9N A;  2JS0 A;  4M7D F;  1G2B A;  1QCN A;  4J9F A;  5KYW B;  1G3W A;  2QDY B;  3FRN A;  4WCI A;  2DTO A;  1NZ9 A;  2Y90 A;  1K76 A;  1PC0 A;  3M56 A;  2RNA A;  3OYG A;  4OML A;  1S72 Q;  1YHQ Q;  4N0A C;  1RLQ C;  4M75 E;  3Q1J A;  3LWH A;  2DXU A;  1VQ7 Q;  3QZ9 B;  2E3I A;  3BW1 A;  2EKO A;  1NYG A;  2COW A;  1I5O B;  2GTO A;  4E7H A;  1YJN Q;  1CSK A;  4FYY B;  2ENM A;  3MJX A;  4JRI A;  4O6J A;  1YWP A;  2HMA A;  5DY9 A;  4B9X A;  2KE9 A;  1YIJ Q;  1M90 R;  2DFU A;  2RD1 A;  2DIL A;  3CMA T;  5GMK e;  3KFV A;  2RH2 A;  2R5A A;  3OSV A;  2OTJ T;  2K57 A;  2YRD A;  2E4H A;  1MMD A;  3HPW A;  2P0Q A;  1GL5 A;  2DEU A;  2A37 A;  2DTH A;  1M9S A;  1WXT A;  2DBM A;  1WJS A;  3OS0 A;  2EJ9 A;  2VVK A;  4FT2 A;  1K9M R;  4F7U B;  3L2W A;  1VQ4 T;  2JOY A;  3SD4 A;  3E2U A;  4K11 A;  1QWE A;  2E3H A;  4PFO A;  1JB0 E;  2QA4 Q;  2NLU A;  2JZ2 A;  3CPW P;  1G3S A;  3V7C A;  2RHI A;  4DBQ A;  5DM7 R;  1PKS A;  2CP2 A;  8ATC B;  1UG1 A;  4AFQ C;  2AT1 B;  3G6E A;  4C8Q E;  2K5I A;  2AK5 A; 
#chains in the Genus database with same CATH homology
 2DVJ A;  2KGT A;  2DYB A;  2FO0 A;  4JJB A;  3SEM A;  2O31 A;  2JMA A;  2O9S A;  2RQU A;  2J6F A;  4RTY A;  1W6X A;  4M4Z A;  2CDT A;  4OMO A;  4AFU C;  2LQW A;  1TG0 A;  1GBR A;  4GBQ A;  1YWO A;  2HSP A;  1X69 A;  3SHW A;  4OMQ A;  2MOX A;  1NEB A;  2JM9 A;  2EYZ A;  4JPB W;  3ZL7 C;  1ZBJ A;  1Y0M A;  3PVQ A;  2KYM A;  1KSW A;  1SHG A;  2OJ2 A;  1T0H A;  1OPK A;  3M0Q A;  1VYU A;  2D8H A;  3M0T A;  2EGA A;  2CSQ A;  5IH2 A;  1VA7 A;  2FPF A;  2ABL A;  2K6D A;  2KR3 A;  1Z9Z A;  3VS1 A;  1PWT A;  2LJ1 A;  1UGV A;  2B86 A;  5FWB A;  5FWC A;  1HJD A;  2L3Q A;  2VKN A;  1WA7 A;  2EVR A;  1AWO A;  1GRI A;  1JXO A;  2DA9 A;  4OMM A;  2CT3 A;  2YSQ A;  2RN8 A;  1PRL C;  1NM7 A;  2DL7 A;  1OV3 A;  2I0N A;  1E6H A;  1S1N A;  2EPD A;  1MV0 B;  1LCK A;  4J9I A;  3NMZ C;  1SPK A;  1VYV A;  1SHF A;  1ZUY A;  4CC2 A;  1YP5 A;  4Y92 A;  1K0S A;  2D0N A;  3REA B;  2EQI A;  2DRM A;  1UHF A;  1H92 A;  2KBT A;  1X27 A;  1B3Q A;  1TUC A;  1T3S A;  2C0I A;  1BU1 A;  1ARK A;  1B07 A;  3QWX X;  4LN2 A;  2J06 A;  3FJ5 A;  2RPN A;  2JM8 A;  1M3B A;  3H0F A;  4OMN A;  2X3X D;  2DE0 X;  4LNP A;  1H3H A;  2PNI A;  1SRM A;  1Y57 A;  1BK2 A;  1NYF A;  1U5S A;  2L3S A;  1U06 A;  1AVZ C;  2A36 A;  4KRT A;  2F2X A;  1JXM A;  5IXB A;  2KXC A;  2O88 A;  2FG0 A;  4OMP A;  1FMK A;  3GBQ A;  3TSZ A;  1CKA A;  2LJ3 A;  1WI7 A;  2JS2 A;  4Z8A A;  1JO8 A;  1QCF A;  1AWX A;  2L0A A;  2K3B A;  1XOV A;  1ZSG A;  1WYX A;  4RTV A;  3H41 A;  1ZUU A;  2PZ1 A;  4LE9 A;  1UFF A;  4R0K A;  2L3P A;  3EG1 A;  2FRW A;  2JXB A;  4CC3 A;  4F16 A;  2KRS A;  1X2K A;  2RQW A;  4F17 A;  2V1R A;  2SEM A;  2O9V A;  2EKH A;  5I22 A;  1JEG A;  1OPL A;  1OEB A;  1AWJ A;  2EBP A;  4ESR A;  1M27 C;  1TUD A;  1JQQ A;  3QWY A;  4HCK A;  2KRN A;  2KT1 A;  3LH5 A;  2BTT A;  1ZLM A;  3EHQ A;  1Z9Q A;  1WFW A;  1I07 A;  1NLO C;  3VS5 A;  2X3W D;  1AOJ A;  1OOT A;  2C0O A;  1T3L A;  1YCS B;  1BB9 A;  1PHT A;  2GTJ A;  2KXD A;  3H0I A;  3UA6 A;  3UF4 A;  2CT4 A;  5FW9 A;  4EIK A;  2FRY A;  1JU5 C;  2BZX A;  4RTX A;  5HCK A;  2ECZ A;  2D1X A;  1UE9 A;  1UDL A;  3RNJ A;  1K4U S;  3NPF A;  1QKX A;  2JMC A;  2KRO A;  2DRK A;  3UA7 A;  3TSW A;  4CC4 B;  2GGR A;  1HD3 A;  3PE0 A;  1E6G A;  4ORZ A;  3RBB B;  2DMO A;  2LJ0 A;  5IHI A;  2J6K A;  5IHK A;  2ROT A;  2AZV A;  2LMJ A;  3A98 A;  1AEY A;  4J9H A;  3VS0 A;  4D8D A;  4J9B A;  1GCQ C;  2J7I A;  2MCN A;  1N5Z A;  4LUD A;  2A28 A;  2CRE A;  3CQT A;  1FYN A;  2BZ8 A;  1M3C A;  2MIO A;  3TVT A;  1EFN A;  2KRM A;  5I11 A;  2A08 A;  4AG2 C;  2OI3 A;  2K2M A;  2C0T A;  2EGC A;  1WXU A;  4Z88 A;  4Z89 A;  3VRY A;  1KJW A;  3EG3 A;  4F14 A;  4HVW A;  1QLY A;  4E6R A;  1MUZ A;  2L2P A;  2ROL A;  2DJQ A;  1QWF A;  2DLP A;  2CUD A;  1KFZ A;  1W1F A;  2XMF A;  2CH4 W;  4IIM A;  3U23 A;  2KT8 A;  2PTK A;  3VS6 A;  1I1J A;  3O5Z A;  3ULR B;  2QDL A;  1NEG A;  2JTE A;  1W70 A;  1NLP C;  2CSI A;  4RUG A;  4AFS C;  4A63 B;  3REB B;  2GQI A;  3I9Q A;  1AD5 A;  2VWF A;  2HDA A;  2LCS A;  4JJC A;  1UHC A;  1X2Q A;  1IO6 A;  2CH4 A;  2JW4 A;  4RTT A;  1SRL A;  3VRZ A;  2BZY A;  1HSQ A;  2NWM A;  1ABQ A;  1I0C A;  2IIM A;  2RMO A;  3M0R A;  4JZ4 A;  1KIK A;  1E7O A;  4IIO A;  3R6N A;  2W10 A;  1K0X A;  2DBK A;  1AZG B;  2LZ6 B;  4FSS A;  4AFZ C;  3I5R A;  1UTI A;  2P4R A;  1X43 A;  1AWW A;  2EYY A;  4HVV A;  3VS7 A;  2D8J A;  5GJW B;  3M0P A;  1VYT A;  4JZ3 A;  4DEX A;  1UJY A;  2ESW A;  2DL3 A;  4D8K A;  4RTZ A;  2OAW A;  3EGU A;  2AKL A;  2FEI A;  2M0Y A;  1GFC A;  3NGP A;  5L23 A;  2H8H A;  1PRM C;  3H0H A;  1MV3 A;  4X1V A;  1UJ0 A;  2SRC A;  1UUE A;  2G6F X;  2YUN A;  4J9G A;  1SEM A;  1AZE A;  3EG0 A;  3THK A;  4ZNX A;  2DL8 A;  4GLM A;  2W0Z A;  2EYW A;  2F2V A;  2EGE A;  2JT4 A;  3EHR A;  1YNZ A;  4HVU A;  4LUE A;  1T0J A;  5IHN A;  1X6G A;  1K1Z A;  3M0S A;  2LNH B;  1GCP A;  1WIE A;  5IXF A;  1GCQ A;  1M3A A;  1QKW A;  1NG2 A;  2LX7 A;  2RQR A;  4J9C A;  2AZS A;  4RTU A;  2RF0 A;  1SSH A;  3M0U A;  2ED1 A;  2EYX A;  2JS0 A;  1G2B A;  4RTW A;  4J9F A;  2HCK A;  4WCI A;  5ECA A;  2E5K A;  1K76 A;  2LQN A;  2HEQ A;  2CUB A;  2YUO A;  2RQT A;  2RNA A;  4OML A;  1RI9 A;  1J3T A;  3PVL A;  1RLP C;  1K9A A;  4JJD A;  5GJV B;  1RLQ C;  2DX1 A;  2DL4 A;  2RQV A;  1U3O A;  1CKB A;  1BBZ A;  2GBQ A;  1NYG A;  2DM1 A;  2ED0 A;  1WDX A;  2GTO A;  2KNB B;  1H8K A;  1WXB A;  1ZUK A;  2DF6 A;  1CSK A;  2LP5 A;  2ENM A;  2EW3 A;  1WX6 A;  1ABO A;  1YWP A;  2F2W A;  2YDL A;  2KE9 A;  3C0C A;  3VS3 A;  2M51 A;  4J9E A;  4HXJ A;  2DIL A;  3I35 A;  1V1C A;  2YUP A;  3KFV A;  1GBQ A;  1WLP B;  4AG1 C;  2J6O A;  3I5S A;  5EC7 A;  4QT7 A;  1G83 A;  2YUQ A;  2J05 A;  2K7A A;  1A0N B;  1PKT A;  1GL5 A;  2AKK A;  2V1Q A;  4J9D A;  1M30 A;  1X6B A;  2A37 A;  1WXT A;  2DBM A;  3VS2 A;  4DEY A;  2VVK A;  1ZX6 A;  3EG2 A;  3IQL A;  4K11 A;  1QWE A;  2YT6 A;  2K79 A;  2FPD A;  3UAT A;  3NHN A;  1GFD A;  1PKS A;  2DL5 A;  2NUZ A;  3JV3 A;  1UEC A;  2KYB A;  2HBW A;  4CC7 A;  1PNJ A;  2K9G A;  2GNC A;  1UG1 A;  3VS4 A;  4AFQ C;  2KEA A;  1M8M A;  1YN8 A;  2DNU A;  2O2O A;  2FPE A;  2AK5 A;  1RUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...