5A0DA

N-terminal thioester domain of surface protein from clostridium perfringens, cys138ala mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
175
structure length
175
Chain Sequence
b'KYKGYTLLDKYPKEDDFRDAIYIEDMDNNDTSSVVYAFNVTKATPTFKGSVVKVLYNEQFGSSKLFTEKAIKPRVKGDELKNSVLRVIYNGYPSNALGIKEKYQLTEGQFRKLTQRAVWNFTDSNLSLDKLSQKEIDALNELINAKNAIPDNLVLNLYLPDDSYYQNLLGTKFVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SURFACE ANCHORED PROTEIN
publication title An internal thioester in a pathogen surface protein mediates covalent host binding.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Cell adhesion
total genus 58
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5a0dA01
4BUGA 5A0DA 5A0LA 4C0ZA 2XIDA 2XI9A 2XICA 5A0GA
chains in the Genus database with same CATH superfamily
4ELYC 2KRNA 3N5BB 1AWWA 2ROTA 1YBYA 1JB0E 1JO8A 3CBOA 3OS5A 2EJFA 2GGRA 1SHGA 4RCBA 4LUEA 2P0KA 2D8JA 1UHCA 3GBQA 5ECAA 5LJ5g 4MZPA 3KFVA 2K3BA 3F70A 4HA8A 2L0AA 5HK0A 1SEMA 4M78G 1PD0A 1IHVA 3CCRT 2RA2A 3AT1B 2LZ6B 1NPPA 4LDYA 1VQ6A 3VUBA 4J7FA 2AK5A 2ESWA 4QKUA 1VQNA 3GIBA 2HD0A 3M4YA 2BKDN 3JSCA 4JJCA 2LT1A 4DBHA 2RI2A 5LJ3f 3OYLA 1LNXA 4F7UF 3TVTA 2NUPA 2AT1B 3LGLA 1Y96B 5M9OA 1VYVA 4CC7A 4XAXB 4AFSC 3EG1A 2DEUA 4M7AC 4GBQA 5I11A 3RKXA 1O75A 3BDUA 5GAMf 4C0ZA 2VC8A 1BI2A 2DL7A 1JU5C 5LJ5j 1YNZA 2J7IA 9ATCB 4Q5WA 3EG0A 2E3HA 2DD4A 1YIJQ 2E6ZA 2XMFA 2JMCA 4OMPA 4QQDA 1T3LA 3A8GB 3QZ9B 1VQ4Q 1MGQA 1W1FA 1VQPQ 5HK3A 1D1CA 4OMMA 4N0AA 2LQWA 5FU7C 2KDSA 3FJPA 3GP8A 2XICA 1OU8A 5GAN5 2QTVA 1YITT 3X25B 4ANJA 2Y4XA 4E7JA 2QQ9A 1WXBA 2YUQA 3QBYA 3NTIA 3BW1A 2RMOA 4ME7A 4DA4A 2CS7A 4DBQA 2JS2A 2CT3A 1K76A 1RAHB 2GTJA 3QWYA 3S3MA 3M9QA 1YJWA 2RHYA 1B34B 1PC0A 1QKWA 3EFRA 1NJIR 3TU4K 4GY5A 3OS1A 2KYBA 2PVGB 1FXXA 2E12A 4BE1A 4FW1A 4JS5A 4KUIA 3L42A 3CXCS 4RTZA 2HAXA 3G4ST 1ABOA 3FC3A 3I9QA 2E5KA 4FL6A 3DB4A 3CCQA 1G5VA 3PT9A 1X6OA 2XU8A 1M4ZA 2SRCA 1ZBJA 3JCMh 1IZ6A 3CMAQ 1JEGA 2RQRA 4PJJA 5J39A 5I22A 5LJ3e 1YJNT 4B9WA 3OA6A 1KQSS 2ZZDA 1NLOC 3CC7Q 1TH7A 1GBRA 5DY9A 2BUDA 2A08A 1PKSA 2QQSA 1S72Q 1RACB 2Y4YA 4HCZA 5IXBA 4A4FA 4NL2A 1X2KA 4N4GA 1ZLMA 5FU6B 2E41A 2A28A 1VQLQ 4BDZA 1UUEA 3REBB 1TWBA 1RI9A 4M77G 5KCOA 1VQ7A 3CPWP 3QDRB 4JLIA 4ZTFA 3SEMA 3V7RA 2L89A 4LUDA 2F5TX 1YJWT 1YN8A 3G1JA 3QYGB 3OYGA 1WDXA 5GAOr 4LDVA 1YJ9A 1ABQA 1AEYA 1WHGA 2C0TA 5GJVB 2XDBA 3ZL7C 3PTAA 2CSQA 3JCMg 5GJWB 4JLGA 2QAZA 3PMTA 2BE9B 3ME9A 3A8LB 5I2MA 3EGDB 4ORZA 1W2BP 3V8LA 2GQVA 2I2LA 1UDLA 3CCQT 1ZHIA 1QKXA 2DO3A 3M59A 3V7CA 1KK7A 4OF1A 1GFCA 4C8QD 1K0XA 2DIQA 1K0SA 3MKDA 2HZYA 2YRVA 3NTHA 1VQOA 4OB1B 4LD9K 4M7AE 2KYMA 4AFZC 2ZPGB 2JS0A 2F2VA 2V1QA 2YSQA 2LJ0A 4Z8AA 2FZKB 1YIJT 1UGVA 3QKJA 1ZSZB 3M56A 3ZEHA 1RABB 4MDWA 3HKSA 1K73U 3HHTB 1NJIC 3M53A 3EAEA 1VQ4T 3D7SB 1VQPT 3M0SA 3WVDB 1KFZA 2JM8A 1U1TA 2DTIA 4J8OA 1Q7YR 2X3WD 1OI1A 2E64A 4JZ3A 2FPFA 1H92A 4KUDK 1NPRA 4J6WA 2VXEA 2KVQG 4KGXB 2K3YA 3PGGA 4LXCA 3R6NA 5GANf 1X43A 3RIRA 1YJ9T 4NS5A 2LT4A 2KR3A 2MI6A 1I8FA 5CQYA 4X1VA 1UGSB 4BE2A 2OTJA 2CP6A 2HCKA 2RJFA 2JM9A 3RMSA 4R56A 1K8AU 4C92E 2VKNA 1T0HA 1GL5A 2JW4A 4JJBA 2OI3A 4RTWA 3OBWA 4X9CA 5KYYA 1M1FA 4ZGJB 1RAFB 2EKOA 2CDTA 1EZZB 2CYZB 2XDDA 1BIBA 2FYKA 2L8DA 1IGQA 1U8RA 2JTFA 3VS2A 3CMAT 2RD1A 1AZEA 3VS3A 3JB9G 1WHLA 1YI2A 4P5NA 4M7DD 4DBRA 4LE9A 3CC7T 3FB9A 2BZ8A 1Q7YU 2LC4A 3G71Q 2VGNA 1S72T 4OMNA 2KNBB 1RLQC 3GPLA 4F7UE 2KT8A 1BB9A 2FHDA 1WPYA 3QSUA 4ATOA 3CCSQ 2RF0A 1AWOA 1RLPC 3CCVQ 5AYFA 3OSVA 2LNHB 2DD5A 3M54A 3HP9A 2GCXA 3JCMd 3VYHB 4DOWA 3VKIA 1U1SA 3H6ZA 1M5Q1 2DVJA 4N0AC 2QDLA 4ELZC 2RHXA 2DPPB 2KXCA 2QXFA 3M0TA 2IPOB 2P0QA 2DTOA 3NTKA 4B6MA 4FM4B 2EJ9A 3L2WA 4J9EA 1XOVA 2L2PA 2FZGB 1QCOA 3JCMc 2DJZA 1C0MA 1NEBA 4E7IA 2X4JA 2O9SA 2J6KA 3J80E 3HRSA 1AT1B 3L2RA 2I0NA 1BYMA 4A4GA 2CGHA 1NLPC 3PVLA 2R5MA 4HCKA 2RK1A 1OYXA 1Q7YC 4J9GA 1VYUA 2O9VA 4AMCA 3GLXA 5GMKj 1IHWA 1IRXA 5D6XA 1Q86R 1VQ8Q 2A3LA 2CP7A 1PRLC 5HCKA 2PQWA 4CC3A 5KCHA 1KHCA 3OYEA 1MV3A 1DJ7B 2QGGA 3J81E 2DBKA 2KRSA 4IKFA 1WQWA 1XQHA 1OEBA 2JVVA 4XU3A 5I2SA 2PTKA 2GQIA 1MNEA 4ZN3A 4BI3A 2HBPA 5A0DA 4QQ6A 4JZ4A 2JZ2A 3ER0A 3EH2A 2VWFA 1W2BS 2G6FX 2E5QA 1FYNA 2VV5A 1AWXA 2KMTA 5LL6S 1WLPB 3I56A 3JCMX 4HKEA 2ATCB 4PL6A 4Z02A 4YTLA 4DEXA 8ATCB 1KJWA 2EYYA 4EIKA 4F16A 3S3NA 4HVVA 1M27C 4HXJA 2DL8A 2DERA 5A0LA 1GCPA 4J7IA 3HFNA 3CCLA 1V1CA 4C8QA 1BI0A 4D8DA 4N4IA 4BY6B 1MMDA 2A36A 2BZXA 4IURA 3CQTA 4KGZB 3QHSA 4J83A 1ZSZC 4HT8A 5CAIA 2WACA 1TUGB 2DILA 4JRQA 2YRDA 4QVZA 2MYSA 2AZSA 3CPFA 3CCRA 3SWNB 2DNUA 4M75G 4B9XA 1PSEA 1K1ZA 5D6YA 1KHIA 2HBWA 2EAYA 3HPWA 2Y90A 5LJ5h 1Y7XA 2GFAA 2ABLA 3QJ6A 3OYHA 3G71T 4C8QB 2E65A 2DXCA 2F2WA 2V1RA 2CH4W 3JB9H 1SHFA 3CCVT 3QJYA 2YDLA 1M3BA 3EHRA 2L3SA 3GNGA 2RO0A 2CP0A 3OQ5A 4OGCA 3CCUA 3GF5A 3HSBA 1I81A 2DA9A 1Y96A 2RHUA 1Q86C 3M4GA 1U06A 1WHMA 3RERA 5CIUA 2C06A 3FDRA 2OAUA 4E7ZA 4C0FA 3VUZA 1YITA 2O4XA 1WHJA 2ED1A 2KQWA 2F2XA 2NYSA 3JCMP 5I21A 2E3IA 4XTUA 3MEWA 5GAMg 4M75D 1GCQC 1AD5A 1W70A 2SEMA 4RUGA 3AHUA 2DYIA 3I5RA 4A54A 4JRPA 4E7LA 4M7AG 3OYFA 2V26A 1YWOA 1ZUYA 4F04B 1YCYA 2EWNA 2MWOA 2KBTA 2MMPA 2ED0A 4QVDA 4DOVA 4O6JA 1GXIE 1HD3A 3G4SA 3ZFJA 2FPDA 1PM3A 4PJMA 1YCSB 2OJ2A 2DYBA 2HMAA 1D1AA 2QDYB 1B34A 2O4XB 4OB0B 4J9IA 2CREA 4RTTA 5GAN6 3E19A 2JTEA 5GAMj 2RK2A 8AT1B 4M7DB 1YJNA 4FW2A 4C8QF 3CCUT 1SSFA 2K9GA 1JJ2A 4PNOA 5C0MA 3L2QA 4EDUA 1D0ZA 1AVZC 1OULA 1WJQA 2ZGWA 1G2BA 3MCAB 3G7ZA 3BFMA 2DL4A 2BTTA 1MNDA 2EKHA 1RUWA 2PU9B 4LNPA 4RTYA 4QQGA 4ZTJA 4C92G 1QW1A 3UT1A 1OPKA 2QQRA 2IG0A 1SF9A 3I35A 3VS1A 4OVAA 1M30A 4M78D 4XK8E 1CKAA 4IUQA 5CKEA 2ZPHB 1U5SA 2EJGA 3HTRA 1M1GA 3RUXA 4RTXA 1MMNA 4Z88A 2H3EB 3L1AA 5FRMA 2FEIA 2O88A 2PVOB 2P84A 4E7SA 3QZ5B 4D8KA 3LX7A 4OGEA 1N8RR 2K79A 2QEXQ 1RAGB 2K5IA 2XHCA 3KUFA 2DFUA 1K4US 4IUUA 5GAOp 5GAOm 1C1AA 3NGPA 3E9FA 2JXBA 3M57A 5FRNA 1GBQA 1I4K1 2V8IA 1KQ2A 4F7UG 2X51A 1WHKA 1PHTA 1W6XA 1PKTA 3MP8A 2KT1A 2DLPA 1N27A 3H0HA 1IXDA 3CCMQ 3CMEQ 1I0CA 2YLCA 4BY6C 4XU1A 2KK4A 2K2VA 2RHIA 3MEAA 2DRKA 1C6VX 2LRQA 3CCEQ 2OTLQ 3EGDA 2KI7A 3P8DA 1YIJA 3J7AF 3A8MB 2ZCFB 1UHFA 2CZ0B 3MHXA 2LQKA 5LJ5d 2MAMA 2ZAEA 1HJDA 4PFPA 1VQ4A 2X3XD 5GAOl 2HSEB 3SWNC 1VQPA 2CP3A 2COWA 1AZGB 4M7DF 1K73R 4PJOG 1QCFA 3OSSC 1Y0MA 2L3PA 2HQHA 4Y91A 5L8RE 4E2FB 5LJ5e 2D0NA 5GAN4 1TOVA 2HL3A 3PNWC 1N8RU 1TUDA 1ZSZA 5IHNA 5IHIA 4JRKA 3UA7A 1QWFA 4OMLA 4C8QC 3CCJQ 3CC4Q 3CC2Q 4OB3B 3DLMA 2GF7A 5L23A 5CKDA 1GFDA 4J9CA 2M16A 5IN1A 2MPXC 3HRUA 2NUTA 3MO8A 3VS4A 1ZA2B 3DKMA 2EVRA 4HT9A 2RNAA 4RG2A 2K4YA 1BBZA 1K8AR 2X35A 2YLBA 1OQKA 2COYA 3X24B 1QVGA 4M77C 1QCNA 4RCCA 2FVUA 5IH2A 4GLKA 1YHQQ 3CD6Q 1K9MR 5GANg 3EHQA 3CMAA 1SPKA 1NEGA 4L59A 4FYWB 3A8HB 3SB2A 1WI7A 3CCMA 2DKGA 2K6DA 4IUPA 2EQMA 3I5SA 3CC7A 1NYFA 2LVMA 4M77D 2C0IA 4PJOD 1S72A 1EFNA 1N8RC 1M90R 2MCNA 1YWPA 2MWPA 3E2UA 3SHWA 2COZA 2NUTB 2J06A 3JCMf 2B86A 1VQLA 4M4ZA 1G3YA 2VB6A 3G6EQ 2AIRB 3RKWA 2DXUA 4O5VA 1VQ5Q 1I07A 2JN0A 2K5FA 2KE9A 4FT4A 4OMOA 5KYUB 5GAOn 3NMZC 2HEQA 2X4XA 2ZPBB 2RQWA 3NHNA 1GCQA 2RJDA 4RKUE 2J6FA 2DTHA 2VGMA 2GNCA 2AKKA 3CCJA 1TS9A 4BE0A 1D3BA 4CRIA 2QEXT 2BZYA 5GMKh 2RH2A 2XI9A 4M7DC 4FT2A 1QVFA 1R0CB 2QGFB 3C12A 1K9MU 1VA7A 1FMKA 4Z89A 2DMOA 3A5ZB 4M75B 1X27A 2EFIA 2CSIA 1K73C 1R0BG 2VYTA 3MP6A 5CKBA 1ZSGA 2GBQA 1OX8A 1Q95G 2HNIA 1VYTA 3CCMT 4C0DC 3CMET 3CBMA 2CUDA 1M90U 2RQUA 3CD6A 4BUGA 1ZX6A 3MJXA 1UGRB 1HSQA 4FYXB 4PJNA 4XU2A 3KXTA 3RNJA 2LNVA 2OTLT 4M78A 4BDYA 1PNJA 4A4HA 3UPUA 5KYNA 1VQLT 1D3BB 4KBMB 3A98A 3OYCA 1QWEA 2QQAA 2M0YA 4C5HA 5IT9E 2EW3A 1K8AC 1KSWA 1M1KR 3RR6A 5GAOq 1E6HA 4Y92A 4AG1C 2PNIA 3P8BB 4LD6A 1X6BA 1YFNA 4C8QE 5EG2A 1K9MC 4KRTA 2FZCB 1X75C 3JCMe 3CCJT 3CC4T 4QT7A 3UDCA 1VQKQ 3CC2T 2K2MA 2EBPA 4BB7A 4ZGEB 5IXFA 1NZ9A 2M9UA 2XKOC 2M0OA 3C0CA 3JB9I 1SKUB 4Y28E 3EGXA 2QK0A 3QIIA 2D1XA 1UGQB 2RJCA 5FWBA 4M78B 3TEEA 1BI1A 1ZUKA 3VRZA 2ECZA 3M55A 1FX7A 1M90C 1HK9A 1IB8A 3JCMb 4FU6A 3WXMB 3PIPA 3JB9D 2H3JA 1CSKA 3OB9A 1G3SA 2R5AA 2RI5A 4NL3A 1M2VA 2W10A 2C0OA 1YHQT 2YUNA 4CI0C 3CD6T 3OS0A 1K9AA 1V76A 3EG9A 1F1BB 1N9SA 2PVDB 2LTOA 1MUZA 1VQ9Q 1R8OB 3META 2YXYA 1Y71A 4M75F 4BACA 3A1PA 4JPBW 2X4WA 1M9SA 2NLUA 1QMCA 3G71A 3PFSA 1M1KU 3S3OA 3TREA 2LX9A 1NE8A 1WZOA 1LVKA 3EGXB 3CCSA 3FLGA 1ZUUA 5KE2A 3SWNA 1WNLA 3TQ7P 5FWCA 2HKNA 3CCVA 3G6ET 3OYMA 4IUVA 1QVGP 1VQ5T 1M8MA 2JOYA 1S1NA 3OBYA 3V8JA 1MMGA 3EGUA 1M2VB 1B3QA 2GFUA 2CP2A 3EH1A 2YHTA 1T3SA 1EX4A 3ASKA 3EG9B 3Q1JA 3JRZA 4OP0A 2F69A 1M2OA 3FRNA 1Q82R 2MF2A 3VS6A 1B07A 4E6RA 2LCSA 2VXFA 4HCCA 3KBGA 5CO7A 1SG5A 4M7DE 1BU1A 2K57A 3QYHB 1T0JA 1J3TA 2EYXA 1N6AA 2QTXA 4XTWA 4PLLA 1VQMQ 1M3AA 2PZ1A 1UJYA 5LJ3h 1BIAA 2IVWA 3OS2A 1WXTA 3LWIA 3LYIA 4M77A 2D0QB 2DZ9A 4M78F 1M1KC 2IIMA 5A2QE 3I55Q 1BKBA 2AHJB 2F1LA 1VQ8A 1VQ6Q 1U3OA 2CH4A 2P4TA 1VQNQ 1LCKA 5GAMh 1WXUA 3MP1A 1WYXA 2RB6A 4CC2A 1X2QA 5KYWA 1EIFA 3FIFA 3CCST 2DIGA 2AKLA 2DXTA 1JJ2S 1QLYA 1KC8R 1QVFP 3RESA 1RAIB 4C0GA 5GMKe 3CPWA 1JXOA 3JV3A 2QASA 2EQIA 1OV3A 4C5EA 3CBPA 2XK0A 1Q82U 2WSEE 1Z9ZA 3OY9A 5CQXA 4M77B 4M75C 4PJOB 5LJ3g 3O5ZA 1BCOA 1QP3A 1RAAB 1VQKT 1WA7A 1WX6A 3FEOA 2JTMA 3O8VA 3L2ZA 2K7AA 4PKCC 3EFSA 5KYWB 3LW5E 4M7DA 2AZVA 2DBMA 1WJSA 2BIVA 2WSFE 1VQMA 2W0ZA 2LCLA 4AT1B 4ESRA 3RKYA 1YJWQ 1VQ8T 2RI3A 1LOJA 2EYWA 5A0GA 2FPEA 1FMVA 2FB7A 3CEYA 2NWMA 1KC8U 1VQ9T 1CKBA 5LJ3j 3I55A 1N5ZA 5GAN2 2DM1A 2D6FA 4JUVA 3LH5A 1Q82C 2P4RA 4C5GA 3U23A 5DM7R 1VIEA 4X9DA 3QUIA 2L3QA 4EMGA 3CCQQ 3GNFB 4QVCA 1XTDA 3PE0A 2X9HA 3QWXX 2O2OA 3OYBA 2FL7A 4M78C 5CKFA 4AFQC 5LJ5f 4JRIA 6AT1B 3HL8A 4R0KA 3OW2A 1RAEB 1Z9QA 2M1HA 1UJ0A 3E1SA 1SRMA 4LDUA 1OPLA 4JJNK 4C0DB 3JCMV 3VS7A 2YT6A 4VUBA 3ULRB 2CZ6B 1TU0B 2V8JA 4M77F 4OB2B 3RDVA 4M7AD 2QG9B 4PJOF 1VQ7Q 3H0IA 1KC8C 1VQMT 2K5LA 2A37A 2RJEA 2WSCE 1D1BA 2JT4A 1OZ3A 1VIFA 2NUPB 4FSXA 3NFCA 2LJ1A 2KY9A 4EMHA 3QO3A 1YJ9Q 1QVGS 3LGFA 1NG2A 3I55T 4A63B 1UECA 4WF2A 1VQ6T 3SFMA 3IQLA 3RBBB 4KGVB 1KQ1A 4XU0A 3QXEB 1VQNT 5HY6A 1NYGA 4C92C 1XNIA 4DEYA 1X01A 4MZMA 5CCAA 3OYJA 2E1HA 3VS0A 4PFZA 4D6WA 2LMJA 2LQ8A 4PK4A 1TG0A 5LJ3d 4MZTA 4HVUA 4WCIA 3M0RA 1VQOQ 2ZPFB 4KH1B 3PIOA 2J6OA 2RPNA 2MOXA 3EFOA 1AOJA 3QPHA 1I5OB 2HQEA 3UF4A 5FLXE 2KXDA 4C92D 2NUZA 2DK3A 4C8QG 2EGEA 4MMKA 4M75E 1E6GA 5GAMd 5GANh 2A0FB 1RL2A 2DJQA 1QQJA 4LDWA 4EMKA 1G3TA 2D8HA 4J9FA 1MMAA 4XQ3A 4EPCA 5GAMe 3ZBDA 3M58A 1X69A 4F17A 2JMAA 1N9RA 2KEAA 1IGUA 4JDSA 4FCYA 1H8KA 1QVFS 1WGSA 5EC7A 2FO0A 2EQJA 5GAN7 1NJIU 2HKQB 5KYXA 2EQUA 3SD4A 4IIMA 5CK9A 3EFOB 2OTJQ 1PG5B 3VS5A 2HQXA 1G3WA 2KGTA 2QEXA 1UB4A 3S6WA 5DLQE 4HVWA 1PCXA 3TCJA 5KYUA 2QA4Q 5GAN8 4PJOC 4EMKB 5IHKA 1MV0B 1G83A 3H9NA 1E7OA 2RN8A 3CMEA 1G8XA 4DBFA 4M78E 1WQ7A 1JXMA 1UG1A 4RTUA 2KSSA 3JB9F 3CXCA 1LPLA 1YI2Q 1I5LA 3CCEA 1QP2A 4OMQA 2EIFA 2OTLA 4FIBA 5KYXB 2LJ3A 1BCMA 4ZNXA 4DQ2A 4R55A 4M75A 2HSPA 1FWZA 3JCMQ 1Y07A 2DF6A 3WVEB 4M7DG 1KQSA 2YUPA 3E9GA 4RTVA 1D0YA 2KRMA 2DEQA 2D9TA 5GANj 2DETA 1VQ7T 2VUBA 3C4SA 1TXQA 3M5AA 3UA6A 2DXBA 3VRYA 1H3ZA 3JB9J 4J5YA 5CVIA 4ZGDB 1SSHA 1OZ2A 3UWNA 2LQNA 2YWWA 2VVKA 3CC4A 4ZN1A 1JJ2P 3CC2A 1D0XA 3OW2P 1KG1A 3OYKA 3L2UA 2LP5A 2MIOA 2PUKB 2YUOA 1X6GA 2DL5A 1VOMA 4L5GA 2E70A 4A4EA 4F14A 2LCCA 3X20B 1R77A 5CKHA 2CP5A 4IUTA 1Q81R 4BI8B 2QI2A 2GTOA 2QA4A 1H3HA 4MMLA 1SRLA 3BE3A 4MDXA 3VV0A 2V8KA 5KE3A 1I1JA 1UGPB 1YHQA 3C95A 1TSFA 5GMKm 1VQOT 3LLRA 2DVEA 3CCET 4XTVA 3L2VA 1O9SA 5FW9A 4M7AA 3QDFA 5FROA 4II1A 4XTZA 2RM4A 4NOYA 5HKCA 3A8OB 2R57A 1JBMA 3V8KA 3MEVA 1OU9A 1HXDA 4J6YA 4GLMA 1KD1R 3OYAA 2DRMA 4J9BA 3G6EA 2ZPIB 1LJOA 1PRMC 2DL3A 5D6WA 1VQ5A 3H41A 1ACMB 2E6NA 2FRYA 1YP5A 2FG0A 3PMIA 3I56Q 3VJPA 5GMKl 2CUBA 2K3XA 3JCMW 4WTOB 5KYYB 4A4KA 2G3RA 1ZQ1A 2XIDA 2KROA 2L3RA 4FYVB 5KH6A 4CC4B 2LX7A 4E47A 5GANd 1H641 3CCLQ 2OTJT 4RMOA 1Q81U 1KIKA 3RMQA 1A0NB 2XDPA 1TTHB 3OYYA 7AT1B 4M7AB 1MHNA 2RHZA 3NPFA 2XG8D 1BK2A 2CT4A 4FSSA 2OX7A 4M77E 1ARKA 2QA4T 4IIOA 2JUFA 3C94A 3R6OA 4C92A 5GANe 4PJOE 3OYDA 3X28B 2ENMA 1M3CA 4AG2C 5J3BA 4C5IA 1IREB 1VUBA 3DB3A 1W4SA 1WIEA 4JS4A 1B7TA 4QW2A 3CCRQ 2X4YA 1OX9A 1UEBA 5FU6C 3T9NA 1QVPA 2EGAA 5FU7B 3OMCA 3CPWS 2HDAA 2RQVA 1YI2T 2XD0A 1WHHA 2CZ7B 2CKKA 2Z0WA 1KD1U 5GMKi 3M0QA 3SDZA 4PFOA 2PUOB 3H0FA 3MEUA 3JAME 4N4HA 2BE7D 4OMFB 4BI4A 3VYGA 4KULA 4F7UA 1OOTA 1RI0A 4C92B 1Q81C 1P92A 4KH0B 3GOXA 1GRIA 2KAFA 2EGCA 1HYOA 4E7KA 2E10A 2EYZA 3HRTA 4EMKC 3INZA 3CCUQ 1UE9A 5J26A 3URGA 1PWTA 1VQKA 1NBEB 3CXCP 3V7SA 4XTYA 1XJWB 2OAWA 3THKA 4LDXA 3QG1A 2M51A 4X34A 1FMWA 2JJ9A 2A7YA 4E7HA 5AT1B 1JQQA 4JJDA 4BD3A 4PLIA 1YITQ 2QYZA 3LWHA 2H8HA 1AWJA 2LDMA 2P0PA 4XTXA 3UATA 2F5KA 5GAN3 4KT0E 1UFFA 3EG3A 2B8AA 1NM7A 3EG2A 1WFWA 1IO6A 4PJOA 4V2SA 2EPDA 1KQSP 1V29B 1RADB 1KD1C 4A53A 2M02A 4AFUC 1Q86U 3VU3C 4M7AF 1PD1A 1WJRA 4F7UB 3X26B 3M0PA 5DLOA 1TUCA 5IAYA 3REAB 2L5QA 1VQ9A 4L6V5 2QQBA 4J9HA 1AHJB 1Y57A 2DE0X 2J05A 2O31A 3LH0A 2RQTA 1M8VA 2DAQA 2FRWA 2EYQA 2HL5C 3PVQA 1BI3A 3OYIA 3G4SQ 4LN2A 2ROLA 3OW2S 1ZA1B 3OMGA 1JRIA 4J6XA 4PJLA 3BY7A 4K11A 3M0UA 2DX1A 4J9DA 5CR2A 1D09B 4HCBA 2E4HA 3FJ5A 2O01E 3H8ZA 2JNGA 3TSWA 1UTIA 2CZ1B 3DLLA 1YJNQ 2DZCA 1ZBXA 4RG8A 3I56T 4FYYB 2YRCA 3BDLA 3MPUB 2EQKA 2MK5A 2R58A 3P8HA 1PSFA 5C6SA 4TVRA 4UC4A 3JCMJ 1W2BA 3OYNA 3TSZA 5D7UA 3CCLT 2VASA 4C92F 2ZPEB 3HFOA
chains in the Genus database with same CATH topology
4MZTA 4ELYC 3J81E 4IKFA 1WQWA 2ZPFB 1XQHA 2JVVA 3N5BB 4XU3A 3PIOA 2RJDA 4RKUE 5I2SA 2DTHA 2VGMA 1YBYA 4ZN3A 3CCJA 4BI3A 1JB0E 3QPHA 3CBOA 3OS5A 2EJFA 2HQEA 5FLXE 4RCBA 4BE0A 2HBPA 4C92D 1D3BA 4CRIA 2QEXT 2P0KA 5GMKh 5A0DA 2DK3A 2RH2A 4QQ6A 4C8QG 2XI9A 5LJ5g 4M7DC 4MMKA 2JZ2A 3ER0A 4MZPA 4M75E 4FT2A 1QVFA 3HSBA 3F70A 4HA8A 5GAMd 1W2BS 3C12A 1K9MU 5GANh 5HK0A 4M78G 3CCRT 1RL2A 2E5QA 2VV5A 2RA2A 2KMTA 5LL6S 3A5ZB 4LDWA 4M75B 3I56A 1NPPA 4LDYA 4EMKA 3JCMX 4HKEA 1G3TA 2EFIA 4PL6A 1VQ6A 3VUBA 1K73C 4J7FA 1VQNA 3MP6A 2VYTA 5CKBA 4YTLA 2HD0A 3M4YA 2BKDN 4XQ3A 4Z02A 4EPCA 3GIBA 3JSCA 2HNIA 2LT1A 2RI2A 5GAMe 3CCMT 5LJ3f 3OYLA 4C0DC 3CMET 1LNXA 3S3NA 3CBMA 5A0LA 3ZBDA 4F7UF 3M58A 4J7IA 3HFNA 1N9RA 3CCLA 1M90U 3CD6A 4C8QA 1BI0A 4JDSA 4BUGA 3LGLA 1UGRB 1QVFS 1Y96B 5M9OA 1WGSA 4XU2A 4XAXB 3KXTA 4N4IA 2LNVA 4BY6B 2OTLT 4M78A 4BDYA 2EQJA 5GAN7 1NJIU 4IURA 2EQUA 3SD4A 4M7AC 4A4HA 5CK9A 3QHSA 4J83A 3UPUA 3RKXA 1O75A 3BDUA 5GAMf 4C0ZA 1VQLT 2VC8A 1BI2A 5LJ5j 2HQXA 1D3BB 1G3WA 4KBMB 1UB4A 4Q5WA 5CAIA 3OYCA 2QEXA 4HT8A 2WACA 2DD4A 3S6WA 5DLQE 2QQAA 2E6ZA 4JRQA 4QQDA 4C5HA 4QVZA 5IT9E 3A8GB 3TCJA 3CPFA 1K8AC 3CCRA 3QZ9B 3SWNB 5GAN8 4PJOC 1MGQA 5GAOq 4M75G 4B9XA 4EMKB 1PSEA 5D6YA 1KHIA 2OTLA 5HK3A 3P8BB 2EAYA 4LD6A 3HPWA 4N0AA 5FU7C 2Y90A 4C8QE 2KDSA 3FJPA 5EG2A 3GP8A 1K9MC 5LJ5h 2XICA 1X75C 3JCMe 1Y7XA 3CCJT 3CMEA 2GFAA 5GAN5 3CC4T 1YITT 3UDCA 3CC2T 3X25B 3QJ6A 2Y4XA 4E7JA 4M78E 1WQ7A 4BB7A 3OYHA 2QQ9A 4ZGEB 3G71T 2KSSA 4C8QB 3JB9F 1NZ9A 2E65A 3QBYA 2M9UA 3CXCA 2XKOC 2M0OA 3NTIA 3JB9I 2DXCA 3BW1A 1I5LA 3CCEA 1QP2A 4Y28E 3QIIA 2EIFA 4ME7A 4DA4A 2RJCA 1UGQB 4FIBA 2CS7A 4M78B 1BI1A 3TEEA 3JB9H 4DQ2A 4R55A 4M75A 3M55A 3CCVT 3S3MA 3M9QA 1YJWA 1FX7A 1M90C 3QJYA 1HK9A 2RHYA 1B34B 3JCMb 4FU6A 1FWZA 3WXMB 3EFRA 3PIPA 3TU4K 3JB9D 2H3JA 4GY5A 3JCMQ 1Y07A 3OB9A 1G3SA 3GNGA 3WVEB 2R5AA 2RO0A 2RI5A 3OS1A 4NL3A 1NJIC 4M7DG 2PVGB 3OQ5A 4OGCA 1KQSA 1FXXA 2E12A 3E9GA 3GF5A 3CCUA 1I81A 4JS5A 4BE1A 4CI0C 1YHQT 3CD6T 3OS0A 4KUIA 3L42A 2DEQA 2D9TA 1Y96A 2RHUA 3CXCS 5GANj 1Q86C 1VQ7T 2VUBA 3M4GA 1N9SA 2PVDB 2LTOA 3C4SA 3G4ST 2HAXA 3RERA 3M5AA 3FC3A 2DXBA 5CIUA 1R8OB 3META 1H3ZA 3JB9J 1Y71A 4FL6A 4J5YA 4M75F 5CVIA 4ZGDB 3DB4A 3CCQA 3FDRA 2OAUA 2C06A 1G5VA 1OZ2A 3PT9A 3UWNA 4C0FA 3VUZA 1X6OA 2XU8A 1M4ZA 1YITA 2X4WA 4ZN1A 3CC4A 2O4XA 1M9SA 3CC2A 2NLUA 1IZ6A 2KQWA 3JCMh 3G71A 3PFSA 3JCMP 1M1KU 3S3OA 3TREA 2LX9A 5J39A 1NE8A 5I21A 1KG1A 5LJ3e 3OYKA 3L2UA 1YJNT 4XTUA 3CCSA 4B9WA 3FLGA 3MEWA 3OA6A 2ZZDA 5KE2A 5GAMg 4M75D 1KQSS 1TH7A 2PUKB 3SWNA 1WNLA 5DY9A 2BUDA 3AHUA 4A54A 4L5GA 4JRPA 2E70A 3G6ET 3CCVA 4E7LA 4M7AG 4A4EA 2QQSA 3OYMA 4IUVA 3OYFA 2Y4YA 4HCZA 1VQ5T 2LCCA 3X20B 5CKHA 2JOYA 4IUTA 4A4FA 4NL2A 3OBYA 2QI2A 3V8JA 4N4GA 1YCYA 2EWNA 4BI8B 2QA4A 5FU6B 2E41A 2MWOA 2MMPA 4MMLA 4BDZA 4MDXA 3VV0A 4DOVA 2GFUA 2V8KA 4QVDA 5KE3A 1UGPB 2YHTA 1YHQA 3C95A 5GMKm 4M77G 1VQOT 4O6JA 3LLRA 5KCOA 1GXIE 3ASKA 3Q1JA 2DVEA 1VQ7A 3JRZA 4OP0A 3CCET 3QDRB 4XTVA 3G4SA 3ZFJA 2F69A 4JLIA 3FRNA 4ZTFA 3L2VA 2MF2A 1O9SA 3V7RA 2VXFA 4M7AA 4HCCA 2L89A 3KBGA 2F5TX 5CO7A 5FROA 4BACA 1YJWT 2QDYB 4M7DE 3QYGB 1B34A 4II1A 4XTZA 2RM4A 4NOYA 2O4XB 3OYGA 2K57A 3QYHB 4OB0B 5HKCA 5GAOr 3A8OB 4LDVA 1YJ9A 5GAN6 3E19A 1N6AA 2R57A 2QTXA 4XTWA 4PLLA 5GAMj 1JBMA 2XDBA 3PTAA 3V8KA 2RK2A 4M7DB 1YJNA 3MEVA 5LJ3h 1BIAA 2IVWA 3JCMg 4C8QF 3OS2A 1HXDA 3CCUT 1SSFA 4J6YA 4JLGA 3LWIA 3LYIA 1JJ2A 4M77A 4PNOA 5C0MA 3OYAA 4EDUA 3L2QA 3PMTA 1WJQA 2D0QB 2ZGWA 3A8LB 2DZ9A 3ME9A 3MCAB 3G7ZA 5I2MA 4M78F 3G6EA 3BFMA 2ZPIB 1M1KC 1LJOA 5D6WA 5A2QE 1VQ5A 3V8LA 2E6NA 1BKBA 2GQVA 2PU9B 2AHJB 3PMIA 2I2LA 3VJPA 3CCQT 1VQ8A 1ZHIA 4QQGA 5GMKl 2DO3A 3M59A 4ZTJA 3V7CA 2K3XA 2P4TA 4OF1A 4C8QD 4C92G 2DIQA 1QW1A 5GAMh 3UT1A 3JCMW 3MP1A 4A4KA 2QQRA 2IG0A 2RB6A 2G3RA 2YRVA 3NTHA 4OVAA 1ZQ1A 4M78D 4XK8E 4OB1B 4IUQA 1VQOA 4LD9K 2XIDA 4M7AE 1EIFA 3FIFA 3CCST 2DIGA 2L3RA 5KH6A 2ZPGB 4E47A 5GANd 1H641 2DXTA 1JJ2S 4RMOA 2OTJT 5CKEA 2ZPHB 2EJGA 1Q81U 3RMQA 2XDPA 1M1GA 3OYYA 4M7AB 3RESA 3RUXA 1MHNA 2RHZA 4C0GA 1YIJT 3L1AA 3QKJA 2XG8D 5GMKe 3CPWA 3M56A 5FRMA 3ZEHA 2PVOB 4M77E 4MDWA 2QA4T 3HKSA 3QZ5B 1K73U 4C5EA 3HHTB 3CBPA 2XK0A 2JUFA 3C94A 3LX7A 3R6OA 3M53A 4OGEA 4C92A 5GANe 3EAEA 1VQ4T 4PJOE 3OYDA 3X28B 1Q82U 2WSEE 2K5IA 3OY9A 5J3BA 2XHCA 3WVDB 4C5IA 3KUFA 5CQXA 1IREB 4M77B 1VQPT 1U1TA 4IUUA 1VUBA 4M75C 5GAOp 3DB3A 1W4SA 4PJOB 4JS4A 2DTIA 4J8OA 5GAOm 3E9FA 1OI1A 2E64A 4QW2A 3M57A 5LJ3g 5FRNA 2X4YA 1I4K1 4KUDK 1NPRA 1QP3A 2V8IA 1VQKT 4J6WA 1KQ2A 1UEBA 5FU6C 4F7UG 3T9NA 1QVPA 2VXEA 5FU7B 2KVQG 3FEOA 3OMCA 2JTMA 3O8VA 2K3YA 3L2ZA 3PGGA 4PKCC 5GANf 3CPWS 1YI2T 2XD0A 1YJ9T 3EFSA 3RIRA 2LT4A 2CZ7B 3MP8A 2CKKA 4NS5A 1N27A 2MI6A 1KD1U 1I8FA 5CQYA 3LW5E 5GMKi 3SDZA 4M7DA 2YLCA 4BY6C 1UGSB 4XU1A 2KK4A 2PUOB 2K2VA 4BE2A 2OTJA 1WJSA 3MEUA 3JAME 2RHIA 2RJFA 3MEAA 2LRQA 4N4HA 4OMFB 3RMSA 4R56A 4BI4A 3P8DA 2BIVA 4C92E 2WSFE 1YIJA 1K8AU 3VYGA 1VQMA 3A8MB 2ZCFB 3J7AF 2CZ0B 2LCLA 4KULA 3MHXA 3RKYA 4F7UA 2LQKA 5LJ5d 2MAMA 1VQ8T 2RI3A 1LOJA 3OBWA 1RI0A 4C92B 1Q81C 1VQ4A 5A0GA 1P92A 4X9CA 5GAOl 3CEYA 2FB7A 1M1FA 3SWNC 4ZGJB 3GOXA 1VQPA 1KC8U 1VQ9T 2KAFA 2EKOA 3I55A 5LJ3j 4M7DF 2CYZB 2XDDA 4E7KA 2E10A 1BIBA 2FYKA 3HRTA 4EMKC 5GAN2 4PJOG 2L8DA 2D6FA 3INZA 4JUVA 1U8RA 3OSSC 2JTFA 5J26A 5L8RE 4Y91A 3URGA 1VQKA 5LJ5e 3V7SA 4XTYA 3CMAT 4LDXA 1Q82C 2RD1A 3QG1A 5GAN4 3PNWC 4C5GA 5DM7R 1N8RU 4X34A 1VIEA 3JB9G 4X9DA 2A7YA 3QUIA 4JRKA 1YI2A 4E7HA 4P5NA 4EMGA 4M7DD 4C8QC 3GNFB 4BD3A 4PLIA 3CC7T 4QVCA 1XTDA 3FB9A 3LWHA 1Q7YU 4OB3B 3OYBA 2LC4A 2FL7A 2LDMA 2GF7A 3DLMA 4M78C 5CKFA 2P0PA 4XTXA 5GAN3 2F5KA 2VGNA 5CKDA 1S72T 4KT0E 3GPLA 2M16A 5IN1A 4F7UE 2B8AA 4JRIA 2FHDA 3HRUA 1WPYA 5LJ5f 3QSUA 4ATOA 4PJOA 3HL8A 4V2SA 3MO8A 3OW2A 1V29B 1KD1C 3DKMA 4HT9A 2M1HA 4A53A 3E1SA 1Q86U 3VU3C 4M7AF 1WJRA 4F7UB 5AYFA 4LDUA 4RG2A 3OSVA 2K4YA 3X26B 2X35A 2DD5A 3M54A 5DLOA 3HP9A 2GCXA 2YLBA 3VYHB 4C0DB 3JCMd 4JJNK 3JCMV 3X24B 5IAYA 1QVGA 4M77C 4VUBA 2L5QA 4RCCA 4DOWA 1VQ9A 4L6V5 3VKIA 2FVUA 2QQBA 1AHJB 3LH0A 2CZ6B 1M8VA 2DAQA 1U1SA 4GLKA 2EYQA 2V8JA 3H6ZA 4M77F 4OB2B 4M7AD 1M5Q1 5GANg 4N0AC 4ELZC 2RHXA 3CMAA 4L59A 4PJOF 1BI3A 2DPPB 3OYIA 2QXFA 3A8HB 3OW2S 3SB2A 1KC8C 3CCMA 2P0QA 1VQMT 2DTOA 3NTKA 1JRIA 2K5LA 3OMGA 4J6XA 2DKGA 2RJEA 2WSCE 2EJ9A 4FM4B 4IUPA 3L2WA 3BY7A 1XOVA 2EQMA 1OZ3A 1VIFA 3CC7A 4FSXA 3NFCA 2KY9A 4EMHA 2LVMA 4M77D 3QO3A 3JCMc 2DJZA 5CR2A 4E7IA 2X4JA 1QVGS 3LGFA 4HCBA 4PJOD 1S72A 3J80E 2O01E 3H8ZA 3HRSA 1N8RC 2JNGA 3I55T 3L2RA 2CZ1B 2MWPA 3DLLA 2DZCA 1ZBXA 1BYMA 4RG8A 4A4GA 3I56T 2CGHA 4WF2A 3JCMf 3BDLA 1VQLA 1VQ6T 2EQKA 3SFMA 2R5MA 1KQ1A 1G3YA 2RK1A 4XU0A 1OYXA 3QXEB 1Q7YC 1VQNT 3RKWA 2R58A 2DXUA 5HY6A 3P8HA 1PSFA 4C92C 5C6SA 1XNIA 4O5VA 4TVRA 1X01A 2JN0A 3GLXA 4MZMA 5CCAA 2K5FA 4UC4A 5GMKj 3OYJA 4FT4A 5D6XA 2E1HA 3JCMJ 1W2BA 3OYNA 2A3LA 3CCLT 5GAOn 2PQWA 4C92F 4D6WA 5KCHA 1KHCA 2LQ8A 2ZPEB 3HFOA 3OYEA 2X4XA 1DJ7B 2ZPBB 5LJ3d
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUG A;  5A0D A;  5A0L A;  4C0Z A;  2XID A;  2XI9 A;  2XIC A;  5A0G A; 
#chains in the Genus database with same CATH topology
 4ELY C;  2KRN A;  3N5B B;  1AWW A;  2ROT A;  1YBY A;  1JB0 E;  1JO8 A;  3CBO A;  3OS5 A;  2EJF A;  2GGR A;  1SHG A;  4RCB A;  4LUE A;  2P0K A;  2D8J A;  1UHC A;  3GBQ A;  5ECA A;  5LJ5 g;  4MZP A;  3KFV A;  2K3B A;  3F70 A;  4HA8 A;  2L0A A;  5HK0 A;  1SEM A;  4M78 G;  1PD0 A;  1IHV A;  3CCR T;  2RA2 A;  3AT1 B;  2LZ6 B;  1NPP A;  4LDY A;  1VQ6 A;  3VUB A;  4J7F A;  2AK5 A;  2ESW A;  4QKU A;  1VQN A;  3GIB A;  2HD0 A;  3M4Y A;  2BKD N;  3JSC A;  4JJC A;  2LT1 A;  4DBH A;  2RI2 A;  5LJ3 f;  3OYL A;  1LNX A;  4F7U F;  3TVT A;  2NUP A;  2AT1 B;  3LGL A;  1Y96 B;  5M9O A;  1VYV A;  4CC7 A;  4XAX B;  4AFS C;  3EG1 A;  2DEU A;  4M7A C;  4GBQ A;  5I11 A;  3RKX A;  1O75 A;  3BDU A;  5GAM f;  4C0Z A;  2VC8 A;  1BI2 A;  2DL7 A;  1JU5 C;  5LJ5 j;  1YNZ A;  2J7I A;  9ATC B;  4Q5W A;  3EG0 A;  2E3H A;  2DD4 A;  1YIJ Q;  2E6Z A;  2XMF A;  2JMC A;  4OMP A;  4QQD A;  1T3L A;  3A8G B;  3QZ9 B;  1VQ4 Q;  1MGQ A;  1W1F A;  1VQP Q;  5HK3 A;  1D1C A;  4OMM A;  4N0A A;  2LQW A;  5FU7 C;  2KDS A;  3FJP A;  3GP8 A;  2XIC A;  1OU8 A;  5GAN 5;  2QTV A;  1YIT T;  3X25 B;  4ANJ A;  2Y4X A;  4E7J A;  2QQ9 A;  1WXB A;  2YUQ A;  3QBY A;  3NTI A;  3BW1 A;  2RMO A;  4ME7 A;  4DA4 A;  2CS7 A;  4DBQ A;  2JS2 A;  2CT3 A;  1K76 A;  1RAH B;  2GTJ A;  3QWY A;  3S3M A;  3M9Q A;  1YJW A;  2RHY A;  1B34 B;  1PC0 A;  1QKW A;  3EFR A;  1NJI R;  3TU4 K;  4GY5 A;  3OS1 A;  2KYB A;  2PVG B;  1FXX A;  2E12 A;  4BE1 A;  4FW1 A;  4JS5 A;  4KUI A;  3L42 A;  3CXC S;  4RTZ A;  2HAX A;  3G4S T;  1ABO A;  3FC3 A;  3I9Q A;  2E5K A;  4FL6 A;  3DB4 A;  3CCQ A;  1G5V A;  3PT9 A;  1X6O A;  2XU8 A;  1M4Z A;  2SRC A;  1ZBJ A;  3JCM h;  1IZ6 A;  3CMA Q;  1JEG A;  2RQR A;  4PJJ A;  5J39 A;  5I22 A;  5LJ3 e;  1YJN T;  4B9W A;  3OA6 A;  1KQS S;  2ZZD A;  1NLO C;  3CC7 Q;  1TH7 A;  1GBR A;  5DY9 A;  2BUD A;  2A08 A;  1PKS A;  2QQS A;  1S72 Q;  1RAC B;  2Y4Y A;  4HCZ A;  5IXB A;  4A4F A;  4NL2 A;  1X2K A;  4N4G A;  1ZLM A;  5FU6 B;  2E41 A;  2A28 A;  1VQL Q;  4BDZ A;  1UUE A;  3REB B;  1TWB A;  1RI9 A;  4M77 G;  5KCO A;  1VQ7 A;  3CPW P;  3QDR B;  4JLI A;  4ZTF A;  3SEM A;  3V7R A;  2L89 A;  4LUD A;  2F5T X;  1YJW T;  1YN8 A;  3G1J A;  3QYG B;  3OYG A;  1WDX A;  5GAO r;  4LDV A;  1YJ9 A;  1ABQ A;  1AEY A;  1WHG A;  2C0T A;  5GJV B;  2XDB A;  3ZL7 C;  3PTA A;  2CSQ A;  3JCM g;  5GJW B;  4JLG A;  2QAZ A;  3PMT A;  2BE9 B;  3ME9 A;  3A8L B;  5I2M A;  3EGD B;  4ORZ A;  1W2B P;  3V8L A;  2GQV A;  2I2L A;  1UDL A;  3CCQ T;  1ZHI A;  1QKX A;  2DO3 A;  3M59 A;  3V7C A;  1KK7 A;  4OF1 A;  1GFC A;  4C8Q D;  1K0X A;  2DIQ A;  1K0S A;  3MKD A;  2HZY A;  2YRV A;  3NTH A;  1VQO A;  4OB1 B;  4LD9 K;  4M7A E;  2KYM A;  4AFZ C;  2ZPG B;  2JS0 A;  2F2V A;  2V1Q A;  2YSQ A;  2LJ0 A;  4Z8A A;  2FZK B;  1YIJ T;  1UGV A;  3QKJ A;  1ZSZ B;  3M56 A;  3ZEH A;  1RAB B;  4MDW A;  3HKS A;  1K73 U;  3HHT B;  1NJI C;  3M53 A;  3EAE A;  1VQ4 T;  3D7S B;  1VQP T;  3M0S A;  3WVD B;  1KFZ A;  2JM8 A;  1U1T A;  2DTI A;  4J8O A;  1Q7Y R;  2X3W D;  1OI1 A;  2E64 A;  4JZ3 A;  2FPF A;  1H92 A;  4KUD K;  1NPR A;  4J6W A;  2VXE A;  2KVQ G;  4KGX B;  2K3Y A;  3PGG A;  4LXC A;  3R6N A;  5GAN f;  1X43 A;  3RIR A;  1YJ9 T;  4NS5 A;  2LT4 A;  2KR3 A;  2MI6 A;  1I8F A;  5CQY A;  4X1V A;  1UGS B;  4BE2 A;  2OTJ A;  2CP6 A;  2HCK A;  2RJF A;  2JM9 A;  3RMS A;  4R56 A;  1K8A U;  4C92 E;  2VKN A;  1T0H A;  1GL5 A;  2JW4 A;  4JJB A;  2OI3 A;  4RTW A;  3OBW A;  4X9C A;  5KYY A;  1M1F A;  4ZGJ B;  1RAF B;  2EKO A;  2CDT A;  1EZZ B;  2CYZ B;  2XDD A;  1BIB A;  2FYK A;  2L8D A;  1IGQ A;  1U8R A;  2JTF A;  3VS2 A;  3CMA T;  2RD1 A;  1AZE A;  3VS3 A;  3JB9 G;  1WHL A;  1YI2 A;  4P5N A;  4M7D D;  4DBR A;  4LE9 A;  3CC7 T;  3FB9 A;  2BZ8 A;  1Q7Y U;  2LC4 A;  3G71 Q;  2VGN A;  1S72 T;  4OMN A;  2KNB B;  1RLQ C;  3GPL A;  4F7U E;  2KT8 A;  1BB9 A;  2FHD A;  1WPY A;  3QSU A;  4ATO A;  3CCS Q;  2RF0 A;  1AWO A;  1RLP C;  3CCV Q;  5AYF A;  3OSV A;  2LNH B;  2DD5 A;  3M54 A;  3HP9 A;  2GCX A;  3JCM d;  3VYH B;  4DOW A;  3VKI A;  1U1S A;  3H6Z A;  1M5Q 1;  2DVJ A;  4N0A C;  2QDL A;  4ELZ C;  2RHX A;  2DPP B;  2KXC A;  2QXF A;  3M0T A;  2IPO B;  2P0Q A;  2DTO A;  3NTK A;  4B6M A;  4FM4 B;  2EJ9 A;  3L2W A;  4J9E A;  1XOV A;  2L2P A;  2FZG B;  1QCO A;  3JCM c;  2DJZ A;  1C0M A;  1NEB A;  4E7I A;  2X4J A;  2O9S A;  2J6K A;  3J80 E;  3HRS A;  1AT1 B;  3L2R A;  2I0N A;  1BYM A;  4A4G A;  2CGH A;  1NLP C;  3PVL A;  2R5M A;  4HCK A;  2RK1 A;  1OYX A;  1Q7Y C;  4J9G A;  1VYU A;  2O9V A;  4AMC A;  3GLX A;  5GMK j;  1IHW A;  1IRX A;  5D6X A;  1Q86 R;  1VQ8 Q;  2A3L A;  2CP7 A;  1PRL C;  5HCK A;  2PQW A;  4CC3 A;  5KCH A;  1KHC A;  3OYE A;  1MV3 A;  1DJ7 B;  2QGG A;  3J81 E;  2DBK A;  2KRS A;  4IKF A;  1WQW A;  1XQH A;  1OEB A;  2JVV A;  4XU3 A;  5I2S A;  2PTK A;  2GQI A;  1MNE A;  4ZN3 A;  4BI3 A;  2HBP A;  5A0D A;  4QQ6 A;  4JZ4 A;  2JZ2 A;  3ER0 A;  3EH2 A;  2VWF A;  1W2B S;  2G6F X;  2E5Q A;  1FYN A;  2VV5 A;  1AWX A;  2KMT A;  5LL6 S;  1WLP B;  3I56 A;  3JCM X;  4HKE A;  2ATC B;  4PL6 A;  4Z02 A;  4YTL A;  4DEX A;  8ATC B;  1KJW A;  2EYY A;  4EIK A;  4F16 A;  3S3N A;  4HVV A;  1M27 C;  4HXJ A;  2DL8 A;  2DER A;  5A0L A;  1GCP A;  4J7I A;  3HFN A;  3CCL A;  1V1C A;  4C8Q A;  1BI0 A;  4D8D A;  4N4I A;  4BY6 B;  1MMD A;  2A36 A;  2BZX A;  4IUR A;  3CQT A;  4KGZ B;  3QHS A;  4J83 A;  1ZSZ C;  4HT8 A;  5CAI A;  2WAC A;  1TUG B;  2DIL A;  4JRQ A;  2YRD A;  4QVZ A;  2MYS A;  2AZS A;  3CPF A;  3CCR A;  3SWN B;  2DNU A;  4M75 G;  4B9X A;  1PSE A;  1K1Z A;  5D6Y A;  1KHI A;  2HBW A;  2EAY A;  3HPW A;  2Y90 A;  5LJ5 h;  1Y7X A;  2GFA A;  2ABL A;  3QJ6 A;  3OYH A;  3G71 T;  4C8Q B;  2E65 A;  2DXC A;  2F2W A;  2V1R A;  2CH4 W;  3JB9 H;  1SHF A;  3CCV T;  3QJY A;  2YDL A;  1M3B A;  3EHR A;  2L3S A;  3GNG A;  2RO0 A;  2CP0 A;  3OQ5 A;  4OGC A;  3CCU A;  3GF5 A;  3HSB A;  1I81 A;  2DA9 A;  1Y96 A;  2RHU A;  1Q86 C;  3M4G A;  1U06 A;  1WHM A;  3RER A;  5CIU A;  2C06 A;  3FDR A;  2OAU A;  4E7Z A;  4C0F A;  3VUZ A;  1YIT A;  2O4X A;  1WHJ A;  2ED1 A;  2KQW A;  2F2X A;  2NYS A;  3JCM P;  5I21 A;  2E3I A;  4XTU A;  3MEW A;  5GAM g;  4M75 D;  1GCQ C;  1AD5 A;  1W70 A;  2SEM A;  4RUG A;  3AHU A;  2DYI A;  3I5R A;  4A54 A;  4JRP A;  4E7L A;  4M7A G;  3OYF A;  2V26 A;  1YWO A;  1ZUY A;  4F04 B;  1YCY A;  2EWN A;  2MWO A;  2KBT A;  2MMP A;  2ED0 A;  4QVD A;  4DOV A;  4O6J A;  1GXI E;  1HD3 A;  3G4S A;  3ZFJ A;  2FPD A;  1PM3 A;  4PJM A;  1YCS B;  2OJ2 A;  2DYB A;  2HMA A;  1D1A A;  2QDY B;  1B34 A;  2O4X B;  4OB0 B;  4J9I A;  2CRE A;  4RTT A;  5GAN 6;  3E19 A;  2JTE A;  5GAM j;  2RK2 A;  8AT1 B;  4M7D B;  1YJN A;  4FW2 A;  4C8Q F;  3CCU T;  1SSF A;  2K9G A;  1JJ2 A;  4PNO A;  5C0M A;  3L2Q A;  4EDU A;  1D0Z A;  1AVZ C;  1OUL A;  1WJQ A;  2ZGW A;  1G2B A;  3MCA B;  3G7Z A;  3BFM A;  2DL4 A;  2BTT A;  1MND A;  2EKH A;  1RUW A;  2PU9 B;  4LNP A;  4RTY A;  4QQG A;  4ZTJ A;  4C92 G;  1QW1 A;  3UT1 A;  1OPK A;  2QQR A;  2IG0 A;  1SF9 A;  3I35 A;  3VS1 A;  4OVA A;  1M30 A;  4M78 D;  4XK8 E;  1CKA A;  4IUQ A;  5CKE A;  2ZPH B;  1U5S A;  2EJG A;  3HTR A;  1M1G A;  3RUX A;  4RTX A;  1MMN A;  4Z88 A;  2H3E B;  3L1A A;  5FRM A;  2FEI A;  2O88 A;  2PVO B;  2P84 A;  4E7S A;  3QZ5 B;  4D8K A;  3LX7 A;  4OGE A;  1N8R R;  2K79 A;  2QEX Q;  1RAG B;  2K5I A;  2XHC A;  3KUF A;  2DFU A;  1K4U S;  4IUU A;  5GAO p;  5GAO m;  1C1A A;  3NGP A;  3E9F A;  2JXB A;  3M57 A;  5FRN A;  1GBQ A;  1I4K 1;  2V8I A;  1KQ2 A;  4F7U G;  2X51 A;  1WHK A;  1PHT A;  1W6X A;  1PKT A;  3MP8 A;  2KT1 A;  2DLP A;  1N27 A;  3H0H A;  1IXD A;  3CCM Q;  3CME Q;  1I0C A;  2YLC A;  4BY6 C;  4XU1 A;  2KK4 A;  2K2V A;  2RHI A;  3MEA A;  2DRK A;  1C6V X;  2LRQ A;  3CCE Q;  2OTL Q;  3EGD A;  2KI7 A;  3P8D A;  1YIJ A;  3J7A F;  3A8M B;  2ZCF B;  1UHF A;  2CZ0 B;  3MHX A;  2LQK A;  5LJ5 d;  2MAM A;  2ZAE A;  1HJD A;  4PFP A;  1VQ4 A;  2X3X D;  5GAO l;  2HSE B;  3SWN C;  1VQP A;  2CP3 A;  2COW A;  1AZG B;  4M7D F;  1K73 R;  4PJO G;  1QCF A;  3OSS C;  1Y0M A;  2L3P A;  2HQH A;  4Y91 A;  5L8R E;  4E2F B;  5LJ5 e;  2D0N A;  5GAN 4;  1TOV A;  2HL3 A;  3PNW C;  1N8R U;  1TUD A;  1ZSZ A;  5IHN A;  5IHI A;  4JRK A;  3UA7 A;  1QWF A;  4OML A;  4C8Q C;  3CCJ Q;  3CC4 Q;  3CC2 Q;  4OB3 B;  3DLM A;  2GF7 A;  5L23 A;  5CKD A;  1GFD A;  4J9C A;  2M16 A;  5IN1 A;  2MPX C;  3HRU A;  2NUT A;  3MO8 A;  3VS4 A;  1ZA2 B;  3DKM A;  2EVR A;  4HT9 A;  2RNA A;  4RG2 A;  2K4Y A;  1BBZ A;  1K8A R;  2X35 A;  2YLB A;  1OQK A;  2COY A;  3X24 B;  1QVG A;  4M77 C;  1QCN A;  4RCC A;  2FVU A;  5IH2 A;  4GLK A;  1YHQ Q;  3CD6 Q;  1K9M R;  5GAN g;  3EHQ A;  3CMA A;  1SPK A;  1NEG A;  4L59 A;  4FYW B;  3A8H B;  3SB2 A;  1WI7 A;  3CCM A;  2DKG A;  2K6D A;  4IUP A;  2EQM A;  3I5S A;  3CC7 A;  1NYF A;  2LVM A;  4M77 D;  2C0I A;  4PJO D;  1S72 A;  1EFN A;  1N8R C;  1M90 R;  2MCN A;  1YWP A;  2MWP A;  3E2U A;  3SHW A;  2COZ A;  2NUT B;  2J06 A;  3JCM f;  2B86 A;  1VQL A;  4M4Z A;  1G3Y A;  2VB6 A;  3G6E Q;  2AIR B;  3RKW A;  2DXU A;  4O5V A;  1VQ5 Q;  1I07 A;  2JN0 A;  2K5F A;  2KE9 A;  4FT4 A;  4OMO A;  5KYU B;  5GAO n;  3NMZ C;  2HEQ A;  2X4X A;  2ZPB B;  2RQW A;  3NHN A;  1GCQ A;  2RJD A;  4RKU E;  2J6F A;  2DTH A;  2VGM A;  2GNC A;  2AKK A;  3CCJ A;  1TS9 A;  4BE0 A;  1D3B A;  4CRI A;  2QEX T;  2BZY A;  5GMK h;  2RH2 A;  2XI9 A;  4M7D C;  4FT2 A;  1QVF A;  1R0C B;  2QGF B;  3C12 A;  1K9M U;  1VA7 A;  1FMK A;  4Z89 A;  2DMO A;  3A5Z B;  4M75 B;  1X27 A;  2EFI A;  2CSI A;  1K73 C;  1R0B G;  2VYT A;  3MP6 A;  5CKB A;  1ZSG A;  2GBQ A;  1OX8 A;  1Q95 G;  2HNI A;  1VYT A;  3CCM T;  4C0D C;  3CME T;  3CBM A;  2CUD A;  1M90 U;  2RQU A;  3CD6 A;  4BUG A;  1ZX6 A;  3MJX A;  1UGR B;  1HSQ A;  4FYX B;  4PJN A;  4XU2 A;  3KXT A;  3RNJ A;  2LNV A;  2OTL T;  4M78 A;  4BDY A;  1PNJ A;  4A4H A;  3UPU A;  5KYN A;  1VQL T;  1D3B B;  4KBM B;  3A98 A;  3OYC A;  1QWE A;  2QQA A;  2M0Y A;  4C5H A;  5IT9 E;  2EW3 A;  1K8A C;  1KSW A;  1M1K R;  3RR6 A;  5GAO q;  1E6H A;  4Y92 A;  4AG1 C;  2PNI A;  3P8B B;  4LD6 A;  1X6B A;  1YFN A;  4C8Q E;  5EG2 A;  1K9M C;  4KRT A;  2FZC B;  1X75 C;  3JCM e;  3CCJ T;  3CC4 T;  4QT7 A;  3UDC A;  1VQK Q;  3CC2 T;  2K2M A;  2EBP A;  4BB7 A;  4ZGE B;  5IXF A;  1NZ9 A;  2M9U A;  2XKO C;  2M0O A;  3C0C A;  3JB9 I;  1SKU B;  4Y28 E;  3EGX A;  2QK0 A;  3QII A;  2D1X A;  1UGQ B;  2RJC A;  5FWB A;  4M78 B;  3TEE A;  1BI1 A;  1ZUK A;  3VRZ A;  2ECZ A;  3M55 A;  1FX7 A;  1M90 C;  1HK9 A;  1IB8 A;  3JCM b;  4FU6 A;  3WXM B;  3PIP A;  3JB9 D;  2H3J A;  1CSK A;  3OB9 A;  1G3S A;  2R5A A;  2RI5 A;  4NL3 A;  1M2V A;  2W10 A;  2C0O A;  1YHQ T;  2YUN A;  4CI0 C;  3CD6 T;  3OS0 A;  1K9A A;  1V76 A;  3EG9 A;  1F1B B;  1N9S A;  2PVD B;  2LTO A;  1MUZ A;  1VQ9 Q;  1R8O B;  3MET A;  2YXY A;  1Y71 A;  4M75 F;  4BAC A;  3A1P A;  4JPB W;  2X4W A;  1M9S A;  2NLU A;  1QMC A;  3G71 A;  3PFS A;  1M1K U;  3S3O A;  3TRE A;  2LX9 A;  1NE8 A;  1WZO A;  1LVK A;  3EGX B;  3CCS A;  3FLG A;  1ZUU A;  5KE2 A;  3SWN A;  1WNL A;  3TQ7 P;  5FWC A;  2HKN A;  3CCV A;  3G6E T;  3OYM A;  4IUV A;  1QVG P;  1VQ5 T;  1M8M A;  2JOY A;  1S1N A;  3OBY A;  3V8J A;  1MMG A;  3EGU A;  1M2V B;  1B3Q A;  2GFU A;  2CP2 A;  3EH1 A;  2YHT A;  1T3S A;  1EX4 A;  3ASK A;  3EG9 B;  3Q1J A;  3JRZ A;  4OP0 A;  2F69 A;  1M2O A;  3FRN A;  1Q82 R;  2MF2 A;  3VS6 A;  1B07 A;  4E6R A;  2LCS A;  2VXF A;  4HCC A;  3KBG A;  5CO7 A;  1SG5 A;  4M7D E;  1BU1 A;  2K57 A;  3QYH B;  1T0J A;  1J3T A;  2EYX A;  1N6A A;  2QTX A;  4XTW A;  4PLL A;  1VQM Q;  1M3A A;  2PZ1 A;  1UJY A;  5LJ3 h;  1BIA A;  2IVW A;  3OS2 A;  1WXT A;  3LWI A;  3LYI A;  4M77 A;  2D0Q B;  2DZ9 A;  4M78 F;  1M1K C;  2IIM A;  5A2Q E;  3I55 Q;  1BKB A;  2AHJ B;  2F1L A;  1VQ8 A;  1VQ6 Q;  1U3O A;  2CH4 A;  2P4T A;  1VQN Q;  1LCK A;  5GAM h;  1WXU A;  3MP1 A;  1WYX A;  2RB6 A;  4CC2 A;  1X2Q A;  5KYW A;  1EIF A;  3FIF A;  3CCS T;  2DIG A;  2AKL A;  2DXT A;  1JJ2 S;  1QLY A;  1KC8 R;  1QVF P;  3RES A;  1RAI B;  4C0G A;  5GMK e;  3CPW A;  1JXO A;  3JV3 A;  2QAS A;  2EQI A;  1OV3 A;  4C5E A;  3CBP A;  2XK0 A;  1Q82 U;  2WSE E;  1Z9Z A;  3OY9 A;  5CQX A;  4M77 B;  4M75 C;  4PJO B;  5LJ3 g;  3O5Z A;  1BCO A;  1QP3 A;  1RAA B;  1VQK T;  1WA7 A;  1WX6 A;  3FEO A;  2JTM A;  3O8V A;  3L2Z A;  2K7A A;  4PKC C;  3EFS A;  5KYW B;  3LW5 E;  4M7D A;  2AZV A;  2DBM A;  1WJS A;  2BIV A;  2WSF E;  1VQM A;  2W0Z A;  2LCL A;  4AT1 B;  4ESR A;  3RKY A;  1YJW Q;  1VQ8 T;  2RI3 A;  1LOJ A;  2EYW A;  5A0G A;  2FPE A;  1FMV A;  2FB7 A;  3CEY A;  2NWM A;  1KC8 U;  1VQ9 T;  1CKB A;  5LJ3 j;  3I55 A;  1N5Z A;  5GAN 2;  2DM1 A;  2D6F A;  4JUV A;  3LH5 A;  1Q82 C;  2P4R A;  4C5G A;  3U23 A;  5DM7 R;  1VIE A;  4X9D A;  3QUI A;  2L3Q A;  4EMG A;  3CCQ Q;  3GNF B;  4QVC A;  1XTD A;  3PE0 A;  2X9H A;  3QWX X;  2O2O A;  3OYB A;  2FL7 A;  4M78 C;  5CKF A;  4AFQ C;  5LJ5 f;  4JRI A;  6AT1 B;  3HL8 A;  4R0K A;  3OW2 A;  1RAE B;  1Z9Q A;  2M1H A;  1UJ0 A;  3E1S A;  1SRM A;  4LDU A;  1OPL A;  4JJN K;  4C0D B;  3JCM V;  3VS7 A;  2YT6 A;  4VUB A;  3ULR B;  2CZ6 B;  1TU0 B;  2V8J A;  4M77 F;  4OB2 B;  3RDV A;  4M7A D;  2QG9 B;  4PJO F;  1VQ7 Q;  3H0I A;  1KC8 C;  1VQM T;  2K5L A;  2A37 A;  2RJE A;  2WSC E;  1D1B A;  2JT4 A;  1OZ3 A;  1VIF A;  2NUP B;  4FSX A;  3NFC A;  2LJ1 A;  2KY9 A;  4EMH A;  3QO3 A;  1YJ9 Q;  1QVG S;  3LGF A;  1NG2 A;  3I55 T;  4A63 B;  1UEC A;  4WF2 A;  1VQ6 T;  3SFM A;  3IQL A;  3RBB B;  4KGV B;  1KQ1 A;  4XU0 A;  3QXE B;  1VQN T;  5HY6 A;  1NYG A;  4C92 C;  1XNI A;  4DEY A;  1X01 A;  4MZM A;  5CCA A;  3OYJ A;  2E1H A;  3VS0 A;  4PFZ A;  4D6W A;  2LMJ A;  2LQ8 A;  4PK4 A;  1TG0 A;  5LJ3 d;  4MZT A;  4HVU A;  4WCI A;  3M0R A;  1VQO Q;  2ZPF B;  4KH1 B;  3PIO A;  2J6O A;  2RPN A;  2MOX A;  3EFO A;  1AOJ A;  3QPH A;  1I5O B;  2HQE A;  3UF4 A;  5FLX E;  2KXD A;  4C92 D;  2NUZ A;  2DK3 A;  4C8Q G;  2EGE A;  4MMK A;  4M75 E;  1E6G A;  5GAM d;  5GAN h;  2A0F B;  1RL2 A;  2DJQ A;  1QQJ A;  4LDW A;  4EMK A;  1G3T A;  2D8H A;  4J9F A;  1MMA A;  4XQ3 A;  4EPC A;  5GAM e;  3ZBD A;  3M58 A;  1X69 A;  4F17 A;  2JMA A;  1N9R A;  2KEA A;  1IGU A;  4JDS A;  4FCY A;  1H8K A;  1QVF S;  1WGS A;  5EC7 A;  2FO0 A;  2EQJ A;  5GAN 7;  1NJI U;  2HKQ B;  5KYX A;  2EQU A;  3SD4 A;  4IIM A;  5CK9 A;  3EFO B;  2OTJ Q;  1PG5 B;  3VS5 A;  2HQX A;  1G3W A;  2KGT A;  2QEX A;  1UB4 A;  3S6W A;  5DLQ E;  4HVW A;  1PCX A;  3TCJ A;  5KYU A;  2QA4 Q;  5GAN 8;  4PJO C;  4EMK B;  5IHK A;  1MV0 B;  1G83 A;  3H9N A;  1E7O A;  2RN8 A;  3CME A;  1G8X A;  4DBF A;  4M78 E;  1WQ7 A;  1JXM A;  1UG1 A;  4RTU A;  2KSS A;  3JB9 F;  3CXC A;  1LPL A;  1YI2 Q;  1I5L A;  3CCE A;  1QP2 A;  4OMQ A;  2EIF A;  2OTL A;  4FIB A;  5KYX B;  2LJ3 A;  1BCM A;  4ZNX A;  4DQ2 A;  4R55 A;  4M75 A;  2HSP A;  1FWZ A;  3JCM Q;  1Y07 A;  2DF6 A;  3WVE B;  4M7D G;  1KQS A;  2YUP A;  3E9G A;  4RTV A;  1D0Y A;  2KRM A;  2DEQ A;  2D9T A;  5GAN j;  2DET A;  1VQ7 T;  2VUB A;  3C4S A;  1TXQ A;  3M5A A;  3UA6 A;  2DXB A;  3VRY A;  1H3Z A;  3JB9 J;  4J5Y A;  5CVI A;  4ZGD B;  1SSH A;  1OZ2 A;  3UWN A;  2LQN A;  2YWW A;  2VVK A;  3CC4 A;  4ZN1 A;  1JJ2 P;  3CC2 A;  1D0X A;  3OW2 P;  1KG1 A;  3OYK A;  3L2U A;  2LP5 A;  2MIO A;  2PUK B;  2YUO A;  1X6G A;  2DL5 A;  1VOM A;  4L5G A;  2E70 A;  4A4E A;  4F14 A;  2LCC A;  3X20 B;  1R77 A;  5CKH A;  2CP5 A;  4IUT A;  1Q81 R;  4BI8 B;  2QI2 A;  2GTO A;  2QA4 A;  1H3H A;  4MML A;  1SRL A;  3BE3 A;  4MDX A;  3VV0 A;  2V8K A;  5KE3 A;  1I1J A;  1UGP B;  1YHQ A;  3C95 A;  1TSF A;  5GMK m;  1VQO T;  3LLR A;  2DVE A;  3CCE T;  4XTV A;  3L2V A;  1O9S A;  5FW9 A;  4M7A A;  3QDF A;  5FRO A;  4II1 A;  4XTZ A;  2RM4 A;  4NOY A;  5HKC A;  3A8O B;  2R57 A;  1JBM A;  3V8K A;  3MEV A;  1OU9 A;  1HXD A;  4J6Y A;  4GLM A;  1KD1 R;  3OYA A;  2DRM A;  4J9B A;  3G6E A;  2ZPI B;  1LJO A;  1PRM C;  2DL3 A;  5D6W A;  1VQ5 A;  3H41 A;  1ACM B;  2E6N A;  2FRY A;  1YP5 A;  2FG0 A;  3PMI A;  3I56 Q;  3VJP A;  5GMK l;  2CUB A;  2K3X A;  3JCM W;  4WTO B;  5KYY B;  4A4K A;  2G3R A;  1ZQ1 A;  2XID A;  2KRO A;  2L3R A;  4FYV B;  5KH6 A;  4CC4 B;  2LX7 A;  4E47 A;  5GAN d;  1H64 1;  3CCL Q;  2OTJ T;  4RMO A;  1Q81 U;  1KIK A;  3RMQ A;  1A0N B;  2XDP A;  1TTH B;  3OYY A;  7AT1 B;  4M7A B;  1MHN A;  2RHZ A;  3NPF A;  2XG8 D;  1BK2 A;  2CT4 A;  4FSS A;  2OX7 A;  4M77 E;  1ARK A;  2QA4 T;  4IIO A;  2JUF A;  3C94 A;  3R6O A;  4C92 A;  5GAN e;  4PJO E;  3OYD A;  3X28 B;  2ENM A;  1M3C A;  4AG2 C;  5J3B A;  4C5I A;  1IRE B;  1VUB A;  3DB3 A;  1W4S A;  1WIE A;  4JS4 A;  1B7T A;  4QW2 A;  3CCR Q;  2X4Y A;  1OX9 A;  1UEB A;  5FU6 C;  3T9N A;  1QVP A;  2EGA A;  5FU7 B;  3OMC A;  3CPW S;  2HDA A;  2RQV A;  1YI2 T;  2XD0 A;  1WHH A;  2CZ7 B;  2CKK A;  2Z0W A;  1KD1 U;  5GMK i;  3M0Q A;  3SDZ A;  4PFO A;  2PUO B;  3H0F A;  3MEU A;  3JAM E;  4N4H A;  2BE7 D;  4OMF B;  4BI4 A;  3VYG A;  4KUL A;  4F7U A;  1OOT A;  1RI0 A;  4C92 B;  1Q81 C;  1P92 A;  4KH0 B;  3GOX A;  1GRI A;  2KAF A;  2EGC A;  1HYO A;  4E7K A;  2E10 A;  2EYZ A;  3HRT A;  4EMK C;  3INZ A;  3CCU Q;  1UE9 A;  5J26 A;  3URG A;  1PWT A;  1VQK A;  1NBE B;  3CXC P;  3V7S A;  4XTY A;  1XJW B;  2OAW A;  3THK A;  4LDX A;  3QG1 A;  2M51 A;  4X34 A;  1FMW A;  2JJ9 A;  2A7Y A;  4E7H A;  5AT1 B;  1JQQ A;  4JJD A;  4BD3 A;  4PLI A;  1YIT Q;  2QYZ A;  3LWH A;  2H8H A;  1AWJ A;  2LDM A;  2P0P A;  4XTX A;  3UAT A;  2F5K A;  5GAN 3;  4KT0 E;  1UFF A;  3EG3 A;  2B8A A;  1NM7 A;  3EG2 A;  1WFW A;  1IO6 A;  4PJO A;  4V2S A;  2EPD A;  1KQS P;  1V29 B;  1RAD B;  1KD1 C;  4A53 A;  2M02 A;  4AFU C;  1Q86 U;  3VU3 C;  4M7A F;  1PD1 A;  1WJR A;  4F7U B;  3X26 B;  3M0P A;  5DLO A;  1TUC A;  5IAY A;  3REA B;  2L5Q A;  1VQ9 A;  4L6V 5;  2QQB A;  4J9H A;  1AHJ B;  1Y57 A;  2DE0 X;  2J05 A;  2O31 A;  3LH0 A;  2RQT A;  1M8V A;  2DAQ A;  2FRW A;  2EYQ A;  2HL5 C;  3PVQ A;  1BI3 A;  3OYI A;  3G4S Q;  4LN2 A;  2ROL A;  3OW2 S;  1ZA1 B;  3OMG A;  1JRI A;  4J6X A;  4PJL A;  3BY7 A;  4K11 A;  3M0U A;  2DX1 A;  4J9D A;  5CR2 A;  1D09 B;  4HCB A;  2E4H A;  3FJ5 A;  2O01 E;  3H8Z A;  2JNG A;  3TSW A;  1UTI A;  2CZ1 B;  3DLL A;  1YJN Q;  2DZC A;  1ZBX A;  4RG8 A;  3I56 T;  4FYY B;  2YRC A;  3BDL A;  3MPU B;  2EQK A;  2MK5 A;  2R58 A;  3P8H A;  1PSF A;  5C6S A;  4TVR A;  4UC4 A;  3JCM J;  1W2B A;  3OYN A;  3TSZ A;  5D7U A;  3CCL T;  2VAS A;  4C92 F;  2ZPE B;  3HFO A; 
#chains in the Genus database with same CATH homology
 4MZT A;  4ELY C;  3J81 E;  4IKF A;  1WQW A;  2ZPF B;  1XQH A;  2JVV A;  3N5B B;  4XU3 A;  3PIO A;  2RJD A;  4RKU E;  5I2S A;  2DTH A;  2VGM A;  1YBY A;  4ZN3 A;  3CCJ A;  4BI3 A;  1JB0 E;  3QPH A;  3CBO A;  3OS5 A;  2EJF A;  2HQE A;  5FLX E;  4RCB A;  4BE0 A;  2HBP A;  4C92 D;  1D3B A;  4CRI A;  2QEX T;  2P0K A;  5GMK h;  5A0D A;  2DK3 A;  2RH2 A;  4QQ6 A;  4C8Q G;  2XI9 A;  5LJ5 g;  4M7D C;  4MMK A;  2JZ2 A;  3ER0 A;  4MZP A;  4M75 E;  4FT2 A;  1QVF A;  3HSB A;  3F70 A;  4HA8 A;  5GAM d;  1W2B S;  3C12 A;  1K9M U;  5GAN h;  5HK0 A;  4M78 G;  3CCR T;  1RL2 A;  2E5Q A;  2VV5 A;  2RA2 A;  2KMT A;  5LL6 S;  3A5Z B;  4LDW A;  4M75 B;  3I56 A;  1NPP A;  4LDY A;  4EMK A;  3JCM X;  4HKE A;  1G3T A;  2EFI A;  4PL6 A;  1VQ6 A;  3VUB A;  1K73 C;  4J7F A;  1VQN A;  3MP6 A;  2VYT A;  5CKB A;  4YTL A;  2HD0 A;  3M4Y A;  2BKD N;  4XQ3 A;  4Z02 A;  4EPC A;  3GIB A;  3JSC A;  2HNI A;  2LT1 A;  2RI2 A;  5GAM e;  3CCM T;  5LJ3 f;  3OYL A;  4C0D C;  3CME T;  1LNX A;  3S3N A;  3CBM A;  5A0L A;  3ZBD A;  4F7U F;  3M58 A;  4J7I A;  3HFN A;  1N9R A;  3CCL A;  1M90 U;  3CD6 A;  4C8Q A;  1BI0 A;  4JDS A;  4BUG A;  3LGL A;  1UGR B;  1QVF S;  1Y96 B;  5M9O A;  1WGS A;  4XU2 A;  4XAX B;  3KXT A;  4N4I A;  2LNV A;  4BY6 B;  2OTL T;  4M78 A;  4BDY A;  2EQJ A;  5GAN 7;  1NJI U;  4IUR A;  2EQU A;  3SD4 A;  4M7A C;  4A4H A;  5CK9 A;  3QHS A;  4J83 A;  3UPU A;  3RKX A;  1O75 A;  3BDU A;  5GAM f;  4C0Z A;  1VQL T;  2VC8 A;  1BI2 A;  5LJ5 j;  2HQX A;  1D3B B;  1G3W A;  4KBM B;  1UB4 A;  4Q5W A;  5CAI A;  3OYC A;  2QEX A;  4HT8 A;  2WAC A;  2DD4 A;  3S6W A;  5DLQ E;  2QQA A;  2E6Z A;  4JRQ A;  4QQD A;  4C5H A;  4QVZ A;  5IT9 E;  3A8G B;  3TCJ A;  3CPF A;  1K8A C;  3CCR A;  3QZ9 B;  3SWN B;  5GAN 8;  4PJO C;  1MGQ A;  5GAO q;  4M75 G;  4B9X A;  4EMK B;  1PSE A;  5D6Y A;  1KHI A;  2OTL A;  5HK3 A;  3P8B B;  2EAY A;  4LD6 A;  3HPW A;  4N0A A;  5FU7 C;  2Y90 A;  4C8Q E;  2KDS A;  3FJP A;  5EG2 A;  3GP8 A;  1K9M C;  5LJ5 h;  2XIC A;  1X75 C;  3JCM e;  1Y7X A;  3CCJ T;  3CME A;  2GFA A;  5GAN 5;  3CC4 T;  1YIT T;  3UDC A;  3CC2 T;  3X25 B;  3QJ6 A;  2Y4X A;  4E7J A;  4M78 E;  1WQ7 A;  4BB7 A;  3OYH A;  2QQ9 A;  4ZGE B;  3G71 T;  2KSS A;  4C8Q B;  3JB9 F;  1NZ9 A;  2E65 A;  3QBY A;  2M9U A;  3CXC A;  2XKO C;  2M0O A;  3NTI A;  3JB9 I;  2DXC A;  3BW1 A;  1I5L A;  3CCE A;  1QP2 A;  4Y28 E;  3QII A;  2EIF A;  4ME7 A;  4DA4 A;  2RJC A;  1UGQ B;  4FIB A;  2CS7 A;  4M78 B;  1BI1 A;  3TEE A;  3JB9 H;  4DQ2 A;  4R55 A;  4M75 A;  3M55 A;  3CCV T;  3S3M A;  3M9Q A;  1YJW A;  1FX7 A;  1M90 C;  3QJY A;  1HK9 A;  2RHY A;  1B34 B;  3JCM b;  4FU6 A;  1FWZ A;  3WXM B;  3EFR A;  3PIP A;  3TU4 K;  3JB9 D;  2H3J A;  4GY5 A;  3JCM Q;  1Y07 A;  3OB9 A;  1G3S A;  3GNG A;  3WVE B;  2R5A A;  2RO0 A;  2RI5 A;  3OS1 A;  4NL3 A;  1NJI C;  4M7D G;  2PVG B;  3OQ5 A;  4OGC A;  1KQS A;  1FXX A;  2E12 A;  3E9G A;  3GF5 A;  3CCU A;  1I81 A;  4JS5 A;  4BE1 A;  4CI0 C;  1YHQ T;  3CD6 T;  3OS0 A;  4KUI A;  3L42 A;  2DEQ A;  2D9T A;  1Y96 A;  2RHU A;  3CXC S;  5GAN j;  1Q86 C;  1VQ7 T;  2VUB A;  3M4G A;  1N9S A;  2PVD B;  2LTO A;  3C4S A;  3G4S T;  2HAX A;  3RER A;  3M5A A;  3FC3 A;  2DXB A;  5CIU A;  1R8O B;  3MET A;  1H3Z A;  3JB9 J;  1Y71 A;  4FL6 A;  4J5Y A;  4M75 F;  5CVI A;  4ZGD B;  3DB4 A;  3CCQ A;  3FDR A;  2OAU A;  2C06 A;  1G5V A;  1OZ2 A;  3PT9 A;  3UWN A;  4C0F A;  3VUZ A;  1X6O A;  2XU8 A;  1M4Z A;  1YIT A;  2X4W A;  4ZN1 A;  3CC4 A;  2O4X A;  1M9S A;  3CC2 A;  2NLU A;  1IZ6 A;  2KQW A;  3JCM h;  3G71 A;  3PFS A;  3JCM P;  1M1K U;  3S3O A;  3TRE A;  2LX9 A;  5J39 A;  1NE8 A;  5I21 A;  1KG1 A;  5LJ3 e;  3OYK A;  3L2U A;  1YJN T;  4XTU A;  3CCS A;  4B9W A;  3FLG A;  3MEW A;  3OA6 A;  2ZZD A;  5KE2 A;  5GAM g;  4M75 D;  1KQS S;  1TH7 A;  2PUK B;  3SWN A;  1WNL A;  5DY9 A;  2BUD A;  3AHU A;  4A54 A;  4L5G A;  4JRP A;  2E70 A;  3G6E T;  3CCV A;  4E7L A;  4M7A G;  4A4E A;  2QQS A;  3OYM A;  4IUV A;  3OYF A;  2Y4Y A;  4HCZ A;  1VQ5 T;  2LCC A;  3X20 B;  5CKH A;  2JOY A;  4IUT A;  4A4F A;  4NL2 A;  3OBY A;  2QI2 A;  3V8J A;  4N4G A;  1YCY A;  2EWN A;  4BI8 B;  2QA4 A;  5FU6 B;  2E41 A;  2MWO A;  2MMP A;  4MML A;  4BDZ A;  4MDX A;  3VV0 A;  4DOV A;  2GFU A;  2V8K A;  4QVD A;  5KE3 A;  1UGP B;  2YHT A;  1YHQ A;  3C95 A;  5GMK m;  4M77 G;  1VQO T;  4O6J A;  3LLR A;  5KCO A;  1GXI E;  3ASK A;  3Q1J A;  2DVE A;  1VQ7 A;  3JRZ A;  4OP0 A;  3CCE T;  3QDR B;  4XTV A;  3G4S A;  3ZFJ A;  2F69 A;  4JLI A;  3FRN A;  4ZTF A;  3L2V A;  2MF2 A;  1O9S A;  3V7R A;  2VXF A;  4M7A A;  4HCC A;  2L89 A;  3KBG A;  2F5T X;  5CO7 A;  5FRO A;  4BAC A;  1YJW T;  2QDY B;  4M7D E;  3QYG B;  1B34 A;  4II1 A;  4XTZ A;  2RM4 A;  4NOY A;  2O4X B;  3OYG A;  2K57 A;  3QYH B;  4OB0 B;  5HKC A;  5GAO r;  3A8O B;  4LDV A;  1YJ9 A;  5GAN 6;  3E19 A;  1N6A A;  2R57 A;  2QTX A;  4XTW A;  4PLL A;  5GAM j;  1JBM A;  2XDB A;  3PTA A;  3V8K A;  2RK2 A;  4M7D B;  1YJN A;  3MEV A;  5LJ3 h;  1BIA A;  2IVW A;  3JCM g;  4C8Q F;  3OS2 A;  1HXD A;  3CCU T;  1SSF A;  4J6Y A;  4JLG A;  3LWI A;  3LYI A;  1JJ2 A;  4M77 A;  4PNO A;  5C0M A;  3OYA A;  4EDU A;  3L2Q A;  3PMT A;  1WJQ A;  2D0Q B;  2ZGW A;  3A8L B;  2DZ9 A;  3ME9 A;  3MCA B;  3G7Z A;  5I2M A;  4M78 F;  3G6E A;  3BFM A;  2ZPI B;  1M1K C;  1LJO A;  5D6W A;  5A2Q E;  1VQ5 A;  3V8L A;  2E6N A;  1BKB A;  2GQV A;  2PU9 B;  2AHJ B;  3PMI A;  2I2L A;  3VJP A;  3CCQ T;  1VQ8 A;  1ZHI A;  4QQG A;  5GMK l;  2DO3 A;  3M59 A;  4ZTJ A;  3V7C A;  2K3X A;  2P4T A;  4OF1 A;  4C8Q D;  4C92 G;  2DIQ A;  1QW1 A;  5GAM h;  3UT1 A;  3JCM W;  3MP1 A;  4A4K A;  2QQR A;  2IG0 A;  2RB6 A;  2G3R A;  2YRV A;  3NTH A;  4OVA A;  1ZQ1 A;  4M78 D;  4XK8 E;  4OB1 B;  4IUQ A;  1VQO A;  4LD9 K;  2XID A;  4M7A E;  1EIF A;  3FIF A;  3CCS T;  2DIG A;  2L3R A;  5KH6 A;  2ZPG B;  4E47 A;  5GAN d;  1H64 1;  2DXT A;  1JJ2 S;  4RMO A;  2OTJ T;  5CKE A;  2ZPH B;  2EJG A;  1Q81 U;  3RMQ A;  2XDP A;  1M1G A;  3OYY A;  4M7A B;  3RES A;  3RUX A;  1MHN A;  2RHZ A;  4C0G A;  1YIJ T;  3L1A A;  3QKJ A;  2XG8 D;  5GMK e;  3CPW A;  3M56 A;  5FRM A;  3ZEH A;  2PVO B;  4M77 E;  4MDW A;  2QA4 T;  3HKS A;  3QZ5 B;  1K73 U;  4C5E A;  3HHT B;  3CBP A;  2XK0 A;  2JUF A;  3C94 A;  3LX7 A;  3R6O A;  3M53 A;  4OGE A;  4C92 A;  5GAN e;  3EAE A;  1VQ4 T;  4PJO E;  3OYD A;  3X28 B;  1Q82 U;  2WSE E;  2K5I A;  3OY9 A;  5J3B A;  2XHC A;  3WVD B;  4C5I A;  3KUF A;  5CQX A;  1IRE B;  4M77 B;  1VQP T;  1U1T A;  4IUU A;  1VUB A;  4M75 C;  5GAO p;  3DB3 A;  1W4S A;  4PJO B;  4JS4 A;  2DTI A;  4J8O A;  5GAO m;  3E9F A;  1OI1 A;  2E64 A;  4QW2 A;  3M57 A;  5LJ3 g;  5FRN A;  2X4Y A;  1I4K 1;  4KUD K;  1NPR A;  1QP3 A;  2V8I A;  1VQK T;  4J6W A;  1KQ2 A;  1UEB A;  5FU6 C;  4F7U G;  3T9N A;  1QVP A;  2VXE A;  5FU7 B;  2KVQ G;  3FEO A;  3OMC A;  2JTM A;  3O8V A;  2K3Y A;  3L2Z A;  3PGG A;  4PKC C;  5GAN f;  3CPW S;  1YI2 T;  2XD0 A;  1YJ9 T;  3EFS A;  3RIR A;  2LT4 A;  2CZ7 B;  3MP8 A;  2CKK A;  4NS5 A;  1N27 A;  2MI6 A;  1KD1 U;  1I8F A;  5CQY A;  3LW5 E;  5GMK i;  3SDZ A;  4M7D A;  2YLC A;  4BY6 C;  1UGS B;  4XU1 A;  2KK4 A;  2PUO B;  2K2V A;  4BE2 A;  2OTJ A;  1WJS A;  3MEU A;  3JAM E;  2RHI A;  2RJF A;  3MEA A;  2LRQ A;  4N4H A;  4OMF B;  3RMS A;  4R56 A;  4BI4 A;  3P8D A;  2BIV A;  4C92 E;  2WSF E;  1YIJ A;  1K8A U;  3VYG A;  1VQM A;  3A8M B;  2ZCF B;  3J7A F;  2CZ0 B;  2LCL A;  4KUL A;  3MHX A;  3RKY A;  4F7U A;  2LQK A;  5LJ5 d;  2MAM A;  1VQ8 T;  2RI3 A;  1LOJ A;  3OBW A;  1RI0 A;  4C92 B;  1Q81 C;  1VQ4 A;  5A0G A;  1P92 A;  4X9C A;  5GAO l;  3CEY A;  2FB7 A;  1M1F A;  3SWN C;  4ZGJ B;  3GOX A;  1VQP A;  1KC8 U;  1VQ9 T;  2KAF A;  2EKO A;  3I55 A;  5LJ3 j;  4M7D F;  2CYZ B;  2XDD A;  4E7K A;  2E10 A;  1BIB A;  2FYK A;  3HRT A;  4EMK C;  5GAN 2;  4PJO G;  2L8D A;  2D6F A;  3INZ A;  4JUV A;  1U8R A;  3OSS C;  2JTF A;  5J26 A;  5L8R E;  4Y91 A;  3URG A;  1VQK A;  5LJ5 e;  3V7S A;  4XTY A;  3CMA T;  4LDX A;  1Q82 C;  2RD1 A;  3QG1 A;  5GAN 4;  3PNW C;  4C5G A;  5DM7 R;  1N8R U;  4X34 A;  1VIE A;  3JB9 G;  4X9D A;  2A7Y A;  3QUI A;  4JRK A;  1YI2 A;  4E7H A;  4P5N A;  4EMG A;  4M7D D;  4C8Q C;  3GNF B;  4BD3 A;  4PLI A;  3CC7 T;  4QVC A;  1XTD A;  3FB9 A;  3LWH A;  1Q7Y U;  4OB3 B;  3OYB A;  2LC4 A;  2FL7 A;  2LDM A;  2GF7 A;  3DLM A;  4M78 C;  5CKF A;  2P0P A;  4XTX A;  5GAN 3;  2F5K A;  2VGN A;  5CKD A;  1S72 T;  4KT0 E;  3GPL A;  2M16 A;  5IN1 A;  4F7U E;  2B8A A;  4JRI A;  2FHD A;  3HRU A;  1WPY A;  5LJ5 f;  3QSU A;  4ATO A;  4PJO A;  3HL8 A;  4V2S A;  3MO8 A;  3OW2 A;  1V29 B;  1KD1 C;  3DKM A;  4HT9 A;  2M1H A;  4A53 A;  3E1S A;  1Q86 U;  3VU3 C;  4M7A F;  1WJR A;  4F7U B;  5AYF A;  4LDU A;  4RG2 A;  3OSV A;  2K4Y A;  3X26 B;  2X35 A;  2DD5 A;  3M54 A;  5DLO A;  3HP9 A;  2GCX A;  2YLB A;  3VYH B;  4C0D B;  3JCM d;  4JJN K;  3JCM V;  3X24 B;  5IAY A;  1QVG A;  4M77 C;  4VUB A;  2L5Q A;  4RCC A;  4DOW A;  1VQ9 A;  4L6V 5;  3VKI A;  2FVU A;  2QQB A;  1AHJ B;  3LH0 A;  2CZ6 B;  1M8V A;  2DAQ A;  1U1S A;  4GLK A;  2EYQ A;  2V8J A;  3H6Z A;  4M77 F;  4OB2 B;  4M7A D;  1M5Q 1;  5GAN g;  4N0A C;  4ELZ C;  2RHX A;  3CMA A;  4L59 A;  4PJO F;  1BI3 A;  2DPP B;  3OYI A;  2QXF A;  3A8H B;  3OW2 S;  3SB2 A;  1KC8 C;  3CCM A;  2P0Q A;  1VQM T;  2DTO A;  3NTK A;  1JRI A;  2K5L A;  3OMG A;  4J6X A;  2DKG A;  2RJE A;  2WSC E;  2EJ9 A;  4FM4 B;  4IUP A;  3L2W A;  3BY7 A;  1XOV A;  2EQM A;  1OZ3 A;  1VIF A;  3CC7 A;  4FSX A;  3NFC A;  2KY9 A;  4EMH A;  2LVM A;  4M77 D;  3QO3 A;  3JCM c;  2DJZ A;  5CR2 A;  4E7I A;  2X4J A;  1QVG S;  3LGF A;  4HCB A;  4PJO D;  1S72 A;  3J80 E;  2O01 E;  3H8Z A;  3HRS A;  1N8R C;  2JNG A;  3I55 T;  3L2R A;  2CZ1 B;  2MWP A;  3DLL A;  2DZC A;  1ZBX A;  1BYM A;  4RG8 A;  4A4G A;  3I56 T;  2CGH A;  4WF2 A;  3JCM f;  3BDL A;  1VQL A;  1VQ6 T;  2EQK A;  3SFM A;  2R5M A;  1KQ1 A;  1G3Y A;  2RK1 A;  4XU0 A;  1OYX A;  3QXE B;  1Q7Y C;  1VQN T;  3RKW A;  2R58 A;  2DXU A;  5HY6 A;  3P8H A;  1PSF A;  4C92 C;  5C6S A;  1XNI A;  4O5V A;  4TVR A;  1X01 A;  2JN0 A;  3GLX A;  4MZM A;  5CCA A;  2K5F A;  4UC4 A;  5GMK j;  3OYJ A;  4FT4 A;  5D6X A;  2E1H A;  3JCM J;  1W2B A;  3OYN A;  2A3L A;  3CCL T;  5GAO n;  2PQW A;  4C92 F;  4D6W A;  5KCH A;  1KHC A;  2LQ8 A;  2ZPE B;  3HFO A;  3OYE A;  2X4X A;  1DJ7 B;  2ZPB B;  5LJ3 d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...