1UUEA

A-spectrin sh3 domain (v44t, d48g mutant)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKTEVNGRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN
publication title Solvation in Protein Folding Analysis: Combination of Theoretical and Experimental Approaches
pubmed doi rcsb
source organism Gallus gallus
molecule tags Sh3-domain
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uueA00
1PHTA 1WXUA 1WX6A 4X1VA 3VS1A 1K4US 4RUGA 3H0FA 1M3AA 1K1ZA 2JS0A 2PTKA 4LUDA 2A08A 2X3XD 2O31A 2AZSA 1WYXA 2FPEA 1WIEA 2BZXA 1CKBA 1NLOC 2EYYA 4JJCA 4ZNXA 3SHWA 3UF4A 3JV3A 4HCKA 2O9SA 1H92A 2CDTA 4AFZC 1ZX6A 1X6GA 5I22A 2JM8A 2HCKA 1AWXA 2JMAA 1T0JA 2KE9A 1ZUYA 4R0KA 3FJ5A 2MIOA 4LNPA 2D1XA 1BBZA 2W10A 2EVRA 2ABLA 1PKSA 1UFFA 4AFUC 3RNJA 2C0IA 4OMNA 1RLQC 1SPKA 2AKKA 2BZ8A 1OPLA 2BZYA 4AFQC 3VS7A 2EYZA 2C0TA 3SEMA 5GJVB 4F14A 2KNBB 1M27C 1S1NA 3PE0A 4HVVA 1QLYA 2JXBA 4JZ4A 1WFWA 4JPBW 3I35A 2LJ3A 3EHQA 2RQTA 2CUBA 2OI3A 2MOXA 3TSWA 2NUZA 1E6HA 1M3CA 2A28A 5GJWB 3NPFA 4KRTA 1YWPA 2KROA 4LUEA 1W6XA 2JS2A 1GCPA 2KXCA 1M30A 1AVZC 1SRLA 2RMOA 1AZEA 2GBQA 3M0SA 2FPFA 1GBRA 4HVUA 1X27A 2FO0A 1YN8A 4AG2C 1FMKA 4GLMA 3IQLA 1N5ZA 2JW4A 2YDLA 4FSSA 2LQNA 1BU1A 1CKAA 2BTTA 2J6OA 3RBBB 2JM9A 2XMFA 3LH5A 2MCNA 4ORZA 4J9GA 2VWFA 2DL8A 3VRZA 1VYVA 4OMLA 4QT7A 4OMQA 1U3OA 2EYWA 3ZL7C 2DMOA 1TUDA 2W0ZA 2D0NA 2K7AA 1BB9A 2L2PA 1JU5C 2RF0A 1JO8A 2F2XA 1UTIA 1PKTA 3M0PA 2J6FA 2DYBA 1TUCA 1IO6A 1E7OA 1UJYA 2LX7A 2V1RA 2K6DA 1NG2A 2CT3A 2DL4A 2I0NA 1W70A 2FEIA 2K9GA 4RTYA 3M0RA 1AZGB 1G2BA 5FW9A 3EG3A 1AOJA 2DBKA 1JXMA 3REAB 3TSZA 1ZUKA 1T0HA 3NHNA 2DILA 1JXOA 3VS5A 2SRCA 4CC3A 2NWMA 2PZ1A 4D8DA 3C0CA 2YUOA 1GFDA 3I5SA 2KRSA 2DX1A 1NYGA 2D8HA 2O9VA 4JJBA 2DLPA 2ENMA 2ROLA 3VS0A 5IH2A 3GBQA 3NGPA 4RTZA 1X6BA 1ZSGA 1PWTA 1AWJA 2M0YA 2DJQA 1OPKA 1WLPB 2D8JA 3PVLA 5IHNA 1RLPC 1VA7A 2H8HA 3H0IA 1Y0MA 2HBWA 2DVJA 2SEMA 1HD3A 2KT1A 2F2WA 4AFSC 1HSQA 3VS6A 4DEXA 2GNCA 1X2QA 1ABQA 4DEYA 2RQRA 2CH4A 2EW3A 2FPDA 2IIMA 2EGEA 2YUQA 5IXFA 2OJ2A 2DL3A 2K3BA 1H3HA 3EHRA 2EQIA 2B86A 2KYBA 3M0UA 1UECA 3VS3A 1V1CA 1GFCA 1RI9A 3TVTA 2RQVA 4K11A 3EG2A 4HVWA 2ROTA 2HSPA 4Z8AA 3NMZC 3CQTA 2J05A 2HDAA 3REBB 2A36A 1QWEA 2GGRA 2RQWA 3I9QA 5IHKA 2CREA 5FWCA 2E5KA 5L23A 3O5ZA 3PVQA 2LCSA 4J9EA 1T3SA 1NLPC 1J3TA 3QWXX 4IIMA 2K79A 4WCIA 4GBQA 5FWBA 2C0OA 2K2MA 3M0TA 2JMCA 2KXDA 1MUZA 1ABOA 2L3PA 2EYXA 4Z89A 2LMJA 4J9CA 2O88A 1A0NB 5EC7A 1U5SA 1GBQA 1Z9QA 1G83A 4RTWA 1AWWA 4RTTA 2RNAA 3QWYA 1HJDA 1KFZA 1WXBA 2LJ0A 1GRIA 1I07A 4HXJA 1XOVA 2KT8A 2KBTA 1NEBA 1ZLMA 1UDLA 1TG0A 2HEQA 4Z88A 4LE9A 2CSIA 1U06A 1AEYA 4IIOA 2LZ6B 2L0AA 4OMPA 1B07A 1UE9A 4AG1C 1X43A 3VS2A 1YNZA 2L3QA 1JQQA 2DBMA 1I0CA 1AWOA 2OAWA 1Z9ZA 1E6GA 1YWOA 4CC7A 2DA9A 2DL7A 2ESWA 4J9FA 1NM7A 1MV0B 3EG1A 1UHCA 1KSWA 2CUDA 2FRWA 1PRLC 3ULRB 2RPNA 2DF6A 2P4RA 2RQUA 4OMMA 3A98A 5I11A 1B3QA 1K0SA 4D8KA 2F2VA 4LN2A 2JT4A 1X2KA 1PNJA 1ZUUA 1VYUA 2A37A 1YP5A 1SEMA 2CH4W 2M51A 2EPDA 3EGUA 2DE0X 4CC4B 2VVKA 1SRMA 3H0HA 4F16A 1QKXA 1EFNA 2EKHA 1I1JA 2GTOA 2YUNA 2GQIA 1W1FA 3KFVA 1NEGA 4Y92A 1KJWA 5ECAA 1UGVA 4RTXA 1SSHA 3EG0A 1QKWA 1UJ0A 2KGTA 2V1QA 1WXTA 1M3BA 4E6RA 1K76A 1UG1A 2AKLA 2KRMA 1WA7A 1GCQA 1LCKA 5IXBA 2O2OA 3H41A 2X3WD 3I5RA 2ECZA 1WI7A 1OV3A 2CSQA 3M0QA 3VRYA 3R6NA 2YSQA 2RN8A 1T3LA 2J6KA 2AZVA 1QWFA 3UATA 1JEGA 2LQWA 2J06A 4F17A 2EBPA 2G6FX 4OMOA 2ED1A 1AD5A 2KEAA 2EGCA 1VYTA 2DL5A 4CC2A 2QDLA 2KR3A 3U23A 1OOTA 1GCQC 4M4ZA 2JTEA 5IHIA 1H8KA 2FG0A 2KYMA 2LP5A 2J7IA 1UUEA 5HCKA 4J9DA 4JJDA 2DRKA 1RUWA 4EIKA 1MV3A 4J9HA 1CSKA 1UHFA 1NYFA 2AK5A 3UA7A 4RTUA 1QCFA 4J9BA 1PRMC 2LJ1A 1X69A 1ZBJA 1SHGA 2ED0A 2YT6A 2DRMA 3UA6A 2EGAA 2PNIA 4A63B 1Y57A 1ARKA 3THKA 1SHFA 1FYNA 1M8MA 2KRNA 2LNHB 2GTJA 4ESRA 4J9IA 3VS4A 1KIKA 2L3SA 2DM1A 1WDXA 2YUPA 1OEBA 4JZ3A 2DNUA 1K9AA 2FRYA 2CT4A 1BK2A 4RTVA 1K0XA 2VKNA 1YCSB 1GL5A
chains in the Genus database with same CATH superfamily
2DERA 1WXUA 1BI2A 3MPUB 2RH2A 2VC8A 3I56A 2JS0A 1PG5B 2A08A 2AZSA 4JLIA 2FPEA 3JCMV 2EYYA 1NLOC 1X01A 3JV3A 2O9SA 1VOMA 3OBWA 2CYZB 3L2WA 2QEXT 2JM8A 2EJGA 4XTYA 4HT9A 2R57A 2JMAA 2KE9A 3V7SA 3CC7A 4NL3A 4N0AC 4A4FA 2MIOA 2OTJT 1BBZA 1QVFS 4R56A 3DB4A 3PFSA 3OYDA 3E1SA 5KYYA 3KXTA 5GMKm 3CCMQ 1OI1A 1BCOA 1S1NA 4FCYA 1QLYA 2JXBA 1W2BS 4JZ4A 1WFWA 3GF5A 4XK8E 5KYUB 4XTXA 5FU6C 4DBFA 4JPBW 3I35A 1WPYA 1PSEA 2O4XB 5LJ3f 1VQNQ 4M7DC 2MOXA 1HXDA 2A28A 2Y90A 2EFIA 4A53A 4PJOF 2JS2A 1QP3A 2M16A 1VQOT 3OB9A 3WVDB 2KXCA 3JCMh 2E65A 1AVZC 2YRDA 2DD4A 1B34A 1JB0E 2RMOA 2ZPHB 4J6WA 3G1JA 4M75D 4A4EA 3L2ZA 2GBQA 4BACA 4MDXA 4HVUA 1X75C 2WACA 3CPFA 1D0XA 4GLMA 2VYTA 1R0CB 2F5KA 1FMWA 1BU1A 1CKAA 4QVDA 4C8QF 2E1HA 3EFSA 3LH5A 4FT4A 1KD1R 1YCYA 1UGPB 4ORZA 2VWFA 2DL8A 1YITT 4E7IA 4ZTFA 1H3ZA 2KK4A 4M78A 4OF1A 1BB9A 2L2PA 1JU5C 2BKDN 1OULA 3GLXA 4XU1A 4BDZA 4HT8A 2LX7A 2PVGB 3JCMe 1KC8U 4M7AA 4BY6B 3CCLT 2DL4A 2DXBA 2I0NA 2FEIA 1VQ5T 1QVFP 1KHIA 1PD0A 3JCMJ 4RTYA 3M0RA 4IUUA 1G2BA 5FW9A 2MPXC 3T9NA 3OS2A 3EG3A 5GMKl 4DQ2A 2G3RA 1YI2T 4KGZB 3TSZA 4BE1A 4F7UG 3MO8A 4Y91A 2DIGA 1M90C 3C95A 2P84A 2QTXA 5FRNA 3F70A 3DKMA 3RKXA 3SWNB 4KBMB 2NWMA 2PZ1A 4D8DA 3C0CA 4C0DB 1GFDA 4FIBA 2D8HA 2DLPA 2ROLA 4QQGA 2M9UA 1KQ1A 5GAOl 3GBQA 4LDVA 1VQ7T 4RTZA 3L42A 2COZA 1NJIR 2FVUA 3CCMA 4PJJA 4C8QG 2DXUA 3R6OA 1C6VX 1PC0A 2COYA 2RK1A 1VQNA 3EH2A 1HD3A 4M77G 1NJIU 1X2QA 4PFZA 2EW3A 1ZA1B 4FSXA 2FPDA 1RL2A 5CKBA 2ZAEA 1Q86C 1VQLQ 1KHCA 2DL3A 2BE7D 4V2SA 1H3HA 3I55T 3EHRA 1VIEA 4F7UE 3LWHA 4FYVB 2X4YA 2GF7A 3V8KA 2DXTA 4NS5A 2LVMA 3TVTA 4K11A 1Q82C 2ROTA 1M2VA 3JCMW 5IN1A 2OAUA 3QYGB 2HDAA 3CD6T 2A36A 1QWEA 4PFOA 3CMET 2GGRA 2HKQB 3X24B 2LQ8A 5IHKA 2A3LA 5FWCA 2E5KA 3D7SB 4J9EA 5GAN6 3FJPA 2CZ1B 2HSEB 4JJNK 5FWBA 1YFNA 1O75A 5CR2A 3M0TA 4N4HA 5FU6B 2EWNA 3OYJA 2O88A 4M7DB 4O5VA 1UB4A 4M77E 1QVFA 4RTTA 3A5ZB 2RNAA 1W4SA 3A8GB 3QUIA 4DOWA 3MEVA 1KFZA 2LJ0A 1GRIA 2KSSA 1IGQA 1W2BA 2KT8A 5LJ5f 2KBTA 3P8HA 4ZTJA 1M5Q1 2MK5A 1MHNA 4LE9A 3CCET 2H3EB 1U06A 3OY9A 1KG1A 1B07A 1UE9A 1X43A 4E7LA 3VS2A 2LT4A 4DA4A 2BIVA 2EQJA 3JCMX 1E6GA 2NUTA 4LDXA 1YWOA 5GAMf 4PJOC 3SB2A 1NM7A 2VXFA 3MP6A 4DBQA 1KSWA 1PRLC 1QCOA 1JJ2S 2RPNA 3A98A 2OTLT 1K0SA 2F2VA 4LN2A 1X2KA 1D0ZA 1V29B 1VYUA 1YP5A 2CH4W 3QJYA 3CCQA 1VQLA 2M51A 3OYEA 3CCRQ 2EPDA 4CC4B 4C8QC 1BIAA 3QO3A 2BUDA 1QKXA 1EFNA 4JRIA 5IT9E 1U8RA 2QQAA 4FW2A 4IUVA 5KE3A 4M7AD 2E3HA 3BW1A 1UGVA 4RTXA 4RKUE 1QKWA 1UJ0A 2DK3A 2DEQA 3L2UA 3JB9F 2ZPFB 4AT1B 2QAZA 3E9GA 1UG1A 2AKLA 1QVGP 1WA7A 3RUXA 3JCMf 1PSFA 1BI3A 1YJ9T 5LJ3h 2QTVA 2ECZA 3GNGA 1WI7A 4FL6A 2CSQA 3VRYA 3MEWA 1ZSZA 2DETA 2LQWA 2Y4YA 2EQKA 4OMOA 2ED1A 3FLGA 1FWZA 3QHSA 3CMAQ 2YLBA 3H9NA 4KULA 1K73R 5GAOr 2P0QA 1JJ2P 5KYNA 5IHIA 2KYMA 2MWPA 1BI1A 1UUEA 3QYHB 5HCKA 3PTAA 2K3XA 1IGUA 1N9SA 3OS1A 1UHFA 3HRTA 4YTLA 2K3YA 2KY9A 4RTUA 1LOJA 2F5TX 2PVDB 3NTHA 1VQNT 4QVCA 4OVAA 1D1AA 4M7DF 2EQUA 2RI5A 2DRMA 2EGAA 2PNIA 4ZGEB 1SKUB 1Y57A 1VQPT 2KMTA 4KGXB 3JB9G 2PUOB 1FYNA 1RABB 1D1BA 3META 3L2RA 2RD1A 1KIKA 2L3SA 3S6WA 2HQHA 5LL6S 4ANJA 2VGMA 3QIIA 1QP2A 1RACB 3CCRA 4RTVA 1JBMA 1YCSB 3V8JA 1PHTA 4KH0B 1WX6A 4IUQA 4C92F 2KQWA 4HCBA 1K4US 4RUGA 4BDYA 1GXIE 1M2OA 2O01E 1WZOA 3QZ5B 4D6WA 1K8AR 2PTKA 4IUPA 2I2LA 1AHJB 4PJLA 1WHKA 2X9HA 1BI0A 2BZXA 2L89A 4JJCA 5CO7A 4LD6A 3UWNA 4AFZC 1IZ6A 1X6GA 1ZX6A 3ZBDA 5I22A 1AWXA 1T0JA 3CC4Q 4LNPA 2D1XA 2EVRA 2ABLA 2F1LA 1PKSA 3OW2S 1UFFA 2K5FA 1QVGA 2AKKA 1XTDA 4PJOB 4HCZA 4AFQC 3VS7A 3OS5A 4M7DG 3FIFA 5GJVB 3FDRA 3PE0A 4HVVA 1C1AA 5LJ3d 1BKBA 3CMAA 4X34A 2LJ3A 3EHQA 2OI3A 3OSVA 1M3CA 1Q7YR 2JOYA 5GJWB 3NPFA 4KRTA 5HK0A 1YWPA 2E10A 5GMKi 1UEBA 2D0QB 1W6XA 4C8QB 4QW2A 3RDVA 5GAMg 2ATCB 2L3RA 3HSBA 2D9TA 1JJ2A 2RHYA 5C6SA 4PLLA 2QASA 3DLMA 2FO0A 4J6XA 1YN8A 3JCMb 1FMKA 2E6ZA 4FW1A 2X4JA 3IQLA 2YDLA 4FSSA 2CZ7B 4KUIA 5KH6A 1I5LA 4J9GA 4OMLA 2EYWA 3EGXB 1KD1C 3J80E 4C0ZA 1TUDA 3HFNA 3OYGA 2K7AA 4M75F 1NE8A 2H3JA 1UTIA 2MAMA 4JS5A 1OX8A 1VQ6T 3EFRA 3LW5E 2DYBA 3HFOA 4F7UA 2V1RA 1NPRA 2NUPA 2AT1B 2X4XA 3OYBA 1NG2A 1TU0B 2QA4Q 2JN0A 1VQ9T 4M7DE 8AT1B 2QG9B 3OW2P 4PJOA 5C0MA 4OMFB 4BUGA 2QGFB 5D7UA 5LJ5h 3VV0A 2VUBA 5D6XA 2CZ6B 3REAB 1ZUKA 2LRQA 1I8FA 1OU8A 1UGSB 1ZA2B 2R58A 4XTZA 2CGHA 3QPHA 1EIFA 4MZMA 1VQKQ 4JS4A 2RA2A 2K57A 4OB0B 1VQMQ 1QCNA 1RAIB 3VS5A 2SRCA 4C8QA 4CC3A 4XAXB 4C5IA 3RMSA 1D0YA 3I5SA 2GCXA 3CC4A 5GAMh 4XQ3A 2DPPB 2GFUA 2DTIA 2ENMA 1RAGB 6AT1B 4M77A 3RKYA 2QQBA 4LDUA 2XI9A 4EMKA 3NGPA 2X51A 4ZGJB 1X6BA 5LJ3j 1ZSGA 1N8RU 5LJ5e 5CVIA 4C5GA 3EGXA 3EFOB 2QGGA 4EDUA 4UC4A 1Y0MA 1G3YA 2HBWA 2SEMA 2KT1A 4A54A 2RM4A 3PIPA 2ZCFB 3C94A 2GNCA 1ABQA 4DEYA 2XICA 2HZYA 1HYOA 3MJXA 1TWBA 5GAMe 2YUQA 3CCST 3ZFJA 3QSUA 3VUZA 1XJWB 2EQIA 1UGRB 2E3IA 3M0UA 4XU3A 1GFCA 4FYYB 1K9MU 5AT1B 3G6ET 3EG2A 5HY6A 2JVVA 5GAOm 4NOYA 2XDBA 4Z8AA 3RR6A 3AT1B 4P5NA 3NMZC 3HTRA 4PFPA 2EQMA 3CCRT 2RQWA 1ZHIA 3I9QA 2FHDA 5GANg 4C92C 3GPLA 1TTHB 1KC8R 2QA4A 1M1KU 3G4SQ 2F69A 2K2MA 1S72T 4Z89A 4IURA 5GAN5 4PK4A 4LD9K 4RTWA 1AWWA 5L8RE 4E7KA 1R8OB 2E6NA 3OW2A 3EFOA 2PU9B 4ATOA 3X20B 5FU7B 3J7AF 1VQKA 1HJDA 3LLRA 1VQMA 3OSSC 1I07A 2ZPGB 1XOVA 3V8LA 2LT1A 2V26A 5KYUA 4B9WA 2O4XA 4XTWA 1D1CA 3LX7A 4CRIA 3M9QA 2RJCA 2QQSA 2LZ6B 4PJOG 2L0AA 4OMPA 4AG1C 3LWIA 1YNZA 2EYQA 2AHJB 3M57A 2OAWA 1Z9ZA 2YLCA 4CC7A 3PMIA 4BD3A 4RCBA 2VB6A 2DXCA 2VXEA 5EG2A 5A2QE 2CUDA 1YIJT 1VQ4Q 2DZ9A 2DF6A 2P4RA 3VYGA 2NYSA 3FC3A 2P0PA 2RK2A 2XHCA 4B6MA 1BYMA 4C5EA 2XK0A 1TOVA 2FL7A 3H0HA 1VUBA 2M0OA 2YUNA 2LC4A 2HQEA 3CCQQ 3KFVA 4M75C 2COWA 2JNGA 4J7FA 1LNXA 1RAFB 2V1QA 3QJ6A 1M3BA 1OX9A 3OYIA 2KDSA 4AMCA 4E6RA 1K76A 3C12A 3JCMd 5CAIA 5GANe 4J83A 4M78F 1GCQA 1JRIA 2O2OA 4X9DA 4PJOE 3JRZA 3G4SA 3R6NA 3J81E 3SWNA 4M7AF 2RN8A 1T3LA 2J6KA 2AZVA 4F17A 1UGQB 4DOVA 1VYTA 1B7TA 5LJ5j 4C8QE 3I56T 2A0FB 5CIUA 4NL2A 3U23A 4M4ZA 4FM4B 1K73C 1H8KA 2LP5A 2JJ9A 2PUKB 5GAN7 1MV3A 3CC7T 1CSKA 3JCMP 1QVGS 1NPPA 2YHTA 5GMKh 1KQ2A 3A8LB 1QCFA 4J9BA 3SD4A 1PRMC 2LJ1A 1SHGA 1Q81C 2QQRA 2ED0A 2YT6A 1G3TA 3UA6A 3JCMQ 1ARKA 3THKA 3TCJA 4C92B 1M8MA 3G71Q 2JTMA 2GTJA 4ESRA 1VQ4A 3VS4A 1KQSP 9ATCB 3OYKA 2DNUA 1K9AA 2FRYA 1IHWA 4XU2A 2CT4A 5CQYA 3A1PA 1K0XA 4N0AA 1WGSA 2HMAA 2FZKB 2DVEA 3BFMA 5GMKe 1WJQA 5KYWB 3M55A 1M3AA 3CC2A 1K1ZA 1M90U 3EG9B 1K8AC 2X3XD 2O31A 1H641 1WYXA 1WIEA 3NTIA 1CKBA 3SHWA 4M78D 3UF4A 3HL8A 4ZNXA 1XNIA 1RAEB 4HCKA 4M7DA 3RERA 2CDTA 2CP7A 2HCKA 3RESA 5D6WA 4PL6A 3OYHA 3JB9I 3FJ5A 3NTKA 4PKCC 1BCMA 4AFUC 3RNJA 3OYYA 1RLQC 1QVPA 2BZ8A 1OPLA 2BZYA 2P4TA 2FZGB 4QKUA 3M53A 4E7SA 4F14A 1YITQ 1M27C 1N27A 3EGDB 1D3BB 1VQMT 2CS7A 4J5YA 4L6V5 3LH0A 4C92A 1OYXA 2RQTA 3MP8A 2CUBA 3EAEA 3TSWA 2NUZA 1LPLA 1LVKA 2RJDA 1SSFA 1Q95G 2L5QA 3JCMc 1Q7YC 3DB3A 1VQ5Q 1MMDA 3SFMA 1Q86U 3M4YA 3VU3C 1M30A 1SRLA 5J3BA 3PMTA 4RG2A 1AZEA 2FPFA 1GBRA 1IRXA 1QQJA 3P8BB 4M75B 3PT9A 1X27A 4HKEA 1YI2Q 4AG2C 5CCAA 4PJNA 1N5ZA 4OGEA 2LQNA 2BTTA 1Q82U 4QQ6A 4FYWB 1VYVA 2QEXA 1U3OA 3CCMT 2DMOA 3G71A 4LDYA 2D0NA 1IREB 4N4IA 1NZ9A 2RF0A 1TH7A 4HA8A 3M0PA 4OB2B 1TUCA 1IO6A 1E7OA 2XIDA 3OBYA 3AHUA 4II1A 2K6DA 5GAN4 1Y96B 4HCCA 1W70A 1WQ7A 2IG0A 4Y28E 3BDLA 1U1TA 2DKGA 4J7IA 2PQWA 1AOJA 2EKOA 2DBKA 3MHXA 2DILA 4N4GA 3OYFA 2A7YA 3CPWS 4KUDK 3EH1A 2LQKA 4M78C 1EZZB 2WSEE 1MMGA 5FROA 1JXOA 1IXDA 1M8VA 4JLGA 1Q81U 5GANf 3WVEB 4M7AC 4PJMA 3L2VA 5I2MA 2KRSA 1NYGA 4CI0C 2M1HA 2O9VA 4JJBA 5KYXB 2HKNA 3VS0A 3BDUA 5IH2A 1WHMA 2EJFA 2DO3A 3OMGA 3PGGA 3M4GA 2M0YA 5D6YA 1OPKA 1WLPB 2D8JA 1YITA 2XDDA 3CD6Q 2NLUA 2RHUA 3GNFB 3PVLA 5IHNA 4ELZC 2H8HA 2GQVA 3H0IA 2DVJA 3X28B 3VS6A 4DEXA 2K5LA 2RHIA 2RQRA 2CH4A 1VQ5A 4QVZA 2IPOB 1PM3A 2IIMA 5IXFA 2E64A 2OJ2A 2DD5A 4IKFA 1YI2A 2B86A 2KYBA 3QDFA 1UECA 1I81A 3VS3A 1Y7XA 5FLXE 2RJEA 1X6OA 1RI9A 1VQ4T 3E9FA 1DJ7B 4RG8A 4HVWA 3CCUQ 4C92G 3CPWP 5CKHA 3CQTA 2WSFE 2CREA 1HK9A 2M02A 5L23A 3CCEQ 1V76A 3O5ZA 2LCSA 1TXQA 1NLPC 1J3TA 3UT1A 1RI0A 4A4HA 2K79A 1G8XA 4WCIA 1FXXA 1KC8C 3OYAA 4PNOA 4GBQA 3MEAA 2JMCA 4OB1B 3CCQT 2KXDA 1VQLT 1MUZA 2L3PA 2KVQG 2EYXA 3SDZA 2R5MA 2LMJA 3GIBA 1A0NB 5GAN3 1GBQA 4JRQA 1Z9QA 4MMKA 5I2SA 1ACMB 2OTLQ 2L8DA 2Y4XA 3HHTB 3JAME 4BE2A 1WXBA 4Z02A 4HXJA 2Z0WA 4JDSA 1ZLMA 5KYYB 3I55A 2YWWA 3KUFA 2QDYB 5GAN8 3N5BB 4Z88A 1PCXA 2JZ2A 2HNIA 3VYHB 2CSIA 4J8OA 4IIOA 2CP3A 2VASA 2DAQA 5J26A 1VQ8Q 1N8RR 4C92E 1JQQA 1M4ZA 2DBMA 1I0CA 1AWOA 3MKDA 2DA9A 2DL7A 2ESWA 3CD6A 1B34B 3A8HB 4KT0E 1UHCA 3MCAB 1WHLA 4Q5WA 1G3WA 5I11A 4D8KA 3L2QA 1YJ9Q 1PNJA 1ZUUA 2A37A 3C4SA 1NJIC 2VV5A 1TS9A 5CKEA 3M58A 4M75G 4F16A 1G3SA 5KCHA 2YXYA 4M78B 1I1JA 3KBGA 2GTOA 1WHGA 3TU4K 4OB3B 3G71T 2LNVA 2GQIA 1W1FA 1NEGA 1K9MR 1KJWA 4EMHA 4OP0A 2CZ0B 5ECAA 5CK9A 1SSHA 2RI2A 3EG0A 4M7AB 3CCUA 3QBYA 2LCLA 4QQDA 2KRMA 5CKDA 1RAAB 3JB9H 1C0MA 2E41A 1IB8A 1LCKA 2HD0A 3CCEA 3PNWC 4FT2A 3CPWA 3H41A 3OYLA 3I5RA 4F7UF 2K4YA 4O6JA 3CEYA 1M1KR 4EMGA 4BI8B 3CCJQ 5I21A 5GAOq 4BI3A 3UATA 1JEGA 1AT1B 2J06A 2EBPA 2G6FX 1VQPQ 1YHQQ 2K2VA 4J6YA 1AD5A 4PLIA 2KEAA 2OTLA 3FEOA 2HL5C 2KR3A 2JTEA 2FG0A 3ER0A 1R0BG 3GOXA 2J7IA 1LJOA 3RKWA 2CP2A 2DTHA 2YRVA 1YJWQ 4JJDA 4M75E 1RUWA 2IVWA 3HRUA 1YJNQ 3MEUA 1ZSZC 2ZGWA 5LJ5d 4M77F 4FU6A 2CKKA 4GY5A 1VQ8A 1ZBJA 1SF9A 2ZPIB 3P8DA 1KD1U 2P0KA 1SHFA 2KRNA 1FMVA 4J9IA 3CMAT 1YBYA 2DM1A 1YJ9A 5GAMd 2ZPBB 2ZPEB 3E19A 4VUBA 3JSCA 3QZ9B 1Y07A 5GAN2 1D09B 1W2BP 3A8OB 3LGLA 4A4GA 2X35A 4KH1B 2R5AA 3NFCA 2LX9A 4GLKA 1GL5A 1M2VB 1P92A 4F04B 4X1VA 3VS1A 3L1AA 1M9SA 3VKIA 5GANh 2XU8A 2PVOB 3H0FA 5A0GA 5DLQE 1KK7A 2D6FA 4E47A 2YRCA 3UPUA 4LUDA 2KAFA 3BE3A 4MZTA 3QKJA 2QI2A 3ASKA 1H92A 4RMOA 3HP9A 2HL3A 1ZUYA 4R0KA 3CC2Q 2V8JA 2W10A 2BE9B 4XTVA 3M54A 1M1FA 4LDWA 4PJOD 2C0IA 4OMNA 7AT1B 1KQSS 3CCJA 3X25B 1SPKA 2FZCB 4BB7A 2EYZA 2C0TA 3SEMA 1VQPA 1YHQA 1EX4A 2KNBB 2E5QA 4EPCA 3HKSA 1VQ6Q 1E6HA 1MNEA 4C8QD 3CCVQ 2KROA 3HPWA 1VQ9Q 4LUEA 1SG5A 1GCPA 4JRPA 1YJWA 4MMLA 4ELYC 5HKCA 3FRNA 3X26B 4M77D 2NUTB 1YJNA 2XKOC 5IAYA 3M0SA 3CC4T 3M5AA 2DEUA 2QK0A 3ME9A 2JW4A 2J6OA 3RBBB 2JM9A 1WHHA 2XMFA 2MCNA 3VRZA 1OZ3A 4QT7A 4OMQA 8ATCB 3ZL7C 3E2UA 2MMPA 2W0ZA 5DLOA 5GAMj 2EAYA 1MMNA 1JO8A 2F2XA 5AYFA 2QXFA 1PKTA 2J6FA 1UJYA 3QXEB 2CT3A 2ZZDA 4MZPA 2QEXQ 4E7ZA 2K9GA 2E4HA 1AZGB 4KGVB 3INZA 4X9CA 4ZGDB 3OYCA 3UDCA 2OTJQ 4M78G 3CCUT 1JXMA 5A0DA 1M1GA 1M90R 1T0HA 4XU0A 3NHNA 4OGCA 1RADB 1G5VA 2JTFA 5LJ3g 2K5IA 4M7AG 3TQ7P 5GANd 1XQHA 3CCSQ 1ZSZB 2LCCA 2OX7A 2YUOA 3RIRA 2DX1A 3PIOA 5FRMA 5HK3A 1VQOQ 4B9XA 4L59A 2MYSA 2FYKA 3LYIA 3V7CA 2QA4T 3G6EQ 1PWTA 3OS0A 1AWJA 2DJQA 1N9RA 1N6AA 2KI7A 3V7RA 4E7JA 4R55A 5M9OA 1RLPC 1VA7A 1VQ6A 2F2WA 2AIRB 4AFSC 1HSQA 3CXCS 3VUBA 4E2FB 3CCVA 4IUTA 3TEEA 1VQ9A 2CP6A 1ZBXA 1TUGB 1Q86R 2XD0A 1VQKT 2MI6A 1S72Q 4M77C 2RO0A 2HBPA 2DJZA 2EGEA 5CKFA 4M78E 5A0LA 1VQ8T 4EMKC 2RHXA 2K3BA 4BI4A 3CCLQ 3OMCA 5DY9A 4M7AE 3QDRB 1V1CA 4MDWA 1Q82R 1WNLA 1QMCA 3URGA 2RQVA 4LXCA 2RI3A 2HSPA 3VJPA 3BY7A 4FYXB 3H8ZA 3HRSA 2J05A 2QYZA 3REBB 2JUFA 5KYWA 1U1SA 1O9SA 2GFAA 1MNDA 3EG9A 3OA6A 3OYNA 3PVQA 1T3SA 3QWXX 4IIMA 1F1BB 2C0OA 1ABOA 1WHJA 2OTJA 1RAHB 4J9CA 4ZN1A 5EC7A 1U5SA 1G83A 1YIJQ 1VQ7Q 1VIFA 3G7ZA 4DBRA 2X4WA 5GANj 3QWYA 5LJ3e 1KQSA 3TREA 1BIBA 4DBHA 2VGNA 3MP1A 4JRKA 3S3NA 2DFUA 1K73U 1MMAA 3CXCP 3CCSA 2E70A 1Q81R 3QG1A 3EGDA 1D3BA 1NEBA 1I4K1 3WXMB 3CCJT 4ME7A 1UDLA 1TG0A 3ZEHA 2HEQA 1YHQT 1VQOA 1AEYA 2HQXA 5GAOp 3G6EA 3GP8A 4WTOB 4C0GA 2L3QA 3G4ST 1N8RC 3I55Q 3CBOA 4J9FA 4M75A 1MV0B 1OZ2A 3EG1A 2FRWA 1YJWT 3ULRB 4WF2A 4OMMA 2RQUA 5DM7R 2DYIA 1ZQ1A 1B3QA 1YJNT 2MWOA 2JT4A 3DLLA 1QW1A 4A4KA 1SEMA 1S72A 3JB9D 2RHZA 3CMEQ 1R77A 2CP5A 3EGUA 2DE0X 2VVKA 1SRMA 2B8AA 3S3MA 2EKHA 3CCLA 2EJ9A 3I56Q 1K8AU 1Y96A 4Y92A 4L5GA 4F7UB 1TSFA 2NUPB 1K9MC 2KGTA 1WXTA 2QQ9A 5KE2A 1WQWA 2RB6A 1WJSA 3OYMA 3CBPA 5CQXA 5LJ5g 3M59A 1IHVA 2XG8D 5IXBA 3CC7Q 5GMKj 1FX7A 2X3WD 2HAXA 1OV3A 4ZN3A 3M0QA 4C0FA 2YSQA 2MF2A 1M1KC 2EIFA 2LDMA 1QWFA 4BY6C 3H6ZA 1OQKA 5KYXA 2LTOA 1YIJA 1VQ7A 5FU7C 1NBEB 3M56A 2EGCA 2XDPA 2DL5A 3O8VA 4CC2A 4M77B 2QDLA 3CC2T 1Q7YU 4M7DD 1I5OB 1PD1A 1OOTA 1GCQC 2V8IA 4EMKB 3FB9A 4J9DA 2DRKA 2RJFA 2DTOA 3SWNC 3LGFA 4EIKA 3CXCA 3OQ5A 4J9HA 2V8KA 1NYFA 2AK5A 4C0DC 3UA7A 2WSCE 4E7HA 4RCCA 1MGQA 2CP0A 1X69A 1WJRA 2FB7A 4JUVA 4C92D 3CCVT 3CBMA 4A63B 4TVRA 3RMQA 3JB9J 2LNHB 2DZCA 3Q1JA 4BE0A 5GAOn 1WDXA 4XTUA 5KCOA 2YUPA 1OEBA 3A8MB 1OU9A 1Y71A 2DIQA 4JZ3A 3JCMg 2C06A 2E12A 3CMEA 1BK2A 4C5HA 3S3OA 2VKNA 5J39A
chains in the Genus database with same CATH topology
1PHTA 1WXUA 1WX6A 4X1VA 3VS1A 1K4US 4RUGA 3H0FA 1M3AA 1K1ZA 2JS0A 2PTKA 4LUDA 2A08A 2X3XD 2O31A 2AZSA 1WYXA 2FPEA 1WIEA 2BZXA 1CKBA 1NLOC 2EYYA 4JJCA 4ZNXA 3SHWA 3UF4A 3JV3A 4HCKA 2O9SA 1H92A 2CDTA 4AFZC 1ZX6A 1X6GA 5I22A 2JM8A 2HCKA 1AWXA 2JMAA 1T0JA 2KE9A 1ZUYA 4R0KA 3FJ5A 2MIOA 4LNPA 2D1XA 1BBZA 2W10A 2EVRA 2ABLA 1PKSA 1UFFA 4AFUC 3RNJA 2C0IA 4OMNA 1RLQC 1SPKA 2AKKA 2BZ8A 1OPLA 2BZYA 4AFQC 3VS7A 2EYZA 2C0TA 3SEMA 5GJVB 4F14A 2KNBB 1M27C 1S1NA 3PE0A 4HVVA 1QLYA 2JXBA 4JZ4A 1WFWA 4JPBW 3I35A 2LJ3A 3EHQA 2RQTA 2CUBA 2OI3A 2MOXA 3TSWA 2NUZA 1E6HA 1M3CA 2A28A 5GJWB 3NPFA 4KRTA 1YWPA 2KROA 4LUEA 1W6XA 2JS2A 1GCPA 2KXCA 1M30A 1AVZC 1SRLA 2RMOA 1AZEA 2GBQA 3M0SA 2FPFA 1GBRA 4HVUA 1X27A 2FO0A 1YN8A 4AG2C 1FMKA 4GLMA 3IQLA 1N5ZA 2JW4A 2YDLA 4FSSA 2LQNA 1BU1A 1CKAA 2BTTA 2J6OA 3RBBB 2JM9A 2XMFA 3LH5A 2MCNA 4ORZA 4J9GA 2VWFA 2DL8A 3VRZA 1VYVA 4OMLA 4QT7A 4OMQA 1U3OA 2EYWA 3ZL7C 2DMOA 1TUDA 2W0ZA 2D0NA 2K7AA 1BB9A 2L2PA 1JU5C 2RF0A 1JO8A 2F2XA 1UTIA 1PKTA 3M0PA 2J6FA 2DYBA 1TUCA 1IO6A 1E7OA 1UJYA 2LX7A 2V1RA 2K6DA 1NG2A 2CT3A 2DL4A 2I0NA 1W70A 2FEIA 2K9GA 4RTYA 3M0RA 1AZGB 1G2BA 5FW9A 3EG3A 1AOJA 2DBKA 1JXMA 3REAB 3TSZA 1ZUKA 1T0HA 3NHNA 2DILA 1JXOA 3VS5A 2SRCA 4CC3A 2NWMA 2PZ1A 4D8DA 3C0CA 2YUOA 1GFDA 3I5SA 2KRSA 2DX1A 1NYGA 2D8HA 2O9VA 4JJBA 2DLPA 2ENMA 2ROLA 3VS0A 5IH2A 3GBQA 3NGPA 4RTZA 1X6BA 1ZSGA 1PWTA 1AWJA 2M0YA 2DJQA 1OPKA 1WLPB 2D8JA 3PVLA 5IHNA 1RLPC 1VA7A 2H8HA 3H0IA 1Y0MA 2HBWA 2DVJA 2SEMA 1HD3A 2KT1A 2F2WA 4AFSC 1HSQA 3VS6A 4DEXA 2GNCA 1X2QA 1ABQA 4DEYA 2RQRA 2CH4A 2EW3A 2FPDA 2IIMA 2EGEA 2YUQA 5IXFA 2OJ2A 2DL3A 2K3BA 1H3HA 3EHRA 2EQIA 2B86A 2KYBA 3M0UA 1UECA 3VS3A 1V1CA 1GFCA 1RI9A 3TVTA 2RQVA 4K11A 3EG2A 4HVWA 2ROTA 2HSPA 4Z8AA 3NMZC 3CQTA 2J05A 2HDAA 3REBB 2A36A 1QWEA 2GGRA 2RQWA 3I9QA 5IHKA 2CREA 5FWCA 2E5KA 5L23A 3O5ZA 3PVQA 2LCSA 4J9EA 1T3SA 1NLPC 1J3TA 3QWXX 4IIMA 2K79A 4WCIA 4GBQA 5FWBA 2C0OA 2K2MA 3M0TA 2JMCA 2KXDA 1MUZA 1ABOA 2L3PA 2EYXA 4Z89A 2LMJA 4J9CA 2O88A 1A0NB 5EC7A 1U5SA 1GBQA 1Z9QA 1G83A 4RTWA 1AWWA 4RTTA 2RNAA 3QWYA 1HJDA 1KFZA 1WXBA 2LJ0A 1GRIA 1I07A 4HXJA 1XOVA 2KT8A 2KBTA 1NEBA 1ZLMA 1UDLA 1TG0A 2HEQA 4Z88A 4LE9A 2CSIA 1U06A 1AEYA 4IIOA 2LZ6B 2L0AA 4OMPA 1B07A 1UE9A 4AG1C 1X43A 3VS2A 1YNZA 2L3QA 1JQQA 2DBMA 1I0CA 1AWOA 2OAWA 1Z9ZA 1E6GA 1YWOA 4CC7A 2DA9A 2DL7A 2ESWA 4J9FA 1NM7A 1MV0B 3EG1A 1UHCA 1KSWA 2CUDA 2FRWA 1PRLC 3ULRB 2RPNA 2DF6A 2P4RA 2RQUA 4OMMA 3A98A 5I11A 1B3QA 1K0SA 4D8KA 2F2VA 4LN2A 2JT4A 1X2KA 1PNJA 1ZUUA 1VYUA 2A37A 1YP5A 1SEMA 2CH4W 2M51A 2EPDA 3EGUA 2DE0X 4CC4B 2VVKA 1SRMA 3H0HA 4F16A 1QKXA 1EFNA 2EKHA 1I1JA 2GTOA 2YUNA 2GQIA 1W1FA 3KFVA 1NEGA 4Y92A 1KJWA 5ECAA 1UGVA 4RTXA 1SSHA 3EG0A 1QKWA 1UJ0A 2KGTA 2V1QA 1WXTA 1M3BA 4E6RA 1K76A 1UG1A 2AKLA 2KRMA 1WA7A 1GCQA 1LCKA 5IXBA 2O2OA 3H41A 2X3WD 3I5RA 2ECZA 1WI7A 1OV3A 2CSQA 3M0QA 3VRYA 3R6NA 2YSQA 2RN8A 1T3LA 2J6KA 2AZVA 1QWFA 3UATA 1JEGA 2LQWA 2J06A 4F17A 2EBPA 2G6FX 4OMOA 2ED1A 1AD5A 2KEAA 2EGCA 1VYTA 2DL5A 4CC2A 2QDLA 2KR3A 3U23A 1OOTA 1GCQC 4M4ZA 2JTEA 5IHIA 1H8KA 2FG0A 2KYMA 2LP5A 2J7IA 1UUEA 5HCKA 4J9DA 4JJDA 2DRKA 1RUWA 4EIKA 1MV3A 4J9HA 1CSKA 1UHFA 1NYFA 2AK5A 3UA7A 4RTUA 1QCFA 4J9BA 1PRMC 2LJ1A 1X69A 1ZBJA 1SHGA 2ED0A 2YT6A 2DRMA 3UA6A 2EGAA 2PNIA 4A63B 1Y57A 1ARKA 3THKA 1SHFA 1FYNA 1M8MA 2KRNA 2LNHB 2GTJA 4ESRA 4J9IA 3VS4A 1KIKA 2L3SA 2DM1A 1WDXA 2YUPA 1OEBA 4JZ3A 2DNUA 1K9AA 2FRYA 2CT4A 1BK2A 4RTVA 1K0XA 2VKNA 1YCSB 1GL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PHT A;  1WXU A;  1WX6 A;  4X1V A;  3VS1 A;  1K4U S;  4RUG A;  3H0F A;  1M3A A;  1K1Z A;  2JS0 A;  2PTK A;  4LUD A;  2A08 A;  2X3X D;  2O31 A;  2AZS A;  1WYX A;  2FPE A;  1WIE A;  2BZX A;  1CKB A;  1NLO C;  2EYY A;  4JJC A;  4ZNX A;  3SHW A;  3UF4 A;  3JV3 A;  4HCK A;  2O9S A;  1H92 A;  2CDT A;  4AFZ C;  1ZX6 A;  1X6G A;  5I22 A;  2JM8 A;  2HCK A;  1AWX A;  2JMA A;  1T0J A;  2KE9 A;  1ZUY A;  4R0K A;  3FJ5 A;  2MIO A;  4LNP A;  2D1X A;  1BBZ A;  2W10 A;  2EVR A;  2ABL A;  1PKS A;  1UFF A;  4AFU C;  3RNJ A;  2C0I A;  4OMN A;  1RLQ C;  1SPK A;  2AKK A;  2BZ8 A;  1OPL A;  2BZY A;  4AFQ C;  3VS7 A;  2EYZ A;  2C0T A;  3SEM A;  5GJV B;  4F14 A;  2KNB B;  1M27 C;  1S1N A;  3PE0 A;  4HVV A;  1QLY A;  2JXB A;  4JZ4 A;  1WFW A;  4JPB W;  3I35 A;  2LJ3 A;  3EHQ A;  2RQT A;  2CUB A;  2OI3 A;  2MOX A;  3TSW A;  2NUZ A;  1E6H A;  1M3C A;  2A28 A;  5GJW B;  3NPF A;  4KRT A;  1YWP A;  2KRO A;  4LUE A;  1W6X A;  2JS2 A;  1GCP A;  2KXC A;  1M30 A;  1AVZ C;  1SRL A;  2RMO A;  1AZE A;  2GBQ A;  3M0S A;  2FPF A;  1GBR A;  4HVU A;  1X27 A;  2FO0 A;  1YN8 A;  4AG2 C;  1FMK A;  4GLM A;  3IQL A;  1N5Z A;  2JW4 A;  2YDL A;  4FSS A;  2LQN A;  1BU1 A;  1CKA A;  2BTT A;  2J6O A;  3RBB B;  2JM9 A;  2XMF A;  3LH5 A;  2MCN A;  4ORZ A;  4J9G A;  2VWF A;  2DL8 A;  3VRZ A;  1VYV A;  4OML A;  4QT7 A;  4OMQ A;  1U3O A;  2EYW A;  3ZL7 C;  2DMO A;  1TUD A;  2W0Z A;  2D0N A;  2K7A A;  1BB9 A;  2L2P A;  1JU5 C;  2RF0 A;  1JO8 A;  2F2X A;  1UTI A;  1PKT A;  3M0P A;  2J6F A;  2DYB A;  1TUC A;  1IO6 A;  1E7O A;  1UJY A;  2LX7 A;  2V1R A;  2K6D A;  1NG2 A;  2CT3 A;  2DL4 A;  2I0N A;  1W70 A;  2FEI A;  2K9G A;  4RTY A;  3M0R A;  1AZG B;  1G2B A;  5FW9 A;  3EG3 A;  1AOJ A;  2DBK A;  1JXM A;  3REA B;  3TSZ A;  1ZUK A;  1T0H A;  3NHN A;  2DIL A;  1JXO A;  3VS5 A;  2SRC A;  4CC3 A;  2NWM A;  2PZ1 A;  4D8D A;  3C0C A;  2YUO A;  1GFD A;  3I5S A;  2KRS A;  2DX1 A;  1NYG A;  2D8H A;  2O9V A;  4JJB A;  2DLP A;  2ENM A;  2ROL A;  3VS0 A;  5IH2 A;  3GBQ A;  3NGP A;  4RTZ A;  1X6B A;  1ZSG A;  1PWT A;  1AWJ A;  2M0Y A;  2DJQ A;  1OPK A;  1WLP B;  2D8J A;  3PVL A;  5IHN A;  1RLP C;  1VA7 A;  2H8H A;  3H0I A;  1Y0M A;  2HBW A;  2DVJ A;  2SEM A;  1HD3 A;  2KT1 A;  2F2W A;  4AFS C;  1HSQ A;  3VS6 A;  4DEX A;  2GNC A;  1X2Q A;  1ABQ A;  4DEY A;  2RQR A;  2CH4 A;  2EW3 A;  2FPD A;  2IIM A;  2EGE A;  2YUQ A;  5IXF A;  2OJ2 A;  2DL3 A;  2K3B A;  1H3H A;  3EHR A;  2EQI A;  2B86 A;  2KYB A;  3M0U A;  1UEC A;  3VS3 A;  1V1C A;  1GFC A;  1RI9 A;  3TVT A;  2RQV A;  4K11 A;  3EG2 A;  4HVW A;  2ROT A;  2HSP A;  4Z8A A;  3NMZ C;  3CQT A;  2J05 A;  2HDA A;  3REB B;  2A36 A;  1QWE A;  2GGR A;  2RQW A;  3I9Q A;  5IHK A;  2CRE A;  5FWC A;  2E5K A;  5L23 A;  3O5Z A;  3PVQ A;  2LCS A;  4J9E A;  1T3S A;  1NLP C;  1J3T A;  3QWX X;  4IIM A;  2K79 A;  4WCI A;  4GBQ A;  5FWB A;  2C0O A;  2K2M A;  3M0T A;  2JMC A;  2KXD A;  1MUZ A;  1ABO A;  2L3P A;  2EYX A;  4Z89 A;  2LMJ A;  4J9C A;  2O88 A;  1A0N B;  5EC7 A;  1U5S A;  1GBQ A;  1Z9Q A;  1G83 A;  4RTW A;  1AWW A;  4RTT A;  2RNA A;  3QWY A;  1HJD A;  1KFZ A;  1WXB A;  2LJ0 A;  1GRI A;  1I07 A;  4HXJ A;  1XOV A;  2KT8 A;  2KBT A;  1NEB A;  1ZLM A;  1UDL A;  1TG0 A;  2HEQ A;  4Z88 A;  4LE9 A;  2CSI A;  1U06 A;  1AEY A;  4IIO A;  2LZ6 B;  2L0A A;  4OMP A;  1B07 A;  1UE9 A;  4AG1 C;  1X43 A;  3VS2 A;  1YNZ A;  2L3Q A;  1JQQ A;  2DBM A;  1I0C A;  1AWO A;  2OAW A;  1Z9Z A;  1E6G A;  1YWO A;  4CC7 A;  2DA9 A;  2DL7 A;  2ESW A;  4J9F A;  1NM7 A;  1MV0 B;  3EG1 A;  1UHC A;  1KSW A;  2CUD A;  2FRW A;  1PRL C;  3ULR B;  2RPN A;  2DF6 A;  2P4R A;  2RQU A;  4OMM A;  3A98 A;  5I11 A;  1B3Q A;  1K0S A;  4D8K A;  2F2V A;  4LN2 A;  2JT4 A;  1X2K A;  1PNJ A;  1ZUU A;  1VYU A;  2A37 A;  1YP5 A;  1SEM A;  2CH4 W;  2M51 A;  2EPD A;  3EGU A;  2DE0 X;  4CC4 B;  2VVK A;  1SRM A;  3H0H A;  4F16 A;  1QKX A;  1EFN A;  2EKH A;  1I1J A;  2GTO A;  2YUN A;  2GQI A;  1W1F A;  3KFV A;  1NEG A;  4Y92 A;  1KJW A;  5ECA A;  1UGV A;  4RTX A;  1SSH A;  3EG0 A;  1QKW A;  1UJ0 A;  2KGT A;  2V1Q A;  1WXT A;  1M3B A;  4E6R A;  1K76 A;  1UG1 A;  2AKL A;  2KRM A;  1WA7 A;  1GCQ A;  1LCK A;  5IXB A;  2O2O A;  3H41 A;  2X3W D;  3I5R A;  2ECZ A;  1WI7 A;  1OV3 A;  2CSQ A;  3M0Q A;  3VRY A;  3R6N A;  2YSQ A;  2RN8 A;  1T3L A;  2J6K A;  2AZV A;  1QWF A;  3UAT A;  1JEG A;  2LQW A;  2J06 A;  4F17 A;  2EBP A;  2G6F X;  4OMO A;  2ED1 A;  1AD5 A;  2KEA A;  2EGC A;  1VYT A;  2DL5 A;  4CC2 A;  2QDL A;  2KR3 A;  3U23 A;  1OOT A;  1GCQ C;  4M4Z A;  2JTE A;  5IHI A;  1H8K A;  2FG0 A;  2KYM A;  2LP5 A;  2J7I A;  1UUE A;  5HCK A;  4J9D A;  4JJD A;  2DRK A;  1RUW A;  4EIK A;  1MV3 A;  4J9H A;  1CSK A;  1UHF A;  1NYF A;  2AK5 A;  3UA7 A;  4RTU A;  1QCF A;  4J9B A;  1PRM C;  2LJ1 A;  1X69 A;  1ZBJ A;  1SHG A;  2ED0 A;  2YT6 A;  2DRM A;  3UA6 A;  2EGA A;  2PNI A;  4A63 B;  1Y57 A;  1ARK A;  3THK A;  1SHF A;  1FYN A;  1M8M A;  2KRN A;  2LNH B;  2GTJ A;  4ESR A;  4J9I A;  3VS4 A;  1KIK A;  2L3S A;  2DM1 A;  1WDX A;  2YUP A;  1OEB A;  4JZ3 A;  2DNU A;  1K9A A;  2FRY A;  2CT4 A;  1BK2 A;  4RTV A;  1K0X A;  2VKN A;  1YCS B;  1GL5 A; 
#chains in the Genus database with same CATH topology
 2DER A;  1WXU A;  1BI2 A;  3MPU B;  2RH2 A;  2VC8 A;  3I56 A;  2JS0 A;  1PG5 B;  2A08 A;  2AZS A;  4JLI A;  2FPE A;  3JCM V;  2EYY A;  1NLO C;  1X01 A;  3JV3 A;  2O9S A;  1VOM A;  3OBW A;  2CYZ B;  3L2W A;  2QEX T;  2JM8 A;  2EJG A;  4XTY A;  4HT9 A;  2R57 A;  2JMA A;  2KE9 A;  3V7S A;  3CC7 A;  4NL3 A;  4N0A C;  4A4F A;  2MIO A;  2OTJ T;  1BBZ A;  1QVF S;  4R56 A;  3DB4 A;  3PFS A;  3OYD A;  3E1S A;  5KYY A;  3KXT A;  5GMK m;  3CCM Q;  1OI1 A;  1BCO A;  1S1N A;  4FCY A;  1QLY A;  2JXB A;  1W2B S;  4JZ4 A;  1WFW A;  3GF5 A;  4XK8 E;  5KYU B;  4XTX A;  5FU6 C;  4DBF A;  4JPB W;  3I35 A;  1WPY A;  1PSE A;  2O4X B;  5LJ3 f;  1VQN Q;  4M7D C;  2MOX A;  1HXD A;  2A28 A;  2Y90 A;  2EFI A;  4A53 A;  4PJO F;  2JS2 A;  1QP3 A;  2M16 A;  1VQO T;  3OB9 A;  3WVD B;  2KXC A;  3JCM h;  2E65 A;  1AVZ C;  2YRD A;  2DD4 A;  1B34 A;  1JB0 E;  2RMO A;  2ZPH B;  4J6W A;  3G1J A;  4M75 D;  4A4E A;  3L2Z A;  2GBQ A;  4BAC A;  4MDX A;  4HVU A;  1X75 C;  2WAC A;  3CPF A;  1D0X A;  4GLM A;  2VYT A;  1R0C B;  2F5K A;  1FMW A;  1BU1 A;  1CKA A;  4QVD A;  4C8Q F;  2E1H A;  3EFS A;  3LH5 A;  4FT4 A;  1KD1 R;  1YCY A;  1UGP B;  4ORZ A;  2VWF A;  2DL8 A;  1YIT T;  4E7I A;  4ZTF A;  1H3Z A;  2KK4 A;  4M78 A;  4OF1 A;  1BB9 A;  2L2P A;  1JU5 C;  2BKD N;  1OUL A;  3GLX A;  4XU1 A;  4BDZ A;  4HT8 A;  2LX7 A;  2PVG B;  3JCM e;  1KC8 U;  4M7A A;  4BY6 B;  3CCL T;  2DL4 A;  2DXB A;  2I0N A;  2FEI A;  1VQ5 T;  1QVF P;  1KHI A;  1PD0 A;  3JCM J;  4RTY A;  3M0R A;  4IUU A;  1G2B A;  5FW9 A;  2MPX C;  3T9N A;  3OS2 A;  3EG3 A;  5GMK l;  4DQ2 A;  2G3R A;  1YI2 T;  4KGZ B;  3TSZ A;  4BE1 A;  4F7U G;  3MO8 A;  4Y91 A;  2DIG A;  1M90 C;  3C95 A;  2P84 A;  2QTX A;  5FRN A;  3F70 A;  3DKM A;  3RKX A;  3SWN B;  4KBM B;  2NWM A;  2PZ1 A;  4D8D A;  3C0C A;  4C0D B;  1GFD A;  4FIB A;  2D8H A;  2DLP A;  2ROL A;  4QQG A;  2M9U A;  1KQ1 A;  5GAO l;  3GBQ A;  4LDV A;  1VQ7 T;  4RTZ A;  3L42 A;  2COZ A;  1NJI R;  2FVU A;  3CCM A;  4PJJ A;  4C8Q G;  2DXU A;  3R6O A;  1C6V X;  1PC0 A;  2COY A;  2RK1 A;  1VQN A;  3EH2 A;  1HD3 A;  4M77 G;  1NJI U;  1X2Q A;  4PFZ A;  2EW3 A;  1ZA1 B;  4FSX A;  2FPD A;  1RL2 A;  5CKB A;  2ZAE A;  1Q86 C;  1VQL Q;  1KHC A;  2DL3 A;  2BE7 D;  4V2S A;  1H3H A;  3I55 T;  3EHR A;  1VIE A;  4F7U E;  3LWH A;  4FYV B;  2X4Y A;  2GF7 A;  3V8K A;  2DXT A;  4NS5 A;  2LVM A;  3TVT A;  4K11 A;  1Q82 C;  2ROT A;  1M2V A;  3JCM W;  5IN1 A;  2OAU A;  3QYG B;  2HDA A;  3CD6 T;  2A36 A;  1QWE A;  4PFO A;  3CME T;  2GGR A;  2HKQ B;  3X24 B;  2LQ8 A;  5IHK A;  2A3L A;  5FWC A;  2E5K A;  3D7S B;  4J9E A;  5GAN 6;  3FJP A;  2CZ1 B;  2HSE B;  4JJN K;  5FWB A;  1YFN A;  1O75 A;  5CR2 A;  3M0T A;  4N4H A;  5FU6 B;  2EWN A;  3OYJ A;  2O88 A;  4M7D B;  4O5V A;  1UB4 A;  4M77 E;  1QVF A;  4RTT A;  3A5Z B;  2RNA A;  1W4S A;  3A8G B;  3QUI A;  4DOW A;  3MEV A;  1KFZ A;  2LJ0 A;  1GRI A;  2KSS A;  1IGQ A;  1W2B A;  2KT8 A;  5LJ5 f;  2KBT A;  3P8H A;  4ZTJ A;  1M5Q 1;  2MK5 A;  1MHN A;  4LE9 A;  3CCE T;  2H3E B;  1U06 A;  3OY9 A;  1KG1 A;  1B07 A;  1UE9 A;  1X43 A;  4E7L A;  3VS2 A;  2LT4 A;  4DA4 A;  2BIV A;  2EQJ A;  3JCM X;  1E6G A;  2NUT A;  4LDX A;  1YWO A;  5GAM f;  4PJO C;  3SB2 A;  1NM7 A;  2VXF A;  3MP6 A;  4DBQ A;  1KSW A;  1PRL C;  1QCO A;  1JJ2 S;  2RPN A;  3A98 A;  2OTL T;  1K0S A;  2F2V A;  4LN2 A;  1X2K A;  1D0Z A;  1V29 B;  1VYU A;  1YP5 A;  2CH4 W;  3QJY A;  3CCQ A;  1VQL A;  2M51 A;  3OYE A;  3CCR Q;  2EPD A;  4CC4 B;  4C8Q C;  1BIA A;  3QO3 A;  2BUD A;  1QKX A;  1EFN A;  4JRI A;  5IT9 E;  1U8R A;  2QQA A;  4FW2 A;  4IUV A;  5KE3 A;  4M7A D;  2E3H A;  3BW1 A;  1UGV A;  4RTX A;  4RKU E;  1QKW A;  1UJ0 A;  2DK3 A;  2DEQ A;  3L2U A;  3JB9 F;  2ZPF B;  4AT1 B;  2QAZ A;  3E9G A;  1UG1 A;  2AKL A;  1QVG P;  1WA7 A;  3RUX A;  3JCM f;  1PSF A;  1BI3 A;  1YJ9 T;  5LJ3 h;  2QTV A;  2ECZ A;  3GNG A;  1WI7 A;  4FL6 A;  2CSQ A;  3VRY A;  3MEW A;  1ZSZ A;  2DET A;  2LQW A;  2Y4Y A;  2EQK A;  4OMO A;  2ED1 A;  3FLG A;  1FWZ A;  3QHS A;  3CMA Q;  2YLB A;  3H9N A;  4KUL A;  1K73 R;  5GAO r;  2P0Q A;  1JJ2 P;  5KYN A;  5IHI A;  2KYM A;  2MWP A;  1BI1 A;  1UUE A;  3QYH B;  5HCK A;  3PTA A;  2K3X A;  1IGU A;  1N9S A;  3OS1 A;  1UHF A;  3HRT A;  4YTL A;  2K3Y A;  2KY9 A;  4RTU A;  1LOJ A;  2F5T X;  2PVD B;  3NTH A;  1VQN T;  4QVC A;  4OVA A;  1D1A A;  4M7D F;  2EQU A;  2RI5 A;  2DRM A;  2EGA A;  2PNI A;  4ZGE B;  1SKU B;  1Y57 A;  1VQP T;  2KMT A;  4KGX B;  3JB9 G;  2PUO B;  1FYN A;  1RAB B;  1D1B A;  3MET A;  3L2R A;  2RD1 A;  1KIK A;  2L3S A;  3S6W A;  2HQH A;  5LL6 S;  4ANJ A;  2VGM A;  3QII A;  1QP2 A;  1RAC B;  3CCR A;  4RTV A;  1JBM A;  1YCS B;  3V8J A;  1PHT A;  4KH0 B;  1WX6 A;  4IUQ A;  4C92 F;  2KQW A;  4HCB A;  1K4U S;  4RUG A;  4BDY A;  1GXI E;  1M2O A;  2O01 E;  1WZO A;  3QZ5 B;  4D6W A;  1K8A R;  2PTK A;  4IUP A;  2I2L A;  1AHJ B;  4PJL A;  1WHK A;  2X9H A;  1BI0 A;  2BZX A;  2L89 A;  4JJC A;  5CO7 A;  4LD6 A;  3UWN A;  4AFZ C;  1IZ6 A;  1X6G A;  1ZX6 A;  3ZBD A;  5I22 A;  1AWX A;  1T0J A;  3CC4 Q;  4LNP A;  2D1X A;  2EVR A;  2ABL A;  2F1L A;  1PKS A;  3OW2 S;  1UFF A;  2K5F A;  1QVG A;  2AKK A;  1XTD A;  4PJO B;  4HCZ A;  4AFQ C;  3VS7 A;  3OS5 A;  4M7D G;  3FIF A;  5GJV B;  3FDR A;  3PE0 A;  4HVV A;  1C1A A;  5LJ3 d;  1BKB A;  3CMA A;  4X34 A;  2LJ3 A;  3EHQ A;  2OI3 A;  3OSV A;  1M3C A;  1Q7Y R;  2JOY A;  5GJW B;  3NPF A;  4KRT A;  5HK0 A;  1YWP A;  2E10 A;  5GMK i;  1UEB A;  2D0Q B;  1W6X A;  4C8Q B;  4QW2 A;  3RDV A;  5GAM g;  2ATC B;  2L3R A;  3HSB A;  2D9T A;  1JJ2 A;  2RHY A;  5C6S A;  4PLL A;  2QAS A;  3DLM A;  2FO0 A;  4J6X A;  1YN8 A;  3JCM b;  1FMK A;  2E6Z A;  4FW1 A;  2X4J A;  3IQL A;  2YDL A;  4FSS A;  2CZ7 B;  4KUI A;  5KH6 A;  1I5L A;  4J9G A;  4OML A;  2EYW A;  3EGX B;  1KD1 C;  3J80 E;  4C0Z A;  1TUD A;  3HFN A;  3OYG A;  2K7A A;  4M75 F;  1NE8 A;  2H3J A;  1UTI A;  2MAM A;  4JS5 A;  1OX8 A;  1VQ6 T;  3EFR A;  3LW5 E;  2DYB A;  3HFO A;  4F7U A;  2V1R A;  1NPR A;  2NUP A;  2AT1 B;  2X4X A;  3OYB A;  1NG2 A;  1TU0 B;  2QA4 Q;  2JN0 A;  1VQ9 T;  4M7D E;  8AT1 B;  2QG9 B;  3OW2 P;  4PJO A;  5C0M A;  4OMF B;  4BUG A;  2QGF B;  5D7U A;  5LJ5 h;  3VV0 A;  2VUB A;  5D6X A;  2CZ6 B;  3REA B;  1ZUK A;  2LRQ A;  1I8F A;  1OU8 A;  1UGS B;  1ZA2 B;  2R58 A;  4XTZ A;  2CGH A;  3QPH A;  1EIF A;  4MZM A;  1VQK Q;  4JS4 A;  2RA2 A;  2K57 A;  4OB0 B;  1VQM Q;  1QCN A;  1RAI B;  3VS5 A;  2SRC A;  4C8Q A;  4CC3 A;  4XAX B;  4C5I A;  3RMS A;  1D0Y A;  3I5S A;  2GCX A;  3CC4 A;  5GAM h;  4XQ3 A;  2DPP B;  2GFU A;  2DTI A;  2ENM A;  1RAG B;  6AT1 B;  4M77 A;  3RKY A;  2QQB A;  4LDU A;  2XI9 A;  4EMK A;  3NGP A;  2X51 A;  4ZGJ B;  1X6B A;  5LJ3 j;  1ZSG A;  1N8R U;  5LJ5 e;  5CVI A;  4C5G A;  3EGX A;  3EFO B;  2QGG A;  4EDU A;  4UC4 A;  1Y0M A;  1G3Y A;  2HBW A;  2SEM A;  2KT1 A;  4A54 A;  2RM4 A;  3PIP A;  2ZCF B;  3C94 A;  2GNC A;  1ABQ A;  4DEY A;  2XIC A;  2HZY A;  1HYO A;  3MJX A;  1TWB A;  5GAM e;  2YUQ A;  3CCS T;  3ZFJ A;  3QSU A;  3VUZ A;  1XJW B;  2EQI A;  1UGR B;  2E3I A;  3M0U A;  4XU3 A;  1GFC A;  4FYY B;  1K9M U;  5AT1 B;  3G6E T;  3EG2 A;  5HY6 A;  2JVV A;  5GAO m;  4NOY A;  2XDB A;  4Z8A A;  3RR6 A;  3AT1 B;  4P5N A;  3NMZ C;  3HTR A;  4PFP A;  2EQM A;  3CCR T;  2RQW A;  1ZHI A;  3I9Q A;  2FHD A;  5GAN g;  4C92 C;  3GPL A;  1TTH B;  1KC8 R;  2QA4 A;  1M1K U;  3G4S Q;  2F69 A;  2K2M A;  1S72 T;  4Z89 A;  4IUR A;  5GAN 5;  4PK4 A;  4LD9 K;  4RTW A;  1AWW A;  5L8R E;  4E7K A;  1R8O B;  2E6N A;  3OW2 A;  3EFO A;  2PU9 B;  4ATO A;  3X20 B;  5FU7 B;  3J7A F;  1VQK A;  1HJD A;  3LLR A;  1VQM A;  3OSS C;  1I07 A;  2ZPG B;  1XOV A;  3V8L A;  2LT1 A;  2V26 A;  5KYU A;  4B9W A;  2O4X A;  4XTW A;  1D1C A;  3LX7 A;  4CRI A;  3M9Q A;  2RJC A;  2QQS A;  2LZ6 B;  4PJO G;  2L0A A;  4OMP A;  4AG1 C;  3LWI A;  1YNZ A;  2EYQ A;  2AHJ B;  3M57 A;  2OAW A;  1Z9Z A;  2YLC A;  4CC7 A;  3PMI A;  4BD3 A;  4RCB A;  2VB6 A;  2DXC A;  2VXE A;  5EG2 A;  5A2Q E;  2CUD A;  1YIJ T;  1VQ4 Q;  2DZ9 A;  2DF6 A;  2P4R A;  3VYG A;  2NYS A;  3FC3 A;  2P0P A;  2RK2 A;  2XHC A;  4B6M A;  1BYM A;  4C5E A;  2XK0 A;  1TOV A;  2FL7 A;  3H0H A;  1VUB A;  2M0O A;  2YUN A;  2LC4 A;  2HQE A;  3CCQ Q;  3KFV A;  4M75 C;  2COW A;  2JNG A;  4J7F A;  1LNX A;  1RAF B;  2V1Q A;  3QJ6 A;  1M3B A;  1OX9 A;  3OYI A;  2KDS A;  4AMC A;  4E6R A;  1K76 A;  3C12 A;  3JCM d;  5CAI A;  5GAN e;  4J83 A;  4M78 F;  1GCQ A;  1JRI A;  2O2O A;  4X9D A;  4PJO E;  3JRZ A;  3G4S A;  3R6N A;  3J81 E;  3SWN A;  4M7A F;  2RN8 A;  1T3L A;  2J6K A;  2AZV A;  4F17 A;  1UGQ B;  4DOV A;  1VYT A;  1B7T A;  5LJ5 j;  4C8Q E;  3I56 T;  2A0F B;  5CIU A;  4NL2 A;  3U23 A;  4M4Z A;  4FM4 B;  1K73 C;  1H8K A;  2LP5 A;  2JJ9 A;  2PUK B;  5GAN 7;  1MV3 A;  3CC7 T;  1CSK A;  3JCM P;  1QVG S;  1NPP A;  2YHT A;  5GMK h;  1KQ2 A;  3A8L B;  1QCF A;  4J9B A;  3SD4 A;  1PRM C;  2LJ1 A;  1SHG A;  1Q81 C;  2QQR A;  2ED0 A;  2YT6 A;  1G3T A;  3UA6 A;  3JCM Q;  1ARK A;  3THK A;  3TCJ A;  4C92 B;  1M8M A;  3G71 Q;  2JTM A;  2GTJ A;  4ESR A;  1VQ4 A;  3VS4 A;  1KQS P;  9ATC B;  3OYK A;  2DNU A;  1K9A A;  2FRY A;  1IHW A;  4XU2 A;  2CT4 A;  5CQY A;  3A1P A;  1K0X A;  4N0A A;  1WGS A;  2HMA A;  2FZK B;  2DVE A;  3BFM A;  5GMK e;  1WJQ A;  5KYW B;  3M55 A;  1M3A A;  3CC2 A;  1K1Z A;  1M90 U;  3EG9 B;  1K8A C;  2X3X D;  2O31 A;  1H64 1;  1WYX A;  1WIE A;  3NTI A;  1CKB A;  3SHW A;  4M78 D;  3UF4 A;  3HL8 A;  4ZNX A;  1XNI A;  1RAE B;  4HCK A;  4M7D A;  3RER A;  2CDT A;  2CP7 A;  2HCK A;  3RES A;  5D6W A;  4PL6 A;  3OYH A;  3JB9 I;  3FJ5 A;  3NTK A;  4PKC C;  1BCM A;  4AFU C;  3RNJ A;  3OYY A;  1RLQ C;  1QVP A;  2BZ8 A;  1OPL A;  2BZY A;  2P4T A;  2FZG B;  4QKU A;  3M53 A;  4E7S A;  4F14 A;  1YIT Q;  1M27 C;  1N27 A;  3EGD B;  1D3B B;  1VQM T;  2CS7 A;  4J5Y A;  4L6V 5;  3LH0 A;  4C92 A;  1OYX A;  2RQT A;  3MP8 A;  2CUB A;  3EAE A;  3TSW A;  2NUZ A;  1LPL A;  1LVK A;  2RJD A;  1SSF A;  1Q95 G;  2L5Q A;  3JCM c;  1Q7Y C;  3DB3 A;  1VQ5 Q;  1MMD A;  3SFM A;  1Q86 U;  3M4Y A;  3VU3 C;  1M30 A;  1SRL A;  5J3B A;  3PMT A;  4RG2 A;  1AZE A;  2FPF A;  1GBR A;  1IRX A;  1QQJ A;  3P8B B;  4M75 B;  3PT9 A;  1X27 A;  4HKE A;  1YI2 Q;  4AG2 C;  5CCA A;  4PJN A;  1N5Z A;  4OGE A;  2LQN A;  2BTT A;  1Q82 U;  4QQ6 A;  4FYW B;  1VYV A;  2QEX A;  1U3O A;  3CCM T;  2DMO A;  3G71 A;  4LDY A;  2D0N A;  1IRE B;  4N4I A;  1NZ9 A;  2RF0 A;  1TH7 A;  4HA8 A;  3M0P A;  4OB2 B;  1TUC A;  1IO6 A;  1E7O A;  2XID A;  3OBY A;  3AHU A;  4II1 A;  2K6D A;  5GAN 4;  1Y96 B;  4HCC A;  1W70 A;  1WQ7 A;  2IG0 A;  4Y28 E;  3BDL A;  1U1T A;  2DKG A;  4J7I A;  2PQW A;  1AOJ A;  2EKO A;  2DBK A;  3MHX A;  2DIL A;  4N4G A;  3OYF A;  2A7Y A;  3CPW S;  4KUD K;  3EH1 A;  2LQK A;  4M78 C;  1EZZ B;  2WSE E;  1MMG A;  5FRO A;  1JXO A;  1IXD A;  1M8V A;  4JLG A;  1Q81 U;  5GAN f;  3WVE B;  4M7A C;  4PJM A;  3L2V A;  5I2M A;  2KRS A;  1NYG A;  4CI0 C;  2M1H A;  2O9V A;  4JJB A;  5KYX B;  2HKN A;  3VS0 A;  3BDU A;  5IH2 A;  1WHM A;  2EJF A;  2DO3 A;  3OMG A;  3PGG A;  3M4G A;  2M0Y A;  5D6Y A;  1OPK A;  1WLP B;  2D8J A;  1YIT A;  2XDD A;  3CD6 Q;  2NLU A;  2RHU A;  3GNF B;  3PVL A;  5IHN A;  4ELZ C;  2H8H A;  2GQV A;  3H0I A;  2DVJ A;  3X28 B;  3VS6 A;  4DEX A;  2K5L A;  2RHI A;  2RQR A;  2CH4 A;  1VQ5 A;  4QVZ A;  2IPO B;  1PM3 A;  2IIM A;  5IXF A;  2E64 A;  2OJ2 A;  2DD5 A;  4IKF A;  1YI2 A;  2B86 A;  2KYB A;  3QDF A;  1UEC A;  1I81 A;  3VS3 A;  1Y7X A;  5FLX E;  2RJE A;  1X6O A;  1RI9 A;  1VQ4 T;  3E9F A;  1DJ7 B;  4RG8 A;  4HVW A;  3CCU Q;  4C92 G;  3CPW P;  5CKH A;  3CQT A;  2WSF E;  2CRE A;  1HK9 A;  2M02 A;  5L23 A;  3CCE Q;  1V76 A;  3O5Z A;  2LCS A;  1TXQ A;  1NLP C;  1J3T A;  3UT1 A;  1RI0 A;  4A4H A;  2K79 A;  1G8X A;  4WCI A;  1FXX A;  1KC8 C;  3OYA A;  4PNO A;  4GBQ A;  3MEA A;  2JMC A;  4OB1 B;  3CCQ T;  2KXD A;  1VQL T;  1MUZ A;  2L3P A;  2KVQ G;  2EYX A;  3SDZ A;  2R5M A;  2LMJ A;  3GIB A;  1A0N B;  5GAN 3;  1GBQ A;  4JRQ A;  1Z9Q A;  4MMK A;  5I2S A;  1ACM B;  2OTL Q;  2L8D A;  2Y4X A;  3HHT B;  3JAM E;  4BE2 A;  1WXB A;  4Z02 A;  4HXJ A;  2Z0W A;  4JDS A;  1ZLM A;  5KYY B;  3I55 A;  2YWW A;  3KUF A;  2QDY B;  5GAN 8;  3N5B B;  4Z88 A;  1PCX A;  2JZ2 A;  2HNI A;  3VYH B;  2CSI A;  4J8O A;  4IIO A;  2CP3 A;  2VAS A;  2DAQ A;  5J26 A;  1VQ8 Q;  1N8R R;  4C92 E;  1JQQ A;  1M4Z A;  2DBM A;  1I0C A;  1AWO A;  3MKD A;  2DA9 A;  2DL7 A;  2ESW A;  3CD6 A;  1B34 B;  3A8H B;  4KT0 E;  1UHC A;  3MCA B;  1WHL A;  4Q5W A;  1G3W A;  5I11 A;  4D8K A;  3L2Q A;  1YJ9 Q;  1PNJ A;  1ZUU A;  2A37 A;  3C4S A;  1NJI C;  2VV5 A;  1TS9 A;  5CKE A;  3M58 A;  4M75 G;  4F16 A;  1G3S A;  5KCH A;  2YXY A;  4M78 B;  1I1J A;  3KBG A;  2GTO A;  1WHG A;  3TU4 K;  4OB3 B;  3G71 T;  2LNV A;  2GQI A;  1W1F A;  1NEG A;  1K9M R;  1KJW A;  4EMH A;  4OP0 A;  2CZ0 B;  5ECA A;  5CK9 A;  1SSH A;  2RI2 A;  3EG0 A;  4M7A B;  3CCU A;  3QBY A;  2LCL A;  4QQD A;  2KRM A;  5CKD A;  1RAA B;  3JB9 H;  1C0M A;  2E41 A;  1IB8 A;  1LCK A;  2HD0 A;  3CCE A;  3PNW C;  4FT2 A;  3CPW A;  3H41 A;  3OYL A;  3I5R A;  4F7U F;  2K4Y A;  4O6J A;  3CEY A;  1M1K R;  4EMG A;  4BI8 B;  3CCJ Q;  5I21 A;  5GAO q;  4BI3 A;  3UAT A;  1JEG A;  1AT1 B;  2J06 A;  2EBP A;  2G6F X;  1VQP Q;  1YHQ Q;  2K2V A;  4J6Y A;  1AD5 A;  4PLI A;  2KEA A;  2OTL A;  3FEO A;  2HL5 C;  2KR3 A;  2JTE A;  2FG0 A;  3ER0 A;  1R0B G;  3GOX A;  2J7I A;  1LJO A;  3RKW A;  2CP2 A;  2DTH A;  2YRV A;  1YJW Q;  4JJD A;  4M75 E;  1RUW A;  2IVW A;  3HRU A;  1YJN Q;  3MEU A;  1ZSZ C;  2ZGW A;  5LJ5 d;  4M77 F;  4FU6 A;  2CKK A;  4GY5 A;  1VQ8 A;  1ZBJ A;  1SF9 A;  2ZPI B;  3P8D A;  1KD1 U;  2P0K A;  1SHF A;  2KRN A;  1FMV A;  4J9I A;  3CMA T;  1YBY A;  2DM1 A;  1YJ9 A;  5GAM d;  2ZPB B;  2ZPE B;  3E19 A;  4VUB A;  3JSC A;  3QZ9 B;  1Y07 A;  5GAN 2;  1D09 B;  1W2B P;  3A8O B;  3LGL A;  4A4G A;  2X35 A;  4KH1 B;  2R5A A;  3NFC A;  2LX9 A;  4GLK A;  1GL5 A;  1M2V B;  1P92 A;  4F04 B;  4X1V A;  3VS1 A;  3L1A A;  1M9S A;  3VKI A;  5GAN h;  2XU8 A;  2PVO B;  3H0F A;  5A0G A;  5DLQ E;  1KK7 A;  2D6F A;  4E47 A;  2YRC A;  3UPU A;  4LUD A;  2KAF A;  3BE3 A;  4MZT A;  3QKJ A;  2QI2 A;  3ASK A;  1H92 A;  4RMO A;  3HP9 A;  2HL3 A;  1ZUY A;  4R0K A;  3CC2 Q;  2V8J A;  2W10 A;  2BE9 B;  4XTV A;  3M54 A;  1M1F A;  4LDW A;  4PJO D;  2C0I A;  4OMN A;  7AT1 B;  1KQS S;  3CCJ A;  3X25 B;  1SPK A;  2FZC B;  4BB7 A;  2EYZ A;  2C0T A;  3SEM A;  1VQP A;  1YHQ A;  1EX4 A;  2KNB B;  2E5Q A;  4EPC A;  3HKS A;  1VQ6 Q;  1E6H A;  1MNE A;  4C8Q D;  3CCV Q;  2KRO A;  3HPW A;  1VQ9 Q;  4LUE A;  1SG5 A;  1GCP A;  4JRP A;  1YJW A;  4MML A;  4ELY C;  5HKC A;  3FRN A;  3X26 B;  4M77 D;  2NUT B;  1YJN A;  2XKO C;  5IAY A;  3M0S A;  3CC4 T;  3M5A A;  2DEU A;  2QK0 A;  3ME9 A;  2JW4 A;  2J6O A;  3RBB B;  2JM9 A;  1WHH A;  2XMF A;  2MCN A;  3VRZ A;  1OZ3 A;  4QT7 A;  4OMQ A;  8ATC B;  3ZL7 C;  3E2U A;  2MMP A;  2W0Z A;  5DLO A;  5GAM j;  2EAY A;  1MMN A;  1JO8 A;  2F2X A;  5AYF A;  2QXF A;  1PKT A;  2J6F A;  1UJY A;  3QXE B;  2CT3 A;  2ZZD A;  4MZP A;  2QEX Q;  4E7Z A;  2K9G A;  2E4H A;  1AZG B;  4KGV B;  3INZ A;  4X9C A;  4ZGD B;  3OYC A;  3UDC A;  2OTJ Q;  4M78 G;  3CCU T;  1JXM A;  5A0D A;  1M1G A;  1M90 R;  1T0H A;  4XU0 A;  3NHN A;  4OGC A;  1RAD B;  1G5V A;  2JTF A;  5LJ3 g;  2K5I A;  4M7A G;  3TQ7 P;  5GAN d;  1XQH A;  3CCS Q;  1ZSZ B;  2LCC A;  2OX7 A;  2YUO A;  3RIR A;  2DX1 A;  3PIO A;  5FRM A;  5HK3 A;  1VQO Q;  4B9X A;  4L59 A;  2MYS A;  2FYK A;  3LYI A;  3V7C A;  2QA4 T;  3G6E Q;  1PWT A;  3OS0 A;  1AWJ A;  2DJQ A;  1N9R A;  1N6A A;  2KI7 A;  3V7R A;  4E7J A;  4R55 A;  5M9O A;  1RLP C;  1VA7 A;  1VQ6 A;  2F2W A;  2AIR B;  4AFS C;  1HSQ A;  3CXC S;  3VUB A;  4E2F B;  3CCV A;  4IUT A;  3TEE A;  1VQ9 A;  2CP6 A;  1ZBX A;  1TUG B;  1Q86 R;  2XD0 A;  1VQK T;  2MI6 A;  1S72 Q;  4M77 C;  2RO0 A;  2HBP A;  2DJZ A;  2EGE A;  5CKF A;  4M78 E;  5A0L A;  1VQ8 T;  4EMK C;  2RHX A;  2K3B A;  4BI4 A;  3CCL Q;  3OMC A;  5DY9 A;  4M7A E;  3QDR B;  1V1C A;  4MDW A;  1Q82 R;  1WNL A;  1QMC A;  3URG A;  2RQV A;  4LXC A;  2RI3 A;  2HSP A;  3VJP A;  3BY7 A;  4FYX B;  3H8Z A;  3HRS A;  2J05 A;  2QYZ A;  3REB B;  2JUF A;  5KYW A;  1U1S A;  1O9S A;  2GFA A;  1MND A;  3EG9 A;  3OA6 A;  3OYN A;  3PVQ A;  1T3S A;  3QWX X;  4IIM A;  1F1B B;  2C0O A;  1ABO A;  1WHJ A;  2OTJ A;  1RAH B;  4J9C A;  4ZN1 A;  5EC7 A;  1U5S A;  1G83 A;  1YIJ Q;  1VQ7 Q;  1VIF A;  3G7Z A;  4DBR A;  2X4W A;  5GAN j;  3QWY A;  5LJ3 e;  1KQS A;  3TRE A;  1BIB A;  4DBH A;  2VGN A;  3MP1 A;  4JRK A;  3S3N A;  2DFU A;  1K73 U;  1MMA A;  3CXC P;  3CCS A;  2E70 A;  1Q81 R;  3QG1 A;  3EGD A;  1D3B A;  1NEB A;  1I4K 1;  3WXM B;  3CCJ T;  4ME7 A;  1UDL A;  1TG0 A;  3ZEH A;  2HEQ A;  1YHQ T;  1VQO A;  1AEY A;  2HQX A;  5GAO p;  3G6E A;  3GP8 A;  4WTO B;  4C0G A;  2L3Q A;  3G4S T;  1N8R C;  3I55 Q;  3CBO A;  4J9F A;  4M75 A;  1MV0 B;  1OZ2 A;  3EG1 A;  2FRW A;  1YJW T;  3ULR B;  4WF2 A;  4OMM A;  2RQU A;  5DM7 R;  2DYI A;  1ZQ1 A;  1B3Q A;  1YJN T;  2MWO A;  2JT4 A;  3DLL A;  1QW1 A;  4A4K A;  1SEM A;  1S72 A;  3JB9 D;  2RHZ A;  3CME Q;  1R77 A;  2CP5 A;  3EGU A;  2DE0 X;  2VVK A;  1SRM A;  2B8A A;  3S3M A;  2EKH A;  3CCL A;  2EJ9 A;  3I56 Q;  1K8A U;  1Y96 A;  4Y92 A;  4L5G A;  4F7U B;  1TSF A;  2NUP B;  1K9M C;  2KGT A;  1WXT A;  2QQ9 A;  5KE2 A;  1WQW A;  2RB6 A;  1WJS A;  3OYM A;  3CBP A;  5CQX A;  5LJ5 g;  3M59 A;  1IHV A;  2XG8 D;  5IXB A;  3CC7 Q;  5GMK j;  1FX7 A;  2X3W D;  2HAX A;  1OV3 A;  4ZN3 A;  3M0Q A;  4C0F A;  2YSQ A;  2MF2 A;  1M1K C;  2EIF A;  2LDM A;  1QWF A;  4BY6 C;  3H6Z A;  1OQK A;  5KYX A;  2LTO A;  1YIJ A;  1VQ7 A;  5FU7 C;  1NBE B;  3M56 A;  2EGC A;  2XDP A;  2DL5 A;  3O8V A;  4CC2 A;  4M77 B;  2QDL A;  3CC2 T;  1Q7Y U;  4M7D D;  1I5O B;  1PD1 A;  1OOT A;  1GCQ C;  2V8I A;  4EMK B;  3FB9 A;  4J9D A;  2DRK A;  2RJF A;  2DTO A;  3SWN C;  3LGF A;  4EIK A;  3CXC A;  3OQ5 A;  4J9H A;  2V8K A;  1NYF A;  2AK5 A;  4C0D C;  3UA7 A;  2WSC E;  4E7H A;  4RCC A;  1MGQ A;  2CP0 A;  1X69 A;  1WJR A;  2FB7 A;  4JUV A;  4C92 D;  3CCV T;  3CBM A;  4A63 B;  4TVR A;  3RMQ A;  3JB9 J;  2LNH B;  2DZC A;  3Q1J A;  4BE0 A;  5GAO n;  1WDX A;  4XTU A;  5KCO A;  2YUP A;  1OEB A;  3A8M B;  1OU9 A;  1Y71 A;  2DIQ A;  4JZ3 A;  3JCM g;  2C06 A;  2E12 A;  3CME A;  1BK2 A;  4C5H A;  3S3O A;  2VKN A;  5J39 A; 
#chains in the Genus database with same CATH homology
 1PHT A;  1WXU A;  1WX6 A;  4X1V A;  3VS1 A;  1K4U S;  4RUG A;  3H0F A;  1M3A A;  1K1Z A;  2JS0 A;  2PTK A;  4LUD A;  2A08 A;  2X3X D;  2O31 A;  2AZS A;  1WYX A;  2FPE A;  1WIE A;  2BZX A;  1CKB A;  1NLO C;  2EYY A;  4JJC A;  4ZNX A;  3SHW A;  3UF4 A;  3JV3 A;  4HCK A;  2O9S A;  1H92 A;  2CDT A;  4AFZ C;  1ZX6 A;  1X6G A;  5I22 A;  2JM8 A;  2HCK A;  1AWX A;  2JMA A;  1T0J A;  2KE9 A;  1ZUY A;  4R0K A;  3FJ5 A;  2MIO A;  4LNP A;  2D1X A;  1BBZ A;  2W10 A;  2EVR A;  2ABL A;  1PKS A;  1UFF A;  4AFU C;  3RNJ A;  2C0I A;  4OMN A;  1RLQ C;  1SPK A;  2AKK A;  2BZ8 A;  1OPL A;  2BZY A;  4AFQ C;  3VS7 A;  2EYZ A;  2C0T A;  3SEM A;  5GJV B;  4F14 A;  2KNB B;  1M27 C;  1S1N A;  3PE0 A;  4HVV A;  1QLY A;  2JXB A;  4JZ4 A;  1WFW A;  4JPB W;  3I35 A;  2LJ3 A;  3EHQ A;  2RQT A;  2CUB A;  2OI3 A;  2MOX A;  3TSW A;  2NUZ A;  1E6H A;  1M3C A;  2A28 A;  5GJW B;  3NPF A;  4KRT A;  1YWP A;  2KRO A;  4LUE A;  1W6X A;  2JS2 A;  1GCP A;  2KXC A;  1M30 A;  1AVZ C;  1SRL A;  2RMO A;  1AZE A;  2GBQ A;  3M0S A;  2FPF A;  1GBR A;  4HVU A;  1X27 A;  2FO0 A;  1YN8 A;  4AG2 C;  1FMK A;  4GLM A;  3IQL A;  1N5Z A;  2JW4 A;  2YDL A;  4FSS A;  2LQN A;  1BU1 A;  1CKA A;  2BTT A;  2J6O A;  3RBB B;  2JM9 A;  2XMF A;  3LH5 A;  2MCN A;  4ORZ A;  4J9G A;  2VWF A;  2DL8 A;  3VRZ A;  1VYV A;  4OML A;  4QT7 A;  4OMQ A;  1U3O A;  2EYW A;  3ZL7 C;  2DMO A;  1TUD A;  2W0Z A;  2D0N A;  2K7A A;  1BB9 A;  2L2P A;  1JU5 C;  2RF0 A;  1JO8 A;  2F2X A;  1UTI A;  1PKT A;  3M0P A;  2J6F A;  2DYB A;  1TUC A;  1IO6 A;  1E7O A;  1UJY A;  2LX7 A;  2V1R A;  2K6D A;  1NG2 A;  2CT3 A;  2DL4 A;  2I0N A;  1W70 A;  2FEI A;  2K9G A;  4RTY A;  3M0R A;  1AZG B;  1G2B A;  5FW9 A;  3EG3 A;  1AOJ A;  2DBK A;  1JXM A;  3REA B;  3TSZ A;  1ZUK A;  1T0H A;  3NHN A;  2DIL A;  1JXO A;  3VS5 A;  2SRC A;  4CC3 A;  2NWM A;  2PZ1 A;  4D8D A;  3C0C A;  2YUO A;  1GFD A;  3I5S A;  2KRS A;  2DX1 A;  1NYG A;  2D8H A;  2O9V A;  4JJB A;  2DLP A;  2ENM A;  2ROL A;  3VS0 A;  5IH2 A;  3GBQ A;  3NGP A;  4RTZ A;  1X6B A;  1ZSG A;  1PWT A;  1AWJ A;  2M0Y A;  2DJQ A;  1OPK A;  1WLP B;  2D8J A;  3PVL A;  5IHN A;  1RLP C;  1VA7 A;  2H8H A;  3H0I A;  1Y0M A;  2HBW A;  2DVJ A;  2SEM A;  1HD3 A;  2KT1 A;  2F2W A;  4AFS C;  1HSQ A;  3VS6 A;  4DEX A;  2GNC A;  1X2Q A;  1ABQ A;  4DEY A;  2RQR A;  2CH4 A;  2EW3 A;  2FPD A;  2IIM A;  2EGE A;  2YUQ A;  5IXF A;  2OJ2 A;  2DL3 A;  2K3B A;  1H3H A;  3EHR A;  2EQI A;  2B86 A;  2KYB A;  3M0U A;  1UEC A;  3VS3 A;  1V1C A;  1GFC A;  1RI9 A;  3TVT A;  2RQV A;  4K11 A;  3EG2 A;  4HVW A;  2ROT A;  2HSP A;  4Z8A A;  3NMZ C;  3CQT A;  2J05 A;  2HDA A;  3REB B;  2A36 A;  1QWE A;  2GGR A;  2RQW A;  3I9Q A;  5IHK A;  2CRE A;  5FWC A;  2E5K A;  5L23 A;  3O5Z A;  3PVQ A;  2LCS A;  4J9E A;  1T3S A;  1NLP C;  1J3T A;  3QWX X;  4IIM A;  2K79 A;  4WCI A;  4GBQ A;  5FWB A;  2C0O A;  2K2M A;  3M0T A;  2JMC A;  2KXD A;  1MUZ A;  1ABO A;  2L3P A;  2EYX A;  4Z89 A;  2LMJ A;  4J9C A;  2O88 A;  1A0N B;  5EC7 A;  1U5S A;  1GBQ A;  1Z9Q A;  1G83 A;  4RTW A;  1AWW A;  4RTT A;  2RNA A;  3QWY A;  1HJD A;  1KFZ A;  1WXB A;  2LJ0 A;  1GRI A;  1I07 A;  4HXJ A;  1XOV A;  2KT8 A;  2KBT A;  1NEB A;  1ZLM A;  1UDL A;  1TG0 A;  2HEQ A;  4Z88 A;  4LE9 A;  2CSI A;  1U06 A;  1AEY A;  4IIO A;  2LZ6 B;  2L0A A;  4OMP A;  1B07 A;  1UE9 A;  4AG1 C;  1X43 A;  3VS2 A;  1YNZ A;  2L3Q A;  1JQQ A;  2DBM A;  1I0C A;  1AWO A;  2OAW A;  1Z9Z A;  1E6G A;  1YWO A;  4CC7 A;  2DA9 A;  2DL7 A;  2ESW A;  4J9F A;  1NM7 A;  1MV0 B;  3EG1 A;  1UHC A;  1KSW A;  2CUD A;  2FRW A;  1PRL C;  3ULR B;  2RPN A;  2DF6 A;  2P4R A;  2RQU A;  4OMM A;  3A98 A;  5I11 A;  1B3Q A;  1K0S A;  4D8K A;  2F2V A;  4LN2 A;  2JT4 A;  1X2K A;  1PNJ A;  1ZUU A;  1VYU A;  2A37 A;  1YP5 A;  1SEM A;  2CH4 W;  2M51 A;  2EPD A;  3EGU A;  2DE0 X;  4CC4 B;  2VVK A;  1SRM A;  3H0H A;  4F16 A;  1QKX A;  1EFN A;  2EKH A;  1I1J A;  2GTO A;  2YUN A;  2GQI A;  1W1F A;  3KFV A;  1NEG A;  4Y92 A;  1KJW A;  5ECA A;  1UGV A;  4RTX A;  1SSH A;  3EG0 A;  1QKW A;  1UJ0 A;  2KGT A;  2V1Q A;  1WXT A;  1M3B A;  4E6R A;  1K76 A;  1UG1 A;  2AKL A;  2KRM A;  1WA7 A;  1GCQ A;  1LCK A;  5IXB A;  2O2O A;  3H41 A;  2X3W D;  3I5R A;  2ECZ A;  1WI7 A;  1OV3 A;  2CSQ A;  3M0Q A;  3VRY A;  3R6N A;  2YSQ A;  2RN8 A;  1T3L A;  2J6K A;  2AZV A;  1QWF A;  3UAT A;  1JEG A;  2LQW A;  2J06 A;  4F17 A;  2EBP A;  2G6F X;  4OMO A;  2ED1 A;  1AD5 A;  2KEA A;  2EGC A;  1VYT A;  2DL5 A;  4CC2 A;  2QDL A;  2KR3 A;  3U23 A;  1OOT A;  1GCQ C;  4M4Z A;  2JTE A;  5IHI A;  1H8K A;  2FG0 A;  2KYM A;  2LP5 A;  2J7I A;  1UUE A;  5HCK A;  4J9D A;  4JJD A;  2DRK A;  1RUW A;  4EIK A;  1MV3 A;  4J9H A;  1CSK A;  1UHF A;  1NYF A;  2AK5 A;  3UA7 A;  4RTU A;  1QCF A;  4J9B A;  1PRM C;  2LJ1 A;  1X69 A;  1ZBJ A;  1SHG A;  2ED0 A;  2YT6 A;  2DRM A;  3UA6 A;  2EGA A;  2PNI A;  4A63 B;  1Y57 A;  1ARK A;  3THK A;  1SHF A;  1FYN A;  1M8M A;  2KRN A;  2LNH B;  2GTJ A;  4ESR A;  4J9I A;  3VS4 A;  1KIK A;  2L3S A;  2DM1 A;  1WDX A;  2YUP A;  1OEB A;  4JZ3 A;  2DNU A;  1K9A A;  2FRY A;  2CT4 A;  1BK2 A;  4RTV A;  1K0X A;  2VKN A;  1YCS B;  1GL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...