5A0DA

N-terminal thioester domain of surface protein from clostridium perfringens, cys138ala mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
175
structure length
175
Chain Sequence
KYKGYTLLDKYPKEDDFRDAIYIEDMDNNDTSSVVYAFNVTKATPTFKGSVVKVLYNEQFGSSKLFTEKAIKPRVKGDELKNSVLRVIYNGYPSNALGIKEKYQLTEGQFRKLTQRAVWNFTDSNLSLDKLSQKEIDALNELINAKNAIPDNLVLNLYLPDDSYYQNLLGTKFVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An internal thioester in a pathogen surface protein mediates covalent host binding.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Cell adhesion
molecule keywords SURFACE ANCHORED PROTEIN
total genus 58
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5a0dA01
5A0DA 5A0GA 4BUGA 2XIDA 4C0ZA 2XI9A 2XICA 5A0LA
chains in the Genus database with same CATH superfamily
3CCJQ 2LT4A 1SSFA 3ULRB 3CMET 5LL6S 1GXIE 2K2MA 4JRPA 3CCSA 4MZPA 4FYWB 1VQ4T 5CVIA 1UECA 3M57A 3SD4A 3LH5A 1S72Q 2GFUA 2KSSA 1ZUUA 4M77D 1M8VA 4QVZA 3RKWA 1K9MU 5KYYB 1K4US 4M7DA 2O2OA 5GAOl 1R77A 1MMGA 1VIEA 3LWIA 2DXTA 4AG2C 2E41A 4CC7A 4XU3A 4DQ2A 4KGXB 1TUGB 3QPHA 3QDFA 3X28B 3CD6A 1M1FA 2P4RA 4X34A 2FHDA 1B34A 1I07A 1OQKA 1UJ0A 2DYBA 1UEBA 3LGFA 4M77A 5GANg 2ED1A 3V7RA 2LCSA 1VIFA 4F04B 3CPWA 3TSZA 2JNGA 2CZ0B 2YUQA 4LDWA 2IG0A 2K5FA 2SEMA 1I5OB 1WJQA 2LC4A 5HKCA 5DLOA 5GAMg 3VS2A 2BIVA 2VVKA 2CP2A 3CC4A 3O8VA 1ZA2B 2KBTA 2DD4A 4PJOF 5CK9A 4DA4A 5CO7A 3HTRA 3A98A 1VOMA 3RMQA 3I55Q 2FPFA 2KXDA 4E7IA 1SRMA 5KCOA 1NJIC 2K57A 3CCQT 2CT4A 1DJ7B 2GFAA 4XU1A 3M56A 2KNBB 2DTOA 4PJMA 1Z9ZA 2JS2A 4RCCA 1MV3A 5CKBA 1YCSB 1QVPA 2HBPA 2A7YA 1C1AA 1G5VA 1GFDA 1BU1A 1G2BA 1OPKA 4JRQA 1YI2T 2E65A 2QA4A 5KYWA 1X75C 1SPKA 4FW2A 2KYMA 7AT1B 2X4WA 2E64A 5IHIA 2XICA 1BI0A 1VQ9Q 1W1FA 2LCLA 2QQSA 2I0NA 4L5GA 3NGPA 4XTZA 1YHQT 4KULA 1K9MC 2D6FA 3A8OB 1ZA1B 4ME7A 1YHQQ 1BI3A 3OS0A 2V8IA 4M78F 2K5IA 2RN8A 4BE1A 2FO0A 1U1SA 4M7AB 1I81A 4J9HA 3CCVQ 2EBPA 3EFRA 3L2ZA 4RG8A 4M75D 4HCBA 4PJJA 4XQ3A 1VQ4Q 1PSEA 1V76A 2JN0A 4E7LA 1AWOA 1K73R 2K4YA 5DY9A 1U1TA 4M75A 4A4FA 2D8HA 1NE8A 4EMGA 3OYJA 1QWFA 4QVCA 3C4SA 5KYNA 3JCMb 4FW1A 1G8XA 2KGTA 4FIBA 4ZGDB 1WZOA 3DKMA 2F5KA 4C5GA 1TUDA 4DEYA 4R56A 4EMHA 1OPLA 2EGEA 2ZZDA 3I55T 2DL5A 2RQTA 1Y07A 4M7DG 4HXJA 1Q82R 3CC7Q 2M0OA 2CGHA 1TWBA 2FRYA 4IKFA 1KC8R 5GANd 4ATOA 3H0HA 1ZUKA 4FL6A 4RKUE 2RA2A 4JPBW 1N6AA 2EYXA 3FRNA 5IXBA 3OYIA 4O6JA 5CQXA 5C6SA 4Z89A 2DJQA 2QI2A 4CC2A 4KGVB 1JBMA 1O9SA 3JCMJ 1Y96A 2P0KA 2EVRA 4CC4B 1VQOT 1RAHB 2LP5A 2NLUA 1UB4A 4C92C 1WHLA 1MNDA 5LJ5g 2JT4A 2GF7A 3SEMA 2G6FX 4B9WA 1PKSA 2ENMA 1NEBA 2O9SA 3M0QA 3RBBB 2CYZB 1FX7A 1MV0B 1UGVA 1N8RC 3M0RA 1RUWA 4C8QC 5KH6A 2HL3A 1VQPQ 1S72A 2BZXA 4LDVA 4PLIA 1RAIB 1OV3A 2E70A 4J83A 2V8KA 5GAOq 4D6WA 4M77E 4C5EA 4ELZC 1AT1B 2E6ZA 3HPWA 2LNVA 6AT1B 5LJ5f 3V8JA 4QVDA 2LJ3A 4TVRA 4F17A 2PVGB 1T3SA 3VS5A 1EX4A 1UHFA 3ZFJA 1YI2A 1IRXA 1PRMC 1XQHA 1UGQB 2YUOA 5KYYA 3J81E 2EQKA 3QKJA 4XU2A 3REBB 1X43A 2RK1A 1GL5A 3NTKA 2DMOA 2F2XA 1BIBA 3NHNA 2RNAA 1T0JA 1I1JA 1SRLA 3P8HA 5FRNA 1WHGA 2CSQA 5LJ5j 3L2WA 3G4ST 1T3LA 3CEYA 2KMTA 2JTMA 3OYNA 2E6NA 4FSXA 4PL6A 3EG0A 5LJ5h 3LWHA 1JJ2S 3TCJA 3OB9A 2RJCA 5KYXB 3G71T 3QJYA 4PJOE 1R0BG 4UC4A 4A63B 1A0NB 3EFOB 2NUTA 5GAN6 1MUZA 4C92F 2DM1A 3JCMV 5J3BA 2DIQA 3GNGA 5A0DA 1BCMA 2O4XA 2J7IA 3TEEA 1GCQC 4LNPA 5GAOp 5FROA 2EQMA 3N5BB 4JJBA 1PHTA 4AFSC 1RLPC 1FMWA 1WHJA 4YTLA 2CSIA 4MMKA 2MI6A 1QWEA 5LJ5d 3FB9A 2KRMA 2HCKA 4BDZA 2ATCB 2DVJA 2RF0A 1UHCA 1D09B 1UJYA 2MPXC 2P4TA 4ESRA 3M55A 1RAGB 2DEQA 2BE9B 5KE3A 1VQ8Q 4ZN3A 3CCST 4NL3A 1MMDA 3JV3A 4M78E 1M5Q1 4AG1C 3REAB 1H8KA 3L2RA 1AEYA 2DTIA 1JU5C 2QK0A 2XI9A 5FLXE 1ZSZA 4M7AC 3URGA 1S72T 4FU6A 1CKAA 4RUGA 1PD0A 4FYVB 2WACA 3FC3A 2O01E 1W2BP 4OMPA 3CPFA 2BZYA 1XNIA 3LLRA 3KXTA 1NLPC 3UWNA 5D7UA 2DLPA 2L3QA 3CCSQ 3PFSA 4M77B 5AYFA 4LUDA 3OW2P 3VYHB 3JCMX 3WVDB 1JRIA 2AT1B 3ME9A 2YUPA 5J39A 2L3SA 2PU9B 2LQKA 3CCLQ 2ZGWA 1U3OA 2EJGA 3M4GA 2JVVA 4J6WA 3VS4A 4OB2B 1Q86C 3CCUQ 9ATCB 4L6V5 1LPLA 1U5SA 3FJPA 5CIUA 3T9NA 4JZ3A 4Y28E 5DM7R 2O9VA 2EYZA 1M3CA 1WXBA 2DPPB 2DKGA 1AZEA 3OYGA 3QDRB 1H92A 1QKWA 1NPRA 1TH7A 1FMVA 2FVUA 2W10A 4J6XA 1F1BB 3FIFA 4E47A 2OX7A 1VQ6A 1WXUA 3GBQA 5IHNA 5D6XA 2HSEB 1CSKA 2G3RA 1EFNA 2OTLA 3M0PA 4C5IA 1X01A 1WFWA 1UFFA 1PWTA 2X51A 4JZ4A 2RMOA 4PJOA 3CC2T 4JJNK 4J6YA 3NTIA 3HRSA 1W2BA 3HHTB 2RQUA 1TG0A 4EMKB 1VQPA 2VXEA 3FJ5A 1WNLA 2MWOA 5CCAA 3S6WA 3V7CA 3I35A 1QVFA 2KYBA 2MK5A 4C8QF 2L2PA 2LVMA 1Q7YC 3EGXA 1QCFA 1WYXA 2V26A 4QW2A 3AT1B 2A28A 2X35A 1NYFA 3SB2A 1R0CB 1VQNT 2EYQA 2O4XB 1VQ7A 2QA4T 2VXFA 1P92A 4QQDA 3M0UA 2FZKB 4NOYA 4Q5WA 4M7AF 5HCKA 3M58A 2VGNA 2DRMA 4PJOC 1B34B 1X6GA 4J9DA 1AVZC 1SF9A 2CP7A 2RHXA 2AKLA 2RQRA 4OMMA 1VA7A 4RTYA 3ZEHA 2YXYA 1QVGS 2PZ1A 3JB9J 2HQHA 5IAYA 2KDSA 2KQWA 5C0MA 3CC2Q 3ASKA 2DL3A 4J8OA 5EG2A 4PFZA 3V8LA 1ZHIA 2L3RA 1XJWB 1RACB 3TQ7P 2COZA 3UATA 1KQ2A 1VQNA 3JAME 5FU7B 3JCMf 1I4K1 3JCMe 1N27A 4V2SA 3UT1A 3QYGB 3KBGA 4X9DA 3QWYA 4BI8B 3BFMA 3FLGA 4M78G 4QKUA 4ANJA 2QDLA 1KC8U 4C0GA 4C8QB 2CP6A 3Q1JA 2CZ7B 3DLMA 2AHJB 1VQ4A 2I2LA 3TU4K 2VKNA 1ZX6A 3UA7A 2CP0A 1VQKT 4II1A 4RTTA 5LJ3j 2QAZA 2RH2A 3JSCA 1M90C 5IT9E 1WHKA 3H9NA 3UA6A 1ZBJA 3OMGA 1SHFA 2GNCA 5KYUA 2QEXQ 3CD6T 5GMKi 2YRVA 4P5NA 1YIJT 2R57A 3AHUA 2DJZA 1QLYA 3LW5E 1SG5A 2DD5A 2ZPGB 1YJNT 4PNOA 1G83A 1NYGA 2CT3A 3CC2A 2DXBA 4PJOD 4J5YA 1WI7A 2JMAA 1K1ZA 2EKHA 3MEVA 1VQNQ 4HT8A 4ZNXA 5A0LA 1KK7A 1PG5B 5GAN2 5GAMh 1NEGA 2EJ9A 3C95A 4J9FA 3KUFA 2X9HA 5CKEA 3MEUA 1OU8A 4R0KA 3MEWA 2D0NA 2PUOB 1Q82U 1ACMB 4X9CA 2WSEE 2BUDA 1KIKA 1PKTA 4N4HA 1ZBXA 3L1AA 5GMKj 1OYXA 1HYOA 4FYXB 2K9GA 1VQ8T 4E2FB 1I5LA 1W70A 1OZ2A 5I2MA 1WGSA 3CCJA 2FPEA 2EYYA 4ZTFA 4IURA 2QDYB 3CCJT 2KRSA 3M53A 4PJLA 3RERA 2KT8A 2L89A 3CCQQ 4DOWA 2QTXA 2VV5A 1TU0B 1YIJQ 2KAFA 2COWA 2E4HA 4OP0A 3LGLA 4M75F 2J06A 2IPOB 4HVUA 3GNFB 3UDCA 4J7FA 1WIEA 1X2QA 1WPYA 2L0AA 2A36A 4MDWA 2OI3A 2YUNA 1LCKA 5GJVB 3EGUA 2JS0A 1KQSP 5GAN8 2CZ6B 1BI2A 3OYHA 1YITQ 3BE3A 3A8LB 4M7DB 1M8MA 2XMFA 2EIFA 2ZAEA 1YJ9A 1N8RR 5FU7C 3CC4Q 4IUVA 2XU8A 3HP9A 3VJPA 2DTHA 3PMIA 3G71A 2XHCA 2FB7A 4M7DD 1RLQC 2QG9B 3NFCA 1XTDA 5IN1A 3I55A 4XTWA 2RI3A 2J6KA 2HAXA 5CR2A 3M59A 1TS9A 4HVVA 4ORZA 3HSBA 2V1RA 2X4JA 1X2KA 2KT1A 4XU0A 3L2VA 2JXBA 5GMKe 2FZCB 1VQLA 1SEMA 4XTXA 5CKDA 3QUIA 5GANh 3L2QA 2QEXA 2DNUA 1E7OA 4JRIA 4RTUA 3SWNC 2ZCFB 4PKCC 3PMTA 4LD6A 4ELYC 1D0YA 2Y4YA 2GGRA 4RG2A 3CCMQ 3EG2A 3QHSA 2LNHB 1IZ6A 4C8QA 5GMKh 3CCEA 4E7SA 2D0QB 5GAN7 1T0HA 2RI2A 5LJ3d 1YHQA 5GANe 4OGCA 2DBKA 3KFVA 4PJOG 1Q86U 3R6NA 1GCPA 3I5RA 4E7ZA 2AKKA 1M30A 4HCKA 3RUXA 4J9CA 1UGSB 2R58A 3CBMA 1OULA 1QVGP 5GMKm 5I22A 1YJ9Q 2EAYA 5FRMA 2KE9A 1G3SA 2LQ8A 5LJ3g 3OYLA 2K7AA 2NUPB 2HSPA 2F1LA 4BI3A 5HY6A 4F7UF 3OY9A 1JEGA 2MMPA 4N4IA 3LYIA 1VQOQ 4A54A 2D9TA 1HK9A 2VC8A 4M78B 2AIRB 5I2SA 4OF1A 1Q86R 3NTHA 2XD0A 2L5QA 1QKXA 2D8JA 2OTLT 1Q95G 2ZPBB 4LDUA 1MHNA 2CZ1B 4IUPA 5GAOn 4OMNA 2DX1A 2K3XA 3BDLA 4C8QE 1FXXA 2LRQA 2ROLA 2DILA 1JO8A 3CC7T 1O75A 2BTTA 1YCYA 3EFSA 3G6ET 1YJWQ 1X6BA 4C92E 5GAMj 1M2VA 3MCAB 1BKBA 4EMKC 5HK3A 2QGGA 2DZCA 2EKOA 2HMAA 4BACA 4OMLA 1NLOC 1VYTA 3PIPA 3G6EA 3VKIA 2CH4W 4QT7A 5LJ3f 2LJ1A 3CCET 2DA9A 1G3WA 2PVDB 2WSFE 1QVGA 3CQTA 1VQ5Q 1KD1U 2DRKA 4J9GA 1PSFA 1H3HA 4C0ZA 4LXCA 2KRNA 1AWWA 1D3BB 3MPUB 3U23A 1VQPT 1Q7YR 2XG8D 1KQ1A 3PE0A 4A4EA 3GF5A 1YJNQ 1ABQA 3CCVA 3MP8A 4JLIA 3A5ZB 2LTOA 4KT0E 1I8FA 3IQLA 4ZGEB 4WTOB 1E6HA 2QEXT 1ZQ1A 2JMCA 3CXCA 2A08A 5FW9A 4M75G 2E12A 2YRDA 2C0IA 3VV0A 2DFUA 2ROTA 2RD1A 4M75E 2NUPA 2DXCA 2LQNA 4GLKA 2ESWA 2M9UA 2DBMA 2DIGA 5IH2A 3OYMA 1GRIA 2LDMA 2GTOA 4C8QG 4GLMA 5AT1B 3J80E 4F7UE 4HCZA 3X25B 3J7AF 3BW1A 1D3BA 2DO3A 3E9GA 1NPPA 4C5HA 2DAQA 4PFOA 1HJDA 3E1SA 2JTEA 2J05A 1RAAB 1OX8A 1IHVA 1IXDA 3MHXA 1YITA 1MGQA 4A4GA 1YITT 4FCYA 2Y90A 4M77C 3PIOA 1M1GA 1JQQA 3CCRA 2YT6A 3G1JA 3G4SQ 3OYAA 2M1HA 4OB0B 4B9XA 2DZ9A 4KH1B 3JCMh 2C06A 2HBWA 4BUGA 1IO6A 1KSWA 2E5QA 1K73C 2RJEA 4Y92A 1YJNA 2FRWA 3GPLA 3MP6A 2FEIA 4IUTA 4LE9A 3RESA 4OMQA 2K79A 3RKYA 4AT1B 1QQJA 2HQXA 2EJFA 5GAMd 2QASA 2LX9A 3JCMW 5LJ5e 5GANj 3CPWP 2Y4XA 3EHQA 4BE0A 3OMCA 3EFOA 2MOXA 4BY6B 1K8AC 3RDVA 2EFIA 3MJXA 4AFZC 2KROA 4C0DC 5CQYA 4J9EA 1ZSGA 2C0TA 4JDSA 1ZSZC 3X20B 5DLQE 4ZGJB 1AOJA 1RI9A 2AZVA 2ED0A 2O88A 3V7SA 1HSQA 2MYSA 1OI1A 2ZPIB 4X1VA 4MMLA 2HD0A 2LX7A 1Q81C 4OMOA 3A8HB 4C8QD 2CKKA 1OOTA 2YDLA 2XKOC 2HL5C 3VS3A 2DEUA 5D6WA 2JOYA 2RJDA 2QYZA 3JB9H 3X26B 2YHTA 1X69A 3CCRQ 1J3TA 4JJDA 2H3JA 1VQ9A 3H0FA 1BIAA 1GBQA 1VYVA 4ZN1A 1GFCA 3SDZA 4M7DE 1JJ2A 3EGXB 5GAMf 3EG3A 1PNJA 3JCMg 3QYHB 3EG1A 1QP3A 2KY9A 3CMAA 4BI4A 3MKDA 4C92A 4J9BA 2B86A 1V29B 2CREA 1OZ3A 2HKNA 1RADB 4M7AG 3VRZA 2CP5A 2CH4A 2BKDN 1PM3A 3QIIA 5CKHA 3EGDA 3JCMd 2RPNA 3VUBA 4M7AE 4N0AA 4BDYA 1JJ2P 1Z9QA 5LJ3e 2RQVA 4F7UB 4RTXA 1MMNA 3WVEB 3CCUT 1YN8A 2L8DA 3E2UA 3QSUA 2MWPA 5I11A 3JCMc 4RTZA 2RHYA 3P8BB 4EDUA 5LJ3h 2KVQG 2QQ9A 2ZPEB 1JXMA 1BB9A 4QQ6A 3H41A 2DK3A 4DOVA 3SWNB 3JB9F 3VS0A 5L23A 1KHCA 3E19A 1NJIU 2FL7A 3S3NA 2OAWA 1Y96B 1CKBA 1SHGA 2M0YA 2F2WA 1VQ5A 4MZTA 2E3IA 4OVAA 1U06A 1K0SA 3QXEB 2EYWA 4OB1B 2RI5A 2J6OA 1VQKA 2CDTA 4FM4B 1M2VB 2XDDA 4WF2A 1KHIA 4KRTA 4Z88A 5J26A 1PCXA 2FYKA 2JJ9A 3MP1A 3M0SA 1I0CA 3BY7A 3GIBA 3HFOA 1VQLT 1C6VX 1K76A 3I56A 4KH0B 2P0PA 1VQMT 4AMCA 2LQWA 3EG9A 4CRIA 2GBQA 4OB3B 4Z02A 1M90R 3CMAT 1Y7XA 5GAOr 4MDXA 2MF2A 1FYNA 1M1KR 1RAFB 1VQ7Q 2COYA 4RTVA 2RJFA 3CCLA 1LJOA 1WLPB 5A0GA 4ZTJA 4XAXB 2GQVA 2ZPHB 1YWOA 2K6DA 2YLCA 3GP8A 4BD3A 1EIFA 2RO0A 3OQ5A 2X4YA 1AWXA 1WHMA 1IHWA 4N4GA 1PRLC 2RM4A 3QZ9B 2R5AA 2KK4A 3CCMA 4AFUC 1YWPA 2ZPFB 1VQ7T 5GAN3 2XDBA 1Y0MA 4PLLA 1QVFP 4LD9K 3M5AA 1KC8C 1VQ8A 3NPFA 1UG1A 4IUQA 4PK4A 3M54A 3OSVA 1G3TA 1AWJA 4M77G 2KEAA 1OEBA 4LN2A 3FEOA 4M77F 4RCBA 2JM9A 1AZGB 1XOVA 4EPCA 2DE0X 1Y71A 2GCXA 3CMAQ 2BZ8A 3CPWS 4DBFA 1W2BS 2VUBA 3LX7A 4E7KA 2Z0WA 2AK5A 3I9QA 4OGEA 2NYSA 2RHUA 3GLXA 3VRYA 2VASA 3SFMA 1M2OA 4BY6C 1NJIR 2A3LA 1IGQA 3E9FA 4E7JA 3SHWA 4M78C 1S1NA 4XTUA 3QO3A 4DBRA 1QCNA 3M9QA 4M7DF 1KG1A 2DF6A 1D0XA 5FU6C 1KD1R 1ARKA 3HKSA 3PTAA 5GAN4 4JJCA 3PNWC 4C92G 4HKEA 2KR3A 3EG9B 2OJ2A 1Q7YU 2H3EB 3ER0A 5GJWB 2PQWA 1Q81U 3R6OA 3UF4A 3G7ZA 2FPDA 3DB3A 1M1KU 3PVQA 2A0FB 2W0ZA 1K73U 5CKFA 4M75B 2K3YA 1YJWT 1K8AR 1BI1A 3G6EQ 4BE2A 2RB6A 4XK8E 1VQMA 3THKA 2QTVA 1WXTA 2VB6A 4M7AA 4NS5A 1R8OB 3HRUA 2BE7D 1N9RA 2OAUA 1UUEA 2QQAA 4EIKA 4FT4A 1YFNA 2F2VA 3OBYA 1SKUB 5M9OA 1OU9A 2RK2A 3QZ5B 3A8MB 2JTFA 1Q81R 3CC4T 3SWNA 3CXCS 2DERA 3JB9G 3TSWA 3TREA 2HNIA 3OW2S 3TVTA 3H0IA 8ATCB 1QMCA 3FDRA 4B6MA 2VWFA 2D1XA 4DEXA 3OS5A 1D0ZA 1GCQA 2LCCA 4DBHA 1MMAA 3VS7A 1BYMA 3JCMP 3CBPA 2GQIA 2E3HA 2V1QA 3CC7A 2M16A 4J7IA 2RQWA 4JRKA 4M78D 4DBQA 1VQLQ 2PUKB 2HQEA 4VUBA 1WHHA 2K2VA 4LDXA 2B8AA 2JM8A 2M51A 1KJWA 3EAEA 4F16A 3NMZC 2P84A 2JZ2A 2E1HA 1N9SA 2X3WD 4CI0C 1QW1A 3OYKA 3S3MA 2EPDA 1PD1A 3MEAA 4FT2A 4QQGA 2PVOB 3VS6A 1IGUA 3V8KA 2F69A 5KCHA 2OTJA 4MZMA 1GBRA 4FYYB 5D6YA 4IIOA 4F7UA 4M78A 2MCNA 1VQ6T 5EC7A 3M4YA 2ECZA 1BK2A 1UGPB 3VS1A 5GAOm 3BDUA 3X24B 1NG2A 1B07A 4R55A 4AFQC 1K8AU 3QBYA 2YWWA 2EQUA 5GMKl 1HXDA 1LVKA 3OS1A 1K0XA 2MIOA 1NZ9A 2FG0A 3HFNA 2QXFA 1VQ9T 3ZL7C 2LT1A 3VU3C 4E6RA 2LZ6B 3RKXA 4JLGA 1W4SA 3CXCP 1YI2Q 1RL2A 1JXOA 1AD5A 5FU6B 1LNXA 3CCQA 4PFPA 5FWCA 1M27C 2A37A 1M9SA 1EZZB 2EGCA 1U8RA 4OMFB 2RHZA 1WDXA 3CD6Q 1KQSA 3WXMB 1ZSZB 3O5ZA 1UE9A 3EH2A 1M90U 5KYWB 5HK0A 1AHJB 1C0MA 1B3QA 4PJNA 2DVEA 1VQKQ 5ECAA 1TXQA 1YNZA 4KUDK 4D8DA 1VYUA 3I5SA 1IB8A 3PT9A 3CCLT 1D1CA 4KGZB 1UTIA 2CS7A 2YRCA 5GAN5 1MNEA 3RMSA 1M4ZA 1WQWA 3S3OA 1K9MR 2DL8A 4Y91A 3CCRT 2XIDA 4JUVA 5IHKA 2RHIA 3JB9I 1BCOA 2EW3A 2JUFA 4HA8A 3HL8A 2HEQA 3CCVT 1JB0E 3QJ6A 1N8RU 1WQ7A 3OYBA 1QVFS 2DETA 4EMKA 2NUTB 3CBOA 3CMEQ 1M3AA 3JRZA 2EQJA 5IXFA 1D1BA 2PTKA 3GOXA 4HT9A 1FMKA 3EGDB 3OYDA 2ABLA 3C0CA 2J6FA 3HRTA 1E6GA 2JW4A 3OYYA 2O31A 4O5VA 3CCEQ 2EWNA 2NWMA 1KQSS 5L8RE 4M75C 1Q82C 2DYIA 2VYTA 3P8DA 4D8KA 4JS4A 2X3XD 2CUDA 4XTVA 4C92D 1KD1C 5KE2A 3OSSC 8AT1B 3G4SA 4N0AC 3RIRA 1RABB 1BBZA 1TOVA 1SSHA 1YBYA 4PJOB 3EHRA 1ABOA 4Z8AA 1VQOA 2EQIA 3QG1A 5GANf 3I56Q 1N5ZA 3M0TA 1X27A 3D7SB 4HCCA 3PGGA 1YJWA 2L3PA 2VGMA 4A4KA 1YIJA 3RR6A 3CMEA 1H641 5FWBA 2K5LA 2YLBA 2QQBA 1RI0A 2F5TX 1WA7A 1TUCA 3H8ZA 4XTYA 2WSCE 2E10A 2HKQB 4C0DB 1ZLMA 1VQMQ 1YJ9T 3JCMQ 2EGAA 2LMJA 2P0QA 1W6XA 2HDAA 3CCMT 3OYCA 2SRCA 3MO8A 2XK0A 1Y57A 2OTJQ 1TTHB 1K9AA 1VUBA 1TSFA 4HVWA 2QA4Q 3A1PA 2OTJT 1UDLA 4F7UG 1B7TA 1VQ6Q 2PNIA 3OBWA 4IUUA 3EH1A 4E7HA 4C92B 1WJSA 2DL4A 4GY5A 2H8HA 4C0FA 3OYEA 4NL2A 2IIMA 2CP3A 2X4XA 1ZUYA 2R5MA 2FZGB 3OS2A 2M02A 3LH0A 1VQ5T 2QGFB 4A53A 3JB9D 1G3YA 1M1KC 2LJ0A 5A2QE 1IREB 3VYGA 2XDPA 4GBQA 2HZYA 3META 4M7DC 1HD3A 4RTWA 1NBEB 4M4ZA 4BB7A 2YSQA 1UGRB 3H6ZA 3C12A 3ZBDA 1D1AA 3PVLA 3C94A 3A8GB 4RMOA 2KI7A 2QQRA 1KFZA 2E5KA 1LOJA 1OX9A 3OYFA 4KBMB 5I21A 5KYXA 4A4HA 4JS5A 3L42A 4FSSA 3DB4A 2KXCA 2IVWA 2NUZA 3DLLA 3CCUA 3F70A 2AZSA 2K3BA 1QP2A 1X6OA 1PC0A 2C0OA 2CUBA 4WCIA 3VUZA 4K11A 3I56T 3UPUA 2OTLQ 3OA6A 1WX6A 1NM7A 4KUIA 4L59A 3L2UA 3QWXX 2GTJA 4CC3A 2DXUA 3INZA 4LUEA 1H3ZA 2V8JA 4J9IA 3G71Q 4IIMA 5GAMe 1RAEB 1V1CA 5KYUB 4LDYA 3RNJA 1WJRA 4M7AD 5CAIA 1YP5A 1M3BA 3OW2A 2DL7A 1QCOA 1FWZA 2MAMA 4F14A
chains in the Genus database with same CATH topology
1N9RA 2OAUA 2PU9B 2LQKA 2QQAA 4FT4A 2ZGWA 3M4GA 2EJGA 2JVVA 2LT4A 3OBYA 4J6WA 3PIPA 1SSFA 3G6EA 4OB2B 3VKIA 5M9OA 1Q86C 5J39A 3CMET 5LL6S 1GXIE 4L6V5 5LJ3f 2RK2A 3CCET 4JRPA 3QZ5B 4MZPA 3CCSA 1G3WA 3FJPA 3A8MB 5CIUA 3T9NA 1VQ4T 5DM7R 4Y28E 5CVIA 2PVDB 3M57A 3SD4A 2JTFA 2WSFE 3CC4T 1QVGA 3SWNA 2DPPB 2GFUA 3CXCS 2KSSA 1KD1U 3JB9G 2DKGA 4M77D 3OYGA 3QDRB 3TREA 1M8VA 1PSFA 2HNIA 4QVZA 3OW2S 3RKWA 4C0ZA 1K9MU 1D3BB 3FDRA 4M7DA 1NPRA 1TH7A 1VQPT 5GAOl 2XG8D 1KQ1A 2FVUA 4A4EA 3GF5A 4J6XA 3FIFA 3OS5A 4E47A 1VIEA 3CCVA 3MP8A 2LCCA 4JLIA 3A5ZB 3LWIA 1VQ6A 2DXTA 2E41A 2LTOA 4KT0E 5D6XA 1BYMA 3JCMP 1I8FA 4XU3A 4DQ2A 3CBPA 2G3RA 3CC7A 2OTLA 2M16A 3QPHA 4J7IA 3X28B 4C5IA 4M78D 4JRKA 4ZGEB 1M1FA 3CD6A 1X01A 2PUKB 2HQEA 2QEXT 4X34A 1ZQ1A 2FHDA 3CXCA 1B34A 4VUBA 1UEBA 4M75G 2E12A 2K2VA 4LDXA 2B8AA 3LGFA 3EAEA 4M77A 5GANg 3VV0A 4PJOA 3CC2T 2JZ2A 4JJNK 3V7RA 4J6YA 2E1HA 1N9SA 3NTIA 2RD1A 1QW1A 3HRSA 4M75E 4CI0C 3OYKA 1VIFA 2DXCA 3HHTB 4GLKA 1W2BA 2M9UA 3CPWA 2DIGA 2JNGA 2CZ0B 3OYMA 4EMKB 1VQPA 4LDWA 2VXEA 2IG0A 3MEAA 1WNLA 2MWOA 5CCAA 3S6WA 2K5FA 2LDMA 4C8QG 3V7CA 4FT2A 1WJQA 4QQGA 2LC4A 2PVOB 3J80E 4F7UE 5HKCA 4HCZA 3S3MA 5DLOA 3V8KA 5GAMg 2F69A 3X25B 4C8QF 1QVFA 5KCHA 2OTJA 3J7AF 2LVMA 3BW1A 4MZMA 1Q7YC 1D3BA 2BIVA 2DO3A 3E9GA 4QW2A 1NPPA 4C5HA 5D6YA 2DAQA 2X35A 3CC4A 4F7UA 4M78A 3E1SA 3O8VA 1VQ6T 3SB2A 1VQNT 2EYQA 3M4YA 2O4XB 1VQ7A 1UGPB 2DD4A 3MHXA 2VXFA 1P92A 4QQDA 4PJOF 3BDUA 5GAOm 2QA4T 1YITA 5CK9A 4NOYA 4Q5WA 4DA4A 4M7AF 1MGQA 3M58A 5CO7A 2VGNA 4A4GA 1YITT 3X24B 3RMQA 4PJOC 2Y90A 4R55A 1B34B 4M77C 1K8AU 3QBYA 3PIOA 1M1GA 2EQUA 5GMKl 4E7IA 2RHXA 1HXDA 3OS1A 3CCRA 5KCOA 1NJIC 2K57A 1NZ9A 3OYAA 3CCQT 3HFNA 3ZEHA 1DJ7B 2QXFA 2M1HA 4OB0B 1VQ9T 2GFAA 4XU1A 3M56A 2DZ9A 4B9XA 1QVGS 3JB9J 2LT1A 2DTOA 3JCMh 3VU3C 5IAYA 2KDSA 2KQWA 4RCCA 4BUGA 5C0MA 2C06A 3ASKA 3RKXA 4J8OA 2E5QA 1W4SA 4JLGA 5CKBA 5EG2A 1K73C 1QVPA 2HBPA 2RJEA 1YJNA 2A7YA 1ZHIA 1RL2A 3V8LA 2L3RA 3GPLA 1G5VA 3MP6A 1KQ2A 1VQNA 4IUTA 4JRQA 5FU6B 1LNXA 2E65A 3RESA 5FU7B 3JAME 2QA4A 1X75C 1YI2T 3JCMf 1I4K1 3JCMe 3RKYA 3CCQA 2X4WA 1N27A 2E64A 2HQXA 2XICA 3UT1A 4V2SA 2EJFA 3QYGB 1BI0A 3KBGA 4X9DA 4BI8B 1M9SA 2QQSA 2LCLA 5GAMd 3BFMA 3FLGA 4M78G 2LX9A 4L5GA 1KC8U 3JCMW 5LJ5e 4XTZA 4C0GA 5GANj 4C8QB 1YHQT 1U8RA 2Y4XA 2CZ7B 2RHZA 3DLMA 3Q1JA 4KULA 2AHJB 3OMCA 4OMFB 4BE0A 3A8OB 4ME7A 1K9MC 2D6FA 4BY6B 1VQ4A 1K8AC 1BI3A 2EFIA 1KQSA 3OS0A 2V8IA 4M78F 2I2LA 2K5IA 3WXMB 4C0DC 3TU4K 5CQYA 4BE1A 1U1SA 4M7AB 1M90U 1VQKT 4II1A 1I81A 5LJ3j 5HK0A 1AHJB 2RH2A 3EFRA 3JSCA 3L2ZA 4JDSA 4RG8A 5DLQE 3X20B 2DVEA 4M75D 1M90C 5IT9E 4ZGJB 4HCBA 4XQ3A 3OMGA 1PSEA 2JN0A 4E7LA 4KUDK 2K4YA 5DY9A 1U1TA 4M75A 4A4FA 3PT9A 1NE8A 4EMGA 3OYJA 3V7SA 3CD6T 5GMKi 2YRVA 4P5NA 1YIJT 2R57A 1OI1A 2ZPIB 3AHUA 2DJZA 4MMLA 4QVCA 2HD0A 3CCLT 3C4SA 3JCMb 1Q81C 3LW5E 3A8HB 4C8QD 2CKKA 4FIBA 2CS7A 4ZGDB 2XKOC 5GAN5 3DKMA 2ZPGB 2DD5A 2F5KA 2JOYA 2RJDA 5D6WA 4C5GA 1YJNT 3RMSA 4PNOA 3JB9H 1M4ZA 3X26B 4R56A 2YHTA 4EMHA 1WQWA 2ZZDA 3I55T 3S3OA 4M7DG 1Y07A 2H3JA 1VQ9A 3CC2A 2DXBA 4PJOD 4Y91A 4J5YA 3CCRT 2XIDA 1BIAA 4JUVA 2M0OA 2RHIA 4ZN1A 3JB9I 3MEVA 2CGHA 3SDZA 4M7DE 2JUFA 4HA8A 3HL8A 1JJ2A 3CCVT 4HT8A 1JB0E 3QJ6A 1N8RU 5GAMf 4IKFA 5A0LA 5GANd 4ATOA 1WQ7A 3OYBA 3JCMg 4FL6A 3QYHB 4RKUE 5GAN2 1QVFS 2RA2A 4EMKA 5GAMh 1QP3A 3CBOA 2KY9A 3CMAA 2EJ9A 3C95A 1N6AA 3FRNA 3KUFA 4BI4A 4C92A 5CKEA 3MEUA 4O6JA 3JRZA 5CQXA 2EQJA 3OYIA 5C6SA 3MEWA 1V29B 2PUOB 1Q82U 2QI2A 1OZ3A 4X9CA 1JBMA 1O9SA 3GOXA 3JCMJ 2WSEE 2BUDA 4HT9A 3OYDA 1Y96A 2P0KA 4N4HA 1ZBXA 4M7AG 3L1AA 5GMKj 1VQOT 1OYXA 2BKDN 3QIIA 5CKHA 2NLUA 3HRTA 1UB4A 1VQ8T 3JCMd 3VUBA 4M7AE 4N0AA 3OYYA 4C92C 4BDYA 1I5LA 5LJ3e 4O5VA 2EWNA 4F7UB 1OZ2A 5I2MA 1WGSA 3CCJA 1KQSS 5L8RE 5LJ5g 4M75C 3WVEB 3CCUT 2GF7A 4IURA 4ZTFA 2L8DA 1Q82C 4B9WA 2QDYB 2VYTA 3P8DA 3CCJT 3M53A 3RERA 4JS4A 2L89A 3QSUA 2MWPA 3JCMc 2RHYA 2CYZB 3P8BB 1FX7A 4EDUA 5LJ3h 2KVQG 1N8RC 2QQ9A 4XTVA 2ZPEB 4C92D 1KD1C 5KE2A 4DOWA 2QTXA 2VV5A 3OSSC 4QQ6A 4C8QC 5KH6A 3G4SA 4N0AC 3RIRA 2KAFA 2DK3A 1S72A 4OP0A 3LGLA 4DOVA 4M75F 4LDVA 3SWNB 3JB9F 1YBYA 1KHCA 4PLIA 4PJOB 3E19A 1NJIU 2E70A 4J83A 2V8KA 2FL7A 3S3NA 3GNFB 5GAOq 1Y96B 3UDCA 4J7FA 1VQOA 4D6WA 4M77E 1WPYA 4MZTA 4C5EA 3QG1A 4ELZC 5GANf 1VQ5A 4MDWA 2E6ZA 3HPWA 4OVAA 2LNVA 3QXEB 5LJ5f 3V8JA 4OB1B 4QVDA 2RI5A 2CZ6B 1BI2A 5GAN8 4HCCA 4TVRA 3OYHA 1VQKA 2PVGB 4FM4B 3PGGA 3ZFJA 3A8LB 2XDDA 1YJWA 1YI2A 4M7DB 4WF2A 1KHIA 2VGMA 4A4KA 1YIJA 2EIFA 1XQHA 1YJ9A 3CMEA 5FU7C 1UGQB 5J26A 4IUVA 2XU8A 3J81E 3HP9A 3VJPA 2DTHA 2FYKA 2EQKA 3PMIA 3QKJA 4XU2A 1H641 3MP1A 3G71A 2K5LA 2XHCA 2RK1A 2YLBA 3NTKA 3BY7A 2QQBA 2FB7A 4M7DD 3GIBA 1RI0A 2F5TX 3HFOA 1BIBA 1VQLT 3NFCA 3H8ZA 4XTYA 3I56A 2WSCE 1XTDA 2P0PA 5IN1A 3I55A 4XTWA 1VQMT 2E10A 2RI3A 3P8HA 4C0DB 5FRNA 2HAXA 4CRIA 5CR2A 3M59A 4OB3B 4Z02A 1YJ9T 3CMAT 1Y7XA 3JCMQ 2P0QA 5LJ5j 5GAOr 3L2WA 3HSBA 3G4ST 3CCMT 4MDXA 3CEYA 2MF2A 2X4JA 2KMTA 3OYCA 2RJFA 2JTMA 3OYNA 3CCLA 1LJOA 2E6NA 3MO8A 4FSXA 4XU0A 4PL6A 5A0GA 3L2VA 4XAXB 4ZTJA 2GQVA 2XK0A 2ZPHB 5GMKe 5LJ5h 1VQLA 2YLCA 3LWHA 4XTXA 3GP8A 1JJ2S 4BD3A 1EIFA 3TCJA 3OB9A 2RO0A 2RJCA 2X4YA 3OQ5A 3QUIA 5CKDA 5GANh 3L2QA 1VUBA 4N4GA 2QEXA 3G71T 2OTJT 2RM4A 4JRIA 3QZ9B 4F7UG 2R5AA 3SWNC 2ZCFB 2KK4A 3QJYA 4PJOE 3CCMA 3OBWA 4PKCC 4IUUA 3PMTA 4UC4A 4LD6A 4ELYC 4E7HA 4C92B 1WJSA 2Y4YA 2ZPFB 4RG2A 1VQ7T 5GAN6 4GY5A 5GAN3 4C0FA 3QHSA 4C92F 3OYEA 2XDBA 4NL2A 1IZ6A 4C8QA 2X4XA 2R5MA 5GMKh 3CCEA 4PLLA 2D0QB 3JCMV 5GAN7 2RI2A 5LJ3d 1YHQA 3OS2A 5J3BA 2DIQA 3GNGA 5A0DA 3M5AA 4LD9K 5GANe 1KC8C 1VQ8A 4OGCA 4IUQA 2O4XA 3LH0A 1VQ5T 3M54A 4PJOG 3OSVA 3TEEA 1G3TA 4M77G 4A53A 3JB9D 1Q86U 1G3YA 1M1KC 5A2QE 1IREB 3VYGA 4M77F 2XDPA 3FEOA 4RCBA 5GAOp 5FROA 2EQMA 3RUXA 3N5BB 3META 4M7DC 1UGSB 1XOVA 2R58A 4EPCA 1Y71A 3CBMA 4YTLA 2GCXA 5GMKm 4MMKA 4BB7A 3CPWS 2MI6A 2EAYA 5FRMA 1UGRB 5LJ3g 1G3SA 2LQ8A 3FB9A 3H6ZA 5LJ5d 2VUBA 1W2BS 3C12A 3ZBDA 3OYLA 3C94A 3A8GB 4RMOA 4BDZA 2QQRA 3LX7A 1LOJA 3OYFA 4KBMB 4E7KA 5I21A 4OGEA 2RHUA 4BI3A 3GLXA 2P4TA 4A4HA 3M55A 4JS5A 2DEQA 5HY6A 4F7UF 3OY9A 3SFMA 2MMPA 5KE3A 3L42A 4BY6C 3DB4A 4ZN3A 2A3LA 3E9FA 4N4IA 3CCST 2IVWA 4E7JA 3LYIA 4NL3A 4M78E 3DLLA 1M5Q1 3CCUA 4A54A 3F70A 4M78C 3L2RA 4XTUA 2D9TA 1HK9A 3QO3A 2DTIA 2XI9A 5FLXE 3M9QA 4M7DF 2VC8A 3URGA 1S72T 4M7AC 5FU6C 4FU6A 1KG1A 4M78B 1QP2A 1X6OA 5I2SA 4OF1A 3NTHA 3HKSA 3PTAA 5GAN4 3VUZA 2XD0A 3PNWC 4C92G 2L5QA 4HKEA 3I56T 3UPUA 2OTLT 2ZPBB 2WACA 3OA6A 3FC3A 4LDUA 2O01E 1MHNA 4KUIA 2CZ1B 3CPFA 1Q7YU 4L59A 3L2UA 3ER0A 4IUPA 5GAOn 2PQWA 2DXUA 1Q81U 3INZA 1XNIA 1H3ZA 2V8JA 3LLRA 3R6OA 3KXTA 3UWNA 5GAMe 3G7ZA 2K3XA 3BDLA 4C8QE 1FXXA 2LRQA 3DB3A 3CC7T 1M1KU 1O75A 1K73U 4LDYA 5CKFA 3PFSA 4M77B 1YCYA 3EFSA 4M75B 3G6ET 5AYFA 2K3YA 4C92E 1WJRA 5GAMj 1YJWT 1BI1A 3MCAB 1BKBA 4BE2A 4EMKC 4M7AD 2RB6A 4XK8E 3VYHB 5HK3A 5CAIA 1VQMA 3OW2A 3JCMX 3WVDB 1JRIA 2DZCA 1FWZA 3ME9A 4M7AA 4NS5A 2MAMA 2EKOA 1R8OB 3HRUA 4BACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A0D A;  5A0G A;  4BUG A;  2XID A;  4C0Z A;  2XI9 A;  2XIC A;  5A0L A; 
#chains in the Genus database with same CATH topology
 3CCJ Q;  2LT4 A;  1SSF A;  3ULR B;  3CME T;  5LL6 S;  1GXI E;  2K2M A;  4JRP A;  3CCS A;  4MZP A;  4FYW B;  1VQ4 T;  5CVI A;  1UEC A;  3M57 A;  3SD4 A;  3LH5 A;  1S72 Q;  2GFU A;  2KSS A;  1ZUU A;  4M77 D;  1M8V A;  4QVZ A;  3RKW A;  1K9M U;  5KYY B;  1K4U S;  4M7D A;  2O2O A;  5GAO l;  1R77 A;  1MMG A;  1VIE A;  3LWI A;  2DXT A;  4AG2 C;  2E41 A;  4CC7 A;  4XU3 A;  4DQ2 A;  4KGX B;  1TUG B;  3QPH A;  3QDF A;  3X28 B;  3CD6 A;  1M1F A;  2P4R A;  4X34 A;  2FHD A;  1B34 A;  1I07 A;  1OQK A;  1UJ0 A;  2DYB A;  1UEB A;  3LGF A;  4M77 A;  5GAN g;  2ED1 A;  3V7R A;  2LCS A;  1VIF A;  4F04 B;  3CPW A;  3TSZ A;  2JNG A;  2CZ0 B;  2YUQ A;  4LDW A;  2IG0 A;  2K5F A;  2SEM A;  1I5O B;  1WJQ A;  2LC4 A;  5HKC A;  5DLO A;  5GAM g;  3VS2 A;  2BIV A;  2VVK A;  2CP2 A;  3CC4 A;  3O8V A;  1ZA2 B;  2KBT A;  2DD4 A;  4PJO F;  5CK9 A;  4DA4 A;  5CO7 A;  3HTR A;  3A98 A;  1VOM A;  3RMQ A;  3I55 Q;  2FPF A;  2KXD A;  4E7I A;  1SRM A;  5KCO A;  1NJI C;  2K57 A;  3CCQ T;  2CT4 A;  1DJ7 B;  2GFA A;  4XU1 A;  3M56 A;  2KNB B;  2DTO A;  4PJM A;  1Z9Z A;  2JS2 A;  4RCC A;  1MV3 A;  5CKB A;  1YCS B;  1QVP A;  2HBP A;  2A7Y A;  1C1A A;  1G5V A;  1GFD A;  1BU1 A;  1G2B A;  1OPK A;  4JRQ A;  1YI2 T;  2E65 A;  2QA4 A;  5KYW A;  1X75 C;  1SPK A;  4FW2 A;  2KYM A;  7AT1 B;  2X4W A;  2E64 A;  5IHI A;  2XIC A;  1BI0 A;  1VQ9 Q;  1W1F A;  2LCL A;  2QQS A;  2I0N A;  4L5G A;  3NGP A;  4XTZ A;  1YHQ T;  4KUL A;  1K9M C;  2D6F A;  3A8O B;  1ZA1 B;  4ME7 A;  1YHQ Q;  1BI3 A;  3OS0 A;  2V8I A;  4M78 F;  2K5I A;  2RN8 A;  4BE1 A;  2FO0 A;  1U1S A;  4M7A B;  1I81 A;  4J9H A;  3CCV Q;  2EBP A;  3EFR A;  3L2Z A;  4RG8 A;  4M75 D;  4HCB A;  4PJJ A;  4XQ3 A;  1VQ4 Q;  1PSE A;  1V76 A;  2JN0 A;  4E7L A;  1AWO A;  1K73 R;  2K4Y A;  5DY9 A;  1U1T A;  4M75 A;  4A4F A;  2D8H A;  1NE8 A;  4EMG A;  3OYJ A;  1QWF A;  4QVC A;  3C4S A;  5KYN A;  3JCM b;  4FW1 A;  1G8X A;  2KGT A;  4FIB A;  4ZGD B;  1WZO A;  3DKM A;  2F5K A;  4C5G A;  1TUD A;  4DEY A;  4R56 A;  4EMH A;  1OPL A;  2EGE A;  2ZZD A;  3I55 T;  2DL5 A;  2RQT A;  1Y07 A;  4M7D G;  4HXJ A;  1Q82 R;  3CC7 Q;  2M0O A;  2CGH A;  1TWB A;  2FRY A;  4IKF A;  1KC8 R;  5GAN d;  4ATO A;  3H0H A;  1ZUK A;  4FL6 A;  4RKU E;  2RA2 A;  4JPB W;  1N6A A;  2EYX A;  3FRN A;  5IXB A;  3OYI A;  4O6J A;  5CQX A;  5C6S A;  4Z89 A;  2DJQ A;  2QI2 A;  4CC2 A;  4KGV B;  1JBM A;  1O9S A;  3JCM J;  1Y96 A;  2P0K A;  2EVR A;  4CC4 B;  1VQO T;  1RAH B;  2LP5 A;  2NLU A;  1UB4 A;  4C92 C;  1WHL A;  1MND A;  5LJ5 g;  2JT4 A;  2GF7 A;  3SEM A;  2G6F X;  4B9W A;  1PKS A;  2ENM A;  1NEB A;  2O9S A;  3M0Q A;  3RBB B;  2CYZ B;  1FX7 A;  1MV0 B;  1UGV A;  1N8R C;  3M0R A;  1RUW A;  4C8Q C;  5KH6 A;  2HL3 A;  1VQP Q;  1S72 A;  2BZX A;  4LDV A;  4PLI A;  1RAI B;  1OV3 A;  2E70 A;  4J83 A;  2V8K A;  5GAO q;  4D6W A;  4M77 E;  4C5E A;  4ELZ C;  1AT1 B;  2E6Z A;  3HPW A;  2LNV A;  6AT1 B;  5LJ5 f;  3V8J A;  4QVD A;  2LJ3 A;  4TVR A;  4F17 A;  2PVG B;  1T3S A;  3VS5 A;  1EX4 A;  1UHF A;  3ZFJ A;  1YI2 A;  1IRX A;  1PRM C;  1XQH A;  1UGQ B;  2YUO A;  5KYY A;  3J81 E;  2EQK A;  3QKJ A;  4XU2 A;  3REB B;  1X43 A;  2RK1 A;  1GL5 A;  3NTK A;  2DMO A;  2F2X A;  1BIB A;  3NHN A;  2RNA A;  1T0J A;  1I1J A;  1SRL A;  3P8H A;  5FRN A;  1WHG A;  2CSQ A;  5LJ5 j;  3L2W A;  3G4S T;  1T3L A;  3CEY A;  2KMT A;  2JTM A;  3OYN A;  2E6N A;  4FSX A;  4PL6 A;  3EG0 A;  5LJ5 h;  3LWH A;  1JJ2 S;  3TCJ A;  3OB9 A;  2RJC A;  5KYX B;  3G71 T;  3QJY A;  4PJO E;  1R0B G;  4UC4 A;  4A63 B;  1A0N B;  3EFO B;  2NUT A;  5GAN 6;  1MUZ A;  4C92 F;  2DM1 A;  3JCM V;  5J3B A;  2DIQ A;  3GNG A;  5A0D A;  1BCM A;  2O4X A;  2J7I A;  3TEE A;  1GCQ C;  4LNP A;  5GAO p;  5FRO A;  2EQM A;  3N5B B;  4JJB A;  1PHT A;  4AFS C;  1RLP C;  1FMW A;  1WHJ A;  4YTL A;  2CSI A;  4MMK A;  2MI6 A;  1QWE A;  5LJ5 d;  3FB9 A;  2KRM A;  2HCK A;  4BDZ A;  2ATC B;  2DVJ A;  2RF0 A;  1UHC A;  1D09 B;  1UJY A;  2MPX C;  2P4T A;  4ESR A;  3M55 A;  1RAG B;  2DEQ A;  2BE9 B;  5KE3 A;  1VQ8 Q;  4ZN3 A;  3CCS T;  4NL3 A;  1MMD A;  3JV3 A;  4M78 E;  1M5Q 1;  4AG1 C;  3REA B;  1H8K A;  3L2R A;  1AEY A;  2DTI A;  1JU5 C;  2QK0 A;  2XI9 A;  5FLX E;  1ZSZ A;  4M7A C;  3URG A;  1S72 T;  4FU6 A;  1CKA A;  4RUG A;  1PD0 A;  4FYV B;  2WAC A;  3FC3 A;  2O01 E;  1W2B P;  4OMP A;  3CPF A;  2BZY A;  1XNI A;  3LLR A;  3KXT A;  1NLP C;  3UWN A;  5D7U A;  2DLP A;  2L3Q A;  3CCS Q;  3PFS A;  4M77 B;  5AYF A;  4LUD A;  3OW2 P;  3VYH B;  3JCM X;  3WVD B;  1JRI A;  2AT1 B;  3ME9 A;  2YUP A;  5J39 A;  2L3S A;  2PU9 B;  2LQK A;  3CCL Q;  2ZGW A;  1U3O A;  2EJG A;  3M4G A;  2JVV A;  4J6W A;  3VS4 A;  4OB2 B;  1Q86 C;  3CCU Q;  9ATC B;  4L6V 5;  1LPL A;  1U5S A;  3FJP A;  5CIU A;  3T9N A;  4JZ3 A;  4Y28 E;  5DM7 R;  2O9V A;  2EYZ A;  1M3C A;  1WXB A;  2DPP B;  2DKG A;  1AZE A;  3OYG A;  3QDR B;  1H92 A;  1QKW A;  1NPR A;  1TH7 A;  1FMV A;  2FVU A;  2W10 A;  4J6X A;  1F1B B;  3FIF A;  4E47 A;  2OX7 A;  1VQ6 A;  1WXU A;  3GBQ A;  5IHN A;  5D6X A;  2HSE B;  1CSK A;  2G3R A;  1EFN A;  2OTL A;  3M0P A;  4C5I A;  1X01 A;  1WFW A;  1UFF A;  1PWT A;  2X51 A;  4JZ4 A;  2RMO A;  4PJO A;  3CC2 T;  4JJN K;  4J6Y A;  3NTI A;  3HRS A;  1W2B A;  3HHT B;  2RQU A;  1TG0 A;  4EMK B;  1VQP A;  2VXE A;  3FJ5 A;  1WNL A;  2MWO A;  5CCA A;  3S6W A;  3V7C A;  3I35 A;  1QVF A;  2KYB A;  2MK5 A;  4C8Q F;  2L2P A;  2LVM A;  1Q7Y C;  3EGX A;  1QCF A;  1WYX A;  2V26 A;  4QW2 A;  3AT1 B;  2A28 A;  2X35 A;  1NYF A;  3SB2 A;  1R0C B;  1VQN T;  2EYQ A;  2O4X B;  1VQ7 A;  2QA4 T;  2VXF A;  1P92 A;  4QQD A;  3M0U A;  2FZK B;  4NOY A;  4Q5W A;  4M7A F;  5HCK A;  3M58 A;  2VGN A;  2DRM A;  4PJO C;  1B34 B;  1X6G A;  4J9D A;  1AVZ C;  1SF9 A;  2CP7 A;  2RHX A;  2AKL A;  2RQR A;  4OMM A;  1VA7 A;  4RTY A;  3ZEH A;  2YXY A;  1QVG S;  2PZ1 A;  3JB9 J;  2HQH A;  5IAY A;  2KDS A;  2KQW A;  5C0M A;  3CC2 Q;  3ASK A;  2DL3 A;  4J8O A;  5EG2 A;  4PFZ A;  3V8L A;  1ZHI A;  2L3R A;  1XJW B;  1RAC B;  3TQ7 P;  2COZ A;  3UAT A;  1KQ2 A;  1VQN A;  3JAM E;  5FU7 B;  3JCM f;  1I4K 1;  3JCM e;  1N27 A;  4V2S A;  3UT1 A;  3QYG B;  3KBG A;  4X9D A;  3QWY A;  4BI8 B;  3BFM A;  3FLG A;  4M78 G;  4QKU A;  4ANJ A;  2QDL A;  1KC8 U;  4C0G A;  4C8Q B;  2CP6 A;  3Q1J A;  2CZ7 B;  3DLM A;  2AHJ B;  1VQ4 A;  2I2L A;  3TU4 K;  2VKN A;  1ZX6 A;  3UA7 A;  2CP0 A;  1VQK T;  4II1 A;  4RTT A;  5LJ3 j;  2QAZ A;  2RH2 A;  3JSC A;  1M90 C;  5IT9 E;  1WHK A;  3H9N A;  3UA6 A;  1ZBJ A;  3OMG A;  1SHF A;  2GNC A;  5KYU A;  2QEX Q;  3CD6 T;  5GMK i;  2YRV A;  4P5N A;  1YIJ T;  2R57 A;  3AHU A;  2DJZ A;  1QLY A;  3LW5 E;  1SG5 A;  2DD5 A;  2ZPG B;  1YJN T;  4PNO A;  1G83 A;  1NYG A;  2CT3 A;  3CC2 A;  2DXB A;  4PJO D;  4J5Y A;  1WI7 A;  2JMA A;  1K1Z A;  2EKH A;  3MEV A;  1VQN Q;  4HT8 A;  4ZNX A;  5A0L A;  1KK7 A;  1PG5 B;  5GAN 2;  5GAM h;  1NEG A;  2EJ9 A;  3C95 A;  4J9F A;  3KUF A;  2X9H A;  5CKE A;  3MEU A;  1OU8 A;  4R0K A;  3MEW A;  2D0N A;  2PUO B;  1Q82 U;  1ACM B;  4X9C A;  2WSE E;  2BUD A;  1KIK A;  1PKT A;  4N4H A;  1ZBX A;  3L1A A;  5GMK j;  1OYX A;  1HYO A;  4FYX B;  2K9G A;  1VQ8 T;  4E2F B;  1I5L A;  1W70 A;  1OZ2 A;  5I2M A;  1WGS A;  3CCJ A;  2FPE A;  2EYY A;  4ZTF A;  4IUR A;  2QDY B;  3CCJ T;  2KRS A;  3M53 A;  4PJL A;  3RER A;  2KT8 A;  2L89 A;  3CCQ Q;  4DOW A;  2QTX A;  2VV5 A;  1TU0 B;  1YIJ Q;  2KAF A;  2COW A;  2E4H A;  4OP0 A;  3LGL A;  4M75 F;  2J06 A;  2IPO B;  4HVU A;  3GNF B;  3UDC A;  4J7F A;  1WIE A;  1X2Q A;  1WPY A;  2L0A A;  2A36 A;  4MDW A;  2OI3 A;  2YUN A;  1LCK A;  5GJV B;  3EGU A;  2JS0 A;  1KQS P;  5GAN 8;  2CZ6 B;  1BI2 A;  3OYH A;  1YIT Q;  3BE3 A;  3A8L B;  4M7D B;  1M8M A;  2XMF A;  2EIF A;  2ZAE A;  1YJ9 A;  1N8R R;  5FU7 C;  3CC4 Q;  4IUV A;  2XU8 A;  3HP9 A;  3VJP A;  2DTH A;  3PMI A;  3G71 A;  2XHC A;  2FB7 A;  4M7D D;  1RLQ C;  2QG9 B;  3NFC A;  1XTD A;  5IN1 A;  3I55 A;  4XTW A;  2RI3 A;  2J6K A;  2HAX A;  5CR2 A;  3M59 A;  1TS9 A;  4HVV A;  4ORZ A;  3HSB A;  2V1R A;  2X4J A;  1X2K A;  2KT1 A;  4XU0 A;  3L2V A;  2JXB A;  5GMK e;  2FZC B;  1VQL A;  1SEM A;  4XTX A;  5CKD A;  3QUI A;  5GAN h;  3L2Q A;  2QEX A;  2DNU A;  1E7O A;  4JRI A;  4RTU A;  3SWN C;  2ZCF B;  4PKC C;  3PMT A;  4LD6 A;  4ELY C;  1D0Y A;  2Y4Y A;  2GGR A;  4RG2 A;  3CCM Q;  3EG2 A;  3QHS A;  2LNH B;  1IZ6 A;  4C8Q A;  5GMK h;  3CCE A;  4E7S A;  2D0Q B;  5GAN 7;  1T0H A;  2RI2 A;  5LJ3 d;  1YHQ A;  5GAN e;  4OGC A;  2DBK A;  3KFV A;  4PJO G;  1Q86 U;  3R6N A;  1GCP A;  3I5R A;  4E7Z A;  2AKK A;  1M30 A;  4HCK A;  3RUX A;  4J9C A;  1UGS B;  2R58 A;  3CBM A;  1OUL A;  1QVG P;  5GMK m;  5I22 A;  1YJ9 Q;  2EAY A;  5FRM A;  2KE9 A;  1G3S A;  2LQ8 A;  5LJ3 g;  3OYL A;  2K7A A;  2NUP B;  2HSP A;  2F1L A;  4BI3 A;  5HY6 A;  4F7U F;  3OY9 A;  1JEG A;  2MMP A;  4N4I A;  3LYI A;  1VQO Q;  4A54 A;  2D9T A;  1HK9 A;  2VC8 A;  4M78 B;  2AIR B;  5I2S A;  4OF1 A;  1Q86 R;  3NTH A;  2XD0 A;  2L5Q A;  1QKX A;  2D8J A;  2OTL T;  1Q95 G;  2ZPB B;  4LDU A;  1MHN A;  2CZ1 B;  4IUP A;  5GAO n;  4OMN A;  2DX1 A;  2K3X A;  3BDL A;  4C8Q E;  1FXX A;  2LRQ A;  2ROL A;  2DIL A;  1JO8 A;  3CC7 T;  1O75 A;  2BTT A;  1YCY A;  3EFS A;  3G6E T;  1YJW Q;  1X6B A;  4C92 E;  5GAM j;  1M2V A;  3MCA B;  1BKB A;  4EMK C;  5HK3 A;  2QGG A;  2DZC A;  2EKO A;  2HMA A;  4BAC A;  4OML A;  1NLO C;  1VYT A;  3PIP A;  3G6E A;  3VKI A;  2CH4 W;  4QT7 A;  5LJ3 f;  2LJ1 A;  3CCE T;  2DA9 A;  1G3W A;  2PVD B;  2WSF E;  1QVG A;  3CQT A;  1VQ5 Q;  1KD1 U;  2DRK A;  4J9G A;  1PSF A;  1H3H A;  4C0Z A;  4LXC A;  2KRN A;  1AWW A;  1D3B B;  3MPU B;  3U23 A;  1VQP T;  1Q7Y R;  2XG8 D;  1KQ1 A;  3PE0 A;  4A4E A;  3GF5 A;  1YJN Q;  1ABQ A;  3CCV A;  3MP8 A;  4JLI A;  3A5Z B;  2LTO A;  4KT0 E;  1I8F A;  3IQL A;  4ZGE B;  4WTO B;  1E6H A;  2QEX T;  1ZQ1 A;  2JMC A;  3CXC A;  2A08 A;  5FW9 A;  4M75 G;  2E12 A;  2YRD A;  2C0I A;  3VV0 A;  2DFU A;  2ROT A;  2RD1 A;  4M75 E;  2NUP A;  2DXC A;  2LQN A;  4GLK A;  2ESW A;  2M9U A;  2DBM A;  2DIG A;  5IH2 A;  3OYM A;  1GRI A;  2LDM A;  2GTO A;  4C8Q G;  4GLM A;  5AT1 B;  3J80 E;  4F7U E;  4HCZ A;  3X25 B;  3J7A F;  3BW1 A;  1D3B A;  2DO3 A;  3E9G A;  1NPP A;  4C5H A;  2DAQ A;  4PFO A;  1HJD A;  3E1S A;  2JTE A;  2J05 A;  1RAA B;  1OX8 A;  1IHV A;  1IXD A;  3MHX A;  1YIT A;  1MGQ A;  4A4G A;  1YIT T;  4FCY A;  2Y90 A;  4M77 C;  3PIO A;  1M1G A;  1JQQ A;  3CCR A;  2YT6 A;  3G1J A;  3G4S Q;  3OYA A;  2M1H A;  4OB0 B;  4B9X A;  2DZ9 A;  4KH1 B;  3JCM h;  2C06 A;  2HBW A;  4BUG A;  1IO6 A;  1KSW A;  2E5Q A;  1K73 C;  2RJE A;  4Y92 A;  1YJN A;  2FRW A;  3GPL A;  3MP6 A;  2FEI A;  4IUT A;  4LE9 A;  3RES A;  4OMQ A;  2K79 A;  3RKY A;  4AT1 B;  1QQJ A;  2HQX A;  2EJF A;  5GAM d;  2QAS A;  2LX9 A;  3JCM W;  5LJ5 e;  5GAN j;  3CPW P;  2Y4X A;  3EHQ A;  4BE0 A;  3OMC A;  3EFO A;  2MOX A;  4BY6 B;  1K8A C;  3RDV A;  2EFI A;  3MJX A;  4AFZ C;  2KRO A;  4C0D C;  5CQY A;  4J9E A;  1ZSG A;  2C0T A;  4JDS A;  1ZSZ C;  3X20 B;  5DLQ E;  4ZGJ B;  1AOJ A;  1RI9 A;  2AZV A;  2ED0 A;  2O88 A;  3V7S A;  1HSQ A;  2MYS A;  1OI1 A;  2ZPI B;  4X1V A;  4MML A;  2HD0 A;  2LX7 A;  1Q81 C;  4OMO A;  3A8H B;  4C8Q D;  2CKK A;  1OOT A;  2YDL A;  2XKO C;  2HL5 C;  3VS3 A;  2DEU A;  5D6W A;  2JOY A;  2RJD A;  2QYZ A;  3JB9 H;  3X26 B;  2YHT A;  1X69 A;  3CCR Q;  1J3T A;  4JJD A;  2H3J A;  1VQ9 A;  3H0F A;  1BIA A;  1GBQ A;  1VYV A;  4ZN1 A;  1GFC A;  3SDZ A;  4M7D E;  1JJ2 A;  3EGX B;  5GAM f;  3EG3 A;  1PNJ A;  3JCM g;  3QYH B;  3EG1 A;  1QP3 A;  2KY9 A;  3CMA A;  4BI4 A;  3MKD A;  4C92 A;  4J9B A;  2B86 A;  1V29 B;  2CRE A;  1OZ3 A;  2HKN A;  1RAD B;  4M7A G;  3VRZ A;  2CP5 A;  2CH4 A;  2BKD N;  1PM3 A;  3QII A;  5CKH A;  3EGD A;  3JCM d;  2RPN A;  3VUB A;  4M7A E;  4N0A A;  4BDY A;  1JJ2 P;  1Z9Q A;  5LJ3 e;  2RQV A;  4F7U B;  4RTX A;  1MMN A;  3WVE B;  3CCU T;  1YN8 A;  2L8D A;  3E2U A;  3QSU A;  2MWP A;  5I11 A;  3JCM c;  4RTZ A;  2RHY A;  3P8B B;  4EDU A;  5LJ3 h;  2KVQ G;  2QQ9 A;  2ZPE B;  1JXM A;  1BB9 A;  4QQ6 A;  3H41 A;  2DK3 A;  4DOV A;  3SWN B;  3JB9 F;  3VS0 A;  5L23 A;  1KHC A;  3E19 A;  1NJI U;  2FL7 A;  3S3N A;  2OAW A;  1Y96 B;  1CKB A;  1SHG A;  2M0Y A;  2F2W A;  1VQ5 A;  4MZT A;  2E3I A;  4OVA A;  1U06 A;  1K0S A;  3QXE B;  2EYW A;  4OB1 B;  2RI5 A;  2J6O A;  1VQK A;  2CDT A;  4FM4 B;  1M2V B;  2XDD A;  4WF2 A;  1KHI A;  4KRT A;  4Z88 A;  5J26 A;  1PCX A;  2FYK A;  2JJ9 A;  3MP1 A;  3M0S A;  1I0C A;  3BY7 A;  3GIB A;  3HFO A;  1VQL T;  1C6V X;  1K76 A;  3I56 A;  4KH0 B;  2P0P A;  1VQM T;  4AMC A;  2LQW A;  3EG9 A;  4CRI A;  2GBQ A;  4OB3 B;  4Z02 A;  1M90 R;  3CMA T;  1Y7X A;  5GAO r;  4MDX A;  2MF2 A;  1FYN A;  1M1K R;  1RAF B;  1VQ7 Q;  2COY A;  4RTV A;  2RJF A;  3CCL A;  1LJO A;  1WLP B;  5A0G A;  4ZTJ A;  4XAX B;  2GQV A;  2ZPH B;  1YWO A;  2K6D A;  2YLC A;  3GP8 A;  4BD3 A;  1EIF A;  2RO0 A;  3OQ5 A;  2X4Y A;  1AWX A;  1WHM A;  1IHW A;  4N4G A;  1PRL C;  2RM4 A;  3QZ9 B;  2R5A A;  2KK4 A;  3CCM A;  4AFU C;  1YWP A;  2ZPF B;  1VQ7 T;  5GAN 3;  2XDB A;  1Y0M A;  4PLL A;  1QVF P;  4LD9 K;  3M5A A;  1KC8 C;  1VQ8 A;  3NPF A;  1UG1 A;  4IUQ A;  4PK4 A;  3M54 A;  3OSV A;  1G3T A;  1AWJ A;  4M77 G;  2KEA A;  1OEB A;  4LN2 A;  3FEO A;  4M77 F;  4RCB A;  2JM9 A;  1AZG B;  1XOV A;  4EPC A;  2DE0 X;  1Y71 A;  2GCX A;  3CMA Q;  2BZ8 A;  3CPW S;  4DBF A;  1W2B S;  2VUB A;  3LX7 A;  4E7K A;  2Z0W A;  2AK5 A;  3I9Q A;  4OGE A;  2NYS A;  2RHU A;  3GLX A;  3VRY A;  2VAS A;  3SFM A;  1M2O A;  4BY6 C;  1NJI R;  2A3L A;  1IGQ A;  3E9F A;  4E7J A;  3SHW A;  4M78 C;  1S1N A;  4XTU A;  3QO3 A;  4DBR A;  1QCN A;  3M9Q A;  4M7D F;  1KG1 A;  2DF6 A;  1D0X A;  5FU6 C;  1KD1 R;  1ARK A;  3HKS A;  3PTA A;  5GAN 4;  4JJC A;  3PNW C;  4C92 G;  4HKE A;  2KR3 A;  3EG9 B;  2OJ2 A;  1Q7Y U;  2H3E B;  3ER0 A;  5GJW B;  2PQW A;  1Q81 U;  3R6O A;  3UF4 A;  3G7Z A;  2FPD A;  3DB3 A;  1M1K U;  3PVQ A;  2A0F B;  2W0Z A;  1K73 U;  5CKF A;  4M75 B;  2K3Y A;  1YJW T;  1K8A R;  1BI1 A;  3G6E Q;  4BE2 A;  2RB6 A;  4XK8 E;  1VQM A;  3THK A;  2QTV A;  1WXT A;  2VB6 A;  4M7A A;  4NS5 A;  1R8O B;  3HRU A;  2BE7 D;  1N9R A;  2OAU A;  1UUE A;  2QQA A;  4EIK A;  4FT4 A;  1YFN A;  2F2V A;  3OBY A;  1SKU B;  5M9O A;  1OU9 A;  2RK2 A;  3QZ5 B;  3A8M B;  2JTF A;  1Q81 R;  3CC4 T;  3SWN A;  3CXC S;  2DER A;  3JB9 G;  3TSW A;  3TRE A;  2HNI A;  3OW2 S;  3TVT A;  3H0I A;  8ATC B;  1QMC A;  3FDR A;  4B6M A;  2VWF A;  2D1X A;  4DEX A;  3OS5 A;  1D0Z A;  1GCQ A;  2LCC A;  4DBH A;  1MMA A;  3VS7 A;  1BYM A;  3JCM P;  3CBP A;  2GQI A;  2E3H A;  2V1Q A;  3CC7 A;  2M16 A;  4J7I A;  2RQW A;  4JRK A;  4M78 D;  4DBQ A;  1VQL Q;  2PUK B;  2HQE A;  4VUB A;  1WHH A;  2K2V A;  4LDX A;  2B8A A;  2JM8 A;  2M51 A;  1KJW A;  3EAE A;  4F16 A;  3NMZ C;  2P84 A;  2JZ2 A;  2E1H A;  1N9S A;  2X3W D;  4CI0 C;  1QW1 A;  3OYK A;  3S3M A;  2EPD A;  1PD1 A;  3MEA A;  4FT2 A;  4QQG A;  2PVO B;  3VS6 A;  1IGU A;  3V8K A;  2F69 A;  5KCH A;  2OTJ A;  4MZM A;  1GBR A;  4FYY B;  5D6Y A;  4IIO A;  4F7U A;  4M78 A;  2MCN A;  1VQ6 T;  5EC7 A;  3M4Y A;  2ECZ A;  1BK2 A;  1UGP B;  3VS1 A;  5GAO m;  3BDU A;  3X24 B;  1NG2 A;  1B07 A;  4R55 A;  4AFQ C;  1K8A U;  3QBY A;  2YWW A;  2EQU A;  5GMK l;  1HXD A;  1LVK A;  3OS1 A;  1K0X A;  2MIO A;  1NZ9 A;  2FG0 A;  3HFN A;  2QXF A;  1VQ9 T;  3ZL7 C;  2LT1 A;  3VU3 C;  4E6R A;  2LZ6 B;  3RKX A;  4JLG A;  1W4S A;  3CXC P;  1YI2 Q;  1RL2 A;  1JXO A;  1AD5 A;  5FU6 B;  1LNX A;  3CCQ A;  4PFP A;  5FWC A;  1M27 C;  2A37 A;  1M9S A;  1EZZ B;  2EGC A;  1U8R A;  4OMF B;  2RHZ A;  1WDX A;  3CD6 Q;  1KQS A;  3WXM B;  1ZSZ B;  3O5Z A;  1UE9 A;  3EH2 A;  1M90 U;  5KYW B;  5HK0 A;  1AHJ B;  1C0M A;  1B3Q A;  4PJN A;  2DVE A;  1VQK Q;  5ECA A;  1TXQ A;  1YNZ A;  4KUD K;  4D8D A;  1VYU A;  3I5S A;  1IB8 A;  3PT9 A;  3CCL T;  1D1C A;  4KGZ B;  1UTI A;  2CS7 A;  2YRC A;  5GAN 5;  1MNE A;  3RMS A;  1M4Z A;  1WQW A;  3S3O A;  1K9M R;  2DL8 A;  4Y91 A;  3CCR T;  2XID A;  4JUV A;  5IHK A;  2RHI A;  3JB9 I;  1BCO A;  2EW3 A;  2JUF A;  4HA8 A;  3HL8 A;  2HEQ A;  3CCV T;  1JB0 E;  3QJ6 A;  1N8R U;  1WQ7 A;  3OYB A;  1QVF S;  2DET A;  4EMK A;  2NUT B;  3CBO A;  3CME Q;  1M3A A;  3JRZ A;  2EQJ A;  5IXF A;  1D1B A;  2PTK A;  3GOX A;  4HT9 A;  1FMK A;  3EGD B;  3OYD A;  2ABL A;  3C0C A;  2J6F A;  3HRT A;  1E6G A;  2JW4 A;  3OYY A;  2O31 A;  4O5V A;  3CCE Q;  2EWN A;  2NWM A;  1KQS S;  5L8R E;  4M75 C;  1Q82 C;  2DYI A;  2VYT A;  3P8D A;  4D8K A;  4JS4 A;  2X3X D;  2CUD A;  4XTV A;  4C92 D;  1KD1 C;  5KE2 A;  3OSS C;  8AT1 B;  3G4S A;  4N0A C;  3RIR A;  1RAB B;  1BBZ A;  1TOV A;  1SSH A;  1YBY A;  4PJO B;  3EHR A;  1ABO A;  4Z8A A;  1VQO A;  2EQI A;  3QG1 A;  5GAN f;  3I56 Q;  1N5Z A;  3M0T A;  1X27 A;  3D7S B;  4HCC A;  3PGG A;  1YJW A;  2L3P A;  2VGM A;  4A4K A;  1YIJ A;  3RR6 A;  3CME A;  1H64 1;  5FWB A;  2K5L A;  2YLB A;  2QQB A;  1RI0 A;  2F5T X;  1WA7 A;  1TUC A;  3H8Z A;  4XTY A;  2WSC E;  2E10 A;  2HKQ B;  4C0D B;  1ZLM A;  1VQM Q;  1YJ9 T;  3JCM Q;  2EGA A;  2LMJ A;  2P0Q A;  1W6X A;  2HDA A;  3CCM T;  3OYC A;  2SRC A;  3MO8 A;  2XK0 A;  1Y57 A;  2OTJ Q;  1TTH B;  1K9A A;  1VUB A;  1TSF A;  4HVW A;  2QA4 Q;  3A1P A;  2OTJ T;  1UDL A;  4F7U G;  1B7T A;  1VQ6 Q;  2PNI A;  3OBW A;  4IUU A;  3EH1 A;  4E7H A;  4C92 B;  1WJS A;  2DL4 A;  4GY5 A;  2H8H A;  4C0F A;  3OYE A;  4NL2 A;  2IIM A;  2CP3 A;  2X4X A;  1ZUY A;  2R5M A;  2FZG B;  3OS2 A;  2M02 A;  3LH0 A;  1VQ5 T;  2QGF B;  4A53 A;  3JB9 D;  1G3Y A;  1M1K C;  2LJ0 A;  5A2Q E;  1IRE B;  3VYG A;  2XDP A;  4GBQ A;  2HZY A;  3MET A;  4M7D C;  1HD3 A;  4RTW A;  1NBE B;  4M4Z A;  4BB7 A;  2YSQ A;  1UGR B;  3H6Z A;  3C12 A;  3ZBD A;  1D1A A;  3PVL A;  3C94 A;  3A8G B;  4RMO A;  2KI7 A;  2QQR A;  1KFZ A;  2E5K A;  1LOJ A;  1OX9 A;  3OYF A;  4KBM B;  5I21 A;  5KYX A;  4A4H A;  4JS5 A;  3L42 A;  4FSS A;  3DB4 A;  2KXC A;  2IVW A;  2NUZ A;  3DLL A;  3CCU A;  3F70 A;  2AZS A;  2K3B A;  1QP2 A;  1X6O A;  1PC0 A;  2C0O A;  2CUB A;  4WCI A;  3VUZ A;  4K11 A;  3I56 T;  3UPU A;  2OTL Q;  3OA6 A;  1WX6 A;  1NM7 A;  4KUI A;  4L59 A;  3L2U A;  3QWX X;  2GTJ A;  4CC3 A;  2DXU A;  3INZ A;  4LUE A;  1H3Z A;  2V8J A;  4J9I A;  3G71 Q;  4IIM A;  5GAM e;  1RAE B;  1V1C A;  5KYU B;  4LDY A;  3RNJ A;  1WJR A;  4M7A D;  5CAI A;  1YP5 A;  1M3B A;  3OW2 A;  2DL7 A;  1QCO A;  1FWZ A;  2MAM A;  4F14 A; 
#chains in the Genus database with same CATH homology
 1N9R A;  2OAU A;  2PU9 B;  2LQK A;  2QQA A;  4FT4 A;  2ZGW A;  3M4G A;  2EJG A;  2JVV A;  2LT4 A;  3OBY A;  4J6W A;  3PIP A;  1SSF A;  3G6E A;  4OB2 B;  3VKI A;  5M9O A;  1Q86 C;  5J39 A;  3CME T;  5LL6 S;  1GXI E;  4L6V 5;  5LJ3 f;  2RK2 A;  3CCE T;  4JRP A;  3QZ5 B;  4MZP A;  3CCS A;  1G3W A;  3FJP A;  3A8M B;  5CIU A;  3T9N A;  1VQ4 T;  5DM7 R;  4Y28 E;  5CVI A;  2PVD B;  3M57 A;  3SD4 A;  2JTF A;  2WSF E;  3CC4 T;  1QVG A;  3SWN A;  2DPP B;  2GFU A;  3CXC S;  2KSS A;  1KD1 U;  3JB9 G;  2DKG A;  4M77 D;  3OYG A;  3QDR B;  3TRE A;  1M8V A;  1PSF A;  2HNI A;  4QVZ A;  3OW2 S;  3RKW A;  4C0Z A;  1K9M U;  1D3B B;  3FDR A;  4M7D A;  1NPR A;  1TH7 A;  1VQP T;  5GAO l;  2XG8 D;  1KQ1 A;  2FVU A;  4A4E A;  3GF5 A;  4J6X A;  3FIF A;  3OS5 A;  4E47 A;  1VIE A;  3CCV A;  3MP8 A;  2LCC A;  4JLI A;  3A5Z B;  3LWI A;  1VQ6 A;  2DXT A;  2E41 A;  2LTO A;  4KT0 E;  5D6X A;  1BYM A;  3JCM P;  1I8F A;  4XU3 A;  4DQ2 A;  3CBP A;  2G3R A;  3CC7 A;  2OTL A;  2M16 A;  3QPH A;  4J7I A;  3X28 B;  4C5I A;  4M78 D;  4JRK A;  4ZGE B;  1M1F A;  3CD6 A;  1X01 A;  2PUK B;  2HQE A;  2QEX T;  4X34 A;  1ZQ1 A;  2FHD A;  3CXC A;  1B34 A;  4VUB A;  1UEB A;  4M75 G;  2E12 A;  2K2V A;  4LDX A;  2B8A A;  3LGF A;  3EAE A;  4M77 A;  5GAN g;  3VV0 A;  4PJO A;  3CC2 T;  2JZ2 A;  4JJN K;  3V7R A;  4J6Y A;  2E1H A;  1N9S A;  3NTI A;  2RD1 A;  1QW1 A;  3HRS A;  4M75 E;  4CI0 C;  3OYK A;  1VIF A;  2DXC A;  3HHT B;  4GLK A;  1W2B A;  2M9U A;  3CPW A;  2DIG A;  2JNG A;  2CZ0 B;  3OYM A;  4EMK B;  1VQP A;  4LDW A;  2VXE A;  2IG0 A;  3MEA A;  1WNL A;  2MWO A;  5CCA A;  3S6W A;  2K5F A;  2LDM A;  4C8Q G;  3V7C A;  4FT2 A;  1WJQ A;  4QQG A;  2LC4 A;  2PVO B;  3J80 E;  4F7U E;  5HKC A;  4HCZ A;  3S3M A;  5DLO A;  3V8K A;  5GAM g;  2F69 A;  3X25 B;  4C8Q F;  1QVF A;  5KCH A;  2OTJ A;  3J7A F;  2LVM A;  3BW1 A;  4MZM A;  1Q7Y C;  1D3B A;  2BIV A;  2DO3 A;  3E9G A;  4QW2 A;  1NPP A;  4C5H A;  5D6Y A;  2DAQ A;  2X35 A;  3CC4 A;  4F7U A;  4M78 A;  3E1S A;  3O8V A;  1VQ6 T;  3SB2 A;  1VQN T;  2EYQ A;  3M4Y A;  2O4X B;  1VQ7 A;  1UGP B;  2DD4 A;  3MHX A;  2VXF A;  1P92 A;  4QQD A;  4PJO F;  3BDU A;  5GAO m;  2QA4 T;  1YIT A;  5CK9 A;  4NOY A;  4Q5W A;  4DA4 A;  4M7A F;  1MGQ A;  3M58 A;  5CO7 A;  2VGN A;  4A4G A;  1YIT T;  3X24 B;  3RMQ A;  4PJO C;  2Y90 A;  4R55 A;  1B34 B;  4M77 C;  1K8A U;  3QBY A;  3PIO A;  1M1G A;  2EQU A;  5GMK l;  4E7I A;  2RHX A;  1HXD A;  3OS1 A;  3CCR A;  5KCO A;  1NJI C;  2K57 A;  1NZ9 A;  3OYA A;  3CCQ T;  3HFN A;  3ZEH A;  1DJ7 B;  2QXF A;  2M1H A;  4OB0 B;  1VQ9 T;  2GFA A;  4XU1 A;  3M56 A;  2DZ9 A;  4B9X A;  1QVG S;  3JB9 J;  2LT1 A;  2DTO A;  3JCM h;  3VU3 C;  5IAY A;  2KDS A;  2KQW A;  4RCC A;  4BUG A;  5C0M A;  2C06 A;  3ASK A;  3RKX A;  4J8O A;  2E5Q A;  1W4S A;  4JLG A;  5CKB A;  5EG2 A;  1K73 C;  1QVP A;  2HBP A;  2RJE A;  1YJN A;  2A7Y A;  1ZHI A;  1RL2 A;  3V8L A;  2L3R A;  3GPL A;  1G5V A;  3MP6 A;  1KQ2 A;  1VQN A;  4IUT A;  4JRQ A;  5FU6 B;  1LNX A;  2E65 A;  3RES A;  5FU7 B;  3JAM E;  2QA4 A;  1X75 C;  1YI2 T;  3JCM f;  1I4K 1;  3JCM e;  3RKY A;  3CCQ A;  2X4W A;  1N27 A;  2E64 A;  2HQX A;  2XIC A;  3UT1 A;  4V2S A;  2EJF A;  3QYG B;  1BI0 A;  3KBG A;  4X9D A;  4BI8 B;  1M9S A;  2QQS A;  2LCL A;  5GAM d;  3BFM A;  3FLG A;  4M78 G;  2LX9 A;  4L5G A;  1KC8 U;  3JCM W;  5LJ5 e;  4XTZ A;  4C0G A;  5GAN j;  4C8Q B;  1YHQ T;  1U8R A;  2Y4X A;  2CZ7 B;  2RHZ A;  3DLM A;  3Q1J A;  4KUL A;  2AHJ B;  3OMC A;  4OMF B;  4BE0 A;  3A8O B;  4ME7 A;  1K9M C;  2D6F A;  4BY6 B;  1VQ4 A;  1K8A C;  1BI3 A;  2EFI A;  1KQS A;  3OS0 A;  2V8I A;  4M78 F;  2I2L A;  2K5I A;  3WXM B;  4C0D C;  3TU4 K;  5CQY A;  4BE1 A;  1U1S A;  4M7A B;  1M90 U;  1VQK T;  4II1 A;  1I81 A;  5LJ3 j;  5HK0 A;  1AHJ B;  2RH2 A;  3EFR A;  3JSC A;  3L2Z A;  4JDS A;  4RG8 A;  5DLQ E;  3X20 B;  2DVE A;  4M75 D;  1M90 C;  5IT9 E;  4ZGJ B;  4HCB A;  4XQ3 A;  3OMG A;  1PSE A;  2JN0 A;  4E7L A;  4KUD K;  2K4Y A;  5DY9 A;  1U1T A;  4M75 A;  4A4F A;  3PT9 A;  1NE8 A;  4EMG A;  3OYJ A;  3V7S A;  3CD6 T;  5GMK i;  2YRV A;  4P5N A;  1YIJ T;  2R57 A;  1OI1 A;  2ZPI B;  3AHU A;  2DJZ A;  4MML A;  4QVC A;  2HD0 A;  3CCL T;  3C4S A;  3JCM b;  1Q81 C;  3LW5 E;  3A8H B;  4C8Q D;  2CKK A;  4FIB A;  2CS7 A;  4ZGD B;  2XKO C;  5GAN 5;  3DKM A;  2ZPG B;  2DD5 A;  2F5K A;  2JOY A;  2RJD A;  5D6W A;  4C5G A;  1YJN T;  3RMS A;  4PNO A;  3JB9 H;  1M4Z A;  3X26 B;  4R56 A;  2YHT A;  4EMH A;  1WQW A;  2ZZD A;  3I55 T;  3S3O A;  4M7D G;  1Y07 A;  2H3J A;  1VQ9 A;  3CC2 A;  2DXB A;  4PJO D;  4Y91 A;  4J5Y A;  3CCR T;  2XID A;  1BIA A;  4JUV A;  2M0O A;  2RHI A;  4ZN1 A;  3JB9 I;  3MEV A;  2CGH A;  3SDZ A;  4M7D E;  2JUF A;  4HA8 A;  3HL8 A;  1JJ2 A;  3CCV T;  4HT8 A;  1JB0 E;  3QJ6 A;  1N8R U;  5GAM f;  4IKF A;  5A0L A;  5GAN d;  4ATO A;  1WQ7 A;  3OYB A;  3JCM g;  4FL6 A;  3QYH B;  4RKU E;  5GAN 2;  1QVF S;  2RA2 A;  4EMK A;  5GAM h;  1QP3 A;  3CBO A;  2KY9 A;  3CMA A;  2EJ9 A;  3C95 A;  1N6A A;  3FRN A;  3KUF A;  4BI4 A;  4C92 A;  5CKE A;  3MEU A;  4O6J A;  3JRZ A;  5CQX A;  2EQJ A;  3OYI A;  5C6S A;  3MEW A;  1V29 B;  2PUO B;  1Q82 U;  2QI2 A;  1OZ3 A;  4X9C A;  1JBM A;  1O9S A;  3GOX A;  3JCM J;  2WSE E;  2BUD A;  4HT9 A;  3OYD A;  1Y96 A;  2P0K A;  4N4H A;  1ZBX A;  4M7A G;  3L1A A;  5GMK j;  1VQO T;  1OYX A;  2BKD N;  3QII A;  5CKH A;  2NLU A;  3HRT A;  1UB4 A;  1VQ8 T;  3JCM d;  3VUB A;  4M7A E;  4N0A A;  3OYY A;  4C92 C;  4BDY A;  1I5L A;  5LJ3 e;  4O5V A;  2EWN A;  4F7U B;  1OZ2 A;  5I2M A;  1WGS A;  3CCJ A;  1KQS S;  5L8R E;  5LJ5 g;  4M75 C;  3WVE B;  3CCU T;  2GF7 A;  4IUR A;  4ZTF A;  2L8D A;  1Q82 C;  4B9W A;  2QDY B;  2VYT A;  3P8D A;  3CCJ T;  3M53 A;  3RER A;  4JS4 A;  2L89 A;  3QSU A;  2MWP A;  3JCM c;  2RHY A;  2CYZ B;  3P8B B;  1FX7 A;  4EDU A;  5LJ3 h;  2KVQ G;  1N8R C;  2QQ9 A;  4XTV A;  2ZPE B;  4C92 D;  1KD1 C;  5KE2 A;  4DOW A;  2QTX A;  2VV5 A;  3OSS C;  4QQ6 A;  4C8Q C;  5KH6 A;  3G4S A;  4N0A C;  3RIR A;  2KAF A;  2DK3 A;  1S72 A;  4OP0 A;  3LGL A;  4DOV A;  4M75 F;  4LDV A;  3SWN B;  3JB9 F;  1YBY A;  1KHC A;  4PLI A;  4PJO B;  3E19 A;  1NJI U;  2E70 A;  4J83 A;  2V8K A;  2FL7 A;  3S3N A;  3GNF B;  5GAO q;  1Y96 B;  3UDC A;  4J7F A;  1VQO A;  4D6W A;  4M77 E;  1WPY A;  4MZT A;  4C5E A;  3QG1 A;  4ELZ C;  5GAN f;  1VQ5 A;  4MDW A;  2E6Z A;  3HPW A;  4OVA A;  2LNV A;  3QXE B;  5LJ5 f;  3V8J A;  4OB1 B;  4QVD A;  2RI5 A;  2CZ6 B;  1BI2 A;  5GAN 8;  4HCC A;  4TVR A;  3OYH A;  1VQK A;  2PVG B;  4FM4 B;  3PGG A;  3ZFJ A;  3A8L B;  2XDD A;  1YJW A;  1YI2 A;  4M7D B;  4WF2 A;  1KHI A;  2VGM A;  4A4K A;  1YIJ A;  2EIF A;  1XQH A;  1YJ9 A;  3CME A;  5FU7 C;  1UGQ B;  5J26 A;  4IUV A;  2XU8 A;  3J81 E;  3HP9 A;  3VJP A;  2DTH A;  2FYK A;  2EQK A;  3PMI A;  3QKJ A;  4XU2 A;  1H64 1;  3MP1 A;  3G71 A;  2K5L A;  2XHC A;  2RK1 A;  2YLB A;  3NTK A;  3BY7 A;  2QQB A;  2FB7 A;  4M7D D;  3GIB A;  1RI0 A;  2F5T X;  3HFO A;  1BIB A;  1VQL T;  3NFC A;  3H8Z A;  4XTY A;  3I56 A;  2WSC E;  1XTD A;  2P0P A;  5IN1 A;  3I55 A;  4XTW A;  1VQM T;  2E10 A;  2RI3 A;  3P8H A;  4C0D B;  5FRN A;  2HAX A;  4CRI A;  5CR2 A;  3M59 A;  4OB3 B;  4Z02 A;  1YJ9 T;  3CMA T;  1Y7X A;  3JCM Q;  2P0Q A;  5LJ5 j;  5GAO r;  3L2W A;  3HSB A;  3G4S T;  3CCM T;  4MDX A;  3CEY A;  2MF2 A;  2X4J A;  2KMT A;  3OYC A;  2RJF A;  2JTM A;  3OYN A;  3CCL A;  1LJO A;  2E6N A;  3MO8 A;  4FSX A;  4XU0 A;  4PL6 A;  5A0G A;  3L2V A;  4XAX B;  4ZTJ A;  2GQV A;  2XK0 A;  2ZPH B;  5GMK e;  5LJ5 h;  1VQL A;  2YLC A;  3LWH A;  4XTX A;  3GP8 A;  1JJ2 S;  4BD3 A;  1EIF A;  3TCJ A;  3OB9 A;  2RO0 A;  2RJC A;  2X4Y A;  3OQ5 A;  3QUI A;  5CKD A;  5GAN h;  3L2Q A;  1VUB A;  4N4G A;  2QEX A;  3G71 T;  2OTJ T;  2RM4 A;  4JRI A;  3QZ9 B;  4F7U G;  2R5A A;  3SWN C;  2ZCF B;  2KK4 A;  3QJY A;  4PJO E;  3CCM A;  3OBW A;  4PKC C;  4IUU A;  3PMT A;  4UC4 A;  4LD6 A;  4ELY C;  4E7H A;  4C92 B;  1WJS A;  2Y4Y A;  2ZPF B;  4RG2 A;  1VQ7 T;  5GAN 6;  4GY5 A;  5GAN 3;  4C0F A;  3QHS A;  4C92 F;  3OYE A;  2XDB A;  4NL2 A;  1IZ6 A;  4C8Q A;  2X4X A;  2R5M A;  5GMK h;  3CCE A;  4PLL A;  2D0Q B;  3JCM V;  5GAN 7;  2RI2 A;  5LJ3 d;  1YHQ A;  3OS2 A;  5J3B A;  2DIQ A;  3GNG A;  5A0D A;  3M5A A;  4LD9 K;  5GAN e;  1KC8 C;  1VQ8 A;  4OGC A;  4IUQ A;  2O4X A;  3LH0 A;  1VQ5 T;  3M54 A;  4PJO G;  3OSV A;  3TEE A;  1G3T A;  4M77 G;  4A53 A;  3JB9 D;  1Q86 U;  1G3Y A;  1M1K C;  5A2Q E;  1IRE B;  3VYG A;  4M77 F;  2XDP A;  3FEO A;  4RCB A;  5GAO p;  5FRO A;  2EQM A;  3RUX A;  3N5B B;  3MET A;  4M7D C;  1UGS B;  1XOV A;  2R58 A;  4EPC A;  1Y71 A;  3CBM A;  4YTL A;  2GCX A;  5GMK m;  4MMK A;  4BB7 A;  3CPW S;  2MI6 A;  2EAY A;  5FRM A;  1UGR B;  5LJ3 g;  1G3S A;  2LQ8 A;  3FB9 A;  3H6Z A;  5LJ5 d;  2VUB A;  1W2B S;  3C12 A;  3ZBD A;  3OYL A;  3C94 A;  3A8G B;  4RMO A;  4BDZ A;  2QQR A;  3LX7 A;  1LOJ A;  3OYF A;  4KBM B;  4E7K A;  5I21 A;  4OGE A;  2RHU A;  4BI3 A;  3GLX A;  2P4T A;  4A4H A;  3M55 A;  4JS5 A;  2DEQ A;  5HY6 A;  4F7U F;  3OY9 A;  3SFM A;  2MMP A;  5KE3 A;  3L42 A;  4BY6 C;  3DB4 A;  4ZN3 A;  2A3L A;  3E9F A;  4N4I A;  3CCS T;  2IVW A;  4E7J A;  3LYI A;  4NL3 A;  4M78 E;  3DLL A;  1M5Q 1;  3CCU A;  4A54 A;  3F70 A;  4M78 C;  3L2R A;  4XTU A;  2D9T A;  1HK9 A;  3QO3 A;  2DTI A;  2XI9 A;  5FLX E;  3M9Q A;  4M7D F;  2VC8 A;  3URG A;  1S72 T;  4M7A C;  5FU6 C;  4FU6 A;  1KG1 A;  4M78 B;  1QP2 A;  1X6O A;  5I2S A;  4OF1 A;  3NTH A;  3HKS A;  3PTA A;  5GAN 4;  3VUZ A;  2XD0 A;  3PNW C;  4C92 G;  2L5Q A;  4HKE A;  3I56 T;  3UPU A;  2OTL T;  2ZPB B;  2WAC A;  3OA6 A;  3FC3 A;  4LDU A;  2O01 E;  1MHN A;  4KUI A;  2CZ1 B;  3CPF A;  1Q7Y U;  4L59 A;  3L2U A;  3ER0 A;  4IUP A;  5GAO n;  2PQW A;  2DXU A;  1Q81 U;  3INZ A;  1XNI A;  1H3Z A;  2V8J A;  3LLR A;  3R6O A;  3KXT A;  3UWN A;  5GAM e;  3G7Z A;  2K3X A;  3BDL A;  4C8Q E;  1FXX A;  2LRQ A;  3DB3 A;  3CC7 T;  1M1K U;  1O75 A;  1K73 U;  4LDY A;  5CKF A;  3PFS A;  4M77 B;  1YCY A;  3EFS A;  4M75 B;  3G6E T;  5AYF A;  2K3Y A;  4C92 E;  1WJR A;  5GAM j;  1YJW T;  1BI1 A;  3MCA B;  1BKB A;  4BE2 A;  4EMK C;  4M7A D;  2RB6 A;  4XK8 E;  3VYH B;  5HK3 A;  5CAI A;  1VQM A;  3OW2 A;  3JCM X;  3WVD B;  1JRI A;  2DZC A;  1FWZ A;  3ME9 A;  4M7A A;  4NS5 A;  2MAM A;  2EKO A;  1R8O B;  3HRU A;  4BAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...