4XK8E

Crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
63
structure length
63
Chain Sequence
b'GPKRGAKVKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIQEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structural basis for energy transfer pathways in the plant PSI-LHCI supercomplex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 9
structure length 63
sequence length 63
chains with identical sequence e
ec nomenclature
pdb deposition date 2015-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xk8E00
2CZ1B 3VYGA 3A8GB 2ZPIB 2CYZB 3VYHB 1UGSB 2PUOB 2PUKB 1UGPB 1IREB 4OB3B 3WVDB 2WSFE 4OB0B 2DXBA 2PVGB 3WVEB 2ZZDA 2PVDB 2ZPBB 2D0QB 3A8OB 2ZPHB 1PSEA 4ZGJB 3LW5E 3A8MB 2AHJB 4ZGDB 2ZCFB 1UGRB 4ZGEB 4OB1B 3X26B 2WSEE 1QP3A 2DD5A 2PVOB 2PU9B 2ZPGB 4OB2B 4FM4B 3A8LB 2DD4A 4Y28E 1AHJB 3X28B 4XK8E 4L6V5 3QYHB 2WSCE 1DJ7B 1V29B 3QXEB 3X24B 1UGQB 1QP2A 3QZ5B 1PSFA 2DPPB 2ZPFB 3X25B 3A8HB 1JB0E 2ZPEB 2CZ6B 3HHTB 1GXIE 5L8RE 2QDYB 2O01E 4RKUE 3QYGB 3QZ9B 2DXCA 2CZ0B 4KT0E 2CZ7B 3X20B
chains in the Genus database with same CATH superfamily
2DJQA 4EPCA 3M0PA 2QTVA 3FLGA 1VQ8Q 2IVWA 1N9SA 1VQ5T 3CCLT 3OYIA 2J05A 2DXUA 1PRLC 3VYHB 2BTTA 1QKXA 2DZCA 2D0NA 3RERA 3DB3A 3S3OA 2IG0A 1QVPA 2OTLQ 4J7IA 1Q81R 1BI2A 4FT4A 1N8RR 1WHJA 3GLXA 2CH4A 1W2BA 2GBQA 1OPKA 3EFOA 3VU3C 3JCMg 1AVZC 2X4JA 4KGVB 4HT8A 4M77D 2L89A 2R57A 2QA4T 3VS3A 2DRMA 3CXCP 3EG9A 5L23A 4IUUA 2J6KA 1GBQA 4M78C 4C92A 1PKTA 1YWPA 2ZAEA 4FM4B 3OMGA 1I8FA 1YIJA 2MAMA 2LDMA 3OMCA 3M53A 1MMDA 4L6V5 3I35A 3X24B 4M7AG 4OGEA 2KROA 1NJIU 4KRTA 3EAEA 2SRCA 3C95A 4IIMA 2VUBA 3EG0A 3P8BB 4M75A 2K7AA 3CBOA 3GP8A 2KT1A 1HK9A 4RCBA 1WI7A 3X25B 4J8OA 3GF5A 1Q81C 4L59A 1N8RC 5I11A 5CKBA 1T3SA 2D1XA 2OX7A 1IRXA 4OMQA 3PE0A 2FEIA 1OPLA 4F17A 4F7UG 1UDLA 3X20B 1EFNA 3V8JA 3M55A 3E9GA 4JZ3A 1MNEA 4HXJA 3F70A 5LJ3f 1VOMA 5D6YA 4E7KA 2LX7A 3HTRA 5GAN3 4M7AB 3HP9A 2EYYA 2XHCA 4XTWA 4OB0B 4BB7A 2LJ0A 3E1SA 2KAFA 1Y0MA 1A0NB 4E6RA 3SEMA 5GAOp 5A2QE 2P4TA 3OYHA 2CSQA 1W2BS 1VQNT 1PNJA 4AFZC 2LCSA 2DX1A 1SHGA 2RF0A 4OF1A 3L2WA 3PIPA 1WJSA 2ABLA 2RO0A 4B9XA 4C8QC 1GCQC 1RAHB 4NOYA 2M51A 2L2PA 4F7UB 5FU7B 3RNJA 4OVAA 4XTXA 2W10A 4HVWA 3MO8A 4DBQA 3CC2A 2L3RA 1PD1A 2E65A 5D7UA 1ZLMA 2LMJA 2NWMA 3CCET 4X9DA 4Z88A 2PTKA 1M90R 1Y57A 3I56Q 3GIBA 4LNPA 2M1HA 1WIEA 3HRUA 5HK0A 3OW2S 2COYA 4JRQA 3NTKA 1SEMA 3MKDA 2NLUA 1IB8A 1FMWA 2IPOB 2A37A 1LCKA 4R55A 2FPFA 2KNBB 4C5HA 1Y96A 2QEXQ 1NYGA 2AK5A 4MZPA 1PWTA 2RI3A 4PJOG 1I1JA 2H8HA 1JB0E 3C94A 1S72A 5LJ3d 2CH4W 1NM7A 1M30A 3JB9I 4JPBW 2QDYB 4QQ6A 3H8ZA 4OMNA 1UUEA 1K1ZA 4LDXA 1WQ7A 3V7RA 3META 4VUBA 2ATCB 3PFSA 2LVMA 1XOVA 2EGCA 3TQ7P 2LQKA 2JS0A 5GAOr 1VQ6Q 2XU8A 3IQLA 4A63B 4JLIA 2MPXC 3V8KA 1VQLT 2LJ3A 1KG1A 3E19A 3CCJQ 2DYBA 3I5RA 1M90C 2O9SA 2RQRA 2EGAA 5J26A 3QUIA 4HT9A 4ZTFA 4LD9K 2F2WA 2RK2A 4PJOB 1M9SA 2K57A 2FZGB 2X9HA 2E6NA 1AWJA 2ZZDA 1B7TA 2F5TX 2J6OA 2KRSA 1KSWA 1NLOC 2XDPA 2EYZA 2I0NA 1VQ4Q 1VQKQ 4RTUA 2MYSA 4HCKA 5KYYA 1Y7XA 1W70A 4DBRA 5LJ3h 3CCUA 2BZ8A 1ZSZC 2KMTA 8AT1B 1YIJQ 3S3NA 5J39A 3M0SA 3FDRA 3X26B 3C4SA 4EIKA 2ECZA 2YXYA 4E7SA 3CD6A 2ZPGB 3EGDA 1GBRA 4LDWA 2A28A 4C8QF 2CT4A 1R0CB 1Y96B 1M8VA 4FSSA 1OYXA 2DL4A 2KI7A 1RAFB 3CPWP 3S3MA 1PRMC 3RDVA 1KQSA 1YJ9Q 4P5NA 1QW1A 2DPPB 2E3IA 4XTUA 1X6GA 5KYWB 1ACMB 1ZUKA 1PCXA 1UTIA 3PVQA 3NTHA 2BZYA 3CCQQ 2BKDN 5KYXB 1UGVA 4M77C 5L8RE 2FHDA 1TXQA 4LUDA 1YI2A 4RTZA 1VQMA 3PT9A 1N9RA 2RM4A 1YIJT 3RMQA 2CS7A 4N4GA 4FYVB 4PFZA 4RTXA 5FU6C 1QCNA 4WCIA 1QWEA 2E3HA 4BY6C 1I5OB 2BIVA 2RA2A 3CCRA 3OBYA 1TSFA 2X3WD 5GMKh 1NJIC 4XTYA 1VQ7Q 1MV0B 3DLLA 2WSFE 3KFVA 2ZGWA 1VQPA 2DIQA 3PTAA 2RMOA 4EMGA 3M0UA 2QGGA 2PVDB 5CKFA 4DEYA 1YITQ 1GFCA 3BE3A 2LZ6B 2JTMA 1MMNA 4N4IA 3L2QA 5HK3A 1VQ8A 4ZGEB 4YTLA 1GFDA 4KGXB 2GQIA 3LX7A 2JT4A 1QP3A 1Q95G 1CKAA 1YN8A 4IUQA 1NYFA 2OTLA 3ULRB 1AWOA 3H41A 1M1KR 5C6SA 3I9QA 4EMKA 5KCOA 3JCMe 3GOXA 1KQ2A 2DO3A 1ZBJA 2MOXA 5LJ3g 5FW9A 3CC2T 3LWHA 3RMSA 2DJZA 2NYSA 1AOJA 2MWOA 3EFRA 2P0PA 4A53A 4BI4A 5CKDA 4PJMA 1NE8A 2BE7D 4PJOD 4RKUE 1Q82U 5HKCA 3H0IA 3R6NA 2M0OA 2GTOA 2HSEB 2ROTA 5LJ5e 2O9VA 1VQOA 2EJGA 2DL7A 2HNIA 2M0YA 1D1AA 4M77F 2KRNA 1EX4A 3JSCA 2KR3A 4OB3B 1S72T 4MZMA 4XTZA 4WF2A 5IT9E 4AFQC 3HKSA 4NL2A 4PJNA 2WACA 1QMCA 2RJCA 3M54A 2FB7A 3A8OB 2FYKA 2HAXA 2Z0WA 1PSEA 5A0LA 4JJCA 4RUGA 1OI1A 2HMAA 2HKNA 3J81E 2VASA 2MF2A 5CQYA 1BIBA 1RABB 3UT1A 2A0FB 2CUBA 1BBZA 1RI0A 1UG1A 2PU9B 1G3TA 4JRPA 1H92A 2NUTA 3X28B 4CC2A 1B3QA 3EHRA 3MEAA 2HEQA 2LNVA 2YUPA 2K2MA 4XU2A 3QXEB 2DEUA 2QI2A 4ME7A 4F14A 4II1A 2DL8A 3CCUT 3OSVA 1LVKA 3M5AA 3P8HA 2DBKA 2BUDA 3PMIA 4F16A 1UB4A 2HQXA 2F5KA 3VS5A 1Z9QA 4NS5A 3REAB 1ZX6A 3Q1JA 3TU4K 2CP0A 2VYTA 3I55Q 3SWNC 1YBYA 1FMKA 3CD6T 3BFMA 4CC3A 3VS2A 2DA9A 5DLOA 5IH2A 3MP8A 4MDXA 3I56A 3OQ5A 4XU3A 4FCYA 4X1VA 1I07A 3CCSQ 4JUVA 1GCPA 1KIKA 1OX9A 1PD0A 1ZA1B 5EG2A 2PUOB 2PUKB 4GY5A 1O9SA 1EIFA 4CC4B 2JZ2A 3FB9A 2QEXA 2XDDA 1PG5B 2JJ9A 3RKXA 2GQVA 2LTOA 2VXEA 5KE3A 3OYJA 3JCMQ 2D9TA 1YI2T 2EQMA 2H3JA 4O5VA 1VQMT 2K3XA 3QKJA 3WVEB 4JJNK 1WA7A 4KH1B 5LL6S 3HSBA 1MNDA 2E6ZA 9ATCB 3RR6A 3AHUA 4ESRA 2DZ9A 4JJBA 1VQ6A 3A8MB 1V76A 3CC7Q 3CCRT 2EBPA 2NUTB 2HL5C 2KYBA 4M7AA 3EGXB 3CCJA 1KHIA 4C8QE 4F04B 1VQPT 1BK2A 1GL5A 2E5KA 4C92C 5FU7C 1O75A 1BI1A 1B07A 3A8LB 2EQKA 5GAMj 2V8KA 2DD4A 3ME9A 1AHJB 3GBQA 3GPLA 2RHUA 1JQQA 1OU8A 5IHNA 3EG2A 2LQ8A 1QVFS 5GANj 3GNFB 2KYMA 4BI3A 2LNHB 1VQ4A 1VQKA 1Q82R 4RTWA 2E5QA 4M75C 3OS5A 3OYLA 2BE9B 1VQ8T 2DE0X 4JS5A 4F7UA 5IHIA 5KYUB 2DVJA 2JVVA 3VV0A 5ECAA 2PNIA 3OW2A 4MZTA 3JB9D 1VQOQ 3LH0A 2OTLT 4B6MA 4J9DA 3KBGA 4Y91A 3LGFA 1D3BB 5KE2A 1Z9ZA 4AFUC 1KQSP 1C1AA 1WXUA 2J7IA 2E70A 1ZSGA 1AD5A 2SEMA 2CYZB 2O4XA 1YJ9A 4B9WA 3EH1A 1VA7A 3FEOA 4PFPA 4J9BA 2K79A 3QPHA 5GAOl 2YWWA 1PKSA 1YHQQ 3DLMA 3CCQA 4DA4A 1QVGS 4Z8AA 1YJNQ 4OMFB 4D8KA 4BD3A 1TU0B 1VUBA 4KBMB 1KJWA 1IZ6A 2X4XA 3HL8A 1Q82C 1QWFA 3CCMQ 1SRMA 3QO3A 3BDLA 1LNXA 4Z02A 4A4HA 3J7AF 1VQOT 4ELZC 2AHJB 2YUQA 3M9QA 4FYYB 4K11A 2L8DA 1NEGA 3M4GA 3RKWA 3OYMA 4E47A 4LN2A 2NUZA 2DFUA 2LT1A 1I5LA 1I4K1 1RAGB 1VQ7A 1T0JA 3L2ZA 1TTHB 1E6HA 4FT2A 6AT1B 4PJOA 4XK8E 1SF9A 1UJYA 1R77A 3ZBDA 4N4HA 2HBWA 3A98A 1YITA 2YHTA 1WLPB 1VYUA 3KXTA 3V7CA 1KQ1A 2ZPFB 3AT1B 4PFOA 1SG5A 2HZYA 4C92F 2PZ1A 2EJ9A 1Q86R 1OZ2A 1UHFA 4GBQA 5CVIA 2QQRA 2ENMA 1WJRA 3E2UA 3OYCA 2O4XB 2CP3A 4ZN3A 2K4YA 4M75F 1N27A 2A7YA 1TG0A 2L3SA 3DKMA 4M77E 4LXCA 4M78F 1YCYA 4JRKA 5DLQE 1FX7A 1FXXA 1JJ2A 5A0GA 1M1KU 2A3LA 2J06A 3M0RA 3G71Q 3WXMB 1BYMA 4AFSC 5KYWA 1VQ9Q 3ASKA 5LJ3e 2EAYA 3R6OA 2HL3A 5KYXA 5IN1A 2DILA 2DEQA 2RJEA 1U8RA 1IGQA 1E6GA 4LDYA 1K0SA 2RQTA 3OSSC 3INZA 2CDTA 1M1FA 3I56T 1K8AU 4LDUA 4JDSA 2JMAA 2F69A 4ATOA 1HJDA 1WHKA 1H3ZA 2HKQB 2EPDA 2LJ1A 2X51A 3SHWA 2CT3A 5CCAA 2QEXT 4C8QG 1TWBA 3G4SQ 1AZGB 2DIGA 2DD5A 5CKHA 5GAOm 2XG8D 1LJOA 3OBWA 2EKOA 1QQJA 1ZUUA 2VXFA 4WTOB 4E7HA 4C5GA 2CKKA 5GMKl 1M5Q1 2WSCE 1V29B 1OQKA 1UGQB 4A54A 4CRIA 1VQ6T 1M4ZA 2QQSA 1D1BA 3H0HA 5KH6A 2CREA 3A8HB 2E12A 4OGCA 1XNIA 3CCJT 2M02A 5GMKe 1QLYA 3OYAA 1U06A 1AEYA 2DETA 1X43A 4C8QB 2KT8A 1C0MA 1OU9A 4M7DE 2KSSA 1WHHA 5GAN5 2IIMA 1K9AA 1AWXA 4M7AD 2HBPA 2CZ1B 1JJ2S 2KXDA 5CIUA 3UDCA 2LQWA 2EYWA 5GAOq 1VQ4T 1VQKT 1K0XA 1YP5A 5D6WA 4IIOA 1YWOA 2A36A 3QDRB 1KFZA 1UGPB 1YNZA 4UC4A 3HRSA 4OMOA 2K2VA 3FJPA 2GF7A 2AZVA 1WHGA 3I55A 1RL2A 3G6EA 2ZPBB 5HY6A 1KC8U 5C0MA 5HCKA 2D0QB 3JAME 4HVUA 2ZPHB 4FW2A 2EW3A 4C0DC 4NL3A 5CKEA 3CCSA 2COZA 4ZGDB 1YJ9T 5IHKA 1Y07A 5GAMf 1UGRB 3MHXA 3PNWC 4J9GA 1RADB 2YRVA 2CP2A 1IHWA 2QYZA 1BCOA 4RTVA 4D6WA 2YT6A 4LD6A 1PHTA 5GANf 2QXFA 2COWA 4MDWA 4X34A 3CCQT 1WX6A 3OS2A 2FPEA 2JUFA 2XD0A 1WHMA 4J6XA 3VS4A 4N0AA 5J3BA 4IURA 2VV5A 3SB2A 4FYXB 2O2OA 3EHQA 4EMKC 1ABQA 2ESWA 1G83A 1K76A 1M2VB 3CC4Q 3CC7A 2VKNA 2CP7A 3HRTA 4C0GA 2YRDA 5FWBA 1GXIE 3PMTA 3OS1A 1W2BP 2RHZA 4J9HA 2KK4A 1NLPC 1VQ7T 4R0KA 2XI9A 1YJWQ 3G7ZA 4EDUA 1D0ZA 4E7IA 2P0KA 2CZ0B 4A4FA 2JM8A 5GMKm 2RNAA 1RUWA 3S6WA 1H3HA 1SSHA 1PM3A 2H3EB 2OJ2A 4M77G 3VS7A 1LOJA 1YITT 5IXBA 3L2UA 4KUIA 4QVCA 2VC8A 2QG9B 1ABOA 2LQNA 2M16A 4DBFA 2E41A 1WQWA 2AT1B 3M4YA 4FL6A 3QWYA 1K8AR 1F1BB 2JXBA 3VRZA 3KUFA 2G6FX 3OW2P 2E10A 2YRCA 4R56A 5GAMd 3OYGA 4C5EA 3OA6A 4J7FA 3CMEQ 1FMVA 1OX8A 2R5AA 3JB9H 5GANd 3NTIA 2RHIA 2V8JA 1EZZB 4FSXA 5GJWB 4AT1B 4ZGJB 1D0XA 2CGHA 2FZKB 2Y4XA 4IKFA 4IUTA 1RAEB 2ZCFB 1C6VX 2MI6A 2W0ZA 4M77B 4MMKA 2KDSA 3QSUA 2V1QA 3CMAQ 3OYDA 4M7DA 1M1KC 2RD1A 2HDAA 2K5LA 3RESA 4CI0C 1YHQA 2KQWA 1ZQ1A 2AKLA 4QT7A 3OY9A 4Y28E 1TS9A 3MP6A 4C8QD 1JO8A 2QDLA 4BY6B 1YJNA 3THKA 1X6OA 3JB9F 2MIOA 2B86A 2OAUA 4DEXA 1BI3A 1JRIA 3QZ5B 3CCMA 4C92E 4IUPA 2AKKA 4E7LA 1M8MA 1BIAA 4RCCA 1K8AC 1ZA2B 4ZN1A 3HPWA 2C06A 5GAMh 2R58A 2C0TA 1Y71A 1ZHIA 1RAAB 3QIIA 4OMPA 2DERA 4PLIA 4A4GA 3EGXA 5GANh 3QZ9B 4BACA 1NEBA 1SRLA 4M75E 1G3WA 4M7DG 2X3XD 4M78E 1QVFA 2E64A 2JM9A 1NG2A 1WZOA 2VWFA 3RKYA 1KK7A 1M1GA 4RMOA 1RLPC 4QKUA 4XU1A 3CPWA 1BU1A 3FJ5A 2K3BA 5I2SA 1RACB 4QVZA 2F1LA 3OYFA 2FO0A 3G6EQ 2JTEA 4Q5WA 3NHNA 1KC8R 2GNCA 3JCMW 2YUNA 1RI9A 1ZUYA 3PVLA 2K9GA 2VGMA 2RPNA 4JJDA 5KYUA 1RAIB 2FRYA 2K6DA 2EGEA 2YUOA 2DK3A 4GLKA 2JS2A 1Q86U 1MMGA 1K4US 2JN0A 3ZFJA 1VQ5Q 3NGPA 3CCLQ 2O31A 4A4KA 2OTJA 1D3BA 1XJWB 1UEBA 4M7DB 2GCXA 4FIBA 4LUEA 1JXOA 4DQ2A 2AZSA 4PNOA 3G71A 1MUZA 4M7AC 1QVGA 3EGUA 4HKEA 2JOYA 1VQ9A 2ED0A 3I5SA 1G3SA 3FC3A 1TOVA 3I55T 3G6ET 3O5ZA 1DJ7B 4BE1A 2QA4Q 2DMOA 1OOTA 1S1NA 3RUXA 2GTJA 2EYQA 1Q7YR 3OB9A 1WHLA 1KC8C 3CCST 4BDYA 1SKUB 4BI8B 3LLRA 3HHTB 2RQVA 2KY9A 1B34A 3VS0A 3C0CA 5I21A 1BI0A 2JW4A 3G4SA 3UA7A 1J3TA 3CEYA 4E7ZA 5EC7A 2E4HA 4V2SA 2L5QA 1UFFA 2YLCA 3MEWA 2RH2A 1WYXA 5FLXE 1W1FA 2Y4YA 1M2OA 5LJ5j 2I2LA 3CPWS 2RJDA 1G2BA 2YLBA 2CP5A 1G3YA 3VS1A 1IREB 3C12A 3L2RA 3CC7T 3L42A 2QTXA 3GNGA 2MMPA 5GAMg 2EIFA 1YFNA 5GAN2 1MGQA 3LGLA 2RHYA 4D8DA 2DF6A 2FPDA 2XK0A 2DL5A 5GANg 1Q7YC 5FRNA 2LCCA 2JMCA 2NUPB 2DTOA 4X9CA 1TUCA 4Z89A 2LRQA 2FZCB 5LJ5g 4RTYA 2GFUA 3UWNA 4QQDA 5GAN4 3N5BB 3SWNB 1G8XA 3NPFA 2JNGA 3M58A 1IO6A 2K3YA 2KBTA 3MPUB 3E9FA 3OYNA 4M78A 4XAXB 3H6ZA 1WFWA 1VIFA 1VQNQ 4QW2A 2OI3A 4J9EA 1K9MU 2QGFB 1MV3A 5CO7A 2Y90A 4PJOC 2RN8A 2RB6A 4C92G 3U23A 5GAN6 1B34B 3BY7A 2EYXA 2R5MA 4M7AF 4ELYC 4ORZA 5M9OA 3EH2A 3CCEQ 4KH0B 2MWPA 3D7SB 3QWXX 2DVEA 3EFSA 3M0TA 2RI5A 3MEVA 7AT1B 5CK9A 5CAIA 2V26A 3EFOB 4M75G 2O88A 5FWCA 1YHQT 3TCJA 1NPPA 3JCMP 4M78G 1ARKA 1SSFA 2LT4A 4KT0E 4HVVA 3REBB 4OMMA 1YJNT 1ZBXA 2QK0A 3EG9B 4M7DD 3CCMT 4F7UF 3A8GB 2HSPA 3JCMJ 1OZ3A 3JB9J 1G5VA 3CCVA 3A5ZB 1XTDA 4C92B 1W4SA 1T0HA 3CC4A 2OTJQ 3ER0A 2EQJA 5IAYA 2DXBA 2EVRA 5KCHA 1IGUA 2XKOC 4ZNXA 5D6XA 2LP5A 1YJWA 1TUDA 4FYWB 4QVDA 4C8QA 1GCQA 4M75B 1VQLQ 2K5FA 1CKBA 1N6AA 4DBHA 4MMLA 4M78B 1NPRA 3MCAB 3VUZA 1E7OA 2QQAA 5CQXA 1FYNA 2YDLA 4OB1B 3LWIA 4PJLA 2RHXA 2RJFA 3ZL7C 4J6YA 3JCMb 2L0AA 1R8OB 2QAZA 3SFMA 3OYKA 3J80E 4C5IA 1VIEA 4BE0A 2FVUA 1VYVA 3RBBB 1H641 4JZ4A 1QKWA 3QYHB 2EWNA 3OYEA 2QASA 2OTJT 3MEUA 1LPLA 3CMEA 3LH5A 1KHCA 1WXTA 1Q86C 3NMZC 2P4RA 4PJJA 2CP6A 3M56A 4ZTJA 4GLMA 3JCMV 1CSKA 3G71T 2M9UA 1NBEB 2XMFA 1K73U 3CMAA 4PJOF 1VQ9T 3H0FA 1U5SA 4M4ZA 1PC0A 4E2FB 2DXCA 4Y92A 1AWWA 3L2VA 2D8HA 3FRNA 3RIRA 1TUGB 3PGGA 1MMAA 3OS0A 4LDVA 1UE9A 2ZPIB 4J83A 2CSIA 3EG3A 2F2VA 3CXCA 1P92A 1X6BA 4J9FA 2GGRA 1OEBA 1NZ9A 3V8LA 1WXBA 2DTIA 5KYNA 2L3QA 3SD4A 2X35A 2QQBA 3M0QA 1M2VA 3H9NA 4OMLA 2JTFA 2PVGB 1OV3A 4JS4A 1NJIR 3G4ST 4FW1A 2C0IA 2KEAA 1X69A 8ATCB 1QVFP 4AG1C 3TSWA 1AT1B 1KD1U 4LE9A 4OP0A 3M57A 2PQWA 4BE2A 3LW5E 4TVRA 3LYIA 1K9MR 1ZSZA 4AG2C 4A4EA 3BW1A 1W6XA 2B8AA 1U1SA 2YSQA 5A0DA 1QCFA 2K5IA 2WSEE 2EJFA 3A1PA 1JXMA 1SPKA 2LX9A 4HA8A 2C0OA 3JCMf 2RI2A 3O8VA 3T9NA 5AYFA 4AMCA 4C0FA 5DY9A 3EG1A 4N0AC 4RG2A 4J9IA 1VQ5A 1BB9A 3CCLA 2KXCA 3V7SA 2RK1A 2XICA 4RG8A 1UHCA 2HD0A 4C92D 3QJYA 5FROA 4BDZA 1QVGP 4M77A 2CZ6B 3QBYA 5LJ5f 3CBPA 2L3PA 3JCMc 2DLPA 2DAQA 4DOWA 4JLGA 5CR2A 1R0BG 4HCZA 3CCVQ 2BZXA 5KYYB 2KGTA 4M75D 5I2MA 3PIOA 1K9MC 1WJQA 1AZEA 5FRMA 4M78D 3QJ6A 2QA4A 3VYGA 4IUVA 1I0CA 3CXCS 1VYTA 3CC2Q 1UGSB 1X2KA 2DTHA 4KULA 1WGSA 2D8JA 3VJPA 3QHSA 1Q7YU 1I81A 4KUDK 4FU6A 3EGDB 2V8IA 1JU5C 5LJ3j 3HFNA 2VGNA 3NFCA 1X75C 4DOVA 2DL3A 2QQ9A 3OYBA 1ZSZB 2XDBA 4PK4A 2DM1A 2KE9A 1YCSB 1KQSS 3JCMd 1N5ZA 1Q81U 1N8RU 3CPFA 4L5GA 3URGA 1HSQA 4C0ZA 1S72Q 4J6WA 4J5YA 2DBMA 5GMKi 3CCVT 4E7JA 2MCNA 1FWZA 2LCLA 2KRMA 3MJXA 2EFIA 3TVTA 4M7DC 4PL6A 4HCBA 3CC4T 3CQTA 3JB9G 1X01A 4PLLA 4EMHA 5GAMe 1HD3A 1H8KA 2EQIA 4O6JA 1HYOA 1YJWT 2HQEA 4XTVA 4M7AE 5LJ5d 5GANe 1K73R 1QP2A 1PSFA 1WDXA 2KVQG 2ROLA 5IXFA 2E1HA 1MHNA 1SHFA 2EQUA 2X4WA 2HCKA 2J6FA 4BUGA 2ZPEB 2CUDA 3OYYA 5FU6B 2O01E 5GMKj 1JEGA 5I22A 2X4YA 1VQNA 1UECA 1WNLA 1WPYA 4CC7A 3JCMh 2FG0A 2CZ7B 4XQ3A 2EKHA 4F7UE 4C0DB 1JBMA 5GAN8 3CCUQ 1BKBA 5GJVB 4HCCA 1M27C 3CMET 3P8DA 2DRKA 1XQHA 3BDUA 3VS6A 2DKGA 2GFAA 1V1CA 2OAWA 1D0YA 3UPUA 3VKIA 1RLQC 3WVDB 1KD1R 3CD6Q 2FRWA 3HFOA 2MK5A 1QCOA 3CCEA 3TEEA 4JRIA 2F2XA 3CMAT 1M3AA 1IHVA 5LJ5h 3JCMX 1TH7A 1K73C 4EMKB 3JV3A 2FL7A 2DNUA 1D09B 1X27A 3TSZA 2DXTA 1IXDA 1U3OA 2D6FA 2G3RA 1GRIA 3QDFA 2RQWA 3FIFA 3MP1A 1BCMA 1YI2Q 1VQMQ 3UA6A 2VB6A 2PVOB 3VUBA 4OB2B 3VRYA 1X2QA 5GAN7 4J9CA 3JRZA 4XU0A 5GAOn 3G1JA 3L1AA 1JJ2P 2VVKA 4RTTA 3ZEHA 1U1TA 3CCRQ 2HQHA 2DYIA 3QG1A 5DM7R 1M90U 2NUPA 3UF4A 3UATA 3DB4A 1VQLA 3M59A 1KD1C 4M7DF 3SDZA 2RQUA 2V1RA 2P0QA 1VQPQ 1D1CA 2A08A 4KGZB 4PJOE 2XIDA 4PKCC 5AT1B 2P84A 2ED1A 3TREA 3SWNA 1HXDA 1T3LA 1UJ0A 1M3BA 2LC4A 4QQGA 1OULA 3QYGB 3CBMA 4ANJA 1M3CA 2AIRB
chains in the Genus database with same CATH topology
4EPCA 1ZBXA 3FLGA 4M7AD 2HBPA 2CZ1B 2IVWA 5LJ5e 1JJ2S 4M7DD 5CIUA 1N9SA 3UDCA 1VQOA 1VQ5T 2EJGA 3CCLT 4F7UF 2HNIA 5GAOq 3A8GB 3OYIA 3CCMT 3JCMJ 1VQ4T 1OZ3A 2DXUA 1VQKT 3VYHB 3JB9J 5D6WA 2DZCA 1G5VA 3QDRB 4M77F 3CCVA 1UGPB 3DB3A 3RERA 3A5ZB 1XTDA 4UC4A 1W4SA 4C92B 3JSCA 4OB3B 3S3OA 1S72T 2IG0A 4MZMA 3HRSA 1QVPA 3CC4A 4XTZA 4WF2A 3ER0A 2EQJA 4J7IA 5IAYA 2K2VA 3FJPA 5IT9E 2DXBA 2GF7A 1BI2A 4FT4A 5KCHA 3HKSA 2XKOC 1RL2A 4NL2A 3GLXA 5D6XA 3I55A 2WACA 3G6EA 1W2BA 1YJWA 2RJCA 3VU3C 2ZPBB 5HY6A 4QVDA 5C0MA 1KC8U 3M54A 4C8QA 2FB7A 4M75B 2D0QB 3A8OB 2FYKA 2HAXA 2K5FA 3JAME 1N6AA 3JCMg 2X4JA 4M78B 4MMLA 2ZPHB 1NPRA 3MCAB 2L89A 4M77D 1PSEA 3VUZA 2R57A 2QQAA 5A0LA 2QA4T 5CQXA 4C0DC 4NL3A 5CKEA 3CCSA 1OI1A 4ZGDB 1YJ9T 1Y07A 5GAMf 3J81E 1UGRB 3MHXA 3PNWC 2MF2A 2YRVA 4OB1B 3LWIA 4IUUA 5CQYA 1BIBA 2RHXA 2RJFA 4J6YA 3UT1A 4D6WA 4M78C 3JCMb 4C92A 1R8OB 4LD6A 1RI0A 3SFMA 2QXFA 2PU9B 4X34A 4MDWA 5GANf 3J80E 3OYKA 3CCQT 1G3TA 4C5IA 1VIEA 4JRPA 4FM4B 4BE0A 3OMGA 2FVUA 1I8FA 1YIJA 2MAMA 3X28B 3OS2A 2LDMA 3OMCA 1H641 2JUFA 3M53A 3MEAA 2XD0A 4L6V5 3QYHB 2EWNA 2LNVA 4J6XA 4XU2A 3OYEA 3QXEB 4N0AA 3X24B 2QI2A 5J3BA 4M7AG 4IURA 3MEUA 2VV5A 4OGEA 1NJIU 2OTJT 4ME7A 3EAEA 3SB2A 3CMEA 1KHCA 3C95A 4II1A 1Q86C 4EMKC 2VUBA 3P8BB 4M75A 3CCUT 3CBOA 3OSVA 3GP8A 3M5AA 1HK9A 3P8HA 2BUDA 4RCBA 3PMIA 3X25B 3M56A 4ZTJA 1UB4A 2HQXA 4J8OA 2F5KA 3JCMV 3CC7A 3OY9A 3GF5A 4NS5A 1Q81C 4L59A 1N8RC 3HRTA 3G71T 4C0GA 3Q1JA 2M9UA 5CKBA 1K73U 3TU4K 1GXIE 3PMTA 3OS1A 3CMAA 2RHZA 2VYTA 2KK4A 3SWNC 4PJOF 1YBYA 1VQ7T 2XI9A 3CD6T 1VQ9T 3G7ZA 3BFMA 4EDUA 4E7IA 2P0KA 5DLOA 2DXCA 2CZ0B 4A4FA 4F7UG 3L2VA 3X20B 3MP8A 3V8JA 5GMKm 3I56A 3OQ5A 3M55A 3E9GA 3FRNA 4MDXA 3S6WA 3RIRA 4XU3A 3PGGA 4M77G 3F70A 4JUVA 3OS0A 4LDVA 5LJ3f 1LOJA 1YITT 5D6YA 4E7KA 5EG2A 2ZPIB 4J83A 3L2UA 2PUOB 3CXCA 2PUKB 4KUIA 1P92A 5GAN3 4GY5A 2VC8A 3HP9A 4M7AB 4QVCA 1O9SA 1EIFA 1NZ9A 3V8LA 2DTIA 2M16A 2JZ2A 2XHCA 3FB9A 2E41A 1WQWA 2QEXA 3M4YA 4FL6A 3SD4A 2XDDA 2X35A 2QQBA 4XTWA 4OB0B 4BB7A 3E1SA 2KAFA 3RKXA 2GQVA 2LTOA 3KUFA 2VXEA 5KE3A 3OYJA 2E10A 3JCMQ 2JTFA 2D9TA 2PVGB 4R56A 4JS4A 5GAMd 5GAOp 2EQMA 2H3JA 4O5VA 5A2QE 3G4ST 2P4TA 2K3XA 3QKJA 3WVEB 3OYGA 3OYHA 1W2BS 4C5EA 1VQNT 3OA6A 4J7FA 4OF1A 4JJNK 2R5AA 3L2WA 1KD1U 3PIPA 5LL6S 1WJSA 3HSBA 3JB9H 2RO0A 4B9XA 5GANd 4C8QC 2E6ZA 4NOYA 3NTIA 2RHIA 2V8JA 4FSXA 3AHUA 2DZ9A 4OP0A 3M57A 4ZGJB 2PQWA 4F7UB 2CGHA 3LW5E 5FU7B 4TVRA 3LYIA 3A8MB 4BE2A 1VQ6A 4OVAA 4XTXA 3CCRT 2Y4XA 4IKFA 4IUTA 2ZCFB 4A4EA 2MI6A 4M77B 4MMKA 2KDSA 3BW1A 3QSUA 3MO8A 3CC2A 2L3RA 3OYDA 2B8AA 1U1SA 5A0DA 4M7AA 2E65A 3CCJA 4M7DA 1M1KC 2K5IA 2WSEE 1KHIA 4C8QE 2RD1A 2EJFA 1VQPT 3CCET 4X9DA 2K5LA 5FU7C 3RESA 4C92C 1O75A 2LX9A 1JJ2A 1BI1A 4CI0C 1YHQA 2KQWA 1ZQ1A 4HA8A 3A8LB 2EQKA 5GAMj 2V8KA 2DD4A 2M1HA 3HRUA 3ME9A 4Y28E 3JCMf 5HK0A 3MP6A 1AHJB 4C8QD 3OW2S 2RI2A 3O8VA 3T9NA 3GPLA 4BY6B 4JRQA 1YJNA 5AYFA 2RHUA 3NTKA 1X6OA 3JB9F 2NLUA 4C0FA 5DY9A 2LQ8A 1QVFS 2OAUA 4N0AC 4RG2A 1BI3A 5GANj 1JRIA 3GNFB 3QZ5B 4BI3A 1VQ5A 4R55A 3CCMA 3CCLA 4C92E 1VQ4A 1VQKA 3V7SA 2RK1A 4C5HA 2E5QA 1Y96A 4IUPA 3OS5A 4M75C 3OYLA 2XICA 4E7LA 1BIAA 4RCCA 1K8AC 1VQ8T 4MZPA 4RG8A 4JS5A 2RI3A 4PJOG 4F7UA 2HD0A 4ZN1A 3HPWA 4C92D 2C06A 5GAMh 2R58A 3QJYA 1JB0E 3C94A 5FROA 4BDZA 1S72A 5LJ3d 4M77A 1Y71A 1ZHIA 2CZ6B 3JB9I 2JVVA 3VV0A 3QIIA 3QBYA 2QDYB 4PLIA 4QQ6A 3H8ZA 4A4GA 5LJ5f 3CBPA 3OW2A 5GANh 3QZ9B 4BACA 4MZTA 3JB9D 1YI2T 4M75E 4LDXA 1WQ7A 3LH0A 3JCMc 3V7RA 1G3WA 2OTLT 2DAQA 3KBGA 3META 4Y91A 4M7DG 3LGFA 4JLGA 4M78E 4VUBA 1D3BB 4DOWA 5CR2A 1QVFA 3PFSA 5KE2A 4HCZA 2LVMA 2E64A 1XOVA 3RKYA 2LQKA 4M75D 5I2MA 3PIOA 1K9MC 1M1GA 1WJQA 5GAOr 2XU8A 4RMOA 5FRMA 4M78D 2E70A 3QJ6A 4XU1A 2QA4A 3VYGA 4JLIA 4IUVA 3CPWA 3CXCS 3V8KA 2CYZB 1VQLT 2O4XA 1UGSB 5I2SA 1YJ9A 1KG1A 2DTHA 4B9WA 3E19A 4KULA 4QVZA 3OYFA 1WGSA 3FEOA 3VJPA 3QHSA 1Q7YU 1I81A 4Q5WA 3QPHA 1M90C 5GAOl 4KUDK 5J26A 4FU6A 3JCMW 2V8IA 3QUIA 5LJ3j 2VGMA 3HFNA 4HT9A 4ZTFA 2VGNA 3NFCA 3DLMA 3CCQA 2RK2A 4DA4A 4LD9K 1M9SA 4PJOB 1QVGS 2K57A 2E6NA 4OMFB 4BD3A 1VUBA 4KBMB 1X75C 2ZZDA 2DK3A 1IZ6A 2X4XA 4DOVA 4GLKA 1Q86U 2JN0A 2F5TX 2QQ9A 3HL8A 3ZFJA 3OYBA 2XDPA 1Q82C 2XDBA 4A4KA 2OTJA 3QO3A 3BDLA 1D3BA 1LNXA 1UEBA 4Z02A 4A4HA 4M7DB 1KQSS 1Y7XA 2GCXA 3JCMd 3J7AF 5LJ3h 1VQOT 4ELZC 3CCUA 1Q81U 1N8RU 3CPFA 2AHJB 4L5GA 3M9QA 3URGA 4FIBA 4C0ZA 2L8DA 4J6WA 4J5YA 3M4GA 5GMKi 2KMTA 3CCVT 3RKWA 4E7JA 4DQ2A 3OYMA 3S3NA 4E47A 1FWZA 4PNOA 5J39A 2LCLA 3G71A 2LT1A 1I5LA 3FDRA 4M7AC 3X26B 2EFIA 3C4SA 1QVGA 1I4K1 4M7DC 4PL6A 4HCBA 4HKEA 3CC4T 2JOYA 1VQ7A 3CD6A 2ZPGB 1VQ9A 3JB9G 1X01A 1G3SA 3FC3A 3L2ZA 4PLLA 4EMHA 4LDWA 4PJOE 5GAMe 4FT2A 3I55T 4C8QF 3G6ET 4PJOA 4XK8E 1Y96B 1M8VA 4O6JA 1OYXA 1YJWT 3S3MA 1DJ7B 3ZBDA 4BE1A 2HQEA 4N4HA 1KQSA 4XTVA 4M7AE 5LJ5d 5GANe 3RUXA 1QP2A 1YITA 1PSFA 2KVQG 4P5NA 2EYQA 2YHTA 1QW1A 3OB9A 2DPPB 3KXTA 4XTUA 3V7CA 1KC8C 3CCST 2E1HA 1KQ1A 1MHNA 2ZPFB 4BDYA 2EQUA 2X4WA 4BUGA 3NTHA 4C92F 2EJ9A 4BI8B 2BKDN 3LLRA 2ZPEB 3HHTB 2KY9A 3OYYA 4M77C 1B34A 1OZ2A 2FHDA 2O01E 5FU6B 5L8RE 5GMKj 5I21A 1BI0A 1YI2A 1VQMA 5CVIA 2QQRA 3G4SA 2X4YA 3CEYA 1VQNA 3PT9A 1N9RA 1WJRA 2RM4A 1WNLA 1WPYA 1YIJT 4V2SA 2L5QA 3JCMh 3OYCA 2O4XB 2YLCA 3RMQA 2CZ7B 4XQ3A 3MEWA 4F7UE 2RH2A 4ZN3A 4C0DB 2K4YA 2CS7A 4N4GA 1JBMA 4M75F 1N27A 2A7YA 5GAN8 1BKBA 5FLXE 4HCCA 2Y4YA 5FU6C 3DKMA 3CMET 4M77E 2I2LA 4M78F 3P8DA 4BY6C 5LJ5j 3CPWS 1XQHA 2RJDA 1YCYA 2BIVA 2RA2A 1FX7A 1FXXA 3BDUA 4JRKA 5DLQE 2YLBA 5A0GA 3CCRA 1M1KU 2DKGA 2GFAA 3OBYA 2A3LA 5GMKh 1G3YA 1NJIC 1IREB 4XTYA 3UPUA 3C12A 3VKIA 3WXMB 1BYMA 3WVDB 3L2RA 3CC7T 3ASKA 3HFOA 3L42A 2QTXA 2WSFE 5LJ3e 3DLLA 2ZGWA 1VQPA 2DIQA 2EAYA 3R6OA 3TEEA 3GNGA 3CCEA 2MMPA 5GAMg 4JRIA 3CMAT 3PTAA 5IN1A 2EIFA 5GAN2 1MGQA 4EMGA 3LGLA 2RHYA 3JCMX 5LJ5h 2DEQA 2RJEA 2PVDB 1U8RA 1TH7A 4LDYA 5CKFA 1K73C 2XK0A 4EMKB 1Q7YC 5GANg 5FRNA 3OSSC 2LCCA 2FL7A 3INZA 1M1FA 3I56T 2DTOA 1K8AU 4LDUA 4JDSA 4X9CA 2F69A 4ATOA 2JTMA 2DXTA 2LRQA 4N4IA 5LJ5g 3L2QA 2D6FA 1H3ZA 2GFUA 5HK3A 1VQ8A 3UWNA 2G3RA 4HT8A 4QQDA 5GAN4 3FIFA 3MP1A 4ZGEB 3N5BB 3SWNB 4YTLA 5CCAA 2JNGA 3M58A 2K3YA 2QEXT 3E9FA 3OYNA 3LX7A 4M78A 4XAXB 3H6ZA 4C8QG 1VIFA 1QP3A 2DIGA 2DD5A 5CKHA 5GAOm 2PVOB 2XG8D 3VUBA 1LJOA 3GIBA 3OBWA 4OB2B 4QW2A 4IUQA 2EKOA 5GAN7 1K9MU 2VXFA 4E7HA 3JRZA 2OTLA 4C5GA 2CKKA 4XU0A 5GMKl 5GAOn 5CO7A 2Y90A 4PJOC 1M5Q1 3L1AA 2WSCE 1V29B 3ZEHA 1U1TA 5C6SA 1UGQB 2RB6A 4EMKA 4C92G 3QG1A 5DM7R 4A54A 5GAN6 1M90U 4CRIA 5KCOA 3DB4A 1VQLA 3JCMe 1B34B 3M59A 3BY7A 1VQ6T 1KD1C 1M4ZA 2R5MA 4M7AF 4ELYC 2QQSA 3GOXA 1KQ2A 2DO3A 3SDZA 5KH6A 5M9OA 4M7DF 2P0QA 5LJ3g 1YJNT 3A8HB 2MWPA 3CC2T 2E12A 3RMSA 3LWHA 4OGCA 1XNIA 2XIDA 2DJZA 4PKCC 2DVEA 3EFSA 2RI5A 2MWOA 3EFRA 2P0PA 3MEVA 3TREA 3SWNA 4A53A 4BI4A 5CKDA 3CCJT 5CK9A 1NE8A 5GMKe 5CAIA 4PJOD 1HXDA 4RKUE 3OYAA 1Q82U 5HKCA 2LC4A 4M75G 4QQGA 3QYGB 1YHQT 3TCJA 1NPPA 3JCMP 4M78G 4C8QB 3CBMA 1SSFA 2LT4A 2M0OA 4KT0E 1VQMT 4M7DE 2KSSA 5GAN5
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ1 B;  3VYG A;  3A8G B;  2ZPI B;  2CYZ B;  3VYH B;  1UGS B;  2PUO B;  2PUK B;  1UGP B;  1IRE B;  4OB3 B;  3WVD B;  2WSF E;  4OB0 B;  2DXB A;  2PVG B;  3WVE B;  2ZZD A;  2PVD B;  2ZPB B;  2D0Q B;  3A8O B;  2ZPH B;  1PSE A;  4ZGJ B;  3LW5 E;  3A8M B;  2AHJ B;  4ZGD B;  2ZCF B;  1UGR B;  4ZGE B;  4OB1 B;  3X26 B;  2WSE E;  1QP3 A;  2DD5 A;  2PVO B;  2PU9 B;  2ZPG B;  4OB2 B;  4FM4 B;  3A8L B;  2DD4 A;  4Y28 E;  1AHJ B;  3X28 B;  4XK8 E;  4L6V 5;  3QYH B;  2WSC E;  1DJ7 B;  1V29 B;  3QXE B;  3X24 B;  1UGQ B;  1QP2 A;  3QZ5 B;  1PSF A;  2DPP B;  2ZPF B;  3X25 B;  3A8H B;  1JB0 E;  2ZPE B;  2CZ6 B;  3HHT B;  1GXI E;  5L8R E;  2QDY B;  2O01 E;  4RKU E;  3QYG B;  3QZ9 B;  2DXC A;  2CZ0 B;  4KT0 E;  2CZ7 B;  3X20 B; 
#chains in the Genus database with same CATH topology
 2DJQ A;  4EPC A;  3M0P A;  2QTV A;  3FLG A;  1VQ8 Q;  2IVW A;  1N9S A;  1VQ5 T;  3CCL T;  3OYI A;  2J05 A;  2DXU A;  1PRL C;  3VYH B;  2BTT A;  1QKX A;  2DZC A;  2D0N A;  3RER A;  3DB3 A;  3S3O A;  2IG0 A;  1QVP A;  2OTL Q;  4J7I A;  1Q81 R;  1BI2 A;  4FT4 A;  1N8R R;  1WHJ A;  3GLX A;  2CH4 A;  1W2B A;  2GBQ A;  1OPK A;  3EFO A;  3VU3 C;  3JCM g;  1AVZ C;  2X4J A;  4KGV B;  4HT8 A;  4M77 D;  2L89 A;  2R57 A;  2QA4 T;  3VS3 A;  2DRM A;  3CXC P;  3EG9 A;  5L23 A;  4IUU A;  2J6K A;  1GBQ A;  4M78 C;  4C92 A;  1PKT A;  1YWP A;  2ZAE A;  4FM4 B;  3OMG A;  1I8F A;  1YIJ A;  2MAM A;  2LDM A;  3OMC A;  3M53 A;  1MMD A;  4L6V 5;  3I35 A;  3X24 B;  4M7A G;  4OGE A;  2KRO A;  1NJI U;  4KRT A;  3EAE A;  2SRC A;  3C95 A;  4IIM A;  2VUB A;  3EG0 A;  3P8B B;  4M75 A;  2K7A A;  3CBO A;  3GP8 A;  2KT1 A;  1HK9 A;  4RCB A;  1WI7 A;  3X25 B;  4J8O A;  3GF5 A;  1Q81 C;  4L59 A;  1N8R C;  5I11 A;  5CKB A;  1T3S A;  2D1X A;  2OX7 A;  1IRX A;  4OMQ A;  3PE0 A;  2FEI A;  1OPL A;  4F17 A;  4F7U G;  1UDL A;  3X20 B;  1EFN A;  3V8J A;  3M55 A;  3E9G A;  4JZ3 A;  1MNE A;  4HXJ A;  3F70 A;  5LJ3 f;  1VOM A;  5D6Y A;  4E7K A;  2LX7 A;  3HTR A;  5GAN 3;  4M7A B;  3HP9 A;  2EYY A;  2XHC A;  4XTW A;  4OB0 B;  4BB7 A;  2LJ0 A;  3E1S A;  2KAF A;  1Y0M A;  1A0N B;  4E6R A;  3SEM A;  5GAO p;  5A2Q E;  2P4T A;  3OYH A;  2CSQ A;  1W2B S;  1VQN T;  1PNJ A;  4AFZ C;  2LCS A;  2DX1 A;  1SHG A;  2RF0 A;  4OF1 A;  3L2W A;  3PIP A;  1WJS A;  2ABL A;  2RO0 A;  4B9X A;  4C8Q C;  1GCQ C;  1RAH B;  4NOY A;  2M51 A;  2L2P A;  4F7U B;  5FU7 B;  3RNJ A;  4OVA A;  4XTX A;  2W10 A;  4HVW A;  3MO8 A;  4DBQ A;  3CC2 A;  2L3R A;  1PD1 A;  2E65 A;  5D7U A;  1ZLM A;  2LMJ A;  2NWM A;  3CCE T;  4X9D A;  4Z88 A;  2PTK A;  1M90 R;  1Y57 A;  3I56 Q;  3GIB A;  4LNP A;  2M1H A;  1WIE A;  3HRU A;  5HK0 A;  3OW2 S;  2COY A;  4JRQ A;  3NTK A;  1SEM A;  3MKD A;  2NLU A;  1IB8 A;  1FMW A;  2IPO B;  2A37 A;  1LCK A;  4R55 A;  2FPF A;  2KNB B;  4C5H A;  1Y96 A;  2QEX Q;  1NYG A;  2AK5 A;  4MZP A;  1PWT A;  2RI3 A;  4PJO G;  1I1J A;  2H8H A;  1JB0 E;  3C94 A;  1S72 A;  5LJ3 d;  2CH4 W;  1NM7 A;  1M30 A;  3JB9 I;  4JPB W;  2QDY B;  4QQ6 A;  3H8Z A;  4OMN A;  1UUE A;  1K1Z A;  4LDX A;  1WQ7 A;  3V7R A;  3MET A;  4VUB A;  2ATC B;  3PFS A;  2LVM A;  1XOV A;  2EGC A;  3TQ7 P;  2LQK A;  2JS0 A;  5GAO r;  1VQ6 Q;  2XU8 A;  3IQL A;  4A63 B;  4JLI A;  2MPX C;  3V8K A;  1VQL T;  2LJ3 A;  1KG1 A;  3E19 A;  3CCJ Q;  2DYB A;  3I5R A;  1M90 C;  2O9S A;  2RQR A;  2EGA A;  5J26 A;  3QUI A;  4HT9 A;  4ZTF A;  4LD9 K;  2F2W A;  2RK2 A;  4PJO B;  1M9S A;  2K57 A;  2FZG B;  2X9H A;  2E6N A;  1AWJ A;  2ZZD A;  1B7T A;  2F5T X;  2J6O A;  2KRS A;  1KSW A;  1NLO C;  2XDP A;  2EYZ A;  2I0N A;  1VQ4 Q;  1VQK Q;  4RTU A;  2MYS A;  4HCK A;  5KYY A;  1Y7X A;  1W70 A;  4DBR A;  5LJ3 h;  3CCU A;  2BZ8 A;  1ZSZ C;  2KMT A;  8AT1 B;  1YIJ Q;  3S3N A;  5J39 A;  3M0S A;  3FDR A;  3X26 B;  3C4S A;  4EIK A;  2ECZ A;  2YXY A;  4E7S A;  3CD6 A;  2ZPG B;  3EGD A;  1GBR A;  4LDW A;  2A28 A;  4C8Q F;  2CT4 A;  1R0C B;  1Y96 B;  1M8V A;  4FSS A;  1OYX A;  2DL4 A;  2KI7 A;  1RAF B;  3CPW P;  3S3M A;  1PRM C;  3RDV A;  1KQS A;  1YJ9 Q;  4P5N A;  1QW1 A;  2DPP B;  2E3I A;  4XTU A;  1X6G A;  5KYW B;  1ACM B;  1ZUK A;  1PCX A;  1UTI A;  3PVQ A;  3NTH A;  2BZY A;  3CCQ Q;  2BKD N;  5KYX B;  1UGV A;  4M77 C;  5L8R E;  2FHD A;  1TXQ A;  4LUD A;  1YI2 A;  4RTZ A;  1VQM A;  3PT9 A;  1N9R A;  2RM4 A;  1YIJ T;  3RMQ A;  2CS7 A;  4N4G A;  4FYV B;  4PFZ A;  4RTX A;  5FU6 C;  1QCN A;  4WCI A;  1QWE A;  2E3H A;  4BY6 C;  1I5O B;  2BIV A;  2RA2 A;  3CCR A;  3OBY A;  1TSF A;  2X3W D;  5GMK h;  1NJI C;  4XTY A;  1VQ7 Q;  1MV0 B;  3DLL A;  2WSF E;  3KFV A;  2ZGW A;  1VQP A;  2DIQ A;  3PTA A;  2RMO A;  4EMG A;  3M0U A;  2QGG A;  2PVD B;  5CKF A;  4DEY A;  1YIT Q;  1GFC A;  3BE3 A;  2LZ6 B;  2JTM A;  1MMN A;  4N4I A;  3L2Q A;  5HK3 A;  1VQ8 A;  4ZGE B;  4YTL A;  1GFD A;  4KGX B;  2GQI A;  3LX7 A;  2JT4 A;  1QP3 A;  1Q95 G;  1CKA A;  1YN8 A;  4IUQ A;  1NYF A;  2OTL A;  3ULR B;  1AWO A;  3H41 A;  1M1K R;  5C6S A;  3I9Q A;  4EMK A;  5KCO A;  3JCM e;  3GOX A;  1KQ2 A;  2DO3 A;  1ZBJ A;  2MOX A;  5LJ3 g;  5FW9 A;  3CC2 T;  3LWH A;  3RMS A;  2DJZ A;  2NYS A;  1AOJ A;  2MWO A;  3EFR A;  2P0P A;  4A53 A;  4BI4 A;  5CKD A;  4PJM A;  1NE8 A;  2BE7 D;  4PJO D;  4RKU E;  1Q82 U;  5HKC A;  3H0I A;  3R6N A;  2M0O A;  2GTO A;  2HSE B;  2ROT A;  5LJ5 e;  2O9V A;  1VQO A;  2EJG A;  2DL7 A;  2HNI A;  2M0Y A;  1D1A A;  4M77 F;  2KRN A;  1EX4 A;  3JSC A;  2KR3 A;  4OB3 B;  1S72 T;  4MZM A;  4XTZ A;  4WF2 A;  5IT9 E;  4AFQ C;  3HKS A;  4NL2 A;  4PJN A;  2WAC A;  1QMC A;  2RJC A;  3M54 A;  2FB7 A;  3A8O B;  2FYK A;  2HAX A;  2Z0W A;  1PSE A;  5A0L A;  4JJC A;  4RUG A;  1OI1 A;  2HMA A;  2HKN A;  3J81 E;  2VAS A;  2MF2 A;  5CQY A;  1BIB A;  1RAB B;  3UT1 A;  2A0F B;  2CUB A;  1BBZ A;  1RI0 A;  1UG1 A;  2PU9 B;  1G3T A;  4JRP A;  1H92 A;  2NUT A;  3X28 B;  4CC2 A;  1B3Q A;  3EHR A;  3MEA A;  2HEQ A;  2LNV A;  2YUP A;  2K2M A;  4XU2 A;  3QXE B;  2DEU A;  2QI2 A;  4ME7 A;  4F14 A;  4II1 A;  2DL8 A;  3CCU T;  3OSV A;  1LVK A;  3M5A A;  3P8H A;  2DBK A;  2BUD A;  3PMI A;  4F16 A;  1UB4 A;  2HQX A;  2F5K A;  3VS5 A;  1Z9Q A;  4NS5 A;  3REA B;  1ZX6 A;  3Q1J A;  3TU4 K;  2CP0 A;  2VYT A;  3I55 Q;  3SWN C;  1YBY A;  1FMK A;  3CD6 T;  3BFM A;  4CC3 A;  3VS2 A;  2DA9 A;  5DLO A;  5IH2 A;  3MP8 A;  4MDX A;  3I56 A;  3OQ5 A;  4XU3 A;  4FCY A;  4X1V A;  1I07 A;  3CCS Q;  4JUV A;  1GCP A;  1KIK A;  1OX9 A;  1PD0 A;  1ZA1 B;  5EG2 A;  2PUO B;  2PUK B;  4GY5 A;  1O9S A;  1EIF A;  4CC4 B;  2JZ2 A;  3FB9 A;  2QEX A;  2XDD A;  1PG5 B;  2JJ9 A;  3RKX A;  2GQV A;  2LTO A;  2VXE A;  5KE3 A;  3OYJ A;  3JCM Q;  2D9T A;  1YI2 T;  2EQM A;  2H3J A;  4O5V A;  1VQM T;  2K3X A;  3QKJ A;  3WVE B;  4JJN K;  1WA7 A;  4KH1 B;  5LL6 S;  3HSB A;  1MND A;  2E6Z A;  9ATC B;  3RR6 A;  3AHU A;  4ESR A;  2DZ9 A;  4JJB A;  1VQ6 A;  3A8M B;  1V76 A;  3CC7 Q;  3CCR T;  2EBP A;  2NUT B;  2HL5 C;  2KYB A;  4M7A A;  3EGX B;  3CCJ A;  1KHI A;  4C8Q E;  4F04 B;  1VQP T;  1BK2 A;  1GL5 A;  2E5K A;  4C92 C;  5FU7 C;  1O75 A;  1BI1 A;  1B07 A;  3A8L B;  2EQK A;  5GAM j;  2V8K A;  2DD4 A;  3ME9 A;  1AHJ B;  3GBQ A;  3GPL A;  2RHU A;  1JQQ A;  1OU8 A;  5IHN A;  3EG2 A;  2LQ8 A;  1QVF S;  5GAN j;  3GNF B;  2KYM A;  4BI3 A;  2LNH B;  1VQ4 A;  1VQK A;  1Q82 R;  4RTW A;  2E5Q A;  4M75 C;  3OS5 A;  3OYL A;  2BE9 B;  1VQ8 T;  2DE0 X;  4JS5 A;  4F7U A;  5IHI A;  5KYU B;  2DVJ A;  2JVV A;  3VV0 A;  5ECA A;  2PNI A;  3OW2 A;  4MZT A;  3JB9 D;  1VQO Q;  3LH0 A;  2OTL T;  4B6M A;  4J9D A;  3KBG A;  4Y91 A;  3LGF A;  1D3B B;  5KE2 A;  1Z9Z A;  4AFU C;  1KQS P;  1C1A A;  1WXU A;  2J7I A;  2E70 A;  1ZSG A;  1AD5 A;  2SEM A;  2CYZ B;  2O4X A;  1YJ9 A;  4B9W A;  3EH1 A;  1VA7 A;  3FEO A;  4PFP A;  4J9B A;  2K79 A;  3QPH A;  5GAO l;  2YWW A;  1PKS A;  1YHQ Q;  3DLM A;  3CCQ A;  4DA4 A;  1QVG S;  4Z8A A;  1YJN Q;  4OMF B;  4D8K A;  4BD3 A;  1TU0 B;  1VUB A;  4KBM B;  1KJW A;  1IZ6 A;  2X4X A;  3HL8 A;  1Q82 C;  1QWF A;  3CCM Q;  1SRM A;  3QO3 A;  3BDL A;  1LNX A;  4Z02 A;  4A4H A;  3J7A F;  1VQO T;  4ELZ C;  2AHJ B;  2YUQ A;  3M9Q A;  4FYY B;  4K11 A;  2L8D A;  1NEG A;  3M4G A;  3RKW A;  3OYM A;  4E47 A;  4LN2 A;  2NUZ A;  2DFU A;  2LT1 A;  1I5L A;  1I4K 1;  1RAG B;  1VQ7 A;  1T0J A;  3L2Z A;  1TTH B;  1E6H A;  4FT2 A;  6AT1 B;  4PJO A;  4XK8 E;  1SF9 A;  1UJY A;  1R77 A;  3ZBD A;  4N4H A;  2HBW A;  3A98 A;  1YIT A;  2YHT A;  1WLP B;  1VYU A;  3KXT A;  3V7C A;  1KQ1 A;  2ZPF B;  3AT1 B;  4PFO A;  1SG5 A;  2HZY A;  4C92 F;  2PZ1 A;  2EJ9 A;  1Q86 R;  1OZ2 A;  1UHF A;  4GBQ A;  5CVI A;  2QQR A;  2ENM A;  1WJR A;  3E2U A;  3OYC A;  2O4X B;  2CP3 A;  4ZN3 A;  2K4Y A;  4M75 F;  1N27 A;  2A7Y A;  1TG0 A;  2L3S A;  3DKM A;  4M77 E;  4LXC A;  4M78 F;  1YCY A;  4JRK A;  5DLQ E;  1FX7 A;  1FXX A;  1JJ2 A;  5A0G A;  1M1K U;  2A3L A;  2J06 A;  3M0R A;  3G71 Q;  3WXM B;  1BYM A;  4AFS C;  5KYW A;  1VQ9 Q;  3ASK A;  5LJ3 e;  2EAY A;  3R6O A;  2HL3 A;  5KYX A;  5IN1 A;  2DIL A;  2DEQ A;  2RJE A;  1U8R A;  1IGQ A;  1E6G A;  4LDY A;  1K0S A;  2RQT A;  3OSS C;  3INZ A;  2CDT A;  1M1F A;  3I56 T;  1K8A U;  4LDU A;  4JDS A;  2JMA A;  2F69 A;  4ATO A;  1HJD A;  1WHK A;  1H3Z A;  2HKQ B;  2EPD A;  2LJ1 A;  2X51 A;  3SHW A;  2CT3 A;  5CCA A;  2QEX T;  4C8Q G;  1TWB A;  3G4S Q;  1AZG B;  2DIG A;  2DD5 A;  5CKH A;  5GAO m;  2XG8 D;  1LJO A;  3OBW A;  2EKO A;  1QQJ A;  1ZUU A;  2VXF A;  4WTO B;  4E7H A;  4C5G A;  2CKK A;  5GMK l;  1M5Q 1;  2WSC E;  1V29 B;  1OQK A;  1UGQ B;  4A54 A;  4CRI A;  1VQ6 T;  1M4Z A;  2QQS A;  1D1B A;  3H0H A;  5KH6 A;  2CRE A;  3A8H B;  2E12 A;  4OGC A;  1XNI A;  3CCJ T;  2M02 A;  5GMK e;  1QLY A;  3OYA A;  1U06 A;  1AEY A;  2DET A;  1X43 A;  4C8Q B;  2KT8 A;  1C0M A;  1OU9 A;  4M7D E;  2KSS A;  1WHH A;  5GAN 5;  2IIM A;  1K9A A;  1AWX A;  4M7A D;  2HBP A;  2CZ1 B;  1JJ2 S;  2KXD A;  5CIU A;  3UDC A;  2LQW A;  2EYW A;  5GAO q;  1VQ4 T;  1VQK T;  1K0X A;  1YP5 A;  5D6W A;  4IIO A;  1YWO A;  2A36 A;  3QDR B;  1KFZ A;  1UGP B;  1YNZ A;  4UC4 A;  3HRS A;  4OMO A;  2K2V A;  3FJP A;  2GF7 A;  2AZV A;  1WHG A;  3I55 A;  1RL2 A;  3G6E A;  2ZPB B;  5HY6 A;  1KC8 U;  5C0M A;  5HCK A;  2D0Q B;  3JAM E;  4HVU A;  2ZPH B;  4FW2 A;  2EW3 A;  4C0D C;  4NL3 A;  5CKE A;  3CCS A;  2COZ A;  4ZGD B;  1YJ9 T;  5IHK A;  1Y07 A;  5GAM f;  1UGR B;  3MHX A;  3PNW C;  4J9G A;  1RAD B;  2YRV A;  2CP2 A;  1IHW A;  2QYZ A;  1BCO A;  4RTV A;  4D6W A;  2YT6 A;  4LD6 A;  1PHT A;  5GAN f;  2QXF A;  2COW A;  4MDW A;  4X34 A;  3CCQ T;  1WX6 A;  3OS2 A;  2FPE A;  2JUF A;  2XD0 A;  1WHM A;  4J6X A;  3VS4 A;  4N0A A;  5J3B A;  4IUR A;  2VV5 A;  3SB2 A;  4FYX B;  2O2O A;  3EHQ A;  4EMK C;  1ABQ A;  2ESW A;  1G83 A;  1K76 A;  1M2V B;  3CC4 Q;  3CC7 A;  2VKN A;  2CP7 A;  3HRT A;  4C0G A;  2YRD A;  5FWB A;  1GXI E;  3PMT A;  3OS1 A;  1W2B P;  2RHZ A;  4J9H A;  2KK4 A;  1NLP C;  1VQ7 T;  4R0K A;  2XI9 A;  1YJW Q;  3G7Z A;  4EDU A;  1D0Z A;  4E7I A;  2P0K A;  2CZ0 B;  4A4F A;  2JM8 A;  5GMK m;  2RNA A;  1RUW A;  3S6W A;  1H3H A;  1SSH A;  1PM3 A;  2H3E B;  2OJ2 A;  4M77 G;  3VS7 A;  1LOJ A;  1YIT T;  5IXB A;  3L2U A;  4KUI A;  4QVC A;  2VC8 A;  2QG9 B;  1ABO A;  2LQN A;  2M16 A;  4DBF A;  2E41 A;  1WQW A;  2AT1 B;  3M4Y A;  4FL6 A;  3QWY A;  1K8A R;  1F1B B;  2JXB A;  3VRZ A;  3KUF A;  2G6F X;  3OW2 P;  2E10 A;  2YRC A;  4R56 A;  5GAM d;  3OYG A;  4C5E A;  3OA6 A;  4J7F A;  3CME Q;  1FMV A;  1OX8 A;  2R5A A;  3JB9 H;  5GAN d;  3NTI A;  2RHI A;  2V8J A;  1EZZ B;  4FSX A;  5GJW B;  4AT1 B;  4ZGJ B;  1D0X A;  2CGH A;  2FZK B;  2Y4X A;  4IKF A;  4IUT A;  1RAE B;  2ZCF B;  1C6V X;  2MI6 A;  2W0Z A;  4M77 B;  4MMK A;  2KDS A;  3QSU A;  2V1Q A;  3CMA Q;  3OYD A;  4M7D A;  1M1K C;  2RD1 A;  2HDA A;  2K5L A;  3RES A;  4CI0 C;  1YHQ A;  2KQW A;  1ZQ1 A;  2AKL A;  4QT7 A;  3OY9 A;  4Y28 E;  1TS9 A;  3MP6 A;  4C8Q D;  1JO8 A;  2QDL A;  4BY6 B;  1YJN A;  3THK A;  1X6O A;  3JB9 F;  2MIO A;  2B86 A;  2OAU A;  4DEX A;  1BI3 A;  1JRI A;  3QZ5 B;  3CCM A;  4C92 E;  4IUP A;  2AKK A;  4E7L A;  1M8M A;  1BIA A;  4RCC A;  1K8A C;  1ZA2 B;  4ZN1 A;  3HPW A;  2C06 A;  5GAM h;  2R58 A;  2C0T A;  1Y71 A;  1ZHI A;  1RAA B;  3QII A;  4OMP A;  2DER A;  4PLI A;  4A4G A;  3EGX A;  5GAN h;  3QZ9 B;  4BAC A;  1NEB A;  1SRL A;  4M75 E;  1G3W A;  4M7D G;  2X3X D;  4M78 E;  1QVF A;  2E64 A;  2JM9 A;  1NG2 A;  1WZO A;  2VWF A;  3RKY A;  1KK7 A;  1M1G A;  4RMO A;  1RLP C;  4QKU A;  4XU1 A;  3CPW A;  1BU1 A;  3FJ5 A;  2K3B A;  5I2S A;  1RAC B;  4QVZ A;  2F1L A;  3OYF A;  2FO0 A;  3G6E Q;  2JTE A;  4Q5W A;  3NHN A;  1KC8 R;  2GNC A;  3JCM W;  2YUN A;  1RI9 A;  1ZUY A;  3PVL A;  2K9G A;  2VGM A;  2RPN A;  4JJD A;  5KYU A;  1RAI B;  2FRY A;  2K6D A;  2EGE A;  2YUO A;  2DK3 A;  4GLK A;  2JS2 A;  1Q86 U;  1MMG A;  1K4U S;  2JN0 A;  3ZFJ A;  1VQ5 Q;  3NGP A;  3CCL Q;  2O31 A;  4A4K A;  2OTJ A;  1D3B A;  1XJW B;  1UEB A;  4M7D B;  2GCX A;  4FIB A;  4LUE A;  1JXO A;  4DQ2 A;  2AZS A;  4PNO A;  3G71 A;  1MUZ A;  4M7A C;  1QVG A;  3EGU A;  4HKE A;  2JOY A;  1VQ9 A;  2ED0 A;  3I5S A;  1G3S A;  3FC3 A;  1TOV A;  3I55 T;  3G6E T;  3O5Z A;  1DJ7 B;  4BE1 A;  2QA4 Q;  2DMO A;  1OOT A;  1S1N A;  3RUX A;  2GTJ A;  2EYQ A;  1Q7Y R;  3OB9 A;  1WHL A;  1KC8 C;  3CCS T;  4BDY A;  1SKU B;  4BI8 B;  3LLR A;  3HHT B;  2RQV A;  2KY9 A;  1B34 A;  3VS0 A;  3C0C A;  5I21 A;  1BI0 A;  2JW4 A;  3G4S A;  3UA7 A;  1J3T A;  3CEY A;  4E7Z A;  5EC7 A;  2E4H A;  4V2S A;  2L5Q A;  1UFF A;  2YLC A;  3MEW A;  2RH2 A;  1WYX A;  5FLX E;  1W1F A;  2Y4Y A;  1M2O A;  5LJ5 j;  2I2L A;  3CPW S;  2RJD A;  1G2B A;  2YLB A;  2CP5 A;  1G3Y A;  3VS1 A;  1IRE B;  3C12 A;  3L2R A;  3CC7 T;  3L42 A;  2QTX A;  3GNG A;  2MMP A;  5GAM g;  2EIF A;  1YFN A;  5GAN 2;  1MGQ A;  3LGL A;  2RHY A;  4D8D A;  2DF6 A;  2FPD A;  2XK0 A;  2DL5 A;  5GAN g;  1Q7Y C;  5FRN A;  2LCC A;  2JMC A;  2NUP B;  2DTO A;  4X9C A;  1TUC A;  4Z89 A;  2LRQ A;  2FZC B;  5LJ5 g;  4RTY A;  2GFU A;  3UWN A;  4QQD A;  5GAN 4;  3N5B B;  3SWN B;  1G8X A;  3NPF A;  2JNG A;  3M58 A;  1IO6 A;  2K3Y A;  2KBT A;  3MPU B;  3E9F A;  3OYN A;  4M78 A;  4XAX B;  3H6Z A;  1WFW A;  1VIF A;  1VQN Q;  4QW2 A;  2OI3 A;  4J9E A;  1K9M U;  2QGF B;  1MV3 A;  5CO7 A;  2Y90 A;  4PJO C;  2RN8 A;  2RB6 A;  4C92 G;  3U23 A;  5GAN 6;  1B34 B;  3BY7 A;  2EYX A;  2R5M A;  4M7A F;  4ELY C;  4ORZ A;  5M9O A;  3EH2 A;  3CCE Q;  4KH0 B;  2MWP A;  3D7S B;  3QWX X;  2DVE A;  3EFS A;  3M0T A;  2RI5 A;  3MEV A;  7AT1 B;  5CK9 A;  5CAI A;  2V26 A;  3EFO B;  4M75 G;  2O88 A;  5FWC A;  1YHQ T;  3TCJ A;  1NPP A;  3JCM P;  4M78 G;  1ARK A;  1SSF A;  2LT4 A;  4KT0 E;  4HVV A;  3REB B;  4OMM A;  1YJN T;  1ZBX A;  2QK0 A;  3EG9 B;  4M7D D;  3CCM T;  4F7U F;  3A8G B;  2HSP A;  3JCM J;  1OZ3 A;  3JB9 J;  1G5V A;  3CCV A;  3A5Z B;  1XTD A;  4C92 B;  1W4S A;  1T0H A;  3CC4 A;  2OTJ Q;  3ER0 A;  2EQJ A;  5IAY A;  2DXB A;  2EVR A;  5KCH A;  1IGU A;  2XKO C;  4ZNX A;  5D6X A;  2LP5 A;  1YJW A;  1TUD A;  4FYW B;  4QVD A;  4C8Q A;  1GCQ A;  4M75 B;  1VQL Q;  2K5F A;  1CKB A;  1N6A A;  4DBH A;  4MML A;  4M78 B;  1NPR A;  3MCA B;  3VUZ A;  1E7O A;  2QQA A;  5CQX A;  1FYN A;  2YDL A;  4OB1 B;  3LWI A;  4PJL A;  2RHX A;  2RJF A;  3ZL7 C;  4J6Y A;  3JCM b;  2L0A A;  1R8O B;  2QAZ A;  3SFM A;  3OYK A;  3J80 E;  4C5I A;  1VIE A;  4BE0 A;  2FVU A;  1VYV A;  3RBB B;  1H64 1;  4JZ4 A;  1QKW A;  3QYH B;  2EWN A;  3OYE A;  2QAS A;  2OTJ T;  3MEU A;  1LPL A;  3CME A;  3LH5 A;  1KHC A;  1WXT A;  1Q86 C;  3NMZ C;  2P4R A;  4PJJ A;  2CP6 A;  3M56 A;  4ZTJ A;  4GLM A;  3JCM V;  1CSK A;  3G71 T;  2M9U A;  1NBE B;  2XMF A;  1K73 U;  3CMA A;  4PJO F;  1VQ9 T;  3H0F A;  1U5S A;  4M4Z A;  1PC0 A;  4E2F B;  2DXC A;  4Y92 A;  1AWW A;  3L2V A;  2D8H A;  3FRN A;  3RIR A;  1TUG B;  3PGG A;  1MMA A;  3OS0 A;  4LDV A;  1UE9 A;  2ZPI B;  4J83 A;  2CSI A;  3EG3 A;  2F2V A;  3CXC A;  1P92 A;  1X6B A;  4J9F A;  2GGR A;  1OEB A;  1NZ9 A;  3V8L A;  1WXB A;  2DTI A;  5KYN A;  2L3Q A;  3SD4 A;  2X35 A;  2QQB A;  3M0Q A;  1M2V A;  3H9N A;  4OML A;  2JTF A;  2PVG B;  1OV3 A;  4JS4 A;  1NJI R;  3G4S T;  4FW1 A;  2C0I A;  2KEA A;  1X69 A;  8ATC B;  1QVF P;  4AG1 C;  3TSW A;  1AT1 B;  1KD1 U;  4LE9 A;  4OP0 A;  3M57 A;  2PQW A;  4BE2 A;  3LW5 E;  4TVR A;  3LYI A;  1K9M R;  1ZSZ A;  4AG2 C;  4A4E A;  3BW1 A;  1W6X A;  2B8A A;  1U1S A;  2YSQ A;  5A0D A;  1QCF A;  2K5I A;  2WSE E;  2EJF A;  3A1P A;  1JXM A;  1SPK A;  2LX9 A;  4HA8 A;  2C0O A;  3JCM f;  2RI2 A;  3O8V A;  3T9N A;  5AYF A;  4AMC A;  4C0F A;  5DY9 A;  3EG1 A;  4N0A C;  4RG2 A;  4J9I A;  1VQ5 A;  1BB9 A;  3CCL A;  2KXC A;  3V7S A;  2RK1 A;  2XIC A;  4RG8 A;  1UHC A;  2HD0 A;  4C92 D;  3QJY A;  5FRO A;  4BDZ A;  1QVG P;  4M77 A;  2CZ6 B;  3QBY A;  5LJ5 f;  3CBP A;  2L3P A;  3JCM c;  2DLP A;  2DAQ A;  4DOW A;  4JLG A;  5CR2 A;  1R0B G;  4HCZ A;  3CCV Q;  2BZX A;  5KYY B;  2KGT A;  4M75 D;  5I2M A;  3PIO A;  1K9M C;  1WJQ A;  1AZE A;  5FRM A;  4M78 D;  3QJ6 A;  2QA4 A;  3VYG A;  4IUV A;  1I0C A;  3CXC S;  1VYT A;  3CC2 Q;  1UGS B;  1X2K A;  2DTH A;  4KUL A;  1WGS A;  2D8J A;  3VJP A;  3QHS A;  1Q7Y U;  1I81 A;  4KUD K;  4FU6 A;  3EGD B;  2V8I A;  1JU5 C;  5LJ3 j;  3HFN A;  2VGN A;  3NFC A;  1X75 C;  4DOV A;  2DL3 A;  2QQ9 A;  3OYB A;  1ZSZ B;  2XDB A;  4PK4 A;  2DM1 A;  2KE9 A;  1YCS B;  1KQS S;  3JCM d;  1N5Z A;  1Q81 U;  1N8R U;  3CPF A;  4L5G A;  3URG A;  1HSQ A;  4C0Z A;  1S72 Q;  4J6W A;  4J5Y A;  2DBM A;  5GMK i;  3CCV T;  4E7J A;  2MCN A;  1FWZ A;  2LCL A;  2KRM A;  3MJX A;  2EFI A;  3TVT A;  4M7D C;  4PL6 A;  4HCB A;  3CC4 T;  3CQT A;  3JB9 G;  1X01 A;  4PLL A;  4EMH A;  5GAM e;  1HD3 A;  1H8K A;  2EQI A;  4O6J A;  1HYO A;  1YJW T;  2HQE A;  4XTV A;  4M7A E;  5LJ5 d;  5GAN e;  1K73 R;  1QP2 A;  1PSF A;  1WDX A;  2KVQ G;  2ROL A;  5IXF A;  2E1H A;  1MHN A;  1SHF A;  2EQU A;  2X4W A;  2HCK A;  2J6F A;  4BUG A;  2ZPE B;  2CUD A;  3OYY A;  5FU6 B;  2O01 E;  5GMK j;  1JEG A;  5I22 A;  2X4Y A;  1VQN A;  1UEC A;  1WNL A;  1WPY A;  4CC7 A;  3JCM h;  2FG0 A;  2CZ7 B;  4XQ3 A;  2EKH A;  4F7U E;  4C0D B;  1JBM A;  5GAN 8;  3CCU Q;  1BKB A;  5GJV B;  4HCC A;  1M27 C;  3CME T;  3P8D A;  2DRK A;  1XQH A;  3BDU A;  3VS6 A;  2DKG A;  2GFA A;  1V1C A;  2OAW A;  1D0Y A;  3UPU A;  3VKI A;  1RLQ C;  3WVD B;  1KD1 R;  3CD6 Q;  2FRW A;  3HFO A;  2MK5 A;  1QCO A;  3CCE A;  3TEE A;  4JRI A;  2F2X A;  3CMA T;  1M3A A;  1IHV A;  5LJ5 h;  3JCM X;  1TH7 A;  1K73 C;  4EMK B;  3JV3 A;  2FL7 A;  2DNU A;  1D09 B;  1X27 A;  3TSZ A;  2DXT A;  1IXD A;  1U3O A;  2D6F A;  2G3R A;  1GRI A;  3QDF A;  2RQW A;  3FIF A;  3MP1 A;  1BCM A;  1YI2 Q;  1VQM Q;  3UA6 A;  2VB6 A;  2PVO B;  3VUB A;  4OB2 B;  3VRY A;  1X2Q A;  5GAN 7;  4J9C A;  3JRZ A;  4XU0 A;  5GAO n;  3G1J A;  3L1A A;  1JJ2 P;  2VVK A;  4RTT A;  3ZEH A;  1U1T A;  3CCR Q;  2HQH A;  2DYI A;  3QG1 A;  5DM7 R;  1M90 U;  2NUP A;  3UF4 A;  3UAT A;  3DB4 A;  1VQL A;  3M59 A;  1KD1 C;  4M7D F;  3SDZ A;  2RQU A;  2V1R A;  2P0Q A;  1VQP Q;  1D1C A;  2A08 A;  4KGZ B;  4PJO E;  2XID A;  4PKC C;  5AT1 B;  2P84 A;  2ED1 A;  3TRE A;  3SWN A;  1HXD A;  1T3L A;  1UJ0 A;  1M3B A;  2LC4 A;  4QQG A;  1OUL A;  3QYG B;  3CBM A;  4ANJ A;  1M3C A;  2AIR B; 
#chains in the Genus database with same CATH homology
 4EPC A;  1ZBX A;  3FLG A;  4M7A D;  2HBP A;  2CZ1 B;  2IVW A;  5LJ5 e;  1JJ2 S;  4M7D D;  5CIU A;  1N9S A;  3UDC A;  1VQO A;  1VQ5 T;  2EJG A;  3CCL T;  4F7U F;  2HNI A;  5GAO q;  3A8G B;  3OYI A;  3CCM T;  3JCM J;  1VQ4 T;  1OZ3 A;  2DXU A;  1VQK T;  3VYH B;  3JB9 J;  5D6W A;  2DZC A;  1G5V A;  3QDR B;  4M77 F;  3CCV A;  1UGP B;  3DB3 A;  3RER A;  3A5Z B;  1XTD A;  4UC4 A;  1W4S A;  4C92 B;  3JSC A;  4OB3 B;  3S3O A;  1S72 T;  2IG0 A;  4MZM A;  3HRS A;  1QVP A;  3CC4 A;  4XTZ A;  4WF2 A;  3ER0 A;  2EQJ A;  4J7I A;  5IAY A;  2K2V A;  3FJP A;  5IT9 E;  2DXB A;  2GF7 A;  1BI2 A;  4FT4 A;  5KCH A;  3HKS A;  2XKO C;  1RL2 A;  4NL2 A;  3GLX A;  5D6X A;  3I55 A;  2WAC A;  3G6E A;  1W2B A;  1YJW A;  2RJC A;  3VU3 C;  2ZPB B;  5HY6 A;  4QVD A;  5C0M A;  1KC8 U;  3M54 A;  4C8Q A;  2FB7 A;  4M75 B;  2D0Q B;  3A8O B;  2FYK A;  2HAX A;  2K5F A;  3JAM E;  1N6A A;  3JCM g;  2X4J A;  4M78 B;  4MML A;  2ZPH B;  1NPR A;  3MCA B;  2L89 A;  4M77 D;  1PSE A;  3VUZ A;  2R57 A;  2QQA A;  5A0L A;  2QA4 T;  5CQX A;  4C0D C;  4NL3 A;  5CKE A;  3CCS A;  1OI1 A;  4ZGD B;  1YJ9 T;  1Y07 A;  5GAM f;  3J81 E;  1UGR B;  3MHX A;  3PNW C;  2MF2 A;  2YRV A;  4OB1 B;  3LWI A;  4IUU A;  5CQY A;  1BIB A;  2RHX A;  2RJF A;  4J6Y A;  3UT1 A;  4D6W A;  4M78 C;  3JCM b;  4C92 A;  1R8O B;  4LD6 A;  1RI0 A;  3SFM A;  2QXF A;  2PU9 B;  4X34 A;  4MDW A;  5GAN f;  3J80 E;  3OYK A;  3CCQ T;  1G3T A;  4C5I A;  1VIE A;  4JRP A;  4FM4 B;  4BE0 A;  3OMG A;  2FVU A;  1I8F A;  1YIJ A;  2MAM A;  3X28 B;  3OS2 A;  2LDM A;  3OMC A;  1H64 1;  2JUF A;  3M53 A;  3MEA A;  2XD0 A;  4L6V 5;  3QYH B;  2EWN A;  2LNV A;  4J6X A;  4XU2 A;  3OYE A;  3QXE B;  4N0A A;  3X24 B;  2QI2 A;  5J3B A;  4M7A G;  4IUR A;  3MEU A;  2VV5 A;  4OGE A;  1NJI U;  2OTJ T;  4ME7 A;  3EAE A;  3SB2 A;  3CME A;  1KHC A;  3C95 A;  4II1 A;  1Q86 C;  4EMK C;  2VUB A;  3P8B B;  4M75 A;  3CCU T;  3CBO A;  3OSV A;  3GP8 A;  3M5A A;  1HK9 A;  3P8H A;  2BUD A;  4RCB A;  3PMI A;  3X25 B;  3M56 A;  4ZTJ A;  1UB4 A;  2HQX A;  4J8O A;  2F5K A;  3JCM V;  3CC7 A;  3OY9 A;  3GF5 A;  4NS5 A;  1Q81 C;  4L59 A;  1N8R C;  3HRT A;  3G71 T;  4C0G A;  3Q1J A;  2M9U A;  5CKB A;  1K73 U;  3TU4 K;  1GXI E;  3PMT A;  3OS1 A;  3CMA A;  2RHZ A;  2VYT A;  2KK4 A;  3SWN C;  4PJO F;  1YBY A;  1VQ7 T;  2XI9 A;  3CD6 T;  1VQ9 T;  3G7Z A;  3BFM A;  4EDU A;  4E7I A;  2P0K A;  5DLO A;  2DXC A;  2CZ0 B;  4A4F A;  4F7U G;  3L2V A;  3X20 B;  3MP8 A;  3V8J A;  5GMK m;  3I56 A;  3OQ5 A;  3M55 A;  3E9G A;  3FRN A;  4MDX A;  3S6W A;  3RIR A;  4XU3 A;  3PGG A;  4M77 G;  3F70 A;  4JUV A;  3OS0 A;  4LDV A;  5LJ3 f;  1LOJ A;  1YIT T;  5D6Y A;  4E7K A;  5EG2 A;  2ZPI B;  4J83 A;  3L2U A;  2PUO B;  3CXC A;  2PUK B;  4KUI A;  1P92 A;  5GAN 3;  4GY5 A;  2VC8 A;  3HP9 A;  4M7A B;  4QVC A;  1O9S A;  1EIF A;  1NZ9 A;  3V8L A;  2DTI A;  2M16 A;  2JZ2 A;  2XHC A;  3FB9 A;  2E41 A;  1WQW A;  2QEX A;  3M4Y A;  4FL6 A;  3SD4 A;  2XDD A;  2X35 A;  2QQB A;  4XTW A;  4OB0 B;  4BB7 A;  3E1S A;  2KAF A;  3RKX A;  2GQV A;  2LTO A;  3KUF A;  2VXE A;  5KE3 A;  3OYJ A;  2E10 A;  3JCM Q;  2JTF A;  2D9T A;  2PVG B;  4R56 A;  4JS4 A;  5GAM d;  5GAO p;  2EQM A;  2H3J A;  4O5V A;  5A2Q E;  3G4S T;  2P4T A;  2K3X A;  3QKJ A;  3WVE B;  3OYG A;  3OYH A;  1W2B S;  4C5E A;  1VQN T;  3OA6 A;  4J7F A;  4OF1 A;  4JJN K;  2R5A A;  3L2W A;  1KD1 U;  3PIP A;  5LL6 S;  1WJS A;  3HSB A;  3JB9 H;  2RO0 A;  4B9X A;  5GAN d;  4C8Q C;  2E6Z A;  4NOY A;  3NTI A;  2RHI A;  2V8J A;  4FSX A;  3AHU A;  2DZ9 A;  4OP0 A;  3M57 A;  4ZGJ B;  2PQW A;  4F7U B;  2CGH A;  3LW5 E;  5FU7 B;  4TVR A;  3LYI A;  3A8M B;  4BE2 A;  1VQ6 A;  4OVA A;  4XTX A;  3CCR T;  2Y4X A;  4IKF A;  4IUT A;  2ZCF B;  4A4E A;  2MI6 A;  4M77 B;  4MMK A;  2KDS A;  3BW1 A;  3QSU A;  3MO8 A;  3CC2 A;  2L3R A;  3OYD A;  2B8A A;  1U1S A;  5A0D A;  4M7A A;  2E65 A;  3CCJ A;  4M7D A;  1M1K C;  2K5I A;  2WSE E;  1KHI A;  4C8Q E;  2RD1 A;  2EJF A;  1VQP T;  3CCE T;  4X9D A;  2K5L A;  5FU7 C;  3RES A;  4C92 C;  1O75 A;  2LX9 A;  1JJ2 A;  1BI1 A;  4CI0 C;  1YHQ A;  2KQW A;  1ZQ1 A;  4HA8 A;  3A8L B;  2EQK A;  5GAM j;  2V8K A;  2DD4 A;  2M1H A;  3HRU A;  3ME9 A;  4Y28 E;  3JCM f;  5HK0 A;  3MP6 A;  1AHJ B;  4C8Q D;  3OW2 S;  2RI2 A;  3O8V A;  3T9N A;  3GPL A;  4BY6 B;  4JRQ A;  1YJN A;  5AYF A;  2RHU A;  3NTK A;  1X6O A;  3JB9 F;  2NLU A;  4C0F A;  5DY9 A;  2LQ8 A;  1QVF S;  2OAU A;  4N0A C;  4RG2 A;  1BI3 A;  5GAN j;  1JRI A;  3GNF B;  3QZ5 B;  4BI3 A;  1VQ5 A;  4R55 A;  3CCM A;  3CCL A;  4C92 E;  1VQ4 A;  1VQK A;  3V7S A;  2RK1 A;  4C5H A;  2E5Q A;  1Y96 A;  4IUP A;  3OS5 A;  4M75 C;  3OYL A;  2XIC A;  4E7L A;  1BIA A;  4RCC A;  1K8A C;  1VQ8 T;  4MZP A;  4RG8 A;  4JS5 A;  2RI3 A;  4PJO G;  4F7U A;  2HD0 A;  4ZN1 A;  3HPW A;  4C92 D;  2C06 A;  5GAM h;  2R58 A;  3QJY A;  1JB0 E;  3C94 A;  5FRO A;  4BDZ A;  1S72 A;  5LJ3 d;  4M77 A;  1Y71 A;  1ZHI A;  2CZ6 B;  3JB9 I;  2JVV A;  3VV0 A;  3QII A;  3QBY A;  2QDY B;  4PLI A;  4QQ6 A;  3H8Z A;  4A4G A;  5LJ5 f;  3CBP A;  3OW2 A;  5GAN h;  3QZ9 B;  4BAC A;  4MZT A;  3JB9 D;  1YI2 T;  4M75 E;  4LDX A;  1WQ7 A;  3LH0 A;  3JCM c;  3V7R A;  1G3W A;  2OTL T;  2DAQ A;  3KBG A;  3MET A;  4Y91 A;  4M7D G;  3LGF A;  4JLG A;  4M78 E;  4VUB A;  1D3B B;  4DOW A;  5CR2 A;  1QVF A;  3PFS A;  5KE2 A;  4HCZ A;  2LVM A;  2E64 A;  1XOV A;  3RKY A;  2LQK A;  4M75 D;  5I2M A;  3PIO A;  1K9M C;  1M1G A;  1WJQ A;  5GAO r;  2XU8 A;  4RMO A;  5FRM A;  4M78 D;  2E70 A;  3QJ6 A;  4XU1 A;  2QA4 A;  3VYG A;  4JLI A;  4IUV A;  3CPW A;  3CXC S;  3V8K A;  2CYZ B;  1VQL T;  2O4X A;  1UGS B;  5I2S A;  1YJ9 A;  1KG1 A;  2DTH A;  4B9W A;  3E19 A;  4KUL A;  4QVZ A;  3OYF A;  1WGS A;  3FEO A;  3VJP A;  3QHS A;  1Q7Y U;  1I81 A;  4Q5W A;  3QPH A;  1M90 C;  5GAO l;  4KUD K;  5J26 A;  4FU6 A;  3JCM W;  2V8I A;  3QUI A;  5LJ3 j;  2VGM A;  3HFN A;  4HT9 A;  4ZTF A;  2VGN A;  3NFC A;  3DLM A;  3CCQ A;  2RK2 A;  4DA4 A;  4LD9 K;  1M9S A;  4PJO B;  1QVG S;  2K57 A;  2E6N A;  4OMF B;  4BD3 A;  1VUB A;  4KBM B;  1X75 C;  2ZZD A;  2DK3 A;  1IZ6 A;  2X4X A;  4DOV A;  4GLK A;  1Q86 U;  2JN0 A;  2F5T X;  2QQ9 A;  3HL8 A;  3ZFJ A;  3OYB A;  2XDP A;  1Q82 C;  2XDB A;  4A4K A;  2OTJ A;  3QO3 A;  3BDL A;  1D3B A;  1LNX A;  1UEB A;  4Z02 A;  4A4H A;  4M7D B;  1KQS S;  1Y7X A;  2GCX A;  3JCM d;  3J7A F;  5LJ3 h;  1VQO T;  4ELZ C;  3CCU A;  1Q81 U;  1N8R U;  3CPF A;  2AHJ B;  4L5G A;  3M9Q A;  3URG A;  4FIB A;  4C0Z A;  2L8D A;  4J6W A;  4J5Y A;  3M4G A;  5GMK i;  2KMT A;  3CCV T;  3RKW A;  4E7J A;  4DQ2 A;  3OYM A;  3S3N A;  4E47 A;  1FWZ A;  4PNO A;  5J39 A;  2LCL A;  3G71 A;  2LT1 A;  1I5L A;  3FDR A;  4M7A C;  3X26 B;  2EFI A;  3C4S A;  1QVG A;  1I4K 1;  4M7D C;  4PL6 A;  4HCB A;  4HKE A;  3CC4 T;  2JOY A;  1VQ7 A;  3CD6 A;  2ZPG B;  1VQ9 A;  3JB9 G;  1X01 A;  1G3S A;  3FC3 A;  3L2Z A;  4PLL A;  4EMH A;  4LDW A;  4PJO E;  5GAM e;  4FT2 A;  3I55 T;  4C8Q F;  3G6E T;  4PJO A;  4XK8 E;  1Y96 B;  1M8V A;  4O6J A;  1OYX A;  1YJW T;  3S3M A;  1DJ7 B;  3ZBD A;  4BE1 A;  2HQE A;  4N4H A;  1KQS A;  4XTV A;  4M7A E;  5LJ5 d;  5GAN e;  3RUX A;  1QP2 A;  1YIT A;  1PSF A;  2KVQ G;  4P5N A;  2EYQ A;  2YHT A;  1QW1 A;  3OB9 A;  2DPP B;  3KXT A;  4XTU A;  3V7C A;  1KC8 C;  3CCS T;  2E1H A;  1KQ1 A;  1MHN A;  2ZPF B;  4BDY A;  2EQU A;  2X4W A;  4BUG A;  3NTH A;  4C92 F;  2EJ9 A;  4BI8 B;  2BKD N;  3LLR A;  2ZPE B;  3HHT B;  2KY9 A;  3OYY A;  4M77 C;  1B34 A;  1OZ2 A;  2FHD A;  2O01 E;  5FU6 B;  5L8R E;  5GMK j;  5I21 A;  1BI0 A;  1YI2 A;  1VQM A;  5CVI A;  2QQR A;  3G4S A;  2X4Y A;  3CEY A;  1VQN A;  3PT9 A;  1N9R A;  1WJR A;  2RM4 A;  1WNL A;  1WPY A;  1YIJ T;  4V2S A;  2L5Q A;  3JCM h;  3OYC A;  2O4X B;  2YLC A;  3RMQ A;  2CZ7 B;  4XQ3 A;  3MEW A;  4F7U E;  2RH2 A;  4ZN3 A;  4C0D B;  2K4Y A;  2CS7 A;  4N4G A;  1JBM A;  4M75 F;  1N27 A;  2A7Y A;  5GAN 8;  1BKB A;  5FLX E;  4HCC A;  2Y4Y A;  5FU6 C;  3DKM A;  3CME T;  4M77 E;  2I2L A;  4M78 F;  3P8D A;  4BY6 C;  5LJ5 j;  3CPW S;  1XQH A;  2RJD A;  1YCY A;  2BIV A;  2RA2 A;  1FX7 A;  1FXX A;  3BDU A;  4JRK A;  5DLQ E;  2YLB A;  5A0G A;  3CCR A;  1M1K U;  2DKG A;  2GFA A;  3OBY A;  2A3L A;  5GMK h;  1G3Y A;  1NJI C;  1IRE B;  4XTY A;  3UPU A;  3C12 A;  3VKI A;  3WXM B;  1BYM A;  3WVD B;  3L2R A;  3CC7 T;  3ASK A;  3HFO A;  3L42 A;  2QTX A;  2WSF E;  5LJ3 e;  3DLL A;  2ZGW A;  1VQP A;  2DIQ A;  2EAY A;  3R6O A;  3TEE A;  3GNG A;  3CCE A;  2MMP A;  5GAM g;  4JRI A;  3CMA T;  3PTA A;  5IN1 A;  2EIF A;  5GAN 2;  1MGQ A;  4EMG A;  3LGL A;  2RHY A;  3JCM X;  5LJ5 h;  2DEQ A;  2RJE A;  2PVD B;  1U8R A;  1TH7 A;  4LDY A;  5CKF A;  1K73 C;  2XK0 A;  4EMK B;  1Q7Y C;  5GAN g;  5FRN A;  3OSS C;  2LCC A;  2FL7 A;  3INZ A;  1M1F A;  3I56 T;  2DTO A;  1K8A U;  4LDU A;  4JDS A;  4X9C A;  2F69 A;  4ATO A;  2JTM A;  2DXT A;  2LRQ A;  4N4I A;  5LJ5 g;  3L2Q A;  2D6F A;  1H3Z A;  2GFU A;  5HK3 A;  1VQ8 A;  3UWN A;  2G3R A;  4HT8 A;  4QQD A;  5GAN 4;  3FIF A;  3MP1 A;  4ZGE B;  3N5B B;  3SWN B;  4YTL A;  5CCA A;  2JNG A;  3M58 A;  2K3Y A;  2QEX T;  3E9F A;  3OYN A;  3LX7 A;  4M78 A;  4XAX B;  3H6Z A;  4C8Q G;  1VIF A;  1QP3 A;  2DIG A;  2DD5 A;  5CKH A;  5GAO m;  2PVO B;  2XG8 D;  3VUB A;  1LJO A;  3GIB A;  3OBW A;  4OB2 B;  4QW2 A;  4IUQ A;  2EKO A;  5GAN 7;  1K9M U;  2VXF A;  4E7H A;  3JRZ A;  2OTL A;  4C5G A;  2CKK A;  4XU0 A;  5GMK l;  5GAO n;  5CO7 A;  2Y90 A;  4PJO C;  1M5Q 1;  3L1A A;  2WSC E;  1V29 B;  3ZEH A;  1U1T A;  5C6S A;  1UGQ B;  2RB6 A;  4EMK A;  4C92 G;  3QG1 A;  5DM7 R;  4A54 A;  5GAN 6;  1M90 U;  4CRI A;  5KCO A;  3DB4 A;  1VQL A;  3JCM e;  1B34 B;  3M59 A;  3BY7 A;  1VQ6 T;  1KD1 C;  1M4Z A;  2R5M A;  4M7A F;  4ELY C;  2QQS A;  3GOX A;  1KQ2 A;  2DO3 A;  3SDZ A;  5KH6 A;  5M9O A;  4M7D F;  2P0Q A;  5LJ3 g;  1YJN T;  3A8H B;  2MWP A;  3CC2 T;  2E12 A;  3RMS A;  3LWH A;  4OGC A;  1XNI A;  2XID A;  2DJZ A;  4PKC C;  2DVE A;  3EFS A;  2RI5 A;  2MWO A;  3EFR A;  2P0P A;  3MEV A;  3TRE A;  3SWN A;  4A53 A;  4BI4 A;  5CKD A;  3CCJ T;  5CK9 A;  1NE8 A;  5GMK e;  5CAI A;  4PJO D;  1HXD A;  4RKU E;  3OYA A;  1Q82 U;  5HKC A;  2LC4 A;  4M75 G;  4QQG A;  3QYG B;  1YHQ T;  3TCJ A;  1NPP A;  3JCM P;  4M78 G;  4C8Q B;  3CBM A;  1SSF A;  2LT4 A;  2M0O A;  4KT0 E;  1VQM T;  4M7D E;  2KSS A;  5GAN 5; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...