5GMKe

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
65
Chain Sequence
b'VIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 8
structure length 65
sequence length 65
chains with identical sequence g
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmke00
4C8QA 4XU0A 4XTUA 5GAMj 4X9CA 2DZ9A 2E41A 4M77G 4M7DF 4A54A 4J5YA 5GAOp 2Y90A 3JCMc 4M7AG 3JCMh 5GMKh 3RKXA 5GAMg 3JCMP 1BIBA 1B34A 4M75G 4PJOB 3RKWA 1HK9A 3BDUA 3QHSA 4M77E 3JCMe 4JUVA 4M77A 4XU3A 3RESA 2DTIA 3JCMg 2ZGWA 2DXUA 5GMKe 4PJOC 3EFRA 5GMKm 4RCCA 4M78D 3FB9A 3RERA 4J6XA 3JCMd 4PJOG 1JBMA 2FYKA 1Y96B 3JB9I 4HA8A 4JLIA 4JRIA 1U1SA 4M7DB 3RKYA 1BIAA 4X9DA 4C8QE 2RB6A 4XU1A 4NOYA 2JN0A 4MMKA 4M7DC 3L2ZA 3V7RA 4OP0A 1N9SA 4C92D 4EMHA 1M8VA 4N0AC 2CGHA 3JB9J 2DVEA 1I4K1 4M7DG 5GMKl 3PGGA 5LJ3h 4PJOE 4C92B 5GAOm 4A53A 3JB9D 4PJOA 5LJ5f 5CAIA 4C92C 2VXEA 5GMKj 1U1TA 5GAOn 2VXFA 3JCMX 2DXTA 3RIRA 2HNIA 1WQ7A 4C92F 2E10A 3FJPA 3HFNA 1LNXA 5I21A 5LJ5h 4M7DE 4M7AD 1LOJA 3JCMJ 4M7DA 5GAN7 5GAN3 5GAOq 3L1AA 5LJ3d 4V2SA 5LJ3e 4N0AA 2RA2A 5GAOl 3FIFA 5GANf 4M75D 3QO3A 4Y91A 2E65A 1D3BB 1TH7A 2I2LA 5LJ5e 1LJOA 4M78B 5GAN4 3JB9H 5LJ5g 3JCMb 4XTWA 4C8QD 5LJ3f 2DEQA 5GANh 2E1HA 2EWNA 4PNOA 2DJZA 3GIBA 4M78C 5LJ5d 2RM4A 3QUIA 5GAN2 3JCMW 3V7SA 1YCYA 2K57A 4M78F 3V8JA 1MGQA 4MMLA 5GAN6 3JCMQ 4F7UB 3AHUA 1I5LA 1KQ1A 3SWNB 2DKGA 5GANe 5LJ3j 3HSBA 1HXDA 5GANg 2QTXA 2DTOA 4C8QF 3V8LA 3SWNC 1B34B 5GANd 4M77D 4EMKB 4RCBA 4C92G 4F7UF 4NL3A 5GAN8 3SB2A 1Y96A 5LJ3g 3EFSA 4M78E 5GAOr 1D3BA 1WNLA 2DZCA 4M77B 4JRKA 4M78A 4XTZA 4EMKC 5LJ5j 3JB9F 1H641 1WQWA 4M7AB 3BW1A 4XU2A 5GAMh 2YHTA 1WPYA 3M4GA 1M5Q1 4QVDA 4HT9A 4M77F 4C92E 4M75B 4F7UE 4M7AC 4QVCA 3BFMA 4C92A 4F7UA 3SWNA 4M7AF 2YLBA 5GANj 4M75C 5GAMe 4PJOD 4J6YA 4C8QB 4M78G 4HT8A 4DQ2A 4M75F 3V8KA 2VC8A 4EMKA 2EJ9A 3INZA 1KQ2A 5GAMd 4C8QC 2EAYA 1I81A 2EJGA 1N9RA 4EMGA 4J6WA 5DY9A 3V7CA 4C8QG 3RUXA 4NL2A 4XQ3A 4M7AE 1JRIA 3VU3C 3HFOA 4XTYA 4F7UG 1X01A 4M7AA 4M7DD 4PJOF 5GAMf 3JCMV 1I8FA 4M75E 2DTHA 5GAN5 2RD1A 4M75A 2YLCA 3JB9G 3QSUA 3BY7A 2E64A 5GMKi 2EJFA 4XTVA 4XTXA 4M77C 4WF2A 3JCMf 2FB7A
chains in the Genus database with same CATH superfamily
2DRKA 1IXDA 2HQXA 2KR3A 3CMET 1M1KU 1G3TA 1OV3A 2ABLA 3I5RA 2K7AA 4M75G 4ZN3A 1PCXA 3QHSA 1VQ5T 4A4HA 2DTIA 3PE0A 1GL5A 2C0OA 4RCCA 1W2BP 1WYXA 1AZEA 2QQBA 2FYKA 2GFAA 3TCJA 4JLIA 2GTOA 3CCQA 1AD5A 3U23A 2MOXA 2DE0X 4WTOB 1NBEB 4KULA 5LJ3h 4FT4A 4XK8E 2DMOA 2VGMA 4FIBA 2MMPA 2E10A 1LNXA 4M7DE 1N27A 2EYYA 5M9OA 1RI0A 2A08A 2DEUA 1MMAA 2OTJQ 1VQ5A 3MEUA 1G83A 5HKCA 5LJ5e 2FO0A 1JQQA 4CI0C 1VQ7A 2XD0A 1BK2A 4BE1A 1M3CA 1Y07A 4IKFA 4L6V5 1UHFA 4HVWA 4PLIA 1K0XA 4PKCC 2QASA 2DXBA 1V1CA 4MDWA 1RL2A 3DLMA 3LGFA 1VYUA 2OAUA 2RQUA 5FWCA 1WNLA 4BI3A 4EPCA 3MP6A 3CBMA 2YHTA 4EDUA 4QVCA 1U3OA 3UATA 3CC4T 2VUBA 3E2UA 3CCQQ 4J9CA 4QKUA 1AWXA 1X43A 4O5VA 3J81E 3LGLA 3CD6T 4HCKA 2JW4A 4F04B 4M75A 2RHUA 2K6DA 2RJCA 2R58A 2KK4A 3CMEQ 4Q5WA 1VQNT 3CCJT 4LUDA 4KGVB 1NEBA 5GAOp 1Q95G 1K0SA 2DAQA 3OS0A 1Q7YC 1VQ5Q 2R57A 4MDXA 1VQ7Q 1WHKA 3H41A 2ZPFB 4CC3A 1IHWA 3CC4A 1G3SA 5IHKA 4IUQA 1KQSA 1PSFA 2ECZA 1FMVA 1ZA2B 1E7OA 1U1SA 1KJWA 3CPFA 2K3BA 2CUDA 1N8RU 2KEAA 2K3YA 4AG2C 1OX9A 1F1BB 3G4SA 3CCJA 3Q1JA 1LVKA 1Z9ZA 1U1TA 5KYXB 5LJ3e 3QWYA 3C4SA 2FL7A 1WHHA 2O4XB 1M3AA 1TOVA 3OS5A 1WGSA 3OSSC 1TH7A 1YITA 1YJ9A 1TS9A 5J39A 3O8VA 4JDSA 3GOXA 2KQWA 1WLPB 1KQ1A 1HXDA 1TXQA 2RN8A 1AZGB 4M77D 3I55T 1KQSS 1Y96A 2HSEB 1WQWA 1J3TA 1RLQC 1TSFA 2LQKA 4GLMA 3I35A 4LDYA 1M27C 3CC4Q 5FROA 4OGCA 2ZPIB 2QA4A 1WIEA 4EMKA 2AKKA 5GAMd 4C8QC 4EMGA 2NUPB 2CP7A 3KUFA 2AK5A 2V8IA 3G4SQ 3CCJQ 1QCNA 4ELZC 2RQTA 1YI2A 2PVOB 2LCCA 4IUVA 4N4HA 2NUTA 2LTOA 2GFUA 2X35A 1T0HA 3WVEB 1YJ9Q 1BI2A 1ZSZA 3BDUA 3HHTB 3MEAA 3JCMg 2VGNA 2RI5A 3UA7A 1K1ZA 1N8RR 2X51A 3CC7T 4CC4B 4IUUA 4JJCA 3TSWA 2O88A 1I07A 3M0QA 1VOMA 4FSSA 3M58A 1M4ZA 5GAOm 3H8ZA 1TUDA 4C0FA 1GFCA 5AYFA 1G3YA 2CYZB 1M2VA 2DO3A 5IN1A 4KUDK 4KUIA 2QA4Q 3VS7A 2JVVA 4OB3B 5IT9E 3GIBA 2QQ9A 4IIOA 4OMLA 1MGQA 2XICA 4F7UB 3I55Q 1K73C 2PUKB 3HSBA 4E7KA 2QGGA 4C8QF 3SWNC 2KAFA 1YI2Q 3I56T 4ZTJA 3M5AA 4RCBA 1WXUA 1QVGA 5GAN8 3MP8A 1VQOT 4E6RA 1K76A 2DZCA 4GLKA 1QW1A 4M7AB 1NJIR 3M0RA 3M4GA 4OMOA 3G7ZA 2HCKA 2EQJA 2NYSA 2W0ZA 5GANj 3OYYA 4OF1A 1VQ9T 4AG1C 2CP5A 1UGQB 1ZA1B 2CS7A 3RUXA 3M9QA 5D6WA 1RACB 5KE2A 2A36A 2XKOC 3D7SB 2RHZA 1X75C 2D6FA 2H3JA 2HD0A 3GF5A 2RF0A 4JS5A 1UGRB 2K2VA 3E19A 3N5BB 1D0XA 1YIJT 2O01E 1XOVA 2DYBA 5GMKh 3CCMT 3G6EA 2RQRA 1ABQA 2MYSA 3RKWA 1SHGA 1QVGS 2RH2A 4M77E 3CC7Q 3FDRA 1VQ9A 4PJOC 1CSKA 3LH0A 3R6NA 2XU8A 4PJLA 3JCMd 3PTAA 2JM8A 2L3PA 1QVPA 3OMCA 1B7TA 2AHJB 2OAWA 2RB6A 4MMKA 1VQ4T 1Q86R 4N0AC 3OYFA 2DIGA 3RNJA 4C92B 3NPFA 4RTWA 4ZNXA 4YTLA 1N5ZA 1YNZA 4BY6B 2YUQA 1OPLA 4ME7A 4R55A 1Q81U 4F17A 2EQMA 2IIMA 1C0MA 3OYNA 3CC2T 4M7AD 3OSVA 5GAOq 4P5NA 1IB8A 4E7LA 3H9NA 3SHWA 3HP9A 3PFSA 1H3HA 1AOJA 1LJOA 3RMQA 1XQHA 4AFSC 3JCMb 7AT1B 4HKEA 5DM7R 2EWNA 2KXDA 4D6WA 2QI2A 2KSSA 4KBMB 4QW2A 1X6OA 1X6BA 2L8DA 2RJEA 1NLOC 5ECAA 2ZPEB 1VQ4A 3OW2A 3VS5A 4FW1A 2QDLA 2GCXA 1FYNA 1B34B 1SKUB 2AIRB 2F2WA 4F7UF 1NYFA 3C95A 3H0FA 2QG9B 2LP5A 1MMDA 1R0BG 3VRYA 3G6EQ 4JJBA 4FYYB 5CQYA 3SEMA 2M9UA 4M75B 1VQ9Q 4UC4A 4M7AF 2A28A 3LW5E 1VIEA 3M0UA 1M30A 3HKSA 5A0LA 5KYXA 1H92A 1VQLA 4CC2A 3NTKA 1M9SA 3L2QA 4XQ3A 1I1JA 4PJOF 3CXCS 3PIOA 2J6OA 3JCMf 3QDRB 3GNFB 2BZYA 2RO0A 2L3RA 4C8QA 3CCSA 3C94A 4LDVA 1KHCA 1KQSP 2XI9A 4RTXA 4HXJA 5FU6C 1RI9A 3O5ZA 2K9GA 1UJYA 4JUVA 5GMKe 3S3OA 3PMTA 5CKHA 2JS0A 9ATCB 2LT4A 2YUPA 2CREA 1IHVA 2D9TA 2KT8A 1N8RC 1VQ4Q 1B07A 2D8HA 3MKDA 1UGSB 2K3XA 3EG3A 3M54A 4NOYA 3V7RA 1N9SA 1YCSB 2DX1A 4MZMA 1I4K1 4CRIA 2QK0A 3UF4A 1X69A 5I2MA 1RAFB 1K9AA 2NUPA 5GJWB 3CQTA 2PVDB 2CZ7B 2J6FA 3JCMX 1TTHB 3RIRA 4C92F 3OQ5A 2ENMA 3VKIA 5I22A 2YDLA 5GAOl 4M75D 1VQLQ 1QKWA 1V76A 2E65A 1KC8R 5LJ5g 2WSCE 2E1HA 4PNOA 4M78C 1TU0B 2EGAA 5GAN6 2KXCA 1ABOA 2D0NA 1CKAA 3M0SA 3V8LA 2HDAA 2FRWA 3CCSQ 4EMKB 2YWWA 2JTFA 3GNGA 3C12A 4A4FA 4QVDA 1M5Q1 4F7UE 2JZ2A 3BFMA 3SWNA 2HL3A 2YLBA 3VUBA 3A8HB 2P0QA 4M75F 2RJFA 3QJ6A 1SRMA 2NUTB 3FLGA 4DBFA 2M02A 1TG0A 3OYKA 4M7AE 1ZSZB 2VVKA 3QZ5B 1W6XA 2DZ9A 2DYIA 2E41A 1K8AR 4N4IA 2Y90A 1R8OB 3SD4A 4BDYA 2D1XA 1RAEB 1ZBXA 1JJ2S 3RESA 2ZGWA 5GMKm 4LDUA 1FXXA 4J6XA 1KSWA 4JRQA 1ZBJA 3I9QA 4A63B 2M0OA 2BKDN 2PZ1A 1U8RA 4J7IA 2CP6A 2JTEA 1IO6A 5A0GA 4IUPA 4OMMA 3A8GB 1S72A 1Q86C 2EYWA 4M7DG 2K2MA 5KYYA 1H3ZA 1YJNA 4PJOA 3JV3A 5KCHA 1ZSGA 1ZUUA 3DB3A 3PIPA 1UGPB 3OS1A 3HFNA 4JRPA 4PFZA 1BBZA 5CKBA 4N0AA 1VQ7T 3LWHA 4OMPA 1QVFA 3C0CA 3A8LB 3J80E 2K5LA 1QVGP 5LJ5d 2FPFA 3PNWC 5GAN2 3V7SA 2EGEA 4M4ZA 4C0DC 3LWIA 4OMNA 4RTUA 2DTOA 2HKQB 4E7IA 1Y71A 2XDDA 4MZPA 5A2QE 3MJXA 3EGXB 2RK2A 4JRKA 3I5SA 1H641 2WSFE 1RUWA 2H3EB 2EW3A 1VYTA 4QT7A 2DF6A 2ROLA 4C92A 1WFWA 3PVLA 3CBOA 2K4YA 4M78G 1UTIA 5LL6S 3L2RA 3VS0A 2Y4XA 2E5QA 5DY9A 1PC0A 3EH1A 2B8AA 3L2WA 4KH0B 1YJNQ 2HEQA 4M75E 1QVFS 2DL4A 2QQAA 1UG1A 2ZAEA 4WF2A 4XTUA 3TQ7P 4Z02A 2E6NA 1G2BA 2GTJA 3JCMc 1NPPA 4E7SA 2J05A 2DIQA 2LJ0A 5GAMg 4IURA 1B34A 5HY6A 1JB0E 2JJ9A 2B86A 3VYGA 2VKNA 2ZPHB 3EFRA 1AVZC 1U5SA 4DBQA 1M1FA 4JRIA 5I11A 2MWOA 2X4WA 1WJSA 3G4ST 2NWMA 4EMHA 1Q81C 1UE9A 1VQ6A 4J9DA 2EQKA 4XAXB 3CXCP 1LPLA 5LJ5f 1GBRA 4HCBA 3EG1A 3GP8A 1VQKA 2DL7A 4RG2A 2LCLA 5GAN3 5LJ3d 1YITT 1YJ9T 2F5TX 1T3SA 2DJQA 3GLXA 3CCRA 2V26A 4RMOA 1KC8C 1FWZA 5IXFA 4LXCA 5A0DA 5GANh 2M51A 2SEMA 2RM4A 5CVIA 3JCMQ 3WVDB 1SPKA 1WXBA 2QTXA 1YWOA 2ESWA 1U06A 2G3RA 2F1LA 3QPHA 2LX7A 2O2OA 1NM7A 1D3BA 2HL5C 4D8DA 4M78A 1BI1A 4Z89A 2EYQA 2A7YA 2FZKB 2V8KA 4Y28E 2K5FA 1BYMA 2QA4T 3QZ9B 2QAZA 2GQIA 4RKUE 4J6YA 4C8QB 2VV5A 2CH4A 5DLOA 3INZA 1M90R 1MMGA 4IUTA 3X25B 4QQ6A 1BCOA 3VU3C 2XMFA 1X01A 1VQ6Q 4AMCA 1YI2T 2KNBB 3L2VA 2ZPGB 4ZN1A 1AWOA 3CEYA 4DA4A 1VQKQ 1BI3A 3OB9A 1K8AC 2YRCA 2DPPB 3HRSA 3RKXA 1NJIU 1E6HA 2LJ1A 3CCRQ 1UHCA 1BKBA 1EX4A 2HQEA 4MZTA 5J3BA 5HK3A 3G71A 3FB9A 2L89A 1WHMA 2JN0A 1JXOA 2CZ0B 3KBGA 5GMKl 1K9MR 1KD1R 4C0GA 4B9XA 1Y7XA 5CAIA 1YITQ 4DOWA 5CKEA 5I21A 3FJPA 3JCMJ 2JTMA 2YRDA 2RHYA 1AWWA 3NTIA 2O31A 1YHQT 1QP2A 5IHIA 4C8QD 3A5ZB 3X20B 1PHTA 1JJ2P 4PL6A 3RR6A 4EIKA 1QMCA 2BTTA 4MMLA 3SWNB 2CZ6B 5GANe 1PG5B 3OY9A 1Q86U 1N6AA 2X3XD 2KY9A 3X28B 4J83A 3OBYA 4J9BA 2PQWA 1YHQA 3VJPA 3G71Q 3A8MB 4JS4A 1JO8A 2L3QA 4OB2B 4DQ2A 2DERA 3CCUA 4R56A 4A4EA 2AT1B 3CMAA 3HFOA 2AKLA 3M55A 2LCSA 1PSEA 4DOVA 3UA6A 5GAMf 2CZ1B 2YLCA 5GMKi 1ZUYA 4C0ZA 1XNIA 4OMFB 4B6MA 2XG8D 2PNIA 4M77G 5GAMj 3G6ET 1GCQC 2DA9A 5AT1B 1YN8A 1W2BA 3QG1A 2LNHB 2V1RA 5CKDA 1JEGA 1YJWA 5KYYB 3ER0A 2HAXA 4PJOB 2QXFA 2DNUA 3EGXA 1S1NA 4F14A 2RHIA 1VYVA 2RK1A 2DXUA 4JZ3A 3HRUA 2PU9B 4FYXB 5C0MA 3L2ZA 4NS5A 2FHDA 2DVEA 1OQKA 4BE2A 4E7JA 2KROA 4RTYA 4QVZA 4OGEA 4PJJA 1QVFP 4IIMA 5GAOn 4QQDA 4VUBA 3VS4A 2DXTA 1YHQQ 4FYWB 3TVTA 3PVQA 3L1AA 2KBTA 2RI2A 4HVUA 2CT3A 1VQ8T 3CCUQ 2E70A 3CCLA 2HZYA 4OB0B 4XTWA 4J9HA 3CMAQ 5D7UA 2LJ3A 4L5GA 2FZGB 2JXBA 3OBWA 3V8JA 4JZ4A 5CK9A 1GCPA 3EAEA 2DKGA 4C5GA 2DLPA 3OYGA 1ZHIA 3A8OB 5FW9A 4NL3A 3THKA 1YFNA 4ESRA 1O75A 1W1FA 1QWEA 2BUDA 1YJWQ 3BW1A 4XU2A 5D6YA 4PFOA 1VQ8A 2LQNA 1VQLT 2VB6A 4PJOD 1KC8U 2Z0WA 3OYHA 3NMZC 1WA7A 3A98A 2C0IA 4TVRA 4PJNA 2E12A 2JNGA 1M8MA 1PD0A 1ZX6A 2J06A 3FJ5A 5KYUA 3QSUA 3CCST 3S3MA 1WZOA 3EGDA 4C8QE 4BD3A 1SSFA 1RADB 3ME9A 2LNVA 2KYMA 5FU6B 2A3LA 1HSQA 4LDXA 1YP5A 2HQHA 2EVRA 4QQGA 1M1GA 4OB1B 2E3HA 2EYZA 1W70A 1CKBA 1OZ3A 2DL5A 2CP2A 3QYHB 1SHFA 2OI3A 3KFVA 4OMQA 4DBHA 4M7DC 4C92D 1M8VA 2DRMA 3OYCA 1IRXA 2VASA 4DEYA 3OW2S 1KD1C 1UB4A 1Y57A 5C6SA 3X24B 1K8AU 2HNIA 1VQ8Q 1LOJA 2QQSA 3TREA 4J8OA 1HYOA 1D3BB 1VUBA 4M78B 3JB9H 3EHRA 1IREB 2MK5A 2DVJA 3EG2A 1KIKA 3JCMW 2KGTA 1IZ6A 1FMKA 3CCVA 2FPDA 2CSIA 3AHUA 1MV0B 2X4XA 2EKOA 2O9SA 1SEMA 2P4TA 4RTZA 3L42A 2OTLA 5CKFA 4RUGA 4BDZA 2GF7A 5KYWA 1BI0A 5IHNA 3OYDA 2HKNA 1NE8A 1P92A 1Q7YR 3X26B 4F16A 1UGVA 1WHGA 3T9NA 2A37A 3DB4A 1GFDA 1VIFA 2QGFB 4KT0E 1I81A 1N9RA 1XJWB 2KRMA 3BDLA 2LMJA 1GBQA 1WHJA 2EPDA 2HBPA 1I8FA 8ATCB 2DTHA 2QYZA 3CPWA 3M0TA 4ANJA 1SRLA 3QYGB 2ED1A 1NJIC 4XU0A 4M7DF 2DM1A 1OEBA 3QDFA 1BU1A 1Z9QA 4PFPA 2MAMA 4XU3A 3VS3A 4M78D 3CCVQ 1GCQA 1AHJB 1JBMA 2DL3A 4HA8A 1S72T 4J7FA 2OTLQ 3ZL7C 1YJNT 4J9GA 4OP0A 2R5AA 2E4HA 4PJOE 1OYXA 4A53A 4BI4A 2DILA 3LX7A 3MO8A 1UDLA 5FU7C 3URGA 2XK0A 1RAHB 1WXTA 2NUZA 2CH4W 2VWFA 3M56A 3FC3A 1ACMB 3CPWS 2DXCA 2EYXA 2XHCA 2GNCA 2KE9A 3OYMA 2HBWA 4AFQC 4C0DB 2DBKA 3VS1A 3EHQA 3UPUA 4M78F 4BUGA 1IGUA 5CO7A 5HCKA 1X6GA 1I5LA 2K5IA 4GY5A 3OYJA 4J9IA 5CQXA 2SRCA 3QXEB 2YXYA 1TUCA 3MP1A 2DD4A 1OU9A 3OYEA 5LJ3g 3LYIA 3HRTA 1NYGA 3LLRA 1MNDA 2OX7A 2MIOA 4HT9A 4C92E 2WSEE 1OPKA 2P0PA 1AWJA 2H8HA 4B9WA 2LZ6B 1FX7A 1R77A 2CT4A 2VC8A 3GPLA 2EJ9A 2EBPA 3RDVA 4E2FB 2M0YA 4LN2A 3ASKA 2FZCB 4RTVA 5CR2A 4LD9K 5GAN5 3EGUA 3JB9G 3MEWA 1YWPA 2EJFA 2DBMA 2RQVA 2ROTA 2GBQA 4RTTA 2GGRA 4X9CA 3PMIA 4X1VA 2LVMA 1ZQ1A 2VYTA 1D0ZA 3QKJA 3CMEA 4E47A 4J9FA 4LUEA 1HK9A 1YBYA 4KGZB 1UFFA 4E7HA 3TEEA 1S72Q 2CKKA 2RHXA 2KRSA 2JMCA 5D6XA 3QIIA 1M90U 2PUOB 4X9DA 3OYLA 1RAIB 1VQ6T 1QKXA 3A1PA 1BB9A 2MPXC 2WACA 1WHLA 3FRNA 1K73R 1WDXA 3S6WA 2YUOA 3AT1B 2QTVA 1VQKT 2BZ8A 3BE3A 3CCRT 4M7DA 2DFUA 2AZVA 2X4JA 1NPRA 1D1AA 3QO3A 4Y91A 4ZGDB 1VQMT 5FWBA 5KH6A 3EG9A 1KK7A 1T3LA 1X27A 1V29B 1MHNA 4Y92A 2COYA 4LD6A 2R5MA 3QUIA 3JSCA 4KGXB 1Q82R 3S3NA 2HMAA 5GANg 1WX6A 5FLXE 1O9SA 5CCAA 1WJQA 2RQWA 4D8KA 3UDCA 1K9MU 3EFSA 4M78E 1KD1U 4M77B 5LJ5j 5FRNA 1M1KR 3OW2P 5GAMh 5KYUB 1PWTA 4FW2A 3EGDB 3HPWA 1VQMA 1WJRA 1PM3A 2P4RA 1EIFA 3OA6A 4FSXA 4HT8A 4C5HA 4FCYA 2IVWA 3GBQA 2MWPA 1I5OB 1D1BA 3E1SA 5EC7A 1JU5C 4HVVA 1UUEA 1OOTA 1W4SA 3CD6A 2E64A 4R0KA 4ORZA 4XTVA 4XTXA 4KRTA 3OYIA 1KFZA 4M77C 2KRNA 2ED0A 1VQNA 2F69A 4KH1B 3SFMA 2J6KA 2OJ2A 3G71T 1TWBA 2PTKA 1VA7A 2DETA 1MV3A 4II1A 1QLYA 2EFIA 2ZPBB 1OI1A 1B3QA 2MF2A 2XIDA 3TSZA 2CGHA 4J9EA 1D09B 1IGQA 1EZZB 2BIVA 2X3WD 4A4GA 2L3SA 2BZXA 2VXFA 3MPUB 1VQMQ 1PNJA 4PLLA 3ZFJA 5KCOA 3EFOB 5KYWB 1SG5A 4N4GA 5LJ3f 4FT2A 1RAGB 4ZGEB 4FM4B 1NLPC 5GJVB 3IQLA 3CD6Q 3VV0A 5LJ3j 2JUFA 2LDMA 2X4YA 2O9VA 5GANd 3VS6A 4BACA 3RMSA 2E5KA 5GAOr 2V1QA 1VQNQ 2QEXT 3ZBDA 2XDBA 3I55A 4FYVB 2HSPA 1NZ9A 4M77F 2FEIA 2KDSA 2LRQA 3FEOA 3CCUT 5GAMe 2D0QB 3EH2A 1X2KA 3HL8A 5IH2A 3CPWP 3CMAT 2JT4A 4BI8B 2KYBA 2I0NA 3HTRA 1WI7A 1DJ7B 1QCOA 5DLQE 2J7IA 3DLLA 2QEXA 8AT1B 4PK4A 2FPEA 4A54A 2G6FX 1YJWT 2V8JA 3JCMh 2QQRA 3CCET 6AT1B 2GQVA 1MMNA 3NGPA 2QDYB 2CUBA 4BE0A 2EKHA 2KT1A 4PJMA 3M4YA 3JB9I 1C1AA 1BIAA 3MHXA 1ARKA 2IPOB 5KE3A 2JS2A 3CC7A 3EG0A 4Z8AA 4FU6A 3JB9J 1KG1A 3VRZA 1X2QA 2MCNA 1M2OA 4BB7A 3VS2A 3RBBB 3E9GA 2LC4A 2ATCB 3CCEA 4AFZC 1AEYA 5L8RE 3CCLT 3UT1A 5GANf 2I2LA 4RG8A 3M57A 5IXBA 1TUGB 4LE9A 2DJZA 2BE7D 2K57A 2M16A 1GRIA 2DK3A 2RNAA 1Q82C 4WCIA 2QEXQ 2D8JA 2KI7A 4XTZA 1QWFA 3I56A 2CSQA 2RI3A 1G8XA 1M1KC 4C5IA 3ZEHA 1VQOA 1BCMA 4M7AC 3SDZA 2X9HA 1W2BS 3QJYA 3M59A 4AFUC 2RPNA 4J6WA 1OX8A 4C8QG 2M1HA 3MCAB 1JRIA 4DEXA 5CIUA 3JCMV 1T0JA 1OZ2A 2FG0A 2JOYA 3V7CA 1UEBA 2FB7A 4CC7A 3LH5A 3DKMA 3CCEQ 4J5YA 1FMWA 4ELYC 3JCMP 1YIJA 1C6VX 3CCMA 3JCMe 4M77A 1Q7YU 1M90C 2Y4YA 3H6ZA 4JPBW 3RERA 2A0FB 3OMGA 3M53A 3CXCA 3P8DA 2PVGB 4M7DB 4JLGA 3RKYA 1G5VA 4XU1A 1KHIA 1JXMA 3VUZA 3EG9B 3I56Q 1ZUKA 1VQOQ 4C92C 2JM9A 2E3IA 2VXEA 2KVQG 3CCLQ 4BY6C 3ULRB 5GAN7 2DL8A 2RA2A 4A4KA 3FIFA 2L0AA 3CC2A 1RLPC 3JAME 3OS2A 3CCVT 2DEQA 4HCCA 1VQPT 4JJDA 3QBYA 1YCYA 3JRZA 3MEVA 2OTLT 4L59A 2YSQA 1K9MC 3J7AF 1R0CB 4OVAA 2NLUA 2EQIA 2O4XA 1RABB 3NHNA 2F2VA 3SB2A 3L2UA 1XTDA 1YIJQ 3NTHA 3CCMQ 2AZSA 4ATOA 3P8BB 3F70A 1A0NB 4M75C 3E9FA 1OULA 2P0KA 4DBRA 1K4US 1VQPA 1KQ2A 2EAYA 2EJGA 1NEGA 2E6ZA 3P8HA 1QCFA 2YT6A 2P84A 3WXMB 1M3BA 1QQJA 4F7UG 4M7DD 5IAYA 4C5EA 5L23A 3EFOA 1HJDA 3CBPA 4FL6A 2RD1A 2EQUA 3BY7A 3OYBA 2F2XA 2LQWA 2RMOA 1I0CA 1Q81R 2LQ8A 3VYHB 4M7AG 1OU8A 3CC2Q 1BIBA 2RJDA 1D0YA 2MI6A 2C0TA 1AT1B 2K79A 1PKSA 2YRVA 4PJOG 3PT9A 1Y96B 4E7ZA 3H0HA 2EIFA 2COZA 3KXTA 1PRMC 1G3WA 3G1JA 4LDWA 5J26A 3PGGA 5KYNA 3JB9D 3REAB 5FU7B 3OYAA 4LNPA 5GMKj 1ZLMA 2JMAA 2W10A 2CP3A 1JJ2A 1WQ7A 1UJ0A 5LJ5h 3NFCA 1SSHA 3R6OA 2FVUA 3M0PA 1PD1A 4V2SA 1PRLC 2YUNA 1Y0MA 1E6GA 1VQPQ 3TU4K 5GAN4 2CP0A 2XDPA 2OTJT 2CDTA 4ZTFA 2C06A 1D1CA 2IG0A 1LCKA 2COWA 1HD3A 1EFNA 2L5QA 2LX9A 1RAAB 1UECA 2DD5A 1PKTA 1SF9A 4C92G 2ZCFB 5I2SA 4GBQA 1K73U 4EMKC 3UWNA 3JB9F 2EGCA 4ZGJB 4AT1B 1H8KA 3H0IA 3REBB 1WPYA 4HCZA 5HK0A 4JJNK 5EG2A 4F7UA 4K11A 2BE9B 2LT1A 1NG2A 2ZZDA 2OTJA 3V8KA 3QWXX 1QP3A 2FRYA 1MUZA 4X34A 4NL2A 3META 3CCQT 4XTYA 4M7AA 4O6JA 4Z88A 1MNEA 2KMTA 1Q82U 1M2VB 2L2PA 5FRMA 1ZSZC 1GXIE 2F5KA
chains in the Genus database with same CATH topology
2RO0A 4C8QA 5GAMj 2XG8D 4M77G 3CCSA 3C94A 3G6ET 4LDVA 1KHCA 1W2BA 3QG1A 2HQXA 2XI9A 2F69A 3CMET 1M1KU 1VQNA 1G3TA 5CKDA 5FU6C 3SFMA 4M75G 4ZN3A 3QDRB 1YJWA 3ER0A 3G71T 2HAXA 4PJOB 2QXFA 3QHSA 1VQ5T 2RHIA 4JUVA 5GMKe 2RK1A 3PMTA 2DTIA 5CKHA 4A4HA 2DXUA 3S3OA 2LT4A 4RCCA 4II1A 2QQBA 2D9TA 3HRUA 2FYKA 1N8RC 2GFAA 3TCJA 2PU9B 4JLIA 1UGSB 2K3XA 2EFIA 5C0MA 2ZPBB 3CCQA 1OI1A 3M54A 2MF2A 2XIDA 4NOYA 3L2ZA 4NS5A 3V7RA 1N9SA 2FHDA 2CGHA 2DVEA 1I4K1 4MZMA 4CRIA 4BE2A 4E7JA 4KULA 5LJ3h 4FT4A 2BIVA 4XK8E 5I2MA 4QVZA 4OGEA 4A4GA 2PVDB 2CZ7B 5GAOn 4QQDA 4VUBA 2VGMA 2VXFA 4FIBA 2DXTA 3RIRA 4C92F 2MMPA 3JCMX 2E10A 3OQ5A 1LNXA 4M7DE 1N27A 3VKIA 4PLLA 3L1AA 5M9OA 2RI2A 3ZFJA 1RI0A 5GAOl 4M75D 1VQ8T 1VQ5A 3MEUA 5KCOA 2E65A 5HKCA 2E70A 5LJ5e 3CCLA 4OB0B 5LJ5g 2WSCE 4N4GA 4XTWA 5LJ3f 4CI0C 1VQ7A 2XD0A 2E1HA 4FT2A 4PNOA 4M78C 4BE1A 4ZGEB 1Y07A 4FM4B 4L5GA 3OBWA 4IKFA 4L6V5 3V8JA 5CK9A 5GAN6 3EAEA 4PLIA 3VV0A 5LJ3j 2DKGA 4C5GA 4PKCC 3OYGA 2JUFA 2LDMA 1ZHIA 2DXBA 2X4YA 3V8LA 5GANd 4EMKB 4MDWA 4BACA 1RL2A 3A8OB 3DLMA 3RMSA 4NL3A 3LGFA 2OAUA 5GAOr 2JTFA 3GNGA 4OMFB 1WNLA 3ZBDA 2QEXT 2XDBA 1O75A 3C12A 4BI3A 3I55A 4A4FA 4EPCA 2BUDA 3MP6A 3BW1A 3CBMA 4XU2A 2YHTA 5D6YA 4QVDA 1M5Q1 1NZ9A 4M77F 4F7UE 4EDUA 2JZ2A 3BFMA 4QVCA 1VQ8A 2KDSA 3SWNA 1VQLT 2LRQA 2YLBA 3VUBA 3FEOA 3A8HB 3CCUT 5GAMe 4PJOD 2D0QB 3CC4T 2VUBA 3HL8A 2P0QA 1KC8U 4M75F 2RJFA 3CMAT 3QJ6A 4BI8B 3OYHA 3FLGA 4O5VA 4TVRA 3OYKA 3J81E 3LGLA 2E12A 4M7AE 3CD6T 1DJ7B 2JNGA 5DLQE 3DLLA 3QSUA 4M75A 3CCST 2RHUA 3S3MA 2RJCA 2R58A 2KK4A 4C8QE 3QZ5B 2QEXA 4Q5WA 1VQNT 3CCJT 4BD3A 2DZ9A 2E41A 1SSFA 4A54A 3ME9A 2LNVA 4N4IA 5GAOp 2Y90A 2A3LA 5FU6B 2V8JA 1YJWT 3JCMh 4LDXA 1R8OB 2DAQA 2QQRA 3SD4A 3OS0A 4BDYA 1Q7YC 2R57A 3CCET 4QQGA 4MDXA 1ZBXA 2GQVA 2ZPFB 3GNFB 3CC2T 1M1GA 4OB1B 2QDYB 1JJ2S 3CC4A 1G3SA 4IUQA 3RESA 2ZGWA 5GMKm 4LDUA 1KQSA 4BE0A 1FXXA 1PSFA 4J6XA 1OZ3A 4JRQA 3M4YA 3JB9I 2M0OA 3QYHB 1U1SA 2BKDN 1BIAA 3CPFA 3MHXA 4J7IA 1U8RA 5KE3A 3CC7A 4M7DC 4C92D 1N8RU 4FU6A 5A0GA 3OYCA 2K3YA 4IUPA 3JB9J 3A8GB 1S72A 1Q86C 1KG1A 4M7DG 1H3ZA 1YJNA 4PJOA 3G4SA 3CCJA 3Q1JA 3OW2S 1KD1C 5KCHA 1UB4A 4BB7A 5C6SA 1U1TA 3X24B 3DB3A 3PIPA 5LJ3e 1K8AU 1UGPB 2HNIA 3OS1A 3HFNA 3C4SA 4JRPA 3E9GA 2LC4A 1LOJA 2FL7A 3CCEA 2QQSA 2O4XB 1GXIE 5L8RE 3TREA 4J8OA 4N0AA 3OS5A 5CKBA 3UT1A 3CCLT 1WGSA 5GANf 1VQ7T 3LWHA 3OSSC 1QVFA 1D3BB 1TH7A 1VUBA 2I2LA 3A8LB 4M78B 3J80E 1YITA 3JB9H 4RG8A 3M57A 1YJ9A 1IREB 2K5LA 2DJZA 5J39A 3O8VA 5LJ5d 4JDSA 3PNWC 5GAN2 3JCMW 3V7SA 1IZ6A 2K57A 3GOXA 3CCVA 2KQWA 4C0DC 3AHUA 2X4XA 2EKOA 2M16A 1KQ1A 2DK3A 3LWIA 2P4TA 1HXDA 1Q82C 4E7IA 2DTOA 1Y71A 3L42A 2XDDA 4MZPA 4M77D 5A2QE 3I55T 5CKFA 2OTLA 1KQSS 1Y96A 4BDZA 2GF7A 4XTZA 2RK2A 4JRKA 3I56A 1BI0A 1H641 1WQWA 2WSFE 2RI3A 2LQKA 1M1KC 4C5IA 3ZEHA 1VQOA 4LDYA 3OYDA 1NE8A 4M7AC 1P92A 5FROA 3SDZA 4C92A 4OGCA 2ZPIB 3X26B 1W2BS 3T9NA 3CBOA 2K4YA 4M78G 3DB4A 3QJYA 2QA4A 4EMKA 5LL6S 1VIFA 4KT0E 4C8QC 5GAMd 3M59A 3L2RA 1I81A 1N9RA 2Y4XA 4EMGA 2E5QA 4J6WA 5DY9A 3BDLA 2M1HA 2B8AA 4C8QG 3L2WA 3MCAB 1JRIA 2HBPA 3KUFA 5CIUA 3JCMV 1I8FA 2V8IA 4M75E 2DTHA 1QVFS 3CPWA 1OZ2A 2QQAA 2JOYA 3QYGB 4WF2A 3V7CA 4ELZC 1UEBA 2FB7A 1NJIC 4XU0A 4XTUA 1YI2A 3DKMA 4Z02A 4M7DF 2E6NA 2PVOB 2LCCA 4IUVA 4J5YA 4N4HA 3JCMc 1NPPA 2LTOA 2DIQA 2GFUA 2X35A 4ELYC 5GAMg 3JCMP 4IURA 1B34A 5HY6A 1JB0E 1YIJA 3VYGA 2MAMA 3WVEB 3CCMA 1BI2A 3BDUA 3JCMe 2ZPHB 4M77A 3HHTB 3MEAA 4XU3A 2VGNA 3JCMg 2RI5A 1Q7YU 1M90C 3EFRA 2Y4YA 3H6ZA 4M78D 3RERA 1AHJB 1JBMA 3OMGA 3M53A 3CC7T 4HA8A 3CXCA 1M1FA 4JRIA 3P8DA 2PVGB 4IUUA 4M7DB 1S72T 4JLGA 4J7FA 3RKYA 2MWOA 1G5VA 2X4WA 4XU1A 1KHIA 1YJNT 1WJSA 4OP0A 3G4ST 4EMHA 3VUZA 2R5AA 3M58A 1M4ZA 1Q81C 4PJOE 1OYXA 5GAOm 4A53A 1VQ6A 4BI4A 2EQKA 3H8ZA 4XAXB 5LJ5f 4HCBA 3LX7A 4C92C 3MO8A 2VXEA 3GP8A 5FU7C 3URGA 2KVQG 4C0FA 4BY6C 2XK0A 5AYFA 1G3YA 1VQKA 4RG2A 2CYZB 2DO3A 2LCLA 5GAN7 5GAN3 5LJ3d 3M56A 5IN1A 3FC3A 1YITT 4KUIA 4KUDK 2RA2A 4A4KA 2F5TX 3FIFA 3CPWS 2JVVA 1YJ9T 2DXCA 3GLXA 4OB3B 3CC2A 2XHCA 3CCRA 4RMOA 3JAME 1KC8C 1FWZA 3OS2A 3CCVT 2DEQA 5A0DA 5GANh 3OYMA 5IT9E 3GIBA 4HCCA 1VQPT 4C0DB 2RM4A 2QQ9A 3QBYA 3UPUA 5CVIA 1YCYA 4M78F 3JRZA 1MGQA 2XICA 4BUGA 3MEVA 5CO7A 4F7UB 3JCMQ 2OTLT 4L59A 1I5LA 1K9MC 1K73C 2PUKB 2K5IA 3WVDB 3HSBA 3J7AF 4E7KA 2QTXA 4GY5A 1M8VA 4OVAA 2NLUA 4C8QF 3OYJA 2O4XA 2G3RA 5CQXA 3QXEB 2KAFA 3SWNC 3MP1A 2DD4A 3QPHA 3I56T 3M5AA 4RCBA 4ZTJA 1QVGA 5GAN8 3OYEA 3SB2A 3MP8A 5LJ3g 3LYIA 3HRTA 1D3BA 3L2UA 1VQOT 1XTDA 2DZCA 4M78A 1BI1A 4GLKA 2EYQA 2A7YA 3LLRA 1QW1A 4M7AB 3NTHA 2V8KA 3M4GA 4ATOA 4Y28E 4HT9A 4C92E 2K5FA 3G7ZA 1BYMA 3P8BB 2QA4T 3F70A 3QZ9B 2WSEE 2EQJA 2P0PA 5GANj 3OYYA 4M75C 4RKUE 3E9FA 4J6YA 4B9WA 2P0KA 4C8QB 1FX7A 2VV5A 4OF1A 1VQ9T 2VC8A 5DLOA 3GPLA 2EJ9A 3INZA 1UGQB 1VQPA 1KQ2A 2EAYA 2EJGA 2CS7A 2E6ZA 3P8HA 4IUTA 3RUXA 3M9QA 3ASKA 5D6WA 4QQ6A 3WXMB 3X25B 3VU3C 4F7UG 5KE2A 4M7DD 1X01A 5IAYA 5CR2A 4C5EA 2XKOC 4LD9K 2RHZA 1X75C 3CBPA 4FL6A 5GAN5 2RD1A 3JB9G 2H3JA 2HD0A 3MEWA 2EQUA 3BY7A 1YI2T 2EJFA 2D6FA 3OYBA 3GF5A 3L2VA 4JS5A 2ZPGB 4ZN1A 1UGRB 2K2VA 3E19A 3CEYA 4X9CA 2LQ8A 3N5BB 4DA4A 3PMIA 3VYHB 2LVMA 1ZQ1A 1BI3A 3OB9A 2O01E 1YIJT 1XOVA 1K8AC 4M7AG 2VYTA 2DPPB 3HRSA 3RKXA 5GMKh 3CCMT 1NJIU 3G6EA 1BIBA 3QKJA 1BKBA 2RJDA 3CMEA 2HQEA 2MI6A 3RKWA 1HK9A 1YBYA 4E47A 2RH2A 4M77E 1QVGS 3FDRA 4MZTA 5J3BA 5HK3A 4E7HA 3TEEA 1VQ9A 4PJOC 2CKKA 3LH0A 3G71A 2XU8A 3FB9A 2YRVA 2RHXA 3JCMd 3PTAA 4PJOG 3PT9A 1Y96B 2L89A 5D6XA 3QIIA 1M90U 1QVPA 2EIFA 2PUOB 4X9DA 3OYLA 2RB6A 2AHJB 3OMCA 2JN0A 4MMKA 1VQ4T 1VQ6T 3KXTA 1G3WA 2CZ0B 4N0AC 3KBGA 4LDWA 3OYFA 2DIGA 2WACA 5J26A 5GMKl 3PGGA 3FRNA 4C92B 3JB9D 3S6WA 4C0GA 4B9XA 5FU7B 1Y7XA 4YTLA 3OYAA 4BY6B 5CAIA 1VQKT 5GMKj 4DOWA 4ME7A 5CKEA 4R55A 1Q81U 5I21A 1JJ2A 1WQ7A 3FJPA 2EQMA 5LJ5h 3NFCA 3R6OA 3OYNA 3JCMJ 2JTMA 2FVUA 3OSVA 2RHYA 3CCRT 5GAOq 2X4JA 1NPRA 4P5NA 4M7DA 4V2SA 3NTIA 4E7LA 3QO3A 4Y91A 1YHQT 1QP2A 3HP9A 3PFSA 4ZGDB 3TU4K 1VQMT 5KH6A 1LJOA 3RMQA 1XQHA 5GAN4 3JCMb 2XDPA 4C8QD 2OTJT 1V29B 3A5ZB 4HKEA 3X20B 5DM7R 1MHNA 2EWNA 4PL6A 4LD6A 4D6WA 2QI2A 2KSSA 4KBMB 2R5MA 3QUIA 4ZTFA 4QW2A 1X6OA 2L8DA 2RJEA 3JSCA 4MMLA 2ZPEB 2C06A 1VQ4A 2IG0A 3OW2A 3SWNB 2CZ6B 5GANe 3S3NA 5GANg 5FLXE 3OY9A 2L5QA 2LX9A 1O9SA 1B34B 2GCXA 5CCAA 1Q86U 2DD5A 4M7AD 1N6AA 1WJQA 4C92G 2ZCFB 4F7UF 5I2SA 3C95A 3UDCA 1K9MU 1K73U 3EFSA 4M78E 1KD1U 4EMKC 4M77B 3CD6A 3UWNA 5LJ5j 3JB9F 5FRNA 4ZGJB 2KY9A 3X28B 4J83A 5GAMh 5CQYA 3OBYA 1WPYA 2M9UA 4M75B 4HCZA 5HK0A 4JJNK 2PQWA 4UC4A 5EG2A 4F7UA 3HPWA 3VJPA 1YHQA 1VQMA 3A8MB 1WJRA 3LW5E 4JS4A 4M7AF 1VIEA 2LT1A 1EIFA 2ZZDA 3OA6A 4OB2B 4FSXA 3HKSA 4DQ2A 5A0LA 3V8KA 4HT8A 4C5HA 2OTJA 1QP3A 1VQLA 3CCUA 4R56A 2IVWA 2MWPA 1M9SA 3NTKA 4A4EA 3L2QA 4X34A 4NL2A 3META 4XQ3A 3CMAA 3CCQT 3HFOA 4XTYA 4M7AA 3E1SA 3M55A 4O6JA 1PSEA 4PJOF 4DOVA 2KMTA 5GAMf 2CZ1B 1Q82U 3CXCS 2YLCA 1W4SA 5GMKi 2E64A 3PIOA 5FRMA 4C0ZA 4XTVA 4XTXA 3OYIA 1XNIA 4M77C 3JCMf 2F5KA 2L3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q A;  4XU0 A;  4XTU A;  5GAM j;  4X9C A;  2DZ9 A;  2E41 A;  4M77 G;  4M7D F;  4A54 A;  4J5Y A;  5GAO p;  2Y90 A;  3JCM c;  4M7A G;  3JCM h;  5GMK h;  3RKX A;  5GAM g;  3JCM P;  1BIB A;  1B34 A;  4M75 G;  4PJO B;  3RKW A;  1HK9 A;  3BDU A;  3QHS A;  4M77 E;  3JCM e;  4JUV A;  4M77 A;  4XU3 A;  3RES A;  2DTI A;  3JCM g;  2ZGW A;  2DXU A;  5GMK e;  4PJO C;  3EFR A;  5GMK m;  4RCC A;  4M78 D;  3FB9 A;  3RER A;  4J6X A;  3JCM d;  4PJO G;  1JBM A;  2FYK A;  1Y96 B;  3JB9 I;  4HA8 A;  4JLI A;  4JRI A;  1U1S A;  4M7D B;  3RKY A;  1BIA A;  4X9D A;  4C8Q E;  2RB6 A;  4XU1 A;  4NOY A;  2JN0 A;  4MMK A;  4M7D C;  3L2Z A;  3V7R A;  4OP0 A;  1N9S A;  4C92 D;  4EMH A;  1M8V A;  4N0A C;  2CGH A;  3JB9 J;  2DVE A;  1I4K 1;  4M7D G;  5GMK l;  3PGG A;  5LJ3 h;  4PJO E;  4C92 B;  5GAO m;  4A53 A;  3JB9 D;  4PJO A;  5LJ5 f;  5CAI A;  4C92 C;  2VXE A;  5GMK j;  1U1T A;  5GAO n;  2VXF A;  3JCM X;  2DXT A;  3RIR A;  2HNI A;  1WQ7 A;  4C92 F;  2E10 A;  3FJP A;  3HFN A;  1LNX A;  5I21 A;  5LJ5 h;  4M7D E;  4M7A D;  1LOJ A;  3JCM J;  4M7D A;  5GAN 7;  5GAN 3;  5GAO q;  3L1A A;  5LJ3 d;  4V2S A;  5LJ3 e;  4N0A A;  2RA2 A;  5GAO l;  3FIF A;  5GAN f;  4M75 D;  3QO3 A;  4Y91 A;  2E65 A;  1D3B B;  1TH7 A;  2I2L A;  5LJ5 e;  1LJO A;  4M78 B;  5GAN 4;  3JB9 H;  5LJ5 g;  3JCM b;  4XTW A;  4C8Q D;  5LJ3 f;  2DEQ A;  5GAN h;  2E1H A;  2EWN A;  4PNO A;  2DJZ A;  3GIB A;  4M78 C;  5LJ5 d;  2RM4 A;  3QUI A;  5GAN 2;  3JCM W;  3V7S A;  1YCY A;  2K57 A;  4M78 F;  3V8J A;  1MGQ A;  4MML A;  5GAN 6;  3JCM Q;  4F7U B;  3AHU A;  1I5L A;  1KQ1 A;  3SWN B;  2DKG A;  5GAN e;  5LJ3 j;  3HSB A;  1HXD A;  5GAN g;  2QTX A;  2DTO A;  4C8Q F;  3V8L A;  3SWN C;  1B34 B;  5GAN d;  4M77 D;  4EMK B;  4RCB A;  4C92 G;  4F7U F;  4NL3 A;  5GAN 8;  3SB2 A;  1Y96 A;  5LJ3 g;  3EFS A;  4M78 E;  5GAO r;  1D3B A;  1WNL A;  2DZC A;  4M77 B;  4JRK A;  4M78 A;  4XTZ A;  4EMK C;  5LJ5 j;  3JB9 F;  1H64 1;  1WQW A;  4M7A B;  3BW1 A;  4XU2 A;  5GAM h;  2YHT A;  1WPY A;  3M4G A;  1M5Q 1;  4QVD A;  4HT9 A;  4M77 F;  4C92 E;  4M75 B;  4F7U E;  4M7A C;  4QVC A;  3BFM A;  4C92 A;  4F7U A;  3SWN A;  4M7A F;  2YLB A;  5GAN j;  4M75 C;  5GAM e;  4PJO D;  4J6Y A;  4C8Q B;  4M78 G;  4HT8 A;  4DQ2 A;  4M75 F;  3V8K A;  2VC8 A;  4EMK A;  2EJ9 A;  3INZ A;  1KQ2 A;  5GAM d;  4C8Q C;  2EAY A;  1I81 A;  2EJG A;  1N9R A;  4EMG A;  4J6W A;  5DY9 A;  3V7C A;  4C8Q G;  3RUX A;  4NL2 A;  4XQ3 A;  4M7A E;  1JRI A;  3VU3 C;  3HFO A;  4XTY A;  4F7U G;  1X01 A;  4M7A A;  4M7D D;  4PJO F;  5GAM f;  3JCM V;  1I8F A;  4M75 E;  2DTH A;  5GAN 5;  2RD1 A;  4M75 A;  2YLC A;  3JB9 G;  3QSU A;  3BY7 A;  2E64 A;  5GMK i;  2EJF A;  4XTV A;  4XTX A;  4M77 C;  4WF2 A;  3JCM f;  2FB7 A; 
#chains in the Genus database with same CATH topology
 2DRK A;  1IXD A;  2HQX A;  2KR3 A;  3CME T;  1M1K U;  1G3T A;  1OV3 A;  2ABL A;  3I5R A;  2K7A A;  4M75 G;  4ZN3 A;  1PCX A;  3QHS A;  1VQ5 T;  4A4H A;  2DTI A;  3PE0 A;  1GL5 A;  2C0O A;  4RCC A;  1W2B P;  1WYX A;  1AZE A;  2QQB A;  2FYK A;  2GFA A;  3TCJ A;  4JLI A;  2GTO A;  3CCQ A;  1AD5 A;  3U23 A;  2MOX A;  2DE0 X;  4WTO B;  1NBE B;  4KUL A;  5LJ3 h;  4FT4 A;  4XK8 E;  2DMO A;  2VGM A;  4FIB A;  2MMP A;  2E10 A;  1LNX A;  4M7D E;  1N27 A;  2EYY A;  5M9O A;  1RI0 A;  2A08 A;  2DEU A;  1MMA A;  2OTJ Q;  1VQ5 A;  3MEU A;  1G83 A;  5HKC A;  5LJ5 e;  2FO0 A;  1JQQ A;  4CI0 C;  1VQ7 A;  2XD0 A;  1BK2 A;  4BE1 A;  1M3C A;  1Y07 A;  4IKF A;  4L6V 5;  1UHF A;  4HVW A;  4PLI A;  1K0X A;  4PKC C;  2QAS A;  2DXB A;  1V1C A;  4MDW A;  1RL2 A;  3DLM A;  3LGF A;  1VYU A;  2OAU A;  2RQU A;  5FWC A;  1WNL A;  4BI3 A;  4EPC A;  3MP6 A;  3CBM A;  2YHT A;  4EDU A;  4QVC A;  1U3O A;  3UAT A;  3CC4 T;  2VUB A;  3E2U A;  3CCQ Q;  4J9C A;  4QKU A;  1AWX A;  1X43 A;  4O5V A;  3J81 E;  3LGL A;  3CD6 T;  4HCK A;  2JW4 A;  4F04 B;  4M75 A;  2RHU A;  2K6D A;  2RJC A;  2R58 A;  2KK4 A;  3CME Q;  4Q5W A;  1VQN T;  3CCJ T;  4LUD A;  4KGV B;  1NEB A;  5GAO p;  1Q95 G;  1K0S A;  2DAQ A;  3OS0 A;  1Q7Y C;  1VQ5 Q;  2R57 A;  4MDX A;  1VQ7 Q;  1WHK A;  3H41 A;  2ZPF B;  4CC3 A;  1IHW A;  3CC4 A;  1G3S A;  5IHK A;  4IUQ A;  1KQS A;  1PSF A;  2ECZ A;  1FMV A;  1ZA2 B;  1E7O A;  1U1S A;  1KJW A;  3CPF A;  2K3B A;  2CUD A;  1N8R U;  2KEA A;  2K3Y A;  4AG2 C;  1OX9 A;  1F1B B;  3G4S A;  3CCJ A;  3Q1J A;  1LVK A;  1Z9Z A;  1U1T A;  5KYX B;  5LJ3 e;  3QWY A;  3C4S A;  2FL7 A;  1WHH A;  2O4X B;  1M3A A;  1TOV A;  3OS5 A;  1WGS A;  3OSS C;  1TH7 A;  1YIT A;  1YJ9 A;  1TS9 A;  5J39 A;  3O8V A;  4JDS A;  3GOX A;  2KQW A;  1WLP B;  1KQ1 A;  1HXD A;  1TXQ A;  2RN8 A;  1AZG B;  4M77 D;  3I55 T;  1KQS S;  1Y96 A;  2HSE B;  1WQW A;  1J3T A;  1RLQ C;  1TSF A;  2LQK A;  4GLM A;  3I35 A;  4LDY A;  1M27 C;  3CC4 Q;  5FRO A;  4OGC A;  2ZPI B;  2QA4 A;  1WIE A;  4EMK A;  2AKK A;  5GAM d;  4C8Q C;  4EMG A;  2NUP B;  2CP7 A;  3KUF A;  2AK5 A;  2V8I A;  3G4S Q;  3CCJ Q;  1QCN A;  4ELZ C;  2RQT A;  1YI2 A;  2PVO B;  2LCC A;  4IUV A;  4N4H A;  2NUT A;  2LTO A;  2GFU A;  2X35 A;  1T0H A;  3WVE B;  1YJ9 Q;  1BI2 A;  1ZSZ A;  3BDU A;  3HHT B;  3MEA A;  3JCM g;  2VGN A;  2RI5 A;  3UA7 A;  1K1Z A;  1N8R R;  2X51 A;  3CC7 T;  4CC4 B;  4IUU A;  4JJC A;  3TSW A;  2O88 A;  1I07 A;  3M0Q A;  1VOM A;  4FSS A;  3M58 A;  1M4Z A;  5GAO m;  3H8Z A;  1TUD A;  4C0F A;  1GFC A;  5AYF A;  1G3Y A;  2CYZ B;  1M2V A;  2DO3 A;  5IN1 A;  4KUD K;  4KUI A;  2QA4 Q;  3VS7 A;  2JVV A;  4OB3 B;  5IT9 E;  3GIB A;  2QQ9 A;  4IIO A;  4OML A;  1MGQ A;  2XIC A;  4F7U B;  3I55 Q;  1K73 C;  2PUK B;  3HSB A;  4E7K A;  2QGG A;  4C8Q F;  3SWN C;  2KAF A;  1YI2 Q;  3I56 T;  4ZTJ A;  3M5A A;  4RCB A;  1WXU A;  1QVG A;  5GAN 8;  3MP8 A;  1VQO T;  4E6R A;  1K76 A;  2DZC A;  4GLK A;  1QW1 A;  4M7A B;  1NJI R;  3M0R A;  3M4G A;  4OMO A;  3G7Z A;  2HCK A;  2EQJ A;  2NYS A;  2W0Z A;  5GAN j;  3OYY A;  4OF1 A;  1VQ9 T;  4AG1 C;  2CP5 A;  1UGQ B;  1ZA1 B;  2CS7 A;  3RUX A;  3M9Q A;  5D6W A;  1RAC B;  5KE2 A;  2A36 A;  2XKO C;  3D7S B;  2RHZ A;  1X75 C;  2D6F A;  2H3J A;  2HD0 A;  3GF5 A;  2RF0 A;  4JS5 A;  1UGR B;  2K2V A;  3E19 A;  3N5B B;  1D0X A;  1YIJ T;  2O01 E;  1XOV A;  2DYB A;  5GMK h;  3CCM T;  3G6E A;  2RQR A;  1ABQ A;  2MYS A;  3RKW A;  1SHG A;  1QVG S;  2RH2 A;  4M77 E;  3CC7 Q;  3FDR A;  1VQ9 A;  4PJO C;  1CSK A;  3LH0 A;  3R6N A;  2XU8 A;  4PJL A;  3JCM d;  3PTA A;  2JM8 A;  2L3P A;  1QVP A;  3OMC A;  1B7T A;  2AHJ B;  2OAW A;  2RB6 A;  4MMK A;  1VQ4 T;  1Q86 R;  4N0A C;  3OYF A;  2DIG A;  3RNJ A;  4C92 B;  3NPF A;  4RTW A;  4ZNX A;  4YTL A;  1N5Z A;  1YNZ A;  4BY6 B;  2YUQ A;  1OPL A;  4ME7 A;  4R55 A;  1Q81 U;  4F17 A;  2EQM A;  2IIM A;  1C0M A;  3OYN A;  3CC2 T;  4M7A D;  3OSV A;  5GAO q;  4P5N A;  1IB8 A;  4E7L A;  3H9N A;  3SHW A;  3HP9 A;  3PFS A;  1H3H A;  1AOJ A;  1LJO A;  3RMQ A;  1XQH A;  4AFS C;  3JCM b;  7AT1 B;  4HKE A;  5DM7 R;  2EWN A;  2KXD A;  4D6W A;  2QI2 A;  2KSS A;  4KBM B;  4QW2 A;  1X6O A;  1X6B A;  2L8D A;  2RJE A;  1NLO C;  5ECA A;  2ZPE B;  1VQ4 A;  3OW2 A;  3VS5 A;  4FW1 A;  2QDL A;  2GCX A;  1FYN A;  1B34 B;  1SKU B;  2AIR B;  2F2W A;  4F7U F;  1NYF A;  3C95 A;  3H0F A;  2QG9 B;  2LP5 A;  1MMD A;  1R0B G;  3VRY A;  3G6E Q;  4JJB A;  4FYY B;  5CQY A;  3SEM A;  2M9U A;  4M75 B;  1VQ9 Q;  4UC4 A;  4M7A F;  2A28 A;  3LW5 E;  1VIE A;  3M0U A;  1M30 A;  3HKS A;  5A0L A;  5KYX A;  1H92 A;  1VQL A;  4CC2 A;  3NTK A;  1M9S A;  3L2Q A;  4XQ3 A;  1I1J A;  4PJO F;  3CXC S;  3PIO A;  2J6O A;  3JCM f;  3QDR B;  3GNF B;  2BZY A;  2RO0 A;  2L3R A;  4C8Q A;  3CCS A;  3C94 A;  4LDV A;  1KHC A;  1KQS P;  2XI9 A;  4RTX A;  4HXJ A;  5FU6 C;  1RI9 A;  3O5Z A;  2K9G A;  1UJY A;  4JUV A;  5GMK e;  3S3O A;  3PMT A;  5CKH A;  2JS0 A;  9ATC B;  2LT4 A;  2YUP A;  2CRE A;  1IHV A;  2D9T A;  2KT8 A;  1N8R C;  1VQ4 Q;  1B07 A;  2D8H A;  3MKD A;  1UGS B;  2K3X A;  3EG3 A;  3M54 A;  4NOY A;  3V7R A;  1N9S A;  1YCS B;  2DX1 A;  4MZM A;  1I4K 1;  4CRI A;  2QK0 A;  3UF4 A;  1X69 A;  5I2M A;  1RAF B;  1K9A A;  2NUP A;  5GJW B;  3CQT A;  2PVD B;  2CZ7 B;  2J6F A;  3JCM X;  1TTH B;  3RIR A;  4C92 F;  3OQ5 A;  2ENM A;  3VKI A;  5I22 A;  2YDL A;  5GAO l;  4M75 D;  1VQL Q;  1QKW A;  1V76 A;  2E65 A;  1KC8 R;  5LJ5 g;  2WSC E;  2E1H A;  4PNO A;  4M78 C;  1TU0 B;  2EGA A;  5GAN 6;  2KXC A;  1ABO A;  2D0N A;  1CKA A;  3M0S A;  3V8L A;  2HDA A;  2FRW A;  3CCS Q;  4EMK B;  2YWW A;  2JTF A;  3GNG A;  3C12 A;  4A4F A;  4QVD A;  1M5Q 1;  4F7U E;  2JZ2 A;  3BFM A;  3SWN A;  2HL3 A;  2YLB A;  3VUB A;  3A8H B;  2P0Q A;  4M75 F;  2RJF A;  3QJ6 A;  1SRM A;  2NUT B;  3FLG A;  4DBF A;  2M02 A;  1TG0 A;  3OYK A;  4M7A E;  1ZSZ B;  2VVK A;  3QZ5 B;  1W6X A;  2DZ9 A;  2DYI A;  2E41 A;  1K8A R;  4N4I A;  2Y90 A;  1R8O B;  3SD4 A;  4BDY A;  2D1X A;  1RAE B;  1ZBX A;  1JJ2 S;  3RES A;  2ZGW A;  5GMK m;  4LDU A;  1FXX A;  4J6X A;  1KSW A;  4JRQ A;  1ZBJ A;  3I9Q A;  4A63 B;  2M0O A;  2BKD N;  2PZ1 A;  1U8R A;  4J7I A;  2CP6 A;  2JTE A;  1IO6 A;  5A0G A;  4IUP A;  4OMM A;  3A8G B;  1S72 A;  1Q86 C;  2EYW A;  4M7D G;  2K2M A;  5KYY A;  1H3Z A;  1YJN A;  4PJO A;  3JV3 A;  5KCH A;  1ZSG A;  1ZUU A;  3DB3 A;  3PIP A;  1UGP B;  3OS1 A;  3HFN A;  4JRP A;  4PFZ A;  1BBZ A;  5CKB A;  4N0A A;  1VQ7 T;  3LWH A;  4OMP A;  1QVF A;  3C0C A;  3A8L B;  3J80 E;  2K5L A;  1QVG P;  5LJ5 d;  2FPF A;  3PNW C;  5GAN 2;  3V7S A;  2EGE A;  4M4Z A;  4C0D C;  3LWI A;  4OMN A;  4RTU A;  2DTO A;  2HKQ B;  4E7I A;  1Y71 A;  2XDD A;  4MZP A;  5A2Q E;  3MJX A;  3EGX B;  2RK2 A;  4JRK A;  3I5S A;  1H64 1;  2WSF E;  1RUW A;  2H3E B;  2EW3 A;  1VYT A;  4QT7 A;  2DF6 A;  2ROL A;  4C92 A;  1WFW A;  3PVL A;  3CBO A;  2K4Y A;  4M78 G;  1UTI A;  5LL6 S;  3L2R A;  3VS0 A;  2Y4X A;  2E5Q A;  5DY9 A;  1PC0 A;  3EH1 A;  2B8A A;  3L2W A;  4KH0 B;  1YJN Q;  2HEQ A;  4M75 E;  1QVF S;  2DL4 A;  2QQA A;  1UG1 A;  2ZAE A;  4WF2 A;  4XTU A;  3TQ7 P;  4Z02 A;  2E6N A;  1G2B A;  2GTJ A;  3JCM c;  1NPP A;  4E7S A;  2J05 A;  2DIQ A;  2LJ0 A;  5GAM g;  4IUR A;  1B34 A;  5HY6 A;  1JB0 E;  2JJ9 A;  2B86 A;  3VYG A;  2VKN A;  2ZPH B;  3EFR A;  1AVZ C;  1U5S A;  4DBQ A;  1M1F A;  4JRI A;  5I11 A;  2MWO A;  2X4W A;  1WJS A;  3G4S T;  2NWM A;  4EMH A;  1Q81 C;  1UE9 A;  1VQ6 A;  4J9D A;  2EQK A;  4XAX B;  3CXC P;  1LPL A;  5LJ5 f;  1GBR A;  4HCB A;  3EG1 A;  3GP8 A;  1VQK A;  2DL7 A;  4RG2 A;  2LCL A;  5GAN 3;  5LJ3 d;  1YIT T;  1YJ9 T;  2F5T X;  1T3S A;  2DJQ A;  3GLX A;  3CCR A;  2V26 A;  4RMO A;  1KC8 C;  1FWZ A;  5IXF A;  4LXC A;  5A0D A;  5GAN h;  2M51 A;  2SEM A;  2RM4 A;  5CVI A;  3JCM Q;  3WVD B;  1SPK A;  1WXB A;  2QTX A;  1YWO A;  2ESW A;  1U06 A;  2G3R A;  2F1L A;  3QPH A;  2LX7 A;  2O2O A;  1NM7 A;  1D3B A;  2HL5 C;  4D8D A;  4M78 A;  1BI1 A;  4Z89 A;  2EYQ A;  2A7Y A;  2FZK B;  2V8K A;  4Y28 E;  2K5F A;  1BYM A;  2QA4 T;  3QZ9 B;  2QAZ A;  2GQI A;  4RKU E;  4J6Y A;  4C8Q B;  2VV5 A;  2CH4 A;  5DLO A;  3INZ A;  1M90 R;  1MMG A;  4IUT A;  3X25 B;  4QQ6 A;  1BCO A;  3VU3 C;  2XMF A;  1X01 A;  1VQ6 Q;  4AMC A;  1YI2 T;  2KNB B;  3L2V A;  2ZPG B;  4ZN1 A;  1AWO A;  3CEY A;  4DA4 A;  1VQK Q;  1BI3 A;  3OB9 A;  1K8A C;  2YRC A;  2DPP B;  3HRS A;  3RKX A;  1NJI U;  1E6H A;  2LJ1 A;  3CCR Q;  1UHC A;  1BKB A;  1EX4 A;  2HQE A;  4MZT A;  5J3B A;  5HK3 A;  3G71 A;  3FB9 A;  2L89 A;  1WHM A;  2JN0 A;  1JXO A;  2CZ0 B;  3KBG A;  5GMK l;  1K9M R;  1KD1 R;  4C0G A;  4B9X A;  1Y7X A;  5CAI A;  1YIT Q;  4DOW A;  5CKE A;  5I21 A;  3FJP A;  3JCM J;  2JTM A;  2YRD A;  2RHY A;  1AWW A;  3NTI A;  2O31 A;  1YHQ T;  1QP2 A;  5IHI A;  4C8Q D;  3A5Z B;  3X20 B;  1PHT A;  1JJ2 P;  4PL6 A;  3RR6 A;  4EIK A;  1QMC A;  2BTT A;  4MML A;  3SWN B;  2CZ6 B;  5GAN e;  1PG5 B;  3OY9 A;  1Q86 U;  1N6A A;  2X3X D;  2KY9 A;  3X28 B;  4J83 A;  3OBY A;  4J9B A;  2PQW A;  1YHQ A;  3VJP A;  3G71 Q;  3A8M B;  4JS4 A;  1JO8 A;  2L3Q A;  4OB2 B;  4DQ2 A;  2DER A;  3CCU A;  4R56 A;  4A4E A;  2AT1 B;  3CMA A;  3HFO A;  2AKL A;  3M55 A;  2LCS A;  1PSE A;  4DOV A;  3UA6 A;  5GAM f;  2CZ1 B;  2YLC A;  5GMK i;  1ZUY A;  4C0Z A;  1XNI A;  4OMF B;  4B6M A;  2XG8 D;  2PNI A;  4M77 G;  5GAM j;  3G6E T;  1GCQ C;  2DA9 A;  5AT1 B;  1YN8 A;  1W2B A;  3QG1 A;  2LNH B;  2V1R A;  5CKD A;  1JEG A;  1YJW A;  5KYY B;  3ER0 A;  2HAX A;  4PJO B;  2QXF A;  2DNU A;  3EGX A;  1S1N A;  4F14 A;  2RHI A;  1VYV A;  2RK1 A;  2DXU A;  4JZ3 A;  3HRU A;  2PU9 B;  4FYX B;  5C0M A;  3L2Z A;  4NS5 A;  2FHD A;  2DVE A;  1OQK A;  4BE2 A;  4E7J A;  2KRO A;  4RTY A;  4QVZ A;  4OGE A;  4PJJ A;  1QVF P;  4IIM A;  5GAO n;  4QQD A;  4VUB A;  3VS4 A;  2DXT A;  1YHQ Q;  4FYW B;  3TVT A;  3PVQ A;  3L1A A;  2KBT A;  2RI2 A;  4HVU A;  2CT3 A;  1VQ8 T;  3CCU Q;  2E70 A;  3CCL A;  2HZY A;  4OB0 B;  4XTW A;  4J9H A;  3CMA Q;  5D7U A;  2LJ3 A;  4L5G A;  2FZG B;  2JXB A;  3OBW A;  3V8J A;  4JZ4 A;  5CK9 A;  1GCP A;  3EAE A;  2DKG A;  4C5G A;  2DLP A;  3OYG A;  1ZHI A;  3A8O B;  5FW9 A;  4NL3 A;  3THK A;  1YFN A;  4ESR A;  1O75 A;  1W1F A;  1QWE A;  2BUD A;  1YJW Q;  3BW1 A;  4XU2 A;  5D6Y A;  4PFO A;  1VQ8 A;  2LQN A;  1VQL T;  2VB6 A;  4PJO D;  1KC8 U;  2Z0W A;  3OYH A;  3NMZ C;  1WA7 A;  3A98 A;  2C0I A;  4TVR A;  4PJN A;  2E12 A;  2JNG A;  1M8M A;  1PD0 A;  1ZX6 A;  2J06 A;  3FJ5 A;  5KYU A;  3QSU A;  3CCS T;  3S3M A;  1WZO A;  3EGD A;  4C8Q E;  4BD3 A;  1SSF A;  1RAD B;  3ME9 A;  2LNV A;  2KYM A;  5FU6 B;  2A3L A;  1HSQ A;  4LDX A;  1YP5 A;  2HQH A;  2EVR A;  4QQG A;  1M1G A;  4OB1 B;  2E3H A;  2EYZ A;  1W70 A;  1CKB A;  1OZ3 A;  2DL5 A;  2CP2 A;  3QYH B;  1SHF A;  2OI3 A;  3KFV A;  4OMQ A;  4DBH A;  4M7D C;  4C92 D;  1M8V A;  2DRM A;  3OYC A;  1IRX A;  2VAS A;  4DEY A;  3OW2 S;  1KD1 C;  1UB4 A;  1Y57 A;  5C6S A;  3X24 B;  1K8A U;  2HNI A;  1VQ8 Q;  1LOJ A;  2QQS A;  3TRE A;  4J8O A;  1HYO A;  1D3B B;  1VUB A;  4M78 B;  3JB9 H;  3EHR A;  1IRE B;  2MK5 A;  2DVJ A;  3EG2 A;  1KIK A;  3JCM W;  2KGT A;  1IZ6 A;  1FMK A;  3CCV A;  2FPD A;  2CSI A;  3AHU A;  1MV0 B;  2X4X A;  2EKO A;  2O9S A;  1SEM A;  2P4T A;  4RTZ A;  3L42 A;  2OTL A;  5CKF A;  4RUG A;  4BDZ A;  2GF7 A;  5KYW A;  1BI0 A;  5IHN A;  3OYD A;  2HKN A;  1NE8 A;  1P92 A;  1Q7Y R;  3X26 B;  4F16 A;  1UGV A;  1WHG A;  3T9N A;  2A37 A;  3DB4 A;  1GFD A;  1VIF A;  2QGF B;  4KT0 E;  1I81 A;  1N9R A;  1XJW B;  2KRM A;  3BDL A;  2LMJ A;  1GBQ A;  1WHJ A;  2EPD A;  2HBP A;  1I8F A;  8ATC B;  2DTH A;  2QYZ A;  3CPW A;  3M0T A;  4ANJ A;  1SRL A;  3QYG B;  2ED1 A;  1NJI C;  4XU0 A;  4M7D F;  2DM1 A;  1OEB A;  3QDF A;  1BU1 A;  1Z9Q A;  4PFP A;  2MAM A;  4XU3 A;  3VS3 A;  4M78 D;  3CCV Q;  1GCQ A;  1AHJ B;  1JBM A;  2DL3 A;  4HA8 A;  1S72 T;  4J7F A;  2OTL Q;  3ZL7 C;  1YJN T;  4J9G A;  4OP0 A;  2R5A A;  2E4H A;  4PJO E;  1OYX A;  4A53 A;  4BI4 A;  2DIL A;  3LX7 A;  3MO8 A;  1UDL A;  5FU7 C;  3URG A;  2XK0 A;  1RAH B;  1WXT A;  2NUZ A;  2CH4 W;  2VWF A;  3M56 A;  3FC3 A;  1ACM B;  3CPW S;  2DXC A;  2EYX A;  2XHC A;  2GNC A;  2KE9 A;  3OYM A;  2HBW A;  4AFQ C;  4C0D B;  2DBK A;  3VS1 A;  3EHQ A;  3UPU A;  4M78 F;  4BUG A;  1IGU A;  5CO7 A;  5HCK A;  1X6G A;  1I5L A;  2K5I A;  4GY5 A;  3OYJ A;  4J9I A;  5CQX A;  2SRC A;  3QXE B;  2YXY A;  1TUC A;  3MP1 A;  2DD4 A;  1OU9 A;  3OYE A;  5LJ3 g;  3LYI A;  3HRT A;  1NYG A;  3LLR A;  1MND A;  2OX7 A;  2MIO A;  4HT9 A;  4C92 E;  2WSE E;  1OPK A;  2P0P A;  1AWJ A;  2H8H A;  4B9W A;  2LZ6 B;  1FX7 A;  1R77 A;  2CT4 A;  2VC8 A;  3GPL A;  2EJ9 A;  2EBP A;  3RDV A;  4E2F B;  2M0Y A;  4LN2 A;  3ASK A;  2FZC B;  4RTV A;  5CR2 A;  4LD9 K;  5GAN 5;  3EGU A;  3JB9 G;  3MEW A;  1YWP A;  2EJF A;  2DBM A;  2RQV A;  2ROT A;  2GBQ A;  4RTT A;  2GGR A;  4X9C A;  3PMI A;  4X1V A;  2LVM A;  1ZQ1 A;  2VYT A;  1D0Z A;  3QKJ A;  3CME A;  4E47 A;  4J9F A;  4LUE A;  1HK9 A;  1YBY A;  4KGZ B;  1UFF A;  4E7H A;  3TEE A;  1S72 Q;  2CKK A;  2RHX A;  2KRS A;  2JMC A;  5D6X A;  3QII A;  1M90 U;  2PUO B;  4X9D A;  3OYL A;  1RAI B;  1VQ6 T;  1QKX A;  3A1P A;  1BB9 A;  2MPX C;  2WAC A;  1WHL A;  3FRN A;  1K73 R;  1WDX A;  3S6W A;  2YUO A;  3AT1 B;  2QTV A;  1VQK T;  2BZ8 A;  3BE3 A;  3CCR T;  4M7D A;  2DFU A;  2AZV A;  2X4J A;  1NPR A;  1D1A A;  3QO3 A;  4Y91 A;  4ZGD B;  1VQM T;  5FWB A;  5KH6 A;  3EG9 A;  1KK7 A;  1T3L A;  1X27 A;  1V29 B;  1MHN A;  4Y92 A;  2COY A;  4LD6 A;  2R5M A;  3QUI A;  3JSC A;  4KGX B;  1Q82 R;  3S3N A;  2HMA A;  5GAN g;  1WX6 A;  5FLX E;  1O9S A;  5CCA A;  1WJQ A;  2RQW A;  4D8K A;  3UDC A;  1K9M U;  3EFS A;  4M78 E;  1KD1 U;  4M77 B;  5LJ5 j;  5FRN A;  1M1K R;  3OW2 P;  5GAM h;  5KYU B;  1PWT A;  4FW2 A;  3EGD B;  3HPW A;  1VQM A;  1WJR A;  1PM3 A;  2P4R A;  1EIF A;  3OA6 A;  4FSX A;  4HT8 A;  4C5H A;  4FCY A;  2IVW A;  3GBQ A;  2MWP A;  1I5O B;  1D1B A;  3E1S A;  5EC7 A;  1JU5 C;  4HVV A;  1UUE A;  1OOT A;  1W4S A;  3CD6 A;  2E64 A;  4R0K A;  4ORZ A;  4XTV A;  4XTX A;  4KRT A;  3OYI A;  1KFZ A;  4M77 C;  2KRN A;  2ED0 A;  1VQN A;  2F69 A;  4KH1 B;  3SFM A;  2J6K A;  2OJ2 A;  3G71 T;  1TWB A;  2PTK A;  1VA7 A;  2DET A;  1MV3 A;  4II1 A;  1QLY A;  2EFI A;  2ZPB B;  1OI1 A;  1B3Q A;  2MF2 A;  2XID A;  3TSZ A;  2CGH A;  4J9E A;  1D09 B;  1IGQ A;  1EZZ B;  2BIV A;  2X3W D;  4A4G A;  2L3S A;  2BZX A;  2VXF A;  3MPU B;  1VQM Q;  1PNJ A;  4PLL A;  3ZFJ A;  5KCO A;  3EFO B;  5KYW B;  1SG5 A;  4N4G A;  5LJ3 f;  4FT2 A;  1RAG B;  4ZGE B;  4FM4 B;  1NLP C;  5GJV B;  3IQL A;  3CD6 Q;  3VV0 A;  5LJ3 j;  2JUF A;  2LDM A;  2X4Y A;  2O9V A;  5GAN d;  3VS6 A;  4BAC A;  3RMS A;  2E5K A;  5GAO r;  2V1Q A;  1VQN Q;  2QEX T;  3ZBD A;  2XDB A;  3I55 A;  4FYV B;  2HSP A;  1NZ9 A;  4M77 F;  2FEI A;  2KDS A;  2LRQ A;  3FEO A;  3CCU T;  5GAM e;  2D0Q B;  3EH2 A;  1X2K A;  3HL8 A;  5IH2 A;  3CPW P;  3CMA T;  2JT4 A;  4BI8 B;  2KYB A;  2I0N A;  3HTR A;  1WI7 A;  1DJ7 B;  1QCO A;  5DLQ E;  2J7I A;  3DLL A;  2QEX A;  8AT1 B;  4PK4 A;  2FPE A;  4A54 A;  2G6F X;  1YJW T;  2V8J A;  3JCM h;  2QQR A;  3CCE T;  6AT1 B;  2GQV A;  1MMN A;  3NGP A;  2QDY B;  2CUB A;  4BE0 A;  2EKH A;  2KT1 A;  4PJM A;  3M4Y A;  3JB9 I;  1C1A A;  1BIA A;  3MHX A;  1ARK A;  2IPO B;  5KE3 A;  2JS2 A;  3CC7 A;  3EG0 A;  4Z8A A;  4FU6 A;  3JB9 J;  1KG1 A;  3VRZ A;  1X2Q A;  2MCN A;  1M2O A;  4BB7 A;  3VS2 A;  3RBB B;  3E9G A;  2LC4 A;  2ATC B;  3CCE A;  4AFZ C;  1AEY A;  5L8R E;  3CCL T;  3UT1 A;  5GAN f;  2I2L A;  4RG8 A;  3M57 A;  5IXB A;  1TUG B;  4LE9 A;  2DJZ A;  2BE7 D;  2K57 A;  2M16 A;  1GRI A;  2DK3 A;  2RNA A;  1Q82 C;  4WCI A;  2QEX Q;  2D8J A;  2KI7 A;  4XTZ A;  1QWF A;  3I56 A;  2CSQ A;  2RI3 A;  1G8X A;  1M1K C;  4C5I A;  3ZEH A;  1VQO A;  1BCM A;  4M7A C;  3SDZ A;  2X9H A;  1W2B S;  3QJY A;  3M59 A;  4AFU C;  2RPN A;  4J6W A;  1OX8 A;  4C8Q G;  2M1H A;  3MCA B;  1JRI A;  4DEX A;  5CIU A;  3JCM V;  1T0J A;  1OZ2 A;  2FG0 A;  2JOY A;  3V7C A;  1UEB A;  2FB7 A;  4CC7 A;  3LH5 A;  3DKM A;  3CCE Q;  4J5Y A;  1FMW A;  4ELY C;  3JCM P;  1YIJ A;  1C6V X;  3CCM A;  3JCM e;  4M77 A;  1Q7Y U;  1M90 C;  2Y4Y A;  3H6Z A;  4JPB W;  3RER A;  2A0F B;  3OMG A;  3M53 A;  3CXC A;  3P8D A;  2PVG B;  4M7D B;  4JLG A;  3RKY A;  1G5V A;  4XU1 A;  1KHI A;  1JXM A;  3VUZ A;  3EG9 B;  3I56 Q;  1ZUK A;  1VQO Q;  4C92 C;  2JM9 A;  2E3I A;  2VXE A;  2KVQ G;  3CCL Q;  4BY6 C;  3ULR B;  5GAN 7;  2DL8 A;  2RA2 A;  4A4K A;  3FIF A;  2L0A A;  3CC2 A;  1RLP C;  3JAM E;  3OS2 A;  3CCV T;  2DEQ A;  4HCC A;  1VQP T;  4JJD A;  3QBY A;  1YCY A;  3JRZ A;  3MEV A;  2OTL T;  4L59 A;  2YSQ A;  1K9M C;  3J7A F;  1R0C B;  4OVA A;  2NLU A;  2EQI A;  2O4X A;  1RAB B;  3NHN A;  2F2V A;  3SB2 A;  3L2U A;  1XTD A;  1YIJ Q;  3NTH A;  3CCM Q;  2AZS A;  4ATO A;  3P8B B;  3F70 A;  1A0N B;  4M75 C;  3E9F A;  1OUL A;  2P0K A;  4DBR A;  1K4U S;  1VQP A;  1KQ2 A;  2EAY A;  2EJG A;  1NEG A;  2E6Z A;  3P8H A;  1QCF A;  2YT6 A;  2P84 A;  3WXM B;  1M3B A;  1QQJ A;  4F7U G;  4M7D D;  5IAY A;  4C5E A;  5L23 A;  3EFO A;  1HJD A;  3CBP A;  4FL6 A;  2RD1 A;  2EQU A;  3BY7 A;  3OYB A;  2F2X A;  2LQW A;  2RMO A;  1I0C A;  1Q81 R;  2LQ8 A;  3VYH B;  4M7A G;  1OU8 A;  3CC2 Q;  1BIB A;  2RJD A;  1D0Y A;  2MI6 A;  2C0T A;  1AT1 B;  2K79 A;  1PKS A;  2YRV A;  4PJO G;  3PT9 A;  1Y96 B;  4E7Z A;  3H0H A;  2EIF A;  2COZ A;  3KXT A;  1PRM C;  1G3W A;  3G1J A;  4LDW A;  5J26 A;  3PGG A;  5KYN A;  3JB9 D;  3REA B;  5FU7 B;  3OYA A;  4LNP A;  5GMK j;  1ZLM A;  2JMA A;  2W10 A;  2CP3 A;  1JJ2 A;  1WQ7 A;  1UJ0 A;  5LJ5 h;  3NFC A;  1SSH A;  3R6O A;  2FVU A;  3M0P A;  1PD1 A;  4V2S A;  1PRL C;  2YUN A;  1Y0M A;  1E6G A;  1VQP Q;  3TU4 K;  5GAN 4;  2CP0 A;  2XDP A;  2OTJ T;  2CDT A;  4ZTF A;  2C06 A;  1D1C A;  2IG0 A;  1LCK A;  2COW A;  1HD3 A;  1EFN A;  2L5Q A;  2LX9 A;  1RAA B;  1UEC A;  2DD5 A;  1PKT A;  1SF9 A;  4C92 G;  2ZCF B;  5I2S A;  4GBQ A;  1K73 U;  4EMK C;  3UWN A;  3JB9 F;  2EGC A;  4ZGJ B;  4AT1 B;  1H8K A;  3H0I A;  3REB B;  1WPY A;  4HCZ A;  5HK0 A;  4JJN K;  5EG2 A;  4F7U A;  4K11 A;  2BE9 B;  2LT1 A;  1NG2 A;  2ZZD A;  2OTJ A;  3V8K A;  3QWX X;  1QP3 A;  2FRY A;  1MUZ A;  4X34 A;  4NL2 A;  3MET A;  3CCQ T;  4XTY A;  4M7A A;  4O6J A;  4Z88 A;  1MNE A;  2KMT A;  1Q82 U;  1M2V B;  2L2P A;  5FRM A;  1ZSZ C;  1GXI E;  2F5K A; 
#chains in the Genus database with same CATH homology
 2RO0 A;  4C8Q A;  5GAM j;  2XG8 D;  4M77 G;  3CCS A;  3C94 A;  3G6E T;  4LDV A;  1KHC A;  1W2B A;  3QG1 A;  2HQX A;  2XI9 A;  2F69 A;  3CME T;  1M1K U;  1VQN A;  1G3T A;  5CKD A;  5FU6 C;  3SFM A;  4M75 G;  4ZN3 A;  3QDR B;  1YJW A;  3ER0 A;  3G71 T;  2HAX A;  4PJO B;  2QXF A;  3QHS A;  1VQ5 T;  2RHI A;  4JUV A;  5GMK e;  2RK1 A;  3PMT A;  2DTI A;  5CKH A;  4A4H A;  2DXU A;  3S3O A;  2LT4 A;  4RCC A;  4II1 A;  2QQB A;  2D9T A;  3HRU A;  2FYK A;  1N8R C;  2GFA A;  3TCJ A;  2PU9 B;  4JLI A;  1UGS B;  2K3X A;  2EFI A;  5C0M A;  2ZPB B;  3CCQ A;  1OI1 A;  3M54 A;  2MF2 A;  2XID A;  4NOY A;  3L2Z A;  4NS5 A;  3V7R A;  1N9S A;  2FHD A;  2CGH A;  2DVE A;  1I4K 1;  4MZM A;  4CRI A;  4BE2 A;  4E7J A;  4KUL A;  5LJ3 h;  4FT4 A;  2BIV A;  4XK8 E;  5I2M A;  4QVZ A;  4OGE A;  4A4G A;  2PVD B;  2CZ7 B;  5GAO n;  4QQD A;  4VUB A;  2VGM A;  2VXF A;  4FIB A;  2DXT A;  3RIR A;  4C92 F;  2MMP A;  3JCM X;  2E10 A;  3OQ5 A;  1LNX A;  4M7D E;  1N27 A;  3VKI A;  4PLL A;  3L1A A;  5M9O A;  2RI2 A;  3ZFJ A;  1RI0 A;  5GAO l;  4M75 D;  1VQ8 T;  1VQ5 A;  3MEU A;  5KCO A;  2E65 A;  5HKC A;  2E70 A;  5LJ5 e;  3CCL A;  4OB0 B;  5LJ5 g;  2WSC E;  4N4G A;  4XTW A;  5LJ3 f;  4CI0 C;  1VQ7 A;  2XD0 A;  2E1H A;  4FT2 A;  4PNO A;  4M78 C;  4BE1 A;  4ZGE B;  1Y07 A;  4FM4 B;  4L5G A;  3OBW A;  4IKF A;  4L6V 5;  3V8J A;  5CK9 A;  5GAN 6;  3EAE A;  4PLI A;  3VV0 A;  5LJ3 j;  2DKG A;  4C5G A;  4PKC C;  3OYG A;  2JUF A;  2LDM A;  1ZHI A;  2DXB A;  2X4Y A;  3V8L A;  5GAN d;  4EMK B;  4MDW A;  4BAC A;  1RL2 A;  3A8O B;  3DLM A;  3RMS A;  4NL3 A;  3LGF A;  2OAU A;  5GAO r;  2JTF A;  3GNG A;  4OMF B;  1WNL A;  3ZBD A;  2QEX T;  2XDB A;  1O75 A;  3C12 A;  4BI3 A;  3I55 A;  4A4F A;  4EPC A;  2BUD A;  3MP6 A;  3BW1 A;  3CBM A;  4XU2 A;  2YHT A;  5D6Y A;  4QVD A;  1M5Q 1;  1NZ9 A;  4M77 F;  4F7U E;  4EDU A;  2JZ2 A;  3BFM A;  4QVC A;  1VQ8 A;  2KDS A;  3SWN A;  1VQL T;  2LRQ A;  2YLB A;  3VUB A;  3FEO A;  3A8H B;  3CCU T;  5GAM e;  4PJO D;  2D0Q B;  3CC4 T;  2VUB A;  3HL8 A;  2P0Q A;  1KC8 U;  4M75 F;  2RJF A;  3CMA T;  3QJ6 A;  4BI8 B;  3OYH A;  3FLG A;  4O5V A;  4TVR A;  3OYK A;  3J81 E;  3LGL A;  2E12 A;  4M7A E;  3CD6 T;  1DJ7 B;  2JNG A;  5DLQ E;  3DLL A;  3QSU A;  4M75 A;  3CCS T;  2RHU A;  3S3M A;  2RJC A;  2R58 A;  2KK4 A;  4C8Q E;  3QZ5 B;  2QEX A;  4Q5W A;  1VQN T;  3CCJ T;  4BD3 A;  2DZ9 A;  2E41 A;  1SSF A;  4A54 A;  3ME9 A;  2LNV A;  4N4I A;  5GAO p;  2Y90 A;  2A3L A;  5FU6 B;  2V8J A;  1YJW T;  3JCM h;  4LDX A;  1R8O B;  2DAQ A;  2QQR A;  3SD4 A;  3OS0 A;  4BDY A;  1Q7Y C;  2R57 A;  3CCE T;  4QQG A;  4MDX A;  1ZBX A;  2GQV A;  2ZPF B;  3GNF B;  3CC2 T;  1M1G A;  4OB1 B;  2QDY B;  1JJ2 S;  3CC4 A;  1G3S A;  4IUQ A;  3RES A;  2ZGW A;  5GMK m;  4LDU A;  1KQS A;  4BE0 A;  1FXX A;  1PSF A;  4J6X A;  1OZ3 A;  4JRQ A;  3M4Y A;  3JB9 I;  2M0O A;  3QYH B;  1U1S A;  2BKD N;  1BIA A;  3CPF A;  3MHX A;  4J7I A;  1U8R A;  5KE3 A;  3CC7 A;  4M7D C;  4C92 D;  1N8R U;  4FU6 A;  5A0G A;  3OYC A;  2K3Y A;  4IUP A;  3JB9 J;  3A8G B;  1S72 A;  1Q86 C;  1KG1 A;  4M7D G;  1H3Z A;  1YJN A;  4PJO A;  3G4S A;  3CCJ A;  3Q1J A;  3OW2 S;  1KD1 C;  5KCH A;  1UB4 A;  4BB7 A;  5C6S A;  1U1T A;  3X24 B;  3DB3 A;  3PIP A;  5LJ3 e;  1K8A U;  1UGP B;  2HNI A;  3OS1 A;  3HFN A;  3C4S A;  4JRP A;  3E9G A;  2LC4 A;  1LOJ A;  2FL7 A;  3CCE A;  2QQS A;  2O4X B;  1GXI E;  5L8R E;  3TRE A;  4J8O A;  4N0A A;  3OS5 A;  5CKB A;  3UT1 A;  3CCL T;  1WGS A;  5GAN f;  1VQ7 T;  3LWH A;  3OSS C;  1QVF A;  1D3B B;  1TH7 A;  1VUB A;  2I2L A;  3A8L B;  4M78 B;  3J80 E;  1YIT A;  3JB9 H;  4RG8 A;  3M57 A;  1YJ9 A;  1IRE B;  2K5L A;  2DJZ A;  5J39 A;  3O8V A;  5LJ5 d;  4JDS A;  3PNW C;  5GAN 2;  3JCM W;  3V7S A;  1IZ6 A;  2K57 A;  3GOX A;  3CCV A;  2KQW A;  4C0D C;  3AHU A;  2X4X A;  2EKO A;  2M16 A;  1KQ1 A;  2DK3 A;  3LWI A;  2P4T A;  1HXD A;  1Q82 C;  4E7I A;  2DTO A;  1Y71 A;  3L42 A;  2XDD A;  4MZP A;  4M77 D;  5A2Q E;  3I55 T;  5CKF A;  2OTL A;  1KQS S;  1Y96 A;  4BDZ A;  2GF7 A;  4XTZ A;  2RK2 A;  4JRK A;  3I56 A;  1BI0 A;  1H64 1;  1WQW A;  2WSF E;  2RI3 A;  2LQK A;  1M1K C;  4C5I A;  3ZEH A;  1VQO A;  4LDY A;  3OYD A;  1NE8 A;  4M7A C;  1P92 A;  5FRO A;  3SDZ A;  4C92 A;  4OGC A;  2ZPI B;  3X26 B;  1W2B S;  3T9N A;  3CBO A;  2K4Y A;  4M78 G;  3DB4 A;  3QJY A;  2QA4 A;  4EMK A;  5LL6 S;  1VIF A;  4KT0 E;  4C8Q C;  5GAM d;  3M59 A;  3L2R A;  1I81 A;  1N9R A;  2Y4X A;  4EMG A;  2E5Q A;  4J6W A;  5DY9 A;  3BDL A;  2M1H A;  2B8A A;  4C8Q G;  3L2W A;  3MCA B;  1JRI A;  2HBP A;  3KUF A;  5CIU A;  3JCM V;  1I8F A;  2V8I A;  4M75 E;  2DTH A;  1QVF S;  3CPW A;  1OZ2 A;  2QQA A;  2JOY A;  3QYG B;  4WF2 A;  3V7C A;  4ELZ C;  1UEB A;  2FB7 A;  1NJI C;  4XU0 A;  4XTU A;  1YI2 A;  3DKM A;  4Z02 A;  4M7D F;  2E6N A;  2PVO B;  2LCC A;  4IUV A;  4J5Y A;  4N4H A;  3JCM c;  1NPP A;  2LTO A;  2DIQ A;  2GFU A;  2X35 A;  4ELY C;  5GAM g;  3JCM P;  4IUR A;  1B34 A;  5HY6 A;  1JB0 E;  1YIJ A;  3VYG A;  2MAM A;  3WVE B;  3CCM A;  1BI2 A;  3BDU A;  3JCM e;  2ZPH B;  4M77 A;  3HHT B;  3MEA A;  4XU3 A;  2VGN A;  3JCM g;  2RI5 A;  1Q7Y U;  1M90 C;  3EFR A;  2Y4Y A;  3H6Z A;  4M78 D;  3RER A;  1AHJ B;  1JBM A;  3OMG A;  3M53 A;  3CC7 T;  4HA8 A;  3CXC A;  1M1F A;  4JRI A;  3P8D A;  2PVG B;  4IUU A;  4M7D B;  1S72 T;  4JLG A;  4J7F A;  3RKY A;  2MWO A;  1G5V A;  2X4W A;  4XU1 A;  1KHI A;  1YJN T;  1WJS A;  4OP0 A;  3G4S T;  4EMH A;  3VUZ A;  2R5A A;  3M58 A;  1M4Z A;  1Q81 C;  4PJO E;  1OYX A;  5GAO m;  4A53 A;  1VQ6 A;  4BI4 A;  2EQK A;  3H8Z A;  4XAX B;  5LJ5 f;  4HCB A;  3LX7 A;  4C92 C;  3MO8 A;  2VXE A;  3GP8 A;  5FU7 C;  3URG A;  2KVQ G;  4C0F A;  4BY6 C;  2XK0 A;  5AYF A;  1G3Y A;  1VQK A;  4RG2 A;  2CYZ B;  2DO3 A;  2LCL A;  5GAN 7;  5GAN 3;  5LJ3 d;  3M56 A;  5IN1 A;  3FC3 A;  1YIT T;  4KUI A;  4KUD K;  2RA2 A;  4A4K A;  2F5T X;  3FIF A;  3CPW S;  2JVV A;  1YJ9 T;  2DXC A;  3GLX A;  4OB3 B;  3CC2 A;  2XHC A;  3CCR A;  4RMO A;  3JAM E;  1KC8 C;  1FWZ A;  3OS2 A;  3CCV T;  2DEQ A;  5A0D A;  5GAN h;  3OYM A;  5IT9 E;  3GIB A;  4HCC A;  1VQP T;  4C0D B;  2RM4 A;  2QQ9 A;  3QBY A;  3UPU A;  5CVI A;  1YCY A;  4M78 F;  3JRZ A;  1MGQ A;  2XIC A;  4BUG A;  3MEV A;  5CO7 A;  4F7U B;  3JCM Q;  2OTL T;  4L59 A;  1I5L A;  1K9M C;  1K73 C;  2PUK B;  2K5I A;  3WVD B;  3HSB A;  3J7A F;  4E7K A;  2QTX A;  4GY5 A;  1M8V A;  4OVA A;  2NLU A;  4C8Q F;  3OYJ A;  2O4X A;  2G3R A;  5CQX A;  3QXE B;  2KAF A;  3SWN C;  3MP1 A;  2DD4 A;  3QPH A;  3I56 T;  3M5A A;  4RCB A;  4ZTJ A;  1QVG A;  5GAN 8;  3OYE A;  3SB2 A;  3MP8 A;  5LJ3 g;  3LYI A;  3HRT A;  1D3B A;  3L2U A;  1VQO T;  1XTD A;  2DZC A;  4M78 A;  1BI1 A;  4GLK A;  2EYQ A;  2A7Y A;  3LLR A;  1QW1 A;  4M7A B;  3NTH A;  2V8K A;  3M4G A;  4ATO A;  4Y28 E;  4HT9 A;  4C92 E;  2K5F A;  3G7Z A;  1BYM A;  3P8B B;  2QA4 T;  3F70 A;  3QZ9 B;  2WSE E;  2EQJ A;  2P0P A;  5GAN j;  3OYY A;  4M75 C;  4RKU E;  3E9F A;  4J6Y A;  4B9W A;  2P0K A;  4C8Q B;  1FX7 A;  2VV5 A;  4OF1 A;  1VQ9 T;  2VC8 A;  5DLO A;  3GPL A;  2EJ9 A;  3INZ A;  1UGQ B;  1VQP A;  1KQ2 A;  2EAY A;  2EJG A;  2CS7 A;  2E6Z A;  3P8H A;  4IUT A;  3RUX A;  3M9Q A;  3ASK A;  5D6W A;  4QQ6 A;  3WXM B;  3X25 B;  3VU3 C;  4F7U G;  5KE2 A;  4M7D D;  1X01 A;  5IAY A;  5CR2 A;  4C5E A;  2XKO C;  4LD9 K;  2RHZ A;  1X75 C;  3CBP A;  4FL6 A;  5GAN 5;  2RD1 A;  3JB9 G;  2H3J A;  2HD0 A;  3MEW A;  2EQU A;  3BY7 A;  1YI2 T;  2EJF A;  2D6F A;  3OYB A;  3GF5 A;  3L2V A;  4JS5 A;  2ZPG B;  4ZN1 A;  1UGR B;  2K2V A;  3E19 A;  3CEY A;  4X9C A;  2LQ8 A;  3N5B B;  4DA4 A;  3PMI A;  3VYH B;  2LVM A;  1ZQ1 A;  1BI3 A;  3OB9 A;  2O01 E;  1YIJ T;  1XOV A;  1K8A C;  4M7A G;  2VYT A;  2DPP B;  3HRS A;  3RKX A;  5GMK h;  3CCM T;  1NJI U;  3G6E A;  1BIB A;  3QKJ A;  1BKB A;  2RJD A;  3CME A;  2HQE A;  2MI6 A;  3RKW A;  1HK9 A;  1YBY A;  4E47 A;  2RH2 A;  4M77 E;  1QVG S;  3FDR A;  4MZT A;  5J3B A;  5HK3 A;  4E7H A;  3TEE A;  1VQ9 A;  4PJO C;  2CKK A;  3LH0 A;  3G71 A;  2XU8 A;  3FB9 A;  2YRV A;  2RHX A;  3JCM d;  3PTA A;  4PJO G;  3PT9 A;  1Y96 B;  2L89 A;  5D6X A;  3QII A;  1M90 U;  1QVP A;  2EIF A;  2PUO B;  4X9D A;  3OYL A;  2RB6 A;  2AHJ B;  3OMC A;  2JN0 A;  4MMK A;  1VQ4 T;  1VQ6 T;  3KXT A;  1G3W A;  2CZ0 B;  4N0A C;  3KBG A;  4LDW A;  3OYF A;  2DIG A;  2WAC A;  5J26 A;  5GMK l;  3PGG A;  3FRN A;  4C92 B;  3JB9 D;  3S6W A;  4C0G A;  4B9X A;  5FU7 B;  1Y7X A;  4YTL A;  3OYA A;  4BY6 B;  5CAI A;  1VQK T;  5GMK j;  4DOW A;  4ME7 A;  5CKE A;  4R55 A;  1Q81 U;  5I21 A;  1JJ2 A;  1WQ7 A;  3FJP A;  2EQM A;  5LJ5 h;  3NFC A;  3R6O A;  3OYN A;  3JCM J;  2JTM A;  2FVU A;  3OSV A;  2RHY A;  3CCR T;  5GAO q;  2X4J A;  1NPR A;  4P5N A;  4M7D A;  4V2S A;  3NTI A;  4E7L A;  3QO3 A;  4Y91 A;  1YHQ T;  1QP2 A;  3HP9 A;  3PFS A;  4ZGD B;  3TU4 K;  1VQM T;  5KH6 A;  1LJO A;  3RMQ A;  1XQH A;  5GAN 4;  3JCM b;  2XDP A;  4C8Q D;  2OTJ T;  1V29 B;  3A5Z B;  4HKE A;  3X20 B;  5DM7 R;  1MHN A;  2EWN A;  4PL6 A;  4LD6 A;  4D6W A;  2QI2 A;  2KSS A;  4KBM B;  2R5M A;  3QUI A;  4ZTF A;  4QW2 A;  1X6O A;  2L8D A;  2RJE A;  3JSC A;  4MML A;  2ZPE B;  2C06 A;  1VQ4 A;  2IG0 A;  3OW2 A;  3SWN B;  2CZ6 B;  5GAN e;  3S3N A;  5GAN g;  5FLX E;  3OY9 A;  2L5Q A;  2LX9 A;  1O9S A;  1B34 B;  2GCX A;  5CCA A;  1Q86 U;  2DD5 A;  4M7A D;  1N6A A;  1WJQ A;  4C92 G;  2ZCF B;  4F7U F;  5I2S A;  3C95 A;  3UDC A;  1K9M U;  1K73 U;  3EFS A;  4M78 E;  1KD1 U;  4EMK C;  4M77 B;  3CD6 A;  3UWN A;  5LJ5 j;  3JB9 F;  5FRN A;  4ZGJ B;  2KY9 A;  3X28 B;  4J83 A;  5GAM h;  5CQY A;  3OBY A;  1WPY A;  2M9U A;  4M75 B;  4HCZ A;  5HK0 A;  4JJN K;  2PQW A;  4UC4 A;  5EG2 A;  4F7U A;  3HPW A;  3VJP A;  1YHQ A;  1VQM A;  3A8M B;  1WJR A;  3LW5 E;  4JS4 A;  4M7A F;  1VIE A;  2LT1 A;  1EIF A;  2ZZD A;  3OA6 A;  4OB2 B;  4FSX A;  3HKS A;  4DQ2 A;  5A0L A;  3V8K A;  4HT8 A;  4C5H A;  2OTJ A;  1QP3 A;  1VQL A;  3CCU A;  4R56 A;  2IVW A;  2MWP A;  1M9S A;  3NTK A;  4A4E A;  3L2Q A;  4X34 A;  4NL2 A;  3MET A;  4XQ3 A;  3CMA A;  3CCQ T;  3HFO A;  4XTY A;  4M7A A;  3E1S A;  3M55 A;  4O6J A;  1PSE A;  4PJO F;  4DOV A;  2KMT A;  5GAM f;  2CZ1 B;  1Q82 U;  3CXC S;  2YLC A;  1W4S A;  5GMK i;  2E64 A;  3PIO A;  5FRM A;  4C0Z A;  4XTV A;  4XTX A;  3OYI A;  1XNI A;  4M77 C;  3JCM f;  2F5K A;  2L3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...