1CKBA

Structural basis for the specific interaction of lysine-containing proline-rich peptides with the n-terminal sh3 domain of c-crk
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C-CRK N-TERMINAL SH3 DOMAIN
publication title Structural basis for the specific interaction of lysine-containing proline-rich peptides with the N-terminal SH3 domain of c-Crk.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (oncogene protein/peptide)
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1995-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ckbA00
1HD3A 2RQVA 3O5ZA 1ZLMA 3THKA 1UTIA 1RUWA 1X2KA 2CDTA 1MV0B 2ABLA 2GBQA 1RI9A 3NPFA 5FWBA 3M0PA 1KSWA 1VYUA 3SEMA 1GBQA 1MV3A 2O9SA 5GJWB 2CSIA 4AFSC 4GBQA 2EYYA 2LX7A 2KXDA 4R0KA 2FRYA 1G2BA 3VS6A 2W0ZA 4LUEA 1JXMA 5I11A 3VS4A 1YNZA 3VRYA 1Z9QA 1I1JA 4J9IA 2DRMA 4KRTA 1NYFA 3VS5A 1NLOC 1WA7A 4RUGA 1BU1A 1H8KA 2LJ1A 4JZ4A 1AWXA 2DL4A 1K1ZA 2PNIA 3EHQA 1VYVA 2CUBA 2DL8A 3PVLA 1NEBA 2D1XA 4HVUA 4JJBA 2FEIA 4J9EA 3VS0A 4IIMA 2CREA 2RMOA 2RF0A 4Z8AA 2EVRA 4AFUC 2FPFA 3FJ5A 2VWFA 2M51A 1GBRA 1JXOA 1Y0MA 2BTTA 3PE0A 3UF4A 1HSQA 4LE9A 2DILA 2JT4A 1VYTA 1M3BA 4F16A 1WYXA 1OPLA 4AFQC 1YP5A 4OMMA 1AWJA 1UFFA 1M30A 4A63B 1GCQA 1E6HA 1WI7A 1QWEA 1UE9A 1X2QA 2J06A 3M0RA 1FYNA 1ARKA 4OMQA 2DL5A 1FMKA 2HCKA 2NWMA 2YSQA 1ZUYA 3RBBB 2D0NA 2OJ2A 3NMZC 3UATA 2DM1A 2KRSA 4RTYA 5IHIA 1SHGA 1SSHA 2SEMA 2MOXA 5I22A 1OV3A 3IQLA 3R6NA 1K9AA 2ENMA 1GFCA 1T3LA 1W6XA 3M0TA 2LQNA 2L2PA 2O31A 2HBWA 1K0XA 2DNUA 2J05A 1AOJA 2FPEA 2GTOA 1X27A 2RPNA 1ZUUA 3KFVA 2F2VA 4E6RA 2ROLA 3EHRA 1S1NA 4WCIA 2F2XA 3A98A 3TSWA 1AEYA 1JQQA 2ESWA 2YUQA 3VS3A 4AG2C 1Y57A 1X6BA 1YWPA 2W10A 3H0FA 4HVWA 1T0JA 2A28A 1AWWA 4FSSA 2EGEA 3EG2A 1BB9A 4GLMA 4AFZC 2JS0A 1B07A 2VVKA 2LZ6B 3SHWA 1QCFA 1JEGA 2HEQA 2EW3A 2KEAA 2KNBB 3EG0A 1TUCA 1ZSGA 1SEMA 2DYBA 4Z89A 2EGAA 2LJ0A 4J9FA 1WIEA 4J9BA 2M0YA 1W1FA 1YWOA 3H0IA 1U3OA 2KBTA 4Z88A 2H8HA 1TUDA 2AK5A 2JM9A 2GTJA 1WXTA 3EG1A 1GRIA 3C0CA 2LMJA 2CT4A 1N5ZA 4JZ3A 1V1CA 1BK2A 1PWTA 2JTEA 3I9QA 5FW9A 2YT6A 1PKSA 2KRMA 2KT8A 4ESRA 3I35A 2ROTA 2EPDA 2J7IA 5IH2A 2XMFA 2GGRA 3EG3A 2K6DA 1E6GA 2RNAA 1NLPC 2EQIA 2KYMA 1WXUA 5IXFA 4CC3A 2CUDA 1TG0A 2RN8A 4OMPA 1LCKA 2JM8A 1U06A 2PTKA 2L3QA 2P4RA 1B3QA 2DBMA 2AZSA 4OMOA 2EGCA 1U5SA 2L0AA 2O9VA 1AVZC 1T0HA 1X43A 1H3HA 2EYZA 2X3XD 2DL3A 2V1RA 1UJYA 2DMOA 2IIMA 2A36A 2LJ3A 2DJQA 3QWXX 1ABOA 2AKKA 3VRZA 1CKBA 2A37A 2O88A 4J9DA 2ED0A 1KFZA 1UG1A 1XOVA 1ABQA 2FPDA 2G6FX 2EYXA 4ZNXA 1WXBA 2C0TA 2K3BA 2NUZA 3VS7A 1UHCA 1SRLA 2FG0A 2RQWA 2K9GA 4F14A 4CC2A 1M27C 3U23A 3QWYA 1UUEA 2J6KA 1A0NB 3GBQA 2CH4W 3I5RA 1YN8A 2KGTA 5HCKA 1K76A 4Y92A 4RTXA 2VKNA 1Z9ZA 1JO8A 2LNHB 2CH4A 4RTUA 3REBB 4K11A 2DBKA 1RLPC 4CC7A 4OMLA 2AKLA 1BBZA 2J6OA 3UA7A 3ULRB 2GNCA 2A08A 3TVTA 1UDLA 2L3SA 2QDLA 4LNPA 2RQUA 4RTZA 3REAB 2KT1A 4RTVA 2LP5A 2JMCA 2YUOA 2RQRA 1SPKA 1IO6A 4LUDA 1CSKA 3NHNA 2CT3A 4ORZA 1UHFA 3M0SA 2DLPA 2OI3A 2B86A 4CC4B 1HJDA 2D8HA 1AZEA 1GFDA 2MIOA 1ZUKA 1NYGA 1T3SA 4J9GA 1SRMA 1WLPB 4IIOA 1GCPA 1ZBJA 1AD5A 2J6FA 4D8DA 1QKWA 4HCKA 2KROA 2FRWA 3M0UA 2D8JA 5L23A 1PNJA 3VS1A 4RTTA 2FO0A 2OAWA 1WDXA 3M0QA 1OPKA 1I07A 2K7AA 3NGPA 1X69A 2GQIA 2V1QA 1NM7A 2YUPA 2KYBA 4J9CA 1UECA 1EFNA 1AWOA 1E7OA 1WFWA 5EC7A 1J3TA 3H0HA 1K0SA 4JPBW 4HVVA 2JW4A 1MUZA 4M4ZA 2EKHA 3TSZA 1K4US 4DEYA 1KJWA 4DEXA 3RNJA 2L3PA 1H92A 3I5SA 1NEGA 2KR3A 4JJDA 2DF6A 5IHKA 5IHNA 1PKTA 4QT7A 3LH5A 1QLYA 3JV3A 1CKAA 3VS2A 1AZGB 1UJ0A 3H41A 5ECAA 4OMNA 2BZXA 1YCSB 4F17A 1I0CA 1GL5A 2DVJA 2F2WA 2EBPA 1QKXA 1M8MA 4JJCA 4D8KA 2RQTA 2DX1A 2K79A 2MCNA 1SHFA 2E5KA 5FWCA 1M3CA 2K2MA 2KXCA 1M3AA 2DA9A 2O2OA 2SRCA 1NG2A 3ZL7C 2AZVA 2CSQA 1OOTA 5IXBA 4X1VA 1UGVA 2KRNA 1VA7A 1PHTA 2BZ8A 2YDLA 1PRMC 2DL7A 2LQWA 4EIKA 3UA6A 2EYWA 1GCQC 1OEBA 2DRKA 2BZYA 2C0OA 2ED1A 1X6GA 2LCSA 1KIKA 2I0NA 4AG1C 5GJVB 1G83A 1JU5C 2PZ1A 2YUNA 1WX6A 1QWFA 3CQTA 4HXJA 1W70A 2HDAA 2KE9A 2X3WD 4J9HA 2JS2A 2JMAA 2ECZA 1PRLC 4RTWA 2HSPA 2C0IA 1ZX6A 2DE0X 3EGUA 3PVQA 4LN2A 2JXBA 1RLQC
chains in the Genus database with same CATH superfamily
3J80E 3V7RA 4XTYA 1K9MC 4ATOA 3BW1A 2GBQA 5FWBA 2FHDA 3M0PA 4C0DB 1OX9A 3CCMQ 1VQ5T 1OX8A 3SEMA 3CCSA 2O9SA 1PSFA 2DTOA 5GJWB 3HRSA 2WSCE 2X4XA 5CQXA 5LJ5d 1QVFA 1PC0A 2RD1A 1IRXA 3EFSA 2HQEA 1VQ6A 3CC2A 4J9IA 2DRMA 3OYHA 1NLOC 3DB4A 1VQ4Q 1H8KA 4JZ4A 2YLCA 5LJ5h 4EMGA 1KD1C 1Q7YC 2KMTA 4BI3A 2IVWA 2ZZDA 2OTLQ 3PVLA 4HVUA 2XDBA 3VS0A 3PIPA 4IIMA 3O8VA 2EVRA 4AFUC 2FPFA 3H9NA 2M51A 3G71A 2LVMA 3OW2A 5I21A 2XK0A 4KUIA 3OSVA 3EG9B 3CMET 4F16A 1YP5A 2KSSA 1UFFA 1M30A 4A63B 3GIBA 3QIIA 4LDWA 4OMQA 3G4ST 2NWMA 4IUQA 8AT1B 2D0NA 3SWNA 5LJ3e 3NMZC 3ASKA 4EDUA 1Y71A 3MJXA 3CCLA 1M4ZA 1UGPB 4J7IA 1SSHA 3SD4A 4E2FB 1T3LA 1W6XA 4PJOA 1KC8C 3M0TA 2JNGA 2L2PA 4OB0B 4E7IA 1K0XA 2DNUA 1AOJA 2FPEA 3QYGB 2FZKB 3CD6Q 4A4KA 9ATCB 1MGQA 3OYNA 1X27A 2RPNA 2YRCA 3KFVA 5AYFA 3CCRQ 5HK3A 1S1NA 2CP7A 4XK8E 4C92D 2JVVA 1YI2A 3TREA 1MHNA 3L42A 3A8HB 5DM7R 2ESWA 1BI0A 1YHQA 2LC4A 4C5GA 1YWPA 2L8DA 2W10A 3LWIA 4FSSA 5GAMe 1WHLA 1LOJA 1QCOA 2COWA 4J7FA 2XI9A 1BI2A 3CCUQ 1JEGA 4NL2A 1C0MA 2LT4A 5CQYA 1HYOA 1TUCA 4BE0A 1SEMA 3HP9A 2DYBA 2EGAA 1UGSB 2X4JA 4J9FA 5GANe 1W1FA 1K9MR 4KGZB 1U3OA 1LJOA 2ZPFB 1TUDA 4M77A 2JM9A 4C0FA 2Y4YA 3VJPA 5D6WA 1KQSP 1YITT 3MHXA 1XTDA 3PFSA 3VV0A 4M7AE 1VQMT 1PWTA 2JTEA 3MEAA 4N4HA 3QDRB 2CP5A 5D6YA 3I35A 1KQ1A 2OTJT 4C92B 2XMFA 2GGRA 4JLIA 4OVAA 1E6GA 3CCMA 1NLPC 1R0BG 4M78B 3MP1A 1WXUA 2NYSA 5CR2A 2K57A 2JM8A 4Z02A 2O01E 4PJJA 2QGFB 2ZPEB 3C12A 1Q81C 2EGCA 2QTVA 3CPWP 4C8QE 5LJ5e 2EYZA 4B6MA 4C92G 4M78G 4XU1A 2DJQA 3CC4Q 3BFMA 2O88A 3RKXA 3CCEA 1F1BB 1WXBA 1N6AA 2PVGB 3VS7A 1WNLA 2V8IA 2QYZA 3OYKA 4A4GA 2J6KA 1NJIC 4PJOF 2PUOB 5FROA 4JRQA 1M90C 4C0GA 4FYYB 1Z9ZA 1BYMA 2DBKA 1IGQA 1IREB 5LJ3g 5CVIA 4CC7A 3HFOA 3HKSA 1BBZA 4HKEA 3CCVA 2VXFA 1IZ6A 3TVTA 1NBEB 2RQUA 5LJ3f 1QQJA 3REAB 1RAGB 2RQRA 1SPKA 4LUDA 1CSKA 3E9GA 4BACA 3VYGA 2MK5A 1G3YA 1WQ7A 1HJDA 2B86A 1XJWB 2D8HA 3OYBA 1UGRB 1AZEA 3BY7A 1VIEA 3KBGA 1NYGA 3ZFJA 4A4HA 3CD6A 1SRMA 4FCYA 1WLPB 3CC7T 3EFOA 2J6FA 2RHIA 1K9MU 4A54A 3FIFA 4XTXA 4HCKA 2QAZA 2KROA 2D8JA 4ANJA 4EMKC 3JCMc 2XHCA 3QG1A 4OB2B 1G5VA 2FO0A 2OAWA 4M77F 2QDYB 5FRNA 2X4WA 1VIFA 1VQLT 3GP8A 2GQIA 2BUDA 1FX7A 1AWOA 1E7OA 8ATCB 2ZCFB 4FU6A 3CCUA 4BE1A 2DVEA 5GAMf 1M5Q1 4MDWA 3FJPA 2EQJA 3SDZA 1KD1U 2A0FB 2LCLA 1D09B 3TSZA 1K4US 1OQKA 1RAAB 1KJWA 5IAYA 3A5ZB 3PTAA 2COYA 1G3SA 2RJEA 2DF6A 2RB6A 2VB6A 4QT7A 1QLYA 2ZGWA 5FU7C 5ECAA 1UJ0A 5GAN4 1VQ7T 1YCSB 1I0CA 2F2WA 2EBPA 3P8HA 4J8OA 1RAIB 1OU8A 2K79A 1QVGP 2E5KA 5FWCA 1Q81R 2X9HA 4J5YA 1G3TA 2K4YA 1M3AA 1QP2A 3ZL7C 2WSFE 5EG2A 2EQMA 3I56T 1Q82C 1PHTA 5GMKh 1S72Q 5KCOA 1YITQ 3ZBDA 1VQMQ 1H641 3QYHB 2BZYA 4AG1C 3M9QA 5LJ5g 4FT2A 1KQSS 1YJ9Q 5IT9E 3OMGA 5FU6C 3SWNC 1M90R 1OZ2A 3CC4A 2HDAA 2X3WD 2E70A 1TUGB 3Q1JA 1XQHA 5LJ5f 4RTWA 4OF1A 4DOWA 2C0IA 2DE0X 2JXBA 2RQVA 2P0QA 5J3BA 2CDTA 4QQ6A 4PJOC 3OW2S 3A8MB 1N9RA 2CSIA 4E7KA 4QQDA 2RI2A 2DXUA 2PQWA 2E64A 2GCXA 2E4HA 2KXDA 4R0KA 1WHJA 1MMGA 2HQXA 5CKDA 2W0ZA 4LUEA 5I11A 3VS4A 3PT9A 3CPWS 3FC3A 3TU4K 2EQUA 2V26A 4KRTA 1B34B 5GMKm 1YJWQ 3EAEA 1VQ8T 2XG8D 2E6NA 4M75D 3TQ7P 4HCBA 1ZA1B 2E6ZA 1NEBA 3NTKA 1I8FA 5GAN6 2CREA 2KQWA 3FJ5A 2DXCA 2K3XA 3RMSA 4KH0B 3L2QA 2BTTA 3M4YA 4PJLA 3DKMA 1ZHIA 1HSQA 5GAOn 2DILA 1VYTA 3PGGA 3OYGA 3OB9A 1VQPQ 4LD6A 2VYTA 2J06A 4M77C 1FYNA 3JCMd 2H3EB 3META 4D6WA 2K2VA 1VQOT 3RBBB 2RO0A 4E7JA 2YHTA 2GQVA 2KRSA 5IHIA 1Q81U 1SHGA 4HT9A 3JCMP 1K9AA 3CC7Q 2QEXA 1G8XA 2RHUA 4C0ZA 4M75A 4BI4A 2F69A 3G6ET 4GY5A 2RA2A 3RMQA 2O31A 3HL8A 4J83A 2QQSA 5D6XA 4FYWB 2GTOA 4PFZA 2ATCB 3VU3C 2QG9B 3LH0A 3OYCA 4KGVB 4E6RA 2ROLA 3EHRA 1Q82R 3A98A 1AEYA 5KE2A 5GAN3 1EX4A 4KT0E 3NTIA 1M90U 4EMKB 1W2BP 3EGXB 1PD0A 2FB7A 2QA4T 1X6BA 3QDFA 3A8GB 1R8OB 4PK4A 1BB9A 2JUFA 2JS0A 3OS5A 5GMKe 4DQ2A 1TWBA 3E2UA 3EGDA 4JS4A 2KNBB 3EH2A 1ZSGA 3S3MA 4C5HA 1S72A 1IB8A 4C92E 1AHJB 1YITA 2P84A 1JB0E 3INZA 4BI8B 1WIEA 4M78E 4PL6A 1YWOA 1JJ2S 1VQMA 2BIVA 2H8HA 1KQSA 5AT1B 3MEUA 3CMAQ 4HCZA 2NUPA 1YJ9A 1YJNT 2DETA 5FU7B 2P0KA 1ZQ1A 3C0CA 2KY9A 4BUGA 1QVGS 4PJOD 3BDLA 1PKSA 2GFUA 4ESRA 2HKQB 4ZTFA 2ROTA 2RHYA 1OYXA 2K6DA 4QVDA 2RNAA 5A0GA 1KQ2A 3LGLA 1C6VX 1U1TA 5IXFA 4CC3A 3CXCP 4N4IA 4JS5A 4OMPA 4B9XA 2JN0A 1U06A 3HHTB 2HMAA 1OZ3A 1QVPA 3CPWA 2MF2A 2KVQG 3ER0A 4R55A 2KAFA 2AZSA 1U5SA 2L0AA 3N5BB 4F04B 2DL3A 2DO3A 4JRKA 1WPYA 2K5FA 2IIMA 5GAN7 4F7UA 3V8LA 3VRZA 1YJWA 2A37A 2ED0A 2D6FA 2JTMA 5FU6B 2G6FX 3SWNB 7AT1B 1HK9A 4ZNXA 4RG8A 3S6WA 1SG5A 2C0TA 3WVDB 3FEOA 4RCCA 1KK7A 1SRLA 3M59A 1YIJA 2QXFA 2L5QA 4JRIA 3QWYA 4M77D 4M75F 1OU9A 2B8AA 3OYFA 3OYIA 3ZEHA 4PJOB 2CH4W 2KGTA 5HCKA 2ZAEA 1VQPA 2VUBA 1O9SA 3RDVA 4RTXA 4DBHA 1Q82U 2CH4A 2FYKA 1U1SA 4K11A 3PMIA 5GMKi 3I55Q 1TOVA 2ZPHB 2VV5A 3UA7A 4LDVA 2GNCA 3QUIA 4E7ZA 1LVKA 1WJSA 2RI5A 2L3SA 4LNPA 4PJOG 3RESA 3DLLA 3JSCA 1IO6A 1G3WA 5HY6A 2BKDN 5GAN2 4MDXA 3L2VA 1UHFA 2OI3A 4J6XA 4KH1B 3A1PA 2DIGA 2MIOA 4M7DA 1T3SA 4J9GA 4IIOA 3V7CA 1VQKQ 1QKWA 3TEEA 2FRWA 2F1LA 2V8KA 3CCQQ 1WDXA 1PD1A 1I81A 1QVFP 3J7AF 4M77B 2HBPA 3X24B 1OPKA 1I07A 2BE9B 3G6EQ 1K73C 3JCMQ 4FL6A 4A4FA 2QQRA 1BCOA 4J9CA 5CCAA 5KYYA 2DKGA 5GAOr 3QKJA 1KD1R 5EC7A 1Q7YR 1VQ6T 3P8DA 1J3TA 3CC2T 4JPBW 4QKUA 4IUPA 2L3RA 4ZN1A 1JJ2A 4M77G 4Q5WA 4FIBA 1H92A 3JCMV 1I5LA 2RHXA 2JTFA 3JB9H 3CMAA 1VQ4A 1Y7XA 3GNFB 2BZXA 3L2WA 4EPCA 3G71T 1QVGA 2XU8A 3RIRA 4D8KA 1VQ5Q 1M1FA 4ELZC 2OTLA 1VQNT 2DX1A 2EYQA 4PLLA 4BE2A 4ZN3A 1RAFB 3FB9A 5M9OA 4F7UF 4PKCC 3HPWA 2Z0WA 1NG2A 1NPRA 2AZVA 4MZPA 2HL5C 2C06A 5LL6S 2FZCB 2KRNA 4IKFA 1D1CA 2BZ8A 3CCLT 1KC8R 3PMTA 2X51A 5GAOq 3OS2A 1PRMC 3GLXA 2DEUA 2DL7A 3UA6A 1M1KC 2EJ9A 1DJ7B 4JJNK 2LCSA 2I0NA 5GJVB 1Y96A 5GMKl 2YUNA 3EFRA 2CZ7B 3QBYA 2HSPA 1ZX6A 2XDDA 3CMEQ 4ZGDB 1RLQC 1HD3A 1FWZA 3O5ZA 1ZLMA 4MMLA 3THKA 1RUWA 3OA6A 3JRZA 3GF5A 3G4SQ 3NPFA 2ZPIB 1YI2T 4M75C 3CCJT 5KYXA 1YHQT 1KSWA 1Y07A 2K5IA 2EJFA 1GBQA 1PG5B 4C5IA 3CXCS 2IG0A 3D7SB 4RG2A 4YTLA 2EYYA 3CCRA 1G2BA 1V76A 1ACMB 2MPXC 3LWHA 3EFOB 2RHZA 1YNZA 3PNWC 3I55A 2YRVA 3VRYA 1Z9QA 1NYFA 4RUGA 1BU1A 4JLGA 1K1ZA 2PNIA 4X34A 4N0AA 3CEYA 2XD0A 2D1XA 3OMCA 1Q7YU 4C8QD 4Z8AA 2VWFA 1GBRA 2WSEE 1K73R 1WGSA 1NPPA 2RJFA 3MP6A 4PNOA 3VUBA 4ZGJB 1H3ZA 3X26B 2EWNA 3RR6A 2JT4A 1VQKA 3FLGA 4M7AA 2HD0A 1M3BA 3V7SA 4AFQC 1LNXA 4OMMA 1GCQA 1QWEA 2EQKA 2QQBA 2DXTA 3M0RA 1FMKA 2CS7A 2H3JA 2JJ9A 2HCKA 2YSQA 3RUXA 1R0CB 3CCQA 3JCMW 1ZUYA 1KHCA 2LX9A 2OJ2A 4FSXA 1YBYA 5KYUA 2HZYA 3HSBA 4RTYA 2YWWA 2CZ0B 3M56A 2SEMA 2MOXA 5I22A 3VUZA 3R6NA 3LX7A 1YFNA 1UEBA 2ENMA 3E19A 4KGXB 2DTIA 2X35A 2GFAA 2LQNA 2HBWA 4XTZA 4C8QA 1TTHB 2J05A 2JZ2A 2EFIA 3P8BB 1HXDA 1KC8U 3UPUA 3MEVA 2NUTA 1TSFA 3CCET 1NJIR 2Y90A 2F2VA 2MI6A 3LW5E 4WCIA 4LDYA 4DBQA 2F2XA 3OS0A 1OI1A 2OTJQ 3TSWA 5KYWA 2P0PA 3QSUA 1VQ5A 2YUQA 2OAUA 4BD3A 3VS3A 5A0LA 4AG2C 2O4XA 1Y57A 3H0FA 4HVWA 1T0JA 1M1KR 2L89A 5CK9A 3HFNA 2QTXA 3GOXA 4GLMA 4AFZC 2RK1A 2VVKA 5GAN8 1C1AA 3SHWA 2R58A 3H6ZA 4J6WA 1QCFA 1MMDA 2A3LA 4EMHA 1D1AA 2D9TA 2EW3A 2KEAA 3EG0A 2LJ0A 4L59A 3CCVT 4J9BA 2LDMA 2M0YA 3HTRA 4LD9K 2GF7A 3H0IA 3QPHA 2KBTA 1QCNA 1VQNQ 2EAYA 1MMNA 2AK5A 2LNVA 1X01A 2GTJA 5KYNA 1WXTA 2M0OA 3EG1A 2DJZA 4FT4A 4GLKA 5CIUA 5LJ3j 2P4TA 1GRIA 3SB2A 3CD6T 4ME7A 5DLQE 5DY9A 1N5ZA 4JZ3A 1BI3A 1ZSZA 2HKNA 1BK2A 3CMEA 5FW9A 4CI0C 1D0ZA 1FMVA 3BDUA 3MCAB 4LXCA 3CBMA 4HCCA 3G4SA 5IH2A 3CXCA 3EG3A 3EH1A 2A7YA 1K73U 2EQIA 2E65A 3QO3A 2KYMA 3RERA 1ZSZB 2CUDA 2RN8A 3QHSA 3L2UA 4M7DC 4MZTA 2VGMA 2KK4A 2PTKA 4VUBA 5I2SA 3NTHA 1B3QA 4M7AF 2DBMA 4FW1A 4PJOE 1D3BA 3CCUT 2O9VA 2EIFA 1AVZC 1X43A 1H3HA 5HK0A 2V1RA 1UJYA 2CP2A 2DMOA 4PFOA 3QWXX 1ABOA 1CKBA 2CZ6B 3JCMh 5GAMd 3CCJQ 2M9UA 1TH7A 1NZ9A 4KULA 1XOVA 1ABQA 2CP6A 2FPDA 1YHQQ 5GAMj 2FL7A 2K3BA 4O6JA 1M9SA 3PIOA 3T9NA 2QI2A 2M1HA 2KI7A 4KBMB 4F14A 4CC2A 3U23A 4JUVA 1UUEA 3M58A 4BDZA 3J81E 2I2LA 4J6YA 5GANd 2LTOA 4M75B 4XU3A 4C8QF 1VQLQ 1NJIU 5GANj 2VKNA 2F5KA 1XNIA 4RKUE 2LNHB 4RTUA 3REBB 1FMWA 2RJDA 5KE3A 2E5QA 3CBPA 1RLPC 4QW2A 2AKLA 5J26A 2A08A 1M1KU 3WVEB 1UDLA 4M75G 2QDLA 3OBWA 4M77E 4RTZA 4DA4A 4RTVA 2LP5A 2JMCA 2DIQA 2Y4XA 3G7ZA 4BB7A 3RKWA 2CT3A 1VQ9T 1SF9A 4IUUA 4IURA 1VQ7Q 3JAME 1BKBA 3JB9I 2HQHA 3CC4T 1ZUKA 4IUTA 1KG1A 4CRIA 1N8RC 3JB9J 4D8DA 4V2SA 3EGDB 3MPUB 1RACB 2RJCA 1O75A 3OYEA 5L23A 2DD5A 5GAN5 2OTJA 1PNJA 3VS1A 4DBRA 1RAHB 3QXEB 4OP0A 5LJ5j 3I56Q 3M0QA 2NUPB 3NGPA 5KH6A 2YRDA 2AHJB 1UECA 1BI1A 3QJ6A 1WFWA 3CCEQ 1PM3A 4C5EA 1K0SA 2FVUA 3EG9A 3AT1B 2JW4A 4RMOA 4M4ZA 2EKHA 5DLOA 3I5SA 1WHGA 1NEGA 1PKTA 1VQNA 2E3IA 4ELYC 3JV3A 3GPLA 2R5MA 1CKAA 1VUBA 1AZGB 1VOMA 5A2QE 1QMCA 2QGGA 4OMNA 1GL5A 2DYIA 1QKXA 1M8MA 2VXEA 4FW2A 2VGNA 3OYLA 2K2MA 2MAMA 4M7DD 4N0AC 4F7UB 3M57A 2XICA 3CCVQ 1GXIE 2CSQA 1OOTA 5J39A 5IXBA 4X1VA 4HA8A 2HL3A 1VA7A 1MNEA 1B7TA 3URGA 4QVZA 1D0XA 4M7AC 3MEWA 5KCHA 4XQ3A 1W4SA 3JCMb 2LQWA 1VQ8Q 1GCQC 1OEBA 2QEXT 1JBMA 2DRKA 2QQ9A 2ED1A 2C0OA 1X6GA 4F7UG 1KIKA 3JCMe 4A4EA 1JU5C 3LYIA 4QVCA 2M16A 1K8AC 1WX6A 1QWFA 1QW1A 1Q86C 4HXJA 1SSFA 1W70A 3OBYA 2VASA 2KE9A 3EGUA 4E7HA 3CCJA 2JS2A 2JMAA 4M78D 3CC7A 3C94A 4X9DA 2E41A 4LN2A 1JRIA 5L8RE 4R56A 3C95A 2K5LA 4P5NA 2LQKA 2DL4A 1A0NB 1RI0A 1UTIA 1X2KA 1MV0B 2ABLA 1RI9A 3JB9D 1VQOQ 1Q95G 1VYUA 2E12A 2DERA 1MV3A 4C8QC 2PVOB 2DZCA 4AFSC 4GBQA 2LX7A 1VQLA 4XU2A 2FRYA 5CKFA 4M7DB 2QASA 4XTVA 3VS6A 1JXMA 2CZ1B 3CCST 3LLRA 3AHUA 4B9WA 4MMKA 1I1JA 1WJRA 3VS5A 1N8RR 1WA7A 2LJ1A 2XKOC 3JCMJ 1S72T 1AWXA 1NE8A 2FZGB 4FYVB 4BY6C 3EHQA 1VYVA 4C92A 4OGCA 2CUBA 2VC8A 3HRUA 2DL8A 4M78A 3E1SA 1IHVA 3H8ZA 3FDRA 4JJBA 2FEIA 3DLMA 3JCMX 4J9EA 4M7DG 2PUKB 2E10A 2RMOA 2RF0A 1YJ9T 1VQ7A 5KYYB 1WQWA 5FLXE 2LCCA 4ZGEB 3V8JA 1JXOA 1TU0B 2KDSA 1Y0MA 5CKBA 2LQ8A 3PE0A 3WXMB 3UF4A 2EKOA 3OW2P 4LE9A 2QA4Q 4MZMA 1WYXA 1OPLA 3OS1A 2ZPGB 1AWJA 1RAEB 1E6HA 1WI7A 1UE9A 1WHMA 1X2QA 3UDCA 3L2RA 1ARKA 4E7LA 2DL5A 1W2BS 3X28B 1I5OB 3I56A 3UATA 2CKKA 2DM1A 2RI3A 5CKEA 1VQ9Q 2F5TX 3KUFA 2QQAA 1ZSZC 3QZ5B 5HKCA 1OV3A 3IQLA 1D1BA 2DXBA 3M4GA 4FM4B 1GFCA 1P92A 2YLBA 1RL2A 3JB9G 4NOYA 1YJNQ 1YJWT 1ZBXA 2RH2A 4HT8A 2E1HA 1ZUUA 1V29B 2EJGA 2YXYA 4DOVA 2WACA 1X75C 1YIJT 4AMCA 2V8JA 2COZA 1JQQA 3X20B 2DZ9A 1Y96B 2A28A 3UWNA 3L2ZA 1AWWA 2EGEA 1VQPT 3EG2A 1LPLA 1B07A 2LRQA 2HSEB 2MMPA 1K8AR 2MWPA 3OY9A 2LZ6B 1Q86R 4TVRA 4M7AD 2R5AA 2HEQA 1MMAA 4M7DF 5I2MA 4Z89A 2IPOB 2PVDB 3A8OB 1R77A 1RADB 3MP8A 2E3HA 5KYXB 3OYYA 5CO7A 4Z88A 1VQ8A 1SKUB 1BCMA 2AT1B 3OYDA 3JCMg 3VYHB 1N8RU 2R57A 2LMJA 2CT4A 3GNGA 4L6V5 6AT1B 3JCMf 3OQ5A 1V1CA 3I9QA 1UB4A 2YT6A 4PJNA 4E7SA 4C0DC 2M02A 4C92F 2KRMA 3X25B 2KT8A 2RK2A 4PFPA 5GAMg 2EPDA 2J7IA 4M78F 3V8KA 1VQOA 3OSSC 2NLUA 1QP3A 2QEXQ 2X4YA 1TG0A 3CBOA 1WHKA 2CP0A 1LCKA 2DK3A 4Y28E 5GAOp 3JB9F 1ZA2B 1M1GA 4AT1B 2L3QA 2P4RA 3CCMT 2G3RA 1X6OA 4M75E 4OMOA 5GANg 3BE3A 1IHWA 2HNIA 1JJ2P 4M7AB 1T0HA 2RM4A 4JRPA 2X3XD 2MYSA 3G6EA 1BIBA 5GAOl 2A36A 2LJ3A 5GANf 2AKKA 3QZ9B 4J9DA 1KFZA 3S3NA 1EZZB 1M2OA 1UG1A 3L1AA 5IN1A 1TS9A 2EYXA 3DB3A 5KYUB 4II1A 2NUZA 1PCXA 3KXTA 1UHCA 3CMAT 1VQ4T 2FG0A 4X9CA 2RQWA 2K9GA 5GMKj 4NS5A 3R6OA 1M27C 1M2VA 4M7AG 3E9FA 3HRTA 4UC4A 3CCSQ 2OTLT 4IUVA 3VKIA 2QA4A 2DAQA 3GBQA 1EIFA 3I5RA 1OULA 1YN8A 4C8QB 1W2BA 1K76A 4Y92A 1M2VB 4JDSA 1JO8A 4L5GA 1QVFS 2NUTB 1VQ6Q 1WZOA 3CC2Q 3MKDA 4OMLA 5CKHA 1VQ9A 2J6OA 3ULRB 1WHHA 4E47A 5KYWB 3M54A 3G1JA 4N4GA 1PSEA 3MO8A 1U8RA 2KT1A 2O4XB 5D7UA 4C8QG 2YUOA 1K8AU 1IXDA 4BY6B 2ZPBB 1Q86U 3NHNA 4ORZA 3M0SA 2DLPA 2PU9B 3M53A 4CC4B 2DEQA 2XIDA 1YJNA 3G71Q 1GFDA 1GCPA 2K3YA 3C4SA 1ZBJA 1AD5A 4OB3B 5A0DA 1B34A 5LJ3d 4Y91A 4PJMA 3M0UA 4O5VA 4RTTA 3QJYA 4XU0A 4ZTJA 4PLIA 3FRNA 3RKYA 1AT1B 4DBFA 2DTHA 3CCRT 1RABB 2K7AA 3NFCA 1X69A 3CCLQ 1I4K1 2LT1A 2V1QA 1NM7A 2YUPA 2KYBA 4FYXB 5LJ3h 3M55A 1EFNA 4XAXB 1N9SA 3I55T 3H0HA 4F7UE 3S3OA 4HVVA 1MUZA 3OYJA 4XTUA 1IGUA 1YIJQ 4DEYA 4DEXA 3RNJA 2L3PA 4JJDA 2KR3A 5IHKA 5IHNA 2DD4A 5C0MA 2CP3A 2QK0A 3LH5A 3TCJA 3VS2A 3H41A 4BDYA 3SFMA 4F17A 2DVJA 1YI2Q 4JJCA 2CGHA 2JOYA 2HAXA 5C6SA 1D3BB 4WF2A 2RQTA 2DPPB 4XTWA 1YCYA 3F70A 3UT1A 2MCNA 1SHFA 1N27A 1VQKT 1M3CA 4C92C 2AIRB 2KXCA 1FXXA 4LDUA 4M78C 2DA9A 2O2OA 1MNDA 2SRCA 3CCQT 5GAMh 4QQGA 3OYAA 1WJQA 1UGVA 2YDLA 2OX7A 3LGFA 2DFUA 4KUDK 4NL3A 1KHIA 4EIKA 5FRMA 4EMKA 3A8LB 2EYWA 3EGXA 1BIAA 2CYZB 4WTOB 5GANh 1G83A 4RCBA 2PZ1A 2BE7D 4M7DE 4A53A 3OYMA 5GAOm 4OMFB 1M8VA 3CPFA 3CQTA 2XDPA 1TXQA 2MWOA 1UGQB 4LDXA 4J9HA 2ECZA 1PRLC 1D0YA 3ME9A 5CAIA 3M5AA 3PVQA 4OB1B 2D0QB 4OGEA
chains in the Genus database with same CATH topology
1HD3A 2RQVA 3O5ZA 1ZLMA 3THKA 1UTIA 1RUWA 1X2KA 2CDTA 1MV0B 2ABLA 2GBQA 1RI9A 3NPFA 5FWBA 3M0PA 1KSWA 1VYUA 3SEMA 1GBQA 1MV3A 2O9SA 5GJWB 2CSIA 4AFSC 4GBQA 2EYYA 2LX7A 2KXDA 4R0KA 2FRYA 1G2BA 3VS6A 2W0ZA 4LUEA 1JXMA 5I11A 3VS4A 1YNZA 3VRYA 1Z9QA 1I1JA 4J9IA 2DRMA 4KRTA 1NYFA 3VS5A 1NLOC 1WA7A 4RUGA 1BU1A 1H8KA 2LJ1A 4JZ4A 1AWXA 2DL4A 1K1ZA 2PNIA 3EHQA 1VYVA 2CUBA 2DL8A 3PVLA 1NEBA 2D1XA 4HVUA 4JJBA 2FEIA 4J9EA 3VS0A 4IIMA 2CREA 2RMOA 2RF0A 4Z8AA 2EVRA 4AFUC 2FPFA 3FJ5A 2VWFA 2M51A 1GBRA 1JXOA 1Y0MA 2BTTA 3PE0A 3UF4A 1HSQA 4LE9A 2DILA 2JT4A 1VYTA 1M3BA 4F16A 1WYXA 1OPLA 4AFQC 1YP5A 4OMMA 1AWJA 1UFFA 1M30A 4A63B 1GCQA 1E6HA 1WI7A 1QWEA 1UE9A 1X2QA 2J06A 3M0RA 1FYNA 1ARKA 4OMQA 2DL5A 1FMKA 2HCKA 2NWMA 2YSQA 1ZUYA 3RBBB 2D0NA 2OJ2A 3NMZC 3UATA 2DM1A 2KRSA 4RTYA 5IHIA 1SHGA 1SSHA 2SEMA 2MOXA 5I22A 1OV3A 3IQLA 3R6NA 1K9AA 2ENMA 1GFCA 1T3LA 1W6XA 3M0TA 2LQNA 2L2PA 2O31A 2HBWA 1K0XA 2DNUA 2J05A 1AOJA 2FPEA 2GTOA 1X27A 2RPNA 1ZUUA 3KFVA 2F2VA 4E6RA 2ROLA 3EHRA 1S1NA 4WCIA 2F2XA 3A98A 3TSWA 1AEYA 1JQQA 2ESWA 2YUQA 3VS3A 4AG2C 1Y57A 1X6BA 1YWPA 2W10A 3H0FA 4HVWA 1T0JA 2A28A 1AWWA 4FSSA 2EGEA 3EG2A 1BB9A 4GLMA 4AFZC 2JS0A 1B07A 2VVKA 2LZ6B 3SHWA 1QCFA 1JEGA 2HEQA 2EW3A 2KEAA 2KNBB 3EG0A 1TUCA 1ZSGA 1SEMA 2DYBA 4Z89A 2EGAA 2LJ0A 4J9FA 1WIEA 4J9BA 2M0YA 1W1FA 1YWOA 3H0IA 1U3OA 2KBTA 4Z88A 2H8HA 1TUDA 2AK5A 2JM9A 2GTJA 1WXTA 3EG1A 1GRIA 3C0CA 2LMJA 2CT4A 1N5ZA 4JZ3A 1V1CA 1BK2A 1PWTA 2JTEA 3I9QA 5FW9A 2YT6A 1PKSA 2KRMA 2KT8A 4ESRA 3I35A 2ROTA 2EPDA 2J7IA 5IH2A 2XMFA 2GGRA 3EG3A 2K6DA 1E6GA 2RNAA 1NLPC 2EQIA 2KYMA 1WXUA 5IXFA 4CC3A 2CUDA 1TG0A 2RN8A 4OMPA 1LCKA 2JM8A 1U06A 2PTKA 2L3QA 2P4RA 1B3QA 2DBMA 2AZSA 4OMOA 2EGCA 1U5SA 2L0AA 2O9VA 1AVZC 1T0HA 1X43A 1H3HA 2EYZA 2X3XD 2DL3A 2V1RA 1UJYA 2DMOA 2IIMA 2A36A 2LJ3A 2DJQA 3QWXX 1ABOA 2AKKA 3VRZA 1CKBA 2A37A 2O88A 4J9DA 2ED0A 1KFZA 1UG1A 1XOVA 1ABQA 2FPDA 2G6FX 2EYXA 4ZNXA 1WXBA 2C0TA 2K3BA 2NUZA 3VS7A 1UHCA 1SRLA 2FG0A 2RQWA 2K9GA 4F14A 4CC2A 1M27C 3U23A 3QWYA 1UUEA 2J6KA 1A0NB 3GBQA 2CH4W 3I5RA 1YN8A 2KGTA 5HCKA 1K76A 4Y92A 4RTXA 2VKNA 1Z9ZA 1JO8A 2LNHB 2CH4A 4RTUA 3REBB 4K11A 2DBKA 1RLPC 4CC7A 4OMLA 2AKLA 1BBZA 2J6OA 3UA7A 3ULRB 2GNCA 2A08A 3TVTA 1UDLA 2L3SA 2QDLA 4LNPA 2RQUA 4RTZA 3REAB 2KT1A 4RTVA 2LP5A 2JMCA 2YUOA 2RQRA 1SPKA 1IO6A 4LUDA 1CSKA 3NHNA 2CT3A 4ORZA 1UHFA 3M0SA 2DLPA 2OI3A 2B86A 4CC4B 1HJDA 2D8HA 1AZEA 1GFDA 2MIOA 1ZUKA 1NYGA 1T3SA 4J9GA 1SRMA 1WLPB 4IIOA 1GCPA 1ZBJA 1AD5A 2J6FA 4D8DA 1QKWA 4HCKA 2KROA 2FRWA 3M0UA 2D8JA 5L23A 1PNJA 3VS1A 4RTTA 2FO0A 2OAWA 1WDXA 3M0QA 1OPKA 1I07A 2K7AA 3NGPA 1X69A 2GQIA 2V1QA 1NM7A 2YUPA 2KYBA 4J9CA 1UECA 1EFNA 1AWOA 1E7OA 1WFWA 5EC7A 1J3TA 3H0HA 1K0SA 4JPBW 4HVVA 2JW4A 1MUZA 4M4ZA 2EKHA 3TSZA 1K4US 4DEYA 1KJWA 4DEXA 3RNJA 2L3PA 1H92A 3I5SA 1NEGA 2KR3A 4JJDA 2DF6A 5IHKA 5IHNA 1PKTA 4QT7A 3LH5A 1QLYA 3JV3A 1CKAA 3VS2A 1AZGB 1UJ0A 3H41A 5ECAA 4OMNA 2BZXA 1YCSB 4F17A 1I0CA 1GL5A 2DVJA 2F2WA 2EBPA 1QKXA 1M8MA 4JJCA 4D8KA 2RQTA 2DX1A 2K79A 2MCNA 1SHFA 2E5KA 5FWCA 1M3CA 2K2MA 2KXCA 1M3AA 2DA9A 2O2OA 2SRCA 1NG2A 3ZL7C 2AZVA 2CSQA 1OOTA 5IXBA 4X1VA 1UGVA 2KRNA 1VA7A 1PHTA 2BZ8A 2YDLA 1PRMC 2DL7A 2LQWA 4EIKA 3UA6A 2EYWA 1GCQC 1OEBA 2DRKA 2BZYA 2C0OA 2ED1A 1X6GA 2LCSA 1KIKA 2I0NA 4AG1C 5GJVB 1G83A 1JU5C 2PZ1A 2YUNA 1WX6A 1QWFA 3CQTA 4HXJA 1W70A 2HDAA 2KE9A 2X3WD 4J9HA 2JS2A 2JMAA 2ECZA 1PRLC 4RTWA 2HSPA 2C0IA 1ZX6A 2DE0X 3EGUA 3PVQA 4LN2A 2JXBA 1RLQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HD3 A;  2RQV A;  3O5Z A;  1ZLM A;  3THK A;  1UTI A;  1RUW A;  1X2K A;  2CDT A;  1MV0 B;  2ABL A;  2GBQ A;  1RI9 A;  3NPF A;  5FWB A;  3M0P A;  1KSW A;  1VYU A;  3SEM A;  1GBQ A;  1MV3 A;  2O9S A;  5GJW B;  2CSI A;  4AFS C;  4GBQ A;  2EYY A;  2LX7 A;  2KXD A;  4R0K A;  2FRY A;  1G2B A;  3VS6 A;  2W0Z A;  4LUE A;  1JXM A;  5I11 A;  3VS4 A;  1YNZ A;  3VRY A;  1Z9Q A;  1I1J A;  4J9I A;  2DRM A;  4KRT A;  1NYF A;  3VS5 A;  1NLO C;  1WA7 A;  4RUG A;  1BU1 A;  1H8K A;  2LJ1 A;  4JZ4 A;  1AWX A;  2DL4 A;  1K1Z A;  2PNI A;  3EHQ A;  1VYV A;  2CUB A;  2DL8 A;  3PVL A;  1NEB A;  2D1X A;  4HVU A;  4JJB A;  2FEI A;  4J9E A;  3VS0 A;  4IIM A;  2CRE A;  2RMO A;  2RF0 A;  4Z8A A;  2EVR A;  4AFU C;  2FPF A;  3FJ5 A;  2VWF A;  2M51 A;  1GBR A;  1JXO A;  1Y0M A;  2BTT A;  3PE0 A;  3UF4 A;  1HSQ A;  4LE9 A;  2DIL A;  2JT4 A;  1VYT A;  1M3B A;  4F16 A;  1WYX A;  1OPL A;  4AFQ C;  1YP5 A;  4OMM A;  1AWJ A;  1UFF A;  1M30 A;  4A63 B;  1GCQ A;  1E6H A;  1WI7 A;  1QWE A;  1UE9 A;  1X2Q A;  2J06 A;  3M0R A;  1FYN A;  1ARK A;  4OMQ A;  2DL5 A;  1FMK A;  2HCK A;  2NWM A;  2YSQ A;  1ZUY A;  3RBB B;  2D0N A;  2OJ2 A;  3NMZ C;  3UAT A;  2DM1 A;  2KRS A;  4RTY A;  5IHI A;  1SHG A;  1SSH A;  2SEM A;  2MOX A;  5I22 A;  1OV3 A;  3IQL A;  3R6N A;  1K9A A;  2ENM A;  1GFC A;  1T3L A;  1W6X A;  3M0T A;  2LQN A;  2L2P A;  2O31 A;  2HBW A;  1K0X A;  2DNU A;  2J05 A;  1AOJ A;  2FPE A;  2GTO A;  1X27 A;  2RPN A;  1ZUU A;  3KFV A;  2F2V A;  4E6R A;  2ROL A;  3EHR A;  1S1N A;  4WCI A;  2F2X A;  3A98 A;  3TSW A;  1AEY A;  1JQQ A;  2ESW A;  2YUQ A;  3VS3 A;  4AG2 C;  1Y57 A;  1X6B A;  1YWP A;  2W10 A;  3H0F A;  4HVW A;  1T0J A;  2A28 A;  1AWW A;  4FSS A;  2EGE A;  3EG2 A;  1BB9 A;  4GLM A;  4AFZ C;  2JS0 A;  1B07 A;  2VVK A;  2LZ6 B;  3SHW A;  1QCF A;  1JEG A;  2HEQ A;  2EW3 A;  2KEA A;  2KNB B;  3EG0 A;  1TUC A;  1ZSG A;  1SEM A;  2DYB A;  4Z89 A;  2EGA A;  2LJ0 A;  4J9F A;  1WIE A;  4J9B A;  2M0Y A;  1W1F A;  1YWO A;  3H0I A;  1U3O A;  2KBT A;  4Z88 A;  2H8H A;  1TUD A;  2AK5 A;  2JM9 A;  2GTJ A;  1WXT A;  3EG1 A;  1GRI A;  3C0C A;  2LMJ A;  2CT4 A;  1N5Z A;  4JZ3 A;  1V1C A;  1BK2 A;  1PWT A;  2JTE A;  3I9Q A;  5FW9 A;  2YT6 A;  1PKS A;  2KRM A;  2KT8 A;  4ESR A;  3I35 A;  2ROT A;  2EPD A;  2J7I A;  5IH2 A;  2XMF A;  2GGR A;  3EG3 A;  2K6D A;  1E6G A;  2RNA A;  1NLP C;  2EQI A;  2KYM A;  1WXU A;  5IXF A;  4CC3 A;  2CUD A;  1TG0 A;  2RN8 A;  4OMP A;  1LCK A;  2JM8 A;  1U06 A;  2PTK A;  2L3Q A;  2P4R A;  1B3Q A;  2DBM A;  2AZS A;  4OMO A;  2EGC A;  1U5S A;  2L0A A;  2O9V A;  1AVZ C;  1T0H A;  1X43 A;  1H3H A;  2EYZ A;  2X3X D;  2DL3 A;  2V1R A;  1UJY A;  2DMO A;  2IIM A;  2A36 A;  2LJ3 A;  2DJQ A;  3QWX X;  1ABO A;  2AKK A;  3VRZ A;  1CKB A;  2A37 A;  2O88 A;  4J9D A;  2ED0 A;  1KFZ A;  1UG1 A;  1XOV A;  1ABQ A;  2FPD A;  2G6F X;  2EYX A;  4ZNX A;  1WXB A;  2C0T A;  2K3B A;  2NUZ A;  3VS7 A;  1UHC A;  1SRL A;  2FG0 A;  2RQW A;  2K9G A;  4F14 A;  4CC2 A;  1M27 C;  3U23 A;  3QWY A;  1UUE A;  2J6K A;  1A0N B;  3GBQ A;  2CH4 W;  3I5R A;  1YN8 A;  2KGT A;  5HCK A;  1K76 A;  4Y92 A;  4RTX A;  2VKN A;  1Z9Z A;  1JO8 A;  2LNH B;  2CH4 A;  4RTU A;  3REB B;  4K11 A;  2DBK A;  1RLP C;  4CC7 A;  4OML A;  2AKL A;  1BBZ A;  2J6O A;  3UA7 A;  3ULR B;  2GNC A;  2A08 A;  3TVT A;  1UDL A;  2L3S A;  2QDL A;  4LNP A;  2RQU A;  4RTZ A;  3REA B;  2KT1 A;  4RTV A;  2LP5 A;  2JMC A;  2YUO A;  2RQR A;  1SPK A;  1IO6 A;  4LUD A;  1CSK A;  3NHN A;  2CT3 A;  4ORZ A;  1UHF A;  3M0S A;  2DLP A;  2OI3 A;  2B86 A;  4CC4 B;  1HJD A;  2D8H A;  1AZE A;  1GFD A;  2MIO A;  1ZUK A;  1NYG A;  1T3S A;  4J9G A;  1SRM A;  1WLP B;  4IIO A;  1GCP A;  1ZBJ A;  1AD5 A;  2J6F A;  4D8D A;  1QKW A;  4HCK A;  2KRO A;  2FRW A;  3M0U A;  2D8J A;  5L23 A;  1PNJ A;  3VS1 A;  4RTT A;  2FO0 A;  2OAW A;  1WDX A;  3M0Q A;  1OPK A;  1I07 A;  2K7A A;  3NGP A;  1X69 A;  2GQI A;  2V1Q A;  1NM7 A;  2YUP A;  2KYB A;  4J9C A;  1UEC A;  1EFN A;  1AWO A;  1E7O A;  1WFW A;  5EC7 A;  1J3T A;  3H0H A;  1K0S A;  4JPB W;  4HVV A;  2JW4 A;  1MUZ A;  4M4Z A;  2EKH A;  3TSZ A;  1K4U S;  4DEY A;  1KJW A;  4DEX A;  3RNJ A;  2L3P A;  1H92 A;  3I5S A;  1NEG A;  2KR3 A;  4JJD A;  2DF6 A;  5IHK A;  5IHN A;  1PKT A;  4QT7 A;  3LH5 A;  1QLY A;  3JV3 A;  1CKA A;  3VS2 A;  1AZG B;  1UJ0 A;  3H41 A;  5ECA A;  4OMN A;  2BZX A;  1YCS B;  4F17 A;  1I0C A;  1GL5 A;  2DVJ A;  2F2W A;  2EBP A;  1QKX A;  1M8M A;  4JJC A;  4D8K A;  2RQT A;  2DX1 A;  2K79 A;  2MCN A;  1SHF A;  2E5K A;  5FWC A;  1M3C A;  2K2M A;  2KXC A;  1M3A A;  2DA9 A;  2O2O A;  2SRC A;  1NG2 A;  3ZL7 C;  2AZV A;  2CSQ A;  1OOT A;  5IXB A;  4X1V A;  1UGV A;  2KRN A;  1VA7 A;  1PHT A;  2BZ8 A;  2YDL A;  1PRM C;  2DL7 A;  2LQW A;  4EIK A;  3UA6 A;  2EYW A;  1GCQ C;  1OEB A;  2DRK A;  2BZY A;  2C0O A;  2ED1 A;  1X6G A;  2LCS A;  1KIK A;  2I0N A;  4AG1 C;  5GJV B;  1G83 A;  1JU5 C;  2PZ1 A;  2YUN A;  1WX6 A;  1QWF A;  3CQT A;  4HXJ A;  1W70 A;  2HDA A;  2KE9 A;  2X3W D;  4J9H A;  2JS2 A;  2JMA A;  2ECZ A;  1PRL C;  4RTW A;  2HSP A;  2C0I A;  1ZX6 A;  2DE0 X;  3EGU A;  3PVQ A;  4LN2 A;  2JXB A;  1RLQ C; 
#chains in the Genus database with same CATH topology
 3J80 E;  3V7R A;  4XTY A;  1K9M C;  4ATO A;  3BW1 A;  2GBQ A;  5FWB A;  2FHD A;  3M0P A;  4C0D B;  1OX9 A;  3CCM Q;  1VQ5 T;  1OX8 A;  3SEM A;  3CCS A;  2O9S A;  1PSF A;  2DTO A;  5GJW B;  3HRS A;  2WSC E;  2X4X A;  5CQX A;  5LJ5 d;  1QVF A;  1PC0 A;  2RD1 A;  1IRX A;  3EFS A;  2HQE A;  1VQ6 A;  3CC2 A;  4J9I A;  2DRM A;  3OYH A;  1NLO C;  3DB4 A;  1VQ4 Q;  1H8K A;  4JZ4 A;  2YLC A;  5LJ5 h;  4EMG A;  1KD1 C;  1Q7Y C;  2KMT A;  4BI3 A;  2IVW A;  2ZZD A;  2OTL Q;  3PVL A;  4HVU A;  2XDB A;  3VS0 A;  3PIP A;  4IIM A;  3O8V A;  2EVR A;  4AFU C;  2FPF A;  3H9N A;  2M51 A;  3G71 A;  2LVM A;  3OW2 A;  5I21 A;  2XK0 A;  4KUI A;  3OSV A;  3EG9 B;  3CME T;  4F16 A;  1YP5 A;  2KSS A;  1UFF A;  1M30 A;  4A63 B;  3GIB A;  3QII A;  4LDW A;  4OMQ A;  3G4S T;  2NWM A;  4IUQ A;  8AT1 B;  2D0N A;  3SWN A;  5LJ3 e;  3NMZ C;  3ASK A;  4EDU A;  1Y71 A;  3MJX A;  3CCL A;  1M4Z A;  1UGP B;  4J7I A;  1SSH A;  3SD4 A;  4E2F B;  1T3L A;  1W6X A;  4PJO A;  1KC8 C;  3M0T A;  2JNG A;  2L2P A;  4OB0 B;  4E7I A;  1K0X A;  2DNU A;  1AOJ A;  2FPE A;  3QYG B;  2FZK B;  3CD6 Q;  4A4K A;  9ATC B;  1MGQ A;  3OYN A;  1X27 A;  2RPN A;  2YRC A;  3KFV A;  5AYF A;  3CCR Q;  5HK3 A;  1S1N A;  2CP7 A;  4XK8 E;  4C92 D;  2JVV A;  1YI2 A;  3TRE A;  1MHN A;  3L42 A;  3A8H B;  5DM7 R;  2ESW A;  1BI0 A;  1YHQ A;  2LC4 A;  4C5G A;  1YWP A;  2L8D A;  2W10 A;  3LWI A;  4FSS A;  5GAM e;  1WHL A;  1LOJ A;  1QCO A;  2COW A;  4J7F A;  2XI9 A;  1BI2 A;  3CCU Q;  1JEG A;  4NL2 A;  1C0M A;  2LT4 A;  5CQY A;  1HYO A;  1TUC A;  4BE0 A;  1SEM A;  3HP9 A;  2DYB A;  2EGA A;  1UGS B;  2X4J A;  4J9F A;  5GAN e;  1W1F A;  1K9M R;  4KGZ B;  1U3O A;  1LJO A;  2ZPF B;  1TUD A;  4M77 A;  2JM9 A;  4C0F A;  2Y4Y A;  3VJP A;  5D6W A;  1KQS P;  1YIT T;  3MHX A;  1XTD A;  3PFS A;  3VV0 A;  4M7A E;  1VQM T;  1PWT A;  2JTE A;  3MEA A;  4N4H A;  3QDR B;  2CP5 A;  5D6Y A;  3I35 A;  1KQ1 A;  2OTJ T;  4C92 B;  2XMF A;  2GGR A;  4JLI A;  4OVA A;  1E6G A;  3CCM A;  1NLP C;  1R0B G;  4M78 B;  3MP1 A;  1WXU A;  2NYS A;  5CR2 A;  2K57 A;  2JM8 A;  4Z02 A;  2O01 E;  4PJJ A;  2QGF B;  2ZPE B;  3C12 A;  1Q81 C;  2EGC A;  2QTV A;  3CPW P;  4C8Q E;  5LJ5 e;  2EYZ A;  4B6M A;  4C92 G;  4M78 G;  4XU1 A;  2DJQ A;  3CC4 Q;  3BFM A;  2O88 A;  3RKX A;  3CCE A;  1F1B B;  1WXB A;  1N6A A;  2PVG B;  3VS7 A;  1WNL A;  2V8I A;  2QYZ A;  3OYK A;  4A4G A;  2J6K A;  1NJI C;  4PJO F;  2PUO B;  5FRO A;  4JRQ A;  1M90 C;  4C0G A;  4FYY B;  1Z9Z A;  1BYM A;  2DBK A;  1IGQ A;  1IRE B;  5LJ3 g;  5CVI A;  4CC7 A;  3HFO A;  3HKS A;  1BBZ A;  4HKE A;  3CCV A;  2VXF A;  1IZ6 A;  3TVT A;  1NBE B;  2RQU A;  5LJ3 f;  1QQJ A;  3REA B;  1RAG B;  2RQR A;  1SPK A;  4LUD A;  1CSK A;  3E9G A;  4BAC A;  3VYG A;  2MK5 A;  1G3Y A;  1WQ7 A;  1HJD A;  2B86 A;  1XJW B;  2D8H A;  3OYB A;  1UGR B;  1AZE A;  3BY7 A;  1VIE A;  3KBG A;  1NYG A;  3ZFJ A;  4A4H A;  3CD6 A;  1SRM A;  4FCY A;  1WLP B;  3CC7 T;  3EFO A;  2J6F A;  2RHI A;  1K9M U;  4A54 A;  3FIF A;  4XTX A;  4HCK A;  2QAZ A;  2KRO A;  2D8J A;  4ANJ A;  4EMK C;  3JCM c;  2XHC A;  3QG1 A;  4OB2 B;  1G5V A;  2FO0 A;  2OAW A;  4M77 F;  2QDY B;  5FRN A;  2X4W A;  1VIF A;  1VQL T;  3GP8 A;  2GQI A;  2BUD A;  1FX7 A;  1AWO A;  1E7O A;  8ATC B;  2ZCF B;  4FU6 A;  3CCU A;  4BE1 A;  2DVE A;  5GAM f;  1M5Q 1;  4MDW A;  3FJP A;  2EQJ A;  3SDZ A;  1KD1 U;  2A0F B;  2LCL A;  1D09 B;  3TSZ A;  1K4U S;  1OQK A;  1RAA B;  1KJW A;  5IAY A;  3A5Z B;  3PTA A;  2COY A;  1G3S A;  2RJE A;  2DF6 A;  2RB6 A;  2VB6 A;  4QT7 A;  1QLY A;  2ZGW A;  5FU7 C;  5ECA A;  1UJ0 A;  5GAN 4;  1VQ7 T;  1YCS B;  1I0C A;  2F2W A;  2EBP A;  3P8H A;  4J8O A;  1RAI B;  1OU8 A;  2K79 A;  1QVG P;  2E5K A;  5FWC A;  1Q81 R;  2X9H A;  4J5Y A;  1G3T A;  2K4Y A;  1M3A A;  1QP2 A;  3ZL7 C;  2WSF E;  5EG2 A;  2EQM A;  3I56 T;  1Q82 C;  1PHT A;  5GMK h;  1S72 Q;  5KCO A;  1YIT Q;  3ZBD A;  1VQM Q;  1H64 1;  3QYH B;  2BZY A;  4AG1 C;  3M9Q A;  5LJ5 g;  4FT2 A;  1KQS S;  1YJ9 Q;  5IT9 E;  3OMG A;  5FU6 C;  3SWN C;  1M90 R;  1OZ2 A;  3CC4 A;  2HDA A;  2X3W D;  2E70 A;  1TUG B;  3Q1J A;  1XQH A;  5LJ5 f;  4RTW A;  4OF1 A;  4DOW A;  2C0I A;  2DE0 X;  2JXB A;  2RQV A;  2P0Q A;  5J3B A;  2CDT A;  4QQ6 A;  4PJO C;  3OW2 S;  3A8M B;  1N9R A;  2CSI A;  4E7K A;  4QQD A;  2RI2 A;  2DXU A;  2PQW A;  2E64 A;  2GCX A;  2E4H A;  2KXD A;  4R0K A;  1WHJ A;  1MMG A;  2HQX A;  5CKD A;  2W0Z A;  4LUE A;  5I11 A;  3VS4 A;  3PT9 A;  3CPW S;  3FC3 A;  3TU4 K;  2EQU A;  2V26 A;  4KRT A;  1B34 B;  5GMK m;  1YJW Q;  3EAE A;  1VQ8 T;  2XG8 D;  2E6N A;  4M75 D;  3TQ7 P;  4HCB A;  1ZA1 B;  2E6Z A;  1NEB A;  3NTK A;  1I8F A;  5GAN 6;  2CRE A;  2KQW A;  3FJ5 A;  2DXC A;  2K3X A;  3RMS A;  4KH0 B;  3L2Q A;  2BTT A;  3M4Y A;  4PJL A;  3DKM A;  1ZHI A;  1HSQ A;  5GAO n;  2DIL A;  1VYT A;  3PGG A;  3OYG A;  3OB9 A;  1VQP Q;  4LD6 A;  2VYT A;  2J06 A;  4M77 C;  1FYN A;  3JCM d;  2H3E B;  3MET A;  4D6W A;  2K2V A;  1VQO T;  3RBB B;  2RO0 A;  4E7J A;  2YHT A;  2GQV A;  2KRS A;  5IHI A;  1Q81 U;  1SHG A;  4HT9 A;  3JCM P;  1K9A A;  3CC7 Q;  2QEX A;  1G8X A;  2RHU A;  4C0Z A;  4M75 A;  4BI4 A;  2F69 A;  3G6E T;  4GY5 A;  2RA2 A;  3RMQ A;  2O31 A;  3HL8 A;  4J83 A;  2QQS A;  5D6X A;  4FYW B;  2GTO A;  4PFZ A;  2ATC B;  3VU3 C;  2QG9 B;  3LH0 A;  3OYC A;  4KGV B;  4E6R A;  2ROL A;  3EHR A;  1Q82 R;  3A98 A;  1AEY A;  5KE2 A;  5GAN 3;  1EX4 A;  4KT0 E;  3NTI A;  1M90 U;  4EMK B;  1W2B P;  3EGX B;  1PD0 A;  2FB7 A;  2QA4 T;  1X6B A;  3QDF A;  3A8G B;  1R8O B;  4PK4 A;  1BB9 A;  2JUF A;  2JS0 A;  3OS5 A;  5GMK e;  4DQ2 A;  1TWB A;  3E2U A;  3EGD A;  4JS4 A;  2KNB B;  3EH2 A;  1ZSG A;  3S3M A;  4C5H A;  1S72 A;  1IB8 A;  4C92 E;  1AHJ B;  1YIT A;  2P84 A;  1JB0 E;  3INZ A;  4BI8 B;  1WIE A;  4M78 E;  4PL6 A;  1YWO A;  1JJ2 S;  1VQM A;  2BIV A;  2H8H A;  1KQS A;  5AT1 B;  3MEU A;  3CMA Q;  4HCZ A;  2NUP A;  1YJ9 A;  1YJN T;  2DET A;  5FU7 B;  2P0K A;  1ZQ1 A;  3C0C A;  2KY9 A;  4BUG A;  1QVG S;  4PJO D;  3BDL A;  1PKS A;  2GFU A;  4ESR A;  2HKQ B;  4ZTF A;  2ROT A;  2RHY A;  1OYX A;  2K6D A;  4QVD A;  2RNA A;  5A0G A;  1KQ2 A;  3LGL A;  1C6V X;  1U1T A;  5IXF A;  4CC3 A;  3CXC P;  4N4I A;  4JS5 A;  4OMP A;  4B9X A;  2JN0 A;  1U06 A;  3HHT B;  2HMA A;  1OZ3 A;  1QVP A;  3CPW A;  2MF2 A;  2KVQ G;  3ER0 A;  4R55 A;  2KAF A;  2AZS A;  1U5S A;  2L0A A;  3N5B B;  4F04 B;  2DL3 A;  2DO3 A;  4JRK A;  1WPY A;  2K5F A;  2IIM A;  5GAN 7;  4F7U A;  3V8L A;  3VRZ A;  1YJW A;  2A37 A;  2ED0 A;  2D6F A;  2JTM A;  5FU6 B;  2G6F X;  3SWN B;  7AT1 B;  1HK9 A;  4ZNX A;  4RG8 A;  3S6W A;  1SG5 A;  2C0T A;  3WVD B;  3FEO A;  4RCC A;  1KK7 A;  1SRL A;  3M59 A;  1YIJ A;  2QXF A;  2L5Q A;  4JRI A;  3QWY A;  4M77 D;  4M75 F;  1OU9 A;  2B8A A;  3OYF A;  3OYI A;  3ZEH A;  4PJO B;  2CH4 W;  2KGT A;  5HCK A;  2ZAE A;  1VQP A;  2VUB A;  1O9S A;  3RDV A;  4RTX A;  4DBH A;  1Q82 U;  2CH4 A;  2FYK A;  1U1S A;  4K11 A;  3PMI A;  5GMK i;  3I55 Q;  1TOV A;  2ZPH B;  2VV5 A;  3UA7 A;  4LDV A;  2GNC A;  3QUI A;  4E7Z A;  1LVK A;  1WJS A;  2RI5 A;  2L3S A;  4LNP A;  4PJO G;  3RES A;  3DLL A;  3JSC A;  1IO6 A;  1G3W A;  5HY6 A;  2BKD N;  5GAN 2;  4MDX A;  3L2V A;  1UHF A;  2OI3 A;  4J6X A;  4KH1 B;  3A1P A;  2DIG A;  2MIO A;  4M7D A;  1T3S A;  4J9G A;  4IIO A;  3V7C A;  1VQK Q;  1QKW A;  3TEE A;  2FRW A;  2F1L A;  2V8K A;  3CCQ Q;  1WDX A;  1PD1 A;  1I81 A;  1QVF P;  3J7A F;  4M77 B;  2HBP A;  3X24 B;  1OPK A;  1I07 A;  2BE9 B;  3G6E Q;  1K73 C;  3JCM Q;  4FL6 A;  4A4F A;  2QQR A;  1BCO A;  4J9C A;  5CCA A;  5KYY A;  2DKG A;  5GAO r;  3QKJ A;  1KD1 R;  5EC7 A;  1Q7Y R;  1VQ6 T;  3P8D A;  1J3T A;  3CC2 T;  4JPB W;  4QKU A;  4IUP A;  2L3R A;  4ZN1 A;  1JJ2 A;  4M77 G;  4Q5W A;  4FIB A;  1H92 A;  3JCM V;  1I5L A;  2RHX A;  2JTF A;  3JB9 H;  3CMA A;  1VQ4 A;  1Y7X A;  3GNF B;  2BZX A;  3L2W A;  4EPC A;  3G71 T;  1QVG A;  2XU8 A;  3RIR A;  4D8K A;  1VQ5 Q;  1M1F A;  4ELZ C;  2OTL A;  1VQN T;  2DX1 A;  2EYQ A;  4PLL A;  4BE2 A;  4ZN3 A;  1RAF B;  3FB9 A;  5M9O A;  4F7U F;  4PKC C;  3HPW A;  2Z0W A;  1NG2 A;  1NPR A;  2AZV A;  4MZP A;  2HL5 C;  2C06 A;  5LL6 S;  2FZC B;  2KRN A;  4IKF A;  1D1C A;  2BZ8 A;  3CCL T;  1KC8 R;  3PMT A;  2X51 A;  5GAO q;  3OS2 A;  1PRM C;  3GLX A;  2DEU A;  2DL7 A;  3UA6 A;  1M1K C;  2EJ9 A;  1DJ7 B;  4JJN K;  2LCS A;  2I0N A;  5GJV B;  1Y96 A;  5GMK l;  2YUN A;  3EFR A;  2CZ7 B;  3QBY A;  2HSP A;  1ZX6 A;  2XDD A;  3CME Q;  4ZGD B;  1RLQ C;  1HD3 A;  1FWZ A;  3O5Z A;  1ZLM A;  4MML A;  3THK A;  1RUW A;  3OA6 A;  3JRZ A;  3GF5 A;  3G4S Q;  3NPF A;  2ZPI B;  1YI2 T;  4M75 C;  3CCJ T;  5KYX A;  1YHQ T;  1KSW A;  1Y07 A;  2K5I A;  2EJF A;  1GBQ A;  1PG5 B;  4C5I A;  3CXC S;  2IG0 A;  3D7S B;  4RG2 A;  4YTL A;  2EYY A;  3CCR A;  1G2B A;  1V76 A;  1ACM B;  2MPX C;  3LWH A;  3EFO B;  2RHZ A;  1YNZ A;  3PNW C;  3I55 A;  2YRV A;  3VRY A;  1Z9Q A;  1NYF A;  4RUG A;  1BU1 A;  4JLG A;  1K1Z A;  2PNI A;  4X34 A;  4N0A A;  3CEY A;  2XD0 A;  2D1X A;  3OMC A;  1Q7Y U;  4C8Q D;  4Z8A A;  2VWF A;  1GBR A;  2WSE E;  1K73 R;  1WGS A;  1NPP A;  2RJF A;  3MP6 A;  4PNO A;  3VUB A;  4ZGJ B;  1H3Z A;  3X26 B;  2EWN A;  3RR6 A;  2JT4 A;  1VQK A;  3FLG A;  4M7A A;  2HD0 A;  1M3B A;  3V7S A;  4AFQ C;  1LNX A;  4OMM A;  1GCQ A;  1QWE A;  2EQK A;  2QQB A;  2DXT A;  3M0R A;  1FMK A;  2CS7 A;  2H3J A;  2JJ9 A;  2HCK A;  2YSQ A;  3RUX A;  1R0C B;  3CCQ A;  3JCM W;  1ZUY A;  1KHC A;  2LX9 A;  2OJ2 A;  4FSX A;  1YBY A;  5KYU A;  2HZY A;  3HSB A;  4RTY A;  2YWW A;  2CZ0 B;  3M56 A;  2SEM A;  2MOX A;  5I22 A;  3VUZ A;  3R6N A;  3LX7 A;  1YFN A;  1UEB A;  2ENM A;  3E19 A;  4KGX B;  2DTI A;  2X35 A;  2GFA A;  2LQN A;  2HBW A;  4XTZ A;  4C8Q A;  1TTH B;  2J05 A;  2JZ2 A;  2EFI A;  3P8B B;  1HXD A;  1KC8 U;  3UPU A;  3MEV A;  2NUT A;  1TSF A;  3CCE T;  1NJI R;  2Y90 A;  2F2V A;  2MI6 A;  3LW5 E;  4WCI A;  4LDY A;  4DBQ A;  2F2X A;  3OS0 A;  1OI1 A;  2OTJ Q;  3TSW A;  5KYW A;  2P0P A;  3QSU A;  1VQ5 A;  2YUQ A;  2OAU A;  4BD3 A;  3VS3 A;  5A0L A;  4AG2 C;  2O4X A;  1Y57 A;  3H0F A;  4HVW A;  1T0J A;  1M1K R;  2L89 A;  5CK9 A;  3HFN A;  2QTX A;  3GOX A;  4GLM A;  4AFZ C;  2RK1 A;  2VVK A;  5GAN 8;  1C1A A;  3SHW A;  2R58 A;  3H6Z A;  4J6W A;  1QCF A;  1MMD A;  2A3L A;  4EMH A;  1D1A A;  2D9T A;  2EW3 A;  2KEA A;  3EG0 A;  2LJ0 A;  4L59 A;  3CCV T;  4J9B A;  2LDM A;  2M0Y A;  3HTR A;  4LD9 K;  2GF7 A;  3H0I A;  3QPH A;  2KBT A;  1QCN A;  1VQN Q;  2EAY A;  1MMN A;  2AK5 A;  2LNV A;  1X01 A;  2GTJ A;  5KYN A;  1WXT A;  2M0O A;  3EG1 A;  2DJZ A;  4FT4 A;  4GLK A;  5CIU A;  5LJ3 j;  2P4T A;  1GRI A;  3SB2 A;  3CD6 T;  4ME7 A;  5DLQ E;  5DY9 A;  1N5Z A;  4JZ3 A;  1BI3 A;  1ZSZ A;  2HKN A;  1BK2 A;  3CME A;  5FW9 A;  4CI0 C;  1D0Z A;  1FMV A;  3BDU A;  3MCA B;  4LXC A;  3CBM A;  4HCC A;  3G4S A;  5IH2 A;  3CXC A;  3EG3 A;  3EH1 A;  2A7Y A;  1K73 U;  2EQI A;  2E65 A;  3QO3 A;  2KYM A;  3RER A;  1ZSZ B;  2CUD A;  2RN8 A;  3QHS A;  3L2U A;  4M7D C;  4MZT A;  2VGM A;  2KK4 A;  2PTK A;  4VUB A;  5I2S A;  3NTH A;  1B3Q A;  4M7A F;  2DBM A;  4FW1 A;  4PJO E;  1D3B A;  3CCU T;  2O9V A;  2EIF A;  1AVZ C;  1X43 A;  1H3H A;  5HK0 A;  2V1R A;  1UJY A;  2CP2 A;  2DMO A;  4PFO A;  3QWX X;  1ABO A;  1CKB A;  2CZ6 B;  3JCM h;  5GAM d;  3CCJ Q;  2M9U A;  1TH7 A;  1NZ9 A;  4KUL A;  1XOV A;  1ABQ A;  2CP6 A;  2FPD A;  1YHQ Q;  5GAM j;  2FL7 A;  2K3B A;  4O6J A;  1M9S A;  3PIO A;  3T9N A;  2QI2 A;  2M1H A;  2KI7 A;  4KBM B;  4F14 A;  4CC2 A;  3U23 A;  4JUV A;  1UUE A;  3M58 A;  4BDZ A;  3J81 E;  2I2L A;  4J6Y A;  5GAN d;  2LTO A;  4M75 B;  4XU3 A;  4C8Q F;  1VQL Q;  1NJI U;  5GAN j;  2VKN A;  2F5K A;  1XNI A;  4RKU E;  2LNH B;  4RTU A;  3REB B;  1FMW A;  2RJD A;  5KE3 A;  2E5Q A;  3CBP A;  1RLP C;  4QW2 A;  2AKL A;  5J26 A;  2A08 A;  1M1K U;  3WVE B;  1UDL A;  4M75 G;  2QDL A;  3OBW A;  4M77 E;  4RTZ A;  4DA4 A;  4RTV A;  2LP5 A;  2JMC A;  2DIQ A;  2Y4X A;  3G7Z A;  4BB7 A;  3RKW A;  2CT3 A;  1VQ9 T;  1SF9 A;  4IUU A;  4IUR A;  1VQ7 Q;  3JAM E;  1BKB A;  3JB9 I;  2HQH A;  3CC4 T;  1ZUK A;  4IUT A;  1KG1 A;  4CRI A;  1N8R C;  3JB9 J;  4D8D A;  4V2S A;  3EGD B;  3MPU B;  1RAC B;  2RJC A;  1O75 A;  3OYE A;  5L23 A;  2DD5 A;  5GAN 5;  2OTJ A;  1PNJ A;  3VS1 A;  4DBR A;  1RAH B;  3QXE B;  4OP0 A;  5LJ5 j;  3I56 Q;  3M0Q A;  2NUP B;  3NGP A;  5KH6 A;  2YRD A;  2AHJ B;  1UEC A;  1BI1 A;  3QJ6 A;  1WFW A;  3CCE Q;  1PM3 A;  4C5E A;  1K0S A;  2FVU A;  3EG9 A;  3AT1 B;  2JW4 A;  4RMO A;  4M4Z A;  2EKH A;  5DLO A;  3I5S A;  1WHG A;  1NEG A;  1PKT A;  1VQN A;  2E3I A;  4ELY C;  3JV3 A;  3GPL A;  2R5M A;  1CKA A;  1VUB A;  1AZG B;  1VOM A;  5A2Q E;  1QMC A;  2QGG A;  4OMN A;  1GL5 A;  2DYI A;  1QKX A;  1M8M A;  2VXE A;  4FW2 A;  2VGN A;  3OYL A;  2K2M A;  2MAM A;  4M7D D;  4N0A C;  4F7U B;  3M57 A;  2XIC A;  3CCV Q;  1GXI E;  2CSQ A;  1OOT A;  5J39 A;  5IXB A;  4X1V A;  4HA8 A;  2HL3 A;  1VA7 A;  1MNE A;  1B7T A;  3URG A;  4QVZ A;  1D0X A;  4M7A C;  3MEW A;  5KCH A;  4XQ3 A;  1W4S A;  3JCM b;  2LQW A;  1VQ8 Q;  1GCQ C;  1OEB A;  2QEX T;  1JBM A;  2DRK A;  2QQ9 A;  2ED1 A;  2C0O A;  1X6G A;  4F7U G;  1KIK A;  3JCM e;  4A4E A;  1JU5 C;  3LYI A;  4QVC A;  2M16 A;  1K8A C;  1WX6 A;  1QWF A;  1QW1 A;  1Q86 C;  4HXJ A;  1SSF A;  1W70 A;  3OBY A;  2VAS A;  2KE9 A;  3EGU A;  4E7H A;  3CCJ A;  2JS2 A;  2JMA A;  4M78 D;  3CC7 A;  3C94 A;  4X9D A;  2E41 A;  4LN2 A;  1JRI A;  5L8R E;  4R56 A;  3C95 A;  2K5L A;  4P5N A;  2LQK A;  2DL4 A;  1A0N B;  1RI0 A;  1UTI A;  1X2K A;  1MV0 B;  2ABL A;  1RI9 A;  3JB9 D;  1VQO Q;  1Q95 G;  1VYU A;  2E12 A;  2DER A;  1MV3 A;  4C8Q C;  2PVO B;  2DZC A;  4AFS C;  4GBQ A;  2LX7 A;  1VQL A;  4XU2 A;  2FRY A;  5CKF A;  4M7D B;  2QAS A;  4XTV A;  3VS6 A;  1JXM A;  2CZ1 B;  3CCS T;  3LLR A;  3AHU A;  4B9W A;  4MMK A;  1I1J A;  1WJR A;  3VS5 A;  1N8R R;  1WA7 A;  2LJ1 A;  2XKO C;  3JCM J;  1S72 T;  1AWX A;  1NE8 A;  2FZG B;  4FYV B;  4BY6 C;  3EHQ A;  1VYV A;  4C92 A;  4OGC A;  2CUB A;  2VC8 A;  3HRU A;  2DL8 A;  4M78 A;  3E1S A;  1IHV A;  3H8Z A;  3FDR A;  4JJB A;  2FEI A;  3DLM A;  3JCM X;  4J9E A;  4M7D G;  2PUK B;  2E10 A;  2RMO A;  2RF0 A;  1YJ9 T;  1VQ7 A;  5KYY B;  1WQW A;  5FLX E;  2LCC A;  4ZGE B;  3V8J A;  1JXO A;  1TU0 B;  2KDS A;  1Y0M A;  5CKB A;  2LQ8 A;  3PE0 A;  3WXM B;  3UF4 A;  2EKO A;  3OW2 P;  4LE9 A;  2QA4 Q;  4MZM A;  1WYX A;  1OPL A;  3OS1 A;  2ZPG B;  1AWJ A;  1RAE B;  1E6H A;  1WI7 A;  1UE9 A;  1WHM A;  1X2Q A;  3UDC A;  3L2R A;  1ARK A;  4E7L A;  2DL5 A;  1W2B S;  3X28 B;  1I5O B;  3I56 A;  3UAT A;  2CKK A;  2DM1 A;  2RI3 A;  5CKE A;  1VQ9 Q;  2F5T X;  3KUF A;  2QQA A;  1ZSZ C;  3QZ5 B;  5HKC A;  1OV3 A;  3IQL A;  1D1B A;  2DXB A;  3M4G A;  4FM4 B;  1GFC A;  1P92 A;  2YLB A;  1RL2 A;  3JB9 G;  4NOY A;  1YJN Q;  1YJW T;  1ZBX A;  2RH2 A;  4HT8 A;  2E1H A;  1ZUU A;  1V29 B;  2EJG A;  2YXY A;  4DOV A;  2WAC A;  1X75 C;  1YIJ T;  4AMC A;  2V8J A;  2COZ A;  1JQQ A;  3X20 B;  2DZ9 A;  1Y96 B;  2A28 A;  3UWN A;  3L2Z A;  1AWW A;  2EGE A;  1VQP T;  3EG2 A;  1LPL A;  1B07 A;  2LRQ A;  2HSE B;  2MMP A;  1K8A R;  2MWP A;  3OY9 A;  2LZ6 B;  1Q86 R;  4TVR A;  4M7A D;  2R5A A;  2HEQ A;  1MMA A;  4M7D F;  5I2M A;  4Z89 A;  2IPO B;  2PVD B;  3A8O B;  1R77 A;  1RAD B;  3MP8 A;  2E3H A;  5KYX B;  3OYY A;  5CO7 A;  4Z88 A;  1VQ8 A;  1SKU B;  1BCM A;  2AT1 B;  3OYD A;  3JCM g;  3VYH B;  1N8R U;  2R57 A;  2LMJ A;  2CT4 A;  3GNG A;  4L6V 5;  6AT1 B;  3JCM f;  3OQ5 A;  1V1C A;  3I9Q A;  1UB4 A;  2YT6 A;  4PJN A;  4E7S A;  4C0D C;  2M02 A;  4C92 F;  2KRM A;  3X25 B;  2KT8 A;  2RK2 A;  4PFP A;  5GAM g;  2EPD A;  2J7I A;  4M78 F;  3V8K A;  1VQO A;  3OSS C;  2NLU A;  1QP3 A;  2QEX Q;  2X4Y A;  1TG0 A;  3CBO A;  1WHK A;  2CP0 A;  1LCK A;  2DK3 A;  4Y28 E;  5GAO p;  3JB9 F;  1ZA2 B;  1M1G A;  4AT1 B;  2L3Q A;  2P4R A;  3CCM T;  2G3R A;  1X6O A;  4M75 E;  4OMO A;  5GAN g;  3BE3 A;  1IHW A;  2HNI A;  1JJ2 P;  4M7A B;  1T0H A;  2RM4 A;  4JRP A;  2X3X D;  2MYS A;  3G6E A;  1BIB A;  5GAO l;  2A36 A;  2LJ3 A;  5GAN f;  2AKK A;  3QZ9 B;  4J9D A;  1KFZ A;  3S3N A;  1EZZ B;  1M2O A;  1UG1 A;  3L1A A;  5IN1 A;  1TS9 A;  2EYX A;  3DB3 A;  5KYU B;  4II1 A;  2NUZ A;  1PCX A;  3KXT A;  1UHC A;  3CMA T;  1VQ4 T;  2FG0 A;  4X9C A;  2RQW A;  2K9G A;  5GMK j;  4NS5 A;  3R6O A;  1M27 C;  1M2V A;  4M7A G;  3E9F A;  3HRT A;  4UC4 A;  3CCS Q;  2OTL T;  4IUV A;  3VKI A;  2QA4 A;  2DAQ A;  3GBQ A;  1EIF A;  3I5R A;  1OUL A;  1YN8 A;  4C8Q B;  1W2B A;  1K76 A;  4Y92 A;  1M2V B;  4JDS A;  1JO8 A;  4L5G A;  1QVF S;  2NUT B;  1VQ6 Q;  1WZO A;  3CC2 Q;  3MKD A;  4OML A;  5CKH A;  1VQ9 A;  2J6O A;  3ULR B;  1WHH A;  4E47 A;  5KYW B;  3M54 A;  3G1J A;  4N4G A;  1PSE A;  3MO8 A;  1U8R A;  2KT1 A;  2O4X B;  5D7U A;  4C8Q G;  2YUO A;  1K8A U;  1IXD A;  4BY6 B;  2ZPB B;  1Q86 U;  3NHN A;  4ORZ A;  3M0S A;  2DLP A;  2PU9 B;  3M53 A;  4CC4 B;  2DEQ A;  2XID A;  1YJN A;  3G71 Q;  1GFD A;  1GCP A;  2K3Y A;  3C4S A;  1ZBJ A;  1AD5 A;  4OB3 B;  5A0D A;  1B34 A;  5LJ3 d;  4Y91 A;  4PJM A;  3M0U A;  4O5V A;  4RTT A;  3QJY A;  4XU0 A;  4ZTJ A;  4PLI A;  3FRN A;  3RKY A;  1AT1 B;  4DBF A;  2DTH A;  3CCR T;  1RAB B;  2K7A A;  3NFC A;  1X69 A;  3CCL Q;  1I4K 1;  2LT1 A;  2V1Q A;  1NM7 A;  2YUP A;  2KYB A;  4FYX B;  5LJ3 h;  3M55 A;  1EFN A;  4XAX B;  1N9S A;  3I55 T;  3H0H A;  4F7U E;  3S3O A;  4HVV A;  1MUZ A;  3OYJ A;  4XTU A;  1IGU A;  1YIJ Q;  4DEY A;  4DEX A;  3RNJ A;  2L3P A;  4JJD A;  2KR3 A;  5IHK A;  5IHN A;  2DD4 A;  5C0M A;  2CP3 A;  2QK0 A;  3LH5 A;  3TCJ A;  3VS2 A;  3H41 A;  4BDY A;  3SFM A;  4F17 A;  2DVJ A;  1YI2 Q;  4JJC A;  2CGH A;  2JOY A;  2HAX A;  5C6S A;  1D3B B;  4WF2 A;  2RQT A;  2DPP B;  4XTW A;  1YCY A;  3F70 A;  3UT1 A;  2MCN A;  1SHF A;  1N27 A;  1VQK T;  1M3C A;  4C92 C;  2AIR B;  2KXC A;  1FXX A;  4LDU A;  4M78 C;  2DA9 A;  2O2O A;  1MND A;  2SRC A;  3CCQ T;  5GAM h;  4QQG A;  3OYA A;  1WJQ A;  1UGV A;  2YDL A;  2OX7 A;  3LGF A;  2DFU A;  4KUD K;  4NL3 A;  1KHI A;  4EIK A;  5FRM A;  4EMK A;  3A8L B;  2EYW A;  3EGX A;  1BIA A;  2CYZ B;  4WTO B;  5GAN h;  1G83 A;  4RCB A;  2PZ1 A;  2BE7 D;  4M7D E;  4A53 A;  3OYM A;  5GAO m;  4OMF B;  1M8V A;  3CPF A;  3CQT A;  2XDP A;  1TXQ A;  2MWO A;  1UGQ B;  4LDX A;  4J9H A;  2ECZ A;  1PRL C;  1D0Y A;  3ME9 A;  5CAI A;  3M5A A;  3PVQ A;  4OB1 B;  2D0Q B;  4OGE A; 
#chains in the Genus database with same CATH homology
 1HD3 A;  2RQV A;  3O5Z A;  1ZLM A;  3THK A;  1UTI A;  1RUW A;  1X2K A;  2CDT A;  1MV0 B;  2ABL A;  2GBQ A;  1RI9 A;  3NPF A;  5FWB A;  3M0P A;  1KSW A;  1VYU A;  3SEM A;  1GBQ A;  1MV3 A;  2O9S A;  5GJW B;  2CSI A;  4AFS C;  4GBQ A;  2EYY A;  2LX7 A;  2KXD A;  4R0K A;  2FRY A;  1G2B A;  3VS6 A;  2W0Z A;  4LUE A;  1JXM A;  5I11 A;  3VS4 A;  1YNZ A;  3VRY A;  1Z9Q A;  1I1J A;  4J9I A;  2DRM A;  4KRT A;  1NYF A;  3VS5 A;  1NLO C;  1WA7 A;  4RUG A;  1BU1 A;  1H8K A;  2LJ1 A;  4JZ4 A;  1AWX A;  2DL4 A;  1K1Z A;  2PNI A;  3EHQ A;  1VYV A;  2CUB A;  2DL8 A;  3PVL A;  1NEB A;  2D1X A;  4HVU A;  4JJB A;  2FEI A;  4J9E A;  3VS0 A;  4IIM A;  2CRE A;  2RMO A;  2RF0 A;  4Z8A A;  2EVR A;  4AFU C;  2FPF A;  3FJ5 A;  2VWF A;  2M51 A;  1GBR A;  1JXO A;  1Y0M A;  2BTT A;  3PE0 A;  3UF4 A;  1HSQ A;  4LE9 A;  2DIL A;  2JT4 A;  1VYT A;  1M3B A;  4F16 A;  1WYX A;  1OPL A;  4AFQ C;  1YP5 A;  4OMM A;  1AWJ A;  1UFF A;  1M30 A;  4A63 B;  1GCQ A;  1E6H A;  1WI7 A;  1QWE A;  1UE9 A;  1X2Q A;  2J06 A;  3M0R A;  1FYN A;  1ARK A;  4OMQ A;  2DL5 A;  1FMK A;  2HCK A;  2NWM A;  2YSQ A;  1ZUY A;  3RBB B;  2D0N A;  2OJ2 A;  3NMZ C;  3UAT A;  2DM1 A;  2KRS A;  4RTY A;  5IHI A;  1SHG A;  1SSH A;  2SEM A;  2MOX A;  5I22 A;  1OV3 A;  3IQL A;  3R6N A;  1K9A A;  2ENM A;  1GFC A;  1T3L A;  1W6X A;  3M0T A;  2LQN A;  2L2P A;  2O31 A;  2HBW A;  1K0X A;  2DNU A;  2J05 A;  1AOJ A;  2FPE A;  2GTO A;  1X27 A;  2RPN A;  1ZUU A;  3KFV A;  2F2V A;  4E6R A;  2ROL A;  3EHR A;  1S1N A;  4WCI A;  2F2X A;  3A98 A;  3TSW A;  1AEY A;  1JQQ A;  2ESW A;  2YUQ A;  3VS3 A;  4AG2 C;  1Y57 A;  1X6B A;  1YWP A;  2W10 A;  3H0F A;  4HVW A;  1T0J A;  2A28 A;  1AWW A;  4FSS A;  2EGE A;  3EG2 A;  1BB9 A;  4GLM A;  4AFZ C;  2JS0 A;  1B07 A;  2VVK A;  2LZ6 B;  3SHW A;  1QCF A;  1JEG A;  2HEQ A;  2EW3 A;  2KEA A;  2KNB B;  3EG0 A;  1TUC A;  1ZSG A;  1SEM A;  2DYB A;  4Z89 A;  2EGA A;  2LJ0 A;  4J9F A;  1WIE A;  4J9B A;  2M0Y A;  1W1F A;  1YWO A;  3H0I A;  1U3O A;  2KBT A;  4Z88 A;  2H8H A;  1TUD A;  2AK5 A;  2JM9 A;  2GTJ A;  1WXT A;  3EG1 A;  1GRI A;  3C0C A;  2LMJ A;  2CT4 A;  1N5Z A;  4JZ3 A;  1V1C A;  1BK2 A;  1PWT A;  2JTE A;  3I9Q A;  5FW9 A;  2YT6 A;  1PKS A;  2KRM A;  2KT8 A;  4ESR A;  3I35 A;  2ROT A;  2EPD A;  2J7I A;  5IH2 A;  2XMF A;  2GGR A;  3EG3 A;  2K6D A;  1E6G A;  2RNA A;  1NLP C;  2EQI A;  2KYM A;  1WXU A;  5IXF A;  4CC3 A;  2CUD A;  1TG0 A;  2RN8 A;  4OMP A;  1LCK A;  2JM8 A;  1U06 A;  2PTK A;  2L3Q A;  2P4R A;  1B3Q A;  2DBM A;  2AZS A;  4OMO A;  2EGC A;  1U5S A;  2L0A A;  2O9V A;  1AVZ C;  1T0H A;  1X43 A;  1H3H A;  2EYZ A;  2X3X D;  2DL3 A;  2V1R A;  1UJY A;  2DMO A;  2IIM A;  2A36 A;  2LJ3 A;  2DJQ A;  3QWX X;  1ABO A;  2AKK A;  3VRZ A;  1CKB A;  2A37 A;  2O88 A;  4J9D A;  2ED0 A;  1KFZ A;  1UG1 A;  1XOV A;  1ABQ A;  2FPD A;  2G6F X;  2EYX A;  4ZNX A;  1WXB A;  2C0T A;  2K3B A;  2NUZ A;  3VS7 A;  1UHC A;  1SRL A;  2FG0 A;  2RQW A;  2K9G A;  4F14 A;  4CC2 A;  1M27 C;  3U23 A;  3QWY A;  1UUE A;  2J6K A;  1A0N B;  3GBQ A;  2CH4 W;  3I5R A;  1YN8 A;  2KGT A;  5HCK A;  1K76 A;  4Y92 A;  4RTX A;  2VKN A;  1Z9Z A;  1JO8 A;  2LNH B;  2CH4 A;  4RTU A;  3REB B;  4K11 A;  2DBK A;  1RLP C;  4CC7 A;  4OML A;  2AKL A;  1BBZ A;  2J6O A;  3UA7 A;  3ULR B;  2GNC A;  2A08 A;  3TVT A;  1UDL A;  2L3S A;  2QDL A;  4LNP A;  2RQU A;  4RTZ A;  3REA B;  2KT1 A;  4RTV A;  2LP5 A;  2JMC A;  2YUO A;  2RQR A;  1SPK A;  1IO6 A;  4LUD A;  1CSK A;  3NHN A;  2CT3 A;  4ORZ A;  1UHF A;  3M0S A;  2DLP A;  2OI3 A;  2B86 A;  4CC4 B;  1HJD A;  2D8H A;  1AZE A;  1GFD A;  2MIO A;  1ZUK A;  1NYG A;  1T3S A;  4J9G A;  1SRM A;  1WLP B;  4IIO A;  1GCP A;  1ZBJ A;  1AD5 A;  2J6F A;  4D8D A;  1QKW A;  4HCK A;  2KRO A;  2FRW A;  3M0U A;  2D8J A;  5L23 A;  1PNJ A;  3VS1 A;  4RTT A;  2FO0 A;  2OAW A;  1WDX A;  3M0Q A;  1OPK A;  1I07 A;  2K7A A;  3NGP A;  1X69 A;  2GQI A;  2V1Q A;  1NM7 A;  2YUP A;  2KYB A;  4J9C A;  1UEC A;  1EFN A;  1AWO A;  1E7O A;  1WFW A;  5EC7 A;  1J3T A;  3H0H A;  1K0S A;  4JPB W;  4HVV A;  2JW4 A;  1MUZ A;  4M4Z A;  2EKH A;  3TSZ A;  1K4U S;  4DEY A;  1KJW A;  4DEX A;  3RNJ A;  2L3P A;  1H92 A;  3I5S A;  1NEG A;  2KR3 A;  4JJD A;  2DF6 A;  5IHK A;  5IHN A;  1PKT A;  4QT7 A;  3LH5 A;  1QLY A;  3JV3 A;  1CKA A;  3VS2 A;  1AZG B;  1UJ0 A;  3H41 A;  5ECA A;  4OMN A;  2BZX A;  1YCS B;  4F17 A;  1I0C A;  1GL5 A;  2DVJ A;  2F2W A;  2EBP A;  1QKX A;  1M8M A;  4JJC A;  4D8K A;  2RQT A;  2DX1 A;  2K79 A;  2MCN A;  1SHF A;  2E5K A;  5FWC A;  1M3C A;  2K2M A;  2KXC A;  1M3A A;  2DA9 A;  2O2O A;  2SRC A;  1NG2 A;  3ZL7 C;  2AZV A;  2CSQ A;  1OOT A;  5IXB A;  4X1V A;  1UGV A;  2KRN A;  1VA7 A;  1PHT A;  2BZ8 A;  2YDL A;  1PRM C;  2DL7 A;  2LQW A;  4EIK A;  3UA6 A;  2EYW A;  1GCQ C;  1OEB A;  2DRK A;  2BZY A;  2C0O A;  2ED1 A;  1X6G A;  2LCS A;  1KIK A;  2I0N A;  4AG1 C;  5GJV B;  1G83 A;  1JU5 C;  2PZ1 A;  2YUN A;  1WX6 A;  1QWF A;  3CQT A;  4HXJ A;  1W70 A;  2HDA A;  2KE9 A;  2X3W D;  4J9H A;  2JS2 A;  2JMA A;  2ECZ A;  1PRL C;  4RTW A;  2HSP A;  2C0I A;  1ZX6 A;  2DE0 X;  3EGU A;  3PVQ A;  4LN2 A;  2JXB A;  1RLQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...