1UUEA

A-spectrin sh3 domain (v44t, d48g mutant)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKTEVNGRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN
publication title Solvation in Protein Folding Analysis: Combination of Theoretical and Experimental Approaches
pubmed doi rcsb
source organism Gallus gallus
molecule tags Sh3-domain
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uueA00
4A63B 1AOJA 1WX6A 4DEXA 1JEGA 2DRKA 4AFSC 1JQQA 2CH4W 1T0HA 3EHQA 5IHKA 1W6XA 1K1ZA 2CDTA 1M8MA 2JS0A 2XMFA 1TUCA 4OMOA 2LX7A 1NEGA 1KFZA 2PNIA 4D8DA 2BTTA 2CREA 4RTVA 2KR3A 1AVZC 3M0PA 1AEYA 1AWJA 2J05A 4OMQA 3REAB 2JMCA 1WA7A 2B86A 2F2WA 3JV3A 3QWXX 2GNCA 2EW3A 1G2BA 2A28A 2MOXA 3H0HA 1GFDA 1VYTA 2DMOA 3U23A 1LCKA 3I35A 1FMKA 1ZLMA 4F16A 5IHNA 1GCPA 4ORZA 3SHWA 4KRTA 4AG2C 4HCKA 1S1NA 2YT6A 1QWFA 1K9AA 2FRYA 3GBQA 2FPDA 2X3XD 2H8HA 3M0QA 2KRSA 1UECA 1OPLA 2L3PA 3EHRA 2J6FA 2LQWA 2KE9A 4HVVA 3O5ZA 2DYBA 1K0XA 1H92A 2ED0A 2EPDA 4AFQC 2CH4A 1SHFA 2DILA 4RTWA 3VS7A 1SSHA 1WIEA 2K9GA 4D8KA 1KIKA 2FRWA 4J9FA 2O31A 2EVRA 2O2OA 3VS6A 1T0JA 4JZ3A 1OPKA 4RTZA 2HBWA 3NMZC 1RLPC 1T3SA 1J3TA 1WYXA 1OV3A 1G83A 4RTYA 1V1CA 4K11A 5FWCA 5IXBA 1HD3A 4CC2A 2LJ0A 1JXMA 4IIOA 4Z88A 1QLYA 2FG0A 2FEIA 3I5SA 2LMJA 1ZUKA 2JT4A 4AFZC 2BZ8A 2KEAA 1HJDA 2RQUA 1WXBA 2DF6A 2A37A 2LZ6B 2F2VA 2NWMA 1GCQA 1BK2A 1X2KA 2ECZA 2OJ2A 1YWPA 4GBQA 2DX1A 2EYYA 3EG3A 3VS2A 2FPFA 2D0NA 1Y0MA 2LJ1A 5FW9A 2MCNA 2M51A 2D8JA 1Z9ZA 4LNPA 3RNJA 1CKAA 3PVQA 3H41A 1UUEA 4GLMA 5ECAA 2DLPA 2L3QA 2RMOA 1PKTA 1UGVA 2A08A 2AZVA 2PZ1A 3C0CA 4RUGA 2D8HA 2ESWA 2KGTA 2KXCA 1MV3A 2EYWA 4Z8AA 2CT4A 2VWFA 1WDXA 2DVJA 2RQTA 4J9GA 5EC7A 4EIKA 5I11A 1WI7A 3THKA 1SHGA 2K3BA 3FJ5A 2O88A 1TG0A 1SRLA 2JM8A 5IHIA 1UG1A 2ABLA 1PKSA 1SRMA 5IH2A 2W0ZA 3VS0A 2KT8A 1GBQA 1GL5A 2JW4A 4CC7A 4LUDA 2C0IA 5FWBA 3CQTA 3IQLA 4X1VA 1WFWA 1M27C 4JJDA 3M0TA 1GFCA 2A36A 2RQRA 3VS5A 1MV0B 4F14A 2AKKA 2J7IA 2CUBA 2LNHB 3NGPA 2DJQA 2KT1A 3PVLA 1NYGA 2JMAA 1AZEA 1AWOA 2CUDA 3R6NA 2DE0X 2IIMA 1K76A 2DL4A 1SPKA 1W70A 1OEBA 4Y92A 2P4RA 1K4US 2DL5A 3I9QA 3QWYA 2EGEA 2LP5A 1PWTA 2LCSA 1B3QA 1YWOA 1X43A 4HVWA 1MUZA 5L23A 2DL7A 4OMNA 1UJYA 1I0CA 1WLPB 1ZSGA 1QKXA 1U06A 4JJCA 2JTEA 4RTXA 2BZXA 2F2XA 1UE9A 1ZBJA 4J9DA 2OAWA 1GBRA 2G6FX 3VS1A 3VRZA 1BU1A 3H0IA 2C0TA 3M0UA 2ROTA 4J9IA 3SEMA 2V1QA 2D1XA 2CSQA 2GGRA 3UA7A 1AD5A 4M4ZA 3KFVA 2RQWA 1M3AA 2L2PA 1NG2A 4JPBW 5I22A 2YDLA 2KXDA 4J9EA 2L0AA 1GRIA 1UFFA 2RQVA 2K2MA 2HCKA 1UHCA 1PRLC 2DM1A 1CKBA 1NYFA 2LJ3A 4ZNXA 1KJWA 1CSKA 2FPEA 2SRCA 1VA7A 1RUWA 4HVUA 2RN8A 1KSWA 1X6BA 2MIOA 3EG0A 2DRMA 2DBMA 1VYUA 2GTJA 1AWWA 1QWEA 2YSQA 1QCFA 4AG1C 3REBB 4R0KA 2ED1A 1ARKA 1X2QA 2GTOA 3VRYA 1ZUUA 3NHNA 4JJBA 2VVKA 1ABOA 2I0NA 1BBZA 2YUQA 1YNZA 1U5SA 1E6HA 2J06A 1X69A 2BZYA 1YP5A 4RTTA 1H8KA 2PTKA 1ZUYA 4E6RA 4QT7A 2E5KA 5GJWB 1TUDA 1VYVA 4J9BA 1X27A 2HSPA 4AFUC 2EQIA 2VKNA 1UTIA 1BB9A 2V1RA 1N5ZA 2L3SA 2AKLA 2AK5A 2JXBA 1AZGB 1UDLA 2YUPA 2SEMA 1I07A 2AZSA 4JZ4A 1W1FA 2EKHA 2GQIA 1NLPC 3TVTA 4HXJA 2KROA 1JO8A 4Z89A 2ROLA 1JU5C 2K7AA 1X6GA 2K6DA 5GJVB 3VS3A 2FO0A 1IO6A 2X3WD 2KRMA 1M3CA 2JM9A 4OMMA 1ABQA 1FYNA 1T3LA 1PRMC 1JXOA 3H0FA 4RTUA 1E7OA 1RLQC 3PE0A 1H3HA 1SEMA 1WXUA 1HSQA 3EG2A 2QDLA 5IXFA 3M0RA 3UATA 3ZL7C 2J6OA 1OOTA 2EYZA 2ENMA 2JS2A 2KYMA 2OI3A 2W10A 1Z9QA 4DEYA 2EGCA 4CC3A 3TSZA 2EBPA 3I5RA 3M0SA 2J6KA 4J9HA 1UHFA 2DNUA 2RF0A 3A98A 3EGUA 4LUEA 1EFNA 1WXTA 1M30A 1YCSB 2O9SA 1PNJA 4LE9A 4F17A 1XOVA 4IIMA 4WCIA 4J9CA 4OMLA 1U3OA 2NUZA 1NM7A 2EYXA 2RNAA 1Y57A 2CT3A 1ZX6A 1UJ0A 1QKWA 2DL3A 4CC4B 2DBKA 5HCKA 2O9VA 2KYBA 3UA6A 1NLOC 2HEQA 2K79A 1B07A 2CSIA 2DL8A 4LN2A 2HDAA 3ULRB 2C0OA 3UF4A 1YN8A 1AWXA 3NPFA 2YUOA 3EG1A 2KNBB 1NEBA 2M0YA 2EGAA 4ESRA 1E6GA 3VS4A 2DA9A 3LH5A 1A0NB 1I1JA 2KRNA 2YUNA 1M3BA 2LQNA 1K0SA 1GCQC 2GBQA 4OMPA 2RPNA 1RI9A 1PHTA 2KBTA 3RBBB 4FSSA 3TSWA
chains in the Genus database with same CATH superfamily
3EG9B 5CQYA 1Y96B 2KVQG 2RJDA 4A63B 1BCOA 3INZA 1WX6A 4NL2A 3CCQA 4AFSC 2HKQB 2WSEE 2I2LA 4IUPA 2EQJA 5IHKA 1K1ZA 2XMFA 4OMOA 4F7UG 1YJ9T 2LNVA 5GAN4 3OYEA 4XQ3A 2PNIA 3OYNA 2CS7A 2K3YA 2LTOA 1AWJA 4OMQA 2B86A 2MAMA 4BI4A 1BI0A 3CMET 4L5GA 5GAOp 1VYTA 3U23A 1KC8U 2MI6A 4BY6C 1SF9A 2YLCA 1FMKA 3VKIA 1PD0A 5IHNA 5DM7R 1XNIA 1VQ8T 1MMDA 3LYIA 5I2SA 3QPHA 4Y28E 2CP0A 2FPDA 4M78A 4F7UF 3EHRA 1NZ9A 2LQWA 2KE9A 2DZCA 1OU8A 4HVVA 2DYBA 3JRZA 4JDSA 2ED0A 3DLLA 4AFQC 3RIRA 4J8OA 1I8FA 3JB9H 1KHIA 3EG9A 3P8HA 1SSHA 3CMEA 1KD1R 1KIKA 5KYXB 2FHDA 2KK4A 4RCCA 1WJQA 4JZ3A 5J3BA 4RTZA 2HBWA 2DIQA 2EWNA 1T3SA 1O9SA 1OV3A 4BY6B 1XTDA 4XU0A 2DTIA 3FIFA 1M9SA 4CI0C 3QJYA 1I81A 2DERA 2GFUA 1JXMA 4Z88A 3I55T 2FG0A 3I5SA 2LMJA 3JCMV 1W2BS 4EMHA 2BZ8A 2KEAA 2NLUA 5FRMA 2F2VA 2NWMA 1QP2A 4JLIA 3MEUA 1BK2A 1X2KA 2PUOB 2DK3A 2LDMA 1YWPA 2QA4T 2KAFA 3X24B 2DX1A 2EYYA 1Y0MA 3OSVA 5FW9A 2LRQA 3OS2A 2M51A 3GNGA 4LNPA 1OU9A 4DOWA 2RI5A 1BIBA 4E7HA 1UUEA 4GLMA 6AT1B 1VQPT 2HQEA 1PKTA 2A08A 3CPWP 4M78G 1AT1B 4RUGA 2FZGB 2KXCA 3MP1A 1MV3A 2CT4A 5KYXA 1WDXA 2DVJA 3E9GA 5EC7A 4FT4A 4BI8B 4HT9A 1WI7A 3THKA 4M77E 2JM8A 2PVGB 4EPCA 4D6WA 5IHIA 5KYWB 1TU0B 3CCUQ 4L59A 2JW4A 4CC7A 3DLMA 4IUTA 5GAMg 3IQLA 2B8AA 3LGFA 1C1AA 1YIJQ 2DETA 4FIBA 2A36A 5CAIA 2QTVA 1I5LA 4A4FA 1RI0A 1TUGB 2RQRA 3VS5A 1MV0B 1Q82C 2AKKA 2PVOB 2CUBA 4M78F 2LNHB 1VQ6Q 4M77D 5KH6A 3PVLA 3LX7A 1IB8A 1AWOA 2DE0X 5GAOn 2E5QA 1X01A 3OS1A 4C92A 3JCMb 4J7IA 3OYJA 3A5ZB 3NTKA 1RAGB 2BIVA 1KQSP 2X4JA 1PWTA 1PCXA 3TEEA 4M77C 3EFOB 2RJEA 2DL7A 4LXCA 2CP5A 2YRCA 1I0CA 1ZSGA 2QGFB 2Y90A 1XJWB 4LDYA 2DYIA 3EAEA 4RTXA 1UE9A 5KYWA 4J9DA 2OAWA 1GBRA 1SKUB 3QIIA 1IZ6A 3H0IA 3OYDA 3M0UA 5CKHA 4J9IA 3OYBA 1D3BA 2D1XA 1W4SA 2F5TX 2CSQA 2ZAEA 4N4HA 5A0LA 4M4ZA 2RHZA 4A4GA 3KFVA 2EJ9A 2RQWA 3PNWC 1VQ7Q 2L2PA 3M58A 1NG2A 3CCLT 5I22A 3A1PA 1PM3A 3GF5A 3E1SA 1TS9A 2RQVA 5I21A 1M90U 3QZ5B 4FM4B 1PRLC 1NYFA 4XU1A 4M77B 4IKFA 4C8QA 3CCUA 4MDXA 3CD6Q 1M1FA 1CSKA 1YHQT 3L2VA 3OYYA 1QVGA 2ZPEB 3VUZA 3CBPA 3V8KA 4OB0B 3EFOA 2HQXA 2GTJA 4C92G 1YIJA 4OVAA 2YSQA 4M75E 1ARKA 1X2QA 2GTOA 4M7AD 5CKBA 1ZUUA 3CCMT 1VQ6A 3NHNA 4M7DD 2K2VA 2I0NA 2YUQA 4KH0B 4ZN1A 3CCLA 4A53A 1YNZA 3I56Q 1TSFA 1U5SA 2E70A 1YP5A 4RTTA 3MKDA 4E6RA 4QT7A 2ZPFB 3MEAA 5GJWB 1TUDA 1WHGA 1G3TA 1D0ZA 4M7AC 4O5VA 4RCBA 4QQDA 1X27A 4AFUC 1WHLA 4M7DC 4C92F 2VKNA 5LJ5j 2DEQA 1UTIA 2OTJT 1N5ZA 3A8HB 2JXBA 1VQKT 2YUPA 3CEYA 4JZ4A 3CCMA 3GP8A 2EJFA 2EJGA 5I2MA 1MGQA 1JU5C 4O6JA 5HY6A 1X6GA 2D6FA 2AIRB 3VS3A 2EQMA 2FO0A 2EYQA 2M16A 3S3NA 5D7UA 1IO6A 1VQOT 2JM9A 3HFNA 4C8QG 5GANh 5GMKl 5LJ3j 4EMGA 3CC4T 1T3LA 3H6ZA 2A0FB 1JXOA 2E41A 1NJIR 4LDWA 1JJ2P 1VQ7A 1SEMA 2QQRA 2OTJA 2ENMA 4WF2A 1QVFP 4M7AB 2EGCA 4CC3A 3CD6A 1K8AU 4M7DB 1UHFA 2K3XA 3A98A 4ELZC 4R55A 3RUXA 4KH1B 2O9SA 3QBYA 4LE9A 2DVEA 1VQOA 4C8QF 1ACMB 3CPWA 1XOVA 4WCIA 1QP3A 4MZMA 3CC4A 1U3OA 2PVDB 2CT3A 3JB9J 2JTFA 3FLGA 2R58A 4CC4B 3CXCP 1C6VX 1YJNT 1KQSS 1RAHB 1VQMQ 2P0KA 3MHXA 4LN2A 3UF4A 2ZCFB 3CCVQ 1N6AA 4NL3A 1VQ9Q 2M0YA 4FYWB 3OYGA 1Q7YC 3HRSA 3VS4A 3MEVA 1UGPB 3QZ9B 1EIFA 3C94A 1M3BA 1ZA2B 4ANJA 4ELYC 4M7AA 1RI9A 2DTHA 2KBTA 3FB9A 2NYSA 4M7DA 3TSWA 4FSXA 5GAN7 1YJNA 3OYHA 1AOJA 4DEXA 1RACB 2CP2A 4C0GA 4BDYA 2X35A 2JS0A 4QQ6A 1KFZA 4D8DA 1AEYA 1QW1A 2K5LA 2F2WA 2XKOC 1G2BA 1WQ7A 1NPPA 3H0HA 1GFDA 2V8JA 3M55A 4PJOF 3TREA 1KQ1A 4XTYA 1IRXA 3JSCA 3O8VA 4YTLA 1W2BP 4MMKA 2XDDA 2Z0WA 3SHWA 1BCMA 2O4XB 2MMPA 5GAN2 1S1NA 1QWFA 3GOXA 2LCCA 3EGDB 1Q86C 3M0QA 3META 5GAN5 2QEXT 4OF1A 5LJ3d 1WNLA 1VOMA 1K0XA 2HBPA 1YITQ 1H92A 2VV5A 2RI2A 1SHFA 1QQJA 4JRPA 1WIEA 3JCMe 2HNIA 2M9UA 1Y7XA 4M7AG 1K9MC 2EAYA 3VS6A 5GAOq 1BI1A 4M7DG 3QUIA 2R5MA 3CCVA 3NMZC 3ASKA 1O75A 1BI3A 2ZPHB 1BYMA 1D0YA 5GMKh 3WVDB 5GAN8 1Q7YR 3CCST 3OYKA 3JB9D 4RG2A 1QVPA 1TOVA 5FWCA 3P8DA 1BIAA 1D0XA 3OB9A 2LC4A 3GNFB 5AT1B 4N4GA 1IXDA 2RM4A 1M5Q1 1Q81U 4RG8A 3CCQT 1HJDA 5HK3A 3NTHA 2A37A 1WHMA 3JCMf 1YJWQ 1PC0A 4M7AF 2XD0A 2ECZA 1JJ2S 2E6ZA 4GBQA 3VS2A 4M7DF 2FPFA 2D0NA 2VGNA 2RD1A 2LJ1A 2DXTA 3EGDA 2XG8D 1QVFS 1UGRB 2D8JA 3RNJA 5IT9E 1YI2Q 1PD1A 2L3QA 5D6YA 1M1KC 2PU9B 3C0CA 2D8HA 3H9NA 2ESWA 2HQHA 2RQTA 4EIKA 1HYOA 4FW2A 1SHGA 3TQ7P 1MMNA 4P5NA 2PQWA 1U8RA 5LJ5e 3L2ZA 3CC2Q 1GBQA 1Q86R 3CXCS 5FWBA 1QCOA 3L2UA 1WFWA 3BDLA 1M90R 4JJDA 4JLGA 3M0TA 4AMCA 1RADB 4IUUA 3SWNC 3NTIA 2J7IA 2GCXA 2KT1A 2RH2A 5LJ3e 1HXDA 1K9MR 2JMAA 4XK8E 1AZEA 3R6NA 4FT2A 1V29B 2IIMA 4EDUA 1HK9A 2WSCE 4XTZA 1OEBA 5LJ5f 5L8RE 4X9DA 4ZGJB 1B3QA 1YWOA 3OSSC 1X43A 4JRKA 1Y96A 2QDYB 2XICA 1G3WA 5KCOA 2BZXA 2F2XA 5LJ3f 2E3HA 1ZBJA 3UDCA 2OX7A 1C0MA 2E10A 5GANj 2IG0A 4C0ZA 2YWWA 5C6SA 3VRZA 2BUDA 3SWNB 3OW2P 1B7TA 1N8RU 1Y71A 2C0TA 2D9TA 3QDRB 2VXFA 1YI2A 1KK7A 1B34B 1M1KR 5DY9A 5LJ3g 1DJ7B 4KGZB 3V7CA 2MPXC 5GAMh 2VUBA 4DA4A 1F1BB 2COWA 5GAN6 2KXDA 4J9EA 2A3LA 1GRIA 1VUBA 1D1AA 3DKMA 2EIFA 2HCKA 1UHCA 2DM1A 3PIPA 5GAN3 1AHJB 3CC2A 2M1HA 2RN8A 2CP6A 1KSWA 1MNDA 2GFAA 1LOJA 3FRNA 1AWWA 1QWEA 4AG1C 1K8AR 2WSFE 3GIBA 4JJBA 4FYYB 3MCAB 2MF2A 2KI7A 2K5FA 2CP7A 2G3RA 4RKUE 3RESA 1E6HA 2EQUA 1LNXA 3OY9A 2NUTB 4PK4A 4E7ZA 4F04B 3G4SQ 2FB7A 1B34A 1TXQA 2HSPA 1NBEB 2Y4YA 4OGCA 7AT1B 3UPUA 2V1RA 1I5OB 3RMSA 2AKLA 1WJRA 1S72Q 1UDLA 2F1LA 5FRNA 3DB4A 4DBRA 3NFCA 1I07A 2DTOA 2R57A 1NLPC 4HT8A 5CK9A 4PJOE 4PJLA 4E7SA 2E3IA 1M2OA 3GLXA 2KRMA 2RK2A 5AYFA 3FDRA 3PGGA 1X6OA 4R56A 4KUDK 1ABQA 2QG9B 4OB2B 3M4GA 2ZPGB 3H0FA 2YHTA 3L42A 1E7OA 3VUBA 2MWPA 4PKCC 1WXUA 3CCUT 2M02A 2JS2A 2X4WA 3TSZA 2EBPA 2L89A 3QXEB 2NUTA 1NPRA 3M0SA 2DNUA 5CKFA 4IURA 1YIJT 4C0DC 5M9OA 1KG1A 1WXTA 1WJSA 3CCJQ 1PNJA 1FMWA 1VQ6T 1NJIC 2XIDA 4OMLA 2RNAA 4BUGA 5GAOl 1WZOA 4ZTFA 1VQ4Q 1OX8A 3CC7Q 1VQNQ 1RL2A 2IVWA 2DBKA 1OQKA 1LVKA 1FX7A 5CO7A 5GMKj 2RJCA 2HEQA 4L6V5 2DL8A 2HDAA 3ULRB 4PL6A 8ATCB 2KY9A 2YUOA 1NEBA 2QQAA 2EGAA 2CZ0B 1KC8C 2GF7A 2K5IA 3RR6A 3HP9A 2L8DA 9ATCB 3VV0A 4C0DB 1S72A 4KGXB 1GCQC 4OMPA 3ZEHA 3OW2S 3OA6A 3JAME 4MZTA 4FSSA 1X75C 1OX9A 3EFRA 5KCHA 4JUVA 4C5HA 3V8JA 1JEGA 1K73U 2CP3A 4M75D 2V8KA 1MNEA 2QXFA 1VQ7T 2CH4W 1ZQ1A 1W6XA 2CDTA 1M8MA 1TUCA 3OYIA 4II1A 1KD1U 1NEGA 3QYHB 1P92A 4RTVA 1VQLQ 1AVZC 3X28B 3M0PA 3CD6T 2DJZA 3KBGA 4M77A 3REAB 2JMCA 3QWXX 2EW3A 2MOXA 2HL5C 2RI3A 2DMOA 1LCKA 3I35A 2XK0A 4M75C 1ZLMA 1Q95G 5CCAA 4F16A 3V7RA 4NS5A 4BI3A 4MMLA 3EH2A 2BE9B 2FVUA 3JCMX 4AG2C 3CCJA 2JUFA 2YT6A 4DQ2A 1ZBXA 1K9AA 3GBQA 2X3XD 3CCRQ 4F7UE 2LCLA 1U1TA 5GANe 1UECA 3CCEQ 1OPLA 3I56T 2J6FA 3ER0A 3O5ZA 2DXBA 3HFOA 1VQ4A 2EPDA 5HK0A 4XTXA 1WPYA 1TH7A 3RKXA 1Y07A 2FRWA 4J9FA 2O31A 1UEBA 2VXEA 3VJPA 4ME7A 2P4TA 4C5GA 3M56A 1RAEB 1RLPC 1WYXA 1IREB 1KC8R 1V1CA 4M75B 1MMAA 4K11A 3JCMd 2CZ6B 5IXBA 1HD3A 5GANf 4CC2A 2LJ0A 4JS4A 3I56A 1VQ5Q 1QLYA 3CMAQ 1ZUKA 3QJ6A 2VB6A 4NOYA 4M77G 2COZA 2DF6A 2LZ6B 2FZCB 3OBYA 4IUQA 2QQSA 1GCQA 5A2QE 2CZ1B 1OZ3A 5IAYA 5FU7C 3EG3A 3PTAA 1EX4A 1R0CB 1QMCA 1G3SA 3MP6A 4JRIA 2OTLQ 5GAMj 1VQLA 4IUVA 2V8IA 3PVQA 3H41A 5ECAA 2DLPA 4N0AC 1UGVA 2PZ1A 1M4ZA 2LT1A 4Z8AA 5D6WA 4OP0A 2K3BA 3L2RA 1KQSA 1KQ2A 1SRLA 4M77F 2JVVA 2ABLA 3X25B 1YBYA 1PKSA 2RHYA 5IH2A 3G6EQ 1G5VA 2EKOA 5KYYB 4M75A 2EQKA 3VS0A 3CCRA 3M4YA 1GL5A 1OULA 3CCEA 1VQMT 3BE3A 2R5AA 2E1HA 5LJ5d 5FU7B 2DKGA 2JJ9A 2PUKB 4M78E 4WTOB 3NGPA 2DJQA 3CCVT 1VQ9T 1RAIB 3D7SB 3OYLA 1K76A 2DL4A 3SB2A 1UGSB 2P0PA 4UC4A 4Y92A 2RHIA 2MK5A 2P4RA 1K4US 3QWYA 3MJXA 3RKYA 5DLOA 2EGEA 1M90C 2F5KA 2KSSA 2QYZA 2X4YA 2LCSA 4ZN3A 3LWIA 3SD4A 3SFMA 3EGXB 4E2FB 5L23A 4JRQA 3VYHB 1VQMA 1QKXA 4GY5A 3RKWA 1U06A 2XDPA 4JJCA 8AT1B 4J83A 3VS1A 1VQ9A 5KYYA 2XHCA 1Q82U 3M9QA 1BU1A 3TCJA 4PJJA 3G71Q 1MHNA 2ROTA 1R0BG 3QO3A 2V1QA 2DPPB 3SEMA 4OGEA 2F69A 4C5EA 1AD5A 5GMKe 4M75G 2RA2A 4BDZA 1SG5A 5HKCA 2O4XA 4JPBW 2YDLA 1YJ9Q 2JOYA 2L0AA 3QG1A 2K2MA 2X9HA 2YRDA 4PFOA 4ZNXA 3R6OA 3G6EA 3OS0A 3MP8A 2O01E 2HKNA 3CMEQ 2FPEA 3LLRA 1VA7A 2X51A 1YITT 1RABB 5KE3A 1X6BA 1WHKA 2DBMA 3JCMg 4DOVA 1VQ8Q 5J26A 1RAAB 3REBB 4M75F 3J81E 5A0GA 1VIFA 1PSFA 5A0DA 2JNGA 4KGVB 1NE8A 4QW2A 2HL3A 2VVKA 1MMGA 1BBZA 4QQGA 3A8GB 3JCMJ 2RO0A 3BW1A 3LW5E 4RMOA 2J06A 4J6YA 2BZYA 2QGGA 1JJ2A 1H8KA 2PTKA 1ZUYA 2XU8A 2E5KA 2QI2A 4C5IA 1QVFA 1YITA 5FU6C 1WHJA 2VYTA 1WHHA 4C92E 1PG5B 1K8AC 2EQIA 1TWBA 1YJWT 1BB9A 2L3SA 4MDWA 1QVGP 2FYKA 4C0FA 2LT4A 3S6WA 2CGHA 2SEMA 4FYXB 1D1BA 1W1FA 2EKHA 1V76A 5LJ3h 3V7SA 2KROA 3RMQA 4Z89A 4FU6A 1RAFB 3JCMP 1PSEA 1YI2T 3A8LB 5GJVB 3I55Q 2CZ7B 1M3CA 3G71A 4A4KA 4C92D 4OMMA 3CXCA 1FYNA 4Y91A 4RTUA 1RLQC 3MPUB 3PE0A 1ZSZC 2QA4Q 5LJ5g 3VYGA 3EG2A 3PIOA 2QDLA 5IXFA 1YJWA 3OYFA 3ZL7C 3HPWA 2J6OA 1YJ9A 2DEUA 2EYZA 3CC2T 3QDFA 2JN0A 2KYMA 2W10A 3QYGB 1K73R 1Z9QA 5FU6B 2QTXA 3OYCA 4B6MA 3PFSA 4LD6A 2J6KA 4J9HA 4C92C 1VQPQ 2RF0A 4LUEA 3C4SA 4KULA 2YLBA 4C8QE 2XI9A 1VQ8A 3J80E 4JJNK 3WXMB 4IIMA 4J9CA 4KUIA 3OYMA 1NM7A 1ZX6A 1UJ0A 1QKWA 4HCBA 1XQHA 4HKEA 5HCKA 5FROA 4FW1A 5GAMe 4ZGDB 2O9VA 1ZSZB 2P0QA 1N27A 3VU3C 4ZTJA 3AT1B 4C8QD 3M57A 4BACA 3HHTB 1YN8A 3DB3A 2KNBB 3P8BB 4ESRA 2A7YA 1E6GA 4BE2A 2FL7A 3X20B 5CKEA 4E47A 1A0NB 3LH5A 4C92B 4JS5A 3OMGA 1W2BA 1I1JA 2QQBA 2YUNA 3HRUA 1EZZB 2GBQA 1FWZA 3UWNA 5DLQE 2RPNA 4BE1A 5CR2A 1YFNA 4QKUA 3SWNA 3RBBB 2YXYA 1R8OB 4C8QC 5GAMf 2LQ8A 2NUPB 3MO8A 3PMIA 3I55A 3BY7A 3M5AA 4X9CA 2DRKA 4EMKC 1JRIA 1JQQA 3AHUA 4A4EA 3S3MA 3EHQA 1T0HA 4Q5WA 3LGLA 4XU2A 2LX7A 3S3OA 3QSUA 2BTTA 2CREA 2QA4A 3JB9G 2KR3A 2K57A 3HSBA 2J05A 2DIGA 3E9FA 1WA7A 3JV3A 1D3BB 2GNCA 2A28A 4ATOA 2ZPIB 3UT1A 3JCMQ 1Q7YU 1ZSZA 4OB3B 4XTVA 1VQPA 1GCPA 4ORZA 4KRTA 3CCLQ 4HCKA 4CRIA 1D09B 1BI2A 2FRYA 4C8QB 2RHUA 2DD4A 1Q81C 2H8HA 3JB9I 2RK1A 1H641 2KRSA 1FXXA 3C12A 1M2VB 2L3PA 1YHQQ 1QCNA 4PFZA 3ZFJA 2DFUA 1IGUA 3JB9F 4PJOD 4EMKB 4FYVB 2AHJB 2FZKB 3E2UA 2CH4A 4V2SA 2ZZDA 2DILA 4RTWA 3VS7A 2NUPA 1M8VA 2QAZA 2K9GA 4D8KA 2KMTA 3G4ST 4PJNA 4BD3A 5GANd 4J5YA 2EVRA 2O2OA 3RDVA 1T0JA 1OPKA 3CCMQ 2HZYA 5KE2A 2CKKA 4PLIA 4QVDA 1J3TA 1S72T 1QVGS 3QKJA 3M54A 3BDUA 4PJOC 1G83A 4RTYA 3CPFA 4PFPA 4QVCA 4KBMB 4IIOA 2FEIA 2JT4A 1Q86U 4AFZC 3J7AF 2RQUA 1WXBA 4OB1B 2MYSA 2L3RA 4M7AE 2OTJQ 3G4SA 2IPOB 2OJ2A 1VQKQ 3KUFA 4M7DE 2DO3A 3L1AA 2MCNA 1M2VA 4J6WA 4OMFB 1UB4A 1Z9ZA 1K9MU 4EMKA 1CKAA 1D1CA 4PJMA 2COYA 4KT0E 1G8XA 2RMOA 1VQOQ 2AZVA 4E7KA 1KHCA 1M1GA 2KGTA 2ZGWA 2EYWA 4HA8A 4B9WA 2VWFA 3CC4Q 4PJOB 3V8LA 4BE0A 4LDVA 4J9GA 3CCJT 1Q82R 5I11A 3RERA 3FJ5A 4N4IA 2O88A 1TG0A 4E7IA 3Q1JA 3N5BB 1UG1A 2Y4XA 2E4HA 4FCYA 2KDSA 1SRMA 3OMCA 2W0ZA 2WACA 1Q81R 2KT8A 3TU4K 1LJOA 1VQ4T 2BE7D 4DBFA 3CC7T 4LUDA 1VQNT 2C0IA 1N9RA 2LQKA 1YHQA 3CQTA 4X1VA 4B9XA 4HCCA 4FL6A 1M27C 5KYNA 1GFCA 1N9SA 4MZPA 4F14A 3OW2A 5CKDA 1N8RC 3FEOA 1NYGA 2AT1B 2CUDA 1M1KU 3L2WA 3H8ZA 1SPKA 1W70A 3A8OB 2ZPBB 3LWHA 3SDZA 4J7FA 1I4K1 2DL5A 2E65A 5D6XA 3I9QA 1YJNQ 5EG2A 2LP5A 3CPWS 3CC7A 1VQNA 4HVWA 1MUZA 4OMNA 1OZ2A 1UJYA 4PJOA 1IGQA 1WLPB 3JCMc 2L5QA 2DAQA 2OAUA 5IN1A 2JTEA 4Z02A 3X26B 2DXCA 1WQWA 4PLLA 2G6FX 1VQKA 3JCMW 1VQLT 3C95A 4LDUA 2KQWA 1UGQB 2K4YA 5CVIA 2H3JA 2RB6A 3M59A 3WVEB 3HL8A 2GGRA 3UA7A 4E7LA 3OS5A 5KYUB 4LD9K 4DBHA 1M3AA 4A54A 2E12A 3F70A 1JB0E 1UFFA 3CCRT 1ZA1B 1CKBA 3KXTA 2LJ3A 5GANg 3CCET 1KJWA 2GQVA 2X4XA 2SRCA 1RUWA 4HCZA 4HVUA 3E19A 2MIOA 3EG0A 2DRMA 1OI1A 1VYUA 4DBQA 2JZ2A 1QCFA 4R0KA 2ED1A 3VRYA 1N8RR 1BKBA 1ABOA 2QEXQ 4A4HA 4PJOG 1WGSA 2DZ9A 3CBOA 5CIUA 1X69A 3FC3A 3OBWA 3M53A 1IHVA 2QQ9A 4TVRA 4F7UB 1VQ5T 2LVMA 3CMAT 2D0QB 1JBMA 1VYVA 4J9BA 5KYUA 1IHWA 2MWOA 4X34A 2V26A 3CBMA 4PNOA 5C0MA 2AK5A 1AZGB 4QVZA 3CCSQ 2AZSA 3MEWA 3LH0A 2GQIA 2OTLT 3TVTA 5GAOm 4HXJA 4AT1B 3GPLA 1JO8A 2VC8A 3OQ5A 2CYZB 2ROLA 1R77A 2BKDN 2K7AA 2M0OA 2K6DA 1YCYA 4GLKA 3ZBDA 2VASA 2X3WD 3CCQQ 1LPLA 2RJFA 4M78D 2EFIA 2HSEB 1G3YA 3EH1A 2JTMA 1VQ5A 1PRMC 2QASA 4XTWA 3CMAA 4ZGEB 1H3HA 1FMVA 1HSQA 1VIEA 2DD5A 1OYXA 3M0RA 3UATA 5FLXE 3G6ET 3JCMh 1OOTA 3FJPA 4VUBA 2OI3A 2XDBA 4DEYA 1TTHB 2QK0A 3ME9A 5LL6S 3HKSA 3I5RA 2OTLA 4M78C 2LX9A 4F7UA 2RHXA 2YRVA 3EGUA 3URGA 1EFNA 3T9NA 3QHSA 4XTUA 1M30A 1YCSB 2HMAA 3G1JA 1ZHIA 1H3ZA 2P84A 3L2QA 4F17A 2HD0A 2H3EB 2NUZA 2EYXA 1Y57A 3G7ZA 2ATCB 4E7JA 2E6NA 3PT9A 4XU3A 1U1SA 3A8MB 1K73C 4N0AA 3HRTA 2DL3A 2QEXA 3HTRA 3PMTA 3BFMA 3OYAA 1KD1C 2KYBA 2DXUA 3UA6A 1NLOC 2K79A 1B07A 2C06A 2CSIA 5GAOr 2C0OA 1AWXA 3EGXA 3NPFA 3EG1A 5CQXA 3EFSA 5GAMd 2VGMA 5GMKm 1SSFA 1GXIE 2DA9A 4M78B 4J6XA 2E64A 2KRNA 2LQNA 5J39A 1K0SA 5GMKi 3CCSA 1NJIU 1PHTA 4LDXA 4XAXB 4BB7A 2HAXA 3G71T 5LJ5h
chains in the Genus database with same CATH topology
4A63B 1AOJA 1WX6A 4DEXA 1JEGA 2DRKA 4AFSC 1JQQA 2CH4W 1T0HA 3EHQA 5IHKA 1W6XA 1K1ZA 2CDTA 1M8MA 2JS0A 2XMFA 1TUCA 4OMOA 2LX7A 1NEGA 1KFZA 2PNIA 4D8DA 2BTTA 2CREA 4RTVA 2KR3A 1AVZC 3M0PA 1AEYA 1AWJA 2J05A 4OMQA 3REAB 2JMCA 1WA7A 2B86A 2F2WA 3JV3A 3QWXX 2GNCA 2EW3A 1G2BA 2A28A 2MOXA 3H0HA 1GFDA 1VYTA 2DMOA 3U23A 1LCKA 3I35A 1FMKA 1ZLMA 4F16A 5IHNA 1GCPA 4ORZA 3SHWA 4KRTA 4AG2C 4HCKA 1S1NA 2YT6A 1QWFA 1K9AA 2FRYA 3GBQA 2FPDA 2X3XD 2H8HA 3M0QA 2KRSA 1UECA 1OPLA 2L3PA 3EHRA 2J6FA 2LQWA 2KE9A 4HVVA 3O5ZA 2DYBA 1K0XA 1H92A 2ED0A 2EPDA 4AFQC 2CH4A 1SHFA 2DILA 4RTWA 3VS7A 1SSHA 1WIEA 2K9GA 4D8KA 1KIKA 2FRWA 4J9FA 2O31A 2EVRA 2O2OA 3VS6A 1T0JA 4JZ3A 1OPKA 4RTZA 2HBWA 3NMZC 1RLPC 1T3SA 1J3TA 1WYXA 1OV3A 1G83A 4RTYA 1V1CA 4K11A 5FWCA 5IXBA 1HD3A 4CC2A 2LJ0A 1JXMA 4IIOA 4Z88A 1QLYA 2FG0A 2FEIA 3I5SA 2LMJA 1ZUKA 2JT4A 4AFZC 2BZ8A 2KEAA 1HJDA 2RQUA 1WXBA 2DF6A 2A37A 2LZ6B 2F2VA 2NWMA 1GCQA 1BK2A 1X2KA 2ECZA 2OJ2A 1YWPA 4GBQA 2DX1A 2EYYA 3EG3A 3VS2A 2FPFA 2D0NA 1Y0MA 2LJ1A 5FW9A 2MCNA 2M51A 2D8JA 1Z9ZA 4LNPA 3RNJA 1CKAA 3PVQA 3H41A 1UUEA 4GLMA 5ECAA 2DLPA 2L3QA 2RMOA 1PKTA 1UGVA 2A08A 2AZVA 2PZ1A 3C0CA 4RUGA 2D8HA 2ESWA 2KGTA 2KXCA 1MV3A 2EYWA 4Z8AA 2CT4A 2VWFA 1WDXA 2DVJA 2RQTA 4J9GA 5EC7A 4EIKA 5I11A 1WI7A 3THKA 1SHGA 2K3BA 3FJ5A 2O88A 1TG0A 1SRLA 2JM8A 5IHIA 1UG1A 2ABLA 1PKSA 1SRMA 5IH2A 2W0ZA 3VS0A 2KT8A 1GBQA 1GL5A 2JW4A 4CC7A 4LUDA 2C0IA 5FWBA 3CQTA 3IQLA 4X1VA 1WFWA 1M27C 4JJDA 3M0TA 1GFCA 2A36A 2RQRA 3VS5A 1MV0B 4F14A 2AKKA 2J7IA 2CUBA 2LNHB 3NGPA 2DJQA 2KT1A 3PVLA 1NYGA 2JMAA 1AZEA 1AWOA 2CUDA 3R6NA 2DE0X 2IIMA 1K76A 2DL4A 1SPKA 1W70A 1OEBA 4Y92A 2P4RA 1K4US 2DL5A 3I9QA 3QWYA 2EGEA 2LP5A 1PWTA 2LCSA 1B3QA 1YWOA 1X43A 4HVWA 1MUZA 5L23A 2DL7A 4OMNA 1UJYA 1I0CA 1WLPB 1ZSGA 1QKXA 1U06A 4JJCA 2JTEA 4RTXA 2BZXA 2F2XA 1UE9A 1ZBJA 4J9DA 2OAWA 1GBRA 2G6FX 3VS1A 3VRZA 1BU1A 3H0IA 2C0TA 3M0UA 2ROTA 4J9IA 3SEMA 2V1QA 2D1XA 2CSQA 2GGRA 3UA7A 1AD5A 4M4ZA 3KFVA 2RQWA 1M3AA 2L2PA 1NG2A 4JPBW 5I22A 2YDLA 2KXDA 4J9EA 2L0AA 1GRIA 1UFFA 2RQVA 2K2MA 2HCKA 1UHCA 1PRLC 2DM1A 1CKBA 1NYFA 2LJ3A 4ZNXA 1KJWA 1CSKA 2FPEA 2SRCA 1VA7A 1RUWA 4HVUA 2RN8A 1KSWA 1X6BA 2MIOA 3EG0A 2DRMA 2DBMA 1VYUA 2GTJA 1AWWA 1QWEA 2YSQA 1QCFA 4AG1C 3REBB 4R0KA 2ED1A 1ARKA 1X2QA 2GTOA 3VRYA 1ZUUA 3NHNA 4JJBA 2VVKA 1ABOA 2I0NA 1BBZA 2YUQA 1YNZA 1U5SA 1E6HA 2J06A 1X69A 2BZYA 1YP5A 4RTTA 1H8KA 2PTKA 1ZUYA 4E6RA 4QT7A 2E5KA 5GJWB 1TUDA 1VYVA 4J9BA 1X27A 2HSPA 4AFUC 2EQIA 2VKNA 1UTIA 1BB9A 2V1RA 1N5ZA 2L3SA 2AKLA 2AK5A 2JXBA 1AZGB 1UDLA 2YUPA 2SEMA 1I07A 2AZSA 4JZ4A 1W1FA 2EKHA 2GQIA 1NLPC 3TVTA 4HXJA 2KROA 1JO8A 4Z89A 2ROLA 1JU5C 2K7AA 1X6GA 2K6DA 5GJVB 3VS3A 2FO0A 1IO6A 2X3WD 2KRMA 1M3CA 2JM9A 4OMMA 1ABQA 1FYNA 1T3LA 1PRMC 1JXOA 3H0FA 4RTUA 1E7OA 1RLQC 3PE0A 1H3HA 1SEMA 1WXUA 1HSQA 3EG2A 2QDLA 5IXFA 3M0RA 3UATA 3ZL7C 2J6OA 1OOTA 2EYZA 2ENMA 2JS2A 2KYMA 2OI3A 2W10A 1Z9QA 4DEYA 2EGCA 4CC3A 3TSZA 2EBPA 3I5RA 3M0SA 2J6KA 4J9HA 1UHFA 2DNUA 2RF0A 3A98A 3EGUA 4LUEA 1EFNA 1WXTA 1M30A 1YCSB 2O9SA 1PNJA 4LE9A 4F17A 1XOVA 4IIMA 4WCIA 4J9CA 4OMLA 1U3OA 2NUZA 1NM7A 2EYXA 2RNAA 1Y57A 2CT3A 1ZX6A 1UJ0A 1QKWA 2DL3A 4CC4B 2DBKA 5HCKA 2O9VA 2KYBA 3UA6A 1NLOC 2HEQA 2K79A 1B07A 2CSIA 2DL8A 4LN2A 2HDAA 3ULRB 2C0OA 3UF4A 1YN8A 1AWXA 3NPFA 2YUOA 3EG1A 2KNBB 1NEBA 2M0YA 2EGAA 4ESRA 1E6GA 3VS4A 2DA9A 3LH5A 1A0NB 1I1JA 2KRNA 2YUNA 1M3BA 2LQNA 1K0SA 1GCQC 2GBQA 4OMPA 2RPNA 1RI9A 1PHTA 2KBTA 3RBBB 4FSSA 3TSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A63 B;  1AOJ A;  1WX6 A;  4DEX A;  1JEG A;  2DRK A;  4AFS C;  1JQQ A;  2CH4 W;  1T0H A;  3EHQ A;  5IHK A;  1W6X A;  1K1Z A;  2CDT A;  1M8M A;  2JS0 A;  2XMF A;  1TUC A;  4OMO A;  2LX7 A;  1NEG A;  1KFZ A;  2PNI A;  4D8D A;  2BTT A;  2CRE A;  4RTV A;  2KR3 A;  1AVZ C;  3M0P A;  1AEY A;  1AWJ A;  2J05 A;  4OMQ A;  3REA B;  2JMC A;  1WA7 A;  2B86 A;  2F2W A;  3JV3 A;  3QWX X;  2GNC A;  2EW3 A;  1G2B A;  2A28 A;  2MOX A;  3H0H A;  1GFD A;  1VYT A;  2DMO A;  3U23 A;  1LCK A;  3I35 A;  1FMK A;  1ZLM A;  4F16 A;  5IHN A;  1GCP A;  4ORZ A;  3SHW A;  4KRT A;  4AG2 C;  4HCK A;  1S1N A;  2YT6 A;  1QWF A;  1K9A A;  2FRY A;  3GBQ A;  2FPD A;  2X3X D;  2H8H A;  3M0Q A;  2KRS A;  1UEC A;  1OPL A;  2L3P A;  3EHR A;  2J6F A;  2LQW A;  2KE9 A;  4HVV A;  3O5Z A;  2DYB A;  1K0X A;  1H92 A;  2ED0 A;  2EPD A;  4AFQ C;  2CH4 A;  1SHF A;  2DIL A;  4RTW A;  3VS7 A;  1SSH A;  1WIE A;  2K9G A;  4D8K A;  1KIK A;  2FRW A;  4J9F A;  2O31 A;  2EVR A;  2O2O A;  3VS6 A;  1T0J A;  4JZ3 A;  1OPK A;  4RTZ A;  2HBW A;  3NMZ C;  1RLP C;  1T3S A;  1J3T A;  1WYX A;  1OV3 A;  1G83 A;  4RTY A;  1V1C A;  4K11 A;  5FWC A;  5IXB A;  1HD3 A;  4CC2 A;  2LJ0 A;  1JXM A;  4IIO A;  4Z88 A;  1QLY A;  2FG0 A;  2FEI A;  3I5S A;  2LMJ A;  1ZUK A;  2JT4 A;  4AFZ C;  2BZ8 A;  2KEA A;  1HJD A;  2RQU A;  1WXB A;  2DF6 A;  2A37 A;  2LZ6 B;  2F2V A;  2NWM A;  1GCQ A;  1BK2 A;  1X2K A;  2ECZ A;  2OJ2 A;  1YWP A;  4GBQ A;  2DX1 A;  2EYY A;  3EG3 A;  3VS2 A;  2FPF A;  2D0N A;  1Y0M A;  2LJ1 A;  5FW9 A;  2MCN A;  2M51 A;  2D8J A;  1Z9Z A;  4LNP A;  3RNJ A;  1CKA A;  3PVQ A;  3H41 A;  1UUE A;  4GLM A;  5ECA A;  2DLP A;  2L3Q A;  2RMO A;  1PKT A;  1UGV A;  2A08 A;  2AZV A;  2PZ1 A;  3C0C A;  4RUG A;  2D8H A;  2ESW A;  2KGT A;  2KXC A;  1MV3 A;  2EYW A;  4Z8A A;  2CT4 A;  2VWF A;  1WDX A;  2DVJ A;  2RQT A;  4J9G A;  5EC7 A;  4EIK A;  5I11 A;  1WI7 A;  3THK A;  1SHG A;  2K3B A;  3FJ5 A;  2O88 A;  1TG0 A;  1SRL A;  2JM8 A;  5IHI A;  1UG1 A;  2ABL A;  1PKS A;  1SRM A;  5IH2 A;  2W0Z A;  3VS0 A;  2KT8 A;  1GBQ A;  1GL5 A;  2JW4 A;  4CC7 A;  4LUD A;  2C0I A;  5FWB A;  3CQT A;  3IQL A;  4X1V A;  1WFW A;  1M27 C;  4JJD A;  3M0T A;  1GFC A;  2A36 A;  2RQR A;  3VS5 A;  1MV0 B;  4F14 A;  2AKK A;  2J7I A;  2CUB A;  2LNH B;  3NGP A;  2DJQ A;  2KT1 A;  3PVL A;  1NYG A;  2JMA A;  1AZE A;  1AWO A;  2CUD A;  3R6N A;  2DE0 X;  2IIM A;  1K76 A;  2DL4 A;  1SPK A;  1W70 A;  1OEB A;  4Y92 A;  2P4R A;  1K4U S;  2DL5 A;  3I9Q A;  3QWY A;  2EGE A;  2LP5 A;  1PWT A;  2LCS A;  1B3Q A;  1YWO A;  1X43 A;  4HVW A;  1MUZ A;  5L23 A;  2DL7 A;  4OMN A;  1UJY A;  1I0C A;  1WLP B;  1ZSG A;  1QKX A;  1U06 A;  4JJC A;  2JTE A;  4RTX A;  2BZX A;  2F2X A;  1UE9 A;  1ZBJ A;  4J9D A;  2OAW A;  1GBR A;  2G6F X;  3VS1 A;  3VRZ A;  1BU1 A;  3H0I A;  2C0T A;  3M0U A;  2ROT A;  4J9I A;  3SEM A;  2V1Q A;  2D1X A;  2CSQ A;  2GGR A;  3UA7 A;  1AD5 A;  4M4Z A;  3KFV A;  2RQW A;  1M3A A;  2L2P A;  1NG2 A;  4JPB W;  5I22 A;  2YDL A;  2KXD A;  4J9E A;  2L0A A;  1GRI A;  1UFF A;  2RQV A;  2K2M A;  2HCK A;  1UHC A;  1PRL C;  2DM1 A;  1CKB A;  1NYF A;  2LJ3 A;  4ZNX A;  1KJW A;  1CSK A;  2FPE A;  2SRC A;  1VA7 A;  1RUW A;  4HVU A;  2RN8 A;  1KSW A;  1X6B A;  2MIO A;  3EG0 A;  2DRM A;  2DBM A;  1VYU A;  2GTJ A;  1AWW A;  1QWE A;  2YSQ A;  1QCF A;  4AG1 C;  3REB B;  4R0K A;  2ED1 A;  1ARK A;  1X2Q A;  2GTO A;  3VRY A;  1ZUU A;  3NHN A;  4JJB A;  2VVK A;  1ABO A;  2I0N A;  1BBZ A;  2YUQ A;  1YNZ A;  1U5S A;  1E6H A;  2J06 A;  1X69 A;  2BZY A;  1YP5 A;  4RTT A;  1H8K A;  2PTK A;  1ZUY A;  4E6R A;  4QT7 A;  2E5K A;  5GJW B;  1TUD A;  1VYV A;  4J9B A;  1X27 A;  2HSP A;  4AFU C;  2EQI A;  2VKN A;  1UTI A;  1BB9 A;  2V1R A;  1N5Z A;  2L3S A;  2AKL A;  2AK5 A;  2JXB A;  1AZG B;  1UDL A;  2YUP A;  2SEM A;  1I07 A;  2AZS A;  4JZ4 A;  1W1F A;  2EKH A;  2GQI A;  1NLP C;  3TVT A;  4HXJ A;  2KRO A;  1JO8 A;  4Z89 A;  2ROL A;  1JU5 C;  2K7A A;  1X6G A;  2K6D A;  5GJV B;  3VS3 A;  2FO0 A;  1IO6 A;  2X3W D;  2KRM A;  1M3C A;  2JM9 A;  4OMM A;  1ABQ A;  1FYN A;  1T3L A;  1PRM C;  1JXO A;  3H0F A;  4RTU A;  1E7O A;  1RLQ C;  3PE0 A;  1H3H A;  1SEM A;  1WXU A;  1HSQ A;  3EG2 A;  2QDL A;  5IXF A;  3M0R A;  3UAT A;  3ZL7 C;  2J6O A;  1OOT A;  2EYZ A;  2ENM A;  2JS2 A;  2KYM A;  2OI3 A;  2W10 A;  1Z9Q A;  4DEY A;  2EGC A;  4CC3 A;  3TSZ A;  2EBP A;  3I5R A;  3M0S A;  2J6K A;  4J9H A;  1UHF A;  2DNU A;  2RF0 A;  3A98 A;  3EGU A;  4LUE A;  1EFN A;  1WXT A;  1M30 A;  1YCS B;  2O9S A;  1PNJ A;  4LE9 A;  4F17 A;  1XOV A;  4IIM A;  4WCI A;  4J9C A;  4OML A;  1U3O A;  2NUZ A;  1NM7 A;  2EYX A;  2RNA A;  1Y57 A;  2CT3 A;  1ZX6 A;  1UJ0 A;  1QKW A;  2DL3 A;  4CC4 B;  2DBK A;  5HCK A;  2O9V A;  2KYB A;  3UA6 A;  1NLO C;  2HEQ A;  2K79 A;  1B07 A;  2CSI A;  2DL8 A;  4LN2 A;  2HDA A;  3ULR B;  2C0O A;  3UF4 A;  1YN8 A;  1AWX A;  3NPF A;  2YUO A;  3EG1 A;  2KNB B;  1NEB A;  2M0Y A;  2EGA A;  4ESR A;  1E6G A;  3VS4 A;  2DA9 A;  3LH5 A;  1A0N B;  1I1J A;  2KRN A;  2YUN A;  1M3B A;  2LQN A;  1K0S A;  1GCQ C;  2GBQ A;  4OMP A;  2RPN A;  1RI9 A;  1PHT A;  2KBT A;  3RBB B;  4FSS A;  3TSW A; 
#chains in the Genus database with same CATH topology
 3EG9 B;  5CQY A;  1Y96 B;  2KVQ G;  2RJD A;  4A63 B;  1BCO A;  3INZ A;  1WX6 A;  4NL2 A;  3CCQ A;  4AFS C;  2HKQ B;  2WSE E;  2I2L A;  4IUP A;  2EQJ A;  5IHK A;  1K1Z A;  2XMF A;  4OMO A;  4F7U G;  1YJ9 T;  2LNV A;  5GAN 4;  3OYE A;  4XQ3 A;  2PNI A;  3OYN A;  2CS7 A;  2K3Y A;  2LTO A;  1AWJ A;  4OMQ A;  2B86 A;  2MAM A;  4BI4 A;  1BI0 A;  3CME T;  4L5G A;  5GAO p;  1VYT A;  3U23 A;  1KC8 U;  2MI6 A;  4BY6 C;  1SF9 A;  2YLC A;  1FMK A;  3VKI A;  1PD0 A;  5IHN A;  5DM7 R;  1XNI A;  1VQ8 T;  1MMD A;  3LYI A;  5I2S A;  3QPH A;  4Y28 E;  2CP0 A;  2FPD A;  4M78 A;  4F7U F;  3EHR A;  1NZ9 A;  2LQW A;  2KE9 A;  2DZC A;  1OU8 A;  4HVV A;  2DYB A;  3JRZ A;  4JDS A;  2ED0 A;  3DLL A;  4AFQ C;  3RIR A;  4J8O A;  1I8F A;  3JB9 H;  1KHI A;  3EG9 A;  3P8H A;  1SSH A;  3CME A;  1KD1 R;  1KIK A;  5KYX B;  2FHD A;  2KK4 A;  4RCC A;  1WJQ A;  4JZ3 A;  5J3B A;  4RTZ A;  2HBW A;  2DIQ A;  2EWN A;  1T3S A;  1O9S A;  1OV3 A;  4BY6 B;  1XTD A;  4XU0 A;  2DTI A;  3FIF A;  1M9S A;  4CI0 C;  3QJY A;  1I81 A;  2DER A;  2GFU A;  1JXM A;  4Z88 A;  3I55 T;  2FG0 A;  3I5S A;  2LMJ A;  3JCM V;  1W2B S;  4EMH A;  2BZ8 A;  2KEA A;  2NLU A;  5FRM A;  2F2V A;  2NWM A;  1QP2 A;  4JLI A;  3MEU A;  1BK2 A;  1X2K A;  2PUO B;  2DK3 A;  2LDM A;  1YWP A;  2QA4 T;  2KAF A;  3X24 B;  2DX1 A;  2EYY A;  1Y0M A;  3OSV A;  5FW9 A;  2LRQ A;  3OS2 A;  2M51 A;  3GNG A;  4LNP A;  1OU9 A;  4DOW A;  2RI5 A;  1BIB A;  4E7H A;  1UUE A;  4GLM A;  6AT1 B;  1VQP T;  2HQE A;  1PKT A;  2A08 A;  3CPW P;  4M78 G;  1AT1 B;  4RUG A;  2FZG B;  2KXC A;  3MP1 A;  1MV3 A;  2CT4 A;  5KYX A;  1WDX A;  2DVJ A;  3E9G A;  5EC7 A;  4FT4 A;  4BI8 B;  4HT9 A;  1WI7 A;  3THK A;  4M77 E;  2JM8 A;  2PVG B;  4EPC A;  4D6W A;  5IHI A;  5KYW B;  1TU0 B;  3CCU Q;  4L59 A;  2JW4 A;  4CC7 A;  3DLM A;  4IUT A;  5GAM g;  3IQL A;  2B8A A;  3LGF A;  1C1A A;  1YIJ Q;  2DET A;  4FIB A;  2A36 A;  5CAI A;  2QTV A;  1I5L A;  4A4F A;  1RI0 A;  1TUG B;  2RQR A;  3VS5 A;  1MV0 B;  1Q82 C;  2AKK A;  2PVO B;  2CUB A;  4M78 F;  2LNH B;  1VQ6 Q;  4M77 D;  5KH6 A;  3PVL A;  3LX7 A;  1IB8 A;  1AWO A;  2DE0 X;  5GAO n;  2E5Q A;  1X01 A;  3OS1 A;  4C92 A;  3JCM b;  4J7I A;  3OYJ A;  3A5Z B;  3NTK A;  1RAG B;  2BIV A;  1KQS P;  2X4J A;  1PWT A;  1PCX A;  3TEE A;  4M77 C;  3EFO B;  2RJE A;  2DL7 A;  4LXC A;  2CP5 A;  2YRC A;  1I0C A;  1ZSG A;  2QGF B;  2Y90 A;  1XJW B;  4LDY A;  2DYI A;  3EAE A;  4RTX A;  1UE9 A;  5KYW A;  4J9D A;  2OAW A;  1GBR A;  1SKU B;  3QII A;  1IZ6 A;  3H0I A;  3OYD A;  3M0U A;  5CKH A;  4J9I A;  3OYB A;  1D3B A;  2D1X A;  1W4S A;  2F5T X;  2CSQ A;  2ZAE A;  4N4H A;  5A0L A;  4M4Z A;  2RHZ A;  4A4G A;  3KFV A;  2EJ9 A;  2RQW A;  3PNW C;  1VQ7 Q;  2L2P A;  3M58 A;  1NG2 A;  3CCL T;  5I22 A;  3A1P A;  1PM3 A;  3GF5 A;  3E1S A;  1TS9 A;  2RQV A;  5I21 A;  1M90 U;  3QZ5 B;  4FM4 B;  1PRL C;  1NYF A;  4XU1 A;  4M77 B;  4IKF A;  4C8Q A;  3CCU A;  4MDX A;  3CD6 Q;  1M1F A;  1CSK A;  1YHQ T;  3L2V A;  3OYY A;  1QVG A;  2ZPE B;  3VUZ A;  3CBP A;  3V8K A;  4OB0 B;  3EFO A;  2HQX A;  2GTJ A;  4C92 G;  1YIJ A;  4OVA A;  2YSQ A;  4M75 E;  1ARK A;  1X2Q A;  2GTO A;  4M7A D;  5CKB A;  1ZUU A;  3CCM T;  1VQ6 A;  3NHN A;  4M7D D;  2K2V A;  2I0N A;  2YUQ A;  4KH0 B;  4ZN1 A;  3CCL A;  4A53 A;  1YNZ A;  3I56 Q;  1TSF A;  1U5S A;  2E70 A;  1YP5 A;  4RTT A;  3MKD A;  4E6R A;  4QT7 A;  2ZPF B;  3MEA A;  5GJW B;  1TUD A;  1WHG A;  1G3T A;  1D0Z A;  4M7A C;  4O5V A;  4RCB A;  4QQD A;  1X27 A;  4AFU C;  1WHL A;  4M7D C;  4C92 F;  2VKN A;  5LJ5 j;  2DEQ A;  1UTI A;  2OTJ T;  1N5Z A;  3A8H B;  2JXB A;  1VQK T;  2YUP A;  3CEY A;  4JZ4 A;  3CCM A;  3GP8 A;  2EJF A;  2EJG A;  5I2M A;  1MGQ A;  1JU5 C;  4O6J A;  5HY6 A;  1X6G A;  2D6F A;  2AIR B;  3VS3 A;  2EQM A;  2FO0 A;  2EYQ A;  2M16 A;  3S3N A;  5D7U A;  1IO6 A;  1VQO T;  2JM9 A;  3HFN A;  4C8Q G;  5GAN h;  5GMK l;  5LJ3 j;  4EMG A;  3CC4 T;  1T3L A;  3H6Z A;  2A0F B;  1JXO A;  2E41 A;  1NJI R;  4LDW A;  1JJ2 P;  1VQ7 A;  1SEM A;  2QQR A;  2OTJ A;  2ENM A;  4WF2 A;  1QVF P;  4M7A B;  2EGC A;  4CC3 A;  3CD6 A;  1K8A U;  4M7D B;  1UHF A;  2K3X A;  3A98 A;  4ELZ C;  4R55 A;  3RUX A;  4KH1 B;  2O9S A;  3QBY A;  4LE9 A;  2DVE A;  1VQO A;  4C8Q F;  1ACM B;  3CPW A;  1XOV A;  4WCI A;  1QP3 A;  4MZM A;  3CC4 A;  1U3O A;  2PVD B;  2CT3 A;  3JB9 J;  2JTF A;  3FLG A;  2R58 A;  4CC4 B;  3CXC P;  1C6V X;  1YJN T;  1KQS S;  1RAH B;  1VQM Q;  2P0K A;  3MHX A;  4LN2 A;  3UF4 A;  2ZCF B;  3CCV Q;  1N6A A;  4NL3 A;  1VQ9 Q;  2M0Y A;  4FYW B;  3OYG A;  1Q7Y C;  3HRS A;  3VS4 A;  3MEV A;  1UGP B;  3QZ9 B;  1EIF A;  3C94 A;  1M3B A;  1ZA2 B;  4ANJ A;  4ELY C;  4M7A A;  1RI9 A;  2DTH A;  2KBT A;  3FB9 A;  2NYS A;  4M7D A;  3TSW A;  4FSX A;  5GAN 7;  1YJN A;  3OYH A;  1AOJ A;  4DEX A;  1RAC B;  2CP2 A;  4C0G A;  4BDY A;  2X35 A;  2JS0 A;  4QQ6 A;  1KFZ A;  4D8D A;  1AEY A;  1QW1 A;  2K5L A;  2F2W A;  2XKO C;  1G2B A;  1WQ7 A;  1NPP A;  3H0H A;  1GFD A;  2V8J A;  3M55 A;  4PJO F;  3TRE A;  1KQ1 A;  4XTY A;  1IRX A;  3JSC A;  3O8V A;  4YTL A;  1W2B P;  4MMK A;  2XDD A;  2Z0W A;  3SHW A;  1BCM A;  2O4X B;  2MMP A;  5GAN 2;  1S1N A;  1QWF A;  3GOX A;  2LCC A;  3EGD B;  1Q86 C;  3M0Q A;  3MET A;  5GAN 5;  2QEX T;  4OF1 A;  5LJ3 d;  1WNL A;  1VOM A;  1K0X A;  2HBP A;  1YIT Q;  1H92 A;  2VV5 A;  2RI2 A;  1SHF A;  1QQJ A;  4JRP A;  1WIE A;  3JCM e;  2HNI A;  2M9U A;  1Y7X A;  4M7A G;  1K9M C;  2EAY A;  3VS6 A;  5GAO q;  1BI1 A;  4M7D G;  3QUI A;  2R5M A;  3CCV A;  3NMZ C;  3ASK A;  1O75 A;  1BI3 A;  2ZPH B;  1BYM A;  1D0Y A;  5GMK h;  3WVD B;  5GAN 8;  1Q7Y R;  3CCS T;  3OYK A;  3JB9 D;  4RG2 A;  1QVP A;  1TOV A;  5FWC A;  3P8D A;  1BIA A;  1D0X A;  3OB9 A;  2LC4 A;  3GNF B;  5AT1 B;  4N4G A;  1IXD A;  2RM4 A;  1M5Q 1;  1Q81 U;  4RG8 A;  3CCQ T;  1HJD A;  5HK3 A;  3NTH A;  2A37 A;  1WHM A;  3JCM f;  1YJW Q;  1PC0 A;  4M7A F;  2XD0 A;  2ECZ A;  1JJ2 S;  2E6Z A;  4GBQ A;  3VS2 A;  4M7D F;  2FPF A;  2D0N A;  2VGN A;  2RD1 A;  2LJ1 A;  2DXT A;  3EGD A;  2XG8 D;  1QVF S;  1UGR B;  2D8J A;  3RNJ A;  5IT9 E;  1YI2 Q;  1PD1 A;  2L3Q A;  5D6Y A;  1M1K C;  2PU9 B;  3C0C A;  2D8H A;  3H9N A;  2ESW A;  2HQH A;  2RQT A;  4EIK A;  1HYO A;  4FW2 A;  1SHG A;  3TQ7 P;  1MMN A;  4P5N A;  2PQW A;  1U8R A;  5LJ5 e;  3L2Z A;  3CC2 Q;  1GBQ A;  1Q86 R;  3CXC S;  5FWB A;  1QCO A;  3L2U A;  1WFW A;  3BDL A;  1M90 R;  4JJD A;  4JLG A;  3M0T A;  4AMC A;  1RAD B;  4IUU A;  3SWN C;  3NTI A;  2J7I A;  2GCX A;  2KT1 A;  2RH2 A;  5LJ3 e;  1HXD A;  1K9M R;  2JMA A;  4XK8 E;  1AZE A;  3R6N A;  4FT2 A;  1V29 B;  2IIM A;  4EDU A;  1HK9 A;  2WSC E;  4XTZ A;  1OEB A;  5LJ5 f;  5L8R E;  4X9D A;  4ZGJ B;  1B3Q A;  1YWO A;  3OSS C;  1X43 A;  4JRK A;  1Y96 A;  2QDY B;  2XIC A;  1G3W A;  5KCO A;  2BZX A;  2F2X A;  5LJ3 f;  2E3H A;  1ZBJ A;  3UDC A;  2OX7 A;  1C0M A;  2E10 A;  5GAN j;  2IG0 A;  4C0Z A;  2YWW A;  5C6S A;  3VRZ A;  2BUD A;  3SWN B;  3OW2 P;  1B7T A;  1N8R U;  1Y71 A;  2C0T A;  2D9T A;  3QDR B;  2VXF A;  1YI2 A;  1KK7 A;  1B34 B;  1M1K R;  5DY9 A;  5LJ3 g;  1DJ7 B;  4KGZ B;  3V7C A;  2MPX C;  5GAM h;  2VUB A;  4DA4 A;  1F1B B;  2COW A;  5GAN 6;  2KXD A;  4J9E A;  2A3L A;  1GRI A;  1VUB A;  1D1A A;  3DKM A;  2EIF A;  2HCK A;  1UHC A;  2DM1 A;  3PIP A;  5GAN 3;  1AHJ B;  3CC2 A;  2M1H A;  2RN8 A;  2CP6 A;  1KSW A;  1MND A;  2GFA A;  1LOJ A;  3FRN A;  1AWW A;  1QWE A;  4AG1 C;  1K8A R;  2WSF E;  3GIB A;  4JJB A;  4FYY B;  3MCA B;  2MF2 A;  2KI7 A;  2K5F A;  2CP7 A;  2G3R A;  4RKU E;  3RES A;  1E6H A;  2EQU A;  1LNX A;  3OY9 A;  2NUT B;  4PK4 A;  4E7Z A;  4F04 B;  3G4S Q;  2FB7 A;  1B34 A;  1TXQ A;  2HSP A;  1NBE B;  2Y4Y A;  4OGC A;  7AT1 B;  3UPU A;  2V1R A;  1I5O B;  3RMS A;  2AKL A;  1WJR A;  1S72 Q;  1UDL A;  2F1L A;  5FRN A;  3DB4 A;  4DBR A;  3NFC A;  1I07 A;  2DTO A;  2R57 A;  1NLP C;  4HT8 A;  5CK9 A;  4PJO E;  4PJL A;  4E7S A;  2E3I A;  1M2O A;  3GLX A;  2KRM A;  2RK2 A;  5AYF A;  3FDR A;  3PGG A;  1X6O A;  4R56 A;  4KUD K;  1ABQ A;  2QG9 B;  4OB2 B;  3M4G A;  2ZPG B;  3H0F A;  2YHT A;  3L42 A;  1E7O A;  3VUB A;  2MWP A;  4PKC C;  1WXU A;  3CCU T;  2M02 A;  2JS2 A;  2X4W A;  3TSZ A;  2EBP A;  2L89 A;  3QXE B;  2NUT A;  1NPR A;  3M0S A;  2DNU A;  5CKF A;  4IUR A;  1YIJ T;  4C0D C;  5M9O A;  1KG1 A;  1WXT A;  1WJS A;  3CCJ Q;  1PNJ A;  1FMW A;  1VQ6 T;  1NJI C;  2XID A;  4OML A;  2RNA A;  4BUG A;  5GAO l;  1WZO A;  4ZTF A;  1VQ4 Q;  1OX8 A;  3CC7 Q;  1VQN Q;  1RL2 A;  2IVW A;  2DBK A;  1OQK A;  1LVK A;  1FX7 A;  5CO7 A;  5GMK j;  2RJC A;  2HEQ A;  4L6V 5;  2DL8 A;  2HDA A;  3ULR B;  4PL6 A;  8ATC B;  2KY9 A;  2YUO A;  1NEB A;  2QQA A;  2EGA A;  2CZ0 B;  1KC8 C;  2GF7 A;  2K5I A;  3RR6 A;  3HP9 A;  2L8D A;  9ATC B;  3VV0 A;  4C0D B;  1S72 A;  4KGX B;  1GCQ C;  4OMP A;  3ZEH A;  3OW2 S;  3OA6 A;  3JAM E;  4MZT A;  4FSS A;  1X75 C;  1OX9 A;  3EFR A;  5KCH A;  4JUV A;  4C5H A;  3V8J A;  1JEG A;  1K73 U;  2CP3 A;  4M75 D;  2V8K A;  1MNE A;  2QXF A;  1VQ7 T;  2CH4 W;  1ZQ1 A;  1W6X A;  2CDT A;  1M8M A;  1TUC A;  3OYI A;  4II1 A;  1KD1 U;  1NEG A;  3QYH B;  1P92 A;  4RTV A;  1VQL Q;  1AVZ C;  3X28 B;  3M0P A;  3CD6 T;  2DJZ A;  3KBG A;  4M77 A;  3REA B;  2JMC A;  3QWX X;  2EW3 A;  2MOX A;  2HL5 C;  2RI3 A;  2DMO A;  1LCK A;  3I35 A;  2XK0 A;  4M75 C;  1ZLM A;  1Q95 G;  5CCA A;  4F16 A;  3V7R A;  4NS5 A;  4BI3 A;  4MML A;  3EH2 A;  2BE9 B;  2FVU A;  3JCM X;  4AG2 C;  3CCJ A;  2JUF A;  2YT6 A;  4DQ2 A;  1ZBX A;  1K9A A;  3GBQ A;  2X3X D;  3CCR Q;  4F7U E;  2LCL A;  1U1T A;  5GAN e;  1UEC A;  3CCE Q;  1OPL A;  3I56 T;  2J6F A;  3ER0 A;  3O5Z A;  2DXB A;  3HFO A;  1VQ4 A;  2EPD A;  5HK0 A;  4XTX A;  1WPY A;  1TH7 A;  3RKX A;  1Y07 A;  2FRW A;  4J9F A;  2O31 A;  1UEB A;  2VXE A;  3VJP A;  4ME7 A;  2P4T A;  4C5G A;  3M56 A;  1RAE B;  1RLP C;  1WYX A;  1IRE B;  1KC8 R;  1V1C A;  4M75 B;  1MMA A;  4K11 A;  3JCM d;  2CZ6 B;  5IXB A;  1HD3 A;  5GAN f;  4CC2 A;  2LJ0 A;  4JS4 A;  3I56 A;  1VQ5 Q;  1QLY A;  3CMA Q;  1ZUK A;  3QJ6 A;  2VB6 A;  4NOY A;  4M77 G;  2COZ A;  2DF6 A;  2LZ6 B;  2FZC B;  3OBY A;  4IUQ A;  2QQS A;  1GCQ A;  5A2Q E;  2CZ1 B;  1OZ3 A;  5IAY A;  5FU7 C;  3EG3 A;  3PTA A;  1EX4 A;  1R0C B;  1QMC A;  1G3S A;  3MP6 A;  4JRI A;  2OTL Q;  5GAM j;  1VQL A;  4IUV A;  2V8I A;  3PVQ A;  3H41 A;  5ECA A;  2DLP A;  4N0A C;  1UGV A;  2PZ1 A;  1M4Z A;  2LT1 A;  4Z8A A;  5D6W A;  4OP0 A;  2K3B A;  3L2R A;  1KQS A;  1KQ2 A;  1SRL A;  4M77 F;  2JVV A;  2ABL A;  3X25 B;  1YBY A;  1PKS A;  2RHY A;  5IH2 A;  3G6E Q;  1G5V A;  2EKO A;  5KYY B;  4M75 A;  2EQK A;  3VS0 A;  3CCR A;  3M4Y A;  1GL5 A;  1OUL A;  3CCE A;  1VQM T;  3BE3 A;  2R5A A;  2E1H A;  5LJ5 d;  5FU7 B;  2DKG A;  2JJ9 A;  2PUK B;  4M78 E;  4WTO B;  3NGP A;  2DJQ A;  3CCV T;  1VQ9 T;  1RAI B;  3D7S B;  3OYL A;  1K76 A;  2DL4 A;  3SB2 A;  1UGS B;  2P0P A;  4UC4 A;  4Y92 A;  2RHI A;  2MK5 A;  2P4R A;  1K4U S;  3QWY A;  3MJX A;  3RKY A;  5DLO A;  2EGE A;  1M90 C;  2F5K A;  2KSS A;  2QYZ A;  2X4Y A;  2LCS A;  4ZN3 A;  3LWI A;  3SD4 A;  3SFM A;  3EGX B;  4E2F B;  5L23 A;  4JRQ A;  3VYH B;  1VQM A;  1QKX A;  4GY5 A;  3RKW A;  1U06 A;  2XDP A;  4JJC A;  8AT1 B;  4J83 A;  3VS1 A;  1VQ9 A;  5KYY A;  2XHC A;  1Q82 U;  3M9Q A;  1BU1 A;  3TCJ A;  4PJJ A;  3G71 Q;  1MHN A;  2ROT A;  1R0B G;  3QO3 A;  2V1Q A;  2DPP B;  3SEM A;  4OGE A;  2F69 A;  4C5E A;  1AD5 A;  5GMK e;  4M75 G;  2RA2 A;  4BDZ A;  1SG5 A;  5HKC A;  2O4X A;  4JPB W;  2YDL A;  1YJ9 Q;  2JOY A;  2L0A A;  3QG1 A;  2K2M A;  2X9H A;  2YRD A;  4PFO A;  4ZNX A;  3R6O A;  3G6E A;  3OS0 A;  3MP8 A;  2O01 E;  2HKN A;  3CME Q;  2FPE A;  3LLR A;  1VA7 A;  2X51 A;  1YIT T;  1RAB B;  5KE3 A;  1X6B A;  1WHK A;  2DBM A;  3JCM g;  4DOV A;  1VQ8 Q;  5J26 A;  1RAA B;  3REB B;  4M75 F;  3J81 E;  5A0G A;  1VIF A;  1PSF A;  5A0D A;  2JNG A;  4KGV B;  1NE8 A;  4QW2 A;  2HL3 A;  2VVK A;  1MMG A;  1BBZ A;  4QQG A;  3A8G B;  3JCM J;  2RO0 A;  3BW1 A;  3LW5 E;  4RMO A;  2J06 A;  4J6Y A;  2BZY A;  2QGG A;  1JJ2 A;  1H8K A;  2PTK A;  1ZUY A;  2XU8 A;  2E5K A;  2QI2 A;  4C5I A;  1QVF A;  1YIT A;  5FU6 C;  1WHJ A;  2VYT A;  1WHH A;  4C92 E;  1PG5 B;  1K8A C;  2EQI A;  1TWB A;  1YJW T;  1BB9 A;  2L3S A;  4MDW A;  1QVG P;  2FYK A;  4C0F A;  2LT4 A;  3S6W A;  2CGH A;  2SEM A;  4FYX B;  1D1B A;  1W1F A;  2EKH A;  1V76 A;  5LJ3 h;  3V7S A;  2KRO A;  3RMQ A;  4Z89 A;  4FU6 A;  1RAF B;  3JCM P;  1PSE A;  1YI2 T;  3A8L B;  5GJV B;  3I55 Q;  2CZ7 B;  1M3C A;  3G71 A;  4A4K A;  4C92 D;  4OMM A;  3CXC A;  1FYN A;  4Y91 A;  4RTU A;  1RLQ C;  3MPU B;  3PE0 A;  1ZSZ C;  2QA4 Q;  5LJ5 g;  3VYG A;  3EG2 A;  3PIO A;  2QDL A;  5IXF A;  1YJW A;  3OYF A;  3ZL7 C;  3HPW A;  2J6O A;  1YJ9 A;  2DEU A;  2EYZ A;  3CC2 T;  3QDF A;  2JN0 A;  2KYM A;  2W10 A;  3QYG B;  1K73 R;  1Z9Q A;  5FU6 B;  2QTX A;  3OYC A;  4B6M A;  3PFS A;  4LD6 A;  2J6K A;  4J9H A;  4C92 C;  1VQP Q;  2RF0 A;  4LUE A;  3C4S A;  4KUL A;  2YLB A;  4C8Q E;  2XI9 A;  1VQ8 A;  3J80 E;  4JJN K;  3WXM B;  4IIM A;  4J9C A;  4KUI A;  3OYM A;  1NM7 A;  1ZX6 A;  1UJ0 A;  1QKW A;  4HCB A;  1XQH A;  4HKE A;  5HCK A;  5FRO A;  4FW1 A;  5GAM e;  4ZGD B;  2O9V A;  1ZSZ B;  2P0Q A;  1N27 A;  3VU3 C;  4ZTJ A;  3AT1 B;  4C8Q D;  3M57 A;  4BAC A;  3HHT B;  1YN8 A;  3DB3 A;  2KNB B;  3P8B B;  4ESR A;  2A7Y A;  1E6G A;  4BE2 A;  2FL7 A;  3X20 B;  5CKE A;  4E47 A;  1A0N B;  3LH5 A;  4C92 B;  4JS5 A;  3OMG A;  1W2B A;  1I1J A;  2QQB A;  2YUN A;  3HRU A;  1EZZ B;  2GBQ A;  1FWZ A;  3UWN A;  5DLQ E;  2RPN A;  4BE1 A;  5CR2 A;  1YFN A;  4QKU A;  3SWN A;  3RBB B;  2YXY A;  1R8O B;  4C8Q C;  5GAM f;  2LQ8 A;  2NUP B;  3MO8 A;  3PMI A;  3I55 A;  3BY7 A;  3M5A A;  4X9C A;  2DRK A;  4EMK C;  1JRI A;  1JQQ A;  3AHU A;  4A4E A;  3S3M A;  3EHQ A;  1T0H A;  4Q5W A;  3LGL A;  4XU2 A;  2LX7 A;  3S3O A;  3QSU A;  2BTT A;  2CRE A;  2QA4 A;  3JB9 G;  2KR3 A;  2K57 A;  3HSB A;  2J05 A;  2DIG A;  3E9F A;  1WA7 A;  3JV3 A;  1D3B B;  2GNC A;  2A28 A;  4ATO A;  2ZPI B;  3UT1 A;  3JCM Q;  1Q7Y U;  1ZSZ A;  4OB3 B;  4XTV A;  1VQP A;  1GCP A;  4ORZ A;  4KRT A;  3CCL Q;  4HCK A;  4CRI A;  1D09 B;  1BI2 A;  2FRY A;  4C8Q B;  2RHU A;  2DD4 A;  1Q81 C;  2H8H A;  3JB9 I;  2RK1 A;  1H64 1;  2KRS A;  1FXX A;  3C12 A;  1M2V B;  2L3P A;  1YHQ Q;  1QCN A;  4PFZ A;  3ZFJ A;  2DFU A;  1IGU A;  3JB9 F;  4PJO D;  4EMK B;  4FYV B;  2AHJ B;  2FZK B;  3E2U A;  2CH4 A;  4V2S A;  2ZZD A;  2DIL A;  4RTW A;  3VS7 A;  2NUP A;  1M8V A;  2QAZ A;  2K9G A;  4D8K A;  2KMT A;  3G4S T;  4PJN A;  4BD3 A;  5GAN d;  4J5Y A;  2EVR A;  2O2O A;  3RDV A;  1T0J A;  1OPK A;  3CCM Q;  2HZY A;  5KE2 A;  2CKK A;  4PLI A;  4QVD A;  1J3T A;  1S72 T;  1QVG S;  3QKJ A;  3M54 A;  3BDU A;  4PJO C;  1G83 A;  4RTY A;  3CPF A;  4PFP A;  4QVC A;  4KBM B;  4IIO A;  2FEI A;  2JT4 A;  1Q86 U;  4AFZ C;  3J7A F;  2RQU A;  1WXB A;  4OB1 B;  2MYS A;  2L3R A;  4M7A E;  2OTJ Q;  3G4S A;  2IPO B;  2OJ2 A;  1VQK Q;  3KUF A;  4M7D E;  2DO3 A;  3L1A A;  2MCN A;  1M2V A;  4J6W A;  4OMF B;  1UB4 A;  1Z9Z A;  1K9M U;  4EMK A;  1CKA A;  1D1C A;  4PJM A;  2COY A;  4KT0 E;  1G8X A;  2RMO A;  1VQO Q;  2AZV A;  4E7K A;  1KHC A;  1M1G A;  2KGT A;  2ZGW A;  2EYW A;  4HA8 A;  4B9W A;  2VWF A;  3CC4 Q;  4PJO B;  3V8L A;  4BE0 A;  4LDV A;  4J9G A;  3CCJ T;  1Q82 R;  5I11 A;  3RER A;  3FJ5 A;  4N4I A;  2O88 A;  1TG0 A;  4E7I A;  3Q1J A;  3N5B B;  1UG1 A;  2Y4X A;  2E4H A;  4FCY A;  2KDS A;  1SRM A;  3OMC A;  2W0Z A;  2WAC A;  1Q81 R;  2KT8 A;  3TU4 K;  1LJO A;  1VQ4 T;  2BE7 D;  4DBF A;  3CC7 T;  4LUD A;  1VQN T;  2C0I A;  1N9R A;  2LQK A;  1YHQ A;  3CQT A;  4X1V A;  4B9X A;  4HCC A;  4FL6 A;  1M27 C;  5KYN A;  1GFC A;  1N9S A;  4MZP A;  4F14 A;  3OW2 A;  5CKD A;  1N8R C;  3FEO A;  1NYG A;  2AT1 B;  2CUD A;  1M1K U;  3L2W A;  3H8Z A;  1SPK A;  1W70 A;  3A8O B;  2ZPB B;  3LWH A;  3SDZ A;  4J7F A;  1I4K 1;  2DL5 A;  2E65 A;  5D6X A;  3I9Q A;  1YJN Q;  5EG2 A;  2LP5 A;  3CPW S;  3CC7 A;  1VQN A;  4HVW A;  1MUZ A;  4OMN A;  1OZ2 A;  1UJY A;  4PJO A;  1IGQ A;  1WLP B;  3JCM c;  2L5Q A;  2DAQ A;  2OAU A;  5IN1 A;  2JTE A;  4Z02 A;  3X26 B;  2DXC A;  1WQW A;  4PLL A;  2G6F X;  1VQK A;  3JCM W;  1VQL T;  3C95 A;  4LDU A;  2KQW A;  1UGQ B;  2K4Y A;  5CVI A;  2H3J A;  2RB6 A;  3M59 A;  3WVE B;  3HL8 A;  2GGR A;  3UA7 A;  4E7L A;  3OS5 A;  5KYU B;  4LD9 K;  4DBH A;  1M3A A;  4A54 A;  2E12 A;  3F70 A;  1JB0 E;  1UFF A;  3CCR T;  1ZA1 B;  1CKB A;  3KXT A;  2LJ3 A;  5GAN g;  3CCE T;  1KJW A;  2GQV A;  2X4X A;  2SRC A;  1RUW A;  4HCZ A;  4HVU A;  3E19 A;  2MIO A;  3EG0 A;  2DRM A;  1OI1 A;  1VYU A;  4DBQ A;  2JZ2 A;  1QCF A;  4R0K A;  2ED1 A;  3VRY A;  1N8R R;  1BKB A;  1ABO A;  2QEX Q;  4A4H A;  4PJO G;  1WGS A;  2DZ9 A;  3CBO A;  5CIU A;  1X69 A;  3FC3 A;  3OBW A;  3M53 A;  1IHV A;  2QQ9 A;  4TVR A;  4F7U B;  1VQ5 T;  2LVM A;  3CMA T;  2D0Q B;  1JBM A;  1VYV A;  4J9B A;  5KYU A;  1IHW A;  2MWO A;  4X34 A;  2V26 A;  3CBM A;  4PNO A;  5C0M A;  2AK5 A;  1AZG B;  4QVZ A;  3CCS Q;  2AZS A;  3MEW A;  3LH0 A;  2GQI A;  2OTL T;  3TVT A;  5GAO m;  4HXJ A;  4AT1 B;  3GPL A;  1JO8 A;  2VC8 A;  3OQ5 A;  2CYZ B;  2ROL A;  1R77 A;  2BKD N;  2K7A A;  2M0O A;  2K6D A;  1YCY A;  4GLK A;  3ZBD A;  2VAS A;  2X3W D;  3CCQ Q;  1LPL A;  2RJF A;  4M78 D;  2EFI A;  2HSE B;  1G3Y A;  3EH1 A;  2JTM A;  1VQ5 A;  1PRM C;  2QAS A;  4XTW A;  3CMA A;  4ZGE B;  1H3H A;  1FMV A;  1HSQ A;  1VIE A;  2DD5 A;  1OYX A;  3M0R A;  3UAT A;  5FLX E;  3G6E T;  3JCM h;  1OOT A;  3FJP A;  4VUB A;  2OI3 A;  2XDB A;  4DEY A;  1TTH B;  2QK0 A;  3ME9 A;  5LL6 S;  3HKS A;  3I5R A;  2OTL A;  4M78 C;  2LX9 A;  4F7U A;  2RHX A;  2YRV A;  3EGU A;  3URG A;  1EFN A;  3T9N A;  3QHS A;  4XTU A;  1M30 A;  1YCS B;  2HMA A;  3G1J A;  1ZHI A;  1H3Z A;  2P84 A;  3L2Q A;  4F17 A;  2HD0 A;  2H3E B;  2NUZ A;  2EYX A;  1Y57 A;  3G7Z A;  2ATC B;  4E7J A;  2E6N A;  3PT9 A;  4XU3 A;  1U1S A;  3A8M B;  1K73 C;  4N0A A;  3HRT A;  2DL3 A;  2QEX A;  3HTR A;  3PMT A;  3BFM A;  3OYA A;  1KD1 C;  2KYB A;  2DXU A;  3UA6 A;  1NLO C;  2K79 A;  1B07 A;  2C06 A;  2CSI A;  5GAO r;  2C0O A;  1AWX A;  3EGX A;  3NPF A;  3EG1 A;  5CQX A;  3EFS A;  5GAM d;  2VGM A;  5GMK m;  1SSF A;  1GXI E;  2DA9 A;  4M78 B;  4J6X A;  2E64 A;  2KRN A;  2LQN A;  5J39 A;  1K0S A;  5GMK i;  3CCS A;  1NJI U;  1PHT A;  4LDX A;  4XAX B;  4BB7 A;  2HAX A;  3G71 T;  5LJ5 h; 
#chains in the Genus database with same CATH homology
 4A63 B;  1AOJ A;  1WX6 A;  4DEX A;  1JEG A;  2DRK A;  4AFS C;  1JQQ A;  2CH4 W;  1T0H A;  3EHQ A;  5IHK A;  1W6X A;  1K1Z A;  2CDT A;  1M8M A;  2JS0 A;  2XMF A;  1TUC A;  4OMO A;  2LX7 A;  1NEG A;  1KFZ A;  2PNI A;  4D8D A;  2BTT A;  2CRE A;  4RTV A;  2KR3 A;  1AVZ C;  3M0P A;  1AEY A;  1AWJ A;  2J05 A;  4OMQ A;  3REA B;  2JMC A;  1WA7 A;  2B86 A;  2F2W A;  3JV3 A;  3QWX X;  2GNC A;  2EW3 A;  1G2B A;  2A28 A;  2MOX A;  3H0H A;  1GFD A;  1VYT A;  2DMO A;  3U23 A;  1LCK A;  3I35 A;  1FMK A;  1ZLM A;  4F16 A;  5IHN A;  1GCP A;  4ORZ A;  3SHW A;  4KRT A;  4AG2 C;  4HCK A;  1S1N A;  2YT6 A;  1QWF A;  1K9A A;  2FRY A;  3GBQ A;  2FPD A;  2X3X D;  2H8H A;  3M0Q A;  2KRS A;  1UEC A;  1OPL A;  2L3P A;  3EHR A;  2J6F A;  2LQW A;  2KE9 A;  4HVV A;  3O5Z A;  2DYB A;  1K0X A;  1H92 A;  2ED0 A;  2EPD A;  4AFQ C;  2CH4 A;  1SHF A;  2DIL A;  4RTW A;  3VS7 A;  1SSH A;  1WIE A;  2K9G A;  4D8K A;  1KIK A;  2FRW A;  4J9F A;  2O31 A;  2EVR A;  2O2O A;  3VS6 A;  1T0J A;  4JZ3 A;  1OPK A;  4RTZ A;  2HBW A;  3NMZ C;  1RLP C;  1T3S A;  1J3T A;  1WYX A;  1OV3 A;  1G83 A;  4RTY A;  1V1C A;  4K11 A;  5FWC A;  5IXB A;  1HD3 A;  4CC2 A;  2LJ0 A;  1JXM A;  4IIO A;  4Z88 A;  1QLY A;  2FG0 A;  2FEI A;  3I5S A;  2LMJ A;  1ZUK A;  2JT4 A;  4AFZ C;  2BZ8 A;  2KEA A;  1HJD A;  2RQU A;  1WXB A;  2DF6 A;  2A37 A;  2LZ6 B;  2F2V A;  2NWM A;  1GCQ A;  1BK2 A;  1X2K A;  2ECZ A;  2OJ2 A;  1YWP A;  4GBQ A;  2DX1 A;  2EYY A;  3EG3 A;  3VS2 A;  2FPF A;  2D0N A;  1Y0M A;  2LJ1 A;  5FW9 A;  2MCN A;  2M51 A;  2D8J A;  1Z9Z A;  4LNP A;  3RNJ A;  1CKA A;  3PVQ A;  3H41 A;  1UUE A;  4GLM A;  5ECA A;  2DLP A;  2L3Q A;  2RMO A;  1PKT A;  1UGV A;  2A08 A;  2AZV A;  2PZ1 A;  3C0C A;  4RUG A;  2D8H A;  2ESW A;  2KGT A;  2KXC A;  1MV3 A;  2EYW A;  4Z8A A;  2CT4 A;  2VWF A;  1WDX A;  2DVJ A;  2RQT A;  4J9G A;  5EC7 A;  4EIK A;  5I11 A;  1WI7 A;  3THK A;  1SHG A;  2K3B A;  3FJ5 A;  2O88 A;  1TG0 A;  1SRL A;  2JM8 A;  5IHI A;  1UG1 A;  2ABL A;  1PKS A;  1SRM A;  5IH2 A;  2W0Z A;  3VS0 A;  2KT8 A;  1GBQ A;  1GL5 A;  2JW4 A;  4CC7 A;  4LUD A;  2C0I A;  5FWB A;  3CQT A;  3IQL A;  4X1V A;  1WFW A;  1M27 C;  4JJD A;  3M0T A;  1GFC A;  2A36 A;  2RQR A;  3VS5 A;  1MV0 B;  4F14 A;  2AKK A;  2J7I A;  2CUB A;  2LNH B;  3NGP A;  2DJQ A;  2KT1 A;  3PVL A;  1NYG A;  2JMA A;  1AZE A;  1AWO A;  2CUD A;  3R6N A;  2DE0 X;  2IIM A;  1K76 A;  2DL4 A;  1SPK A;  1W70 A;  1OEB A;  4Y92 A;  2P4R A;  1K4U S;  2DL5 A;  3I9Q A;  3QWY A;  2EGE A;  2LP5 A;  1PWT A;  2LCS A;  1B3Q A;  1YWO A;  1X43 A;  4HVW A;  1MUZ A;  5L23 A;  2DL7 A;  4OMN A;  1UJY A;  1I0C A;  1WLP B;  1ZSG A;  1QKX A;  1U06 A;  4JJC A;  2JTE A;  4RTX A;  2BZX A;  2F2X A;  1UE9 A;  1ZBJ A;  4J9D A;  2OAW A;  1GBR A;  2G6F X;  3VS1 A;  3VRZ A;  1BU1 A;  3H0I A;  2C0T A;  3M0U A;  2ROT A;  4J9I A;  3SEM A;  2V1Q A;  2D1X A;  2CSQ A;  2GGR A;  3UA7 A;  1AD5 A;  4M4Z A;  3KFV A;  2RQW A;  1M3A A;  2L2P A;  1NG2 A;  4JPB W;  5I22 A;  2YDL A;  2KXD A;  4J9E A;  2L0A A;  1GRI A;  1UFF A;  2RQV A;  2K2M A;  2HCK A;  1UHC A;  1PRL C;  2DM1 A;  1CKB A;  1NYF A;  2LJ3 A;  4ZNX A;  1KJW A;  1CSK A;  2FPE A;  2SRC A;  1VA7 A;  1RUW A;  4HVU A;  2RN8 A;  1KSW A;  1X6B A;  2MIO A;  3EG0 A;  2DRM A;  2DBM A;  1VYU A;  2GTJ A;  1AWW A;  1QWE A;  2YSQ A;  1QCF A;  4AG1 C;  3REB B;  4R0K A;  2ED1 A;  1ARK A;  1X2Q A;  2GTO A;  3VRY A;  1ZUU A;  3NHN A;  4JJB A;  2VVK A;  1ABO A;  2I0N A;  1BBZ A;  2YUQ A;  1YNZ A;  1U5S A;  1E6H A;  2J06 A;  1X69 A;  2BZY A;  1YP5 A;  4RTT A;  1H8K A;  2PTK A;  1ZUY A;  4E6R A;  4QT7 A;  2E5K A;  5GJW B;  1TUD A;  1VYV A;  4J9B A;  1X27 A;  2HSP A;  4AFU C;  2EQI A;  2VKN A;  1UTI A;  1BB9 A;  2V1R A;  1N5Z A;  2L3S A;  2AKL A;  2AK5 A;  2JXB A;  1AZG B;  1UDL A;  2YUP A;  2SEM A;  1I07 A;  2AZS A;  4JZ4 A;  1W1F A;  2EKH A;  2GQI A;  1NLP C;  3TVT A;  4HXJ A;  2KRO A;  1JO8 A;  4Z89 A;  2ROL A;  1JU5 C;  2K7A A;  1X6G A;  2K6D A;  5GJV B;  3VS3 A;  2FO0 A;  1IO6 A;  2X3W D;  2KRM A;  1M3C A;  2JM9 A;  4OMM A;  1ABQ A;  1FYN A;  1T3L A;  1PRM C;  1JXO A;  3H0F A;  4RTU A;  1E7O A;  1RLQ C;  3PE0 A;  1H3H A;  1SEM A;  1WXU A;  1HSQ A;  3EG2 A;  2QDL A;  5IXF A;  3M0R A;  3UAT A;  3ZL7 C;  2J6O A;  1OOT A;  2EYZ A;  2ENM A;  2JS2 A;  2KYM A;  2OI3 A;  2W10 A;  1Z9Q A;  4DEY A;  2EGC A;  4CC3 A;  3TSZ A;  2EBP A;  3I5R A;  3M0S A;  2J6K A;  4J9H A;  1UHF A;  2DNU A;  2RF0 A;  3A98 A;  3EGU A;  4LUE A;  1EFN A;  1WXT A;  1M30 A;  1YCS B;  2O9S A;  1PNJ A;  4LE9 A;  4F17 A;  1XOV A;  4IIM A;  4WCI A;  4J9C A;  4OML A;  1U3O A;  2NUZ A;  1NM7 A;  2EYX A;  2RNA A;  1Y57 A;  2CT3 A;  1ZX6 A;  1UJ0 A;  1QKW A;  2DL3 A;  4CC4 B;  2DBK A;  5HCK A;  2O9V A;  2KYB A;  3UA6 A;  1NLO C;  2HEQ A;  2K79 A;  1B07 A;  2CSI A;  2DL8 A;  4LN2 A;  2HDA A;  3ULR B;  2C0O A;  3UF4 A;  1YN8 A;  1AWX A;  3NPF A;  2YUO A;  3EG1 A;  2KNB B;  1NEB A;  2M0Y A;  2EGA A;  4ESR A;  1E6G A;  3VS4 A;  2DA9 A;  3LH5 A;  1A0N B;  1I1J A;  2KRN A;  2YUN A;  1M3B A;  2LQN A;  1K0S A;  1GCQ C;  2GBQ A;  4OMP A;  2RPN A;  1RI9 A;  1PHT A;  2KBT A;  3RBB B;  4FSS A;  3TSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...