5A0DA

N-terminal thioester domain of surface protein from clostridium perfringens, cys138ala mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
175
structure length
175
Chain Sequence
KYKGYTLLDKYPKEDDFRDAIYIEDMDNNDTSSVVYAFNVTKATPTFKGSVVKVLYNEQFGSSKLFTEKAIKPRVKGDELKNSVLRVIYNGYPSNALGIKEKYQLTEGQFRKLTQRAVWNFTDSNLSLDKLSQKEIDALNELINAKNAIPDNLVLNLYLPDDSYYQNLLGTKFVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An internal thioester in a pathogen surface protein mediates covalent host binding.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Cell adhesion
molecule keywords SURFACE ANCHORED PROTEIN
total genus 58
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5a0dA01
2XIDA 5A0DA 5A0GA 2XI9A 4C0ZA 2XICA 5A0LA 4BUGA
chains in the Genus database with same CATH superfamily
3I55T 2DILA 2QI2A 2CP5A 1UUEA 1LNXA 1YJNA 3OSVA 1NPRA 1X43A 3OQ5A 5GAMg 4AG2C 1YI2Q 2K7AA 2YWWA 3CCEQ 2KROA 2X9HA 4M75F 3SFMA 2JZ2A 1ZUUA 2HQXA 2DIGA 2DXTA 5LJ5j 4C92B 1XJWB 4A54A 2ZPHB 5I22A 2RQWA 3TU4K 1DJ7B 1RABB 3PT9A 1PCXA 4C92E 3CCST 2KYBA 2C0OA 4C0FA 3G71T 3MP6A 3QBYA 3GBQA 4M75B 5IN1A 1Q95G 1QQJA 2DD4A 4PJOA 3JCMW 1RAGB 2PVDB 1VQ8Q 4J9EA 3OYKA 2JOYA 2M1HA 1KHCA 1BI0A 4C5IA 1X2KA 1EZZB 1UTIA 4ZTFA 4C0ZA 4KGXB 1VQ6Q 1Q7YU 4YTLA 3OYCA 1VQLQ 2IPOB 3HPWA 1S1NA 2DFUA 2GFAA 3M56A 2FPDA 3A8MB 1U06A 1YWOA 4D6WA 1WXTA 1G5VA 2JT4A 3QWYA 1OPLA 2MYSA 1SG5A 2ZPEB 4GBQA 2EQJA 4F04B 4E47A 1KD1R 2ZPGB 5I2SA 1E6HA 2YUPA 4RCCA 3CCJT 4E7LA 2GNCA 2EQKA 2RQTA 4F16A 1NLPC 1WHGA 2CZ0B 2OTJQ 3EG1A 2QQ9A 4J9HA 5GMKi 5CVIA 4BY6B 5GAOn 3MEVA 1I4K1 3LWIA 4ESRA 2DEQA 3MEUA 1N8RU 2ZPFB 2AIRB 2ROTA 5IHNA 2HEQA 2QDYB 4CC4B 5LJ3g 2JS0A 3EFRA 5GAN4 1Y96B 4C8QC 1KQSS 3OS5A 2MWPA 2QK0A 3SWNB 1M90R 1O9SA 4XTYA 2PVGB 3RKXA 3F70A 5GAMd 1K9MR 1D09B 4J7FA 3JB9F 1VQLT 2VB6A 2ZGWA 1SF9A 2V1QA 2XMFA 1SSFA 2DK3A 5J26A 5GANe 1UECA 3UPUA 2KNBB 2K79A 1I81A 4J5YA 2LNVA 1AWWA 3G7ZA 3H9NA 1V29B 5CCAA 3FC3A 2X4XA 2QQRA 2YUNA 4E6RA 2KGTA 2MMPA 1IXDA 2X3WD 5KYUA 2C06A 4ZNXA 3M0QA 2CP6A 2YRDA 1M2VA 1NM7A 2VXEA 2VV5A 2DE0X 2DERA 1BB9A 3L1AA 4HKEA 4E7KA 1VQMA 4PJJA 3LH5A 4FSXA 2L3QA 1RACB 1VQ4A 3SD4A 1VQPA 2O4XA 2DRKA 2CP7A 2FEIA 3QJYA 4BE1A 1YWPA 1K1ZA 1N5ZA 2F2VA 4LD6A 1W2BP 2KEAA 4IIMA 1JBMA 1PSEA 2OJ2A 3O5ZA 4M78D 1QVFP 2LX9A 3E9GA 3MP1A 3JCMV 4PLIA 2D8HA 1NPPA 1K4US 2E4HA 5AT1B 4EDUA 2DTHA 2L3RA 2EQIA 4A4KA 2F2WA 3JAME 3A98A 1JXOA 5KE3A 4PJOC 4M7AD 2VVKA 3JB9I 2KYMA 4DOVA 5LJ3j 1K9MC 1NJIC 2EJ9A 5IT9E 1ZSGA 3CQTA 4FYVB 1VQ7A 3M59A 3H6ZA 3J81E 3SWNA 2JVVA 2VWFA 3OS0A 5IXBA 3M0UA 4MZMA 2DZ9A 1N27A 3V8JA 2C0TA 1KQ2A 2P4TA 4M7DB 4RTTA 4C8QE 4M78E 3CC7A 2O88A 2XI9A 1WNLA 2ZCFB 4PJOG 1MGQA 1VQ5Q 2A37A 2DETA 3TVTA 2HAXA 3OYJA 4QQ6A 1JJ2P 1QLYA 2BKDN 1MV3A 4KULA 4F7UB 1KD1C 4A4GA 4OMQA 4JUVA 4IUVA 2DD5A 1E6GA 2MK5A 2DJZA 2LTOA 1YN8A 4NL3A 5GMKe 1Q86R 3P8BB 1JJ2A 1NYGA 2FHDA 3RNJA 2LCLA 2NLUA 2M51A 2RJFA 1C6VX 4KUIA 2JJ9A 2P0QA 1AEYA 2V26A 4XTWA 1HK9A 1GBQA 3M58A 3X28B 4VUBA 3VS3A 2RK1A 3OB9A 1K8AU 1UJ0A 2DL5A 4E7HA 2DXCA 3LW5E 3JCMb 2K5FA 4Z88A 4LXCA 3CCJQ 2DNUA 1YJWQ 1JB0E 2OTLT 1D0YA 3LLRA 3CCUQ 1M3BA 5GAN8 2IG0A 4JZ4A 3REBB 3M9QA 2K3XA 2E1HA 2DJQA 1VYVA 3EGXA 1G8XA 1NBEB 5GAOr 1UGPB 4C8QG 4K11A 1PD1A 2RA2A 3HL8A 4PJOE 3TQ7P 2K5LA 3OBYA 2QXFA 3CCMT 3JCMJ 4DBFA 1YIJQ 2H8HA 4M7AC 4LUEA 2FYKA 1VQ5T 2DBMA 4JDSA 1M2VB 2CUDA 1ZLMA 1UB4A 4RTWA 3PIPA 4MDXA 2GTJA 2HCKA 2HNIA 1N8RR 2KK4A 4PJMA 1FWZA 3AHUA 5LL6S 1QVGS 1SHFA 3FDRA 2CT3A 4EPCA 1AOJA 5A0DA 4RTUA 3A1PA 2R5MA 2VC8A 2QYZA 4OB1B 2EGCA 3JV3A 2YRVA 1Q82U 2RO0A 1NZ9A 2X4JA 2PVOB 5CKHA 3L2ZA 2CUBA 1Q7YC 3G4SA 4BDYA 2YHTA 2EBPA 3VKIA 5KH6A 1WQWA 4C8QA 5ECAA 5KYUB 4UC4A 2JMAA 4AMCA 3REAB 4Y28E 5GAN7 3CC4A 1OV3A 5IHIA 1Y57A 2BZXA 4DBHA 4J9CA 1ACMB 1TXQA 2L2PA 4A4HA 1YIJA 4KGZB 2G6FX 3P8HA 2KVQG 3A8LB 4E7SA 2HSEB 5KYYB 1ZHIA 3OYBA 5FU6C 4RUGA 5CKDA 1KC8R 1WLPB 3A8OB 3DB4A 3OYFA 3JCMd 1K0XA 4FM4B 3BE3A 3OYDA 1BI1A 2C0IA 1T3SA 4P5NA 1VQ9Q 5HCKA 1JRIA 1MMAA 3NGPA 2FVUA 2JM8A 2P4RA 2R57A 4J9DA 3TREA 1R77A 3NHNA 4NOYA 4BDZA 2BZYA 3M0SA 2FZCB 2FPEA 2QQSA 3OS2A 3RIRA 3JB9J 3OYHA 3CCEA 1OOTA 3URGA 1IHVA 1HJDA 3L42A 5CAIA 1A0NB 1YJ9T 1BIAA 3VUZA 2DL4A 2W0ZA 5D6WA 2KY9A 5CIUA 3ER0A 3PTAA 3CC4Q 2YUOA 3GF5A 3CCMQ 1VQ8A 3CBOA 3SDZA 4AFUC 3GOXA 1WA7A 3FEOA 2DEUA 2K2MA 5LJ3e 2BE9B 5KYWB 2Y4YA 4M7DF 4ELYC 3EH2A 4FW2A 1Q82R 4OB2B 1JXMA 2NUTB 4V2SA 1WHJA 3OYMA 2CH4W 4C8QB 5GANd 4J6XA 5DLQE 3EHRA 1IRXA 2GQVA 3CCLT 1U1TA 1M9SA 2A36A 2E5KA 1OYXA 2DBKA 4BACA 4M7DG 3CCRA 1S72A 4OMNA 4A4FA 4MMKA 2B8AA 4IUQA 3QYGB 2DPPB 3D7SB 3EG9B 3GPLA 3I56Q 4M7AE 5KYNA 2B86A 1RI0A 2RM4A 2QEXQ 5A2QE 2DZCA 1N8RC 1KQSA 3CBPA 3OY9A 4LDYA 3OYYA 1VQOQ 1PM3A 1K9MU 2NYSA 5CKEA 2YLCA 1TTHB 3UF4A 4TVRA 3G71Q 2WSCE 2KDSA 2RHYA 4N4HA 2D9TA 1B7TA 4M78C 3JCMg 2DAQA 4E7JA 1CSKA 2MIOA 1TWBA 2ZAEA 4F7UG 2NUTA 2FPFA 3WVEB 1QKXA 3GLXA 1YCYA 4PJOD 3G6EQ 4F7UF 1YP5A 1LJOA 4GY5A 4O5VA 2X4YA 1NEGA 1OEBA 2J05A 1TUGB 2VGNA 4PJLA 2RH2A 5KE2A 4Q5WA 1VIFA 2G3RA 1G3TA 4C92C 5KYYA 4C92A 5LJ5e 2QQBA 4QKUA 4JRIA 2RI3A 1R0BG 1RLQC 2AZVA 3VU3C 3HSBA 4FYXB 1K8AC 1XQHA 2JTEA 2KT1A 2E70A 3MO8A 3QDFA 2DL3A 7AT1B 4ME7A 1YHQQ 1EX4A 3QSUA 3JCMh 2XICA 4LE9A 3BY7A 1E7OA 2O9SA 2COWA 4R55A 4KBMB 2WSEE 4DA4A 3A8HB 2M9UA 3U23A 4F7UE 3X26B 1GRIA 1JO8A 1KHIA 4IUUA 3I9QA 3MKDA 1QCFA 4M78G 2DL8A 1LPLA 1JJ2S 1FMKA 5GAMj 2VKNA 1D1CA 2LT4A 4X1VA 3SHWA 3CCQT 1Y7XA 2J6KA 4BE0A 2OAWA 1ZUKA 1QCOA 2KBTA 2M02A 4J9IA 3EAEA 1RAAB 3INZA 1I5OB 2OTJA 3E2UA 1GCQC 1K73C 4GLMA 1YCSB 1H92A 4M4ZA 3JCMP 1VQNT 3E9FA 1YHQA 1Y71A 2EFIA 3OYLA 4ORZA 2ED0A 1VA7A 2J6FA 2PQWA 4XU3A 2XIDA 2FL7A 4JRKA 2CZ7B 2E3IA 1HSQA 3CCVQ 4LDWA 1OULA 1D1AA 2D8JA 2EJFA 3QUIA 1N9SA 8ATCB 2RQVA 2JS2A 3OYGA 2DO3A 1IHWA 4M78A 3VJPA 1HD3A 4QVCA 2RN8A 3GIBA 1AT1B 1V76A 2NWMA 1Q82C 3VS5A 2M0YA 4E7ZA 3RESA 2EYXA 1WJSA 3S3NA 3CCJA 2JXBA 2I0NA 2LCSA 2VUBA 1M4ZA 4GLKA 5FU7B 4M7AA 3UDCA 4HCZA 4OGCA 1SSHA 1TUCA 2RNAA 4M75G 4MMLA 3OYIA 1SPKA 4RCBA 3M4GA 2FRWA 3H41A 4FCYA 1ZSZC 5DY9A 1ZSZA 3UWNA 1VQPQ 3PVQA 3ZFJA 1WJQA 2E6NA 3H8ZA 4LDVA 1P92A 4B6MA 2SEMA 4XTVA 4II1A 4PFZA 1MNEA 3R6OA 4WTOB 3T9NA 3PIOA 1M27C 1M90C 3WXMB 3ZEHA 1VQPT 1IO6A 4M77B 2E65A 2J7IA 2EGEA 3ZL7C 3HTRA 3TCJA 3JCMQ 3JCMc 4OMOA 2CREA 4RMOA 1VQ6T 4RKUE 4C92G 5KCHA 1UDLA 4IURA 2LQKA 4J6YA 1TUDA 1WDXA 3FLGA 2IVWA 4EMGA 4ZGJB 3CMAA 4C5HA 3SEMA 2HL5C 4HCKA 3CC7T 2LJ1A 1RADB 4JJDA 3CMEQ 2LJ0A 1X6OA 1WI7A 3HRSA 3CCVT 1U3OA 1IREB 1OPKA 1AWJA 1F1BB 4XU0A 4J9GA 1UFFA 2MF2A 2EAYA 2GBQA 4QT7A 2CP0A 1ABQA 1RI9A 1JEGA 1K8AR 3HP9A 3JRZA 3PNWC 5HY6A 1BCOA 3LH0A 4QQGA 2LP5A 1MV0B 2BTTA 2X4WA 1D3BA 3M0PA 1KIKA 4XTUA 2F5TX 4RTVA 4M77G 3ULRB 4JZ3A 4PFPA 3NMZC 1X2QA 2M0OA 2NUZA 3JB9G 4EIKA 2KXCA 5CKBA 1OZ3A 1VQKQ 5D6YA 4BI8B 2RHIA 2RHZA 1IZ6A 1K9AA 2E6ZA 4ZTJA 4ATOA 2GCXA 1FYNA 4LDXA 3I55A 1MMNA 1VYUA 5HK0A 1M5Q1 4KH1B 4RG2A 3DB3A 3VS1A 2X35A 3JCMX 3LWHA 3CCUA 4M77C 1H8KA 5KYWA 1AZGB 4JPBW 1NJIR 1O75A 4BE2A 1D1BA 1Y96A 3M4YA 4FU6A 1ZX6A 1SKUB 1WPYA 1D3BB 1FMVA 2DXUA 3CMET 2MI6A 2LNHB 1GCQA 3OW2P 2L3SA 1ZQ1A 1OI1A 3OYNA 4C8QD 4ELZC 5EG2A 3EGUA 3JB9D 1ZBXA 5IXFA 5GAMe 4EMHA 5GAMh 3P8DA 4KUDK 2QTXA 1D0ZA 5CK9A 1NJIU 3LGFA 3I35A 3I56T 5IAYA 3UT1A 2F1LA 4Y91A 4PFOA 4L5GA 4JLGA 3QPHA 1Q86C 2OTLA 2RQUA 4M75A 3M53A 3UA7A 3OYEA 2Y4XA 4PJNA 4ZGEB 5CR2A 3VS4A 2DTIA 3L2UA 2BZ8A 1X27A 2LMJA 4J7IA 2XDDA 3OW2S 1RAIB 1AWOA 2JW4A 2KT8A 4Z8AA 2EGAA 5I2MA 3EHQA 1W1FA 1QCNA 3OYAA 2HZYA 5GMKh 2QTVA 5J39A 1TH7A 2RK2A 1M1KR 1D0XA 4BI3A 8AT1B 1PSFA 3VS0A 1TSFA 1N6AA 2YRCA 2KAFA 3PVLA 1R8OB 2D1XA 2RHXA 5GMKl 2HBPA 3V7SA 3EGXB 1K76A 3J7AF 5HKCA 1RLPC 1OX8A 5LJ3d 2KSSA 5DM7R 4BY6C 4N0AC 3VS6A 1M1KC 4Y92A 3QDRB 4N0AA 1VQ9A 2E41A 3QJ6A 2F69A 1BIBA 2WACA 4E7IA 3L2RA 3CXCA 2K2VA 4LDUA 3G1JA 2BUDA 2DL7A 2AT1B 2LZ6B 3C12A 2K9GA 4HVVA 2JN0A 4C5EA 1G3YA 3QIIA 1PKTA 2O9VA 1Q86U 1BCMA 2CP3A 4R56A 3HFOA 2CDTA 2HSPA 4J8OA 3LX7A 5A0GA 3HFNA 3GNFB 3M5AA 1NYFA 2DF6A 2DX1A 5GMKm 2P0KA 4C8QF 3CCSA 2COYA 2CH4A 3V7CA 2VXFA 4M77A 4WCIA 3MEWA 2RB6A 1Q7YR 2CKKA 4AG1C 1AZEA 1BYMA 1TOVA 4BI4A 3RMQA 4HT9A 2QDLA 4DBQA 2O2OA 4JLIA 1ZUYA 3RKWA 2LVMA 4QQDA 2GFUA 1QVGP 3CC2A 2CZ1B 1AHJB 2EIFA 1FX7A 3A5ZB 3EG9A 1WQ7A 3CD6T 2PTKA 2PUKB 1KC8U 3CCRQ 1S72Q 1KD1U 1MNDA 2KI7A 1WGSA 4KRTA 2L5QA 4HA8A 1XTDA 4QVDA 2KXDA 1OQKA 1ABOA 1UGSB 2WSFE 1K0SA 1JU5C 3LYIA 5FRMA 3UA6A 1PD0A 2FB7A 2MOXA 2RF0A 4OMPA 4PJOB 4PNOA 2RD1A 5IHKA 3H0IA 4B9WA 1QVFS 4C92D 1Z9QA 1M90U 3CBMA 3J80E 2V8IA 1VQOA 2LCCA 4JJCA 3V7RA 3N5BB 5KYXA 3TSWA 4OMMA 1GFCA 1G2BA 4PJOF 2QGGA 1W4SA 3CCVA 4ZN3A 1CKBA 1YJNT 4X9CA 1UGQB 1AWXA 4LN2A 2QA4Q 2V1RA 4DOWA 1YIJT 2RI2A 1VQLA 3CCLA 2LQ8A 4HXJA 2HD0A 2W10A 4HT8A 4PKCC 1GBRA 2LJ3A 4AT1B 4LUDA 4M75E 1OZ2A 2KRNA 4EMKC 1YITA 2RJCA 1GL5A 1VQ7T 2X51A 1W2BA 1G3WA 2YLBA 4IKFA 1QWEA 1T0HA 2KE9A 3THKA 2ECZA 1J3TA 2XG8D 1I07A 3OBWA 4HVUA 5KCOA 1RL2A 2HKNA 4BB7A 2V8JA 4M77D 1M8MA 4J83A 1RAEB 3QZ5B 2EYWA 3X24B 2DLPA 5GAOp 2DMOA 2F5KA 2QA4T 2AZSA 2XD0A 5LJ3f 2L3PA 4FT4A 2QEXA 5IH2A 2DRMA 2DTOA 4HCCA 2HQHA 4FSSA 4B9XA 3PFSA 2DYBA 3OW2A 4IUTA 5J3BA 5FWBA 1WXUA 2K3YA 1U5SA 1VQOT 3CPWA 2PU9B 1MUZA 3VS2A 1T3LA 2LDMA 1H3HA 1C0MA 3G71A 1HYOA 5GAOm 2E5QA 4MZTA 2EJGA 3CMAT 1B34A 2LQWA 5GMKj 2K57A 3NTKA 3NFCA 1H641 1X01A 1MHNA 3CCLQ 3HKSA 1RAFB 3OMGA 5GAN3 4PK4A 2BE7D 5FRNA 2LRQA 4F14A 4F7UA 2XDBA 1YITQ 3M0RA 1I5LA 5KYXB 1X69A 2CSIA 3ASKA 2EYYA 1VYTA 3CD6Q 2RJEA 4C0GA 1M3AA 2YUQA 5L23A 1WXBA 1R0CB 1YBYA 1MMGA 2A28A 3BDUA 3FJPA 2LQNA 2OX7A 2RQRA 4EMKB 2PUOB 4FW1A 3S3OA 1BKBA 2BIVA 2DIQA 2H3JA 4ZN1A 2RPNA 3OMCA 4CC7A 3QG1A 2SRCA 1M2OA 2PZ1A 3I5SA 2ESWA 1VQMT 4J9FA 4XAXB 1M1GA 1BBZA 3RERA 3X25B 2EQUA 1UG1A 2DVEA 1Q81R 2LT1A 4CI0C 2FZKB 1B3QA 1VQKA 2CS7A 3I5RA 6AT1B 5FU7C 4Z02A 2E12A 1NEBA 2IIMA 1M8VA 1QP2A 2EPDA 1GXIE 2QASA 2ZPIB 2FG0A 3VV0A 1ZA2B 2AK5A 3L2VA 1WHHA 3VRZA 2R58A 1RUWA 1NG2A 3AT1B 2Y90A 4FL6A 3CCRT 1S72T 1UGVA 1GFDA 2AKKA 4DBRA 3ZBDA 3HRTA 1EIFA 4JRQA 2EKHA 3EFOA 2XU8A 1VQ9T 3CC7Q 3SB2A 4WF2A 2CP2A 2EYZA 2V8KA 5GAOl 1PHTA 1B34B 3MJXA 3PMIA 4QW2A 4HCBA 1YHQT 4M78B 3PGGA 1YI2A 1VOMA 1VQMQ 1X75C 2JM9A 3RDVA 4M75C 4OMLA 5FROA 3TSZA 4N4GA 2ED1A 3DKMA 2YSQA 2P84A 3VS7A 1OU9A 1WHKA 2O01E 1I8FA 3E19A 2GF7A 3QKJA 1YITT 2ABLA 1SRLA 4CC2A 4JS4A 3CCUT 4ANJA 1VIEA 1VQNA 1W70A 2OTLQ 3FIFA 1QWFA 4M78F 1XOVA 1K73U 4OGEA 4CC3A 1LOJA 3WVDB 3CMAQ 1YNZA 3GP8A 1VQ7Q 1KQ1A 2DXBA 3CXCS 1AVZC 1Y07A 2DA9A 4C0DB 2XK0A 1G3SA 2I2LA 2AHJB 2K5IA 2Z0WA 2MAMA 2R5AA 4OB0B 2HDAA 2OI3A 3S6WA 1NLOC 3GNGA 5LJ5f 3DLLA 2YT6A 3BDLA 2DM1A 3LGLA 5I11A 1PKSA 2K3BA 2RJDA 1Y0MA 1PRMC 2QAZA 4XTXA 3JCMf 3IQLA 1IB8A 1Z9ZA 1IGUA 4FIBA 1K73R 1VQ5A 3MPUB 2K6DA 5GJWB 3CPWP 4IIOA 4M7DC 4F17A 1N9RA 3EFOB 2A3LA 2DKGA 2VGMA 3FB9A 4M77E 2HBWA 3CXCP 5EC7A 5HK3A 4M7DE 1WFWA 5GAOq 3A8GB 1X6GA 5CQXA 1G83A 4OVAA 3RR6A 1VUBA 3NTIA 3KFVA 1FMWA 3M57A 2DVJA 1YJWT 2ZZDA 1WX6A 3JCMe 1VQNQ 4MDWA 4RG8A 1OX9A 3C4SA 2MCNA 1WHLA 2FO0A 1QW1A 2YDLA 4D8DA 1KQSP 3I55Q 4N4IA 3QZ9B 2F2XA 5FWCA 1YI2T 1WIEA 1QKWA 2MPXC 3G4SQ 1NE8A 3KXTA 3MHXA 2JTFA 4M75D 3CPWS 1UE9A 1UJYA 2CT4A 3VYHB 4RTZA 9ATCB 3KBGA 3RMSA 2EWNA 3CMEA 1KG1A 3PE0A 1YJ9Q 4L6V5 3NTHA 2KRMA 3BW1A 1LCKA 1VQ4Q 5GANh 4OF1A 5GJVB 2A7YA 2KR3A 4OB3B 3EG0A 1H3ZA 2KRSA 3META 4PL6A 1V1CA 1PC0A 1JQQA 2HKQB 1M3CA 3CC2Q 1BU1A 5A0LA 5FLXE 3E1SA 3TEEA 3QO3A 1WZOA 3VRYA 3CCET 2EKOA 2EYQA 1WHMA 2RI5A 5LJ5h 1UHFA 1W2BS 2CSQA 1VQ4T 1KJWA 1WJRA 4AFZC 4C92F 3H0HA 2J06A 2DYIA 2HMAA 1SRMA 4A53A 4L59A 2OAUA 1SEMA 1GCPA 1X6BA 5GAN5 1U8RA 4J9BA 1W6XA 4R0KA 4AFSC 3L2QA 5LJ3h 2YXYA 4OP0A 1VQKT 1PRLC 1M1FA 2L89A 3G4ST 2E10A 1I0CA 1QP3A 3C95A 1KFZA 3FJ5A 3Q1JA 2E64A 2GTOA 1QVGA 2ROLA 3CPFA 3RKYA 5CQYA 3CCMA 3V8KA 3EGDA 1ARKA 1YJ9A 2VASA 3G6ET 3MEAA 4QVZA 1ZBJA 2M16A 1B07A 2AKLA 1OU8A 1UEBA 3RBBB 3RUXA 2QA4A 5GANj 2ATCB 1C1AA 4XK8E 5LJ5g 4JRPA 2D6FA 3SWNC 3FRNA 4XTZA 3R6NA 3OSSC 3DLMA 2PNIA 1M30A 3M54A 2QG9B 4M7DA 4M7AB 1ZA1B 2LX7A 4FT2A 3OA6A 2JMCA 4XU1A 4XQ3A 5C6SA 2ZPBB 3C94A 4DEYA 1XNIA 4RTYA 5FW9A 1LVKA 2EQMA 1U1SA 4HVWA 3CCQA 4C5GA 5L8RE 2MWOA 2LC4A 1ZSZB 2QEXT 5AYFA 3HRUA 4XU2A 3EH1A 3EFSA 4ZGDB 2A0FB 1BI3A 3MP8A 4IUPA 2EVRA 2H3EB 2KQWA 4PLLA 4J6WA 3NPFA 2JUFA 1TG0A 2E3HA 2J6OA 1TS9A 4C0DC 4LNPA 3EGDB 2GGRA 5GAN2 1YJWA 4BUGA 2NUPB 4DEXA 1UHCA 2VYTA 2CYZB 1T0JA 2K4YA 2XDPA 2CGHA 3M0TA 4KT0E 5D7UA 3HHTB 1AD5A 1TU0B 1BK2A 5M9OA 4BD3A 5GAN6 5D6XA 3PMTA 3QXEB 1EFNA 3X20B 3MCAB 1PG5B 1QVPA 4KGVB 3EG3A 2RHUA 2P0PA 2OTJT 3JB9H 4M7AF 1KK7A 4JJBA 4EMKA 3CC4T 5CKFA 4A4EA 4DQ2A 1IGQA 3L2WA 2L0AA 4FYWB 2COZA 5GANg 4O6JA 4OMFB 3BFMA 2RMOA 2HL3A 4AFQC 4M7AG 3CCQQ 3CD6A 1KC8C 1QMCA 2FRYA 3QHSA 4LD9K 1Q81C 1VQ8T 4KH0B 1YJNQ 2GQIA 3EG2A 2O31A 3UATA 2HQEA 1MMDA 3C0CA 5GANf 5LJ5d 5C0MA 4CRIA 3I56A 1WYXA 2FZGB 2QGFB 3KUFA 2JTMA 1RAHB 2O4XB 3QWXX 2XHCA 3H0FA 4NL2A 4MZPA 1PWTA 3V8LA 1Q81U 1HXDA 1SHGA 2D0NA 2ENMA 4E2FB 5I21A 2XKOC 3VUBA 2D0QB 4M77F 3CCSQ 3M55A 2A08A 2EW3A 4M7DD 4NS5A 5FU6B 2X3XD 4A63B 3ME9A 1M1KU 3CC2T 1KSWA 1QVFA 1UGRB 4JS5A 4X9DA 2NUPA 3S3MA 4JJNK 1BI2A 5GAMf 3O8VA 2JNGA 1VQ6A 1I1JA 3JSCA 2CZ6B 4FYYB 1CKAA 1YFNA 3G6EA 4Z89A 3VYGA 2QQAA 3CEYA 1FXXA 4X34A 1PNJA 2KMTA 3OS1A 4RTXA 5CO7A 5DLOA 2L8DA 4D8KA 3QYHB
chains in the Genus database with same CATH topology
2GCXA 2R58A 2Y90A 3I55T 4FL6A 3CCRT 1S72T 4LDXA 3I55A 2QI2A 5HK0A 2QQSA 3OS2A 3ZBDA 1LNXA 3HRTA 3RIRA 1EIFA 1M5Q1 4RG2A 3JB9J 4JRQA 1YJNA 3OSVA 3OYHA 3CCEA 2XU8A 3URGA 1VQ9T 3SB2A 3L42A 1NPRA 3DB3A 5CAIA 4WF2A 2X35A 3JCMX 3OQ5A 5GAMg 3LWHA 3CCUA 2V8KA 5GAOl 4M77C 4M7AE 1B34B 3PMIA 4QW2A 4M75F 4HCBA 1O75A 4BE2A 3SFMA 1BIAA 4M78B 1YHQT 1YJ9T 3VUZA 2JZ2A 1Y96A 3M4YA 3PGGA 4FU6A 1YI2A 2HQXA 2DIGA 2DXTA 1WPYA 4C92B 5LJ5j 4A54A 1X75C 2ZPHB 3TU4K 5D6WA 1D3BB 1DJ7B 2KY9A 3ER0A 4M75C 2DXUA 3PT9A 5CIUA 4C92E 3PTAA 3GF5A 3CCST 3CMET 2MI6A 5FROA 4C0FA 3G71T 1VQ8A 3MP6A 1ZQ1A 1OI1A 3CBOA 3QBYA 4N4GA 3SDZA 4C8QD 3OYNA 4M75B 5IN1A 4ELZC 3GOXA 3DKMA 2DD4A 4PJOA 5EG2A 3JCMW 2PVDB 1ZBXA 3FEOA 3JB9D 2O01E 5GAMe 3OYKA 2JOYA 2M1HA 1I8FA 5LJ3e 3E19A 2GF7A 3QKJA 4EMHA 1KHCA 5GAMh 1YITT 1BI0A 3P8DA 4C5IA 4KUDK 4JS4A 2Y4YA 2QTXA 3CCUT 4ELYC 4ZTFA 4M7DF 4C0ZA 5CK9A 1NJIU 1VIEA 1VQNA 4OB2B 1Q7YU 4YTLA 3LGFA 4V2SA 3FIFA 3OYCA 3OYMA 3I56T 4C8QB 5GANd 4M78F 3HPWA 4J6XA 5DLQE 3UT1A 5IAYA 1XOVA 1K73U 4Y91A 2GQVA 4JLGA 4L5GA 1U1TA 2GFAA 3CCLT 3M56A 3QPHA 1M9SA 4OGEA 1Q86C 3A8MB 2OTLA 1OYXA 4M75A 4BACA 4M7DG 3CCRA 1S72A 1LOJA 3WVDB 4A4FA 4D6WA 1G5VA 3M53A 3GP8A 1KQ1A 4MMKA 2B8AA 2DXBA 3CXCS 1Y07A 2ZPEB 4C0DB 4IUQA 2XK0A 3OYEA 1G3SA 2DPPB 2EQJA 2Y4XA 3QYGB 4E47A 3GPLA 2ZPGB 4ZGEB 5CR2A 2I2LA 2AHJB 2DTIA 2K5IA 2MAMA 2R5AA 4RCCA 4OB0B 5I2SA 3L2UA 3CCJT 4E7LA 2EQKA 3S6WA 4J7IA 1RI0A 3GNGA 5LJ5f 2CZ0B 2RM4A 2XDDA 3DLLA 3OW2S 3BDLA 2QQ9A 5A2QE 3LGLA 5I2MA 5GMKi 2DZCA 5CVIA 2RJDA 4BY6B 5GAOn 3MEVA 1I4K1 4XTXA 3JCMf 3OYAA 3LWIA 1N8RC 1KQSA 3CBPA 2DEQA 3MEUA 4LDYA 3OY9A 5GMKh 4FIBA 3OYYA 1K9MU 5J39A 1VQ5A 1TH7A 5CKEA 2RK2A 1N8RU 2YLCA 4BI3A 4TVRA 2ZPFB 2WSCE 2KDSA 1PSFA 4M7DC 2RHYA 4N4HA 2D9TA 1N6AA 1N9RA 2A3LA 2DKGA 2QDYB 2VGMA 2KAFA 5LJ3g 1R8OB 3EFRA 5GAN4 2RHXA 3FB9A 4M77E 4M78C 3JCMg 1Y96B 4C8QC 1KQSS 2DAQA 4E7JA 5GMKl 2HBPA 3OS5A 4F7UG 5HK3A 4M7DE 3V7SA 2MWPA 5GAOq 3A8GB 3SWNB 1O9SA 5CQXA 5HKCA 3J7AF 3SWNC 4OVAA 4XTYA 2PVGB 5LJ3d 3WVEB 2KSSA 5DM7R 1VUBA 3NTIA 3F70A 4N0AC 3RKXA 4BY6C 5GAMd 1M1KC 3QDRB 3GLXA 3M57A 4N0AA 1VQ9A 2E41A 4J7FA 1YJWT 1YCYA 3JB9F 4PJOD 2ZZDA 1VQLT 2ZGWA 3QJ6A 3JCMe 2F69A 4F7UF 1SSFA 2DK3A 4MDWA 5J26A 1LJOA 1BIBA 2WACA 4GY5A 4O5VA 4RG8A 5GANe 3UPUA 3L2RA 3C4SA 2X4YA 4E7IA 3CXCA 1I81A 4J5YA 1QW1A 2K2VA 4LDUA 2BUDA 4N4IA 3QZ9B 2LNVA 2VGNA 3G7ZA 3C12A 2RH2A 1YI2T 2JN0A 5KE2A 1V29B 4Q5WA 1VIFA 5CCAA 2G3RA 1G3TA 4C5EA 4C92C 1G3YA 3FC3A 3QIIA 4C92A 2X4XA 1Q86U 5LJ5e 2QQBA 1NE8A 3KXTA 4JRIA 2QQRA 3MHXA 2MMPA 2RI3A 2JTFA 4M75D 3VU3C 3CPWS 3HSBA 4R56A 2C06A 3HFOA 4J8OA 1K8AC 3LX7A 1XQHA 3VYHB 5A0GA 3HFNA 3GNFB 3KBGA 3M5AA 2VXEA 2EWNA 2VV5A 3RMSA 5GMKm 2P0KA 3CMEA 3L1AA 4HKEA 4E7KA 2E70A 4C8QF 1VQMA 3MO8A 4FSXA 1KG1A 3CCSA 1VQ4A 3SD4A 1VQPA 4ME7A 2O4XA 4L6V5 3NTHA 3BW1A 3QSUA 3V7CA 2VXFA 4M77A 3QJYA 4BE1A 3JCMh 2XICA 3MEWA 2RB6A 2CKKA 3BY7A 5GANh 4LD6A 4OF1A 1BYMA 2A7YA 4OB3B 4BI4A 1H3ZA 1JBMA 3RMQA 1PSEA 3META 4HT9A 4M78D 4R55A 2LX9A 3E9GA 3MP1A 4PL6A 3JCMV 4PLIA 4JLIA 4KBMB 1NPPA 2WSEE 5FLXE 3E1SA 3TEEA 3QO3A 3RKWA 2LVMA 4QQDA 5A0LA 4EDUA 3A8HB 2GFUA 4DA4A 2DTHA 2L3RA 2M9UA 3CCET 2EKOA 2EYQA 2RI5A 4F7UE 5LJ5h 3X26B 4A4KA 1W2BS 1VQ4T 3CC2A 2CZ1B 3JAME 1AHJB 2EIFA 5KE3A 1FX7A 1WJRA 4PJOC 4M7AD 4C92F 1KHIA 3A5ZB 4IUUA 3JB9I 1WQ7A 4DOVA 3CD6T 2PUKB 4M78G 1KC8U 4A53A 1JJ2S 5LJ3j 1K9MC 1KD1U 4L59A 1NJIC 5GAMj 2EJ9A 2OAUA 5IT9E 1VQ7A 3M59A 2LT4A 3CCQT 5GAN5 1U8RA 1Y7XA 1WGSA 4BE0A 2L5QA 3L2QA 4HA8A 1XTDA 3H6ZA 5LJ3h 4QVDA 4OP0A 3J81E 1VQKT 3SWNA 2JVVA 3OS0A 1M1FA 2L89A 3EAEA 3G4ST 2E10A 3INZA 1UGSB 2WSFE 4MZMA 2DZ9A 3LYIA 2OTJA 1N27A 5FRMA 3V8JA 1KQ2A 2P4TA 2FB7A 4M7DB 4C8QE 4M78E 3CC7A 4PJOB 1QP3A 3C95A 4PNOA 2RD1A 1K73C 2XI9A 3Q1JA 2E64A 4B9WA 1WNLA 2ZCFB 1QVGA 1QVFS 4C92D 3CPFA 4PJOG 1M90U 3CBMA 1MGQA 5CQYA 3RKYA 3J80E 3CCMA 3JCMP 2V8IA 3V8KA 1VQOA 2LCCA 1VQNT 3E9FA 1YJ9A 1YHQA 3G6ET 3MEAA 3V7RA 1Y71A 3N5BB 2EFIA 3OYLA 2HAXA 4QVZA 3OYJA 4QQ6A 2M16A 2BKDN 1UEBA 3RUXA 4PJOF 4KULA 2QA4A 5GANj 4XK8E 5LJ5g 1W4SA 3CCVA 4F7UB 4ZN3A 1KD1C 4A4GA 4JRPA 1YJNT 4JUVA 2PQWA 2D6FA 4IUVA 4XU3A 2DD5A 1UGQB 2XIDA 3FRNA 4X9CA 4XTZA 2FL7A 3OSSC 2CZ7B 4JRKA 4DOWA 3DLMA 4LDWA 2RI2A 3M54A 1YIJT 1VQLA 2EJFA 3QUIA 1N9SA 3CCLA 4M7AB 2DJZA 4M7DA 2LQ8A 2HD0A 2LTOA 4HT8A 4FT2A 3OA6A 4NL3A 4XU1A 5GMKe 3OYGA 3P8BB 2DO3A 4PKCC 4XQ3A 5C6SA 1JJ2A 2FHDA 4M78A 3VJPA 2LCLA 2ZPBB 3C94A 4QVCA 3GIBA 2NLUA 4M75E 1OZ2A 1XNIA 2RJFA 4EMKC 4KUIA 2EQMA 1Q82C 1YITA 1U1SA 2P0QA 2RJCA 3CCQA 1W2BA 3M58A 1HK9A 4XTWA 3X28B 3RESA 4C5GA 4VUBA 5L8RE 1WJSA 2MWOA 2LC4A 1G3WA 2RK1A 2YLBA 3OB9A 3CCJA 3S3NA 1K8AU 4IKFA 2QEXT 4E7HA 2VUBA 1M4ZA 4GLKA 5FU7B 4M7AA 2DXCA 3HRUA 3LW5E 5AYFA 3JCMb 4XU2A 3UDCA 2XG8D 2K5FA 3OBWA 3EFSA 4HCZA 4OGCA 5KCOA 4ZGDB 1JB0E 2OTLT 1BI3A 3MP8A 4IUPA 2KQWA 4J6WA 4PLLA 1RL2A 3LLRA 2JUFA 4BB7A 4M75G 2V8JA 4MMLA 4M77D 3OYIA 4J83A 4C0DC 4RCBA 3QZ5B 3M4GA 3X24B 5GAN8 5GAN2 2IG0A 4BUGA 5GAOp 1YJWA 3M9QA 2K3XA 2E1HA 2F5KA 5DY9A 2QA4T 3UWNA 2XD0A 5LJ3f 4FT4A 3ZFJA 5GAOr 1UGPB 1WJQA 2VYTA 2QEXA 2CYZB 2E6NA 4C8QG 2K4YA 2DTOA 4HCCA 2XDPA 2CGHA 2RA2A 3H8ZA 3HL8A 4LDVA 4PJOE 1P92A 4B9XA 4XTVA 4KT0E 2K5LA 3HHTB 3PFSA 3OW2A 3OBYA 4II1A 4IUTA 2QXFA 5J3BA 3CCMT 3JCMJ 3R6OA 2K3YA 5M9OA 3T9NA 4BD3A 5GAN6 3PIOA 1VQOT 3CPWA 5D6XA 2PU9B 1M90C 3PMTA 2LDMA 4M7AC 3WXMB 3QXEB 2FYKA 1VQ5T 3ZEHA 3G71A 1VQPT 1VQ7T 3X20B 4JDSA 3MCAB 5GAOm 1QVPA 2E65A 4M77B 2E5QA 2RHUA 4MZTA 2EJGA 3CMAT 1B34A 2P0PA 5GMKj 2K57A 3NTKA 2OTJT 3NFCA 1H641 1X01A 1MHNA 3JB9H 1UB4A 4M7AF 3HKSA 3PIPA 4EMKA 4MDXA 3TCJA 3JCMQ 3OMGA 5GAN3 3JCMc 4ZTJA 3CC4T 5CKFA 4RMOA 4A4EA 2HNIA 1VQ6T 4DQ2A 2KK4A 5FRNA 4RKUE 4C92G 2LRQA 5KCHA 3L2WA 1FWZA 4F7UA 3AHUA 5LL6S 1QVGS 5GANg 4O6JA 3BFMA 4OMFB 3FDRA 4IURA 2XDBA 2LQKA 4EPCA 4M7AG 4J6YA 5A0DA 3CD6A 1I5LA 1KC8C 3QHSA 3FLGA 4LD9K 2IVWA 4EMGA 4ZGJB 3CMAA 1Q81C 1VQ8T 3ASKA 2R5MA 2VC8A 4C5HA 4OB1B 2YRVA 1Q82U 2RO0A 1NZ9A 2RJEA 2HQEA 4C0GA 3CC7T 5GANf 5LJ5d 5C0MA 4CRIA 2X4JA 2PVOB 5CKHA 3I56A 3L2ZA 1X6OA 3KUFA 2JTMA 1YBYA 3HRSA 1Q7YC 3G4SA 3BDUA 4BDYA 3CCVT 2YHTA 3FJPA 2O4XB 2XHCA 1IREB 3VKIA 5KH6A 4NL2A 4XU0A 1WQWA 4MZPA 4EMKB 4C8QA 3V8LA 2MF2A 4UC4A 1Q81U 1HXDA 2PUOB 2EAYA 3S3OA 4Y28E 5GAN7 3CC4A 1BKBA 2BIVA 5I21A 2XKOC 2DIQA 3VUBA 2H3JA 4ZN1A 2D0QB 4M77F 3OMCA 3HP9A 3JRZA 3M55A 3PNWC 3QG1A 4M7DD 5HY6A 3LH0A 4NS5A 1VQMT 4QQGA 4XAXB 4A4HA 1M1GA 2X4WA 5FU6B 1D3BA 1YIJA 3ME9A 1M1KU 3CC2T 3RERA 3X25B 2EQUA 4XTUA 3P8HA 2F5TX 2KVQG 3A8LB 2DVEA 1QVFA 1UGRB 4M77G 1ZHIA 2LT1A 4JS5A 4X9DA 4CI0C 3OYBA 5FU6C 3S3MA 5CKDA 4JJNK 1BI2A 3A8OB 5GAMf 3DB4A 2M0OA 3OYFA 2CS7A 1VQKA 3O8VA 5FU7C 3JB9G 2JNGA 4Z02A 3JCMd 4FM4B 2E12A 3OYDA 1VQ6A 1BI1A 1M8VA 1QP2A 3JSCA 4P5NA 2CZ6B 1JRIA 1OZ3A 5CKBA 3G6EA 1GXIE 5D6YA 3VYGA 2FVUA 4BI8B 2RHIA 2QQAA 3CEYA 2R57A 2RHZA 1IZ6A 2ZPIB 3VV0A 1FXXA 4X34A 3TREA 2KMTA 4NOYA 3OS1A 5CO7A 3L2VA 5DLOA 4BDZA 2L8DA 2E6ZA 4ATOA 3QYHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XID A;  5A0D A;  5A0G A;  2XI9 A;  4C0Z A;  2XIC A;  5A0L A;  4BUG A; 
#chains in the Genus database with same CATH topology
 3I55 T;  2DIL A;  2QI2 A;  2CP5 A;  1UUE A;  1LNX A;  1YJN A;  3OSV A;  1NPR A;  1X43 A;  3OQ5 A;  5GAM g;  4AG2 C;  1YI2 Q;  2K7A A;  2YWW A;  3CCE Q;  2KRO A;  2X9H A;  4M75 F;  3SFM A;  2JZ2 A;  1ZUU A;  2HQX A;  2DIG A;  2DXT A;  5LJ5 j;  4C92 B;  1XJW B;  4A54 A;  2ZPH B;  5I22 A;  2RQW A;  3TU4 K;  1DJ7 B;  1RAB B;  3PT9 A;  1PCX A;  4C92 E;  3CCS T;  2KYB A;  2C0O A;  4C0F A;  3G71 T;  3MP6 A;  3QBY A;  3GBQ A;  4M75 B;  5IN1 A;  1Q95 G;  1QQJ A;  2DD4 A;  4PJO A;  3JCM W;  1RAG B;  2PVD B;  1VQ8 Q;  4J9E A;  3OYK A;  2JOY A;  2M1H A;  1KHC A;  1BI0 A;  4C5I A;  1X2K A;  1EZZ B;  1UTI A;  4ZTF A;  4C0Z A;  4KGX B;  1VQ6 Q;  1Q7Y U;  4YTL A;  3OYC A;  1VQL Q;  2IPO B;  3HPW A;  1S1N A;  2DFU A;  2GFA A;  3M56 A;  2FPD A;  3A8M B;  1U06 A;  1YWO A;  4D6W A;  1WXT A;  1G5V A;  2JT4 A;  3QWY A;  1OPL A;  2MYS A;  1SG5 A;  2ZPE B;  4GBQ A;  2EQJ A;  4F04 B;  4E47 A;  1KD1 R;  2ZPG B;  5I2S A;  1E6H A;  2YUP A;  4RCC A;  3CCJ T;  4E7L A;  2GNC A;  2EQK A;  2RQT A;  4F16 A;  1NLP C;  1WHG A;  2CZ0 B;  2OTJ Q;  3EG1 A;  2QQ9 A;  4J9H A;  5GMK i;  5CVI A;  4BY6 B;  5GAO n;  3MEV A;  1I4K 1;  3LWI A;  4ESR A;  2DEQ A;  3MEU A;  1N8R U;  2ZPF B;  2AIR B;  2ROT A;  5IHN A;  2HEQ A;  2QDY B;  4CC4 B;  5LJ3 g;  2JS0 A;  3EFR A;  5GAN 4;  1Y96 B;  4C8Q C;  1KQS S;  3OS5 A;  2MWP A;  2QK0 A;  3SWN B;  1M90 R;  1O9S A;  4XTY A;  2PVG B;  3RKX A;  3F70 A;  5GAM d;  1K9M R;  1D09 B;  4J7F A;  3JB9 F;  1VQL T;  2VB6 A;  2ZGW A;  1SF9 A;  2V1Q A;  2XMF A;  1SSF A;  2DK3 A;  5J26 A;  5GAN e;  1UEC A;  3UPU A;  2KNB B;  2K79 A;  1I81 A;  4J5Y A;  2LNV A;  1AWW A;  3G7Z A;  3H9N A;  1V29 B;  5CCA A;  3FC3 A;  2X4X A;  2QQR A;  2YUN A;  4E6R A;  2KGT A;  2MMP A;  1IXD A;  2X3W D;  5KYU A;  2C06 A;  4ZNX A;  3M0Q A;  2CP6 A;  2YRD A;  1M2V A;  1NM7 A;  2VXE A;  2VV5 A;  2DE0 X;  2DER A;  1BB9 A;  3L1A A;  4HKE A;  4E7K A;  1VQM A;  4PJJ A;  3LH5 A;  4FSX A;  2L3Q A;  1RAC B;  1VQ4 A;  3SD4 A;  1VQP A;  2O4X A;  2DRK A;  2CP7 A;  2FEI A;  3QJY A;  4BE1 A;  1YWP A;  1K1Z A;  1N5Z A;  2F2V A;  4LD6 A;  1W2B P;  2KEA A;  4IIM A;  1JBM A;  1PSE A;  2OJ2 A;  3O5Z A;  4M78 D;  1QVF P;  2LX9 A;  3E9G A;  3MP1 A;  3JCM V;  4PLI A;  2D8H A;  1NPP A;  1K4U S;  2E4H A;  5AT1 B;  4EDU A;  2DTH A;  2L3R A;  2EQI A;  4A4K A;  2F2W A;  3JAM E;  3A98 A;  1JXO A;  5KE3 A;  4PJO C;  4M7A D;  2VVK A;  3JB9 I;  2KYM A;  4DOV A;  5LJ3 j;  1K9M C;  1NJI C;  2EJ9 A;  5IT9 E;  1ZSG A;  3CQT A;  4FYV B;  1VQ7 A;  3M59 A;  3H6Z A;  3J81 E;  3SWN A;  2JVV A;  2VWF A;  3OS0 A;  5IXB A;  3M0U A;  4MZM A;  2DZ9 A;  1N27 A;  3V8J A;  2C0T A;  1KQ2 A;  2P4T A;  4M7D B;  4RTT A;  4C8Q E;  4M78 E;  3CC7 A;  2O88 A;  2XI9 A;  1WNL A;  2ZCF B;  4PJO G;  1MGQ A;  1VQ5 Q;  2A37 A;  2DET A;  3TVT A;  2HAX A;  3OYJ A;  4QQ6 A;  1JJ2 P;  1QLY A;  2BKD N;  1MV3 A;  4KUL A;  4F7U B;  1KD1 C;  4A4G A;  4OMQ A;  4JUV A;  4IUV A;  2DD5 A;  1E6G A;  2MK5 A;  2DJZ A;  2LTO A;  1YN8 A;  4NL3 A;  5GMK e;  1Q86 R;  3P8B B;  1JJ2 A;  1NYG A;  2FHD A;  3RNJ A;  2LCL A;  2NLU A;  2M51 A;  2RJF A;  1C6V X;  4KUI A;  2JJ9 A;  2P0Q A;  1AEY A;  2V26 A;  4XTW A;  1HK9 A;  1GBQ A;  3M58 A;  3X28 B;  4VUB A;  3VS3 A;  2RK1 A;  3OB9 A;  1K8A U;  1UJ0 A;  2DL5 A;  4E7H A;  2DXC A;  3LW5 E;  3JCM b;  2K5F A;  4Z88 A;  4LXC A;  3CCJ Q;  2DNU A;  1YJW Q;  1JB0 E;  2OTL T;  1D0Y A;  3LLR A;  3CCU Q;  1M3B A;  5GAN 8;  2IG0 A;  4JZ4 A;  3REB B;  3M9Q A;  2K3X A;  2E1H A;  2DJQ A;  1VYV A;  3EGX A;  1G8X A;  1NBE B;  5GAO r;  1UGP B;  4C8Q G;  4K11 A;  1PD1 A;  2RA2 A;  3HL8 A;  4PJO E;  3TQ7 P;  2K5L A;  3OBY A;  2QXF A;  3CCM T;  3JCM J;  4DBF A;  1YIJ Q;  2H8H A;  4M7A C;  4LUE A;  2FYK A;  1VQ5 T;  2DBM A;  4JDS A;  1M2V B;  2CUD A;  1ZLM A;  1UB4 A;  4RTW A;  3PIP A;  4MDX A;  2GTJ A;  2HCK A;  2HNI A;  1N8R R;  2KK4 A;  4PJM A;  1FWZ A;  3AHU A;  5LL6 S;  1QVG S;  1SHF A;  3FDR A;  2CT3 A;  4EPC A;  1AOJ A;  5A0D A;  4RTU A;  3A1P A;  2R5M A;  2VC8 A;  2QYZ A;  4OB1 B;  2EGC A;  3JV3 A;  2YRV A;  1Q82 U;  2RO0 A;  1NZ9 A;  2X4J A;  2PVO B;  5CKH A;  3L2Z A;  2CUB A;  1Q7Y C;  3G4S A;  4BDY A;  2YHT A;  2EBP A;  3VKI A;  5KH6 A;  1WQW A;  4C8Q A;  5ECA A;  5KYU B;  4UC4 A;  2JMA A;  4AMC A;  3REA B;  4Y28 E;  5GAN 7;  3CC4 A;  1OV3 A;  5IHI A;  1Y57 A;  2BZX A;  4DBH A;  4J9C A;  1ACM B;  1TXQ A;  2L2P A;  4A4H A;  1YIJ A;  4KGZ B;  2G6F X;  3P8H A;  2KVQ G;  3A8L B;  4E7S A;  2HSE B;  5KYY B;  1ZHI A;  3OYB A;  5FU6 C;  4RUG A;  5CKD A;  1KC8 R;  1WLP B;  3A8O B;  3DB4 A;  3OYF A;  3JCM d;  1K0X A;  4FM4 B;  3BE3 A;  3OYD A;  1BI1 A;  2C0I A;  1T3S A;  4P5N A;  1VQ9 Q;  5HCK A;  1JRI A;  1MMA A;  3NGP A;  2FVU A;  2JM8 A;  2P4R A;  2R57 A;  4J9D A;  3TRE A;  1R77 A;  3NHN A;  4NOY A;  4BDZ A;  2BZY A;  3M0S A;  2FZC B;  2FPE A;  2QQS A;  3OS2 A;  3RIR A;  3JB9 J;  3OYH A;  3CCE A;  1OOT A;  3URG A;  1IHV A;  1HJD A;  3L42 A;  5CAI A;  1A0N B;  1YJ9 T;  1BIA A;  3VUZ A;  2DL4 A;  2W0Z A;  5D6W A;  2KY9 A;  5CIU A;  3ER0 A;  3PTA A;  3CC4 Q;  2YUO A;  3GF5 A;  3CCM Q;  1VQ8 A;  3CBO A;  3SDZ A;  4AFU C;  3GOX A;  1WA7 A;  3FEO A;  2DEU A;  2K2M A;  5LJ3 e;  2BE9 B;  5KYW B;  2Y4Y A;  4M7D F;  4ELY C;  3EH2 A;  4FW2 A;  1Q82 R;  4OB2 B;  1JXM A;  2NUT B;  4V2S A;  1WHJ A;  3OYM A;  2CH4 W;  4C8Q B;  5GAN d;  4J6X A;  5DLQ E;  3EHR A;  1IRX A;  2GQV A;  3CCL T;  1U1T A;  1M9S A;  2A36 A;  2E5K A;  1OYX A;  2DBK A;  4BAC A;  4M7D G;  3CCR A;  1S72 A;  4OMN A;  4A4F A;  4MMK A;  2B8A A;  4IUQ A;  3QYG B;  2DPP B;  3D7S B;  3EG9 B;  3GPL A;  3I56 Q;  4M7A E;  5KYN A;  2B86 A;  1RI0 A;  2RM4 A;  2QEX Q;  5A2Q E;  2DZC A;  1N8R C;  1KQS A;  3CBP A;  3OY9 A;  4LDY A;  3OYY A;  1VQO Q;  1PM3 A;  1K9M U;  2NYS A;  5CKE A;  2YLC A;  1TTH B;  3UF4 A;  4TVR A;  3G71 Q;  2WSC E;  2KDS A;  2RHY A;  4N4H A;  2D9T A;  1B7T A;  4M78 C;  3JCM g;  2DAQ A;  4E7J A;  1CSK A;  2MIO A;  1TWB A;  2ZAE A;  4F7U G;  2NUT A;  2FPF A;  3WVE B;  1QKX A;  3GLX A;  1YCY A;  4PJO D;  3G6E Q;  4F7U F;  1YP5 A;  1LJO A;  4GY5 A;  4O5V A;  2X4Y A;  1NEG A;  1OEB A;  2J05 A;  1TUG B;  2VGN A;  4PJL A;  2RH2 A;  5KE2 A;  4Q5W A;  1VIF A;  2G3R A;  1G3T A;  4C92 C;  5KYY A;  4C92 A;  5LJ5 e;  2QQB A;  4QKU A;  4JRI A;  2RI3 A;  1R0B G;  1RLQ C;  2AZV A;  3VU3 C;  3HSB A;  4FYX B;  1K8A C;  1XQH A;  2JTE A;  2KT1 A;  2E70 A;  3MO8 A;  3QDF A;  2DL3 A;  7AT1 B;  4ME7 A;  1YHQ Q;  1EX4 A;  3QSU A;  3JCM h;  2XIC A;  4LE9 A;  3BY7 A;  1E7O A;  2O9S A;  2COW A;  4R55 A;  4KBM B;  2WSE E;  4DA4 A;  3A8H B;  2M9U A;  3U23 A;  4F7U E;  3X26 B;  1GRI A;  1JO8 A;  1KHI A;  4IUU A;  3I9Q A;  3MKD A;  1QCF A;  4M78 G;  2DL8 A;  1LPL A;  1JJ2 S;  1FMK A;  5GAM j;  2VKN A;  1D1C A;  2LT4 A;  4X1V A;  3SHW A;  3CCQ T;  1Y7X A;  2J6K A;  4BE0 A;  2OAW A;  1ZUK A;  1QCO A;  2KBT A;  2M02 A;  4J9I A;  3EAE A;  1RAA B;  3INZ A;  1I5O B;  2OTJ A;  3E2U A;  1GCQ C;  1K73 C;  4GLM A;  1YCS B;  1H92 A;  4M4Z A;  3JCM P;  1VQN T;  3E9F A;  1YHQ A;  1Y71 A;  2EFI A;  3OYL A;  4ORZ A;  2ED0 A;  1VA7 A;  2J6F A;  2PQW A;  4XU3 A;  2XID A;  2FL7 A;  4JRK A;  2CZ7 B;  2E3I A;  1HSQ A;  3CCV Q;  4LDW A;  1OUL A;  1D1A A;  2D8J A;  2EJF A;  3QUI A;  1N9S A;  8ATC B;  2RQV A;  2JS2 A;  3OYG A;  2DO3 A;  1IHW A;  4M78 A;  3VJP A;  1HD3 A;  4QVC A;  2RN8 A;  3GIB A;  1AT1 B;  1V76 A;  2NWM A;  1Q82 C;  3VS5 A;  2M0Y A;  4E7Z A;  3RES A;  2EYX A;  1WJS A;  3S3N A;  3CCJ A;  2JXB A;  2I0N A;  2LCS A;  2VUB A;  1M4Z A;  4GLK A;  5FU7 B;  4M7A A;  3UDC A;  4HCZ A;  4OGC A;  1SSH A;  1TUC A;  2RNA A;  4M75 G;  4MML A;  3OYI A;  1SPK A;  4RCB A;  3M4G A;  2FRW A;  3H41 A;  4FCY A;  1ZSZ C;  5DY9 A;  1ZSZ A;  3UWN A;  1VQP Q;  3PVQ A;  3ZFJ A;  1WJQ A;  2E6N A;  3H8Z A;  4LDV A;  1P92 A;  4B6M A;  2SEM A;  4XTV A;  4II1 A;  4PFZ A;  1MNE A;  3R6O A;  4WTO B;  3T9N A;  3PIO A;  1M27 C;  1M90 C;  3WXM B;  3ZEH A;  1VQP T;  1IO6 A;  4M77 B;  2E65 A;  2J7I A;  2EGE A;  3ZL7 C;  3HTR A;  3TCJ A;  3JCM Q;  3JCM c;  4OMO A;  2CRE A;  4RMO A;  1VQ6 T;  4RKU E;  4C92 G;  5KCH A;  1UDL A;  4IUR A;  2LQK A;  4J6Y A;  1TUD A;  1WDX A;  3FLG A;  2IVW A;  4EMG A;  4ZGJ B;  3CMA A;  4C5H A;  3SEM A;  2HL5 C;  4HCK A;  3CC7 T;  2LJ1 A;  1RAD B;  4JJD A;  3CME Q;  2LJ0 A;  1X6O A;  1WI7 A;  3HRS A;  3CCV T;  1U3O A;  1IRE B;  1OPK A;  1AWJ A;  1F1B B;  4XU0 A;  4J9G A;  1UFF A;  2MF2 A;  2EAY A;  2GBQ A;  4QT7 A;  2CP0 A;  1ABQ A;  1RI9 A;  1JEG A;  1K8A R;  3HP9 A;  3JRZ A;  3PNW C;  5HY6 A;  1BCO A;  3LH0 A;  4QQG A;  2LP5 A;  1MV0 B;  2BTT A;  2X4W A;  1D3B A;  3M0P A;  1KIK A;  4XTU A;  2F5T X;  4RTV A;  4M77 G;  3ULR B;  4JZ3 A;  4PFP A;  3NMZ C;  1X2Q A;  2M0O A;  2NUZ A;  3JB9 G;  4EIK A;  2KXC A;  5CKB A;  1OZ3 A;  1VQK Q;  5D6Y A;  4BI8 B;  2RHI A;  2RHZ A;  1IZ6 A;  1K9A A;  2E6Z A;  4ZTJ A;  4ATO A;  2GCX A;  1FYN A;  4LDX A;  3I55 A;  1MMN A;  1VYU A;  5HK0 A;  1M5Q 1;  4KH1 B;  4RG2 A;  3DB3 A;  3VS1 A;  2X35 A;  3JCM X;  3LWH A;  3CCU A;  4M77 C;  1H8K A;  5KYW A;  1AZG B;  4JPB W;  1NJI R;  1O75 A;  4BE2 A;  1D1B A;  1Y96 A;  3M4Y A;  4FU6 A;  1ZX6 A;  1SKU B;  1WPY A;  1D3B B;  1FMV A;  2DXU A;  3CME T;  2MI6 A;  2LNH B;  1GCQ A;  3OW2 P;  2L3S A;  1ZQ1 A;  1OI1 A;  3OYN A;  4C8Q D;  4ELZ C;  5EG2 A;  3EGU A;  3JB9 D;  1ZBX A;  5IXF A;  5GAM e;  4EMH A;  5GAM h;  3P8D A;  4KUD K;  2QTX A;  1D0Z A;  5CK9 A;  1NJI U;  3LGF A;  3I35 A;  3I56 T;  5IAY A;  3UT1 A;  2F1L A;  4Y91 A;  4PFO A;  4L5G A;  4JLG A;  3QPH A;  1Q86 C;  2OTL A;  2RQU A;  4M75 A;  3M53 A;  3UA7 A;  3OYE A;  2Y4X A;  4PJN A;  4ZGE B;  5CR2 A;  3VS4 A;  2DTI A;  3L2U A;  2BZ8 A;  1X27 A;  2LMJ A;  4J7I A;  2XDD A;  3OW2 S;  1RAI B;  1AWO A;  2JW4 A;  2KT8 A;  4Z8A A;  2EGA A;  5I2M A;  3EHQ A;  1W1F A;  1QCN A;  3OYA A;  2HZY A;  5GMK h;  2QTV A;  5J39 A;  1TH7 A;  2RK2 A;  1M1K R;  1D0X A;  4BI3 A;  8AT1 B;  1PSF A;  3VS0 A;  1TSF A;  1N6A A;  2YRC A;  2KAF A;  3PVL A;  1R8O B;  2D1X A;  2RHX A;  5GMK l;  2HBP A;  3V7S A;  3EGX B;  1K76 A;  3J7A F;  5HKC A;  1RLP C;  1OX8 A;  5LJ3 d;  2KSS A;  5DM7 R;  4BY6 C;  4N0A C;  3VS6 A;  1M1K C;  4Y92 A;  3QDR B;  4N0A A;  1VQ9 A;  2E41 A;  3QJ6 A;  2F69 A;  1BIB A;  2WAC A;  4E7I A;  3L2R A;  3CXC A;  2K2V A;  4LDU A;  3G1J A;  2BUD A;  2DL7 A;  2AT1 B;  2LZ6 B;  3C12 A;  2K9G A;  4HVV A;  2JN0 A;  4C5E A;  1G3Y A;  3QII A;  1PKT A;  2O9V A;  1Q86 U;  1BCM A;  2CP3 A;  4R56 A;  3HFO A;  2CDT A;  2HSP A;  4J8O A;  3LX7 A;  5A0G A;  3HFN A;  3GNF B;  3M5A A;  1NYF A;  2DF6 A;  2DX1 A;  5GMK m;  2P0K A;  4C8Q F;  3CCS A;  2COY A;  2CH4 A;  3V7C A;  2VXF A;  4M77 A;  4WCI A;  3MEW A;  2RB6 A;  1Q7Y R;  2CKK A;  4AG1 C;  1AZE A;  1BYM A;  1TOV A;  4BI4 A;  3RMQ A;  4HT9 A;  2QDL A;  4DBQ A;  2O2O A;  4JLI A;  1ZUY A;  3RKW A;  2LVM A;  4QQD A;  2GFU A;  1QVG P;  3CC2 A;  2CZ1 B;  1AHJ B;  2EIF A;  1FX7 A;  3A5Z B;  3EG9 A;  1WQ7 A;  3CD6 T;  2PTK A;  2PUK B;  1KC8 U;  3CCR Q;  1S72 Q;  1KD1 U;  1MND A;  2KI7 A;  1WGS A;  4KRT A;  2L5Q A;  4HA8 A;  1XTD A;  4QVD A;  2KXD A;  1OQK A;  1ABO A;  1UGS B;  2WSF E;  1K0S A;  1JU5 C;  3LYI A;  5FRM A;  3UA6 A;  1PD0 A;  2FB7 A;  2MOX A;  2RF0 A;  4OMP A;  4PJO B;  4PNO A;  2RD1 A;  5IHK A;  3H0I A;  4B9W A;  1QVF S;  4C92 D;  1Z9Q A;  1M90 U;  3CBM A;  3J80 E;  2V8I A;  1VQO A;  2LCC A;  4JJC A;  3V7R A;  3N5B B;  5KYX A;  3TSW A;  4OMM A;  1GFC A;  1G2B A;  4PJO F;  2QGG A;  1W4S A;  3CCV A;  4ZN3 A;  1CKB A;  1YJN T;  4X9C A;  1UGQ B;  1AWX A;  4LN2 A;  2QA4 Q;  2V1R A;  4DOW A;  1YIJ T;  2RI2 A;  1VQL A;  3CCL A;  2LQ8 A;  4HXJ A;  2HD0 A;  2W10 A;  4HT8 A;  4PKC C;  1GBR A;  2LJ3 A;  4AT1 B;  4LUD A;  4M75 E;  1OZ2 A;  2KRN A;  4EMK C;  1YIT A;  2RJC A;  1GL5 A;  1VQ7 T;  2X51 A;  1W2B A;  1G3W A;  2YLB A;  4IKF A;  1QWE A;  1T0H A;  2KE9 A;  3THK A;  2ECZ A;  1J3T A;  2XG8 D;  1I07 A;  3OBW A;  4HVU A;  5KCO A;  1RL2 A;  2HKN A;  4BB7 A;  2V8J A;  4M77 D;  1M8M A;  4J83 A;  1RAE B;  3QZ5 B;  2EYW A;  3X24 B;  2DLP A;  5GAO p;  2DMO A;  2F5K A;  2QA4 T;  2AZS A;  2XD0 A;  5LJ3 f;  2L3P A;  4FT4 A;  2QEX A;  5IH2 A;  2DRM A;  2DTO A;  4HCC A;  2HQH A;  4FSS A;  4B9X A;  3PFS A;  2DYB A;  3OW2 A;  4IUT A;  5J3B A;  5FWB A;  1WXU A;  2K3Y A;  1U5S A;  1VQO T;  3CPW A;  2PU9 B;  1MUZ A;  3VS2 A;  1T3L A;  2LDM A;  1H3H A;  1C0M A;  3G71 A;  1HYO A;  5GAO m;  2E5Q A;  4MZT A;  2EJG A;  3CMA T;  1B34 A;  2LQW A;  5GMK j;  2K57 A;  3NTK A;  3NFC A;  1H64 1;  1X01 A;  1MHN A;  3CCL Q;  3HKS A;  1RAF B;  3OMG A;  5GAN 3;  4PK4 A;  2BE7 D;  5FRN A;  2LRQ A;  4F14 A;  4F7U A;  2XDB A;  1YIT Q;  3M0R A;  1I5L A;  5KYX B;  1X69 A;  2CSI A;  3ASK A;  2EYY A;  1VYT A;  3CD6 Q;  2RJE A;  4C0G A;  1M3A A;  2YUQ A;  5L23 A;  1WXB A;  1R0C B;  1YBY A;  1MMG A;  2A28 A;  3BDU A;  3FJP A;  2LQN A;  2OX7 A;  2RQR A;  4EMK B;  2PUO B;  4FW1 A;  3S3O A;  1BKB A;  2BIV A;  2DIQ A;  2H3J A;  4ZN1 A;  2RPN A;  3OMC A;  4CC7 A;  3QG1 A;  2SRC A;  1M2O A;  2PZ1 A;  3I5S A;  2ESW A;  1VQM T;  4J9F A;  4XAX B;  1M1G A;  1BBZ A;  3RER A;  3X25 B;  2EQU A;  1UG1 A;  2DVE A;  1Q81 R;  2LT1 A;  4CI0 C;  2FZK B;  1B3Q A;  1VQK A;  2CS7 A;  3I5R A;  6AT1 B;  5FU7 C;  4Z02 A;  2E12 A;  1NEB A;  2IIM A;  1M8V A;  1QP2 A;  2EPD A;  1GXI E;  2QAS A;  2ZPI B;  2FG0 A;  3VV0 A;  1ZA2 B;  2AK5 A;  3L2V A;  1WHH A;  3VRZ A;  2R58 A;  1RUW A;  1NG2 A;  3AT1 B;  2Y90 A;  4FL6 A;  3CCR T;  1S72 T;  1UGV A;  1GFD A;  2AKK A;  4DBR A;  3ZBD A;  3HRT A;  1EIF A;  4JRQ A;  2EKH A;  3EFO A;  2XU8 A;  1VQ9 T;  3CC7 Q;  3SB2 A;  4WF2 A;  2CP2 A;  2EYZ A;  2V8K A;  5GAO l;  1PHT A;  1B34 B;  3MJX A;  3PMI A;  4QW2 A;  4HCB A;  1YHQ T;  4M78 B;  3PGG A;  1YI2 A;  1VOM A;  1VQM Q;  1X75 C;  2JM9 A;  3RDV A;  4M75 C;  4OML A;  5FRO A;  3TSZ A;  4N4G A;  2ED1 A;  3DKM A;  2YSQ A;  2P84 A;  3VS7 A;  1OU9 A;  1WHK A;  2O01 E;  1I8F A;  3E19 A;  2GF7 A;  3QKJ A;  1YIT T;  2ABL A;  1SRL A;  4CC2 A;  4JS4 A;  3CCU T;  4ANJ A;  1VIE A;  1VQN A;  1W70 A;  2OTL Q;  3FIF A;  1QWF A;  4M78 F;  1XOV A;  1K73 U;  4OGE A;  4CC3 A;  1LOJ A;  3WVD B;  3CMA Q;  1YNZ A;  3GP8 A;  1VQ7 Q;  1KQ1 A;  2DXB A;  3CXC S;  1AVZ C;  1Y07 A;  2DA9 A;  4C0D B;  2XK0 A;  1G3S A;  2I2L A;  2AHJ B;  2K5I A;  2Z0W A;  2MAM A;  2R5A A;  4OB0 B;  2HDA A;  2OI3 A;  3S6W A;  1NLO C;  3GNG A;  5LJ5 f;  3DLL A;  2YT6 A;  3BDL A;  2DM1 A;  3LGL A;  5I11 A;  1PKS A;  2K3B A;  2RJD A;  1Y0M A;  1PRM C;  2QAZ A;  4XTX A;  3JCM f;  3IQL A;  1IB8 A;  1Z9Z A;  1IGU A;  4FIB A;  1K73 R;  1VQ5 A;  3MPU B;  2K6D A;  5GJW B;  3CPW P;  4IIO A;  4M7D C;  4F17 A;  1N9R A;  3EFO B;  2A3L A;  2DKG A;  2VGM A;  3FB9 A;  4M77 E;  2HBW A;  3CXC P;  5EC7 A;  5HK3 A;  4M7D E;  1WFW A;  5GAO q;  3A8G B;  1X6G A;  5CQX A;  1G83 A;  4OVA A;  3RR6 A;  1VUB A;  3NTI A;  3KFV A;  1FMW A;  3M57 A;  2DVJ A;  1YJW T;  2ZZD A;  1WX6 A;  3JCM e;  1VQN Q;  4MDW A;  4RG8 A;  1OX9 A;  3C4S A;  2MCN A;  1WHL A;  2FO0 A;  1QW1 A;  2YDL A;  4D8D A;  1KQS P;  3I55 Q;  4N4I A;  3QZ9 B;  2F2X A;  5FWC A;  1YI2 T;  1WIE A;  1QKW A;  2MPX C;  3G4S Q;  1NE8 A;  3KXT A;  3MHX A;  2JTF A;  4M75 D;  3CPW S;  1UE9 A;  1UJY A;  2CT4 A;  3VYH B;  4RTZ A;  9ATC B;  3KBG A;  3RMS A;  2EWN A;  3CME A;  1KG1 A;  3PE0 A;  1YJ9 Q;  4L6V 5;  3NTH A;  2KRM A;  3BW1 A;  1LCK A;  1VQ4 Q;  5GAN h;  4OF1 A;  5GJV B;  2A7Y A;  2KR3 A;  4OB3 B;  3EG0 A;  1H3Z A;  2KRS A;  3MET A;  4PL6 A;  1V1C A;  1PC0 A;  1JQQ A;  2HKQ B;  1M3C A;  3CC2 Q;  1BU1 A;  5A0L A;  5FLX E;  3E1S A;  3TEE A;  3QO3 A;  1WZO A;  3VRY A;  3CCE T;  2EKO A;  2EYQ A;  1WHM A;  2RI5 A;  5LJ5 h;  1UHF A;  1W2B S;  2CSQ A;  1VQ4 T;  1KJW A;  1WJR A;  4AFZ C;  4C92 F;  3H0H A;  2J06 A;  2DYI A;  2HMA A;  1SRM A;  4A53 A;  4L59 A;  2OAU A;  1SEM A;  1GCP A;  1X6B A;  5GAN 5;  1U8R A;  4J9B A;  1W6X A;  4R0K A;  4AFS C;  3L2Q A;  5LJ3 h;  2YXY A;  4OP0 A;  1VQK T;  1PRL C;  1M1F A;  2L89 A;  3G4S T;  2E10 A;  1I0C A;  1QP3 A;  3C95 A;  1KFZ A;  3FJ5 A;  3Q1J A;  2E64 A;  2GTO A;  1QVG A;  2ROL A;  3CPF A;  3RKY A;  5CQY A;  3CCM A;  3V8K A;  3EGD A;  1ARK A;  1YJ9 A;  2VAS A;  3G6E T;  3MEA A;  4QVZ A;  1ZBJ A;  2M16 A;  1B07 A;  2AKL A;  1OU8 A;  1UEB A;  3RBB B;  3RUX A;  2QA4 A;  5GAN j;  2ATC B;  1C1A A;  4XK8 E;  5LJ5 g;  4JRP A;  2D6F A;  3SWN C;  3FRN A;  4XTZ A;  3R6N A;  3OSS C;  3DLM A;  2PNI A;  1M30 A;  3M54 A;  2QG9 B;  4M7D A;  4M7A B;  1ZA1 B;  2LX7 A;  4FT2 A;  3OA6 A;  2JMC A;  4XU1 A;  4XQ3 A;  5C6S A;  2ZPB B;  3C94 A;  4DEY A;  1XNI A;  4RTY A;  5FW9 A;  1LVK A;  2EQM A;  1U1S A;  4HVW A;  3CCQ A;  4C5G A;  5L8R E;  2MWO A;  2LC4 A;  1ZSZ B;  2QEX T;  5AYF A;  3HRU A;  4XU2 A;  3EH1 A;  3EFS A;  4ZGD B;  2A0F B;  1BI3 A;  3MP8 A;  4IUP A;  2EVR A;  2H3E B;  2KQW A;  4PLL A;  4J6W A;  3NPF A;  2JUF A;  1TG0 A;  2E3H A;  2J6O A;  1TS9 A;  4C0D C;  4LNP A;  3EGD B;  2GGR A;  5GAN 2;  1YJW A;  4BUG A;  2NUP B;  4DEX A;  1UHC A;  2VYT A;  2CYZ B;  1T0J A;  2K4Y A;  2XDP A;  2CGH A;  3M0T A;  4KT0 E;  5D7U A;  3HHT B;  1AD5 A;  1TU0 B;  1BK2 A;  5M9O A;  4BD3 A;  5GAN 6;  5D6X A;  3PMT A;  3QXE B;  1EFN A;  3X20 B;  3MCA B;  1PG5 B;  1QVP A;  4KGV B;  3EG3 A;  2RHU A;  2P0P A;  2OTJ T;  3JB9 H;  4M7A F;  1KK7 A;  4JJB A;  4EMK A;  3CC4 T;  5CKF A;  4A4E A;  4DQ2 A;  1IGQ A;  3L2W A;  2L0A A;  4FYW B;  2COZ A;  5GAN g;  4O6J A;  4OMF B;  3BFM A;  2RMO A;  2HL3 A;  4AFQ C;  4M7A G;  3CCQ Q;  3CD6 A;  1KC8 C;  1QMC A;  2FRY A;  3QHS A;  4LD9 K;  1Q81 C;  1VQ8 T;  4KH0 B;  1YJN Q;  2GQI A;  3EG2 A;  2O31 A;  3UAT A;  2HQE A;  1MMD A;  3C0C A;  5GAN f;  5LJ5 d;  5C0M A;  4CRI A;  3I56 A;  1WYX A;  2FZG B;  2QGF B;  3KUF A;  2JTM A;  1RAH B;  2O4X B;  3QWX X;  2XHC A;  3H0F A;  4NL2 A;  4MZP A;  1PWT A;  3V8L A;  1Q81 U;  1HXD A;  1SHG A;  2D0N A;  2ENM A;  4E2F B;  5I21 A;  2XKO C;  3VUB A;  2D0Q B;  4M77 F;  3CCS Q;  3M55 A;  2A08 A;  2EW3 A;  4M7D D;  4NS5 A;  5FU6 B;  2X3X D;  4A63 B;  3ME9 A;  1M1K U;  3CC2 T;  1KSW A;  1QVF A;  1UGR B;  4JS5 A;  4X9D A;  2NUP A;  3S3M A;  4JJN K;  1BI2 A;  5GAM f;  3O8V A;  2JNG A;  1VQ6 A;  1I1J A;  3JSC A;  2CZ6 B;  4FYY B;  1CKA A;  1YFN A;  3G6E A;  4Z89 A;  3VYG A;  2QQA A;  3CEY A;  1FXX A;  4X34 A;  1PNJ A;  2KMT A;  3OS1 A;  4RTX A;  5CO7 A;  5DLO A;  2L8D A;  4D8K A;  3QYH B; 
#chains in the Genus database with same CATH homology
 2GCX A;  2R58 A;  2Y90 A;  3I55 T;  4FL6 A;  3CCR T;  1S72 T;  4LDX A;  3I55 A;  2QI2 A;  5HK0 A;  2QQS A;  3OS2 A;  3ZBD A;  1LNX A;  3HRT A;  3RIR A;  1EIF A;  1M5Q 1;  4RG2 A;  3JB9 J;  4JRQ A;  1YJN A;  3OSV A;  3OYH A;  3CCE A;  2XU8 A;  3URG A;  1VQ9 T;  3SB2 A;  3L42 A;  1NPR A;  3DB3 A;  5CAI A;  4WF2 A;  2X35 A;  3JCM X;  3OQ5 A;  5GAM g;  3LWH A;  3CCU A;  2V8K A;  5GAO l;  4M77 C;  4M7A E;  1B34 B;  3PMI A;  4QW2 A;  4M75 F;  4HCB A;  1O75 A;  4BE2 A;  3SFM A;  1BIA A;  4M78 B;  1YHQ T;  1YJ9 T;  3VUZ A;  2JZ2 A;  1Y96 A;  3M4Y A;  3PGG A;  4FU6 A;  1YI2 A;  2HQX A;  2DIG A;  2DXT A;  1WPY A;  4C92 B;  5LJ5 j;  4A54 A;  1X75 C;  2ZPH B;  3TU4 K;  5D6W A;  1D3B B;  1DJ7 B;  2KY9 A;  3ER0 A;  4M75 C;  2DXU A;  3PT9 A;  5CIU A;  4C92 E;  3PTA A;  3GF5 A;  3CCS T;  3CME T;  2MI6 A;  5FRO A;  4C0F A;  3G71 T;  1VQ8 A;  3MP6 A;  1ZQ1 A;  1OI1 A;  3CBO A;  3QBY A;  4N4G A;  3SDZ A;  4C8Q D;  3OYN A;  4M75 B;  5IN1 A;  4ELZ C;  3GOX A;  3DKM A;  2DD4 A;  4PJO A;  5EG2 A;  3JCM W;  2PVD B;  1ZBX A;  3FEO A;  3JB9 D;  2O01 E;  5GAM e;  3OYK A;  2JOY A;  2M1H A;  1I8F A;  5LJ3 e;  3E19 A;  2GF7 A;  3QKJ A;  4EMH A;  1KHC A;  5GAM h;  1YIT T;  1BI0 A;  3P8D A;  4C5I A;  4KUD K;  4JS4 A;  2Y4Y A;  2QTX A;  3CCU T;  4ELY C;  4ZTF A;  4M7D F;  4C0Z A;  5CK9 A;  1NJI U;  1VIE A;  1VQN A;  4OB2 B;  1Q7Y U;  4YTL A;  3LGF A;  4V2S A;  3FIF A;  3OYC A;  3OYM A;  3I56 T;  4C8Q B;  5GAN d;  4M78 F;  3HPW A;  4J6X A;  5DLQ E;  3UT1 A;  5IAY A;  1XOV A;  1K73 U;  4Y91 A;  2GQV A;  4JLG A;  4L5G A;  1U1T A;  2GFA A;  3CCL T;  3M56 A;  3QPH A;  1M9S A;  4OGE A;  1Q86 C;  3A8M B;  2OTL A;  1OYX A;  4M75 A;  4BAC A;  4M7D G;  3CCR A;  1S72 A;  1LOJ A;  3WVD B;  4A4F A;  4D6W A;  1G5V A;  3M53 A;  3GP8 A;  1KQ1 A;  4MMK A;  2B8A A;  2DXB A;  3CXC S;  1Y07 A;  2ZPE B;  4C0D B;  4IUQ A;  2XK0 A;  3OYE A;  1G3S A;  2DPP B;  2EQJ A;  2Y4X A;  3QYG B;  4E47 A;  3GPL A;  2ZPG B;  4ZGE B;  5CR2 A;  2I2L A;  2AHJ B;  2DTI A;  2K5I A;  2MAM A;  2R5A A;  4RCC A;  4OB0 B;  5I2S A;  3L2U A;  3CCJ T;  4E7L A;  2EQK A;  3S6W A;  4J7I A;  1RI0 A;  3GNG A;  5LJ5 f;  2CZ0 B;  2RM4 A;  2XDD A;  3DLL A;  3OW2 S;  3BDL A;  2QQ9 A;  5A2Q E;  3LGL A;  5I2M A;  5GMK i;  2DZC A;  5CVI A;  2RJD A;  4BY6 B;  5GAO n;  3MEV A;  1I4K 1;  4XTX A;  3JCM f;  3OYA A;  3LWI A;  1N8R C;  1KQS A;  3CBP A;  2DEQ A;  3MEU A;  4LDY A;  3OY9 A;  5GMK h;  4FIB A;  3OYY A;  1K9M U;  5J39 A;  1VQ5 A;  1TH7 A;  5CKE A;  2RK2 A;  1N8R U;  2YLC A;  4BI3 A;  4TVR A;  2ZPF B;  2WSC E;  2KDS A;  1PSF A;  4M7D C;  2RHY A;  4N4H A;  2D9T A;  1N6A A;  1N9R A;  2A3L A;  2DKG A;  2QDY B;  2VGM A;  2KAF A;  5LJ3 g;  1R8O B;  3EFR A;  5GAN 4;  2RHX A;  3FB9 A;  4M77 E;  4M78 C;  3JCM g;  1Y96 B;  4C8Q C;  1KQS S;  2DAQ A;  4E7J A;  5GMK l;  2HBP A;  3OS5 A;  4F7U G;  5HK3 A;  4M7D E;  3V7S A;  2MWP A;  5GAO q;  3A8G B;  3SWN B;  1O9S A;  5CQX A;  5HKC A;  3J7A F;  3SWN C;  4OVA A;  4XTY A;  2PVG B;  5LJ3 d;  3WVE B;  2KSS A;  5DM7 R;  1VUB A;  3NTI A;  3F70 A;  4N0A C;  3RKX A;  4BY6 C;  5GAM d;  1M1K C;  3QDR B;  3GLX A;  3M57 A;  4N0A A;  1VQ9 A;  2E41 A;  4J7F A;  1YJW T;  1YCY A;  3JB9 F;  4PJO D;  2ZZD A;  1VQL T;  2ZGW A;  3QJ6 A;  3JCM e;  2F69 A;  4F7U F;  1SSF A;  2DK3 A;  4MDW A;  5J26 A;  1LJO A;  1BIB A;  2WAC A;  4GY5 A;  4O5V A;  4RG8 A;  5GAN e;  3UPU A;  3L2R A;  3C4S A;  2X4Y A;  4E7I A;  3CXC A;  1I81 A;  4J5Y A;  1QW1 A;  2K2V A;  4LDU A;  2BUD A;  4N4I A;  3QZ9 B;  2LNV A;  2VGN A;  3G7Z A;  3C12 A;  2RH2 A;  1YI2 T;  2JN0 A;  5KE2 A;  1V29 B;  4Q5W A;  1VIF A;  5CCA A;  2G3R A;  1G3T A;  4C5E A;  4C92 C;  1G3Y A;  3FC3 A;  3QII A;  4C92 A;  2X4X A;  1Q86 U;  5LJ5 e;  2QQB A;  1NE8 A;  3KXT A;  4JRI A;  2QQR A;  3MHX A;  2MMP A;  2RI3 A;  2JTF A;  4M75 D;  3VU3 C;  3CPW S;  3HSB A;  4R56 A;  2C06 A;  3HFO A;  4J8O A;  1K8A C;  3LX7 A;  1XQH A;  3VYH B;  5A0G A;  3HFN A;  3GNF B;  3KBG A;  3M5A A;  2VXE A;  2EWN A;  2VV5 A;  3RMS A;  5GMK m;  2P0K A;  3CME A;  3L1A A;  4HKE A;  4E7K A;  2E70 A;  4C8Q F;  1VQM A;  3MO8 A;  4FSX A;  1KG1 A;  3CCS A;  1VQ4 A;  3SD4 A;  1VQP A;  4ME7 A;  2O4X A;  4L6V 5;  3NTH A;  3BW1 A;  3QSU A;  3V7C A;  2VXF A;  4M77 A;  3QJY A;  4BE1 A;  3JCM h;  2XIC A;  3MEW A;  2RB6 A;  2CKK A;  3BY7 A;  5GAN h;  4LD6 A;  4OF1 A;  1BYM A;  2A7Y A;  4OB3 B;  4BI4 A;  1H3Z A;  1JBM A;  3RMQ A;  1PSE A;  3MET A;  4HT9 A;  4M78 D;  4R55 A;  2LX9 A;  3E9G A;  3MP1 A;  4PL6 A;  3JCM V;  4PLI A;  4JLI A;  4KBM B;  1NPP A;  2WSE E;  5FLX E;  3E1S A;  3TEE A;  3QO3 A;  3RKW A;  2LVM A;  4QQD A;  5A0L A;  4EDU A;  3A8H B;  2GFU A;  4DA4 A;  2DTH A;  2L3R A;  2M9U A;  3CCE T;  2EKO A;  2EYQ A;  2RI5 A;  4F7U E;  5LJ5 h;  3X26 B;  4A4K A;  1W2B S;  1VQ4 T;  3CC2 A;  2CZ1 B;  3JAM E;  1AHJ B;  2EIF A;  5KE3 A;  1FX7 A;  1WJR A;  4PJO C;  4M7A D;  4C92 F;  1KHI A;  3A5Z B;  4IUU A;  3JB9 I;  1WQ7 A;  4DOV A;  3CD6 T;  2PUK B;  4M78 G;  1KC8 U;  4A53 A;  1JJ2 S;  5LJ3 j;  1K9M C;  1KD1 U;  4L59 A;  1NJI C;  5GAM j;  2EJ9 A;  2OAU A;  5IT9 E;  1VQ7 A;  3M59 A;  2LT4 A;  3CCQ T;  5GAN 5;  1U8R A;  1Y7X A;  1WGS A;  4BE0 A;  2L5Q A;  3L2Q A;  4HA8 A;  1XTD A;  3H6Z A;  5LJ3 h;  4QVD A;  4OP0 A;  3J81 E;  1VQK T;  3SWN A;  2JVV A;  3OS0 A;  1M1F A;  2L89 A;  3EAE A;  3G4S T;  2E10 A;  3INZ A;  1UGS B;  2WSF E;  4MZM A;  2DZ9 A;  3LYI A;  2OTJ A;  1N27 A;  5FRM A;  3V8J A;  1KQ2 A;  2P4T A;  2FB7 A;  4M7D B;  4C8Q E;  4M78 E;  3CC7 A;  4PJO B;  1QP3 A;  3C95 A;  4PNO A;  2RD1 A;  1K73 C;  2XI9 A;  3Q1J A;  2E64 A;  4B9W A;  1WNL A;  2ZCF B;  1QVG A;  1QVF S;  4C92 D;  3CPF A;  4PJO G;  1M90 U;  3CBM A;  1MGQ A;  5CQY A;  3RKY A;  3J80 E;  3CCM A;  3JCM P;  2V8I A;  3V8K A;  1VQO A;  2LCC A;  1VQN T;  3E9F A;  1YJ9 A;  1YHQ A;  3G6E T;  3MEA A;  3V7R A;  1Y71 A;  3N5B B;  2EFI A;  3OYL A;  2HAX A;  4QVZ A;  3OYJ A;  4QQ6 A;  2M16 A;  2BKD N;  1UEB A;  3RUX A;  4PJO F;  4KUL A;  2QA4 A;  5GAN j;  4XK8 E;  5LJ5 g;  1W4S A;  3CCV A;  4F7U B;  4ZN3 A;  1KD1 C;  4A4G A;  4JRP A;  1YJN T;  4JUV A;  2PQW A;  2D6F A;  4IUV A;  4XU3 A;  2DD5 A;  1UGQ B;  2XID A;  3FRN A;  4X9C A;  4XTZ A;  2FL7 A;  3OSS C;  2CZ7 B;  4JRK A;  4DOW A;  3DLM A;  4LDW A;  2RI2 A;  3M54 A;  1YIJ T;  1VQL A;  2EJF A;  3QUI A;  1N9S A;  3CCL A;  4M7A B;  2DJZ A;  4M7D A;  2LQ8 A;  2HD0 A;  2LTO A;  4HT8 A;  4FT2 A;  3OA6 A;  4NL3 A;  4XU1 A;  5GMK e;  3OYG A;  3P8B B;  2DO3 A;  4PKC C;  4XQ3 A;  5C6S A;  1JJ2 A;  2FHD A;  4M78 A;  3VJP A;  2LCL A;  2ZPB B;  3C94 A;  4QVC A;  3GIB A;  2NLU A;  4M75 E;  1OZ2 A;  1XNI A;  2RJF A;  4EMK C;  4KUI A;  2EQM A;  1Q82 C;  1YIT A;  1U1S A;  2P0Q A;  2RJC A;  3CCQ A;  1W2B A;  3M58 A;  1HK9 A;  4XTW A;  3X28 B;  3RES A;  4C5G A;  4VUB A;  5L8R E;  1WJS A;  2MWO A;  2LC4 A;  1G3W A;  2RK1 A;  2YLB A;  3OB9 A;  3CCJ A;  3S3N A;  1K8A U;  4IKF A;  2QEX T;  4E7H A;  2VUB A;  1M4Z A;  4GLK A;  5FU7 B;  4M7A A;  2DXC A;  3HRU A;  3LW5 E;  5AYF A;  3JCM b;  4XU2 A;  3UDC A;  2XG8 D;  2K5F A;  3OBW A;  3EFS A;  4HCZ A;  4OGC A;  5KCO A;  4ZGD B;  1JB0 E;  2OTL T;  1BI3 A;  3MP8 A;  4IUP A;  2KQW A;  4J6W A;  4PLL A;  1RL2 A;  3LLR A;  2JUF A;  4BB7 A;  4M75 G;  2V8J A;  4MML A;  4M77 D;  3OYI A;  4J83 A;  4C0D C;  4RCB A;  3QZ5 B;  3M4G A;  3X24 B;  5GAN 8;  5GAN 2;  2IG0 A;  4BUG A;  5GAO p;  1YJW A;  3M9Q A;  2K3X A;  2E1H A;  2F5K A;  5DY9 A;  2QA4 T;  3UWN A;  2XD0 A;  5LJ3 f;  4FT4 A;  3ZFJ A;  5GAO r;  1UGP B;  1WJQ A;  2VYT A;  2QEX A;  2CYZ B;  2E6N A;  4C8Q G;  2K4Y A;  2DTO A;  4HCC A;  2XDP A;  2CGH A;  2RA2 A;  3H8Z A;  3HL8 A;  4LDV A;  4PJO E;  1P92 A;  4B9X A;  4XTV A;  4KT0 E;  2K5L A;  3HHT B;  3PFS A;  3OW2 A;  3OBY A;  4II1 A;  4IUT A;  2QXF A;  5J3B A;  3CCM T;  3JCM J;  3R6O A;  2K3Y A;  5M9O A;  3T9N A;  4BD3 A;  5GAN 6;  3PIO A;  1VQO T;  3CPW A;  5D6X A;  2PU9 B;  1M90 C;  3PMT A;  2LDM A;  4M7A C;  3WXM B;  3QXE B;  2FYK A;  1VQ5 T;  3ZEH A;  3G71 A;  1VQP T;  1VQ7 T;  3X20 B;  4JDS A;  3MCA B;  5GAO m;  1QVP A;  2E65 A;  4M77 B;  2E5Q A;  2RHU A;  4MZT A;  2EJG A;  3CMA T;  1B34 A;  2P0P A;  5GMK j;  2K57 A;  3NTK A;  2OTJ T;  3NFC A;  1H64 1;  1X01 A;  1MHN A;  3JB9 H;  1UB4 A;  4M7A F;  3HKS A;  3PIP A;  4EMK A;  4MDX A;  3TCJ A;  3JCM Q;  3OMG A;  5GAN 3;  3JCM c;  4ZTJ A;  3CC4 T;  5CKF A;  4RMO A;  4A4E A;  2HNI A;  1VQ6 T;  4DQ2 A;  2KK4 A;  5FRN A;  4RKU E;  4C92 G;  2LRQ A;  5KCH A;  3L2W A;  1FWZ A;  4F7U A;  3AHU A;  5LL6 S;  1QVG S;  5GAN g;  4O6J A;  3BFM A;  4OMF B;  3FDR A;  4IUR A;  2XDB A;  2LQK A;  4EPC A;  4M7A G;  4J6Y A;  5A0D A;  3CD6 A;  1I5L A;  1KC8 C;  3QHS A;  3FLG A;  4LD9 K;  2IVW A;  4EMG A;  4ZGJ B;  3CMA A;  1Q81 C;  1VQ8 T;  3ASK A;  2R5M A;  2VC8 A;  4C5H A;  4OB1 B;  2YRV A;  1Q82 U;  2RO0 A;  1NZ9 A;  2RJE A;  2HQE A;  4C0G A;  3CC7 T;  5GAN f;  5LJ5 d;  5C0M A;  4CRI A;  2X4J A;  2PVO B;  5CKH A;  3I56 A;  3L2Z A;  1X6O A;  3KUF A;  2JTM A;  1YBY A;  3HRS A;  1Q7Y C;  3G4S A;  3BDU A;  4BDY A;  3CCV T;  2YHT A;  3FJP A;  2O4X B;  2XHC A;  1IRE B;  3VKI A;  5KH6 A;  4NL2 A;  4XU0 A;  1WQW A;  4MZP A;  4EMK B;  4C8Q A;  3V8L A;  2MF2 A;  4UC4 A;  1Q81 U;  1HXD A;  2PUO B;  2EAY A;  3S3O A;  4Y28 E;  5GAN 7;  3CC4 A;  1BKB A;  2BIV A;  5I21 A;  2XKO C;  2DIQ A;  3VUB A;  2H3J A;  4ZN1 A;  2D0Q B;  4M77 F;  3OMC A;  3HP9 A;  3JRZ A;  3M55 A;  3PNW C;  3QG1 A;  4M7D D;  5HY6 A;  3LH0 A;  4NS5 A;  1VQM T;  4QQG A;  4XAX B;  4A4H A;  1M1G A;  2X4W A;  5FU6 B;  1D3B A;  1YIJ A;  3ME9 A;  1M1K U;  3CC2 T;  3RER A;  3X25 B;  2EQU A;  4XTU A;  3P8H A;  2F5T X;  2KVQ G;  3A8L B;  2DVE A;  1QVF A;  1UGR B;  4M77 G;  1ZHI A;  2LT1 A;  4JS5 A;  4X9D A;  4CI0 C;  3OYB A;  5FU6 C;  3S3M A;  5CKD A;  4JJN K;  1BI2 A;  3A8O B;  5GAM f;  3DB4 A;  2M0O A;  3OYF A;  2CS7 A;  1VQK A;  3O8V A;  5FU7 C;  3JB9 G;  2JNG A;  4Z02 A;  3JCM d;  4FM4 B;  2E12 A;  3OYD A;  1VQ6 A;  1BI1 A;  1M8V A;  1QP2 A;  3JSC A;  4P5N A;  2CZ6 B;  1JRI A;  1OZ3 A;  5CKB A;  3G6E A;  1GXI E;  5D6Y A;  3VYG A;  2FVU A;  4BI8 B;  2RHI A;  2QQA A;  3CEY A;  2R57 A;  2RHZ A;  1IZ6 A;  2ZPI B;  3VV0 A;  1FXX A;  4X34 A;  3TRE A;  2KMT A;  4NOY A;  3OS1 A;  5CO7 A;  3L2V A;  5DLO A;  4BDZ A;  2L8D A;  2E6Z A;  4ATO A;  3QYH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...