5A0DA

N-terminal thioester domain of surface protein from clostridium perfringens, cys138ala mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
175
structure length
175
Chain Sequence
KYKGYTLLDKYPKEDDFRDAIYIEDMDNNDTSSVVYAFNVTKATPTFKGSVVKVLYNEQFGSSKLFTEKAIKPRVKGDELKNSVLRVIYNGYPSNALGIKEKYQLTEGQFRKLTQRAVWNFTDSNLSLDKLSQKEIDALNELINAKNAIPDNLVLNLYLPDDSYYQNLLGTKFVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SURFACE ANCHORED PROTEIN
publication title An internal thioester in a pathogen surface protein mediates covalent host binding.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Cell adhesion
total genus 58
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5a0dA01
5A0LA 2XIDA 4BUGA 4C0ZA 2XICA 5A0DA 5A0GA 2XI9A
chains in the Genus database with same CATH superfamily
2FPEA 2LNVA 4PJOD 4HXJA 1K8AC 1U06A 3QJ6A 3VS4A 3LWHA 1QKXA 3S6WA 2R5MA 1RLQC 3ZEHA 1MHNA 4AFZC 2CT3A 2EPDA 4ZNXA 2FVUA 3I56A 3RNJA 4E6RA 2QG9B 4BUGA 1QP3A 5EG2A 2CSIA 2ATCB 2CUDA 2QEXQ 3TSZA 1PRLC 1E7OA 2ED0A 2LT4A 4M78G 2CP5A 1IXDA 4C92C 2K5IA 4FCYA 5GAMh 2JMCA 1K73C 2K6DA 4AFQC 3C4SA 4M77G 3V7CA 3OYMA 2F5KA 1JJ2A 3CCQA 2VKNA 2R58A 2ZGWA 3CD6Q 3CMAT 1VQ8T 2G3RA 2K2MA 2HBPA 1RAAB 3R6OA 2L8DA 2RHIA 1OZ3A 3QXEB 3H9NA 2BIVA 5AT1B 4ZGJB 2DXBA 2FEIA 1VQ6T 4A4KA 2JXBA 9ATCB 1WHMA 5GAMd 2ESWA 1R0CB 3GNGA 2JTFA 1TUDA 2JMAA 1K9MR 4DEYA 2RB6A 1RAFB 1D0XA 2LQ8A 1RAHB 2LCLA 3SDZA 5CAIA 4CI0C 4EDUA 4ELYC 3CBOA 3CCRQ 1FMWA 3JCMg 1YJNQ 1VQ5A 5I21A 4GBQA 5GAOn 2LC4A 2HKNA 5AYFA 1D0ZA 4C8QA 5KYXB 1VQLQ 3LGLA 2P4TA 3BY7A 5LJ3e 2DTHA 3A8LB 4Z8AA 3TU4K 1H8KA 1VQ4A 2HSPA 2X4WA 1PCXA 2MOXA 1P92A 2RHYA 3QUIA 2EYZA 3V8JA 2MWOA 4XAXB 4BDZA 2E12A 4RCCA 3J81E 4JZ3A 5GANf 2HZYA 1GFCA 3EGDA 4Y91A 4HT8A 3CC7T 2JZ2A 5FWBA 2DILA 4M4ZA 1QCNA 2ZCFB 5J3BA 4KUIA 2K5LA 2E65A 2YUQA 3RUXA 1Y7XA 4ELZC 4M77B 2FZCB 2J06A 4M7DF 3EG2A 1NBEB 4HVWA 3MJXA 5KE3A 3QWXX 1BI2A 3MEAA 2LMJA 4PJOA 2VWFA 4PFPA 1NZ9A 2DZCA 2EKOA 3E19A 1WZOA 2F69A 3S3MA 1IB8A 2DL7A 3PE0A 2C0TA 3D7SB 5LJ5g 2JJ9A 1YFNA 2FO0A 4MZMA 3M55A 2O9SA 2W10A 3G4ST 3CCUT 2GFAA 4ZN3A 3CCLQ 2K3YA 2P4RA 4NOYA 3RR6A 2HD0A 5CO7A 4DA4A 2GQIA 2KDSA 4YTLA 3MO8A 1Y0MA 1VQMA 4FYXB 1W2BP 4XTYA 2K4YA 4F17A 2PVGB 3FB9A 3FDRA 2LJ0A 2FZKB 4LUEA 1V1CA 4XU1A 1S72Q 1N9RA 4RTYA 1D1CA 5GMKh 5GMKm 1EIFA 2PUKB 2GNCA 8ATCB 3RDVA 3NTKA 2ED1A 4AG1C 3SD4A 1K4US 2L5QA 4E7LA 4FT2A 4MMLA 4HVUA 2DYBA 2K2VA 2K57A 5M9OA 2EQMA 2ROLA 1OPLA 3VS7A 2A7YA 4R55A 3X26B 1UDLA 1Z9ZA 4GY5A 1K9MU 1NEBA 5CCAA 1X75C 1S1NA 1I4K1 1VQKT 2KQWA 5GAN3 5GAOp 4X9DA 4PL6A 3RMSA 1YI2A 2HSEB 3RKYA 1N9SA 2NYSA 1XJWB 2YLCA 2GF7A 3OYYA 3CPWS 4FT4A 3OMCA 4BE2A 2LJ1A 2HMAA 3FIFA 1MMNA 1QP2A 5D6WA 2XU8A 3EAEA 3GIBA 4XK8E 2DO3A 2AZSA 4QVZA 1JU5C 2DBMA 2Z0WA 3EFSA 2EFIA 4D8DA 3BW1A 4WF2A 3I56Q 3EFOB 1K9AA 1D1AA 3M0RA 2A08A 5KYXA 1ZA2B 2EYYA 4RMOA 3G1JA 1NLPC 1QVPA 2MYSA 5IHNA 3SFMA 4O6JA 3ULRB 3L42A 3R6NA 1LVKA 3I5RA 1IGQA 1K9MC 1M27C 2MAMA 2X4JA 2VYTA 3A8OB 2IG0A 3PMTA 4JRIA 1HYOA 5IXFA 4OF1A 3CCQQ 4Y28E 4M7AD 2OTLT 1BIAA 2M51A 2H3JA 2RPNA 1UGRB 4DOVA 1U8RA 1M90R 5CKHA 1ABQA 3A8MB 2CSQA 2L0AA 5LJ3g 5LJ5j 4JLGA 1E6GA 5KE2A 3JB9H 2HCKA 3OS5A 2QA4Q 1YHQT 4M77A 4M7DB 1VQ9A 4C92F 2EGAA 4JJBA 1KC8R 1ZHIA 2RJFA 1V29B 5FU6C 3URGA 1BB9A 3VUBA 1H3ZA 1HD3A 2GTOA 4WTOB 1UB4A 2CZ7B 4BI3A 3CCMA 2DBKA 1G3TA 3FRNA 4M7DD 3ZBDA 4XTVA 2DLPA 5IAYA 2DA9A 3OYEA 5IHIA 2F2WA 2BZYA 4KBMB 4JJNK 1VQ5Q 2RI2A 4JJCA 1TOVA 4M75E 3UT1A 3OS0A 3CCJA 1QWFA 1X2QA 4ME7A 1RADB 1BKBA 2YUNA 1X43A 3CBMA 1KJWA 2QA4T 1VQ4Q 1OX8A 4J9IA 1Q82U 2BZ8A 5C6SA 1AWOA 2JS0A 1JXOA 2KROA 1VQ7A 2GTJA 3JCMf 1ZSZC 4PFOA 4Z89A 5DY9A 4DBQA 1VYUA 3CCSA 3M54A 5D6XA 3TCJA 2EYWA 1IHVA 2X4YA 2E4HA 3HRTA 4M7AC 3A8HB 1M1GA 3LH5A 2VGMA 2H3EB 3UPUA 3CC2A 5CIUA 4BI4A 4J7IA 4RTWA 3JB9F 1R77A 2ZPFB 4E7ZA 2H8HA 4N0AC 4EMKC 2EBPA 2M0YA 2CREA 5GAN4 3TVTA 5KCOA 4L59A 5FRMA 4XU3A 1UTIA 1HSQA 2E6ZA 1AOJA 1NYFA 1LJOA 2ZPIB 1WGSA 4C0ZA 1NLOC 2I2LA 3CBPA 3META 3CPFA 2ENMA 1WFWA 1W6XA 4F7UE 1AWWA 4M75C 4KGXB 4PJOG 2X3WD 1WXBA 2V1RA 6AT1B 2RO0A 1C0MA 1WHHA 3EFOA 3LLRA 4JJDA 4NL2A 1T0HA 2GQVA 1VQMQ 2VGNA 1B34B 1WPYA 2CH4A 3INZA 5LJ5f 1WYXA 5LJ3j 2C0IA 3ZL7C 3X24B 4EPCA 1FWZA 1BCOA 4BD3A 2RHUA 3I55A 1UG1A 2EYXA 3OY9A 3QIIA 4DQ2A 2OJ2A 5IXBA 1G83A 2CP7A 4JPBW 1GBQA 1AT1B 3E1SA 2SRCA 2CP6A 3I5SA 1I1JA 3CPWP 1KC8U 3BFMA 3C12A 2CDTA 1UHCA 2L2PA 3HHTB 2GBQA 4A54A 3RERA 2OAUA 2P0KA 4R0KA 1J3TA 2GCXA 2KYBA 4C92B 3G6EA 4M7DA 5L23A 2K3BA 2CP0A 2HL5C 2XMFA 1ZLMA 2K3XA 1YI2Q 4C92D 4LDVA 3UDCA 2RQVA 3UA7A 3OYBA 1AVZC 3OYHA 1I07A 3CC4Q 1TUGB 1PD0A 1FMKA 5IH2A 1M90C 2V26A 5ECAA 1Q95G 2KT8A 1KD1R 2KR3A 2RHZA 3L2ZA 2RH2A 2RK1A 4QKUA 2VUBA 3TQ7P 2L89A 5I2SA 1NPPA 1TXQA 1M8VA 4D8KA 3EGXA 1KC8C 1Y71A 4C8QE 1JQQA 4RTTA 1VQNA 4OVAA 3CMEA 1M2VB 4RG8A 2HAXA 3KXTA 5GAN5 1YI2T 3OYKA 2DM1A 2BE9B 1YJWA 1C6VX 1RABB 2LT1A 4RTZA 3QYGB 3MCAB 3OYDA 1VIFA 3CXCA 1MGQA 2OTJT 4Q5WA 3CC4T 2NUTB 4QQDA 4KH0B 3EH1A 5GJVB 2O9VA 1AHJB 2E5QA 3HSBA 1WJQA 3L1AA 4LDUA 5GANd 1QVFS 1IO6A 2RI5A 1VQ9Q 4XTXA 4ZGEB 4EMGA 2KBTA 1EFNA 4RTVA 2DIGA 1BCMA 3CCMQ 1K0XA 3CPWA 2QI2A 2LNHB 2KRSA 1GXIE 7AT1B 3JB9D 2J6OA 2YXYA 4JUVA 2KEAA 3ER0A 1OV3A 1TWBA 5LJ3f 2RHXA 1YNZA 1R8OB 2KRNA 1WHKA 3ASKA 1YJ9T 3JSCA 2QYZA 2HQEA 1QW1A 4AMCA 3CCJQ 2QXFA 1BYMA 2DRMA 1TUCA 3M56A 3OS1A 4J9FA 3EGUA 3JV3A 1R0BG 3PFSA 4C8QC 2QGFB 3C94A 1VQ9T 1B34A 2RF0A 1YCSB 4IIMA 1Y96B 5GAN2 4C0GA 4ANJA 2D1XA 1M1KR 1Q86C 1VQ7Q 2DIQA 4HA8A 4ORZA 2JTMA 4BE0A 2EW3A 2FYKA 2QEXT 3EG0A 2Y90A 3CCEA 4LD6A 1ACMB 3OW2P 2EQUA 2MPXC 1VQPA 1N8RR 2FB7A 1O75A 3PIOA 1KHCA 3LX7A 3VU3C 1UECA 3CC2Q 4E2FB 1OQKA 3UA6A 3NTIA 3S3OA 2DVEA 4C92A 3CD6T 3QZ5B 2DD4A 1NJIR 2G6FX 4J83A 4DBFA 3MHXA 4LUDA 2RMOA 3VRYA 1F1BB 3G71A 4M7AF 2O01E 2L3QA 2K9GA 1KD1U 3CQTA 3DKMA 1OULA 1WQ7A 4PFZA 3MEWA 2K79A 4PLLA 2LVMA 3KBGA 3UWNA 2R57A 1UE9A 2E70A 2J7IA 2MWPA 2QQ9A 4A4EA 2C0OA 3CCVA 3OSVA 2NUZA 4EIKA 4IKFA 4XTUA 1VUBA 2D6FA 2JW4A 5KH6A 5I2MA 3MPUB 1N5ZA 2XHCA 3NHNA 3M0TA 1PWTA 3OBYA 3CCRT 4A53A 1YJNT 3V8KA 2JNGA 5I11A 2WACA 3C0CA 4IUPA 4JS5A 2DJQA 4FYYB 2EAYA 1VQLT 4TVRA 3SEMA 2DXUA 1M2VA 3I55Q 3HP9A 1CSKA 3NTHA 1VQOA 4M75F 2SEMA 3LW5E 3LH0A 2XIDA 2DL5A 1I0CA 2EYQA 3QDFA 1WXTA 2NUTA 3RIRA 1PG5B 4Z02A 1KD1C 4PKCC 1UEBA 4M78E 2CKKA 3FC3A 4FW1A 4J9CA 3G6EQ 4M7AG 3SB2A 4QVCA 3H0HA 2DPPB 4M77E 1IZ6A 2J05A 2XKOC 5FWCA 3L2QA 2QAZA 1XNIA 4DEXA 2PVDB 3OW2A 3MKDA 2R5AA 2WSCE 1EX4A 1G5VA 1G3WA 2B8AA 3AT1B 4HCCA 3VKIA 2FHDA 1M4ZA 4MZTA 4XU0A 3J80E 4JRPA 2BE7D 4M7DG 2QQSA 2KT1A 3HTRA 1T3LA 2MK5A 4FW2A 2DNUA 3JCMh 1GCQC 3F70A 2X3XD 2KVQG 4FYVB 1OYXA 4E7KA 3CXCS 3VS2A 2XICA 1QVFP 1OZ2A 3RKWA 2KRMA 1VQNQ 3CCLT 4NS5A 1M1FA 2NLUA 3CMEQ 2CZ6B 1Y96A 4IURA 1Q81R 1SEMA 2EGCA 2HNIA 4CC3A 5J26A 5IN1A 3QG1A 1N8RU 4F7UF 1W70A 2C06A 1YJWQ 1UHFA 2VASA 3HL8A 3SHWA 1FX7A 1PM3A 4RTXA 2M1HA 1FYNA 4J9GA 3QYHB 3DLLA 5J39A 1B07A 1UGSB 1WXUA 2YLBA 1S72T 1NJIU 3JCMd 1N6AA 5A0GA 5A0DA 3M0SA 4M78C 3FJ5A 2AZVA 2ECZA 1YIJA 1RLPC 1KQSA 1ZSZB 3OS2A 4M77C 3M57A 2DETA 3NMZC 1M1KC 4MDWA 3M4GA 4KT0E 4JZ4A 4M7AB 5GAMe 2K5FA 1GFDA 3P8DA 2DAQA 5GAN7 5LJ5h 1M30A 2JUFA 2EQJA 4EMKB 1N8RC 1WDXA 5KYYB 3VUZA 4CC2A 1FXXA 2X51A 2I0NA 1YCYA 2JM8A 1M8MA 2A36A 3EFRA 1BIBA 2EWNA 1JEGA 2M16A 1NJIC 1QCFA 4PLIA 2HDAA 3M0QA 3JCMX 3TEEA 3HFNA 4OGCA 3I56T 1QLYA 2DTOA 2PVOB 3VS5A 5I22A 3CMAA 1VQ8A 5GAOq 2OX7A 4KH1B 3VV0A 2ABLA 3CCEQ 4BY6B 5FROA 3V8LA 5LJ5d 3GF5A 1ZBXA 4UC4A 3WXMB 3H8ZA 3Q1JA 2X4XA 3GBQA 1QVFA 1RUWA 4C8QF 1VQPQ 1XOVA 4M75D 2M9UA 3M9QA 1VQ6A 3QJYA 3CCQT 4N4GA 1M2OA 3UATA 1QCOA 2KMTA 2LQNA 4RG2A 3PTAA 4E7SA 2FRYA 1PKSA 1U1SA 4OMLA 1Z9QA 4JS4A 1KIKA 1G3SA 1KG1A 1M3CA 1AWXA 3M4YA 1GL5A 3L2WA 4V2SA 3IQLA 8AT1B 2XDBA 1D0YA 1SG5A 4FL6A 3QO3A 1U5SA 2PU9B 2DYIA 4BDYA 1SSFA 1QMCA 2XK0A 1MMAA 2DMOA 3NFCA 4C0DC 3P8BB 1X69A 2DF6A 3GLXA 2LDMA 4JDSA 4C92G 3CCVQ 1WX6A 1EZZB 4ZN1A 4BI8B 1I81A 3QPHA 2CYZB 4LN2A 2DVJA 2V8KA 2ZPHB 2FZGB 1Q81U 1B3QA 1BU1A 5FU7C 1OEBA 1AEYA 4BACA 2VXFA 2CUBA 2GGRA 1VQ5T 1BI1A 1Q7YR 2LP5A 3JCMP 3CC7A 1WJRA 1G3YA 1VIEA 4LXCA 2BZXA 1VQOQ 1UFFA 3I9QA 1QVGA 3MP6A 1VQ4T 4F7UB 1W1FA 1GBRA 1Q86R 2DEQA 3H0IA 4PJNA 3OW2S 4IUVA 3H41A 2RJCA 1X01A 4J9DA 1O9SA 3SWNC 4HVVA 3T9NA 2YSQA 4FIBA 3VYHB 1UUEA 1G2BA 4J6XA 2GFUA 3VS1A 2JN0A 1ZSZA 1RI0A 2YHTA 3EG1A 1K1ZA 3CXCP 2DL8A 4OMPA 2CP2A 1Q81C 2F2XA 2PTKA 1ZUKA 3G4SA 1JB0E 5CKBA 4RCBA 2JOYA 3CCUA 1SRLA 2E3HA 3JCMc 5FLXE 4M7AA 2LRQA 5GMKe 2PZ1A 5CQXA 3NPFA 1M90U 1SKUB 1HJDA 1IRXA 4LE9A 3QDRB 1OPKA 1W4SA 4N0AA 4EMKA 3JB9G 1WQWA 5L8RE 5KYYA 2LZ6B 1RAGB 2DZ9A 3RBBB 1WA7A 5LJ3d 1TSFA 1X2KA 1JRIA 1WJSA 1H92A 3GNFB 1IGUA 2J6KA 4OMFB 1OX9A 4R56A 3AHUA 3EHRA 1BI0A 5GAMg 3C95A 5GMKi 5FRNA 1KQSS 2RJEA 1VQMT 2D9TA 3JCMb 3J7AF 2COZA 2KGTA 3M0UA 4WCIA 1DJ7B 2EQKA 2CP3A 4PJJA 5GAOm 3RKXA 3PT9A 4F04B 4B9WA 4KUDK 2P84A 3QWYA 4X9CA 1JBMA 1VQKA 4J9BA 2EVRA 1VYTA 2RQTA 1D3BB 2IIMA 3H0FA 1YIJQ 3DB4A 4C5IA 4O5VA 3M59A 4C8QD 5GANh 5C0MA 4IUTA 3V7RA 2O4XB 4XU2A 4JRQA 1UGQB 2YDLA 5HKCA 3TREA 1M5Q1 2P0QA 2LCSA 3OYGA 4M78F 2FG0A 2CT4A 1YJ9Q 3OYLA 2KXCA 2L3SA 1ZQ1A 1WI7A 1ZUYA 3O8VA 4M77F 1M9SA 4OB1B 4BE1A 2YRDA 1Q7YU 4A4HA 2PUOB 1IREB 2FL7A 2LJ3A 4GLMA 3KUFA 4J6YA 1YIJT 1Q86U 3L2VA 3HRSA 3OYIA 4RUGA 2OTLA 2X9HA 4J5YA 1WIEA 3CMAQ 1VQ8Q 2RM4A 4PJOE 2FPDA 4RKUE 4F7UA 2YUOA 4F14A 3ME9A 1AZEA 3QKJA 1VA7A 2CZ0B 1YHQA 2M0OA 3QHSA 4KGZB 2AT1B 1D09B 3JCMV 4JRKA 3FJPA 4FYWB 1VQ6Q 2PNIA 3N5BB 4J6WA 2D8HA 3V7SA 1MV0B 2KAFA 2RI3A 4A4FA 2LQWA 4Z88A 2EKHA 3PNWC 4BB7A 4HCBA 2XDDA 1NEGA 2ZAEA 1Q7YC 1LNXA 2HKQB 4QQGA 1AD5A 5LL6S 2KYMA 2LX7A 2W0ZA 4N4IA 1ABOA 5EC7A 4HCZA 2O2OA 1VOMA 3CCMT 5GAMj 3A8GB 4OP0A 4QW2A 2DEUA 1MV3A 2YWWA 1ZBJA 3CCSQ 4AT1B 2XG8D 1QVGS 2XI9A 2CH4W 2QA4A 4OB2B 4ESRA 3A5ZB 2EJ9A 3JB9I 3VS6A 1OOTA 3RMQA 2MF2A 2DX1A 2VXEA 4NL3A 4HT9A 3PMIA 3ZFJA 3CCJT 3A1PA 1QWEA 3E9GA 5GAOr 1N27A 1CKBA 1YITA 3CC7Q 2X35A 2QK0A 2RQUA 2NWMA 2KE9A 4II1A 4FSSA 4PJOC 2YUPA 3GPLA 1GCPA 4ATOA 2HEQA 2FRWA 5D7UA 4OB0B 4J9EA 3OA6A 2F5TX 1VQ7T 2AHJB 2RN8A 4OMMA 2LX9A 1MMGA 2LCCA 3CCST 1PNJA 1X6OA 1D3BA 2NUPB 3OYCA 3S3NA 2J6FA 4E7IA 4J8OA 1PKTA 4QT7A 1YWPA 3CC2T 1H641 2EQIA 2VB6A 1RACB 2DXCA 2O4XA 1SRMA 4L5GA 3X20B 3G4SQ 3JCMW 4C5HA 2JT4A 1SF9A 3CCUQ 4E7JA 2Y4XA 2MI6A 3VS3A 2EJGA 4M78B 1KQSP 4F16A 4D6WA 1TS9A 4AFUC 4KRTA 4MMKA 5GMKl 4LDWA 4J7FA 1SSHA 4MZPA 1HXDA 1WNLA 2DRKA 4DBRA 4M78D 3X25B 3CEYA 2KXDA 4ZGDB 4PJMA 4M77D 2A0FB 4XTZA 1TTHB 5GAN8 2E41A 5DLOA 1CKAA 2IPOB 3O5ZA 1H3HA 3PIPA 2HQHA 1UGVA 2RQRA 2EIFA 2CS7A 3KFVA 3OYJA 2E1HA 4B9XA 2HL3A 3PVLA 1ZSGA 2ZPEB 3OYFA 4EMHA 4FSXA 3FLGA 1NYGA 5GJWB 3I55T 2HBWA 3OB9A 1U3OA 1VQKQ 5FU6B 2COYA 4C5GA 5GAMf 3JCMQ 2MMPA 2RJDA 2P0PA 1PRMC 1MNDA 4N4HA 2YRCA 5GANe 2DD5A 3A98A 3OYAA 2D0NA 2QTVA 3U23A 1M1KU 2L3RA 2EJFA 4KULA 2XDPA 4M75G 5KYWB 3L2UA 3G6ET 1Q82R 3THKA 1WHLA 2DL4A 3MEUA 1K0SA 1MMDA 3VRZA 2AKKA 2QQRA 4FU6A 5GMKj 1RAIB 3H6ZA 3OYNA 1SHGA 1GRIA 3M5AA 2MCNA 1ARKA 3P8HA 2QDYB 3M58A 1MUZA 5CQYA 2ROTA 1B7TA 1T3SA 3E2UA 5DLQE 4E7HA 2RK2A 4C0DB 2OTLQ 2QQAA 1IHWA 1Y57A 1PSFA 1QKWA 1M3BA 1D1BA 2V1QA 2OTJA 3CC4A 1VQNT 5FW9A 1WHGA 2F1LA 1OU8A 4Y92A 3CMET 5DM7R 4AFSC 1GCQA 3DLMA 2ZPBB 2D0QB 1YHQQ 4DBHA 4LDXA 3GOXA 5FU7B 1JJ2S 2ZZDA 1PSEA 1ZX6A 1X6GA 1YJWT 2WSEE 1KQ2A 2E3IA 1E6HA 4VUBA 1QVGP 4P5NA 1NG2A 2DE0X 2RA2A 3WVDB 2NUPA 5GAN6 1HK9A 2DXTA 4CRIA 3JCMJ 3PVQA 1AZGB 2LQKA 2AKLA 1JXMA 4GLKA 4F7UG 1OI1A 1SPKA 4L6V5 1NE8A 4IUQA 1YJ9A 4MDXA 2DKGA 3E9FA 1TH7A 3SWNB 2PQWA 1SHFA 2COWA 2AIRB 4M7AE 4M78A 1W2BA 1G8XA 3M0PA 4M75B 3X28B 4FM4B 2ZPGB 1RL2A 1AWJA 5KYUB 4CC4B 4X1VA 1LCKA 1T0JA 1LPLA 2YT6A 2EGEA 2QASA 2L3PA 1I5OB 1BK2A 2KNBB 2VVKA 1RI9A 2QEXA 2F2VA 2BTTA 4IUUA 3HFOA 4IIOA 3TSWA 2RQWA 4M7DE 3VS0A 1YITQ 2LTOA 2BUDA 3NGPA 4AG2C 1UJYA 3BE3A 2DJZA 3G71Q 2YRVA 3PGGA 3JAME 4RTUA 4C0FA 3MP8A 2O31A 1K8AR 4PK4A 5CKDA 1JO8A 1KFZA 4XTWA 3CD6A 1BI3A 1KQ1A 5D6YA 3OMGA 3EGXB 4PNOA 4OMOA 1LOJA 3REAB 5KYNA 2KK4A 4ZTJA 3CCET 3EG9B 3JRZA 4K11A 4B6MA 5IT9E 3REBB 3MEVA 3HRUA 1FMVA 2QDLA 1M3AA 5KCHA 2CGHA 4ZTFA 1VQPT 4LD9K 4PJOF 3LWIA 1NM7A 4OMNA 5HK0A 5KYWA 2DK3A 4C5EA 1A0NB 1MNEA 4OMQA 2V8JA 4OB3B 5IHKA 1YITT 1K73R 1U1TA 4C8QG 3VJPA 5HCKA 3HKSA 4CC7A 3G71T 4LNPA 3EH2A 2WSFE 3CCRA 2RD1A 1YJNA 3OQ5A 2KI7A 5GANg 1XQHA 3FEOA 2JS2A 2OAWA 1VQLA 1VYVA 2A3LA 2HQXA 3CCVT 1RAEB 5A0LA 5LJ3h 2Y4YA 4KGVB 3BDLA 3VYGA 1Q82C 4M7DC 1PHTA 1YN8A 2QQBA 1ZUUA 3BDUA 1PC0A 2K7AA 4DOWA 2IVWA 5HY6A 2AK5A 2KSSA 4A4GA 5CK9A 2KY9A 5A2QE 2DERA 3DB3A 5GAOl 4QVDA 1YBYA 1VQOT 4A63B 2D8JA 4BY6C 5CKFA 1NPRA 1I5LA 1I8FA 3JCMe 4LDYA 1X27A 2DL3A 1Y07A 2QGGA 1K76A 3LYIA 4E47A 1PD1A 4PJLA 1C1AA 2DTIA 1KSWA 3G7ZA 1OU9A 2O88A 3QSUA 2MIOA 4JLIA 1WLPB 3QBYA 2RNAA 3RESA 3EG3A 2VC8A 3SWNA 3MP1A 2FPFA 1TG0A 4QQ6A 2CZ1B 2JTEA 4OGEA 1UJ0A 2E10A 2BKDN 4M75A 2XD0A 2OI3A 2QTXA 5KYUA 3CCLA 2E6NA 1JJ2P 1KK7A 4C8QB 2JVVA 5CKEA 1QQJA 1YWOA 2VV5A 1YP5A 2JM9A 2B86A 3WVEB 1TU0B 1UGPB 1K8AU 1BBZA 2E5KA 4C92E 4HCKA 5CVIA 2OTJQ 2E64A 4J9HA 4XQ3A 1S72A 3L2RA 3JB9J 1X6BA 3EGDB 4HKEA 3M53A 1V76A 1KHIA 2V8IA 3I35A 4X34A 5LJ5e 3EHQA 5HK3A 3EG9A 1W2BS 3UF4A 5CR2A 3LGFA 1ZA1B 1K73U 4PJOB 5GANj 3QZ9B 1WHJA 2A28A 3GP8A 2DFUA 3OSSC 2M02A 3HPWA 3OBWA 2A37A 1XTDA
chains in the Genus database with same CATH topology
4L5GA 3X20B 4XU3A 3JCMW 4C5HA 4M7AB 5GAMe 4E7JA 2E6ZA 2K5FA 2LNVA 4PJOD 2Y4XA 2MI6A 2EJGA 1LJOA 4M78B 2ZPIB 3P8DA 1WGSA 1K8AC 4C0ZA 2DAQA 3QJ6A 3LWHA 2I2LA 3CBPA 3META 5GAN7 4IKFA 3CPFA 3S6WA 5LJ5h 4D6WA 2JUFA 2EQJA 2R5MA 4MMKA 3ZEHA 5GMKl 4LDWA 4EMKB 1MHNA 4J7FA 4F7UE 1N8RC 3VUZA 4MZPA 1HXDA 1WNLA 1FXXA 4M75C 4M78D 4PJOG 3X25B 3CEYA 1YCYA 2FVUA 3I56A 3EFRA 2RO0A 1BIBA 2EWNA 3LLRA 4NL2A 4ZGDB 2GQVA 2M16A 4BUGA 2VGNA 1B34B 4M77D 1NJIC 1QP3A 4PLIA 5EG2A 3JCMX 1WPYA 3INZA 4XTZA 5LJ5f 5GAN8 2E41A 3TEEA 5LJ3j 5DLOA 3HFNA 4OGCA 2LT4A 3I56T 4M78G 3X24B 3PIPA 2DTOA 4EPCA 1FWZA 2PVOB 2EIFA 4BD3A 4C92C 2RHUA 2K5IA 3I55A 3OY9A 5GAMh 3QIIA 4DQ2A 3CMAA 2CS7A 1VQ8A 3OYJA 2E1HA 4B9XA 5GAOq 1K73C 3C4SA 4M77G 3V7CA 3VV0A 3OYMA 2F5KA 1JJ2A 4BY6B 2ZPEB 5FROA 3V8LA 3OYFA 3CCQA 3E1SA 5LJ5d 3GF5A 4EMHA 2R58A 4FSXA 3FLGA 1ZBXA 4UC4A 3WXMB 3H8ZA 3Q1JA 3I55T 1KC8U 2ZGWA 2X4XA 3CMAT 3BFMA 3OB9A 3C12A 1VQ8T 1QVFA 2G3RA 4C8QF 3HHTB 1XOVA 2HBPA 4A54A 3RERA 4M75D 2M9UA 3M9QA 3R6OA 2L8DA 3QJYA 2RHIA 5FU6B 4C5GA 4N4GA 5GAMf 3JCMQ 3CCQT 2OAUA 1OZ3A 2MMPA 2P0KA 2P0PA 2RJDA 3QXEB 4N4HA 2KMTA 2GCXA 4C92B 5GANe 3G6EA 2BIVA 2DD5A 4RG2A 4M7DA 3PTAA 4ZGJB 3OYAA 1M1KU 2DXBA 2L3RA 1U1SA 4JS4A 1VQ6T 4A4KA 2EJFA 1VQ6A 4KULA 2XDPA 1G3SA 4M75G 1KG1A 2K3XA 3L2UA 3G6ET 3M4YA 5GAMd 4C92D 3GNGA 2JTFA 4LDVA 3UDCA 3L2WA 4V2SA 2RB6A 2XDBA 3OYBA 3MEUA 4FL6A 3QO3A 3OYHA 2LQ8A 2LCLA 3SDZA 5CAIA 2PU9B 4CI0C 4BDYA 1SSFA 2XK0A 3NFCA 4C0DC 4EDUA 3P8BB 4ELYC 2QQRA 4FU6A 5GMKj 3GLXA 2LDMA 4JDSA 3H6ZA 3CBOA 4C92G 3JCMg 3OYNA 1M90C 4ZN1A 4BI8B 1VQ5A 1I81A 2RHZA 5I21A 3QPHA 3L2ZA 2CYZB 2RH2A 2RK1A 3M5AA 2V8KA 2VUBA 2ZPHB 2L89A 3P8HA 2LC4A 5I2SA 5GAOn 1NPPA 5AYFA 4C8QA 2QDYB 1Q81U 1M8VA 3LGLA 3M58A 2P4TA 1KC8C 3BY7A 5CQYA 1Y71A 5LJ3e 2DTHA 3A8LB 5FU7C 4BACA 2VXFA 4C8QE 3TU4K 1VQ5T 1VQ4A 1VQNA 1BI1A 2X4WA 5DLQE 4E7HA 2RK2A 4OVAA 3CMEA 4C0DB 1P92A 2RHYA 3QUIA 3V8JA 3JCMP 2MWOA 4RG8A 4XAXB 2HAXA 2QQAA 3CC7A 1PSFA 1WJRA 1G3YA 1VIEA 3KXTA 4BDZA 3HSBA 2E12A 4RCCA 5GAN5 3J81E 2OTJA 1QVGA 3CC4A 3MP6A 1VQ4T 4F7UB 1YI2T 1VQNT 5GANf 3OYKA 1YJWA 2DEQA 3CMET 5DM7R 2LT1A 4Y91A 4HT8A 3DLMA 2ZPBB 3QYGB 2D0QB 3MCAB 3OYDA 1VIFA 3OW2S 3CC7T 3CXCA 4LDXA 1MGQA 3GOXA 2JZ2A 5FU7B 1JJ2S 2OTJT 4Q5WA 3CC4T 4IUVA 2RJCA 2ZCFB 2ZZDA 1X01A 5J3BA 1O9SA 4QQDA 3SWNC 4KUIA 2K5LA 2E65A 3T9NA 1PSEA 1YJWT 4FIBA 2WSEE 1AHJB 3RUXA 1Y7XA 2E5QA 4ELZC 1KQ2A 1WJQA 3L1AA 4LDUA 3VYHB 4M77B 4VUBA 5GANd 1QVFS 4J6XA 2RI5A 4P5NA 4M7DF 2RA2A 5KE3A 4XTXA 3WVDB 2GFUA 4ZGEB 5GAN6 1HK9A 2DXTA 1BI2A 2JN0A 4CRIA 3JCMJ 1RI0A 2LQKA 3MEAA 2YHTA 4EMGA 4GLKA 4F7UG 2DIGA 4PJOA 1OI1A 1NZ9A 2DZCA 2EKOA 3CPWA 1Q81C 2QI2A 3E19A 1GXIE 4L6V5 2F69A 1NE8A 4IUQA 1YJ9A 3S3MA 2DKGA 3G4SA 1JB0E 3JB9D 5CKBA 4RCBA 4MDXA 2JOYA 1TH7A 3E9FA 4JUVA 3SWNB 3CCUA 3ER0A 3JCMc 5FLXE 2PQWA 4M7AA 2LRQA 5LJ3f 5GMKe 2RHXA 5CQXA 5LJ5g 1R8OB 4M7AE 4M78A 1W2BA 1M90U 4MZMA 4M75B 3ASKA 4FM4B 3M55A 3X28B 1YJ9T 3QDRB 3G4ST 3JSCA 2ZPGB 3CCUT 1W4SA 2GFAA 1RL2A 2HQEA 1QW1A 4ZN3A 4N0AA 4EMKA 3JB9G 1WQWA 5L8RE 2DZ9A 2K3YA 2QXFA 1BYMA 5LJ3d 4NOYA 2HD0A 5CO7A 3M56A 4DA4A 3OS1A 2KDSA 4YTLA 1JRIA 1WJSA 3MO8A 3PFSA 1VQMA 4C8QC 3C94A 3GNFB 4XTYA 1B34A 4OMFB 4R56A 1VQ9T 2K4YA 3AHUA 2QEXA 1Y96B 2PVGB 4C0GA 5GAN2 4IUUA 3HFOA 1BI0A 5GAMg 1VQ7T 4M7DE 3C95A 5GMKi 2LTOA 3FB9A 3FDRA 1Q86C 5FRNA 1KQSS 2RJEA 1VQMT 2D9TA 2BUDA 2DIQA 3JCMb 4HA8A 3CD6T 3J7AF 4XU1A 1N9RA 2DJZA 4BE0A 2JTMA 2YRVA 2FYKA 3PGGA 5GMKh 5GMKm 3JAME 2QEXT 2Y90A 1DJ7B 2EQKA 1EIFA 5GAOm 3CCEA 2PUKB 3MP8A 3RKXA 4C0FA 5CKDA 4LD6A 4XTWA 3PT9A 3NTKA 4B9WA 4KUDK 2EQUA 3CD6A 1BI3A 3SD4A 1KQ1A 5D6YA 1VQPA 3OMGA 2FB7A 2L5QA 1O75A 4PNOA 4E7LA 4FT2A 4MMLA 1LOJA 3PIOA 4X9CA 2K57A 2K2VA 2KK4A 4ZTJA 5M9OA 3CCET 1JBMA 1VQKA 2EQMA 1KHCA 3LX7A 3JRZA 3VU3C 5IT9E 2A7YA 3MEVA 4R55A 3X26B 1D3BB 3DB4A 4C5IA 3HRUA 3NTIA 4GY5A 2DVEA 4O5VA 4C92A 3S3OA 3M59A 1K9MU 5KCHA 2CGHA 3QZ5B 5CCAA 4C8QD 1X75C 2DD4A 4ZTFA 1VQPT 4J83A 4LD9K 3MHXA 5GANh 1I4K1 4PJOF 3LWIA 1VQKT 2KQWA 5HK0A 5GAN3 5GAOp 5C0MA 4IUTA 4X9DA 3V7RA 2DK3A 2O4XB 4PL6A 3RMSA 4C5EA 1YI2A 3G71A 3RKYA 1N9SA 4XU2A 2YLCA 4JRQA 1UGQB 2V8JA 2GF7A 5HKCA 2O01E 3TREA 4M7AF 3OYYA 4OB3B 3CPWS 4FT4A 1YITT 1KD1U 1U1TA 4C8QG 1M5Q1 3OMCA 2P0QA 3DKMA 3VJPA 1WQ7A 3OYGA 4BE2A 4M78F 3HKSA 3MEWA 3OYLA 3FIFA 4PLLA 3G71T 1QP2A 1ZQ1A 5D6WA 2LVMA 3KBGA 2WSFE 2R57A 3UWNA 2E70A 2XU8A 3EAEA 2MWPA 3CCRA 3O8VA 4XK8E 2QQ9A 4M77F 4A4EA 1M9SA 3OSVA 3CCVA 3GIBA 4OB1B 5KCOA 4BE1A 2DO3A 2RD1A 1YJNA 4XTUA 1VUBA 3OQ5A 5GANg 4QVZA 5KH6A 1Q7YU 5I2MA 2D6FA 4A4HA 1XQHA 3EFSA 2EFIA 3FEOA 2XHCA 3BW1A 4WF2A 2PUOB 1IREB 2FL7A 1VQLA 3OBYA 2A3LA 2HQXA 3CCRT 3KUFA 3CCVT 4RMOA 4A53A 1YJNT 3V8KA 4J6YA 5A0LA 1QVPA 1YIJT 5LJ3h 1Q86U 2JNGA 2Y4YA 3L2VA 2WACA 3BDLA 3HRSA 4IUPA 4JS5A 3SFMA 4O6JA 3OYIA 3L42A 2EAYA 2OTLA 3VYGA 1VQLT 4TVRA 1Q82C 4M7DC 4J5YA 2DXUA 2QQBA 3BDUA 1K9MC 2MAMA 3HP9A 3NTHA 2IVWA 2X4JA 5HY6A 4DOWA 1VQOA 2KSSA 2RM4A 2VYTA 2IG0A 3A8OB 4A4GA 4PJOE 3PMTA 4JRIA 4RKUE 4M75F 4F7UA 5CK9A 2KY9A 5A2QE 3ME9A 4OF1A 4Y28E 4M7AD 2OTLT 3DB3A 3LW5E 1BIAA 3QKJA 3LH0A 2CZ0B 2XIDA 1YHQA 5GAOl 2M0OA 4QVDA 3QHSA 1YBYA 2H3JA 2EYQA 1VQOT 1UGRB 4BY6C 4DOVA 1U8RA 5CKFA 3JCMV 3RIRA 1NPRA 4JRKA 5CKHA 4Z02A 3A8MB 1KD1C 3FJPA 4PKCC 1I5LA 1UEBA 3N5BB 4M78E 4J6WA 2CKKA 5LJ3g 5LJ5j 1I8FA 4JLGA 5KE2A 3JCMe 3FC3A 3JB9H 3OS5A 3V7SA 2KAFA 4LDYA 2RI3A 4M77A 1YHQT 4M7DB 1VQ9A 4M7AG 4C92F 4A4FA 3SB2A 4QVCA 1ZHIA 1Y07A 1V29B 2DPPB 2RJFA 5FU6C 3LYIA 1IZ6A 4M77E 3URGA 3VUBA 2XKOC 4E47A 1H3ZA 3PNWC 4L59A 4BB7A 4HCBA 2XDDA 1Q7YC 3L2QA 1LNXA 1UB4A 2DTIA 2CZ7B 1XNIA 4BI3A 4QQGA 3G7ZA 3CCMA 1G3TA 3FRNA 3QSUA 4M7DD 2PVDB 3ZBDA 4XTVA 3OW2A 5LL6S 4JLIA 3QBYA 2R5AA 2WSCE 3RESA 4N4IA 5IAYA 1G5VA 1G3WA 2B8AA 2VC8A 3MP1A 3SWNA 4HCZA 4HCCA 3VKIA 3CCMT 2FHDA 1M4ZA 4QQ6A 3OYEA 2CZ1B 4MZTA 3A8GB 4OGEA 4XU0A 4OP0A 5GAMj 4QW2A 3J80E 4JRPA 2E10A 2BKDN 4M75A 4M7DG 2QQSA 2XD0A 1QVGS 2XG8D 4KBMB 2QTXA 2XI9A 2QA4A 4JJNK 2RI2A 4M75E 4OB2B 3UT1A 3OS0A 3CCJA 3CCLA 3A5ZB 2EJ9A 2E6NA 3F70A 3JCMh 3JB9I 4C8QB 2KVQG 2JVVA 4ME7A 1OYXA 4E7KA 1BKBA 5CKEA 3CXCS 3CBMA 3RMQA 2VV5A 2XICA 2MF2A 2VXEA 4NL3A 4HT9A 2QA4T 1OZ2A 3PMIA 3RKWA 3WVEB 3ZFJA 3CCJT 1Q82U 1UGPB 3CCLT 4NS5A 5C6SA 1M1FA 3E9GA 5GAOr 2NLUA 1N27A 2CZ6B 1Y96A 1K8AU 4IURA 4C92E 1YITA 2X35A 2HNIA 1VQ7A 3JCMf 5CVIA 2E64A 4XQ3A 5J26A 5IN1A 3QG1A 5DY9A 1N8RU 1S72A 4II1A 4F7UF 3L2RA 2C06A 3JB9J 4PJOC 3GPLA 3HL8A 3CCSA 4ATOA 3M54A 4HKEA 1FX7A 3M53A 4OB0B 5D6XA 3TCJA 3OA6A 2M1HA 1KHIA 2F5TX 2AHJB 2V8IA 4X34A 2X4YA 3QYHB 5LJ5e 3DLLA 5J39A 3HRTA 1UGSB 2YLBA 1S72T 1NJIU 4M7AC 2LX9A 3A8HB 3JCMd 1N6AA 5A0GA 2LCCA 1M1GA 5A0DA 3CCST 4M78C 2VGMA 5HK3A 3UPUA 1W2BS 3CC2A 5CIUA 4BI4A 4J7IA 5CR2A 1X6OA 1D3BA 1YIJA 3OYCA 3S3NA 1KQSA 3JB9F 3OS2A 2ZPFB 4E7IA 4N0AC 4EMKC 4M77C 3LGFA 4J8OA 1K73U 4PJOB 3M57A 5GANj 3QZ9B 3CC2T 3GP8A 1H641 1M1KC 3OSSC 4MDWA 3M4GA 4KT0E 5GAN4 2DXCA 3HPWA 2O4XA 3OBWA 1XTDA 5FRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A0L A;  2XID A;  4BUG A;  4C0Z A;  2XIC A;  5A0D A;  5A0G A;  2XI9 A; 
#chains in the Genus database with same CATH topology
 2FPE A;  2LNV A;  4PJO D;  4HXJ A;  1K8A C;  1U06 A;  3QJ6 A;  3VS4 A;  3LWH A;  1QKX A;  3S6W A;  2R5M A;  1RLQ C;  3ZEH A;  1MHN A;  4AFZ C;  2CT3 A;  2EPD A;  4ZNX A;  2FVU A;  3I56 A;  3RNJ A;  4E6R A;  2QG9 B;  4BUG A;  1QP3 A;  5EG2 A;  2CSI A;  2ATC B;  2CUD A;  2QEX Q;  3TSZ A;  1PRL C;  1E7O A;  2ED0 A;  2LT4 A;  4M78 G;  2CP5 A;  1IXD A;  4C92 C;  2K5I A;  4FCY A;  5GAM h;  2JMC A;  1K73 C;  2K6D A;  4AFQ C;  3C4S A;  4M77 G;  3V7C A;  3OYM A;  2F5K A;  1JJ2 A;  3CCQ A;  2VKN A;  2R58 A;  2ZGW A;  3CD6 Q;  3CMA T;  1VQ8 T;  2G3R A;  2K2M A;  2HBP A;  1RAA B;  3R6O A;  2L8D A;  2RHI A;  1OZ3 A;  3QXE B;  3H9N A;  2BIV A;  5AT1 B;  4ZGJ B;  2DXB A;  2FEI A;  1VQ6 T;  4A4K A;  2JXB A;  9ATC B;  1WHM A;  5GAM d;  2ESW A;  1R0C B;  3GNG A;  2JTF A;  1TUD A;  2JMA A;  1K9M R;  4DEY A;  2RB6 A;  1RAF B;  1D0X A;  2LQ8 A;  1RAH B;  2LCL A;  3SDZ A;  5CAI A;  4CI0 C;  4EDU A;  4ELY C;  3CBO A;  3CCR Q;  1FMW A;  3JCM g;  1YJN Q;  1VQ5 A;  5I21 A;  4GBQ A;  5GAO n;  2LC4 A;  2HKN A;  5AYF A;  1D0Z A;  4C8Q A;  5KYX B;  1VQL Q;  3LGL A;  2P4T A;  3BY7 A;  5LJ3 e;  2DTH A;  3A8L B;  4Z8A A;  3TU4 K;  1H8K A;  1VQ4 A;  2HSP A;  2X4W A;  1PCX A;  2MOX A;  1P92 A;  2RHY A;  3QUI A;  2EYZ A;  3V8J A;  2MWO A;  4XAX B;  4BDZ A;  2E12 A;  4RCC A;  3J81 E;  4JZ3 A;  5GAN f;  2HZY A;  1GFC A;  3EGD A;  4Y91 A;  4HT8 A;  3CC7 T;  2JZ2 A;  5FWB A;  2DIL A;  4M4Z A;  1QCN A;  2ZCF B;  5J3B A;  4KUI A;  2K5L A;  2E65 A;  2YUQ A;  3RUX A;  1Y7X A;  4ELZ C;  4M77 B;  2FZC B;  2J06 A;  4M7D F;  3EG2 A;  1NBE B;  4HVW A;  3MJX A;  5KE3 A;  3QWX X;  1BI2 A;  3MEA A;  2LMJ A;  4PJO A;  2VWF A;  4PFP A;  1NZ9 A;  2DZC A;  2EKO A;  3E19 A;  1WZO A;  2F69 A;  3S3M A;  1IB8 A;  2DL7 A;  3PE0 A;  2C0T A;  3D7S B;  5LJ5 g;  2JJ9 A;  1YFN A;  2FO0 A;  4MZM A;  3M55 A;  2O9S A;  2W10 A;  3G4S T;  3CCU T;  2GFA A;  4ZN3 A;  3CCL Q;  2K3Y A;  2P4R A;  4NOY A;  3RR6 A;  2HD0 A;  5CO7 A;  4DA4 A;  2GQI A;  2KDS A;  4YTL A;  3MO8 A;  1Y0M A;  1VQM A;  4FYX B;  1W2B P;  4XTY A;  2K4Y A;  4F17 A;  2PVG B;  3FB9 A;  3FDR A;  2LJ0 A;  2FZK B;  4LUE A;  1V1C A;  4XU1 A;  1S72 Q;  1N9R A;  4RTY A;  1D1C A;  5GMK h;  5GMK m;  1EIF A;  2PUK B;  2GNC A;  8ATC B;  3RDV A;  3NTK A;  2ED1 A;  4AG1 C;  3SD4 A;  1K4U S;  2L5Q A;  4E7L A;  4FT2 A;  4MML A;  4HVU A;  2DYB A;  2K2V A;  2K57 A;  5M9O A;  2EQM A;  2ROL A;  1OPL A;  3VS7 A;  2A7Y A;  4R55 A;  3X26 B;  1UDL A;  1Z9Z A;  4GY5 A;  1K9M U;  1NEB A;  5CCA A;  1X75 C;  1S1N A;  1I4K 1;  1VQK T;  2KQW A;  5GAN 3;  5GAO p;  4X9D A;  4PL6 A;  3RMS A;  1YI2 A;  2HSE B;  3RKY A;  1N9S A;  2NYS A;  1XJW B;  2YLC A;  2GF7 A;  3OYY A;  3CPW S;  4FT4 A;  3OMC A;  4BE2 A;  2LJ1 A;  2HMA A;  3FIF A;  1MMN A;  1QP2 A;  5D6W A;  2XU8 A;  3EAE A;  3GIB A;  4XK8 E;  2DO3 A;  2AZS A;  4QVZ A;  1JU5 C;  2DBM A;  2Z0W A;  3EFS A;  2EFI A;  4D8D A;  3BW1 A;  4WF2 A;  3I56 Q;  3EFO B;  1K9A A;  1D1A A;  3M0R A;  2A08 A;  5KYX A;  1ZA2 B;  2EYY A;  4RMO A;  3G1J A;  1NLP C;  1QVP A;  2MYS A;  5IHN A;  3SFM A;  4O6J A;  3ULR B;  3L42 A;  3R6N A;  1LVK A;  3I5R A;  1IGQ A;  1K9M C;  1M27 C;  2MAM A;  2X4J A;  2VYT A;  3A8O B;  2IG0 A;  3PMT A;  4JRI A;  1HYO A;  5IXF A;  4OF1 A;  3CCQ Q;  4Y28 E;  4M7A D;  2OTL T;  1BIA A;  2M51 A;  2H3J A;  2RPN A;  1UGR B;  4DOV A;  1U8R A;  1M90 R;  5CKH A;  1ABQ A;  3A8M B;  2CSQ A;  2L0A A;  5LJ3 g;  5LJ5 j;  4JLG A;  1E6G A;  5KE2 A;  3JB9 H;  2HCK A;  3OS5 A;  2QA4 Q;  1YHQ T;  4M77 A;  4M7D B;  1VQ9 A;  4C92 F;  2EGA A;  4JJB A;  1KC8 R;  1ZHI A;  2RJF A;  1V29 B;  5FU6 C;  3URG A;  1BB9 A;  3VUB A;  1H3Z A;  1HD3 A;  2GTO A;  4WTO B;  1UB4 A;  2CZ7 B;  4BI3 A;  3CCM A;  2DBK A;  1G3T A;  3FRN A;  4M7D D;  3ZBD A;  4XTV A;  2DLP A;  5IAY A;  2DA9 A;  3OYE A;  5IHI A;  2F2W A;  2BZY A;  4KBM B;  4JJN K;  1VQ5 Q;  2RI2 A;  4JJC A;  1TOV A;  4M75 E;  3UT1 A;  3OS0 A;  3CCJ A;  1QWF A;  1X2Q A;  4ME7 A;  1RAD B;  1BKB A;  2YUN A;  1X43 A;  3CBM A;  1KJW A;  2QA4 T;  1VQ4 Q;  1OX8 A;  4J9I A;  1Q82 U;  2BZ8 A;  5C6S A;  1AWO A;  2JS0 A;  1JXO A;  2KRO A;  1VQ7 A;  2GTJ A;  3JCM f;  1ZSZ C;  4PFO A;  4Z89 A;  5DY9 A;  4DBQ A;  1VYU A;  3CCS A;  3M54 A;  5D6X A;  3TCJ A;  2EYW A;  1IHV A;  2X4Y A;  2E4H A;  3HRT A;  4M7A C;  3A8H B;  1M1G A;  3LH5 A;  2VGM A;  2H3E B;  3UPU A;  3CC2 A;  5CIU A;  4BI4 A;  4J7I A;  4RTW A;  3JB9 F;  1R77 A;  2ZPF B;  4E7Z A;  2H8H A;  4N0A C;  4EMK C;  2EBP A;  2M0Y A;  2CRE A;  5GAN 4;  3TVT A;  5KCO A;  4L59 A;  5FRM A;  4XU3 A;  1UTI A;  1HSQ A;  2E6Z A;  1AOJ A;  1NYF A;  1LJO A;  2ZPI B;  1WGS A;  4C0Z A;  1NLO C;  2I2L A;  3CBP A;  3MET A;  3CPF A;  2ENM A;  1WFW A;  1W6X A;  4F7U E;  1AWW A;  4M75 C;  4KGX B;  4PJO G;  2X3W D;  1WXB A;  2V1R A;  6AT1 B;  2RO0 A;  1C0M A;  1WHH A;  3EFO A;  3LLR A;  4JJD A;  4NL2 A;  1T0H A;  2GQV A;  1VQM Q;  2VGN A;  1B34 B;  1WPY A;  2CH4 A;  3INZ A;  5LJ5 f;  1WYX A;  5LJ3 j;  2C0I A;  3ZL7 C;  3X24 B;  4EPC A;  1FWZ A;  1BCO A;  4BD3 A;  2RHU A;  3I55 A;  1UG1 A;  2EYX A;  3OY9 A;  3QII A;  4DQ2 A;  2OJ2 A;  5IXB A;  1G83 A;  2CP7 A;  4JPB W;  1GBQ A;  1AT1 B;  3E1S A;  2SRC A;  2CP6 A;  3I5S A;  1I1J A;  3CPW P;  1KC8 U;  3BFM A;  3C12 A;  2CDT A;  1UHC A;  2L2P A;  3HHT B;  2GBQ A;  4A54 A;  3RER A;  2OAU A;  2P0K A;  4R0K A;  1J3T A;  2GCX A;  2KYB A;  4C92 B;  3G6E A;  4M7D A;  5L23 A;  2K3B A;  2CP0 A;  2HL5 C;  2XMF A;  1ZLM A;  2K3X A;  1YI2 Q;  4C92 D;  4LDV A;  3UDC A;  2RQV A;  3UA7 A;  3OYB A;  1AVZ C;  3OYH A;  1I07 A;  3CC4 Q;  1TUG B;  1PD0 A;  1FMK A;  5IH2 A;  1M90 C;  2V26 A;  5ECA A;  1Q95 G;  2KT8 A;  1KD1 R;  2KR3 A;  2RHZ A;  3L2Z A;  2RH2 A;  2RK1 A;  4QKU A;  2VUB A;  3TQ7 P;  2L89 A;  5I2S A;  1NPP A;  1TXQ A;  1M8V A;  4D8K A;  3EGX A;  1KC8 C;  1Y71 A;  4C8Q E;  1JQQ A;  4RTT A;  1VQN A;  4OVA A;  3CME A;  1M2V B;  4RG8 A;  2HAX A;  3KXT A;  5GAN 5;  1YI2 T;  3OYK A;  2DM1 A;  2BE9 B;  1YJW A;  1C6V X;  1RAB B;  2LT1 A;  4RTZ A;  3QYG B;  3MCA B;  3OYD A;  1VIF A;  3CXC A;  1MGQ A;  2OTJ T;  4Q5W A;  3CC4 T;  2NUT B;  4QQD A;  4KH0 B;  3EH1 A;  5GJV B;  2O9V A;  1AHJ B;  2E5Q A;  3HSB A;  1WJQ A;  3L1A A;  4LDU A;  5GAN d;  1QVF S;  1IO6 A;  2RI5 A;  1VQ9 Q;  4XTX A;  4ZGE B;  4EMG A;  2KBT A;  1EFN A;  4RTV A;  2DIG A;  1BCM A;  3CCM Q;  1K0X A;  3CPW A;  2QI2 A;  2LNH B;  2KRS A;  1GXI E;  7AT1 B;  3JB9 D;  2J6O A;  2YXY A;  4JUV A;  2KEA A;  3ER0 A;  1OV3 A;  1TWB A;  5LJ3 f;  2RHX A;  1YNZ A;  1R8O B;  2KRN A;  1WHK A;  3ASK A;  1YJ9 T;  3JSC A;  2QYZ A;  2HQE A;  1QW1 A;  4AMC A;  3CCJ Q;  2QXF A;  1BYM A;  2DRM A;  1TUC A;  3M56 A;  3OS1 A;  4J9F A;  3EGU A;  3JV3 A;  1R0B G;  3PFS A;  4C8Q C;  2QGF B;  3C94 A;  1VQ9 T;  1B34 A;  2RF0 A;  1YCS B;  4IIM A;  1Y96 B;  5GAN 2;  4C0G A;  4ANJ A;  2D1X A;  1M1K R;  1Q86 C;  1VQ7 Q;  2DIQ A;  4HA8 A;  4ORZ A;  2JTM A;  4BE0 A;  2EW3 A;  2FYK A;  2QEX T;  3EG0 A;  2Y90 A;  3CCE A;  4LD6 A;  1ACM B;  3OW2 P;  2EQU A;  2MPX C;  1VQP A;  1N8R R;  2FB7 A;  1O75 A;  3PIO A;  1KHC A;  3LX7 A;  3VU3 C;  1UEC A;  3CC2 Q;  4E2F B;  1OQK A;  3UA6 A;  3NTI A;  3S3O A;  2DVE A;  4C92 A;  3CD6 T;  3QZ5 B;  2DD4 A;  1NJI R;  2G6F X;  4J83 A;  4DBF A;  3MHX A;  4LUD A;  2RMO A;  3VRY A;  1F1B B;  3G71 A;  4M7A F;  2O01 E;  2L3Q A;  2K9G A;  1KD1 U;  3CQT A;  3DKM A;  1OUL A;  1WQ7 A;  4PFZ A;  3MEW A;  2K79 A;  4PLL A;  2LVM A;  3KBG A;  3UWN A;  2R57 A;  1UE9 A;  2E70 A;  2J7I A;  2MWP A;  2QQ9 A;  4A4E A;  2C0O A;  3CCV A;  3OSV A;  2NUZ A;  4EIK A;  4IKF A;  4XTU A;  1VUB A;  2D6F A;  2JW4 A;  5KH6 A;  5I2M A;  3MPU B;  1N5Z A;  2XHC A;  3NHN A;  3M0T A;  1PWT A;  3OBY A;  3CCR T;  4A53 A;  1YJN T;  3V8K A;  2JNG A;  5I11 A;  2WAC A;  3C0C A;  4IUP A;  4JS5 A;  2DJQ A;  4FYY B;  2EAY A;  1VQL T;  4TVR A;  3SEM A;  2DXU A;  1M2V A;  3I55 Q;  3HP9 A;  1CSK A;  3NTH A;  1VQO A;  4M75 F;  2SEM A;  3LW5 E;  3LH0 A;  2XID A;  2DL5 A;  1I0C A;  2EYQ A;  3QDF A;  1WXT A;  2NUT A;  3RIR A;  1PG5 B;  4Z02 A;  1KD1 C;  4PKC C;  1UEB A;  4M78 E;  2CKK A;  3FC3 A;  4FW1 A;  4J9C A;  3G6E Q;  4M7A G;  3SB2 A;  4QVC A;  3H0H A;  2DPP B;  4M77 E;  1IZ6 A;  2J05 A;  2XKO C;  5FWC A;  3L2Q A;  2QAZ A;  1XNI A;  4DEX A;  2PVD B;  3OW2 A;  3MKD A;  2R5A A;  2WSC E;  1EX4 A;  1G5V A;  1G3W A;  2B8A A;  3AT1 B;  4HCC A;  3VKI A;  2FHD A;  1M4Z A;  4MZT A;  4XU0 A;  3J80 E;  4JRP A;  2BE7 D;  4M7D G;  2QQS A;  2KT1 A;  3HTR A;  1T3L A;  2MK5 A;  4FW2 A;  2DNU A;  3JCM h;  1GCQ C;  3F70 A;  2X3X D;  2KVQ G;  4FYV B;  1OYX A;  4E7K A;  3CXC S;  3VS2 A;  2XIC A;  1QVF P;  1OZ2 A;  3RKW A;  2KRM A;  1VQN Q;  3CCL T;  4NS5 A;  1M1F A;  2NLU A;  3CME Q;  2CZ6 B;  1Y96 A;  4IUR A;  1Q81 R;  1SEM A;  2EGC A;  2HNI A;  4CC3 A;  5J26 A;  5IN1 A;  3QG1 A;  1N8R U;  4F7U F;  1W70 A;  2C06 A;  1YJW Q;  1UHF A;  2VAS A;  3HL8 A;  3SHW A;  1FX7 A;  1PM3 A;  4RTX A;  2M1H A;  1FYN A;  4J9G A;  3QYH B;  3DLL A;  5J39 A;  1B07 A;  1UGS B;  1WXU A;  2YLB A;  1S72 T;  1NJI U;  3JCM d;  1N6A A;  5A0G A;  5A0D A;  3M0S A;  4M78 C;  3FJ5 A;  2AZV A;  2ECZ A;  1YIJ A;  1RLP C;  1KQS A;  1ZSZ B;  3OS2 A;  4M77 C;  3M57 A;  2DET A;  3NMZ C;  1M1K C;  4MDW A;  3M4G A;  4KT0 E;  4JZ4 A;  4M7A B;  5GAM e;  2K5F A;  1GFD A;  3P8D A;  2DAQ A;  5GAN 7;  5LJ5 h;  1M30 A;  2JUF A;  2EQJ A;  4EMK B;  1N8R C;  1WDX A;  5KYY B;  3VUZ A;  4CC2 A;  1FXX A;  2X51 A;  2I0N A;  1YCY A;  2JM8 A;  1M8M A;  2A36 A;  3EFR A;  1BIB A;  2EWN A;  1JEG A;  2M16 A;  1NJI C;  1QCF A;  4PLI A;  2HDA A;  3M0Q A;  3JCM X;  3TEE A;  3HFN A;  4OGC A;  3I56 T;  1QLY A;  2DTO A;  2PVO B;  3VS5 A;  5I22 A;  3CMA A;  1VQ8 A;  5GAO q;  2OX7 A;  4KH1 B;  3VV0 A;  2ABL A;  3CCE Q;  4BY6 B;  5FRO A;  3V8L A;  5LJ5 d;  3GF5 A;  1ZBX A;  4UC4 A;  3WXM B;  3H8Z A;  3Q1J A;  2X4X A;  3GBQ A;  1QVF A;  1RUW A;  4C8Q F;  1VQP Q;  1XOV A;  4M75 D;  2M9U A;  3M9Q A;  1VQ6 A;  3QJY A;  3CCQ T;  4N4G A;  1M2O A;  3UAT A;  1QCO A;  2KMT A;  2LQN A;  4RG2 A;  3PTA A;  4E7S A;  2FRY A;  1PKS A;  1U1S A;  4OML A;  1Z9Q A;  4JS4 A;  1KIK A;  1G3S A;  1KG1 A;  1M3C A;  1AWX A;  3M4Y A;  1GL5 A;  3L2W A;  4V2S A;  3IQL A;  8AT1 B;  2XDB A;  1D0Y A;  1SG5 A;  4FL6 A;  3QO3 A;  1U5S A;  2PU9 B;  2DYI A;  4BDY A;  1SSF A;  1QMC A;  2XK0 A;  1MMA A;  2DMO A;  3NFC A;  4C0D C;  3P8B B;  1X69 A;  2DF6 A;  3GLX A;  2LDM A;  4JDS A;  4C92 G;  3CCV Q;  1WX6 A;  1EZZ B;  4ZN1 A;  4BI8 B;  1I81 A;  3QPH A;  2CYZ B;  4LN2 A;  2DVJ A;  2V8K A;  2ZPH B;  2FZG B;  1Q81 U;  1B3Q A;  1BU1 A;  5FU7 C;  1OEB A;  1AEY A;  4BAC A;  2VXF A;  2CUB A;  2GGR A;  1VQ5 T;  1BI1 A;  1Q7Y R;  2LP5 A;  3JCM P;  3CC7 A;  1WJR A;  1G3Y A;  1VIE A;  4LXC A;  2BZX A;  1VQO Q;  1UFF A;  3I9Q A;  1QVG A;  3MP6 A;  1VQ4 T;  4F7U B;  1W1F A;  1GBR A;  1Q86 R;  2DEQ A;  3H0I A;  4PJN A;  3OW2 S;  4IUV A;  3H41 A;  2RJC A;  1X01 A;  4J9D A;  1O9S A;  3SWN C;  4HVV A;  3T9N A;  2YSQ A;  4FIB A;  3VYH B;  1UUE A;  1G2B A;  4J6X A;  2GFU A;  3VS1 A;  2JN0 A;  1ZSZ A;  1RI0 A;  2YHT A;  3EG1 A;  1K1Z A;  3CXC P;  2DL8 A;  4OMP A;  2CP2 A;  1Q81 C;  2F2X A;  2PTK A;  1ZUK A;  3G4S A;  1JB0 E;  5CKB A;  4RCB A;  2JOY A;  3CCU A;  1SRL A;  2E3H A;  3JCM c;  5FLX E;  4M7A A;  2LRQ A;  5GMK e;  2PZ1 A;  5CQX A;  3NPF A;  1M90 U;  1SKU B;  1HJD A;  1IRX A;  4LE9 A;  3QDR B;  1OPK A;  1W4S A;  4N0A A;  4EMK A;  3JB9 G;  1WQW A;  5L8R E;  5KYY A;  2LZ6 B;  1RAG B;  2DZ9 A;  3RBB B;  1WA7 A;  5LJ3 d;  1TSF A;  1X2K A;  1JRI A;  1WJS A;  1H92 A;  3GNF B;  1IGU A;  2J6K A;  4OMF B;  1OX9 A;  4R56 A;  3AHU A;  3EHR A;  1BI0 A;  5GAM g;  3C95 A;  5GMK i;  5FRN A;  1KQS S;  2RJE A;  1VQM T;  2D9T A;  3JCM b;  3J7A F;  2COZ A;  2KGT A;  3M0U A;  4WCI A;  1DJ7 B;  2EQK A;  2CP3 A;  4PJJ A;  5GAO m;  3RKX A;  3PT9 A;  4F04 B;  4B9W A;  4KUD K;  2P84 A;  3QWY A;  4X9C A;  1JBM A;  1VQK A;  4J9B A;  2EVR A;  1VYT A;  2RQT A;  1D3B B;  2IIM A;  3H0F A;  1YIJ Q;  3DB4 A;  4C5I A;  4O5V A;  3M59 A;  4C8Q D;  5GAN h;  5C0M A;  4IUT A;  3V7R A;  2O4X B;  4XU2 A;  4JRQ A;  1UGQ B;  2YDL A;  5HKC A;  3TRE A;  1M5Q 1;  2P0Q A;  2LCS A;  3OYG A;  4M78 F;  2FG0 A;  2CT4 A;  1YJ9 Q;  3OYL A;  2KXC A;  2L3S A;  1ZQ1 A;  1WI7 A;  1ZUY A;  3O8V A;  4M77 F;  1M9S A;  4OB1 B;  4BE1 A;  2YRD A;  1Q7Y U;  4A4H A;  2PUO B;  1IRE B;  2FL7 A;  2LJ3 A;  4GLM A;  3KUF A;  4J6Y A;  1YIJ T;  1Q86 U;  3L2V A;  3HRS A;  3OYI A;  4RUG A;  2OTL A;  2X9H A;  4J5Y A;  1WIE A;  3CMA Q;  1VQ8 Q;  2RM4 A;  4PJO E;  2FPD A;  4RKU E;  4F7U A;  2YUO A;  4F14 A;  3ME9 A;  1AZE A;  3QKJ A;  1VA7 A;  2CZ0 B;  1YHQ A;  2M0O A;  3QHS A;  4KGZ B;  2AT1 B;  1D09 B;  3JCM V;  4JRK A;  3FJP A;  4FYW B;  1VQ6 Q;  2PNI A;  3N5B B;  4J6W A;  2D8H A;  3V7S A;  1MV0 B;  2KAF A;  2RI3 A;  4A4F A;  2LQW A;  4Z88 A;  2EKH A;  3PNW C;  4BB7 A;  4HCB A;  2XDD A;  1NEG A;  2ZAE A;  1Q7Y C;  1LNX A;  2HKQ B;  4QQG A;  1AD5 A;  5LL6 S;  2KYM A;  2LX7 A;  2W0Z A;  4N4I A;  1ABO A;  5EC7 A;  4HCZ A;  2O2O A;  1VOM A;  3CCM T;  5GAM j;  3A8G B;  4OP0 A;  4QW2 A;  2DEU A;  1MV3 A;  2YWW A;  1ZBJ A;  3CCS Q;  4AT1 B;  2XG8 D;  1QVG S;  2XI9 A;  2CH4 W;  2QA4 A;  4OB2 B;  4ESR A;  3A5Z B;  2EJ9 A;  3JB9 I;  3VS6 A;  1OOT A;  3RMQ A;  2MF2 A;  2DX1 A;  2VXE A;  4NL3 A;  4HT9 A;  3PMI A;  3ZFJ A;  3CCJ T;  3A1P A;  1QWE A;  3E9G A;  5GAO r;  1N27 A;  1CKB A;  1YIT A;  3CC7 Q;  2X35 A;  2QK0 A;  2RQU A;  2NWM A;  2KE9 A;  4II1 A;  4FSS A;  4PJO C;  2YUP A;  3GPL A;  1GCP A;  4ATO A;  2HEQ A;  2FRW A;  5D7U A;  4OB0 B;  4J9E A;  3OA6 A;  2F5T X;  1VQ7 T;  2AHJ B;  2RN8 A;  4OMM A;  2LX9 A;  1MMG A;  2LCC A;  3CCS T;  1PNJ A;  1X6O A;  1D3B A;  2NUP B;  3OYC A;  3S3N A;  2J6F A;  4E7I A;  4J8O A;  1PKT A;  4QT7 A;  1YWP A;  3CC2 T;  1H64 1;  2EQI A;  2VB6 A;  1RAC B;  2DXC A;  2O4X A;  1SRM A;  4L5G A;  3X20 B;  3G4S Q;  3JCM W;  4C5H A;  2JT4 A;  1SF9 A;  3CCU Q;  4E7J A;  2Y4X A;  2MI6 A;  3VS3 A;  2EJG A;  4M78 B;  1KQS P;  4F16 A;  4D6W A;  1TS9 A;  4AFU C;  4KRT A;  4MMK A;  5GMK l;  4LDW A;  4J7F A;  1SSH A;  4MZP A;  1HXD A;  1WNL A;  2DRK A;  4DBR A;  4M78 D;  3X25 B;  3CEY A;  2KXD A;  4ZGD B;  4PJM A;  4M77 D;  2A0F B;  4XTZ A;  1TTH B;  5GAN 8;  2E41 A;  5DLO A;  1CKA A;  2IPO B;  3O5Z A;  1H3H A;  3PIP A;  2HQH A;  1UGV A;  2RQR A;  2EIF A;  2CS7 A;  3KFV A;  3OYJ A;  2E1H A;  4B9X A;  2HL3 A;  3PVL A;  1ZSG A;  2ZPE B;  3OYF A;  4EMH A;  4FSX A;  3FLG A;  1NYG A;  5GJW B;  3I55 T;  2HBW A;  3OB9 A;  1U3O A;  1VQK Q;  5FU6 B;  2COY A;  4C5G A;  5GAM f;  3JCM Q;  2MMP A;  2RJD A;  2P0P A;  1PRM C;  1MND A;  4N4H A;  2YRC A;  5GAN e;  2DD5 A;  3A98 A;  3OYA A;  2D0N A;  2QTV A;  3U23 A;  1M1K U;  2L3R A;  2EJF A;  4KUL A;  2XDP A;  4M75 G;  5KYW B;  3L2U A;  3G6E T;  1Q82 R;  3THK A;  1WHL A;  2DL4 A;  3MEU A;  1K0S A;  1MMD A;  3VRZ A;  2AKK A;  2QQR A;  4FU6 A;  5GMK j;  1RAI B;  3H6Z A;  3OYN A;  1SHG A;  1GRI A;  3M5A A;  2MCN A;  1ARK A;  3P8H A;  2QDY B;  3M58 A;  1MUZ A;  5CQY A;  2ROT A;  1B7T A;  1T3S A;  3E2U A;  5DLQ E;  4E7H A;  2RK2 A;  4C0D B;  2OTL Q;  2QQA A;  1IHW A;  1Y57 A;  1PSF A;  1QKW A;  1M3B A;  1D1B A;  2V1Q A;  2OTJ A;  3CC4 A;  1VQN T;  5FW9 A;  1WHG A;  2F1L A;  1OU8 A;  4Y92 A;  3CME T;  5DM7 R;  4AFS C;  1GCQ A;  3DLM A;  2ZPB B;  2D0Q B;  1YHQ Q;  4DBH A;  4LDX A;  3GOX A;  5FU7 B;  1JJ2 S;  2ZZD A;  1PSE A;  1ZX6 A;  1X6G A;  1YJW T;  2WSE E;  1KQ2 A;  2E3I A;  1E6H A;  4VUB A;  1QVG P;  4P5N A;  1NG2 A;  2DE0 X;  2RA2 A;  3WVD B;  2NUP A;  5GAN 6;  1HK9 A;  2DXT A;  4CRI A;  3JCM J;  3PVQ A;  1AZG B;  2LQK A;  2AKL A;  1JXM A;  4GLK A;  4F7U G;  1OI1 A;  1SPK A;  4L6V 5;  1NE8 A;  4IUQ A;  1YJ9 A;  4MDX A;  2DKG A;  3E9F A;  1TH7 A;  3SWN B;  2PQW A;  1SHF A;  2COW A;  2AIR B;  4M7A E;  4M78 A;  1W2B A;  1G8X A;  3M0P A;  4M75 B;  3X28 B;  4FM4 B;  2ZPG B;  1RL2 A;  1AWJ A;  5KYU B;  4CC4 B;  4X1V A;  1LCK A;  1T0J A;  1LPL A;  2YT6 A;  2EGE A;  2QAS A;  2L3P A;  1I5O B;  1BK2 A;  2KNB B;  2VVK A;  1RI9 A;  2QEX A;  2F2V A;  2BTT A;  4IUU A;  3HFO A;  4IIO A;  3TSW A;  2RQW A;  4M7D E;  3VS0 A;  1YIT Q;  2LTO A;  2BUD A;  3NGP A;  4AG2 C;  1UJY A;  3BE3 A;  2DJZ A;  3G71 Q;  2YRV A;  3PGG A;  3JAM E;  4RTU A;  4C0F A;  3MP8 A;  2O31 A;  1K8A R;  4PK4 A;  5CKD A;  1JO8 A;  1KFZ A;  4XTW A;  3CD6 A;  1BI3 A;  1KQ1 A;  5D6Y A;  3OMG A;  3EGX B;  4PNO A;  4OMO A;  1LOJ A;  3REA B;  5KYN A;  2KK4 A;  4ZTJ A;  3CCE T;  3EG9 B;  3JRZ A;  4K11 A;  4B6M A;  5IT9 E;  3REB B;  3MEV A;  3HRU A;  1FMV A;  2QDL A;  1M3A A;  5KCH A;  2CGH A;  4ZTF A;  1VQP T;  4LD9 K;  4PJO F;  3LWI A;  1NM7 A;  4OMN A;  5HK0 A;  5KYW A;  2DK3 A;  4C5E A;  1A0N B;  1MNE A;  4OMQ A;  2V8J A;  4OB3 B;  5IHK A;  1YIT T;  1K73 R;  1U1T A;  4C8Q G;  3VJP A;  5HCK A;  3HKS A;  4CC7 A;  3G71 T;  4LNP A;  3EH2 A;  2WSF E;  3CCR A;  2RD1 A;  1YJN A;  3OQ5 A;  2KI7 A;  5GAN g;  1XQH A;  3FEO A;  2JS2 A;  2OAW A;  1VQL A;  1VYV A;  2A3L A;  2HQX A;  3CCV T;  1RAE B;  5A0L A;  5LJ3 h;  2Y4Y A;  4KGV B;  3BDL A;  3VYG A;  1Q82 C;  4M7D C;  1PHT A;  1YN8 A;  2QQB A;  1ZUU A;  3BDU A;  1PC0 A;  2K7A A;  4DOW A;  2IVW A;  5HY6 A;  2AK5 A;  2KSS A;  4A4G A;  5CK9 A;  2KY9 A;  5A2Q E;  2DER A;  3DB3 A;  5GAO l;  4QVD A;  1YBY A;  1VQO T;  4A63 B;  2D8J A;  4BY6 C;  5CKF A;  1NPR A;  1I5L A;  1I8F A;  3JCM e;  4LDY A;  1X27 A;  2DL3 A;  1Y07 A;  2QGG A;  1K76 A;  3LYI A;  4E47 A;  1PD1 A;  4PJL A;  1C1A A;  2DTI A;  1KSW A;  3G7Z A;  1OU9 A;  2O88 A;  3QSU A;  2MIO A;  4JLI A;  1WLP B;  3QBY A;  2RNA A;  3RES A;  3EG3 A;  2VC8 A;  3SWN A;  3MP1 A;  2FPF A;  1TG0 A;  4QQ6 A;  2CZ1 B;  2JTE A;  4OGE A;  1UJ0 A;  2E10 A;  2BKD N;  4M75 A;  2XD0 A;  2OI3 A;  2QTX A;  5KYU A;  3CCL A;  2E6N A;  1JJ2 P;  1KK7 A;  4C8Q B;  2JVV A;  5CKE A;  1QQJ A;  1YWO A;  2VV5 A;  1YP5 A;  2JM9 A;  2B86 A;  3WVE B;  1TU0 B;  1UGP B;  1K8A U;  1BBZ A;  2E5K A;  4C92 E;  4HCK A;  5CVI A;  2OTJ Q;  2E64 A;  4J9H A;  4XQ3 A;  1S72 A;  3L2R A;  3JB9 J;  1X6B A;  3EGD B;  4HKE A;  3M53 A;  1V76 A;  1KHI A;  2V8I A;  3I35 A;  4X34 A;  5LJ5 e;  3EHQ A;  5HK3 A;  3EG9 A;  1W2B S;  3UF4 A;  5CR2 A;  3LGF A;  1ZA1 B;  1K73 U;  4PJO B;  5GAN j;  3QZ9 B;  1WHJ A;  2A28 A;  3GP8 A;  2DFU A;  3OSS C;  2M02 A;  3HPW A;  3OBW A;  2A37 A;  1XTD A; 
#chains in the Genus database with same CATH homology
 4L5G A;  3X20 B;  4XU3 A;  3JCM W;  4C5H A;  4M7A B;  5GAM e;  4E7J A;  2E6Z A;  2K5F A;  2LNV A;  4PJO D;  2Y4X A;  2MI6 A;  2EJG A;  1LJO A;  4M78 B;  2ZPI B;  3P8D A;  1WGS A;  1K8A C;  4C0Z A;  2DAQ A;  3QJ6 A;  3LWH A;  2I2L A;  3CBP A;  3MET A;  5GAN 7;  4IKF A;  3CPF A;  3S6W A;  5LJ5 h;  4D6W A;  2JUF A;  2EQJ A;  2R5M A;  4MMK A;  3ZEH A;  5GMK l;  4LDW A;  4EMK B;  1MHN A;  4J7F A;  4F7U E;  1N8R C;  3VUZ A;  4MZP A;  1HXD A;  1WNL A;  1FXX A;  4M75 C;  4M78 D;  4PJO G;  3X25 B;  3CEY A;  1YCY A;  2FVU A;  3I56 A;  3EFR A;  2RO0 A;  1BIB A;  2EWN A;  3LLR A;  4NL2 A;  4ZGD B;  2GQV A;  2M16 A;  4BUG A;  2VGN A;  1B34 B;  4M77 D;  1NJI C;  1QP3 A;  4PLI A;  5EG2 A;  3JCM X;  1WPY A;  3INZ A;  4XTZ A;  5LJ5 f;  5GAN 8;  2E41 A;  3TEE A;  5LJ3 j;  5DLO A;  3HFN A;  4OGC A;  2LT4 A;  3I56 T;  4M78 G;  3X24 B;  3PIP A;  2DTO A;  4EPC A;  1FWZ A;  2PVO B;  2EIF A;  4BD3 A;  4C92 C;  2RHU A;  2K5I A;  3I55 A;  3OY9 A;  5GAM h;  3QII A;  4DQ2 A;  3CMA A;  2CS7 A;  1VQ8 A;  3OYJ A;  2E1H A;  4B9X A;  5GAO q;  1K73 C;  3C4S A;  4M77 G;  3V7C A;  3VV0 A;  3OYM A;  2F5K A;  1JJ2 A;  4BY6 B;  2ZPE B;  5FRO A;  3V8L A;  3OYF A;  3CCQ A;  3E1S A;  5LJ5 d;  3GF5 A;  4EMH A;  2R58 A;  4FSX A;  3FLG A;  1ZBX A;  4UC4 A;  3WXM B;  3H8Z A;  3Q1J A;  3I55 T;  1KC8 U;  2ZGW A;  2X4X A;  3CMA T;  3BFM A;  3OB9 A;  3C12 A;  1VQ8 T;  1QVF A;  2G3R A;  4C8Q F;  3HHT B;  1XOV A;  2HBP A;  4A54 A;  3RER A;  4M75 D;  2M9U A;  3M9Q A;  3R6O A;  2L8D A;  3QJY A;  2RHI A;  5FU6 B;  4C5G A;  4N4G A;  5GAM f;  3JCM Q;  3CCQ T;  2OAU A;  1OZ3 A;  2MMP A;  2P0K A;  2P0P A;  2RJD A;  3QXE B;  4N4H A;  2KMT A;  2GCX A;  4C92 B;  5GAN e;  3G6E A;  2BIV A;  2DD5 A;  4RG2 A;  4M7D A;  3PTA A;  4ZGJ B;  3OYA A;  1M1K U;  2DXB A;  2L3R A;  1U1S A;  4JS4 A;  1VQ6 T;  4A4K A;  2EJF A;  1VQ6 A;  4KUL A;  2XDP A;  1G3S A;  4M75 G;  1KG1 A;  2K3X A;  3L2U A;  3G6E T;  3M4Y A;  5GAM d;  4C92 D;  3GNG A;  2JTF A;  4LDV A;  3UDC A;  3L2W A;  4V2S A;  2RB6 A;  2XDB A;  3OYB A;  3MEU A;  4FL6 A;  3QO3 A;  3OYH A;  2LQ8 A;  2LCL A;  3SDZ A;  5CAI A;  2PU9 B;  4CI0 C;  4BDY A;  1SSF A;  2XK0 A;  3NFC A;  4C0D C;  4EDU A;  3P8B B;  4ELY C;  2QQR A;  4FU6 A;  5GMK j;  3GLX A;  2LDM A;  4JDS A;  3H6Z A;  3CBO A;  4C92 G;  3JCM g;  3OYN A;  1M90 C;  4ZN1 A;  4BI8 B;  1VQ5 A;  1I81 A;  2RHZ A;  5I21 A;  3QPH A;  3L2Z A;  2CYZ B;  2RH2 A;  2RK1 A;  3M5A A;  2V8K A;  2VUB A;  2ZPH B;  2L89 A;  3P8H A;  2LC4 A;  5I2S A;  5GAO n;  1NPP A;  5AYF A;  4C8Q A;  2QDY B;  1Q81 U;  1M8V A;  3LGL A;  3M58 A;  2P4T A;  1KC8 C;  3BY7 A;  5CQY A;  1Y71 A;  5LJ3 e;  2DTH A;  3A8L B;  5FU7 C;  4BAC A;  2VXF A;  4C8Q E;  3TU4 K;  1VQ5 T;  1VQ4 A;  1VQN A;  1BI1 A;  2X4W A;  5DLQ E;  4E7H A;  2RK2 A;  4OVA A;  3CME A;  4C0D B;  1P92 A;  2RHY A;  3QUI A;  3V8J A;  3JCM P;  2MWO A;  4RG8 A;  4XAX B;  2HAX A;  2QQA A;  3CC7 A;  1PSF A;  1WJR A;  1G3Y A;  1VIE A;  3KXT A;  4BDZ A;  3HSB A;  2E12 A;  4RCC A;  5GAN 5;  3J81 E;  2OTJ A;  1QVG A;  3CC4 A;  3MP6 A;  1VQ4 T;  4F7U B;  1YI2 T;  1VQN T;  5GAN f;  3OYK A;  1YJW A;  2DEQ A;  3CME T;  5DM7 R;  2LT1 A;  4Y91 A;  4HT8 A;  3DLM A;  2ZPB B;  3QYG B;  2D0Q B;  3MCA B;  3OYD A;  1VIF A;  3OW2 S;  3CC7 T;  3CXC A;  4LDX A;  1MGQ A;  3GOX A;  2JZ2 A;  5FU7 B;  1JJ2 S;  2OTJ T;  4Q5W A;  3CC4 T;  4IUV A;  2RJC A;  2ZCF B;  2ZZD A;  1X01 A;  5J3B A;  1O9S A;  4QQD A;  3SWN C;  4KUI A;  2K5L A;  2E65 A;  3T9N A;  1PSE A;  1YJW T;  4FIB A;  2WSE E;  1AHJ B;  3RUX A;  1Y7X A;  2E5Q A;  4ELZ C;  1KQ2 A;  1WJQ A;  3L1A A;  4LDU A;  3VYH B;  4M77 B;  4VUB A;  5GAN d;  1QVF S;  4J6X A;  2RI5 A;  4P5N A;  4M7D F;  2RA2 A;  5KE3 A;  4XTX A;  3WVD B;  2GFU A;  4ZGE B;  5GAN 6;  1HK9 A;  2DXT A;  1BI2 A;  2JN0 A;  4CRI A;  3JCM J;  1RI0 A;  2LQK A;  3MEA A;  2YHT A;  4EMG A;  4GLK A;  4F7U G;  2DIG A;  4PJO A;  1OI1 A;  1NZ9 A;  2DZC A;  2EKO A;  3CPW A;  1Q81 C;  2QI2 A;  3E19 A;  1GXI E;  4L6V 5;  2F69 A;  1NE8 A;  4IUQ A;  1YJ9 A;  3S3M A;  2DKG A;  3G4S A;  1JB0 E;  3JB9 D;  5CKB A;  4RCB A;  4MDX A;  2JOY A;  1TH7 A;  3E9F A;  4JUV A;  3SWN B;  3CCU A;  3ER0 A;  3JCM c;  5FLX E;  2PQW A;  4M7A A;  2LRQ A;  5LJ3 f;  5GMK e;  2RHX A;  5CQX A;  5LJ5 g;  1R8O B;  4M7A E;  4M78 A;  1W2B A;  1M90 U;  4MZM A;  4M75 B;  3ASK A;  4FM4 B;  3M55 A;  3X28 B;  1YJ9 T;  3QDR B;  3G4S T;  3JSC A;  2ZPG B;  3CCU T;  1W4S A;  2GFA A;  1RL2 A;  2HQE A;  1QW1 A;  4ZN3 A;  4N0A A;  4EMK A;  3JB9 G;  1WQW A;  5L8R E;  2DZ9 A;  2K3Y A;  2QXF A;  1BYM A;  5LJ3 d;  4NOY A;  2HD0 A;  5CO7 A;  3M56 A;  4DA4 A;  3OS1 A;  2KDS A;  4YTL A;  1JRI A;  1WJS A;  3MO8 A;  3PFS A;  1VQM A;  4C8Q C;  3C94 A;  3GNF B;  4XTY A;  1B34 A;  4OMF B;  4R56 A;  1VQ9 T;  2K4Y A;  3AHU A;  2QEX A;  1Y96 B;  2PVG B;  4C0G A;  5GAN 2;  4IUU A;  3HFO A;  1BI0 A;  5GAM g;  1VQ7 T;  4M7D E;  3C95 A;  5GMK i;  2LTO A;  3FB9 A;  3FDR A;  1Q86 C;  5FRN A;  1KQS S;  2RJE A;  1VQM T;  2D9T A;  2BUD A;  2DIQ A;  3JCM b;  4HA8 A;  3CD6 T;  3J7A F;  4XU1 A;  1N9R A;  2DJZ A;  4BE0 A;  2JTM A;  2YRV A;  2FYK A;  3PGG A;  5GMK h;  5GMK m;  3JAM E;  2QEX T;  2Y90 A;  1DJ7 B;  2EQK A;  1EIF A;  5GAO m;  3CCE A;  2PUK B;  3MP8 A;  3RKX A;  4C0F A;  5CKD A;  4LD6 A;  4XTW A;  3PT9 A;  3NTK A;  4B9W A;  4KUD K;  2EQU A;  3CD6 A;  1BI3 A;  3SD4 A;  1KQ1 A;  5D6Y A;  1VQP A;  3OMG A;  2FB7 A;  2L5Q A;  1O75 A;  4PNO A;  4E7L A;  4FT2 A;  4MML A;  1LOJ A;  3PIO A;  4X9C A;  2K57 A;  2K2V A;  2KK4 A;  4ZTJ A;  5M9O A;  3CCE T;  1JBM A;  1VQK A;  2EQM A;  1KHC A;  3LX7 A;  3JRZ A;  3VU3 C;  5IT9 E;  2A7Y A;  3MEV A;  4R55 A;  3X26 B;  1D3B B;  3DB4 A;  4C5I A;  3HRU A;  3NTI A;  4GY5 A;  2DVE A;  4O5V A;  4C92 A;  3S3O A;  3M59 A;  1K9M U;  5KCH A;  2CGH A;  3QZ5 B;  5CCA A;  4C8Q D;  1X75 C;  2DD4 A;  4ZTF A;  1VQP T;  4J83 A;  4LD9 K;  3MHX A;  5GAN h;  1I4K 1;  4PJO F;  3LWI A;  1VQK T;  2KQW A;  5HK0 A;  5GAN 3;  5GAO p;  5C0M A;  4IUT A;  4X9D A;  3V7R A;  2DK3 A;  2O4X B;  4PL6 A;  3RMS A;  4C5E A;  1YI2 A;  3G71 A;  3RKY A;  1N9S A;  4XU2 A;  2YLC A;  4JRQ A;  1UGQ B;  2V8J A;  2GF7 A;  5HKC A;  2O01 E;  3TRE A;  4M7A F;  3OYY A;  4OB3 B;  3CPW S;  4FT4 A;  1YIT T;  1KD1 U;  1U1T A;  4C8Q G;  1M5Q 1;  3OMC A;  2P0Q A;  3DKM A;  3VJP A;  1WQ7 A;  3OYG A;  4BE2 A;  4M78 F;  3HKS A;  3MEW A;  3OYL A;  3FIF A;  4PLL A;  3G71 T;  1QP2 A;  1ZQ1 A;  5D6W A;  2LVM A;  3KBG A;  2WSF E;  2R57 A;  3UWN A;  2E70 A;  2XU8 A;  3EAE A;  2MWP A;  3CCR A;  3O8V A;  4XK8 E;  2QQ9 A;  4M77 F;  4A4E A;  1M9S A;  3OSV A;  3CCV A;  3GIB A;  4OB1 B;  5KCO A;  4BE1 A;  2DO3 A;  2RD1 A;  1YJN A;  4XTU A;  1VUB A;  3OQ5 A;  5GAN g;  4QVZ A;  5KH6 A;  1Q7Y U;  5I2M A;  2D6F A;  4A4H A;  1XQH A;  3EFS A;  2EFI A;  3FEO A;  2XHC A;  3BW1 A;  4WF2 A;  2PUO B;  1IRE B;  2FL7 A;  1VQL A;  3OBY A;  2A3L A;  2HQX A;  3CCR T;  3KUF A;  3CCV T;  4RMO A;  4A53 A;  1YJN T;  3V8K A;  4J6Y A;  5A0L A;  1QVP A;  1YIJ T;  5LJ3 h;  1Q86 U;  2JNG A;  2Y4Y A;  3L2V A;  2WAC A;  3BDL A;  3HRS A;  4IUP A;  4JS5 A;  3SFM A;  4O6J A;  3OYI A;  3L42 A;  2EAY A;  2OTL A;  3VYG A;  1VQL T;  4TVR A;  1Q82 C;  4M7D C;  4J5Y A;  2DXU A;  2QQB A;  3BDU A;  1K9M C;  2MAM A;  3HP9 A;  3NTH A;  2IVW A;  2X4J A;  5HY6 A;  4DOW A;  1VQO A;  2KSS A;  2RM4 A;  2VYT A;  2IG0 A;  3A8O B;  4A4G A;  4PJO E;  3PMT A;  4JRI A;  4RKU E;  4M75 F;  4F7U A;  5CK9 A;  2KY9 A;  5A2Q E;  3ME9 A;  4OF1 A;  4Y28 E;  4M7A D;  2OTL T;  3DB3 A;  3LW5 E;  1BIA A;  3QKJ A;  3LH0 A;  2CZ0 B;  2XID A;  1YHQ A;  5GAO l;  2M0O A;  4QVD A;  3QHS A;  1YBY A;  2H3J A;  2EYQ A;  1VQO T;  1UGR B;  4BY6 C;  4DOV A;  1U8R A;  5CKF A;  3JCM V;  3RIR A;  1NPR A;  4JRK A;  5CKH A;  4Z02 A;  3A8M B;  1KD1 C;  3FJP A;  4PKC C;  1I5L A;  1UEB A;  3N5B B;  4M78 E;  4J6W A;  2CKK A;  5LJ3 g;  5LJ5 j;  1I8F A;  4JLG A;  5KE2 A;  3JCM e;  3FC3 A;  3JB9 H;  3OS5 A;  3V7S A;  2KAF A;  4LDY A;  2RI3 A;  4M77 A;  1YHQ T;  4M7D B;  1VQ9 A;  4M7A G;  4C92 F;  4A4F A;  3SB2 A;  4QVC A;  1ZHI A;  1Y07 A;  1V29 B;  2DPP B;  2RJF A;  5FU6 C;  3LYI A;  1IZ6 A;  4M77 E;  3URG A;  3VUB A;  2XKO C;  4E47 A;  1H3Z A;  3PNW C;  4L59 A;  4BB7 A;  4HCB A;  2XDD A;  1Q7Y C;  3L2Q A;  1LNX A;  1UB4 A;  2DTI A;  2CZ7 B;  1XNI A;  4BI3 A;  4QQG A;  3G7Z A;  3CCM A;  1G3T A;  3FRN A;  3QSU A;  4M7D D;  2PVD B;  3ZBD A;  4XTV A;  3OW2 A;  5LL6 S;  4JLI A;  3QBY A;  2R5A A;  2WSC E;  3RES A;  4N4I A;  5IAY A;  1G5V A;  1G3W A;  2B8A A;  2VC8 A;  3MP1 A;  3SWN A;  4HCZ A;  4HCC A;  3VKI A;  3CCM T;  2FHD A;  1M4Z A;  4QQ6 A;  3OYE A;  2CZ1 B;  4MZT A;  3A8G B;  4OGE A;  4XU0 A;  4OP0 A;  5GAM j;  4QW2 A;  3J80 E;  4JRP A;  2E10 A;  2BKD N;  4M75 A;  4M7D G;  2QQS A;  2XD0 A;  1QVG S;  2XG8 D;  4KBM B;  2QTX A;  2XI9 A;  2QA4 A;  4JJN K;  2RI2 A;  4M75 E;  4OB2 B;  3UT1 A;  3OS0 A;  3CCJ A;  3CCL A;  3A5Z B;  2EJ9 A;  2E6N A;  3F70 A;  3JCM h;  3JB9 I;  4C8Q B;  2KVQ G;  2JVV A;  4ME7 A;  1OYX A;  4E7K A;  1BKB A;  5CKE A;  3CXC S;  3CBM A;  3RMQ A;  2VV5 A;  2XIC A;  2MF2 A;  2VXE A;  4NL3 A;  4HT9 A;  2QA4 T;  1OZ2 A;  3PMI A;  3RKW A;  3WVE B;  3ZFJ A;  3CCJ T;  1Q82 U;  1UGP B;  3CCL T;  4NS5 A;  5C6S A;  1M1F A;  3E9G A;  5GAO r;  2NLU A;  1N27 A;  2CZ6 B;  1Y96 A;  1K8A U;  4IUR A;  4C92 E;  1YIT A;  2X35 A;  2HNI A;  1VQ7 A;  3JCM f;  5CVI A;  2E64 A;  4XQ3 A;  5J26 A;  5IN1 A;  3QG1 A;  5DY9 A;  1N8R U;  1S72 A;  4II1 A;  4F7U F;  3L2R A;  2C06 A;  3JB9 J;  4PJO C;  3GPL A;  3HL8 A;  3CCS A;  4ATO A;  3M54 A;  4HKE A;  1FX7 A;  3M53 A;  4OB0 B;  5D6X A;  3TCJ A;  3OA6 A;  2M1H A;  1KHI A;  2F5T X;  2AHJ B;  2V8I A;  4X34 A;  2X4Y A;  3QYH B;  5LJ5 e;  3DLL A;  5J39 A;  3HRT A;  1UGS B;  2YLB A;  1S72 T;  1NJI U;  4M7A C;  2LX9 A;  3A8H B;  3JCM d;  1N6A A;  5A0G A;  2LCC A;  1M1G A;  5A0D A;  3CCS T;  4M78 C;  2VGM A;  5HK3 A;  3UPU A;  1W2B S;  3CC2 A;  5CIU A;  4BI4 A;  4J7I A;  5CR2 A;  1X6O A;  1D3B A;  1YIJ A;  3OYC A;  3S3N A;  1KQS A;  3JB9 F;  3OS2 A;  2ZPF B;  4E7I A;  4N0A C;  4EMK C;  4M77 C;  3LGF A;  4J8O A;  1K73 U;  4PJO B;  3M57 A;  5GAN j;  3QZ9 B;  3CC2 T;  3GP8 A;  1H64 1;  1M1K C;  3OSS C;  4MDW A;  3M4G A;  4KT0 E;  5GAN 4;  2DXC A;  3HPW A;  2O4X A;  3OBW A;  1XTD A;  5FRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...