5GMKe

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
65
Chain Sequence
VIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
total genus 8
structure length 65
sequence length 65
chains with identical sequence g
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmke00
1I8FA 4M7AA 1YCYA 4M7DA 2QTXA 1WPYA 2HNIA 1I81A 3INZA 4XTYA 3V7CA 3V8LA 5GANj 1MGQA 1HXDA 3RIRA 2EWNA 4XQ3A 4V2SA 3QO3A 1KQ2A 5GAOq 5GAMj 5GAOp 3JCMV 4M7AE 5LJ5j 4M7DE 1Y96A 2DKGA 3JCMc 4M77C 4XU3A 4C92F 3JB9D 2DEQA 4J5YA 4M7DD 3V7SA 4M78C 4J6YA 3JCMe 3JCMb 2RB6A 2CGHA 4PJOE 2DJZA 2FYKA 3JCMg 4Y91A 4A53A 4M7DG 4PJOD 3JB9G 4C92B 2JN0A 5LJ3h 3JCMP 2DZCA 5GANe 5GAN4 1HK9A 4M75E 3HFNA 4M75D 5DY9A 5GMKe 2DTIA 2E64A 2E10A 4M77F 3HFOA 4PJOG 4F7UA 5GANg 4HT8A 4M7DC 3EFRA 4M7AC 3RKWA 4RCCA 4M78F 3L2ZA 3RKYA 4XTUA 4JRIA 3V7RA 3SWNA 4M75G 5GAOr 4JRKA 3M4GA 4QVDA 4HT9A 4C8QE 2RD1A 3FB9A 5LJ3f 4C8QD 4F7UE 1U1SA 2I2LA 2EJ9A 4M77B 4PJOC 3QSUA 1B34A 4HA8A 1LOJA 5GMKj 4M78B 2VXFA 3JCMW 3JB9J 4M7AF 4C8QG 4F7UG 3JB9F 1I4K1 3L1AA 4XU0A 4N0AA 3JCMJ 4MMLA 4M75A 4XTWA 5I21A 3FJPA 2E65A 4XTZA 4MMKA 3RUXA 5GAOl 4NL3A 2DZ9A 4M7AB 5GAMh 4DQ2A 5GAOn 4M7DB 5LJ5h 1I5LA 1M8VA 2Y90A 4QVCA 4EMKA 1D3BA 3SWNC 1LNXA 4C8QA 4EMHA 5LJ3d 3HSBA 1Y96B 4PJOB 1BIBA 3SB2A 3JB9H 5GAMf 1N9RA 5LJ3j 4F7UF 1LJOA 1H641 3QUIA 4C92D 4C92E 5GMKm 5LJ5g 5LJ5f 3RERA 3FIFA 4NOYA 4N0AC 2EAYA 3JCMh 4M75C 3JCMX 2VXEA 1U1TA 4M7DF 1WNLA 4X9DA 3V8KA 4C92G 4F7UB 4JLIA 5GANh 3BDUA 1KQ1A 3AHUA 4EMKC 2E1HA 2EJGA 4X9CA 4JUVA 1WQ7A 3SWNB 5GMKh 4PJOF 1X01A 4C8QC 4M77D 1JRIA 4PNOA 4XTXA 5LJ3e 3JCMf 2VC8A 4M78D 2FB7A 5GAOm 3BFMA 1B34B 1TH7A 4M75F 4RCBA 3VU3C 5LJ3g 3RESA 2RA2A 3BY7A 4C92A 5GAMd 4M77G 4EMGA 5LJ5d 3JB9I 5GAN3 5GANf 2YLCA 4XU1A 2DTOA 1JBMA 4M78G 3RKXA 2DXUA 1N9SA 3QHSA 4M75B 2ZGWA 4C8QF 4J6WA 4M7AD 5GAN6 5GAN7 4PJOA 4WF2A 2DTHA 3GIBA 1BIAA 2EJFA 1WQWA 3BW1A 4XU2A 4EMKB 1D3BB 2DVEA 4M77A 4XTVA 4M7AG 4C8QB 5GAN2 2K57A 2YHTA 4M78A 4A54A 3EFSA 4J6XA 4OP0A 3V8JA 3JCMd 5GAN5 4M77E 1M5Q1 5GAMe 2RM4A 4C92C 5LJ5e 5GAN8 5CAIA 3JCMQ 4M78E 2DXTA 2E41A 5GANd 5GMKl 5GAMg 3PGGA 4NL2A 5GMKi 2YLBA
chains in the Genus database with same CATH superfamily
1HD3A 1GBRA 3OYNA 4LDVA 3DLMA 4ZN3A 3V7SA 3GF5A 3GPLA 3CMAT 2RB6A 2QA4Q 3JCMg 3EGXB 5D6XA 4C92B 3JCMP 4RG2A 4M75E 1UJ0A 2LT1A 2DTIA 3CCRA 2V8KA 2CZ1B 2EBPA 1X27A 3OYLA 4M4ZA 1KHCA 2X4JA 1ZHIA 1SHFA 3G6ET 2IIMA 1UEBA 5DM7R 3JB9J 3NMZC 1VOMA 3DKMA 4AFSC 3CCQT 1PG5B 2V26A 4XTWA 2FPDA 2DZ9A 2DO3A 5GAOn 2J7IA 4MDXA 3SWNC 2OJ2A 5IT9E 1SSHA 3NTHA 1N8RR 3OYCA 3QUIA 4DA4A 1FXXA 3E1SA 3G4SQ 1K9MU 4R56A 4OGCA 4C5EA 4C92G 1HJDA 4IURA 1WYXA 2QQAA 1BCOA 2QQRA 1X01A 1R8OB 1B34B 3OQ5A 1IXDA 3I55A 3EGXA 4C92A 4XU1A 4J83A 1JJ2P 5DLQE 3ZFJA 2C06A 2OAWA 2DILA 3URGA 2DFUA 4OMOA 3CCUQ 1QCOA 4BE1A 2RN8A 3VS7A 2J6OA 1KD1R 1TUDA 1VQ8T 1ZBXA 4EMKB 1H3HA 1D3BB 3HKSA 4BDYA 4XTVA 1T0JA 3C4SA 1EFNA 4JJBA 5EG2A 2G6FX 3GBQA 1MMAA 3CC4A 5M9OA 3M54A 5GAMe 4HCZA 2E41A 3JV3A 1FMKA 2W10A 2K4YA 3CD6A 2P0QA 3INZA 1WHMA 2P84A 3DB4A 1NM7A 4XU3A 4J5YA 3PVQA 2ECZA 2CGHA 3OSSC 2M02A 1Y57A 3FC3A 1OQKA 1M2OA 4MDWA 1K1ZA 1TOVA 3OSVA 4M7DC 2X3XD 2YUNA 3A5ZB 2EGAA 1TUGB 1Y07A 4F7UE 4VUBA 2DXBA 4C8QD 2ENMA 1KC8U 1QVFA 1UECA 4ESRA 1B34A 2ZPGB 4FSSA 2RPNA 1VQMA 1RI9A 4N0AA 2P0PA 4AFQC 3S3MA 2VKNA 3CCUT 1QP2A 2EGEA 1PCXA 1WXBA 2JXBA 4EMKA 1Q81C 1D3BA 2EYZA 3OYFA 1X6GA 1RABB 4WCIA 2RK2A 4F7UF 1K9AA 2BTTA 3DB3A 1WX6A 1WDXA 1QCNA 1G3YA 9ATCB 3JSCA 1VQ4A 4KGZB 2WACA 2LCLA 3SWNB 1MUZA 1A0NB 1G83A 2E5QA 3VRYA 1EZZB 2KSSA 4RCBA 5DLOA 1BYMA 3HP9A 5C6SA 1QW1A 2IG0A 2JOYA 2RJFA 3I56A 8ATCB 1XJWB 2OTJA 2MPXC 5GAN2 2HSEB 1KJWA 1AVZC 4KH1B 3A8HB 3ER0A 5AT1B 4M78E 2DBKA 2E6ZA 1I81A 3OMGA 1JXMA 4RMOA 2QTXA 1S1NA 4DBHA 5FU7B 2KT1A 3CCRQ 3MEAA 1WHLA 1NJIU 1K0XA 1WJQA 4DOVA 5GANe 2QDLA 4JRQA 1ZUUA 2XHCA 4PJOG 2LVMA 4M78F 2M0YA 3SWNA 4IKFA 4C8QE 2RD1A 3S3OA 3RR6A 2QK0A 2VXFA 4ZGJB 1NEGA 3ZL7C 1ZX6A 2M0OA 2R57A 3LW5E 3CMEA 2FG0A 4II1A 4M7DB 1M8VA 3GP8A 5FRMA 5J3BA 3UA6A 2LJ0A 1BIBA 3G71A 3EAEA 5GAMf 5D6YA 3THKA 1NPPA 4OMFB 4M7DF 4RTUA 4X9DA 3I55Q 4OMNA 1YNZA 2JJ9A 3BDUA 2KYMA 1RL2A 1RLPC 2MK5A 5KH6A 4ZTFA 2DERA 4LD9K 1MNEA 2OAUA 1XQHA 3JB9I 2SRCA 4JLGA 2YLCA 2MF2A 4M7AD 2KEAA 2A28A 1IHVA 3MP8A 2MYSA 3CC4Q 1H8KA 1BIAA 4HVVA 2E4HA 3TVTA 3OMCA 3UT1A 2GQIA 3CD6Q 2MIOA 2A08A 2RQWA 5CAIA 2EGCA 2K2MA 5LJ5g 3H9NA 4PKCC 4ZGDB 1HYOA 2DD5A 4QQDA 1Q81R 4M7DA 1UG1A 3QO3A 5GAOp 1K73U 2AHJB 5LJ5j 1UGSB 3H0IA 4PJMA 3T9NA 4P5NA 2X3WD 4J6YA 4EDUA 2PUKB 1SG5A 1SF9A 4HCKA 1BI2A 4ME7A 1AZEA 4R55A 5CKHA 5GMKe 5IHKA 2E10A 5D6WA 4XTUA 1WJSA 3I55T 2VGNA 2FZGB 2KNBB 1VQMQ 3TEEA 3C95A 2PVGB 1M90U 1IRXA 2FHDA 4PJNA 5KYUB 4OMQA 3L1AA 1JQQA 3GLXA 2OI3A 4FW1A 2WSEE 3RDVA 1M1KU 5GAMh 4IIOA 1S72T 5AYFA 2E3HA 3NTIA 3KXTA 4IUTA 1U5SA 3J81E 2OTLA 1IB8A 2HL5C 2QA4A 3CD6T 4QQ6A 1UGQB 2NLUA 1Q82R 1VQ4Q 2IVWA 1ZSGA 2X35A 3P8DA 1R0BG 2L8DA 4NOYA 3OYBA 3JCMX 4XAXB 4O6JA 4C0FA 2L3QA 4OF1A 3A8LB 1U8RA 2RHIA 1T3SA 2XDPA 3PE0A 3EGUA 4FIBA 1RACB 3M9QA 4LDXA 4KUDK 5LJ3g 3EH2A 2D8HA 1UUEA 4A4GA 5GANf 3S3NA 1JBMA 2OTJQ 2BIVA 5HKCA 4OB0B 1VQMT 3CXCS 2XU8A 3OYEA 2CT3A 4BB7A 1J3TA 1CKAA 2E12A 1AEYA 5KYUA 3G4SA 3PFSA 2HQHA 4M77E 3UF4A 2DXTA 3QJYA 4HKEA 1WHHA 3EG0A 1YCYA 4PFPA 1AWXA 3HRUA 4RTXA 1D0XA 2AZVA 2AKLA 2EVRA 3ZBDA 1KQ2A 3VS5A 1W4SA 1TSFA 3X25B 5J26A 1CKBA 1G3WA 1JO8A 2KGTA 4Y92A 1RADB 1YJNA 5CKFA 4J9HA 2RI5A 4IUPA 4M77F 3L2WA 4LUEA 3M4GA 4KULA 3CMEQ 1FX7A 3CCSA 3I56T 1ZLMA 2QDYB 5A0GA 3UWNA 2OTJT 1QVFP 1YJ9A 5KE3A 1AT1B 3M59A 1FYNA 3HSBA 2XIDA 5HY6A 3C0CA 2K5FA 4C92D 3F70A 1ZSZC 2NUZA 2F2XA 3FEOA 2P0KA 3VYGA 4CI0C 2EQJA 4BY6C 3OYKA 5GANh 1KQ1A 2F2VA 3LH5A 1KHIA 2PZ1A 3H6ZA 3VU3C 2RA2A 3BY7A 3CCVA 1RI0A 5IXFA 2YUOA 4FT2A 3M0RA 2LQNA 4LXCA 4L6V5 1YCSB 5GAN7 2RHYA 4WF2A 3JRZA 3BW1A 3OS2A 1K0SA 1SSFA 5GJWB 1OV3A 1GCPA 3JCMd 4N4HA 2KY9A 1OZ2A 4MZTA 5CKEA 1VQLT 3G71T 5GANj 2BUDA 4BI4A 3EFOB 4IIMA 5GAOq 1U06A 1VIFA 2YRVA 1MMNA 3CBOA 1QP3A 1UB4A 4E7JA 3X26B 3PMIA 3JB9G 2FL7A 4ZNXA 2P4TA 1P92A 1WHKA 2FO0A 1AZGB 2L2PA 1Z9QA 5A0LA 2O4XB 4IUUA 1BKBA 1I07A 3EG2A 1G2BA 2QXFA 1EIFA 1K4US 4AG2C 2GQVA 1MMDA 4RTWA 2K3BA 2OTLQ 4MMKA 1TUCA 1V1CA 1QCFA 5KYXB 1YIJA 2XICA 2AT1B 1Y0MA 5ECAA 1LNXA 2F5KA 1BI3A 2DE0X 1UDLA 4C92E 3OBWA 2JTMA 3I5SA 1NYFA 1Q86R 3C12A 2KDSA 1B07A 2VVKA 3OYMA 3V8KA 3EFOA 4RTZA 2JTEA 4RTYA 1K8AC 5GMKh 3X20B 4JJDA 2J05A 1KD1U 4RTTA 4TVRA 3OW2A 1TH7A 4M75F 1KIKA 2YXYA 1K76A 3CCMA 2BE9B 1ZSZB 2Y4YA 1VQPQ 2D8JA 4J6WA 5GAN6 4FYXB 3MP6A 4BY6B 2RI2A 3PNWC 1WQWA 2O4XA 2HSPA 2DVEA 2VWFA 5FLXE 3CBMA 1HSQA 3KUFA 1QWEA 3V8JA 2RJDA 4E47A 2LJ1A 2FEIA 1BK2A 4ANJA 5KYXA 2X4YA 4C0GA 2OTLT 1SRMA 3OB9A 3A8MB 2QA4T 3WVEB 3HTRA 2EWNA 1YJNQ 1RAAB 1T3LA 2LRQA 2XDDA 2RQTA 4M78C 2CP0A 4C0DC 5FU7C 4PJOD 2DYIA 3CEYA 4GY5A 3CCSQ 3RKWA 1WHGA 2DBMA 3L2ZA 4F16A 2RHXA 1W6XA 4HT9A 3FB9A 4LUDA 5KE2A 3M0TA 4A4KA 2YWWA 1YJ9Q 2PTKA 2L3RA 1ZSZA 4R0KA 2KROA 2R5AA 5GAOl 3I5RA 4J9BA 4KT0E 3LYIA 3G4ST 1ZA2B 3A8GB 2ED0A 2KYBA 1VQ6A 2LP5A 3U23A 1YN8A 2DAQA 3L2VA 2GFAA 2EKHA 1WHJA 2QGFB 1LJOA 3UATA 2FRYA 5J39A 2XDBA 2F69A 1NPRA 3P8HA 1ZUKA 1OU9A 1WNLA 4F7UB 5CQYA 3CCVQ 3CQTA 1ARKA 3OW2S 1G5VA 1LVKA 1ACMB 2DIGA 2DL3A 4LDUA 4KGXB 4D8DA 1NZ9A 2KT8A 1MV0B 3J7AF 1AWOA 1KK7A 2X51A 2K3XA 3E2UA 2RQVA 4E7HA 1AD5A 2D0QB 4ORZA 4E2FB 4CC7A 1YJ9T 3FJ5A 5IXBA 3G1JA 3REAB 5GMKi 2YLBA 4XTYA 1HXDA 4J7IA 2HBPA 1QQJA 1AHJB 3PTAA 4OB3B 3JCMb 3LLRA 4BDZA 4PJOE 1OI1A 3LH0A 1GBQA 4A4FA 1PRMC 4BI3A 4F7UA 2EQUA 1K8AR 4AFUC 1G3SA 4E7LA 3CCVT 2VUBA 1WJRA 1PM3A 2AK5A 2MOXA 2JS2A 1RAGB 3ULRB 4M78B 1YIJQ 2EW3A 2I0NA 4C0DB 2ZPHB 2DL4A 4XU0A 2YSQA 3M55A 1K73C 2EYXA 2E65A 6AT1B 1Y7XA 5C0MA 3EG9B 1VQNQ 3X24B 3M4YA 4PK4A 1Y96B 2DRKA 4Z88A 2B86A 3HPWA 3JB9H 2W0ZA 2QQSA 3PIPA 2E70A 3FIFA 4ZN1A 2ROLA 1U1TA 3CCMQ 1M90C 4JLIA 2Z0WA 1NLOC 2JT4A 4L59A 3OYAA 1BBZA 4DEXA 1RAEB 2LJ3A 2O2OA 5LJ5d 5GAN3 2L89A 2X4WA 4M78G 2DF6A 2KRMA 2C0TA 3PIOA 1N9SA 4C8QF 4OGEA 2JM9A 3M0QA 1VQKA 1TU0B 2WSFE 1QLYA 4JPBW 3SD4A 2COYA 2CP5A 1NEBA 2K57A 3NTKA 4M78A 1VQ7Q 3MKDA 2VB6A 4F04B 4HVWA 2XMFA 1M5Q1 1C0MA 4FYWB 3CCRT 1QKXA 1MNDA 3VV0A 1WPYA 4PLIA 2DYBA 2V1RA 1W1FA 3EG9A 1Q7YU 3MEWA 1Y96A 3O8VA 4M77C 1PRLC 3FLGA 3JCMe 3S6WA 5I2MA 3VUBA 4M7DG 4ZGEB 2KBTA 4D8KA 2ROTA 3CXCA 1KFZA 3OYIA 1M2VB 4RCCA 3CCMT 4C5IA 1YP5A 2EYYA 2HZYA 2HD0A 4BACA 1PD1A 2RMOA 2J6FA 2HKQB 2KMTA 2DLPA 1N5ZA 2LQWA 1Q82U 1VQ6Q 3CC7A 3M0UA 2JVVA 4FW2A 3SDZA 2JTFA 4OVAA 2M16A 3QBYA 1W2BS 2L3PA 4ZTJA 5LJ3d 5FRNA 3CPWA 1NE8A 2KRNA 4OMPA 1N27A 3E9FA 3OS1A 8AT1B 1I5OB 2RHUA 2PVDB 1EX4A 4J8OA 1VQ9Q 2MCNA 3PMTA 2E1HA 2EJGA 1T0HA 4PNOA 3LWHA 1DJ7B 2ZAEA 3CC4T 3TU4K 2V8JA 2QEXA 3TSWA 1OEBA 2CUBA 2YRCA 4D6WA 4E7SA 4UC4A 2RNAA 2FRWA 2COWA 3OYDA 1M2VA 3M0PA 1C6VX 3OW2P 3GNGA 1VYVA 2EJFA 1VQ5A 3M58A 4C5GA 1OPKA 1WFWA 1WGSA 2CSQA 3LGFA 4IUQA 3EH1A 3CC2A 4NS5A 2GNCA 1MV3A 1VYUA 2HQXA 2RM4A 1K73R 3QKJA 5KYNA 5GAMg 5EC7A 1VQ6T 2VYTA 5FU6C 1M8MA 3CPFA 3EG3A 5GAMj 4M7AE 3JCMV 3JCMc 1VQ8A 3JB9D 5CR2A 4JRPA 1NG2A 2LX9A 1GXIE 2KE9A 4HVUA 2KAFA 2XKOC 4A53A 1YITA 1VQPA 2CDTA 1HK9A 2LMJA 1GCQC 1IZ6A 1M3CA 1WXUA 3VS6A 2CREA 1D1CA 3FRNA 4JRKA 5IN1A 3LGLA 2GCXA 4M77B 3WVDB 4Y28E 2RI3A 3KFVA 1H92A 4M7AF 4BE0A 4L5GA 4CRIA 1X43A 1GL5A 1VQ4T 3UPUA 4DOWA 2CZ0B 3CPWS 2VV5A 1N6AA 4EMHA 5KYWB 1IO6A 2DXCA 2HEQA 3E9GA 2X4XA 4DBQA 2GFUA 3QDFA 5FWBA 3P8BB 2MWPA 2K2VA 2EAYA 1OPLA 4M75C 1YBYA 4FT4A 1PSEA 3WXMB 3EHRA 3OY9A 2CP7A 3AHUA 3TSZA 2DRMA 3JCMf 5IHIA 3EGDB 2K5IA 1VQKQ 2PVOB 4A4HA 4M77G 1KSWA 2G3RA 3HRTA 3C94A 2DK3A 3VS1A 2H8HA 2DXUA 3R6NA 2ZPBB 3ZEHA 2DTHA 2CS7A 3CCEA 1BI0A 2ABLA 3GOXA 4M77A 2GTOA 4A54A 3EFSA 2LT4A 2DNUA 3VS3A 3REBB 2RO0A 2CYZB 4IUVA 4JS5A 3MCAB 4PLLA 4X34A 4KH0B 5KYYB 1TG0A 2QYZA 3H8ZA 4XK8E 1IREB 1XOVA 5I22A 5IAYA 3FDRA 2ATCB 2DEUA 5KYWA 2DD4A 2DEQA 2NUPB 2H3EB 4Z89A 3D7SB 1AWJA 5L8RE 1AWWA 2LCCA 3L2QA 3QIIA 1K9MC 3CMET 1PKSA 1B3QA 3DLLA 2GTJA 3HFNA 2E64A 5GANg 3M0SA 1G8XA 2LQ8A 5FU6B 3EFRA 1UGPB 3ASKA 5FW9A 3RNJA 5GAOr 4FYVB 3MP1A 2M1HA 3EGDA 3CC7Q 5IHNA 4HA8A 2PUOB 1VQKT 3JB9F 4J9EA 1WI7A 3VS2A 5I21A 3H41A 4XTZA 4OMMA 1Q86U 2DM1A 2SEMA 2L3SA 3G7ZA 2RQUA 3G6EQ 2BZXA 2A36A 1I1JA 2QTVA 1D1AA 3L2RA 1N9RA 2XD0A 4LNPA 5KYYA 3JCMh 2RQRA 1E6HA 2NUTB 1UFFA 4OB2B 1YJWA 1KQSA 2IPOB 2QEXQ 1UE9A 1N8RU 5GJVB 2CUDA 2EYQA 1JRIA 4XTXA 2F1LA 2NUPA 4JJNK 1CSKA 4FU6A 1X6BA 1RUWA 2P4RA 1VQ5Q 4EMGA 2JW4A 2EKOA 3JAME 4KGVB 4M75B 1H3ZA 3CC2Q 2D9TA 1VQNA 4PJLA 2EQMA 3CCLA 4K11A 4J9IA 1UTIA 2A3LA 4Z02A 1KC8C 3QWYA 1M4ZA 3CC7T 1BCMA 1UJYA 2BE7D 2MI6A 5LJ5e 1GCQA 3PGGA 1VQ8Q 3M5AA 4GLMA 4BE2A 2MWOA 2X9HA 3V7CA 3VS4A 4ELZC 5FROA 4V2SA 1YITQ 4ELYC 3VKIA 2AKKA 2KQWA 4C92F 1QKWA 1X69A 3X28B 2CP3A 2EFIA 2FYKA 2H3JA 1SKUB 2NUTA 5D7UA 3SHWA 4BI8B 2HKNA 1OX8A 3MHXA 5IH2A 2LC4A 1M1FA 1Q95G 2QEXT 4M75G 1W70A 1VQ7A 2OX7A 1U1SA 4PJOC 2CSIA 4LDYA 3CXCP 1WA7A 5GMKj 1VIEA 1WIEA 1IGQA 1VQ5T 2KXCA 4M75A 2Y4XA 4BUGA 4E7ZA 3CC2T 1I5LA 2CT4A 3KBGA 1FMWA 1X2QA 2QGGA 2K7AA 3NGPA 4QQGA 1AOJA 2L0AA 3TCJA 5KCHA 4HCCA 5GMKm 2ZZDA 1KQSS 4PFZA 1Y71A 2ZPFB 3EG1A 4J7FA 3CPWP 4C5HA 1B7TA 4J9CA 2NWMA 1S72A 1YITT 1VQPT 4C8QC 3OYHA 5LJ3e 4M78D 1OULA 2DL8A 2GF7A 1K9MR 3RESA 1NJIC 1PSFA 3CCEQ 1UGRB 1BI1A 2M51A 2RK1A 4FSXA 4Q5WA 5CQXA 2KI7A 1ZBJA 4GLKA 2BZ8A 1YJNT 4LD6A 1QVGA 2DETA 2QG9B 2ESWA 1PNJA 4BD3A 1VQ9A 3OYGA 4CC2A 4NL2A 3N5BB 4DBRA 5CK9A 3PVLA 2HCKA 3V8LA 2MMPA 2HL3A 2LTOA 4J9GA 1M1GA 1K8AU 4M7DD 2LX7A 3QYGB 5I2SA 3CCST 2L5QA 4OB1B 3M56A 5HCKA 1OU8A 1D0YA 2DZCA 4QKUA 4DBFA 3RMSA 3A1PA 2JS0A 4JJCA 3QJ6A 2EJ9A 1QWFA 2K3YA 3QSUA 1LOJA 2ZPEB 3JCMW 2FPFA 4F7UG 1I4K1 2QASA 2J06A 3CCET 1Q7YC 2JZ2A 4MMLA 1VYTA 4YTLA 1JXOA 2DMOA 1KC8R 1X2KA 4EIKA 4PJOB 4HXJA 2B8AA 1QVPA 2KXDA 3SB2A 1YJWQ 2RJCA 2KVQG 5LJ5f 2QAZA 3RERA 4JZ4A 2HBWA 2O01E 2QQBA 1YI2A 2QI2A 4QT7A 2D6FA 2CZ6B 3PT9A 1M30A 3QWXX 4MZMA 4PJOF 2VC8A 1Q82C 3BFMA 4RTVA 3CCLQ 3HL8A 3J80E 3O5ZA 2DTOA 1W2BA 3RKXA 3OYYA 4KBMB 3HHTB 3CCJA 2FZKB 5CCAA 1QVGS 4C8QB 2EPDA 4LE9A 1O9SA 4F14A 2DL7A 4OP0A 2LDMA 3OA6A 2JUFA 5FWCA 1NLPC 3MEVA 1E7OA 5GAN8 1QVFS 1YWOA 3QDRB 4E7IA 1I8FA 2JNGA 1M1KC 3QYHB 1RAHB 2XI9A 1LPLA 3RIRA 1UHCA 4N4IA 2DA9A 4M7DE 4PJOA 1YWPA 1JU5C 4CC3A 3A8OB 2CKKA 4OMLA 1Q81U 1YJWT 3OBYA 1SHGA 3VUZA 2YUQA 1PWTA 4B9WA 5GAN4 1YIJT 5DY9A 4HT8A 4M7AC 1VQLA 1YHQA 2E5KA 4QVDA 2VASA 5LJ3f 4J9FA 1NJIR 1MHNA 2DPPB 2RJEA 4JDSA 4KRTA 4E7KA 1VQOA 1R0CB 5CKBA 1VQNT 5CIUA 4C8QG 3CCLT 1SRLA 1VUBA 3JCMJ 1YFNA 3QG1A 2EQKA 3RMQA 2JMCA 1PKTA 4DQ2A 5LJ5h 4QVZA 4O5VA 2ED1A 4C8QA 1IHWA 4PFOA 1R77A 4GBQA 1S72Q 4RKUE 2C0IA 1O75A 2CP6A 3CBPA 4EPCA 1PD0A 3CMAA 2K5LA 3E19A 3UDCA 2O9SA 1G3TA 3SFMA 4X9CA 2HAXA 1JJ2A 4M77D 1JEGA 2AZSA 4E6RA 7AT1B 1TS9A 1KQSP 2C0OA 5GAMd 2FZCB 3EHQA 1VQ7T 1JB0E 4QW2A 4AFZC 4JS4A 3G6EA 1Z9ZA 4FM4B 3BDLA 4B9XA 1M3AA 3QZ5B 4XU2A 3MEUA 1GRIA 4CC4B 3CCQA 1NBEB 2KRSA 1Q7YR 2FPEA 2LZ6B 4C0ZA 2GGRA 5GMKl 1RLQC 2BKDN 2HNIA 4HCBA 4MZPA 4X1VA 2EIFA 1MGQA 5I11A 1XNIA 1TXQA 3OYJA 2A37A 4PJJA 2RH2A 2GBQA 2HDAA 5CO7A 2PNIA 5LJ3h 2E6NA 1M27C 4J9DA 2EYWA 5HK3A 3HFOA 3A98A 1SPKA 3VS0A 3RKYA 1ABQA 2K9GA 1F1BB 3META 4LN2A 2O31A 1FMVA 5LL6S 2F5TX 3R6OA 1XTDA 3ME9A 5CKDA 2COZA 2HQEA 3FJPA 3RUXA 4NL3A 3M57A 4M7AB 5HK0A 3OS5A 2CP2A 2Y90A 4QVCA 1M90R 1D1BA 3I56Q 1VQ9T 1YI2Q 1WXTA 1D0ZA 4WTOB 5LJ3j 4A4EA 4AT1B 3OS0A 1M1KR 1BB9A 1V76A 3NHNA 2FVUA 1JJ2S 3SEMA 2JM8A 4AG1C 2XG8D 2D0NA 1LCKA 1WQ7A 1MMGA 2WSCE 3VRZA 3I9QA 3TQ7P 1M3BA 5GAOm 2R58A 1I0CA 2E3IA 2VGMA 4FCYA 2LNVA 2DJQA 3CCJQ 1Q86C 3QXEB 2YUPA 3L42A 1V29B 1C1AA 2ZGWA 1FWZA 5L23A 2KR3A 1BU1A 2NYSA 2XK0A 3AT1B 4M7AG 3CCUA 1UHFA 2O9VA 3GNFB 5GAN5 3MJXA 4C92C 3JCMQ 1VA7A 5GANd 1N8RC 4M7AA 2BZYA 2PQWA 4FYYB 3L2UA 1QVGP 4XQ3A 4PL6A 2LNHB 2DKGA 5KCOA 1YI2T 2DX1A 2ZCFB 1VQLQ 2DIQA 2DJZA 4Y91A 2CH4W 3G71Q 1YHQQ 1PHTA 2JN0A 3MO8A 4RG8A 2D1XA 3I35A 4N4GA 4M75D 3Q1JA 1VQOQ 2R5MA 2HMAA 1X75C 4JRIA 3V7RA 3HRSA 2PU9B 1IGUA 3LX7A 2I2LA 3RBBB 1KD1C 3LWIA 2K79A 1TTHB 3IQLA 3CCJT 4B6MA 2EQIA 3H0HA 4LDWA 1SEMA 2DL5A 1ZA1B 2A0FB 1OYXA 2J6KA 3BE3A 1WLPB 1U3OA 2YRDA 3TREA 1ABOA 1GFDA 1RAFB 3QPHA 3NFCA 1PC0A 1NYGA 4RUGA 2RF0A 3CMAQ 1OZ3A 1OX9A 1D09B 2MAMA 1H641 2JMAA 2M9UA 4N0AC 1ZQ1A 1OOTA 2VXEA 2A7YA 2AIRB 4F17A 2K6DA 3M53A 1KG1A 4EMKC 3UA7A 4JUVA 2KK4A 2YT6A 3MPUB 2FB7A 1X6OA 1TWBA 1RAIB 2V1QA 1YHQT 2F2WA 3CCQQ 4FL6A 3QHSA 2ZPIB 4JZ3A 1ZUYA 2LCSA 1VQOT 3GIBA 2CZ7B 1QMCA 3NPFA 3VJPA 4KUIA 5CVIA 2LQKA 2CH4A 2YDLA 2YHTA 1W2BP 4J6XA 1E6GA 2O88A 1WZOA 2V8IA 4Z8AA 2QQ9A 4ATOA 2RHZA 3VYHB 1GFCA 4DEYA 3H0FA 3QZ9B 2DVJA 4A63B 4AMCA 5A2QE 1M9SA 1UGVA 5A0DA
chains in the Genus database with same CATH topology
3VV0A 1YCYA 5CK9A 3HRUA 1WPYA 4PLIA 3V8LA 3OYNA 2MMPA 4LDVA 3DLMA 1Q7YU 2LTOA 3ZBDA 1KQ2A 1M1GA 1W4SA 3MEWA 1K8AU 1Y96A 3O8VA 3X25B 4M77C 4ZN3A 5J26A 5I2SA 3QYGB 4M7DD 3FLGA 1G3WA 3CCST 3V7SA 3GF5A 3JCMe 2L5QA 3S6WA 3GPLA 3CMAT 2RB6A 5I2MA 3JCMg 4OB1B 3M56A 3VUBA 4ZGEB 1YJNA 4M7DG 5D6XA 4C92B 5CKFA 3JCMP 2DZCA 2RI5A 4RG2A 4M75E 3CXCA 2LT1A 2DTIA 3OYIA 3CCRA 2V8KA 4IUPA 2CZ1B 4M77F 3L2WA 4RCCA 3OYLA 4C5IA 3CCMT 3RMSA 3M4GA 3QJ6A 2HD0A 1KHCA 2EJ9A 2K3YA 4KULA 3QSUA 1LOJA 4BACA 2X4JA 1ZHIA 2ZPEB 3G6ET 1FX7A 3CCSA 3I55T 3JCMW 1UEBA 5DM7R 3JB9J 3I56T 4F7UG 2KMTA 3DKMA 1I4K1 3CCET 1Q7YC 2JZ2A 2QDYB 5A0GA 4MMLA 3UWNA 3CCQT 3CC7A 4YTLA 4XTWA 1Q82U 2OTJT 2JVVA 2DZ9A 1YJ9A 2DO3A 2JTFA 4OVAA 3SDZA 5GAOn 5KE3A 2M16A 4MDXA 3SWNC 3QBYA 1W2BS 3M59A 5IT9E 4ZTJA 5LJ3d 5FRNA 3HSBA 2XIDA 3CPWA 1NE8A 5HY6A 4PJOB 1N27A 2B8AA 1QVPA 3NTHA 3SB2A 2RJCA 2KVQG 3E9FA 5LJ5f 3OYCA 3QUIA 4DA4A 2K5FA 4C92D 1FXXA 3E1SA 3F70A 3OS1A 3RERA 1K9MU 2RHUA 3FEOA 2PVDB 2O01E 4J8OA 2P0KA 2QQBA 4OGCA 3VYGA 2QI2A 2EQJA 4C5EA 4C92G 4CI0C 4R56A 1YI2A 2D6FA 4BY6C 2CZ6B 3PT9A 3OYKA 4IURA 3PMTA 5GANh 1KQ1A 2QQAA 2E1HA 2EJGA 4MZMA 2QQRA 4PJOF 1X01A 1R8OB 4PNOA 1KHIA 1DJ7B 3LWHA 2VC8A 3CC4T 3TU4K 1Q82C 3BFMA 1B34B 3H6ZA 3OQ5A 2V8JA 3VU3C 2RA2A 3BY7A 3I55A 3CCVA 2QEXA 1RI0A 4C92A 3HL8A 4D6WA 3J80E 4XU1A 2DTOA 4UC4A 4J83A 5DLQE 3ZFJA 2C06A 4FT2A 3RKXA 3OYYA 4L6V5 3OYDA 3URGA 1W2BA 4KBMB 3HHTB 5GAN7 2RHYA 4WF2A 4BE1A 3GNGA 2EJFA 3JRZA 3BW1A 3OS2A 3CCJA 1VQ8T 5CCAA 1ZBXA 1VQ5A 1SSFA 4EMKB 1D3BB 3HKSA 4BDYA 4XTVA 1QVGS 3C4SA 3M58A 4C8QB 4C5GA 1O9SA 1WGSA 4OP0A 3JCMd 3LGFA 5EG2A 4IUQA 3CC2A 2LDMA 4N4HA 4NS5A 3OA6A 3CC4A 2JUFA 5M9OA 2HQXA 2KY9A 3M54A 3MEVA 5GAMe 2RM4A 5GAN8 3QKJA 4HCZA 1OZ2A 2E41A 1QVFS 4MZTA 5GAMg 3QDRB 4E7IA 1VQ6T 2K4YA 1I8FA 2JNGA 2VYTA 3QYHB 5CKEA 5FU6C 1M1KC 1VQLT 3CD6A 2P0QA 3INZA 3G71T 5GANj 2BUDA 2XI9A 4BI4A 3CPFA 3RIRA 3DB4A 5GAOq 5GAMj 4M7AE 3JCMV 4N4IA 4M7DE 1VIFA 3JCMc 4PJOA 2YRVA 1VQ8A 4XU3A 3JB9D 4J5YA 3CBOA 1QP3A 5CR2A 4JRPA 3AHUA 3A8OB 1UB4A 2CKKA 4E7JA 2CGHA 1YJWT 1Q81U 2LX9A 3OBYA 3OSSC 3VUZA 3X26B 1GXIE 2KAFA 2XKOC 3PMIA 4A53A 1YITA 3JB9G 2FL7A 3FC3A 4B9WA 1VQPA 2P4TA 1P92A 5GAN4 1HK9A 4MDWA 5DY9A 1YIJT 1IZ6A 3OSVA 4HT8A 4M7AC 4M7DC 3A5ZB 1VQLA 1YHQA 3FRNA 1Y07A 2O4XB 4IUUA 4JRKA 5A0LA 5IN1A 5LJ3f 4VUBA 2DXBA 3LGLA 2GCXA 4C8QD 1BKBA 4F7UE 1KC8U 4M77B 1QVFA 1B34A 3WVDB 4Y28E 1MHNA 2DPPB 2RJEA 4JDSA 4E7KA 2RI3A 2QXFA 1VQOA 2ZPGB 4M7AF 5CKBA 4BE0A 5CIUA 4C8QG 1VQNT 3CCLT 1EIFA 1VUBA 1VQMA 2GQVA 4L5GA 4N0AA 4CRIA 3JCMJ 3QG1A 2P0PA 1VQ4T 3S3MA 4MMKA 3UPUA 2EQKA 3RMQA 3CCUT 2XICA 4DOWA 1YIJA 4DQ2A 2CZ0B 5LJ5h 1QP2A 3CPWS 2VV5A 1N6AA 4EMKA 4QVZA 1Q81C 1D3BA 4O5VA 1LNXA 4C8QA 4EMHA 2DXCA 3E9GA 3OYFA 2F5KA 2X4XA 1BI3A 2GFUA 2RK2A 3P8BB 4C92E 4F7UF 2MWPA 2K2VA 3OBWA 2JTMA 4RKUE 3DB3A 2EAYA 1O75A 3C12A 3CBPA 1YBYA 2KDSA 4M75C 4EPCA 1G3YA 3CMAA 4FT4A 2K5LA 3E19A 3OYMA 3V8KA 1PSEA 3JSCA 3WXMB 1VQ4A 3UDCA 2WACA 3OY9A 1G3TA 2LCLA 3SFMA 4X9CA 5GMKh 1K8AC 2HAXA 3SWNB 1JJ2A 3X20B 4M77D 2E5QA 3JCMf 1KD1U 2K5IA 4TVRA 2KSSA 3OW2A 1TH7A 4M75F 4RCBA 5DLOA 1BYMA 3HP9A 3CCMA 2PVOB 4A4HA 5GAMd 4M77G 5C6SA 2G3RA 1QW1A 3HRTA 3C94A 2IG0A 2DK3A 1VQ7T 1JB0E 2DXUA 2Y4YA 4QW2A 4JS4A 4J6WA 5GAN6 3G6EA 2ZPBB 3ZEHA 2DTHA 4FM4B 2CS7A 2JOYA 2RJFA 3MP6A 3BDLA 2RI2A 3PNWC 4B9XA 1WQWA 2O4XA 3QZ5B 4BY6B 3CCEA 1BI0A 3MEUA 4XU2A 3GOXA 2DVEA 3CCQA 4M77A 2OTJA 5FLXE 5GAN2 3CBMA 4A54A 3EFSA 2LT4A 3KUFA 3V8JA 2RJDA 2RO0A 4E47A 2CYZB 4IUVA 4JS5A 3MCAB 3A8HB 3ER0A 4PLLA 4C0ZA 4X34A 4M78E 2E6ZA 5GMKl 1I81A 2X4YA 4C0GA 2BKDN 3OB9A 3OMGA 4RMOA 2OTLT 3A8MB 2QTXA 2QA4T 3WVEB 2HNIA 4HCBA 4MZPA 2EIFA 1MGQA 3H8ZA 4XK8E 2EWNA 1IREB 1XNIA 1XOVA 3OYJA 5IAYA 3FDRA 2LRQA 2RH2A 2XDDA 2DD4A 5FU7B 2DEQA 3MEAA 4M78C 5CO7A 4C0DC 5L8RE 1NJIU 5FU7C 2LCCA 1WJQA 4PJOD 4DOVA 3L2QA 5LJ3h 3QIIA 1K9MC 2E6NA 3CMET 5GANe 3CEYA 3DLLA 3HFNA 4JRQA 5HK3A 2E64A 5GANg 2XHCA 3HFOA 2LVMA 2LQ8A 4GY5A 5FU6B 3EFRA 4PJOG 3RKWA 4M78F 3L2ZA 3RKYA 1UGPB 3META 3I56A 2RHXA 3ASKA 3SWNA 5GAOr 4QVDA 4IKFA 4HT9A 3MP1A 4C8QE 2RD1A 3FB9A 2M1HA 5LL6S 5KE2A 2F5TX 4A4KA 4HA8A 3S3OA 3R6OA 2VXFA 4ZGJB 1XTDA 2PUOB 1VQKT 3ME9A 3JB9F 5CKDA 2L3RA 2M0OA 2R57A 2HQEA 3LW5E 5I21A 2R5AA 3FJPA 4XTZA 3RUXA 5GAOl 4NL3A 3CMEA 3M57A 4M7AB 5HK0A 4KT0E 4II1A 1Q86U 3LYIA 3G4ST 3OS5A 4M7DB 1M8VA 3GP8A 2Y90A 3G7ZA 5J3BA 4QVCA 4E7LA 5FRMA 3A8GB 1VQ9T 1VQ6A 1BIBA 2DAQA 3L2VA 2GFAA 3L2RA 3G71A 3EAEA 5GAMf 1N9RA 5D6YA 5LJ3j 1LJOA 2XDBA 4A4EA 5J39A 2F69A 1NPRA 3P8HA 3OS0A 2XD0A 3JCMh 1NPPA 4OMFB 4M7DF 4OB2B 2FVUA 1WNLA 4X9DA 4F7UB 1YJWA 5CQYA 1KQSA 1JJ2S 2XG8D 1N8RU 3BDUA 1G5VA 3OW2S 1WQ7A 1RL2A 2WSCE 2EYQA 1JRIA 4XTXA 5KH6A 2DIGA 4JJNK 4ZTFA 5GAOm 4FU6A 2R58A 2VGMA 4LDUA 4LD9K 2OAUA 2LNVA 1XQHA 4EMGA 3JB9I 1Q86C 3QXEB 1NZ9A 4JLGA 2YLCA 3L42A 2EKOA 1V29B 3JAME 3J7AF 4M75B 2MF2A 1FWZA 2ZGWA 4M7AD 3MP8A 2K3XA 1H3ZA 2D9TA 1VQNA 1BIAA 2EQMA 3CCLA 3OMCA 3UT1A 2A3LA 4Z02A 2XK0A 4E7HA 1KC8C 4M7AG 2D0QB 1M4ZA 3CC7T 3CCUA 3GNFB 1YJ9T 5GAN5 2MI6A 4C92C 5LJ5e 5CAIA 3JCMQ 5GANd 1N8RC 3PGGA 5GMKi 2YLBA 5LJ5g 3M5AA 4M7AA 4PKCC 4ZGDB 4BE2A 2DD5A 2MWOA 4QQDA 2PQWA 4XTYA 3V7CA 4M7DA 1HXDA 3L2UA 4ELZC 5FROA 4XQ3A 4V2SA 4J7IA 4PL6A 2HBPA 3QO3A 4ELYC 5GAOp 1K73U 2AHJB 5LJ5j 1UGSB 3VKIA 2DKGA 4C92F 2KQWA 3T9NA 4P5NA 1AHJB 3PTAA 4OB3B 4J6YA 5KCOA 3LLRA 3X28B 3JCMb 4EDUA 2PUKB 1YI2T 2EFIA 2ZCFB 4BDZA 1BI2A 2DIQA 1OI1A 2DJZA 2FYKA 4ME7A 2H3JA 4Y91A 4PJOE 2JN0A 3LH0A 3MO8A 4RG8A 4N4GA 4R55A 5CKHA 4A4FA 4M75D 4BI8B 5GMKe 4BI3A 3Q1JA 2E10A 2EQUA 4F7UA 5D6WA 3MHXA 2R5MA 2LC4A 1M1FA 1G3SA 4XTUA 1WJSA 1X75C 2VUBA 1WJRA 4JRIA 2VGNA 3HRSA 4M75G 2PU9B 3V7RA 2QEXT 1VQ7A 3TEEA 3C95A 3LX7A 1U1SA 2I2LA 2PVGB 1KD1C 4PJOC 4LDYA 3LWIA 5GMKj 1M90U 4M78B 2FHDA 1VIEA 4C0DB 2ZPHB 1VQ5T 3CCJT 3L1AA 4XU0A 3GLXA 3M55A 4M75A 4LDWA 2Y4XA 1K73C 4BUGA 2E65A 2WSEE 1M1KU 5GAMh 1OYXA 1S72T 3CC2T 1I5LA 1Y7XA 5C0MA 3KBGA 5AYFA 3TREA 3NTIA 3KXTA 3X24B 4IUTA 3M4YA 3CCVT 3QPHA 3J81E 2OTLA 1Y96B 3NFCA 2QA4A 3CD6T 4QQGA 3HPWA 1OZ3A 2NLUA 1UGQB 4QQ6A 3TCJA 2MAMA 5KCHA 4HCCA 2IVWA 2QQSA 3PIPA 2X35A 3JB9H 1H641 3P8DA 5GMKm 2L8DA 2E70A 2ZZDA 3FIFA 1KQSS 4NOYA 2M9UA 4N0AC 1ZQ1A 1Y71A 3OYBA 4ZN1A 2ZPFB 4J7FA 4XAXB 2VXEA 3JCMX 4O6JA 4C5HA 1U1TA 2A7YA 4OF1A 4C0FA 3A8LB 1U8RA 3M53A 4JLIA 1M90C 2RHIA 2XDPA 1KG1A 1S72A 4EMKC 1YITT 4JUVA 4L59A 1VQPT 4FIBA 4C8QC 3OYHA 2KK4A 3M9QA 5LJ3e 4LDXA 4M78D 2FB7A 3OYAA 4KUDK 1X6OA 2GF7A 5LJ3g 3RESA 1NJIC 1PSFA 5LJ5d 5GAN3 5GANf 4A4GA 1YHQT 2L89A 2X4WA 1UGRB 1JBMA 4M78G 3S3NA 1BI1A 2BIVA 4FL6A 3PIOA 1N9SA 3QHSA 5HKCA 4C8QF 2ZPIB 4OGEA 2RK1A 4FSXA 4Q5WA 1VQOT 4OB0B 1VQKA 2WSFE 3GIBA 3SD4A 2CZ7B 3VJPA 4KUIA 5CQXA 5CVIA 1VQMT 2LQKA 2XU8A 3CXCS 3OYEA 4BB7A 2K57A 3NTKA 2YHTA 4GLKA 4M78A 2E12A 4J6XA 1YJNT 3G4SA 3PFSA 4LD6A 2V8IA 1QVGA 2QQ9A 4M77E 4ATOA 2RHZA 1M5Q1 3VYHB 3QZ9B 2DXTA 3QJYA 4BD3A 4HKEA 1M9SA 5A2QE 3OYGA 3CCRT 1VQ9A 4NL2A 5A0DA 3N5BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I8F A;  4M7A A;  1YCY A;  4M7D A;  2QTX A;  1WPY A;  2HNI A;  1I81 A;  3INZ A;  4XTY A;  3V7C A;  3V8L A;  5GAN j;  1MGQ A;  1HXD A;  3RIR A;  2EWN A;  4XQ3 A;  4V2S A;  3QO3 A;  1KQ2 A;  5GAO q;  5GAM j;  5GAO p;  3JCM V;  4M7A E;  5LJ5 j;  4M7D E;  1Y96 A;  2DKG A;  3JCM c;  4M77 C;  4XU3 A;  4C92 F;  3JB9 D;  2DEQ A;  4J5Y A;  4M7D D;  3V7S A;  4M78 C;  4J6Y A;  3JCM e;  3JCM b;  2RB6 A;  2CGH A;  4PJO E;  2DJZ A;  2FYK A;  3JCM g;  4Y91 A;  4A53 A;  4M7D G;  4PJO D;  3JB9 G;  4C92 B;  2JN0 A;  5LJ3 h;  3JCM P;  2DZC A;  5GAN e;  5GAN 4;  1HK9 A;  4M75 E;  3HFN A;  4M75 D;  5DY9 A;  5GMK e;  2DTI A;  2E64 A;  2E10 A;  4M77 F;  3HFO A;  4PJO G;  4F7U A;  5GAN g;  4HT8 A;  4M7D C;  3EFR A;  4M7A C;  3RKW A;  4RCC A;  4M78 F;  3L2Z A;  3RKY A;  4XTU A;  4JRI A;  3V7R A;  3SWN A;  4M75 G;  5GAO r;  4JRK A;  3M4G A;  4QVD A;  4HT9 A;  4C8Q E;  2RD1 A;  3FB9 A;  5LJ3 f;  4C8Q D;  4F7U E;  1U1S A;  2I2L A;  2EJ9 A;  4M77 B;  4PJO C;  3QSU A;  1B34 A;  4HA8 A;  1LOJ A;  5GMK j;  4M78 B;  2VXF A;  3JCM W;  3JB9 J;  4M7A F;  4C8Q G;  4F7U G;  3JB9 F;  1I4K 1;  3L1A A;  4XU0 A;  4N0A A;  3JCM J;  4MML A;  4M75 A;  4XTW A;  5I21 A;  3FJP A;  2E65 A;  4XTZ A;  4MMK A;  3RUX A;  5GAO l;  4NL3 A;  2DZ9 A;  4M7A B;  5GAM h;  4DQ2 A;  5GAO n;  4M7D B;  5LJ5 h;  1I5L A;  1M8V A;  2Y90 A;  4QVC A;  4EMK A;  1D3B A;  3SWN C;  1LNX A;  4C8Q A;  4EMH A;  5LJ3 d;  3HSB A;  1Y96 B;  4PJO B;  1BIB A;  3SB2 A;  3JB9 H;  5GAM f;  1N9R A;  5LJ3 j;  4F7U F;  1LJO A;  1H64 1;  3QUI A;  4C92 D;  4C92 E;  5GMK m;  5LJ5 g;  5LJ5 f;  3RER A;  3FIF A;  4NOY A;  4N0A C;  2EAY A;  3JCM h;  4M75 C;  3JCM X;  2VXE A;  1U1T A;  4M7D F;  1WNL A;  4X9D A;  3V8K A;  4C92 G;  4F7U B;  4JLI A;  5GAN h;  3BDU A;  1KQ1 A;  3AHU A;  4EMK C;  2E1H A;  2EJG A;  4X9C A;  4JUV A;  1WQ7 A;  3SWN B;  5GMK h;  4PJO F;  1X01 A;  4C8Q C;  4M77 D;  1JRI A;  4PNO A;  4XTX A;  5LJ3 e;  3JCM f;  2VC8 A;  4M78 D;  2FB7 A;  5GAO m;  3BFM A;  1B34 B;  1TH7 A;  4M75 F;  4RCB A;  3VU3 C;  5LJ3 g;  3RES A;  2RA2 A;  3BY7 A;  4C92 A;  5GAM d;  4M77 G;  4EMG A;  5LJ5 d;  3JB9 I;  5GAN 3;  5GAN f;  2YLC A;  4XU1 A;  2DTO A;  1JBM A;  4M78 G;  3RKX A;  2DXU A;  1N9S A;  3QHS A;  4M75 B;  2ZGW A;  4C8Q F;  4J6W A;  4M7A D;  5GAN 6;  5GAN 7;  4PJO A;  4WF2 A;  2DTH A;  3GIB A;  1BIA A;  2EJF A;  1WQW A;  3BW1 A;  4XU2 A;  4EMK B;  1D3B B;  2DVE A;  4M77 A;  4XTV A;  4M7A G;  4C8Q B;  5GAN 2;  2K57 A;  2YHT A;  4M78 A;  4A54 A;  3EFS A;  4J6X A;  4OP0 A;  3V8J A;  3JCM d;  5GAN 5;  4M77 E;  1M5Q 1;  5GAM e;  2RM4 A;  4C92 C;  5LJ5 e;  5GAN 8;  5CAI A;  3JCM Q;  4M78 E;  2DXT A;  2E41 A;  5GAN d;  5GMK l;  5GAM g;  3PGG A;  4NL2 A;  5GMK i;  2YLB A; 
#chains in the Genus database with same CATH topology
 1HD3 A;  1GBR A;  3OYN A;  4LDV A;  3DLM A;  4ZN3 A;  3V7S A;  3GF5 A;  3GPL A;  3CMA T;  2RB6 A;  2QA4 Q;  3JCM g;  3EGX B;  5D6X A;  4C92 B;  3JCM P;  4RG2 A;  4M75 E;  1UJ0 A;  2LT1 A;  2DTI A;  3CCR A;  2V8K A;  2CZ1 B;  2EBP A;  1X27 A;  3OYL A;  4M4Z A;  1KHC A;  2X4J A;  1ZHI A;  1SHF A;  3G6E T;  2IIM A;  1UEB A;  5DM7 R;  3JB9 J;  3NMZ C;  1VOM A;  3DKM A;  4AFS C;  3CCQ T;  1PG5 B;  2V26 A;  4XTW A;  2FPD A;  2DZ9 A;  2DO3 A;  5GAO n;  2J7I A;  4MDX A;  3SWN C;  2OJ2 A;  5IT9 E;  1SSH A;  3NTH A;  1N8R R;  3OYC A;  3QUI A;  4DA4 A;  1FXX A;  3E1S A;  3G4S Q;  1K9M U;  4R56 A;  4OGC A;  4C5E A;  4C92 G;  1HJD A;  4IUR A;  1WYX A;  2QQA A;  1BCO A;  2QQR A;  1X01 A;  1R8O B;  1B34 B;  3OQ5 A;  1IXD A;  3I55 A;  3EGX A;  4C92 A;  4XU1 A;  4J83 A;  1JJ2 P;  5DLQ E;  3ZFJ A;  2C06 A;  2OAW A;  2DIL A;  3URG A;  2DFU A;  4OMO A;  3CCU Q;  1QCO A;  4BE1 A;  2RN8 A;  3VS7 A;  2J6O A;  1KD1 R;  1TUD A;  1VQ8 T;  1ZBX A;  4EMK B;  1H3H A;  1D3B B;  3HKS A;  4BDY A;  4XTV A;  1T0J A;  3C4S A;  1EFN A;  4JJB A;  5EG2 A;  2G6F X;  3GBQ A;  1MMA A;  3CC4 A;  5M9O A;  3M54 A;  5GAM e;  4HCZ A;  2E41 A;  3JV3 A;  1FMK A;  2W10 A;  2K4Y A;  3CD6 A;  2P0Q A;  3INZ A;  1WHM A;  2P84 A;  3DB4 A;  1NM7 A;  4XU3 A;  4J5Y A;  3PVQ A;  2ECZ A;  2CGH A;  3OSS C;  2M02 A;  1Y57 A;  3FC3 A;  1OQK A;  1M2O A;  4MDW A;  1K1Z A;  1TOV A;  3OSV A;  4M7D C;  2X3X D;  2YUN A;  3A5Z B;  2EGA A;  1TUG B;  1Y07 A;  4F7U E;  4VUB A;  2DXB A;  4C8Q D;  2ENM A;  1KC8 U;  1QVF A;  1UEC A;  4ESR A;  1B34 A;  2ZPG B;  4FSS A;  2RPN A;  1VQM A;  1RI9 A;  4N0A A;  2P0P A;  4AFQ C;  3S3M A;  2VKN A;  3CCU T;  1QP2 A;  2EGE A;  1PCX A;  1WXB A;  2JXB A;  4EMK A;  1Q81 C;  1D3B A;  2EYZ A;  3OYF A;  1X6G A;  1RAB B;  4WCI A;  2RK2 A;  4F7U F;  1K9A A;  2BTT A;  3DB3 A;  1WX6 A;  1WDX A;  1QCN A;  1G3Y A;  9ATC B;  3JSC A;  1VQ4 A;  4KGZ B;  2WAC A;  2LCL A;  3SWN B;  1MUZ A;  1A0N B;  1G83 A;  2E5Q A;  3VRY A;  1EZZ B;  2KSS A;  4RCB A;  5DLO A;  1BYM A;  3HP9 A;  5C6S A;  1QW1 A;  2IG0 A;  2JOY A;  2RJF A;  3I56 A;  8ATC B;  1XJW B;  2OTJ A;  2MPX C;  5GAN 2;  2HSE B;  1KJW A;  1AVZ C;  4KH1 B;  3A8H B;  3ER0 A;  5AT1 B;  4M78 E;  2DBK A;  2E6Z A;  1I81 A;  3OMG A;  1JXM A;  4RMO A;  2QTX A;  1S1N A;  4DBH A;  5FU7 B;  2KT1 A;  3CCR Q;  3MEA A;  1WHL A;  1NJI U;  1K0X A;  1WJQ A;  4DOV A;  5GAN e;  2QDL A;  4JRQ A;  1ZUU A;  2XHC A;  4PJO G;  2LVM A;  4M78 F;  2M0Y A;  3SWN A;  4IKF A;  4C8Q E;  2RD1 A;  3S3O A;  3RR6 A;  2QK0 A;  2VXF A;  4ZGJ B;  1NEG A;  3ZL7 C;  1ZX6 A;  2M0O A;  2R57 A;  3LW5 E;  3CME A;  2FG0 A;  4II1 A;  4M7D B;  1M8V A;  3GP8 A;  5FRM A;  5J3B A;  3UA6 A;  2LJ0 A;  1BIB A;  3G71 A;  3EAE A;  5GAM f;  5D6Y A;  3THK A;  1NPP A;  4OMF B;  4M7D F;  4RTU A;  4X9D A;  3I55 Q;  4OMN A;  1YNZ A;  2JJ9 A;  3BDU A;  2KYM A;  1RL2 A;  1RLP C;  2MK5 A;  5KH6 A;  4ZTF A;  2DER A;  4LD9 K;  1MNE A;  2OAU A;  1XQH A;  3JB9 I;  2SRC A;  4JLG A;  2YLC A;  2MF2 A;  4M7A D;  2KEA A;  2A28 A;  1IHV A;  3MP8 A;  2MYS A;  3CC4 Q;  1H8K A;  1BIA A;  4HVV A;  2E4H A;  3TVT A;  3OMC A;  3UT1 A;  2GQI A;  3CD6 Q;  2MIO A;  2A08 A;  2RQW A;  5CAI A;  2EGC A;  2K2M A;  5LJ5 g;  3H9N A;  4PKC C;  4ZGD B;  1HYO A;  2DD5 A;  4QQD A;  1Q81 R;  4M7D A;  1UG1 A;  3QO3 A;  5GAO p;  1K73 U;  2AHJ B;  5LJ5 j;  1UGS B;  3H0I A;  4PJM A;  3T9N A;  4P5N A;  2X3W D;  4J6Y A;  4EDU A;  2PUK B;  1SG5 A;  1SF9 A;  4HCK A;  1BI2 A;  4ME7 A;  1AZE A;  4R55 A;  5CKH A;  5GMK e;  5IHK A;  2E10 A;  5D6W A;  4XTU A;  1WJS A;  3I55 T;  2VGN A;  2FZG B;  2KNB B;  1VQM Q;  3TEE A;  3C95 A;  2PVG B;  1M90 U;  1IRX A;  2FHD A;  4PJN A;  5KYU B;  4OMQ A;  3L1A A;  1JQQ A;  3GLX A;  2OI3 A;  4FW1 A;  2WSE E;  3RDV A;  1M1K U;  5GAM h;  4IIO A;  1S72 T;  5AYF A;  2E3H A;  3NTI A;  3KXT A;  4IUT A;  1U5S A;  3J81 E;  2OTL A;  1IB8 A;  2HL5 C;  2QA4 A;  3CD6 T;  4QQ6 A;  1UGQ B;  2NLU A;  1Q82 R;  1VQ4 Q;  2IVW A;  1ZSG A;  2X35 A;  3P8D A;  1R0B G;  2L8D A;  4NOY A;  3OYB A;  3JCM X;  4XAX B;  4O6J A;  4C0F A;  2L3Q A;  4OF1 A;  3A8L B;  1U8R A;  2RHI A;  1T3S A;  2XDP A;  3PE0 A;  3EGU A;  4FIB A;  1RAC B;  3M9Q A;  4LDX A;  4KUD K;  5LJ3 g;  3EH2 A;  2D8H A;  1UUE A;  4A4G A;  5GAN f;  3S3N A;  1JBM A;  2OTJ Q;  2BIV A;  5HKC A;  4OB0 B;  1VQM T;  3CXC S;  2XU8 A;  3OYE A;  2CT3 A;  4BB7 A;  1J3T A;  1CKA A;  2E12 A;  1AEY A;  5KYU A;  3G4S A;  3PFS A;  2HQH A;  4M77 E;  3UF4 A;  2DXT A;  3QJY A;  4HKE A;  1WHH A;  3EG0 A;  1YCY A;  4PFP A;  1AWX A;  3HRU A;  4RTX A;  1D0X A;  2AZV A;  2AKL A;  2EVR A;  3ZBD A;  1KQ2 A;  3VS5 A;  1W4S A;  1TSF A;  3X25 B;  5J26 A;  1CKB A;  1G3W A;  1JO8 A;  2KGT A;  4Y92 A;  1RAD B;  1YJN A;  5CKF A;  4J9H A;  2RI5 A;  4IUP A;  4M77 F;  3L2W A;  4LUE A;  3M4G A;  4KUL A;  3CME Q;  1FX7 A;  3CCS A;  3I56 T;  1ZLM A;  2QDY B;  5A0G A;  3UWN A;  2OTJ T;  1QVF P;  1YJ9 A;  5KE3 A;  1AT1 B;  3M59 A;  1FYN A;  3HSB A;  2XID A;  5HY6 A;  3C0C A;  2K5F A;  4C92 D;  3F70 A;  1ZSZ C;  2NUZ A;  2F2X A;  3FEO A;  2P0K A;  3VYG A;  4CI0 C;  2EQJ A;  4BY6 C;  3OYK A;  5GAN h;  1KQ1 A;  2F2V A;  3LH5 A;  1KHI A;  2PZ1 A;  3H6Z A;  3VU3 C;  2RA2 A;  3BY7 A;  3CCV A;  1RI0 A;  5IXF A;  2YUO A;  4FT2 A;  3M0R A;  2LQN A;  4LXC A;  4L6V 5;  1YCS B;  5GAN 7;  2RHY A;  4WF2 A;  3JRZ A;  3BW1 A;  3OS2 A;  1K0S A;  1SSF A;  5GJW B;  1OV3 A;  1GCP A;  3JCM d;  4N4H A;  2KY9 A;  1OZ2 A;  4MZT A;  5CKE A;  1VQL T;  3G71 T;  5GAN j;  2BUD A;  4BI4 A;  3EFO B;  4IIM A;  5GAO q;  1U06 A;  1VIF A;  2YRV A;  1MMN A;  3CBO A;  1QP3 A;  1UB4 A;  4E7J A;  3X26 B;  3PMI A;  3JB9 G;  2FL7 A;  4ZNX A;  2P4T A;  1P92 A;  1WHK A;  2FO0 A;  1AZG B;  2L2P A;  1Z9Q A;  5A0L A;  2O4X B;  4IUU A;  1BKB A;  1I07 A;  3EG2 A;  1G2B A;  2QXF A;  1EIF A;  1K4U S;  4AG2 C;  2GQV A;  1MMD A;  4RTW A;  2K3B A;  2OTL Q;  4MMK A;  1TUC A;  1V1C A;  1QCF A;  5KYX B;  1YIJ A;  2XIC A;  2AT1 B;  1Y0M A;  5ECA A;  1LNX A;  2F5K A;  1BI3 A;  2DE0 X;  1UDL A;  4C92 E;  3OBW A;  2JTM A;  3I5S A;  1NYF A;  1Q86 R;  3C12 A;  2KDS A;  1B07 A;  2VVK A;  3OYM A;  3V8K A;  3EFO A;  4RTZ A;  2JTE A;  4RTY A;  1K8A C;  5GMK h;  3X20 B;  4JJD A;  2J05 A;  1KD1 U;  4RTT A;  4TVR A;  3OW2 A;  1TH7 A;  4M75 F;  1KIK A;  2YXY A;  1K76 A;  3CCM A;  2BE9 B;  1ZSZ B;  2Y4Y A;  1VQP Q;  2D8J A;  4J6W A;  5GAN 6;  4FYX B;  3MP6 A;  4BY6 B;  2RI2 A;  3PNW C;  1WQW A;  2O4X A;  2HSP A;  2DVE A;  2VWF A;  5FLX E;  3CBM A;  1HSQ A;  3KUF A;  1QWE A;  3V8J A;  2RJD A;  4E47 A;  2LJ1 A;  2FEI A;  1BK2 A;  4ANJ A;  5KYX A;  2X4Y A;  4C0G A;  2OTL T;  1SRM A;  3OB9 A;  3A8M B;  2QA4 T;  3WVE B;  3HTR A;  2EWN A;  1YJN Q;  1RAA B;  1T3L A;  2LRQ A;  2XDD A;  2RQT A;  4M78 C;  2CP0 A;  4C0D C;  5FU7 C;  4PJO D;  2DYI A;  3CEY A;  4GY5 A;  3CCS Q;  3RKW A;  1WHG A;  2DBM A;  3L2Z A;  4F16 A;  2RHX A;  1W6X A;  4HT9 A;  3FB9 A;  4LUD A;  5KE2 A;  3M0T A;  4A4K A;  2YWW A;  1YJ9 Q;  2PTK A;  2L3R A;  1ZSZ A;  4R0K A;  2KRO A;  2R5A A;  5GAO l;  3I5R A;  4J9B A;  4KT0 E;  3LYI A;  3G4S T;  1ZA2 B;  3A8G B;  2ED0 A;  2KYB A;  1VQ6 A;  2LP5 A;  3U23 A;  1YN8 A;  2DAQ A;  3L2V A;  2GFA A;  2EKH A;  1WHJ A;  2QGF B;  1LJO A;  3UAT A;  2FRY A;  5J39 A;  2XDB A;  2F69 A;  1NPR A;  3P8H A;  1ZUK A;  1OU9 A;  1WNL A;  4F7U B;  5CQY A;  3CCV Q;  3CQT A;  1ARK A;  3OW2 S;  1G5V A;  1LVK A;  1ACM B;  2DIG A;  2DL3 A;  4LDU A;  4KGX B;  4D8D A;  1NZ9 A;  2KT8 A;  1MV0 B;  3J7A F;  1AWO A;  1KK7 A;  2X51 A;  2K3X A;  3E2U A;  2RQV A;  4E7H A;  1AD5 A;  2D0Q B;  4ORZ A;  4E2F B;  4CC7 A;  1YJ9 T;  3FJ5 A;  5IXB A;  3G1J A;  3REA B;  5GMK i;  2YLB A;  4XTY A;  1HXD A;  4J7I A;  2HBP A;  1QQJ A;  1AHJ B;  3PTA A;  4OB3 B;  3JCM b;  3LLR A;  4BDZ A;  4PJO E;  1OI1 A;  3LH0 A;  1GBQ A;  4A4F A;  1PRM C;  4BI3 A;  4F7U A;  2EQU A;  1K8A R;  4AFU C;  1G3S A;  4E7L A;  3CCV T;  2VUB A;  1WJR A;  1PM3 A;  2AK5 A;  2MOX A;  2JS2 A;  1RAG B;  3ULR B;  4M78 B;  1YIJ Q;  2EW3 A;  2I0N A;  4C0D B;  2ZPH B;  2DL4 A;  4XU0 A;  2YSQ A;  3M55 A;  1K73 C;  2EYX A;  2E65 A;  6AT1 B;  1Y7X A;  5C0M A;  3EG9 B;  1VQN Q;  3X24 B;  3M4Y A;  4PK4 A;  1Y96 B;  2DRK A;  4Z88 A;  2B86 A;  3HPW A;  3JB9 H;  2W0Z A;  2QQS A;  3PIP A;  2E70 A;  3FIF A;  4ZN1 A;  2ROL A;  1U1T A;  3CCM Q;  1M90 C;  4JLI A;  2Z0W A;  1NLO C;  2JT4 A;  4L59 A;  3OYA A;  1BBZ A;  4DEX A;  1RAE B;  2LJ3 A;  2O2O A;  5LJ5 d;  5GAN 3;  2L89 A;  2X4W A;  4M78 G;  2DF6 A;  2KRM A;  2C0T A;  3PIO A;  1N9S A;  4C8Q F;  4OGE A;  2JM9 A;  3M0Q A;  1VQK A;  1TU0 B;  2WSF E;  1QLY A;  4JPB W;  3SD4 A;  2COY A;  2CP5 A;  1NEB A;  2K57 A;  3NTK A;  4M78 A;  1VQ7 Q;  3MKD A;  2VB6 A;  4F04 B;  4HVW A;  2XMF A;  1M5Q 1;  1C0M A;  4FYW B;  3CCR T;  1QKX A;  1MND A;  3VV0 A;  1WPY A;  4PLI A;  2DYB A;  2V1R A;  1W1F A;  3EG9 A;  1Q7Y U;  3MEW A;  1Y96 A;  3O8V A;  4M77 C;  1PRL C;  3FLG A;  3JCM e;  3S6W A;  5I2M A;  3VUB A;  4M7D G;  4ZGE B;  2KBT A;  4D8K A;  2ROT A;  3CXC A;  1KFZ A;  3OYI A;  1M2V B;  4RCC A;  3CCM T;  4C5I A;  1YP5 A;  2EYY A;  2HZY A;  2HD0 A;  4BAC A;  1PD1 A;  2RMO A;  2J6F A;  2HKQ B;  2KMT A;  2DLP A;  1N5Z A;  2LQW A;  1Q82 U;  1VQ6 Q;  3CC7 A;  3M0U A;  2JVV A;  4FW2 A;  3SDZ A;  2JTF A;  4OVA A;  2M16 A;  3QBY A;  1W2B S;  2L3P A;  4ZTJ A;  5LJ3 d;  5FRN A;  3CPW A;  1NE8 A;  2KRN A;  4OMP A;  1N27 A;  3E9F A;  3OS1 A;  8AT1 B;  1I5O B;  2RHU A;  2PVD B;  1EX4 A;  4J8O A;  1VQ9 Q;  2MCN A;  3PMT A;  2E1H A;  2EJG A;  1T0H A;  4PNO A;  3LWH A;  1DJ7 B;  2ZAE A;  3CC4 T;  3TU4 K;  2V8J A;  2QEX A;  3TSW A;  1OEB A;  2CUB A;  2YRC A;  4D6W A;  4E7S A;  4UC4 A;  2RNA A;  2FRW A;  2COW A;  3OYD A;  1M2V A;  3M0P A;  1C6V X;  3OW2 P;  3GNG A;  1VYV A;  2EJF A;  1VQ5 A;  3M58 A;  4C5G A;  1OPK A;  1WFW A;  1WGS A;  2CSQ A;  3LGF A;  4IUQ A;  3EH1 A;  3CC2 A;  4NS5 A;  2GNC A;  1MV3 A;  1VYU A;  2HQX A;  2RM4 A;  1K73 R;  3QKJ A;  5KYN A;  5GAM g;  5EC7 A;  1VQ6 T;  2VYT A;  5FU6 C;  1M8M A;  3CPF A;  3EG3 A;  5GAM j;  4M7A E;  3JCM V;  3JCM c;  1VQ8 A;  3JB9 D;  5CR2 A;  4JRP A;  1NG2 A;  2LX9 A;  1GXI E;  2KE9 A;  4HVU A;  2KAF A;  2XKO C;  4A53 A;  1YIT A;  1VQP A;  2CDT A;  1HK9 A;  2LMJ A;  1GCQ C;  1IZ6 A;  1M3C A;  1WXU A;  3VS6 A;  2CRE A;  1D1C A;  3FRN A;  4JRK A;  5IN1 A;  3LGL A;  2GCX A;  4M77 B;  3WVD B;  4Y28 E;  2RI3 A;  3KFV A;  1H92 A;  4M7A F;  4BE0 A;  4L5G A;  4CRI A;  1X43 A;  1GL5 A;  1VQ4 T;  3UPU A;  4DOW A;  2CZ0 B;  3CPW S;  2VV5 A;  1N6A A;  4EMH A;  5KYW B;  1IO6 A;  2DXC A;  2HEQ A;  3E9G A;  2X4X A;  4DBQ A;  2GFU A;  3QDF A;  5FWB A;  3P8B B;  2MWP A;  2K2V A;  2EAY A;  1OPL A;  4M75 C;  1YBY A;  4FT4 A;  1PSE A;  3WXM B;  3EHR A;  3OY9 A;  2CP7 A;  3AHU A;  3TSZ A;  2DRM A;  3JCM f;  5IHI A;  3EGD B;  2K5I A;  1VQK Q;  2PVO B;  4A4H A;  4M77 G;  1KSW A;  2G3R A;  3HRT A;  3C94 A;  2DK3 A;  3VS1 A;  2H8H A;  2DXU A;  3R6N A;  2ZPB B;  3ZEH A;  2DTH A;  2CS7 A;  3CCE A;  1BI0 A;  2ABL A;  3GOX A;  4M77 A;  2GTO A;  4A54 A;  3EFS A;  2LT4 A;  2DNU A;  3VS3 A;  3REB B;  2RO0 A;  2CYZ B;  4IUV A;  4JS5 A;  3MCA B;  4PLL A;  4X34 A;  4KH0 B;  5KYY B;  1TG0 A;  2QYZ A;  3H8Z A;  4XK8 E;  1IRE B;  1XOV A;  5I22 A;  5IAY A;  3FDR A;  2ATC B;  2DEU A;  5KYW A;  2DD4 A;  2DEQ A;  2NUP B;  2H3E B;  4Z89 A;  3D7S B;  1AWJ A;  5L8R E;  1AWW A;  2LCC A;  3L2Q A;  3QII A;  1K9M C;  3CME T;  1PKS A;  1B3Q A;  3DLL A;  2GTJ A;  3HFN A;  2E64 A;  5GAN g;  3M0S A;  1G8X A;  2LQ8 A;  5FU6 B;  3EFR A;  1UGP B;  3ASK A;  5FW9 A;  3RNJ A;  5GAO r;  4FYV B;  3MP1 A;  2M1H A;  3EGD A;  3CC7 Q;  5IHN A;  4HA8 A;  2PUO B;  1VQK T;  3JB9 F;  4J9E A;  1WI7 A;  3VS2 A;  5I21 A;  3H41 A;  4XTZ A;  4OMM A;  1Q86 U;  2DM1 A;  2SEM A;  2L3S A;  3G7Z A;  2RQU A;  3G6E Q;  2BZX A;  2A36 A;  1I1J A;  2QTV A;  1D1A A;  3L2R A;  1N9R A;  2XD0 A;  4LNP A;  5KYY A;  3JCM h;  2RQR A;  1E6H A;  2NUT B;  1UFF A;  4OB2 B;  1YJW A;  1KQS A;  2IPO B;  2QEX Q;  1UE9 A;  1N8R U;  5GJV B;  2CUD A;  2EYQ A;  1JRI A;  4XTX A;  2F1L A;  2NUP A;  4JJN K;  1CSK A;  4FU6 A;  1X6B A;  1RUW A;  2P4R A;  1VQ5 Q;  4EMG A;  2JW4 A;  2EKO A;  3JAM E;  4KGV B;  4M75 B;  1H3Z A;  3CC2 Q;  2D9T A;  1VQN A;  4PJL A;  2EQM A;  3CCL A;  4K11 A;  4J9I A;  1UTI A;  2A3L A;  4Z02 A;  1KC8 C;  3QWY A;  1M4Z A;  3CC7 T;  1BCM A;  1UJY A;  2BE7 D;  2MI6 A;  5LJ5 e;  1GCQ A;  3PGG A;  1VQ8 Q;  3M5A A;  4GLM A;  4BE2 A;  2MWO A;  2X9H A;  3V7C A;  3VS4 A;  4ELZ C;  5FRO A;  4V2S A;  1YIT Q;  4ELY C;  3VKI A;  2AKK A;  2KQW A;  4C92 F;  1QKW A;  1X69 A;  3X28 B;  2CP3 A;  2EFI A;  2FYK A;  2H3J A;  1SKU B;  2NUT A;  5D7U A;  3SHW A;  4BI8 B;  2HKN A;  1OX8 A;  3MHX A;  5IH2 A;  2LC4 A;  1M1F A;  1Q95 G;  2QEX T;  4M75 G;  1W70 A;  1VQ7 A;  2OX7 A;  1U1S A;  4PJO C;  2CSI A;  4LDY A;  3CXC P;  1WA7 A;  5GMK j;  1VIE A;  1WIE A;  1IGQ A;  1VQ5 T;  2KXC A;  4M75 A;  2Y4X A;  4BUG A;  4E7Z A;  3CC2 T;  1I5L A;  2CT4 A;  3KBG A;  1FMW A;  1X2Q A;  2QGG A;  2K7A A;  3NGP A;  4QQG A;  1AOJ A;  2L0A A;  3TCJ A;  5KCH A;  4HCC A;  5GMK m;  2ZZD A;  1KQS S;  4PFZ A;  1Y71 A;  2ZPF B;  3EG1 A;  4J7F A;  3CPW P;  4C5H A;  1B7T A;  4J9C A;  2NWM A;  1S72 A;  1YIT T;  1VQP T;  4C8Q C;  3OYH A;  5LJ3 e;  4M78 D;  1OUL A;  2DL8 A;  2GF7 A;  1K9M R;  3RES A;  1NJI C;  1PSF A;  3CCE Q;  1UGR B;  1BI1 A;  2M51 A;  2RK1 A;  4FSX A;  4Q5W A;  5CQX A;  2KI7 A;  1ZBJ A;  4GLK A;  2BZ8 A;  1YJN T;  4LD6 A;  1QVG A;  2DET A;  2QG9 B;  2ESW A;  1PNJ A;  4BD3 A;  1VQ9 A;  3OYG A;  4CC2 A;  4NL2 A;  3N5B B;  4DBR A;  5CK9 A;  3PVL A;  2HCK A;  3V8L A;  2MMP A;  2HL3 A;  2LTO A;  4J9G A;  1M1G A;  1K8A U;  4M7D D;  2LX7 A;  3QYG B;  5I2S A;  3CCS T;  2L5Q A;  4OB1 B;  3M56 A;  5HCK A;  1OU8 A;  1D0Y A;  2DZC A;  4QKU A;  4DBF A;  3RMS A;  3A1P A;  2JS0 A;  4JJC A;  3QJ6 A;  2EJ9 A;  1QWF A;  2K3Y A;  3QSU A;  1LOJ A;  2ZPE B;  3JCM W;  2FPF A;  4F7U G;  1I4K 1;  2QAS A;  2J06 A;  3CCE T;  1Q7Y C;  2JZ2 A;  4MML A;  1VYT A;  4YTL A;  1JXO A;  2DMO A;  1KC8 R;  1X2K A;  4EIK A;  4PJO B;  4HXJ A;  2B8A A;  1QVP A;  2KXD A;  3SB2 A;  1YJW Q;  2RJC A;  2KVQ G;  5LJ5 f;  2QAZ A;  3RER A;  4JZ4 A;  2HBW A;  2O01 E;  2QQB A;  1YI2 A;  2QI2 A;  4QT7 A;  2D6F A;  2CZ6 B;  3PT9 A;  1M30 A;  3QWX X;  4MZM A;  4PJO F;  2VC8 A;  1Q82 C;  3BFM A;  4RTV A;  3CCL Q;  3HL8 A;  3J80 E;  3O5Z A;  2DTO A;  1W2B A;  3RKX A;  3OYY A;  4KBM B;  3HHT B;  3CCJ A;  2FZK B;  5CCA A;  1QVG S;  4C8Q B;  2EPD A;  4LE9 A;  1O9S A;  4F14 A;  2DL7 A;  4OP0 A;  2LDM A;  3OA6 A;  2JUF A;  5FWC A;  1NLP C;  3MEV A;  1E7O A;  5GAN 8;  1QVF S;  1YWO A;  3QDR B;  4E7I A;  1I8F A;  2JNG A;  1M1K C;  3QYH B;  1RAH B;  2XI9 A;  1LPL A;  3RIR A;  1UHC A;  4N4I A;  2DA9 A;  4M7D E;  4PJO A;  1YWP A;  1JU5 C;  4CC3 A;  3A8O B;  2CKK A;  4OML A;  1Q81 U;  1YJW T;  3OBY A;  1SHG A;  3VUZ A;  2YUQ A;  1PWT A;  4B9W A;  5GAN 4;  1YIJ T;  5DY9 A;  4HT8 A;  4M7A C;  1VQL A;  1YHQ A;  2E5K A;  4QVD A;  2VAS A;  5LJ3 f;  4J9F A;  1NJI R;  1MHN A;  2DPP B;  2RJE A;  4JDS A;  4KRT A;  4E7K A;  1VQO A;  1R0C B;  5CKB A;  1VQN T;  5CIU A;  4C8Q G;  3CCL T;  1SRL A;  1VUB A;  3JCM J;  1YFN A;  3QG1 A;  2EQK A;  3RMQ A;  2JMC A;  1PKT A;  4DQ2 A;  5LJ5 h;  4QVZ A;  4O5V A;  2ED1 A;  4C8Q A;  1IHW A;  4PFO A;  1R77 A;  4GBQ A;  1S72 Q;  4RKU E;  2C0I A;  1O75 A;  2CP6 A;  3CBP A;  4EPC A;  1PD0 A;  3CMA A;  2K5L A;  3E19 A;  3UDC A;  2O9S A;  1G3T A;  3SFM A;  4X9C A;  2HAX A;  1JJ2 A;  4M77 D;  1JEG A;  2AZS A;  4E6R A;  7AT1 B;  1TS9 A;  1KQS P;  2C0O A;  5GAM d;  2FZC B;  3EHQ A;  1VQ7 T;  1JB0 E;  4QW2 A;  4AFZ C;  4JS4 A;  3G6E A;  1Z9Z A;  4FM4 B;  3BDL A;  4B9X A;  1M3A A;  3QZ5 B;  4XU2 A;  3MEU A;  1GRI A;  4CC4 B;  3CCQ A;  1NBE B;  2KRS A;  1Q7Y R;  2FPE A;  2LZ6 B;  4C0Z A;  2GGR A;  5GMK l;  1RLQ C;  2BKD N;  2HNI A;  4HCB A;  4MZP A;  4X1V A;  2EIF A;  1MGQ A;  5I11 A;  1XNI A;  1TXQ A;  3OYJ A;  2A37 A;  4PJJ A;  2RH2 A;  2GBQ A;  2HDA A;  5CO7 A;  2PNI A;  5LJ3 h;  2E6N A;  1M27 C;  4J9D A;  2EYW A;  5HK3 A;  3HFO A;  3A98 A;  1SPK A;  3VS0 A;  3RKY A;  1ABQ A;  2K9G A;  1F1B B;  3MET A;  4LN2 A;  2O31 A;  1FMV A;  5LL6 S;  2F5T X;  3R6O A;  1XTD A;  3ME9 A;  5CKD A;  2COZ A;  2HQE A;  3FJP A;  3RUX A;  4NL3 A;  3M57 A;  4M7A B;  5HK0 A;  3OS5 A;  2CP2 A;  2Y90 A;  4QVC A;  1M90 R;  1D1B A;  3I56 Q;  1VQ9 T;  1YI2 Q;  1WXT A;  1D0Z A;  4WTO B;  5LJ3 j;  4A4E A;  4AT1 B;  3OS0 A;  1M1K R;  1BB9 A;  1V76 A;  3NHN A;  2FVU A;  1JJ2 S;  3SEM A;  2JM8 A;  4AG1 C;  2XG8 D;  2D0N A;  1LCK A;  1WQ7 A;  1MMG A;  2WSC E;  3VRZ A;  3I9Q A;  3TQ7 P;  1M3B A;  5GAO m;  2R58 A;  1I0C A;  2E3I A;  2VGM A;  4FCY A;  2LNV A;  2DJQ A;  3CCJ Q;  1Q86 C;  3QXE B;  2YUP A;  3L42 A;  1V29 B;  1C1A A;  2ZGW A;  1FWZ A;  5L23 A;  2KR3 A;  1BU1 A;  2NYS A;  2XK0 A;  3AT1 B;  4M7A G;  3CCU A;  1UHF A;  2O9V A;  3GNF B;  5GAN 5;  3MJX A;  4C92 C;  3JCM Q;  1VA7 A;  5GAN d;  1N8R C;  4M7A A;  2BZY A;  2PQW A;  4FYY B;  3L2U A;  1QVG P;  4XQ3 A;  4PL6 A;  2LNH B;  2DKG A;  5KCO A;  1YI2 T;  2DX1 A;  2ZCF B;  1VQL Q;  2DIQ A;  2DJZ A;  4Y91 A;  2CH4 W;  3G71 Q;  1YHQ Q;  1PHT A;  2JN0 A;  3MO8 A;  4RG8 A;  2D1X A;  3I35 A;  4N4G A;  4M75 D;  3Q1J A;  1VQO Q;  2R5M A;  2HMA A;  1X75 C;  4JRI A;  3V7R A;  3HRS A;  2PU9 B;  1IGU A;  3LX7 A;  2I2L A;  3RBB B;  1KD1 C;  3LWI A;  2K79 A;  1TTH B;  3IQL A;  3CCJ T;  4B6M A;  2EQI A;  3H0H A;  4LDW A;  1SEM A;  2DL5 A;  1ZA1 B;  2A0F B;  1OYX A;  2J6K A;  3BE3 A;  1WLP B;  1U3O A;  2YRD A;  3TRE A;  1ABO A;  1GFD A;  1RAF B;  3QPH A;  3NFC A;  1PC0 A;  1NYG A;  4RUG A;  2RF0 A;  3CMA Q;  1OZ3 A;  1OX9 A;  1D09 B;  2MAM A;  1H64 1;  2JMA A;  2M9U A;  4N0A C;  1ZQ1 A;  1OOT A;  2VXE A;  2A7Y A;  2AIR B;  4F17 A;  2K6D A;  3M53 A;  1KG1 A;  4EMK C;  3UA7 A;  4JUV A;  2KK4 A;  2YT6 A;  3MPU B;  2FB7 A;  1X6O A;  1TWB A;  1RAI B;  2V1Q A;  1YHQ T;  2F2W A;  3CCQ Q;  4FL6 A;  3QHS A;  2ZPI B;  4JZ3 A;  1ZUY A;  2LCS A;  1VQO T;  3GIB A;  2CZ7 B;  1QMC A;  3NPF A;  3VJP A;  4KUI A;  5CVI A;  2LQK A;  2CH4 A;  2YDL A;  2YHT A;  1W2B P;  4J6X A;  1E6G A;  2O88 A;  1WZO A;  2V8I A;  4Z8A A;  2QQ9 A;  4ATO A;  2RHZ A;  3VYH B;  1GFC A;  4DEY A;  3H0F A;  3QZ9 B;  2DVJ A;  4A63 B;  4AMC A;  5A2Q E;  1M9S A;  1UGV A;  5A0D A; 
#chains in the Genus database with same CATH homology
 3VV0 A;  1YCY A;  5CK9 A;  3HRU A;  1WPY A;  4PLI A;  3V8L A;  3OYN A;  2MMP A;  4LDV A;  3DLM A;  1Q7Y U;  2LTO A;  3ZBD A;  1KQ2 A;  1M1G A;  1W4S A;  3MEW A;  1K8A U;  1Y96 A;  3O8V A;  3X25 B;  4M77 C;  4ZN3 A;  5J26 A;  5I2S A;  3QYG B;  4M7D D;  3FLG A;  1G3W A;  3CCS T;  3V7S A;  3GF5 A;  3JCM e;  2L5Q A;  3S6W A;  3GPL A;  3CMA T;  2RB6 A;  5I2M A;  3JCM g;  4OB1 B;  3M56 A;  3VUB A;  4ZGE B;  1YJN A;  4M7D G;  5D6X A;  4C92 B;  5CKF A;  3JCM P;  2DZC A;  2RI5 A;  4RG2 A;  4M75 E;  3CXC A;  2LT1 A;  2DTI A;  3OYI A;  3CCR A;  2V8K A;  4IUP A;  2CZ1 B;  4M77 F;  3L2W A;  4RCC A;  3OYL A;  4C5I A;  3CCM T;  3RMS A;  3M4G A;  3QJ6 A;  2HD0 A;  1KHC A;  2EJ9 A;  2K3Y A;  4KUL A;  3QSU A;  1LOJ A;  4BAC A;  2X4J A;  1ZHI A;  2ZPE B;  3G6E T;  1FX7 A;  3CCS A;  3I55 T;  3JCM W;  1UEB A;  5DM7 R;  3JB9 J;  3I56 T;  4F7U G;  2KMT A;  3DKM A;  1I4K 1;  3CCE T;  1Q7Y C;  2JZ2 A;  2QDY B;  5A0G A;  4MML A;  3UWN A;  3CCQ T;  3CC7 A;  4YTL A;  4XTW A;  1Q82 U;  2OTJ T;  2JVV A;  2DZ9 A;  1YJ9 A;  2DO3 A;  2JTF A;  4OVA A;  3SDZ A;  5GAO n;  5KE3 A;  2M16 A;  4MDX A;  3SWN C;  3QBY A;  1W2B S;  3M59 A;  5IT9 E;  4ZTJ A;  5LJ3 d;  5FRN A;  3HSB A;  2XID A;  3CPW A;  1NE8 A;  5HY6 A;  4PJO B;  1N27 A;  2B8A A;  1QVP A;  3NTH A;  3SB2 A;  2RJC A;  2KVQ G;  3E9F A;  5LJ5 f;  3OYC A;  3QUI A;  4DA4 A;  2K5F A;  4C92 D;  1FXX A;  3E1S A;  3F70 A;  3OS1 A;  3RER A;  1K9M U;  2RHU A;  3FEO A;  2PVD B;  2O01 E;  4J8O A;  2P0K A;  2QQB A;  4OGC A;  3VYG A;  2QI2 A;  2EQJ A;  4C5E A;  4C92 G;  4CI0 C;  4R56 A;  1YI2 A;  2D6F A;  4BY6 C;  2CZ6 B;  3PT9 A;  3OYK A;  4IUR A;  3PMT A;  5GAN h;  1KQ1 A;  2QQA A;  2E1H A;  2EJG A;  4MZM A;  2QQR A;  4PJO F;  1X01 A;  1R8O B;  4PNO A;  1KHI A;  1DJ7 B;  3LWH A;  2VC8 A;  3CC4 T;  3TU4 K;  1Q82 C;  3BFM A;  1B34 B;  3H6Z A;  3OQ5 A;  2V8J A;  3VU3 C;  2RA2 A;  3BY7 A;  3I55 A;  3CCV A;  2QEX A;  1RI0 A;  4C92 A;  3HL8 A;  4D6W A;  3J80 E;  4XU1 A;  2DTO A;  4UC4 A;  4J83 A;  5DLQ E;  3ZFJ A;  2C06 A;  4FT2 A;  3RKX A;  3OYY A;  4L6V 5;  3OYD A;  3URG A;  1W2B A;  4KBM B;  3HHT B;  5GAN 7;  2RHY A;  4WF2 A;  4BE1 A;  3GNG A;  2EJF A;  3JRZ A;  3BW1 A;  3OS2 A;  3CCJ A;  1VQ8 T;  5CCA A;  1ZBX A;  1VQ5 A;  1SSF A;  4EMK B;  1D3B B;  3HKS A;  4BDY A;  4XTV A;  1QVG S;  3C4S A;  3M58 A;  4C8Q B;  4C5G A;  1O9S A;  1WGS A;  4OP0 A;  3JCM d;  3LGF A;  5EG2 A;  4IUQ A;  3CC2 A;  2LDM A;  4N4H A;  4NS5 A;  3OA6 A;  3CC4 A;  2JUF A;  5M9O A;  2HQX A;  2KY9 A;  3M54 A;  3MEV A;  5GAM e;  2RM4 A;  5GAN 8;  3QKJ A;  4HCZ A;  1OZ2 A;  2E41 A;  1QVF S;  4MZT A;  5GAM g;  3QDR B;  4E7I A;  1VQ6 T;  2K4Y A;  1I8F A;  2JNG A;  2VYT A;  3QYH B;  5CKE A;  5FU6 C;  1M1K C;  1VQL T;  3CD6 A;  2P0Q A;  3INZ A;  3G71 T;  5GAN j;  2BUD A;  2XI9 A;  4BI4 A;  3CPF A;  3RIR A;  3DB4 A;  5GAO q;  5GAM j;  4M7A E;  3JCM V;  4N4I A;  4M7D E;  1VIF A;  3JCM c;  4PJO A;  2YRV A;  1VQ8 A;  4XU3 A;  3JB9 D;  4J5Y A;  3CBO A;  1QP3 A;  5CR2 A;  4JRP A;  3AHU A;  3A8O B;  1UB4 A;  2CKK A;  4E7J A;  2CGH A;  1YJW T;  1Q81 U;  2LX9 A;  3OBY A;  3OSS C;  3VUZ A;  3X26 B;  1GXI E;  2KAF A;  2XKO C;  3PMI A;  4A53 A;  1YIT A;  3JB9 G;  2FL7 A;  3FC3 A;  4B9W A;  1VQP A;  2P4T A;  1P92 A;  5GAN 4;  1HK9 A;  4MDW A;  5DY9 A;  1YIJ T;  1IZ6 A;  3OSV A;  4HT8 A;  4M7A C;  4M7D C;  3A5Z B;  1VQL A;  1YHQ A;  3FRN A;  1Y07 A;  2O4X B;  4IUU A;  4JRK A;  5A0L A;  5IN1 A;  5LJ3 f;  4VUB A;  2DXB A;  3LGL A;  2GCX A;  4C8Q D;  1BKB A;  4F7U E;  1KC8 U;  4M77 B;  1QVF A;  1B34 A;  3WVD B;  4Y28 E;  1MHN A;  2DPP B;  2RJE A;  4JDS A;  4E7K A;  2RI3 A;  2QXF A;  1VQO A;  2ZPG B;  4M7A F;  5CKB A;  4BE0 A;  5CIU A;  4C8Q G;  1VQN T;  3CCL T;  1EIF A;  1VUB A;  1VQM A;  2GQV A;  4L5G A;  4N0A A;  4CRI A;  3JCM J;  3QG1 A;  2P0P A;  1VQ4 T;  3S3M A;  4MMK A;  3UPU A;  2EQK A;  3RMQ A;  3CCU T;  2XIC A;  4DOW A;  1YIJ A;  4DQ2 A;  2CZ0 B;  5LJ5 h;  1QP2 A;  3CPW S;  2VV5 A;  1N6A A;  4EMK A;  4QVZ A;  1Q81 C;  1D3B A;  4O5V A;  1LNX A;  4C8Q A;  4EMH A;  2DXC A;  3E9G A;  3OYF A;  2F5K A;  2X4X A;  1BI3 A;  2GFU A;  2RK2 A;  3P8B B;  4C92 E;  4F7U F;  2MWP A;  2K2V A;  3OBW A;  2JTM A;  4RKU E;  3DB3 A;  2EAY A;  1O75 A;  3C12 A;  3CBP A;  1YBY A;  2KDS A;  4M75 C;  4EPC A;  1G3Y A;  3CMA A;  4FT4 A;  2K5L A;  3E19 A;  3OYM A;  3V8K A;  1PSE A;  3JSC A;  3WXM B;  1VQ4 A;  3UDC A;  2WAC A;  3OY9 A;  1G3T A;  2LCL A;  3SFM A;  4X9C A;  5GMK h;  1K8A C;  2HAX A;  3SWN B;  1JJ2 A;  3X20 B;  4M77 D;  2E5Q A;  3JCM f;  1KD1 U;  2K5I A;  4TVR A;  2KSS A;  3OW2 A;  1TH7 A;  4M75 F;  4RCB A;  5DLO A;  1BYM A;  3HP9 A;  3CCM A;  2PVO B;  4A4H A;  5GAM d;  4M77 G;  5C6S A;  2G3R A;  1QW1 A;  3HRT A;  3C94 A;  2IG0 A;  2DK3 A;  1VQ7 T;  1JB0 E;  2DXU A;  2Y4Y A;  4QW2 A;  4JS4 A;  4J6W A;  5GAN 6;  3G6E A;  2ZPB B;  3ZEH A;  2DTH A;  4FM4 B;  2CS7 A;  2JOY A;  2RJF A;  3MP6 A;  3BDL A;  2RI2 A;  3PNW C;  4B9X A;  1WQW A;  2O4X A;  3QZ5 B;  4BY6 B;  3CCE A;  1BI0 A;  3MEU A;  4XU2 A;  3GOX A;  2DVE A;  3CCQ A;  4M77 A;  2OTJ A;  5FLX E;  5GAN 2;  3CBM A;  4A54 A;  3EFS A;  2LT4 A;  3KUF A;  3V8J A;  2RJD A;  2RO0 A;  4E47 A;  2CYZ B;  4IUV A;  4JS5 A;  3MCA B;  3A8H B;  3ER0 A;  4PLL A;  4C0Z A;  4X34 A;  4M78 E;  2E6Z A;  5GMK l;  1I81 A;  2X4Y A;  4C0G A;  2BKD N;  3OB9 A;  3OMG A;  4RMO A;  2OTL T;  3A8M B;  2QTX A;  2QA4 T;  3WVE B;  2HNI A;  4HCB A;  4MZP A;  2EIF A;  1MGQ A;  3H8Z A;  4XK8 E;  2EWN A;  1IRE B;  1XNI A;  1XOV A;  3OYJ A;  5IAY A;  3FDR A;  2LRQ A;  2RH2 A;  2XDD A;  2DD4 A;  5FU7 B;  2DEQ A;  3MEA A;  4M78 C;  5CO7 A;  4C0D C;  5L8R E;  1NJI U;  5FU7 C;  2LCC A;  1WJQ A;  4PJO D;  4DOV A;  3L2Q A;  5LJ3 h;  3QII A;  1K9M C;  2E6N A;  3CME T;  5GAN e;  3CEY A;  3DLL A;  3HFN A;  4JRQ A;  5HK3 A;  2E64 A;  5GAN g;  2XHC A;  3HFO A;  2LVM A;  2LQ8 A;  4GY5 A;  5FU6 B;  3EFR A;  4PJO G;  3RKW A;  4M78 F;  3L2Z A;  3RKY A;  1UGP B;  3MET A;  3I56 A;  2RHX A;  3ASK A;  3SWN A;  5GAO r;  4QVD A;  4IKF A;  4HT9 A;  3MP1 A;  4C8Q E;  2RD1 A;  3FB9 A;  2M1H A;  5LL6 S;  5KE2 A;  2F5T X;  4A4K A;  4HA8 A;  3S3O A;  3R6O A;  2VXF A;  4ZGJ B;  1XTD A;  2PUO B;  1VQK T;  3ME9 A;  3JB9 F;  5CKD A;  2L3R A;  2M0O A;  2R57 A;  2HQE A;  3LW5 E;  5I21 A;  2R5A A;  3FJP A;  4XTZ A;  3RUX A;  5GAO l;  4NL3 A;  3CME A;  3M57 A;  4M7A B;  5HK0 A;  4KT0 E;  4II1 A;  1Q86 U;  3LYI A;  3G4S T;  3OS5 A;  4M7D B;  1M8V A;  3GP8 A;  2Y90 A;  3G7Z A;  5J3B A;  4QVC A;  4E7L A;  5FRM A;  3A8G B;  1VQ9 T;  1VQ6 A;  1BIB A;  2DAQ A;  3L2V A;  2GFA A;  3L2R A;  3G71 A;  3EAE A;  5GAM f;  1N9R A;  5D6Y A;  5LJ3 j;  1LJO A;  2XDB A;  4A4E A;  5J39 A;  2F69 A;  1NPR A;  3P8H A;  3OS0 A;  2XD0 A;  3JCM h;  1NPP A;  4OMF B;  4M7D F;  4OB2 B;  2FVU A;  1WNL A;  4X9D A;  4F7U B;  1YJW A;  5CQY A;  1KQS A;  1JJ2 S;  2XG8 D;  1N8R U;  3BDU A;  1G5V A;  3OW2 S;  1WQ7 A;  1RL2 A;  2WSC E;  2EYQ A;  1JRI A;  4XTX A;  5KH6 A;  2DIG A;  4JJN K;  4ZTF A;  5GAO m;  4FU6 A;  2R58 A;  2VGM A;  4LDU A;  4LD9 K;  2OAU A;  2LNV A;  1XQH A;  4EMG A;  3JB9 I;  1Q86 C;  3QXE B;  1NZ9 A;  4JLG A;  2YLC A;  3L42 A;  2EKO A;  1V29 B;  3JAM E;  3J7A F;  4M75 B;  2MF2 A;  1FWZ A;  2ZGW A;  4M7A D;  3MP8 A;  2K3X A;  1H3Z A;  2D9T A;  1VQN A;  1BIA A;  2EQM A;  3CCL A;  3OMC A;  3UT1 A;  2A3L A;  4Z02 A;  2XK0 A;  4E7H A;  1KC8 C;  4M7A G;  2D0Q B;  1M4Z A;  3CC7 T;  3CCU A;  3GNF B;  1YJ9 T;  5GAN 5;  2MI6 A;  4C92 C;  5LJ5 e;  5CAI A;  3JCM Q;  5GAN d;  1N8R C;  3PGG A;  5GMK i;  2YLB A;  5LJ5 g;  3M5A A;  4M7A A;  4PKC C;  4ZGD B;  4BE2 A;  2DD5 A;  2MWO A;  4QQD A;  2PQW A;  4XTY A;  3V7C A;  4M7D A;  1HXD A;  3L2U A;  4ELZ C;  5FRO A;  4XQ3 A;  4V2S A;  4J7I A;  4PL6 A;  2HBP A;  3QO3 A;  4ELY C;  5GAO p;  1K73 U;  2AHJ B;  5LJ5 j;  1UGS B;  3VKI A;  2DKG A;  4C92 F;  2KQW A;  3T9N A;  4P5N A;  1AHJ B;  3PTA A;  4OB3 B;  4J6Y A;  5KCO A;  3LLR A;  3X28 B;  3JCM b;  4EDU A;  2PUK B;  1YI2 T;  2EFI A;  2ZCF B;  4BDZ A;  1BI2 A;  2DIQ A;  1OI1 A;  2DJZ A;  2FYK A;  4ME7 A;  2H3J A;  4Y91 A;  4PJO E;  2JN0 A;  3LH0 A;  3MO8 A;  4RG8 A;  4N4G A;  4R55 A;  5CKH A;  4A4F A;  4M75 D;  4BI8 B;  5GMK e;  4BI3 A;  3Q1J A;  2E10 A;  2EQU A;  4F7U A;  5D6W A;  3MHX A;  2R5M A;  2LC4 A;  1M1F A;  1G3S A;  4XTU A;  1WJS A;  1X75 C;  2VUB A;  1WJR A;  4JRI A;  2VGN A;  3HRS A;  4M75 G;  2PU9 B;  3V7R A;  2QEX T;  1VQ7 A;  3TEE A;  3C95 A;  3LX7 A;  1U1S A;  2I2L A;  2PVG B;  1KD1 C;  4PJO C;  4LDY A;  3LWI A;  5GMK j;  1M90 U;  4M78 B;  2FHD A;  1VIE A;  4C0D B;  2ZPH B;  1VQ5 T;  3CCJ T;  3L1A A;  4XU0 A;  3GLX A;  3M55 A;  4M75 A;  4LDW A;  2Y4X A;  1K73 C;  4BUG A;  2E65 A;  2WSE E;  1M1K U;  5GAM h;  1OYX A;  1S72 T;  3CC2 T;  1I5L A;  1Y7X A;  5C0M A;  3KBG A;  5AYF A;  3TRE A;  3NTI A;  3KXT A;  3X24 B;  4IUT A;  3M4Y A;  3CCV T;  3QPH A;  3J81 E;  2OTL A;  1Y96 B;  3NFC A;  2QA4 A;  3CD6 T;  4QQG A;  3HPW A;  1OZ3 A;  2NLU A;  1UGQ B;  4QQ6 A;  3TCJ A;  2MAM A;  5KCH A;  4HCC A;  2IVW A;  2QQS A;  3PIP A;  2X35 A;  3JB9 H;  1H64 1;  3P8D A;  5GMK m;  2L8D A;  2E70 A;  2ZZD A;  3FIF A;  1KQS S;  4NOY A;  2M9U A;  4N0A C;  1ZQ1 A;  1Y71 A;  3OYB A;  4ZN1 A;  2ZPF B;  4J7F A;  4XAX B;  2VXE A;  3JCM X;  4O6J A;  4C5H A;  1U1T A;  2A7Y A;  4OF1 A;  4C0F A;  3A8L B;  1U8R A;  3M53 A;  4JLI A;  1M90 C;  2RHI A;  2XDP A;  1KG1 A;  1S72 A;  4EMK C;  1YIT T;  4JUV A;  4L59 A;  1VQP T;  4FIB A;  4C8Q C;  3OYH A;  2KK4 A;  3M9Q A;  5LJ3 e;  4LDX A;  4M78 D;  2FB7 A;  3OYA A;  4KUD K;  1X6O A;  2GF7 A;  5LJ3 g;  3RES A;  1NJI C;  1PSF A;  5LJ5 d;  5GAN 3;  5GAN f;  4A4G A;  1YHQ T;  2L89 A;  2X4W A;  1UGR B;  1JBM A;  4M78 G;  3S3N A;  1BI1 A;  2BIV A;  4FL6 A;  3PIO A;  1N9S A;  3QHS A;  5HKC A;  4C8Q F;  2ZPI B;  4OGE A;  2RK1 A;  4FSX A;  4Q5W A;  1VQO T;  4OB0 B;  1VQK A;  2WSF E;  3GIB A;  3SD4 A;  2CZ7 B;  3VJP A;  4KUI A;  5CQX A;  5CVI A;  1VQM T;  2LQK A;  2XU8 A;  3CXC S;  3OYE A;  4BB7 A;  2K57 A;  3NTK A;  2YHT A;  4GLK A;  4M78 A;  2E12 A;  4J6X A;  1YJN T;  3G4S A;  3PFS A;  4LD6 A;  2V8I A;  1QVG A;  2QQ9 A;  4M77 E;  4ATO A;  2RHZ A;  1M5Q 1;  3VYH B;  3QZ9 B;  2DXT A;  3QJY A;  4BD3 A;  4HKE A;  1M9S A;  5A2Q E;  3OYG A;  3CCR T;  1VQ9 A;  4NL2 A;  5A0D A;  3N5B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...