5GMKe

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
65
Chain Sequence
VIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
total genus 8
structure length 65
sequence length 65
chains with identical sequence g
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmke00
4F7UB 4J5YA 4M77F 4XTVA 5LJ3h 5GAMj 4J6YA 4MMLA 5LJ3e 4PJOC 3JCMV 2DVEA 2DTHA 4C92A 2JN0A 2HNIA 4M7DA 4NOYA 4M77D 2FYKA 4C8QG 3QO3A 4PJOF 3QSUA 3JCMe 4M7DC 3BDUA 4HA8A 4QVDA 4PJOG 3INZA 5GMKj 5GMKl 3V8LA 1TH7A 2VXFA 2YHTA 4M75E 4M7DG 3HFOA 3V7SA 3QUIA 1WNLA 4EMKB 4C8QE 5GAN6 4EMGA 2EAYA 2EJGA 3JCMQ 1KQ1A 2E10A 4XTWA 5GAMg 2RA2A 5GMKe 2QTXA 4WF2A 4XU1A 4DQ2A 4PJOB 4JRKA 4M7AF 5GAMe 5GANg 2E65A 5LJ5f 2ZGWA 4QVCA 5GAN8 5GAN5 3JB9F 4EMKA 2DTIA 1B34B 4M77E 1WQ7A 2YLCA 4N0AC 5GAN2 5GAN4 4C8QB 5GAMd 2RM4A 5GAOq 5GMKi 3JB9G 1Y96A 4JLIA 4N0AA 4C92C 5LJ3j 1BIBA 5GAMh 3V7RA 4M7AD 2RD1A 3JCMW 3JCMJ 4A53A 2EWNA 4C92G 3HSBA 1B34A 1D3BB 2DXTA 3SWNA 4XQ3A 4C8QA 4F7UG 4EMHA 2E1HA 3FIFA 4F7UE 4PJOE 3BY7A 3JB9D 4XTXA 1BIAA 4M77G 4PJOA 4M78B 1Y96B 4M78G 1M8VA 2YLBA 3EFRA 3JB9J 4C8QC 3V7CA 3PGGA 2EJFA 5LJ3g 3FB9A 3FJPA 4RCBA 3GIBA 5GMKh 4M75F 2RB6A 4J6XA 4M78F 4C92B 4X9DA 4HT9A 4M7DD 5GANe 2DKGA 4C92E 3JCMf 1LJOA 5GANh 4V2SA 1N9SA 3BFMA 4M78A 4M75G 2DZ9A 3JB9H 4M7DE 1M5Q1 2I2LA 2FB7A 4M77C 5DY9A 5LJ3d 2VXEA 4M75D 5GANd 4RCCA 4EMKC 3RKWA 5GAOp 2E41A 2Y90A 3BW1A 1D3BA 2DEQA 4XTUA 4M78C 5LJ3f 3V8KA 3JCMX 3JCMd 3JB9I 4M7AE 4M78D 4M7DF 4PJOD 4XU2A 4J6WA 3RUXA 2DXUA 4C8QF 4M75A 1LNXA 1YCYA 5CAIA 3RERA 1WQWA 5GAOr 2DJZA 1I8FA 3HFNA 3QHSA 3JCMc 5LJ5j 4HT8A 2VC8A 2K57A 4M75C 3JCMg 5LJ5h 4M7AB 3SWNC 4M7AG 3L2ZA 4PNOA 3SB2A 5LJ5e 4NL3A 1U1SA 4M7DB 1WPYA 4XTZA 1U1TA 1JRIA 1X01A 4C92D 1JBMA 1LOJA 1I4K1 4M77A 5GAOm 1HK9A 2CGHA 5GAN7 4OP0A 3RESA 5GANj 3RIRA 5LJ5g 4M7AA 1N9RA 4A54A 4JUVA 2DZCA 1I81A 4MMKA 2E64A 4M78E 4C92F 5GAOn 5GAN3 4M75B 4NL2A 2EJ9A 3RKYA 3SWNB 4M7AC 1MGQA 5GAOl 4X9CA 3RKXA 5GMKm 4F7UA 5LJ5d 4Y91A 1H641 4XTYA 3JCMP 1HXDA 1I5LA 1KQ2A 4C8QD 3L1AA 3JCMh 4XU3A 3VU3C 5GAMf 3V8JA 5GANf 3AHUA 5I21A 4M77B 4F7UF 3JCMb 4XU0A 2DTOA 3M4GA 4JRIA 3EFSA
chains in the Genus database with same CATH superfamily
2WSCE 3QYHB 4KRTA 3OYYA 2LP5A 1XJWB 2DRKA 2Y4XA 2VWFA 1BI2A 3EGXB 2ABLA 2NUPB 2MWPA 1PRMC 3PFSA 5FU7B 5GMKl 3LGFA 3REBB 2X35A 1TH7A 3LWHA 1VUBA 3QUIA 1ZLMA 1WGSA 2RQRA 1SRLA 2D9TA 3HL8A 3HRUA 3QWXX 4JRPA 4JLGA 2LRQA 3OS2A 2YLCA 1JEGA 3CCVT 2HBWA 2EGEA 1RI9A 4AT1B 1WHHA 2CDTA 1BIBA 4D8KA 1W4SA 4OMMA 3JCMJ 1B34A 1D3BB 3DKMA 2MIOA 2F5KA 1G3WA 3FJPA 4LDWA 3ZL7C 1IRXA 4L59A 4R0KA 1JJ2P 1YHQQ 1Z9ZA 1ZSZA 4II1A 3OSSC 2VXEA 1ZBXA 4JS4A 1FMVA 3JB9I 4PLIA 1YHQA 2X4YA 4DBRA 3EG9B 3KFVA 3FLGA 2KBTA 2LC4A 3T9NA 4LN2A 4QQGA 2QI2A 1MNEA 4FT2A 3OYFA 3SB2A 2FHDA 5CIUA 1D1BA 1X01A 1FX7A 4RG2A 3NTIA 2M1HA 2PU9B 1D1CA 1Z9QA 2XD0A 1QCOA 2DYIA 3H8ZA 1OYXA 2RK1A 3G6ET 1I5LA 2FVUA 1TTHB 4AFUC 2HZYA 3R6NA 2HQXA 1IHVA 3EG2A 2RHZA 3G1JA 3OYAA 3PIOA 2NUTB 2HSEB 1Q81U 2IG0A 2DILA 2QEXT 4HVUA 1KSWA 4M7DA 1V29B 2HQEA 2A08A 1Q86R 1K4US 4LNPA 2ED0A 1U06A 1VQ4Q 2QGFB 1N8RU 3FJ5A 3VJPA 2L8DA 1VQ9Q 3CCUA 3CCET 2ZPEB 4C0DB 4CC3A 3JCMQ 1KK7A 4XU1A 2CUDA 2XIDA 1PD1A 1ARKA 1ZUUA 5GAN8 3HRTA 4M7DE 4E7ZA 3QYGB 2MWOA 2DD4A 3VS1A 3VS4A 3TCJA 3TU4K 3CEYA 1K76A 3A8LB 4CRIA 3LWIA 2D0NA 3FDRA 4BE1A 1FMWA 1NLOC 4PJOA 2KMTA 4PFPA 2H3JA 4J7FA 1KQSS 5LJ3g 1VQ4A 1M1GA 1A0NB 3OMGA 2SRCA 2JOYA 3BW1A 2DEQA 2AZSA 3O8VA 3JCMX 3CCVA 1WQWA 1O75A 4BD3A 2RMOA 2ZPFB 4PNOA 1S72A 1R8OB 4AFSC 2O2OA 5KYNA 1K9MC 3DLLA 3MP1A 2A36A 4RMOA 1VQKA 4FYWB 3CCRQ 5IXBA 5D6WA 4M7AC 5CKHA 1VIFA 1M30A 2XKOC 3RBBB 2RJEA 3ULRB 1KQ2A 3NGPA 2NUZA 1QW1A 2FRYA 4PJLA 1KD1R 2QASA 1TSFA 4FSSA 3CCQQ 3E9GA 3I35A 2DVEA 2EYQA 1VQMA 4J9GA 1NBEB 4QT7A 5GMKj 3NMZC 3DB3A 2F2XA 2YHTA 5HY6A 3VS3A 3HPWA 1IZ6A 1I5OB 1YI2A 1PKSA 3S3MA 1YI2T 2I0NA 1N8RC 3JB9F 1GFDA 3FRNA 2IIMA 4B9XA 3JB9G 1SKUB 2HSPA 1YP5A 4E7SA 2RF0A 1IREB 1GCPA 1X2KA 4CC7A 3QJ6A 2QA4Q 3DB4A 4RTYA 3BY7A 1ZSZB 2ZAEA 3AT1B 3SHWA 3CC2Q 3FB9A 3GIBA 1K1ZA 3G4SQ 4M77C 5I22A 5L23A 4XTUA 4ZGEB 4M7DF 2M51A 3RERA 1S72T 2X3WD 1YJWT 2DEUA 2DF6A 3MEUA 2BKDN 3C94A 5HKCA 1QCNA 2RQTA 3HHTB 3C4SA 4HVWA 2D8JA 1TUCA 2RHUA 1M2OA 1VYVA 2FZKB 2E12A 3VS2A 4A4EA 3QKJA 1VQ6Q 4IUTA 2DL7A 1RAAB 2HL5C 2X3XD 3KXTA 1W70A 2EJ9A 3CMAA 2RJDA 1RAFB 2KQWA 3CMEA 1HXDA 4JRQA 1YIJT 4HXJA 3FEOA 3URGA 3JCMh 4XU3A 3WVDB 4F7UF 1UHFA 4JRIA 4HKEA 1X27A 2DAQA 2QEXQ 2E5KA 2QQAA 4BE2A 2FZGB 3MKDA 1BB9A 1JJ2A 4FM4B 4HA8A 7AT1B 1YJWQ 2PTKA 2W0ZA 1OV3A 3V7SA 2KT8A 3A98A 5GMKe 1G3SA 4JRKA 2EQIA 2DFUA 3RMQA 1VQ9T 2XI9A 1BU1A 5GAN2 4C0ZA 1JXOA 2DA9A 2DJQA 2YDLA 3A5ZB 4P5NA 2FRWA 4ZGJB 4FYVB 2RD1A 2E6ZA 1Q81R 3META 3VUBA 1WLPB 2M9UA 1PSEA 1RAEB 3EFRA 3WVEB 4F17A 4HT9A 3PVQA 2CZ7B 1Q86C 2HKQB 1D1AA 3ZFJA 2QG9B 3MP6A 1ZHIA 3F70A 3JCMd 1M4ZA 4M78D 5KE3A 2LCSA 2K3YA 2KGTA 2LNHB 3CQTA 2ZCFB 5IH2A 1NPRA 2ROLA 2AZVA 4L6V5 5LJ5h 4M7AB 3EG3A 3G6EQ 3RDVA 1VQ7Q 1Q82C 3SD4A 4XAXB 2PZ1A 5J3BA 3CMAQ 1KD1C 2ZPGB 3H0IA 2P4RA 4IIMA 2QQSA 4X9CA 1K73U 2X9HA 1BCMA 2R58A 2A37A 4Y91A 3JAME 1YFNA 1OPLA 5GAMf 2DL4A 2E6NA 1UG1A 3CMET 1AHJB 2BTTA 2A3LA 4F7UB 2K5IA 3M0PA 1AT1B 3A1PA 3HKSA 5KYYB 2V26A 2EYWA 5I11A 1K0SA 1RACB 3M5AA 4BY6C 4ZTFA 3QSUA 1HD3A 2EYXA 3JCMe 3BDUA 2BIVA 4QVDA 4M7DG 2CP5A 2OJ2A 2VVKA 2BZXA 1X6BA 3M4YA 5KH6A 5GAMg 2LQNA 1QCFA 3L2VA 1VQ4T 1UGQB 2CP2A 1C1AA 2AK5A 5DLQE 2X51A 3JCMW 2EYYA 1VQOT 4IUQA 1YI2Q 3HSBA 2WSEE 4XTXA 1V1CA 4C8QC 2FPFA 2J6KA 4OMPA 2EJFA 3M56A 4C92B 4LDYA 1BBZA 4L5GA 4M75D 4M7AE 5GAOp 4CC4B 2JNGA 1Q82U 1M1FA 1CSKA 2K5FA 2V8KA 3I55A 2XMFA 5LJ5j 5GAOr 3HFNA 3OA6A 2K57A 3JCMg 2EGCA 2RH2A 3LLRA 3CXCS 1U1SA 2A28A 3CD6T 1LOJA 4E7IA 2BZYA 3RIRA 1YJ9A 3CCRA 4M7AA 1GBQA 1ZA2B 2DL5A 3CCJQ 2F2VA 1Q86U 1VQLA 2LJ1A 5GAN3 4LD9K 1NYGA 4NL2A 1WDXA 4RTTA 4Z88A 5FLXE 4O6JA 4X1VA 2VGNA 1R0CB 4E47A 1O9SA 2YXYA 1VQOA 5EC7A 4QW2A 3VU3C 2JJ9A 4M77B 4N4HA 1YJNA 3CCVQ 3OW2P 4JZ3A 5IHNA 3CCMA 3LH5A 3SFMA 3ZBDA 1YITQ 3S6WA 2KR3A 3ZEHA 2YRVA 5KYXA 4LDUA 5EG2A 1ABQA 3INZA 4J8OA 2F5TX 2E70A 2QXFA 4CC2A 4C5IA 1H3HA 1X6GA 1ZA1B 1M9SA 1KQ1A 4MZMA 5CCAA 2KXDA 2LMJA 1BI3A 2GFAA 1TXQA 2E65A 2LX7A 3CMAT 1T0HA 1B34B 3QIIA 3UWNA 2AKLA 2RM4A 1NLPC 1SHGA 3SEMA 1VQPT 2OTLA 2CUBA 4UC4A 1VQ8T 1TU0B 1XNIA 2EQUA 2KNBB 5HCKA 5IN1A 4BB7A 3CCEQ 1ACMB 1BIAA 2EFIA 2YLBA 2L0AA 2B86A 2RB6A 4J6XA 1RADB 5GANe 3X28B 2KT1A 5LL6S 2IPOB 4GBQA 1M3BA 2KY9A 5IHKA 2QA4T 1OEBA 2FPDA 1BYMA 1ZQ1A 2EYZA 4LUEA 4WCIA 2L89A 2PNIA 5IAYA 2RHXA 2CS7A 5FWBA 2CP7A 3L2ZA 4Q5WA 5CKDA 2OTJQ 4BDYA 1Q7YC 2GCXA 1MMNA 4KGZB 4FW1A 2KYBA 1HYOA 2DZCA 4LD6A 1ZSZC 4XK8E 1AWJA 1VQ8Q 3RKYA 5GAOl 5GJWB 4R55A 1JJ2S 2LCLA 3M4GA 1MV0B 2BZ8A 3OW2S 1K73C 2RK2A 2XK0A 5LJ3h 4J9HA 3MCAB 3EFOA 2DTHA 2VUBA 1VA7A 2HNIA 1K8AR 1Y7XA 3QO3A 4PJOF 2GTOA 4OMFB 3QBYA 4PKCC 2YRDA 1KFZA 4PJOG 1QMCA 2LJ3A 4M75E 3TVTA 1OI1A 5GAN6 3GNFB 4N4GA 3QZ9B 1IGQA 3D7SB 1RL2A 1MMDA 1B3QA 1YWOA 3M55A 5A0GA 4DQ2A 3VV0A 3CD6Q 4EMKA 5GAN4 1VQ5T 1G3YA 1PD0A 3J80E 3NPFA 4QQDA 3I56A 5KCHA 2XDBA 1H3ZA 1FMKA 2EWNA 1W1FA 2MK5A 2LQKA 1M27C 1KC8C 3X26B 3UA6A 4M78G 1M8VA 3JB9J 2ECZA 4A4GA 4RCBA 2JM9A 2EIFA 4M78F 4YTLA 4JJCA 4LE9A 5DLOA 1LJOA 2ESWA 2MAMA 3PMTA 5LJ3d 2J06A 2Y90A 5KCOA 4LXCA 2HL3A 4JZ4A 2COYA 3KBGA 1U8RA 2DXUA 2O31A 2LNVA 1M8MA 3QHSA 1B07A 2LT1A 4FL6A 3CCST 2WSFE 1JB0E 2KK4A 1N27A 3H0HA 2K2VA 2X4XA 4J9CA 4OB3B 3G7ZA 1UUEA 5LJ5g 1DJ7B 4A54A 3GPLA 2QQ9A 1WHLA 2DL3A 4M75B 3SWNB 1G83A 1VQPQ 3A8OB 1RAHB 2D6FA 1QVFA 2QDLA 1BCOA 3OYGA 1SHFA 2PVGB 2DNUA 5GANf 2M02A 4DBHA 1QVFP 5KE2A 2YUPA 5GAMj 1TWBA 2CT3A 3EH1A 3CC4Q 4ORZA 3GLXA 2E3IA 4C92A 3L2RA 1Q7YR 3M57A 2CSQA 2M0YA 1YIJQ 4HCKA 1UGSB 5FRMA 3PTAA 4C8QE 1Q7YU 1SSHA 2E10A 1EIFA 4RTXA 1UTIA 3H0FA 2E5QA 3EAEA 4IURA 3NFCA 5GAN5 4RG8A 2NWMA 2CT4A 3VS7A 3GP8A 1BKBA 3I55T 4KBMB 4AG2C 1C0MA 2RJFA 3FC3A 3VRZA 4C8QA 2XICA 4LUDA 2VASA 2DYBA 2NUTA 1GL5A 1WJSA 1E6HA 2C06A 1NYFA 3CCLA 4F16A 2AKKA 4J9DA 2JTMA 1I07A 3X24B 2D8HA 5DY9A 1VQNA 2E41A 1XOVA 2DRMA 2W10A 1VYUA 1KG1A 3M0RA 1MMGA 2KYMA 4OB2B 3MEWA 5CQYA 2GF7A 4ESRA 2MMPA 3U23A 4DOVA 5GAOm 2C0IA 4MZTA 4RTUA 2GGRA 4ZN3A 1VQPA 4LDVA 1YBYA 2RO0A 5CQXA 2L3QA 4MMKA 2ZPIB 1MNDA 3CXCA 1D09B 5LJ5d 2OAWA 3ER0A 3OYDA 2QDYB 3OYNA 3JRZA 3CCQT 4JPBW 4Y92A 4HCCA 4PJOC 3MPUB 3REAB 4TVRA 1PG5B 4FU6A 1M1KC 1MHNA 2KRNA 1K9MU 1WI7A 4OMOA 5D6XA 1N6AA 2K7AA 3M59A 1MMAA 4BI3A 4KH0B 2EQJA 2KXCA 1ZUKA 5CKEA 2MF2A 4WTOB 5IHIA 4OMLA 1QP2A 3VS0A 3MO8A 1SRMA 4WF2A 2LQWA 3CCRT 1LPLA 1AD5A 2PUOB 2SEMA 2CZ6B 4Z8AA 3QJYA 5GAMe 4M77E 1WQ7A 3M0TA 2CREA 3MJXA 1Y96A 3CCUT 1YJ9T 4HCZA 4QKUA 3CC7A 4FW2A 4AMCA 1ABOA 3CD6A 3CC7T 3FIFA 2HDAA 3OB9A 3CPWS 4J83A 4VUBA 3OYMA 1WHJA 2KROA 4JJNK 2JMAA 1VQ6T 1QVGP 3E19A 2QQBA 4C92E 2R5AA 1KHIA 1RABB 2JS0A 4C5GA 2DZ9A 3OW2A 1IHWA 1GFCA 2I2LA 2KE9A 2RHIA 2GBQA 4OVAA 3RR6A 1UB4A 2F2WA 3I5RA 3VYHB 3UA7A 1XQHA 1LNXA 1IB8A 3JCMc 5M9OA 3CCLQ 4HT8A 2CSIA 4M75C 1W2BP 5LJ5e 3GF5A 3LX7A 1QLYA 3OS1A 3RESA 3OYLA 5GANj 1OZ3A 1Q81C 1I81A 1VQ8A 4BI4A 1X43A 1M90C 3E2UA 4J9BA 4F7UA 3CCSA 2O4XB 2OTJT 4XTYA 4RUGA 3G71T 1WZOA 2RPNA 2YSQA 3AHUA 4J9IA 1KQSA 2J6FA 5DM7R 3JCMb 3L2UA 4E7HA 3OS5A 1M90U 5FU6B 1P92A 2E3HA 4FSXA 2JN0A 1UHCA 4IIOA 4PFZA 5FWCA 1PRLC 2KDSA 1WJQA 1M3CA 4C0FA 2CP3A 3OYEA 3I56T 2EGAA 4QVZA 1S1NA 1WIEA 4A63B 2RN8A 2DMOA 1WHKA 2K4YA 4RKUE 2HAXA 1VQ7T 2DTIA 2KSSA 4RTWA 5GAMd 2F1LA 1WFWA 2EW3A 4N0AA 1G2BA 4KUIA 2QK0A 3SWNA 2CP6A 1BI0A 2AIRB 3M0UA 4HCBA 2Z0WA 4M77G 1LCKA 1Q95G 4BI8B 4GY5A 2YUOA 1Y57A 4ME7A 2JT4A 4M7DD 1WHMA 2HD0A 2Y4YA 3OSVA 1X69A 3G71Q 1VQNQ 4RCCA 2MCNA 1D3BA 1YITA 1JXMA 2JMCA 1WX6A 4J6WA 1QKWA 3JV3A 5I2MA 9ATCB 3VYGA 1GCQA 2VGMA 1SF9A 5KYUB 3HP9A 1VQ5Q 3A8HB 1YJNQ 2JZ2A 1UDLA 2R57A 3M54A 4O5VA 2DX1A 1TUDA 3OS0A 5FRNA 4OP0A 1M1KU 2K79A 5CKFA 1N9RA 5FROA 1RI0A 4PLLA 3VS5A 3CC4T 2E64A 2L3RA 4DBQA 3I56Q 3EGDA 1X75C 2G6FX 4X34A 3RNJA 1M1KR 1H641 2XDDA 2JXBA 4IUVA 3L1AA 2RNAA 4NL3A 4XU0A 2CH4A 4J5YA 1T3SA 3VKIA 4MMLA 3JCMV 2WACA 3OY9A 3UDCA 4AFZC 1NM7A 2JUFA 1OOTA 3HTRA 4M77D 3M9QA 1TOVA 5D6YA 1Y07A 2QTVA 1TUGB 1SG5A 3EGXA 3M53A 3MHXA 3NHNA 2DK3A 2RI2A 1V76A 2FO0A 2RA2A 1X6OA 4ANJA 2YRCA 2ZZDA 5J26A 5LJ5f 4QVCA 2JS2A 2XU8A 3C0CA 4C8QB 2CZ0B 1EX4A 1U3OA 5CO7A 2AHJB 1TS9A 2VB6A 3BE3A 4A53A 1X2QA 1Y71A 1OULA 2LJ0A 4DA4A 2OX7A 4XQ3A 2DM1A 4PJOE 1TG0A 2OTJA 2H3EB 3CPWA 1VQ5A 2EQKA 1AWXA 3CXCP 2CP0A 1YJNT 5GANh 1WXBA 3CC2T 3QXEB 3CCLT 2CH4W 2H8HA 3TEEA 1J3TA 4M78C 4J9FA 3CPWP 4PJOD 3EG1A 2PQWA 4JJDA 4M75A 5CAIA 1WYXA 3CBOA 1VQLT 4OGCA 4PJNA 2MYSA 2P0QA 1U1TA 1KHCA 4A4HA 2HBPA 1KC8R 1HK9A 2CGHA 3PNWC 3OQ5A 1GRIA 4E2FB 2O9SA 2KI7A 2BE7D 3H41A 4FYXB 8ATCB 2M0OA 1RLQC 3THKA 1RAGB 1N8RR 2LVMA 2K3XA 3EGDB 3G6EA 4OB0B 2V8IA 2MI6A 4XTVA 1OQKA 5LJ3e 4DBFA 4FT4A 1UJ0A 3OBWA 4LDXA 1QVGA 2FYKA 4C8QG 2K5LA 2JW4A 4IUUA 2HEQA 2FL7A 3M0QA 2C0OA 1YHQT 2GTJA 3ASKA 2J7IA 3HFOA 1Y0MA 1WNLA 4EMKB 3ME9A 1T0JA 1T3LA 1VQOQ 2QTXA 4QQ6A 1W6XA 2PUKB 2DD5A 1M90R 1R77A 1D0YA 4E7LA 3MP8A 2DBKA 5KYUA 5GMKi 3CCJA 3NTHA 2GQIA 1UFFA 4Z89A 4Z02A 2E1HA 4BDZA 1AEYA 1UGRB 3E1SA 4AFQC 4D6WA 1QP3A 4KGVB 2HKNA 4M75F 2A0FB 1K8AC 1NZ9A 3OYHA 4X9DA 1AWOA 1PHTA 3OYBA 1YJWA 2OTLT 3C95A 1SSFA 1N9SA 4M75G 3JB9H 5C6SA 1FWZA 4RTVA 2KVQG 3PMIA 3RKWA 4EMKC 3G71A 2DPPB 5LJ3f 1PM3A 2RI3A 1AVZC 4ATOA 1VOMA 3TREA 1WXUA 4AG1C 1D0ZA 1GBRA 4IKFA 5IT9E 1ZX6A 4M7DB 1PSFA 4EIKA 2DL8A 1I4K1 3GOXA 4Y28E 1M2VB 3CC7Q 1OU8A 3H9NA 4M78E 3S3OA 3QDFA 3C12A 5GMKm 4D8DA 2YT6A 1W2BS 2RQWA 1HSQA 3E9FA 2G3RA 1K0XA 3V8JA 1QVPA 1YCSB 3DLMA 2O01E 3NTKA 4OB1B 2BUDA 4F04B 2DXBA 4F14A 3L2QA 3VRYA 4NOYA 1IO6A 1C6VX 1K9AA 1OX8A 4E7JA 3G4ST 3BDLA 3UPUA 2D1XA 1ZBJA 3LYIA 4EMGA 2EAYA 2JTFA 4BY6B 4J9EA 4ELYC 4PJOB 1OZ2A 2DLPA 3TSWA 1N5ZA 2ZGWA 1WJRA 4EDUA 4N0AC 2HCKA 1QQJA 1W2BA 3OMCA 5GAOq 1Q82R 2E4HA 2M16A 4C0DC 2DIGA 3LGLA 4C92C 5A0LA 4PL6A 3UATA 4M7AD 4PFOA 1H8KA 1AOJA 3M0SA 2DXTA 1I1JA 1NEGA 3JB9D 2LQ8A 2QQRA 4M78B 1Y96B 5A0DA 2EVRA 1H92A 2HQHA 3EG0A 2IVWA 1PCXA 2GQVA 2P84A 4E7KA 1R0BG 2VYTA 1MUZA 2DETA 4KGXB 1VQMQ 1AWWA 2FB7A 4IUPA 2XG8D 1YNZA 2ZPHB 3V8KA 1U5SA 1UJYA 1M2VA 2GNCA 1E6GA 1VQKT 4C8QF 3CCQA 5CR2A 4MDXA 3M58A 3MEAA 1IGUA 2RJCA 2KRSA 1GXIE 2DO3A 4M77A 1QVFS 1YN8A 3RMSA 1PWTA 4JUVA 2F69A 2LX9A 1SEMA 1AZEA 4BACA 3RKXA 2KAFA 2YUQA 2QGGA 3QDRB 1MV3A 3S3NA 2JM8A 2DBMA 5ECAA 5KYXB 1S72Q 3OYJA 5CKBA 5I21A 5IXFA 3OYKA 4A4FA 4JJBA 2L3SA 4J6YA 4KH1B 2EPDA 4DEXA 1KC8U 2VV5A 5AT1B 1RAIB 3R6OA 4MZPA 2LT4A 3CC4A 3V8LA 1KIKA 1LVKA 1FXXA 3EHRA 5FW9A 3A8GB 5FU6C 4DEYA 2ATCB 2DVJA 3CCEA 2K6DA 4B9WA 5GANg 4PK4A 4ZNXA 1E7OA 3QZ5B 3P8BB 1G8XA 2VKNA 3KUFA 2L2PA 5CVIA 1KQSP 4JLIA 3PIPA 3SDZA 1ZUYA 4OMQA 1K9MR 2RI5A 1WHGA 1D0XA 4EMHA 1UGPB 2A7YA 4KULA 3V7CA 1BK2A 3CCUQ 4FYYB 3EHQA 3X25B 4CI0C 3JSCA 4M78A 5GANd 1F1BB 4ZN1A 3A8MB 3CCMQ 3RUXA 1I8FA 4ZGDB 2EKOA 2J05A 1NJIC 4M7AG 3CC2A 2EQMA 4RTZA 2B8AA 1G3TA 1WPYA 1UE9A 3CCSQ 3L2WA 1OPKA 2RQUA 5J39A 1G5VA 1JBMA 2QA4A 3GBQA 1NJIU 5GAN7 2O4XA 2YUNA 2L3PA 4DOWA 4OGEA 4C5HA 4C92F 3EFOB 2FEIA 2OAUA 1YJ9Q 4FCYA 3QG1A 1VYTA 2V1RA 1BI1A 3UT1A 4GLMA 4HVVA 2CKKA 1VIEA 4N4IA 3X20B 3H6ZA 1EZZB 1QVGS 3OYCA 5HK3A 3I55Q 1YIJA 4M77F 3TSZA 1XTDA 2ED1A 2JVVA 2NLUA 3N5BB 4FIBA 1NEBA 1KJWA 2COZA 1M3AA 1JO8A 2HMAA 1YWPA 2PVOB 3CBMA 3CCJT 2D0QB 1RUWA 2EJGA 4XTWA 2NUPA 2QYZA 2PVDB 3EG9A 4R56A 5KYWB 3UF4A 2FG0A 2DXCA 1QWEA 1B7TA 1VQ6A 5CK9A 5GAMh 1K8AU 2KEAA 1ZSGA 1VQKQ 3CPFA 3VS6A 4F7UG 4A4KA 4F7UE 3P8HA 2OI3A 5HK0A 2P4TA 2LTOA 3P8DA 3PGGA 1NE8A 4J7IA 1WXTA 3LW5E 2EKHA 4BE0A 4NS5A 6AT1B 3J7AF 4E6RA 3BFMA 1QKXA 4JDSA 4PJJA 3PE0A 3G4SA 1K73R 2GFUA 2RQVA 1QWFA 1CKAA 4GLKA 1YCYA 3IQLA 2DJZA 2DERA 1VQMT 4ZTJA 1EFNA 2VC8A 4OMNA 4C0GA 3SWNC 2LCCA 2R5MA 3MEVA 4JS5A 1OU9A 2JTEA 3L42A 4MDWA 4XTZA 2COWA 1JRIA 2K2MA 4C92D 2ZPBB 1JQQA 1UECA 4C5EA 2MOXA 2O88A 3I9QA 2X4JA 1MGQA 3CBPA 2ENMA 2C0TA 1I0CA 3HRSA 4KUDK 3JCMP 3GNGA 4OF1A 2NYSA 2LZ6B 1VQ7A 5C0MA 3QPHA 4C8QD 3EFSA 5GJVB 3PT9A 1NJIR 1NPPA 2BE9B 2L5QA 3WXMB 3O5ZA 3TQ7P 5KYWA 2CYZB 3OBYA 1FYNA 4M7DC 4ELZC 2VXFA 1PKTA 1OX9A 2J6OA 2EBPA 5KYYA 2FZCB 2V8JA 4M7AF 2DE0X 5A2QE 1VQLQ 1NG2A 5LJ3j 3V7RA 3CCMT 2DIQA 1SPKA 2ROTA 5FU7C 1HJDA 3LH0A 4C92G 4M4ZA 2AT1B 4B6MA 4K11A 8AT1B 1GCQC 3EH2A 3QWYA 5GMKh 3VUZA 1VQNT 2DKGA 3JCMf 4V2SA 3OYIA 4KT0E 1M5Q1 2K9GA 1UGVA 2RHYA 2XHCA 3EGUA 2QEXA 1PNJA 4BUGA 2CZ1B 2V1QA 4XU2A 1KD1U 2KRMA 2YWWA 2MPXC 3CMEQ 5D7UA 3I5SA 2OTLQ 1CKBA 4PJMA 2P0PA 4EPCA 2QAZA 5GAOn 1IXDA 1JU5C 3Q1JA 2O9VA 2LDMA 2XDPA 1PC0A 3J81E 1UEBA 5L8RE 1RLPC 1WA7A 1YITT 5AYFA 1VQ9A 2FPEA 2K3BA 2P0KA 5I2SA 2X4WA 2DTOA 1AZGB 3PVLA
chains in the Genus database with same CATH topology
4F7UB 2K5IA 3DLMA 2O01E 2WSCE 3NTKA 4OB1B 3QYHB 3HKSA 4HCCA 3OYYA 4PJOC 2BUDA 2DXBA 4TVRA 4BY6C 3M5AA 4FU6A 1MHNA 1M1KC 3L2QA 4NOYA 2Y4XA 1K9MU 4ZTFA 1BI2A 3QSUA 3JCMe 3BDUA 4E7JA 2BIVA 3G4ST 5D6XA 3BDLA 1N6AA 2MWPA 4QVDA 3UPUA 3PFSA 5FU7B 3M59A 5GMKl 3LGFA 2X35A 1TH7A 3LWHA 4BI3A 4M7DG 1VUBA 3LYIA 2EQJA 3QUIA 5CKEA 4EMGA 2EAYA 2MF2A 2JTFA 3M4YA 4BY6B 1WGSA 1QP2A 5KH6A 5GAMg 3MO8A 2D9TA 3HL8A 3HRUA 4WF2A 4ELYC 3CCRT 4PJOB 2PUOB 1OZ2A 2CZ6B 3QJYA 5GAMe 4JRPA 2ZGWA 4JLGA 1WJRA 4EDUA 2LRQA 4M77E 4N0AC 1WQ7A 2YLCA 3OS2A 3L2VA 1W2BA 3CCVT 1VQ4T 3OMCA 5GAOq 1UGQB 1Y96A 3CCUT 2M16A 4C0DC 2DIGA 1BIBA 3LGLA 4HCZA 4C92C 5A0LA 4PL6A 1W4SA 5DLQE 3CC7A 4M7AD 3JCMW 3JCMJ 1VQOT 4IUQA 3HSBA 1B34A 1D3BB 2DXTA 3CD6A 3CC7T 3FIFA 2WSEE 3JB9D 4XTXA 2LQ8A 3DKMA 3OB9A 2QQRA 4J83A 4M78B 1Y96B 3CPWS 2F5KA 1G3WA 4VUBA 5A0DA 4C8QC 3OYMA 2EJFA 3FJPA 4LDWA 2IVWA 4JJNK 4L59A 3M56A 2GQVA 4E7KA 4C92B 1VQ6T 2VYTA 3E19A 2QQBA 4C92E 2R5AA 1KHIA 4II1A 4C5GA 2DZ9A 3OW2A 3OSSC 4LDYA 2I2LA 2FB7A 2RHIA 4L5GA 2VXEA 1ZBXA 4IUPA 2XG8D 4M75D 5GAOp 4JS4A 2ZPHB 4M7AE 3JB9I 4PLIA 4OVAA 3V8KA 2JNGA 1YHQA 1UB4A 2X4YA 1Q82U 3VYHB 1M1FA 1VQKT 1XQHA 2K5FA 3FLGA 4C8QF 1LNXA 3CCQA 2V8KA 5CR2A 3I55A 5GAOr 3JCMc 5LJ5j 3HFNA 3M58A 2LC4A 3T9NA 5M9OA 3OA6A 4HT8A 4MDXA 2K57A 3MEAA 4M75C 4QQGA 3JCMg 4HT9A 2QI2A 4FT2A 3OYFA 2RH2A 3SB2A 5LJ5e 2FHDA 3GF5A 3LLRA 5CIUA 2RJCA 3CXCS 1U1SA 1GXIE 2DO3A 1X01A 3LX7A 3CD6T 1FX7A 4RG2A 1LOJA 4M77A 3OS1A 1QVFS 3RMSA 3NTIA 4E7IA 3RESA 3OYLA 5GANj 3RIRA 1YJ9A 2M1HA 1OZ3A 3CCRA 4JUVA 1Q81C 2F69A 1I81A 2LX9A 4M7AA 1VQ8A 1Q86U 1VQLA 5GAN3 4LD9K 4BI4A 4NL2A 1M90C 5FLXE 4BACA 4O6JA 2PU9B 3RKXA 2KAFA 2VGNA 3QDRB 4F7UA 2XD0A 3CCSA 2O4XB 3H8ZA 4XTYA 3S3NA 1OYXA 2OTJT 4E47A 2RK1A 3G6ET 1I5LA 3G71T 1O9SA 2FVUA 1VQOA 3VU3C 4QW2A 3OYJA 3AHUA 5CKBA 5I21A 4M77B 4N4HA 2HQXA 5DM7R 1KQSA 3JCMb 1YJNA 3OYKA 2RHZA 3L2UA 4E7HA 3OS5A 4A4FA 3OYAA 3PIOA 5FU6B 1M90U 1P92A 4J6YA 1KC8U 3CCMA 2VV5A 3SFMA 3ZBDA 1Q81U 2IG0A 2QEXT 3R6OA 2JN0A 4FSXA 4M7DA 1V29B 2HQEA 3S6WA 2KDSA 3ZEHA 1WJQA 2YRVA 4MZPA 2LT4A 4C0FA 4LDUA 5EG2A 3OYEA 3CC4A 3INZA 4J8OA 1N8RU 3V8LA 2F5TX 3I56T 2E70A 2L8DA 2QXFA 3VJPA 3CCUA 1FXXA 4QVZA 4C5IA 3CCET 2ZPEB 4C0DB 3JCMQ 1M9SA 1KQ1A 4MZMA 5CCAA 3A8GB 5FU6C 4XU1A 2XIDA 3CCEA 1BI3A 2GFAA 2K4YA 4RKUE 4B9WA 5GANg 2E65A 2HAXA 5GAN8 3HRTA 1VQ7T 3CMAT 2DTIA 1B34B 2KSSA 3P8BB 3QIIA 3QYGB 3QZ5B 3UWNA 4M7DE 5GAMd 2MWOA 2RM4A 3KUFA 5CVIA 2DD4A 4JLIA 4N0AA 3PIPA 1VQPT 2OTLA 3SDZA 4UC4A 3TCJA 3TU4K 4KUIA 3CEYA 3A8LB 4CRIA 1VQ8T 2RI5A 3LWIA 1XNIA 3SWNA 2EQUA 5IN1A 4EMHA 1BI0A 1UGPB 4BB7A 3FDRA 4HCBA 1BIAA 2EFIA 4M77G 4BE1A 4PJOA 2KMTA 2YLBA 2H3JA 2A7YA 4KULA 3V7CA 4BI8B 4GY5A 4J7FA 1KQSS 5LJ3g 1VQ4A 1M1GA 4ME7A 2RB6A 4J6XA 4M7DD 2HD0A 2Y4YA 3X25B 3OSVA 5GANe 3X28B 4CI0C 3JSCA 3OMGA 4M78A 5LL6S 2JOYA 5GANd 2KY9A 4RCCA 2QA4T 3BW1A 1D3BA 2DEQA 1YITA 1BYMA 3O8VA 3JCMX 1ZQ1A 4ZN1A 2L89A 3A8MB 4J6WA 3RUXA 3CCVA 5I2MA 5IAYA 1WQWA 2RHXA 1I8FA 2CS7A 3VYGA 4ZGDB 1O75A 2EKOA 4BD3A 1NJIC 2VGMA 2ZPFB 3HP9A 3A8HB 4M7AG 3L2ZA 4PNOA 3CC2A 2EQMA 4Q5WA 2B8AA 2JZ2A 5CKDA 1G3TA 2R57A 3M54A 1S72A 1R8OB 1WPYA 4O5VA 3L2WA 4BDYA 1Q7YC 5J39A 1G5VA 1JBMA 2QA4A 2GCXA 1NJIU 1K9MC 3OS0A 5GAN7 3DLLA 4OP0A 5FRNA 3MP1A 1M1KU 2O4XA 5CKFA 1N9RA 5FROA 1RI0A 2DZCA 4PLLA 4RMOA 1VQKA 3CC4T 4DOWA 2E64A 2L3RA 4LD6A 4OGEA 4C5HA 4XK8E 4C92F 5D6WA 3RKYA 4M7AC 1X75C 1VIFA 5CKHA 5GAOl 4X34A 2OAUA 2XKOC 3QG1A 2RJEA 1H641 4R55A 2XDDA 1BI1A 3UT1A 1KQ2A 4IUVA 3L1AA 2CKKA 1VIEA 4N4IA 3X20B 3H6ZA 1QW1A 1QVGS 1JJ2S 3OYCA 2LCLA 5HK3A 4NL3A 4XU0A 1YIJA 3M4GA 3OW2S 1K73C 4J5YA 2RK2A 2XK0A 4M77F 5LJ3h 3VKIA 4MMLA 1XTDA 3JCMV 3MCAB 2WACA 3E9GA 3OY9A 2DVEA 3UDCA 2DTHA 2JVVA 2EYQA 2VUBA 2JUFA 2HNIA 4M77D 1Y7XA 2NLUA 3QO3A 4PJOF 3M9QA 3N5BB 1YJ9T 4FIBA 4OMFB 1VQMA 3QBYA 4PKCC 4PJOG 5D6YA 1Y07A 5GMKj 2PVOB 3CBMA 3DB3A 2YHTA 4M75E 5HY6A 3CCJT 3HPWA 1OI1A 5GAN6 3GNFB 1IZ6A 2D0QB 2EJGA 3M53A 3MHXA 4N4GA 3QZ9B 1RL2A 2DK3A 4XTWA 2RI2A 2RA2A 3M55A 1YI2A 5A0GA 1X6OA 4DQ2A 3VV0A 2ZZDA 2PVDB 5J26A 5LJ5f 4QVCA 3S3MA 4R56A 1YI2T 1N8RC 2XU8A 4EMKA 5GAN4 3JB9F 1VQ5T 1G3YA 4C8QB 3J80E 2DXCA 3FRNA 2CZ0B 4QQDA 4B9XA 3I56A 5KCHA 1VQ6A 5CK9A 5GAMh 3JB9G 1K8AU 5CO7A 2XDBA 2AHJB 1H3ZA 1IREB 3CPFA 4A53A 2EWNA 4DA4A 1Y71A 2LQKA 3QJ6A 4XQ3A 4A4KA 3DB4A 4F7UG 3P8HA 4F7UE 1KC8C 3BY7A 4PJOE 3X26B 5HK0A 4M78G 2OTJA 1M8VA 2P4TA 3JB9J 2LTOA 3P8DA 3PGGA 3CPWA 4A4GA 1NE8A 4J7IA 1VQ5A 3FB9A 4RCBA 3GIBA 2EQKA 3LW5E 2EIFA 4M78F 4YTLA 4BE0A 4NS5A 5DLOA 3J7AF 1YJNT 1LJOA 5GANh 3CC2T 3BFMA 3QXEB 4JDSA 3CCLT 2MAMA 3PMTA 4M77C 3G4SA 5LJ3d 3TEEA 2GFUA 2Y90A 5KCOA 4XTUA 4M78C 4ZGEB 4M7DF 4GLKA 3KBGA 4PJOD 1U8RA 2DXUA 2PQWA 1YCYA 4M75A 2LNVA 5CAIA 3RERA 3CBOA 2DJZA 3QHSA 1VQLT 1VQMT 4OGCA 4ZTJA 1S72T 2VC8A 2LT1A 4C0GA 1YJWT 3SWNC 2LCCA 2R5MA 3MEVA 4JS5A 2P0QA 4FL6A 3MEUA 3L42A 2BKDN 3C94A 2WSFE 4MDWA 5HKCA 3CCST 1JB0E 2KK4A 3HHTB 1N27A 1JRIA 1U1TA 1KHCA 3C4SA 4XTZA 4C92D 2K2VA 4A4HA 2RHUA 2HBPA 2ZPBB 1HK9A 2CGHA 2X4XA 3PNWC 2E12A 1QVPA 3QKJA 3OQ5A 3G7ZA 4IUTA 4OB3B 4A4EA 1DJ7B 4C5EA 5LJ5g 4A54A 3GPLA 2QQ9A 3KXTA 2M0OA 4M75B 2EJ9A 3CMAA 2X4JA 3SWNB 1MGQA 2RJDA 3CBPA 2KQWA 3A8OB 2D6FA 3HRSA 4KUDK 3JCMP 1QVFA 3CMEA 1HXDA 2LVMA 4JRQA 1YIJT 2K3XA 3GNGA 3OYGA 4OF1A 3FEOA 3URGA 2PVGB 3JCMh 4XU3A 5GANf 3WVDB 1VQ7A 3G6EA 4F7UF 5KE2A 4OB0B 5C0MA 3QPHA 4JRIA 4HKEA 2V8IA 3EFSA 4C8QD 2MI6A 4XTVA 2DAQA 5GAMj 5LJ3e 3PT9A 4FT4A 2QQAA 3OBWA 4BE2A 3GLXA 1NPPA 4C92A 2L5QA 3WXMB 4LDXA 1QVGA 2FYKA 4C8QG 2K5LA 1JJ2A 3L2RA 2CYZB 4IUUA 3M57A 3OBYA 4FM4B 4M7DC 4HA8A 4ELZC 2FL7A 1YHQT 3ASKA 2VXFA 1UGSB 3JRZA 5FRMA 3HFOA 3V7SA 3PTAA 1WNLA 4EMKB 4C8QE 3ME9A 1Q7YU 3JB9H 2E10A 1EIFA 5GMKe 2QTXA 4QQ6A 2E5QA 1G3SA 2PUKB 2V8JA 4JRKA 4M7AF 2DD5A 3EAEA 3RMQA 4IURA 3NFCA 1VQ9T 2XI9A 5GAN5 4E7LA 4RG8A 5GAN2 5A2QE 3MP8A 4C0ZA 3GP8A 1BKBA 3I55T 4P5NA 3A5ZB 4KBMB 5GMKi 5LJ3j 3CCJA 2RJFA 3NTHA 3V7RA 4ZGJB 3CCMT 2RD1A 2DIQA 5FU7C 2E6ZA 3FC3A 3LH0A 4C92G 3META 4Z02A 4C8QA 2E1HA 4BDZA 3VUBA 2XICA 1UGRB 3E1SA 2M9UA 1PSEA 3EFRA 3WVEB 4D6WA 1QP3A 1WJSA 5GMKh 4M75F 1K8AC 3VUZA 2C06A 1NZ9A 3OYHA 4X9DA 3CCLA 1VQNT 2CZ7B 3OYBA 1Q86C 1YJWA 2DKGA 2OTLT 3JCMf 3C95A 4V2SA 1SSFA 1N9SA 3ZFJA 2JTMA 3MP6A 4M75G 4KT0E 3OYIA 1M5Q1 1ZHIA 1FWZA 3F70A 5DY9A 3X24B 5C6SA 1VQNA 2KVQG 3PMIA 3RKWA 4EMKC 2E41A 3JCMd 2DPPB 2RHYA 1XOVA 1M4ZA 2RI3A 2XHCA 5LJ3f 3G71A 2QEXA 4M78D 4BUGA 2CZ1B 4XU2A 5KE3A 1KD1U 4ATOA 2K3YA 3TREA 2ZCFB 1NPRA 1KG1A 4IKFA 4L6V5 4OB2B 5LJ5h 4M7AB 5IT9E 3MEWA 4M7DB 1PSFA 5CQYA 2GF7A 1Q82C 3SD4A 2MMPA 4DOVA 4XAXB 5GAOm 1I4K1 5J3BA 4MZTA 3GOXA 2P0PA 4ZN3A 4Y28E 1VQPA 1KD1C 2ZPGB 4LDVA 1YBYA 2RO0A 5CQXA 4MMKA 4EPCA 4M78E 2ZPIB 5GAOn 3S3OA 3CXCA 3Q1JA 3C12A 2QQSA 4X9CA 1K73U 5GMKm 2LDMA 2XDPA 2R58A 1W2BS 5LJ5d 3E9FA 4Y91A 3JAME 1UEBA 3J81E 5L8RE 2G3RA 1YITT 3ER0A 5GAMf 5AYFA 3OYDA 2E6NA 3V8JA 1VQ9A 2QDYB 3OYNA 2P0KA 5I2SA 3CMET 2X4WA 1AHJB 2DTOA 3CCQT 2A3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U B;  4J5Y A;  4M77 F;  4XTV A;  5LJ3 h;  5GAM j;  4J6Y A;  4MML A;  5LJ3 e;  4PJO C;  3JCM V;  2DVE A;  2DTH A;  4C92 A;  2JN0 A;  2HNI A;  4M7D A;  4NOY A;  4M77 D;  2FYK A;  4C8Q G;  3QO3 A;  4PJO F;  3QSU A;  3JCM e;  4M7D C;  3BDU A;  4HA8 A;  4QVD A;  4PJO G;  3INZ A;  5GMK j;  5GMK l;  3V8L A;  1TH7 A;  2VXF A;  2YHT A;  4M75 E;  4M7D G;  3HFO A;  3V7S A;  3QUI A;  1WNL A;  4EMK B;  4C8Q E;  5GAN 6;  4EMG A;  2EAY A;  2EJG A;  3JCM Q;  1KQ1 A;  2E10 A;  4XTW A;  5GAM g;  2RA2 A;  5GMK e;  2QTX A;  4WF2 A;  4XU1 A;  4DQ2 A;  4PJO B;  4JRK A;  4M7A F;  5GAM e;  5GAN g;  2E65 A;  5LJ5 f;  2ZGW A;  4QVC A;  5GAN 8;  5GAN 5;  3JB9 F;  4EMK A;  2DTI A;  1B34 B;  4M77 E;  1WQ7 A;  2YLC A;  4N0A C;  5GAN 2;  5GAN 4;  4C8Q B;  5GAM d;  2RM4 A;  5GAO q;  5GMK i;  3JB9 G;  1Y96 A;  4JLI A;  4N0A A;  4C92 C;  5LJ3 j;  1BIB A;  5GAM h;  3V7R A;  4M7A D;  2RD1 A;  3JCM W;  3JCM J;  4A53 A;  2EWN A;  4C92 G;  3HSB A;  1B34 A;  1D3B B;  2DXT A;  3SWN A;  4XQ3 A;  4C8Q A;  4F7U G;  4EMH A;  2E1H A;  3FIF A;  4F7U E;  4PJO E;  3BY7 A;  3JB9 D;  4XTX A;  1BIA A;  4M77 G;  4PJO A;  4M78 B;  1Y96 B;  4M78 G;  1M8V A;  2YLB A;  3EFR A;  3JB9 J;  4C8Q C;  3V7C A;  3PGG A;  2EJF A;  5LJ3 g;  3FB9 A;  3FJP A;  4RCB A;  3GIB A;  5GMK h;  4M75 F;  2RB6 A;  4J6X A;  4M78 F;  4C92 B;  4X9D A;  4HT9 A;  4M7D D;  5GAN e;  2DKG A;  4C92 E;  3JCM f;  1LJO A;  5GAN h;  4V2S A;  1N9S A;  3BFM A;  4M78 A;  4M75 G;  2DZ9 A;  3JB9 H;  4M7D E;  1M5Q 1;  2I2L A;  2FB7 A;  4M77 C;  5DY9 A;  5LJ3 d;  2VXE A;  4M75 D;  5GAN d;  4RCC A;  4EMK C;  3RKW A;  5GAO p;  2E41 A;  2Y90 A;  3BW1 A;  1D3B A;  2DEQ A;  4XTU A;  4M78 C;  5LJ3 f;  3V8K A;  3JCM X;  3JCM d;  3JB9 I;  4M7A E;  4M78 D;  4M7D F;  4PJO D;  4XU2 A;  4J6W A;  3RUX A;  2DXU A;  4C8Q F;  4M75 A;  1LNX A;  1YCY A;  5CAI A;  3RER A;  1WQW A;  5GAO r;  2DJZ A;  1I8F A;  3HFN A;  3QHS A;  3JCM c;  5LJ5 j;  4HT8 A;  2VC8 A;  2K57 A;  4M75 C;  3JCM g;  5LJ5 h;  4M7A B;  3SWN C;  4M7A G;  3L2Z A;  4PNO A;  3SB2 A;  5LJ5 e;  4NL3 A;  1U1S A;  4M7D B;  1WPY A;  4XTZ A;  1U1T A;  1JRI A;  1X01 A;  4C92 D;  1JBM A;  1LOJ A;  1I4K 1;  4M77 A;  5GAO m;  1HK9 A;  2CGH A;  5GAN 7;  4OP0 A;  3RES A;  5GAN j;  3RIR A;  5LJ5 g;  4M7A A;  1N9R A;  4A54 A;  4JUV A;  2DZC A;  1I81 A;  4MMK A;  2E64 A;  4M78 E;  4C92 F;  5GAO n;  5GAN 3;  4M75 B;  4NL2 A;  2EJ9 A;  3RKY A;  3SWN B;  4M7A C;  1MGQ A;  5GAO l;  4X9C A;  3RKX A;  5GMK m;  4F7U A;  5LJ5 d;  4Y91 A;  1H64 1;  4XTY A;  3JCM P;  1HXD A;  1I5L A;  1KQ2 A;  4C8Q D;  3L1A A;  3JCM h;  4XU3 A;  3VU3 C;  5GAM f;  3V8J A;  5GAN f;  3AHU A;  5I21 A;  4M77 B;  4F7U F;  3JCM b;  4XU0 A;  2DTO A;  3M4G A;  4JRI A;  3EFS A; 
#chains in the Genus database with same CATH topology
 2WSC E;  3QYH B;  4KRT A;  3OYY A;  2LP5 A;  1XJW B;  2DRK A;  2Y4X A;  2VWF A;  1BI2 A;  3EGX B;  2ABL A;  2NUP B;  2MWP A;  1PRM C;  3PFS A;  5FU7 B;  5GMK l;  3LGF A;  3REB B;  2X35 A;  1TH7 A;  3LWH A;  1VUB A;  3QUI A;  1ZLM A;  1WGS A;  2RQR A;  1SRL A;  2D9T A;  3HL8 A;  3HRU A;  3QWX X;  4JRP A;  4JLG A;  2LRQ A;  3OS2 A;  2YLC A;  1JEG A;  3CCV T;  2HBW A;  2EGE A;  1RI9 A;  4AT1 B;  1WHH A;  2CDT A;  1BIB A;  4D8K A;  1W4S A;  4OMM A;  3JCM J;  1B34 A;  1D3B B;  3DKM A;  2MIO A;  2F5K A;  1G3W A;  3FJP A;  4LDW A;  3ZL7 C;  1IRX A;  4L59 A;  4R0K A;  1JJ2 P;  1YHQ Q;  1Z9Z A;  1ZSZ A;  4II1 A;  3OSS C;  2VXE A;  1ZBX A;  4JS4 A;  1FMV A;  3JB9 I;  4PLI A;  1YHQ A;  2X4Y A;  4DBR A;  3EG9 B;  3KFV A;  3FLG A;  2KBT A;  2LC4 A;  3T9N A;  4LN2 A;  4QQG A;  2QI2 A;  1MNE A;  4FT2 A;  3OYF A;  3SB2 A;  2FHD A;  5CIU A;  1D1B A;  1X01 A;  1FX7 A;  4RG2 A;  3NTI A;  2M1H A;  2PU9 B;  1D1C A;  1Z9Q A;  2XD0 A;  1QCO A;  2DYI A;  3H8Z A;  1OYX A;  2RK1 A;  3G6E T;  1I5L A;  2FVU A;  1TTH B;  4AFU C;  2HZY A;  3R6N A;  2HQX A;  1IHV A;  3EG2 A;  2RHZ A;  3G1J A;  3OYA A;  3PIO A;  2NUT B;  2HSE B;  1Q81 U;  2IG0 A;  2DIL A;  2QEX T;  4HVU A;  1KSW A;  4M7D A;  1V29 B;  2HQE A;  2A08 A;  1Q86 R;  1K4U S;  4LNP A;  2ED0 A;  1U06 A;  1VQ4 Q;  2QGF B;  1N8R U;  3FJ5 A;  3VJP A;  2L8D A;  1VQ9 Q;  3CCU A;  3CCE T;  2ZPE B;  4C0D B;  4CC3 A;  3JCM Q;  1KK7 A;  4XU1 A;  2CUD A;  2XID A;  1PD1 A;  1ARK A;  1ZUU A;  5GAN 8;  3HRT A;  4M7D E;  4E7Z A;  3QYG B;  2MWO A;  2DD4 A;  3VS1 A;  3VS4 A;  3TCJ A;  3TU4 K;  3CEY A;  1K76 A;  3A8L B;  4CRI A;  3LWI A;  2D0N A;  3FDR A;  4BE1 A;  1FMW A;  1NLO C;  4PJO A;  2KMT A;  4PFP A;  2H3J A;  4J7F A;  1KQS S;  5LJ3 g;  1VQ4 A;  1M1G A;  1A0N B;  3OMG A;  2SRC A;  2JOY A;  3BW1 A;  2DEQ A;  2AZS A;  3O8V A;  3JCM X;  3CCV A;  1WQW A;  1O75 A;  4BD3 A;  2RMO A;  2ZPF B;  4PNO A;  1S72 A;  1R8O B;  4AFS C;  2O2O A;  5KYN A;  1K9M C;  3DLL A;  3MP1 A;  2A36 A;  4RMO A;  1VQK A;  4FYW B;  3CCR Q;  5IXB A;  5D6W A;  4M7A C;  5CKH A;  1VIF A;  1M30 A;  2XKO C;  3RBB B;  2RJE A;  3ULR B;  1KQ2 A;  3NGP A;  2NUZ A;  1QW1 A;  2FRY A;  4PJL A;  1KD1 R;  2QAS A;  1TSF A;  4FSS A;  3CCQ Q;  3E9G A;  3I35 A;  2DVE A;  2EYQ A;  1VQM A;  4J9G A;  1NBE B;  4QT7 A;  5GMK j;  3NMZ C;  3DB3 A;  2F2X A;  2YHT A;  5HY6 A;  3VS3 A;  3HPW A;  1IZ6 A;  1I5O B;  1YI2 A;  1PKS A;  3S3M A;  1YI2 T;  2I0N A;  1N8R C;  3JB9 F;  1GFD A;  3FRN A;  2IIM A;  4B9X A;  3JB9 G;  1SKU B;  2HSP A;  1YP5 A;  4E7S A;  2RF0 A;  1IRE B;  1GCP A;  1X2K A;  4CC7 A;  3QJ6 A;  2QA4 Q;  3DB4 A;  4RTY A;  3BY7 A;  1ZSZ B;  2ZAE A;  3AT1 B;  3SHW A;  3CC2 Q;  3FB9 A;  3GIB A;  1K1Z A;  3G4S Q;  4M77 C;  5I22 A;  5L23 A;  4XTU A;  4ZGE B;  4M7D F;  2M51 A;  3RER A;  1S72 T;  2X3W D;  1YJW T;  2DEU A;  2DF6 A;  3MEU A;  2BKD N;  3C94 A;  5HKC A;  1QCN A;  2RQT A;  3HHT B;  3C4S A;  4HVW A;  2D8J A;  1TUC A;  2RHU A;  1M2O A;  1VYV A;  2FZK B;  2E12 A;  3VS2 A;  4A4E A;  3QKJ A;  1VQ6 Q;  4IUT A;  2DL7 A;  1RAA B;  2HL5 C;  2X3X D;  3KXT A;  1W70 A;  2EJ9 A;  3CMA A;  2RJD A;  1RAF B;  2KQW A;  3CME A;  1HXD A;  4JRQ A;  1YIJ T;  4HXJ A;  3FEO A;  3URG A;  3JCM h;  4XU3 A;  3WVD B;  4F7U F;  1UHF A;  4JRI A;  4HKE A;  1X27 A;  2DAQ A;  2QEX Q;  2E5K A;  2QQA A;  4BE2 A;  2FZG B;  3MKD A;  1BB9 A;  1JJ2 A;  4FM4 B;  4HA8 A;  7AT1 B;  1YJW Q;  2PTK A;  2W0Z A;  1OV3 A;  3V7S A;  2KT8 A;  3A98 A;  5GMK e;  1G3S A;  4JRK A;  2EQI A;  2DFU A;  3RMQ A;  1VQ9 T;  2XI9 A;  1BU1 A;  5GAN 2;  4C0Z A;  1JXO A;  2DA9 A;  2DJQ A;  2YDL A;  3A5Z B;  4P5N A;  2FRW A;  4ZGJ B;  4FYV B;  2RD1 A;  2E6Z A;  1Q81 R;  3MET A;  3VUB A;  1WLP B;  2M9U A;  1PSE A;  1RAE B;  3EFR A;  3WVE B;  4F17 A;  4HT9 A;  3PVQ A;  2CZ7 B;  1Q86 C;  2HKQ B;  1D1A A;  3ZFJ A;  2QG9 B;  3MP6 A;  1ZHI A;  3F70 A;  3JCM d;  1M4Z A;  4M78 D;  5KE3 A;  2LCS A;  2K3Y A;  2KGT A;  2LNH B;  3CQT A;  2ZCF B;  5IH2 A;  1NPR A;  2ROL A;  2AZV A;  4L6V 5;  5LJ5 h;  4M7A B;  3EG3 A;  3G6E Q;  3RDV A;  1VQ7 Q;  1Q82 C;  3SD4 A;  4XAX B;  2PZ1 A;  5J3B A;  3CMA Q;  1KD1 C;  2ZPG B;  3H0I A;  2P4R A;  4IIM A;  2QQS A;  4X9C A;  1K73 U;  2X9H A;  1BCM A;  2R58 A;  2A37 A;  4Y91 A;  3JAM E;  1YFN A;  1OPL A;  5GAM f;  2DL4 A;  2E6N A;  1UG1 A;  3CME T;  1AHJ B;  2BTT A;  2A3L A;  4F7U B;  2K5I A;  3M0P A;  1AT1 B;  3A1P A;  3HKS A;  5KYY B;  2V26 A;  2EYW A;  5I11 A;  1K0S A;  1RAC B;  3M5A A;  4BY6 C;  4ZTF A;  3QSU A;  1HD3 A;  2EYX A;  3JCM e;  3BDU A;  2BIV A;  4QVD A;  4M7D G;  2CP5 A;  2OJ2 A;  2VVK A;  2BZX A;  1X6B A;  3M4Y A;  5KH6 A;  5GAM g;  2LQN A;  1QCF A;  3L2V A;  1VQ4 T;  1UGQ B;  2CP2 A;  1C1A A;  2AK5 A;  5DLQ E;  2X51 A;  3JCM W;  2EYY A;  1VQO T;  4IUQ A;  1YI2 Q;  3HSB A;  2WSE E;  4XTX A;  1V1C A;  4C8Q C;  2FPF A;  2J6K A;  4OMP A;  2EJF A;  3M56 A;  4C92 B;  4LDY A;  1BBZ A;  4L5G A;  4M75 D;  4M7A E;  5GAO p;  4CC4 B;  2JNG A;  1Q82 U;  1M1F A;  1CSK A;  2K5F A;  2V8K A;  3I55 A;  2XMF A;  5LJ5 j;  5GAO r;  3HFN A;  3OA6 A;  2K57 A;  3JCM g;  2EGC A;  2RH2 A;  3LLR A;  3CXC S;  1U1S A;  2A28 A;  3CD6 T;  1LOJ A;  4E7I A;  2BZY A;  3RIR A;  1YJ9 A;  3CCR A;  4M7A A;  1GBQ A;  1ZA2 B;  2DL5 A;  3CCJ Q;  2F2V A;  1Q86 U;  1VQL A;  2LJ1 A;  5GAN 3;  4LD9 K;  1NYG A;  4NL2 A;  1WDX A;  4RTT A;  4Z88 A;  5FLX E;  4O6J A;  4X1V A;  2VGN A;  1R0C B;  4E47 A;  1O9S A;  2YXY A;  1VQO A;  5EC7 A;  4QW2 A;  3VU3 C;  2JJ9 A;  4M77 B;  4N4H A;  1YJN A;  3CCV Q;  3OW2 P;  4JZ3 A;  5IHN A;  3CCM A;  3LH5 A;  3SFM A;  3ZBD A;  1YIT Q;  3S6W A;  2KR3 A;  3ZEH A;  2YRV A;  5KYX A;  4LDU A;  5EG2 A;  1ABQ A;  3INZ A;  4J8O A;  2F5T X;  2E70 A;  2QXF A;  4CC2 A;  4C5I A;  1H3H A;  1X6G A;  1ZA1 B;  1M9S A;  1KQ1 A;  4MZM A;  5CCA A;  2KXD A;  2LMJ A;  1BI3 A;  2GFA A;  1TXQ A;  2E65 A;  2LX7 A;  3CMA T;  1T0H A;  1B34 B;  3QII A;  3UWN A;  2AKL A;  2RM4 A;  1NLP C;  1SHG A;  3SEM A;  1VQP T;  2OTL A;  2CUB A;  4UC4 A;  1VQ8 T;  1TU0 B;  1XNI A;  2EQU A;  2KNB B;  5HCK A;  5IN1 A;  4BB7 A;  3CCE Q;  1ACM B;  1BIA A;  2EFI A;  2YLB A;  2L0A A;  2B86 A;  2RB6 A;  4J6X A;  1RAD B;  5GAN e;  3X28 B;  2KT1 A;  5LL6 S;  2IPO B;  4GBQ A;  1M3B A;  2KY9 A;  5IHK A;  2QA4 T;  1OEB A;  2FPD A;  1BYM A;  1ZQ1 A;  2EYZ A;  4LUE A;  4WCI A;  2L89 A;  2PNI A;  5IAY A;  2RHX A;  2CS7 A;  5FWB A;  2CP7 A;  3L2Z A;  4Q5W A;  5CKD A;  2OTJ Q;  4BDY A;  1Q7Y C;  2GCX A;  1MMN A;  4KGZ B;  4FW1 A;  2KYB A;  1HYO A;  2DZC A;  4LD6 A;  1ZSZ C;  4XK8 E;  1AWJ A;  1VQ8 Q;  3RKY A;  5GAO l;  5GJW B;  4R55 A;  1JJ2 S;  2LCL A;  3M4G A;  1MV0 B;  2BZ8 A;  3OW2 S;  1K73 C;  2RK2 A;  2XK0 A;  5LJ3 h;  4J9H A;  3MCA B;  3EFO A;  2DTH A;  2VUB A;  1VA7 A;  2HNI A;  1K8A R;  1Y7X A;  3QO3 A;  4PJO F;  2GTO A;  4OMF B;  3QBY A;  4PKC C;  2YRD A;  1KFZ A;  4PJO G;  1QMC A;  2LJ3 A;  4M75 E;  3TVT A;  1OI1 A;  5GAN 6;  3GNF B;  4N4G A;  3QZ9 B;  1IGQ A;  3D7S B;  1RL2 A;  1MMD A;  1B3Q A;  1YWO A;  3M55 A;  5A0G A;  4DQ2 A;  3VV0 A;  3CD6 Q;  4EMK A;  5GAN 4;  1VQ5 T;  1G3Y A;  1PD0 A;  3J80 E;  3NPF A;  4QQD A;  3I56 A;  5KCH A;  2XDB A;  1H3Z A;  1FMK A;  2EWN A;  1W1F A;  2MK5 A;  2LQK A;  1M27 C;  1KC8 C;  3X26 B;  3UA6 A;  4M78 G;  1M8V A;  3JB9 J;  2ECZ A;  4A4G A;  4RCB A;  2JM9 A;  2EIF A;  4M78 F;  4YTL A;  4JJC A;  4LE9 A;  5DLO A;  1LJO A;  2ESW A;  2MAM A;  3PMT A;  5LJ3 d;  2J06 A;  2Y90 A;  5KCO A;  4LXC A;  2HL3 A;  4JZ4 A;  2COY A;  3KBG A;  1U8R A;  2DXU A;  2O31 A;  2LNV A;  1M8M A;  3QHS A;  1B07 A;  2LT1 A;  4FL6 A;  3CCS T;  2WSF E;  1JB0 E;  2KK4 A;  1N27 A;  3H0H A;  2K2V A;  2X4X A;  4J9C A;  4OB3 B;  3G7Z A;  1UUE A;  5LJ5 g;  1DJ7 B;  4A54 A;  3GPL A;  2QQ9 A;  1WHL A;  2DL3 A;  4M75 B;  3SWN B;  1G83 A;  1VQP Q;  3A8O B;  1RAH B;  2D6F A;  1QVF A;  2QDL A;  1BCO A;  3OYG A;  1SHF A;  2PVG B;  2DNU A;  5GAN f;  2M02 A;  4DBH A;  1QVF P;  5KE2 A;  2YUP A;  5GAM j;  1TWB A;  2CT3 A;  3EH1 A;  3CC4 Q;  4ORZ A;  3GLX A;  2E3I A;  4C92 A;  3L2R A;  1Q7Y R;  3M57 A;  2CSQ A;  2M0Y A;  1YIJ Q;  4HCK A;  1UGS B;  5FRM A;  3PTA A;  4C8Q E;  1Q7Y U;  1SSH A;  2E10 A;  1EIF A;  4RTX A;  1UTI A;  3H0F A;  2E5Q A;  3EAE A;  4IUR A;  3NFC A;  5GAN 5;  4RG8 A;  2NWM A;  2CT4 A;  3VS7 A;  3GP8 A;  1BKB A;  3I55 T;  4KBM B;  4AG2 C;  1C0M A;  2RJF A;  3FC3 A;  3VRZ A;  4C8Q A;  2XIC A;  4LUD A;  2VAS A;  2DYB A;  2NUT A;  1GL5 A;  1WJS A;  1E6H A;  2C06 A;  1NYF A;  3CCL A;  4F16 A;  2AKK A;  4J9D A;  2JTM A;  1I07 A;  3X24 B;  2D8H A;  5DY9 A;  1VQN A;  2E41 A;  1XOV A;  2DRM A;  2W10 A;  1VYU A;  1KG1 A;  3M0R A;  1MMG A;  2KYM A;  4OB2 B;  3MEW A;  5CQY A;  2GF7 A;  4ESR A;  2MMP A;  3U23 A;  4DOV A;  5GAO m;  2C0I A;  4MZT A;  4RTU A;  2GGR A;  4ZN3 A;  1VQP A;  4LDV A;  1YBY A;  2RO0 A;  5CQX A;  2L3Q A;  4MMK A;  2ZPI B;  1MND A;  3CXC A;  1D09 B;  5LJ5 d;  2OAW A;  3ER0 A;  3OYD A;  2QDY B;  3OYN A;  3JRZ A;  3CCQ T;  4JPB W;  4Y92 A;  4HCC A;  4PJO C;  3MPU B;  3REA B;  4TVR A;  1PG5 B;  4FU6 A;  1M1K C;  1MHN A;  2KRN A;  1K9M U;  1WI7 A;  4OMO A;  5D6X A;  1N6A A;  2K7A A;  3M59 A;  1MMA A;  4BI3 A;  4KH0 B;  2EQJ A;  2KXC A;  1ZUK A;  5CKE A;  2MF2 A;  4WTO B;  5IHI A;  4OML A;  1QP2 A;  3VS0 A;  3MO8 A;  1SRM A;  4WF2 A;  2LQW A;  3CCR T;  1LPL A;  1AD5 A;  2PUO B;  2SEM A;  2CZ6 B;  4Z8A A;  3QJY A;  5GAM e;  4M77 E;  1WQ7 A;  3M0T A;  2CRE A;  3MJX A;  1Y96 A;  3CCU T;  1YJ9 T;  4HCZ A;  4QKU A;  3CC7 A;  4FW2 A;  4AMC A;  1ABO A;  3CD6 A;  3CC7 T;  3FIF A;  2HDA A;  3OB9 A;  3CPW S;  4J83 A;  4VUB A;  3OYM A;  1WHJ A;  2KRO A;  4JJN K;  2JMA A;  1VQ6 T;  1QVG P;  3E19 A;  2QQB A;  4C92 E;  2R5A A;  1KHI A;  1RAB B;  2JS0 A;  4C5G A;  2DZ9 A;  3OW2 A;  1IHW A;  1GFC A;  2I2L A;  2KE9 A;  2RHI A;  2GBQ A;  4OVA A;  3RR6 A;  1UB4 A;  2F2W A;  3I5R A;  3VYH B;  3UA7 A;  1XQH A;  1LNX A;  1IB8 A;  3JCM c;  5M9O A;  3CCL Q;  4HT8 A;  2CSI A;  4M75 C;  1W2B P;  5LJ5 e;  3GF5 A;  3LX7 A;  1QLY A;  3OS1 A;  3RES A;  3OYL A;  5GAN j;  1OZ3 A;  1Q81 C;  1I81 A;  1VQ8 A;  4BI4 A;  1X43 A;  1M90 C;  3E2U A;  4J9B A;  4F7U A;  3CCS A;  2O4X B;  2OTJ T;  4XTY A;  4RUG A;  3G71 T;  1WZO A;  2RPN A;  2YSQ A;  3AHU A;  4J9I A;  1KQS A;  2J6F A;  5DM7 R;  3JCM b;  3L2U A;  4E7H A;  3OS5 A;  1M90 U;  5FU6 B;  1P92 A;  2E3H A;  4FSX A;  2JN0 A;  1UHC A;  4IIO A;  4PFZ A;  5FWC A;  1PRL C;  2KDS A;  1WJQ A;  1M3C A;  4C0F A;  2CP3 A;  3OYE A;  3I56 T;  2EGA A;  4QVZ A;  1S1N A;  1WIE A;  4A63 B;  2RN8 A;  2DMO A;  1WHK A;  2K4Y A;  4RKU E;  2HAX A;  1VQ7 T;  2DTI A;  2KSS A;  4RTW A;  5GAM d;  2F1L A;  1WFW A;  2EW3 A;  4N0A A;  1G2B A;  4KUI A;  2QK0 A;  3SWN A;  2CP6 A;  1BI0 A;  2AIR B;  3M0U A;  4HCB A;  2Z0W A;  4M77 G;  1LCK A;  1Q95 G;  4BI8 B;  4GY5 A;  2YUO A;  1Y57 A;  4ME7 A;  2JT4 A;  4M7D D;  1WHM A;  2HD0 A;  2Y4Y A;  3OSV A;  1X69 A;  3G71 Q;  1VQN Q;  4RCC A;  2MCN A;  1D3B A;  1YIT A;  1JXM A;  2JMC A;  1WX6 A;  4J6W A;  1QKW A;  3JV3 A;  5I2M A;  9ATC B;  3VYG A;  1GCQ A;  2VGM A;  1SF9 A;  5KYU B;  3HP9 A;  1VQ5 Q;  3A8H B;  1YJN Q;  2JZ2 A;  1UDL A;  2R57 A;  3M54 A;  4O5V A;  2DX1 A;  1TUD A;  3OS0 A;  5FRN A;  4OP0 A;  1M1K U;  2K79 A;  5CKF A;  1N9R A;  5FRO A;  1RI0 A;  4PLL A;  3VS5 A;  3CC4 T;  2E64 A;  2L3R A;  4DBQ A;  3I56 Q;  3EGD A;  1X75 C;  2G6F X;  4X34 A;  3RNJ A;  1M1K R;  1H64 1;  2XDD A;  2JXB A;  4IUV A;  3L1A A;  2RNA A;  4NL3 A;  4XU0 A;  2CH4 A;  4J5Y A;  1T3S A;  3VKI A;  4MML A;  3JCM V;  2WAC A;  3OY9 A;  3UDC A;  4AFZ C;  1NM7 A;  2JUF A;  1OOT A;  3HTR A;  4M77 D;  3M9Q A;  1TOV A;  5D6Y A;  1Y07 A;  2QTV A;  1TUG B;  1SG5 A;  3EGX A;  3M53 A;  3MHX A;  3NHN A;  2DK3 A;  2RI2 A;  1V76 A;  2FO0 A;  2RA2 A;  1X6O A;  4ANJ A;  2YRC A;  2ZZD A;  5J26 A;  5LJ5 f;  4QVC A;  2JS2 A;  2XU8 A;  3C0C A;  4C8Q B;  2CZ0 B;  1EX4 A;  1U3O A;  5CO7 A;  2AHJ B;  1TS9 A;  2VB6 A;  3BE3 A;  4A53 A;  1X2Q A;  1Y71 A;  1OUL A;  2LJ0 A;  4DA4 A;  2OX7 A;  4XQ3 A;  2DM1 A;  4PJO E;  1TG0 A;  2OTJ A;  2H3E B;  3CPW A;  1VQ5 A;  2EQK A;  1AWX A;  3CXC P;  2CP0 A;  1YJN T;  5GAN h;  1WXB A;  3CC2 T;  3QXE B;  3CCL T;  2CH4 W;  2H8H A;  3TEE A;  1J3T A;  4M78 C;  4J9F A;  3CPW P;  4PJO D;  3EG1 A;  2PQW A;  4JJD A;  4M75 A;  5CAI A;  1WYX A;  3CBO A;  1VQL T;  4OGC A;  4PJN A;  2MYS A;  2P0Q A;  1U1T A;  1KHC A;  4A4H A;  2HBP A;  1KC8 R;  1HK9 A;  2CGH A;  3PNW C;  3OQ5 A;  1GRI A;  4E2F B;  2O9S A;  2KI7 A;  2BE7 D;  3H41 A;  4FYX B;  8ATC B;  2M0O A;  1RLQ C;  3THK A;  1RAG B;  1N8R R;  2LVM A;  2K3X A;  3EGD B;  3G6E A;  4OB0 B;  2V8I A;  2MI6 A;  4XTV A;  1OQK A;  5LJ3 e;  4DBF A;  4FT4 A;  1UJ0 A;  3OBW A;  4LDX A;  1QVG A;  2FYK A;  4C8Q G;  2K5L A;  2JW4 A;  4IUU A;  2HEQ A;  2FL7 A;  3M0Q A;  2C0O A;  1YHQ T;  2GTJ A;  3ASK A;  2J7I A;  3HFO A;  1Y0M A;  1WNL A;  4EMK B;  3ME9 A;  1T0J A;  1T3L A;  1VQO Q;  2QTX A;  4QQ6 A;  1W6X A;  2PUK B;  2DD5 A;  1M90 R;  1R77 A;  1D0Y A;  4E7L A;  3MP8 A;  2DBK A;  5KYU A;  5GMK i;  3CCJ A;  3NTH A;  2GQI A;  1UFF A;  4Z89 A;  4Z02 A;  2E1H A;  4BDZ A;  1AEY A;  1UGR B;  3E1S A;  4AFQ C;  4D6W A;  1QP3 A;  4KGV B;  2HKN A;  4M75 F;  2A0F B;  1K8A C;  1NZ9 A;  3OYH A;  4X9D A;  1AWO A;  1PHT A;  3OYB A;  1YJW A;  2OTL T;  3C95 A;  1SSF A;  1N9S A;  4M75 G;  3JB9 H;  5C6S A;  1FWZ A;  4RTV A;  2KVQ G;  3PMI A;  3RKW A;  4EMK C;  3G71 A;  2DPP B;  5LJ3 f;  1PM3 A;  2RI3 A;  1AVZ C;  4ATO A;  1VOM A;  3TRE A;  1WXU A;  4AG1 C;  1D0Z A;  1GBR A;  4IKF A;  5IT9 E;  1ZX6 A;  4M7D B;  1PSF A;  4EIK A;  2DL8 A;  1I4K 1;  3GOX A;  4Y28 E;  1M2V B;  3CC7 Q;  1OU8 A;  3H9N A;  4M78 E;  3S3O A;  3QDF A;  3C12 A;  5GMK m;  4D8D A;  2YT6 A;  1W2B S;  2RQW A;  1HSQ A;  3E9F A;  2G3R A;  1K0X A;  3V8J A;  1QVP A;  1YCS B;  3DLM A;  2O01 E;  3NTK A;  4OB1 B;  2BUD A;  4F04 B;  2DXB A;  4F14 A;  3L2Q A;  3VRY A;  4NOY A;  1IO6 A;  1C6V X;  1K9A A;  1OX8 A;  4E7J A;  3G4S T;  3BDL A;  3UPU A;  2D1X A;  1ZBJ A;  3LYI A;  4EMG A;  2EAY A;  2JTF A;  4BY6 B;  4J9E A;  4ELY C;  4PJO B;  1OZ2 A;  2DLP A;  3TSW A;  1N5Z A;  2ZGW A;  1WJR A;  4EDU A;  4N0A C;  2HCK A;  1QQJ A;  1W2B A;  3OMC A;  5GAO q;  1Q82 R;  2E4H A;  2M16 A;  4C0D C;  2DIG A;  3LGL A;  4C92 C;  5A0L A;  4PL6 A;  3UAT A;  4M7A D;  4PFO A;  1H8K A;  1AOJ A;  3M0S A;  2DXT A;  1I1J A;  1NEG A;  3JB9 D;  2LQ8 A;  2QQR A;  4M78 B;  1Y96 B;  5A0D A;  2EVR A;  1H92 A;  2HQH A;  3EG0 A;  2IVW A;  1PCX A;  2GQV A;  2P84 A;  4E7K A;  1R0B G;  2VYT A;  1MUZ A;  2DET A;  4KGX B;  1VQM Q;  1AWW A;  2FB7 A;  4IUP A;  2XG8 D;  1YNZ A;  2ZPH B;  3V8K A;  1U5S A;  1UJY A;  1M2V A;  2GNC A;  1E6G A;  1VQK T;  4C8Q F;  3CCQ A;  5CR2 A;  4MDX A;  3M58 A;  3MEA A;  1IGU A;  2RJC A;  2KRS A;  1GXI E;  2DO3 A;  4M77 A;  1QVF S;  1YN8 A;  3RMS A;  1PWT A;  4JUV A;  2F69 A;  2LX9 A;  1SEM A;  1AZE A;  4BAC A;  3RKX A;  2KAF A;  2YUQ A;  2QGG A;  3QDR B;  1MV3 A;  3S3N A;  2JM8 A;  2DBM A;  5ECA A;  5KYX B;  1S72 Q;  3OYJ A;  5CKB A;  5I21 A;  5IXF A;  3OYK A;  4A4F A;  4JJB A;  2L3S A;  4J6Y A;  4KH1 B;  2EPD A;  4DEX A;  1KC8 U;  2VV5 A;  5AT1 B;  1RAI B;  3R6O A;  4MZP A;  2LT4 A;  3CC4 A;  3V8L A;  1KIK A;  1LVK A;  1FXX A;  3EHR A;  5FW9 A;  3A8G B;  5FU6 C;  4DEY A;  2ATC B;  2DVJ A;  3CCE A;  2K6D A;  4B9W A;  5GAN g;  4PK4 A;  4ZNX A;  1E7O A;  3QZ5 B;  3P8B B;  1G8X A;  2VKN A;  3KUF A;  2L2P A;  5CVI A;  1KQS P;  4JLI A;  3PIP A;  3SDZ A;  1ZUY A;  4OMQ A;  1K9M R;  2RI5 A;  1WHG A;  1D0X A;  4EMH A;  1UGP B;  2A7Y A;  4KUL A;  3V7C A;  1BK2 A;  3CCU Q;  4FYY B;  3EHQ A;  3X25 B;  4CI0 C;  3JSC A;  4M78 A;  5GAN d;  1F1B B;  4ZN1 A;  3A8M B;  3CCM Q;  3RUX A;  1I8F A;  4ZGD B;  2EKO A;  2J05 A;  1NJI C;  4M7A G;  3CC2 A;  2EQM A;  4RTZ A;  2B8A A;  1G3T A;  1WPY A;  1UE9 A;  3CCS Q;  3L2W A;  1OPK A;  2RQU A;  5J39 A;  1G5V A;  1JBM A;  2QA4 A;  3GBQ A;  1NJI U;  5GAN 7;  2O4X A;  2YUN A;  2L3P A;  4DOW A;  4OGE A;  4C5H A;  4C92 F;  3EFO B;  2FEI A;  2OAU A;  1YJ9 Q;  4FCY A;  3QG1 A;  1VYT A;  2V1R A;  1BI1 A;  3UT1 A;  4GLM A;  4HVV A;  2CKK A;  1VIE A;  4N4I A;  3X20 B;  3H6Z A;  1EZZ B;  1QVG S;  3OYC A;  5HK3 A;  3I55 Q;  1YIJ A;  4M77 F;  3TSZ A;  1XTD A;  2ED1 A;  2JVV A;  2NLU A;  3N5B B;  4FIB A;  1NEB A;  1KJW A;  2COZ A;  1M3A A;  1JO8 A;  2HMA A;  1YWP A;  2PVO B;  3CBM A;  3CCJ T;  2D0Q B;  1RUW A;  2EJG A;  4XTW A;  2NUP A;  2QYZ A;  2PVD B;  3EG9 A;  4R56 A;  5KYW B;  3UF4 A;  2FG0 A;  2DXC A;  1QWE A;  1B7T A;  1VQ6 A;  5CK9 A;  5GAM h;  1K8A U;  2KEA A;  1ZSG A;  1VQK Q;  3CPF A;  3VS6 A;  4F7U G;  4A4K A;  4F7U E;  3P8H A;  2OI3 A;  5HK0 A;  2P4T A;  2LTO A;  3P8D A;  3PGG A;  1NE8 A;  4J7I A;  1WXT A;  3LW5 E;  2EKH A;  4BE0 A;  4NS5 A;  6AT1 B;  3J7A F;  4E6R A;  3BFM A;  1QKX A;  4JDS A;  4PJJ A;  3PE0 A;  3G4S A;  1K73 R;  2GFU A;  2RQV A;  1QWF A;  1CKA A;  4GLK A;  1YCY A;  3IQL A;  2DJZ A;  2DER A;  1VQM T;  4ZTJ A;  1EFN A;  2VC8 A;  4OMN A;  4C0G A;  3SWN C;  2LCC A;  2R5M A;  3MEV A;  4JS5 A;  1OU9 A;  2JTE A;  3L42 A;  4MDW A;  4XTZ A;  2COW A;  1JRI A;  2K2M A;  4C92 D;  2ZPB B;  1JQQ A;  1UEC A;  4C5E A;  2MOX A;  2O88 A;  3I9Q A;  2X4J A;  1MGQ A;  3CBP A;  2ENM A;  2C0T A;  1I0C A;  3HRS A;  4KUD K;  3JCM P;  3GNG A;  4OF1 A;  2NYS A;  2LZ6 B;  1VQ7 A;  5C0M A;  3QPH A;  4C8Q D;  3EFS A;  5GJV B;  3PT9 A;  1NJI R;  1NPP A;  2BE9 B;  2L5Q A;  3WXM B;  3O5Z A;  3TQ7 P;  5KYW A;  2CYZ B;  3OBY A;  1FYN A;  4M7D C;  4ELZ C;  2VXF A;  1PKT A;  1OX9 A;  2J6O A;  2EBP A;  5KYY A;  2FZC B;  2V8J A;  4M7A F;  2DE0 X;  5A2Q E;  1VQL Q;  1NG2 A;  5LJ3 j;  3V7R A;  3CCM T;  2DIQ A;  1SPK A;  2ROT A;  5FU7 C;  1HJD A;  3LH0 A;  4C92 G;  4M4Z A;  2AT1 B;  4B6M A;  4K11 A;  8AT1 B;  1GCQ C;  3EH2 A;  3QWY A;  5GMK h;  3VUZ A;  1VQN T;  2DKG A;  3JCM f;  4V2S A;  3OYI A;  4KT0 E;  1M5Q 1;  2K9G A;  1UGV A;  2RHY A;  2XHC A;  3EGU A;  2QEX A;  1PNJ A;  4BUG A;  2CZ1 B;  2V1Q A;  4XU2 A;  1KD1 U;  2KRM A;  2YWW A;  2MPX C;  3CME Q;  5D7U A;  3I5S A;  2OTL Q;  1CKB A;  4PJM A;  2P0P A;  4EPC A;  2QAZ A;  5GAO n;  1IXD A;  1JU5 C;  3Q1J A;  2O9V A;  2LDM A;  2XDP A;  1PC0 A;  3J81 E;  1UEB A;  5L8R E;  1RLP C;  1WA7 A;  1YIT T;  5AYF A;  1VQ9 A;  2FPE A;  2K3B A;  2P0K A;  5I2S A;  2X4W A;  2DTO A;  1AZG B;  3PVL A; 
#chains in the Genus database with same CATH homology
 4F7U B;  2K5I A;  3DLM A;  2O01 E;  2WSC E;  3NTK A;  4OB1 B;  3QYH B;  3HKS A;  4HCC A;  3OYY A;  4PJO C;  2BUD A;  2DXB A;  4TVR A;  4BY6 C;  3M5A A;  4FU6 A;  1MHN A;  1M1K C;  3L2Q A;  4NOY A;  2Y4X A;  1K9M U;  4ZTF A;  1BI2 A;  3QSU A;  3JCM e;  3BDU A;  4E7J A;  2BIV A;  3G4S T;  5D6X A;  3BDL A;  1N6A A;  2MWP A;  4QVD A;  3UPU A;  3PFS A;  5FU7 B;  3M59 A;  5GMK l;  3LGF A;  2X35 A;  1TH7 A;  3LWH A;  4BI3 A;  4M7D G;  1VUB A;  3LYI A;  2EQJ A;  3QUI A;  5CKE A;  4EMG A;  2EAY A;  2MF2 A;  2JTF A;  3M4Y A;  4BY6 B;  1WGS A;  1QP2 A;  5KH6 A;  5GAM g;  3MO8 A;  2D9T A;  3HL8 A;  3HRU A;  4WF2 A;  4ELY C;  3CCR T;  4PJO B;  2PUO B;  1OZ2 A;  2CZ6 B;  3QJY A;  5GAM e;  4JRP A;  2ZGW A;  4JLG A;  1WJR A;  4EDU A;  2LRQ A;  4M77 E;  4N0A C;  1WQ7 A;  2YLC A;  3OS2 A;  3L2V A;  1W2B A;  3CCV T;  1VQ4 T;  3OMC A;  5GAO q;  1UGQ B;  1Y96 A;  3CCU T;  2M16 A;  4C0D C;  2DIG A;  1BIB A;  3LGL A;  4HCZ A;  4C92 C;  5A0L A;  4PL6 A;  1W4S A;  5DLQ E;  3CC7 A;  4M7A D;  3JCM W;  3JCM J;  1VQO T;  4IUQ A;  3HSB A;  1B34 A;  1D3B B;  2DXT A;  3CD6 A;  3CC7 T;  3FIF A;  2WSE E;  3JB9 D;  4XTX A;  2LQ8 A;  3DKM A;  3OB9 A;  2QQR A;  4J83 A;  4M78 B;  1Y96 B;  3CPW S;  2F5K A;  1G3W A;  4VUB A;  5A0D A;  4C8Q C;  3OYM A;  2EJF A;  3FJP A;  4LDW A;  2IVW A;  4JJN K;  4L59 A;  3M56 A;  2GQV A;  4E7K A;  4C92 B;  1VQ6 T;  2VYT A;  3E19 A;  2QQB A;  4C92 E;  2R5A A;  1KHI A;  4II1 A;  4C5G A;  2DZ9 A;  3OW2 A;  3OSS C;  4LDY A;  2I2L A;  2FB7 A;  2RHI A;  4L5G A;  2VXE A;  1ZBX A;  4IUP A;  2XG8 D;  4M75 D;  5GAO p;  4JS4 A;  2ZPH B;  4M7A E;  3JB9 I;  4PLI A;  4OVA A;  3V8K A;  2JNG A;  1YHQ A;  1UB4 A;  2X4Y A;  1Q82 U;  3VYH B;  1M1F A;  1VQK T;  1XQH A;  2K5F A;  3FLG A;  4C8Q F;  1LNX A;  3CCQ A;  2V8K A;  5CR2 A;  3I55 A;  5GAO r;  3JCM c;  5LJ5 j;  3HFN A;  3M58 A;  2LC4 A;  3T9N A;  5M9O A;  3OA6 A;  4HT8 A;  4MDX A;  2K57 A;  3MEA A;  4M75 C;  4QQG A;  3JCM g;  4HT9 A;  2QI2 A;  4FT2 A;  3OYF A;  2RH2 A;  3SB2 A;  5LJ5 e;  2FHD A;  3GF5 A;  3LLR A;  5CIU A;  2RJC A;  3CXC S;  1U1S A;  1GXI E;  2DO3 A;  1X01 A;  3LX7 A;  3CD6 T;  1FX7 A;  4RG2 A;  1LOJ A;  4M77 A;  3OS1 A;  1QVF S;  3RMS A;  3NTI A;  4E7I A;  3RES A;  3OYL A;  5GAN j;  3RIR A;  1YJ9 A;  2M1H A;  1OZ3 A;  3CCR A;  4JUV A;  1Q81 C;  2F69 A;  1I81 A;  2LX9 A;  4M7A A;  1VQ8 A;  1Q86 U;  1VQL A;  5GAN 3;  4LD9 K;  4BI4 A;  4NL2 A;  1M90 C;  5FLX E;  4BAC A;  4O6J A;  2PU9 B;  3RKX A;  2KAF A;  2VGN A;  3QDR B;  4F7U A;  2XD0 A;  3CCS A;  2O4X B;  3H8Z A;  4XTY A;  3S3N A;  1OYX A;  2OTJ T;  4E47 A;  2RK1 A;  3G6E T;  1I5L A;  3G71 T;  1O9S A;  2FVU A;  1VQO A;  3VU3 C;  4QW2 A;  3OYJ A;  3AHU A;  5CKB A;  5I21 A;  4M77 B;  4N4H A;  2HQX A;  5DM7 R;  1KQS A;  3JCM b;  1YJN A;  3OYK A;  2RHZ A;  3L2U A;  4E7H A;  3OS5 A;  4A4F A;  3OYA A;  3PIO A;  5FU6 B;  1M90 U;  1P92 A;  4J6Y A;  1KC8 U;  3CCM A;  2VV5 A;  3SFM A;  3ZBD A;  1Q81 U;  2IG0 A;  2QEX T;  3R6O A;  2JN0 A;  4FSX A;  4M7D A;  1V29 B;  2HQE A;  3S6W A;  2KDS A;  3ZEH A;  1WJQ A;  2YRV A;  4MZP A;  2LT4 A;  4C0F A;  4LDU A;  5EG2 A;  3OYE A;  3CC4 A;  3INZ A;  4J8O A;  1N8R U;  3V8L A;  2F5T X;  3I56 T;  2E70 A;  2L8D A;  2QXF A;  3VJP A;  3CCU A;  1FXX A;  4QVZ A;  4C5I A;  3CCE T;  2ZPE B;  4C0D B;  3JCM Q;  1M9S A;  1KQ1 A;  4MZM A;  5CCA A;  3A8G B;  5FU6 C;  4XU1 A;  2XID A;  3CCE A;  1BI3 A;  2GFA A;  2K4Y A;  4RKU E;  4B9W A;  5GAN g;  2E65 A;  2HAX A;  5GAN 8;  3HRT A;  1VQ7 T;  3CMA T;  2DTI A;  1B34 B;  2KSS A;  3P8B B;  3QII A;  3QYG B;  3QZ5 B;  3UWN A;  4M7D E;  5GAM d;  2MWO A;  2RM4 A;  3KUF A;  5CVI A;  2DD4 A;  4JLI A;  4N0A A;  3PIP A;  1VQP T;  2OTL A;  3SDZ A;  4UC4 A;  3TCJ A;  3TU4 K;  4KUI A;  3CEY A;  3A8L B;  4CRI A;  1VQ8 T;  2RI5 A;  3LWI A;  1XNI A;  3SWN A;  2EQU A;  5IN1 A;  4EMH A;  1BI0 A;  1UGP B;  4BB7 A;  3FDR A;  4HCB A;  1BIA A;  2EFI A;  4M77 G;  4BE1 A;  4PJO A;  2KMT A;  2YLB A;  2H3J A;  2A7Y A;  4KUL A;  3V7C A;  4BI8 B;  4GY5 A;  4J7F A;  1KQS S;  5LJ3 g;  1VQ4 A;  1M1G A;  4ME7 A;  2RB6 A;  4J6X A;  4M7D D;  2HD0 A;  2Y4Y A;  3X25 B;  3OSV A;  5GAN e;  3X28 B;  4CI0 C;  3JSC A;  3OMG A;  4M78 A;  5LL6 S;  2JOY A;  5GAN d;  2KY9 A;  4RCC A;  2QA4 T;  3BW1 A;  1D3B A;  2DEQ A;  1YIT A;  1BYM A;  3O8V A;  3JCM X;  1ZQ1 A;  4ZN1 A;  2L89 A;  3A8M B;  4J6W A;  3RUX A;  3CCV A;  5I2M A;  5IAY A;  1WQW A;  2RHX A;  1I8F A;  2CS7 A;  3VYG A;  4ZGD B;  1O75 A;  2EKO A;  4BD3 A;  1NJI C;  2VGM A;  2ZPF B;  3HP9 A;  3A8H B;  4M7A G;  3L2Z A;  4PNO A;  3CC2 A;  2EQM A;  4Q5W A;  2B8A A;  2JZ2 A;  5CKD A;  1G3T A;  2R57 A;  3M54 A;  1S72 A;  1R8O B;  1WPY A;  4O5V A;  3L2W A;  4BDY A;  1Q7Y C;  5J39 A;  1G5V A;  1JBM A;  2QA4 A;  2GCX A;  1NJI U;  1K9M C;  3OS0 A;  5GAN 7;  3DLL A;  4OP0 A;  5FRN A;  3MP1 A;  1M1K U;  2O4X A;  5CKF A;  1N9R A;  5FRO A;  1RI0 A;  2DZC A;  4PLL A;  4RMO A;  1VQK A;  3CC4 T;  4DOW A;  2E64 A;  2L3R A;  4LD6 A;  4OGE A;  4C5H A;  4XK8 E;  4C92 F;  5D6W A;  3RKY A;  4M7A C;  1X75 C;  1VIF A;  5CKH A;  5GAO l;  4X34 A;  2OAU A;  2XKO C;  3QG1 A;  2RJE A;  1H64 1;  4R55 A;  2XDD A;  1BI1 A;  3UT1 A;  1KQ2 A;  4IUV A;  3L1A A;  2CKK A;  1VIE A;  4N4I A;  3X20 B;  3H6Z A;  1QW1 A;  1QVG S;  1JJ2 S;  3OYC A;  2LCL A;  5HK3 A;  4NL3 A;  4XU0 A;  1YIJ A;  3M4G A;  3OW2 S;  1K73 C;  4J5Y A;  2RK2 A;  2XK0 A;  4M77 F;  5LJ3 h;  3VKI A;  4MML A;  1XTD A;  3JCM V;  3MCA B;  2WAC A;  3E9G A;  3OY9 A;  2DVE A;  3UDC A;  2DTH A;  2JVV A;  2EYQ A;  2VUB A;  2JUF A;  2HNI A;  4M77 D;  1Y7X A;  2NLU A;  3QO3 A;  4PJO F;  3M9Q A;  3N5B B;  1YJ9 T;  4FIB A;  4OMF B;  1VQM A;  3QBY A;  4PKC C;  4PJO G;  5D6Y A;  1Y07 A;  5GMK j;  2PVO B;  3CBM A;  3DB3 A;  2YHT A;  4M75 E;  5HY6 A;  3CCJ T;  3HPW A;  1OI1 A;  5GAN 6;  3GNF B;  1IZ6 A;  2D0Q B;  2EJG A;  3M53 A;  3MHX A;  4N4G A;  3QZ9 B;  1RL2 A;  2DK3 A;  4XTW A;  2RI2 A;  2RA2 A;  3M55 A;  1YI2 A;  5A0G A;  1X6O A;  4DQ2 A;  3VV0 A;  2ZZD A;  2PVD B;  5J26 A;  5LJ5 f;  4QVC A;  3S3M A;  4R56 A;  1YI2 T;  1N8R C;  2XU8 A;  4EMK A;  5GAN 4;  3JB9 F;  1VQ5 T;  1G3Y A;  4C8Q B;  3J80 E;  2DXC A;  3FRN A;  2CZ0 B;  4QQD A;  4B9X A;  3I56 A;  5KCH A;  1VQ6 A;  5CK9 A;  5GAM h;  3JB9 G;  1K8A U;  5CO7 A;  2XDB A;  2AHJ B;  1H3Z A;  1IRE B;  3CPF A;  4A53 A;  2EWN A;  4DA4 A;  1Y71 A;  2LQK A;  3QJ6 A;  4XQ3 A;  4A4K A;  3DB4 A;  4F7U G;  3P8H A;  4F7U E;  1KC8 C;  3BY7 A;  4PJO E;  3X26 B;  5HK0 A;  4M78 G;  2OTJ A;  1M8V A;  2P4T A;  3JB9 J;  2LTO A;  3P8D A;  3PGG A;  3CPW A;  4A4G A;  1NE8 A;  4J7I A;  1VQ5 A;  3FB9 A;  4RCB A;  3GIB A;  2EQK A;  3LW5 E;  2EIF A;  4M78 F;  4YTL A;  4BE0 A;  4NS5 A;  5DLO A;  3J7A F;  1YJN T;  1LJO A;  5GAN h;  3CC2 T;  3BFM A;  3QXE B;  4JDS A;  3CCL T;  2MAM A;  3PMT A;  4M77 C;  3G4S A;  5LJ3 d;  3TEE A;  2GFU A;  2Y90 A;  5KCO A;  4XTU A;  4M78 C;  4ZGE B;  4M7D F;  4GLK A;  3KBG A;  4PJO D;  1U8R A;  2DXU A;  2PQW A;  1YCY A;  4M75 A;  2LNV A;  5CAI A;  3RER A;  3CBO A;  2DJZ A;  3QHS A;  1VQL T;  1VQM T;  4OGC A;  4ZTJ A;  1S72 T;  2VC8 A;  2LT1 A;  4C0G A;  1YJW T;  3SWN C;  2LCC A;  2R5M A;  3MEV A;  4JS5 A;  2P0Q A;  4FL6 A;  3MEU A;  3L42 A;  2BKD N;  3C94 A;  2WSF E;  4MDW A;  5HKC A;  3CCS T;  1JB0 E;  2KK4 A;  3HHT B;  1N27 A;  1JRI A;  1U1T A;  1KHC A;  3C4S A;  4XTZ A;  4C92 D;  2K2V A;  4A4H A;  2RHU A;  2HBP A;  2ZPB B;  1HK9 A;  2CGH A;  2X4X A;  3PNW C;  2E12 A;  1QVP A;  3QKJ A;  3OQ5 A;  3G7Z A;  4IUT A;  4OB3 B;  4A4E A;  1DJ7 B;  4C5E A;  5LJ5 g;  4A54 A;  3GPL A;  2QQ9 A;  3KXT A;  2M0O A;  4M75 B;  2EJ9 A;  3CMA A;  2X4J A;  3SWN B;  1MGQ A;  2RJD A;  3CBP A;  2KQW A;  3A8O B;  2D6F A;  3HRS A;  4KUD K;  3JCM P;  1QVF A;  3CME A;  1HXD A;  2LVM A;  4JRQ A;  1YIJ T;  2K3X A;  3GNG A;  3OYG A;  4OF1 A;  3FEO A;  3URG A;  2PVG B;  3JCM h;  4XU3 A;  5GAN f;  3WVD B;  1VQ7 A;  3G6E A;  4F7U F;  5KE2 A;  4OB0 B;  5C0M A;  3QPH A;  4JRI A;  4HKE A;  2V8I A;  3EFS A;  4C8Q D;  2MI6 A;  4XTV A;  2DAQ A;  5GAM j;  5LJ3 e;  3PT9 A;  4FT4 A;  2QQA A;  3OBW A;  4BE2 A;  3GLX A;  1NPP A;  4C92 A;  2L5Q A;  3WXM B;  4LDX A;  1QVG A;  2FYK A;  4C8Q G;  2K5L A;  1JJ2 A;  3L2R A;  2CYZ B;  4IUU A;  3M57 A;  3OBY A;  4FM4 B;  4M7D C;  4HA8 A;  4ELZ C;  2FL7 A;  1YHQ T;  3ASK A;  2VXF A;  1UGS B;  3JRZ A;  5FRM A;  3HFO A;  3V7S A;  3PTA A;  1WNL A;  4EMK B;  4C8Q E;  3ME9 A;  1Q7Y U;  3JB9 H;  2E10 A;  1EIF A;  5GMK e;  2QTX A;  4QQ6 A;  2E5Q A;  1G3S A;  2PUK B;  2V8J A;  4JRK A;  4M7A F;  2DD5 A;  3EAE A;  3RMQ A;  4IUR A;  3NFC A;  1VQ9 T;  2XI9 A;  5GAN 5;  4E7L A;  4RG8 A;  5GAN 2;  5A2Q E;  3MP8 A;  4C0Z A;  3GP8 A;  1BKB A;  3I55 T;  4P5N A;  3A5Z B;  4KBM B;  5GMK i;  5LJ3 j;  3CCJ A;  2RJF A;  3NTH A;  3V7R A;  4ZGJ B;  3CCM T;  2RD1 A;  2DIQ A;  5FU7 C;  2E6Z A;  3FC3 A;  3LH0 A;  4C92 G;  3MET A;  4Z02 A;  4C8Q A;  2E1H A;  4BDZ A;  3VUB A;  2XIC A;  1UGR B;  3E1S A;  2M9U A;  1PSE A;  3EFR A;  3WVE B;  4D6W A;  1QP3 A;  1WJS A;  5GMK h;  4M75 F;  1K8A C;  3VUZ A;  2C06 A;  1NZ9 A;  3OYH A;  4X9D A;  3CCL A;  1VQN T;  2CZ7 B;  3OYB A;  1Q86 C;  1YJW A;  2DKG A;  2OTL T;  3JCM f;  3C95 A;  4V2S A;  1SSF A;  1N9S A;  3ZFJ A;  2JTM A;  3MP6 A;  4M75 G;  4KT0 E;  3OYI A;  1M5Q 1;  1ZHI A;  1FWZ A;  3F70 A;  5DY9 A;  3X24 B;  5C6S A;  1VQN A;  2KVQ G;  3PMI A;  3RKW A;  4EMK C;  2E41 A;  3JCM d;  2DPP B;  2RHY A;  1XOV A;  1M4Z A;  2RI3 A;  2XHC A;  5LJ3 f;  3G71 A;  2QEX A;  4M78 D;  4BUG A;  2CZ1 B;  4XU2 A;  5KE3 A;  1KD1 U;  4ATO A;  2K3Y A;  3TRE A;  2ZCF B;  1NPR A;  1KG1 A;  4IKF A;  4L6V 5;  4OB2 B;  5LJ5 h;  4M7A B;  5IT9 E;  3MEW A;  4M7D B;  1PSF A;  5CQY A;  2GF7 A;  1Q82 C;  3SD4 A;  2MMP A;  4DOV A;  4XAX B;  5GAO m;  1I4K 1;  5J3B A;  4MZT A;  3GOX A;  2P0P A;  4ZN3 A;  4Y28 E;  1VQP A;  1KD1 C;  2ZPG B;  4LDV A;  1YBY A;  2RO0 A;  5CQX A;  4MMK A;  4EPC A;  4M78 E;  2ZPI B;  5GAO n;  3S3O A;  3CXC A;  3Q1J A;  3C12 A;  2QQS A;  4X9C A;  1K73 U;  5GMK m;  2LDM A;  2XDP A;  2R58 A;  1W2B S;  5LJ5 d;  3E9F A;  4Y91 A;  3JAM E;  1UEB A;  3J81 E;  5L8R E;  2G3R A;  1YIT T;  3ER0 A;  5GAM f;  5AYF A;  3OYD A;  2E6N A;  3V8J A;  1VQ9 A;  2QDY B;  3OYN A;  2P0K A;  5I2S A;  3CME T;  2X4W A;  1AHJ B;  2DTO A;  3CCQ T;  2A3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...