5GMKe

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
65
Chain Sequence
VIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 8
structure length 65
sequence length 65
chains with identical sequence g
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmke00
4XTWA 2I2LA 1HXDA 4M78E 4N0AC 1WPYA 4HA8A 4JUVA 3RKWA 4C92G 1D3BB 4XU2A 4M78A 1WNLA 4C8QA 2FB7A 5LJ5e 3BDUA 4MMKA 3RUXA 1X01A 4NOYA 3JB9D 3EFSA 4F7UE 4M7AE 5GANf 4X9DA 4PJOB 4PJOD 5GAN8 4M7AC 2RM4A 5GMKe 3JB9G 4M75E 4RCCA 4C92A 1MGQA 5GAOq 1I5LA 2HNIA 3JB9H 4M75C 3RKYA 4PJOG 5LJ5g 3JB9F 2ZGWA 2DJZA 5DY9A 5LJ5d 3QSUA 5GANh 5GAOl 4HT9A 4EMKA 2DTHA 2RD1A 3JCMc 3PGGA 2DKGA 4XU1A 5LJ3h 2E41A 4M77A 4XTZA 3FJPA 3SWNC 3SB2A 2DTIA 4M7DB 4PJOA 4J6WA 3HFOA 4JRKA 4J6YA 4XTXA 4A54A 5GANj 5GANe 4JLIA 3HSBA 4C8QE 5GAN6 5GAOp 1BIBA 4DQ2A 4M78C 4C8QC 5LJ3e 1I4K1 2EAYA 4M7DF 4XU3A 3V8LA 5LJ5j 3RERA 3QUIA 4X9CA 4MMLA 1Y96B 4C92E 5CAIA 3V8JA 5GMKj 2EJGA 4J5YA 4C92C 5I21A 5LJ3f 5GANg 3V7RA 5GANd 3RKXA 3JB9J 4HT8A 3VU3C 3JCMX 4F7UB 4M7AB 1H641 3QHSA 2YHTA 5LJ3d 3JCMf 4EMKC 4M78F 3INZA 1D3BA 4OP0A 2VC8A 5GAN7 4M75B 4M77E 2VXFA 2EJ9A 4M7AG 4M77C 3QO3A 4A53A 3L2ZA 3JCMJ 4PJOE 3JB9I 1LOJA 3JCMh 4F7UF 4M7DD 4M75G 4M7AF 3M4GA 1BIAA 4RCBA 3RESA 3V8KA 2YLCA 4M75F 4M7DG 3JCMV 2QTXA 3SWNB 1JRIA 2DEQA 2JN0A 5LJ3j 4PNOA 1N9RA 3BY7A 5GAOn 1U1SA 5GAMf 2Y90A 4J6XA 2E1HA 3RIRA 3JCMb 3JCMW 3JCMP 3BFMA 3V7SA 2DVEA 3JCMe 4M77F 4M78B 4C8QB 4M78D 1LNXA 4M7DA 1LJOA 2DTOA 4WF2A 5GAMh 2DXUA 3AHUA 1M5Q1 3GIBA 4M78G 1YCYA 2YLBA 4NL2A 4C8QG 5GMKl 5LJ3g 4XTVA 2K57A 3V7CA 4EMGA 4M7AD 3SWNA 2DZCA 4C92B 4C8QF 3BW1A 5GAN5 4XQ3A 5GAOr 2EJFA 4V2SA 4XTUA 1WQ7A 4M75D 4F7UG 3JCMd 1I8FA 2CGHA 1HK9A 2E65A 5GMKm 4EMKB 4N0AA 5GAMj 5GAMe 4PJOC 1U1TA 1Y96A 5GMKi 5GAOm 4C92F 2DZ9A 2DXTA 2RB6A 1N9SA 4M77B 1I81A 1M8VA 3FB9A 4M77D 1JBMA 4QVCA 4XU0A 4F7UA 4M7AA 1B34B 5LJ5f 2E64A 4M77G 1KQ1A 4EMHA 2RA2A 4M75A 2EWNA 3L1AA 5GAMg 5GAMd 4M7DE 4C8QD 1TH7A 4PJOF 4M7DC 2E10A 3HFNA 4JRIA 5LJ5h 5GAN3 5GAN2 1WQWA 3JCMQ 3EFRA 1KQ2A 4XTYA 4QVDA 3FIFA 2FYKA 4C92D 3JCMg 5GAN4 1B34A 5GMKh 2VXEA 4Y91A 4NL3A
chains in the Genus database with same CATH superfamily
4N0AC 3EH2A 4JUVA 3CCMQ 4XU2A 5M9OA 1JQQA 3BDUA 1VQ7A 1VQ8Q 5GAN8 3CCJA 3VS1A 2NUPB 1G8XA 2F2VA 4XU1A 1Q82U 1NLOC 2RJFA 3FJPA 3HFOA 2DBKA 4ZN1A 5GANj 3MP6A 1VQMA 3PTAA 2C0TA 4FYXB 4M78C 4C8QC 5LJ3e 2QTVA 1WLPB 1VQKQ 2R58A 2CP6A 1VQOQ 1WIEA 4IURA 3CQTA 4F7UB 4M7AB 3QHSA 5KYXB 1NG2A 3QG1A 1Q86R 4M75B 3X28B 1PD1A 1GCQA 5L8RE 3M53A 2ZAEA 1KFZA 3EGDB 3SDZA 2JNGA 1PHTA 5GAMf 1PC0A 1NJIR 1KD1U 2E1HA 1T0HA 3EG3A 5FU7C 4AFUC 2DERA 2EYZA 5HCKA 4M7DA 4A4FA 4J9IA 3TCJA 3AHUA 1WJSA 2ZZDA 1ACMB 1G5VA 2CZ7B 4VUBA 1OPKA 1K73U 1Y57A 4PFPA 1O75A 1RLPC 4C92F 2DZ9A 2RN8A 1QVFP 4M77B 1VQLQ 1WHJA 3G4SA 2OTJA 1QP3A 4GLKA 1OX8A 1X6BA 2Y4XA 3R6OA 2DIQA 5CK9A 1YJ9T 2PNIA 4JS4A 2V1RA 4CC7A 3REAB 5LJ5e 3MKDA 1WNLA 3GF5A 1Q95G 2V8KA 1FWZA 4AFSC 2QQSA 4RG2A 1YN8A 5LJ5g 3GLXA 1QCNA 3EGXB 3CCRT 3VRYA 2JS0A 2X9HA 4E7ZA 3VS2A 3E9FA 3DLLA 4OMLA 2NUTA 4BUGA 5CQXA 1U5SA 3M0UA 5HY6A 5IHKA 3QJYA 2VV5A 4B6MA 1OV3A 3MO8A 1YHQQ 4C92E 2BIVA 2EYYA 1XNIA 4ZGJB 1PRLC 4J5YA 4Q5WA 1EIFA 3NTIA 5IN1A 3RR6A 1NLPC 1N27A 1WDXA 1IXDA 2RK1A 3J80E 1T3SA 2JZ2A 4DBQA 2LNVA 3CXCS 1OEBA 1KC8C 3Q1JA 1PM3A 2K3BA 2YLCA 1WX6A 1M27C 1XJWB 4JJCA 3QPHA 1FX7A 3NPFA 3OYCA 1QVGA 2M9UA 4R55A 1LJOA 1SEMA 3SFMA 2J6FA 3HRUA 3PMTA 1I07A 2DZCA 4C8QF 1K0XA 2FO0A 4J9BA 4YTLA 3L2UA 2NWMA 3G1JA 2E3HA 2ZPBB 3URGA 3TVTA 2ABLA 1M8VA 4JJDA 3WXMB 1VQ5Q 1M8MA 3OYKA 3L1AA 2L2PA 5GAMd 4PL6A 2E10A 4J8OA 2RHIA 4QVDA 2CZ6B 2EYQA 2WSEE 4JDSA 4IKFA 1RI9A 2DEUA 5KH6A 2LDMA 3HP9A 1HXDA 3RKWA 2DXCA 3KBGA 2PU9B 2VGMA 2LT4A 1UGVA 3RUXA 2MWPA 2GFUA 5GANf 4L59A 3H0HA 3EH1A 1YJNQ 1IB8A 2BKDN 2RF0A 3OSVA 3CMEQ 2RD1A 2DKGA 9ATCB 3M0TA 4N4HA 1FMKA 5CQYA 4PK4A 4A4KA 1N8RU 1VYVA 1VQPA 4RTWA 4J6YA 4XTXA 1K9MU 2K4YA 4C8QE 1JO8A 3QDFA 3G6ET 2QG9B 1EZZB 5GMKj 2JTEA 4HT8A 1VQ9T 2PUKB 3VU3C 3EAEA 2PVGB 3C12A 2X51A 2F5KA 1D3BA 1M4ZA 1MV3A 2KR3A 2KAFA 5GAN7 2XG8D 4HVVA 3CXCP 1NYGA 1TG0A 3TQ7P 2CREA 2GQIA 2E6NA 1D1CA 3CEYA 3CCUT 3OQ5A 1Z9ZA 4M7DG 1YJWT 1GRIA 2YUOA 1ZLMA 4C5IA 5CKHA 4ZTFA 2JVVA 1OYXA 4GBQA 3E19A 2YRVA 4EMGA 4M7AD 2PZ1A 3EFOA 4CI0C 3I56A 4M75D 4DEYA 1HK9A 5FRNA 2KBTA 3QXEB 1VQ4T 4X34A 2D6FA 3VS7A 1ZSZB 2FPEA 4B9XA 3M59A 1PSEA 4RKUE 4C0FA 2H8HA 4IUPA 3EG9A 1P92A 2X4YA 2CUBA 2DK3A 1WQWA 2AT1B 3DB3A 1VQNA 3EHRA 4PNOA 3HHTB 2X3XD 4BB7A 1WYXA 1GCPA 1HSQA 1QVFA 1ZA2B 4M7AC 2KDSA 4J9EA 4M75C 2YRDA 1VQ7Q 3CC7A 3SHWA 3QWYA 5KYUA 4EMKA 4ORZA 2RI2A 5EC7A 4OB2B 3CCJQ 4JS5A 1KJWA 3HTRA 2SRCA 5FU6B 3HSBA 1ZUUA 3CC2A 2R57A 4X9CA 4OMOA 4OB3B 5GANd 4OMPA 4GLMA 2ZPGB 1NEBA 2C0OA 1TOVA 1VQ6T 4M77C 3CCET 1VIEA 1BI3A 1LVKA 5DLOA 3JCMJ 3WVEB 1AZGB 3JCMV 2QQAA 3EG2A 2Y90A 2J6KA 3JCMb 2LQKA 5IXFA 1QVGS 4M78G 4C8QG 1BYMA 2QEXA 1AHJB 2QASA 2LQNA 4Y92A 3OMGA 2MPXC 4F14A 4F17A 5HK0A 2O88A 2HMAA 1MNDA 2QXFA 2AKLA 2CZ1B 2JMCA 1KC8U 5GMKi 5GAOm 5J3BA 1KHIA 1Q7YR 4ZTJA 2CP2A 1UGQB 3QDRB 4J9CA 2MAMA 2RA2A 1HJDA 2DO3A 3M57A 3X24B 2EQUA 1I1JA 2DIGA 2XDDA 1PCXA 4RG8A 2OTJQ 2FHDA 3TREA 2LMJA 4HA8A 1W70A 1SF9A 2LX7A 2YSQA 4KUIA 3A8HB 4RMOA 5L23A 3J7AF 2E6ZA 4LDXA 4PJOD 2HQHA 4MDXA 1YIJT 5GJVB 3RKYA 1M3BA 4D8KA 3G7ZA 2JS2A 1RABB 1VYUA 2O31A 2HL5C 4CRIA 5KYWA 1YJ9A 2OTLQ 2DFUA 1BKBA 3LH0A 4DA4A 3I55T 2M0YA 3FC3A 1M1KC 1FYNA 3J81E 4BACA 2EJGA 2FRWA 4OMFB 8AT1B 3KUFA 3UPUA 2EW3A 4AMCA 2AKKA 3JCMh 1IGQA 4F7UF 4M7AF 4ANJA 3VUZA 1UTIA 3RESA 4M75F 4C5EA 1X6OA 5KE3A 2XICA 4LNPA 5CKBA 2DM1A 1QVGP 5DLQE 1BBZA 4OVAA 1VQKT 2DNUA 3EGDA 3MP8A 1VQOT 1ABOA 2E70A 3QWXX 2E5QA 3M56A 1YWPA 1K9MR 3M0PA 5A2QE 1UJYA 2GCXA 2B8AA 2DYBA 1ZUKA 1X2QA 2D1XA 1UE9A 3VYHB 4QQGA 4FL6A 5FROA 2DD4A 4OMQA 1X2KA 1OI1A 3UF4A 3CCVT 1QWFA 4LDUA 4LD9K 5GMKh 1Y7XA 5GMKm 5A0LA 2CDTA 3L2QA 4E7SA 1RAFB 1EX4A 2M1HA 3NTKA 2BZXA 3S6WA 4F7UE 4M7AE 1UEBA 1AWWA 2O4XA 1VQLT 4M75E 3JB9F 5DY9A 3L2WA 1JJ2S 2K3XA 1K8AU 4QKUA 3R6NA 1AWJA 1GFCA 2RI3A 5FWBA 1YI2A 2KRMA 2D9TA 2LCCA 4JRKA 1QMCA 5D7UA 3ZL7C 1Q81C 4OMMA 2KVQG 3IQLA 3PFSA 3N5BB 1FXXA 2DMOA 3V8LA 4AFQC 3LYIA 2X4WA 5KCHA 1GFDA 5IXBA 2DVJA 1VQPQ 4LD6A 1OX9A 4CC2A 3S3OA 3CPWA 3LWHA 4RTYA 2RK2A 6AT1B 1ZSZC 4M77E 3LGFA 4QVZA 3L2ZA 1Y07A 3JAME 2BE7D 3KFVA 3A8GB 5KYYB 3V8KA 2P0KA 2JM9A 4ESRA 4BE2A 1Z9QA 1UGSB 2WACA 1UHCA 1V29B 1YBYA 1LNXA 3G6EA 5GMKl 2MCNA 5LJ3g 2DPPB 2AZSA 2DETA 1T0JA 5GAOr 2K9GA 1VQ9A 3L2VA 2ESWA 1VIFA 1M2VA 1Y96A 2YT6A 2DLPA 4EPCA 4KULA 3I56Q 4XU0A 1TSFA 3MEWA 2J6OA 2G6FX 3CCUA 2NUZA 4X1VA 4ME7A 5AT1B 1RAIB 1TUCA 4PJOF 3NTHA 5GAN3 1M90R 2XDPA 5FU6C 5GAN2 2KT8A 2D8JA 1UGPB 3M9QA 4ELYC 3OS1A 1WGSA 1SPKA 1WJQA 3VKIA 3S3NA 4II1A 1MV0B 2XI9A 1PNJA 1VQNQ 1VQ4A 4C92A 1I5LA 2HAXA 3OS2A 3A8MB 1RACB 2ZPHB 1TUDA 2HDAA 1WA7A 4LE9A 3CC7Q 1AVZC 5KE2A 2L3RA 1PG5B 5GAOp 3JV3A 4DQ2A 4A4HA 1BU1A 2RJEA 3H8ZA 2W10A 2RQRA 3HL8A 4RTVA 3JB9J 3CC2Q 2O9SA 4BDZA 4FW1A 2LX9A 1Q86C 2YHTA 1JB0E 2QQBA 4RTZA 1YJNT 3OY9A 1GXIE 2FZCB 4M7AG 4PJOE 3CMET 3JB9I 2RJCA 4M75G 1PKSA 2BUDA 2M0OA 3I9QA 1NJIC 4KGXB 2DJQA 3CCLQ 3PMIA 4E7KA 3CD6T 3JCMe 1M1KU 4UC4A 5GAMh 4C0ZA 3LX7A 3GOXA 2K6DA 2KQWA 1OPLA 4N0AA 2E4HA 2QEXQ 3VUBA 1VQ6A 3CCEA 4OB0B 2EGAA 4PJLA 2PTKA 4J7FA 4M77G 1D0ZA 2EQKA 1NZ9A 3NHNA 4CC3A 1NPRA 4ZGEB 1YP5A 1NPPA 4JRIA 5GJWB 2PVOB 3P8HA 2KI7A 3OYDA 3H0FA 4AFZC 5EG2A 2MK5A 3OYGA 2VXEA 2I0NA 5LJ5j 4M78A 4C8QA 3G71A 2QA4Q 4MMKA 3NGPA 3EFSA 2MIOA 4PJOB 1H8KA 1MMDA 5GMKe 8ATCB 3JB9G 3SD4A 3QYGB 4PKCC 2DJZA 4HCKA 1UHFA 1F1BB 4FCYA 2DTIA 4M7DB 1UJ0A 1RAGB 1TUGB 1BIBA 2LC4A 2EQIA 1E7OA 1SRLA 1V76A 4MMLA 3MEUA 3VJPA 2B86A 1YJ9Q 3JCMX 2WSFE 2ZPFB 1H641 4ATOA 1YIJA 1VQ7T 3CPWS 2DD5A 5IHNA 1VUBA 3CCJT 3JSCA 1MMNA 2RHXA 3SWNB 1Q81U 1W4SA 1JRIA 2C0IA 3MHXA 1WXBA 1N9RA 3BY7A 3M55A 5GAOn 3JCMW 3M58A 4J6XA 1CSKA 1E6GA 3M4YA 2V1QA 1D1AA 4A63B 4JZ3A 3I55A 2QGFB 1HD3A 2RI5A 2DL5A 5D6YA 2EBPA 1X6GA 3BW1A 3M0SA 4LDYA 1WQ7A 3QZ9B 1K8AR 1IGUA 2E65A 4FT4A 2RHYA 1BCOA 1YITQ 3LW5E 1XTDA 1ZA1B 2JT4A 1CKAA 3CBOA 2F5TX 2QGGA 2V8JA 3CBMA 2HSPA 4OMNA 2CP3A 3CMAA 1PRMC 2J06A 2NUTB 5IT9E 1OOTA 4N4IA 1SHGA 2M16A 2E64A 3CCQQ 4E7HA 2A37A 4D6WA 1TH7A 2KEAA 2EVRA 5C6SA 2QI2A 4KGVB 1IZ6A 3OYAA 1ZBXA 2RPNA 4Z02A 2LJ3A 2CH4A 2FYKA 2L0AA 2CH4W 1Q82R 4C5GA 1VQKA 1VYTA 4NL3A 1OU9A 4C92G 1WPYA 2DRMA 2WSCE 5LL6S 2IIMA 4NOYA 4IUQA 1MHNA 4RTXA 5CKFA 3VS5A 4C0GA 2HNIA 4BD3A 2F1LA 1MMGA 2A36A 3QSUA 1A0NB 3NMZC 5GANh 2CSQA 2BZ8A 3D7SB 3JCMc 2XHCA 4LDWA 1SKUB 3CC4Q 4XTZA 3SB2A 1XQHA 4O5VA 3MCAB 3EG1A 2P0QA 3CCVA 3CCSA 1AZEA 3RMQA 1ZSGA 2HSEB 1M3AA 1YI2Q 2JOYA 1KD1R 1JJ2A 2H3EB 2JTMA 2RQWA 3ZBDA 3VRZA 2E5KA 3I5SA 2CUDA 3GNFB 3CPWP 2H3JA 2RH2A 3FJ5A 2CT4A 2L8DA 1W6XA 1NBEB 3M5AA 4DOWA 1BIAA 2GTOA 1K73R 1D1BA 1W2BA 2GF7A 1W1FA 4HXJA 3GP8A 1YWOA 2OTLT 2YXYA 1ZBJA 2KT1A 1VQMQ 5IH2A 3M54A 1Q86U 2EFIA 1BI2A 1AWOA 1TWBA 3OYMA 1WI7A 5GAN5 1UG1A 4XTUA 2AZVA 5GAMe 3G6EQ 1RADB 1S72T 1NJIU 4FYWB 4XK8E 4PLIA 1VQ9Q 5LJ5f 2W0ZA 2RMOA 2EQJA 3QZ5B 5GAMg 3OYFA 1ARKA 1K9AA 3X25B 2CP0A 1Y71A 3PVQA 4FSSA 3OW2A 1EFNA 1PD0A 1UGRB 3FRNA 1D3BB 2FB7A 4JRQA 5CO7A 4FYVB 1YCSB 1I0CA 5I2MA 2FRYA 3C95A 1H3ZA 4Y28E 4WTOB 5A0DA 2DILA 3FLGA 4AG1C 2RQUA 1WZOA 2RHUA 3ASKA 3G4SQ 4LUDA 1U3OA 4R0KA 1KQSA 2AHJB 2HD0A 2MWOA 2D8HA 3PE0A 4E6RA 4FM4B 3EFOB 4R56A 2YUPA 2KROA 3C0CA 3LLRA 3KXTA 3RERA 3L42A 2X4JA 2CP7A 3DKMA 1D0YA 2DAQA 2JTFA 1JXMA 5LJ3d 3JRZA 2FZGB 2K5IA 4HVWA 4PJMA 4QQ6A 2F2XA 4HKEA 3EG9B 3QO3A 4A53A 2IG0A 4L5GA 2CS7A 4M7DD 4KH0B 4BI4A 1TXQA 1C6VX 1QCOA 2NUPA 5HKCA 3CCMT 4LDVA 2DVEA 2EPDA 3GNGA 2SEMA 4JZ4A 1VQPT 1VQ8T 1T3LA 1O9SA 4NL2A 4XTVA 3V7CA 5FWCA 1TS9A 1FMVA 2R5AA 2DL3A 2EGEA 1I8FA 2O2OA 1TU0B 5KYUB 4EMKB 3CCRA 1Q7YC 1GCQC 4PJOC 1M1FA 1QCFA 3PT9A 4E7JA 2C06A 3HRSA 5KYNA 1N9SA 3RMSA 5KCOA 2R5MA 3CMEA 1JBMA 4F7UA 4M7AA 1B34B 5KYXA 3PIOA 4M75A 1VQ6Q 3CCEQ 4M7DC 1X75C 5D6WA 3CD6A 2EGCA 2KY9A 3UDCA 2LTOA 1M30A 5GAN4 1OZ3A 1B7TA 2EYXA 2LZ6B 1N8RR 3OA6A 2DBMA 1U8RA 2XK0A 4EIKA 4QT7A 1B07A 2K2VA 3A1PA 4BE1A 3H9NA 3I56T 3JB9H 1BCMA 4E7IA 3G71Q 5LJ5d 3S3MA 4FSXA 4A4EA 3A5ZB 3M0QA 1N6AA 3VS3A 1DJ7B 4M77A 2HBPA 3SWNC 1G3SA 3OMCA 2RQVA 2DYIA 4NS5A 5GANe 2GFAA 1GBRA 1UB4A 1K1ZA 1SHFA 3PIPA 4BY6B 2KRNA 2PVDB 3BE3A 2JW4A 2LCSA 1VQNT 5GANg 4J7IA 1SSFA 2BZYA 5J39A 2GTJA 2VXFA 2EJ9A 2DXBA 3WVDB 4RTUA 2CT3A 1LOJA 1KIKA 3M4GA 3OBYA 1LPLA 4JLGA 3A8LB 3EGXA 3JCMP 4Z89A 2COZA 2G3RA 3RNJA 1W2BS 2RNAA 2DL7A 2DRKA 4M78D 3ER0A 3NFCA 3GIBA 1M5Q1 1NM7A 2DL4A 3OYIA 1SRMA 4V2SA 4D8DA 1J3TA 2OI3A 1K9MC 2ZPIB 5CCAA 1WHMA 3HRTA 3I55Q 1U1TA 1BI0A 2O01E 1I81A 4Z88A 1H3HA 2VWFA 1RL2A 2HKQB 1KQ1A 1G3YA 4MZTA 3CCLT 5KYWB 1C0MA 4KGZB 3CMAQ 3HFNA 1AD5A 1YHQT 4FT2A 4F04B 4EDUA 2LT1A 1PWTA 1N5ZA 4XTWA 2KNBB 2Z0WA 3OW2S 2Y4YA 3UT1A 1YNZA 1QLYA 5HK3A 2AIRB 2HZYA 1OULA 2CSIA 2QEXT 4RCCA 4M4ZA 1WHGA 1D0XA 2K2MA 1YJWA 4J9HA 2A28A 4PJJA 3PGGA 2LVMA 4J83A 4AG2C 4HCZA 4TVRA 2FPFA 3OYBA 2LJ0A 2LQ8A 4PFOA 4FYYB 4PJOA 2VASA 5I11A 1KQSS 1PKTA 2RO0A 4XAXB 2LRQA 3EHQA 3OYJA 2K3YA 3X20B 4M7DF 4XU3A 4B9WA 3CBPA 1PSFA 3QUIA 4MDWA 1X69A 2QA4T 2HL3A 4J9FA 3CCVQ 1QP2A 5I21A 3CCSQ 1JJ2P 5FLXE 1K0SA 4O6JA 5I22A 1VQ5T 1G83A 3ZFJA 1QKXA 3PNWC 4IUTA 4CC4B 3O5ZA 3ULRB 4Z8AA 4IIMA 1K76A 4BDYA 4J9GA 2QQRA 3TSWA 1KC8R 3EGUA 3TSZA 3UA7A 1UDLA 5LJ3j 1W2BP 2JMAA 3P8DA 2X3WD 2FVUA 4ZN3A 4JJBA 2DTOA 2FPDA 2YWWA 3T9NA 1AEYA 2O4XB 1UECA 2D0QB 2K57A 2QK0A 3SWNA 2CZ0B 4XQ3A 4F7UG 1S1NA 2XMFA 3MP1A 3OYLA 4JRPA 2KRSA 2LNHB 4QVCA 3C94A 3VS4A 3TEEA 1YFNA 2NLUA 2EWNA 1M90C 2EQMA 4M7DE 2L3QA 2DF6A 2OTLA 1OQKA 3FIFA 4L6V5 4MZMA 1C1AA 1U06A 3JCMg 2XIDA 1WXTA 3OW2P 1Q7YU 1R0BG 2X4XA 2MOXA 2KK4A 3GBQA 1YITT 3M0RA 1WJRA 5J26A 1S72A 1MGQA 5GAOq 2F69A 2ZGWA 2F2WA 3OBWA 4HT9A 3CCQT 3THKA 2VGNA 1ZSZA 5CIUA 2E41A 2DE0X 2HQEA 3OYYA 2HCKA 2P4TA 4KT0E 1KQSP 2FEIA 4A54A 1ZHIA 5AYFA 2KYBA 3QJ6A 2VYTA 1OZ2A 2GBQA 1I4K1 1UUEA 2DX1A 2EAYA 1VA7A 5CKEA 4C5HA 1M2VB 1Y96B 1KG1A 1M2OA 1GL5A 2A3LA 3V7RA 3RKXA 2EKHA 2J05A 4EMKC 2LJ1A 4M78F 3INZA 2RJDA 4F16A 1E6HA 3CC4T 4JJNK 4FIBA 4RTTA 3E9GA 1RAEB 2V26A 1M9SA 2O9VA 4OGCA 4OF1A 2V8IA 1NYFA 2FG0A 3BFMA 2A7YA 3V7SA 5IHIA 4GY5A 2VUBA 3UATA 2XU8A 1YI2T 1X43A 4C92B 2NYSA 4DBFA 4QQDA 5FW9A 1M3CA 3LGLA 1ZUYA 2VVKA 2IPOB 3CCRQ 2GNCA 2K5LA 1KSWA 1QVPA 4AT1B 3CCMA 4N4GA 2K7AA 1VQMT 1JU5C 3MJXA 1WXUA 2YUNA 1HYOA 2L5QA 4BY6C 1VQ8A 4QW2A 4MZPA 4Y91A 2ECZA 3A98A 3CD6Q 3AT1B 4M78E 5A0GA 1WHKA 5ECAA 3A8OB 3PVLA 5DM7R 2MI6A 2K5FA 4PJOG 3RBBB 4A4GA 2DA9A 3META 4C0DB 2DTHA 1IO6A 2HEQA 2GGRA 1WFWA 1X27A 5GAN6 1I5OB 1RLQC 1VQOA 1G3WA 2PUOB 1LCKA 2DL8A 2MF2A 4PFZA 2L3SA 4E7LA 5LJ3f 1BK2A 4OB1B 2KMTA 3CPFA 5D6XA 4OP0A 5CR2A 2EYWA 2GQVA 2OJ2A 2JUFA 2BTTA 3HPWA 4ZNXA 3G4ST 2KXCA 3ZEHA 4J9DA 4RCBA 2L3PA 2XD0A 2OTJT 2M51A 1R8OB 2QTXA 2ATCB 1JEGA 4HCCA 4PLLA 3H41A 3OS5A 4M78B 3HKSA 4C8QB 2AK5A 3LH5A 2X35A 1YCYA 2YLBA 3I35A 1K8AC 1VQLA 2CYZB 4PJNA 2EJFA 2ED1A 1ZX6A 2FZKB 4ELZC 1IRXA 2KYMA 1KHCA 2JM8A 4JPBW 4RUGA 7AT1B 3FB9A 4M77D 4LN2A 2COWA 3MEVA 4KH1B 5CVIA 5FU7B 1Q82C 1KQ2A 2ENMA 2E12A 3GPLA 1B34A 2QDYB 3O8VA 2COYA 2I2LA 2KE9A 2XDBA 3P8BB 3VYGA 2MYSA 1M1GA 3JB9D 3LWIA 4KBMB 4X9DA 1MUZA 2RM4A 3X26B 3BDLA 4BI8B 2P0PA 1WHHA 1M90U 2KSSA 3E2UA 2K79A 3I5RA 1SSHA 1NE8A 5LJ3h 1JXOA 3CCLA 4DEXA 3CCUQ 3OSSC 4J6WA 1YJWQ 2YDLA 3MPUB 1YHQA 4JLIA 2LP5A 2QQ9A 1MMAA 3VV0A 4ZGDB 1ABQA 1TTHB 3L2RA 1KD1C 3EG0A 3OYNA 3OB9A 4KUDK 1VOMA 1M1KR 3OYEA 3SEMA 1NEGA 3JCMf 2RQTA 3G71T 2J7IA 3UWNA 1QQJA 1VQ4Q 1RAHB 2A08A 4P5NA 1K73C 1XOVA 3DB4A 1ZQ1A 1AOJA 1QW1A 2DEQA 1KK7A 1U1SA 2QDLA 4IUUA 2ZCFB 4OGEA 1BB9A 2XKOC 3VS6A 2IVWA 1OU8A 2MMPA 4WCIA 4WF2A 2QA4A 2VKNA 3QIIA 2P84A 3DLMA 3ME9A 1VQ5A 5GAMj 2LCLA 4E2FB 4E47A 2DXTA 2RB6A 1G3TA 1QKWA 5I2SA 3QBYA 2EKOA 3E1SA 2FL7A 4HVUA 5LJ5h 2OAWA 5KYYA 4XTYA 1SG5A 1FMWA 4C92D 1RI0A 4HCBA 4LXCA 2D0NA 2HBWA 2L89A 4FU6A 4DBHA 2HQXA 1YJNA 2YRCA 3UA6A 2OAUA 1X01A 1RUWA 1GBQA 4DOVA 1BI1A 1G2BA 2KGTA 3U23A 4BI3A 5GAOl 1V1CA 3VS0A 1WHLA 3RDVA 1D09B 1RAAB 4K11A 3F70A 1AWXA 4DBRA 1S72Q 3CMAT 3FEOA 1H92A 3QYHB 3OYHA 3FDRA 5FRMA 4KRTA 2KXDA 3H0IA 2HKNA 1Q81R 1CKBA 5CAIA 1B3QA 3V8JA 4C92C 3OS0A 1YITA 5C0MA 4BE0A 2M02A 2CKKA 2ZPEB 2VC8A 1IHWA 3CXCA 2E3IA 2ROTA 2BE9B 3C4SA 3CCQA 1R77A 4IIOA 2QYZA 3H6ZA 2CP5A 1IHVA 2JN0A 2JJ9A 2VB6A 2OX7A 3RIRA 2YUQA 4M77F 2LQWA 5CKDA 2DXUA 3CCST 2EIFA 2P4RA 3JCMd 4IUVA 2CGHA 3REBB 2ROLA 2ED0A 2PQWA 2QAZA 3QKJA 2JXBA 1Y0MA 1YIJQ 1R0CB 3TU4K 3CC7T 1QVFS 4C0DC 1QWEA 1IREB 3CC4A 4EMHA 1MNEA 4LUEA 1UFFA 4C8QD 1AT1B 4FW2A 1K4US 3MEAA 5IAYA 3JCMQ 3EFRA 3CC2T 2A0FB 1N8RC 2RHZA
chains in the Genus database with same CATH topology
3TREA 4C92G 4N0AC 1Q7YU 1WPYA 4HA8A 4JUVA 2WSCE 2X4XA 4XU2A 5LL6S 2KK4A 5M9OA 1VQ7A 3BDUA 4NOYA 1YITT 4KUIA 3A8HB 4RMOA 3J7AF 2E6ZA 4LDXA 5GAN8 4PJOD 4IUQA 1MHNA 1WJRA 5CKFA 5J26A 1YIJT 4MDXA 1S72A 1MGQA 4C0GA 5GAOq 3CCJA 2HNIA 4BD3A 3RKYA 2F69A 2ZGWA 3QSUA 3OBWA 5GANh 4HT9A 3CCQT 3JCMc 3G7ZA 4XU1A 2XHCA 2VGNA 5CIUA 1Q82U 4LDWA 2E41A 3OYYA 2HQEA 2P4TA 4XTZA 2RJFA 3FJPA 4KT0E 3SB2A 1XQHA 3HFOA 4O5VA 3MCAB 4A54A 4ZN1A 5GANj 3MP6A 1VQMA 1ZHIA 2P0QA 5AYFA 3CCVA 3CCSA 3QJ6A 2VYTA 4CRIA 3PTAA 1OZ2A 4M78C 4C8QC 5LJ3e 1YJ9A 1I4K1 1BKBA 2EAYA 3LH0A 3RMQA 2XIDA 5CKEA 4C5HA 4DA4A 3I55T 3FC3A 1M1KC 1Y96B 2JOYA 3J81E 4BACA 1KG1A 1JJ2A 2R58A 2EJGA 2A3LA 2JTMA 3V7RA 3RKXA 4OMFB 4IURA 3ZBDA 3KUFA 4F7UB 4M7AB 3QHSA 3GNFB 3UPUA 4EMKC 2H3JA 2RH2A 3INZA 3QG1A 4M78F 2RJDA 4M75B 2L8DA 3X28B 3JCMh 3M5AA 5L8RE 4DOWA 3M53A 4F7UF 4M7AF 3VUZA 1BIAA 3CC4T 3RESA 4JJNK 4FIBA 3E9GA 4M75F 3SDZA 2JNGA 4OGCA 1M9SA 4OF1A 1W2BA 2V8IA 1X6OA 4C5EA 5KE3A 5GAMf 2GF7A 1KD1U 2E1HA 2XICA 3BFMA 3GP8A 2A7YA 3V7SA 5FU7C 2OTLT 5CKBA 5DLQE 4GY5A 4OVAA 4M7DA 4A4FA 2VUBA 2XU8A 1YI2T 1VQKT 3M54A 3TCJA 1Q86U 3AHUA 2EFIA 1BI2A 1WJSA 2ZZDA 3OYMA 3MP8A 4C92B 5GAN5 1VQOT 1G5VA 2E70A 4XTUA 2CZ7B 4QQDA 4VUBA 5GAMe 2E5QA 3M56A 1K73U 1O75A 4C92F 2DZ9A 1S72T 3LGLA 1NJIU 4M77B 5A2QE 4XK8E 2GCXA 4PLIA 3G4SA 2B8AA 5LJ5f 2OTJA 1QP3A 2K5LA 2EQJA 3QZ5B 4GLKA 3VYHB 5GAMg 3OYFA 1QVPA 4QQGA 4FL6A 3X25B 5FROA 2DD4A 2Y4XA 3CCMA 4N4GA 1OI1A 1Y71A 3R6OA 1VQMT 3CCVT 2DIQA 4LDUA 4LD9K 2L5QA 5CK9A 1YJ9T 4BY6C 4JS4A 3OW2A 1VQ8A 4QW2A 5GMKh 4MZPA 4Y91A 1Y7XA 1UGRB 3FRNA 4M78E 5GMKm 5LJ5e 1D3BB 1WNLA 3GF5A 2FB7A 5A0LA 3L2QA 4JRQA 5CO7A 5A0GA 2M1HA 3NTKA 3S6WA 4F7UE 2V8KA 4M7AE 1FWZA 2QQSA 1UEBA 3A8OB 5I2MA 3C95A 2O4XA 5DM7R 1VQLT 4M75E 2MI6A 4RG2A 2K5FA 1H3ZA 4PJOG 5LJ5g 3GLXA 3JB9F 4Y28E 5DY9A 4A4GA 3L2WA 1JJ2S 3META 3FLGA 5A0DA 4C0DB 3CCRT 2DTHA 2K3XA 2RHUA 3ASKA 3E9FA 3DLLA 1K8AU 1KQSA 2AHJB 2RI3A 2HD0A 1YI2A 4JRKA 2D9TA 2LCCA 2MWOA 5CQXA 4BUGA 5GAN6 4FM4B 1VQOA 1Q81C 4R56A 5HY6A 3LLRA 1G3WA 2KVQG 2PUOB 3N5BB 1FXXA 3PFSA 3V8LA 3KXTA 3RERA 3L42A 2VV5A 2X4JA 2X4WA 3DKMA 3LYIA 3QJYA 5KCHA 2MF2A 2DAQA 3MO8A 4C92E 2BIVA 2JTFA 1XNIA 4LD6A 4ZGJB 4E7LA 4J5YA 4Q5WA 5LJ3f 1EIFA 3NTIA 5IN1A 3S3OA 4OB1B 3LWHA 2KMTA 3CPWA 5LJ3d 3CPFA 3JRZA 5D6XA 2RK2A 4OP0A 2K5IA 1N27A 4QQ6A 4M77E 4HKEA 5CR2A 2RK1A 3LGFA 3J80E 2GQVA 4QVZA 3QO3A 4A53A 2JZ2A 2IG0A 3L2ZA 4L5GA 1Y07A 2JUFA 2CS7A 2LNVA 3CXCS 3HPWA 3JAME 3G4ST 4M7DD 4BI4A 1KC8C 3A8GB 3ZEHA 4RCBA 3V8KA 2P0KA 2XD0A 3Q1JA 2OTJT 2YLCA 4BE2A 1R8OB 1UGSB 2QTXA 2WACA 4HCCA 5HKCA 3QPHA 4PLLA 1FX7A 3CCMT 4LDVA 2DVEA 3OYCA 1V29B 3OS5A 4M78B 3HKSA 4C8QB 1YBYA 1LNXA 2M9UA 3GNGA 1QVGA 4R55A 1LJOA 1VQPT 1VQ8T 2X35A 3SFMA 3G6EA 1O9SA 1YCYA 2YLBA 4NL2A 5GMKl 5LJ3g 3HRUA 4XTVA 1VQKA 3V7CA 1K8AC 3PMTA 1VQLA 2DPPB 2CYZB 2DZCA 4C8QF 5GAOr 2EJFA 1VQ9A 2R5AA 4ELZC 3L2VA 1I8FA 1VIFA 4EMKB 3CCRA 1Q7YC 1KHCA 4YTLA 4PJOC 1Y96A 1M1FA 3PT9A 3L2UA 4E7JA 2C06A 2ZPBB 3HRSA 3URGA 1N9SA 3RMSA 4EPCA 2R5MA 3FB9A 4M77D 4KULA 1JBMA 5KCOA 3CMEA 1M8VA 4XU0A 3WXMB 4F7UA 4M7AA 1B34B 3MEWA 3PIOA 3CCUA 3OYKA 4M75A 3L1AA 5GAMd 4ME7A 4PL6A 3MEVA 4PJOF 2E10A 1X75C 3NTHA 4J8OA 5D6WA 5GAN3 5CVIA 3CD6A 4M7DC 2KY9A 5FU7B 2XDPA 5FU6C 3UDCA 5GAN2 2RHIA 2LTOA 4QVDA 1Q82C 1KQ2A 2CZ6B 2E12A 2EYQA 1UGPB 2WSEE 3M9QA 4JDSA 4IKFA 4ELYC 3OS1A 1WGSA 5KH6A 5GAN4 3GPLA 1WJQA 2QDYB 1B34A 1OZ3A 3VKIA 2LDMA 3O8VA 3S3NA 4II1A 3HP9A 2I2LA 1HXDA 2XDBA 2XI9A 3RKWA 3P8BB 3OA6A 2DXCA 1U8RA 3VYGA 3KBGA 2PU9B 2VGMA 2LT4A 1M1GA 2XK0A 3RUXA 2MWPA 3JB9D 3LWIA 4KBMB 2GFUA 5GANf 4X9DA 4L59A 2K2VA 1VQ4A 2RM4A 3X26B 4BE1A 3BDLA 4C92A 4BI8B 2P0PA 1I5LA 3I56T 3JB9H 4E7IA 1M90U 2HAXA 2KSSA 5LJ5d 3A8MB 3OS2A 3S3MA 2BKDN 3OSVA 1NE8A 2RD1A 4FSXA 4A4EA 2DKGA 3A5ZB 1N6AA 5LJ3h 1DJ7B 3CCLA 4M77A 4N4HA 2ZPHB 5CQYA 2HBPA 3SWNC 3OSSC 4A4KA 4J6WA 1N8RU 1G3SA 3OMCA 1VQPA 4J6YA 4XTXA 2L3RA 5KE2A 4NS5A 1YHQA 5GANe 1K9MU 4JLIA 2GFAA 2K4YA 2QQ9A 1UB4A 4C8QE 5GAOp 4DQ2A 4A4HA 3VV0A 3PIPA 4BY6B 4ZGDB 2RJEA 3H8ZA 3L2RA 1KD1C 3G6ET 3OYNA 2PVDB 5GMKj 3OB9A 1VQNT 3HL8A 5GANg 3JB9J 4J7IA 4HT8A 1SSFA 1VQ9T 4KUDK 2PUKB 3VU3C 3OYEA 4BDZA 3EAEA 2LX9A 2PVGB 1Q86C 5J39A 3JCMf 2YHTA 1JB0E 2QQBA 3C12A 1YJNT 2F5KA 1D3BA 1M4ZA 3G71T 2KAFA 3UWNA 5GAN7 3OY9A 2XG8D 2VXFA 2EJ9A 1GXIE 2DXBA 4M7AG 3WVDB 4PJOE 3CMET 3JB9I 1LOJA 2E6NA 2RJCA 4M75G 4P5NA 3M4GA 2BUDA 1K73C 1XOVA 3DB4A 3OBYA 2M0OA 3CEYA 3CCUT 3OQ5A 4JLGA 1ZQ1A 4M7DG 1NJIC 3A8LB 1YJWT 1QW1A 2DEQA 3PMIA 1U1SA 4IUUA 4E7KA 3JCMP 3CD6T 2ZCFB 2G3RA 4OGEA 2XKOC 4C5IA 3JCMe 1W2BS 1M1KU 5CKHA 4ZTFA 2JVVA 4M78D 2IVWA 3ER0A 3NFCA 2MMPA 4UC4A 5GAMh 4WF2A 4C0ZA 3GIBA 1M5Q1 1OYXA 3E19A 2YRVA 2QA4A 3OYIA 4EMGA 3QIIA 4M7AD 3LX7A 4CI0C 3GOXA 4V2SA 3I56A 3DLMA 4M75D 2KQWA 1K9MC 3ME9A 2ZPIB 1HK9A 1VQ5A 5FRNA 3QXEB 5CCAA 3HRTA 4N0AA 5GAMj 2LCLA 1U1TA 4X34A 1VQ4T 2D6FA 4B9XA 1BI0A 2O01E 4E47A 2DXTA 2RB6A 3M59A 1PSEA 3VUBA 1VQ6A 1G3TA 1I81A 3CCEA 4RKUE 4C0FA 4OB0B 5I2SA 4J7FA 4M77G 1RL2A 4IUPA 3QBYA 1KQ1A 2EKOA 2EQKA 1G3YA 1NZ9A 3E1SA 4MZTA 3CCLT 2FL7A 1P92A 1NPRA 2X4YA 4ZGEB 1NPPA 3HFNA 2DK3A 4JRIA 5LJ5h 1YHQT 1WQWA 4FT2A 4EDUA 4XTYA 2PVOB 3P8HA 3OYDA 3DB3A 1VQNA 5EG2A 2LT1A 4C92D 1RI0A 4HCBA 3OYGA 2VXEA 2L89A 3HHTB 4FU6A 4PNOA 4XTWA 2HQXA 4BB7A 5LJ5j 3OW2S 2Y4YA 3UT1A 1YJNA 4M78A 4C8QA 3G71A 2OAUA 1QVFA 4MMKA 5HK3A 1X01A 3EFSA 4PJOB 4DOVA 2QEXT 1BI1A 4M7AC 5GMKe 3JB9G 4RCCA 2KDSA 3SD4A 4M75C 3QYGB 4PKCC 2DJZA 1YJWA 3CC7A 4BI3A 5GAOl 4EMKA 3PGGA 2LVMA 2RI2A 4J83A 4OB2B 3F70A 4HCZA 4TVRA 3CMAT 2DTIA 4JS5A 3OYBA 2LQ8A 3FEOA 4M7DB 4PJOA 3QYHB 5FU6B 1KQSS 3OYHA 2RO0A 4XAXB 3FDRA 2LRQA 3HSBA 3OYJA 2K3YA 1BIBA 2LC4A 5FRMA 3CC2A 3X20B 4M7DF 4XU3A 4B9WA 3CBPA 2R57A 1PSFA 3QUIA 4MDWA 4X9CA 2QA4T 4MMLA 5CAIA 4OB3B 3V8JA 4C92C 3OS0A 1QP2A 3MEUA 5I21A 5GANd 3VJPA 1YITA 5FLXE 3JCMX 5C0MA 2WSFE 4O6JA 4BE0A 1VQ5T 2ZPFB 1H641 2ZPGB 2CKKA 1YIJA 4ATOA 2ZPEB 2VC8A 1VQ7T 3CXCA 3CPWS 3ZFJA 2DD5A 1VQ6T 4M77C 3PNWC 1VIEA 1BI3A 4IUTA 5DLOA 3JCMJ 3CCET 3C4SA 3CCQA 3WVEB 1VUBA 3CCJT 4BDYA 3JSCA 3H6ZA 2QQRA 2RHXA 3JCMV 3SWNB 1Q81U 1W4SA 1JRIA 2JN0A 2QQAA 3MHXA 5LJ3j 1N9RA 3BY7A 3M55A 5GAOn 3JCMW 2Y90A 3M58A 4J6XA 3RIRA 3JCMb 3P8DA 2LQKA 3M4YA 4M77F 2FVUA 4ZN3A 2DTOA 5CKDA 2DXUA 3I55A 1QVGS 3T9NA 4M78G 4C8QG 1BYMA 2O4XB 2RI5A 2QEXA 3CCST 2D0QB 2K57A 5D6YA 1AHJB 3SWNA 2CZ0B 2EIFA 3BW1A 3OMGA 4XQ3A 4LDYA 1WQ7A 4F7UG 3JCMd 5HK0A 3MP1A 3QZ9B 4IUVA 3OYLA 2CGHA 2E65A 4FT4A 2RHYA 2QXFA 4JRPA 1XTDA 2CZ1B 3LW5E 2PQWA 1KC8U 5GMKi 5GAOm 3CBOA 3QKJA 5J3BA 2F5TX 2V8JA 3CBMA 1KHIA 4ZTJA 3CMAA 3TU4K 4QVCA 1UGQB 3C94A 3CC7T 5IT9E 3QDRB 1QVFS 3TEEA 4N4IA 4C0DC 2M16A 2E64A 1IREB 2MAMA 3CC4A 4EMHA 4E7HA 2RA2A 2NLUA 2EWNA 1M90C 2EQMA 4D6WA 4M7DE 2DO3A 3M57A 1TH7A 3X24B 2EQUA 4C8QD 5C6SA 2DIGA 3MEAA 2XDDA 5IAYA 2QI2A 1IZ6A 3JCMQ 3EFRA 3OYAA 2OTLA 1ZBXA 3FIFA 4L6V5 4RG8A 4Z02A 2FYKA 4MZMA 3CC2T 4C5GA 3JCMg 2FHDA 1N8RC 2RHZA 4NL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTW A;  2I2L A;  1HXD A;  4M78 E;  4N0A C;  1WPY A;  4HA8 A;  4JUV A;  3RKW A;  4C92 G;  1D3B B;  4XU2 A;  4M78 A;  1WNL A;  4C8Q A;  2FB7 A;  5LJ5 e;  3BDU A;  4MMK A;  3RUX A;  1X01 A;  4NOY A;  3JB9 D;  3EFS A;  4F7U E;  4M7A E;  5GAN f;  4X9D A;  4PJO B;  4PJO D;  5GAN 8;  4M7A C;  2RM4 A;  5GMK e;  3JB9 G;  4M75 E;  4RCC A;  4C92 A;  1MGQ A;  5GAO q;  1I5L A;  2HNI A;  3JB9 H;  4M75 C;  3RKY A;  4PJO G;  5LJ5 g;  3JB9 F;  2ZGW A;  2DJZ A;  5DY9 A;  5LJ5 d;  3QSU A;  5GAN h;  5GAO l;  4HT9 A;  4EMK A;  2DTH A;  2RD1 A;  3JCM c;  3PGG A;  2DKG A;  4XU1 A;  5LJ3 h;  2E41 A;  4M77 A;  4XTZ A;  3FJP A;  3SWN C;  3SB2 A;  2DTI A;  4M7D B;  4PJO A;  4J6W A;  3HFO A;  4JRK A;  4J6Y A;  4XTX A;  4A54 A;  5GAN j;  5GAN e;  4JLI A;  3HSB A;  4C8Q E;  5GAN 6;  5GAO p;  1BIB A;  4DQ2 A;  4M78 C;  4C8Q C;  5LJ3 e;  1I4K 1;  2EAY A;  4M7D F;  4XU3 A;  3V8L A;  5LJ5 j;  3RER A;  3QUI A;  4X9C A;  4MML A;  1Y96 B;  4C92 E;  5CAI A;  3V8J A;  5GMK j;  2EJG A;  4J5Y A;  4C92 C;  5I21 A;  5LJ3 f;  5GAN g;  3V7R A;  5GAN d;  3RKX A;  3JB9 J;  4HT8 A;  3VU3 C;  3JCM X;  4F7U B;  4M7A B;  1H64 1;  3QHS A;  2YHT A;  5LJ3 d;  3JCM f;  4EMK C;  4M78 F;  3INZ A;  1D3B A;  4OP0 A;  2VC8 A;  5GAN 7;  4M75 B;  4M77 E;  2VXF A;  2EJ9 A;  4M7A G;  4M77 C;  3QO3 A;  4A53 A;  3L2Z A;  3JCM J;  4PJO E;  3JB9 I;  1LOJ A;  3JCM h;  4F7U F;  4M7D D;  4M75 G;  4M7A F;  3M4G A;  1BIA A;  4RCB A;  3RES A;  3V8K A;  2YLC A;  4M75 F;  4M7D G;  3JCM V;  2QTX A;  3SWN B;  1JRI A;  2DEQ A;  2JN0 A;  5LJ3 j;  4PNO A;  1N9R A;  3BY7 A;  5GAO n;  1U1S A;  5GAM f;  2Y90 A;  4J6X A;  2E1H A;  3RIR A;  3JCM b;  3JCM W;  3JCM P;  3BFM A;  3V7S A;  2DVE A;  3JCM e;  4M77 F;  4M78 B;  4C8Q B;  4M78 D;  1LNX A;  4M7D A;  1LJO A;  2DTO A;  4WF2 A;  5GAM h;  2DXU A;  3AHU A;  1M5Q 1;  3GIB A;  4M78 G;  1YCY A;  2YLB A;  4NL2 A;  4C8Q G;  5GMK l;  5LJ3 g;  4XTV A;  2K57 A;  3V7C A;  4EMG A;  4M7A D;  3SWN A;  2DZC A;  4C92 B;  4C8Q F;  3BW1 A;  5GAN 5;  4XQ3 A;  5GAO r;  2EJF A;  4V2S A;  4XTU A;  1WQ7 A;  4M75 D;  4F7U G;  3JCM d;  1I8F A;  2CGH A;  1HK9 A;  2E65 A;  5GMK m;  4EMK B;  4N0A A;  5GAM j;  5GAM e;  4PJO C;  1U1T A;  1Y96 A;  5GMK i;  5GAO m;  4C92 F;  2DZ9 A;  2DXT A;  2RB6 A;  1N9S A;  4M77 B;  1I81 A;  1M8V A;  3FB9 A;  4M77 D;  1JBM A;  4QVC A;  4XU0 A;  4F7U A;  4M7A A;  1B34 B;  5LJ5 f;  2E64 A;  4M77 G;  1KQ1 A;  4EMH A;  2RA2 A;  4M75 A;  2EWN A;  3L1A A;  5GAM g;  5GAM d;  4M7D E;  4C8Q D;  1TH7 A;  4PJO F;  4M7D C;  2E10 A;  3HFN A;  4JRI A;  5LJ5 h;  5GAN 3;  5GAN 2;  1WQW A;  3JCM Q;  3EFR A;  1KQ2 A;  4XTY A;  4QVD A;  3FIF A;  2FYK A;  4C92 D;  3JCM g;  5GAN 4;  1B34 A;  5GMK h;  2VXE A;  4Y91 A;  4NL3 A; 
#chains in the Genus database with same CATH topology
 4N0A C;  3EH2 A;  4JUV A;  3CCM Q;  4XU2 A;  5M9O A;  1JQQ A;  3BDU A;  1VQ7 A;  1VQ8 Q;  5GAN 8;  3CCJ A;  3VS1 A;  2NUP B;  1G8X A;  2F2V A;  4XU1 A;  1Q82 U;  1NLO C;  2RJF A;  3FJP A;  3HFO A;  2DBK A;  4ZN1 A;  5GAN j;  3MP6 A;  1VQM A;  3PTA A;  2C0T A;  4FYX B;  4M78 C;  4C8Q C;  5LJ3 e;  2QTV A;  1WLP B;  1VQK Q;  2R58 A;  2CP6 A;  1VQO Q;  1WIE A;  4IUR A;  3CQT A;  4F7U B;  4M7A B;  3QHS A;  5KYX B;  1NG2 A;  3QG1 A;  1Q86 R;  4M75 B;  3X28 B;  1PD1 A;  1GCQ A;  5L8R E;  3M53 A;  2ZAE A;  1KFZ A;  3EGD B;  3SDZ A;  2JNG A;  1PHT A;  5GAM f;  1PC0 A;  1NJI R;  1KD1 U;  2E1H A;  1T0H A;  3EG3 A;  5FU7 C;  4AFU C;  2DER A;  2EYZ A;  5HCK A;  4M7D A;  4A4F A;  4J9I A;  3TCJ A;  3AHU A;  1WJS A;  2ZZD A;  1ACM B;  1G5V A;  2CZ7 B;  4VUB A;  1OPK A;  1K73 U;  1Y57 A;  4PFP A;  1O75 A;  1RLP C;  4C92 F;  2DZ9 A;  2RN8 A;  1QVF P;  4M77 B;  1VQL Q;  1WHJ A;  3G4S A;  2OTJ A;  1QP3 A;  4GLK A;  1OX8 A;  1X6B A;  2Y4X A;  3R6O A;  2DIQ A;  5CK9 A;  1YJ9 T;  2PNI A;  4JS4 A;  2V1R A;  4CC7 A;  3REA B;  5LJ5 e;  3MKD A;  1WNL A;  3GF5 A;  1Q95 G;  2V8K A;  1FWZ A;  4AFS C;  2QQS A;  4RG2 A;  1YN8 A;  5LJ5 g;  3GLX A;  1QCN A;  3EGX B;  3CCR T;  3VRY A;  2JS0 A;  2X9H A;  4E7Z A;  3VS2 A;  3E9F A;  3DLL A;  4OML A;  2NUT A;  4BUG A;  5CQX A;  1U5S A;  3M0U A;  5HY6 A;  5IHK A;  3QJY A;  2VV5 A;  4B6M A;  1OV3 A;  3MO8 A;  1YHQ Q;  4C92 E;  2BIV A;  2EYY A;  1XNI A;  4ZGJ B;  1PRL C;  4J5Y A;  4Q5W A;  1EIF A;  3NTI A;  5IN1 A;  3RR6 A;  1NLP C;  1N27 A;  1WDX A;  1IXD A;  2RK1 A;  3J80 E;  1T3S A;  2JZ2 A;  4DBQ A;  2LNV A;  3CXC S;  1OEB A;  1KC8 C;  3Q1J A;  1PM3 A;  2K3B A;  2YLC A;  1WX6 A;  1M27 C;  1XJW B;  4JJC A;  3QPH A;  1FX7 A;  3NPF A;  3OYC A;  1QVG A;  2M9U A;  4R55 A;  1LJO A;  1SEM A;  3SFM A;  2J6F A;  3HRU A;  3PMT A;  1I07 A;  2DZC A;  4C8Q F;  1K0X A;  2FO0 A;  4J9B A;  4YTL A;  3L2U A;  2NWM A;  3G1J A;  2E3H A;  2ZPB B;  3URG A;  3TVT A;  2ABL A;  1M8V A;  4JJD A;  3WXM B;  1VQ5 Q;  1M8M A;  3OYK A;  3L1A A;  2L2P A;  5GAM d;  4PL6 A;  2E10 A;  4J8O A;  2RHI A;  4QVD A;  2CZ6 B;  2EYQ A;  2WSE E;  4JDS A;  4IKF A;  1RI9 A;  2DEU A;  5KH6 A;  2LDM A;  3HP9 A;  1HXD A;  3RKW A;  2DXC A;  3KBG A;  2PU9 B;  2VGM A;  2LT4 A;  1UGV A;  3RUX A;  2MWP A;  2GFU A;  5GAN f;  4L59 A;  3H0H A;  3EH1 A;  1YJN Q;  1IB8 A;  2BKD N;  2RF0 A;  3OSV A;  3CME Q;  2RD1 A;  2DKG A;  9ATC B;  3M0T A;  4N4H A;  1FMK A;  5CQY A;  4PK4 A;  4A4K A;  1N8R U;  1VYV A;  1VQP A;  4RTW A;  4J6Y A;  4XTX A;  1K9M U;  2K4Y A;  4C8Q E;  1JO8 A;  3QDF A;  3G6E T;  2QG9 B;  1EZZ B;  5GMK j;  2JTE A;  4HT8 A;  1VQ9 T;  2PUK B;  3VU3 C;  3EAE A;  2PVG B;  3C12 A;  2X51 A;  2F5K A;  1D3B A;  1M4Z A;  1MV3 A;  2KR3 A;  2KAF A;  5GAN 7;  2XG8 D;  4HVV A;  3CXC P;  1NYG A;  1TG0 A;  3TQ7 P;  2CRE A;  2GQI A;  2E6N A;  1D1C A;  3CEY A;  3CCU T;  3OQ5 A;  1Z9Z A;  4M7D G;  1YJW T;  1GRI A;  2YUO A;  1ZLM A;  4C5I A;  5CKH A;  4ZTF A;  2JVV A;  1OYX A;  4GBQ A;  3E19 A;  2YRV A;  4EMG A;  4M7A D;  2PZ1 A;  3EFO A;  4CI0 C;  3I56 A;  4M75 D;  4DEY A;  1HK9 A;  5FRN A;  2KBT A;  3QXE B;  1VQ4 T;  4X34 A;  2D6F A;  3VS7 A;  1ZSZ B;  2FPE A;  4B9X A;  3M59 A;  1PSE A;  4RKU E;  4C0F A;  2H8H A;  4IUP A;  3EG9 A;  1P92 A;  2X4Y A;  2CUB A;  2DK3 A;  1WQW A;  2AT1 B;  3DB3 A;  1VQN A;  3EHR A;  4PNO A;  3HHT B;  2X3X D;  4BB7 A;  1WYX A;  1GCP A;  1HSQ A;  1QVF A;  1ZA2 B;  4M7A C;  2KDS A;  4J9E A;  4M75 C;  2YRD A;  1VQ7 Q;  3CC7 A;  3SHW A;  3QWY A;  5KYU A;  4EMK A;  4ORZ A;  2RI2 A;  5EC7 A;  4OB2 B;  3CCJ Q;  4JS5 A;  1KJW A;  3HTR A;  2SRC A;  5FU6 B;  3HSB A;  1ZUU A;  3CC2 A;  2R57 A;  4X9C A;  4OMO A;  4OB3 B;  5GAN d;  4OMP A;  4GLM A;  2ZPG B;  1NEB A;  2C0O A;  1TOV A;  1VQ6 T;  4M77 C;  3CCE T;  1VIE A;  1BI3 A;  1LVK A;  5DLO A;  3JCM J;  3WVE B;  1AZG B;  3JCM V;  2QQA A;  3EG2 A;  2Y90 A;  2J6K A;  3JCM b;  2LQK A;  5IXF A;  1QVG S;  4M78 G;  4C8Q G;  1BYM A;  2QEX A;  1AHJ B;  2QAS A;  2LQN A;  4Y92 A;  3OMG A;  2MPX C;  4F14 A;  4F17 A;  5HK0 A;  2O88 A;  2HMA A;  1MND A;  2QXF A;  2AKL A;  2CZ1 B;  2JMC A;  1KC8 U;  5GMK i;  5GAO m;  5J3B A;  1KHI A;  1Q7Y R;  4ZTJ A;  2CP2 A;  1UGQ B;  3QDR B;  4J9C A;  2MAM A;  2RA2 A;  1HJD A;  2DO3 A;  3M57 A;  3X24 B;  2EQU A;  1I1J A;  2DIG A;  2XDD A;  1PCX A;  4RG8 A;  2OTJ Q;  2FHD A;  3TRE A;  2LMJ A;  4HA8 A;  1W70 A;  1SF9 A;  2LX7 A;  2YSQ A;  4KUI A;  3A8H B;  4RMO A;  5L23 A;  3J7A F;  2E6Z A;  4LDX A;  4PJO D;  2HQH A;  4MDX A;  1YIJ T;  5GJV B;  3RKY A;  1M3B A;  4D8K A;  3G7Z A;  2JS2 A;  1RAB B;  1VYU A;  2O31 A;  2HL5 C;  4CRI A;  5KYW A;  1YJ9 A;  2OTL Q;  2DFU A;  1BKB A;  3LH0 A;  4DA4 A;  3I55 T;  2M0Y A;  3FC3 A;  1M1K C;  1FYN A;  3J81 E;  4BAC A;  2EJG A;  2FRW A;  4OMF B;  8AT1 B;  3KUF A;  3UPU A;  2EW3 A;  4AMC A;  2AKK A;  3JCM h;  1IGQ A;  4F7U F;  4M7A F;  4ANJ A;  3VUZ A;  1UTI A;  3RES A;  4M75 F;  4C5E A;  1X6O A;  5KE3 A;  2XIC A;  4LNP A;  5CKB A;  2DM1 A;  1QVG P;  5DLQ E;  1BBZ A;  4OVA A;  1VQK T;  2DNU A;  3EGD A;  3MP8 A;  1VQO T;  1ABO A;  2E70 A;  3QWX X;  2E5Q A;  3M56 A;  1YWP A;  1K9M R;  3M0P A;  5A2Q E;  1UJY A;  2GCX A;  2B8A A;  2DYB A;  1ZUK A;  1X2Q A;  2D1X A;  1UE9 A;  3VYH B;  4QQG A;  4FL6 A;  5FRO A;  2DD4 A;  4OMQ A;  1X2K A;  1OI1 A;  3UF4 A;  3CCV T;  1QWF A;  4LDU A;  4LD9 K;  5GMK h;  1Y7X A;  5GMK m;  5A0L A;  2CDT A;  3L2Q A;  4E7S A;  1RAF B;  1EX4 A;  2M1H A;  3NTK A;  2BZX A;  3S6W A;  4F7U E;  4M7A E;  1UEB A;  1AWW A;  2O4X A;  1VQL T;  4M75 E;  3JB9 F;  5DY9 A;  3L2W A;  1JJ2 S;  2K3X A;  1K8A U;  4QKU A;  3R6N A;  1AWJ A;  1GFC A;  2RI3 A;  5FWB A;  1YI2 A;  2KRM A;  2D9T A;  2LCC A;  4JRK A;  1QMC A;  5D7U A;  3ZL7 C;  1Q81 C;  4OMM A;  2KVQ G;  3IQL A;  3PFS A;  3N5B B;  1FXX A;  2DMO A;  3V8L A;  4AFQ C;  3LYI A;  2X4W A;  5KCH A;  1GFD A;  5IXB A;  2DVJ A;  1VQP Q;  4LD6 A;  1OX9 A;  4CC2 A;  3S3O A;  3CPW A;  3LWH A;  4RTY A;  2RK2 A;  6AT1 B;  1ZSZ C;  4M77 E;  3LGF A;  4QVZ A;  3L2Z A;  1Y07 A;  3JAM E;  2BE7 D;  3KFV A;  3A8G B;  5KYY B;  3V8K A;  2P0K A;  2JM9 A;  4ESR A;  4BE2 A;  1Z9Q A;  1UGS B;  2WAC A;  1UHC A;  1V29 B;  1YBY A;  1LNX A;  3G6E A;  5GMK l;  2MCN A;  5LJ3 g;  2DPP B;  2AZS A;  2DET A;  1T0J A;  5GAO r;  2K9G A;  1VQ9 A;  3L2V A;  2ESW A;  1VIF A;  1M2V A;  1Y96 A;  2YT6 A;  2DLP A;  4EPC A;  4KUL A;  3I56 Q;  4XU0 A;  1TSF A;  3MEW A;  2J6O A;  2G6F X;  3CCU A;  2NUZ A;  4X1V A;  4ME7 A;  5AT1 B;  1RAI B;  1TUC A;  4PJO F;  3NTH A;  5GAN 3;  1M90 R;  2XDP A;  5FU6 C;  5GAN 2;  2KT8 A;  2D8J A;  1UGP B;  3M9Q A;  4ELY C;  3OS1 A;  1WGS A;  1SPK A;  1WJQ A;  3VKI A;  3S3N A;  4II1 A;  1MV0 B;  2XI9 A;  1PNJ A;  1VQN Q;  1VQ4 A;  4C92 A;  1I5L A;  2HAX A;  3OS2 A;  3A8M B;  1RAC B;  2ZPH B;  1TUD A;  2HDA A;  1WA7 A;  4LE9 A;  3CC7 Q;  1AVZ C;  5KE2 A;  2L3R A;  1PG5 B;  5GAO p;  3JV3 A;  4DQ2 A;  4A4H A;  1BU1 A;  2RJE A;  3H8Z A;  2W10 A;  2RQR A;  3HL8 A;  4RTV A;  3JB9 J;  3CC2 Q;  2O9S A;  4BDZ A;  4FW1 A;  2LX9 A;  1Q86 C;  2YHT A;  1JB0 E;  2QQB A;  4RTZ A;  1YJN T;  3OY9 A;  1GXI E;  2FZC B;  4M7A G;  4PJO E;  3CME T;  3JB9 I;  2RJC A;  4M75 G;  1PKS A;  2BUD A;  2M0O A;  3I9Q A;  1NJI C;  4KGX B;  2DJQ A;  3CCL Q;  3PMI A;  4E7K A;  3CD6 T;  3JCM e;  1M1K U;  4UC4 A;  5GAM h;  4C0Z A;  3LX7 A;  3GOX A;  2K6D A;  2KQW A;  1OPL A;  4N0A A;  2E4H A;  2QEX Q;  3VUB A;  1VQ6 A;  3CCE A;  4OB0 B;  2EGA A;  4PJL A;  2PTK A;  4J7F A;  4M77 G;  1D0Z A;  2EQK A;  1NZ9 A;  3NHN A;  4CC3 A;  1NPR A;  4ZGE B;  1YP5 A;  1NPP A;  4JRI A;  5GJW B;  2PVO B;  3P8H A;  2KI7 A;  3OYD A;  3H0F A;  4AFZ C;  5EG2 A;  2MK5 A;  3OYG A;  2VXE A;  2I0N A;  5LJ5 j;  4M78 A;  4C8Q A;  3G71 A;  2QA4 Q;  4MMK A;  3NGP A;  3EFS A;  2MIO A;  4PJO B;  1H8K A;  1MMD A;  5GMK e;  8ATC B;  3JB9 G;  3SD4 A;  3QYG B;  4PKC C;  2DJZ A;  4HCK A;  1UHF A;  1F1B B;  4FCY A;  2DTI A;  4M7D B;  1UJ0 A;  1RAG B;  1TUG B;  1BIB A;  2LC4 A;  2EQI A;  1E7O A;  1SRL A;  1V76 A;  4MML A;  3MEU A;  3VJP A;  2B86 A;  1YJ9 Q;  3JCM X;  2WSF E;  2ZPF B;  1H64 1;  4ATO A;  1YIJ A;  1VQ7 T;  3CPW S;  2DD5 A;  5IHN A;  1VUB A;  3CCJ T;  3JSC A;  1MMN A;  2RHX A;  3SWN B;  1Q81 U;  1W4S A;  1JRI A;  2C0I A;  3MHX A;  1WXB A;  1N9R A;  3BY7 A;  3M55 A;  5GAO n;  3JCM W;  3M58 A;  4J6X A;  1CSK A;  1E6G A;  3M4Y A;  2V1Q A;  1D1A A;  4A63 B;  4JZ3 A;  3I55 A;  2QGF B;  1HD3 A;  2RI5 A;  2DL5 A;  5D6Y A;  2EBP A;  1X6G A;  3BW1 A;  3M0S A;  4LDY A;  1WQ7 A;  3QZ9 B;  1K8A R;  1IGU A;  2E65 A;  4FT4 A;  2RHY A;  1BCO A;  1YIT Q;  3LW5 E;  1XTD A;  1ZA1 B;  2JT4 A;  1CKA A;  3CBO A;  2F5T X;  2QGG A;  2V8J A;  3CBM A;  2HSP A;  4OMN A;  2CP3 A;  3CMA A;  1PRM C;  2J06 A;  2NUT B;  5IT9 E;  1OOT A;  4N4I A;  1SHG A;  2M16 A;  2E64 A;  3CCQ Q;  4E7H A;  2A37 A;  4D6W A;  1TH7 A;  2KEA A;  2EVR A;  5C6S A;  2QI2 A;  4KGV B;  1IZ6 A;  3OYA A;  1ZBX A;  2RPN A;  4Z02 A;  2LJ3 A;  2CH4 A;  2FYK A;  2L0A A;  2CH4 W;  1Q82 R;  4C5G A;  1VQK A;  1VYT A;  4NL3 A;  1OU9 A;  4C92 G;  1WPY A;  2DRM A;  2WSC E;  5LL6 S;  2IIM A;  4NOY A;  4IUQ A;  1MHN A;  4RTX A;  5CKF A;  3VS5 A;  4C0G A;  2HNI A;  4BD3 A;  2F1L A;  1MMG A;  2A36 A;  3QSU A;  1A0N B;  3NMZ C;  5GAN h;  2CSQ A;  2BZ8 A;  3D7S B;  3JCM c;  2XHC A;  4LDW A;  1SKU B;  3CC4 Q;  4XTZ A;  3SB2 A;  1XQH A;  4O5V A;  3MCA B;  3EG1 A;  2P0Q A;  3CCV A;  3CCS A;  1AZE A;  3RMQ A;  1ZSG A;  2HSE B;  1M3A A;  1YI2 Q;  2JOY A;  1KD1 R;  1JJ2 A;  2H3E B;  2JTM A;  2RQW A;  3ZBD A;  3VRZ A;  2E5K A;  3I5S A;  2CUD A;  3GNF B;  3CPW P;  2H3J A;  2RH2 A;  3FJ5 A;  2CT4 A;  2L8D A;  1W6X A;  1NBE B;  3M5A A;  4DOW A;  1BIA A;  2GTO A;  1K73 R;  1D1B A;  1W2B A;  2GF7 A;  1W1F A;  4HXJ A;  3GP8 A;  1YWO A;  2OTL T;  2YXY A;  1ZBJ A;  2KT1 A;  1VQM Q;  5IH2 A;  3M54 A;  1Q86 U;  2EFI A;  1BI2 A;  1AWO A;  1TWB A;  3OYM A;  1WI7 A;  5GAN 5;  1UG1 A;  4XTU A;  2AZV A;  5GAM e;  3G6E Q;  1RAD B;  1S72 T;  1NJI U;  4FYW B;  4XK8 E;  4PLI A;  1VQ9 Q;  5LJ5 f;  2W0Z A;  2RMO A;  2EQJ A;  3QZ5 B;  5GAM g;  3OYF A;  1ARK A;  1K9A A;  3X25 B;  2CP0 A;  1Y71 A;  3PVQ A;  4FSS A;  3OW2 A;  1EFN A;  1PD0 A;  1UGR B;  3FRN A;  1D3B B;  2FB7 A;  4JRQ A;  5CO7 A;  4FYV B;  1YCS B;  1I0C A;  5I2M A;  2FRY A;  3C95 A;  1H3Z A;  4Y28 E;  4WTO B;  5A0D A;  2DIL A;  3FLG A;  4AG1 C;  2RQU A;  1WZO A;  2RHU A;  3ASK A;  3G4S Q;  4LUD A;  1U3O A;  4R0K A;  1KQS A;  2AHJ B;  2HD0 A;  2MWO A;  2D8H A;  3PE0 A;  4E6R A;  4FM4 B;  3EFO B;  4R56 A;  2YUP A;  2KRO A;  3C0C A;  3LLR A;  3KXT A;  3RER A;  3L42 A;  2X4J A;  2CP7 A;  3DKM A;  1D0Y A;  2DAQ A;  2JTF A;  1JXM A;  5LJ3 d;  3JRZ A;  2FZG B;  2K5I A;  4HVW A;  4PJM A;  4QQ6 A;  2F2X A;  4HKE A;  3EG9 B;  3QO3 A;  4A53 A;  2IG0 A;  4L5G A;  2CS7 A;  4M7D D;  4KH0 B;  4BI4 A;  1TXQ A;  1C6V X;  1QCO A;  2NUP A;  5HKC A;  3CCM T;  4LDV A;  2DVE A;  2EPD A;  3GNG A;  2SEM A;  4JZ4 A;  1VQP T;  1VQ8 T;  1T3L A;  1O9S A;  4NL2 A;  4XTV A;  3V7C A;  5FWC A;  1TS9 A;  1FMV A;  2R5A A;  2DL3 A;  2EGE A;  1I8F A;  2O2O A;  1TU0 B;  5KYU B;  4EMK B;  3CCR A;  1Q7Y C;  1GCQ C;  4PJO C;  1M1F A;  1QCF A;  3PT9 A;  4E7J A;  2C06 A;  3HRS A;  5KYN A;  1N9S A;  3RMS A;  5KCO A;  2R5M A;  3CME A;  1JBM A;  4F7U A;  4M7A A;  1B34 B;  5KYX A;  3PIO A;  4M75 A;  1VQ6 Q;  3CCE Q;  4M7D C;  1X75 C;  5D6W A;  3CD6 A;  2EGC A;  2KY9 A;  3UDC A;  2LTO A;  1M30 A;  5GAN 4;  1OZ3 A;  1B7T A;  2EYX A;  2LZ6 B;  1N8R R;  3OA6 A;  2DBM A;  1U8R A;  2XK0 A;  4EIK A;  4QT7 A;  1B07 A;  2K2V A;  3A1P A;  4BE1 A;  3H9N A;  3I56 T;  3JB9 H;  1BCM A;  4E7I A;  3G71 Q;  5LJ5 d;  3S3M A;  4FSX A;  4A4E A;  3A5Z B;  3M0Q A;  1N6A A;  3VS3 A;  1DJ7 B;  4M77 A;  2HBP A;  3SWN C;  1G3S A;  3OMC A;  2RQV A;  2DYI A;  4NS5 A;  5GAN e;  2GFA A;  1GBR A;  1UB4 A;  1K1Z A;  1SHF A;  3PIP A;  4BY6 B;  2KRN A;  2PVD B;  3BE3 A;  2JW4 A;  2LCS A;  1VQN T;  5GAN g;  4J7I A;  1SSF A;  2BZY A;  5J39 A;  2GTJ A;  2VXF A;  2EJ9 A;  2DXB A;  3WVD B;  4RTU A;  2CT3 A;  1LOJ A;  1KIK A;  3M4G A;  3OBY A;  1LPL A;  4JLG A;  3A8L B;  3EGX A;  3JCM P;  4Z89 A;  2COZ A;  2G3R A;  3RNJ A;  1W2B S;  2RNA A;  2DL7 A;  2DRK A;  4M78 D;  3ER0 A;  3NFC A;  3GIB A;  1M5Q 1;  1NM7 A;  2DL4 A;  3OYI A;  1SRM A;  4V2S A;  4D8D A;  1J3T A;  2OI3 A;  1K9M C;  2ZPI B;  5CCA A;  1WHM A;  3HRT A;  3I55 Q;  1U1T A;  1BI0 A;  2O01 E;  1I81 A;  4Z88 A;  1H3H A;  2VWF A;  1RL2 A;  2HKQ B;  1KQ1 A;  1G3Y A;  4MZT A;  3CCL T;  5KYW B;  1C0M A;  4KGZ B;  3CMA Q;  3HFN A;  1AD5 A;  1YHQ T;  4FT2 A;  4F04 B;  4EDU A;  2LT1 A;  1PWT A;  1N5Z A;  4XTW A;  2KNB B;  2Z0W A;  3OW2 S;  2Y4Y A;  3UT1 A;  1YNZ A;  1QLY A;  5HK3 A;  2AIR B;  2HZY A;  1OUL A;  2CSI A;  2QEX T;  4RCC A;  4M4Z A;  1WHG A;  1D0X A;  2K2M A;  1YJW A;  4J9H A;  2A28 A;  4PJJ A;  3PGG A;  2LVM A;  4J83 A;  4AG2 C;  4HCZ A;  4TVR A;  2FPF A;  3OYB A;  2LJ0 A;  2LQ8 A;  4PFO A;  4FYY B;  4PJO A;  2VAS A;  5I11 A;  1KQS S;  1PKT A;  2RO0 A;  4XAX B;  2LRQ A;  3EHQ A;  3OYJ A;  2K3Y A;  3X20 B;  4M7D F;  4XU3 A;  4B9W A;  3CBP A;  1PSF A;  3QUI A;  4MDW A;  1X69 A;  2QA4 T;  2HL3 A;  4J9F A;  3CCV Q;  1QP2 A;  5I21 A;  3CCS Q;  1JJ2 P;  5FLX E;  1K0S A;  4O6J A;  5I22 A;  1VQ5 T;  1G83 A;  3ZFJ A;  1QKX A;  3PNW C;  4IUT A;  4CC4 B;  3O5Z A;  3ULR B;  4Z8A A;  4IIM A;  1K76 A;  4BDY A;  4J9G A;  2QQR A;  3TSW A;  1KC8 R;  3EGU A;  3TSZ A;  3UA7 A;  1UDL A;  5LJ3 j;  1W2B P;  2JMA A;  3P8D A;  2X3W D;  2FVU A;  4ZN3 A;  4JJB A;  2DTO A;  2FPD A;  2YWW A;  3T9N A;  1AEY A;  2O4X B;  1UEC A;  2D0Q B;  2K57 A;  2QK0 A;  3SWN A;  2CZ0 B;  4XQ3 A;  4F7U G;  1S1N A;  2XMF A;  3MP1 A;  3OYL A;  4JRP A;  2KRS A;  2LNH B;  4QVC A;  3C94 A;  3VS4 A;  3TEE A;  1YFN A;  2NLU A;  2EWN A;  1M90 C;  2EQM A;  4M7D E;  2L3Q A;  2DF6 A;  2OTL A;  1OQK A;  3FIF A;  4L6V 5;  4MZM A;  1C1A A;  1U06 A;  3JCM g;  2XID A;  1WXT A;  3OW2 P;  1Q7Y U;  1R0B G;  2X4X A;  2MOX A;  2KK4 A;  3GBQ A;  1YIT T;  3M0R A;  1WJR A;  5J26 A;  1S72 A;  1MGQ A;  5GAO q;  2F69 A;  2ZGW A;  2F2W A;  3OBW A;  4HT9 A;  3CCQ T;  3THK A;  2VGN A;  1ZSZ A;  5CIU A;  2E41 A;  2DE0 X;  2HQE A;  3OYY A;  2HCK A;  2P4T A;  4KT0 E;  1KQS P;  2FEI A;  4A54 A;  1ZHI A;  5AYF A;  2KYB A;  3QJ6 A;  2VYT A;  1OZ2 A;  2GBQ A;  1I4K 1;  1UUE A;  2DX1 A;  2EAY A;  1VA7 A;  5CKE A;  4C5H A;  1M2V B;  1Y96 B;  1KG1 A;  1M2O A;  1GL5 A;  2A3L A;  3V7R A;  3RKX A;  2EKH A;  2J05 A;  4EMK C;  2LJ1 A;  4M78 F;  3INZ A;  2RJD A;  4F16 A;  1E6H A;  3CC4 T;  4JJN K;  4FIB A;  4RTT A;  3E9G A;  1RAE B;  2V26 A;  1M9S A;  2O9V A;  4OGC A;  4OF1 A;  2V8I A;  1NYF A;  2FG0 A;  3BFM A;  2A7Y A;  3V7S A;  5IHI A;  4GY5 A;  2VUB A;  3UAT A;  2XU8 A;  1YI2 T;  1X43 A;  4C92 B;  2NYS A;  4DBF A;  4QQD A;  5FW9 A;  1M3C A;  3LGL A;  1ZUY A;  2VVK A;  2IPO B;  3CCR Q;  2GNC A;  2K5L A;  1KSW A;  1QVP A;  4AT1 B;  3CCM A;  4N4G A;  2K7A A;  1VQM T;  1JU5 C;  3MJX A;  1WXU A;  2YUN A;  1HYO A;  2L5Q A;  4BY6 C;  1VQ8 A;  4QW2 A;  4MZP A;  4Y91 A;  2ECZ A;  3A98 A;  3CD6 Q;  3AT1 B;  4M78 E;  5A0G A;  1WHK A;  5ECA A;  3A8O B;  3PVL A;  5DM7 R;  2MI6 A;  2K5F A;  4PJO G;  3RBB B;  4A4G A;  2DA9 A;  3MET A;  4C0D B;  2DTH A;  1IO6 A;  2HEQ A;  2GGR A;  1WFW A;  1X27 A;  5GAN 6;  1I5O B;  1RLQ C;  1VQO A;  1G3W A;  2PUO B;  1LCK A;  2DL8 A;  2MF2 A;  4PFZ A;  2L3S A;  4E7L A;  5LJ3 f;  1BK2 A;  4OB1 B;  2KMT A;  3CPF A;  5D6X A;  4OP0 A;  5CR2 A;  2EYW A;  2GQV A;  2OJ2 A;  2JUF A;  2BTT A;  3HPW A;  4ZNX A;  3G4S T;  2KXC A;  3ZEH A;  4J9D A;  4RCB A;  2L3P A;  2XD0 A;  2OTJ T;  2M51 A;  1R8O B;  2QTX A;  2ATC B;  1JEG A;  4HCC A;  4PLL A;  3H41 A;  3OS5 A;  4M78 B;  3HKS A;  4C8Q B;  2AK5 A;  3LH5 A;  2X35 A;  1YCY A;  2YLB A;  3I35 A;  1K8A C;  1VQL A;  2CYZ B;  4PJN A;  2EJF A;  2ED1 A;  1ZX6 A;  2FZK B;  4ELZ C;  1IRX A;  2KYM A;  1KHC A;  2JM8 A;  4JPB W;  4RUG A;  7AT1 B;  3FB9 A;  4M77 D;  4LN2 A;  2COW A;  3MEV A;  4KH1 B;  5CVI A;  5FU7 B;  1Q82 C;  1KQ2 A;  2ENM A;  2E12 A;  3GPL A;  1B34 A;  2QDY B;  3O8V A;  2COY A;  2I2L A;  2KE9 A;  2XDB A;  3P8B B;  3VYG A;  2MYS A;  1M1G A;  3JB9 D;  3LWI A;  4KBM B;  4X9D A;  1MUZ A;  2RM4 A;  3X26 B;  3BDL A;  4BI8 B;  2P0P A;  1WHH A;  1M90 U;  2KSS A;  3E2U A;  2K79 A;  3I5R A;  1SSH A;  1NE8 A;  5LJ3 h;  1JXO A;  3CCL A;  4DEX A;  3CCU Q;  3OSS C;  4J6W A;  1YJW Q;  2YDL A;  3MPU B;  1YHQ A;  4JLI A;  2LP5 A;  2QQ9 A;  1MMA A;  3VV0 A;  4ZGD B;  1ABQ A;  1TTH B;  3L2R A;  1KD1 C;  3EG0 A;  3OYN A;  3OB9 A;  4KUD K;  1VOM A;  1M1K R;  3OYE A;  3SEM A;  1NEG A;  3JCM f;  2RQT A;  3G71 T;  2J7I A;  3UWN A;  1QQJ A;  1VQ4 Q;  1RAH B;  2A08 A;  4P5N A;  1K73 C;  1XOV A;  3DB4 A;  1ZQ1 A;  1AOJ A;  1QW1 A;  2DEQ A;  1KK7 A;  1U1S A;  2QDL A;  4IUU A;  2ZCF B;  4OGE A;  1BB9 A;  2XKO C;  3VS6 A;  2IVW A;  1OU8 A;  2MMP A;  4WCI A;  4WF2 A;  2QA4 A;  2VKN A;  3QII A;  2P84 A;  3DLM A;  3ME9 A;  1VQ5 A;  5GAM j;  2LCL A;  4E2F B;  4E47 A;  2DXT A;  2RB6 A;  1G3T A;  1QKW A;  5I2S A;  3QBY A;  2EKO A;  3E1S A;  2FL7 A;  4HVU A;  5LJ5 h;  2OAW A;  5KYY A;  4XTY A;  1SG5 A;  1FMW A;  4C92 D;  1RI0 A;  4HCB A;  4LXC A;  2D0N A;  2HBW A;  2L89 A;  4FU6 A;  4DBH A;  2HQX A;  1YJN A;  2YRC A;  3UA6 A;  2OAU A;  1X01 A;  1RUW A;  1GBQ A;  4DOV A;  1BI1 A;  1G2B A;  2KGT A;  3U23 A;  4BI3 A;  5GAO l;  1V1C A;  3VS0 A;  1WHL A;  3RDV A;  1D09 B;  1RAA B;  4K11 A;  3F70 A;  1AWX A;  4DBR A;  1S72 Q;  3CMA T;  3FEO A;  1H92 A;  3QYH B;  3OYH A;  3FDR A;  5FRM A;  4KRT A;  2KXD A;  3H0I A;  2HKN A;  1Q81 R;  1CKB A;  5CAI A;  1B3Q A;  3V8J A;  4C92 C;  3OS0 A;  1YIT A;  5C0M A;  4BE0 A;  2M02 A;  2CKK A;  2ZPE B;  2VC8 A;  1IHW A;  3CXC A;  2E3I A;  2ROT A;  2BE9 B;  3C4S A;  3CCQ A;  1R77 A;  4IIO A;  2QYZ A;  3H6Z A;  2CP5 A;  1IHV A;  2JN0 A;  2JJ9 A;  2VB6 A;  2OX7 A;  3RIR A;  2YUQ A;  4M77 F;  2LQW A;  5CKD A;  2DXU A;  3CCS T;  2EIF A;  2P4R A;  3JCM d;  4IUV A;  2CGH A;  3REB B;  2ROL A;  2ED0 A;  2PQW A;  2QAZ A;  3QKJ A;  2JXB A;  1Y0M A;  1YIJ Q;  1R0C B;  3TU4 K;  3CC7 T;  1QVF S;  4C0D C;  1QWE A;  1IRE B;  3CC4 A;  4EMH A;  1MNE A;  4LUE A;  1UFF A;  4C8Q D;  1AT1 B;  4FW2 A;  1K4U S;  3MEA A;  5IAY A;  3JCM Q;  3EFR A;  3CC2 T;  2A0F B;  1N8R C;  2RHZ A; 
#chains in the Genus database with same CATH homology
 3TRE A;  4C92 G;  4N0A C;  1Q7Y U;  1WPY A;  4HA8 A;  4JUV A;  2WSC E;  2X4X A;  4XU2 A;  5LL6 S;  2KK4 A;  5M9O A;  1VQ7 A;  3BDU A;  4NOY A;  1YIT T;  4KUI A;  3A8H B;  4RMO A;  3J7A F;  2E6Z A;  4LDX A;  5GAN 8;  4PJO D;  4IUQ A;  1MHN A;  1WJR A;  5CKF A;  5J26 A;  1YIJ T;  4MDX A;  1S72 A;  1MGQ A;  4C0G A;  5GAO q;  3CCJ A;  2HNI A;  4BD3 A;  3RKY A;  2F69 A;  2ZGW A;  3QSU A;  3OBW A;  5GAN h;  4HT9 A;  3CCQ T;  3JCM c;  3G7Z A;  4XU1 A;  2XHC A;  2VGN A;  5CIU A;  1Q82 U;  4LDW A;  2E41 A;  3OYY A;  2HQE A;  2P4T A;  4XTZ A;  2RJF A;  3FJP A;  4KT0 E;  3SB2 A;  1XQH A;  3HFO A;  4O5V A;  3MCA B;  4A54 A;  4ZN1 A;  5GAN j;  3MP6 A;  1VQM A;  1ZHI A;  2P0Q A;  5AYF A;  3CCV A;  3CCS A;  3QJ6 A;  2VYT A;  4CRI A;  3PTA A;  1OZ2 A;  4M78 C;  4C8Q C;  5LJ3 e;  1YJ9 A;  1I4K 1;  1BKB A;  2EAY A;  3LH0 A;  3RMQ A;  2XID A;  5CKE A;  4C5H A;  4DA4 A;  3I55 T;  3FC3 A;  1M1K C;  1Y96 B;  2JOY A;  3J81 E;  4BAC A;  1KG1 A;  1JJ2 A;  2R58 A;  2EJG A;  2A3L A;  2JTM A;  3V7R A;  3RKX A;  4OMF B;  4IUR A;  3ZBD A;  3KUF A;  4F7U B;  4M7A B;  3QHS A;  3GNF B;  3UPU A;  4EMK C;  2H3J A;  2RH2 A;  3INZ A;  3QG1 A;  4M78 F;  2RJD A;  4M75 B;  2L8D A;  3X28 B;  3JCM h;  3M5A A;  5L8R E;  4DOW A;  3M53 A;  4F7U F;  4M7A F;  3VUZ A;  1BIA A;  3CC4 T;  3RES A;  4JJN K;  4FIB A;  3E9G A;  4M75 F;  3SDZ A;  2JNG A;  4OGC A;  1M9S A;  4OF1 A;  1W2B A;  2V8I A;  1X6O A;  4C5E A;  5KE3 A;  5GAM f;  2GF7 A;  1KD1 U;  2E1H A;  2XIC A;  3BFM A;  3GP8 A;  2A7Y A;  3V7S A;  5FU7 C;  2OTL T;  5CKB A;  5DLQ E;  4GY5 A;  4OVA A;  4M7D A;  4A4F A;  2VUB A;  2XU8 A;  1YI2 T;  1VQK T;  3M54 A;  3TCJ A;  1Q86 U;  3AHU A;  2EFI A;  1BI2 A;  1WJS A;  2ZZD A;  3OYM A;  3MP8 A;  4C92 B;  5GAN 5;  1VQO T;  1G5V A;  2E70 A;  4XTU A;  2CZ7 B;  4QQD A;  4VUB A;  5GAM e;  2E5Q A;  3M56 A;  1K73 U;  1O75 A;  4C92 F;  2DZ9 A;  1S72 T;  3LGL A;  1NJI U;  4M77 B;  5A2Q E;  4XK8 E;  2GCX A;  4PLI A;  3G4S A;  2B8A A;  5LJ5 f;  2OTJ A;  1QP3 A;  2K5L A;  2EQJ A;  3QZ5 B;  4GLK A;  3VYH B;  5GAM g;  3OYF A;  1QVP A;  4QQG A;  4FL6 A;  3X25 B;  5FRO A;  2DD4 A;  2Y4X A;  3CCM A;  4N4G A;  1OI1 A;  1Y71 A;  3R6O A;  1VQM T;  3CCV T;  2DIQ A;  4LDU A;  4LD9 K;  2L5Q A;  5CK9 A;  1YJ9 T;  4BY6 C;  4JS4 A;  3OW2 A;  1VQ8 A;  4QW2 A;  5GMK h;  4MZP A;  4Y91 A;  1Y7X A;  1UGR B;  3FRN A;  4M78 E;  5GMK m;  5LJ5 e;  1D3B B;  1WNL A;  3GF5 A;  2FB7 A;  5A0L A;  3L2Q A;  4JRQ A;  5CO7 A;  5A0G A;  2M1H A;  3NTK A;  3S6W A;  4F7U E;  2V8K A;  4M7A E;  1FWZ A;  2QQS A;  1UEB A;  3A8O B;  5I2M A;  3C95 A;  2O4X A;  5DM7 R;  1VQL T;  4M75 E;  2MI6 A;  4RG2 A;  2K5F A;  1H3Z A;  4PJO G;  5LJ5 g;  3GLX A;  3JB9 F;  4Y28 E;  5DY9 A;  4A4G A;  3L2W A;  1JJ2 S;  3MET A;  3FLG A;  5A0D A;  4C0D B;  3CCR T;  2DTH A;  2K3X A;  2RHU A;  3ASK A;  3E9F A;  3DLL A;  1K8A U;  1KQS A;  2AHJ B;  2RI3 A;  2HD0 A;  1YI2 A;  4JRK A;  2D9T A;  2LCC A;  2MWO A;  5CQX A;  4BUG A;  5GAN 6;  4FM4 B;  1VQO A;  1Q81 C;  4R56 A;  5HY6 A;  3LLR A;  1G3W A;  2KVQ G;  2PUO B;  3N5B B;  1FXX A;  3PFS A;  3V8L A;  3KXT A;  3RER A;  3L42 A;  2VV5 A;  2X4J A;  2X4W A;  3DKM A;  3LYI A;  3QJY A;  5KCH A;  2MF2 A;  2DAQ A;  3MO8 A;  4C92 E;  2BIV A;  2JTF A;  1XNI A;  4LD6 A;  4ZGJ B;  4E7L A;  4J5Y A;  4Q5W A;  5LJ3 f;  1EIF A;  3NTI A;  5IN1 A;  3S3O A;  4OB1 B;  3LWH A;  2KMT A;  3CPW A;  5LJ3 d;  3CPF A;  3JRZ A;  5D6X A;  2RK2 A;  4OP0 A;  2K5I A;  1N27 A;  4QQ6 A;  4M77 E;  4HKE A;  5CR2 A;  2RK1 A;  3LGF A;  3J80 E;  2GQV A;  4QVZ A;  3QO3 A;  4A53 A;  2JZ2 A;  2IG0 A;  3L2Z A;  4L5G A;  1Y07 A;  2JUF A;  2CS7 A;  2LNV A;  3CXC S;  3HPW A;  3JAM E;  3G4S T;  4M7D D;  4BI4 A;  1KC8 C;  3A8G B;  3ZEH A;  4RCB A;  3V8K A;  2P0K A;  2XD0 A;  3Q1J A;  2OTJ T;  2YLC A;  4BE2 A;  1R8O B;  1UGS B;  2QTX A;  2WAC A;  4HCC A;  5HKC A;  3QPH A;  4PLL A;  1FX7 A;  3CCM T;  4LDV A;  2DVE A;  3OYC A;  1V29 B;  3OS5 A;  4M78 B;  3HKS A;  4C8Q B;  1YBY A;  1LNX A;  2M9U A;  3GNG A;  1QVG A;  4R55 A;  1LJO A;  1VQP T;  1VQ8 T;  2X35 A;  3SFM A;  3G6E A;  1O9S A;  1YCY A;  2YLB A;  4NL2 A;  5GMK l;  5LJ3 g;  3HRU A;  4XTV A;  1VQK A;  3V7C A;  1K8A C;  3PMT A;  1VQL A;  2DPP B;  2CYZ B;  2DZC A;  4C8Q F;  5GAO r;  2EJF A;  1VQ9 A;  2R5A A;  4ELZ C;  3L2V A;  1I8F A;  1VIF A;  4EMK B;  3CCR A;  1Q7Y C;  1KHC A;  4YTL A;  4PJO C;  1Y96 A;  1M1F A;  3PT9 A;  3L2U A;  4E7J A;  2C06 A;  2ZPB B;  3HRS A;  3URG A;  1N9S A;  3RMS A;  4EPC A;  2R5M A;  3FB9 A;  4M77 D;  4KUL A;  1JBM A;  5KCO A;  3CME A;  1M8V A;  4XU0 A;  3WXM B;  4F7U A;  4M7A A;  1B34 B;  3MEW A;  3PIO A;  3CCU A;  3OYK A;  4M75 A;  3L1A A;  5GAM d;  4ME7 A;  4PL6 A;  3MEV A;  4PJO F;  2E10 A;  1X75 C;  3NTH A;  4J8O A;  5D6W A;  5GAN 3;  5CVI A;  3CD6 A;  4M7D C;  2KY9 A;  5FU7 B;  2XDP A;  5FU6 C;  3UDC A;  5GAN 2;  2RHI A;  2LTO A;  4QVD A;  1Q82 C;  1KQ2 A;  2CZ6 B;  2E12 A;  2EYQ A;  1UGP B;  2WSE E;  3M9Q A;  4JDS A;  4IKF A;  4ELY C;  3OS1 A;  1WGS A;  5KH6 A;  5GAN 4;  3GPL A;  1WJQ A;  2QDY B;  1B34 A;  1OZ3 A;  3VKI A;  2LDM A;  3O8V A;  3S3N A;  4II1 A;  3HP9 A;  2I2L A;  1HXD A;  2XDB A;  2XI9 A;  3RKW A;  3P8B B;  3OA6 A;  2DXC A;  1U8R A;  3VYG A;  3KBG A;  2PU9 B;  2VGM A;  2LT4 A;  1M1G A;  2XK0 A;  3RUX A;  2MWP A;  3JB9 D;  3LWI A;  4KBM B;  2GFU A;  5GAN f;  4X9D A;  4L59 A;  2K2V A;  1VQ4 A;  2RM4 A;  3X26 B;  4BE1 A;  3BDL A;  4C92 A;  4BI8 B;  2P0P A;  1I5L A;  3I56 T;  3JB9 H;  4E7I A;  1M90 U;  2HAX A;  2KSS A;  5LJ5 d;  3A8M B;  3OS2 A;  3S3M A;  2BKD N;  3OSV A;  1NE8 A;  2RD1 A;  4FSX A;  4A4E A;  2DKG A;  3A5Z B;  1N6A A;  5LJ3 h;  1DJ7 B;  3CCL A;  4M77 A;  4N4H A;  2ZPH B;  5CQY A;  2HBP A;  3SWN C;  3OSS C;  4A4K A;  4J6W A;  1N8R U;  1G3S A;  3OMC A;  1VQP A;  4J6Y A;  4XTX A;  2L3R A;  5KE2 A;  4NS5 A;  1YHQ A;  5GAN e;  1K9M U;  4JLI A;  2GFA A;  2K4Y A;  2QQ9 A;  1UB4 A;  4C8Q E;  5GAO p;  4DQ2 A;  4A4H A;  3VV0 A;  3PIP A;  4BY6 B;  4ZGD B;  2RJE A;  3H8Z A;  3L2R A;  1KD1 C;  3G6E T;  3OYN A;  2PVD B;  5GMK j;  3OB9 A;  1VQN T;  3HL8 A;  5GAN g;  3JB9 J;  4J7I A;  4HT8 A;  1SSF A;  1VQ9 T;  4KUD K;  2PUK B;  3VU3 C;  3OYE A;  4BDZ A;  3EAE A;  2LX9 A;  2PVG B;  1Q86 C;  5J39 A;  3JCM f;  2YHT A;  1JB0 E;  2QQB A;  3C12 A;  1YJN T;  2F5K A;  1D3B A;  1M4Z A;  3G71 T;  2KAF A;  3UWN A;  5GAN 7;  3OY9 A;  2XG8 D;  2VXF A;  2EJ9 A;  1GXI E;  2DXB A;  4M7A G;  3WVD B;  4PJO E;  3CME T;  3JB9 I;  1LOJ A;  2E6N A;  2RJC A;  4M75 G;  4P5N A;  3M4G A;  2BUD A;  1K73 C;  1XOV A;  3DB4 A;  3OBY A;  2M0O A;  3CEY A;  3CCU T;  3OQ5 A;  4JLG A;  1ZQ1 A;  4M7D G;  1NJI C;  3A8L B;  1YJW T;  1QW1 A;  2DEQ A;  3PMI A;  1U1S A;  4IUU A;  4E7K A;  3JCM P;  3CD6 T;  2ZCF B;  2G3R A;  4OGE A;  2XKO C;  4C5I A;  3JCM e;  1W2B S;  1M1K U;  5CKH A;  4ZTF A;  2JVV A;  4M78 D;  2IVW A;  3ER0 A;  3NFC A;  2MMP A;  4UC4 A;  5GAM h;  4WF2 A;  4C0Z A;  3GIB A;  1M5Q 1;  1OYX A;  3E19 A;  2YRV A;  2QA4 A;  3OYI A;  4EMG A;  3QII A;  4M7A D;  3LX7 A;  4CI0 C;  3GOX A;  4V2S A;  3I56 A;  3DLM A;  4M75 D;  2KQW A;  1K9M C;  3ME9 A;  2ZPI B;  1HK9 A;  1VQ5 A;  5FRN A;  3QXE B;  5CCA A;  3HRT A;  4N0A A;  5GAM j;  2LCL A;  1U1T A;  4X34 A;  1VQ4 T;  2D6F A;  4B9X A;  1BI0 A;  2O01 E;  4E47 A;  2DXT A;  2RB6 A;  3M59 A;  1PSE A;  3VUB A;  1VQ6 A;  1G3T A;  1I81 A;  3CCE A;  4RKU E;  4C0F A;  4OB0 B;  5I2S A;  4J7F A;  4M77 G;  1RL2 A;  4IUP A;  3QBY A;  1KQ1 A;  2EKO A;  2EQK A;  1G3Y A;  1NZ9 A;  3E1S A;  4MZT A;  3CCL T;  2FL7 A;  1P92 A;  1NPR A;  2X4Y A;  4ZGE B;  1NPP A;  3HFN A;  2DK3 A;  4JRI A;  5LJ5 h;  1YHQ T;  1WQW A;  4FT2 A;  4EDU A;  4XTY A;  2PVO B;  3P8H A;  3OYD A;  3DB3 A;  1VQN A;  5EG2 A;  2LT1 A;  4C92 D;  1RI0 A;  4HCB A;  3OYG A;  2VXE A;  2L89 A;  3HHT B;  4FU6 A;  4PNO A;  4XTW A;  2HQX A;  4BB7 A;  5LJ5 j;  3OW2 S;  2Y4Y A;  3UT1 A;  1YJN A;  4M78 A;  4C8Q A;  3G71 A;  2OAU A;  1QVF A;  4MMK A;  5HK3 A;  1X01 A;  3EFS A;  4PJO B;  4DOV A;  2QEX T;  1BI1 A;  4M7A C;  5GMK e;  3JB9 G;  4RCC A;  2KDS A;  3SD4 A;  4M75 C;  3QYG B;  4PKC C;  2DJZ A;  1YJW A;  3CC7 A;  4BI3 A;  5GAO l;  4EMK A;  3PGG A;  2LVM A;  2RI2 A;  4J83 A;  4OB2 B;  3F70 A;  4HCZ A;  4TVR A;  3CMA T;  2DTI A;  4JS5 A;  3OYB A;  2LQ8 A;  3FEO A;  4M7D B;  4PJO A;  3QYH B;  5FU6 B;  1KQS S;  3OYH A;  2RO0 A;  4XAX B;  3FDR A;  2LRQ A;  3HSB A;  3OYJ A;  2K3Y A;  1BIB A;  2LC4 A;  5FRM A;  3CC2 A;  3X20 B;  4M7D F;  4XU3 A;  4B9W A;  3CBP A;  2R57 A;  1PSF A;  3QUI A;  4MDW A;  4X9C A;  2QA4 T;  4MML A;  5CAI A;  4OB3 B;  3V8J A;  4C92 C;  3OS0 A;  1QP2 A;  3MEU A;  5I21 A;  5GAN d;  3VJP A;  1YIT A;  5FLX E;  3JCM X;  5C0M A;  2WSF E;  4O6J A;  4BE0 A;  1VQ5 T;  2ZPF B;  1H64 1;  2ZPG B;  2CKK A;  1YIJ A;  4ATO A;  2ZPE B;  2VC8 A;  1VQ7 T;  3CXC A;  3CPW S;  3ZFJ A;  2DD5 A;  1VQ6 T;  4M77 C;  3PNW C;  1VIE A;  1BI3 A;  4IUT A;  5DLO A;  3JCM J;  3CCE T;  3C4S A;  3CCQ A;  3WVE B;  1VUB A;  3CCJ T;  4BDY A;  3JSC A;  3H6Z A;  2QQR A;  2RHX A;  3JCM V;  3SWN B;  1Q81 U;  1W4S A;  1JRI A;  2JN0 A;  2QQA A;  3MHX A;  5LJ3 j;  1N9R A;  3BY7 A;  3M55 A;  5GAO n;  3JCM W;  2Y90 A;  3M58 A;  4J6X A;  3RIR A;  3JCM b;  3P8D A;  2LQK A;  3M4Y A;  4M77 F;  2FVU A;  4ZN3 A;  2DTO A;  5CKD A;  2DXU A;  3I55 A;  1QVG S;  3T9N A;  4M78 G;  4C8Q G;  1BYM A;  2O4X B;  2RI5 A;  2QEX A;  3CCS T;  2D0Q B;  2K57 A;  5D6Y A;  1AHJ B;  3SWN A;  2CZ0 B;  2EIF A;  3BW1 A;  3OMG A;  4XQ3 A;  4LDY A;  1WQ7 A;  4F7U G;  3JCM d;  5HK0 A;  3MP1 A;  3QZ9 B;  4IUV A;  3OYL A;  2CGH A;  2E65 A;  4FT4 A;  2RHY A;  2QXF A;  4JRP A;  1XTD A;  2CZ1 B;  3LW5 E;  2PQW A;  1KC8 U;  5GMK i;  5GAO m;  3CBO A;  3QKJ A;  5J3B A;  2F5T X;  2V8J A;  3CBM A;  1KHI A;  4ZTJ A;  3CMA A;  3TU4 K;  4QVC A;  1UGQ B;  3C94 A;  3CC7 T;  5IT9 E;  3QDR B;  1QVF S;  3TEE A;  4N4I A;  4C0D C;  2M16 A;  2E64 A;  1IRE B;  2MAM A;  3CC4 A;  4EMH A;  4E7H A;  2RA2 A;  2NLU A;  2EWN A;  1M90 C;  2EQM A;  4D6W A;  4M7D E;  2DO3 A;  3M57 A;  1TH7 A;  3X24 B;  2EQU A;  4C8Q D;  5C6S A;  2DIG A;  3MEA A;  2XDD A;  5IAY A;  2QI2 A;  1IZ6 A;  3JCM Q;  3EFR A;  3OYA A;  2OTL A;  1ZBX A;  3FIF A;  4L6V 5;  4RG8 A;  4Z02 A;  2FYK A;  4MZM A;  3CC2 T;  4C5G A;  3JCM g;  2FHD A;  1N8R C;  2RHZ A;  4NL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...