2JTFA

Solution structure of the phf20l1 mbt domain
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
NRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 20-like 1
publication title Structural Analysis of Histone H4K20 Methyllysine Recognition by the MBT Domain of PHF20L1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jtfA00
1WJRA 2R58A 2RJFA 4LD6A 1KHCA 2EQUA 4N4HA 2MWPA 3LGLA 3OS0A 3FEOA 5KE3A 3E9GA 2WACA 3OYCA 1WJSA 3L2UA 2O4XB 4E7JA 2M16A 3ASKA 4E7LA 2F5KA 3E9FA 2E6NA 3PMIA 2D9TA 2XDPA 4FU6A 2LDMA 4IKFA 4N4IA 2K3XA 3FC3A 5D6XA 2M0OA 4E7KA 1MHNA 2RHIA 3NTHA 2EQJA 4PLIA 3QBYA 3ME9A 3MP1A 5M9OA 3S3MA 3MP6A 3UT1A 1SSFA 3L42A 3OYAA 3P8HA 4B9XA 3META 4L59A 5FROA 3LGFA 5FRNA 2LRQA 3OYBA 4HCZA 2HQEA 3OYDA 3UWNA 3PMTA 2BKDN 3DB3A 2RHXA 3EAEA 2JZ2A 2P0KA 2RJDA 1OZ3A 4Z02A 4BE2A 4E7IA 1OI1A 5C0MA 4RG2A 2MWOA 3OS1A 1WGSA 3M9QA 2L8DA 2L3RA 2LCCA 4N4GA 2RI2A 2VYTA 3NTKA 1OZ2A 3LYIA 3OYEA 2X35A 5CIUA 3S3NA 2DIGA 2GF7A 3OYGA 3C4SA 3FLGA 5FRMA 4OVAA 3FDRA 4IUVA 5J39A 3OS2A 3L2RA 4E7HA 3GOXA 3OYLA 4CRIA 4GY5A 2LTOA 2X4WA 2DIQA 4BD3A 3MEAA 3PNWC 4A4EA 1OYXA 4BACA 1N27A 3MEWA 4QVZA 3MO8A 3OMCA 3Q1JA 4C5HA 2NLUA 5D6YA 3OYJA 4QQ6A 3OMGA 4BDYA 2HQXA 4ZTFA 2RHUA 3BDLA 1XNIA 3QKJA 4FL6A 4PL6A 3SD4A 3L2QA 4QQGA 3OYMA 2DAQA 3DLMA 3CEYA 2X4XA 4A4GA 2PQWA 5KH6A 2L89A 5D6WA 5IN1A 5KCOA 3LX7A 3OYNA 4BDZA 5IAYA 2RJCA 3LLRA 3MEVA 4C5EA 1G5VA 4IUUA 2GFAA 3KUFA 4ZTJA 4BE0A 3OYHA 2RO0A 4UC4A 2QQRA 4C5GA 5KCHA 2B8AA 2EQMA 2CKKA 1H3ZA 3OYFA 2YRVA 2EFIA 2K3YA 3P8DA 4QW2A 2G3RA 3DB4A 3OY9A 4EDUA 3OA6A 2R5AA 2RI5A 3L2VA 3OQ5A 3S3OA 5KE2A 2RI3A 3MEUA 2RHYA 4IURA 2GFUA 2LVMA 2XK0A 4A4FA 4C5IA 2EKOA 2RJEA 1WJQA 2BUDA 3H6ZA 2RHZA 2R57A 3NTIA 3PFSA 4NS5A 5J26A 3OYKA 3F70A 3MP8A 4Q5WA 4A4HA 4B9WA 3QJ6A 3OB9A 3S6WA 3OYIA 3ZEHA 3O8VA 2IG0A 2JTFA 2FHDA 5C6SA 2X4YA 4IUTA 2BIVA 2E5QA 3LH0A 4PLLA 4X34A 4BE1A 4IUPA 2M1HA 4IUQA 2O4XA 4QQDA 3L2WA 2EQKA 3H8ZA 4II1A 2R5MA 1RI0A 2QQSA 3QIIA
chains in the Genus database with same CATH superfamily
1WJRA 2RJFA 2MOXA 3L2QA 2EQUA 5LJ5d 5IXBA 4ZTJA 1WJSA 2M16A 4E7LA 2E6NA 1EX4A 3GIBA 2OTLQ 1VQOT 3VRYA 1NYFA 2COWA 4QT7A 3JV3A 1MUZA 3QPHA 4FSXA 5IHKA 1LJOA 3LGFA 2LX7A 1Z9ZA 3CCSQ 2FZCB 1TUDA 2L0AA 2VGMA 1GCQA 3CCLT 3CBPA 3VS2A 2A28A 1D3BB 2DE0X 2NUPA 2YLBA 1QLYA 2MI6A 3CMEA 1VQPQ 1FXXA 3RNJA 1H641 3M4GA 1KK7A 2V8JA 4DEYA 4KUIA 4M78B 1X75C 1B3QA 5ECAA 3C0CA 1YJ9Q 5LJ5j 4C5HA 5D6YA 1YFNA 2DYBA 1HYOA 1QVPA 2YRDA 4QKUA 3EFSA 1HSQA 4M7DE 2C0OA 2DZ9A 2D6FA 3G6ET 4M7AB 1QMCA 2CP3A 2JVVA 4A54A 2CSQA 2HMAA 2JTEA 2FO0A 4LUDA 1H3ZA 1QWEA 1PSEA 5IXFA 2DJQA 3H0HA 2M0YA 2FVUA 3VRZA 3RIRA 3SB2A 3CCQT 4NOYA 2R57A 4OMNA 3F70A 4WTOB 1NEGA 1YBYA 2QASA 1V1CA 1AZGB 2JM9A 1X6OA 2XI9A 5KYXB 3H41A 3EFOB 1KJWA 4M77E 5GMKl 3L2WA 2R5MA 4ANJA 2OTJQ 1ACMB 1FMVA 4E7JA 3BFMA 2RK1A 2LQ8A 2PVGB 2VV5A 4XU3A 1MHNA 1TUCA 3PT9A 1M1FA 3JRZA 5GANd 1K1ZA 2QQ9A 5GAMd 3OW2A 1S72T 4B9XA 3VU3C 1XJWB 1Q95G 4L6V5 1CKBA 3X28B 1KG1A 3OBYA 1WGSA 4L5GA 3JCMe 1VQKT 3HRSA 1GRIA 2HD0A 2IPOB 4M78E 1Q7YC 1RUWA 1VQ5T 2NUPB 1AZEA 4CRIA 3VYGA 1HD3A 1OYXA 5FWCA 5A0GA 3HPWA 2M9UA 3I56Q 1VQLA 3A8OB 4BDYA 3HHTB 3CPWS 1I5OB 2EBPA 4M7AE 4E2FB 2KMTA 3A8GB 1KD1U 2E70A 3RKYA 1Y57A 5GANj 4MDXA 3G71Q 2NYSA 4E47A 1G3YA 2MK5A 4JLGA 3OSSC 2K4YA 2Y4YA 1VYVA 1VQ6A 1M5Q1 1SF9A 2QYZA 2RI5A 1M1KC 1FWZA 3VYHB 3GBQA 2HL5C 4M75G 2DTIA 3KBGA 3M0UA 2RJEA 1PSFA 2K5LA 4JJNK 4RTYA 5AT1B 3S6WA 4XTUA 4RG8A 2EQIA 1ZSGA 3QSUA 1Q82U 4AG2C 1MMGA 1Z9QA 3GPLA 5GAN6 1C6VX 4LD6A 2O88A 2H3EB 1AEYA 1UJ0A 3VS5A 1M2OA 1JO8A 2CP6A 4FU6A 3RBBB 1MMNA 4N4IA 1I5LA 3CCRQ 3URGA 1VQ8A 2E12A 5IH2A 3V8KA 4VUBA 5M9OA 3G4ST 1SHGA 1YCYA 3PIOA 4XAXB 2RHXA 2EGAA 2JZ2A 4E7IA 4M75A 4KULA 1QP2A 1ZLMA 2EJGA 4M75F 1KC8R 3JB9I 4XU0A 1GBQA 3O5ZA 3CCVT 1K9MC 3SFMA 1K9AA 1IRXA 1KQSP 3RDVA 2YT6A 4KT0E 4XU2A 3TVTA 3M5AA 4M75D 3A8MB 3EG0A 3VJPA 2FPDA 1G5VA 1WX6A 4Y91A 2O31A 2WSCE 4C5GA 1M3AA 2CKKA 4BUGA 1X43A 4CI0C 3JCMX 2AT1B 2LX9A 3ZBDA 4IURA 2JT4A 2JXBA 5FW9A 4FW2A 3HSBA 3JCMg 2M51A 3O8VA 3M0TA 4J9IA 3UA6A 3JB9F 3QJYA 4PLLA 3V7SA 1YITQ 3H8ZA 1VQMT 1SEMA 1VQPA 1I4K1 5A0LA 3CMEQ 1VOMA 1X69A 2DO3A 2DTHA 3NGPA 2CYZB 1N9SA 1X01A 3X25B 1YJ9A 1M9SA 2CGHA 4HT8A 3SEMA 1B34B 4P5NA 3GF5A 2LRQA 4HCZA 2DYIA 3PMTA 2KAFA 5I22A 4BE2A 4A63B 2P0PA 3CD6A 5HCKA 4Z8AA 5DY9A 1UE9A 2HSEB 1FYNA 2L3PA 4N4GA 4LE9A 4JJCA 4DBQA 1ZSZC 4M75B 1G3WA 2P0QA 1UGVA 2QAZA 4AFUC 2RPNA 4DOVA 5J39A 3OS2A 2RF0A 1OPLA 2OTLT 3JCMP 4JRKA 4NL2A 1BK2A 2EJ9A 2K2VA 2LP5A 3OMCA 5GMKm 1U5SA 4PL6A 1E7OA 2D0QB 3CCST 2E3IA 2X4XA 5CVIA 1KFZA 4KRTA 2MIOA 1NYGA 1YWPA 2DILA 3VS4A 1VQ7A 1GFDA 2E65A 4E6RA 1RAHB 3HL8A 2A7YA 3NFCA 3CCMT 1K73U 2G3RA 2ZPFB 3OQ5A 5KYUA 2KVQG 3MEUA 1ZX6A 1WPYA 1OU8A 2ZCFB 5IHNA 3M0RA 4BB7A 4M7DA 2GTJA 3EH1A 3ER0A 3OYKA 3PTAA 1BB9A 1WHHA 4B9WA 4EMGA 6AT1B 2JN0A 2BE7D 2BIVA 3GP8A 3QDRB 2EQKA 1VQ4Q 4LD9K 3I5RA 2R58A 3X26B 2P84A 2VUBA 3E9GA 2J6KA 4DBHA 1QVFA 5I11A 2MCNA 1O75A 2K3XA 1RAGB 1ZA1B 2RHIA 1KD1R 1VQLQ 2O9SA 4BI3A 1YCSB 2C0IA 4M77A 1MNEA 4E7ZA 2RN8A 4GBQA 1QW1A 1XQHA 2KRMA 2I0NA 2GBQA 4HCBA 4RKUE 3JCMW 2P0KA 2KSSA 4D8DA 4HXJA 4M75E 4R55A 1LPLA 1IGQA 2LQWA 1OEBA 2OTJT 1W2BA 2QTXA 5FRMA 2SEMA 1R0BG 1YI2T 2CP2A 2ABLA 3GOXA 1RLQC 4PJOC 2LCLA 2X4WA 1KIKA 2QK0A 3MEAA 4BD3A 3CBOA 2EIFA 3WVDB 5GAN5 1D3BA 1Q82R 2KYMA 1KD1C 2JUFA 3OYJA 3CBMA 3GNFB 1M4ZA 2V8IA 1W70A 5CKEA 2JNGA 2ROLA 3DLMA 5LJ3d 4FT2A 5KH6A 5GMKj 1RLPC 4MMLA 4IUUA 4J9EA 4RCBA 2CZ6B 3PVQA 4FCYA 5LJ5h 2YRVA 3E19A 3CCRA 3EFRA 3RERA 1VQ8Q 2KK4A 4AT1B 3RMSA 3H0IA 2QDYB 2ECZA 2RHZA 4KH0B 5J26A 5KYUB 4J7IA 1VQOA 1UGQB 1UEBA 2FHDA 1YIJQ 4IUTA 1OX9A 4QQDA 2HKNA 2K3BA 1IXDA 1IO6A 2A0FB 3LWIA 2LMJA 3G71T 2RMOA 3CCLA 5FWBA 4N4HA 2KNBB 4N0AA 5KE3A 1I0CA 2WACA 3QHSA 3AT1B 4B6MA 3R6OA 2ZPGB 4J9DA 1YHQQ 1WHMA 3FC3A 1BI3A 1VQ9Q 4C0GA 2EYYA 2XD0A 4XTVA 3UT1A 1YJNQ 3L42A 1Q81C 2CP7A 3KFVA 4C8QC 1JXMA 2K2MA 3DLLA 3DB3A 3M0QA 2RJDA 4M77B 1TG0A 2LJ1A 1VIEA 4OB3B 3HFNA 2MWOA 2CP5A 2CT4A 3MHXA 1OX8A 1X6GA 1ZUYA 5LJ5f 4C92C 3DKMA 3UA7A 1OZ2A 3LYIA 5GAOr 4DA4A 3OYLA 3KXTA 2AHJB 1EZZB 2YUPA 2BE9B 3FJPA 4XK8E 4J9BA 1UTIA 2QQAA 3REBB 3A8LB 2K57A 2B86A 5I2SA 5IHIA 4LXCA 2HL3A 4FL6A 2ZZDA 1YITA 1RL2A 4OP0A 4OMOA 4A4GA 2E4HA 1UG1A 7AT1B 3VS1A 4BDZA 2RJCA 1TTHB 3BE3A 3JCMJ 5KCHA 1QVGA 2GCXA 3CXCA 2CH4A 2HBPA 3LW5E 1M8MA 3L2VA 4J7FA 1WHGA 2DL4A 3QO3A 3TREA 3IQLA 1WYXA 2H8HA 2W10A 2CP0A 1EFNA 2D8JA 5GANh 2BUDA 1U1SA 5FU7B 5GAMh 4GLMA 2X4JA 5L23A 2COYA 3SWNC 4HVVA 1K0SA 1S72A 2X4YA 2VASA 3CD6Q 4IUQA 4BY6C 1RAEB 4HA8A 3CC7T 4JS4A 3QYGB 2KGTA 2KI7A 1QCOA 3QIIA 2KROA 5DM7R 1SPKA 3JCMd 1NEBA 1JJ2S 1NLOC 2XDDA 4MZMA 4JS5A 1QCNA 1ZHIA 4IKFA 1BCOA 1NPRA 3FB9A 2DJZA 3TEEA 4EMKC 3S3MA 1JQQA 2EGCA 1HJDA 4AFSC 4Y92A 3HKSA 1VQ7Q 4LDUA 1K73R 2IVWA 1Y07A 2WSEE 1UDLA 3TQ7P 3E1SA 3CMET 1QP3A 3OYEA 3CC4T 4FSSA 3S3NA 2YXYA 1NPPA 2KRNA 3CMAT 2O2OA 5GAMf 2I2LA 3HP9A 4F7UG 2RQRA 2V1RA 4QQ6A 1Y96A 1VA7A 2QDLA 2FG0A 4ZN1A 4JJDA 5GAN8 4PFZA 1RAFB 2HNIA 3JCMc 1VQ4A 2LNVA 1K73C 4X9CA 1D09B 1E6GA 1UECA 2RO0A 4XTXA 2HBWA 4Y28E 3BY7A 1MV0B 3M0PA 2QA4Q 3QG1A 2OAUA 3RMQA 5KE2A 4PJOG 2EYXA 3U23A 2RHYA 1WNLA 2EW3A 2DNUA 4C5IA 4ZGEB 1NJIU 1M3BA 2EKOA 2EJFA 1YN8A 2GNCA 3NTIA 2LJ0A 3PFSA 4NS5A 4DBFA 3EG9A 2COZA 4AFZC 4KH1B 5C6SA 3M0SA 2XMFA 4JRPA 2MMPA 1T3LA 1RI0A 8AT1B 2X3XD 2JS2A 1M30A 4F7UF 1O9SA 1S1NA 3E9FA 3PMIA 1K8AU 3I55A 1MGQA 2LDMA 4XU1A 1PD1A 4D8KA 3HRTA 2X3WD 2DL3A 1SSFA 2NUZA 1SRLA 1AWJA 3OYBA 3UDCA 2RQVA 5KYWB 4PKCC 3EAEA 5CKBA 2GQIA 4C0FA 4PJOF 2CSIA 5C0MA 1N8RR 4LDYA 3OS1A 1KSWA 3OS5A 1B34A 2OAWA 2V8KA 3I9QA 2X35A 2ROTA 3L2RA 2D0NA 3EG3A 2W0ZA 3A5ZB 2IIMA 3M57A 4BACA 1KQ1A 2L3SA 2A36A 1VQOQ 2BZ8A 2LQKA 2RHUA 1YIJA 1WIEA 4C8QG 4PJOD 2DAQA 1X27A 2FEIA 2PQWA 4OF1A 1Y96B 1GBRA 1P92A 2J6OA 3CCLQ 4QVDA 4C92G 3C95A 1YHQA 4LN2A 3HRUA 1VQ9A 1VQ6T 3P8DA 3TSWA 2HZYA 2YUOA 3J80E 2DVEA 2GFUA 1YJNA 4PFOA 4WF2A 3H6ZA 2E5KA 4CC2A 4Q5WA 1PRLC 2HKQB 3ZEHA 9ATCB 1UHFA 1HXDA 2KXDA 2MF2A 2KXCA 2DXCA 3CCJA 3EG9B 4II1A 2HAXA 4KBMB 1ZQ1A 1TOVA 4QVCA 3V7CA 1KC8C 1C1AA 5CO7A 3FEOA 4C8QA 1HK9A 3ASKA 1SHFA 4F7UB 4C8QF 1G2BA 2EVRA 2FYKA 5D6XA 1FMWA 3UF4A 1VQ8T 3PVLA 3QBYA 3VUBA 3WVEB 5FROA 2SRCA 2CZ1B 4C92F 3CCQQ 4PJJA 2QEXT 1VIFA 1LNXA 2XDBA 4XTZA 4PK4A 4E7SA 2RB6A 4FT4A 2M02A 2ZPIB 4PJOB 8ATCB 2VYTA 4C8QD 3NTKA 5HK3A 5CIUA 1TWBA 3A1PA 4CC4B 2XU8A 3FDRA 4Z89A 5FU6B 3CC2A 3D7SB 3RKWA 3PNWC 3UATA 4C92D 3MO8A 3Q1JA 4ZTFA 2LC4A 2KQWA 3VS7A 4OGEA 3VKIA 2ESWA 1DJ7B 3FIFA 1S72Q 1VQNA 1PC0A 4YTLA 4OMMA 2XICA 1OQKA 4OGCA 1V29B 4C0DC 1Q86R 1U1TA 4J83A 3LWHA 3CCUA 3H9NA 2QQRA 3SWNA 5I21A 2EGEA 2FZKB 5GAMg 1IHWA 1N6AA 1KQSA 2R5AA 3LH5A 2F69A 1NBEB 4FW1A 3MPUB 4HT9A 3EGDB 5GMKh 3SDZA 1JJ2P 3RESA 3MP8A 4A4HA 3QJ6A 1NLPC 1WQ7A 3M58A 1MMDA 2E5QA 2K5FA 3M54A 4IUPA 3JAME 5KYNA 1VQPT 2ZGWA 3HFOA 1M27C 1U3OA 4KGZB 1G3TA 1M8VA 1TSFA 4F7UE 3CCEA 1D0YA 2F5KA 2RM4A 1YJ9T 5CAIA 4E7KA 4C8QB 2HDAA 1TXQA 1SRMA 4KGVB 3INZA 1YI2A 2DRMA 2D1XA 3MP6A 3L2ZA 3MJXA 4RTTA 2E1HA 2NUTA 2LT4A 2BZXA 3PIPA 2EWNA 2BKDN 1OU9A 5LJ3h 4PJOE 3CD6T 1W6XA 3BDUA 3TSZA 3M9QA 4IIMA 1NJIR 3G1JA 1AWWA 1OULA 2QA4A 2F2WA 2AIRB 5EC7A 1RADB 2MYSA 2ENMA 4C0ZA 2DD5A 3WXMB 4QVZA 4OB0B 2NLUA 3THKA 2DTOA 3OMGA 4PFPA 3G4SQ 2JJ9A 3EHRA 2KDSA 3CEYA 4J5YA 1K8AR 2YRCA 5CR2A 1CKAA 2QGGA 1MV3A 2Y90A 2EPDA 2HEQA 3I55Q 2JMCA 1YJWA 4X1VA 4QW2A 2F2XA 3OA6A 2XG8D 3AHUA 1UHCA 1X6BA 2V26A 3SWNB 5GAN2 2YSQA 4M7AG 4A4FA 1AWOA 2E6ZA 4BY6B 3CCVQ 4HCKA 2DA9A 2IG0A 5LJ3f 1QKXA 3ULRB 1SSHA 3M59A 1D1CA 1MNDA 1PG5B 3E2UA 2L2PA 2CZ0B 5CK9A 4JRIA 3ZFJA 2J6FA 2FRYA 2DMOA 3UPUA 1N8RU 2P4TA 1K76A 1BU1A 4DEXA 4WCIA 4EMKB 4C8QE 1H92A 4A53A 3I56T 1Q82C 3GNGA 4ESRA 4J9GA 2YWWA 1ZA2B 3VUZA 1BI2A 3META 4L59A 3VS3A 4C92E 2RQUA 3OYDA 2KBTA 1RACB 4CC3A 3REAB 5FLXE 2CUDA 1OI1A 2NUTB 1H3HA 3M55A 2GTOA 1K9MU 4AMCA 1VYTA 2PVDB 2DIGA 2CDTA 3EHQA 4E7HA 2DLPA 5CQXA 3JB9H 1M3CA 2WSFE 4GY5A 4HKEA 3EGUA 1AOJA 3FRNA 1BYMA 3MEWA 3VS6A 5GAOl 3CPWA 1PRMC 5CKDA 2PU9B 4ELZC 1XNIA 2YUQA 1OOTA 2QGFB 3CCJQ 4M7AD 4XTWA 4JUVA 2ZPBB 5CKFA 3G6EA 4ME7A 4X9DA 3OSVA 2QTVA 5GJWB 3CC7A 3JCMh 3J81E 3CCRT 1PD0A 1AD5A 4A4KA 2JS0A 1CSKA 1UGPB 1U06A 1WA7A 2RH2A 2LQNA 3CCQA 1W4SA 4FIBA 2FB7A 1I8FA 2CT3A 1ZBJA 2ZPEB 2BTTA 2M1HA 4O6JA 2O4XA 3EG1A 3OW2P 4DBRA 5D7UA 4OMFB 4EIKA 1MMAA 2CH4W 1QVFS 3CC2Q 3CCMQ 2AK5A 1RAAB 4PJLA 4JRQA 2A3LA 3CC4A 4BI4A 1I81A 3CMAA 1M2VA 2E3HA 3JCMb 4MMKA 3L1AA 1PKSA 3I35A 1VQNQ 4ZGDB 1QQJA 2K7AA 2DXUA 4ATOA 2DXTA 1GL5A 5LJ5e 3CCUQ 2VVKA 1VQKA 1ABQA 2DVJA 4NL3A 1W2BS 3JCMf 1AT1B 4PNOA 1Q86U 1A0NB 4M4ZA 2DFUA 2D8HA 3FLGA 5KYWA 1BKBA 1VQ5A 1ZSZA 2NWMA 4RTUA 1WZOA 3TCJA 2GGRA 2RNAA 1SKUB 1G8XA 2A37A 2L3QA 4FM4B 5GAOn 4JZ3A 1TUGB 4OMPA 2VB6A 1PCXA 4JJBA 1WQWA 4LDVA 2JTMA 2HQXA 2DL7A 2ED0A 1TS9A 1YITT 3QDFA 4MZPA 2ED1A 1XTDA 5HK0A 2KRSA 4J9HA 2L89A 3M4YA 1WI7A 1WHLA 2A08A 3OYNA 1W1FA 1R77A 3KUFA 4PJMA 3CCEQ 1YWOA 2RQTA 5L8RE 2K3YA 2GQVA 2X9HA 5GANf 4M7DC 4HVWA 1T0JA 2VXEA 1Q7YR 3EGXB 1BIBA 1NZ9A 1YI2Q 2XHCA 2KT1A 2DF6A 4K11A 2O01E 2HQHA 1PNJA 2LCSA 2AKLA 1E6HA 4JDSA 4GLKA 4DOWA 4BE1A 1U8RA 1D0XA 2K6DA 1KHCA 2O4XB 1RAIB 2D9TA 3PGGA 1J3TA 2VGNA 4M77C 4OMLA 2DZCA 1M1KR 5LJ3g 1ARKA 2DBKA 5HKCA 2DM1A 3QZ5B 5IT9E 3P8HA 3G4SA 1RABB 1NM7A 4J8OA 5FRNA 4J9FA 3ZL7C 1R0CB 4F7UA 1M2VB 1QCFA 2FZGB 3JCMQ 1UUEA 3C12A 5GAOq 1UGSB 3PE0A 4RG2A 4RTXA 2LCCA 1IREB 2DPPB 2F2VA 2RI2A 1YJWQ 2K9GA 5GAMj 1LOJA 2C0TA 4OVAA 4J9CA 5GANe 1GCPA 1T3SA 2LTOA 5GAMe 1M90U 2FPFA 3CCVA 5CKHA 5A2QE 4PJOA 1BBZA 1ZSZB 2OX7A 2E41A 2LNHB 4M78C 2RQWA 1AHJB 4C0DB 5LL6S 1VQ4T 1JRIA 1M1GA 2VXFA 2VKNA 2F1LA 2PUOB 1OPKA 1FX7A 2EAYA 3MEVA 4KGXB 5FU7C 4KUDK 1QVGS 1JXOA 3CXCS 2XKOC 1V76A 2EFIA 3MCAB 4M7AC 3OY9A 1VQLT 4O5VA 4FYVB 3EG2A 2EYWA 5I2MA 5GAN4 5LJ5g 1K9MR 4PJNA 3V8LA 3BW1A 1R8OB 2EYZA 2DL5A 4CC7A 3CPFA 1N8RC 1WXTA 2J7IA 1YNZA 4N0AC 1YP5A 1AWXA 4JZ4A 1VQMA 3HTRA 1X2KA 2QEXA 3EGDA 3X24B 1Q81U 3VV0A 3LGLA 4IIOA 1BI1A 3I55T 1JBMA 4J6XA 1N5ZA 5GAOm 5CQYA 2M0OA 2G6FX 5CCAA 3A98A 3JB9G 3NTHA 2EQJA 2YDLA 3N5BB 3ME9A 3MP1A 1K0XA 2DETA 1ZUKA 2HSPA 5DLQE 2AZSA 2Y4XA 1GXIE 1WDXA 4V2SA 2FL7A 2HQEA 3UWNA 3OYYA 1B07A 2JMAA 2AZVA 3G6EQ 1D1BA 3SHWA 2O9VA 2L8DA 2E10A 3CC7Q 4RUGA 5GAN3 3M56A 1PHTA 4IUVA 4C92A 3QWXX 3OW2S 1GCQC 4A4EA 2OTLA 3M53A 2J05A 2RK2A 5KYYA 1YIJT 3BDLA 2PTKA 2K5IA 4ELYC 3CCSA 4AG1C 3G7ZA 5IN1A 5KCOA 3LX7A 2JM8A 1AVZC 1T0HA 3LLRA 2DEUA 5AYFA 2GFAA 3OYHA 4OB2B 4UC4A 1YHQT 2RD1A 2KEAA 1VQ9T 5A0DA 2K79A 3CCMA 2MPXC 5GAN7 1B7TA 3DB4A 1ZBXA 4HCCA 2RI3A 3C94A 3CC4Q 1YJNT 2XK0A 1I07A 3CMAQ 5HY6A 1NE8A 1QVFP 4EMHA 2PNIA 2JTFA 3JB9D 3LH0A 3CCJT 5GANg 3J7AF 5DLOA 1VQKQ 2HCKA 4LNPA 1WHJA 1ABOA 2MWPA 3L2UA 2QG9B 2V1QA 1G83A 4RTZA 1VQ5Q 1IGUA 3H0FA 4M7DG 4JPBW 2OJ2A 2AKKA 4OMQA 2XIDA 1VUBA 1W2BP 4Z88A 1C0MA 2ZAEA 2QI2A 2E64A 4EMKA 4MDWA 2Z0WA 4Z02A 3QXEB 2DKGA 1OZ3A 2YLCA 1Q86C 1KHIA 4DQ2A 2L5QA 1F1BB 2OTJA 3QUIA 1BIAA 3TU4K 2CS7A 2DXBA 2GF7A 4D6WA 2VWFA 3CC2T 4M77G 1IHVA 2JW4A 1Q7YU 4BI8B 2JOYA 4C92B 1H8KA 1QWFA 2P4RA 3QKJA 3RUXA 4TVRA 1VQNT 1XOVA 1NG2A 4QQGA 3OYMA 3QZ9B 5J3BA 1OV3A 4HVUA 4M7DF 1ZUUA 5D6WA 1WXUA 5KYYB 1G3SA 2DRKA 4RTWA 1UB4A 2C06A 1WLPB 2VC8A 3CCUT 2B8AA 2EQMA 1UFFA 2DEQA 1UGRB 1TH7A 2X51A 1Y0MA 2CUBA 3V7RA 2DX1A 3I5SA 2LVMA 5GMKi 3MKDA 1WJQA 3NMZC 2LT1A 3I56A 2DBMA 1M1KU 2KT8A 4M78G 4M7DD 1VQ7T 1VYUA 2DL8A 2ATCB 1Y7XA 2F5TX 5GAOp 3JB9J 4XTYA 4ORZA 3X20B 4X34A 3T9NA 2RA2A 4M77F 4J6WA 1NJIC 2KR3A 2QQSA 3G71A 1M90R 3RKXA 1IB8A 3OS0A 3OYCA 1JJ2A 3CCET 2DK3A 2MAMA 4F17A 2XDPA 3CPWP 1JU5C 4LUEA 3CQTA 3P8BB 1VQ6Q 1Y71A 4FYWB 4PLIA 1GFCA 1BI0A 2FPEA 4ZGJB 2DD4A 3OYAA 4LDXA 3QWYA 1IZ6A 3NPFA 2KY9A 4AFQC 1K8AC 3JCMV 4M77D 1KQ2A 1D0ZA 2PVOB 5FU6C 3JSCA 4MZTA 1PKTA 4R56A 5GJVB 1SG5A 2L3RA 4M78A 2YUNA 2QXFA 2QA4T 2OI3A 2DERA 1WXBA 1M90C 5EG2A 4J6YA 3VS0A 4LDWA 1UJYA 1FMKA 4M78F 3OYGA 3R6NA 3C4SA 3OBWA 1N9RA 2H3JA 1TU0B 2PUKB 1QKWA 5GMKe 2DIQA 3EH2A 4M75C 1N27A 1I1JA 4RMOA 1JEGA 1QVGP 3CXCP 1BCMA 4M7AA 3NHNA 3SD4A 1Q81R 2PZ1A 1X2QA 4EPCA 4M7AF 4F16A 4FYYB 4RTVA 4XQ3A 1VQMQ 2EKHA 3FJ5A 5IAYA 2QEXQ 4ZNXA 2EYQA 4C5EA 4M7DB 4OB1B 1K4US 4BE0A 4RCCA 4M78D 2CREA 2LJ3A 3A8HB 1YJWT 2QQBA 3OYFA 1WFWA 4EDUA 2KYBA 2LZ6B 1WHKA 1KQSS 1LCKA 3S3OA 3V8JA 2J06A 1PM3A 4FYXB 1D1AA 5LJ3j 2YHTA 4ZN3A 1RI9A 3GLXA 1JB0E 1KC8U 4R0KA 1PWTA 5KYXA 3EFOA 3OB9A 5LJ3e 3QYHB 3OYIA 2KE9A 1EIFA 2CZ7B 4JLIA 2BZYA 4F04B 3EGXA 2ZPHB 1LVKA 3RR6A 4F14A 2FRWA
chains in the Genus database with same CATH topology
1WJRA 2R58A 2RJFA 3X26B 1KC8C 3L2QA 1KHCA 2EQUA 5LJ5d 2VUBA 5CO7A 3FEOA 3E9GA 4ZTJA 4C8QA 1HK9A 1WJSA 2O4XB 2M16A 3ASKA 4E7LA 1QVFA 2E6NA 2D9TA 3PGGA 3GIBA 4F7UB 1O75A 4C8QF 2VGNA 2K3XA 2FYKA 5D6XA 4M77C 1VQOT 2RHIA 1VQ8T 2DZCA 3QBYA 5LJ3g 5HKCA 4BI3A 3QZ5B 3VUBA 5IT9E 3P8HA 4FSXA 3QPHA 4M77A 3WVEB 3G4SA 1LJOA 5FROA 3LGFA 4J8OA 2CZ1B 4C92F 1QW1A 1XQHA 5FRNA 4HCBA 4RKUE 2QEXT 3JCMW 4F7UA 2P0KA 1VIFA 1LNXA 2KSSA 2VGMA 3CCLT 2XDBA 3JCMQ 4XTZA 3C12A 3CBPA 1UGSB 5GAOq 1D3BB 4RG2A 2RB6A 4FT4A 4M75E 4R55A 2LCCA 2ZPIB 1IREB 4PJOB 2YLBA 2DPPB 2MI6A 2RI2A 2VYTA 4C8QD 3CMEA 1W2BA 1FXXA 3NTKA 2OTJT 5HK3A 5GAMj 2QTXA 5CIUA 1LOJA 1H641 3M4GA 5FRMA 4OVAA 2XU8A 3FDRA 2V8JA 1YI2T 4KUIA 3GOXA 5GANe 5FU6B 4M78B 4PJOC 1X75C 2LCLA 2LTOA 2X4WA 5GAMe 3CC2A 3RKWA 4BD3A 3MEAA 3PNWC 3CBOA 1M90U 2EIFA 3WVDB 5GAN5 1D3BA 5CKHA 3CCVA 4C92D 3MO8A 2JUFA 5LJ5j 1KD1C 3Q1JA 4C5HA 5A2QE 5D6YA 3CBMA 3OYJA 3GNFB 1M4ZA 4PJOA 2V8IA 2E41A 4ZTFA 2LC4A 4M78C 5CKEA 1AHJB 1QVPA 2KQWA 4OGEA 2JNGA 3VKIA 4C0DB 1DJ7B 3FIFA 3EFSA 5LL6S 1VQ4T 1VQNA 3DLMA 1JRIA 1M1GA 4M7DE 5LJ3d 2VXFA 4YTLA 4FT2A 5KH6A 2PUOB 2DZ9A 1FX7A 2XICA 2EAYA 5GMKj 2D6FA 3G6ET 4M7AB 3MEVA 4MMLA 4OGCA 1V29B 4IUUA 4C0DC 1U1TA 2JVVA 4J83A 4A54A 4RCBA 3LWHA 2CZ6B 5FU7C 3CCUA 4KUDK 2QQRA 5LJ5h 3SWNA 1QVGS 1H3ZA 3CXCS 5I21A 2XKOC 2EFIA 2YRVA 5GAMg 3MCAB 1N6AA 1PSEA 4M7AC 3OY9A 1KQSA 2R5AA 3E19A 1VQLT 4O5VA 3CCRA 3EFRA 3RERA 2KK4A 2F69A 3RMSA 2FVUA 2QDYB 3RIRA 5I2MA 5GAN4 4HT9A 3SB2A 5GMKh 2RHZA 4NOYA 2R57A 3CCQT 3SDZA 5LJ5g 5J26A 4J7IA 3RESA 3BW1A 3F70A 3MP8A 3V8LA 4A4HA 1VQOA 1UGQB 3QJ6A 1R8OB 1WQ7A 1UEBA 3M58A 1YBYA 2FHDA 3CPFA 4IUTA 2E5QA 1X6OA 1N8RC 2XI9A 2K5FA 3M54A 4IUPA 4QQDA 4N0AC 4M77E 5GMKl 3JAME 3L2WA 1VQPT 2ZGWA 2R5MA 1VQMA 3HFOA 3LWIA 3G71T 2QEXA 1G3TA 1M8VA 3CCLA 3X24B 1Q81U 4N4HA 3VV0A 3LGLA 4F7UE 4N0AA 5KE3A 2WACA 3QHSA 4E7JA 3BFMA 2RK1A 3CCEA 1BI1A 2F5KA 3I55T 1JBMA 3R6OA 2LQ8A 2PVGB 2ZPGB 4J6XA 2VV5A 3FC3A 5GAOm 2RM4A 1YJ9T 1BI3A 4XU3A 5CQYA 4C0GA 2M0OA 5CAIA 5CCAA 4E7KA 1MHNA 3PT9A 4C8QB 3NTHA 1M1FA 3JB9G 2EQJA 2XD0A 3N5BB 3JRZA 5GANd 3ME9A 3MP1A 4XTVA 2QQ9A 3INZA 5GAMd 1YI2A 3MP6A 3L2ZA 3UT1A 3L42A 3OW2A 1S72T 1Q81C 4B9XA 5DLQE 2Y4XA 3VU3C 2E1HA 2LT4A 1GXIE 4V2SA 2FL7A 4C8QC 2HQEA 3PIPA 3UWNA 2EWNA 3DLLA 2BKDN 3DB3A 3OYYA 4L6V5 2RJDA 5LJ3h 3X28B 4M77B 4PJOE 1KG1A 3CD6T 1VIEA 3BDUA 4OB3B 3HFNA 3OBYA 2MWOA 3MHXA 1WGSA 3M9QA 4L5GA 3JCMe 2L8DA 1VQKT 2E10A 3HRSA 5LJ5f 4C92C 3DKMA 5GAN3 2HD0A 1OZ2A 3LYIA 2QA4A 5GAOr 4M78E 3M56A 1Q7YC 1VQ5T 4IUVA 4DA4A 4C92A 3OYLA 4CRIA 2AHJB 3KXTA 3VYGA 3OW2S 3FJPA 4XK8E 4C0ZA 4A4EA 2OTLA 1OYXA 2DD5A 2QQAA 3WXMB 5A0GA 3A8LB 2K57A 3HPWA 3M53A 4QVZA 4OB0B 2M9UA 1VQLA 2RK2A 2NLUA 2DTOA 3A8OB 3OMGA 5I2SA 4BDYA 3HHTB 3CPWS 1YIJT 3BDLA 2K5IA 4FL6A 4ELYC 2ZZDA 1YITA 3CCSA 4M7AE 2KDSA 2KMTA 3CEYA 1RL2A 3A8GB 4J5YA 4OP0A 4A4GA 2E70A 1KD1U 3G7ZA 3RKYA 5IN1A 5KCOA 5CR2A 3LX7A 5GANj 4MDXA 4BDZA 2RJCA 3LLRA 5AYFA 2GFAA 4E47A 3OYHA 1G3YA 4OB2B 3JCMJ 4UC4A 2Y90A 4JLGA 1YHQT 3OSSC 2K4YA 2RD1A 2Y4YA 5KCHA 1QVGA 2GCXA 3CXCA 2HBPA 1VQ9T 5A0DA 3CCMA 1YJWA 3LW5E 4QW2A 5GAN7 1VQ6A 3DB4A 3L2VA 3OA6A 1M5Q1 4J7FA 2RI5A 1ZBXA 2XG8D 3QO3A 3AHUA 3TREA 2RI3A 1FWZA 1M1KC 3C94A 4HCCA 3VYHB 1YJNT 3SWNB 5GAN2 4M7AG 4M75G 2DTIA 2XK0A 3KBGA 4A4FA 2RJEA 5GANh 1PSFA 2BUDA 2K5LA 1U1SA 4JJNK 5HY6A 5FU7B 5GAMh 2E6ZA 4BY6B 1NE8A 2X4JA 4EMHA 3S6WA 3SWNC 2IG0A 4XTUA 4RG8A 2JTFA 5LJ3f 1S72A 2X4YA 3QSUA 3JB9D 3M59A 3LH0A 1Q82U 4IUQA 3CCJT 4BY6C 4HA8A 3CC7T 5GANg 3J7AF 4JS4A 2CZ0B 5DLOA 3QYGB 5CK9A 4JRIA 3GPLA 3ZFJA 3QIIA 5GAN6 3UPUA 5DM7R 4LD6A 2MWPA 3L2UA 1N8RU 2P4TA 3JCMd 1JJ2S 4EMKB 2XDDA 4MZMA 4JS5A 4C8QE 4M7DG 4FU6A 1ZHIA 4IKFA 4N4IA 4A53A 3I56T 1Q82C 1I5LA 1NPRA 3FB9A 3GNGA 2DJZA 3TEEA 3URGA 1VQ8A 2E12A 4EMKC 3V8KA 4VUBA 2XIDA 5M9OA 3S3MA 1VUBA 3VUZA 3G4ST 1BI2A 3META 4L59A 4C92E 1YCYA 3PIOA 2QI2A 2E64A 4EMKA 4XAXB 3OYDA 4MDWA 3HKSA 4Z02A 2RHXA 3QXEB 2DKGA 2JZ2A 1OZ3A 2YLCA 5FLXE 4LDUA 4E7IA 2IVWA 4M75A 1Y07A 1KHIA 2WSEE 1Q86C 1OI1A 4DQ2A 4KULA 2L5QA 3M55A 1QP2A 1K9MU 2EJGA 4M75F 3E1SA 3CMET 1QP3A 2OTJA 3QUIA 3OYEA 1BIAA 3CC4T 3TU4K 3S3NA 2PVDB 3JB9I 2DIGA 1NPPA 2CS7A 2DXBA 2GF7A 4D6WA 4E7HA 5CQXA 3JB9H 4XU0A 3CMAT 2WSFE 3CC2T 4GY5A 4M77G 4HKEA 3CCVT 1K9MC 3FRNA 1BYMA 3MEWA 1Q7YU 3SFMA 5GAMf 2I2LA 4BI8B 2JOYA 3HP9A 4F7UG 4QQ6A 4C92B 5GAOl 3CPWA 5CKDA 1Y96A 2PU9B 4ELZC 1XNIA 3QKJA 3RUXA 4TVRA 1VQNT 1XOVA 4ZN1A 5GAN8 4QQGA 3OYMA 3QZ9B 4KT0E 5J3BA 2HNIA 4XU2A 3JCMc 2LNVA 1VQ4A 3M5AA 4M7DF 4M7AD 5D6WA 4M75D 3A8MB 3VJPA 4XTWA 4JUVA 2ZPBB 5CKFA 1G3SA 1K73C 4X9CA 1UB4A 3G6EA 4ME7A 4X9DA 2C06A 1G5VA 4Y91A 2VC8A 2RO0A 2WSCE 3OSVA 3CCUT 4XTXA 4C5GA 2B8AA 2EQMA 2CKKA 4BUGA 3CC7A 3JCMh 4Y28E 3BY7A 2DEQA 1UGRB 3J81E 1TH7A 4CI0C 3JCMX 3CCRT 3QG1A 2OAUA 3RMQA 5KE2A 2LX9A 4PJOG 4A4KA 3ZBDA 3V7RA 2RHYA 4IURA 1WNLA 2LVMA 1UGPB 4C5IA 4ZGEB 5GMKi 2EKOA 1NJIU 1WJQA 2EJFA 2RH2A 3HSBA 2LT1A 3CCQA 3NTIA 3PFSA 4NS5A 1W4SA 3I56A 3JCMg 1M1KU 4FIBA 4M78G 4M7DD 2FB7A 1VQ7T 3O8VA 1I8FA 1Y7XA 2F5TX 5GAOp 5C6SA 4XTYA 3JB9J 3JB9F 2ZPEB 3X20B 3QJYA 4PLLA 3V7SA 4X34A 2M1HA 4O6JA 2O4XA 3T9NA 2RA2A 4JRPA 3H8ZA 1VQMT 4M77F 4J6WA 2MMPA 1VQPA 1NJIC 1I4K1 1RI0A 5A0LA 2QQSA 3G71A 4OMFB 3RKXA 2DO3A 3OS0A 3OYCA 2DTHA 1JJ2A 3CCET 4F7UF 1O9SA 3E9FA 2CYZB 2DK3A 2MAMA 3PMIA 1K8AU 3I55A 1MGQA 1QVFS 2XDPA 2LDMA 1N9SA 4XU1A 1X01A 3P8BB 3X25B 1YJ9A 4JRQA 3HRTA 2A3LA 1Y71A 3CC4A 1M9SA 4PLIA 4BI4A 1BI0A 2CGHA 4HT8A 1I81A 1B34B 1SSFA 4ZGJB 2DD4A 3OYAA 3CMAA 3JCMb 4LDXA 4MMKA 1IZ6A 3L1AA 3GF5A 4P5NA 2LRQA 3UDCA 4ZGDB 4HCZA 2KY9A 3OYBA 1K8AC 2DXUA 3JCMV 3PMTA 4M77D 2KAFA 4PKCC 3EAEA 1KQ2A 5CKBA 4BE2A 2PVOB 2P0PA 5FU6C 3JSCA 4ATOA 4C0FA 2DXTA 4MZTA 4PJOF 5C0MA 3CD6A 5LJ5e 4LDYA 3OS1A 4R56A 5DY9A 2L3RA 1VQKA 3OS5A 4N4GA 1B34A 2V8KA 4M78A 2QXFA 4NL3A 2QA4T 1W2BS 3JCMf 1M90C 5EG2A 4M75B 1G3WA 4J6YA 4PNOA 2X35A 2P0QA 4LDWA 1Q86U 4M78F 3OYGA 3C4SA 3FLGA 1N9RA 2H3JA 3OBWA 4DOVA 5J39A 1BKBA 3OS2A 2PUKB 3L2RA 1VQ5A 5GMKe 3TCJA 3A5ZB 2OTLT 3JCMP 2DIQA 4JRKA 3M57A 4BACA 1KQ1A 4M75C 1N27A 4NL2A 4FM4B 5GAOn 2EJ9A 2K2VA 4RMOA 3OMCA 2LQKA 1WQWA 5GMKm 4LDVA 2JTMA 2HQXA 2RHUA 4M7AA 4PL6A 1YIJA 3SD4A 4C8QG 2D0QB 1YITT 4MZPA 3CCST 1XTDA 5HK0A 4PJOD 2DAQA 4EPCA 2X4XA 4M7AF 2PQWA 5CVIA 2L89A 3M4YA 4OF1A 4XQ3A 3OYNA 1VQ7A 1Y96B 5IAYA 4C5EA 2EYQA 2E65A 4M7DB 1P92A 3KUFA 4OB1B 4BE0A 4RCCA 3HL8A 4M78D 4QVDA 2A7YA 4C92G 3C95A 1YHQA 3NFCA 3A8HB 3CCMT 2QQBA 1YJWT 3HRUA 3OYFA 5L8RE 2K3YA 2GQVA 1VQ9A 1VQ6T 3P8DA 1K73U 2G3RA 5GANf 4M7DC 4EDUA 2ZPFB 3OQ5A 1KQSS 2KVQG 2VXEA 3S3OA 3MEUA 3V8JA 2ZCFB 1WPYA 2DVEA 2GFUA 3J80E 4BB7A 1YJNA 1BIBA 1NZ9A 2YHTA 5LJ3j 2XHCA 4ZN3A 4M7DA 4WF2A 3GLXA 3ER0A 3H6ZA 1JB0E 1KC8U 2O01E 3OYKA 3PTAA 4Q5WA 4B9WA 4EMGA 3OB9A 5LJ3e 3QYHB 3OYIA 3ZEHA 1EIFA 1HXDA 2JN0A 2MF2A 2CZ7B 4JDSA 2BIVA 4GLKA 4DOWA 4BE1A 3GP8A 4JLIA 2DXCA 2EQKA 3QDRB 3CCJA 1U8RA 4II1A 2ZPHB 2HAXA 4LD9K 4KBMB 1ZQ1A 4QVCA 3V7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJR A;  2R58 A;  2RJF A;  4LD6 A;  1KHC A;  2EQU A;  4N4H A;  2MWP A;  3LGL A;  3OS0 A;  3FEO A;  5KE3 A;  3E9G A;  2WAC A;  3OYC A;  1WJS A;  3L2U A;  2O4X B;  4E7J A;  2M16 A;  3ASK A;  4E7L A;  2F5K A;  3E9F A;  2E6N A;  3PMI A;  2D9T A;  2XDP A;  4FU6 A;  2LDM A;  4IKF A;  4N4I A;  2K3X A;  3FC3 A;  5D6X A;  2M0O A;  4E7K A;  1MHN A;  2RHI A;  3NTH A;  2EQJ A;  4PLI A;  3QBY A;  3ME9 A;  3MP1 A;  5M9O A;  3S3M A;  3MP6 A;  3UT1 A;  1SSF A;  3L42 A;  3OYA A;  3P8H A;  4B9X A;  3MET A;  4L59 A;  5FRO A;  3LGF A;  5FRN A;  2LRQ A;  3OYB A;  4HCZ A;  2HQE A;  3OYD A;  3UWN A;  3PMT A;  2BKD N;  3DB3 A;  2RHX A;  3EAE A;  2JZ2 A;  2P0K A;  2RJD A;  1OZ3 A;  4Z02 A;  4BE2 A;  4E7I A;  1OI1 A;  5C0M A;  4RG2 A;  2MWO A;  3OS1 A;  1WGS A;  3M9Q A;  2L8D A;  2L3R A;  2LCC A;  4N4G A;  2RI2 A;  2VYT A;  3NTK A;  1OZ2 A;  3LYI A;  3OYE A;  2X35 A;  5CIU A;  3S3N A;  2DIG A;  2GF7 A;  3OYG A;  3C4S A;  3FLG A;  5FRM A;  4OVA A;  3FDR A;  4IUV A;  5J39 A;  3OS2 A;  3L2R A;  4E7H A;  3GOX A;  3OYL A;  4CRI A;  4GY5 A;  2LTO A;  2X4W A;  2DIQ A;  4BD3 A;  3MEA A;  3PNW C;  4A4E A;  1OYX A;  4BAC A;  1N27 A;  3MEW A;  4QVZ A;  3MO8 A;  3OMC A;  3Q1J A;  4C5H A;  2NLU A;  5D6Y A;  3OYJ A;  4QQ6 A;  3OMG A;  4BDY A;  2HQX A;  4ZTF A;  2RHU A;  3BDL A;  1XNI A;  3QKJ A;  4FL6 A;  4PL6 A;  3SD4 A;  3L2Q A;  4QQG A;  3OYM A;  2DAQ A;  3DLM A;  3CEY A;  2X4X A;  4A4G A;  2PQW A;  5KH6 A;  2L89 A;  5D6W A;  5IN1 A;  5KCO A;  3LX7 A;  3OYN A;  4BDZ A;  5IAY A;  2RJC A;  3LLR A;  3MEV A;  4C5E A;  1G5V A;  4IUU A;  2GFA A;  3KUF A;  4ZTJ A;  4BE0 A;  3OYH A;  2RO0 A;  4UC4 A;  2QQR A;  4C5G A;  5KCH A;  2B8A A;  2EQM A;  2CKK A;  1H3Z A;  3OYF A;  2YRV A;  2EFI A;  2K3Y A;  3P8D A;  4QW2 A;  2G3R A;  3DB4 A;  3OY9 A;  4EDU A;  3OA6 A;  2R5A A;  2RI5 A;  3L2V A;  3OQ5 A;  3S3O A;  5KE2 A;  2RI3 A;  3MEU A;  2RHY A;  4IUR A;  2GFU A;  2LVM A;  2XK0 A;  4A4F A;  4C5I A;  2EKO A;  2RJE A;  1WJQ A;  2BUD A;  3H6Z A;  2RHZ A;  2R57 A;  3NTI A;  3PFS A;  4NS5 A;  5J26 A;  3OYK A;  3F70 A;  3MP8 A;  4Q5W A;  4A4H A;  4B9W A;  3QJ6 A;  3OB9 A;  3S6W A;  3OYI A;  3ZEH A;  3O8V A;  2IG0 A;  2JTF A;  2FHD A;  5C6S A;  2X4Y A;  4IUT A;  2BIV A;  2E5Q A;  3LH0 A;  4PLL A;  4X34 A;  4BE1 A;  4IUP A;  2M1H A;  4IUQ A;  2O4X A;  4QQD A;  3L2W A;  2EQK A;  3H8Z A;  4II1 A;  2R5M A;  1RI0 A;  2QQS A;  3QII A; 
#chains in the Genus database with same CATH topology
 1WJR A;  2RJF A;  2MOX A;  3L2Q A;  2EQU A;  5LJ5 d;  5IXB A;  4ZTJ A;  1WJS A;  2M16 A;  4E7L A;  2E6N A;  1EX4 A;  3GIB A;  2OTL Q;  1VQO T;  3VRY A;  1NYF A;  2COW A;  4QT7 A;  3JV3 A;  1MUZ A;  3QPH A;  4FSX A;  5IHK A;  1LJO A;  3LGF A;  2LX7 A;  1Z9Z A;  3CCS Q;  2FZC B;  1TUD A;  2L0A A;  2VGM A;  1GCQ A;  3CCL T;  3CBP A;  3VS2 A;  2A28 A;  1D3B B;  2DE0 X;  2NUP A;  2YLB A;  1QLY A;  2MI6 A;  3CME A;  1VQP Q;  1FXX A;  3RNJ A;  1H64 1;  3M4G A;  1KK7 A;  2V8J A;  4DEY A;  4KUI A;  4M78 B;  1X75 C;  1B3Q A;  5ECA A;  3C0C A;  1YJ9 Q;  5LJ5 j;  4C5H A;  5D6Y A;  1YFN A;  2DYB A;  1HYO A;  1QVP A;  2YRD A;  4QKU A;  3EFS A;  1HSQ A;  4M7D E;  2C0O A;  2DZ9 A;  2D6F A;  3G6E T;  4M7A B;  1QMC A;  2CP3 A;  2JVV A;  4A54 A;  2CSQ A;  2HMA A;  2JTE A;  2FO0 A;  4LUD A;  1H3Z A;  1QWE A;  1PSE A;  5IXF A;  2DJQ A;  3H0H A;  2M0Y A;  2FVU A;  3VRZ A;  3RIR A;  3SB2 A;  3CCQ T;  4NOY A;  2R57 A;  4OMN A;  3F70 A;  4WTO B;  1NEG A;  1YBY A;  2QAS A;  1V1C A;  1AZG B;  2JM9 A;  1X6O A;  2XI9 A;  5KYX B;  3H41 A;  3EFO B;  1KJW A;  4M77 E;  5GMK l;  3L2W A;  2R5M A;  4ANJ A;  2OTJ Q;  1ACM B;  1FMV A;  4E7J A;  3BFM A;  2RK1 A;  2LQ8 A;  2PVG B;  2VV5 A;  4XU3 A;  1MHN A;  1TUC A;  3PT9 A;  1M1F A;  3JRZ A;  5GAN d;  1K1Z A;  2QQ9 A;  5GAM d;  3OW2 A;  1S72 T;  4B9X A;  3VU3 C;  1XJW B;  1Q95 G;  4L6V 5;  1CKB A;  3X28 B;  1KG1 A;  3OBY A;  1WGS A;  4L5G A;  3JCM e;  1VQK T;  3HRS A;  1GRI A;  2HD0 A;  2IPO B;  4M78 E;  1Q7Y C;  1RUW A;  1VQ5 T;  2NUP B;  1AZE A;  4CRI A;  3VYG A;  1HD3 A;  1OYX A;  5FWC A;  5A0G A;  3HPW A;  2M9U A;  3I56 Q;  1VQL A;  3A8O B;  4BDY A;  3HHT B;  3CPW S;  1I5O B;  2EBP A;  4M7A E;  4E2F B;  2KMT A;  3A8G B;  1KD1 U;  2E70 A;  3RKY A;  1Y57 A;  5GAN j;  4MDX A;  3G71 Q;  2NYS A;  4E47 A;  1G3Y A;  2MK5 A;  4JLG A;  3OSS C;  2K4Y A;  2Y4Y A;  1VYV A;  1VQ6 A;  1M5Q 1;  1SF9 A;  2QYZ A;  2RI5 A;  1M1K C;  1FWZ A;  3VYH B;  3GBQ A;  2HL5 C;  4M75 G;  2DTI A;  3KBG A;  3M0U A;  2RJE A;  1PSF A;  2K5L A;  4JJN K;  4RTY A;  5AT1 B;  3S6W A;  4XTU A;  4RG8 A;  2EQI A;  1ZSG A;  3QSU A;  1Q82 U;  4AG2 C;  1MMG A;  1Z9Q A;  3GPL A;  5GAN 6;  1C6V X;  4LD6 A;  2O88 A;  2H3E B;  1AEY A;  1UJ0 A;  3VS5 A;  1M2O A;  1JO8 A;  2CP6 A;  4FU6 A;  3RBB B;  1MMN A;  4N4I A;  1I5L A;  3CCR Q;  3URG A;  1VQ8 A;  2E12 A;  5IH2 A;  3V8K A;  4VUB A;  5M9O A;  3G4S T;  1SHG A;  1YCY A;  3PIO A;  4XAX B;  2RHX A;  2EGA A;  2JZ2 A;  4E7I A;  4M75 A;  4KUL A;  1QP2 A;  1ZLM A;  2EJG A;  4M75 F;  1KC8 R;  3JB9 I;  4XU0 A;  1GBQ A;  3O5Z A;  3CCV T;  1K9M C;  3SFM A;  1K9A A;  1IRX A;  1KQS P;  3RDV A;  2YT6 A;  4KT0 E;  4XU2 A;  3TVT A;  3M5A A;  4M75 D;  3A8M B;  3EG0 A;  3VJP A;  2FPD A;  1G5V A;  1WX6 A;  4Y91 A;  2O31 A;  2WSC E;  4C5G A;  1M3A A;  2CKK A;  4BUG A;  1X43 A;  4CI0 C;  3JCM X;  2AT1 B;  2LX9 A;  3ZBD A;  4IUR A;  2JT4 A;  2JXB A;  5FW9 A;  4FW2 A;  3HSB A;  3JCM g;  2M51 A;  3O8V A;  3M0T A;  4J9I A;  3UA6 A;  3JB9 F;  3QJY A;  4PLL A;  3V7S A;  1YIT Q;  3H8Z A;  1VQM T;  1SEM A;  1VQP A;  1I4K 1;  5A0L A;  3CME Q;  1VOM A;  1X69 A;  2DO3 A;  2DTH A;  3NGP A;  2CYZ B;  1N9S A;  1X01 A;  3X25 B;  1YJ9 A;  1M9S A;  2CGH A;  4HT8 A;  3SEM A;  1B34 B;  4P5N A;  3GF5 A;  2LRQ A;  4HCZ A;  2DYI A;  3PMT A;  2KAF A;  5I22 A;  4BE2 A;  4A63 B;  2P0P A;  3CD6 A;  5HCK A;  4Z8A A;  5DY9 A;  1UE9 A;  2HSE B;  1FYN A;  2L3P A;  4N4G A;  4LE9 A;  4JJC A;  4DBQ A;  1ZSZ C;  4M75 B;  1G3W A;  2P0Q A;  1UGV A;  2QAZ A;  4AFU C;  2RPN A;  4DOV A;  5J39 A;  3OS2 A;  2RF0 A;  1OPL A;  2OTL T;  3JCM P;  4JRK A;  4NL2 A;  1BK2 A;  2EJ9 A;  2K2V A;  2LP5 A;  3OMC A;  5GMK m;  1U5S A;  4PL6 A;  1E7O A;  2D0Q B;  3CCS T;  2E3I A;  2X4X A;  5CVI A;  1KFZ A;  4KRT A;  2MIO A;  1NYG A;  1YWP A;  2DIL A;  3VS4 A;  1VQ7 A;  1GFD A;  2E65 A;  4E6R A;  1RAH B;  3HL8 A;  2A7Y A;  3NFC A;  3CCM T;  1K73 U;  2G3R A;  2ZPF B;  3OQ5 A;  5KYU A;  2KVQ G;  3MEU A;  1ZX6 A;  1WPY A;  1OU8 A;  2ZCF B;  5IHN A;  3M0R A;  4BB7 A;  4M7D A;  2GTJ A;  3EH1 A;  3ER0 A;  3OYK A;  3PTA A;  1BB9 A;  1WHH A;  4B9W A;  4EMG A;  6AT1 B;  2JN0 A;  2BE7 D;  2BIV A;  3GP8 A;  3QDR B;  2EQK A;  1VQ4 Q;  4LD9 K;  3I5R A;  2R58 A;  3X26 B;  2P84 A;  2VUB A;  3E9G A;  2J6K A;  4DBH A;  1QVF A;  5I11 A;  2MCN A;  1O75 A;  2K3X A;  1RAG B;  1ZA1 B;  2RHI A;  1KD1 R;  1VQL Q;  2O9S A;  4BI3 A;  1YCS B;  2C0I A;  4M77 A;  1MNE A;  4E7Z A;  2RN8 A;  4GBQ A;  1QW1 A;  1XQH A;  2KRM A;  2I0N A;  2GBQ A;  4HCB A;  4RKU E;  3JCM W;  2P0K A;  2KSS A;  4D8D A;  4HXJ A;  4M75 E;  4R55 A;  1LPL A;  1IGQ A;  2LQW A;  1OEB A;  2OTJ T;  1W2B A;  2QTX A;  5FRM A;  2SEM A;  1R0B G;  1YI2 T;  2CP2 A;  2ABL A;  3GOX A;  1RLQ C;  4PJO C;  2LCL A;  2X4W A;  1KIK A;  2QK0 A;  3MEA A;  4BD3 A;  3CBO A;  2EIF A;  3WVD B;  5GAN 5;  1D3B A;  1Q82 R;  2KYM A;  1KD1 C;  2JUF A;  3OYJ A;  3CBM A;  3GNF B;  1M4Z A;  2V8I A;  1W70 A;  5CKE A;  2JNG A;  2ROL A;  3DLM A;  5LJ3 d;  4FT2 A;  5KH6 A;  5GMK j;  1RLP C;  4MML A;  4IUU A;  4J9E A;  4RCB A;  2CZ6 B;  3PVQ A;  4FCY A;  5LJ5 h;  2YRV A;  3E19 A;  3CCR A;  3EFR A;  3RER A;  1VQ8 Q;  2KK4 A;  4AT1 B;  3RMS A;  3H0I A;  2QDY B;  2ECZ A;  2RHZ A;  4KH0 B;  5J26 A;  5KYU B;  4J7I A;  1VQO A;  1UGQ B;  1UEB A;  2FHD A;  1YIJ Q;  4IUT A;  1OX9 A;  4QQD A;  2HKN A;  2K3B A;  1IXD A;  1IO6 A;  2A0F B;  3LWI A;  2LMJ A;  3G71 T;  2RMO A;  3CCL A;  5FWB A;  4N4H A;  2KNB B;  4N0A A;  5KE3 A;  1I0C A;  2WAC A;  3QHS A;  3AT1 B;  4B6M A;  3R6O A;  2ZPG B;  4J9D A;  1YHQ Q;  1WHM A;  3FC3 A;  1BI3 A;  1VQ9 Q;  4C0G A;  2EYY A;  2XD0 A;  4XTV A;  3UT1 A;  1YJN Q;  3L42 A;  1Q81 C;  2CP7 A;  3KFV A;  4C8Q C;  1JXM A;  2K2M A;  3DLL A;  3DB3 A;  3M0Q A;  2RJD A;  4M77 B;  1TG0 A;  2LJ1 A;  1VIE A;  4OB3 B;  3HFN A;  2MWO A;  2CP5 A;  2CT4 A;  3MHX A;  1OX8 A;  1X6G A;  1ZUY A;  5LJ5 f;  4C92 C;  3DKM A;  3UA7 A;  1OZ2 A;  3LYI A;  5GAO r;  4DA4 A;  3OYL A;  3KXT A;  2AHJ B;  1EZZ B;  2YUP A;  2BE9 B;  3FJP A;  4XK8 E;  4J9B A;  1UTI A;  2QQA A;  3REB B;  3A8L B;  2K57 A;  2B86 A;  5I2S A;  5IHI A;  4LXC A;  2HL3 A;  4FL6 A;  2ZZD A;  1YIT A;  1RL2 A;  4OP0 A;  4OMO A;  4A4G A;  2E4H A;  1UG1 A;  7AT1 B;  3VS1 A;  4BDZ A;  2RJC A;  1TTH B;  3BE3 A;  3JCM J;  5KCH A;  1QVG A;  2GCX A;  3CXC A;  2CH4 A;  2HBP A;  3LW5 E;  1M8M A;  3L2V A;  4J7F A;  1WHG A;  2DL4 A;  3QO3 A;  3TRE A;  3IQL A;  1WYX A;  2H8H A;  2W10 A;  2CP0 A;  1EFN A;  2D8J A;  5GAN h;  2BUD A;  1U1S A;  5FU7 B;  5GAM h;  4GLM A;  2X4J A;  5L23 A;  2COY A;  3SWN C;  4HVV A;  1K0S A;  1S72 A;  2X4Y A;  2VAS A;  3CD6 Q;  4IUQ A;  4BY6 C;  1RAE B;  4HA8 A;  3CC7 T;  4JS4 A;  3QYG B;  2KGT A;  2KI7 A;  1QCO A;  3QII A;  2KRO A;  5DM7 R;  1SPK A;  3JCM d;  1NEB A;  1JJ2 S;  1NLO C;  2XDD A;  4MZM A;  4JS5 A;  1QCN A;  1ZHI A;  4IKF A;  1BCO A;  1NPR A;  3FB9 A;  2DJZ A;  3TEE A;  4EMK C;  3S3M A;  1JQQ A;  2EGC A;  1HJD A;  4AFS C;  4Y92 A;  3HKS A;  1VQ7 Q;  4LDU A;  1K73 R;  2IVW A;  1Y07 A;  2WSE E;  1UDL A;  3TQ7 P;  3E1S A;  3CME T;  1QP3 A;  3OYE A;  3CC4 T;  4FSS A;  3S3N A;  2YXY A;  1NPP A;  2KRN A;  3CMA T;  2O2O A;  5GAM f;  2I2L A;  3HP9 A;  4F7U G;  2RQR A;  2V1R A;  4QQ6 A;  1Y96 A;  1VA7 A;  2QDL A;  2FG0 A;  4ZN1 A;  4JJD A;  5GAN 8;  4PFZ A;  1RAF B;  2HNI A;  3JCM c;  1VQ4 A;  2LNV A;  1K73 C;  4X9C A;  1D09 B;  1E6G A;  1UEC A;  2RO0 A;  4XTX A;  2HBW A;  4Y28 E;  3BY7 A;  1MV0 B;  3M0P A;  2QA4 Q;  3QG1 A;  2OAU A;  3RMQ A;  5KE2 A;  4PJO G;  2EYX A;  3U23 A;  2RHY A;  1WNL A;  2EW3 A;  2DNU A;  4C5I A;  4ZGE B;  1NJI U;  1M3B A;  2EKO A;  2EJF A;  1YN8 A;  2GNC A;  3NTI A;  2LJ0 A;  3PFS A;  4NS5 A;  4DBF A;  3EG9 A;  2COZ A;  4AFZ C;  4KH1 B;  5C6S A;  3M0S A;  2XMF A;  4JRP A;  2MMP A;  1T3L A;  1RI0 A;  8AT1 B;  2X3X D;  2JS2 A;  1M30 A;  4F7U F;  1O9S A;  1S1N A;  3E9F A;  3PMI A;  1K8A U;  3I55 A;  1MGQ A;  2LDM A;  4XU1 A;  1PD1 A;  4D8K A;  3HRT A;  2X3W D;  2DL3 A;  1SSF A;  2NUZ A;  1SRL A;  1AWJ A;  3OYB A;  3UDC A;  2RQV A;  5KYW B;  4PKC C;  3EAE A;  5CKB A;  2GQI A;  4C0F A;  4PJO F;  2CSI A;  5C0M A;  1N8R R;  4LDY A;  3OS1 A;  1KSW A;  3OS5 A;  1B34 A;  2OAW A;  2V8K A;  3I9Q A;  2X35 A;  2ROT A;  3L2R A;  2D0N A;  3EG3 A;  2W0Z A;  3A5Z B;  2IIM A;  3M57 A;  4BAC A;  1KQ1 A;  2L3S A;  2A36 A;  1VQO Q;  2BZ8 A;  2LQK A;  2RHU A;  1YIJ A;  1WIE A;  4C8Q G;  4PJO D;  2DAQ A;  1X27 A;  2FEI A;  2PQW A;  4OF1 A;  1Y96 B;  1GBR A;  1P92 A;  2J6O A;  3CCL Q;  4QVD A;  4C92 G;  3C95 A;  1YHQ A;  4LN2 A;  3HRU A;  1VQ9 A;  1VQ6 T;  3P8D A;  3TSW A;  2HZY A;  2YUO A;  3J80 E;  2DVE A;  2GFU A;  1YJN A;  4PFO A;  4WF2 A;  3H6Z A;  2E5K A;  4CC2 A;  4Q5W A;  1PRL C;  2HKQ B;  3ZEH A;  9ATC B;  1UHF A;  1HXD A;  2KXD A;  2MF2 A;  2KXC A;  2DXC A;  3CCJ A;  3EG9 B;  4II1 A;  2HAX A;  4KBM B;  1ZQ1 A;  1TOV A;  4QVC A;  3V7C A;  1KC8 C;  1C1A A;  5CO7 A;  3FEO A;  4C8Q A;  1HK9 A;  3ASK A;  1SHF A;  4F7U B;  4C8Q F;  1G2B A;  2EVR A;  2FYK A;  5D6X A;  1FMW A;  3UF4 A;  1VQ8 T;  3PVL A;  3QBY A;  3VUB A;  3WVE B;  5FRO A;  2SRC A;  2CZ1 B;  4C92 F;  3CCQ Q;  4PJJ A;  2QEX T;  1VIF A;  1LNX A;  2XDB A;  4XTZ A;  4PK4 A;  4E7S A;  2RB6 A;  4FT4 A;  2M02 A;  2ZPI B;  4PJO B;  8ATC B;  2VYT A;  4C8Q D;  3NTK A;  5HK3 A;  5CIU A;  1TWB A;  3A1P A;  4CC4 B;  2XU8 A;  3FDR A;  4Z89 A;  5FU6 B;  3CC2 A;  3D7S B;  3RKW A;  3PNW C;  3UAT A;  4C92 D;  3MO8 A;  3Q1J A;  4ZTF A;  2LC4 A;  2KQW A;  3VS7 A;  4OGE A;  3VKI A;  2ESW A;  1DJ7 B;  3FIF A;  1S72 Q;  1VQN A;  1PC0 A;  4YTL A;  4OMM A;  2XIC A;  1OQK A;  4OGC A;  1V29 B;  4C0D C;  1Q86 R;  1U1T A;  4J83 A;  3LWH A;  3CCU A;  3H9N A;  2QQR A;  3SWN A;  5I21 A;  2EGE A;  2FZK B;  5GAM g;  1IHW A;  1N6A A;  1KQS A;  2R5A A;  3LH5 A;  2F69 A;  1NBE B;  4FW1 A;  3MPU B;  4HT9 A;  3EGD B;  5GMK h;  3SDZ A;  1JJ2 P;  3RES A;  3MP8 A;  4A4H A;  3QJ6 A;  1NLP C;  1WQ7 A;  3M58 A;  1MMD A;  2E5Q A;  2K5F A;  3M54 A;  4IUP A;  3JAM E;  5KYN A;  1VQP T;  2ZGW A;  3HFO A;  1M27 C;  1U3O A;  4KGZ B;  1G3T A;  1M8V A;  1TSF A;  4F7U E;  3CCE A;  1D0Y A;  2F5K A;  2RM4 A;  1YJ9 T;  5CAI A;  4E7K A;  4C8Q B;  2HDA A;  1TXQ A;  1SRM A;  4KGV B;  3INZ A;  1YI2 A;  2DRM A;  2D1X A;  3MP6 A;  3L2Z A;  3MJX A;  4RTT A;  2E1H A;  2NUT A;  2LT4 A;  2BZX A;  3PIP A;  2EWN A;  2BKD N;  1OU9 A;  5LJ3 h;  4PJO E;  3CD6 T;  1W6X A;  3BDU A;  3TSZ A;  3M9Q A;  4IIM A;  1NJI R;  3G1J A;  1AWW A;  1OUL A;  2QA4 A;  2F2W A;  2AIR B;  5EC7 A;  1RAD B;  2MYS A;  2ENM A;  4C0Z A;  2DD5 A;  3WXM B;  4QVZ A;  4OB0 B;  2NLU A;  3THK A;  2DTO A;  3OMG A;  4PFP A;  3G4S Q;  2JJ9 A;  3EHR A;  2KDS A;  3CEY A;  4J5Y A;  1K8A R;  2YRC A;  5CR2 A;  1CKA A;  2QGG A;  1MV3 A;  2Y90 A;  2EPD A;  2HEQ A;  3I55 Q;  2JMC A;  1YJW A;  4X1V A;  4QW2 A;  2F2X A;  3OA6 A;  2XG8 D;  3AHU A;  1UHC A;  1X6B A;  2V26 A;  3SWN B;  5GAN 2;  2YSQ A;  4M7A G;  4A4F A;  1AWO A;  2E6Z A;  4BY6 B;  3CCV Q;  4HCK A;  2DA9 A;  2IG0 A;  5LJ3 f;  1QKX A;  3ULR B;  1SSH A;  3M59 A;  1D1C A;  1MND A;  1PG5 B;  3E2U A;  2L2P A;  2CZ0 B;  5CK9 A;  4JRI A;  3ZFJ A;  2J6F A;  2FRY A;  2DMO A;  3UPU A;  1N8R U;  2P4T A;  1K76 A;  1BU1 A;  4DEX A;  4WCI A;  4EMK B;  4C8Q E;  1H92 A;  4A53 A;  3I56 T;  1Q82 C;  3GNG A;  4ESR A;  4J9G A;  2YWW A;  1ZA2 B;  3VUZ A;  1BI2 A;  3MET A;  4L59 A;  3VS3 A;  4C92 E;  2RQU A;  3OYD A;  2KBT A;  1RAC B;  4CC3 A;  3REA B;  5FLX E;  2CUD A;  1OI1 A;  2NUT B;  1H3H A;  3M55 A;  2GTO A;  1K9M U;  4AMC A;  1VYT A;  2PVD B;  2DIG A;  2CDT A;  3EHQ A;  4E7H A;  2DLP A;  5CQX A;  3JB9 H;  1M3C A;  2WSF E;  4GY5 A;  4HKE A;  3EGU A;  1AOJ A;  3FRN A;  1BYM A;  3MEW A;  3VS6 A;  5GAO l;  3CPW A;  1PRM C;  5CKD A;  2PU9 B;  4ELZ C;  1XNI A;  2YUQ A;  1OOT A;  2QGF B;  3CCJ Q;  4M7A D;  4XTW A;  4JUV A;  2ZPB B;  5CKF A;  3G6E A;  4ME7 A;  4X9D A;  3OSV A;  2QTV A;  5GJW B;  3CC7 A;  3JCM h;  3J81 E;  3CCR T;  1PD0 A;  1AD5 A;  4A4K A;  2JS0 A;  1CSK A;  1UGP B;  1U06 A;  1WA7 A;  2RH2 A;  2LQN A;  3CCQ A;  1W4S A;  4FIB A;  2FB7 A;  1I8F A;  2CT3 A;  1ZBJ A;  2ZPE B;  2BTT A;  2M1H A;  4O6J A;  2O4X A;  3EG1 A;  3OW2 P;  4DBR A;  5D7U A;  4OMF B;  4EIK A;  1MMA A;  2CH4 W;  1QVF S;  3CC2 Q;  3CCM Q;  2AK5 A;  1RAA B;  4PJL A;  4JRQ A;  2A3L A;  3CC4 A;  4BI4 A;  1I81 A;  3CMA A;  1M2V A;  2E3H A;  3JCM b;  4MMK A;  3L1A A;  1PKS A;  3I35 A;  1VQN Q;  4ZGD B;  1QQJ A;  2K7A A;  2DXU A;  4ATO A;  2DXT A;  1GL5 A;  5LJ5 e;  3CCU Q;  2VVK A;  1VQK A;  1ABQ A;  2DVJ A;  4NL3 A;  1W2B S;  3JCM f;  1AT1 B;  4PNO A;  1Q86 U;  1A0N B;  4M4Z A;  2DFU A;  2D8H A;  3FLG A;  5KYW A;  1BKB A;  1VQ5 A;  1ZSZ A;  2NWM A;  4RTU A;  1WZO A;  3TCJ A;  2GGR A;  2RNA A;  1SKU B;  1G8X A;  2A37 A;  2L3Q A;  4FM4 B;  5GAO n;  4JZ3 A;  1TUG B;  4OMP A;  2VB6 A;  1PCX A;  4JJB A;  1WQW A;  4LDV A;  2JTM A;  2HQX A;  2DL7 A;  2ED0 A;  1TS9 A;  1YIT T;  3QDF A;  4MZP A;  2ED1 A;  1XTD A;  5HK0 A;  2KRS A;  4J9H A;  2L89 A;  3M4Y A;  1WI7 A;  1WHL A;  2A08 A;  3OYN A;  1W1F A;  1R77 A;  3KUF A;  4PJM A;  3CCE Q;  1YWO A;  2RQT A;  5L8R E;  2K3Y A;  2GQV A;  2X9H A;  5GAN f;  4M7D C;  4HVW A;  1T0J A;  2VXE A;  1Q7Y R;  3EGX B;  1BIB A;  1NZ9 A;  1YI2 Q;  2XHC A;  2KT1 A;  2DF6 A;  4K11 A;  2O01 E;  2HQH A;  1PNJ A;  2LCS A;  2AKL A;  1E6H A;  4JDS A;  4GLK A;  4DOW A;  4BE1 A;  1U8R A;  1D0X A;  2K6D A;  1KHC A;  2O4X B;  1RAI B;  2D9T A;  3PGG A;  1J3T A;  2VGN A;  4M77 C;  4OML A;  2DZC A;  1M1K R;  5LJ3 g;  1ARK A;  2DBK A;  5HKC A;  2DM1 A;  3QZ5 B;  5IT9 E;  3P8H A;  3G4S A;  1RAB B;  1NM7 A;  4J8O A;  5FRN A;  4J9F A;  3ZL7 C;  1R0C B;  4F7U A;  1M2V B;  1QCF A;  2FZG B;  3JCM Q;  1UUE A;  3C12 A;  5GAO q;  1UGS B;  3PE0 A;  4RG2 A;  4RTX A;  2LCC A;  1IRE B;  2DPP B;  2F2V A;  2RI2 A;  1YJW Q;  2K9G A;  5GAM j;  1LOJ A;  2C0T A;  4OVA A;  4J9C A;  5GAN e;  1GCP A;  1T3S A;  2LTO A;  5GAM e;  1M90 U;  2FPF A;  3CCV A;  5CKH A;  5A2Q E;  4PJO A;  1BBZ A;  1ZSZ B;  2OX7 A;  2E41 A;  2LNH B;  4M78 C;  2RQW A;  1AHJ B;  4C0D B;  5LL6 S;  1VQ4 T;  1JRI A;  1M1G A;  2VXF A;  2VKN A;  2F1L A;  2PUO B;  1OPK A;  1FX7 A;  2EAY A;  3MEV A;  4KGX B;  5FU7 C;  4KUD K;  1QVG S;  1JXO A;  3CXC S;  2XKO C;  1V76 A;  2EFI A;  3MCA B;  4M7A C;  3OY9 A;  1VQL T;  4O5V A;  4FYV B;  3EG2 A;  2EYW A;  5I2M A;  5GAN 4;  5LJ5 g;  1K9M R;  4PJN A;  3V8L A;  3BW1 A;  1R8O B;  2EYZ A;  2DL5 A;  4CC7 A;  3CPF A;  1N8R C;  1WXT A;  2J7I A;  1YNZ A;  4N0A C;  1YP5 A;  1AWX A;  4JZ4 A;  1VQM A;  3HTR A;  1X2K A;  2QEX A;  3EGD A;  3X24 B;  1Q81 U;  3VV0 A;  3LGL A;  4IIO A;  1BI1 A;  3I55 T;  1JBM A;  4J6X A;  1N5Z A;  5GAO m;  5CQY A;  2M0O A;  2G6F X;  5CCA A;  3A98 A;  3JB9 G;  3NTH A;  2EQJ A;  2YDL A;  3N5B B;  3ME9 A;  3MP1 A;  1K0X A;  2DET A;  1ZUK A;  2HSP A;  5DLQ E;  2AZS A;  2Y4X A;  1GXI E;  1WDX A;  4V2S A;  2FL7 A;  2HQE A;  3UWN A;  3OYY A;  1B07 A;  2JMA A;  2AZV A;  3G6E Q;  1D1B A;  3SHW A;  2O9V A;  2L8D A;  2E10 A;  3CC7 Q;  4RUG A;  5GAN 3;  3M56 A;  1PHT A;  4IUV A;  4C92 A;  3QWX X;  3OW2 S;  1GCQ C;  4A4E A;  2OTL A;  3M53 A;  2J05 A;  2RK2 A;  5KYY A;  1YIJ T;  3BDL A;  2PTK A;  2K5I A;  4ELY C;  3CCS A;  4AG1 C;  3G7Z A;  5IN1 A;  5KCO A;  3LX7 A;  2JM8 A;  1AVZ C;  1T0H A;  3LLR A;  2DEU A;  5AYF A;  2GFA A;  3OYH A;  4OB2 B;  4UC4 A;  1YHQ T;  2RD1 A;  2KEA A;  1VQ9 T;  5A0D A;  2K79 A;  3CCM A;  2MPX C;  5GAN 7;  1B7T A;  3DB4 A;  1ZBX A;  4HCC A;  2RI3 A;  3C94 A;  3CC4 Q;  1YJN T;  2XK0 A;  1I07 A;  3CMA Q;  5HY6 A;  1NE8 A;  1QVF P;  4EMH A;  2PNI A;  2JTF A;  3JB9 D;  3LH0 A;  3CCJ T;  5GAN g;  3J7A F;  5DLO A;  1VQK Q;  2HCK A;  4LNP A;  1WHJ A;  1ABO A;  2MWP A;  3L2U A;  2QG9 B;  2V1Q A;  1G83 A;  4RTZ A;  1VQ5 Q;  1IGU A;  3H0F A;  4M7D G;  4JPB W;  2OJ2 A;  2AKK A;  4OMQ A;  2XID A;  1VUB A;  1W2B P;  4Z88 A;  1C0M A;  2ZAE A;  2QI2 A;  2E64 A;  4EMK A;  4MDW A;  2Z0W A;  4Z02 A;  3QXE B;  2DKG A;  1OZ3 A;  2YLC A;  1Q86 C;  1KHI A;  4DQ2 A;  2L5Q A;  1F1B B;  2OTJ A;  3QUI A;  1BIA A;  3TU4 K;  2CS7 A;  2DXB A;  2GF7 A;  4D6W A;  2VWF A;  3CC2 T;  4M77 G;  1IHV A;  2JW4 A;  1Q7Y U;  4BI8 B;  2JOY A;  4C92 B;  1H8K A;  1QWF A;  2P4R A;  3QKJ A;  3RUX A;  4TVR A;  1VQN T;  1XOV A;  1NG2 A;  4QQG A;  3OYM A;  3QZ9 B;  5J3B A;  1OV3 A;  4HVU A;  4M7D F;  1ZUU A;  5D6W A;  1WXU A;  5KYY B;  1G3S A;  2DRK A;  4RTW A;  1UB4 A;  2C06 A;  1WLP B;  2VC8 A;  3CCU T;  2B8A A;  2EQM A;  1UFF A;  2DEQ A;  1UGR B;  1TH7 A;  2X51 A;  1Y0M A;  2CUB A;  3V7R A;  2DX1 A;  3I5S A;  2LVM A;  5GMK i;  3MKD A;  1WJQ A;  3NMZ C;  2LT1 A;  3I56 A;  2DBM A;  1M1K U;  2KT8 A;  4M78 G;  4M7D D;  1VQ7 T;  1VYU A;  2DL8 A;  2ATC B;  1Y7X A;  2F5T X;  5GAO p;  3JB9 J;  4XTY A;  4ORZ A;  3X20 B;  4X34 A;  3T9N A;  2RA2 A;  4M77 F;  4J6W A;  1NJI C;  2KR3 A;  2QQS A;  3G71 A;  1M90 R;  3RKX A;  1IB8 A;  3OS0 A;  3OYC A;  1JJ2 A;  3CCE T;  2DK3 A;  2MAM A;  4F17 A;  2XDP A;  3CPW P;  1JU5 C;  4LUE A;  3CQT A;  3P8B B;  1VQ6 Q;  1Y71 A;  4FYW B;  4PLI A;  1GFC A;  1BI0 A;  2FPE A;  4ZGJ B;  2DD4 A;  3OYA A;  4LDX A;  3QWY A;  1IZ6 A;  3NPF A;  2KY9 A;  4AFQ C;  1K8A C;  3JCM V;  4M77 D;  1KQ2 A;  1D0Z A;  2PVO B;  5FU6 C;  3JSC A;  4MZT A;  1PKT A;  4R56 A;  5GJV B;  1SG5 A;  2L3R A;  4M78 A;  2YUN A;  2QXF A;  2QA4 T;  2OI3 A;  2DER A;  1WXB A;  1M90 C;  5EG2 A;  4J6Y A;  3VS0 A;  4LDW A;  1UJY A;  1FMK A;  4M78 F;  3OYG A;  3R6N A;  3C4S A;  3OBW A;  1N9R A;  2H3J A;  1TU0 B;  2PUK B;  1QKW A;  5GMK e;  2DIQ A;  3EH2 A;  4M75 C;  1N27 A;  1I1J A;  4RMO A;  1JEG A;  1QVG P;  3CXC P;  1BCM A;  4M7A A;  3NHN A;  3SD4 A;  1Q81 R;  2PZ1 A;  1X2Q A;  4EPC A;  4M7A F;  4F16 A;  4FYY B;  4RTV A;  4XQ3 A;  1VQM Q;  2EKH A;  3FJ5 A;  5IAY A;  2QEX Q;  4ZNX A;  2EYQ A;  4C5E A;  4M7D B;  4OB1 B;  1K4U S;  4BE0 A;  4RCC A;  4M78 D;  2CRE A;  2LJ3 A;  3A8H B;  1YJW T;  2QQB A;  3OYF A;  1WFW A;  4EDU A;  2KYB A;  2LZ6 B;  1WHK A;  1KQS S;  1LCK A;  3S3O A;  3V8J A;  2J06 A;  1PM3 A;  4FYX B;  1D1A A;  5LJ3 j;  2YHT A;  4ZN3 A;  1RI9 A;  3GLX A;  1JB0 E;  1KC8 U;  4R0K A;  1PWT A;  5KYX A;  3EFO A;  3OB9 A;  5LJ3 e;  3QYH B;  3OYI A;  2KE9 A;  1EIF A;  2CZ7 B;  4JLI A;  2BZY A;  4F04 B;  3EGX A;  2ZPH B;  1LVK A;  3RR6 A;  4F14 A;  2FRW A; 
#chains in the Genus database with same CATH homology
 1WJR A;  2R58 A;  2RJF A;  3X26 B;  1KC8 C;  3L2Q A;  1KHC A;  2EQU A;  5LJ5 d;  2VUB A;  5CO7 A;  3FEO A;  3E9G A;  4ZTJ A;  4C8Q A;  1HK9 A;  1WJS A;  2O4X B;  2M16 A;  3ASK A;  4E7L A;  1QVF A;  2E6N A;  2D9T A;  3PGG A;  3GIB A;  4F7U B;  1O75 A;  4C8Q F;  2VGN A;  2K3X A;  2FYK A;  5D6X A;  4M77 C;  1VQO T;  2RHI A;  1VQ8 T;  2DZC A;  3QBY A;  5LJ3 g;  5HKC A;  4BI3 A;  3QZ5 B;  3VUB A;  5IT9 E;  3P8H A;  4FSX A;  3QPH A;  4M77 A;  3WVE B;  3G4S A;  1LJO A;  5FRO A;  3LGF A;  4J8O A;  2CZ1 B;  4C92 F;  1QW1 A;  1XQH A;  5FRN A;  4HCB A;  4RKU E;  2QEX T;  3JCM W;  4F7U A;  2P0K A;  1VIF A;  1LNX A;  2KSS A;  2VGM A;  3CCL T;  2XDB A;  3JCM Q;  4XTZ A;  3C12 A;  3CBP A;  1UGS B;  5GAO q;  1D3B B;  4RG2 A;  2RB6 A;  4FT4 A;  4M75 E;  4R55 A;  2LCC A;  2ZPI B;  1IRE B;  4PJO B;  2YLB A;  2DPP B;  2MI6 A;  2RI2 A;  2VYT A;  4C8Q D;  3CME A;  1W2B A;  1FXX A;  3NTK A;  2OTJ T;  5HK3 A;  5GAM j;  2QTX A;  5CIU A;  1LOJ A;  1H64 1;  3M4G A;  5FRM A;  4OVA A;  2XU8 A;  3FDR A;  2V8J A;  1YI2 T;  4KUI A;  3GOX A;  5GAN e;  5FU6 B;  4M78 B;  4PJO C;  1X75 C;  2LCL A;  2LTO A;  2X4W A;  5GAM e;  3CC2 A;  3RKW A;  4BD3 A;  3MEA A;  3PNW C;  3CBO A;  1M90 U;  2EIF A;  3WVD B;  5GAN 5;  1D3B A;  5CKH A;  3CCV A;  4C92 D;  3MO8 A;  2JUF A;  5LJ5 j;  1KD1 C;  3Q1J A;  4C5H A;  5A2Q E;  5D6Y A;  3CBM A;  3OYJ A;  3GNF B;  1M4Z A;  4PJO A;  2V8I A;  2E41 A;  4ZTF A;  2LC4 A;  4M78 C;  5CKE A;  1AHJ B;  1QVP A;  2KQW A;  4OGE A;  2JNG A;  3VKI A;  4C0D B;  1DJ7 B;  3FIF A;  3EFS A;  5LL6 S;  1VQ4 T;  1VQN A;  3DLM A;  1JRI A;  1M1G A;  4M7D E;  5LJ3 d;  2VXF A;  4YTL A;  4FT2 A;  5KH6 A;  2PUO B;  2DZ9 A;  1FX7 A;  2XIC A;  2EAY A;  5GMK j;  2D6F A;  3G6E T;  4M7A B;  3MEV A;  4MML A;  4OGC A;  1V29 B;  4IUU A;  4C0D C;  1U1T A;  2JVV A;  4J83 A;  4A54 A;  4RCB A;  3LWH A;  2CZ6 B;  5FU7 C;  3CCU A;  4KUD K;  2QQR A;  5LJ5 h;  3SWN A;  1QVG S;  1H3Z A;  3CXC S;  5I21 A;  2XKO C;  2EFI A;  2YRV A;  5GAM g;  3MCA B;  1N6A A;  1PSE A;  4M7A C;  3OY9 A;  1KQS A;  2R5A A;  3E19 A;  1VQL T;  4O5V A;  3CCR A;  3EFR A;  3RER A;  2KK4 A;  2F69 A;  3RMS A;  2FVU A;  2QDY B;  3RIR A;  5I2M A;  5GAN 4;  4HT9 A;  3SB2 A;  5GMK h;  2RHZ A;  4NOY A;  2R57 A;  3CCQ T;  3SDZ A;  5LJ5 g;  5J26 A;  4J7I A;  3RES A;  3BW1 A;  3F70 A;  3MP8 A;  3V8L A;  4A4H A;  1VQO A;  1UGQ B;  3QJ6 A;  1R8O B;  1WQ7 A;  1UEB A;  3M58 A;  1YBY A;  2FHD A;  3CPF A;  4IUT A;  2E5Q A;  1X6O A;  1N8R C;  2XI9 A;  2K5F A;  3M54 A;  4IUP A;  4QQD A;  4N0A C;  4M77 E;  5GMK l;  3JAM E;  3L2W A;  1VQP T;  2ZGW A;  2R5M A;  1VQM A;  3HFO A;  3LWI A;  3G71 T;  2QEX A;  1G3T A;  1M8V A;  3CCL A;  3X24 B;  1Q81 U;  4N4H A;  3VV0 A;  3LGL A;  4F7U E;  4N0A A;  5KE3 A;  2WAC A;  3QHS A;  4E7J A;  3BFM A;  2RK1 A;  3CCE A;  1BI1 A;  2F5K A;  3I55 T;  1JBM A;  3R6O A;  2LQ8 A;  2PVG B;  2ZPG B;  4J6X A;  2VV5 A;  3FC3 A;  5GAO m;  2RM4 A;  1YJ9 T;  1BI3 A;  4XU3 A;  5CQY A;  4C0G A;  2M0O A;  5CAI A;  5CCA A;  4E7K A;  1MHN A;  3PT9 A;  4C8Q B;  3NTH A;  1M1F A;  3JB9 G;  2EQJ A;  2XD0 A;  3N5B B;  3JRZ A;  5GAN d;  3ME9 A;  3MP1 A;  4XTV A;  2QQ9 A;  3INZ A;  5GAM d;  1YI2 A;  3MP6 A;  3L2Z A;  3UT1 A;  3L42 A;  3OW2 A;  1S72 T;  1Q81 C;  4B9X A;  5DLQ E;  2Y4X A;  3VU3 C;  2E1H A;  2LT4 A;  1GXI E;  4V2S A;  2FL7 A;  4C8Q C;  2HQE A;  3PIP A;  3UWN A;  2EWN A;  3DLL A;  2BKD N;  3DB3 A;  3OYY A;  4L6V 5;  2RJD A;  5LJ3 h;  3X28 B;  4M77 B;  4PJO E;  1KG1 A;  3CD6 T;  1VIE A;  3BDU A;  4OB3 B;  3HFN A;  3OBY A;  2MWO A;  3MHX A;  1WGS A;  3M9Q A;  4L5G A;  3JCM e;  2L8D A;  1VQK T;  2E10 A;  3HRS A;  5LJ5 f;  4C92 C;  3DKM A;  5GAN 3;  2HD0 A;  1OZ2 A;  3LYI A;  2QA4 A;  5GAO r;  4M78 E;  3M56 A;  1Q7Y C;  1VQ5 T;  4IUV A;  4DA4 A;  4C92 A;  3OYL A;  4CRI A;  2AHJ B;  3KXT A;  3VYG A;  3OW2 S;  3FJP A;  4XK8 E;  4C0Z A;  4A4E A;  2OTL A;  1OYX A;  2DD5 A;  2QQA A;  3WXM B;  5A0G A;  3A8L B;  2K57 A;  3HPW A;  3M53 A;  4QVZ A;  4OB0 B;  2M9U A;  1VQL A;  2RK2 A;  2NLU A;  2DTO A;  3A8O B;  3OMG A;  5I2S A;  4BDY A;  3HHT B;  3CPW S;  1YIJ T;  3BDL A;  2K5I A;  4FL6 A;  4ELY C;  2ZZD A;  1YIT A;  3CCS A;  4M7A E;  2KDS A;  2KMT A;  3CEY A;  1RL2 A;  3A8G B;  4J5Y A;  4OP0 A;  4A4G A;  2E70 A;  1KD1 U;  3G7Z A;  3RKY A;  5IN1 A;  5KCO A;  5CR2 A;  3LX7 A;  5GAN j;  4MDX A;  4BDZ A;  2RJC A;  3LLR A;  5AYF A;  2GFA A;  4E47 A;  3OYH A;  1G3Y A;  4OB2 B;  3JCM J;  4UC4 A;  2Y90 A;  4JLG A;  1YHQ T;  3OSS C;  2K4Y A;  2RD1 A;  2Y4Y A;  5KCH A;  1QVG A;  2GCX A;  3CXC A;  2HBP A;  1VQ9 T;  5A0D A;  3CCM A;  1YJW A;  3LW5 E;  4QW2 A;  5GAN 7;  1VQ6 A;  3DB4 A;  3L2V A;  3OA6 A;  1M5Q 1;  4J7F A;  2RI5 A;  1ZBX A;  2XG8 D;  3QO3 A;  3AHU A;  3TRE A;  2RI3 A;  1FWZ A;  1M1K C;  3C94 A;  4HCC A;  3VYH B;  1YJN T;  3SWN B;  5GAN 2;  4M7A G;  4M75 G;  2DTI A;  2XK0 A;  3KBG A;  4A4F A;  2RJE A;  5GAN h;  1PSF A;  2BUD A;  2K5L A;  1U1S A;  4JJN K;  5HY6 A;  5FU7 B;  5GAM h;  2E6Z A;  4BY6 B;  1NE8 A;  2X4J A;  4EMH A;  3S6W A;  3SWN C;  2IG0 A;  4XTU A;  4RG8 A;  2JTF A;  5LJ3 f;  1S72 A;  2X4Y A;  3QSU A;  3JB9 D;  3M59 A;  3LH0 A;  1Q82 U;  4IUQ A;  3CCJ T;  4BY6 C;  4HA8 A;  3CC7 T;  5GAN g;  3J7A F;  4JS4 A;  2CZ0 B;  5DLO A;  3QYG B;  5CK9 A;  4JRI A;  3GPL A;  3ZFJ A;  3QII A;  5GAN 6;  3UPU A;  5DM7 R;  4LD6 A;  2MWP A;  3L2U A;  1N8R U;  2P4T A;  3JCM d;  1JJ2 S;  4EMK B;  2XDD A;  4MZM A;  4JS5 A;  4C8Q E;  4M7D G;  4FU6 A;  1ZHI A;  4IKF A;  4N4I A;  4A53 A;  3I56 T;  1Q82 C;  1I5L A;  1NPR A;  3FB9 A;  3GNG A;  2DJZ A;  3TEE A;  3URG A;  1VQ8 A;  2E12 A;  4EMK C;  3V8K A;  4VUB A;  2XID A;  5M9O A;  3S3M A;  1VUB A;  3VUZ A;  3G4S T;  1BI2 A;  3MET A;  4L59 A;  4C92 E;  1YCY A;  3PIO A;  2QI2 A;  2E64 A;  4EMK A;  4XAX B;  3OYD A;  4MDW A;  3HKS A;  4Z02 A;  2RHX A;  3QXE B;  2DKG A;  2JZ2 A;  1OZ3 A;  2YLC A;  5FLX E;  4LDU A;  4E7I A;  2IVW A;  4M75 A;  1Y07 A;  1KHI A;  2WSE E;  1Q86 C;  1OI1 A;  4DQ2 A;  4KUL A;  2L5Q A;  3M55 A;  1QP2 A;  1K9M U;  2EJG A;  4M75 F;  3E1S A;  3CME T;  1QP3 A;  2OTJ A;  3QUI A;  3OYE A;  1BIA A;  3CC4 T;  3TU4 K;  3S3N A;  2PVD B;  3JB9 I;  2DIG A;  1NPP A;  2CS7 A;  2DXB A;  2GF7 A;  4D6W A;  4E7H A;  5CQX A;  3JB9 H;  4XU0 A;  3CMA T;  2WSF E;  3CC2 T;  4GY5 A;  4M77 G;  4HKE A;  3CCV T;  1K9M C;  3FRN A;  1BYM A;  3MEW A;  1Q7Y U;  3SFM A;  5GAM f;  2I2L A;  4BI8 B;  2JOY A;  3HP9 A;  4F7U G;  4QQ6 A;  4C92 B;  5GAO l;  3CPW A;  5CKD A;  1Y96 A;  2PU9 B;  4ELZ C;  1XNI A;  3QKJ A;  3RUX A;  4TVR A;  1VQN T;  1XOV A;  4ZN1 A;  5GAN 8;  4QQG A;  3OYM A;  3QZ9 B;  4KT0 E;  5J3B A;  2HNI A;  4XU2 A;  3JCM c;  2LNV A;  1VQ4 A;  3M5A A;  4M7D F;  4M7A D;  5D6W A;  4M75 D;  3A8M B;  3VJP A;  4XTW A;  4JUV A;  2ZPB B;  5CKF A;  1G3S A;  1K73 C;  4X9C A;  1UB4 A;  3G6E A;  4ME7 A;  4X9D A;  2C06 A;  1G5V A;  4Y91 A;  2VC8 A;  2RO0 A;  2WSC E;  3OSV A;  3CCU T;  4XTX A;  4C5G A;  2B8A A;  2EQM A;  2CKK A;  4BUG A;  3CC7 A;  3JCM h;  4Y28 E;  3BY7 A;  2DEQ A;  1UGR B;  3J81 E;  1TH7 A;  4CI0 C;  3JCM X;  3CCR T;  3QG1 A;  2OAU A;  3RMQ A;  5KE2 A;  2LX9 A;  4PJO G;  4A4K A;  3ZBD A;  3V7R A;  2RHY A;  4IUR A;  1WNL A;  2LVM A;  1UGP B;  4C5I A;  4ZGE B;  5GMK i;  2EKO A;  1NJI U;  1WJQ A;  2EJF A;  2RH2 A;  3HSB A;  2LT1 A;  3CCQ A;  3NTI A;  3PFS A;  4NS5 A;  1W4S A;  3I56 A;  3JCM g;  1M1K U;  4FIB A;  4M78 G;  4M7D D;  2FB7 A;  1VQ7 T;  3O8V A;  1I8F A;  1Y7X A;  2F5T X;  5GAO p;  5C6S A;  4XTY A;  3JB9 J;  3JB9 F;  2ZPE B;  3X20 B;  3QJY A;  4PLL A;  3V7S A;  4X34 A;  2M1H A;  4O6J A;  2O4X A;  3T9N A;  2RA2 A;  4JRP A;  3H8Z A;  1VQM T;  4M77 F;  4J6W A;  2MMP A;  1VQP A;  1NJI C;  1I4K 1;  1RI0 A;  5A0L A;  2QQS A;  3G71 A;  4OMF B;  3RKX A;  2DO3 A;  3OS0 A;  3OYC A;  2DTH A;  1JJ2 A;  3CCE T;  4F7U F;  1O9S A;  3E9F A;  2CYZ B;  2DK3 A;  2MAM A;  3PMI A;  1K8A U;  3I55 A;  1MGQ A;  1QVF S;  2XDP A;  2LDM A;  1N9S A;  4XU1 A;  1X01 A;  3P8B B;  3X25 B;  1YJ9 A;  4JRQ A;  3HRT A;  2A3L A;  1Y71 A;  3CC4 A;  1M9S A;  4PLI A;  4BI4 A;  1BI0 A;  2CGH A;  4HT8 A;  1I81 A;  1B34 B;  1SSF A;  4ZGJ B;  2DD4 A;  3OYA A;  3CMA A;  3JCM b;  4LDX A;  4MMK A;  1IZ6 A;  3L1A A;  3GF5 A;  4P5N A;  2LRQ A;  3UDC A;  4ZGD B;  4HCZ A;  2KY9 A;  3OYB A;  1K8A C;  2DXU A;  3JCM V;  3PMT A;  4M77 D;  2KAF A;  4PKC C;  3EAE A;  1KQ2 A;  5CKB A;  4BE2 A;  2PVO B;  2P0P A;  5FU6 C;  3JSC A;  4ATO A;  4C0F A;  2DXT A;  4MZT A;  4PJO F;  5C0M A;  3CD6 A;  5LJ5 e;  4LDY A;  3OS1 A;  4R56 A;  5DY9 A;  2L3R A;  1VQK A;  3OS5 A;  4N4G A;  1B34 A;  2V8K A;  4M78 A;  2QXF A;  4NL3 A;  2QA4 T;  1W2B S;  3JCM f;  1M90 C;  5EG2 A;  4M75 B;  1G3W A;  4J6Y A;  4PNO A;  2X35 A;  2P0Q A;  4LDW A;  1Q86 U;  4M78 F;  3OYG A;  3C4S A;  3FLG A;  1N9R A;  2H3J A;  3OBW A;  4DOV A;  5J39 A;  1BKB A;  3OS2 A;  2PUK B;  3L2R A;  1VQ5 A;  5GMK e;  3TCJ A;  3A5Z B;  2OTL T;  3JCM P;  2DIQ A;  4JRK A;  3M57 A;  4BAC A;  1KQ1 A;  4M75 C;  1N27 A;  4NL2 A;  4FM4 B;  5GAO n;  2EJ9 A;  2K2V A;  4RMO A;  3OMC A;  2LQK A;  1WQW A;  5GMK m;  4LDV A;  2JTM A;  2HQX A;  2RHU A;  4M7A A;  4PL6 A;  1YIJ A;  3SD4 A;  4C8Q G;  2D0Q B;  1YIT T;  4MZP A;  3CCS T;  1XTD A;  5HK0 A;  4PJO D;  2DAQ A;  4EPC A;  2X4X A;  4M7A F;  2PQW A;  5CVI A;  2L89 A;  3M4Y A;  4OF1 A;  4XQ3 A;  3OYN A;  1VQ7 A;  1Y96 B;  5IAY A;  4C5E A;  2EYQ A;  2E65 A;  4M7D B;  1P92 A;  3KUF A;  4OB1 B;  4BE0 A;  4RCC A;  3HL8 A;  4M78 D;  4QVD A;  2A7Y A;  4C92 G;  3C95 A;  1YHQ A;  3NFC A;  3A8H B;  3CCM T;  2QQB A;  1YJW T;  3HRU A;  3OYF A;  5L8R E;  2K3Y A;  2GQV A;  1VQ9 A;  1VQ6 T;  3P8D A;  1K73 U;  2G3R A;  5GAN f;  4M7D C;  4EDU A;  2ZPF B;  3OQ5 A;  1KQS S;  2KVQ G;  2VXE A;  3S3O A;  3MEU A;  3V8J A;  2ZCF B;  1WPY A;  2DVE A;  2GFU A;  3J80 E;  4BB7 A;  1YJN A;  1BIB A;  1NZ9 A;  2YHT A;  5LJ3 j;  2XHC A;  4ZN3 A;  4M7D A;  4WF2 A;  3GLX A;  3ER0 A;  3H6Z A;  1JB0 E;  1KC8 U;  2O01 E;  3OYK A;  3PTA A;  4Q5W A;  4B9W A;  4EMG A;  3OB9 A;  5LJ3 e;  3QYH B;  3OYI A;  3ZEH A;  1EIF A;  1HXD A;  2JN0 A;  2MF2 A;  2CZ7 B;  4JDS A;  2BIV A;  4GLK A;  4DOW A;  4BE1 A;  3GP8 A;  4JLI A;  2DXC A;  2EQK A;  3QDR B;  3CCJ A;  1U8R A;  4II1 A;  2ZPH B;  2HAX A;  4LD9 K;  4KBM B;  1ZQ1 A;  4QVC A;  3V7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...