4XK8E

Crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
63
structure length
63
Chain Sequence
GPKRGAKVKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIQEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structural basis for energy transfer pathways in the plant PSI-LHCI supercomplex
pubmed doi rcsb
total genus 9
structure length 63
sequence length 63
chains with identical sequence e
ec nomenclature
pdb deposition date 2015-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xk8E00
2DPPB 2ZPGB 2WSCE 3A8OB 4FM4B 5L8RE 3QYGB 4ZGDB 1UGRB 3A8LB 3X28B 1DJ7B 2PVDB 4OB0B 1PSFA 3VYGA 2ZZDA 2CYZB 2QDYB 2DD4A 1UGSB 2PVGB 2ZPHB 2DXBA 1IREB 4XK8E 2O01E 2PU9B 4OB3B 2CZ0B 4OB2B 2DXCA 3QYHB 3VYHB 3X24B 1AHJB 2ZPFB 4Y28E 3WVEB 3WVDB 2ZCFB 2ZPIB 4ZGEB 1GXIE 3QZ5B 1QP3A 1PSEA 2ZPBB 2CZ6B 2D0QB 2PVOB 3A8HB 3HHTB 2WSFE 3A8MB 2ZPEB 3A8GB 3QZ9B 1UGQB 4KT0E 4L6V5 3X26B 1JB0E 2DD5A 1UGPB 3LW5E 2WSEE 1QP2A 2CZ1B 4RKUE 2AHJB 4ZGJB 4OB1B 2CZ7B 1V29B 2PUOB 3X25B 3X20B 2PUKB 3QXEB
chains in the Genus database with same CATH superfamily
1SHGA 3MHXA 4OMPA 1WI7A 2EAYA 2KR3A 1VA7A 3H9NA 1LNXA 4J6WA 3C94A 2CUBA 3CBPA 2P0KA 1GL5A 4M7AD 3QYGB 2Y90A 1MMNA 2DXTA 3UA6A 1H92A 1PKTA 1UGVA 5GANh 3N5BB 4JPBW 3JCMe 2L0AA 1IREB 3A98A 3M53A 4J9GA 1UJYA 2V1RA 2E3HA 2V26A 4GBQA 1X69A 2E65A 4ATOA 2AT1B 2DK3A 3JCMX 1M2VA 3CC7A 1VQOQ 1UE9A 4M75E 3EHQA 5GMKh 4HVVA 2VXFA 3EFRA 3MP6A 4FT2A 1LVKA 1VQLA 1W2BP 4EDUA 2E5KA 2DYBA 4MZTA 1G2BA 4FYWB 5HY6A 3CC4Q 2YRDA 1OEBA 2SRCA 4M7AC 1PKSA 4BY6B 3OYNA 5C0MA 5LJ5d 2RM4A 2VC8A 1KHCA 1Q7YU 3TEEA 5GJVB 3EH2A 4JJBA 2K5IA 4RTYA 3JCMg 1HK9A 4Z89A 1T0HA 3CCJQ 3VS6A 5KYUB 3QHSA 3P8BB 5CO7A 3TU4K 3PE0A 1RI0A 4PJNA 4CC7A 2DVJA 2R57A 1EX4A 2HEQA 2J06A 4Y92A 3V8KA 1RADB 4E2FB 4C8QA 2O9SA 4KUIA 1XNIA 1K73C 2DL8A 3CMEQ 3OYEA 3MP8A 1VYVA 3FLGA 1N8RR 3A8OB 2PTKA 1QVFA 1BI3A 4PJOB 2RO0A 5IHKA 4M7DA 4LD6A 2FO0A 1VOMA 4DEYA 2DBKA 2JT4A 1FXXA 2EYZA 2OX7A 3H0FA 3L2WA 2EYQA 2O4XB 1B3QA 4FYVB 3EG1A 2JS0A 5HKCA 2DIQA 4B6MA 3G4SQ 2M0YA 4M4ZA 1W6XA 1Z9ZA 1IRXA 1H3ZA 3CC2T 2DAQA 3H0IA 2K4YA 1ZUKA 2FHDA 3V8JA 4RTZA 2ZPFB 4JZ4A 3QG1A 2D9TA 3QKJA 2LQ8A 2QK0A 3NGPA 1NM7A 2KYMA 4JZ3A 3G6EA 2AKLA 1WIEA 3MEAA 1W70A 4IUUA 1MUZA 2VVKA 3DLMA 5IAYA 4A4HA 1FMVA 3M9QA 2J6FA 1X6GA 3GLXA 1YJ9T 2MIOA 2O88A 2RF0A 4FIBA 3BFMA 1WNLA 2RQWA 1UECA 2DL7A 2JNGA 2X35A 4BB7A 3FJPA 2J7IA 1Y96A 2MCNA 2E6ZA 2QTXA 3ME9A 1Q82C 2YLBA 2LCSA 1U8RA 3M5AA 2RJCA 1ZX6A 4PLIA 4XTWA 1M3BA 2EQJA 1JJ2S 1VQKT 2CP7A 3CD6A 1I8FA 2KRMA 3JB9D 2DO3A 3UF4A 1YJNT 4V2SA 5LJ3f 2ZPGB 2LX9A 4A4FA 4JJCA 4JUVA 1E6HA 2QQSA 5CKHA 2QEXT 2HD0A 4DBFA 3I56A 1I1JA 1YWPA 2W0ZA 4DOWA 4PJJA 4TVRA 3UDCA 1K76A 2KI7A 3PT9A 4M7AA 2BIVA 4QVCA 3VRZA 1F1BB 1D0XA 5J3BA 2ROLA 4R0KA 2LDMA 1XJWB 2D8JA 2A37A 2H3EB 3TSWA 1WHHA 2XHCA 3MCAB 1QVPA 1Q86C 2CZ0B 3G7ZA 1RLPC 1SRMA 4M75B 2KGTA 2MI6A 3L42A 4RTTA 3JCMh 1ZA2B 5AT1B 1WHLA 3HRUA 3CCSQ 3I5RA 1VIFA 1KQ2A 2ZCFB 1ZBXA 4C92A 1WDXA 3EFOB 3OSVA 1M1FA 2KT8A 1BCOA 2E1HA 2M9UA 2OAUA 1K73R 3UT1A 4M7AE 1PSEA 3L1AA 2RHIA 2A3LA 3EGXA 1I5OB 3A8HB 2PVOB 3EGDA 4L5GA 1K9AA 1NLOC 4CI0C 2XDDA 1SSFA 3I5SA 3X26B 2E6NA 5FU7C 5KYXA 2FEIA 1D1AA 2K3XA 4A4KA 4D8KA 4B9XA 4PL6A 2E4HA 2GQVA 4Q5WA 3L2RA 1M2VB 1YBYA 4RKUE 5DLQE 3RERA 1AWXA 4OB1B 2F5KA 4BI8B 4EMKC 5IHNA 4J7IA 2MWPA 3J7AF 1V1CA 2GBQA 1X27A 4HT8A 4GY5A 1S1NA 3OYJA 4OMOA 2O31A 1FYNA 4IIMA 2R5MA 3J81E 1X01A 2PQWA 2AZSA 1O9SA 3FRNA 2DE0X 3HSBA 2E5QA 3CPWP 2WSCE 2EQIA 2PNIA 1OYXA 4A4EA 1RAEB 1Y0MA 2COZA 5L8RE 5GMKi 1M1GA 2JXBA 1TG0A 2EWNA 1G5VA 4MZPA 1JJ2A 3X28B 3G6ET 3HFNA 4IUQA 2YUNA 2L89A 4OGCA 5EC7A 4PFOA 1KIKA 1UHFA 2EJ9A 4OMLA 2DD4A 3AHUA 4FW1A 4DEXA 4QVDA 5CQXA 4C5GA 3M56A 3T9NA 1H641 1TUCA 1C0MA 4DOVA 1YITQ 4HCBA 1TH7A 2P4TA 3QIIA 4C8QB 4J7FA 4KGZB 3M58A 4OB3B 1VQ5Q 2QG9B 4JRKA 1RAGB 1MV3A 2EFIA 1Q82R 4RTXA 2C06A 1U1SA 3QSUA 4Y28E 3LYIA 2A28A 1KQSS 3JB9G 3SD4A 2K3BA 3CD6T 1X6BA 3V7SA 4N0AA 4ZGEB 5KYUA 2XU8A 3RKYA 2IIMA 2E64A 4JS5A 1R0CB 2RK1A 1IHWA 4X9CA 3CPFA 3M0SA 4JJDA 2EW3A 3H41A 1V76A 1ZSZA 2DNUA 2CGHA 2X4YA 3E19A 3GIBA 2DD5A 1VUBA 1SG5A 2WSEE 3VS5A 2CZ1B 1WHJA 4BI3A 4F17A 4JRPA 1N8RU 3NFCA 1YIJQ 1QKWA 1VQ7T 2CT3A 1Y07A 2HDAA 4D6WA 1VQ6Q 1VQ8Q 1V29B 4AMCA 2CP5A 3CPWS 2EQUA 2F2VA 3L2ZA 3SB2A 4X1VA 1Q86R 1JEGA 1NEBA 3H0HA 2K3YA 3QWYA 3O8VA 5GAMg 2CUDA 5CIUA 2BZYA 4J5YA 2F69A 3IQLA 4NL2A 4M77G 2B8AA 3CMAQ 1RAIB 2KROA 2PVDB 2VASA 3LWHA 3VS4A 5LJ5e 1OX8A 2L3RA 3GNGA 4C0DC 2CYZB 2DEUA 4IURA 1Y96B 2EKHA 2OTJQ 1VQ4T 4R55A 1WGSA 3G1JA 5CK9A 2OTLT 2OJ2A 4HCCA 4KGXB 7AT1B 5CQYA 2EIFA 3CCRQ 1NYGA 3QPHA 3EG9B 4C5HA 2JTFA 2LJ3A 1R77A 3CEYA 4FU6A 1RACB 4MDXA 4RG8A 5LJ3d 4DQ2A 1VQMA 1BIBA 4MZMA 2M51A 6AT1B 5ECAA 1KD1C 4LDYA 4O5VA 1RAFB 4IUVA 3REAB 3CCQA 1BBZA 1PRLC 1PG5B 1YCYA 4X9DA 2G3RA 3MO8A 4C0FA 1UB4A 1GCPA 4M7AB 1K9MU 1AWWA 1WHKA 1MNDA 3OQ5A 1PWTA 2RQUA 5LJ5g 1KQSA 3R6NA 2VV5A 1Y7XA 2GGRA 1UGPB 1Z9QA 3M4GA 3ZEHA 5A0GA 4IIOA 3JB9F 1KK7A 2DBMA 2K6DA 2YRCA 3ZBDA 3SWNA 3JCMf 5KCHA 4QVZA 3ER0A 5KE2A 3X20B 1OOTA 4LDVA 2V8JA 4M78D 2G6FX 1G3TA 2RJDA 2NWMA 4F7UG 2BUDA 3DB4A 3JCMJ 3EGDB 1BI2A 5GANd 3CPWA 2FG0A 4BD3A 2JTMA 4DBQA 5FWCA 5KYXB 1NJIC 3OYIA 4YTLA 3VJPA 2ZZDA 2LQWA 1K0XA 2DETA 2PVGB 1BU1A 4PFZA 1LOJA 5GMKj 4AFUC 3GNFB 4F16A 3EFOA 1AWJA 1WJRA 4BE0A 1AT1B 2GTJA 1K73U 4O6JA 4HCKA 2NUTB 1YJ9A 4M77F 1PD0A 2ED1A 1GRIA 5GAMj 1YI2A 4XU1A 3QBYA 2RJEA 4M78C 1B07A 1NEGA 2X9HA 4HXJA 2RB6A 5FU6C 1CKAA 2PZ1A 1UJ0A 1S72A 4CC4B 4AFQC 4OMQA 3OS5A 1VQKA 3QDFA 3E9FA 2X4XA 2JMAA 3JCMb 2A7YA 2C0IA 2DEQA 1YJNA 4OF1A 1TWBA 1GCQC 2AZVA 2L5QA 2QEXA 2VGMA 5GAMh 4QT7A 2C0TA 1XOVA 2KQWA 2MYSA 2XICA 1TS9A 3OYHA 2BE9B 3CCVA 3P8DA 3G71T 2DIGA 2YRVA 2FL7A 1CSKA 3HRSA 1LCKA 1FX7A 1UUEA 1BB9A 1OU9A 3DKMA 4F7UE 2RI5A 4M7DG 2K5LA 1VQMT 4C0ZA 3JB9I 2RNAA 2HMAA 3OW2A 2FPEA 3CCQT 3QUIA 1ZSZB 1KD1R 2CT4A 2R5AA 4F14A 1JXOA 4Z8AA 3QWXX 3CCMQ 3EAEA 3CC2Q 2DZCA 1Q82U 3M0QA 2MPXC 1WPYA 1N6AA 2OI3A 4F7UF 3VV0A 1VQOT 1TU0B 2H8HA 1M8MA 1ZHIA 1M27C 3DLLA 2CH4W 2L3PA 1Y57A 1QVGP 5CKDA 1ABOA 2I2LA 1I4K1 1KHIA 4J6YA 5LJ5h 3RKWA 1U3OA 3URGA 1IXDA 3VS3A 2HQEA 5DM7R 4M78G 2EGCA 1OZ3A 1HD3A 1UDLA 3LGLA 3VRYA 2DL3A 4IUTA 3VS0A 1W2BS 4FT4A 3CXCP 2QGFB 4QQGA 2COYA 3OBYA 1HXDA 3NMZC 5FLXE 1MHNA 3DB3A 1WX6A 3CCJT 2J05A 3FB9A 3CC7Q 5FRMA 3RMSA 3S3OA 2GTOA 1NJIR 1Q86U 5FU7B 4E7LA 1VQLQ 2YUQA 2ZGWA 4ZGJB 1K4US 1VQNA 2QEXQ 2X51A 4ME7A 4A53A 2RQRA 4X34A 5GAN4 1U5SA 2PUKB 1SF9A 2ENMA 3HPWA 2HSPA 1RABB 3V8LA 1YI2T 2F2WA 1X2KA 1NBEB 2CSIA 4AG2C 3CBOA 3OYLA 2HNIA 2L2PA 1WZOA 4KRTA 4HT9A 4ZGDB 1UGRB 1Y71A 1YJWA 2D8HA 2KYBA 2FPDA 2MAMA 2YHTA 1S72T 4N4GA 1VQ9A 1E6GA 4ELYC 4OB0B 1PSFA 1MMDA 3CCEA 3EG9A 3BW1A 2XD0A 2HKNA 3NTIA 3JCMV 1QVGS 2XK0A 2X3WD 5FRNA 1D0YA 2YXYA 2LRQA 2P4RA 1N9RA 1WHGA 3SWNB 1M1KC 4PJLA 2FRYA 4ELZC 1OPKA 2DXCA 1BCMA 1SPKA 1YP5A 4EMHA 1UEBA 3CCVT 1PNJA 4M78E 1D1CA 3VS1A 3CXCS 1M3AA 1VQ7A 1SKUB 3LX7A 1B34B 1ZA1B 3FEOA 2RHYA 3M54A 2EJGA 3TQ7P 3VU3C 2D0NA 2EQKA 3RMQA 2CKKA 1NLPC 2BTTA 4ESRA 4QW2A 4L59A 2F2XA 4PNOA 5CCAA 1OX9A 1UGQB 1WJQA 3EH1A 2QQAA 4J9BA 2P0PA 2DZ9A 2LNVA 1JB0E 2KT1A 2FYKA 4J9IA 5CKBA 4LDXA 4OMMA 4JLIA 1IGUA 2M16A 1QCOA 1W2BA 1ZUUA 4M78F 1PM3A 2NYSA 4M77D 1K8AC 2GFAA 2DTOA 1WXTA 1TTHB 1JO8A 3G6EQ 2CP0A 2LQNA 3Q1JA 2K2VA 1VQ4A 4RTWA 4LUDA 1RI9A 2EQMA 1G3SA 1H8KA 2OTLA 3LH5A 4RMOA 3MJXA 2DFUA 1M3CA 4F7UB 5LJ3e 2ABLA 2L8DA 3VKIA 5FW9A 2LC4A 1A0NB 3OBWA 1RL2A 3A8LB 4GLMA 4LUEA 1BK2A 3O5ZA 4BDYA 4A63B 2IG0A 2RH2A 2NUTA 1WXBA 5IN1A 2P84A 1UGSB 3I55A 1X6OA 5GAMf 1ZLMA 4M77C 1G3YA 3E1SA 1IO6A 4KUDK 4C0DB 4K11A 3CD6Q 2RHUA 1C6VX 2K2MA 3CQTA 5GAOp 1VQNT 4E7SA 3CCST 1T3LA 4N4HA 4B9WA 4E6RA 3I56Q 2Y4YA 1QVGA 3RDVA 2KE9A 1WQ7A 3CCLA 1M30A 1SEMA 1I0CA 3HL8A 1ZUYA 2XIDA 1D1BA 2LT1A 3BY7A 5I2MA 1YN8A 2VWFA 1VQ7Q 3OYCA 4XQ3A 2ZPEB 4J6XA 3VUZA 4CRIA 1VYUA 5GAN8 5A0DA 5GANe 1YJWT 4ANJA 3PIOA 1FMWA 1VQ9T 4WCIA 5GJWB 1M4ZA 3FJ5A 1IB8A 4NL3A 3CCET 2K9GA 2SEMA 4PJOG 4BE1A 3TCJA 3GBQA 3RBBB 2E70A 1QQJA 2K57A 5LJ5f 3X25B 1KD1U 5GAN6 2CSQA 1YHQT 4RTVA 1QW1A 1M1KR 2EPDA 2Y4XA 4LDUA 2CS7A 1K0SA 3M57A 1BI1A 1VQPA 2L3QA 4Z02A 4LD9K 2BE7D 3L2VA 1HSQA 3PVQA 1R0BG 4MMKA 5GANg 5GAOn 3MEVA 1EZZB 3L2UA 3M0UA 3CBMA 4II1A 2QDYB 5KYNA 3SFMA 2DXBA 3C4SA 3CCUT 2BZXA 1YITT 3MPUB 3THKA 5CAIA 1X2QA 2QA4A 1VQ5T 3OS0A 4OMFB 3M0RA 1IHVA 4P5NA 2EGAA 3L2QA 4JDSA 4ZNXA 1MNEA 1MGQA 4C5IA 5KCOA 2QGGA 2E41A 2YUPA 4LE9A 1K8AR 1KSWA 2K79A 4KULA 5I22A 3NTKA 4FYXB 4M78B 1EFNA 4AFSC 1NJIU 4C8QD 2FZKB 2DERA 3G71A 2XI9A 2CZ6B 5FU6B 1G83A 2LJ0A 2QQBA 2V1QA 3EGUA 3MEWA 1FWZA 2LQKA 3FIFA 1QVFP 1N27A 4M7DD 2KRNA 3NTHA 1QCNA 3LW5E 4EMKA 3WXMB 4Z88A 3JB9J 1KC8C 5M9OA 2F1LA 3I55T 1VQ6T 1VQ8T 3OYYA 1JQQA 3ULRB 3S3NA 5LL6S 5C6SA 2LNHB 2EVRA 3KBGA 5J39A 1IGQA 4HCZA 4M77A 4XTVA 3JCMc 2LT4A 1ARKA 4OMNA 1T0JA 3VS7A 1MV0B 2ATCB 1VQOA 5J26A 4C8QC 1SSHA 4OVAA 1PRMC 4AT1B 3CCLT 2GQIA 4PJOF 2LVMA 1D3BA 3C12A 4DA4A 5DY9A 4J83A 3CC4A 1LPLA 5KE3A 4M75G 4M7DC 1OZ2A 2OTJT 2O9VA 4BI4A 4XAXB 2QDLA 5HK3A 1RLQC 4PK4A 4KH0B 2QQ9A 2JOYA 2FZCB 3GP8A 1BI0A 3TVTA 2VXEA 4M77E 2PU9B 1B34A 2X4JA 3CCJA 3RNJA 8ATCB 1WA7A 1AVZC 2K7AA 4OB2B 2E12A 2O2OA 3V7RA 3VYHB 3PTAA 3MP1A 2NLUA 1RUWA 4ZN3A 2NUPA 1CKBA 1JU5C 5GAOm 3OMGA 3OS1A 3A1PA 2RHXA 1M90C 4IKFA 2IVWA 1QVFS 4E7HA 3CMEA 4RTUA 3LLRA 4EIKA 2EYWA 1ABQA 3A8GB 4BDZA 1IZ6A 1VQPT 3OYBA 3BDUA 3UWNA 5GAMd 4UC4A 1Q81C 2DX1A 2EYXA 2AHJB 4J9HA 4F7UA 1VQMQ 2HQXA 1SRLA 2HQHA 2QA4T 2RI3A 2LZ6B 2MWOA 3CCQQ 3QDRB 2DXUA 2X4WA 3MKDA 2JM9A 3JCMQ 1O75A 1K9MC 3G4SA 3EG0A 4CC2A 2DVEA 1OQKA 2L3SA 2D6FA 2QASA 4JRIA 1MMGA 2ED0A 3S6WA 2JJ9A 1QWEA 1WFWA 2D1XA 5FWBA 2F5TX 4AG1C 4KH1B 4C8QG 1QMCA 3OSSC 2YLCA 5CVIA 4C0GA 5GMKm 4C92D 3M59A 4FW2A 4E7ZA 4J9FA 3C0CA 3P8HA 5KYWA 3D7SB 2GCXA 4JJNK 2RQVA 4R56A 3LWIA 1NG2A 3KUFA 3ZL7C 3RUXA 1M2OA 5LJ5j 5AYFA 4KGVB 1Q95G 2HSEB 2VGNA 2RI2A 3VS2A 4MDWA 1BYMA 1YWOA 1W4SA 2EJFA 2XDBA 1KC8R 2V8IA 1H3HA 4ORZA 2Z0WA 4M75F 3X24B 4PLLA 1KG1A 1PCXA 4XTXA 5L23A 4EPCA 5GAN7 2JW4A 3E9GA 2YUOA 3J80E 2BZ8A 1N5ZA 2MK5A 2LCCA 4LDWA 5CKEA 1WXUA 2DYIA 2LTOA 1AZGB 4PFPA 4C5EA 4C92C 1GBRA 2JZ2A 2D0QB 1GFDA 3HHTB 4NS5A 3RKXA 2RN8A 4KT0E 2RA2A 4WTOB 3CC4T 2JMCA 2J6OA 2KRSA 4HVUA 1YJ9Q 3VUBA 1QP2A 1JJ2P 1M1KU 1YI2Q 5IXBA 4HA8A 3OYFA 3FDRA 2MOXA 2JM8A 1TUDA 4FL6A 2DMOA 5HCKA 3H6ZA 4DBHA 1XQHA 2FRWA 2MF2A 2JTEA 2HBPA 2QAZA 2IPOB 1S72Q 2HCKA 2XG8D 3C95A 2A08A 2KNBB 3M55A 2DPPB 1YNZA 2QI2A 1VQKQ 2GNCA 3PIPA 4XTYA 8AT1B 1YJNQ 4FM4B 4C8QE 3S3MA 2FPFA 5I21A 3CCSA 2I0NA 4IUPA 2DTHA 3CCMT 1K1ZA 3PNWC 3OYKA 2DL4A 1WQWA 1M90R 1D09B 3CMET 5I11A 1W1FA 2DLPA 3VYGA 4EMKB 5GAOl 4A4GA 1Q7YC 1K8AU 3PMTA 1E7OA 2ESWA 4M7DE 1X43A 3CCVQ 4LN2A 2DF6A 2AIRB 2RQTA 4M78A 4M7AG 1Q81R 4M77B 3EG2A 1YFNA 4PKCC 4C8QF 3PMIA 3PFSA 3QYHB 1JXMA 2EYYA 4Y91A 4BY6C 1RAHB 3I35A 3WVEB 2AKKA 2EBPA 4BUGA 4RCCA 4PJOD 2DKGA 2E10A 1D3BB 1ZSGA 3G4ST 1QCFA 1QWFA 4M7DF 4E7KA 1X75C 1K9MR 3U23A 3QZ5B 4F04B 1QP3A 3NHNA 4AFZC 2ZPBB 2CP6A 3JCMd 2EKOA 1GCQA 3F70A 4N0AC 1YHQA 3A5ZB 4QQ6A 3CC7T 2ROTA 2DA9A 4XTZA 4C92G 3GOXA 3HRTA 1VQLT 2RMOA 4QKUA 1SHFA 1ZSZC 2VB6A 2X3XD 1I5LA 2CDTA 4KBMB 5GMKl 2CH4A 5D6YA 1OV3A 2PUOB 2KBTA 3RESA 1HYOA 2AK5A 2KXCA 1UTIA 1VYTA 2NUPB 3QO3A 3CCUA 3JAME 1YITA 1AWOA 3QXEB 4PJOC 3JV3A 3R6OA 2JS2A 2HL5C 4E7IA 2HZYA 5KYYB 1VQ5A 4QQDA 2LMJA 2DM1A 2GFUA 5IT9E 2RPNA 2CREA 3HTRA 3E2UA 1QLYA 1KJWA 4JRQA 1VQNQ 3LGFA 4FYYB 2XMFA 2DL5A 1OULA 3HP9A 3JCMP 1KFZA 1WHMA 3BDLA 1NPPA 2E3IA 2HAXA 2H3JA 3SEMA 2C0OA 1KQSP 2LCLA 2RJFA 3TSZA 1AOJA 2KVQG 5GANf 4NOYA 2RD1A 5HK0A 1P92A 4XU3A 1YIJA 1PD1A 3HKSA 5D6XA 1M5Q1 2VYTA 3EHRA 1VIEA 3WVDB 1YJWQ 2YSQA 2ZPIB 1VQ6A 1VQ8A 4CC3A 5GAN2 1VQ9Q 5KH6A 1OI1A 2J6KA 3CCEQ 1UFFA 2HBWA 4DBRA 4J9DA 2FVUA 4WF2A 3EFSA 2W10A 3RIRA 2CP3A 3M4YA 2KXDA 4M7AF 2XKOC 4J9EA 4RG2A 9ATCB 2A36A 3A8MB 2QTVA 4C92E 5EG2A 3REBB 5KYWB 2M1HA 3QZ9B 4JLGA 4J9CA 3UA7A 3OS2A 5GAOr 1YHQQ 3CMAA 1KQ1A 3JSCA 3GF5A 1TXQA 5LJ3g 2LP5A 4ZTJA 4PJMA 2LX7A 3JRZA 2QYZA 1Q7YR 3OY9A 4M75D 2OTJA 3OA6A 2QQRA 2GF7A 4N4IA 3OYMA 4VUBA 3UATA 4C92F 3CXCA 3OYAA 3SWNC 5IH2A 3CCRA 4RCBA 2DTIA 3CCUQ 1GFCA 3JCMW 4HVWA 2WACA 5IHIA 1WLPB 2HKQB 1LJOA 1G3WA 5GMKe 3PVLA 1KC8U 4XU2A 1N9SA 1AZEA 5IXFA 4FCYA 1QKXA 1BKBA 2NUZA 4HKEA 1R8OB 2A0FB 1TSFA 4XK8E 5GAMe 4BACA 4M7DB 1G8XA 3EG3A 4M75C 5DLOA 1VQ4Q 2OTLQ 2CP2A 4FSSA 3BE3A 1I81A 3I56T 2FB7A 1U1TA 1UHCA 5I2SA 1PHTA 1JRIA 3V7CA 1PC0A 2KEAA 2M0OA 4EMGA 3FC3A 3KXTA 1M9SA 2BKDN 3OYDA 1GXIE 3RR6A 4A54A 3M0PA 3I55Q 4PJOA 1NYFA 1BIAA 5GAN3 1D0ZA 1WJSA 2DJQA 1NE8A 2KAFA 2MMPA 1XTDA 2VUBA 3NPFA 3OW2P 2O4XA 3GPLA 3UPUA 2QXFA 1ZQ1A 4LXCA 4E47A 3INZA 2CZ7B 3CCLQ 1FMKA 5FROA 3ZFJA 2VKNA 5D6WA 1WYXA 1JBMA 1OU8A 2K5FA 3H8ZA 4MMLA 1M90U 4ZN1A 2XDPA 1UG1A 3PGGA 3OYGA 5CR2A 1YIJT 2KK4A 4PJOE 2FZGB 5A2QE 1HJDA 5GAN5 4D8DA 1NZ9A 4FSXA 2YT6A 4GLKA 1M8VA 2OAWA 4JS4A 1ACMB 1Q81U 2EGEA 1DJ7B 3JB9H 5LJ3j 2M02A 2LJ1A 2RK2A 2JN0A 1T3SA 3I9QA 5GAOq 1J3TA 2P0QA 2RHZA 2ZPHB 1OPLA 3AT1B 3KFVA 4ZTFA 2ECZA 2O01E 3CMAT 1U06A 1MMAA 5A0LA 3SHWA 1N8RC 4OP0A 1AHJB 3MEUA 1VQPQ 3LH0A 2DJZA 2KDSA 5D7UA 4BE2A 2KMTA 1AEYA 1RAAB 5LJ3h 3QJ6A 1TOVA 3CCRT 4XTUA 3TREA 3M0TA 4J8OA 2DRMA 2ZAEA 4E7JA 1B7TA 2WSFE 2YWWA 1YCSB 3OW2S 1EIFA 4OGEA 1NPRA 2QA4Q 4L6V5 4C92B 2R58A 5CKFA 3META 1GBQA 2COWA 3EGXB 5KYYA 5GANj 1C1AA 3CCMA 4XU0A 1AD5A 3CC2A 3OB9A 3OMCA 1TUGB 2YDLA 2JVVA 1ZBJA 3QJYA 4LNPA 2JUFA 3ASKA 4RUGA 1I07A 2HL3A 3SDZA 2V8KA 2DRKA 2KY9A 2DILA 2B86A 4M75A 3G71Q 2KSSA 3HFOA
chains in the Genus database with same CATH topology
2DPPB 3SB2A 1G3SA 2QI2A 3MHXA 2EAYA 2OTLA 4RMOA 3PIPA 2K3YA 4XTYA 1LNXA 3O8VA 4F7UB 5GAMg 4J6WA 5LJ3e 3C94A 2L8DA 5CIUA 3CBPA 3VKIA 4FM4B 2P0KA 4C8QE 2LC4A 3S3MA 4M7AD 3OBWA 3QYGB 1RL2A 2F69A 4J5YA 5I21A 4NL2A 4M77G 3CCSA 2Y90A 2B8AA 4IUPA 2DXTA 3A8LB 2DTHA 3CCMT 4BDYA 3PNWC 3OYKA 2PVDB 1WQWA 2IG0A 3LWHA 2RH2A 3CMET 5GANh 5LJ5e 3VYGA 2L3RA 3N5BB 5IN1A 3GNGA 4C0DC 3JCMe 2CYZB 4EMKB 5GAOl 4IURA 4A4GA 1Q7YC 1Y96B 1UGSB 3I55A 1X6OA 3PMTA 1K8AU 4M7DE 5GAMf 1IREB 4M77C 1G3YA 1VQ4T 3E1SA 3M53A 4R55A 1WGSA 4KUDK 4C0DB 2E65A 5CK9A 2OTLT 4ATOA 2DK3A 2RHUA 4M78A 3JCMX 4HCCA 4M7AG 5CQYA 3CC7A 2EIFA 4M77B 3QPHA 5GAOp 4PKCC 4M75E 4C8QF 5GMKh 3PMIA 1VQNT 3PFSA 4C5HA 3QYHB 3CCST 2JTFA 3CEYA 2VXFA 3EFRA 3MP6A 4FU6A 4FT2A 4N4HA 4B9WA 1VQLA 4MDXA 4RG8A 5LJ3d 4DQ2A 4EDUA 4Y91A 4BY6C 2Y4YA 4MZTA 1QVGA 1VQMA 5HY6A 1BIBA 3WVEB 4MZMA 1WQ7A 3CCLA 4BUGA 4RCCA 1KD1C 4LDYA 4O5VA 4PJOD 4M7AC 2DKGA 2E10A 1D3BB 3G4ST 4IUVA 3HL8A 3CCQA 2XIDA 4BY6B 4E7KA 4M7DF 1X75C 1YCYA 2LT1A 4X9DA 3BY7A 3QZ5B 1QP3A 2G3RA 3OYNA 5C0MA 3MO8A 5LJ5d 2ZPBB 5I2MA 4C0FA 1UB4A 1K9MU 4M7AB 2RM4A 2VC8A 1KHCA 2EKOA 3TEEA 3JCMd 3F70A 1YHQA 4N0AC 3OYCA 1Q7YU 4XQ3A 3OQ5A 2ZPEB 3A5ZB 4J6XA 4QQ6A 3VUZA 2K5IA 4CRIA 5LJ5g 3CC7T 5GAN8 5A0DA 5GANe 4XTZA 4C92G 3JCMg 1HK9A 1YJWT 1KQSA 2VV5A 3PIOA 1Y7XA 3GOXA 1VQ9T 3HRTA 1VQLT 1M4ZA 3QHSA 1UGPB 4NL3A 3ZEHA 3M4GA 5A0GA 3P8BB 3CCET 3JB9F 5CO7A 4PJOG 4BE1A 3TU4K 1RI0A 1I5LA 3TCJA 4KBMB 3ZBDA 5GMKl 2R57A 2E70A 5D6YA 3V8KA 2K57A 2PUOB 5LJ5f 3X25B 3SWNA 3RESA 4C8QA 1KD1U 3JCMf 5KCHA 4QVZA 3ER0A 4KUIA 1XNIA 5GAN6 5KE2A 3QO3A 3X20B 3CCUA 1YHQT 3JAME 1YITA 4LDVA 3QXEB 1K73C 3HFOA 1QW1A 4PJOC 2V8JA 4M78D 3R6OA 3OYEA 4E7IA 1G3TA 3MP8A 3FLGA 2RJDA 1VQ5A 4F7UG 3A8OB 4QQDA 2BUDA 3DB4A 3JCMJ 2Y4XA 4LDUA 2CS7A 1QVFA 1BI3A 4PJOB 2RO0A 3M57A 2GFUA 5IT9E 4M7DA 1BI2A 1BI1A 4LD6A 5GANd 1VQPA 4Z02A 4LD9K 3CPWA 3L2VA 4BD3A 1FXXA 2JTMA 1NJIC 4MMKA 5GANg 3OYIA 5GAOn 4YTLA 3MEVA 3VJPA 3L2UA 2ZZDA 4JRQA 3L2WA 3LGFA 2EYQA 2O4XB 3CBMA 4II1A 2QDYB 3HP9A 3JCMP 2PVGB 3SFMA 5HKCA 2DXBA 3C4SA 3CCUT 1LOJA 1YITT 2DIQA 3BDLA 5GMKj 1NPPA 3GNFB 5CAIA 2QA4A 2HAXA 1VQ5T 2H3JA 3OS0A 4OMFB 4BE0A 1WJRA 1K73U 2LCLA 2RJFA 4P5NA 4O6JA 1YJ9A 4M77F 2KVQG 5GANf 1H3ZA 3L2QA 3CC2T 4JDSA 5GAMj 4NOYA 2RD1A 1YI2A 2DAQA 4XU1A 3QBYA 2RJEA 4M78C 5HK0A 1MGQA 1P92A 2K4YA 4C5IA 2FHDA 4XU3A 3V8JA 2E41A 5KCOA 1YIJA 2ZPFB 3HKSA 5D6XA 3QG1A 1M5Q1 2VYTA 2D9TA 1VIEA 3QKJA 3WVDB 4KULA 2LQ8A 2ZPIB 1VQ6A 1VQ8A 2RB6A 3NTKA 4M78B 5GAN2 5FU6C 5KH6A 1OI1A 1NJIU 4C8QD 3G6EA 1S72A 3MEAA 4IUUA 2FVUA 4WF2A 3EFSA 3G71A 2XI9A 2CZ6B 3DLMA 5FU6B 3OS5A 3RIRA 5IAYA 2QQBA 3M4YA 4A4HA 1VQKA 4M7AF 1FWZA 3E9FA 2X4XA 2XKOC 2LQKA 3M9QA 3MEWA 3A8MB 4RG2A 4C92E 2A7YA 5EG2A 3JCMb 2M1HA 3QZ9B 2DEQA 4JLGA 3GLXA 1YJ9T 3FIFA 1YJNA 4FIBA 3BFMA 1WNLA 3OS2A 2X35A 1N27A 2JNGA 4OF1A 4BB7A 5GAOr 4M7DD 3NTHA 2L5QA 3FJPA 3LW5E 2QEXA 3CMAA 4EMKA 1KQ1A 2VGMA 3WXMB 3JSCA 3GF5A 3JB9J 1Y96A 5GAMh 5LJ3g 5M9OA 2E6ZA 4ZTJA 1XOVA 2QTXA 3I55T 2KQWA 3JRZA 1VQ6T 1VQ8T 3OYYA 3ME9A 3S3NA 2YLBA 5LL6S 5C6SA 1U8RA 1Q82C 2XICA 3OYHA 3M5AA 2RJCA 3OY9A 4M75D 3CCVA 2OTJA 4PLIA 3KBGA 5J39A 3P8DA 3OA6A 4HCZA 4M77A 4XTWA 2DIGA 2EQJA 2QQRA 2YRVA 2FL7A 4XTVA 3JCMc 3G71T 1JJ2S 3HRSA 2LT4A 1VQKT 2GF7A 3CD6A 4N4IA 1FX7A 1I8FA 3JB9D 3OYMA 4VUBA 4C92F 3CXCA 3OYAA 3DKMA 4F7UE 2DO3A 3SWNC 3CCRA 1VQOA 1YJNT 2RI5A 4RCBA 2DTIA 5J26A 5LJ3f 2ZPGB 4C8QC 4M7DG 4OVAA 4V2SA 2K5LA 2LX9A 4A4FA 4JUVA 1VQMT 2QQSA 5CKHA 4C0ZA 2QEXT 3CCLT 3JB9I 2HD0A 4PJOF 2LVMA 1D3BA 3I56A 3JCMW 3C12A 4DA4A 4DOWA 5DY9A 2WACA 4J83A 3OW2A 3CCQT 3CC4A 3QUIA 4TVRA 1LJOA 3UDCA 2R5AA 1G3WA 5KE3A 4M75G 5GMKe 3PT9A 4M7AA 1KC8U 4XU2A 4M7DC 1OZ2A 2OTJT 2BIVA 3EAEA 1N9SA 4QVCA 4BI4A 2DZCA 4XAXB 1Q82U 5HK3A 5J3BA 1BKBA 2QQ9A 3M55A 2JOYA 1WPYA 1R8OB 4HKEA 1N6AA 4XK8E 5GAMe 4BACA 3GP8A 4M7DB 1BI0A 2LDMA 4F7UF 1VQOT 3VV0A 2VXEA 4M75C 4M77E 2PU9B 5DLOA 2XHCA 1ZHIA 1B34A 2X4JA 3MCAB 3DLLA 3CCJA 1QVPA 1Q86C 2CZ0B 3G7ZA 1I81A 5CKDA 4OB2B 2I2LA 3I56T 2FB7A 2E12A 1U1TA 1I4K1 4M75B 1KHIA 3V7RA 4J6YA 3VYHB 5LJ5h 2MI6A 3L42A 3RKWA 5I2SA 3JCMh 3PTAA 3HRUA 1JRIA 3MP1A 3URGA 1VIFA 2NLUA 3V7CA 4ZN3A 1KQ2A 2ZCFB 1ZBXA 4C92A 2HQEA 3OMGA 5DM7R 5GAOm 2M0OA 4M78G 3OSVA 1M1FA 4EMGA 3FC3A 3OS1A 3KXTA 2RHXA 1M9SA 2BKDN 1OZ3A 1M90C 2E1HA 2M9UA 3OYDA 1GXIE 3LGLA 2OAUA 4A54A 3UT1A 4M7AE 4IUTA 4IKFA 1PSEA 2IVWA 3L1AA 2RHIA 4E7HA 1W2BS 2A3LA 3CMEA 1QVFS 4FT4A 1BIAA 4PJOA 3A8HB 2PVOB 3LLRA 4QQGA 3OBYA 1HXDA 4L5GA 5GAN3 1WJSA 5FLXE 1MHNA 3DB3A 3A8GB 4BDZA 1IZ6A 3CCJT 4CI0C 1VQPT 3OYBA 1NE8A 2XDDA 1SSFA 3BDUA 3FB9A 2KAFA 2E6NA 5FU7C 3UWNA 3X26B 5GAMd 1KC8C 2MMPA 2K3XA 4A4KA 5FRMA 4UC4A 4B9XA 1XTDA 4PL6A 3RMSA 2VUBA 3S3OA 1Q81C 2O4XA 3GPLA 2GQVA 3UPUA 1Q86U 2QXFA 4Q5WA 5FU7B 3L2RA 4E7LA 1YBYA 4RKUE 5DLQE 2AHJB 3RERA 2ZGWA 4ZGJB 1ZQ1A 1VQNA 4OB1B 4F7UA 4E47A 3INZA 2F5KA 2HQXA 4BI8B 2CZ7B 4EMKC 4J7IA 2MWPA 3J7AF 4ME7A 5FROA 3ZFJA 4A53A 2RI3A 2QA4T 4HT8A 4X34A 4GY5A 5GAN4 2MWOA 5D6WA 3OYJA 3QDRB 1JBMA 2DXUA 2X4WA 2K5FA 3H8ZA 4MMLA 1M90U 2PUKB 1O75A 2R5MA 4ZN1A 3JCMQ 1X01A 2PQWA 2XDPA 3J81E 3HPWA 3G4SA 1K9MC 3PGGA 3V8LA 1YI2T 1O9SA 3FRNA 2DVEA 3HSBA 3OYGA 2D6FA 2E5QA 3CBOA 2KK4A 4JRIA 2WSCE 5CR2A 5A2QE 3OYLA 3S6WA 1OYXA 1YIJT 4PJOE 2HNIA 4A4EA 5GAN5 5L8RE 5GMKi 2F5TX 1M1GA 4HT9A 4ZGDB 1NZ9A 4C8QG 1UGRB 1Y71A 2EWNA 3OSSC 4FSXA 2YLCA 4GLKA 4MZPA 1YJWA 1JJ2A 3X28B 5CVIA 1G5VA 4C0GA 1M8VA 3G6ET 3HFNA 2MAMA 4IUQA 2YHTA 5GMKm 4JS4A 4C92D 1DJ7B 4N4GA 3M59A 1S72T 4ELYC 1Q81U 5LJ3j 1VQ9A 3JB9H 2L89A 4OB0B 4OGCA 1PSFA 3P8HA 2RK2A 2JN0A 3CCEA 5GAOq 2P0QA 2EJ9A 2GCXA 3BW1A 4JJNK 2DD4A 2XD0A 3AHUA 2RHZA 3LWIA 4R56A 4QVDA 2ZPHB 3NTIA 3JCMV 5CQXA 4C5GA 3M56A 2XK0A 3T9NA 1QVGS 1H641 3KUFA 5FRNA 3RUXA 5LJ5j 2LRQA 4ZTFA 5AYFA 4DOVA 4HCBA 3CMAT 1N9RA 2O01E 2VGNA 1TH7A 2P4TA 2RI2A 3QIIA 3SWNB 4MDWA 1BYMA 4C8QB 4J7FA 1W4SA 3M58A 4OB3B 1M1KC 2EJFA 2XDBA 5A0LA 2V8IA 4JRKA 4ELZC 1N8RC 2DXCA 4OP0A 3X24B 4M75F 1AHJB 4PLLA 2EFIA 1KG1A 3MEUA 2C06A 4EMHA 1UEBA 4XTXA 1U1SA 3CCVT 3QSUA 4EPCA 3LH0A 4Y28E 5GAN7 2DJZA 2KDSA 3LYIA 4M78E 4BE2A 2KMTA 3E9GA 1KQSS 3CXCS 3JB9G 3SD4A 3J80E 3CD6T 1VQ7A 3V7SA 3LX7A 5LJ3h 1B34B 3FEOA 4N0AA 4ZGEB 2LCCA 2RHYA 2XU8A 3M54A 3QJ6A 2EJGA 4LDWA 5CKEA 3RKYA 3CCRT 4XTUA 2LTOA 3VU3C 3TREA 4C5EA 2EQKA 4J8OA 2E64A 4C92C 4JS5A 2JZ2A 2D0QB 3RMQA 2CKKA 4E7JA 2RK1A 3HHTB 4X9CA 2WSFE 3CPFA 4NS5A 3OW2S 1EIFA 4L59A 4QW2A 3RKXA 4PNOA 1NPRA 4OGEA 5CCAA 1UGQB 4KT0E 1WJQA 2RA2A 2CGHA 4L6V5 4C92B 3CC4T 2QQAA 2X4YA 2P0PA 2R58A 2DZ9A 2LNVA 3E19A 1JB0E 3GIBA 2DD5A 2FYKA 1VUBA 5CKBA 4LDXA 3VUBA 2WSEE 4JLIA 5CKFA 1QP2A 3META 1M1KU 2CZ1B 2M16A 4BI3A 4HA8A 4JRPA 3OYFA 4M78F 3FDRA 1W2BA 3NFCA 1N8RU 5GANj 3CCMA 4XU0A 4M77D 3CC2A 1K8AC 1VQ7T 3OB9A 4FL6A 2GFAA 3H6ZA 1Y07A 4D6WA 3OMCA 2JVVA 2DTOA 1V29B 1XQHA 2MF2A 3QJYA 2JUFA 2HBPA 3CPWS 2EQUA 3ASKA 3SDZA 2V8KA 2KY9A 2XG8D 3C95A 3Q1JA 4M75A 2K2VA 3L2ZA 1VQ4A 2KSSA 2EQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DPP B;  2ZPG B;  2WSC E;  3A8O B;  4FM4 B;  5L8R E;  3QYG B;  4ZGD B;  1UGR B;  3A8L B;  3X28 B;  1DJ7 B;  2PVD B;  4OB0 B;  1PSF A;  3VYG A;  2ZZD A;  2CYZ B;  2QDY B;  2DD4 A;  1UGS B;  2PVG B;  2ZPH B;  2DXB A;  1IRE B;  4XK8 E;  2O01 E;  2PU9 B;  4OB3 B;  2CZ0 B;  4OB2 B;  2DXC A;  3QYH B;  3VYH B;  3X24 B;  1AHJ B;  2ZPF B;  4Y28 E;  3WVE B;  3WVD B;  2ZCF B;  2ZPI B;  4ZGE B;  1GXI E;  3QZ5 B;  1QP3 A;  1PSE A;  2ZPB B;  2CZ6 B;  2D0Q B;  2PVO B;  3A8H B;  3HHT B;  2WSF E;  3A8M B;  2ZPE B;  3A8G B;  3QZ9 B;  1UGQ B;  4KT0 E;  4L6V 5;  3X26 B;  1JB0 E;  2DD5 A;  1UGP B;  3LW5 E;  2WSE E;  1QP2 A;  2CZ1 B;  4RKU E;  2AHJ B;  4ZGJ B;  4OB1 B;  2CZ7 B;  1V29 B;  2PUO B;  3X25 B;  3X20 B;  2PUK B;  3QXE B; 
#chains in the Genus database with same CATH topology
 1SHG A;  3MHX A;  4OMP A;  1WI7 A;  2EAY A;  2KR3 A;  1VA7 A;  3H9N A;  1LNX A;  4J6W A;  3C94 A;  2CUB A;  3CBP A;  2P0K A;  1GL5 A;  4M7A D;  3QYG B;  2Y90 A;  1MMN A;  2DXT A;  3UA6 A;  1H92 A;  1PKT A;  1UGV A;  5GAN h;  3N5B B;  4JPB W;  3JCM e;  2L0A A;  1IRE B;  3A98 A;  3M53 A;  4J9G A;  1UJY A;  2V1R A;  2E3H A;  2V26 A;  4GBQ A;  1X69 A;  2E65 A;  4ATO A;  2AT1 B;  2DK3 A;  3JCM X;  1M2V A;  3CC7 A;  1VQO Q;  1UE9 A;  4M75 E;  3EHQ A;  5GMK h;  4HVV A;  2VXF A;  3EFR A;  3MP6 A;  4FT2 A;  1LVK A;  1VQL A;  1W2B P;  4EDU A;  2E5K A;  2DYB A;  4MZT A;  1G2B A;  4FYW B;  5HY6 A;  3CC4 Q;  2YRD A;  1OEB A;  2SRC A;  4M7A C;  1PKS A;  4BY6 B;  3OYN A;  5C0M A;  5LJ5 d;  2RM4 A;  2VC8 A;  1KHC A;  1Q7Y U;  3TEE A;  5GJV B;  3EH2 A;  4JJB A;  2K5I A;  4RTY A;  3JCM g;  1HK9 A;  4Z89 A;  1T0H A;  3CCJ Q;  3VS6 A;  5KYU B;  3QHS A;  3P8B B;  5CO7 A;  3TU4 K;  3PE0 A;  1RI0 A;  4PJN A;  4CC7 A;  2DVJ A;  2R57 A;  1EX4 A;  2HEQ A;  2J06 A;  4Y92 A;  3V8K A;  1RAD B;  4E2F B;  4C8Q A;  2O9S A;  4KUI A;  1XNI A;  1K73 C;  2DL8 A;  3CME Q;  3OYE A;  3MP8 A;  1VYV A;  3FLG A;  1N8R R;  3A8O B;  2PTK A;  1QVF A;  1BI3 A;  4PJO B;  2RO0 A;  5IHK A;  4M7D A;  4LD6 A;  2FO0 A;  1VOM A;  4DEY A;  2DBK A;  2JT4 A;  1FXX A;  2EYZ A;  2OX7 A;  3H0F A;  3L2W A;  2EYQ A;  2O4X B;  1B3Q A;  4FYV B;  3EG1 A;  2JS0 A;  5HKC A;  2DIQ A;  4B6M A;  3G4S Q;  2M0Y A;  4M4Z A;  1W6X A;  1Z9Z A;  1IRX A;  1H3Z A;  3CC2 T;  2DAQ A;  3H0I A;  2K4Y A;  1ZUK A;  2FHD A;  3V8J A;  4RTZ A;  2ZPF B;  4JZ4 A;  3QG1 A;  2D9T A;  3QKJ A;  2LQ8 A;  2QK0 A;  3NGP A;  1NM7 A;  2KYM A;  4JZ3 A;  3G6E A;  2AKL A;  1WIE A;  3MEA A;  1W70 A;  4IUU A;  1MUZ A;  2VVK A;  3DLM A;  5IAY A;  4A4H A;  1FMV A;  3M9Q A;  2J6F A;  1X6G A;  3GLX A;  1YJ9 T;  2MIO A;  2O88 A;  2RF0 A;  4FIB A;  3BFM A;  1WNL A;  2RQW A;  1UEC A;  2DL7 A;  2JNG A;  2X35 A;  4BB7 A;  3FJP A;  2J7I A;  1Y96 A;  2MCN A;  2E6Z A;  2QTX A;  3ME9 A;  1Q82 C;  2YLB A;  2LCS A;  1U8R A;  3M5A A;  2RJC A;  1ZX6 A;  4PLI A;  4XTW A;  1M3B A;  2EQJ A;  1JJ2 S;  1VQK T;  2CP7 A;  3CD6 A;  1I8F A;  2KRM A;  3JB9 D;  2DO3 A;  3UF4 A;  1YJN T;  4V2S A;  5LJ3 f;  2ZPG B;  2LX9 A;  4A4F A;  4JJC A;  4JUV A;  1E6H A;  2QQS A;  5CKH A;  2QEX T;  2HD0 A;  4DBF A;  3I56 A;  1I1J A;  1YWP A;  2W0Z A;  4DOW A;  4PJJ A;  4TVR A;  3UDC A;  1K76 A;  2KI7 A;  3PT9 A;  4M7A A;  2BIV A;  4QVC A;  3VRZ A;  1F1B B;  1D0X A;  5J3B A;  2ROL A;  4R0K A;  2LDM A;  1XJW B;  2D8J A;  2A37 A;  2H3E B;  3TSW A;  1WHH A;  2XHC A;  3MCA B;  1QVP A;  1Q86 C;  2CZ0 B;  3G7Z A;  1RLP C;  1SRM A;  4M75 B;  2KGT A;  2MI6 A;  3L42 A;  4RTT A;  3JCM h;  1ZA2 B;  5AT1 B;  1WHL A;  3HRU A;  3CCS Q;  3I5R A;  1VIF A;  1KQ2 A;  2ZCF B;  1ZBX A;  4C92 A;  1WDX A;  3EFO B;  3OSV A;  1M1F A;  2KT8 A;  1BCO A;  2E1H A;  2M9U A;  2OAU A;  1K73 R;  3UT1 A;  4M7A E;  1PSE A;  3L1A A;  2RHI A;  2A3L A;  3EGX A;  1I5O B;  3A8H B;  2PVO B;  3EGD A;  4L5G A;  1K9A A;  1NLO C;  4CI0 C;  2XDD A;  1SSF A;  3I5S A;  3X26 B;  2E6N A;  5FU7 C;  5KYX A;  2FEI A;  1D1A A;  2K3X A;  4A4K A;  4D8K A;  4B9X A;  4PL6 A;  2E4H A;  2GQV A;  4Q5W A;  3L2R A;  1M2V B;  1YBY A;  4RKU E;  5DLQ E;  3RER A;  1AWX A;  4OB1 B;  2F5K A;  4BI8 B;  4EMK C;  5IHN A;  4J7I A;  2MWP A;  3J7A F;  1V1C A;  2GBQ A;  1X27 A;  4HT8 A;  4GY5 A;  1S1N A;  3OYJ A;  4OMO A;  2O31 A;  1FYN A;  4IIM A;  2R5M A;  3J81 E;  1X01 A;  2PQW A;  2AZS A;  1O9S A;  3FRN A;  2DE0 X;  3HSB A;  2E5Q A;  3CPW P;  2WSC E;  2EQI A;  2PNI A;  1OYX A;  4A4E A;  1RAE B;  1Y0M A;  2COZ A;  5L8R E;  5GMK i;  1M1G A;  2JXB A;  1TG0 A;  2EWN A;  1G5V A;  4MZP A;  1JJ2 A;  3X28 B;  3G6E T;  3HFN A;  4IUQ A;  2YUN A;  2L89 A;  4OGC A;  5EC7 A;  4PFO A;  1KIK A;  1UHF A;  2EJ9 A;  4OML A;  2DD4 A;  3AHU A;  4FW1 A;  4DEX A;  4QVD A;  5CQX A;  4C5G A;  3M56 A;  3T9N A;  1H64 1;  1TUC A;  1C0M A;  4DOV A;  1YIT Q;  4HCB A;  1TH7 A;  2P4T A;  3QII A;  4C8Q B;  4J7F A;  4KGZ B;  3M58 A;  4OB3 B;  1VQ5 Q;  2QG9 B;  4JRK A;  1RAG B;  1MV3 A;  2EFI A;  1Q82 R;  4RTX A;  2C06 A;  1U1S A;  3QSU A;  4Y28 E;  3LYI A;  2A28 A;  1KQS S;  3JB9 G;  3SD4 A;  2K3B A;  3CD6 T;  1X6B A;  3V7S A;  4N0A A;  4ZGE B;  5KYU A;  2XU8 A;  3RKY A;  2IIM A;  2E64 A;  4JS5 A;  1R0C B;  2RK1 A;  1IHW A;  4X9C A;  3CPF A;  3M0S A;  4JJD A;  2EW3 A;  3H41 A;  1V76 A;  1ZSZ A;  2DNU A;  2CGH A;  2X4Y A;  3E19 A;  3GIB A;  2DD5 A;  1VUB A;  1SG5 A;  2WSE E;  3VS5 A;  2CZ1 B;  1WHJ A;  4BI3 A;  4F17 A;  4JRP A;  1N8R U;  3NFC A;  1YIJ Q;  1QKW A;  1VQ7 T;  2CT3 A;  1Y07 A;  2HDA A;  4D6W A;  1VQ6 Q;  1VQ8 Q;  1V29 B;  4AMC A;  2CP5 A;  3CPW S;  2EQU A;  2F2V A;  3L2Z A;  3SB2 A;  4X1V A;  1Q86 R;  1JEG A;  1NEB A;  3H0H A;  2K3Y A;  3QWY A;  3O8V A;  5GAM g;  2CUD A;  5CIU A;  2BZY A;  4J5Y A;  2F69 A;  3IQL A;  4NL2 A;  4M77 G;  2B8A A;  3CMA Q;  1RAI B;  2KRO A;  2PVD B;  2VAS A;  3LWH A;  3VS4 A;  5LJ5 e;  1OX8 A;  2L3R A;  3GNG A;  4C0D C;  2CYZ B;  2DEU A;  4IUR A;  1Y96 B;  2EKH A;  2OTJ Q;  1VQ4 T;  4R55 A;  1WGS A;  3G1J A;  5CK9 A;  2OTL T;  2OJ2 A;  4HCC A;  4KGX B;  7AT1 B;  5CQY A;  2EIF A;  3CCR Q;  1NYG A;  3QPH A;  3EG9 B;  4C5H A;  2JTF A;  2LJ3 A;  1R77 A;  3CEY A;  4FU6 A;  1RAC B;  4MDX A;  4RG8 A;  5LJ3 d;  4DQ2 A;  1VQM A;  1BIB A;  4MZM A;  2M51 A;  6AT1 B;  5ECA A;  1KD1 C;  4LDY A;  4O5V A;  1RAF B;  4IUV A;  3REA B;  3CCQ A;  1BBZ A;  1PRL C;  1PG5 B;  1YCY A;  4X9D A;  2G3R A;  3MO8 A;  4C0F A;  1UB4 A;  1GCP A;  4M7A B;  1K9M U;  1AWW A;  1WHK A;  1MND A;  3OQ5 A;  1PWT A;  2RQU A;  5LJ5 g;  1KQS A;  3R6N A;  2VV5 A;  1Y7X A;  2GGR A;  1UGP B;  1Z9Q A;  3M4G A;  3ZEH A;  5A0G A;  4IIO A;  3JB9 F;  1KK7 A;  2DBM A;  2K6D A;  2YRC A;  3ZBD A;  3SWN A;  3JCM f;  5KCH A;  4QVZ A;  3ER0 A;  5KE2 A;  3X20 B;  1OOT A;  4LDV A;  2V8J A;  4M78 D;  2G6F X;  1G3T A;  2RJD A;  2NWM A;  4F7U G;  2BUD A;  3DB4 A;  3JCM J;  3EGD B;  1BI2 A;  5GAN d;  3CPW A;  2FG0 A;  4BD3 A;  2JTM A;  4DBQ A;  5FWC A;  5KYX B;  1NJI C;  3OYI A;  4YTL A;  3VJP A;  2ZZD A;  2LQW A;  1K0X A;  2DET A;  2PVG B;  1BU1 A;  4PFZ A;  1LOJ A;  5GMK j;  4AFU C;  3GNF B;  4F16 A;  3EFO A;  1AWJ A;  1WJR A;  4BE0 A;  1AT1 B;  2GTJ A;  1K73 U;  4O6J A;  4HCK A;  2NUT B;  1YJ9 A;  4M77 F;  1PD0 A;  2ED1 A;  1GRI A;  5GAM j;  1YI2 A;  4XU1 A;  3QBY A;  2RJE A;  4M78 C;  1B07 A;  1NEG A;  2X9H A;  4HXJ A;  2RB6 A;  5FU6 C;  1CKA A;  2PZ1 A;  1UJ0 A;  1S72 A;  4CC4 B;  4AFQ C;  4OMQ A;  3OS5 A;  1VQK A;  3QDF A;  3E9F A;  2X4X A;  2JMA A;  3JCM b;  2A7Y A;  2C0I A;  2DEQ A;  1YJN A;  4OF1 A;  1TWB A;  1GCQ C;  2AZV A;  2L5Q A;  2QEX A;  2VGM A;  5GAM h;  4QT7 A;  2C0T A;  1XOV A;  2KQW A;  2MYS A;  2XIC A;  1TS9 A;  3OYH A;  2BE9 B;  3CCV A;  3P8D A;  3G71 T;  2DIG A;  2YRV A;  2FL7 A;  1CSK A;  3HRS A;  1LCK A;  1FX7 A;  1UUE A;  1BB9 A;  1OU9 A;  3DKM A;  4F7U E;  2RI5 A;  4M7D G;  2K5L A;  1VQM T;  4C0Z A;  3JB9 I;  2RNA A;  2HMA A;  3OW2 A;  2FPE A;  3CCQ T;  3QUI A;  1ZSZ B;  1KD1 R;  2CT4 A;  2R5A A;  4F14 A;  1JXO A;  4Z8A A;  3QWX X;  3CCM Q;  3EAE A;  3CC2 Q;  2DZC A;  1Q82 U;  3M0Q A;  2MPX C;  1WPY A;  1N6A A;  2OI3 A;  4F7U F;  3VV0 A;  1VQO T;  1TU0 B;  2H8H A;  1M8M A;  1ZHI A;  1M27 C;  3DLL A;  2CH4 W;  2L3P A;  1Y57 A;  1QVG P;  5CKD A;  1ABO A;  2I2L A;  1I4K 1;  1KHI A;  4J6Y A;  5LJ5 h;  3RKW A;  1U3O A;  3URG A;  1IXD A;  3VS3 A;  2HQE A;  5DM7 R;  4M78 G;  2EGC A;  1OZ3 A;  1HD3 A;  1UDL A;  3LGL A;  3VRY A;  2DL3 A;  4IUT A;  3VS0 A;  1W2B S;  4FT4 A;  3CXC P;  2QGF B;  4QQG A;  2COY A;  3OBY A;  1HXD A;  3NMZ C;  5FLX E;  1MHN A;  3DB3 A;  1WX6 A;  3CCJ T;  2J05 A;  3FB9 A;  3CC7 Q;  5FRM A;  3RMS A;  3S3O A;  2GTO A;  1NJI R;  1Q86 U;  5FU7 B;  4E7L A;  1VQL Q;  2YUQ A;  2ZGW A;  4ZGJ B;  1K4U S;  1VQN A;  2QEX Q;  2X51 A;  4ME7 A;  4A53 A;  2RQR A;  4X34 A;  5GAN 4;  1U5S A;  2PUK B;  1SF9 A;  2ENM A;  3HPW A;  2HSP A;  1RAB B;  3V8L A;  1YI2 T;  2F2W A;  1X2K A;  1NBE B;  2CSI A;  4AG2 C;  3CBO A;  3OYL A;  2HNI A;  2L2P A;  1WZO A;  4KRT A;  4HT9 A;  4ZGD B;  1UGR B;  1Y71 A;  1YJW A;  2D8H A;  2KYB A;  2FPD A;  2MAM A;  2YHT A;  1S72 T;  4N4G A;  1VQ9 A;  1E6G A;  4ELY C;  4OB0 B;  1PSF A;  1MMD A;  3CCE A;  3EG9 A;  3BW1 A;  2XD0 A;  2HKN A;  3NTI A;  3JCM V;  1QVG S;  2XK0 A;  2X3W D;  5FRN A;  1D0Y A;  2YXY A;  2LRQ A;  2P4R A;  1N9R A;  1WHG A;  3SWN B;  1M1K C;  4PJL A;  2FRY A;  4ELZ C;  1OPK A;  2DXC A;  1BCM A;  1SPK A;  1YP5 A;  4EMH A;  1UEB A;  3CCV T;  1PNJ A;  4M78 E;  1D1C A;  3VS1 A;  3CXC S;  1M3A A;  1VQ7 A;  1SKU B;  3LX7 A;  1B34 B;  1ZA1 B;  3FEO A;  2RHY A;  3M54 A;  2EJG A;  3TQ7 P;  3VU3 C;  2D0N A;  2EQK A;  3RMQ A;  2CKK A;  1NLP C;  2BTT A;  4ESR A;  4QW2 A;  4L59 A;  2F2X A;  4PNO A;  5CCA A;  1OX9 A;  1UGQ B;  1WJQ A;  3EH1 A;  2QQA A;  4J9B A;  2P0P A;  2DZ9 A;  2LNV A;  1JB0 E;  2KT1 A;  2FYK A;  4J9I A;  5CKB A;  4LDX A;  4OMM A;  4JLI A;  1IGU A;  2M16 A;  1QCO A;  1W2B A;  1ZUU A;  4M78 F;  1PM3 A;  2NYS A;  4M77 D;  1K8A C;  2GFA A;  2DTO A;  1WXT A;  1TTH B;  1JO8 A;  3G6E Q;  2CP0 A;  2LQN A;  3Q1J A;  2K2V A;  1VQ4 A;  4RTW A;  4LUD A;  1RI9 A;  2EQM A;  1G3S A;  1H8K A;  2OTL A;  3LH5 A;  4RMO A;  3MJX A;  2DFU A;  1M3C A;  4F7U B;  5LJ3 e;  2ABL A;  2L8D A;  3VKI A;  5FW9 A;  2LC4 A;  1A0N B;  3OBW A;  1RL2 A;  3A8L B;  4GLM A;  4LUE A;  1BK2 A;  3O5Z A;  4BDY A;  4A63 B;  2IG0 A;  2RH2 A;  2NUT A;  1WXB A;  5IN1 A;  2P84 A;  1UGS B;  3I55 A;  1X6O A;  5GAM f;  1ZLM A;  4M77 C;  1G3Y A;  3E1S A;  1IO6 A;  4KUD K;  4C0D B;  4K11 A;  3CD6 Q;  2RHU A;  1C6V X;  2K2M A;  3CQT A;  5GAO p;  1VQN T;  4E7S A;  3CCS T;  1T3L A;  4N4H A;  4B9W A;  4E6R A;  3I56 Q;  2Y4Y A;  1QVG A;  3RDV A;  2KE9 A;  1WQ7 A;  3CCL A;  1M30 A;  1SEM A;  1I0C A;  3HL8 A;  1ZUY A;  2XID A;  1D1B A;  2LT1 A;  3BY7 A;  5I2M A;  1YN8 A;  2VWF A;  1VQ7 Q;  3OYC A;  4XQ3 A;  2ZPE B;  4J6X A;  3VUZ A;  4CRI A;  1VYU A;  5GAN 8;  5A0D A;  5GAN e;  1YJW T;  4ANJ A;  3PIO A;  1FMW A;  1VQ9 T;  4WCI A;  5GJW B;  1M4Z A;  3FJ5 A;  1IB8 A;  4NL3 A;  3CCE T;  2K9G A;  2SEM A;  4PJO G;  4BE1 A;  3TCJ A;  3GBQ A;  3RBB B;  2E70 A;  1QQJ A;  2K57 A;  5LJ5 f;  3X25 B;  1KD1 U;  5GAN 6;  2CSQ A;  1YHQ T;  4RTV A;  1QW1 A;  1M1K R;  2EPD A;  2Y4X A;  4LDU A;  2CS7 A;  1K0S A;  3M57 A;  1BI1 A;  1VQP A;  2L3Q A;  4Z02 A;  4LD9 K;  2BE7 D;  3L2V A;  1HSQ A;  3PVQ A;  1R0B G;  4MMK A;  5GAN g;  5GAO n;  3MEV A;  1EZZ B;  3L2U A;  3M0U A;  3CBM A;  4II1 A;  2QDY B;  5KYN A;  3SFM A;  2DXB A;  3C4S A;  3CCU T;  2BZX A;  1YIT T;  3MPU B;  3THK A;  5CAI A;  1X2Q A;  2QA4 A;  1VQ5 T;  3OS0 A;  4OMF B;  3M0R A;  1IHV A;  4P5N A;  2EGA A;  3L2Q A;  4JDS A;  4ZNX A;  1MNE A;  1MGQ A;  4C5I A;  5KCO A;  2QGG A;  2E41 A;  2YUP A;  4LE9 A;  1K8A R;  1KSW A;  2K79 A;  4KUL A;  5I22 A;  3NTK A;  4FYX B;  4M78 B;  1EFN A;  4AFS C;  1NJI U;  4C8Q D;  2FZK B;  2DER A;  3G71 A;  2XI9 A;  2CZ6 B;  5FU6 B;  1G83 A;  2LJ0 A;  2QQB A;  2V1Q A;  3EGU A;  3MEW A;  1FWZ A;  2LQK A;  3FIF A;  1QVF P;  1N27 A;  4M7D D;  2KRN A;  3NTH A;  1QCN A;  3LW5 E;  4EMK A;  3WXM B;  4Z88 A;  3JB9 J;  1KC8 C;  5M9O A;  2F1L A;  3I55 T;  1VQ6 T;  1VQ8 T;  3OYY A;  1JQQ A;  3ULR B;  3S3N A;  5LL6 S;  5C6S A;  2LNH B;  2EVR A;  3KBG A;  5J39 A;  1IGQ A;  4HCZ A;  4M77 A;  4XTV A;  3JCM c;  2LT4 A;  1ARK A;  4OMN A;  1T0J A;  3VS7 A;  1MV0 B;  2ATC B;  1VQO A;  5J26 A;  4C8Q C;  1SSH A;  4OVA A;  1PRM C;  4AT1 B;  3CCL T;  2GQI A;  4PJO F;  2LVM A;  1D3B A;  3C12 A;  4DA4 A;  5DY9 A;  4J83 A;  3CC4 A;  1LPL A;  5KE3 A;  4M75 G;  4M7D C;  1OZ2 A;  2OTJ T;  2O9V A;  4BI4 A;  4XAX B;  2QDL A;  5HK3 A;  1RLQ C;  4PK4 A;  4KH0 B;  2QQ9 A;  2JOY A;  2FZC B;  3GP8 A;  1BI0 A;  3TVT A;  2VXE A;  4M77 E;  2PU9 B;  1B34 A;  2X4J A;  3CCJ A;  3RNJ A;  8ATC B;  1WA7 A;  1AVZ C;  2K7A A;  4OB2 B;  2E12 A;  2O2O A;  3V7R A;  3VYH B;  3PTA A;  3MP1 A;  2NLU A;  1RUW A;  4ZN3 A;  2NUP A;  1CKB A;  1JU5 C;  5GAO m;  3OMG A;  3OS1 A;  3A1P A;  2RHX A;  1M90 C;  4IKF A;  2IVW A;  1QVF S;  4E7H A;  3CME A;  4RTU A;  3LLR A;  4EIK A;  2EYW A;  1ABQ A;  3A8G B;  4BDZ A;  1IZ6 A;  1VQP T;  3OYB A;  3BDU A;  3UWN A;  5GAM d;  4UC4 A;  1Q81 C;  2DX1 A;  2EYX A;  2AHJ B;  4J9H A;  4F7U A;  1VQM Q;  2HQX A;  1SRL A;  2HQH A;  2QA4 T;  2RI3 A;  2LZ6 B;  2MWO A;  3CCQ Q;  3QDR B;  2DXU A;  2X4W A;  3MKD A;  2JM9 A;  3JCM Q;  1O75 A;  1K9M C;  3G4S A;  3EG0 A;  4CC2 A;  2DVE A;  1OQK A;  2L3S A;  2D6F A;  2QAS A;  4JRI A;  1MMG A;  2ED0 A;  3S6W A;  2JJ9 A;  1QWE A;  1WFW A;  2D1X A;  5FWB A;  2F5T X;  4AG1 C;  4KH1 B;  4C8Q G;  1QMC A;  3OSS C;  2YLC A;  5CVI A;  4C0G A;  5GMK m;  4C92 D;  3M59 A;  4FW2 A;  4E7Z A;  4J9F A;  3C0C A;  3P8H A;  5KYW A;  3D7S B;  2GCX A;  4JJN K;  2RQV A;  4R56 A;  3LWI A;  1NG2 A;  3KUF A;  3ZL7 C;  3RUX A;  1M2O A;  5LJ5 j;  5AYF A;  4KGV B;  1Q95 G;  2HSE B;  2VGN A;  2RI2 A;  3VS2 A;  4MDW A;  1BYM A;  1YWO A;  1W4S A;  2EJF A;  2XDB A;  1KC8 R;  2V8I A;  1H3H A;  4ORZ A;  2Z0W A;  4M75 F;  3X24 B;  4PLL A;  1KG1 A;  1PCX A;  4XTX A;  5L23 A;  4EPC A;  5GAN 7;  2JW4 A;  3E9G A;  2YUO A;  3J80 E;  2BZ8 A;  1N5Z A;  2MK5 A;  2LCC A;  4LDW A;  5CKE A;  1WXU A;  2DYI A;  2LTO A;  1AZG B;  4PFP A;  4C5E A;  4C92 C;  1GBR A;  2JZ2 A;  2D0Q B;  1GFD A;  3HHT B;  4NS5 A;  3RKX A;  2RN8 A;  4KT0 E;  2RA2 A;  4WTO B;  3CC4 T;  2JMC A;  2J6O A;  2KRS A;  4HVU A;  1YJ9 Q;  3VUB A;  1QP2 A;  1JJ2 P;  1M1K U;  1YI2 Q;  5IXB A;  4HA8 A;  3OYF A;  3FDR A;  2MOX A;  2JM8 A;  1TUD A;  4FL6 A;  2DMO A;  5HCK A;  3H6Z A;  4DBH A;  1XQH A;  2FRW A;  2MF2 A;  2JTE A;  2HBP A;  2QAZ A;  2IPO B;  1S72 Q;  2HCK A;  2XG8 D;  3C95 A;  2A08 A;  2KNB B;  3M55 A;  2DPP B;  1YNZ A;  2QI2 A;  1VQK Q;  2GNC A;  3PIP A;  4XTY A;  8AT1 B;  1YJN Q;  4FM4 B;  4C8Q E;  3S3M A;  2FPF A;  5I21 A;  3CCS A;  2I0N A;  4IUP A;  2DTH A;  3CCM T;  1K1Z A;  3PNW C;  3OYK A;  2DL4 A;  1WQW A;  1M90 R;  1D09 B;  3CME T;  5I11 A;  1W1F A;  2DLP A;  3VYG A;  4EMK B;  5GAO l;  4A4G A;  1Q7Y C;  1K8A U;  3PMT A;  1E7O A;  2ESW A;  4M7D E;  1X43 A;  3CCV Q;  4LN2 A;  2DF6 A;  2AIR B;  2RQT A;  4M78 A;  4M7A G;  1Q81 R;  4M77 B;  3EG2 A;  1YFN A;  4PKC C;  4C8Q F;  3PMI A;  3PFS A;  3QYH B;  1JXM A;  2EYY A;  4Y91 A;  4BY6 C;  1RAH B;  3I35 A;  3WVE B;  2AKK A;  2EBP A;  4BUG A;  4RCC A;  4PJO D;  2DKG A;  2E10 A;  1D3B B;  1ZSG A;  3G4S T;  1QCF A;  1QWF A;  4M7D F;  4E7K A;  1X75 C;  1K9M R;  3U23 A;  3QZ5 B;  4F04 B;  1QP3 A;  3NHN A;  4AFZ C;  2ZPB B;  2CP6 A;  3JCM d;  2EKO A;  1GCQ A;  3F70 A;  4N0A C;  1YHQ A;  3A5Z B;  4QQ6 A;  3CC7 T;  2ROT A;  2DA9 A;  4XTZ A;  4C92 G;  3GOX A;  3HRT A;  1VQL T;  2RMO A;  4QKU A;  1SHF A;  1ZSZ C;  2VB6 A;  2X3X D;  1I5L A;  2CDT A;  4KBM B;  5GMK l;  2CH4 A;  5D6Y A;  1OV3 A;  2PUO B;  2KBT A;  3RES A;  1HYO A;  2AK5 A;  2KXC A;  1UTI A;  1VYT A;  2NUP B;  3QO3 A;  3CCU A;  3JAM E;  1YIT A;  1AWO A;  3QXE B;  4PJO C;  3JV3 A;  3R6O A;  2JS2 A;  2HL5 C;  4E7I A;  2HZY A;  5KYY B;  1VQ5 A;  4QQD A;  2LMJ A;  2DM1 A;  2GFU A;  5IT9 E;  2RPN A;  2CRE A;  3HTR A;  3E2U A;  1QLY A;  1KJW A;  4JRQ A;  1VQN Q;  3LGF A;  4FYY B;  2XMF A;  2DL5 A;  1OUL A;  3HP9 A;  3JCM P;  1KFZ A;  1WHM A;  3BDL A;  1NPP A;  2E3I A;  2HAX A;  2H3J A;  3SEM A;  2C0O A;  1KQS P;  2LCL A;  2RJF A;  3TSZ A;  1AOJ A;  2KVQ G;  5GAN f;  4NOY A;  2RD1 A;  5HK0 A;  1P92 A;  4XU3 A;  1YIJ A;  1PD1 A;  3HKS A;  5D6X A;  1M5Q 1;  2VYT A;  3EHR A;  1VIE A;  3WVD B;  1YJW Q;  2YSQ A;  2ZPI B;  1VQ6 A;  1VQ8 A;  4CC3 A;  5GAN 2;  1VQ9 Q;  5KH6 A;  1OI1 A;  2J6K A;  3CCE Q;  1UFF A;  2HBW A;  4DBR A;  4J9D A;  2FVU A;  4WF2 A;  3EFS A;  2W10 A;  3RIR A;  2CP3 A;  3M4Y A;  2KXD A;  4M7A F;  2XKO C;  4J9E A;  4RG2 A;  9ATC B;  2A36 A;  3A8M B;  2QTV A;  4C92 E;  5EG2 A;  3REB B;  5KYW B;  2M1H A;  3QZ9 B;  4JLG A;  4J9C A;  3UA7 A;  3OS2 A;  5GAO r;  1YHQ Q;  3CMA A;  1KQ1 A;  3JSC A;  3GF5 A;  1TXQ A;  5LJ3 g;  2LP5 A;  4ZTJ A;  4PJM A;  2LX7 A;  3JRZ A;  2QYZ A;  1Q7Y R;  3OY9 A;  4M75 D;  2OTJ A;  3OA6 A;  2QQR A;  2GF7 A;  4N4I A;  3OYM A;  4VUB A;  3UAT A;  4C92 F;  3CXC A;  3OYA A;  3SWN C;  5IH2 A;  3CCR A;  4RCB A;  2DTI A;  3CCU Q;  1GFC A;  3JCM W;  4HVW A;  2WAC A;  5IHI A;  1WLP B;  2HKQ B;  1LJO A;  1G3W A;  5GMK e;  3PVL A;  1KC8 U;  4XU2 A;  1N9S A;  1AZE A;  5IXF A;  4FCY A;  1QKX A;  1BKB A;  2NUZ A;  4HKE A;  1R8O B;  2A0F B;  1TSF A;  4XK8 E;  5GAM e;  4BAC A;  4M7D B;  1G8X A;  3EG3 A;  4M75 C;  5DLO A;  1VQ4 Q;  2OTL Q;  2CP2 A;  4FSS A;  3BE3 A;  1I81 A;  3I56 T;  2FB7 A;  1U1T A;  1UHC A;  5I2S A;  1PHT A;  1JRI A;  3V7C A;  1PC0 A;  2KEA A;  2M0O A;  4EMG A;  3FC3 A;  3KXT A;  1M9S A;  2BKD N;  3OYD A;  1GXI E;  3RR6 A;  4A54 A;  3M0P A;  3I55 Q;  4PJO A;  1NYF A;  1BIA A;  5GAN 3;  1D0Z A;  1WJS A;  2DJQ A;  1NE8 A;  2KAF A;  2MMP A;  1XTD A;  2VUB A;  3NPF A;  3OW2 P;  2O4X A;  3GPL A;  3UPU A;  2QXF A;  1ZQ1 A;  4LXC A;  4E47 A;  3INZ A;  2CZ7 B;  3CCL Q;  1FMK A;  5FRO A;  3ZFJ A;  2VKN A;  5D6W A;  1WYX A;  1JBM A;  1OU8 A;  2K5F A;  3H8Z A;  4MML A;  1M90 U;  4ZN1 A;  2XDP A;  1UG1 A;  3PGG A;  3OYG A;  5CR2 A;  1YIJ T;  2KK4 A;  4PJO E;  2FZG B;  5A2Q E;  1HJD A;  5GAN 5;  4D8D A;  1NZ9 A;  4FSX A;  2YT6 A;  4GLK A;  1M8V A;  2OAW A;  4JS4 A;  1ACM B;  1Q81 U;  2EGE A;  1DJ7 B;  3JB9 H;  5LJ3 j;  2M02 A;  2LJ1 A;  2RK2 A;  2JN0 A;  1T3S A;  3I9Q A;  5GAO q;  1J3T A;  2P0Q A;  2RHZ A;  2ZPH B;  1OPL A;  3AT1 B;  3KFV A;  4ZTF A;  2ECZ A;  2O01 E;  3CMA T;  1U06 A;  1MMA A;  5A0L A;  3SHW A;  1N8R C;  4OP0 A;  1AHJ B;  3MEU A;  1VQP Q;  3LH0 A;  2DJZ A;  2KDS A;  5D7U A;  4BE2 A;  2KMT A;  1AEY A;  1RAA B;  5LJ3 h;  3QJ6 A;  1TOV A;  3CCR T;  4XTU A;  3TRE A;  3M0T A;  4J8O A;  2DRM A;  2ZAE A;  4E7J A;  1B7T A;  2WSF E;  2YWW A;  1YCS B;  3OW2 S;  1EIF A;  4OGE A;  1NPR A;  2QA4 Q;  4L6V 5;  4C92 B;  2R58 A;  5CKF A;  3MET A;  1GBQ A;  2COW A;  3EGX B;  5KYY A;  5GAN j;  1C1A A;  3CCM A;  4XU0 A;  1AD5 A;  3CC2 A;  3OB9 A;  3OMC A;  1TUG B;  2YDL A;  2JVV A;  1ZBJ A;  3QJY A;  4LNP A;  2JUF A;  3ASK A;  4RUG A;  1I07 A;  2HL3 A;  3SDZ A;  2V8K A;  2DRK A;  2KY9 A;  2DIL A;  2B86 A;  4M75 A;  3G71 Q;  2KSS A;  3HFO A; 
#chains in the Genus database with same CATH homology
 2DPP B;  3SB2 A;  1G3S A;  2QI2 A;  3MHX A;  2EAY A;  2OTL A;  4RMO A;  3PIP A;  2K3Y A;  4XTY A;  1LNX A;  3O8V A;  4F7U B;  5GAM g;  4J6W A;  5LJ3 e;  3C94 A;  2L8D A;  5CIU A;  3CBP A;  3VKI A;  4FM4 B;  2P0K A;  4C8Q E;  2LC4 A;  3S3M A;  4M7A D;  3OBW A;  3QYG B;  1RL2 A;  2F69 A;  4J5Y A;  5I21 A;  4NL2 A;  4M77 G;  3CCS A;  2Y90 A;  2B8A A;  4IUP A;  2DXT A;  3A8L B;  2DTH A;  3CCM T;  4BDY A;  3PNW C;  3OYK A;  2PVD B;  1WQW A;  2IG0 A;  3LWH A;  2RH2 A;  3CME T;  5GAN h;  5LJ5 e;  3VYG A;  2L3R A;  3N5B B;  5IN1 A;  3GNG A;  4C0D C;  3JCM e;  2CYZ B;  4EMK B;  5GAO l;  4IUR A;  4A4G A;  1Q7Y C;  1Y96 B;  1UGS B;  3I55 A;  1X6O A;  3PMT A;  1K8A U;  4M7D E;  5GAM f;  1IRE B;  4M77 C;  1G3Y A;  1VQ4 T;  3E1S A;  3M53 A;  4R55 A;  1WGS A;  4KUD K;  4C0D B;  2E65 A;  5CK9 A;  2OTL T;  4ATO A;  2DK3 A;  2RHU A;  4M78 A;  3JCM X;  4HCC A;  4M7A G;  5CQY A;  3CC7 A;  2EIF A;  4M77 B;  3QPH A;  5GAO p;  4PKC C;  4M75 E;  4C8Q F;  5GMK h;  3PMI A;  1VQN T;  3PFS A;  4C5H A;  3QYH B;  3CCS T;  2JTF A;  3CEY A;  2VXF A;  3EFR A;  3MP6 A;  4FU6 A;  4FT2 A;  4N4H A;  4B9W A;  1VQL A;  4MDX A;  4RG8 A;  5LJ3 d;  4DQ2 A;  4EDU A;  4Y91 A;  4BY6 C;  2Y4Y A;  4MZT A;  1QVG A;  1VQM A;  5HY6 A;  1BIB A;  3WVE B;  4MZM A;  1WQ7 A;  3CCL A;  4BUG A;  4RCC A;  1KD1 C;  4LDY A;  4O5V A;  4PJO D;  4M7A C;  2DKG A;  2E10 A;  1D3B B;  3G4S T;  4IUV A;  3HL8 A;  3CCQ A;  2XID A;  4BY6 B;  4E7K A;  4M7D F;  1X75 C;  1YCY A;  2LT1 A;  4X9D A;  3BY7 A;  3QZ5 B;  1QP3 A;  2G3R A;  3OYN A;  5C0M A;  3MO8 A;  5LJ5 d;  2ZPB B;  5I2M A;  4C0F A;  1UB4 A;  1K9M U;  4M7A B;  2RM4 A;  2VC8 A;  1KHC A;  2EKO A;  3TEE A;  3JCM d;  3F70 A;  1YHQ A;  4N0A C;  3OYC A;  1Q7Y U;  4XQ3 A;  3OQ5 A;  2ZPE B;  3A5Z B;  4J6X A;  4QQ6 A;  3VUZ A;  2K5I A;  4CRI A;  5LJ5 g;  3CC7 T;  5GAN 8;  5A0D A;  5GAN e;  4XTZ A;  4C92 G;  3JCM g;  1HK9 A;  1YJW T;  1KQS A;  2VV5 A;  3PIO A;  1Y7X A;  3GOX A;  1VQ9 T;  3HRT A;  1VQL T;  1M4Z A;  3QHS A;  1UGP B;  4NL3 A;  3ZEH A;  3M4G A;  5A0G A;  3P8B B;  3CCE T;  3JB9 F;  5CO7 A;  4PJO G;  4BE1 A;  3TU4 K;  1RI0 A;  1I5L A;  3TCJ A;  4KBM B;  3ZBD A;  5GMK l;  2R57 A;  2E70 A;  5D6Y A;  3V8K A;  2K57 A;  2PUO B;  5LJ5 f;  3X25 B;  3SWN A;  3RES A;  4C8Q A;  1KD1 U;  3JCM f;  5KCH A;  4QVZ A;  3ER0 A;  4KUI A;  1XNI A;  5GAN 6;  5KE2 A;  3QO3 A;  3X20 B;  3CCU A;  1YHQ T;  3JAM E;  1YIT A;  4LDV A;  3QXE B;  1K73 C;  3HFO A;  1QW1 A;  4PJO C;  2V8J A;  4M78 D;  3R6O A;  3OYE A;  4E7I A;  1G3T A;  3MP8 A;  3FLG A;  2RJD A;  1VQ5 A;  4F7U G;  3A8O B;  4QQD A;  2BUD A;  3DB4 A;  3JCM J;  2Y4X A;  4LDU A;  2CS7 A;  1QVF A;  1BI3 A;  4PJO B;  2RO0 A;  3M57 A;  2GFU A;  5IT9 E;  4M7D A;  1BI2 A;  1BI1 A;  4LD6 A;  5GAN d;  1VQP A;  4Z02 A;  4LD9 K;  3CPW A;  3L2V A;  4BD3 A;  1FXX A;  2JTM A;  1NJI C;  4MMK A;  5GAN g;  3OYI A;  5GAO n;  4YTL A;  3MEV A;  3VJP A;  3L2U A;  2ZZD A;  4JRQ A;  3L2W A;  3LGF A;  2EYQ A;  2O4X B;  3CBM A;  4II1 A;  2QDY B;  3HP9 A;  3JCM P;  2PVG B;  3SFM A;  5HKC A;  2DXB A;  3C4S A;  3CCU T;  1LOJ A;  1YIT T;  2DIQ A;  3BDL A;  5GMK j;  1NPP A;  3GNF B;  5CAI A;  2QA4 A;  2HAX A;  1VQ5 T;  2H3J A;  3OS0 A;  4OMF B;  4BE0 A;  1WJR A;  1K73 U;  2LCL A;  2RJF A;  4P5N A;  4O6J A;  1YJ9 A;  4M77 F;  2KVQ G;  5GAN f;  1H3Z A;  3L2Q A;  3CC2 T;  4JDS A;  5GAM j;  4NOY A;  2RD1 A;  1YI2 A;  2DAQ A;  4XU1 A;  3QBY A;  2RJE A;  4M78 C;  5HK0 A;  1MGQ A;  1P92 A;  2K4Y A;  4C5I A;  2FHD A;  4XU3 A;  3V8J A;  2E41 A;  5KCO A;  1YIJ A;  2ZPF B;  3HKS A;  5D6X A;  3QG1 A;  1M5Q 1;  2VYT A;  2D9T A;  1VIE A;  3QKJ A;  3WVD B;  4KUL A;  2LQ8 A;  2ZPI B;  1VQ6 A;  1VQ8 A;  2RB6 A;  3NTK A;  4M78 B;  5GAN 2;  5FU6 C;  5KH6 A;  1OI1 A;  1NJI U;  4C8Q D;  3G6E A;  1S72 A;  3MEA A;  4IUU A;  2FVU A;  4WF2 A;  3EFS A;  3G71 A;  2XI9 A;  2CZ6 B;  3DLM A;  5FU6 B;  3OS5 A;  3RIR A;  5IAY A;  2QQB A;  3M4Y A;  4A4H A;  1VQK A;  4M7A F;  1FWZ A;  3E9F A;  2X4X A;  2XKO C;  2LQK A;  3M9Q A;  3MEW A;  3A8M B;  4RG2 A;  4C92 E;  2A7Y A;  5EG2 A;  3JCM b;  2M1H A;  3QZ9 B;  2DEQ A;  4JLG A;  3GLX A;  1YJ9 T;  3FIF A;  1YJN A;  4FIB A;  3BFM A;  1WNL A;  3OS2 A;  2X35 A;  1N27 A;  2JNG A;  4OF1 A;  4BB7 A;  5GAO r;  4M7D D;  3NTH A;  2L5Q A;  3FJP A;  3LW5 E;  2QEX A;  3CMA A;  4EMK A;  1KQ1 A;  2VGM A;  3WXM B;  3JSC A;  3GF5 A;  3JB9 J;  1Y96 A;  5GAM h;  5LJ3 g;  5M9O A;  2E6Z A;  4ZTJ A;  1XOV A;  2QTX A;  3I55 T;  2KQW A;  3JRZ A;  1VQ6 T;  1VQ8 T;  3OYY A;  3ME9 A;  3S3N A;  2YLB A;  5LL6 S;  5C6S A;  1U8R A;  1Q82 C;  2XIC A;  3OYH A;  3M5A A;  2RJC A;  3OY9 A;  4M75 D;  3CCV A;  2OTJ A;  4PLI A;  3KBG A;  5J39 A;  3P8D A;  3OA6 A;  4HCZ A;  4M77 A;  4XTW A;  2DIG A;  2EQJ A;  2QQR A;  2YRV A;  2FL7 A;  4XTV A;  3JCM c;  3G71 T;  1JJ2 S;  3HRS A;  2LT4 A;  1VQK T;  2GF7 A;  3CD6 A;  4N4I A;  1FX7 A;  1I8F A;  3JB9 D;  3OYM A;  4VUB A;  4C92 F;  3CXC A;  3OYA A;  3DKM A;  4F7U E;  2DO3 A;  3SWN C;  3CCR A;  1VQO A;  1YJN T;  2RI5 A;  4RCB A;  2DTI A;  5J26 A;  5LJ3 f;  2ZPG B;  4C8Q C;  4M7D G;  4OVA A;  4V2S A;  2K5L A;  2LX9 A;  4A4F A;  4JUV A;  1VQM T;  2QQS A;  5CKH A;  4C0Z A;  2QEX T;  3CCL T;  3JB9 I;  2HD0 A;  4PJO F;  2LVM A;  1D3B A;  3I56 A;  3JCM W;  3C12 A;  4DA4 A;  4DOW A;  5DY9 A;  2WAC A;  4J83 A;  3OW2 A;  3CCQ T;  3CC4 A;  3QUI A;  4TVR A;  1LJO A;  3UDC A;  2R5A A;  1G3W A;  5KE3 A;  4M75 G;  5GMK e;  3PT9 A;  4M7A A;  1KC8 U;  4XU2 A;  4M7D C;  1OZ2 A;  2OTJ T;  2BIV A;  3EAE A;  1N9S A;  4QVC A;  4BI4 A;  2DZC A;  4XAX B;  1Q82 U;  5HK3 A;  5J3B A;  1BKB A;  2QQ9 A;  3M55 A;  2JOY A;  1WPY A;  1R8O B;  4HKE A;  1N6A A;  4XK8 E;  5GAM e;  4BAC A;  3GP8 A;  4M7D B;  1BI0 A;  2LDM A;  4F7U F;  1VQO T;  3VV0 A;  2VXE A;  4M75 C;  4M77 E;  2PU9 B;  5DLO A;  2XHC A;  1ZHI A;  1B34 A;  2X4J A;  3MCA B;  3DLL A;  3CCJ A;  1QVP A;  1Q86 C;  2CZ0 B;  3G7Z A;  1I81 A;  5CKD A;  4OB2 B;  2I2L A;  3I56 T;  2FB7 A;  2E12 A;  1U1T A;  1I4K 1;  4M75 B;  1KHI A;  3V7R A;  4J6Y A;  3VYH B;  5LJ5 h;  2MI6 A;  3L42 A;  3RKW A;  5I2S A;  3JCM h;  3PTA A;  3HRU A;  1JRI A;  3MP1 A;  3URG A;  1VIF A;  2NLU A;  3V7C A;  4ZN3 A;  1KQ2 A;  2ZCF B;  1ZBX A;  4C92 A;  2HQE A;  3OMG A;  5DM7 R;  5GAO m;  2M0O A;  4M78 G;  3OSV A;  1M1F A;  4EMG A;  3FC3 A;  3OS1 A;  3KXT A;  2RHX A;  1M9S A;  2BKD N;  1OZ3 A;  1M90 C;  2E1H A;  2M9U A;  3OYD A;  1GXI E;  3LGL A;  2OAU A;  4A54 A;  3UT1 A;  4M7A E;  4IUT A;  4IKF A;  1PSE A;  2IVW A;  3L1A A;  2RHI A;  4E7H A;  1W2B S;  2A3L A;  3CME A;  1QVF S;  4FT4 A;  1BIA A;  4PJO A;  3A8H B;  2PVO B;  3LLR A;  4QQG A;  3OBY A;  1HXD A;  4L5G A;  5GAN 3;  1WJS A;  5FLX E;  1MHN A;  3DB3 A;  3A8G B;  4BDZ A;  1IZ6 A;  3CCJ T;  4CI0 C;  1VQP T;  3OYB A;  1NE8 A;  2XDD A;  1SSF A;  3BDU A;  3FB9 A;  2KAF A;  2E6N A;  5FU7 C;  3UWN A;  3X26 B;  5GAM d;  1KC8 C;  2MMP A;  2K3X A;  4A4K A;  5FRM A;  4UC4 A;  4B9X A;  1XTD A;  4PL6 A;  3RMS A;  2VUB A;  3S3O A;  1Q81 C;  2O4X A;  3GPL A;  2GQV A;  3UPU A;  1Q86 U;  2QXF A;  4Q5W A;  5FU7 B;  3L2R A;  4E7L A;  1YBY A;  4RKU E;  5DLQ E;  2AHJ B;  3RER A;  2ZGW A;  4ZGJ B;  1ZQ1 A;  1VQN A;  4OB1 B;  4F7U A;  4E47 A;  3INZ A;  2F5K A;  2HQX A;  4BI8 B;  2CZ7 B;  4EMK C;  4J7I A;  2MWP A;  3J7A F;  4ME7 A;  5FRO A;  3ZFJ A;  4A53 A;  2RI3 A;  2QA4 T;  4HT8 A;  4X34 A;  4GY5 A;  5GAN 4;  2MWO A;  5D6W A;  3OYJ A;  3QDR B;  1JBM A;  2DXU A;  2X4W A;  2K5F A;  3H8Z A;  4MML A;  1M90 U;  2PUK B;  1O75 A;  2R5M A;  4ZN1 A;  3JCM Q;  1X01 A;  2PQW A;  2XDP A;  3J81 E;  3HPW A;  3G4S A;  1K9M C;  3PGG A;  3V8L A;  1YI2 T;  1O9S A;  3FRN A;  2DVE A;  3HSB A;  3OYG A;  2D6F A;  2E5Q A;  3CBO A;  2KK4 A;  4JRI A;  2WSC E;  5CR2 A;  5A2Q E;  3OYL A;  3S6W A;  1OYX A;  1YIJ T;  4PJO E;  2HNI A;  4A4E A;  5GAN 5;  5L8R E;  5GMK i;  2F5T X;  1M1G A;  4HT9 A;  4ZGD B;  1NZ9 A;  4C8Q G;  1UGR B;  1Y71 A;  2EWN A;  3OSS C;  4FSX A;  2YLC A;  4GLK A;  4MZP A;  1YJW A;  1JJ2 A;  3X28 B;  5CVI A;  1G5V A;  4C0G A;  1M8V A;  3G6E T;  3HFN A;  2MAM A;  4IUQ A;  2YHT A;  5GMK m;  4JS4 A;  4C92 D;  1DJ7 B;  4N4G A;  3M59 A;  1S72 T;  4ELY C;  1Q81 U;  5LJ3 j;  1VQ9 A;  3JB9 H;  2L89 A;  4OB0 B;  4OGC A;  1PSF A;  3P8H A;  2RK2 A;  2JN0 A;  3CCE A;  5GAO q;  2P0Q A;  2EJ9 A;  2GCX A;  3BW1 A;  4JJN K;  2DD4 A;  2XD0 A;  3AHU A;  2RHZ A;  3LWI A;  4R56 A;  4QVD A;  2ZPH B;  3NTI A;  3JCM V;  5CQX A;  4C5G A;  3M56 A;  2XK0 A;  3T9N A;  1QVG S;  1H64 1;  3KUF A;  5FRN A;  3RUX A;  5LJ5 j;  2LRQ A;  4ZTF A;  5AYF A;  4DOV A;  4HCB A;  3CMA T;  1N9R A;  2O01 E;  2VGN A;  1TH7 A;  2P4T A;  2RI2 A;  3QII A;  3SWN B;  4MDW A;  1BYM A;  4C8Q B;  4J7F A;  1W4S A;  3M58 A;  4OB3 B;  1M1K C;  2EJF A;  2XDB A;  5A0L A;  2V8I A;  4JRK A;  4ELZ C;  1N8R C;  2DXC A;  4OP0 A;  3X24 B;  4M75 F;  1AHJ B;  4PLL A;  2EFI A;  1KG1 A;  3MEU A;  2C06 A;  4EMH A;  1UEB A;  4XTX A;  1U1S A;  3CCV T;  3QSU A;  4EPC A;  3LH0 A;  4Y28 E;  5GAN 7;  2DJZ A;  2KDS A;  3LYI A;  4M78 E;  4BE2 A;  2KMT A;  3E9G A;  1KQS S;  3CXC S;  3JB9 G;  3SD4 A;  3J80 E;  3CD6 T;  1VQ7 A;  3V7S A;  3LX7 A;  5LJ3 h;  1B34 B;  3FEO A;  4N0A A;  4ZGE B;  2LCC A;  2RHY A;  2XU8 A;  3M54 A;  3QJ6 A;  2EJG A;  4LDW A;  5CKE A;  3RKY A;  3CCR T;  4XTU A;  2LTO A;  3VU3 C;  3TRE A;  4C5E A;  2EQK A;  4J8O A;  2E64 A;  4C92 C;  4JS5 A;  2JZ2 A;  2D0Q B;  3RMQ A;  2CKK A;  4E7J A;  2RK1 A;  3HHT B;  4X9C A;  2WSF E;  3CPF A;  4NS5 A;  3OW2 S;  1EIF A;  4L59 A;  4QW2 A;  3RKX A;  4PNO A;  1NPR A;  4OGE A;  5CCA A;  1UGQ B;  4KT0 E;  1WJQ A;  2RA2 A;  2CGH A;  4L6V 5;  4C92 B;  3CC4 T;  2QQA A;  2X4Y A;  2P0P A;  2R58 A;  2DZ9 A;  2LNV A;  3E19 A;  1JB0 E;  3GIB A;  2DD5 A;  2FYK A;  1VUB A;  5CKB A;  4LDX A;  3VUB A;  2WSE E;  4JLI A;  5CKF A;  1QP2 A;  3MET A;  1M1K U;  2CZ1 B;  2M16 A;  4BI3 A;  4HA8 A;  4JRP A;  3OYF A;  4M78 F;  3FDR A;  1W2B A;  3NFC A;  1N8R U;  5GAN j;  3CCM A;  4XU0 A;  4M77 D;  3CC2 A;  1K8A C;  1VQ7 T;  3OB9 A;  4FL6 A;  2GFA A;  3H6Z A;  1Y07 A;  4D6W A;  3OMC A;  2JVV A;  2DTO A;  1V29 B;  1XQH A;  2MF2 A;  3QJY A;  2JUF A;  2HBP A;  3CPW S;  2EQU A;  3ASK A;  3SDZ A;  2V8K A;  2KY9 A;  2XG8 D;  3C95 A;  3Q1J A;  4M75 A;  2K2V A;  3L2Z A;  1VQ4 A;  2KSS A;  2EQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...