5GMKe

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
65
Chain Sequence
VIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
total genus 8
structure length 65
sequence length 65
chains with identical sequence g
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmke00
4XU2A 5DY9A 1MGQA 2DVEA 4M7AD 4M7AA 1U1TA 1I8FA 2HNIA 5GAN7 4OP0A 2DXTA 4M7AE 3JB9G 4F7UE 4PJOF 1I5LA 1B34B 5GANg 3JB9F 5GMKi 4XU3A 4C92B 4EMHA 5LJ5h 3BFMA 3VU3C 2EJFA 3SWNC 1U1SA 4NL3A 1KQ1A 4XU1A 3JCMX 3JCMW 4M7DG 2E10A 1M5Q1 1BIAA 2E65A 5GAOq 4M75E 5GANe 5CAIA 3JCMf 5GAN6 3QUIA 3INZA 4M78E 4EMKC 4M78C 4PJOE 4M7AG 5GAOm 3HSBA 1LJOA 3SB2A 2RA2A 3JCMc 3JB9D 3QO3A 3GIBA 4M75A 4M7DA 4PJOD 5GAOn 4M77D 4M75B 4M75F 3JCMV 4M77A 4M78F 4RCBA 2RB6A 4XTWA 5GMKe 3RESA 2EAYA 4WF2A 2DZCA 2VC8A 1WQ7A 4XQ3A 5GAN8 1KQ2A 4N0AA 1Y96B 3RKXA 4QVDA 4M78B 4EMKA 5GAMe 3EFRA 2K57A 3V7SA 5LJ5g 4M7DF 3JB9J 3JCMP 4PJOC 5GANj 4J5YA 4C92C 1JRIA 3SWNA 4M77G 4NL2A 5GAN3 3FIFA 4EMGA 3JCMb 1JBMA 4C8QD 4M7DE 1I81A 4HA8A 3JCMe 4J6YA 1HXDA 2DTOA 4XTXA 2EWNA 2EJGA 2VXEA 3BDUA 1LNXA 4QVCA 4JLIA 2EJ9A 4JUVA 2QTXA 3BW1A 4XTYA 2YLBA 4X9DA 3BY7A 4M75G 5LJ5d 4M7AC 2YLCA 4XU0A 2CGHA 4J6XA 4N0AC 2RM4A 4C8QC 4C92E 1I4K1 3JCMQ 2DTHA 2DEQA 5GAMj 3AHUA 5GAN2 5GAN4 2E41A 4J6WA 2DTIA 4C92D 4C92A 4MMLA 2DKGA 4C92F 1B34A 3FB9A 4XTVA 3RIRA 3RKWA 1WPYA 4C92G 5GMKj 5GAOl 4PNOA 3JCMg 3QHSA 5LJ3h 5LJ3j 2DXUA 3JCMJ 1HK9A 5GANf 2I2LA 2YHTA 4PJOG 3V8LA 1M8VA 1YCYA 2JN0A 3FJPA 4PJOB 4M77C 1LOJA 4M78A 1N9RA 4M7DD 4C8QE 4M7DB 5LJ3d 4PJOA 3JCMh 3EFSA 3HFNA 5LJ3g 2RD1A 3V8JA 5GAMg 3V8KA 3QSUA 3PGGA 4M78D 1N9SA 4M7AF 2E64A 4F7UB 4F7UF 5LJ5f 4MMKA 4F7UA 5GAOp 5GAMd 3RERA 4C8QG 1Y96A 1D3BB 2VXFA 4XTUA 4DQ2A 3JB9I 1D3BA 2FB7A 2Y90A 3V7CA 5LJ5j 4M77B 3RKYA 5GANh 4M7DC 3M4GA 4NOYA 5GAMf 5I21A 3JB9H 3SWNB 4M77E 1WNLA 4M78G 1TH7A 3JCMd 4C8QA 4V2SA 4A53A 2DZ9A 3HFOA 4A54A 4Y91A 3L1AA 4EMKB 4HT8A 3RUXA 5GMKm 2E1HA 1BIBA 5GMKh 5GAN5 5LJ3e 2DJZA 1X01A 4M75D 4M77F 4RCCA 5LJ3f 4HT9A 4X9CA 4M75C 3L2ZA 4F7UG 4JRKA 2ZGWA 5GAOr 2FYKA 5GMKl 4JRIA 5GAMh 4C8QF 4C8QB 5GANd 4XTZA 1WQWA 1H641 3V7RA 5LJ5e 4M7AB
chains in the Genus database with same CATH superfamily
5GAN7 4B9WA 1R0BG 1VQ6T 2J6KA 1KC8U 1VIFA 4M4ZA 3JCMW 5FLXE 3INZA 4EMKC 3FDRA 2A7YA 3NFCA 2P0QA 2KYMA 3JV3A 1BU1A 2P0PA 5D6XA 4E7JA 3M0PA 3OYYA 3DLMA 3NGPA 4IUVA 3JCMP 1XOVA 1X2QA 5I22A 2COYA 2NWMA 3RBBB 2QXFA 1Q81U 4C8QD 3QPHA 2QG9B 4C0FA 4ATOA 4MZMA 2QYZA 1Q82R 3ASKA 5IHNA 4HVWA 1J3TA 2YLCA 2QA4Q 5IN1A 3OMCA 2KRNA 1YIJT 1UGSB 1MNEA 5CO7A 1NJIR 2DXUA 2DD5A 1C0MA 2A08A 4J7FA 3J81E 1C1AA 4PJLA 2RJEA 2LX9A 3FJPA 1QKWA 8ATCB 7AT1B 5CKHA 1BB9A 1OI1A 3UF4A 4FW2A 5CKDA 4IKFA 4BACA 1YJWQ 3JB9I 1AVZC 5GANh 3LWHA 3M4GA 4LD6A 3G71T 1QKXA 3OA6A 3SWNB 4OMQA 4A53A 3M0RA 4A54A 4HT8A 4E6RA 2V8IA 4M75C 2A36A 4JRQA 3GPLA 1P92A 2ZGWA 2YUNA 5GANd 2ZPBB 3TREA 5LJ5e 4M7AD 2O9VA 2FPFA 3M59A 3M0TA 1A0NB 2DETA 5DM7R 1N27A 2OTJQ 1YJWT 4N4GA 2EW3A 4QKUA 2D9TA 3M0QA 4ANJA 3E9GA 1RABB 3REAB 4Z8AA 2X4WA 3HSBA 2E5QA 3VS6A 4A4GA 4HXJA 1T3LA 2MF2A 3E1SA 3DLLA 1VQMT 2HL5C 1UEBA 3EH1A 1KQ2A 3RKXA 3V7SA 3G4SA 1HD3A 3SWNA 4NL2A 2QI2A 1I5OB 4CI0C 5CCAA 3VS3A 1LNXA 3PIPA 1BCOA 2YT6A 4JRPA 2COZA 2J06A 1I4K1 1C6VX 2VVKA 4BI8B 4FCYA 2OI3A 3TEEA 2RNAA 5M9OA 3E2UA 1QP3A 5GAOl 1B7TA 1M30A 2EBPA 2MWOA 2OJ2A 2MAMA 1K9MU 3CMEA 3CMEQ 1TG0A 4FYYB 2JM8A 3CCLA 1W2BP 4M7AF 4CC7A 1CKBA 5GAOp 1Q95G 4C8QG 1D3BB 3LWIA 1GBQA 2QA4T 3CCMT 1RLQC 2ATCB 2C0OA 2DRKA 4A4FA 2VWFA 4M78G 1PD0A 1WHMA 2JNGA 3QBYA 4KUIA 2ED0A 4IURA 4Y91A 3S3NA 2HSPA 3CMAQ 3EGDB 5GAOr 2DA9A 1I07A 5GAMh 2P0KA 2QQBA 4QVZA 5ECAA 4J9BA 2ZPFB 3MKDA 1TOVA 3GF5A 4R0KA 4XU3A 2EVRA 2E6ZA 4C92B 5LJ5h 3CD6Q 1YHQA 4AT1B 5FU7B 3JCMf 2DRMA 3CQTA 4OF1A 2RQVA 3SFMA 3OBWA 1BYMA 1EX4A 2F5KA 4RCBA 5AT1B 1TSFA 3OYIA 3RESA 2EAYA 1N5ZA 3MPUB 3CCQQ 4DOVA 2DPPB 4WCIA 2P4TA 3EFRA 3PNWC 1YJ9Q 1M3CA 1VQNQ 1JRIA 4Z88A 1ZSGA 1UG1A 4ZN1A 1Q7YR 2DTOA 4JLGA 2JW4A 3X25B 3OW2A 3X26B 4E47A 2FL7A 1OOTA 2LVMA 2YUPA 2LQKA 1OU8A 2DTHA 2D0QB 1QQJA 2F1LA 4OMPA 2DTIA 1U3OA 2X4XA 3VUZA 1YP5A 4C92A 1ZUYA 2LC4A 2ZPIB 1WPYA 3X20B 1UHCA 2J05A 1WIEA 1ARKA 2GNCA 1S72A 1HSQA 1M8VA 4ZGDB 3HFNA 2LQNA 3S6WA 1E7OA 1GFCA 3RERA 2IPOB 3V7CA 1T0HA 2JTFA 2CP2A 4NOYA 1EIFA 3UT1A 2KGTA 2KT8A 3L1AA 4J9GA 1BIBA 5CK9A 5GMKh 2ENMA 4DA4A 2LZ6B 2EYXA 3NTKA 4BI4A 5HKCA 2KXDA 2KRMA 3L2ZA 3L2WA 3QDFA 1K9AA 3X24B 2CZ1B 1H641 5GANg 4XU2A 2E3HA 3JAME 2HSEB 1QLYA 2CREA 1IB8A 4F7UE 4OMNA 2JOYA 2OX7A 2D1XA 1IO6A 2MIOA 3OS5A 4XU1A 1OX9A 4J9FA 1Z9ZA 3I5RA 1JB0E 1NYGA 1IHVA 2RA2A 4BY6B 3M57A 2EYZA 2JZ2A 2A0FB 4MDXA 4M78F 3MEVA 3QJ6A 2M9UA 4OB2B 4R56A 1D1AA 3CC4Q 2RQUA 5C6SA 2F2WA 1N8RU 3SEMA 1UE9A 4EMKA 3LX7A 3EG9A 6AT1B 4JJBA 4BE1A 4FIBA 4FYVB 4EMGA 3UDCA 1MMDA 1TWBA 2KE9A 4J6YA 1ZBXA 4XTXA 2EWNA 2XICA 2EJGA 2A3LA 3HL8A 3OYMA 2KQWA 1JEGA 3I5SA 2E5KA 1VIEA 4HKEA 3LYIA 2CGHA 3CC2T 1RAFB 1VQ7Q 4BY6C 2NUTA 2FO0A 2L0AA 1M3AA 4O5VA 3CPWP 3FB9A 3OYDA 5LJ3j 1S1NA 1R0CB 2GTOA 1HK9A 4IUQA 1YHQT 1Y57A 2QDYB 1WYXA 2C06A 3RR6A 3PGGA 2C0TA 5LJ5f 3MEUA 4C5EA 4A63B 2KAFA 5FRMA 2RQRA 3I55A 3M0SA 4HVUA 3ZEHA 2J6OA 4M7DC 2DL4A 2JJ9A 3CBPA 4L59A 4K11A 4KGVB 1RAIB 2EQIA 3UWNA 5GAN5 2QEXQ 3EG1A 1X01A 3Q1JA 4X9CA 4F7UG 3H0HA 2EYQA 5CKFA 2BKDN 1MMGA 5HK3A 1XJWB 2BUDA 1I8FA 4LN2A 3EH2A 3FJ5A 2GTJA 2OTJT 1ZSZB 2QK0A 1PD1A 1N8RC 2FHDA 2OTLQ 2KYBA 2FZCB 1NG2A 2PVOB 1K8AC 2JM9A 4M7DA 2KEAA 3VYHB 4BI3A 2R5MA 2LQ8A 1PC0A 3CCSQ 1WI7A 2MOXA 2EYWA 1YIJQ 4KGXB 1KC8C 3CCUA 2HD0A 4J5YA 1KSWA 1JBMA 4LE9A 1RAHB 4HA8A 3OW2P 1K9MR 2E4HA 2X3XD 4L6V5 3BDUA 2CP0A 3ZL7C 2EYYA 2YLBA 2HBPA 4F04B 2KDSA 2YUOA 2Z0WA 3JCMQ 1E6GA 3MP1A 3C94A 2PU9B 1IREB 1B34A 1X6GA 5A0LA 2XDDA 4DBHA 3VUBA 2D8JA 1KHIA 3FRNA 1WHKA 1UUEA 1VQOQ 1KJWA 3QJYA 1AWOA 3CC7Q 2EKOA 4M7DB 1LCKA 4ZGEB 4C8QE 2AZVA 4O6JA 1XQHA 1JXOA 1RADB 3QSUA 1PCXA 1D0ZA 1MNDA 1SKUB 4F7UB 2KNBB 2LCLA 1Q7YC 1T3SA 2JMAA 3SHWA 1VQ7T 1K4US 3RKYA 1Q86U 2FZKB 2G6FX 4A4EA 2FPEA 5FU6B 4BDYA 4RUGA 4QT7A 1YBYA 4LUEA 1QVGA 3CCQA 4C5IA 2XIDA 4XAXB 1ABQA 1T0JA 1V1CA 1NEBA 2LT4A 2X4JA 4FSXA 1M2VB 2LT1A 4JZ4A 4FM4B 2DK3A 4JS5A 3M54A 3OS2A 1M1KR 9ATCB 1I5LA 1G2BA 2LCCA 3CD6A 2EJFA 4DBQA 2CH4A 1M9SA 4JZ3A 3R6NA 2E6NA 3IQLA 3CCVA 2F5TX 3GIBA 3QYHB 1WHHA 2DLPA 5C0MA 1VQ4A 1SSFA 2KBTA 4B6MA 1WXUA 5J3BA 2EFIA 2MI6A 2XKOC 4C5GA 4E7LA 2K57A 2RH2A 5KE3A 4JPBW 4N4IA 4ELZC 2RO0A 2YUQA 3DB4A 5FWCA 5AYFA 1E6HA 4J9IA 3RDVA 3G7ZA 1G3WA 1MUZA 4BB7A 2ESWA 1JU5C 1ZA2B 2RMOA 2CYZB 1VA7A 2BZYA 1FX7A 2LTOA 2NUPA 5L23A 1ZUKA 1Q7YU 1NJIC 5KYUB 4PJJA 1PHTA 2F2XA 5LJ3d 3BE3A 2ABLA 3KBGA 2XU8A 4GY5A 3VS4A 4M78D 4AMCA 2PZ1A 2KVQG 2P84A 4F7UA 1W6XA 2H3JA 3VS0A 3QXEB 3I56A 4PFZA 1RI9A 2CSQA 3JCMd 3P8BB 3CCRA 3SDZA 4EMKB 2QEXA 4LD9K 1RLPC 2FZGB 3QZ5B 1W2BS 4KBMB 4PLLA 4JRKA 3R6OA 1OX8A 1BI2A 2K3BA 2M02A 1ZLMA 2DVEA 2SEMA 1TUDA 1K73R 4RTZA 5DLOA 2X35A 1VYUA 2D6FA 5CIUA 1D1BA 4NL3A 1U1SA 4GLKA 1M1KC 1RI0A 2COWA 4ME7A 3PVLA 3WVDB 1Q86C 2XDBA 4ESRA 2RPNA 4ZGJB 2H8HA 2RF0A 3TQ7P 1GBRA 1VQ9T 2XK0A 3WVEB 4KRTA 2IG0A 2O4XB 2OAUA 2DXBA 1ABOA 4IIOA 1W70A 2F69A 2JXBA 1SHFA 2JUFA 4C0GA 4PFOA 1CKAA 1HXDA 1VQOT 2B86A 4FT2A 4OB1B 1D0YA 2EJ9A 5IAYA 4X9DA 1W1FA 1VOMA 2ROLA 3CMAT 1VQ9Q 3CCQT 3NPFA 1BK2A 1XNIA 3G6ET 3CPWS 3M0UA 1FXXA 3CC2Q 1G3TA 2FRYA 2QASA 1K0XA 2XI9A 2KMTA 2FRWA 4J9DA 3RMQA 4RTXA 3PE0A 3LH5A 2FEIA 4M78A 5KCOA 4A4HA 1ZSZA 3H8ZA 1UGQB 2DYBA 1UJYA 3V8KA 1Q82C 1KD1C 4FL6A 2K3XA 2GFUA 1Y96A 3LH0A 3MO8A 1KC8R 5KYWB 3CCMQ 5CKBA 3ULRB 3VS2A 4J9CA 2OTLT 4RTTA 2DZ9A 5GMKm 3H0FA 5LJ3f 3VKIA 2DL5A 3CCST 3CPFA 1VQ5A 4PK4A 1D09B 5CVIA 4M7AE 4B9XA 3CCUQ 5IT9E 1WJQA 3BFMA 4LNPA 3HHTB 3JCMX 3HKSA 1LJOA 1UTIA 5A2QE 1VQLQ 1JO8A 5FRNA 2DIQA 5GAN8 4N0AA 1Y96B 2RHYA 1KHCA 2QA4A 3OS0A 1G3YA 1VQNA 4GBQA 2K3YA 2KK4A 3EHQA 1OPKA 4CC3A 1YI2T 3KUFA 3D7SB 3MCAB 1Z9QA 3BW1A 4C0ZA 1KD1R 1UGRB 5A0GA 2DL3A 2DYIA 3AHUA 5GAN4 4OMMA 2CUDA 2WSEE 3CCVT 4Z02A 1PKTA 2KXCA 1RAEB 1JXMA 2M0OA 1VQPT 1Q81R 2I0NA 1B07A 1SPKA 2K5FA 2HAXA 2JN0A 3KFVA 1N9RA 3QWYA 1SRLA 3NMZC 3EFSA 3T9NA 5LJ3g 1GCPA 2J7IA 3KXTA 4AG2C 5GAMg 3E19A 1YITA 4PLIA 3H41A 1Y0MA 2LRQA 4LUDA 3CCET 1U5SA 4HCZA 2CT3A 3HRTA 4LDYA 3CCRQ 4C5HA 4J9HA 5LJ3e 1OV3A 2JTEA 4HT9A 1VQ4Q 3PFSA 4BD3A 2RN8A 1I0CA 1OEBA 2NYSA 5IXBA 2GCXA 4RTVA 2DXTA 1K76A 2QQRA 3CMAA 5CKEA 1Q86R 1FMKA 2MK5A 1YITQ 2YXYA 4M75E 4M78E 3CC4A 4Q5WA 3OBYA 2CP5A 1H92A 3L2VA 4M75F 4M75B 2AIRB 5KE2A 2MMPA 1GFDA 3A8MB 2KROA 1M1FA 3G6EQ 2VUBA 4M7DF 2B8AA 3CCLQ 5GANj 1QCNA 3OMGA 4JJDA 3CCMA 2DEUA 3CBMA 3I55T 1M27C 4DBRA 2EQJA 1I81A 3A8LB 3WXMB 1X69A 5J26A 4ZN3A 1JQQA 2L3RA 1N6AA 3PMTA 4E7HA 2V1RA 1ZUUA 2DL7A 2D8HA 3BY7A 3QDRB 4OMLA 4J6XA 2ZAEA 2OAWA 1NPPA 2DM1A 2BZXA 4J6WA 2ZPGB 2HKNA 1PRMC 5GMKj 2I2LA 1X43A 2K5IA 2K7AA 3GNGA 2QGFB 4M77C 2LDMA 3FC3A 1TTHB 2BZ8A 1RACB 1AWJA 4HVVA 2EGAA 3UPUA 2V1QA 2VXFA 4XTUA 4DQ2A 2ECZA 4IUTA 2NUZA 5GAMf 4M77E 4F17A 1TH7A 1TUGB 2O2OA 2LMJA 1VQPQ 2LJ3A 3G6EA 1BBZA 2QEXT 4RCCA 3THKA 1OU9A 5KYXA 2GQVA 1R77A 3EAEA 1VQ5Q 2CZ0B 1ACMB 4FU6A 1MGQA 2HNIA 2M51A 1WZOA 4J83A 3A5ZB 2AT1B 1K73C 5GAOq 2FVUA 3QUIA 4R55A 1HJDA 1RL2A 2PVDB 1AEYA 2R5AA 1NLOC 4GLMA 3JB9D 5GAOn 2VC8A 4M78B 3HTRA 4PJOC 2G3RA 5EG2A 5KCHA 2MPXC 1RUWA 1QP2A 5GAN3 3FIFA 2GGRA 4XK8E 2O01E 1VQKQ 4OMOA 4JDSA 4DOWA 3CXCS 1GL5A 1PSFA 4QVCA 2KR3A 2QTXA 3P8HA 2L3SA 1UGVA 4Z89A 1AZGB 4XU0A 4N0AC 2DAQA 2WACA 1X75C 3C12A 2E41A 5CQXA 1UDLA 3M5AA 4C92D 2LNHB 4BE2A 4JS4A 2QGGA 3VS5A 5FROA 4PNOA 1WXTA 3OYNA 3JCMJ 3U23A 3CCEA 1JJ2A 2RHIA 4M7DD 3J7AF 3JCMh 2PUOB 4AFZC 1U06A 3PMIA 3ZFJA 2LCSA 2LQWA 1AT1B 4Y28E 4J7IA 4AFQC 4II1A 5HY6A 1VQ8T 1QVFS 1ZSZC 1YITT 5HCKA 1WNLA 3L2UA 1NBEB 4C8QA 1WHLA 2E1HA 3QWXX 1QMCA 1V29B 1YNZA 1IHWA 2X3WD 3E9FA 3HP9A 2XG8D 2MYSA 4RKUE 1IXDA 2QQ9A 1WX6A 3VRYA 2BTTA 4PJNA 1YCSB 2CP6A 4ZNXA 1UFFA 4PJOF 3I9QA 2CUBA 2DO3A 4ZTJA 1RAGB 3SD4A 1GRIA 3JSCA 3QZ9B 5L8RE 5GAOm 2DBMA 1WA7A 4LDXA 3JCMc 4OGEA 3QO3A 1VQMA 3JCMV 3OW2S 3LGLA 2QAZA 3QIIA 2QQAA 2ZCFB 3OSVA 1YWPA 4XQ3A 3TVTA 1PSEA 3BDLA 3EG9B 4LDUA 4QQ6A 1VQ7A 1NE8A 1PKSA 3A8OB 4RTYA 4Y92A 4RG8A 1X6OA 4KGZB 3CCJQ 1BI3A 1X6BA 1JJ2P 5FU6C 4M7DE 2A28A 3EGXA 1ZBJA 4AG1C 3FEOA 3EGDA 4LXCA 2O88A 1G83A 1M90R 3MHXA 3MP6A 1WHJA 4M7AC 4WTOB 3QG1A 4FYXB 4JJNK 3X28B 2OTJA 3C95A 2P4RA 3RKWA 4C92G 3EFOB 2EIFA 4D8KA 3OY9A 4QW2A 3MP8A 2K9GA 1G5VA 2DIGA 2HZYA 3OYBA 1AD5A 3M4YA 3EG2A 1EFNA 1N9SA 4F7UF 2WSFE 3CCUT 2EKHA 1D3BA 4J9EA 2V8JA 1KG1A 1O9SA 1YJ9T 3O8VA 1VYTA 2KT1A 3A8GB 4RTWA 3CXCA 1BI0A 3OQ5A 2R58A 5DLQE 1M8MA 1QWFA 2FYKA 1O75A 1ZHIA 3PTAA 4QVDA 1UB4A 5LJ5g 5D7UA 3NTIA 3JRZA 2GQIA 1N8RR 1AHJB 2JS0A 5GMKi 3CC7A 4EMHA 3LW5E 3TSWA 4M7DG 2GBQA 2JT4A 1VQ8Q 2ZPHB 1NM7A 5GANe 2VKNA 3EHRA 3SB2A 1W2BA 2CT4A 5D6YA 4PL6A 2SRCA 3EG3A 3I35A 5KYYA 3TU4K 4ZTFA 1M1KU 2AK5A 3AT1B 3OS1A 4M77G 1VQNT 1QVPA 3EG0A 1YJNA 5IXFA 2K2MA 2RK1A 3FLGA 3I55Q 1GXIE 1H3ZA 5KYNA 5KH6A 1TU0B 4JLIA 2EQKA 1YFNA 4C92E 2DERA 3N5BB 1KIKA 4EIKA 2X4YA 2YWWA 1B3QA 4FSSA 3UA7A 3CD6T 3OYCA 1Y7XA 3L2RA 1S72T 3M53A 2RHXA 3EFOA 5GANf 1D0XA 3PVQA 4VUBA 1VQ4T 2RD1A 3MJXA 4YTLA 4F16A 4RMOA 1WJSA 3A98A 1IRXA 3TCJA 5GAMd 1M90C 3A1PA 1FMVA 5LJ5j 2MCNA 3GBQA 3GLXA 3CCJA 4J8OA 4CC2A 1NLPC 2V8KA 4V2SA 1YI2Q 4KULA 2RJCA 1W4SA 1Y07A 3UATA 3GOXA 2L2PA 1YJNT 4HCCA 3UA6A 2L3PA 3VV0A 2HQXA 1M2VA 2QQSA 3CCEQ 2DMOA 1WQWA 3V7RA 1VQKA 1X27A 2KSSA 3EGUA 1OZ2A 3G4SQ 3ER0A 3F70A 1PRLC 4LDVA 3OYFA 3VU3C 1FWZA 3QKJA 1BIAA 2E65A 2XD0A 5GAN6 4HCKA 2BE7D 3O5ZA 1Q82U 3OB9A 4DBFA 1YJNQ 1K0SA 5J39A 4XTWA 2QTVA 1FMWA 2VGNA 2Y4YA 4WF2A 1VQ8A 5EC7A 5GAMe 2F2VA 3I56T 4FT4A 3CXCP 4MDWA 1RAAB 2HDAA 4JJCA 2YRCA 1PNJA 1SG5A 1ZX6A 5FW9A 2VGMA 4M75G 2RM4A 1KK7A 1AWWA 2DEQA 5GJVB 5I2MA 2DILA 2DKGA 2M0YA 1SF9A 1WGSA 2HQHA 3JCMg 4ORZA 4AFSC 2FPDA 2W0ZA 5D6WA 5IHKA 2A37A 5IH2A 4KH1B 1H3HA 1LVKA 4C0DC 2WSCE 3CC4T 1UGPB 1G8XA 4MMKA 1M2OA 2AHJB 2AKKA 1H8KA 1M4ZA 3CCLT 1QW1A 5KYXB 1TXQA 1TS9A 2HCKA 3VS1A 2FG0A 1S72Q 2X51A 4M75D 5I11A 1HYOA 5I21A 1JJ2S 5DY9A 5FWBA 3CC2A 1YJWA 4RG2A 3OYLA 3LGFA 2YRDA 3CPWA 3JB9G 2K2VA 1B34B 3VJPA 3JB9F 1LPLA 2E70A 3SWNC 1KQ1A 4N4HA 1SHGA 2CP7A 4M7AG 3MEWA 1QVFA 4M77A 2RB6A 5GMKe 3GNFB 1SRMA 2DZCA 2O4XA 1VQ9A 1KQSP 1PWTA 1QCFA 4QQDA 1UJ0A 3NTHA 3JB9J 1YJ9A 2KY9A 4OMFB 2XMFA 1IZ6A 2PNIA 2OTLA 4D8DA 3ME9A 4AFUC 4JUVA 5I2SA 3HRSA 3M56A 1EZZB 1WFWA 3CCSA 5LJ5d 2MWPA 4BE0A 1NZ9A 4C8QC 3VRZA 2Y4XA 1YIJA 5GAMj 1VQ5T 2K5LA 4MMLA 1CSKA 1WLPB 4UC4A 4C92F 1MV0B 1VQKT 4XTVA 3RIRA 1TUCA 4RTUA 5LJ3h 2LP5A 2HMAA 3C0CA 1OULA 4OB3B 2YHTA 2AKLA 1LOJA 2KRSA 4PJMA 2E3IA 3CEYA 2PVGB 3V8JA 1F1BB 4CC4B 2EPDA 1AOJA 1OZ3A 2XHCA 4E7IA 2E64A 4F14A 1NPRA 1WJRA 2PUKB 2Y90A 2C0IA 2IVWA 2ROTA 1K9MC 3JB9H 1YI2A 3HFOA 3OYKA 4KUDK 3C4SA 1I1JA 1VQ6A 4IIMA 1UECA 3M9QA 1PM3A 2V26A 2DF6A 4C8QF 4C8QB 4OGCA 4M7AB 4EDUA 4TVRA 2KI7A 4OP0A 2HQEA 2CSIA 2NUPB 5CQYA 1K8AR 1PG5B 2L89A 2BIVA 2JVVA 4CRIA 2O31A 5KYUA 1M5Q1 2ED1A 3G71Q 2DVJA 2RHZA 1AZEA 3OYEA 4M78C 1WHGA 3G1JA 1FYNA 4PKCC 3H6ZA 4PJOD 4DEXA 4C0DB 4MZTA 1VQLT 1WQ7A 1OYXA 1VQ6Q 4HCBA 3G4ST 4E7KA 2RK2A 3GP8A 1K73U 2W10A 3RMSA 2XDPA 1KFZA 4C92C 2M1HA 2DFUA 3P8DA 5KYWA 3JCMb 1QVGP 2CH4W 1NJIU 4IUUA 1OPLA 5A0DA 4D6WA 2VXEA 2RJFA 3OYGA 2CDTA 1QVGS 2HBWA 8AT1B 1M3BA 4NS5A 5CR2A 1XTDA 2M16A 2JTMA 1KQSS 3OYJA 2YRVA 3NHNA 2CP3A 2D0NA 1ZQ1A 2J6FA 3REBB 5GAN2 3EGXB 2K79A 2JMCA 4X34A 3OYHA 3DKMA 1U8RA 4KT0E 5LL6S 2GFAA 3DB3A 3QHSA 2PTKA 4MZPA 4OB0B 4PJOG 3CMET 1VQPA 1SEMA 3V8LA 1QCOA 4PJOB 2O9SA 2IIMA 2LNVA 3L2QA 1MV3A 2RI2A 3M58A 5HK0A 2EQUA 2HL3A 1NYFA 2DD4A 1KD1U 4EPCA 3QYGB 1G3SA 2DL8A 2RI5A 3OSSC 2HKQB 3S3OA 3H9NA 2DE0X 2FB7A 1VQLA 1UHFA 3META 3OYAA 4BDZA 3CCRT 5GJWB 1MMNA 2K4YA 3CCJT 2BE9B 2VB6A 2CS7A 3J80E 2DJZA 4E7SA 2L8DA 4ELYC 4PFPA 2PQWA 3LLRA 5GMKl 1M1GA 3RUXA 1ZA1B 1VYVA 1Y71A 4M7AA 1U1TA 4FYWB 3CCVQ 2CZ6B 4LDWA 2ZPEB 1BKBA 2QDLA 4OVAA 3CBOA 2EGCA 3M55A 1R8OB 2E10A 1QVFP 1VUBA 2RQTA 5FU7C 1GCQC 2VYTA 5CAIA 3PT9A 4PJOE 1WDXA 3HPWA 4M75A 2DNUA 4M77D 2YSQA 1M90U 2YDLA 4X1VA 1IGUA 3HRUA 3G71A 4BUGA 1AWXA 4E2FB 4KH0B 2RHUA 2DX1A 2AZSA 2DJQA 1WXBA 4IUPA 3I56Q 2H3EB 3URGA 5KYYB 1VQOA 2CKKA 2RI3A 3JCMe 2LX7A 2ZZDA 2NUTB 1MHNA 2X9HA 4XTYA 3RNJA 1VQMQ 1YHQQ 1DJ7B 1K1ZA 4FW1A 2L3QA 3VYGA 1GCQA 4QQGA 4A4KA 3ZBDA 3S3MA 1Q81C 2HEQA 2EGEA 2RQWA 1OQKA 2L5QA 2K6DA 1IGQA 2GF7A 1D1CA 2DBKA 3MEAA 3CC7T 1YCYA 2VASA 4PJOA 1NEGA 2DXCA 4E7ZA 1X2KA 2LJ1A 1SSHA 2R57A 3PIOA 4L5GA 1BI1A 2NLUA 2VV5A 1V76A 3H0IA 1K8AU 4M77B 2CZ7B 1YWOA 3A8HB 2EQMA 3TSZA 1BCMA 1QWEA 1YN8A 4P5NA 2LJ0A 2E12A 4M77F 2JS2A 1MMAA 1KQSA 3VS7A 4JRIA 4DEYA 5IHIA 2RJDA 3L42A 4XTZA
chains in the Genus database with same CATH topology
2KSSA 2GCXA 2BUDA 1I8FA 5GAN7 2DXTA 4B9WA 1OZ2A 1VQ6T 2QQRA 3ER0A 3F70A 3CMAA 5CKEA 4LDVA 3OYFA 3VU3C 1KC8U 2OTJT 1VIFA 1FWZA 3JCMW 3QKJA 1BIAA 2E65A 5FLXE 4M75E 1N8RC 2XD0A 5GAN6 4M78E 3INZA 3CC4A 4EMKC 4Q5WA 3FDRA 3OBYA 2A7YA 2FHDA 3NFCA 1Q82U 1K8AC 2PVOB 2P0QA 3OB9A 4M7DA 3L2VA 3VYHB 4M75F 4M75B 5J39A 2P0PA 4XTWA 5D6XA 4BI3A 2R5MA 5KE2A 2LQ8A 4E7JA 2MMPA 2VGNA 2Y4YA 4WF2A 1VQ8A 3A8MB 3OYYA 1M1FA 3DLMA 4IUVA 2VUBA 5GAMe 4M7DF 2B8AA 1KC8C 3CCUA 1XOVA 2HD0A 3I56T 4FT4A 4J5YA 3JCMP 3OMGA 5GANj 4MDWA 3CCMA 3CBMA 1JBMA 3I55T 1Q81U 2QXFA 4C8QD 2EQJA 1I81A 3A8LB 4HA8A 3WXMB 5J26A 3QPHA 4ZN3A 4C0FA 2L3RA 4ATOA 4L6V5 1N6AA 3BDUA 4MZMA 3PMTA 4E7HA 3ASKA 2YLBA 3BY7A 3QDRB 2VGMA 4M75G 2HBPA 2KDSA 2YLCA 4J6XA 2RM4A 3JCMQ 2DEQA 1NPPA 3MP1A 5IN1A 3C94A 3OMCA 4J6WA 2ZPGB 1YIJT 2PU9B 5I2MA 2DKGA 1UGSB 1IREB 1B34A 5A0LA 5CO7A 1WGSA 5GMKj 2XDDA 3VUBA 3JCMg 1KHIA 3FRNA 2DXUA 2DD5A 2I2LA 5D6WA 3QJYA 2K5IA 4J7FA 3J81E 2RJEA 2LX9A 3FJPA 3GNGA 2EKOA 4M77C 4M7DB 4ZGEB 4C8QE 2LDMA 4O6JA 1XQHA 5CKHA 4C0DC 3FC3A 2WSCE 3CC4T 1UGPB 3QSUA 1OI1A 4F7UB 5CKDA 4MMKA 4IKFA 2LCLA 1Q7YC 2AHJB 4BACA 3UPUA 2VXFA 4XTUA 4DQ2A 3JB9I 1VQ7T 3RKYA 4IUTA 1M4ZA 5GANh 3M4GA 3LWHA 4LD6A 3G71T 1Q86U 3CCLT 5GAMf 3OA6A 3SWNB 1QW1A 4M77E 5FU6B 4A4EA 4BDYA 4E7KA 1YBYA 1TH7A 4A53A 4A54A 1QVGA 4HT8A 3CCQA 4C5IA 3G6EA 4M75D 2V8IA 2QEXT 4RCCA 2XIDA 4M75C 4JRQA 4XAXB 3GPLA 3CC2A 1P92A 2ZGWA 2GQVA 2LT4A 2X4JA 4FSXA 5GANd 3EAEA 5I21A 2ZPBB 2CZ0B 3TREA 5LJ5e 1JJ2S 2LT1A 4FU6A 1MGQA 5DY9A 4FM4B 2DK3A 4JS5A 2HNIA 3M54A 4RG2A 3OS2A 3M59A 1YJWA 3OYLA 3LGFA 3CPWA 3JB9G 2K2VA 5DM7R 1N27A 1I5LA 1YJWT 1B34B 3A5ZB 4J83A 4N4GA 3VJPA 3JB9F 4M7AD 2LCCA 1K73C 3CD6A 2EJFA 2E70A 3SWNC 1KQ1A 4N4HA 2D9TA 1M9SA 5GAOq 3E9GA 2FVUA 3QUIA 2E6NA 4R55A 4M7AG 3MEWA 2X4WA 1RL2A 2F5TX 2PVDB 2E5QA 3CCVA 3HSBA 2R5AA 4A4GA 3JB9D 3GIBA 1QVFA 3QYHB 5GAOn 2MF2A 5C0MA 4M77A 3E1SA 3DLLA 2RB6A 1VQMT 5GMKe 1VQ4A 1SSFA 3GNFB 1UEBA 2DZCA 2O4XA 2VC8A 1KQ2A 5J3BA 1VQ9A 3RKXA 1VQ7A 2EFIA 4M78B 4QQDA 2MI6A 2XKOC 3NTHA 4C5GA 3V7SA 2K57A 2RH2A 4E7LA 5KE3A 3JB9J 4PJOC 2G3RA 5EG2A 3G4SA 5KCHA 1YJ9A 4N4IA 3SWNA 1QP2A 4NL2A 5GAN3 2QI2A 2RO0A 2KY9A 3FIFA 4ELZC 4XK8E 4OMFB 2O01E 4CI0C 3DB4A 5AYFA 5CCAA 4JDSA 1IZ6A 4KUDK 2OTLA 4DOWA 3CXCS 3G7ZA 1G3WA 1LNXA 3ME9A 1PSFA 4QVCA 4JUVA 2QTXA 5I2SA 3PIPA 3P8HA 3HRSA 3M56A 4BB7A 4JRPA 3CCSA 5LJ5d 2MWPA 4BE0A 1NZ9A 4XU0A 4N0AC 4C8QC 2DAQA 2WACA 1I4K1 2CYZB 1X75C 2Y4XA 3C12A 4BI8B 5GAMj 1YIJA 1VQ5T 1FX7A 3TEEA 2E41A 2LTOA 5CQXA 2K5LA 3M5AA 4C92D 4MMLA 4UC4A 4C92F 5M9OA 1VQKT 4BE2A 4XTVA 3RIRA 5HK3A 4JS4A 1QP3A 5FROA 4PNOA 5GAOl 1Q7YU 5LJ3h 3OYNA 2MWOA 1NJIC 3JCMJ 4OB3B 2MAMA 2YHTA 1K9MU 3CCEA 1JJ2A 2RHIA 1LOJA 3CMEA 4M7DD 5LJ3d 3J7AF 3JCMh 2PUOB 3CEYA 2PVGB 3CCLA 3V8JA 3KBGA 2XU8A 4GY5A 4M78D 1OZ3A 4E7IA 2XHCA 2KVQG 2E64A 4M7AF 1NPRA 3PMIA 3ZFJA 4F7UA 5GAOp 1WJRA 4C8QG 1D3BB 4Y28E 3LWIA 4J7IA 2H3JA 2PUKB 2Y90A 2QA4T 3QXEB 4II1A 2IVWA 3I56A 5HY6A 3CCMT 1VQ8T 1K9MC 3JB9H 1QVFS 1YITT 3L2UA 1WNLA 4A4FA 1YI2A 4M78G 3JCMd 3P8BB 4C8QA 3CCRA 2JNGA 3QBYA 3HFOA 4KUIA 3SDZA 4Y91A 4IURA 4EMKB 3OYKA 3C4SA 2QEXA 2E1HA 3S3NA 4LD9K 1VQ6A 3QZ5B 1W2BS 4KBMB 1V29B 3M9QA 4PLLA 4JRKA 3R6OA 3E9FA 3HP9A 5GAOr 1BI2A 2XG8D 5GAMh 4C8QF 4RKUE 4C8QB 2QQ9A 4OGCA 2P0KA 2QQBA 4QVZA 4M7AB 2DVEA 4EDUA 4TVRA 2ZPFB 2HQEA 4OP0A 5CQYA 4PJOF 3GF5A 5DLOA 2X35A 4XU3A 2DO3A 2E6ZA 4C92B 2L89A 5CIUA 5LJ5h 4ZTJA 2D6FA 2BIVA 2JVVA 4NL3A 1U1SA 1YHQA 4GLKA 1M1KC 4CRIA 5FU7B 1RI0A 1M5Q1 3SD4A 3JCMf 2RHZA 3JSCA 3OYEA 4M78C 4ME7A 3QZ9B 5L8RE 5GAOm 4OF1A 3WVDB 1Q86C 2XDBA 4LDXA 3JCMc 4OGEA 3QO3A 4PKCC 3SFMA 3H6ZA 3OBWA 4ZGJB 1VQMA 4PJOD 1BYMA 3JCMV 3OW2S 3LGLA 2F5KA 3QIIA 4RCBA 2QQAA 3OYIA 1VQ9T 2ZCFB 2EAYA 3OSVA 4MZTA 3RESA 4C0DB 1VQLT 2XK0A 1WQ7A 4XQ3A 3WVEB 2IG0A 1OYXA 2O4XB 1PSEA 2OAUA 3BDLA 2DXBA 4LDUA 4QQ6A 4DOVA 3G4ST 2RK2A 3GP8A 2DPPB 1NE8A 2P4TA 3A8OB 3EFRA 2XDPA 3PNWC 3RMSA 1K73U 4RG8A 4C92C 2M1HA 1JRIA 1X6OA 2F69A 3P8DA 1BI3A 3JCMb 4ZN1A 1NJIU 4IUUA 5FU6C 4M7DE 2JUFA 4C0GA 5A0DA 4D6WA 1HXDA 2DTOA 1VQOT 2VXEA 4FT2A 2RJFA 4JLGA 3OYGA 4OB1B 1QVGS 2EJ9A 3FEOA 5IAYA 4X9DA 3X25B 3OW2A 4NS5A 5CR2A 3MHXA 1XTDA 2M16A 3MP6A 2JTMA 3X26B 4E47A 2FL7A 1KQSS 3CMAT 2LVMA 3CCQT 4M7AC 3OYJA 1XNIA 2YRVA 3QG1A 2LQKA 3G6ET 3CPWS 2DTHA 1ZQ1A 2D0QB 5GAN2 1FXXA 1G3TA 2DTIA 4X34A 4C92A 2X4XA 3VUZA 2XI9A 2KMTA 3X28B 3DKMA 3OYHA 4JJNK 2LC4A 4KT0E 5LL6S 1U8RA 2GFAA 2OTJA 3C95A 2ZPIB 3RKWA 1WPYA 4C92G 3X20B 3RMQA 3DB3A 3QHSA 4MZPA 4OB0B 2EIFA 3OY9A 4QW2A 4PJOG 3CMET 3MP8A 1VQPA 1S72A 3V8LA 1G5VA 2DIGA 1M8VA 3OYBA 4PJOB 4ZGDB 4M78A 2LNVA 3L2QA 5KCOA 4A4HA 3HFNA 2RI2A 3M58A 3M4YA 3H8ZA 1UGQB 5HK0A 3V8KA 2EQUA 1Q82C 3S6WA 2DD4A 1KD1U 1N9SA 4EPCA 4F7UF 4FL6A 2K3XA 1KD1C 3QYGB 1G3SA 2RI5A 2WSFE 2GFUA 3OSSC 1Y96A 3RERA 3LH0A 3MO8A 3CCUT 3S3OA 1D3BA 2FB7A 3V7CA 1VQLA 2V8JA 1KG1A 3META 1O9SA 2JTFA 3OYAA 4BDZA 4NOYA 1YJ9T 3CCRT 3O8VA 5CKBA 1EIFA 3A8GB 3UT1A 2K4YA 3CXCA 3CCJT 2OTLT 2DZ9A 2CS7A 3L1AA 5GMKm 1BI0A 1BIBA 5CK9A 3OQ5A 5GMKh 3J80E 4DA4A 2R58A 5DLQE 2DJZA 5LJ3f 2L8DA 4BI4A 3NTKA 4ELYC 2PQWA 5HKCA 3L2ZA 3L2WA 3VKIA 2FYKA 3CCST 3LLRA 5GMKl 1M1GA 1O75A 1ZHIA 3X24B 3PTAA 2CZ1B 1UB4A 1H641 3CPFA 3RUXA 3NTIA 3JRZA 4QVDA 4XU2A 5LJ5g 1Y71A 5GANg 1VQ5A 4M7AA 1U1TA 3JAME 1AHJB 5CVIA 4M7AE 2CZ6B 4F7UE 4B9XA 4LDWA 2ZPEB 5GMKi 1BKBA 2JOYA 5IT9E 4OVAA 3CC7A 4EMHA 1WJQA 3BFMA 3OS5A 3LW5E 3CBOA 4M7DG 3HHTB 4XU1A 3JCMX 3M55A 1R8OB 2E10A 2ZPHB 1VUBA 3HKSA 5FU7C 2VYTA 1JB0E 5GANe 3PT9A 5CAIA 4PJOE 1LJOA 3SB2A 2RA2A 4BY6B 1W2BA 3M57A 3HPWA 2JZ2A 5A2QE 4M75A 5D6YA 4M77D 4PL6A 1M90U 4MDXA 4M78F 3MEVA 3QJ6A 2M9UA 4OB2B 4R56A 5FRNA 2DIQA 5GAN8 3HRUA 3G71A 4BUGA 4N0AA 5C6SA 3TU4K 1N8RU 1Y96B 2RHYA 4ZTFA 1KHCA 4EMKA 1M1KU 2RHUA 3LX7A 2QA4A 3OS0A 1G3YA 1VQNA 4BE1A 3OS1A 2K3YA 2KK4A 4HCBA 4FIBA 4M77G 1VQNT 1QVPA 4EMGA 1YI2T 4IUPA 3UDCA 1YJNA 3URGA 3KUFA 1VQOA 2CKKA 2RI3A 2RK1A 3JCMe 3FLGA 1ZBXA 4J6YA 1GXIE 4XTXA 1H3ZA 2EWNA 2XICA 2EJGA 5KH6A 2ZZDA 2A3LA 1MHNA 3MCAB 3HL8A 4JLIA 2KQWA 3OYMA 2EQKA 3BW1A 4XTYA 1VIEA 4HKEA 4C0ZA 3LYIA 1DJ7B 1UGRB 5A0GA 2CGHA 3VYGA 4C92E 3CC2T 4QQGA 4A4KA 3ZBDA 3S3MA 4BY6C 5GAN4 1Q81C 3AHUA 3N5BB 2X4YA 2WSEE 4O5VA 3CCVT 3CD6T 4Z02A 3FB9A 3OYCA 1Y7XA 2L5QA 3OYDA 3L2RA 5LJ3j 2M0OA 1VQPT 1S72T 2GF7A 2RHXA 3M53A 1HK9A 5GANf 3MEAA 2K5FA 4IUQA 3CC7T 2HAXA 1YCYA 2JN0A 1YHQT 1N9RA 4PJOA 4VUBA 2QDYB 3EFSA 3T9NA 5LJ3g 1VQ4T 2DXCA 2RD1A 5GAMg 4YTLA 3KXTA 2C06A 3E19A 1YITA 4PLIA 3PGGA 2R57A 3PIOA 4L5GA 5LJ5f 3MEUA 1WJSA 1BI1A 2LRQA 4C5EA 4RMOA 2NLUA 2KAFA 3CCET 3TCJA 5GAMd 1M90C 2VV5A 3I55A 5FRMA 4HCZA 3ZEHA 1K8AU 5LJ5j 4M77B 4M7DC 2CZ7B 3CBPA 3HRTA 4L59A 3GLXA 4LDYA 3CCJA 3A8HB 4J8OA 4C5HA 2EQMA 2V8KA 4V2SA 4KULA 2RJCA 4P5NA 1W4SA 1Y07A 3UWNA 2E12A 5GAN5 5LJ3e 3GOXA 4M77F 1X01A 1YJNT 3Q1JA 4HCCA 4HT9A 4X9CA 1KQSA 4F7UG 2EYQA 5CKFA 3PFSA 3VV0A 4JRIA 2BKDN 2HQXA 2RJDA 2QQSA 3L42A 4BD3A 4XTZA 1WQWA 3V7RA 1VQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XU2 A;  5DY9 A;  1MGQ A;  2DVE A;  4M7A D;  4M7A A;  1U1T A;  1I8F A;  2HNI A;  5GAN 7;  4OP0 A;  2DXT A;  4M7A E;  3JB9 G;  4F7U E;  4PJO F;  1I5L A;  1B34 B;  5GAN g;  3JB9 F;  5GMK i;  4XU3 A;  4C92 B;  4EMH A;  5LJ5 h;  3BFM A;  3VU3 C;  2EJF A;  3SWN C;  1U1S A;  4NL3 A;  1KQ1 A;  4XU1 A;  3JCM X;  3JCM W;  4M7D G;  2E10 A;  1M5Q 1;  1BIA A;  2E65 A;  5GAO q;  4M75 E;  5GAN e;  5CAI A;  3JCM f;  5GAN 6;  3QUI A;  3INZ A;  4M78 E;  4EMK C;  4M78 C;  4PJO E;  4M7A G;  5GAO m;  3HSB A;  1LJO A;  3SB2 A;  2RA2 A;  3JCM c;  3JB9 D;  3QO3 A;  3GIB A;  4M75 A;  4M7D A;  4PJO D;  5GAO n;  4M77 D;  4M75 B;  4M75 F;  3JCM V;  4M77 A;  4M78 F;  4RCB A;  2RB6 A;  4XTW A;  5GMK e;  3RES A;  2EAY A;  4WF2 A;  2DZC A;  2VC8 A;  1WQ7 A;  4XQ3 A;  5GAN 8;  1KQ2 A;  4N0A A;  1Y96 B;  3RKX A;  4QVD A;  4M78 B;  4EMK A;  5GAM e;  3EFR A;  2K57 A;  3V7S A;  5LJ5 g;  4M7D F;  3JB9 J;  3JCM P;  4PJO C;  5GAN j;  4J5Y A;  4C92 C;  1JRI A;  3SWN A;  4M77 G;  4NL2 A;  5GAN 3;  3FIF A;  4EMG A;  3JCM b;  1JBM A;  4C8Q D;  4M7D E;  1I81 A;  4HA8 A;  3JCM e;  4J6Y A;  1HXD A;  2DTO A;  4XTX A;  2EWN A;  2EJG A;  2VXE A;  3BDU A;  1LNX A;  4QVC A;  4JLI A;  2EJ9 A;  4JUV A;  2QTX A;  3BW1 A;  4XTY A;  2YLB A;  4X9D A;  3BY7 A;  4M75 G;  5LJ5 d;  4M7A C;  2YLC A;  4XU0 A;  2CGH A;  4J6X A;  4N0A C;  2RM4 A;  4C8Q C;  4C92 E;  1I4K 1;  3JCM Q;  2DTH A;  2DEQ A;  5GAM j;  3AHU A;  5GAN 2;  5GAN 4;  2E41 A;  4J6W A;  2DTI A;  4C92 D;  4C92 A;  4MML A;  2DKG A;  4C92 F;  1B34 A;  3FB9 A;  4XTV A;  3RIR A;  3RKW A;  1WPY A;  4C92 G;  5GMK j;  5GAO l;  4PNO A;  3JCM g;  3QHS A;  5LJ3 h;  5LJ3 j;  2DXU A;  3JCM J;  1HK9 A;  5GAN f;  2I2L A;  2YHT A;  4PJO G;  3V8L A;  1M8V A;  1YCY A;  2JN0 A;  3FJP A;  4PJO B;  4M77 C;  1LOJ A;  4M78 A;  1N9R A;  4M7D D;  4C8Q E;  4M7D B;  5LJ3 d;  4PJO A;  3JCM h;  3EFS A;  3HFN A;  5LJ3 g;  2RD1 A;  3V8J A;  5GAM g;  3V8K A;  3QSU A;  3PGG A;  4M78 D;  1N9S A;  4M7A F;  2E64 A;  4F7U B;  4F7U F;  5LJ5 f;  4MMK A;  4F7U A;  5GAO p;  5GAM d;  3RER A;  4C8Q G;  1Y96 A;  1D3B B;  2VXF A;  4XTU A;  4DQ2 A;  3JB9 I;  1D3B A;  2FB7 A;  2Y90 A;  3V7C A;  5LJ5 j;  4M77 B;  3RKY A;  5GAN h;  4M7D C;  3M4G A;  4NOY A;  5GAM f;  5I21 A;  3JB9 H;  3SWN B;  4M77 E;  1WNL A;  4M78 G;  1TH7 A;  3JCM d;  4C8Q A;  4V2S A;  4A53 A;  2DZ9 A;  3HFO A;  4A54 A;  4Y91 A;  3L1A A;  4EMK B;  4HT8 A;  3RUX A;  5GMK m;  2E1H A;  1BIB A;  5GMK h;  5GAN 5;  5LJ3 e;  2DJZ A;  1X01 A;  4M75 D;  4M77 F;  4RCC A;  5LJ3 f;  4HT9 A;  4X9C A;  4M75 C;  3L2Z A;  4F7U G;  4JRK A;  2ZGW A;  5GAO r;  2FYK A;  5GMK l;  4JRI A;  5GAM h;  4C8Q F;  4C8Q B;  5GAN d;  4XTZ A;  1WQW A;  1H64 1;  3V7R A;  5LJ5 e;  4M7A B; 
#chains in the Genus database with same CATH topology
 5GAN 7;  4B9W A;  1R0B G;  1VQ6 T;  2J6K A;  1KC8 U;  1VIF A;  4M4Z A;  3JCM W;  5FLX E;  3INZ A;  4EMK C;  3FDR A;  2A7Y A;  3NFC A;  2P0Q A;  2KYM A;  3JV3 A;  1BU1 A;  2P0P A;  5D6X A;  4E7J A;  3M0P A;  3OYY A;  3DLM A;  3NGP A;  4IUV A;  3JCM P;  1XOV A;  1X2Q A;  5I22 A;  2COY A;  2NWM A;  3RBB B;  2QXF A;  1Q81 U;  4C8Q D;  3QPH A;  2QG9 B;  4C0F A;  4ATO A;  4MZM A;  2QYZ A;  1Q82 R;  3ASK A;  5IHN A;  4HVW A;  1J3T A;  2YLC A;  2QA4 Q;  5IN1 A;  3OMC A;  2KRN A;  1YIJ T;  1UGS B;  1MNE A;  5CO7 A;  1NJI R;  2DXU A;  2DD5 A;  1C0M A;  2A08 A;  4J7F A;  3J81 E;  1C1A A;  4PJL A;  2RJE A;  2LX9 A;  3FJP A;  1QKW A;  8ATC B;  7AT1 B;  5CKH A;  1BB9 A;  1OI1 A;  3UF4 A;  4FW2 A;  5CKD A;  4IKF A;  4BAC A;  1YJW Q;  3JB9 I;  1AVZ C;  5GAN h;  3LWH A;  3M4G A;  4LD6 A;  3G71 T;  1QKX A;  3OA6 A;  3SWN B;  4OMQ A;  4A53 A;  3M0R A;  4A54 A;  4HT8 A;  4E6R A;  2V8I A;  4M75 C;  2A36 A;  4JRQ A;  3GPL A;  1P92 A;  2ZGW A;  2YUN A;  5GAN d;  2ZPB B;  3TRE A;  5LJ5 e;  4M7A D;  2O9V A;  2FPF A;  3M59 A;  3M0T A;  1A0N B;  2DET A;  5DM7 R;  1N27 A;  2OTJ Q;  1YJW T;  4N4G A;  2EW3 A;  4QKU A;  2D9T A;  3M0Q A;  4ANJ A;  3E9G A;  1RAB B;  3REA B;  4Z8A A;  2X4W A;  3HSB A;  2E5Q A;  3VS6 A;  4A4G A;  4HXJ A;  1T3L A;  2MF2 A;  3E1S A;  3DLL A;  1VQM T;  2HL5 C;  1UEB A;  3EH1 A;  1KQ2 A;  3RKX A;  3V7S A;  3G4S A;  1HD3 A;  3SWN A;  4NL2 A;  2QI2 A;  1I5O B;  4CI0 C;  5CCA A;  3VS3 A;  1LNX A;  3PIP A;  1BCO A;  2YT6 A;  4JRP A;  2COZ A;  2J06 A;  1I4K 1;  1C6V X;  2VVK A;  4BI8 B;  4FCY A;  2OI3 A;  3TEE A;  2RNA A;  5M9O A;  3E2U A;  1QP3 A;  5GAO l;  1B7T A;  1M30 A;  2EBP A;  2MWO A;  2OJ2 A;  2MAM A;  1K9M U;  3CME A;  3CME Q;  1TG0 A;  4FYY B;  2JM8 A;  3CCL A;  1W2B P;  4M7A F;  4CC7 A;  1CKB A;  5GAO p;  1Q95 G;  4C8Q G;  1D3B B;  3LWI A;  1GBQ A;  2QA4 T;  3CCM T;  1RLQ C;  2ATC B;  2C0O A;  2DRK A;  4A4F A;  2VWF A;  4M78 G;  1PD0 A;  1WHM A;  2JNG A;  3QBY A;  4KUI A;  2ED0 A;  4IUR A;  4Y91 A;  3S3N A;  2HSP A;  3CMA Q;  3EGD B;  5GAO r;  2DA9 A;  1I07 A;  5GAM h;  2P0K A;  2QQB A;  4QVZ A;  5ECA A;  4J9B A;  2ZPF B;  3MKD A;  1TOV A;  3GF5 A;  4R0K A;  4XU3 A;  2EVR A;  2E6Z A;  4C92 B;  5LJ5 h;  3CD6 Q;  1YHQ A;  4AT1 B;  5FU7 B;  3JCM f;  2DRM A;  3CQT A;  4OF1 A;  2RQV A;  3SFM A;  3OBW A;  1BYM A;  1EX4 A;  2F5K A;  4RCB A;  5AT1 B;  1TSF A;  3OYI A;  3RES A;  2EAY A;  1N5Z A;  3MPU B;  3CCQ Q;  4DOV A;  2DPP B;  4WCI A;  2P4T A;  3EFR A;  3PNW C;  1YJ9 Q;  1M3C A;  1VQN Q;  1JRI A;  4Z88 A;  1ZSG A;  1UG1 A;  4ZN1 A;  1Q7Y R;  2DTO A;  4JLG A;  2JW4 A;  3X25 B;  3OW2 A;  3X26 B;  4E47 A;  2FL7 A;  1OOT A;  2LVM A;  2YUP A;  2LQK A;  1OU8 A;  2DTH A;  2D0Q B;  1QQJ A;  2F1L A;  4OMP A;  2DTI A;  1U3O A;  2X4X A;  3VUZ A;  1YP5 A;  4C92 A;  1ZUY A;  2LC4 A;  2ZPI B;  1WPY A;  3X20 B;  1UHC A;  2J05 A;  1WIE A;  1ARK A;  2GNC A;  1S72 A;  1HSQ A;  1M8V A;  4ZGD B;  3HFN A;  2LQN A;  3S6W A;  1E7O A;  1GFC A;  3RER A;  2IPO B;  3V7C A;  1T0H A;  2JTF A;  2CP2 A;  4NOY A;  1EIF A;  3UT1 A;  2KGT A;  2KT8 A;  3L1A A;  4J9G A;  1BIB A;  5CK9 A;  5GMK h;  2ENM A;  4DA4 A;  2LZ6 B;  2EYX A;  3NTK A;  4BI4 A;  5HKC A;  2KXD A;  2KRM A;  3L2Z A;  3L2W A;  3QDF A;  1K9A A;  3X24 B;  2CZ1 B;  1H64 1;  5GAN g;  4XU2 A;  2E3H A;  3JAM E;  2HSE B;  1QLY A;  2CRE A;  1IB8 A;  4F7U E;  4OMN A;  2JOY A;  2OX7 A;  2D1X A;  1IO6 A;  2MIO A;  3OS5 A;  4XU1 A;  1OX9 A;  4J9F A;  1Z9Z A;  3I5R A;  1JB0 E;  1NYG A;  1IHV A;  2RA2 A;  4BY6 B;  3M57 A;  2EYZ A;  2JZ2 A;  2A0F B;  4MDX A;  4M78 F;  3MEV A;  3QJ6 A;  2M9U A;  4OB2 B;  4R56 A;  1D1A A;  3CC4 Q;  2RQU A;  5C6S A;  2F2W A;  1N8R U;  3SEM A;  1UE9 A;  4EMK A;  3LX7 A;  3EG9 A;  6AT1 B;  4JJB A;  4BE1 A;  4FIB A;  4FYV B;  4EMG A;  3UDC A;  1MMD A;  1TWB A;  2KE9 A;  4J6Y A;  1ZBX A;  4XTX A;  2EWN A;  2XIC A;  2EJG A;  2A3L A;  3HL8 A;  3OYM A;  2KQW A;  1JEG A;  3I5S A;  2E5K A;  1VIE A;  4HKE A;  3LYI A;  2CGH A;  3CC2 T;  1RAF B;  1VQ7 Q;  4BY6 C;  2NUT A;  2FO0 A;  2L0A A;  1M3A A;  4O5V A;  3CPW P;  3FB9 A;  3OYD A;  5LJ3 j;  1S1N A;  1R0C B;  2GTO A;  1HK9 A;  4IUQ A;  1YHQ T;  1Y57 A;  2QDY B;  1WYX A;  2C06 A;  3RR6 A;  3PGG A;  2C0T A;  5LJ5 f;  3MEU A;  4C5E A;  4A63 B;  2KAF A;  5FRM A;  2RQR A;  3I55 A;  3M0S A;  4HVU A;  3ZEH A;  2J6O A;  4M7D C;  2DL4 A;  2JJ9 A;  3CBP A;  4L59 A;  4K11 A;  4KGV B;  1RAI B;  2EQI A;  3UWN A;  5GAN 5;  2QEX Q;  3EG1 A;  1X01 A;  3Q1J A;  4X9C A;  4F7U G;  3H0H A;  2EYQ A;  5CKF A;  2BKD N;  1MMG A;  5HK3 A;  1XJW B;  2BUD A;  1I8F A;  4LN2 A;  3EH2 A;  3FJ5 A;  2GTJ A;  2OTJ T;  1ZSZ B;  2QK0 A;  1PD1 A;  1N8R C;  2FHD A;  2OTL Q;  2KYB A;  2FZC B;  1NG2 A;  2PVO B;  1K8A C;  2JM9 A;  4M7D A;  2KEA A;  3VYH B;  4BI3 A;  2R5M A;  2LQ8 A;  1PC0 A;  3CCS Q;  1WI7 A;  2MOX A;  2EYW A;  1YIJ Q;  4KGX B;  1KC8 C;  3CCU A;  2HD0 A;  4J5Y A;  1KSW A;  1JBM A;  4LE9 A;  1RAH B;  4HA8 A;  3OW2 P;  1K9M R;  2E4H A;  2X3X D;  4L6V 5;  3BDU A;  2CP0 A;  3ZL7 C;  2EYY A;  2YLB A;  2HBP A;  4F04 B;  2KDS A;  2YUO A;  2Z0W A;  3JCM Q;  1E6G A;  3MP1 A;  3C94 A;  2PU9 B;  1IRE B;  1B34 A;  1X6G A;  5A0L A;  2XDD A;  4DBH A;  3VUB A;  2D8J A;  1KHI A;  3FRN A;  1WHK A;  1UUE A;  1VQO Q;  1KJW A;  3QJY A;  1AWO A;  3CC7 Q;  2EKO A;  4M7D B;  1LCK A;  4ZGE B;  4C8Q E;  2AZV A;  4O6J A;  1XQH A;  1JXO A;  1RAD B;  3QSU A;  1PCX A;  1D0Z A;  1MND A;  1SKU B;  4F7U B;  2KNB B;  2LCL A;  1Q7Y C;  1T3S A;  2JMA A;  3SHW A;  1VQ7 T;  1K4U S;  3RKY A;  1Q86 U;  2FZK B;  2G6F X;  4A4E A;  2FPE A;  5FU6 B;  4BDY A;  4RUG A;  4QT7 A;  1YBY A;  4LUE A;  1QVG A;  3CCQ A;  4C5I A;  2XID A;  4XAX B;  1ABQ A;  1T0J A;  1V1C A;  1NEB A;  2LT4 A;  2X4J A;  4FSX A;  1M2V B;  2LT1 A;  4JZ4 A;  4FM4 B;  2DK3 A;  4JS5 A;  3M54 A;  3OS2 A;  1M1K R;  9ATC B;  1I5L A;  1G2B A;  2LCC A;  3CD6 A;  2EJF A;  4DBQ A;  2CH4 A;  1M9S A;  4JZ3 A;  3R6N A;  2E6N A;  3IQL A;  3CCV A;  2F5T X;  3GIB A;  3QYH B;  1WHH A;  2DLP A;  5C0M A;  1VQ4 A;  1SSF A;  2KBT A;  4B6M A;  1WXU A;  5J3B A;  2EFI A;  2MI6 A;  2XKO C;  4C5G A;  4E7L A;  2K57 A;  2RH2 A;  5KE3 A;  4JPB W;  4N4I A;  4ELZ C;  2RO0 A;  2YUQ A;  3DB4 A;  5FWC A;  5AYF A;  1E6H A;  4J9I A;  3RDV A;  3G7Z A;  1G3W A;  1MUZ A;  4BB7 A;  2ESW A;  1JU5 C;  1ZA2 B;  2RMO A;  2CYZ B;  1VA7 A;  2BZY A;  1FX7 A;  2LTO A;  2NUP A;  5L23 A;  1ZUK A;  1Q7Y U;  1NJI C;  5KYU B;  4PJJ A;  1PHT A;  2F2X A;  5LJ3 d;  3BE3 A;  2ABL A;  3KBG A;  2XU8 A;  4GY5 A;  3VS4 A;  4M78 D;  4AMC A;  2PZ1 A;  2KVQ G;  2P84 A;  4F7U A;  1W6X A;  2H3J A;  3VS0 A;  3QXE B;  3I56 A;  4PFZ A;  1RI9 A;  2CSQ A;  3JCM d;  3P8B B;  3CCR A;  3SDZ A;  4EMK B;  2QEX A;  4LD9 K;  1RLP C;  2FZG B;  3QZ5 B;  1W2B S;  4KBM B;  4PLL A;  4JRK A;  3R6O A;  1OX8 A;  1BI2 A;  2K3B A;  2M02 A;  1ZLM A;  2DVE A;  2SEM A;  1TUD A;  1K73 R;  4RTZ A;  5DLO A;  2X35 A;  1VYU A;  2D6F A;  5CIU A;  1D1B A;  4NL3 A;  1U1S A;  4GLK A;  1M1K C;  1RI0 A;  2COW A;  4ME7 A;  3PVL A;  3WVD B;  1Q86 C;  2XDB A;  4ESR A;  2RPN A;  4ZGJ B;  2H8H A;  2RF0 A;  3TQ7 P;  1GBR A;  1VQ9 T;  2XK0 A;  3WVE B;  4KRT A;  2IG0 A;  2O4X B;  2OAU A;  2DXB A;  1ABO A;  4IIO A;  1W70 A;  2F69 A;  2JXB A;  1SHF A;  2JUF A;  4C0G A;  4PFO A;  1CKA A;  1HXD A;  1VQO T;  2B86 A;  4FT2 A;  4OB1 B;  1D0Y A;  2EJ9 A;  5IAY A;  4X9D A;  1W1F A;  1VOM A;  2ROL A;  3CMA T;  1VQ9 Q;  3CCQ T;  3NPF A;  1BK2 A;  1XNI A;  3G6E T;  3CPW S;  3M0U A;  1FXX A;  3CC2 Q;  1G3T A;  2FRY A;  2QAS A;  1K0X A;  2XI9 A;  2KMT A;  2FRW A;  4J9D A;  3RMQ A;  4RTX A;  3PE0 A;  3LH5 A;  2FEI A;  4M78 A;  5KCO A;  4A4H A;  1ZSZ A;  3H8Z A;  1UGQ B;  2DYB A;  1UJY A;  3V8K A;  1Q82 C;  1KD1 C;  4FL6 A;  2K3X A;  2GFU A;  1Y96 A;  3LH0 A;  3MO8 A;  1KC8 R;  5KYW B;  3CCM Q;  5CKB A;  3ULR B;  3VS2 A;  4J9C A;  2OTL T;  4RTT A;  2DZ9 A;  5GMK m;  3H0F A;  5LJ3 f;  3VKI A;  2DL5 A;  3CCS T;  3CPF A;  1VQ5 A;  4PK4 A;  1D09 B;  5CVI A;  4M7A E;  4B9X A;  3CCU Q;  5IT9 E;  1WJQ A;  3BFM A;  4LNP A;  3HHT B;  3JCM X;  3HKS A;  1LJO A;  1UTI A;  5A2Q E;  1VQL Q;  1JO8 A;  5FRN A;  2DIQ A;  5GAN 8;  4N0A A;  1Y96 B;  2RHY A;  1KHC A;  2QA4 A;  3OS0 A;  1G3Y A;  1VQN A;  4GBQ A;  2K3Y A;  2KK4 A;  3EHQ A;  1OPK A;  4CC3 A;  1YI2 T;  3KUF A;  3D7S B;  3MCA B;  1Z9Q A;  3BW1 A;  4C0Z A;  1KD1 R;  1UGR B;  5A0G A;  2DL3 A;  2DYI A;  3AHU A;  5GAN 4;  4OMM A;  2CUD A;  2WSE E;  3CCV T;  4Z02 A;  1PKT A;  2KXC A;  1RAE B;  1JXM A;  2M0O A;  1VQP T;  1Q81 R;  2I0N A;  1B07 A;  1SPK A;  2K5F A;  2HAX A;  2JN0 A;  3KFV A;  1N9R A;  3QWY A;  1SRL A;  3NMZ C;  3EFS A;  3T9N A;  5LJ3 g;  1GCP A;  2J7I A;  3KXT A;  4AG2 C;  5GAM g;  3E19 A;  1YIT A;  4PLI A;  3H41 A;  1Y0M A;  2LRQ A;  4LUD A;  3CCE T;  1U5S A;  4HCZ A;  2CT3 A;  3HRT A;  4LDY A;  3CCR Q;  4C5H A;  4J9H A;  5LJ3 e;  1OV3 A;  2JTE A;  4HT9 A;  1VQ4 Q;  3PFS A;  4BD3 A;  2RN8 A;  1I0C A;  1OEB A;  2NYS A;  5IXB A;  2GCX A;  4RTV A;  2DXT A;  1K76 A;  2QQR A;  3CMA A;  5CKE A;  1Q86 R;  1FMK A;  2MK5 A;  1YIT Q;  2YXY A;  4M75 E;  4M78 E;  3CC4 A;  4Q5W A;  3OBY A;  2CP5 A;  1H92 A;  3L2V A;  4M75 F;  4M75 B;  2AIR B;  5KE2 A;  2MMP A;  1GFD A;  3A8M B;  2KRO A;  1M1F A;  3G6E Q;  2VUB A;  4M7D F;  2B8A A;  3CCL Q;  5GAN j;  1QCN A;  3OMG A;  4JJD A;  3CCM A;  2DEU A;  3CBM A;  3I55 T;  1M27 C;  4DBR A;  2EQJ A;  1I81 A;  3A8L B;  3WXM B;  1X69 A;  5J26 A;  4ZN3 A;  1JQQ A;  2L3R A;  1N6A A;  3PMT A;  4E7H A;  2V1R A;  1ZUU A;  2DL7 A;  2D8H A;  3BY7 A;  3QDR B;  4OML A;  4J6X A;  2ZAE A;  2OAW A;  1NPP A;  2DM1 A;  2BZX A;  4J6W A;  2ZPG B;  2HKN A;  1PRM C;  5GMK j;  2I2L A;  1X43 A;  2K5I A;  2K7A A;  3GNG A;  2QGF B;  4M77 C;  2LDM A;  3FC3 A;  1TTH B;  2BZ8 A;  1RAC B;  1AWJ A;  4HVV A;  2EGA A;  3UPU A;  2V1Q A;  2VXF A;  4XTU A;  4DQ2 A;  2ECZ A;  4IUT A;  2NUZ A;  5GAM f;  4M77 E;  4F17 A;  1TH7 A;  1TUG B;  2O2O A;  2LMJ A;  1VQP Q;  2LJ3 A;  3G6E A;  1BBZ A;  2QEX T;  4RCC A;  3THK A;  1OU9 A;  5KYX A;  2GQV A;  1R77 A;  3EAE A;  1VQ5 Q;  2CZ0 B;  1ACM B;  4FU6 A;  1MGQ A;  2HNI A;  2M51 A;  1WZO A;  4J83 A;  3A5Z B;  2AT1 B;  1K73 C;  5GAO q;  2FVU A;  3QUI A;  4R55 A;  1HJD A;  1RL2 A;  2PVD B;  1AEY A;  2R5A A;  1NLO C;  4GLM A;  3JB9 D;  5GAO n;  2VC8 A;  4M78 B;  3HTR A;  4PJO C;  2G3R A;  5EG2 A;  5KCH A;  2MPX C;  1RUW A;  1QP2 A;  5GAN 3;  3FIF A;  2GGR A;  4XK8 E;  2O01 E;  1VQK Q;  4OMO A;  4JDS A;  4DOW A;  3CXC S;  1GL5 A;  1PSF A;  4QVC A;  2KR3 A;  2QTX A;  3P8H A;  2L3S A;  1UGV A;  4Z89 A;  1AZG B;  4XU0 A;  4N0A C;  2DAQ A;  2WAC A;  1X75 C;  3C12 A;  2E41 A;  5CQX A;  1UDL A;  3M5A A;  4C92 D;  2LNH B;  4BE2 A;  4JS4 A;  2QGG A;  3VS5 A;  5FRO A;  4PNO A;  1WXT A;  3OYN A;  3JCM J;  3U23 A;  3CCE A;  1JJ2 A;  2RHI A;  4M7D D;  3J7A F;  3JCM h;  2PUO B;  4AFZ C;  1U06 A;  3PMI A;  3ZFJ A;  2LCS A;  2LQW A;  1AT1 B;  4Y28 E;  4J7I A;  4AFQ C;  4II1 A;  5HY6 A;  1VQ8 T;  1QVF S;  1ZSZ C;  1YIT T;  5HCK A;  1WNL A;  3L2U A;  1NBE B;  4C8Q A;  1WHL A;  2E1H A;  3QWX X;  1QMC A;  1V29 B;  1YNZ A;  1IHW A;  2X3W D;  3E9F A;  3HP9 A;  2XG8 D;  2MYS A;  4RKU E;  1IXD A;  2QQ9 A;  1WX6 A;  3VRY A;  2BTT A;  4PJN A;  1YCS B;  2CP6 A;  4ZNX A;  1UFF A;  4PJO F;  3I9Q A;  2CUB A;  2DO3 A;  4ZTJ A;  1RAG B;  3SD4 A;  1GRI A;  3JSC A;  3QZ9 B;  5L8R E;  5GAO m;  2DBM A;  1WA7 A;  4LDX A;  3JCM c;  4OGE A;  3QO3 A;  1VQM A;  3JCM V;  3OW2 S;  3LGL A;  2QAZ A;  3QII A;  2QQA A;  2ZCF B;  3OSV A;  1YWP A;  4XQ3 A;  3TVT A;  1PSE A;  3BDL A;  3EG9 B;  4LDU A;  4QQ6 A;  1VQ7 A;  1NE8 A;  1PKS A;  3A8O B;  4RTY A;  4Y92 A;  4RG8 A;  1X6O A;  4KGZ B;  3CCJ Q;  1BI3 A;  1X6B A;  1JJ2 P;  5FU6 C;  4M7D E;  2A28 A;  3EGX A;  1ZBJ A;  4AG1 C;  3FEO A;  3EGD A;  4LXC A;  2O88 A;  1G83 A;  1M90 R;  3MHX A;  3MP6 A;  1WHJ A;  4M7A C;  4WTO B;  3QG1 A;  4FYX B;  4JJN K;  3X28 B;  2OTJ A;  3C95 A;  2P4R A;  3RKW A;  4C92 G;  3EFO B;  2EIF A;  4D8K A;  3OY9 A;  4QW2 A;  3MP8 A;  2K9G A;  1G5V A;  2DIG A;  2HZY A;  3OYB A;  1AD5 A;  3M4Y A;  3EG2 A;  1EFN A;  1N9S A;  4F7U F;  2WSF E;  3CCU T;  2EKH A;  1D3B A;  4J9E A;  2V8J A;  1KG1 A;  1O9S A;  1YJ9 T;  3O8V A;  1VYT A;  2KT1 A;  3A8G B;  4RTW A;  3CXC A;  1BI0 A;  3OQ5 A;  2R58 A;  5DLQ E;  1M8M A;  1QWF A;  2FYK A;  1O75 A;  1ZHI A;  3PTA A;  4QVD A;  1UB4 A;  5LJ5 g;  5D7U A;  3NTI A;  3JRZ A;  2GQI A;  1N8R R;  1AHJ B;  2JS0 A;  5GMK i;  3CC7 A;  4EMH A;  3LW5 E;  3TSW A;  4M7D G;  2GBQ A;  2JT4 A;  1VQ8 Q;  2ZPH B;  1NM7 A;  5GAN e;  2VKN A;  3EHR A;  3SB2 A;  1W2B A;  2CT4 A;  5D6Y A;  4PL6 A;  2SRC A;  3EG3 A;  3I35 A;  5KYY A;  3TU4 K;  4ZTF A;  1M1K U;  2AK5 A;  3AT1 B;  3OS1 A;  4M77 G;  1VQN T;  1QVP A;  3EG0 A;  1YJN A;  5IXF A;  2K2M A;  2RK1 A;  3FLG A;  3I55 Q;  1GXI E;  1H3Z A;  5KYN A;  5KH6 A;  1TU0 B;  4JLI A;  2EQK A;  1YFN A;  4C92 E;  2DER A;  3N5B B;  1KIK A;  4EIK A;  2X4Y A;  2YWW A;  1B3Q A;  4FSS A;  3UA7 A;  3CD6 T;  3OYC A;  1Y7X A;  3L2R A;  1S72 T;  3M53 A;  2RHX A;  3EFO A;  5GAN f;  1D0X A;  3PVQ A;  4VUB A;  1VQ4 T;  2RD1 A;  3MJX A;  4YTL A;  4F16 A;  4RMO A;  1WJS A;  3A98 A;  1IRX A;  3TCJ A;  5GAM d;  1M90 C;  3A1P A;  1FMV A;  5LJ5 j;  2MCN A;  3GBQ A;  3GLX A;  3CCJ A;  4J8O A;  4CC2 A;  1NLP C;  2V8K A;  4V2S A;  1YI2 Q;  4KUL A;  2RJC A;  1W4S A;  1Y07 A;  3UAT A;  3GOX A;  2L2P A;  1YJN T;  4HCC A;  3UA6 A;  2L3P A;  3VV0 A;  2HQX A;  1M2V A;  2QQS A;  3CCE Q;  2DMO A;  1WQW A;  3V7R A;  1VQK A;  1X27 A;  2KSS A;  3EGU A;  1OZ2 A;  3G4S Q;  3ER0 A;  3F70 A;  1PRL C;  4LDV A;  3OYF A;  3VU3 C;  1FWZ A;  3QKJ A;  1BIA A;  2E65 A;  2XD0 A;  5GAN 6;  4HCK A;  2BE7 D;  3O5Z A;  1Q82 U;  3OB9 A;  4DBF A;  1YJN Q;  1K0S A;  5J39 A;  4XTW A;  2QTV A;  1FMW A;  2VGN A;  2Y4Y A;  4WF2 A;  1VQ8 A;  5EC7 A;  5GAM e;  2F2V A;  3I56 T;  4FT4 A;  3CXC P;  4MDW A;  1RAA B;  2HDA A;  4JJC A;  2YRC A;  1PNJ A;  1SG5 A;  1ZX6 A;  5FW9 A;  2VGM A;  4M75 G;  2RM4 A;  1KK7 A;  1AWW A;  2DEQ A;  5GJV B;  5I2M A;  2DIL A;  2DKG A;  2M0Y A;  1SF9 A;  1WGS A;  2HQH A;  3JCM g;  4ORZ A;  4AFS C;  2FPD A;  2W0Z A;  5D6W A;  5IHK A;  2A37 A;  5IH2 A;  4KH1 B;  1H3H A;  1LVK A;  4C0D C;  2WSC E;  3CC4 T;  1UGP B;  1G8X A;  4MMK A;  1M2O A;  2AHJ B;  2AKK A;  1H8K A;  1M4Z A;  3CCL T;  1QW1 A;  5KYX B;  1TXQ A;  1TS9 A;  2HCK A;  3VS1 A;  2FG0 A;  1S72 Q;  2X51 A;  4M75 D;  5I11 A;  1HYO A;  5I21 A;  1JJ2 S;  5DY9 A;  5FWB A;  3CC2 A;  1YJW A;  4RG2 A;  3OYL A;  3LGF A;  2YRD A;  3CPW A;  3JB9 G;  2K2V A;  1B34 B;  3VJP A;  3JB9 F;  1LPL A;  2E70 A;  3SWN C;  1KQ1 A;  4N4H A;  1SHG A;  2CP7 A;  4M7A G;  3MEW A;  1QVF A;  4M77 A;  2RB6 A;  5GMK e;  3GNF B;  1SRM A;  2DZC A;  2O4X A;  1VQ9 A;  1KQS P;  1PWT A;  1QCF A;  4QQD A;  1UJ0 A;  3NTH A;  3JB9 J;  1YJ9 A;  2KY9 A;  4OMF B;  2XMF A;  1IZ6 A;  2PNI A;  2OTL A;  4D8D A;  3ME9 A;  4AFU C;  4JUV A;  5I2S A;  3HRS A;  3M56 A;  1EZZ B;  1WFW A;  3CCS A;  5LJ5 d;  2MWP A;  4BE0 A;  1NZ9 A;  4C8Q C;  3VRZ A;  2Y4X A;  1YIJ A;  5GAM j;  1VQ5 T;  2K5L A;  4MML A;  1CSK A;  1WLP B;  4UC4 A;  4C92 F;  1MV0 B;  1VQK T;  4XTV A;  3RIR A;  1TUC A;  4RTU A;  5LJ3 h;  2LP5 A;  2HMA A;  3C0C A;  1OUL A;  4OB3 B;  2YHT A;  2AKL A;  1LOJ A;  2KRS A;  4PJM A;  2E3I A;  3CEY A;  2PVG B;  3V8J A;  1F1B B;  4CC4 B;  2EPD A;  1AOJ A;  1OZ3 A;  2XHC A;  4E7I A;  2E64 A;  4F14 A;  1NPR A;  1WJR A;  2PUK B;  2Y90 A;  2C0I A;  2IVW A;  2ROT A;  1K9M C;  3JB9 H;  1YI2 A;  3HFO A;  3OYK A;  4KUD K;  3C4S A;  1I1J A;  1VQ6 A;  4IIM A;  1UEC A;  3M9Q A;  1PM3 A;  2V26 A;  2DF6 A;  4C8Q F;  4C8Q B;  4OGC A;  4M7A B;  4EDU A;  4TVR A;  2KI7 A;  4OP0 A;  2HQE A;  2CSI A;  2NUP B;  5CQY A;  1K8A R;  1PG5 B;  2L89 A;  2BIV A;  2JVV A;  4CRI A;  2O31 A;  5KYU A;  1M5Q 1;  2ED1 A;  3G71 Q;  2DVJ A;  2RHZ A;  1AZE A;  3OYE A;  4M78 C;  1WHG A;  3G1J A;  1FYN A;  4PKC C;  3H6Z A;  4PJO D;  4DEX A;  4C0D B;  4MZT A;  1VQL T;  1WQ7 A;  1OYX A;  1VQ6 Q;  4HCB A;  3G4S T;  4E7K A;  2RK2 A;  3GP8 A;  1K73 U;  2W10 A;  3RMS A;  2XDP A;  1KFZ A;  4C92 C;  2M1H A;  2DFU A;  3P8D A;  5KYW A;  3JCM b;  1QVG P;  2CH4 W;  1NJI U;  4IUU A;  1OPL A;  5A0D A;  4D6W A;  2VXE A;  2RJF A;  3OYG A;  2CDT A;  1QVG S;  2HBW A;  8AT1 B;  1M3B A;  4NS5 A;  5CR2 A;  1XTD A;  2M16 A;  2JTM A;  1KQS S;  3OYJ A;  2YRV A;  3NHN A;  2CP3 A;  2D0N A;  1ZQ1 A;  2J6F A;  3REB B;  5GAN 2;  3EGX B;  2K79 A;  2JMC A;  4X34 A;  3OYH A;  3DKM A;  1U8R A;  4KT0 E;  5LL6 S;  2GFA A;  3DB3 A;  3QHS A;  2PTK A;  4MZP A;  4OB0 B;  4PJO G;  3CME T;  1VQP A;  1SEM A;  3V8L A;  1QCO A;  4PJO B;  2O9S A;  2IIM A;  2LNV A;  3L2Q A;  1MV3 A;  2RI2 A;  3M58 A;  5HK0 A;  2EQU A;  2HL3 A;  1NYF A;  2DD4 A;  1KD1 U;  4EPC A;  3QYG B;  1G3S A;  2DL8 A;  2RI5 A;  3OSS C;  2HKQ B;  3S3O A;  3H9N A;  2DE0 X;  2FB7 A;  1VQL A;  1UHF A;  3MET A;  3OYA A;  4BDZ A;  3CCR T;  5GJW B;  1MMN A;  2K4Y A;  3CCJ T;  2BE9 B;  2VB6 A;  2CS7 A;  3J80 E;  2DJZ A;  4E7S A;  2L8D A;  4ELY C;  4PFP A;  2PQW A;  3LLR A;  5GMK l;  1M1G A;  3RUX A;  1ZA1 B;  1VYV A;  1Y71 A;  4M7A A;  1U1T A;  4FYW B;  3CCV Q;  2CZ6 B;  4LDW A;  2ZPE B;  1BKB A;  2QDL A;  4OVA A;  3CBO A;  2EGC A;  3M55 A;  1R8O B;  2E10 A;  1QVF P;  1VUB A;  2RQT A;  5FU7 C;  1GCQ C;  2VYT A;  5CAI A;  3PT9 A;  4PJO E;  1WDX A;  3HPW A;  4M75 A;  2DNU A;  4M77 D;  2YSQ A;  1M90 U;  2YDL A;  4X1V A;  1IGU A;  3HRU A;  3G71 A;  4BUG A;  1AWX A;  4E2F B;  4KH0 B;  2RHU A;  2DX1 A;  2AZS A;  2DJQ A;  1WXB A;  4IUP A;  3I56 Q;  2H3E B;  3URG A;  5KYY B;  1VQO A;  2CKK A;  2RI3 A;  3JCM e;  2LX7 A;  2ZZD A;  2NUT B;  1MHN A;  2X9H A;  4XTY A;  3RNJ A;  1VQM Q;  1YHQ Q;  1DJ7 B;  1K1Z A;  4FW1 A;  2L3Q A;  3VYG A;  1GCQ A;  4QQG A;  4A4K A;  3ZBD A;  3S3M A;  1Q81 C;  2HEQ A;  2EGE A;  2RQW A;  1OQK A;  2L5Q A;  2K6D A;  1IGQ A;  2GF7 A;  1D1C A;  2DBK A;  3MEA A;  3CC7 T;  1YCY A;  2VAS A;  4PJO A;  1NEG A;  2DXC A;  4E7Z A;  1X2K A;  2LJ1 A;  1SSH A;  2R57 A;  3PIO A;  4L5G A;  1BI1 A;  2NLU A;  2VV5 A;  1V76 A;  3H0I A;  1K8A U;  4M77 B;  2CZ7 B;  1YWO A;  3A8H B;  2EQM A;  3TSZ A;  1BCM A;  1QWE A;  1YN8 A;  4P5N A;  2LJ0 A;  2E12 A;  4M77 F;  2JS2 A;  1MMA A;  1KQS A;  3VS7 A;  4JRI A;  4DEY A;  5IHI A;  2RJD A;  3L42 A;  4XTZ A; 
#chains in the Genus database with same CATH homology
 2KSS A;  2GCX A;  2BUD A;  1I8F A;  5GAN 7;  2DXT A;  4B9W A;  1OZ2 A;  1VQ6 T;  2QQR A;  3ER0 A;  3F70 A;  3CMA A;  5CKE A;  4LDV A;  3OYF A;  3VU3 C;  1KC8 U;  2OTJ T;  1VIF A;  1FWZ A;  3JCM W;  3QKJ A;  1BIA A;  2E65 A;  5FLX E;  4M75 E;  1N8R C;  2XD0 A;  5GAN 6;  4M78 E;  3INZ A;  3CC4 A;  4EMK C;  4Q5W A;  3FDR A;  3OBY A;  2A7Y A;  2FHD A;  3NFC A;  1Q82 U;  1K8A C;  2PVO B;  2P0Q A;  3OB9 A;  4M7D A;  3L2V A;  3VYH B;  4M75 F;  4M75 B;  5J39 A;  2P0P A;  4XTW A;  5D6X A;  4BI3 A;  2R5M A;  5KE2 A;  2LQ8 A;  4E7J A;  2MMP A;  2VGN A;  2Y4Y A;  4WF2 A;  1VQ8 A;  3A8M B;  3OYY A;  1M1F A;  3DLM A;  4IUV A;  2VUB A;  5GAM e;  4M7D F;  2B8A A;  1KC8 C;  3CCU A;  1XOV A;  2HD0 A;  3I56 T;  4FT4 A;  4J5Y A;  3JCM P;  3OMG A;  5GAN j;  4MDW A;  3CCM A;  3CBM A;  1JBM A;  3I55 T;  1Q81 U;  2QXF A;  4C8Q D;  2EQJ A;  1I81 A;  3A8L B;  4HA8 A;  3WXM B;  5J26 A;  3QPH A;  4ZN3 A;  4C0F A;  2L3R A;  4ATO A;  4L6V 5;  1N6A A;  3BDU A;  4MZM A;  3PMT A;  4E7H A;  3ASK A;  2YLB A;  3BY7 A;  3QDR B;  2VGM A;  4M75 G;  2HBP A;  2KDS A;  2YLC A;  4J6X A;  2RM4 A;  3JCM Q;  2DEQ A;  1NPP A;  3MP1 A;  5IN1 A;  3C94 A;  3OMC A;  4J6W A;  2ZPG B;  1YIJ T;  2PU9 B;  5I2M A;  2DKG A;  1UGS B;  1IRE B;  1B34 A;  5A0L A;  5CO7 A;  1WGS A;  5GMK j;  2XDD A;  3VUB A;  3JCM g;  1KHI A;  3FRN A;  2DXU A;  2DD5 A;  2I2L A;  5D6W A;  3QJY A;  2K5I A;  4J7F A;  3J81 E;  2RJE A;  2LX9 A;  3FJP A;  3GNG A;  2EKO A;  4M77 C;  4M7D B;  4ZGE B;  4C8Q E;  2LDM A;  4O6J A;  1XQH A;  5CKH A;  4C0D C;  3FC3 A;  2WSC E;  3CC4 T;  1UGP B;  3QSU A;  1OI1 A;  4F7U B;  5CKD A;  4MMK A;  4IKF A;  2LCL A;  1Q7Y C;  2AHJ B;  4BAC A;  3UPU A;  2VXF A;  4XTU A;  4DQ2 A;  3JB9 I;  1VQ7 T;  3RKY A;  4IUT A;  1M4Z A;  5GAN h;  3M4G A;  3LWH A;  4LD6 A;  3G71 T;  1Q86 U;  3CCL T;  5GAM f;  3OA6 A;  3SWN B;  1QW1 A;  4M77 E;  5FU6 B;  4A4E A;  4BDY A;  4E7K A;  1YBY A;  1TH7 A;  4A53 A;  4A54 A;  1QVG A;  4HT8 A;  3CCQ A;  4C5I A;  3G6E A;  4M75 D;  2V8I A;  2QEX T;  4RCC A;  2XID A;  4M75 C;  4JRQ A;  4XAX B;  3GPL A;  3CC2 A;  1P92 A;  2ZGW A;  2GQV A;  2LT4 A;  2X4J A;  4FSX A;  5GAN d;  3EAE A;  5I21 A;  2ZPB B;  2CZ0 B;  3TRE A;  5LJ5 e;  1JJ2 S;  2LT1 A;  4FU6 A;  1MGQ A;  5DY9 A;  4FM4 B;  2DK3 A;  4JS5 A;  2HNI A;  3M54 A;  4RG2 A;  3OS2 A;  3M59 A;  1YJW A;  3OYL A;  3LGF A;  3CPW A;  3JB9 G;  2K2V A;  5DM7 R;  1N27 A;  1I5L A;  1YJW T;  1B34 B;  3A5Z B;  4J83 A;  4N4G A;  3VJP A;  3JB9 F;  4M7A D;  2LCC A;  1K73 C;  3CD6 A;  2EJF A;  2E70 A;  3SWN C;  1KQ1 A;  4N4H A;  2D9T A;  1M9S A;  5GAO q;  3E9G A;  2FVU A;  3QUI A;  2E6N A;  4R55 A;  4M7A G;  3MEW A;  2X4W A;  1RL2 A;  2F5T X;  2PVD B;  2E5Q A;  3CCV A;  3HSB A;  2R5A A;  4A4G A;  3JB9 D;  3GIB A;  1QVF A;  3QYH B;  5GAO n;  2MF2 A;  5C0M A;  4M77 A;  3E1S A;  3DLL A;  2RB6 A;  1VQM T;  5GMK e;  1VQ4 A;  1SSF A;  3GNF B;  1UEB A;  2DZC A;  2O4X A;  2VC8 A;  1KQ2 A;  5J3B A;  1VQ9 A;  3RKX A;  1VQ7 A;  2EFI A;  4M78 B;  4QQD A;  2MI6 A;  2XKO C;  3NTH A;  4C5G A;  3V7S A;  2K57 A;  2RH2 A;  4E7L A;  5KE3 A;  3JB9 J;  4PJO C;  2G3R A;  5EG2 A;  3G4S A;  5KCH A;  1YJ9 A;  4N4I A;  3SWN A;  1QP2 A;  4NL2 A;  5GAN 3;  2QI2 A;  2RO0 A;  2KY9 A;  3FIF A;  4ELZ C;  4XK8 E;  4OMF B;  2O01 E;  4CI0 C;  3DB4 A;  5AYF A;  5CCA A;  4JDS A;  1IZ6 A;  4KUD K;  2OTL A;  4DOW A;  3CXC S;  3G7Z A;  1G3W A;  1LNX A;  3ME9 A;  1PSF A;  4QVC A;  4JUV A;  2QTX A;  5I2S A;  3PIP A;  3P8H A;  3HRS A;  3M56 A;  4BB7 A;  4JRP A;  3CCS A;  5LJ5 d;  2MWP A;  4BE0 A;  1NZ9 A;  4XU0 A;  4N0A C;  4C8Q C;  2DAQ A;  2WAC A;  1I4K 1;  2CYZ B;  1X75 C;  2Y4X A;  3C12 A;  4BI8 B;  5GAM j;  1YIJ A;  1VQ5 T;  1FX7 A;  3TEE A;  2E41 A;  2LTO A;  5CQX A;  2K5L A;  3M5A A;  4C92 D;  4MML A;  4UC4 A;  4C92 F;  5M9O A;  1VQK T;  4BE2 A;  4XTV A;  3RIR A;  5HK3 A;  4JS4 A;  1QP3 A;  5FRO A;  4PNO A;  5GAO l;  1Q7Y U;  5LJ3 h;  3OYN A;  2MWO A;  1NJI C;  3JCM J;  4OB3 B;  2MAM A;  2YHT A;  1K9M U;  3CCE A;  1JJ2 A;  2RHI A;  1LOJ A;  3CME A;  4M7D D;  5LJ3 d;  3J7A F;  3JCM h;  2PUO B;  3CEY A;  2PVG B;  3CCL A;  3V8J A;  3KBG A;  2XU8 A;  4GY5 A;  4M78 D;  1OZ3 A;  4E7I A;  2XHC A;  2KVQ G;  2E64 A;  4M7A F;  1NPR A;  3PMI A;  3ZFJ A;  4F7U A;  5GAO p;  1WJR A;  4C8Q G;  1D3B B;  4Y28 E;  3LWI A;  4J7I A;  2H3J A;  2PUK B;  2Y90 A;  2QA4 T;  3QXE B;  4II1 A;  2IVW A;  3I56 A;  5HY6 A;  3CCM T;  1VQ8 T;  1K9M C;  3JB9 H;  1QVF S;  1YIT T;  3L2U A;  1WNL A;  4A4F A;  1YI2 A;  4M78 G;  3JCM d;  3P8B B;  4C8Q A;  3CCR A;  2JNG A;  3QBY A;  3HFO A;  4KUI A;  3SDZ A;  4Y91 A;  4IUR A;  4EMK B;  3OYK A;  3C4S A;  2QEX A;  2E1H A;  3S3N A;  4LD9 K;  1VQ6 A;  3QZ5 B;  1W2B S;  4KBM B;  1V29 B;  3M9Q A;  4PLL A;  4JRK A;  3R6O A;  3E9F A;  3HP9 A;  5GAO r;  1BI2 A;  2XG8 D;  5GAM h;  4C8Q F;  4RKU E;  4C8Q B;  2QQ9 A;  4OGC A;  2P0K A;  2QQB A;  4QVZ A;  4M7A B;  2DVE A;  4EDU A;  4TVR A;  2ZPF B;  2HQE A;  4OP0 A;  5CQY A;  4PJO F;  3GF5 A;  5DLO A;  2X35 A;  4XU3 A;  2DO3 A;  2E6Z A;  4C92 B;  2L89 A;  5CIU A;  5LJ5 h;  4ZTJ A;  2D6F A;  2BIV A;  2JVV A;  4NL3 A;  1U1S A;  1YHQ A;  4GLK A;  1M1K C;  4CRI A;  5FU7 B;  1RI0 A;  1M5Q 1;  3SD4 A;  3JCM f;  2RHZ A;  3JSC A;  3OYE A;  4M78 C;  4ME7 A;  3QZ9 B;  5L8R E;  5GAO m;  4OF1 A;  3WVD B;  1Q86 C;  2XDB A;  4LDX A;  3JCM c;  4OGE A;  3QO3 A;  4PKC C;  3SFM A;  3H6Z A;  3OBW A;  4ZGJ B;  1VQM A;  4PJO D;  1BYM A;  3JCM V;  3OW2 S;  3LGL A;  2F5K A;  3QII A;  4RCB A;  2QQA A;  3OYI A;  1VQ9 T;  2ZCF B;  2EAY A;  3OSV A;  4MZT A;  3RES A;  4C0D B;  1VQL T;  2XK0 A;  1WQ7 A;  4XQ3 A;  3WVE B;  2IG0 A;  1OYX A;  2O4X B;  1PSE A;  2OAU A;  3BDL A;  2DXB A;  4LDU A;  4QQ6 A;  4DOV A;  3G4S T;  2RK2 A;  3GP8 A;  2DPP B;  1NE8 A;  2P4T A;  3A8O B;  3EFR A;  2XDP A;  3PNW C;  3RMS A;  1K73 U;  4RG8 A;  4C92 C;  2M1H A;  1JRI A;  1X6O A;  2F69 A;  3P8D A;  1BI3 A;  3JCM b;  4ZN1 A;  1NJI U;  4IUU A;  5FU6 C;  4M7D E;  2JUF A;  4C0G A;  5A0D A;  4D6W A;  1HXD A;  2DTO A;  1VQO T;  2VXE A;  4FT2 A;  2RJF A;  4JLG A;  3OYG A;  4OB1 B;  1QVG S;  2EJ9 A;  3FEO A;  5IAY A;  4X9D A;  3X25 B;  3OW2 A;  4NS5 A;  5CR2 A;  3MHX A;  1XTD A;  2M16 A;  3MP6 A;  2JTM A;  3X26 B;  4E47 A;  2FL7 A;  1KQS S;  3CMA T;  2LVM A;  3CCQ T;  4M7A C;  3OYJ A;  1XNI A;  2YRV A;  3QG1 A;  2LQK A;  3G6E T;  3CPW S;  2DTH A;  1ZQ1 A;  2D0Q B;  5GAN 2;  1FXX A;  1G3T A;  2DTI A;  4X34 A;  4C92 A;  2X4X A;  3VUZ A;  2XI9 A;  2KMT A;  3X28 B;  3DKM A;  3OYH A;  4JJN K;  2LC4 A;  4KT0 E;  5LL6 S;  1U8R A;  2GFA A;  2OTJ A;  3C95 A;  2ZPI B;  3RKW A;  1WPY A;  4C92 G;  3X20 B;  3RMQ A;  3DB3 A;  3QHS A;  4MZP A;  4OB0 B;  2EIF A;  3OY9 A;  4QW2 A;  4PJO G;  3CME T;  3MP8 A;  1VQP A;  1S72 A;  3V8L A;  1G5V A;  2DIG A;  1M8V A;  3OYB A;  4PJO B;  4ZGD B;  4M78 A;  2LNV A;  3L2Q A;  5KCO A;  4A4H A;  3HFN A;  2RI2 A;  3M58 A;  3M4Y A;  3H8Z A;  1UGQ B;  5HK0 A;  3V8K A;  2EQU A;  1Q82 C;  3S6W A;  2DD4 A;  1KD1 U;  1N9S A;  4EPC A;  4F7U F;  4FL6 A;  2K3X A;  1KD1 C;  3QYG B;  1G3S A;  2RI5 A;  2WSF E;  2GFU A;  3OSS C;  1Y96 A;  3RER A;  3LH0 A;  3MO8 A;  3CCU T;  3S3O A;  1D3B A;  2FB7 A;  3V7C A;  1VQL A;  2V8J A;  1KG1 A;  3MET A;  1O9S A;  2JTF A;  3OYA A;  4BDZ A;  4NOY A;  1YJ9 T;  3CCR T;  3O8V A;  5CKB A;  1EIF A;  3A8G B;  3UT1 A;  2K4Y A;  3CXC A;  3CCJ T;  2OTL T;  2DZ9 A;  2CS7 A;  3L1A A;  5GMK m;  1BI0 A;  1BIB A;  5CK9 A;  3OQ5 A;  5GMK h;  3J80 E;  4DA4 A;  2R58 A;  5DLQ E;  2DJZ A;  5LJ3 f;  2L8D A;  4BI4 A;  3NTK A;  4ELY C;  2PQW A;  5HKC A;  3L2Z A;  3L2W A;  3VKI A;  2FYK A;  3CCS T;  3LLR A;  5GMK l;  1M1G A;  1O75 A;  1ZHI A;  3X24 B;  3PTA A;  2CZ1 B;  1UB4 A;  1H64 1;  3CPF A;  3RUX A;  3NTI A;  3JRZ A;  4QVD A;  4XU2 A;  5LJ5 g;  1Y71 A;  5GAN g;  1VQ5 A;  4M7A A;  1U1T A;  3JAM E;  1AHJ B;  5CVI A;  4M7A E;  2CZ6 B;  4F7U E;  4B9X A;  4LDW A;  2ZPE B;  5GMK i;  1BKB A;  2JOY A;  5IT9 E;  4OVA A;  3CC7 A;  4EMH A;  1WJQ A;  3BFM A;  3OS5 A;  3LW5 E;  3CBO A;  4M7D G;  3HHT B;  4XU1 A;  3JCM X;  3M55 A;  1R8O B;  2E10 A;  2ZPH B;  1VUB A;  3HKS A;  5FU7 C;  2VYT A;  1JB0 E;  5GAN e;  3PT9 A;  5CAI A;  4PJO E;  1LJO A;  3SB2 A;  2RA2 A;  4BY6 B;  1W2B A;  3M57 A;  3HPW A;  2JZ2 A;  5A2Q E;  4M75 A;  5D6Y A;  4M77 D;  4PL6 A;  1M90 U;  4MDX A;  4M78 F;  3MEV A;  3QJ6 A;  2M9U A;  4OB2 B;  4R56 A;  5FRN A;  2DIQ A;  5GAN 8;  3HRU A;  3G71 A;  4BUG A;  4N0A A;  5C6S A;  3TU4 K;  1N8R U;  1Y96 B;  2RHY A;  4ZTF A;  1KHC A;  4EMK A;  1M1K U;  2RHU A;  3LX7 A;  2QA4 A;  3OS0 A;  1G3Y A;  1VQN A;  4BE1 A;  3OS1 A;  2K3Y A;  2KK4 A;  4HCB A;  4FIB A;  4M77 G;  1VQN T;  1QVP A;  4EMG A;  1YI2 T;  4IUP A;  3UDC A;  1YJN A;  3URG A;  3KUF A;  1VQO A;  2CKK A;  2RI3 A;  2RK1 A;  3JCM e;  3FLG A;  1ZBX A;  4J6Y A;  1GXI E;  4XTX A;  1H3Z A;  2EWN A;  2XIC A;  2EJG A;  5KH6 A;  2ZZD A;  2A3L A;  1MHN A;  3MCA B;  3HL8 A;  4JLI A;  2KQW A;  3OYM A;  2EQK A;  3BW1 A;  4XTY A;  1VIE A;  4HKE A;  4C0Z A;  3LYI A;  1DJ7 B;  1UGR B;  5A0G A;  2CGH A;  3VYG A;  4C92 E;  3CC2 T;  4QQG A;  4A4K A;  3ZBD A;  3S3M A;  4BY6 C;  5GAN 4;  1Q81 C;  3AHU A;  3N5B B;  2X4Y A;  2WSE E;  4O5V A;  3CCV T;  3CD6 T;  4Z02 A;  3FB9 A;  3OYC A;  1Y7X A;  2L5Q A;  3OYD A;  3L2R A;  5LJ3 j;  2M0O A;  1VQP T;  1S72 T;  2GF7 A;  2RHX A;  3M53 A;  1HK9 A;  5GAN f;  3MEA A;  2K5F A;  4IUQ A;  3CC7 T;  2HAX A;  1YCY A;  2JN0 A;  1YHQ T;  1N9R A;  4PJO A;  4VUB A;  2QDY B;  3EFS A;  3T9N A;  5LJ3 g;  1VQ4 T;  2DXC A;  2RD1 A;  5GAM g;  4YTL A;  3KXT A;  2C06 A;  3E19 A;  1YIT A;  4PLI A;  3PGG A;  2R57 A;  3PIO A;  4L5G A;  5LJ5 f;  3MEU A;  1WJS A;  1BI1 A;  2LRQ A;  4C5E A;  4RMO A;  2NLU A;  2KAF A;  3CCE T;  3TCJ A;  5GAM d;  1M90 C;  2VV5 A;  3I55 A;  5FRM A;  4HCZ A;  3ZEH A;  1K8A U;  5LJ5 j;  4M77 B;  4M7D C;  2CZ7 B;  3CBP A;  3HRT A;  4L59 A;  3GLX A;  4LDY A;  3CCJ A;  3A8H B;  4J8O A;  4C5H A;  2EQM A;  2V8K A;  4V2S A;  4KUL A;  2RJC A;  4P5N A;  1W4S A;  1Y07 A;  3UWN A;  2E12 A;  5GAN 5;  5LJ3 e;  3GOX A;  4M77 F;  1X01 A;  1YJN T;  3Q1J A;  4HCC A;  4HT9 A;  4X9C A;  1KQS A;  4F7U G;  2EYQ A;  5CKF A;  3PFS A;  3VV0 A;  4JRI A;  2BKD N;  2HQX A;  2RJD A;  2QQS A;  3L42 A;  4BD3 A;  4XTZ A;  1WQW A;  3V7R A;  1VQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...