2JTFA

Solution structure of the phf20l1 mbt domain
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
NRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords PHD finger protein 20-like 1
publication title Structural Analysis of Histone H4K20 Methyllysine Recognition by the MBT Domain of PHF20L1
rcsb
source organism Homo sapiens
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jtfA00
2RJEA 3OYNA 3LGFA 2QQSA 2RI3A 3MO8A 4Z02A 4QVZA 2LCCA 4OVAA 3OS0A 2EKOA 3LH0A 4II1A 2XDPA 3EAEA 4C5GA 2FHDA 4LD6A 2HQXA 4IUVA 5KE2A 2F5KA 2DAQA 3OYGA 2RHIA 4N4GA 2RO0A 1OI1A 2R57A 4BDYA 3NTHA 4IUQA 1WGSA 3QBYA 2RHXA 4IUPA 2D9TA 2X4XA 1OZ2A 3C4SA 2X4YA 3M9QA 4PLLA 3S6WA 5C0MA 3OYBA 2XK0A 2GF7A 4BE1A 3OYEA 4IUTA 3F70A 3E9FA 4E7JA 3OYCA 3DLMA 2K3XA 3L2UA 5J26A 2NLUA 5KH6A 1OZ3A 3OS2A 4C5HA 3E9GA 4X34A 4A4FA 3FLGA 3L42A 3OMGA 4N4IA 5FROA 2PQWA 3OYJA 2LDMA 3SD4A 5D6WA 2O4XA 2RJDA 3QJ6A 2RHZA 3MP1A 5KCOA 4NS5A 3ASKA 2RHUA 2WACA 4IURA 4C5IA 2M1HA 3CEYA 4QW2A 2K3YA 2QQRA 2LVMA 3P8HA 4E7KA 3QIIA 4A4EA 4EDUA 5IN1A 2R5MA 3OQ5A 3P8DA 3MEAA 3OYHA 4E7LA 3S3OA 3LLRA 2R5AA 3OB9A 4RG2A 3L2QA 3GOXA 3H6ZA 4CRIA 3ZEHA 4BE0A 2EQMA 2LRQA 2L8DA 3PMTA 1WJSA 3L2VA 3MP8A 2M0OA 5KE3A 4BE2A 3PFSA 2R58A 1WJRA 2RJCA 1KHCA 3L2RA 3S3MA 2JZ2A 3DB3A 3QKJA 4L59A 2JTFA 3L2WA 3LYIA 5J39A 4BDZA 3OYMA 5D6XA 3OY9A 4IKFA 3OYIA 1H3ZA 3LX7A 4ZTFA 3H8ZA 3UT1A 4PLIA 3OYAA 4FL6A 2HQEA 4E7HA 4QQ6A 2X4WA 4BACA 4UC4A 2E6NA 5CIUA 5C6SA 3DB4A 2BKDN 4BD3A 3NTKA 2M16A 2LTOA 3MEVA 2RI5A 1MHNA 3FDRA 4IUUA 2L3RA 4HCZA 3FEOA 3FC3A 2EFIA 3BDLA 2DIGA 2E5QA 1N27A 2RI2A 4QQDA 4QQGA 2YRVA 3LGLA 4A4HA 3OS1A 2MWPA 5FRMA 3OYDA 2RHYA 5IAYA 1G5VA 1SSFA 2DIQA 3OYKA 4C5EA 2GFUA 2MWOA 1RI0A 3O8VA 3KUFA 4GY5A 3UWNA 2X35A 3NTIA 5KCHA 4E7IA 3META 2G3RA 2VYTA 2EQJA 5M9OA 4ZTJA 2IG0A 3PMIA 4FU6A 3ME9A 2GFAA 2O4XB 1WJQA 2EQUA 4N4HA 1XNIA 4Q5WA 2CKKA 5D6YA 2P0KA 4PL6A 3Q1JA 4A4GA 5FRNA 2B8AA 4B9WA 3S3NA 2RJFA 2BUDA 2BIVA 4B9XA 1OYXA 3OYFA 3OA6A 3MP6A 3PNWC 3MEUA 3MEWA 3OYLA 2EQKA 3OMCA 2L89A
chains in the Genus database with same CATH superfamily
2F2WA 3M4YA 1VQKQ 1ZSZA 3CC2T 3EHRA 2F5TX 3CC2Q 2CP6A 2K79A 4IUQA 1JBMA 1IB8A 2CH4A 2D9TA 5GANf 1IREB 3X20B 1UGRB 4XTUA 3C12A 1PD1A 3HRUA 3FLGA 1FYNA 3EH1A 3MP1A 1YJ9T 2K3YA 4E7KA 3CMAT 2J6FA 3CMAQ 1M1KC 5GAN8 5IHIA 4XTWA 4TVRA 1MNEA 1VQMA 3QDFA 3SHWA 2ESWA 2PZ1A 5FW9A 3EG3A 4ZN3A 1ZUYA 4PJOF 2PVOB 2LNHB 4BE2A 2R58A 5LJ5f 5IXBA 3L2RA 2EYWA 4FYWB 2EYQA 2E1HA 2FO0A 4LDUA 4FM4B 4BUGA 2W10A 1X2KA 4E2FB 1M9SA 1KQSS 3GNFB 3PVQA 1PKTA 1WPYA 2LTOA 2O2OA 1QCOA 2RI5A 1XOVA 4HCZA 1Q82R 4F7UA 2OTJA 4FSSA 4PJOC 5GMKl 2G6FX 1N27A 4QQGA 3QWYA 1M3CA 5IT9E 4J9CA 1R8OB 3LWIA 3M56A 3O8VA 2DA9A 2GQIA 3VYGA 3I55T 3PGGA 1C6VX 4PJOB 1UB4A 2K9GA 2GFAA 2J6OA 3PVLA 1E7OA 2LJ3A 4JUVA 2YRDA 1YFNA 3MEWA 3SEMA 2QA4Q 1IGQA 1P92A 4DA4A 2DVEA 2BE9B 2RHIA 2KGTA 2YUOA 1YWPA 1IHWA 1KFZA 2R57A 3CCQT 2A08A 4MDXA 2MI6A 1M90C 1R0CB 4FYYB 1JQQA 2GF7A 2RH2A 2GGRA 4CC2A 2NUPA 3J7AF 2EVRA 1RADB 2CP0A 1WXUA 1YWOA 3UF4A 3JCMV 5CK9A 3OYJA 5AT1B 3EG0A 2K5IA 3INZA 3OSVA 2E65A 4B6MA 2QGGA 4C92F 1I81A 4Y92A 2CT3A 3H9NA 5IN1A 3G7ZA 1UGPB 2DETA 2EQMA 2BTTA 3PMTA 1UJYA 2HD0A 2P0QA 4JLIA 1ZA2B 1N9RA 3G1JA 1JO8A 4L59A 1VQNT 1VQNQ 3U23A 1UFFA 2K7AA 1TUGB 4R56A 1RL2A 1WQ7A 4E47A 3QUIA 4J8OA 4PLIA 4C92C 3CCUT 2C0TA 5DLOA 2LX9A 1Y0MA 2CS7A 1PRMC 3DLLA 2PU9B 4XTYA 2EYYA 5CKFA 5LJ3h 4C92B 1PWTA 3CCMA 1TTHB 4J9GA 2VB6A 2NWMA 1KQ1A 2DXCA 1U5SA 1SEMA 2IG0A 1QVFA 3ME9A 1BCOA 2EIFA 2DNUA 4RCCA 1Z9ZA 3RESA 4PFPA 2CSQA 2EKOA 1ZUUA 1WFWA 1W6XA 4M78G 1WNLA 4IUVA 1B34B 4M7AD 2F5KA 1OX9A 4J9FA 2OTLT 1OI1A 2OTLQ 1UGQB 3RNJA 1KC8C 1LOJA 2JTMA 3C4SA 3JCMb 4PLLA 1W2BP 2J6KA 1K8AC 3GBQA 2EGAA 2XHCA 1RACB 1VQ6T 4FCYA 2FRYA 1A0NB 1Q86C 3QZ9B 5D6WA 1QMCA 1TG0A 2M9UA 1GCQC 1RAIB 2XKOC 3UATA 2OX7A 3P8DA 4R55A 4E7LA 3CPWA 4RG2A 1I07A 5GAN7 2KI7A 4AG1C 3HP9A 2FPDA 4PFOA 2D6FA 1MMDA 2JZ2A 3CC4T 2D0NA 3CQTA 3VJPA 3CC4Q 3ZFJA 1K0XA 3TEEA 1KIKA 4BDZA 4AT1B 4JRKA 4RKUE 3KBGA 2RQUA 4PJLA 4PJOD 2BKDN 2LCLA 4RTUA 3QYGB 5KYXA 4ZNXA 1JXOA 2L3RA 1M2VA 1G3TA 2AZSA 2LQKA 1U06A 1U1SA 2M02A 1AZEA 3V8LA 1NJIR 4ZGDB 1W70A 1M8VA 2PUOB 3GIBA 2LP5A 2G3RA 1XQHA 4ZTJA 2FPFA 1NJIC 3CD6T 1M5Q1 3CD6Q 2CH4W 3UA6A 2KNBB 1OPLA 3M59A 1ZHIA 2QGFB 3OYFA 1VQ4T 2CUDA 1NM7A 2DXUA 2MOXA 2RJEA 4BB7A 3LGFA 1YHQQ 3CCEQ 1ZUKA 2XDPA 3VS0A 4F16A 4E7SA 1KJWA 5KYWB 1YI2T 1YI2Q 4BDYA 3NTHA 1PM3A 5GAMh 4M7DF 1QW1A 3SWNA 2FB7A 1NPRA 2MPXC 1V76A 1OZ3A 3C0CA 2ZPFB 2CSIA 1S1NA 4X34A 2OTJQ 3A8MB 1OX8A 2PQWA 1QVGS 5IH2A 2HL5C 4DOVA 2O88A 5GAOn 3HL8A 1N5ZA 3V8JA 5FU7C 1Q81R 1G3SA 1PNJA 2O9SA 2E64A 2MAMA 3X26B 5KYNA 2LRQA 3EGXA 1VYTA 2K5FA 2OI3A 5GMKm 4LDYA 4C92D 5GAN5 5FU7B 2X3WD 1WZOA 1YP5A 1SF9A 4AG2C 1NZ9A 2KXCA 2JUFA 4M7DB 3VRYA 4M78E 1X27A 5CKBA 3TQ7P 5L23A 3JCMP 1AOJA 2WSCE 4AFZC 3SDZA 1RI9A 2H3EB 2E6ZA 1Y57A 1QP2A 2LC4A 3LGLA 4KT0E 3I55A 3CMEA 8AT1B 4ESRA 2BZ8A 2BZYA 2DIQA 2V8JA 2A37A 3JB9I 2RQVA 4FU6A 3I56A 2EYZA 3HTRA 4JZ4A 1BU1A 1V1CA 4M7AG 4LDWA 1D1CA 3RBBB 4C0ZA 1IHVA 1Y71A 5GMKe 5L8RE 2RJFA 4MDWA 2BUDA 3A8OB 3JSCA 2BIVA 4WTOB 1PG5B 3MP6A 1MMGA 4IIOA 2JNGA 1VYUA 1PSFA 1TXQA 4C0DC 1BIBA 1N8RC 1K0SA 3WVEB 4NOYA 5KYYB 2DD5A 2AHJB 3CCQA 3NFCA 5DY9A 4C5GA 1WIEA 4LD6A 1RAFB 2BE7D 3H0FA 4LDXA 4E6RA 3EFSA 1K73C 1WGSA 3QBYA 4JJCA 2CT4A 1VQ7Q 4C0DB 1M2OA 4ZN1A 4LDVA 3UPUA 3J81E 3CCVT 1YITT 3CCVQ 1NYFA 2ZPBB 3A1PA 2DYIA 1Q7YU 2LQNA 2LDMA 3E2UA 1LJOA 1UUEA 4NS5A 4AFUC 2M1HA 3EGDA 2LVMA 2VXFA 2HSEB 1M30A 3A98A 4A53A 4KUDK 1AWJA 2ECZA 1VQ5T 1QVFP 4CRIA 1WJSA 5LL6S 5LJ5h 2DILA 3M0SA 5HCKA 1ZSZC 1K4US 2GTJA 3OY9A 3M0UA 2VGMA 1Q81U 4HT9A 4M78A 2NYSA 1ZSZB 2KRSA 2HMAA 3JCMe 2OJ2A 1VQ8T 3HPWA 2AZVA 3URGA 1VQLT 4QQDA 1YJNT 2Y4XA 1YJNQ 1VQPA 4OMQA 3QYHB 3G4SA 5J3BA 1OU8A 1WXBA 4GY5A 4RUGA 3IQLA 2GBQA 3QPHA 2XU8A 3G6ET 4E7ZA 5M9OA 3NGPA 3PE0A 2RM4A 5D6YA 2P4TA 1W2BA 1Y07A 4PL6A 4F7UF 3CCJQ 2FL7A 3CCLT 3CCLQ 5FU6C 5D7UA 2QXFA 3CPWP 3CCRT 3PNWC 3CCRQ 4RTVA 4OMFB 5CKEA 1MGQA 2RI3A 1X6GA 4C8QG 1MNDA 2HQXA 4L5GA 2EKHA 4ME7A 2BZXA 5DLQE 2X4YA 2EAYA 3E9FA 4FSXA 3DLMA 1TH7A 5GMKj 4C5HA 1K9MU 4ORZA 4J9HA 5GJWB 4F7UB 1HJDA 2O4XA 1VQKT 3JCMd 4M7DD 2HBPA 4QW2A 1M8MA 1ZBXA 4M77G 4D8DA 3QIIA 1QVFS 3P8BB 2CDTA 4RCBA 4XTVA 3OQ5A 4M7AE 1YJWA 3GOXA 3H6ZA 3VS1A 2L8DA 3BW1A 3FJ5A 2DK3A 4CC3A 2E3HA 5KYUA 2YUQA 3HRTA 1S72A 4IIMA 2HZYA 3EG2A 3ER0A 4MZPA 1BI2A 1I1JA 2LJ1A 3REAB 3OW2P 2CGHA 1ZX6A 3MEVA 3FEOA 2PUKB 1BI3A 2VWFA 2EBPA 3EFOA 3VV0A 4MMKA 5I2SA 2ABLA 2L2PA 4XK8E 1LVKA 2EGEA 2A3LA 2YXYA 3JRZA 2DRMA 4J6YA 1W1FA 3H0IA 4MZMA 1VQ4A 4O5VA 1GFCA 1X6OA 3VS2A 3CPWS 2QQ9A 3LWHA 3UDCA 3OS5A 5CVIA 1AWOA 2AK5A 2QASA 1N6AA 1Q82C 3SFMA 3ZBDA 1TS9A 4XU1A 4DBFA 1OEBA 2KROA 1ABOA 2LJ0A 2JMAA 3JCMc 1SKUB 1RAGB 3CBPA 4JJBA 3OYCA 4KH1B 2QA4T 3OMGA 4RTZA 5CQXA 1MV0B 2NUTA 1VQOQ 2ZPEB 5A0LA 1VQ9A 2WACA 1YCSB 2CZ1B 2ZAEA 1ZA1B 1MV3A 3GPLA 1BCMA 2QAZA 4M75G 1UJ0A 3OYHA 1KD1R 1D0ZA 4FT4A 4HCCA 3I56Q 4KGXB 4M7AA 3M54A 2JM8A 3PFSA 3L2ZA 1D1BA 2JTFA 2IIMA 4C8QE 2Y4YA 3QWXX 4RTWA 1T3SA 5D6XA 3LX7A 3CC7Q 2M16A 2HBWA 1KK7A 3FDRA 3OBWA 4DBRA 4JZ3A 4A4KA 4QKUA 1RLPC 3G71A 3KFVA 4J9DA 3WVDB 5CAIA 3QZ5B 1WHKA 3J80E 1FMKA 4C8QC 1WI7A 2KMTA 1YN8A 1AVZC 1UDLA 2GNCA 5LJ3e 5A0DA 2XG8D 4J7IA 1IZ6A 3CCSA 3NTIA 1LCKA 2RQTA 4M77E 4PK4A 1H641 1D0XA 2EQUA 4FW2A 1YBYA 1NLOC 1PCXA 2JW4A 3M4GA 1CKBA 2VUBA 3OSSC 4B9XA 2B86A 2SRCA 5GAOl 3HFOA 5DM7R 3OYYA 1PD0A 2WSFE 3LH0A 4II1A 2OAUA 1VIFA 4WF2A 4QT7A 2DVJA 3PT9A 2FYKA 3JB9J 4IUPA 1PRLC 2C06A 2X4XA 3ZL7C 2RB6A 3HKSA 1VUBA 2EYXA 1UTIA 2P84A 3VS3A 3I5RA 3TU4K 5KH6A 1SHGA 1M2VB 2L3PA 2PTKA 3L42A 1YIJT 1YIJQ 1WA7A 1SHFA 1VQPQ 3ASKA 1AZGB 3JB9D 2DKGA 3NPFA 2E41A 5GAOq 1GBRA 1ABQA 3S3OA 5LJ3d 1OOTA 1HYOA 4PNOA 1G2BA 2DL3A 2V8KA 4BI3A 2M0OA 2QK0A 3OBYA 2JM9A 3S3MA 4BI8B 1T0HA 3LYIA 4OB2B 1D3BA 3M53A 3V7SA 5J39A 5GAN2 4MZTA 4C8QA 3VUBA 3UT1A 1KD1U 1VQ8A 3VS6A 4OB1B 3SWNC 1UEBA 1B3QA 3MJXA 2DBKA 3BDLA 1M90U 1TOVA 1Y7XA 2A36A 3TVTA 1G3WA 5I21A 2VVKA 3RR6A 4AFQC 5CR2A 3G6EA 2KYBA 1C0MA 4J9BA 2QEXQ 4E7IA 1O9SA 4WCIA 3CXCA 4LUDA 4F17A 4KUIA 4M75E 4M75F 4AMCA 4M77A 4OMOA 4BY6C 1NEBA 3TSWA 1OYXA 1JU5C 1YJWQ 1AD5A 1QP3A 2L3SA 4HCKA 2EJ9A 3EGXB 2LQ8A 3THKA 2DAQA 2RQWA 3DKMA 2DL5A 2ROLA 1R0BG 4N4GA 4HXJA 4M75C 2KK4A 3M57A 3EHQA 1GFDA 1M27C 1FX7A 2FG0A 2QQAA 2X51A 5GAMe 1VQMT 1VQMQ 4A4FA 3CC2A 3M0QA 1Y96A 1YHQT 4J83A 3M58A 3CCET 1AWWA 5KCOA 2HKQB 3UA7A 4CC4B 1Q7YR 3OW2A 2DJZA 1OQKA 1W2BS 4JLGA 4F04B 1Q7YC 1UECA 2DZ9A 4OB0B 4GBQA 4X9DA 2OTJT 1UGVA 2CUBA 5FLXE 1YJ9A 1HD3A 3CMAA 1AWXA 1ZQ1A 4A54A 3EGUA 3EG9A 2HQHA 2HQEA 1OV3A 2Y90A 3BY7A 1MMNA 5I11A 1KC8U 2EFIA 3VRZA 2HL3A 2PVDB 1M4ZA 2GQVA 2X9HA 1Q81C 2ROTA 1GCPA 4F14A 2ZPIB 2KXDA 1Q86U 4M78F 1NYGA 5GAMd 2QYZA 2DL7A 1WJQA 2QG9B 1XNIA 3JCMQ 2A28A 5I2MA 2XI9A 5FRNA 4B9WA 1NBEB 3EGDB 3CBOA 4M75A 4J6WA 4OP0A 3MEUA 2EQKA 3OMCA 5GAN3 1UG1A 3CPFA 4YTLA 3QJYA 1OU9A 4OGEA 2DEUA 4XQ3A 4M78C 2JJ9A 5GAMg 2HAXA 1NE8A 2DM1A 3JCMW 2H3JA 3JB9G 1QVPA 5A2QE 1B7TA 2CP5A 1AT1B 3MPUB 4M78B 4ANJA 1GRIA 2E3IA 3E9GA 4P5NA 1J3TA 3G71Q 3SD4A 2X3XD 2ZCFB 1K9MR 2COYA 2K2VA 4C5IA 3M0PA 4L6V5 5GANh 4EPCA 2VC8A 3CCSQ 1VQ7T 2K3BA 1BKBA 3A8HB 1K9MC 1ARKA 2RK2A 2DXBA 4XU2A 2XIDA 1JJ2A 2EQIA 2PNIA 4R0KA 4JRPA 5LJ5e 5GAMj 4FYXB 3RKYA 1BBZA 1UE9A 3OYIA 3CCMT 3CCMQ 1NPPA 1MUZA 5CIUA 2AKKA 2LCSA 2EW3A 2RPNA 1WHGA 4JS4A 2MIOA 1VQNA 4PJOG 2JVVA 4AFSC 4KBMB 2COZA 1E6GA 3CCUA 3M0TA 5GAOm 3VYHB 3FIFA 1RI0A 1BI1A 1SPKA 2O4XB 3E19A 5EC7A 1H92A 1SG5A 1MMAA 1PC0A 2F2VA 5HY6A 2C0OA 4HVWA 2DEQA 1X2QA 4RTXA 2SEMA 1TU0B 4CI0C 4C5EA 2KRNA 2Z0WA 1I5OB 3OS0A 5FWBA 2KVQG 3MCAB 4JJDA 1JB0E 5KYUB 3D7SB 4GLMA 2HDAA 2I0NA 3M9QA 2GTOA 5LJ5d 3CCJT 3OYBA 1NLPC 4BE1A 2V1QA 1VYVA 1SRLA 2RNAA 2LT4A 2QQBA 2DBMA 5IXFA 1AEYA 4PKCC 3MHXA 1V29B 2JTEA 4JS5A 2EGCA 4D8KA 1UGSB 4HKEA 3M0RA 2OTLA 1QCNA 3EFOB 2LX7A 2L5QA 4IURA 5FU6B 2LQWA 3P8HA 2L3QA 2EJFA 5LJ5g 2DRKA 1T3LA 1D09B 3CXCP 4JJNK 1VQ6A 3LH5A 1RUWA 2KAFA 3OB9A 3ZEHA 2IPOB 3JAME 2VKNA 1OPKA 3L2VA 4FT2A 4N0AA 3R6OA 1CKAA 1XTDA 1WJRA 2RJCA 2E4HA 1JXMA 1GBQA 1G83A 2CREA 2M51A 1VA7A 4XU3A 4RTTA 2YT6A 4XTXA 2DZCA 1H3ZA 2X4JA 1U1TA 2H8HA 4FL6A 4C92G 2KRMA 5GAOr 4M7AF 3CC4A 2DIGA 3SB2A 4X9CA 2YRVA 1M3BA 1QKXA 1X43A 2RHYA 2XMFA 3JCMg 2ZPGB 1WHLA 3GP8A 5HK3A 4EMKA 5LJ5j 2I2LA 1UHCA 2KT8A 3M55A 2NUTB 4M7AC 4A4GA 1WHHA 1Z9QA 3S3NA 1I4K1 1QKWA 1M3AA 2JT4A 2F2XA 1WHMA 4C0FA 4EMHA 2JN0A 4M78D 2ED0A 1M1KR 1G3YA 1NG2A 4M7AB 3QO3A 2NUPB 3CD6A 2FHDA 2XDBA 3OYGA 1YJ9Q 1PSEA 2E12A 2RHXA 3MKDA 3RIRA 2XK0A 3HRSA 5GAOp 3OYEA 3VS7A 1PHTA 3PIPA 1YHQA 4PJOE 3GLXA 3CCEA 1GXIE 2AIRB 1O75A 4J6XA 4RG8A 1YI2A 1TSFA 3QJ6A 2RHZA 2D8HA 1WLPB 1X75C 1LPLA 3CXCS 4V2SA 2E10A 2E5KA 2O31A 2MF2A 4A4EA 2R5MA 2V26A 1SRMA 2OAWA 2GCXA 2JMCA 4LD9K 1QWFA 4JRIA 4ZGJB 2DLPA 3L1AA 3DB3A 4KH0B 2P0PA 1Q95G 4A63B 1VQOT 4XU0A 5AYFA 2EPDA 4JDSA 2HSPA 4DBQA 3I55Q 3CMET 5A0GA 3CMEQ 2ZPHB 3QSUA 3OYAA 1BYMA 2YWWA 2CP2A 1M1GA 2DTOA 1WQWA 2M0YA 1N9SA 1AHJB 2DERA 5C6SA 1M1FA 4OB3B 3JCMf 2KE9A 2JS2A 2VASA 3VKIA 4ATOA 3I56T 1T0JA 2P4RA 3I35A 1U8RA 2LNVA 1FWZA 4A4HA 2XICA 1M90R 3OYKA 2K6DA 1KD1C 4C8QF 2HNIA 2MWOA 2WSEE 4PJMA 4DEYA 2J06A 3UWNA 2X35A 5CCAA 4CC7A 2KBTA 1X01A 4XTZA 3OW2S 2EQJA 4J7FA 3RERA 3CCQQ 4Q5WA 3CC7T 4J9IA 1JEGA 4MMLA 2K5LA 1LNXA 2C0IA 3FRNA 3BDUA 4HVVA 4KGZB 2QQRA 2L89A 2HEQA 1JJ2P 2A0FB 4Z02A 1I5LA 3REBB 4HA8A 2JS0A 5KE2A 4C92E 3AHUA 3I5SA 3BE3A 3GNGA 4D6WA 1BB9A 4M77F 1D3BB 4BI4A 4FYVB 3S6WA 4C8QB 2O01E 1M1KU 4OMPA 3F70A 5CKDA 5J26A 3OS2A 1RAEB 2COWA 1RLQC 3HHTB 4PJOA 2LT1A 3QG1A 1K9AA 1VQ7A 1NEGA 4J9EA 1XJWB 2DPPB 2FRWA 3CCUQ 2ZZDA 4M77C 2HKNA 1U3OA 2ENMA 3CCVA 1H3HA 1YITA 1IXDA 2JXBA 8ATCB 4GLKA 4M7DG 4HVUA 3RKWA 1DJ7B 3JCMJ 4M77B 4DEXA 1FXXA 3RMQA 3BFMA 5KYXB 1D0YA 4HT8A 2DFUA 3EH2A 2DL8A 1VQPT 1IGUA 3G4ST 3G4SQ 1VQ5A 1Q82U 4BACA 5GMKi 1TUCA 2FVUA 5CQYA 2YHTA 2YLBA 4QVCA 2RI2A 1KC8R 1H8KA 3OYDA 5CO7A 2MK5A 1G5VA 1HXDA 3VUZA 2HCKA 1K8AR 3KUFA 2LMJA 3X24B 4NL2A 2D8JA 1Y96B 2JOYA 2CKKA 2PVGB 1E6HA 2P0KA 5LJ3g 1YJNA 1Q86R 1VQLA 2FEIA 5FWCA 1WYXA 1VQ6Q 3EG1A 4DBHA 3V7CA 1JJ2S 2KEAA 4OMLA 3OYNA 3RMSA 4OVAA 3SWNB 1QVGP 3EAEA 3CCJA 2QEXT 3FJPA 3CCLA 1KQSA 1ZBJA 4PJJA 3JV3A 4LN2A 3CCRA 1OZ2A 4C92A 2FZGB 1BIAA 5C0MA 2YUPA 2DTHA 2RQRA 1K76A 3EG9B 3A8GB 3E1SA 4Y28E 4E7JA 3HSBA 2K3XA 3L2UA 2NLUA 2W0ZA 2CZ7B 1YJWT 2ATCB 2VXEA 4C0GA 1D1AA 4FIBA 4N4IA 1VOMA 2RJDA 2RHUA 4BY6B 1S72T 1S72Q 5LJ3j 1X69A 2MYSA 4EMGA 5GAN6 3PTAA 1SSHA 2CZ0B 4Z89A 2FZKB 2KQWA 1VQKA 3TSZA 2XD0A 1B34A 2KT1A 3QKJA 4RMOA 4M75B 7AT1B 4VUBA 2F1LA 2YLCA 2KDSA 9ATCB 1RAHB 4QVDA 1W4SA 3N5BB 3NTKA 2D1XA 4FW1A 3O5ZA 3TCJA 2E5QA 1VQ4Q 3C95A 5IHKA 3T9NA 1OULA 4DOWA 3VS5A 4ELYC 3OS1A 2MWPA 5LJ3f 4O6JA 2GFUA 4NL3A 1G8XA 1QQJA 5KCHA 3PMIA 2KR3A 5GJVB 2K4YA 2D0QB 3V7RA 5GAN4 2YSQA 2RK1A 4LUEA 1GCQA 4M7DE 1IO6A 1YNZA 1UHFA 4OF1A 5HKCA 4C8QD 2FZCB 4XAXB 1KSWA 1JRIA 2CYZB 2AKLA 1K8AU 2QQSA 3MO8A 4QVZA 2LCCA 1QWEA 1BI0A 1BK2A 5HK0A 3A8LB 2V1RA 1ZLMA 4JRQA 4F7UG 1VQ9T 2F69A 2QDLA 4M7DC 1ZSGA 1VQ9Q 2J05A 3M5AA 4KGVB 2VV5A 4IUTA 2FPEA 2L0AA 3JB9H 2CP3A 5FROA 4M77D 1ACMB 3A5ZB 3QDRB 2QTXA 2ZGWA 3VU3C 1B07A 5IHNA 4PFZA 2MMPA 1RABB 2R5AA 3L2QA 5GANe 2QA4A 1VQOA 4PJNA 3H41A 2CP7A 5KE3A 2IVWA 1KHIA 1KHCA 5KYWA 3I9QA 3EFRA 2RA2A 1RAAB 3PIOA 3L2WA 3G71T 2AT1B 1I0CA 1QLYA 1X6BA 2QDYB 3V8KA 3C94A 2RMOA 4E7HA 2KSSA 4UC4A 3KXTA 1N8RR 3CCST 4BD3A 1KG1A 3FB9A 1NJIU 2YDLA 2RF0A 2E70A 3ULRB 3X25B 3RKXA 1K73R 2YRCA 1CSKA 5FRMA 2O9VA 1TWBA 1SSFA 3RDVA 3GF5A 4ELZC 3CC7A 1I8FA 2DYBA 4RTYA 2VYTA 5EG2A 2ED1A 4LNPA 4OMNA 1EIFA 5GMKh 1VIEA 4LXCA 4N0AC 2B8AA 4KRTA 2DL4A 3OA6A 1YITQ 4M7DA 2CZ6B 4K11A 4J5YA 1EFNA 3NMZC 5GANd 1F1BB 4OMMA 1WX6A 4Y91A 1FMVA 2KYMA 2DJQA 4Z8AA 2RO0A 1PKSA 3CBMA 4M4ZA 2DX1A 5CKHA 1VQ5Q 4Z88A 2DTIA 5GAMf 2QI2A 2RN8A 1EZZB 4OGCA 1C1AA 2DMOA 2J7IA 4EMKC 5GANg 2DD4A 3R6NA 4DQ2A 4M75D 2DO3A 2EWNA 4LE9A 3X28B 3CEYA 4EIKA 1EX4A 2XDDA 4EDUA 3RUXA 1K1ZA 3MEAA 1YCYA 4EMKB 3LLRA 1WHJA 1VQ8Q 4BE0A 3H0HA 1KQ2A 5KYYA 2QTVA 1YIJA 1VQLQ 3LW5E 2LZ6B 3MP8A 3QHSA 2V8IA 3QXEB 2DF6A 2KY9A 4ZGEB 3WXMB 4IKFA 3OYMA 3AT1B 5ECAA 3VS4A 3JCMX 4ZTFA 2VGNA 3H8ZA 3G6EQ 4JPBW 4QQ6A 1WDXA 2X4WA 3JCMh 2E6NA 3NHNA 4F7UE 3DB4A 1KQSP 4KULA 4IUUA 1MHNA 1R77A 3FC3A 1FMWA 1IRXA 2DE0X 6AT1B 1HSQA 1QCFA 5GANj 1HK9A 2A7YA 3TREA 1TUDA 5I22A 1QVGA 5IAYA 2MCNA 3HFNA 2DXTA 2K2MA 1GL5A 2NUZA 1N8RU 3META 4X1VA 4N4HA 3Q1JA 2K57A 3JB9F 2EJGA 1K73U 1WXTA 2RD1A 4HCBA 3OYLA 2QEXA 2YUNA
chains in the Genus database with same CATH topology
1BIBA 1QP3A 3M4YA 1N8RC 2EJ9A 4NOYA 4Z02A 3WVEB 2DD5A 1I5LA 2AHJB 3CCQA 3NFCA 2LQ8A 4HA8A 5DY9A 4C5GA 4LD6A 5KE2A 3CC2T 2DAQA 4LDXA 4C92E 2F5TX 3DKMA 4N4GA 3AHUA 3GNGA 3EFSA 4IUQA 1WGSA 2KK4A 3QBYA 4M75C 3M57A 4M77F 1D3BB 4D6WA 1JBMA 2D9TA 4C0DB 5GANf 4BI4A 1IREB 3S6WA 4C8QB 4ZN1A 2O01E 3X20B 1M1KU 1UGRB 4LDVA 1FX7A 3UPUA 3J81E 3F70A 5CKDA 2QQAA 3CCVT 4XTUA 5GAMe 1YITT 5J26A 1VQMT 3C12A 3OS2A 2ZPBB 3HHTB 3HRUA 4A4FA 4PJOA 3FLGA 1Q7YU 3CC2A 1Y96A 2LT1A 2LDMA 3QG1A 4J83A 1YHQT 3M58A 1LJOA 3CCET 1VQ7A 3MP1A 2DPPB 5KCOA 4NS5A 2ZZDA 2M1HA 4M77C 3OW2A 1YJ9T 2K3YA 4E7KA 2LVMA 3CMAT 2VXFA 1M1KC 2DJZA 5GAN8 4XTWA 4A53A 1W2BS 3CCVA 4KUDK 4TVRA 1YITA 1VQMA 4GLKA 1VQ5T 4JLGA 4M7DG 4CRIA 3RKWA 1WJSA 1Q7YC 2DZ9A 5LL6S 4ZN3A 1DJ7B 5LJ5h 4PJOF 3JCMJ 2PVOB 4OB0B 4BE2A 4M77B 4X9DA 2R58A 5LJ5f 1FXXA 3RMQA 3BFMA 3L2RA 2OTJT 5FLXE 4HT8A 2EYQA 2E1HA 4LDUA 1YJ9A 3CMAA 3OY9A 4FM4B 1ZQ1A 1VQPT 4BUGA 4A54A 2VGMA 1Q81U 3G4ST 1M9SA 4HT9A 2HQEA 1KQSS 1VQ5A 1Q82U 4BACA 4M78A 5GMKi 3GNFB 2Y90A 3BY7A 2FVUA 1WPYA 5CQYA 2LTOA 2RI5A 2YHTA 1XOVA 3JCMe 4HCZA 1K73C 1KC8U 2YLBA 4F7UA 1VQ8T 2EFIA 4IKFA 2OTJA 3HPWA 4PJOC 4QVCA 5GMKl 3URGA 1VQLT 1N27A 2RI2A 4QQDA 4QQGA 1YJNT 2Y4XA 2PVDB 1M4ZA 2GQVA 1VQPA 5IT9E 3QYHB 3OYDA 3G4SA 5CO7A 1Q81C 1G5VA 1HXDA 5J3BA 1R8OB 3VUZA 3LWIA 2ZPIB 3M56A 3O8VA 4GY5A 3KUFA 3VYGA 3X24B 3I55T 3QPHA 4M7DB 1Q86U 3PGGA 4M78F 4NL2A 4PJOB 2XU8A 5GAMd 3G6ET 5M9OA 1Y96B 2JOYA 1UB4A 2GFAA 2RM4A 1WJQA 5D6YA 1XNIA 3JCMQ 2PVGB 2CKKA 2P4TA 5LJ3g 1Y07A 2P0KA 4PL6A 5I2MA 4F7UF 2FL7A 3CCLT 1YJNA 1VQLA 2XI9A 5FRNA 4B9WA 5FU6C 3CBOA 4M75A 4JUVA 2QXFA 3CCRT 3PNWC 4J6WA 4OP0A 1JJ2S 3MEUA 3V7CA 3MEWA 2EQKA 3OMCA 4OMFB 5CKEA 3OYNA 5GAN3 1MGQA 2RI3A 1P92A 3CPFA 4YTLA 3RMSA 4DA4A 4C8QG 1U8RA 2DVEA 3QJYA 4OVAA 4OGEA 3SWNB 4XQ3A 3EAEA 4M78C 5GAMg 2HAXA 2HQXA 3CCJA 1NE8A 2QEXT 3FJPA 3JCMW 3CCLA 2RHIA 1KQSA 2H3JA 2R57A 3CCQT 4MDXA 4L5GA 2MI6A 4ME7A 3CCRA 1OZ2A 5DLQE 2X4YA 4C92A 1BIAA 5C0MA 1QVPA 3JB9G 1M90C 2DTHA 5A2QE 2GF7A 2RH2A 2EAYA 3A8GB 3E1SA 4M78B 3E9FA 4Y28E 4E7JA 4FSXA 3HSBA 3DLMA 2K3XA 3L2UA 3J7AF 1TH7A 2NLUA 2CZ7B 5GMKj 1YJWT 4C5HA 3E9GA 1K9MU 2VXEA 4C0GA 4P5NA 4F7UB 4FIBA 4N4IA 3JCMV 5CK9A 3OYJA 3SD4A 2O4XA 1VQKT 2K5IA 2ZCFB 3JCMd 2RJDA 3INZA 3OSVA 2E65A 2K2VA 2RHUA 4C5IA 4M7DD 4BY6B 1S72T 2HBPA 4QW2A 1ZBXA 4M77G 5LJ3j 4C92F 1I81A 4L6V5 3QIIA 5GANh 1QVFS 3P8BB 2VC8A 4EMGA 4EPCA 4RCBA 5IN1A 4XTVA 3OQ5A 5GAN6 3PTAA 1VQ7T 4M7AE 3G7ZA 1UGPB 2CZ0B 1YJWA 1BKBA 3A8HB 3GOXA 3H6ZA 1K9MC 2EQMA 2L8DA 3PMTA 3BW1A 2RK2A 2DXBA 4XU2A 2KQWA 2HD0A 2XIDA 1JJ2A 2P0QA 2DK3A 4JLIA 1VQKA 2XD0A 1B34A 1N9RA 3QKJA 4L59A 3HRTA 4RMOA 1VQNT 4JRPA 4M75B 5LJ5e 5GAMj 1S72A 3RKYA 4VUBA 3OYIA 3CCMT 4R56A 2YLCA 1RL2A 1W2BA 1NPPA 1WQ7A 2KDSA 4E47A 3QUIA 4J8OA 3ER0A 4PLIA 4C92C 4MZPA 3CCUT 5DLOA 1BI2A 4QVDA 1W4SA 2LX9A 3N5BB 5CIUA 2CGHA 3NTKA 3MEVA 2CS7A 3FEOA 2PUKB 1BI3A 3TCJA 4JS4A 2E5QA 1VQNA 3DLLA 4PJOG 3C95A 2JVVA 2PU9B 4KBMB 4XTYA 5CKFA 3T9NA 5LJ3h 4C92B 3CCMA 3VV0A 4DOWA 3OS1A 4ELYC 4MMKA 2MWPA 5LJ3f 5I2SA 4XK8E 3CCUA 4O6JA 2GFUA 3VYHB 2A3LA 5GAOm 3FIFA 4NL3A 1KQ1A 1RI0A 1BI1A 3JRZA 2DXCA 4J6YA 4ZTFA 5KCHA 2L89A 2IG0A 3PMIA 1QVFA 3ME9A 2O4XB 4MZMA 2K4YA 2D0QB 4O5VA 3E19A 1VQ4A 3V7RA 1X6OA 5GAN4 2RK1A 2EIFA 4M7DE 3CPWS 4RCCA 4OF1A 5HKCA 2QQ9A 4C8QD 3LWHA 3UDCA 5HY6A 3OS5A 5CVIA 4XAXB 2DEQA 3RESA 4CI0C 1JRIA 2CYZB 4C5EA 1K8AU 2QQSA 3MO8A 4QVZA 2LCCA 3OS0A 1N6AA 2EKOA 2KVQG 3MCAB 1Q82C 1JB0E 4M78G 1WNLA 4IUVA 1BI0A 1B34B 3SFMA 2F5KA 3A8LB 3ZBDA 5HK0A 4M7AD 2OTLT 1OI1A 1UGQB 4XU1A 4JRQA 4F7UG 1KC8C 1LOJA 1VQ9T 2F69A 2JTMA 3C4SA 3M9QA 3JCMb 4PLLA 5LJ5d 3CCJT 3OYBA 4M7DC 3M5AA 2VV5A 4BE1A 4IUTA 1K8AC 3JCMc 2LT4A 2QQBA 3CBPA 2XHCA 3OYCA 4PKCC 1VQ6T 3MHXA 1V29B 3JB9H 2QA4T 3OMGA 5CQXA 5FROA 4M77D 4JS5A 1UGSB 4HKEA 2OTLA 1Q86C 3QZ9B 5D6WA 2ZPEB 5A0LA 3A5ZB 3QDRB 1VQ9A 2M9UA 2L5QA 2QTXA 2ZGWA 2WACA 4IURA 3VU3C 5FU6B 2CZ1B 3P8HA 2EJFA 2MMPA 5LJ5g 3GPLA 2XKOC 4M75G 3OYHA 3P8DA 4R55A 4E7LA 4JJNK 2R5AA 3CPWA 3OB9A 2KAFA 4FT4A 4RG2A 5GAN7 3L2QA 5GANe 3ZEHA 4HCCA 2QA4A 3JAME 4M7AA 3HP9A 3L2VA 1VQOA 4FT2A 3M54A 4N0AA 5KE3A 2IVWA 3R6OA 3PFSA 3L2ZA 2D6FA 1XTDA 1WJRA 2RJCA 1KHCA 1KHIA 2JZ2A 3CC4T 2JTFA 3VJPA 2RA2A 2Y4YA 3EFRA 4C8QE 4XU3A 3ZFJA 3PIOA 3TEEA 3L2WA 4XTXA 3G71T 2DZCA 4BDZA 5D6XA 1H3ZA 4JRKA 2X4JA 2QDYB 3LX7A 4RKUE 3V8KA 3KBGA 1U1TA 4FL6A 4C92G 3C94A 4E7HA 2KSSA 4UC4A 3KXTA 4PJOD 3CCST 2BKDN 4BD3A 2LCLA 1KG1A 2M16A 3QYGB 3FB9A 5GAOr 3FDRA 3OBWA 2L3RA 4M7AF 1G3TA 2LQKA 1NJIU 4A4KA 2E70A 2DIGA 3SB2A 3CC4A 3X25B 1U1SA 3RKXA 4X9CA 3G71A 2YRVA 3V8LA 3WVDB 5CAIA 3QZ5B 3J80E 4C8QC 2KMTA 5FRMA 2RHYA 1SSFA 3JCMg 3GF5A 4ZGDB 4ELZC 2XG8D 5A0DA 5LJ3e 2ZPGB 4J7IA 3CC7A 3GP8A 1M8VA 5HK3A 1IZ6A 3CCSA 3NTIA 4EMKA 1I8FA 2PUOB 5LJ5j 3GIBA 2I2LA 2G3RA 2VYTA 4M77E 1XQHA 5EG2A 3M55A 4ZTJA 1H641 1NJIC 1EIFA 5GMKh 3CD6T 2EQUA 1M5Q1 1YBYA 4M7AC 1VIEA 4N0AC 4A4GA 2B8AA 3M59A 1ZHIA 3M4GA 3S3NA 1I4K1 2VUBA 3OSSC 4B9XA 3OYFA 1VQ4T 3OA6A 4M7DA 4C0FA 2CZ6B 4EMHA 2JN0A 4M78D 1G3YA 2DXUA 5GAOl 2RJEA 3HFOA 3LGFA 4BB7A 5DM7R 3OYYA 4J5YA 4M7AB 2WSFE 3QO3A 3LH0A 4II1A 2XDPA 3CD6A 2OAUA 5GANd 2FHDA 1VIFA 2XDBA 3OYGA 4WF2A 4Y91A 1YI2T 2RO0A 1PSEA 3PT9A 3NTHA 4BDYA 2FYKA 2E12A 3CBMA 2RHXA 4IUPA 3JB9J 2C06A 2X4XA 2RB6A 3HKSA 5CKHA 5GAMh 1VUBA 2XK0A 3RIRA 3HRSA 5GAOp 2DTIA 4M7DF 5GAMf 1QW1A 2QI2A 3SWNA 3OYEA 3PIPA 1YHQA 4PJOE 2FB7A 3GLXA 1NPRA 3CCEA 3TU4K 5KH6A 1OZ3A 1GXIE 2ZPFB 4X34A 3A8MB 1O75A 4J6XA 4OGCA 3L42A 4EMKC 2PQWA 4RG8A 2DD4A 5GANg 1YI2A 1YIJT 1QVGS 4DQ2A 4M75D 3QJ6A 2RHZA 2DO3A 2EWNA 3ASKA 4DOVA 3X28B 2DKGA 3JB9D 2E41A 1X75C 5GAOn 3CEYA 3CXCS 3HL8A 5GAOq 4V2SA 3V8JA 2E10A 2XDDA 5FU7C 4A4EA 4EDUA 2MF2A 3RUXA 2R5MA 3MEAA 1G3SA 1YCYA 3LLRA 4EMKB 2GCXA 5LJ3d 3S3OA 2E64A 2MAMA 3X26B 4BE0A 4LD9K 2LRQA 1KQ2A 4PNOA 4JRIA 2V8KA 4ZGJB 3LW5E 4BI3A 1YIJA 3MP8A 2M0OA 3QHSA 2K5FA 3L1AA 2V8IA 3OBYA 3QXEB 4LDYA 5GMKm 3DB3A 3S3MA 4BI8B 4C92D 2P0PA 5GAN5 5FU7B 2KY9A 4ZGEB 1VQOT 4XU0A 3WXMB 1NZ9A 1D3BA 2JUFA 3LYIA 3M53A 4JDSA 4OB2B 5AYFA 4M78E 3V7SA 5J39A 5GAN2 3OYMA 3CMET 5CKBA 4MZTA 5A0GA 4C8QA 2VGNA 3H8ZA 3JCMX 2ZPHB 3VUBA 3UT1A 3OYAA 3QSUA 1BYMA 1KD1U 1VQ8A 4QQ6A 3JCMP 1M1GA 2X4WA 2DTOA 1WQWA 2WSCE 1N9SA 3SDZA 2E6NA 1AHJB 3JCMh 4F7UE 4OB1B 3SWNC 3DB4A 5C6SA 1M1FA 2E6ZA 1UEBA 4KULA 4OB3B 3JCMf 4IUUA 1MHNA 3VKIA 3FC3A 4ATOA 3I56T 1QP2A 3BDLA 2LC4A 1M90U 1Y7XA 1G3WA 3LGLA 5I21A 5GANj 4KT0E 1HK9A 2LNVA 1FWZA 4A4HA 2A7YA 3I55A 3CMEA 3TREA 2XICA 5CR2A 3G6EA 1QVGA 5IAYA 2DIQA 3HFNA 2DXTA 3OYKA 1KD1C 4C8QF 2V8JA 2HNIA 2MWOA 2WSEE 3JB9I 3UWNA 2X35A 1N8RU 5CCAA 3META 1O9SA 4E7IA 1X01A 3CXCA 4XTZA 3OW2S 2EQJA 1VQ6A 4FU6A 4J7FA 3RERA 4N4HA 4Q5WA 3I56A 4KUIA 4M75E 3CC7T 4M75F 4M7AG 4LDWA 3Q1JA 4M77A 2K57A 4C0ZA 1Y71A 2EJGA 4MMLA 5GMKe 1K73U 3JB9F 2K5LA 5L8RE 2RJFA 4MDWA 4BY6C 2BUDA 3A8OB 2BIVA 2RD1A 3JSCA 1OYXA 1LNXA 3FRNA 3MP6A 4HCBA 3BDUA 2JNGA 1PSFA 3OYLA 2QEXA 4C0DC 2QQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJE A;  3OYN A;  3LGF A;  2QQS A;  2RI3 A;  3MO8 A;  4Z02 A;  4QVZ A;  2LCC A;  4OVA A;  3OS0 A;  2EKO A;  3LH0 A;  4II1 A;  2XDP A;  3EAE A;  4C5G A;  2FHD A;  4LD6 A;  2HQX A;  4IUV A;  5KE2 A;  2F5K A;  2DAQ A;  3OYG A;  2RHI A;  4N4G A;  2RO0 A;  1OI1 A;  2R57 A;  4BDY A;  3NTH A;  4IUQ A;  1WGS A;  3QBY A;  2RHX A;  4IUP A;  2D9T A;  2X4X A;  1OZ2 A;  3C4S A;  2X4Y A;  3M9Q A;  4PLL A;  3S6W A;  5C0M A;  3OYB A;  2XK0 A;  2GF7 A;  4BE1 A;  3OYE A;  4IUT A;  3F70 A;  3E9F A;  4E7J A;  3OYC A;  3DLM A;  2K3X A;  3L2U A;  5J26 A;  2NLU A;  5KH6 A;  1OZ3 A;  3OS2 A;  4C5H A;  3E9G A;  4X34 A;  4A4F A;  3FLG A;  3L42 A;  3OMG A;  4N4I A;  5FRO A;  2PQW A;  3OYJ A;  2LDM A;  3SD4 A;  5D6W A;  2O4X A;  2RJD A;  3QJ6 A;  2RHZ A;  3MP1 A;  5KCO A;  4NS5 A;  3ASK A;  2RHU A;  2WAC A;  4IUR A;  4C5I A;  2M1H A;  3CEY A;  4QW2 A;  2K3Y A;  2QQR A;  2LVM A;  3P8H A;  4E7K A;  3QII A;  4A4E A;  4EDU A;  5IN1 A;  2R5M A;  3OQ5 A;  3P8D A;  3MEA A;  3OYH A;  4E7L A;  3S3O A;  3LLR A;  2R5A A;  3OB9 A;  4RG2 A;  3L2Q A;  3GOX A;  3H6Z A;  4CRI A;  3ZEH A;  4BE0 A;  2EQM A;  2LRQ A;  2L8D A;  3PMT A;  1WJS A;  3L2V A;  3MP8 A;  2M0O A;  5KE3 A;  4BE2 A;  3PFS A;  2R58 A;  1WJR A;  2RJC A;  1KHC A;  3L2R A;  3S3M A;  2JZ2 A;  3DB3 A;  3QKJ A;  4L59 A;  2JTF A;  3L2W A;  3LYI A;  5J39 A;  4BDZ A;  3OYM A;  5D6X A;  3OY9 A;  4IKF A;  3OYI A;  1H3Z A;  3LX7 A;  4ZTF A;  3H8Z A;  3UT1 A;  4PLI A;  3OYA A;  4FL6 A;  2HQE A;  4E7H A;  4QQ6 A;  2X4W A;  4BAC A;  4UC4 A;  2E6N A;  5CIU A;  5C6S A;  3DB4 A;  2BKD N;  4BD3 A;  3NTK A;  2M16 A;  2LTO A;  3MEV A;  2RI5 A;  1MHN A;  3FDR A;  4IUU A;  2L3R A;  4HCZ A;  3FEO A;  3FC3 A;  2EFI A;  3BDL A;  2DIG A;  2E5Q A;  1N27 A;  2RI2 A;  4QQD A;  4QQG A;  2YRV A;  3LGL A;  4A4H A;  3OS1 A;  2MWP A;  5FRM A;  3OYD A;  2RHY A;  5IAY A;  1G5V A;  1SSF A;  2DIQ A;  3OYK A;  4C5E A;  2GFU A;  2MWO A;  1RI0 A;  3O8V A;  3KUF A;  4GY5 A;  3UWN A;  2X35 A;  3NTI A;  5KCH A;  4E7I A;  3MET A;  2G3R A;  2VYT A;  2EQJ A;  5M9O A;  4ZTJ A;  2IG0 A;  3PMI A;  4FU6 A;  3ME9 A;  2GFA A;  2O4X B;  1WJQ A;  2EQU A;  4N4H A;  1XNI A;  4Q5W A;  2CKK A;  5D6Y A;  2P0K A;  4PL6 A;  3Q1J A;  4A4G A;  5FRN A;  2B8A A;  4B9W A;  3S3N A;  2RJF A;  2BUD A;  2BIV A;  4B9X A;  1OYX A;  3OYF A;  3OA6 A;  3MP6 A;  3PNW C;  3MEU A;  3MEW A;  3OYL A;  2EQK A;  3OMC A;  2L89 A; 
#chains in the Genus database with same CATH topology
 2F2W A;  3M4Y A;  1VQK Q;  1ZSZ A;  3CC2 T;  3EHR A;  2F5T X;  3CC2 Q;  2CP6 A;  2K79 A;  4IUQ A;  1JBM A;  1IB8 A;  2CH4 A;  2D9T A;  5GAN f;  1IRE B;  3X20 B;  1UGR B;  4XTU A;  3C12 A;  1PD1 A;  3HRU A;  3FLG A;  1FYN A;  3EH1 A;  3MP1 A;  1YJ9 T;  2K3Y A;  4E7K A;  3CMA T;  2J6F A;  3CMA Q;  1M1K C;  5GAN 8;  5IHI A;  4XTW A;  4TVR A;  1MNE A;  1VQM A;  3QDF A;  3SHW A;  2ESW A;  2PZ1 A;  5FW9 A;  3EG3 A;  4ZN3 A;  1ZUY A;  4PJO F;  2PVO B;  2LNH B;  4BE2 A;  2R58 A;  5LJ5 f;  5IXB A;  3L2R A;  2EYW A;  4FYW B;  2EYQ A;  2E1H A;  2FO0 A;  4LDU A;  4FM4 B;  4BUG A;  2W10 A;  1X2K A;  4E2F B;  1M9S A;  1KQS S;  3GNF B;  3PVQ A;  1PKT A;  1WPY A;  2LTO A;  2O2O A;  1QCO A;  2RI5 A;  1XOV A;  4HCZ A;  1Q82 R;  4F7U A;  2OTJ A;  4FSS A;  4PJO C;  5GMK l;  2G6F X;  1N27 A;  4QQG A;  3QWY A;  1M3C A;  5IT9 E;  4J9C A;  1R8O B;  3LWI A;  3M56 A;  3O8V A;  2DA9 A;  2GQI A;  3VYG A;  3I55 T;  3PGG A;  1C6V X;  4PJO B;  1UB4 A;  2K9G A;  2GFA A;  2J6O A;  3PVL A;  1E7O A;  2LJ3 A;  4JUV A;  2YRD A;  1YFN A;  3MEW A;  3SEM A;  2QA4 Q;  1IGQ A;  1P92 A;  4DA4 A;  2DVE A;  2BE9 B;  2RHI A;  2KGT A;  2YUO A;  1YWP A;  1IHW A;  1KFZ A;  2R57 A;  3CCQ T;  2A08 A;  4MDX A;  2MI6 A;  1M90 C;  1R0C B;  4FYY B;  1JQQ A;  2GF7 A;  2RH2 A;  2GGR A;  4CC2 A;  2NUP A;  3J7A F;  2EVR A;  1RAD B;  2CP0 A;  1WXU A;  1YWO A;  3UF4 A;  3JCM V;  5CK9 A;  3OYJ A;  5AT1 B;  3EG0 A;  2K5I A;  3INZ A;  3OSV A;  2E65 A;  4B6M A;  2QGG A;  4C92 F;  1I81 A;  4Y92 A;  2CT3 A;  3H9N A;  5IN1 A;  3G7Z A;  1UGP B;  2DET A;  2EQM A;  2BTT A;  3PMT A;  1UJY A;  2HD0 A;  2P0Q A;  4JLI A;  1ZA2 B;  1N9R A;  3G1J A;  1JO8 A;  4L59 A;  1VQN T;  1VQN Q;  3U23 A;  1UFF A;  2K7A A;  1TUG B;  4R56 A;  1RL2 A;  1WQ7 A;  4E47 A;  3QUI A;  4J8O A;  4PLI A;  4C92 C;  3CCU T;  2C0T A;  5DLO A;  2LX9 A;  1Y0M A;  2CS7 A;  1PRM C;  3DLL A;  2PU9 B;  4XTY A;  2EYY A;  5CKF A;  5LJ3 h;  4C92 B;  1PWT A;  3CCM A;  1TTH B;  4J9G A;  2VB6 A;  2NWM A;  1KQ1 A;  2DXC A;  1U5S A;  1SEM A;  2IG0 A;  1QVF A;  3ME9 A;  1BCO A;  2EIF A;  2DNU A;  4RCC A;  1Z9Z A;  3RES A;  4PFP A;  2CSQ A;  2EKO A;  1ZUU A;  1WFW A;  1W6X A;  4M78 G;  1WNL A;  4IUV A;  1B34 B;  4M7A D;  2F5K A;  1OX9 A;  4J9F A;  2OTL T;  1OI1 A;  2OTL Q;  1UGQ B;  3RNJ A;  1KC8 C;  1LOJ A;  2JTM A;  3C4S A;  3JCM b;  4PLL A;  1W2B P;  2J6K A;  1K8A C;  3GBQ A;  2EGA A;  2XHC A;  1RAC B;  1VQ6 T;  4FCY A;  2FRY A;  1A0N B;  1Q86 C;  3QZ9 B;  5D6W A;  1QMC A;  1TG0 A;  2M9U A;  1GCQ C;  1RAI B;  2XKO C;  3UAT A;  2OX7 A;  3P8D A;  4R55 A;  4E7L A;  3CPW A;  4RG2 A;  1I07 A;  5GAN 7;  2KI7 A;  4AG1 C;  3HP9 A;  2FPD A;  4PFO A;  2D6F A;  1MMD A;  2JZ2 A;  3CC4 T;  2D0N A;  3CQT A;  3VJP A;  3CC4 Q;  3ZFJ A;  1K0X A;  3TEE A;  1KIK A;  4BDZ A;  4AT1 B;  4JRK A;  4RKU E;  3KBG A;  2RQU A;  4PJL A;  4PJO D;  2BKD N;  2LCL A;  4RTU A;  3QYG B;  5KYX A;  4ZNX A;  1JXO A;  2L3R A;  1M2V A;  1G3T A;  2AZS A;  2LQK A;  1U06 A;  1U1S A;  2M02 A;  1AZE A;  3V8L A;  1NJI R;  4ZGD B;  1W70 A;  1M8V A;  2PUO B;  3GIB A;  2LP5 A;  2G3R A;  1XQH A;  4ZTJ A;  2FPF A;  1NJI C;  3CD6 T;  1M5Q 1;  3CD6 Q;  2CH4 W;  3UA6 A;  2KNB B;  1OPL A;  3M59 A;  1ZHI A;  2QGF B;  3OYF A;  1VQ4 T;  2CUD A;  1NM7 A;  2DXU A;  2MOX A;  2RJE A;  4BB7 A;  3LGF A;  1YHQ Q;  3CCE Q;  1ZUK A;  2XDP A;  3VS0 A;  4F16 A;  4E7S A;  1KJW A;  5KYW B;  1YI2 T;  1YI2 Q;  4BDY A;  3NTH A;  1PM3 A;  5GAM h;  4M7D F;  1QW1 A;  3SWN A;  2FB7 A;  1NPR A;  2MPX C;  1V76 A;  1OZ3 A;  3C0C A;  2ZPF B;  2CSI A;  1S1N A;  4X34 A;  2OTJ Q;  3A8M B;  1OX8 A;  2PQW A;  1QVG S;  5IH2 A;  2HL5 C;  4DOV A;  2O88 A;  5GAO n;  3HL8 A;  1N5Z A;  3V8J A;  5FU7 C;  1Q81 R;  1G3S A;  1PNJ A;  2O9S A;  2E64 A;  2MAM A;  3X26 B;  5KYN A;  2LRQ A;  3EGX A;  1VYT A;  2K5F A;  2OI3 A;  5GMK m;  4LDY A;  4C92 D;  5GAN 5;  5FU7 B;  2X3W D;  1WZO A;  1YP5 A;  1SF9 A;  4AG2 C;  1NZ9 A;  2KXC A;  2JUF A;  4M7D B;  3VRY A;  4M78 E;  1X27 A;  5CKB A;  3TQ7 P;  5L23 A;  3JCM P;  1AOJ A;  2WSC E;  4AFZ C;  3SDZ A;  1RI9 A;  2H3E B;  2E6Z A;  1Y57 A;  1QP2 A;  2LC4 A;  3LGL A;  4KT0 E;  3I55 A;  3CME A;  8AT1 B;  4ESR A;  2BZ8 A;  2BZY A;  2DIQ A;  2V8J A;  2A37 A;  3JB9 I;  2RQV A;  4FU6 A;  3I56 A;  2EYZ A;  3HTR A;  4JZ4 A;  1BU1 A;  1V1C A;  4M7A G;  4LDW A;  1D1C A;  3RBB B;  4C0Z A;  1IHV A;  1Y71 A;  5GMK e;  5L8R E;  2RJF A;  4MDW A;  2BUD A;  3A8O B;  3JSC A;  2BIV A;  4WTO B;  1PG5 B;  3MP6 A;  1MMG A;  4IIO A;  2JNG A;  1VYU A;  1PSF A;  1TXQ A;  4C0D C;  1BIB A;  1N8R C;  1K0S A;  3WVE B;  4NOY A;  5KYY B;  2DD5 A;  2AHJ B;  3CCQ A;  3NFC A;  5DY9 A;  4C5G A;  1WIE A;  4LD6 A;  1RAF B;  2BE7 D;  3H0F A;  4LDX A;  4E6R A;  3EFS A;  1K73 C;  1WGS A;  3QBY A;  4JJC A;  2CT4 A;  1VQ7 Q;  4C0D B;  1M2O A;  4ZN1 A;  4LDV A;  3UPU A;  3J81 E;  3CCV T;  1YIT T;  3CCV Q;  1NYF A;  2ZPB B;  3A1P A;  2DYI A;  1Q7Y U;  2LQN A;  2LDM A;  3E2U A;  1LJO A;  1UUE A;  4NS5 A;  4AFU C;  2M1H A;  3EGD A;  2LVM A;  2VXF A;  2HSE B;  1M30 A;  3A98 A;  4A53 A;  4KUD K;  1AWJ A;  2ECZ A;  1VQ5 T;  1QVF P;  4CRI A;  1WJS A;  5LL6 S;  5LJ5 h;  2DIL A;  3M0S A;  5HCK A;  1ZSZ C;  1K4U S;  2GTJ A;  3OY9 A;  3M0U A;  2VGM A;  1Q81 U;  4HT9 A;  4M78 A;  2NYS A;  1ZSZ B;  2KRS A;  2HMA A;  3JCM e;  2OJ2 A;  1VQ8 T;  3HPW A;  2AZV A;  3URG A;  1VQL T;  4QQD A;  1YJN T;  2Y4X A;  1YJN Q;  1VQP A;  4OMQ A;  3QYH B;  3G4S A;  5J3B A;  1OU8 A;  1WXB A;  4GY5 A;  4RUG A;  3IQL A;  2GBQ A;  3QPH A;  2XU8 A;  3G6E T;  4E7Z A;  5M9O A;  3NGP A;  3PE0 A;  2RM4 A;  5D6Y A;  2P4T A;  1W2B A;  1Y07 A;  4PL6 A;  4F7U F;  3CCJ Q;  2FL7 A;  3CCL T;  3CCL Q;  5FU6 C;  5D7U A;  2QXF A;  3CPW P;  3CCR T;  3PNW C;  3CCR Q;  4RTV A;  4OMF B;  5CKE A;  1MGQ A;  2RI3 A;  1X6G A;  4C8Q G;  1MND A;  2HQX A;  4L5G A;  2EKH A;  4ME7 A;  2BZX A;  5DLQ E;  2X4Y A;  2EAY A;  3E9F A;  4FSX A;  3DLM A;  1TH7 A;  5GMK j;  4C5H A;  1K9M U;  4ORZ A;  4J9H A;  5GJW B;  4F7U B;  1HJD A;  2O4X A;  1VQK T;  3JCM d;  4M7D D;  2HBP A;  4QW2 A;  1M8M A;  1ZBX A;  4M77 G;  4D8D A;  3QII A;  1QVF S;  3P8B B;  2CDT A;  4RCB A;  4XTV A;  3OQ5 A;  4M7A E;  1YJW A;  3GOX A;  3H6Z A;  3VS1 A;  2L8D A;  3BW1 A;  3FJ5 A;  2DK3 A;  4CC3 A;  2E3H A;  5KYU A;  2YUQ A;  3HRT A;  1S72 A;  4IIM A;  2HZY A;  3EG2 A;  3ER0 A;  4MZP A;  1BI2 A;  1I1J A;  2LJ1 A;  3REA B;  3OW2 P;  2CGH A;  1ZX6 A;  3MEV A;  3FEO A;  2PUK B;  1BI3 A;  2VWF A;  2EBP A;  3EFO A;  3VV0 A;  4MMK A;  5I2S A;  2ABL A;  2L2P A;  4XK8 E;  1LVK A;  2EGE A;  2A3L A;  2YXY A;  3JRZ A;  2DRM A;  4J6Y A;  1W1F A;  3H0I A;  4MZM A;  1VQ4 A;  4O5V A;  1GFC A;  1X6O A;  3VS2 A;  3CPW S;  2QQ9 A;  3LWH A;  3UDC A;  3OS5 A;  5CVI A;  1AWO A;  2AK5 A;  2QAS A;  1N6A A;  1Q82 C;  3SFM A;  3ZBD A;  1TS9 A;  4XU1 A;  4DBF A;  1OEB A;  2KRO A;  1ABO A;  2LJ0 A;  2JMA A;  3JCM c;  1SKU B;  1RAG B;  3CBP A;  4JJB A;  3OYC A;  4KH1 B;  2QA4 T;  3OMG A;  4RTZ A;  5CQX A;  1MV0 B;  2NUT A;  1VQO Q;  2ZPE B;  5A0L A;  1VQ9 A;  2WAC A;  1YCS B;  2CZ1 B;  2ZAE A;  1ZA1 B;  1MV3 A;  3GPL A;  1BCM A;  2QAZ A;  4M75 G;  1UJ0 A;  3OYH A;  1KD1 R;  1D0Z A;  4FT4 A;  4HCC A;  3I56 Q;  4KGX B;  4M7A A;  3M54 A;  2JM8 A;  3PFS A;  3L2Z A;  1D1B A;  2JTF A;  2IIM A;  4C8Q E;  2Y4Y A;  3QWX X;  4RTW A;  1T3S A;  5D6X A;  3LX7 A;  3CC7 Q;  2M16 A;  2HBW A;  1KK7 A;  3FDR A;  3OBW A;  4DBR A;  4JZ3 A;  4A4K A;  4QKU A;  1RLP C;  3G71 A;  3KFV A;  4J9D A;  3WVD B;  5CAI A;  3QZ5 B;  1WHK A;  3J80 E;  1FMK A;  4C8Q C;  1WI7 A;  2KMT A;  1YN8 A;  1AVZ C;  1UDL A;  2GNC A;  5LJ3 e;  5A0D A;  2XG8 D;  4J7I A;  1IZ6 A;  3CCS A;  3NTI A;  1LCK A;  2RQT A;  4M77 E;  4PK4 A;  1H64 1;  1D0X A;  2EQU A;  4FW2 A;  1YBY A;  1NLO C;  1PCX A;  2JW4 A;  3M4G A;  1CKB A;  2VUB A;  3OSS C;  4B9X A;  2B86 A;  2SRC A;  5GAO l;  3HFO A;  5DM7 R;  3OYY A;  1PD0 A;  2WSF E;  3LH0 A;  4II1 A;  2OAU A;  1VIF A;  4WF2 A;  4QT7 A;  2DVJ A;  3PT9 A;  2FYK A;  3JB9 J;  4IUP A;  1PRL C;  2C06 A;  2X4X A;  3ZL7 C;  2RB6 A;  3HKS A;  1VUB A;  2EYX A;  1UTI A;  2P84 A;  3VS3 A;  3I5R A;  3TU4 K;  5KH6 A;  1SHG A;  1M2V B;  2L3P A;  2PTK A;  3L42 A;  1YIJ T;  1YIJ Q;  1WA7 A;  1SHF A;  1VQP Q;  3ASK A;  1AZG B;  3JB9 D;  2DKG A;  3NPF A;  2E41 A;  5GAO q;  1GBR A;  1ABQ A;  3S3O A;  5LJ3 d;  1OOT A;  1HYO A;  4PNO A;  1G2B A;  2DL3 A;  2V8K A;  4BI3 A;  2M0O A;  2QK0 A;  3OBY A;  2JM9 A;  3S3M A;  4BI8 B;  1T0H A;  3LYI A;  4OB2 B;  1D3B A;  3M53 A;  3V7S A;  5J39 A;  5GAN 2;  4MZT A;  4C8Q A;  3VUB A;  3UT1 A;  1KD1 U;  1VQ8 A;  3VS6 A;  4OB1 B;  3SWN C;  1UEB A;  1B3Q A;  3MJX A;  2DBK A;  3BDL A;  1M90 U;  1TOV A;  1Y7X A;  2A36 A;  3TVT A;  1G3W A;  5I21 A;  2VVK A;  3RR6 A;  4AFQ C;  5CR2 A;  3G6E A;  2KYB A;  1C0M A;  4J9B A;  2QEX Q;  4E7I A;  1O9S A;  4WCI A;  3CXC A;  4LUD A;  4F17 A;  4KUI A;  4M75 E;  4M75 F;  4AMC A;  4M77 A;  4OMO A;  4BY6 C;  1NEB A;  3TSW A;  1OYX A;  1JU5 C;  1YJW Q;  1AD5 A;  1QP3 A;  2L3S A;  4HCK A;  2EJ9 A;  3EGX B;  2LQ8 A;  3THK A;  2DAQ A;  2RQW A;  3DKM A;  2DL5 A;  2ROL A;  1R0B G;  4N4G A;  4HXJ A;  4M75 C;  2KK4 A;  3M57 A;  3EHQ A;  1GFD A;  1M27 C;  1FX7 A;  2FG0 A;  2QQA A;  2X51 A;  5GAM e;  1VQM T;  1VQM Q;  4A4F A;  3CC2 A;  3M0Q A;  1Y96 A;  1YHQ T;  4J83 A;  3M58 A;  3CCE T;  1AWW A;  5KCO A;  2HKQ B;  3UA7 A;  4CC4 B;  1Q7Y R;  3OW2 A;  2DJZ A;  1OQK A;  1W2B S;  4JLG A;  4F04 B;  1Q7Y C;  1UEC A;  2DZ9 A;  4OB0 B;  4GBQ A;  4X9D A;  2OTJ T;  1UGV A;  2CUB A;  5FLX E;  1YJ9 A;  1HD3 A;  3CMA A;  1AWX A;  1ZQ1 A;  4A54 A;  3EGU A;  3EG9 A;  2HQH A;  2HQE A;  1OV3 A;  2Y90 A;  3BY7 A;  1MMN A;  5I11 A;  1KC8 U;  2EFI A;  3VRZ A;  2HL3 A;  2PVD B;  1M4Z A;  2GQV A;  2X9H A;  1Q81 C;  2ROT A;  1GCP A;  4F14 A;  2ZPI B;  2KXD A;  1Q86 U;  4M78 F;  1NYG A;  5GAM d;  2QYZ A;  2DL7 A;  1WJQ A;  2QG9 B;  1XNI A;  3JCM Q;  2A28 A;  5I2M A;  2XI9 A;  5FRN A;  4B9W A;  1NBE B;  3EGD B;  3CBO A;  4M75 A;  4J6W A;  4OP0 A;  3MEU A;  2EQK A;  3OMC A;  5GAN 3;  1UG1 A;  3CPF A;  4YTL A;  3QJY A;  1OU9 A;  4OGE A;  2DEU A;  4XQ3 A;  4M78 C;  2JJ9 A;  5GAM g;  2HAX A;  1NE8 A;  2DM1 A;  3JCM W;  2H3J A;  3JB9 G;  1QVP A;  5A2Q E;  1B7T A;  2CP5 A;  1AT1 B;  3MPU B;  4M78 B;  4ANJ A;  1GRI A;  2E3I A;  3E9G A;  4P5N A;  1J3T A;  3G71 Q;  3SD4 A;  2X3X D;  2ZCF B;  1K9M R;  2COY A;  2K2V A;  4C5I A;  3M0P A;  4L6V 5;  5GAN h;  4EPC A;  2VC8 A;  3CCS Q;  1VQ7 T;  2K3B A;  1BKB A;  3A8H B;  1K9M C;  1ARK A;  2RK2 A;  2DXB A;  4XU2 A;  2XID A;  1JJ2 A;  2EQI A;  2PNI A;  4R0K A;  4JRP A;  5LJ5 e;  5GAM j;  4FYX B;  3RKY A;  1BBZ A;  1UE9 A;  3OYI A;  3CCM T;  3CCM Q;  1NPP A;  1MUZ A;  5CIU A;  2AKK A;  2LCS A;  2EW3 A;  2RPN A;  1WHG A;  4JS4 A;  2MIO A;  1VQN A;  4PJO G;  2JVV A;  4AFS C;  4KBM B;  2COZ A;  1E6G A;  3CCU A;  3M0T A;  5GAO m;  3VYH B;  3FIF A;  1RI0 A;  1BI1 A;  1SPK A;  2O4X B;  3E19 A;  5EC7 A;  1H92 A;  1SG5 A;  1MMA A;  1PC0 A;  2F2V A;  5HY6 A;  2C0O A;  4HVW A;  2DEQ A;  1X2Q A;  4RTX A;  2SEM A;  1TU0 B;  4CI0 C;  4C5E A;  2KRN A;  2Z0W A;  1I5O B;  3OS0 A;  5FWB A;  2KVQ G;  3MCA B;  4JJD A;  1JB0 E;  5KYU B;  3D7S B;  4GLM A;  2HDA A;  2I0N A;  3M9Q A;  2GTO A;  5LJ5 d;  3CCJ T;  3OYB A;  1NLP C;  4BE1 A;  2V1Q A;  1VYV A;  1SRL A;  2RNA A;  2LT4 A;  2QQB A;  2DBM A;  5IXF A;  1AEY A;  4PKC C;  3MHX A;  1V29 B;  2JTE A;  4JS5 A;  2EGC A;  4D8K A;  1UGS B;  4HKE A;  3M0R A;  2OTL A;  1QCN A;  3EFO B;  2LX7 A;  2L5Q A;  4IUR A;  5FU6 B;  2LQW A;  3P8H A;  2L3Q A;  2EJF A;  5LJ5 g;  2DRK A;  1T3L A;  1D09 B;  3CXC P;  4JJN K;  1VQ6 A;  3LH5 A;  1RUW A;  2KAF A;  3OB9 A;  3ZEH A;  2IPO B;  3JAM E;  2VKN A;  1OPK A;  3L2V A;  4FT2 A;  4N0A A;  3R6O A;  1CKA A;  1XTD A;  1WJR A;  2RJC A;  2E4H A;  1JXM A;  1GBQ A;  1G83 A;  2CRE A;  2M51 A;  1VA7 A;  4XU3 A;  4RTT A;  2YT6 A;  4XTX A;  2DZC A;  1H3Z A;  2X4J A;  1U1T A;  2H8H A;  4FL6 A;  4C92 G;  2KRM A;  5GAO r;  4M7A F;  3CC4 A;  2DIG A;  3SB2 A;  4X9C A;  2YRV A;  1M3B A;  1QKX A;  1X43 A;  2RHY A;  2XMF A;  3JCM g;  2ZPG B;  1WHL A;  3GP8 A;  5HK3 A;  4EMK A;  5LJ5 j;  2I2L A;  1UHC A;  2KT8 A;  3M55 A;  2NUT B;  4M7A C;  4A4G A;  1WHH A;  1Z9Q A;  3S3N A;  1I4K 1;  1QKW A;  1M3A A;  2JT4 A;  2F2X A;  1WHM A;  4C0F A;  4EMH A;  2JN0 A;  4M78 D;  2ED0 A;  1M1K R;  1G3Y A;  1NG2 A;  4M7A B;  3QO3 A;  2NUP B;  3CD6 A;  2FHD A;  2XDB A;  3OYG A;  1YJ9 Q;  1PSE A;  2E12 A;  2RHX A;  3MKD A;  3RIR A;  2XK0 A;  3HRS A;  5GAO p;  3OYE A;  3VS7 A;  1PHT A;  3PIP A;  1YHQ A;  4PJO E;  3GLX A;  3CCE A;  1GXI E;  2AIR B;  1O75 A;  4J6X A;  4RG8 A;  1YI2 A;  1TSF A;  3QJ6 A;  2RHZ A;  2D8H A;  1WLP B;  1X75 C;  1LPL A;  3CXC S;  4V2S A;  2E10 A;  2E5K A;  2O31 A;  2MF2 A;  4A4E A;  2R5M A;  2V26 A;  1SRM A;  2OAW A;  2GCX A;  2JMC A;  4LD9 K;  1QWF A;  4JRI A;  4ZGJ B;  2DLP A;  3L1A A;  3DB3 A;  4KH0 B;  2P0P A;  1Q95 G;  4A63 B;  1VQO T;  4XU0 A;  5AYF A;  2EPD A;  4JDS A;  2HSP A;  4DBQ A;  3I55 Q;  3CME T;  5A0G A;  3CME Q;  2ZPH B;  3QSU A;  3OYA A;  1BYM A;  2YWW A;  2CP2 A;  1M1G A;  2DTO A;  1WQW A;  2M0Y A;  1N9S A;  1AHJ B;  2DER A;  5C6S A;  1M1F A;  4OB3 B;  3JCM f;  2KE9 A;  2JS2 A;  2VAS A;  3VKI A;  4ATO A;  3I56 T;  1T0J A;  2P4R A;  3I35 A;  1U8R A;  2LNV A;  1FWZ A;  4A4H A;  2XIC A;  1M90 R;  3OYK A;  2K6D A;  1KD1 C;  4C8Q F;  2HNI A;  2MWO A;  2WSE E;  4PJM A;  4DEY A;  2J06 A;  3UWN A;  2X35 A;  5CCA A;  4CC7 A;  2KBT A;  1X01 A;  4XTZ A;  3OW2 S;  2EQJ A;  4J7F A;  3RER A;  3CCQ Q;  4Q5W A;  3CC7 T;  4J9I A;  1JEG A;  4MML A;  2K5L A;  1LNX A;  2C0I A;  3FRN A;  3BDU A;  4HVV A;  4KGZ B;  2QQR A;  2L89 A;  2HEQ A;  1JJ2 P;  2A0F B;  4Z02 A;  1I5L A;  3REB B;  4HA8 A;  2JS0 A;  5KE2 A;  4C92 E;  3AHU A;  3I5S A;  3BE3 A;  3GNG A;  4D6W A;  1BB9 A;  4M77 F;  1D3B B;  4BI4 A;  4FYV B;  3S6W A;  4C8Q B;  2O01 E;  1M1K U;  4OMP A;  3F70 A;  5CKD A;  5J26 A;  3OS2 A;  1RAE B;  2COW A;  1RLQ C;  3HHT B;  4PJO A;  2LT1 A;  3QG1 A;  1K9A A;  1VQ7 A;  1NEG A;  4J9E A;  1XJW B;  2DPP B;  2FRW A;  3CCU Q;  2ZZD A;  4M77 C;  2HKN A;  1U3O A;  2ENM A;  3CCV A;  1H3H A;  1YIT A;  1IXD A;  2JXB A;  8ATC B;  4GLK A;  4M7D G;  4HVU A;  3RKW A;  1DJ7 B;  3JCM J;  4M77 B;  4DEX A;  1FXX A;  3RMQ A;  3BFM A;  5KYX B;  1D0Y A;  4HT8 A;  2DFU A;  3EH2 A;  2DL8 A;  1VQP T;  1IGU A;  3G4S T;  3G4S Q;  1VQ5 A;  1Q82 U;  4BAC A;  5GMK i;  1TUC A;  2FVU A;  5CQY A;  2YHT A;  2YLB A;  4QVC A;  2RI2 A;  1KC8 R;  1H8K A;  3OYD A;  5CO7 A;  2MK5 A;  1G5V A;  1HXD A;  3VUZ A;  2HCK A;  1K8A R;  3KUF A;  2LMJ A;  3X24 B;  4NL2 A;  2D8J A;  1Y96 B;  2JOY A;  2CKK A;  2PVG B;  1E6H A;  2P0K A;  5LJ3 g;  1YJN A;  1Q86 R;  1VQL A;  2FEI A;  5FWC A;  1WYX A;  1VQ6 Q;  3EG1 A;  4DBH A;  3V7C A;  1JJ2 S;  2KEA A;  4OML A;  3OYN A;  3RMS A;  4OVA A;  3SWN B;  1QVG P;  3EAE A;  3CCJ A;  2QEX T;  3FJP A;  3CCL A;  1KQS A;  1ZBJ A;  4PJJ A;  3JV3 A;  4LN2 A;  3CCR A;  1OZ2 A;  4C92 A;  2FZG B;  1BIA A;  5C0M A;  2YUP A;  2DTH A;  2RQR A;  1K76 A;  3EG9 B;  3A8G B;  3E1S A;  4Y28 E;  4E7J A;  3HSB A;  2K3X A;  3L2U A;  2NLU A;  2W0Z A;  2CZ7 B;  1YJW T;  2ATC B;  2VXE A;  4C0G A;  1D1A A;  4FIB A;  4N4I A;  1VOM A;  2RJD A;  2RHU A;  4BY6 B;  1S72 T;  1S72 Q;  5LJ3 j;  1X69 A;  2MYS A;  4EMG A;  5GAN 6;  3PTA A;  1SSH A;  2CZ0 B;  4Z89 A;  2FZK B;  2KQW A;  1VQK A;  3TSZ A;  2XD0 A;  1B34 A;  2KT1 A;  3QKJ A;  4RMO A;  4M75 B;  7AT1 B;  4VUB A;  2F1L A;  2YLC A;  2KDS A;  9ATC B;  1RAH B;  4QVD A;  1W4S A;  3N5B B;  3NTK A;  2D1X A;  4FW1 A;  3O5Z A;  3TCJ A;  2E5Q A;  1VQ4 Q;  3C95 A;  5IHK A;  3T9N A;  1OUL A;  4DOW A;  3VS5 A;  4ELY C;  3OS1 A;  2MWP A;  5LJ3 f;  4O6J A;  2GFU A;  4NL3 A;  1G8X A;  1QQJ A;  5KCH A;  3PMI A;  2KR3 A;  5GJV B;  2K4Y A;  2D0Q B;  3V7R A;  5GAN 4;  2YSQ A;  2RK1 A;  4LUE A;  1GCQ A;  4M7D E;  1IO6 A;  1YNZ A;  1UHF A;  4OF1 A;  5HKC A;  4C8Q D;  2FZC B;  4XAX B;  1KSW A;  1JRI A;  2CYZ B;  2AKL A;  1K8A U;  2QQS A;  3MO8 A;  4QVZ A;  2LCC A;  1QWE A;  1BI0 A;  1BK2 A;  5HK0 A;  3A8L B;  2V1R A;  1ZLM A;  4JRQ A;  4F7U G;  1VQ9 T;  2F69 A;  2QDL A;  4M7D C;  1ZSG A;  1VQ9 Q;  2J05 A;  3M5A A;  4KGV B;  2VV5 A;  4IUT A;  2FPE A;  2L0A A;  3JB9 H;  2CP3 A;  5FRO A;  4M77 D;  1ACM B;  3A5Z B;  3QDR B;  2QTX A;  2ZGW A;  3VU3 C;  1B07 A;  5IHN A;  4PFZ A;  2MMP A;  1RAB B;  2R5A A;  3L2Q A;  5GAN e;  2QA4 A;  1VQO A;  4PJN A;  3H41 A;  2CP7 A;  5KE3 A;  2IVW A;  1KHI A;  1KHC A;  5KYW A;  3I9Q A;  3EFR A;  2RA2 A;  1RAA B;  3PIO A;  3L2W A;  3G71 T;  2AT1 B;  1I0C A;  1QLY A;  1X6B A;  2QDY B;  3V8K A;  3C94 A;  2RMO A;  4E7H A;  2KSS A;  4UC4 A;  3KXT A;  1N8R R;  3CCS T;  4BD3 A;  1KG1 A;  3FB9 A;  1NJI U;  2YDL A;  2RF0 A;  2E70 A;  3ULR B;  3X25 B;  3RKX A;  1K73 R;  2YRC A;  1CSK A;  5FRM A;  2O9V A;  1TWB A;  1SSF A;  3RDV A;  3GF5 A;  4ELZ C;  3CC7 A;  1I8F A;  2DYB A;  4RTY A;  2VYT A;  5EG2 A;  2ED1 A;  4LNP A;  4OMN A;  1EIF A;  5GMK h;  1VIE A;  4LXC A;  4N0A C;  2B8A A;  4KRT A;  2DL4 A;  3OA6 A;  1YIT Q;  4M7D A;  2CZ6 B;  4K11 A;  4J5Y A;  1EFN A;  3NMZ C;  5GAN d;  1F1B B;  4OMM A;  1WX6 A;  4Y91 A;  1FMV A;  2KYM A;  2DJQ A;  4Z8A A;  2RO0 A;  1PKS A;  3CBM A;  4M4Z A;  2DX1 A;  5CKH A;  1VQ5 Q;  4Z88 A;  2DTI A;  5GAM f;  2QI2 A;  2RN8 A;  1EZZ B;  4OGC A;  1C1A A;  2DMO A;  2J7I A;  4EMK C;  5GAN g;  2DD4 A;  3R6N A;  4DQ2 A;  4M75 D;  2DO3 A;  2EWN A;  4LE9 A;  3X28 B;  3CEY A;  4EIK A;  1EX4 A;  2XDD A;  4EDU A;  3RUX A;  1K1Z A;  3MEA A;  1YCY A;  4EMK B;  3LLR A;  1WHJ A;  1VQ8 Q;  4BE0 A;  3H0H A;  1KQ2 A;  5KYY A;  2QTV A;  1YIJ A;  1VQL Q;  3LW5 E;  2LZ6 B;  3MP8 A;  3QHS A;  2V8I A;  3QXE B;  2DF6 A;  2KY9 A;  4ZGE B;  3WXM B;  4IKF A;  3OYM A;  3AT1 B;  5ECA A;  3VS4 A;  3JCM X;  4ZTF A;  2VGN A;  3H8Z A;  3G6E Q;  4JPB W;  4QQ6 A;  1WDX A;  2X4W A;  3JCM h;  2E6N A;  3NHN A;  4F7U E;  3DB4 A;  1KQS P;  4KUL A;  4IUU A;  1MHN A;  1R77 A;  3FC3 A;  1FMW A;  1IRX A;  2DE0 X;  6AT1 B;  1HSQ A;  1QCF A;  5GAN j;  1HK9 A;  2A7Y A;  3TRE A;  1TUD A;  5I22 A;  1QVG A;  5IAY A;  2MCN A;  3HFN A;  2DXT A;  2K2M A;  1GL5 A;  2NUZ A;  1N8R U;  3MET A;  4X1V A;  4N4H A;  3Q1J A;  2K57 A;  3JB9 F;  2EJG A;  1K73 U;  1WXT A;  2RD1 A;  4HCB A;  3OYL A;  2QEX A;  2YUN A; 
#chains in the Genus database with same CATH homology
 1BIB A;  1QP3 A;  3M4Y A;  1N8R C;  2EJ9 A;  4NOY A;  4Z02 A;  3WVE B;  2DD5 A;  1I5L A;  2AHJ B;  3CCQ A;  3NFC A;  2LQ8 A;  4HA8 A;  5DY9 A;  4C5G A;  4LD6 A;  5KE2 A;  3CC2 T;  2DAQ A;  4LDX A;  4C92 E;  2F5T X;  3DKM A;  4N4G A;  3AHU A;  3GNG A;  3EFS A;  4IUQ A;  1WGS A;  2KK4 A;  3QBY A;  4M75 C;  3M57 A;  4M77 F;  1D3B B;  4D6W A;  1JBM A;  2D9T A;  4C0D B;  5GAN f;  4BI4 A;  1IRE B;  3S6W A;  4C8Q B;  4ZN1 A;  2O01 E;  3X20 B;  1M1K U;  1UGR B;  4LDV A;  1FX7 A;  3UPU A;  3J81 E;  3F70 A;  5CKD A;  2QQA A;  3CCV T;  4XTU A;  5GAM e;  1YIT T;  5J26 A;  1VQM T;  3C12 A;  3OS2 A;  2ZPB B;  3HHT B;  3HRU A;  4A4F A;  4PJO A;  3FLG A;  1Q7Y U;  3CC2 A;  1Y96 A;  2LT1 A;  2LDM A;  3QG1 A;  4J83 A;  1YHQ T;  3M58 A;  1LJO A;  3CCE T;  1VQ7 A;  3MP1 A;  2DPP B;  5KCO A;  4NS5 A;  2ZZD A;  2M1H A;  4M77 C;  3OW2 A;  1YJ9 T;  2K3Y A;  4E7K A;  2LVM A;  3CMA T;  2VXF A;  1M1K C;  2DJZ A;  5GAN 8;  4XTW A;  4A53 A;  1W2B S;  3CCV A;  4KUD K;  4TVR A;  1YIT A;  1VQM A;  4GLK A;  1VQ5 T;  4JLG A;  4M7D G;  4CRI A;  3RKW A;  1WJS A;  1Q7Y C;  2DZ9 A;  5LL6 S;  4ZN3 A;  1DJ7 B;  5LJ5 h;  4PJO F;  3JCM J;  2PVO B;  4OB0 B;  4BE2 A;  4M77 B;  4X9D A;  2R58 A;  5LJ5 f;  1FXX A;  3RMQ A;  3BFM A;  3L2R A;  2OTJ T;  5FLX E;  4HT8 A;  2EYQ A;  2E1H A;  4LDU A;  1YJ9 A;  3CMA A;  3OY9 A;  4FM4 B;  1ZQ1 A;  1VQP T;  4BUG A;  4A54 A;  2VGM A;  1Q81 U;  3G4S T;  1M9S A;  4HT9 A;  2HQE A;  1KQS S;  1VQ5 A;  1Q82 U;  4BAC A;  4M78 A;  5GMK i;  3GNF B;  2Y90 A;  3BY7 A;  2FVU A;  1WPY A;  5CQY A;  2LTO A;  2RI5 A;  2YHT A;  1XOV A;  3JCM e;  4HCZ A;  1K73 C;  1KC8 U;  2YLB A;  4F7U A;  1VQ8 T;  2EFI A;  4IKF A;  2OTJ A;  3HPW A;  4PJO C;  4QVC A;  5GMK l;  3URG A;  1VQL T;  1N27 A;  2RI2 A;  4QQD A;  4QQG A;  1YJN T;  2Y4X A;  2PVD B;  1M4Z A;  2GQV A;  1VQP A;  5IT9 E;  3QYH B;  3OYD A;  3G4S A;  5CO7 A;  1Q81 C;  1G5V A;  1HXD A;  5J3B A;  1R8O B;  3VUZ A;  3LWI A;  2ZPI B;  3M56 A;  3O8V A;  4GY5 A;  3KUF A;  3VYG A;  3X24 B;  3I55 T;  3QPH A;  4M7D B;  1Q86 U;  3PGG A;  4M78 F;  4NL2 A;  4PJO B;  2XU8 A;  5GAM d;  3G6E T;  5M9O A;  1Y96 B;  2JOY A;  1UB4 A;  2GFA A;  2RM4 A;  1WJQ A;  5D6Y A;  1XNI A;  3JCM Q;  2PVG B;  2CKK A;  2P4T A;  5LJ3 g;  1Y07 A;  2P0K A;  4PL6 A;  5I2M A;  4F7U F;  2FL7 A;  3CCL T;  1YJN A;  1VQL A;  2XI9 A;  5FRN A;  4B9W A;  5FU6 C;  3CBO A;  4M75 A;  4JUV A;  2QXF A;  3CCR T;  3PNW C;  4J6W A;  4OP0 A;  1JJ2 S;  3MEU A;  3V7C A;  3MEW A;  2EQK A;  3OMC A;  4OMF B;  5CKE A;  3OYN A;  5GAN 3;  1MGQ A;  2RI3 A;  1P92 A;  3CPF A;  4YTL A;  3RMS A;  4DA4 A;  4C8Q G;  1U8R A;  2DVE A;  3QJY A;  4OVA A;  4OGE A;  3SWN B;  4XQ3 A;  3EAE A;  4M78 C;  5GAM g;  2HAX A;  2HQX A;  3CCJ A;  1NE8 A;  2QEX T;  3FJP A;  3JCM W;  3CCL A;  2RHI A;  1KQS A;  2H3J A;  2R57 A;  3CCQ T;  4MDX A;  4L5G A;  2MI6 A;  4ME7 A;  3CCR A;  1OZ2 A;  5DLQ E;  2X4Y A;  4C92 A;  1BIA A;  5C0M A;  1QVP A;  3JB9 G;  1M90 C;  2DTH A;  5A2Q E;  2GF7 A;  2RH2 A;  2EAY A;  3A8G B;  3E1S A;  4M78 B;  3E9F A;  4Y28 E;  4E7J A;  4FSX A;  3HSB A;  3DLM A;  2K3X A;  3L2U A;  3J7A F;  1TH7 A;  2NLU A;  2CZ7 B;  5GMK j;  1YJW T;  4C5H A;  3E9G A;  1K9M U;  2VXE A;  4C0G A;  4P5N A;  4F7U B;  4FIB A;  4N4I A;  3JCM V;  5CK9 A;  3OYJ A;  3SD4 A;  2O4X A;  1VQK T;  2K5I A;  2ZCF B;  3JCM d;  2RJD A;  3INZ A;  3OSV A;  2E65 A;  2K2V A;  2RHU A;  4C5I A;  4M7D D;  4BY6 B;  1S72 T;  2HBP A;  4QW2 A;  1ZBX A;  4M77 G;  5LJ3 j;  4C92 F;  1I81 A;  4L6V 5;  3QII A;  5GAN h;  1QVF S;  3P8B B;  2VC8 A;  4EMG A;  4EPC A;  4RCB A;  5IN1 A;  4XTV A;  3OQ5 A;  5GAN 6;  3PTA A;  1VQ7 T;  4M7A E;  3G7Z A;  1UGP B;  2CZ0 B;  1YJW A;  1BKB A;  3A8H B;  3GOX A;  3H6Z A;  1K9M C;  2EQM A;  2L8D A;  3PMT A;  3BW1 A;  2RK2 A;  2DXB A;  4XU2 A;  2KQW A;  2HD0 A;  2XID A;  1JJ2 A;  2P0Q A;  2DK3 A;  4JLI A;  1VQK A;  2XD0 A;  1B34 A;  1N9R A;  3QKJ A;  4L59 A;  3HRT A;  4RMO A;  1VQN T;  4JRP A;  4M75 B;  5LJ5 e;  5GAM j;  1S72 A;  3RKY A;  4VUB A;  3OYI A;  3CCM T;  4R56 A;  2YLC A;  1RL2 A;  1W2B A;  1NPP A;  1WQ7 A;  2KDS A;  4E47 A;  3QUI A;  4J8O A;  3ER0 A;  4PLI A;  4C92 C;  4MZP A;  3CCU T;  5DLO A;  1BI2 A;  4QVD A;  1W4S A;  2LX9 A;  3N5B B;  5CIU A;  2CGH A;  3NTK A;  3MEV A;  2CS7 A;  3FEO A;  2PUK B;  1BI3 A;  3TCJ A;  4JS4 A;  2E5Q A;  1VQN A;  3DLL A;  4PJO G;  3C95 A;  2JVV A;  2PU9 B;  4KBM B;  4XTY A;  5CKF A;  3T9N A;  5LJ3 h;  4C92 B;  3CCM A;  3VV0 A;  4DOW A;  3OS1 A;  4ELY C;  4MMK A;  2MWP A;  5LJ3 f;  5I2S A;  4XK8 E;  3CCU A;  4O6J A;  2GFU A;  3VYH B;  2A3L A;  5GAO m;  3FIF A;  4NL3 A;  1KQ1 A;  1RI0 A;  1BI1 A;  3JRZ A;  2DXC A;  4J6Y A;  4ZTF A;  5KCH A;  2L89 A;  2IG0 A;  3PMI A;  1QVF A;  3ME9 A;  2O4X B;  4MZM A;  2K4Y A;  2D0Q B;  4O5V A;  3E19 A;  1VQ4 A;  3V7R A;  1X6O A;  5GAN 4;  2RK1 A;  2EIF A;  4M7D E;  3CPW S;  4RCC A;  4OF1 A;  5HKC A;  2QQ9 A;  4C8Q D;  3LWH A;  3UDC A;  5HY6 A;  3OS5 A;  5CVI A;  4XAX B;  2DEQ A;  3RES A;  4CI0 C;  1JRI A;  2CYZ B;  4C5E A;  1K8A U;  2QQS A;  3MO8 A;  4QVZ A;  2LCC A;  3OS0 A;  1N6A A;  2EKO A;  2KVQ G;  3MCA B;  1Q82 C;  1JB0 E;  4M78 G;  1WNL A;  4IUV A;  1BI0 A;  1B34 B;  3SFM A;  2F5K A;  3A8L B;  3ZBD A;  5HK0 A;  4M7A D;  2OTL T;  1OI1 A;  1UGQ B;  4XU1 A;  4JRQ A;  4F7U G;  1KC8 C;  1LOJ A;  1VQ9 T;  2F69 A;  2JTM A;  3C4S A;  3M9Q A;  3JCM b;  4PLL A;  5LJ5 d;  3CCJ T;  3OYB A;  4M7D C;  3M5A A;  2VV5 A;  4BE1 A;  4IUT A;  1K8A C;  3JCM c;  2LT4 A;  2QQB A;  3CBP A;  2XHC A;  3OYC A;  4PKC C;  1VQ6 T;  3MHX A;  1V29 B;  3JB9 H;  2QA4 T;  3OMG A;  5CQX A;  5FRO A;  4M77 D;  4JS5 A;  1UGS B;  4HKE A;  2OTL A;  1Q86 C;  3QZ9 B;  5D6W A;  2ZPE B;  5A0L A;  3A5Z B;  3QDR B;  1VQ9 A;  2M9U A;  2L5Q A;  2QTX A;  2ZGW A;  2WAC A;  4IUR A;  3VU3 C;  5FU6 B;  2CZ1 B;  3P8H A;  2EJF A;  2MMP A;  5LJ5 g;  3GPL A;  2XKO C;  4M75 G;  3OYH A;  3P8D A;  4R55 A;  4E7L A;  4JJN K;  2R5A A;  3CPW A;  3OB9 A;  2KAF A;  4FT4 A;  4RG2 A;  5GAN 7;  3L2Q A;  5GAN e;  3ZEH A;  4HCC A;  2QA4 A;  3JAM E;  4M7A A;  3HP9 A;  3L2V A;  1VQO A;  4FT2 A;  3M54 A;  4N0A A;  5KE3 A;  2IVW A;  3R6O A;  3PFS A;  3L2Z A;  2D6F A;  1XTD A;  1WJR A;  2RJC A;  1KHC A;  1KHI A;  2JZ2 A;  3CC4 T;  2JTF A;  3VJP A;  2RA2 A;  2Y4Y A;  3EFR A;  4C8Q E;  4XU3 A;  3ZFJ A;  3PIO A;  3TEE A;  3L2W A;  4XTX A;  3G71 T;  2DZC A;  4BDZ A;  5D6X A;  1H3Z A;  4JRK A;  2X4J A;  2QDY B;  3LX7 A;  4RKU E;  3V8K A;  3KBG A;  1U1T A;  4FL6 A;  4C92 G;  3C94 A;  4E7H A;  2KSS A;  4UC4 A;  3KXT A;  4PJO D;  3CCS T;  2BKD N;  4BD3 A;  2LCL A;  1KG1 A;  2M16 A;  3QYG B;  3FB9 A;  5GAO r;  3FDR A;  3OBW A;  2L3R A;  4M7A F;  1G3T A;  2LQK A;  1NJI U;  4A4K A;  2E70 A;  2DIG A;  3SB2 A;  3CC4 A;  3X25 B;  1U1S A;  3RKX A;  4X9C A;  3G71 A;  2YRV A;  3V8L A;  3WVD B;  5CAI A;  3QZ5 B;  3J80 E;  4C8Q C;  2KMT A;  5FRM A;  2RHY A;  1SSF A;  3JCM g;  3GF5 A;  4ZGD B;  4ELZ C;  2XG8 D;  5A0D A;  5LJ3 e;  2ZPG B;  4J7I A;  3CC7 A;  3GP8 A;  1M8V A;  5HK3 A;  1IZ6 A;  3CCS A;  3NTI A;  4EMK A;  1I8F A;  2PUO B;  5LJ5 j;  3GIB A;  2I2L A;  2G3R A;  2VYT A;  4M77 E;  1XQH A;  5EG2 A;  3M55 A;  4ZTJ A;  1H64 1;  1NJI C;  1EIF A;  5GMK h;  3CD6 T;  2EQU A;  1M5Q 1;  1YBY A;  4M7A C;  1VIE A;  4N0A C;  4A4G A;  2B8A A;  3M59 A;  1ZHI A;  3M4G A;  3S3N A;  1I4K 1;  2VUB A;  3OSS C;  4B9X A;  3OYF A;  1VQ4 T;  3OA6 A;  4M7D A;  4C0F A;  2CZ6 B;  4EMH A;  2JN0 A;  4M78 D;  1G3Y A;  2DXU A;  5GAO l;  2RJE A;  3HFO A;  3LGF A;  4BB7 A;  5DM7 R;  3OYY A;  4J5Y A;  4M7A B;  2WSF E;  3QO3 A;  3LH0 A;  4II1 A;  2XDP A;  3CD6 A;  2OAU A;  5GAN d;  2FHD A;  1VIF A;  2XDB A;  3OYG A;  4WF2 A;  4Y91 A;  1YI2 T;  2RO0 A;  1PSE A;  3PT9 A;  3NTH A;  4BDY A;  2FYK A;  2E12 A;  3CBM A;  2RHX A;  4IUP A;  3JB9 J;  2C06 A;  2X4X A;  2RB6 A;  3HKS A;  5CKH A;  5GAM h;  1VUB A;  2XK0 A;  3RIR A;  3HRS A;  5GAO p;  2DTI A;  4M7D F;  5GAM f;  1QW1 A;  2QI2 A;  3SWN A;  3OYE A;  3PIP A;  1YHQ A;  4PJO E;  2FB7 A;  3GLX A;  1NPR A;  3CCE A;  3TU4 K;  5KH6 A;  1OZ3 A;  1GXI E;  2ZPF B;  4X34 A;  3A8M B;  1O75 A;  4J6X A;  4OGC A;  3L42 A;  4EMK C;  2PQW A;  4RG8 A;  2DD4 A;  5GAN g;  1YI2 A;  1YIJ T;  1QVG S;  4DQ2 A;  4M75 D;  3QJ6 A;  2RHZ A;  2DO3 A;  2EWN A;  3ASK A;  4DOV A;  3X28 B;  2DKG A;  3JB9 D;  2E41 A;  1X75 C;  5GAO n;  3CEY A;  3CXC S;  3HL8 A;  5GAO q;  4V2S A;  3V8J A;  2E10 A;  2XDD A;  5FU7 C;  4A4E A;  4EDU A;  2MF2 A;  3RUX A;  2R5M A;  3MEA A;  1G3S A;  1YCY A;  3LLR A;  4EMK B;  2GCX A;  5LJ3 d;  3S3O A;  2E64 A;  2MAM A;  3X26 B;  4BE0 A;  4LD9 K;  2LRQ A;  1KQ2 A;  4PNO A;  4JRI A;  2V8K A;  4ZGJ B;  3LW5 E;  4BI3 A;  1YIJ A;  3MP8 A;  2M0O A;  3QHS A;  2K5F A;  3L1A A;  2V8I A;  3OBY A;  3QXE B;  4LDY A;  5GMK m;  3DB3 A;  3S3M A;  4BI8 B;  4C92 D;  2P0P A;  5GAN 5;  5FU7 B;  2KY9 A;  4ZGE B;  1VQO T;  4XU0 A;  3WXM B;  1NZ9 A;  1D3B A;  2JUF A;  3LYI A;  3M53 A;  4JDS A;  4OB2 B;  5AYF A;  4M78 E;  3V7S A;  5J39 A;  5GAN 2;  3OYM A;  3CME T;  5CKB A;  4MZT A;  5A0G A;  4C8Q A;  2VGN A;  3H8Z A;  3JCM X;  2ZPH B;  3VUB A;  3UT1 A;  3OYA A;  3QSU A;  1BYM A;  1KD1 U;  1VQ8 A;  4QQ6 A;  3JCM P;  1M1G A;  2X4W A;  2DTO A;  1WQW A;  2WSC E;  1N9S A;  3SDZ A;  2E6N A;  1AHJ B;  3JCM h;  4F7U E;  4OB1 B;  3SWN C;  3DB4 A;  5C6S A;  1M1F A;  2E6Z A;  1UEB A;  4KUL A;  4OB3 B;  3JCM f;  4IUU A;  1MHN A;  3VKI A;  3FC3 A;  4ATO A;  3I56 T;  1QP2 A;  3BDL A;  2LC4 A;  1M90 U;  1Y7X A;  1G3W A;  3LGL A;  5I21 A;  5GAN j;  4KT0 E;  1HK9 A;  2LNV A;  1FWZ A;  4A4H A;  2A7Y A;  3I55 A;  3CME A;  3TRE A;  2XIC A;  5CR2 A;  3G6E A;  1QVG A;  5IAY A;  2DIQ A;  3HFN A;  2DXT A;  3OYK A;  1KD1 C;  4C8Q F;  2V8J A;  2HNI A;  2MWO A;  2WSE E;  3JB9 I;  3UWN A;  2X35 A;  1N8R U;  5CCA A;  3MET A;  1O9S A;  4E7I A;  1X01 A;  3CXC A;  4XTZ A;  3OW2 S;  2EQJ A;  1VQ6 A;  4FU6 A;  4J7F A;  3RER A;  4N4H A;  4Q5W A;  3I56 A;  4KUI A;  4M75 E;  3CC7 T;  4M75 F;  4M7A G;  4LDW A;  3Q1J A;  4M77 A;  2K57 A;  4C0Z A;  1Y71 A;  2EJG A;  4MML A;  5GMK e;  1K73 U;  3JB9 F;  2K5L A;  5L8R E;  2RJF A;  4MDW A;  4BY6 C;  2BUD A;  3A8O B;  2BIV A;  2RD1 A;  3JSC A;  1OYX A;  1LNX A;  3FRN A;  3MP6 A;  4HCB A;  3BDU A;  2JNG A;  1PSF A;  3OYL A;  2QEX A;  4C0D C;  2QQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...