1CKBA

Structural basis for the specific interaction of lysine-containing proline-rich peptides with the n-terminal sh3 domain of c-crk
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C-CRK N-TERMINAL SH3 DOMAIN
publication title Structural basis for the specific interaction of lysine-containing proline-rich peptides with the N-terminal SH3 domain of c-Crk.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (oncogene protein/peptide)
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1995-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ckbA00
1FMKA 1GCPA 2H8HA 4HCKA 2RQUA 3EG3A 4RTVA 2JMCA 1YN8A 4R0KA 2RQVA 2YUQA 3M0PA 5GJWB 1PRMC 4OMPA 1QKWA 1OPKA 4J9HA 4Z8AA 1K76A 3TVTA 1NG2A 2ESWA 2W10A 5FW9A 2MIOA 1OEBA 2KGTA 2JT4A 3NPFA 1SHGA 2HSPA 4DEXA 1OOTA 1M3AA 5IXFA 2FRWA 2J6FA 1UTIA 1U5SA 1PRLC 1SPKA 2E5KA 3R6NA 3TSWA 1RUWA 3TSZA 2D0NA 1QCFA 2B86A 4RTYA 1WXTA 1HD3A 1GCQA 4DEYA 3C0CA 4HXJA 1NM7A 1Z9ZA 2W0ZA 4J9BA 3GBQA 4LUDA 2KR3A 1TUCA 3UA6A 1K0XA 3PVQA 2J05A 2LQNA 1B3QA 2DL4A 1BK2A 1QKXA 4JZ4A 2YT6A 4WCIA 2EPDA 3SHWA 4J9GA 2L3QA 2QDLA 1SRMA 1ZX6A 1ABOA 1QWEA 2RF0A 3VS5A 2CH4W 1I1JA 1GL5A 1UECA 4KRTA 3NHNA 2O9SA 2EW3A 4ORZA 4CC7A 2GNCA 1N5ZA 1WYXA 2OAWA 2DRMA 2AKLA 1AWJA 1AOJA 2RNAA 4JPBW 1JO8A 3VS6A 2OJ2A 1I07A 1UFFA 4JZ3A 4D8KA 1WXUA 2EBPA 4AG2C 5I22A 1X6GA 2FPDA 2O2OA 3EG0A 1SEMA 4IIOA 5L23A 2JTEA 2LP5A 2D1XA 2NUZA 1WX6A 3VRZA 1LCKA 1JU5C 2DL3A 2V1RA 2JM9A 2DRKA 1YCSB 1X2QA 2PNIA 3ULRB 2JS2A 1X43A 1ZLMA 2HCKA 3QWYA 4HVWA 1JEGA 4JJDA 4RTZA 2LJ1A 3VS1A 2O31A 2AK5A 4AFSC 2LX7A 2AZSA 1VA7A 1NEBA 1H92A 2KEAA 1UDLA 1UHCA 2A37A 1GRIA 4LUEA 3I5SA 2IIMA 1SHFA 4OMOA 2V1QA 2L0AA 2L3SA 5FWBA 1WI7A 2KXDA 2J06A 1X27A 2F2WA 4AFZC 1I0CA 1NEGA 3CQTA 3PVLA 1AD5A 3ZL7C 4ZNXA 2CSIA 1PHTA 1GCQC 1EFNA 1FYNA 2KYMA 2ECZA 3A98A 4AG1C 2C0TA 2LZ6B 3EG1A 1AWXA 1XOVA 1YWPA 1BBZA 4F17A 1PWTA 3M0SA 1MV0B 3VS2A 1CKAA 2GQIA 5FWCA 5IHNA 3I5RA 2HBWA 3JV3A 2VWFA 3UF4A 3KFVA 1YNZA 2CT3A 3THKA 4LE9A 1TG0A 1B07A 2ROTA 4AFQC 2GTJA 2ED0A 2KYBA 5IH2A 2DX1A 2O88A 1H3HA 2KRNA 1VYVA 2C0IA 4Y92A 4GBQA 4M4ZA 1K9AA 2MCNA 1CKBA 2A08A 3H0IA 3VS0A 3M0TA 1YP5A 1QWFA 1AEYA 1M30A 1V1CA 2I0NA 2LMJA 4OMNA 2PTKA 1PKSA 5HCKA 2P4RA 5I11A 1BB9A 2DE0X 4A63B 2DL5A 4J9EA 1BU1A 4RTTA 5ECAA 2LCSA 1G2BA 2GGRA 1Y0MA 1AWWA 1W70A 4J9FA 3VS3A 2EYYA 2EQIA 2DL7A 2RQTA 4D8DA 4GLMA 1HSQA 2DILA 3PE0A 2AKKA 2J7IA 1CSKA 3RNJA 2CT4A 4IIMA 2K2MA 1PNJA 1GBRA 1NYFA 2EGCA 2K9GA 3EHRA 2KBTA 2DM1A 2HEQA 2GBQA 3FJ5A 2EGEA 1K0SA 3LH5A 3IQLA 4JJCA 1ZSGA 4K11A 1UJ0A 1KFZA 2PZ1A 2RMOA 2CSQA 3REAB 4CC3A 1RI9A 4RTWA 1AVZC 3NMZC 2FPFA 1X69A 2DYBA 1MUZA 2O9VA 1X6BA 2NWMA 1TUDA 2G6FX 4EIKA 2RQRA 2DL8A 4Z89A 1M3CA 3VS7A 2J6KA 2JW4A 2X3XD 4X1VA 2CREA 2FG0A 1UGVA 4Z88A 1T3LA 1SRLA 1S1NA 2BZXA 2BTTA 3M0UA 1U06A 2EYXA 4RTXA 1G83A 1JXOA 2D8HA 1UUEA 1JXMA 2F2VA 1T0JA 1J3TA 1UE9A 2KE9A 2DF6A 2FEIA 2CH4A 5EC7A 1Z9QA 3VS4A 4OMQA 1A0NB 2DA9A 2ED1A 1E7OA 4ESRA 1WLPB 3VRYA 1AZEA 2YUNA 1WFWA 3NGPA 1WIEA 2X3WD 1K1ZA 1SSHA 2A36A 2DBKA 3O5ZA 2RPNA 1VYTA 1UHFA 1QLYA 1JQQA 1RLQC 1M27C 2DNUA 2EVRA 1GBQA 4F16A 1HJDA 1RLPC 1H8KA 3U23A 1PKTA 1OV3A 2ROLA 3I9QA 2KT8A 1X2KA 2JMAA 1E6HA 2LJ3A 3QWXX 3REBB 4J9IA 2LNHB 2BZYA 2K79A 2K7AA 4HVUA 3SEMA 1ZUKA 2GTOA 1ZBJA 2KRSA 2SRCA 2K3BA 4HVVA 2YUOA 4RUGA 4F14A 4FSSA 1T3SA 2JS0A 2EYWA 1NYGA 4OMLA 2J6OA 4CC4B 4LNPA 1IO6A 1NLPC 2CUBA 5GJVB 4JJBA 1VYUA 1ZUUA 1GFDA 1WA7A 2L2PA 1M8MA 1UG1A 2RN8A 4J9CA 2KT1A 5IXBA 5IHIA 1KIKA 3RBBB 3M0QA 2M0YA 3UATA 2YDLA 2KNBB 1WXBA 2YUPA 3H41A 2DLPA 2FO0A 2RQWA 2ENMA 1UJYA 3EHQA 1AZGB 2VVKA 1KSWA 1W1FA 1KJWA 2DVJA 3I35A 3UA7A 2C0OA 3H0FA 4J9DA 2FRYA 2DBMA 2EKHA 1Y57A 1YWOA 2HDAA 1AWOA 4CC2A 3H0HA 2EYZA 2OI3A 2LQWA 4AFUC 2K6DA 1OPLA 2ABLA 1NLOC 1ZUYA 1MV3A 5IHKA 2FPEA 2M51A 2JXBA 3EG2A 4OMMA 2KXCA 2YSQA 1GFCA 2VKNA 2XMFA 2L3PA 1K4US 2LJ0A 2A28A 1M3BA 1WDXA 1ABQA 2DMOA 2CUDA 2JM8A 4RTUA 2BZ8A 2F2XA 1W6XA 4LN2A 2CDTA 4QT7A 3M0RA 1U3OA 2DJQA 2AZVA 3EGUA 1E6GA 4E6RA 1ARKA 2SEMA 2D8JA 2MOXA 2KRMA 1T0HA 2KROA 2EGAA
chains in the Genus database with same CATH superfamily
1FMKA 2RQUA 2VC8A 4RTVA 4E7SA 2HD0A 1YN8A 4BDYA 1UGSB 1NE8A 3I56A 1JRIA 2YUQA 5GJWB 4JS5A 5LJ3g 2EJ9A 1K76A 4M7DB 5LJ5d 3NPFA 2X51A 3CCQQ 4JLIA 3BE3A 1VQKQ 5IXFA 2DERA 1QP2A 1U5SA 5I2SA 1PRLC 4BE2A 3R6NA 2KK4A 2G3RA 3CCST 1HD3A 1GCQA 4DEYA 2YWWA 6AT1B 2OTLQ 4HXJA 1NM7A 1Z9ZA 1M2OA 2CKKA 4IUUA 3LWHA 3RERA 3L2UA 5LJ3h 1SF9A 1H3ZA 5LL6S 1WNLA 5GMKj 5FU7B 4DA4A 3OYGA 1BI2A 1BK2A 4LD9K 1I5OB 4C5EA 3PFSA 2PUKB 4DBHA 1BYMA 1ZX6A 1H641 1HK9A 3VS5A 2CH4W 1NPRA 3CMAT 4PJOB 2ZCFB 3LGLA 1AHJB 4F7UB 2OAWA 4DOVA 2XDBA 1JJ2S 3A8OB 5GAOm 2ZAEA 1JO8A 3VS6A 4XQ3A 1Y96A 4LD6A 4HCZA 3X20B 3OY9A 3CCMA 3QHSA 2DYIA 1OU9A 1VQ4A 1SEMA 4MZMA 1X6OA 2JTEA 5CK9A 1TTHB 5GAMf 1LCKA 5GANd 1ZSZA 3CCLT 3CC7Q 5FU6B 1X2QA 3ULRB 3MKDA 2JS2A 1ZLMA 1KQ1A 4HVWA 3MP1A 1VQLA 3DLLA 4M78E 3CC4T 1VQ9T 3CCVT 3CC2A 2AZSA 3QPHA 1WHMA 1RAAB 2P0QA 1NEBA 3JCMJ 2KEAA 5DY9A 2GFUA 1UHCA 2A37A 3I5SA 1TXQA 1SHFA 1OZ3A 4C5GA 5GMKm 2MI6A 3HP9A 5GAOn 2LT1A 4B6MA 2L3SA 7AT1B 1FWZA 2PVDB 2KXDA 2J06A 1X27A 2FZKB 4FL6A 4C5IA 3NFCA 9ATCB 3CPWA 1S72A 2E3HA 1RI0A 3PMTA 1EFNA 2KYMA 2JJ9A 2QXFA 4AG1C 2C0TA 2H3JA 4A4EA 2EKOA 4M7AG 3JSCA 1KQSA 5GMKe 2XHCA 3HPWA 1YWPA 1HXDA 4F17A 3M0SA 4C8QF 4BY6C 1PCXA 4M77A 5IHNA 3I5RA 2V26A 2VWFA 3UF4A 3HKSA 3KFVA 4M75G 1YNZA 4FSXA 2CT3A 4FT4A 3CCJA 1TG0A 4MZPA 4Z02A 1B07A 4FT2A 2KYBA 4F04B 5IH2A 2QA4A 1PM3A 4Y92A 3VJPA 4M4ZA 4AT1B 4MDWA 1YITA 8ATCB 1TU0B 2Y4XA 2YRCA 3H0IA 3VS0A 1KQSP 3L2WA 2XDDA 4MDXA 4J6WA 3H8ZA 1VQNT 2P4RA 2QGFB 5I11A 5EG2A 4C92E 4ZTFA 4A63B 3FLGA 3M5AA 5I2MA 2GGRA 3MCAB 5GAN7 3OA6A 1Y0MA 3VS3A 3L2VA 4JDSA 2EQIA 2RQTA 4M7DF 4GLMA 4XU3A 5J39A 1CSKA 3VU3C 5AYFA 2CT4A 1W2BS 2K2MA 1XTDA 1NYFA 2K9GA 1TS9A 2DM1A 2HEQA 2GBQA 3FJ5A 1K0SA 3M59A 1ZSGA 3ME9A 1KG1A 3C12A 2KSSA 1IZ6A 1KFZA 1LJOA 3A1PA 3JCMb 2KMTA 4NL3A 1YJ9T 1M1GA 1RI9A 1RAEB 3QJYA 4RG2A 5CIUA 3MO8A 5GAN3 1M90C 5LJ3d 1LOJA 2HQEA 2DYBA 3DKMA 1FMWA 1N9SA 1TUDA 3RMSA 3JB9I 2RQRA 3P8DA 2DL8A 4RKUE 4Z89A 1M3CA 4FW2A 4OF1A 3VS7A 3JAME 2J6KA 2CREA 2RK2A 3JCMV 2FG0A 1UGVA 3OYLA 4Z88A 1BI1A 1S1NA 2RO0A 1M90R 2BZXA 2BTTA 1RAFB 4RTXA 2RHXA 3OYYA 4PJOF 4C8QA 3SWNB 2CZ6B 2KE9A 2E6ZA 3OSVA 4UC4A 4F7UF 1KHCA 2ED1A 2VGNA 4XU0A 3KXTA 3OYAA 1AZEA 1N27A 2YUNA 3M53A 5CQXA 1VQ8A 1R8OB 1UB4A 3SDZA 1D1CA 3HFOA 4M78C 4QW2A 1VQ5A 1G3WA 1QVGS 2XU8A 2QEXA 1K73U 2DKGA 1WHHA 1LNXA 2M0OA 1S72Q 5KYWA 3G4ST 2DNUA 3NTHA 3Q1JA 4OGCA 3U23A 2HKNA 2D9TA 1OV3A 4JRPA 3VYGA 4LXCA 3QG1A 3OYMA 2BZYA 2K79A 3V7SA 4PFZA 1VQ6Q 5CO7A 4M7DA 3SB2A 2RI5A 5I21A 5IT9E 1YHQA 4M7AE 2X9HA 5LJ5g 1T3SA 4FYWB 1NYGA 2CZ0B 4CC4B 4ELYC 1IO6A 1VQOT 3FDRA 4LDYA 2DPPB 3AHUA 1ZUUA 8AT1B 3META 2P0KA 1YITQ 4KGZB 4M75E 3M4GA 2NUTB 3WVDB 2KT1A 3G71T 3CCRQ 4JJNK 1VQMT 1IXDA 1KIKA 2R57A 3QO3A 3MJXA 2M0YA 2YDLA 1ZSZB 2KNBB 1WXBA 2RD1A 4BE0A 4R56A 3QZ9B 2E4HA 2RQWA 2ZPIB 1RADB 1JB0E 3CD6Q 3UA7A 3NTKA 1VOMA 4V2SA 1BKBA 4C0GA 1VQPT 1AWOA 1BIAA 4B9XA 2EYZA 3CCEQ 2FVUA 5LJ5h 2K6DA 4EMKC 5GAMj 2OTJT 2KVQG 4KH0B 4OGEA 3BW1A 3C94A 4C92C 2V8KA 2JOYA 4PJOA 2VKNA 1I8FA 1O9SA 4IUPA 2K3XA 4F7UA 1IGUA 1M3BA 2KY9A 2YHTA 2F2XA 3CMEQ 1KHIA 1KD1R 4LN2A 4RMOA 4XTYA 3GNGA 1U3OA 2EWNA 3JB9G 2K5FA 4A4GA 1ARKA 3L2RA 1B7TA 1GCPA 3OS2A 1G3YA 1RACB 3G6ET 4M77B 3BDUA 1D1AA 3GLXA 2DXBA 2JMCA 3CCQA 2BIVA 2EQKA 5GANg 4M77D 1FMVA 4N4HA 1XQHA 4IUQA 5D6YA 1OPKA 1JJ2A 4Z8AA 1NG2A 5CKEA 5AT1B 2OTLA 4DBQA 2DXTA 2CS7A 1VQ8Q 1OOTA 2WSCE 3JCMd 3GOXA 2LC4A 1UTIA 4X9DA 4BI4A 3MP8A 1M5Q1 4ZGEB 1Q81R 3TSWA 3TEEA 1RUWA 1UGQB 4PJNA 3TSZA 2D0NA 4KH1B 2DJZA 4AMCA 1WXTA 3N5BB 2COYA 5GANh 2KR3A 3I56T 4QQ6A 2CGHA 3CCUQ 3QKJA 1B3QA 2DAQA 2DL4A 1QKXA 3VV0A 2YT6A 1OYXA 2QYZA 3SHWA 5GAMe 1YHQQ 2PUOB 3GP8A 2A7YA 1SRMA 1QWEA 2RF0A 5FLXE 1KD1U 3LX7A 4KRTA 2GNCA 4M78G 1WYXA 1I5LA 1AWJA 5C0MA 3RKYA 1AOJA 2CP0A 3CC7A 3H6ZA 3QIIA 1EX4A 3TCJA 4BACA 4KULA 4A4HA 4D8KA 3M57A 2O2OA 4IIOA 5HK3A 4C8QB 3CBMA 2QGGA 3GPLA 1YJWQ 4MZTA 4C8QD 3S3NA 1WHKA 2VUBA 1V29B 2CP2A 2DL3A 2FYKA 1YCSB 4J7FA 2RB6A 1JEGA 1X43A 4JJDA 4PNOA 5LJ5f 4RTZA 2LJ1A 3I55Q 4QVCA 2WSEE 3URGA 1K8AR 2EQMA 2AK5A 3HL8A 3LLRA 5GAOp 1VA7A 2AT1B 4E7JA 2CYZB 4VUBA 1G5VA 3CXCP 1H92A 1Q81U 1NBEB 3HFNA 1BCOA 3M54A 3OYKA 5KYWB 1GRIA 2GF7A 5GAN6 2EFIA 5GAN5 2F1LA 2Y4YA 4A4KA 2L0AA 1WGSA 3QDFA 3CCMT 1WI7A 2ZPFB 2F2WA 5DM7R 1VQ4T 1BI0A 3CQTA 3PVLA 1AD5A 1W2BA 4ZNXA 1PHTA 5D7UA 1FYNA 1QVFP 2ECZA 3A98A 1YIJA 4M7DD 5GAOl 1XOVA 2E64A 2COZA 1C6VX 4YTLA 3SWNA 5CKHA 1BBZA 2B8AA 4C92G 1VQLT 1WJQA 3QYHB 2AHJB 3CC2T 1CKAA 1OU8A 2FB7A 1I81A 3JV3A 4QQGA 4D6WA 2QI2A 4LE9A 1W2BP 3E9FA 2QTXA 3A8GB 2DX1A 1H3HA 2KRNA 3G1JA 4GBQA 4KGXB 5DLQE 2EAYA 1MNDA 2PQWA 1V1CA 4M77F 3X28B 2COWA 3OBWA 4OMNA 1UGPB 5HCKA 1VQ7Q 1M1FA 3C4SA 5GMKl 4J9EA 3M9QA 2QQAA 2LVMA 3F70A 1G2BA 5GANf 2YRDA 4J9FA 2EYYA 2P84A 4PJOD 1W4SA 3RMQA 1HSQA 1K8AU 3RNJA 1QVGA 1TUGB 1Y7XA 3CCJT 2EGCA 4KT0E 3EHRA 2KAFA 1YI2T 4J5YA 2QA4T 3LH5A 3IQLA 1BI3A 2P0PA 2L8DA 2NUTA 4BD3A 2ZGWA 4BB7A 2PZ1A 2RMOA 2CSQA 3REAB 4CC3A 2FZGB 2F5KA 3QYGB 2X4YA 5CQYA 2JTFA 1NPPA 1U8RA 4BI3A 2O9VA 1QVGP 4EIKA 2X35A 4C0DC 2EYQA 2DZCA 3FRNA 4M7AA 2L3RA 1T3LA 1SRLA 3DLMA 1JXOA 2KQWA 2LT4A 3T9NA 4E7IA 3BDLA 3CCSA 4OMQA 1EIFA 4GLKA 5CKFA 1A0NB 1ZBXA 1R0BG 4ANJA 3UPUA 1F1BB 4CI0C 2O4XA 4RCCA 4BE1A 2WSFE 1WFWA 2X4JA 1WIEA 4X9CA 2X3WD 4MMKA 4NOYA 3OMGA 2RHYA 4M78B 4KUDK 1VQ6A 1JQQA 3CXCS 3PIPA 2K4YA 3J7AF 1WJRA 3RIRA 2YLBA 1GBQA 1HJDA 1IB8A 1YIJQ 1YJNQ 2R58A 3OYHA 4J6YA 4XTZA 3H9NA 3REBB 1N6AA 2GCXA 4J9IA 4LDUA 3JB9H 1U1TA 3SEMA 1QP3A 2KRSA 2NUPA 2VXFA 3CCRA 1NJIC 1QVFS 2JS0A 2EYWA 4FU6A 1MMAA 4L6V5 4LNPA 5FU7C 1NLPC 3CD6A 3JCMg 3FIFA 2CUBA 3MHXA 1VYUA 1VQ5T 2QEXT 2PU9B 2L2PA 2QQBA 3CCEA 5LJ3f 3L2ZA 1NJIR 5IXBA 4JS4A 5CCAA 3M0QA 3UATA 2BKDN 2FO0A 2ENMA 2I2LA 4PJOC 2LDMA 1KJWA 2C0OA 4KGVB 2FRYA 2EKHA 2HL5C 2HDAA 4FIBA 2DD4A 4CC2A 3H0HA 3CMEA 3DB3A 2OI3A 1X75C 2LQWA 3E19A 3A5ZB 4N0AA 2ABLA 2M51A 2RHZA 1BIBA 2JXBA 4RCBA 3JCMh 2A0FB 4FCYA 2XMFA 4C92B 2L3PA 1K4US 1Q7YC 4NS5A 1ZA1B 2LJ0A 1WDXA 1ABQA 5KE2A 2DMOA 2CUDA 2X4XA 3RESA 1W6XA 2KDSA 4ZTJA 5GAOr 3OB9A 1KC8C 1IGQA 4E7KA 5FU6C 3PIOA 3JB9F 1E6GA 1M2VB 2JUFA 5CVIA 2D8JA 2MOXA 1Q7YR 2KRMA 1T0HA 2ZZDA 3ZEHA 3ZBDA 1G3TA 4ZN1A 2HQXA 2DTOA 4HCKA 4R55A 3J81E 1OX8A 4OB0B 5KH6A 4C5HA 4HCCA 3M0PA 2YXYA 1PRMC 4OMFB 4OMPA 4J9HA 3BY7A 3CCSQ 3S3OA 3TVTA 2ESWA 5FW9A 2MIOA 1OEBA 2KGTA 3VUBA 2HSPA 4DEXA 4MMLA 3GNFB 1M3AA 2E12A 2FRWA 3VYHB 1NJIU 1V76A 2HNIA 3CCUA 2HKQB 3RKWA 3KBGA 5A0GA 2B86A 3TQ7P 2XG8D 1UEBA 2QK0A 4Y28E 3R6OA 2LQKA 1YFNA 3GBQA 2ZPGB 3M58A 3CCQT 2R5AA 2NLUA 1VQKT 1AT1B 1K0XA 1G3SA 1WZOA 3UA6A 3CMAQ 2FHDA 2DTIA 2DZ9A 2J05A 2NYSA 3EGDA 2QQSA 4JZ4A 5GANj 1QMCA 4WCIA 1PSEA 1YJ9A 2HQHA 2L3QA 2L89A 3L2QA 3EFRA 2QDLA 1Q82C 2OTLT 3J80E 3X25B 1ABOA 2DFUA 4CRIA 1I1JA 3NHNA 2CP3A 1RL2A 5LJ5e 4CC7A 2LQ8A 3OQ5A 4M78F 1QQJA 1M90U 2RA2A 3KUFA 1YJWA 3INZA 2DRMA 1Q7YU 2M1HA 1Q86C 3CCLQ 4E7LA 1Q82R 1WHLA 2PVOB 2DEQA 3EGXB 4M7AB 5DLOA 5L8RE 1DJ7B 4JZ3A 4J6XA 3CC4Q 1VQ9Q 5I22A 3I55A 1K9MC 1LVKA 2FPDA 3ER0A 4O5VA 3EG0A 1ZA2B 1PD1A 3CCVQ 5L23A 3ASKA 2H3EB 4OVAA 4M77E 3VRZA 2YRVA 2X4WA 4M75B 2V1RA 4HT9A 2JM9A 1N8RC 2DRKA 4OB2B 2K3YA 2DIQA 2PNIA 3PTAA 2O4XB 4WTOB 2HBPA 1K9MR 2IVWA 4AFSC 2M02A 2RHUA 3JCMf 3SD4A 2EQUA 3OS1A 1SKUB 3FC3A 1VIFA 1GXIE 1C0MA 4OMOA 2V1QA 1N8RR 3CC7T 4ATOA 2MPXC 3SWNC 5FWBA 4FM4B 4PJOG 1NEGA 1M8VA 1VUBA 2E1HA 3MPUB 2M9UA 2RJFA 2CSIA 2NUPB 1GCQC 1RABB 3EG1A 1MNEA 1AWXA 4XTWA 4C92F 1U1SA 1C1AA 5GANe 3O8VA 1WQWA 3M4YA 5FWCA 1VQMA 4XTUA 2RJDA 1XJWB 2QG9B 1HYOA 1N9RA 2IPOB 4LDXA 3THKA 1VQNQ 4XU1A 3RDVA 1VQ7A 5CR2A 4N4IA 4AFQC 2GTJA 5GAMg 4M78A 4FYVB 1TOVA 1B34A 2C0IA 1K9AA 4J8OA 2MCNA 4IUTA 2CP5A 2ZPEB 1I4K1 3M0TA 3OMCA 1AEYA 2OTJA 1M30A 4QVZA 4PK4A 2I0NA 5LJ3j 2VYTA 3EFOA 4C0ZA 3EH1A 2LCSA 1UGRB 4C8QE 1R77A 1XNIA 1W70A 1YJ9Q 1M9SA 4D8DA 1K9MU 2DILA 1ZSZC 3PE0A 2XD0A 2FL7A 4IIMA 3CXCA 5GAMh 2EGEA 4JJCA 2CZ7B 3OS0A 4K11A 4C0FA 3EH2A 5A0DA 3M55A 1AVZC 2E10A 3NMZC 2FPFA 5FRMA 3C95A 1QVFA 3S6WA 2DIGA 3OYFA 4HCBA 1G8XA 2CP6A 2RJEA 4M7DE 3LWIA 2GQVA 3OSSC 2JW4A 4X1VA 2A3LA 2X3XD 1YCYA 4QKUA 1PSFA 3V8KA 2BE9B 2EQJA 4ELZC 4C92A 2QQ9A 2MMPA 2D8HA 2IG0A 2BUDA 4FYXB 1JXMA 1J3TA 1UE9A 1WJSA 2FEIA 2HZYA 3QUIA 2VV5A 4M77C 5D6WA 1Z9QA 3OYBA 3OYEA 3G4SQ 2DA9A 3V7RA 1E7OA 2D6FA 3UT1A 4BI8B 3VRYA 1YJNA 4M7AF 3OW2S 2Y90A 1K1ZA 1M2VA 3E2UA 2ATCB 4O6JA 1SSHA 2DBKA 3S3MA 1VYTA 1FX7A 1QLYA 1D1BA 1X01A 4JRKA 1WHGA 4EMHA 3GIBA 3EGDB 2V8IA 3P8HA 4PKCC 5KE3A 2K5LA 1RLQC 1M27C 4BY6B 2EVRA 2WACA 5LJ3e 4M75F 1D0YA 1RLPC 3HRTA 3PGGA 1PKTA 1D09B 1VQOQ 3TREA 1X2KA 1EZZB 2JMAA 4PJOE 2LJ3A 3QWXX 2LNHB 3LYIA 5KYYA 3FEOA 4F7UE 1ZUKA 2GTOA 2JVVA 2QTVA 3RKXA 4L5GA 3G71Q 2SRCA 1S72T 4GY5A 1VQMQ 4HVVA 2YUOA 4RUGA 3P8BB 4F14A 4OB3B 2J6OA 4KBMB 5KYNA 5GJVB 2MWPA 4JJBA 3JB9D 1MMDA 1WA7A 4JRIA 1VQPQ 1MMNA 2F69A 1VQ6T 1M8MA 2C06A 3VUZA 2LRQA 2EIFA 2JNGA 3UWNA 2M16A 4N0AC 5IHIA 2OTJQ 3RBBB 1ZHIA 3JCMP 2DLPA 1UJYA 1KSWA 1ACMB 3I35A 1OZ2A 3H0FA 4XAXB 4J9DA 2FZCB 5HY6A 2DBMA 1Y57A 2CP7A 2VASA 5CKBA 4KUIA 1YITT 2DTHA 3PT9A 4OB1B 4AFUC 3CCRT 1OPLA 2LNVA 5IHKA 2FPEA 4PJLA 5KYXA 2LCCA 1OQKA 3EG2A 2KXCA 2YSQA 1GFCA 3QXEB 2DXUA 5KYUB 3CD6T 4C8QC 2VXEA 2EJGA 2QASA 2A28A 2AIRB 2XDPA 1R0CB 2K5IA 2BZ8A 4RTUA 4ZGJB 3G6EQ 2E5QA 3CCET 5CKDA 4E7HA 3EGXA 4IURA 2RI2A 3MEAA 4QT7A 2V8JA 2DJQA 2AZVA 1RAHB 4E6RA 1Y71A 4HA8A 1D3BB 2KROA 2EGAA 3MEUA 4B9WA 2E65A 5GAN8 2H8HA 4M75A 3CMET 3EG3A 1MHNA 1Y07A 3EG9A 1ZQ1A 1QW1A 4R0KA 5GAMd 2RQVA 3UDCA 1QKWA 2DVEA 2VB6A 2HL3A 4M7DC 1B34B 3PMIA 2W10A 3A8HB 1IHVA 4A4FA 4M78D 3M56A 2JT4A 1SHGA 4ME7A 3OS5A 2E41A 3I56Q 2J6FA 1D0XA 3CMAA 3EFOB 1SPKA 2E5KA 1BCMA 1MGQA 2XICA 5GMKh 1QCFA 4RTYA 2L5QA 4XTXA 2XIDA 2P4TA 3C0CA 2MK5A 2W0ZA 4J9BA 1K73C 4LUDA 3D7SB 1VQ8T 3BFMA 3CPWP 1TUCA 3FB9A 4LDWA 1OX9A 1YI2A 2OAUA 3PVQA 3GF5A 3QSUA 2LQNA 3RUXA 3JCMQ 4A54A 2EPDA 4J9GA 2LCLA 5KCOA 2RHIA 5CAIA 2K2VA 3CCLA 4M77G 1K73R 5A0LA 1PD0A 4RG8A 2DETA 1VQ9A 3CC4A 1GL5A 3HTRA 1UECA 2HSEB 3CCVA 3CCUT 2O9SA 2EW3A 4ORZA 1N5ZA 3MEWA 2AKLA 3JCMe 2YLCA 1M1KC 3JCMc 4X34A 1YHQT 2RNAA 4JPBW 5J26A 2F5TX 2OJ2A 4EMKB 1I07A 1UFFA 4WF2A 1WXUA 2EBPA 4AG2C 3V8LA 1X6GA 1O75A 5LJ5j 1YBYA 2DD5A 2LP5A 4C92D 2D1XA 2NUZA 1WX6A 1M1KR 3CEYA 1JU5C 5GAN2 1TSFA 3JCMW 3CCMQ 3FJPA 2HCKA 3QWYA 4TVRA 3OYNA 3PNWC 1OULA 4J7IA 3VS1A 1VQ4Q 2O31A 4HT8A 2LX7A 3QJ6A 2E70A 1UDLA 1YJWT 1WQ7A 4QQDA 4Y91A 4EDUA 1KC8R 1JBMA 2JN0A 4LUEA 1NZ9A 3WVEB 2IIMA 2E3IA 2EJFA 5HKCA 3VKIA 4ZN3A 1VQLQ 3I55T 4ZGDB 3A8LB 4AFZC 1I0CA 3CC2Q 5KYYB 3ZL7C 5D6XA 2DXCA 2XK0A 3L42A 1VQNA 2LZ6B 3A8MB 3OBYA 4JLGA 2MAMA 3CBOA 1LPLA 1RAIB 3LGFA 1PWTA 1PG5B 3HRSA 1MV0B 3CPFA 1PC0A 4C8QG 2HAXA 3VS2A 2GQIA 2HBWA 4PLLA 2QQRA 3QBYA 3LH0A 4FW1A 2D0QB 5GAOq 3OYIA 2ROTA 2ED0A 2O88A 1VYVA 3MEVA 1CKBA 2A08A 1P92A 1YP5A 1QWFA 2LMJA 3OYCA 2Z0WA 4XK8E 2PTKA 1PKSA 5HK0A 3CCJQ 1Q95G 5J3BA 1Y96B 4QVDA 4DOWA 1BB9A 1IHWA 2DE0X 2DL5A 5KYXB 4RTTA 1BU1A 5ECAA 1YI2Q 2JTMA 2VGMA 2XI9A 3ZFJA 1M1KU 2QA4Q 1AWWA 3V8JA 3EFSA 5M9OA 3OW2A 5KCHA 2DEUA 2DL7A 4L59A 2RM4A 4M7DG 2AKKA 2J7IA 2R5MA 3CPWS 3HSBA 1PNJA 1VQ7T 1GBRA 2KBTA 1KC8U 2BE7D 4M7AD 3DB4A 2K57A 4DQ2A 2QDYB 1KQSS 1UJ0A 4BUGA 4PFOA 3OYJA 1KD1C 2RH2A 4JUVA 1Q86R 3LW5E 4RTWA 2OX7A 5IAYA 3HRUA 4II1A 2KI7A 3WXMB 3OW2P 1WPYA 3EG9B 1X69A 3AT1B 4M75D 1D0ZA 5FROA 4A53A 2MWOA 4IKFA 1MUZA 1X6BA 2NWMA 2G6FX 4BDZA 4PJMA 3G4SA 4PFPA 5FRNA 3JRZA 3E1SA 3L1AA 5KYUA 1TWBA 3M0UA 1U06A 2EYXA 1G83A 1RAGB 4XTVA 1UUEA 4P5NA 2F2VA 5A2QE 4OP0A 1T0JA 3E9GA 1WHJA 2DF6A 2CH4A 5EC7A 4F7UG 4FYYB 3VS4A 4ESRA 3MP6A 3RR6A 1WLPB 1IRXA 1VQKA 1VQOA 3NGPA 4E2FB 5GAN4 1D3BA 2A36A 3O5ZA 1Q81C 5IN1A 1SG5A 2RPNA 2CZ1B 1UHFA 4EMGA 3TU4K 3G71A 2QAZA 1VIEA 4F16A 1H8KA 3JB9J 2ROLA 2JZ2A 1SSFA 3I9QA 2E6NA 2KT8A 3QZ5B 1E6HA 1Q82U 1VQ5Q 3JCMX 2QEXQ 2K7AA 1VQPA 4HVUA 1ZBJA 4Q5WA 2K3BA 4JRQA 1QCOA 4NL2A 2DO3A 1QCNA 4FSSA 4E47A 1JJ2P 1YIJT 1YJNT 4OMLA 4DBFA 4DBRA 2RJCA 2DK3A 4HKEA 1Q86U 1GFDA 3SFMA 3X26B 1MMGA 3OYDA 1KQ2A 1UG1A 2RN8A 4J9CA 4N4GA 1FXXA 2O01E 1OI1A 2RK1A 2ZPHB 2PVGB 4XU2A 3QDRB 2YUPA 2HMAA 3H41A 3EAEA 3EHQA 1AZGB 2VVKA 2DVJA 1W1FA 1IREB 1M4ZA 2LX9A 4E7ZA 2XKOC 3G7ZA 2RI3A 1N8RU 1YWOA 1TH7A 3G6EA 2GFAA 2LTOA 4M7AC 1NLOC 1ZUYA 1MV3A 4J83A 4LDVA 4OMMA 3NTIA 1K8AC 3V7CA 4PJJA 5C6SA 2ZPBB 2JM8A 3X24B 1QVPA 4EPCA 4M75C 4C0DB 2CDTA 2MF2A 4EMKA 2MYSA 3M0RA 4PL6A 3CBPA 3EGUA 1KK7A 5GMKi 2SEMA 4IUVA 4PLIA 3HHTB
chains in the Genus database with same CATH topology
1FMKA 1GCPA 2H8HA 4HCKA 2RQUA 3EG3A 4RTVA 2JMCA 1YN8A 4R0KA 2RQVA 2YUQA 3M0PA 5GJWB 1PRMC 4OMPA 1QKWA 1OPKA 4J9HA 4Z8AA 1K76A 3TVTA 1NG2A 2ESWA 2W10A 5FW9A 2MIOA 1OEBA 2KGTA 2JT4A 3NPFA 1SHGA 2HSPA 4DEXA 1OOTA 1M3AA 5IXFA 2FRWA 2J6FA 1UTIA 1U5SA 1PRLC 1SPKA 2E5KA 3R6NA 3TSWA 1RUWA 3TSZA 2D0NA 1QCFA 2B86A 4RTYA 1WXTA 1HD3A 1GCQA 4DEYA 3C0CA 4HXJA 1NM7A 1Z9ZA 2W0ZA 4J9BA 3GBQA 4LUDA 2KR3A 1TUCA 3UA6A 1K0XA 3PVQA 2J05A 2LQNA 1B3QA 2DL4A 1BK2A 1QKXA 4JZ4A 2YT6A 4WCIA 2EPDA 3SHWA 4J9GA 2L3QA 2QDLA 1SRMA 1ZX6A 1ABOA 1QWEA 2RF0A 3VS5A 2CH4W 1I1JA 1GL5A 1UECA 4KRTA 3NHNA 2O9SA 2EW3A 4ORZA 4CC7A 2GNCA 1N5ZA 1WYXA 2OAWA 2DRMA 2AKLA 1AWJA 1AOJA 2RNAA 4JPBW 1JO8A 3VS6A 2OJ2A 1I07A 1UFFA 4JZ3A 4D8KA 1WXUA 2EBPA 4AG2C 5I22A 1X6GA 2FPDA 2O2OA 3EG0A 1SEMA 4IIOA 5L23A 2JTEA 2LP5A 2D1XA 2NUZA 1WX6A 3VRZA 1LCKA 1JU5C 2DL3A 2V1RA 2JM9A 2DRKA 1YCSB 1X2QA 2PNIA 3ULRB 2JS2A 1X43A 1ZLMA 2HCKA 3QWYA 4HVWA 1JEGA 4JJDA 4RTZA 2LJ1A 3VS1A 2O31A 2AK5A 4AFSC 2LX7A 2AZSA 1VA7A 1NEBA 1H92A 2KEAA 1UDLA 1UHCA 2A37A 1GRIA 4LUEA 3I5SA 2IIMA 1SHFA 4OMOA 2V1QA 2L0AA 2L3SA 5FWBA 1WI7A 2KXDA 2J06A 1X27A 2F2WA 4AFZC 1I0CA 1NEGA 3CQTA 3PVLA 1AD5A 3ZL7C 4ZNXA 2CSIA 1PHTA 1GCQC 1EFNA 1FYNA 2KYMA 2ECZA 3A98A 4AG1C 2C0TA 2LZ6B 3EG1A 1AWXA 1XOVA 1YWPA 1BBZA 4F17A 1PWTA 3M0SA 1MV0B 3VS2A 1CKAA 2GQIA 5FWCA 5IHNA 3I5RA 2HBWA 3JV3A 2VWFA 3UF4A 3KFVA 1YNZA 2CT3A 3THKA 4LE9A 1TG0A 1B07A 2ROTA 4AFQC 2GTJA 2ED0A 2KYBA 5IH2A 2DX1A 2O88A 1H3HA 2KRNA 1VYVA 2C0IA 4Y92A 4GBQA 4M4ZA 1K9AA 2MCNA 1CKBA 2A08A 3H0IA 3VS0A 3M0TA 1YP5A 1QWFA 1AEYA 1M30A 1V1CA 2I0NA 2LMJA 4OMNA 2PTKA 1PKSA 5HCKA 2P4RA 5I11A 1BB9A 2DE0X 4A63B 2DL5A 4J9EA 1BU1A 4RTTA 5ECAA 2LCSA 1G2BA 2GGRA 1Y0MA 1AWWA 1W70A 4J9FA 3VS3A 2EYYA 2EQIA 2DL7A 2RQTA 4D8DA 4GLMA 1HSQA 2DILA 3PE0A 2AKKA 2J7IA 1CSKA 3RNJA 2CT4A 4IIMA 2K2MA 1PNJA 1GBRA 1NYFA 2EGCA 2K9GA 3EHRA 2KBTA 2DM1A 2HEQA 2GBQA 3FJ5A 2EGEA 1K0SA 3LH5A 3IQLA 4JJCA 1ZSGA 4K11A 1UJ0A 1KFZA 2PZ1A 2RMOA 2CSQA 3REAB 4CC3A 1RI9A 4RTWA 1AVZC 3NMZC 2FPFA 1X69A 2DYBA 1MUZA 2O9VA 1X6BA 2NWMA 1TUDA 2G6FX 4EIKA 2RQRA 2DL8A 4Z89A 1M3CA 3VS7A 2J6KA 2JW4A 2X3XD 4X1VA 2CREA 2FG0A 1UGVA 4Z88A 1T3LA 1SRLA 1S1NA 2BZXA 2BTTA 3M0UA 1U06A 2EYXA 4RTXA 1G83A 1JXOA 2D8HA 1UUEA 1JXMA 2F2VA 1T0JA 1J3TA 1UE9A 2KE9A 2DF6A 2FEIA 2CH4A 5EC7A 1Z9QA 3VS4A 4OMQA 1A0NB 2DA9A 2ED1A 1E7OA 4ESRA 1WLPB 3VRYA 1AZEA 2YUNA 1WFWA 3NGPA 1WIEA 2X3WD 1K1ZA 1SSHA 2A36A 2DBKA 3O5ZA 2RPNA 1VYTA 1UHFA 1QLYA 1JQQA 1RLQC 1M27C 2DNUA 2EVRA 1GBQA 4F16A 1HJDA 1RLPC 1H8KA 3U23A 1PKTA 1OV3A 2ROLA 3I9QA 2KT8A 1X2KA 2JMAA 1E6HA 2LJ3A 3QWXX 3REBB 4J9IA 2LNHB 2BZYA 2K79A 2K7AA 4HVUA 3SEMA 1ZUKA 2GTOA 1ZBJA 2KRSA 2SRCA 2K3BA 4HVVA 2YUOA 4RUGA 4F14A 4FSSA 1T3SA 2JS0A 2EYWA 1NYGA 4OMLA 2J6OA 4CC4B 4LNPA 1IO6A 1NLPC 2CUBA 5GJVB 4JJBA 1VYUA 1ZUUA 1GFDA 1WA7A 2L2PA 1M8MA 1UG1A 2RN8A 4J9CA 2KT1A 5IXBA 5IHIA 1KIKA 3RBBB 3M0QA 2M0YA 3UATA 2YDLA 2KNBB 1WXBA 2YUPA 3H41A 2DLPA 2FO0A 2RQWA 2ENMA 1UJYA 3EHQA 1AZGB 2VVKA 1KSWA 1W1FA 1KJWA 2DVJA 3I35A 3UA7A 2C0OA 3H0FA 4J9DA 2FRYA 2DBMA 2EKHA 1Y57A 1YWOA 2HDAA 1AWOA 4CC2A 3H0HA 2EYZA 2OI3A 2LQWA 4AFUC 2K6DA 1OPLA 2ABLA 1NLOC 1ZUYA 1MV3A 5IHKA 2FPEA 2M51A 2JXBA 3EG2A 4OMMA 2KXCA 2YSQA 1GFCA 2VKNA 2XMFA 2L3PA 1K4US 2LJ0A 2A28A 1M3BA 1WDXA 1ABQA 2DMOA 2CUDA 2JM8A 4RTUA 2BZ8A 2F2XA 1W6XA 4LN2A 2CDTA 4QT7A 3M0RA 1U3OA 2DJQA 2AZVA 3EGUA 1E6GA 4E6RA 1ARKA 2SEMA 2D8JA 2MOXA 2KRMA 1T0HA 2KROA 2EGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FMK A;  1GCP A;  2H8H A;  4HCK A;  2RQU A;  3EG3 A;  4RTV A;  2JMC A;  1YN8 A;  4R0K A;  2RQV A;  2YUQ A;  3M0P A;  5GJW B;  1PRM C;  4OMP A;  1QKW A;  1OPK A;  4J9H A;  4Z8A A;  1K76 A;  3TVT A;  1NG2 A;  2ESW A;  2W10 A;  5FW9 A;  2MIO A;  1OEB A;  2KGT A;  2JT4 A;  3NPF A;  1SHG A;  2HSP A;  4DEX A;  1OOT A;  1M3A A;  5IXF A;  2FRW A;  2J6F A;  1UTI A;  1U5S A;  1PRL C;  1SPK A;  2E5K A;  3R6N A;  3TSW A;  1RUW A;  3TSZ A;  2D0N A;  1QCF A;  2B86 A;  4RTY A;  1WXT A;  1HD3 A;  1GCQ A;  4DEY A;  3C0C A;  4HXJ A;  1NM7 A;  1Z9Z A;  2W0Z A;  4J9B A;  3GBQ A;  4LUD A;  2KR3 A;  1TUC A;  3UA6 A;  1K0X A;  3PVQ A;  2J05 A;  2LQN A;  1B3Q A;  2DL4 A;  1BK2 A;  1QKX A;  4JZ4 A;  2YT6 A;  4WCI A;  2EPD A;  3SHW A;  4J9G A;  2L3Q A;  2QDL A;  1SRM A;  1ZX6 A;  1ABO A;  1QWE A;  2RF0 A;  3VS5 A;  2CH4 W;  1I1J A;  1GL5 A;  1UEC A;  4KRT A;  3NHN A;  2O9S A;  2EW3 A;  4ORZ A;  4CC7 A;  2GNC A;  1N5Z A;  1WYX A;  2OAW A;  2DRM A;  2AKL A;  1AWJ A;  1AOJ A;  2RNA A;  4JPB W;  1JO8 A;  3VS6 A;  2OJ2 A;  1I07 A;  1UFF A;  4JZ3 A;  4D8K A;  1WXU A;  2EBP A;  4AG2 C;  5I22 A;  1X6G A;  2FPD A;  2O2O A;  3EG0 A;  1SEM A;  4IIO A;  5L23 A;  2JTE A;  2LP5 A;  2D1X A;  2NUZ A;  1WX6 A;  3VRZ A;  1LCK A;  1JU5 C;  2DL3 A;  2V1R A;  2JM9 A;  2DRK A;  1YCS B;  1X2Q A;  2PNI A;  3ULR B;  2JS2 A;  1X43 A;  1ZLM A;  2HCK A;  3QWY A;  4HVW A;  1JEG A;  4JJD A;  4RTZ A;  2LJ1 A;  3VS1 A;  2O31 A;  2AK5 A;  4AFS C;  2LX7 A;  2AZS A;  1VA7 A;  1NEB A;  1H92 A;  2KEA A;  1UDL A;  1UHC A;  2A37 A;  1GRI A;  4LUE A;  3I5S A;  2IIM A;  1SHF A;  4OMO A;  2V1Q A;  2L0A A;  2L3S A;  5FWB A;  1WI7 A;  2KXD A;  2J06 A;  1X27 A;  2F2W A;  4AFZ C;  1I0C A;  1NEG A;  3CQT A;  3PVL A;  1AD5 A;  3ZL7 C;  4ZNX A;  2CSI A;  1PHT A;  1GCQ C;  1EFN A;  1FYN A;  2KYM A;  2ECZ A;  3A98 A;  4AG1 C;  2C0T A;  2LZ6 B;  3EG1 A;  1AWX A;  1XOV A;  1YWP A;  1BBZ A;  4F17 A;  1PWT A;  3M0S A;  1MV0 B;  3VS2 A;  1CKA A;  2GQI A;  5FWC A;  5IHN A;  3I5R A;  2HBW A;  3JV3 A;  2VWF A;  3UF4 A;  3KFV A;  1YNZ A;  2CT3 A;  3THK A;  4LE9 A;  1TG0 A;  1B07 A;  2ROT A;  4AFQ C;  2GTJ A;  2ED0 A;  2KYB A;  5IH2 A;  2DX1 A;  2O88 A;  1H3H A;  2KRN A;  1VYV A;  2C0I A;  4Y92 A;  4GBQ A;  4M4Z A;  1K9A A;  2MCN A;  1CKB A;  2A08 A;  3H0I A;  3VS0 A;  3M0T A;  1YP5 A;  1QWF A;  1AEY A;  1M30 A;  1V1C A;  2I0N A;  2LMJ A;  4OMN A;  2PTK A;  1PKS A;  5HCK A;  2P4R A;  5I11 A;  1BB9 A;  2DE0 X;  4A63 B;  2DL5 A;  4J9E A;  1BU1 A;  4RTT A;  5ECA A;  2LCS A;  1G2B A;  2GGR A;  1Y0M A;  1AWW A;  1W70 A;  4J9F A;  3VS3 A;  2EYY A;  2EQI A;  2DL7 A;  2RQT A;  4D8D A;  4GLM A;  1HSQ A;  2DIL A;  3PE0 A;  2AKK A;  2J7I A;  1CSK A;  3RNJ A;  2CT4 A;  4IIM A;  2K2M A;  1PNJ A;  1GBR A;  1NYF A;  2EGC A;  2K9G A;  3EHR A;  2KBT A;  2DM1 A;  2HEQ A;  2GBQ A;  3FJ5 A;  2EGE A;  1K0S A;  3LH5 A;  3IQL A;  4JJC A;  1ZSG A;  4K11 A;  1UJ0 A;  1KFZ A;  2PZ1 A;  2RMO A;  2CSQ A;  3REA B;  4CC3 A;  1RI9 A;  4RTW A;  1AVZ C;  3NMZ C;  2FPF A;  1X69 A;  2DYB A;  1MUZ A;  2O9V A;  1X6B A;  2NWM A;  1TUD A;  2G6F X;  4EIK A;  2RQR A;  2DL8 A;  4Z89 A;  1M3C A;  3VS7 A;  2J6K A;  2JW4 A;  2X3X D;  4X1V A;  2CRE A;  2FG0 A;  1UGV A;  4Z88 A;  1T3L A;  1SRL A;  1S1N A;  2BZX A;  2BTT A;  3M0U A;  1U06 A;  2EYX A;  4RTX A;  1G83 A;  1JXO A;  2D8H A;  1UUE A;  1JXM A;  2F2V A;  1T0J A;  1J3T A;  1UE9 A;  2KE9 A;  2DF6 A;  2FEI A;  2CH4 A;  5EC7 A;  1Z9Q A;  3VS4 A;  4OMQ A;  1A0N B;  2DA9 A;  2ED1 A;  1E7O A;  4ESR A;  1WLP B;  3VRY A;  1AZE A;  2YUN A;  1WFW A;  3NGP A;  1WIE A;  2X3W D;  1K1Z A;  1SSH A;  2A36 A;  2DBK A;  3O5Z A;  2RPN A;  1VYT A;  1UHF A;  1QLY A;  1JQQ A;  1RLQ C;  1M27 C;  2DNU A;  2EVR A;  1GBQ A;  4F16 A;  1HJD A;  1RLP C;  1H8K A;  3U23 A;  1PKT A;  1OV3 A;  2ROL A;  3I9Q A;  2KT8 A;  1X2K A;  2JMA A;  1E6H A;  2LJ3 A;  3QWX X;  3REB B;  4J9I A;  2LNH B;  2BZY A;  2K79 A;  2K7A A;  4HVU A;  3SEM A;  1ZUK A;  2GTO A;  1ZBJ A;  2KRS A;  2SRC A;  2K3B A;  4HVV A;  2YUO A;  4RUG A;  4F14 A;  4FSS A;  1T3S A;  2JS0 A;  2EYW A;  1NYG A;  4OML A;  2J6O A;  4CC4 B;  4LNP A;  1IO6 A;  1NLP C;  2CUB A;  5GJV B;  4JJB A;  1VYU A;  1ZUU A;  1GFD A;  1WA7 A;  2L2P A;  1M8M A;  1UG1 A;  2RN8 A;  4J9C A;  2KT1 A;  5IXB A;  5IHI A;  1KIK A;  3RBB B;  3M0Q A;  2M0Y A;  3UAT A;  2YDL A;  2KNB B;  1WXB A;  2YUP A;  3H41 A;  2DLP A;  2FO0 A;  2RQW A;  2ENM A;  1UJY A;  3EHQ A;  1AZG B;  2VVK A;  1KSW A;  1W1F A;  1KJW A;  2DVJ A;  3I35 A;  3UA7 A;  2C0O A;  3H0F A;  4J9D A;  2FRY A;  2DBM A;  2EKH A;  1Y57 A;  1YWO A;  2HDA A;  1AWO A;  4CC2 A;  3H0H A;  2EYZ A;  2OI3 A;  2LQW A;  4AFU C;  2K6D A;  1OPL A;  2ABL A;  1NLO C;  1ZUY A;  1MV3 A;  5IHK A;  2FPE A;  2M51 A;  2JXB A;  3EG2 A;  4OMM A;  2KXC A;  2YSQ A;  1GFC A;  2VKN A;  2XMF A;  2L3P A;  1K4U S;  2LJ0 A;  2A28 A;  1M3B A;  1WDX A;  1ABQ A;  2DMO A;  2CUD A;  2JM8 A;  4RTU A;  2BZ8 A;  2F2X A;  1W6X A;  4LN2 A;  2CDT A;  4QT7 A;  3M0R A;  1U3O A;  2DJQ A;  2AZV A;  3EGU A;  1E6G A;  4E6R A;  1ARK A;  2SEM A;  2D8J A;  2MOX A;  2KRM A;  1T0H A;  2KRO A;  2EGA A; 
#chains in the Genus database with same CATH topology
 1FMK A;  2RQU A;  2VC8 A;  4RTV A;  4E7S A;  2HD0 A;  1YN8 A;  4BDY A;  1UGS B;  1NE8 A;  3I56 A;  1JRI A;  2YUQ A;  5GJW B;  4JS5 A;  5LJ3 g;  2EJ9 A;  1K76 A;  4M7D B;  5LJ5 d;  3NPF A;  2X51 A;  3CCQ Q;  4JLI A;  3BE3 A;  1VQK Q;  5IXF A;  2DER A;  1QP2 A;  1U5S A;  5I2S A;  1PRL C;  4BE2 A;  3R6N A;  2KK4 A;  2G3R A;  3CCS T;  1HD3 A;  1GCQ A;  4DEY A;  2YWW A;  6AT1 B;  2OTL Q;  4HXJ A;  1NM7 A;  1Z9Z A;  1M2O A;  2CKK A;  4IUU A;  3LWH A;  3RER A;  3L2U A;  5LJ3 h;  1SF9 A;  1H3Z A;  5LL6 S;  1WNL A;  5GMK j;  5FU7 B;  4DA4 A;  3OYG A;  1BI2 A;  1BK2 A;  4LD9 K;  1I5O B;  4C5E A;  3PFS A;  2PUK B;  4DBH A;  1BYM A;  1ZX6 A;  1H64 1;  1HK9 A;  3VS5 A;  2CH4 W;  1NPR A;  3CMA T;  4PJO B;  2ZCF B;  3LGL A;  1AHJ B;  4F7U B;  2OAW A;  4DOV A;  2XDB A;  1JJ2 S;  3A8O B;  5GAO m;  2ZAE A;  1JO8 A;  3VS6 A;  4XQ3 A;  1Y96 A;  4LD6 A;  4HCZ A;  3X20 B;  3OY9 A;  3CCM A;  3QHS A;  2DYI A;  1OU9 A;  1VQ4 A;  1SEM A;  4MZM A;  1X6O A;  2JTE A;  5CK9 A;  1TTH B;  5GAM f;  1LCK A;  5GAN d;  1ZSZ A;  3CCL T;  3CC7 Q;  5FU6 B;  1X2Q A;  3ULR B;  3MKD A;  2JS2 A;  1ZLM A;  1KQ1 A;  4HVW A;  3MP1 A;  1VQL A;  3DLL A;  4M78 E;  3CC4 T;  1VQ9 T;  3CCV T;  3CC2 A;  2AZS A;  3QPH A;  1WHM A;  1RAA B;  2P0Q A;  1NEB A;  3JCM J;  2KEA A;  5DY9 A;  2GFU A;  1UHC A;  2A37 A;  3I5S A;  1TXQ A;  1SHF A;  1OZ3 A;  4C5G A;  5GMK m;  2MI6 A;  3HP9 A;  5GAO n;  2LT1 A;  4B6M A;  2L3S A;  7AT1 B;  1FWZ A;  2PVD B;  2KXD A;  2J06 A;  1X27 A;  2FZK B;  4FL6 A;  4C5I A;  3NFC A;  9ATC B;  3CPW A;  1S72 A;  2E3H A;  1RI0 A;  3PMT A;  1EFN A;  2KYM A;  2JJ9 A;  2QXF A;  4AG1 C;  2C0T A;  2H3J A;  4A4E A;  2EKO A;  4M7A G;  3JSC A;  1KQS A;  5GMK e;  2XHC A;  3HPW A;  1YWP A;  1HXD A;  4F17 A;  3M0S A;  4C8Q F;  4BY6 C;  1PCX A;  4M77 A;  5IHN A;  3I5R A;  2V26 A;  2VWF A;  3UF4 A;  3HKS A;  3KFV A;  4M75 G;  1YNZ A;  4FSX A;  2CT3 A;  4FT4 A;  3CCJ A;  1TG0 A;  4MZP A;  4Z02 A;  1B07 A;  4FT2 A;  2KYB A;  4F04 B;  5IH2 A;  2QA4 A;  1PM3 A;  4Y92 A;  3VJP A;  4M4Z A;  4AT1 B;  4MDW A;  1YIT A;  8ATC B;  1TU0 B;  2Y4X A;  2YRC A;  3H0I A;  3VS0 A;  1KQS P;  3L2W A;  2XDD A;  4MDX A;  4J6W A;  3H8Z A;  1VQN T;  2P4R A;  2QGF B;  5I11 A;  5EG2 A;  4C92 E;  4ZTF A;  4A63 B;  3FLG A;  3M5A A;  5I2M A;  2GGR A;  3MCA B;  5GAN 7;  3OA6 A;  1Y0M A;  3VS3 A;  3L2V A;  4JDS A;  2EQI A;  2RQT A;  4M7D F;  4GLM A;  4XU3 A;  5J39 A;  1CSK A;  3VU3 C;  5AYF A;  2CT4 A;  1W2B S;  2K2M A;  1XTD A;  1NYF A;  2K9G A;  1TS9 A;  2DM1 A;  2HEQ A;  2GBQ A;  3FJ5 A;  1K0S A;  3M59 A;  1ZSG A;  3ME9 A;  1KG1 A;  3C12 A;  2KSS A;  1IZ6 A;  1KFZ A;  1LJO A;  3A1P A;  3JCM b;  2KMT A;  4NL3 A;  1YJ9 T;  1M1G A;  1RI9 A;  1RAE B;  3QJY A;  4RG2 A;  5CIU A;  3MO8 A;  5GAN 3;  1M90 C;  5LJ3 d;  1LOJ A;  2HQE A;  2DYB A;  3DKM A;  1FMW A;  1N9S A;  1TUD A;  3RMS A;  3JB9 I;  2RQR A;  3P8D A;  2DL8 A;  4RKU E;  4Z89 A;  1M3C A;  4FW2 A;  4OF1 A;  3VS7 A;  3JAM E;  2J6K A;  2CRE A;  2RK2 A;  3JCM V;  2FG0 A;  1UGV A;  3OYL A;  4Z88 A;  1BI1 A;  1S1N A;  2RO0 A;  1M90 R;  2BZX A;  2BTT A;  1RAF B;  4RTX A;  2RHX A;  3OYY A;  4PJO F;  4C8Q A;  3SWN B;  2CZ6 B;  2KE9 A;  2E6Z A;  3OSV A;  4UC4 A;  4F7U F;  1KHC A;  2ED1 A;  2VGN A;  4XU0 A;  3KXT A;  3OYA A;  1AZE A;  1N27 A;  2YUN A;  3M53 A;  5CQX A;  1VQ8 A;  1R8O B;  1UB4 A;  3SDZ A;  1D1C A;  3HFO A;  4M78 C;  4QW2 A;  1VQ5 A;  1G3W A;  1QVG S;  2XU8 A;  2QEX A;  1K73 U;  2DKG A;  1WHH A;  1LNX A;  2M0O A;  1S72 Q;  5KYW A;  3G4S T;  2DNU A;  3NTH A;  3Q1J A;  4OGC A;  3U23 A;  2HKN A;  2D9T A;  1OV3 A;  4JRP A;  3VYG A;  4LXC A;  3QG1 A;  3OYM A;  2BZY A;  2K79 A;  3V7S A;  4PFZ A;  1VQ6 Q;  5CO7 A;  4M7D A;  3SB2 A;  2RI5 A;  5I21 A;  5IT9 E;  1YHQ A;  4M7A E;  2X9H A;  5LJ5 g;  1T3S A;  4FYW B;  1NYG A;  2CZ0 B;  4CC4 B;  4ELY C;  1IO6 A;  1VQO T;  3FDR A;  4LDY A;  2DPP B;  3AHU A;  1ZUU A;  8AT1 B;  3MET A;  2P0K A;  1YIT Q;  4KGZ B;  4M75 E;  3M4G A;  2NUT B;  3WVD B;  2KT1 A;  3G71 T;  3CCR Q;  4JJN K;  1VQM T;  1IXD A;  1KIK A;  2R57 A;  3QO3 A;  3MJX A;  2M0Y A;  2YDL A;  1ZSZ B;  2KNB B;  1WXB A;  2RD1 A;  4BE0 A;  4R56 A;  3QZ9 B;  2E4H A;  2RQW A;  2ZPI B;  1RAD B;  1JB0 E;  3CD6 Q;  3UA7 A;  3NTK A;  1VOM A;  4V2S A;  1BKB A;  4C0G A;  1VQP T;  1AWO A;  1BIA A;  4B9X A;  2EYZ A;  3CCE Q;  2FVU A;  5LJ5 h;  2K6D A;  4EMK C;  5GAM j;  2OTJ T;  2KVQ G;  4KH0 B;  4OGE A;  3BW1 A;  3C94 A;  4C92 C;  2V8K A;  2JOY A;  4PJO A;  2VKN A;  1I8F A;  1O9S A;  4IUP A;  2K3X A;  4F7U A;  1IGU A;  1M3B A;  2KY9 A;  2YHT A;  2F2X A;  3CME Q;  1KHI A;  1KD1 R;  4LN2 A;  4RMO A;  4XTY A;  3GNG A;  1U3O A;  2EWN A;  3JB9 G;  2K5F A;  4A4G A;  1ARK A;  3L2R A;  1B7T A;  1GCP A;  3OS2 A;  1G3Y A;  1RAC B;  3G6E T;  4M77 B;  3BDU A;  1D1A A;  3GLX A;  2DXB A;  2JMC A;  3CCQ A;  2BIV A;  2EQK A;  5GAN g;  4M77 D;  1FMV A;  4N4H A;  1XQH A;  4IUQ A;  5D6Y A;  1OPK A;  1JJ2 A;  4Z8A A;  1NG2 A;  5CKE A;  5AT1 B;  2OTL A;  4DBQ A;  2DXT A;  2CS7 A;  1VQ8 Q;  1OOT A;  2WSC E;  3JCM d;  3GOX A;  2LC4 A;  1UTI A;  4X9D A;  4BI4 A;  3MP8 A;  1M5Q 1;  4ZGE B;  1Q81 R;  3TSW A;  3TEE A;  1RUW A;  1UGQ B;  4PJN A;  3TSZ A;  2D0N A;  4KH1 B;  2DJZ A;  4AMC A;  1WXT A;  3N5B B;  2COY A;  5GAN h;  2KR3 A;  3I56 T;  4QQ6 A;  2CGH A;  3CCU Q;  3QKJ A;  1B3Q A;  2DAQ A;  2DL4 A;  1QKX A;  3VV0 A;  2YT6 A;  1OYX A;  2QYZ A;  3SHW A;  5GAM e;  1YHQ Q;  2PUO B;  3GP8 A;  2A7Y A;  1SRM A;  1QWE A;  2RF0 A;  5FLX E;  1KD1 U;  3LX7 A;  4KRT A;  2GNC A;  4M78 G;  1WYX A;  1I5L A;  1AWJ A;  5C0M A;  3RKY A;  1AOJ A;  2CP0 A;  3CC7 A;  3H6Z A;  3QII A;  1EX4 A;  3TCJ A;  4BAC A;  4KUL A;  4A4H A;  4D8K A;  3M57 A;  2O2O A;  4IIO A;  5HK3 A;  4C8Q B;  3CBM A;  2QGG A;  3GPL A;  1YJW Q;  4MZT A;  4C8Q D;  3S3N A;  1WHK A;  2VUB A;  1V29 B;  2CP2 A;  2DL3 A;  2FYK A;  1YCS B;  4J7F A;  2RB6 A;  1JEG A;  1X43 A;  4JJD A;  4PNO A;  5LJ5 f;  4RTZ A;  2LJ1 A;  3I55 Q;  4QVC A;  2WSE E;  3URG A;  1K8A R;  2EQM A;  2AK5 A;  3HL8 A;  3LLR A;  5GAO p;  1VA7 A;  2AT1 B;  4E7J A;  2CYZ B;  4VUB A;  1G5V A;  3CXC P;  1H92 A;  1Q81 U;  1NBE B;  3HFN A;  1BCO A;  3M54 A;  3OYK A;  5KYW B;  1GRI A;  2GF7 A;  5GAN 6;  2EFI A;  5GAN 5;  2F1L A;  2Y4Y A;  4A4K A;  2L0A A;  1WGS A;  3QDF A;  3CCM T;  1WI7 A;  2ZPF B;  2F2W A;  5DM7 R;  1VQ4 T;  1BI0 A;  3CQT A;  3PVL A;  1AD5 A;  1W2B A;  4ZNX A;  1PHT A;  5D7U A;  1FYN A;  1QVF P;  2ECZ A;  3A98 A;  1YIJ A;  4M7D D;  5GAO l;  1XOV A;  2E64 A;  2COZ A;  1C6V X;  4YTL A;  3SWN A;  5CKH A;  1BBZ A;  2B8A A;  4C92 G;  1VQL T;  1WJQ A;  3QYH B;  2AHJ B;  3CC2 T;  1CKA A;  1OU8 A;  2FB7 A;  1I81 A;  3JV3 A;  4QQG A;  4D6W A;  2QI2 A;  4LE9 A;  1W2B P;  3E9F A;  2QTX A;  3A8G B;  2DX1 A;  1H3H A;  2KRN A;  3G1J A;  4GBQ A;  4KGX B;  5DLQ E;  2EAY A;  1MND A;  2PQW A;  1V1C A;  4M77 F;  3X28 B;  2COW A;  3OBW A;  4OMN A;  1UGP B;  5HCK A;  1VQ7 Q;  1M1F A;  3C4S A;  5GMK l;  4J9E A;  3M9Q A;  2QQA A;  2LVM A;  3F70 A;  1G2B A;  5GAN f;  2YRD A;  4J9F A;  2EYY A;  2P84 A;  4PJO D;  1W4S A;  3RMQ A;  1HSQ A;  1K8A U;  3RNJ A;  1QVG A;  1TUG B;  1Y7X A;  3CCJ T;  2EGC A;  4KT0 E;  3EHR A;  2KAF A;  1YI2 T;  4J5Y A;  2QA4 T;  3LH5 A;  3IQL A;  1BI3 A;  2P0P A;  2L8D A;  2NUT A;  4BD3 A;  2ZGW A;  4BB7 A;  2PZ1 A;  2RMO A;  2CSQ A;  3REA B;  4CC3 A;  2FZG B;  2F5K A;  3QYG B;  2X4Y A;  5CQY A;  2JTF A;  1NPP A;  1U8R A;  4BI3 A;  2O9V A;  1QVG P;  4EIK A;  2X35 A;  4C0D C;  2EYQ A;  2DZC A;  3FRN A;  4M7A A;  2L3R A;  1T3L A;  1SRL A;  3DLM A;  1JXO A;  2KQW A;  2LT4 A;  3T9N A;  4E7I A;  3BDL A;  3CCS A;  4OMQ A;  1EIF A;  4GLK A;  5CKF A;  1A0N B;  1ZBX A;  1R0B G;  4ANJ A;  3UPU A;  1F1B B;  4CI0 C;  2O4X A;  4RCC A;  4BE1 A;  2WSF E;  1WFW A;  2X4J A;  1WIE A;  4X9C A;  2X3W D;  4MMK A;  4NOY A;  3OMG A;  2RHY A;  4M78 B;  4KUD K;  1VQ6 A;  1JQQ A;  3CXC S;  3PIP A;  2K4Y A;  3J7A F;  1WJR A;  3RIR A;  2YLB A;  1GBQ A;  1HJD A;  1IB8 A;  1YIJ Q;  1YJN Q;  2R58 A;  3OYH A;  4J6Y A;  4XTZ A;  3H9N A;  3REB B;  1N6A A;  2GCX A;  4J9I A;  4LDU A;  3JB9 H;  1U1T A;  3SEM A;  1QP3 A;  2KRS A;  2NUP A;  2VXF A;  3CCR A;  1NJI C;  1QVF S;  2JS0 A;  2EYW A;  4FU6 A;  1MMA A;  4L6V 5;  4LNP A;  5FU7 C;  1NLP C;  3CD6 A;  3JCM g;  3FIF A;  2CUB A;  3MHX A;  1VYU A;  1VQ5 T;  2QEX T;  2PU9 B;  2L2P A;  2QQB A;  3CCE A;  5LJ3 f;  3L2Z A;  1NJI R;  5IXB A;  4JS4 A;  5CCA A;  3M0Q A;  3UAT A;  2BKD N;  2FO0 A;  2ENM A;  2I2L A;  4PJO C;  2LDM A;  1KJW A;  2C0O A;  4KGV B;  2FRY A;  2EKH A;  2HL5 C;  2HDA A;  4FIB A;  2DD4 A;  4CC2 A;  3H0H A;  3CME A;  3DB3 A;  2OI3 A;  1X75 C;  2LQW A;  3E19 A;  3A5Z B;  4N0A A;  2ABL A;  2M51 A;  2RHZ A;  1BIB A;  2JXB A;  4RCB A;  3JCM h;  2A0F B;  4FCY A;  2XMF A;  4C92 B;  2L3P A;  1K4U S;  1Q7Y C;  4NS5 A;  1ZA1 B;  2LJ0 A;  1WDX A;  1ABQ A;  5KE2 A;  2DMO A;  2CUD A;  2X4X A;  3RES A;  1W6X A;  2KDS A;  4ZTJ A;  5GAO r;  3OB9 A;  1KC8 C;  1IGQ A;  4E7K A;  5FU6 C;  3PIO A;  3JB9 F;  1E6G A;  1M2V B;  2JUF A;  5CVI A;  2D8J A;  2MOX A;  1Q7Y R;  2KRM A;  1T0H A;  2ZZD A;  3ZEH A;  3ZBD A;  1G3T A;  4ZN1 A;  2HQX A;  2DTO A;  4HCK A;  4R55 A;  3J81 E;  1OX8 A;  4OB0 B;  5KH6 A;  4C5H A;  4HCC A;  3M0P A;  2YXY A;  1PRM C;  4OMF B;  4OMP A;  4J9H A;  3BY7 A;  3CCS Q;  3S3O A;  3TVT A;  2ESW A;  5FW9 A;  2MIO A;  1OEB A;  2KGT A;  3VUB A;  2HSP A;  4DEX A;  4MML A;  3GNF B;  1M3A A;  2E12 A;  2FRW A;  3VYH B;  1NJI U;  1V76 A;  2HNI A;  3CCU A;  2HKQ B;  3RKW A;  3KBG A;  5A0G A;  2B86 A;  3TQ7 P;  2XG8 D;  1UEB A;  2QK0 A;  4Y28 E;  3R6O A;  2LQK A;  1YFN A;  3GBQ A;  2ZPG B;  3M58 A;  3CCQ T;  2R5A A;  2NLU A;  1VQK T;  1AT1 B;  1K0X A;  1G3S A;  1WZO A;  3UA6 A;  3CMA Q;  2FHD A;  2DTI A;  2DZ9 A;  2J05 A;  2NYS A;  3EGD A;  2QQS A;  4JZ4 A;  5GAN j;  1QMC A;  4WCI A;  1PSE A;  1YJ9 A;  2HQH A;  2L3Q A;  2L89 A;  3L2Q A;  3EFR A;  2QDL A;  1Q82 C;  2OTL T;  3J80 E;  3X25 B;  1ABO A;  2DFU A;  4CRI A;  1I1J A;  3NHN A;  2CP3 A;  1RL2 A;  5LJ5 e;  4CC7 A;  2LQ8 A;  3OQ5 A;  4M78 F;  1QQJ A;  1M90 U;  2RA2 A;  3KUF A;  1YJW A;  3INZ A;  2DRM A;  1Q7Y U;  2M1H A;  1Q86 C;  3CCL Q;  4E7L A;  1Q82 R;  1WHL A;  2PVO B;  2DEQ A;  3EGX B;  4M7A B;  5DLO A;  5L8R E;  1DJ7 B;  4JZ3 A;  4J6X A;  3CC4 Q;  1VQ9 Q;  5I22 A;  3I55 A;  1K9M C;  1LVK A;  2FPD A;  3ER0 A;  4O5V A;  3EG0 A;  1ZA2 B;  1PD1 A;  3CCV Q;  5L23 A;  3ASK A;  2H3E B;  4OVA A;  4M77 E;  3VRZ A;  2YRV A;  2X4W A;  4M75 B;  2V1R A;  4HT9 A;  2JM9 A;  1N8R C;  2DRK A;  4OB2 B;  2K3Y A;  2DIQ A;  2PNI A;  3PTA A;  2O4X B;  4WTO B;  2HBP A;  1K9M R;  2IVW A;  4AFS C;  2M02 A;  2RHU A;  3JCM f;  3SD4 A;  2EQU A;  3OS1 A;  1SKU B;  3FC3 A;  1VIF A;  1GXI E;  1C0M A;  4OMO A;  2V1Q A;  1N8R R;  3CC7 T;  4ATO A;  2MPX C;  3SWN C;  5FWB A;  4FM4 B;  4PJO G;  1NEG A;  1M8V A;  1VUB A;  2E1H A;  3MPU B;  2M9U A;  2RJF A;  2CSI A;  2NUP B;  1GCQ C;  1RAB B;  3EG1 A;  1MNE A;  1AWX A;  4XTW A;  4C92 F;  1U1S A;  1C1A A;  5GAN e;  3O8V A;  1WQW A;  3M4Y A;  5FWC A;  1VQM A;  4XTU A;  2RJD A;  1XJW B;  2QG9 B;  1HYO A;  1N9R A;  2IPO B;  4LDX A;  3THK A;  1VQN Q;  4XU1 A;  3RDV A;  1VQ7 A;  5CR2 A;  4N4I A;  4AFQ C;  2GTJ A;  5GAM g;  4M78 A;  4FYV B;  1TOV A;  1B34 A;  2C0I A;  1K9A A;  4J8O A;  2MCN A;  4IUT A;  2CP5 A;  2ZPE B;  1I4K 1;  3M0T A;  3OMC A;  1AEY A;  2OTJ A;  1M30 A;  4QVZ A;  4PK4 A;  2I0N A;  5LJ3 j;  2VYT A;  3EFO A;  4C0Z A;  3EH1 A;  2LCS A;  1UGR B;  4C8Q E;  1R77 A;  1XNI A;  1W70 A;  1YJ9 Q;  1M9S A;  4D8D A;  1K9M U;  2DIL A;  1ZSZ C;  3PE0 A;  2XD0 A;  2FL7 A;  4IIM A;  3CXC A;  5GAM h;  2EGE A;  4JJC A;  2CZ7 B;  3OS0 A;  4K11 A;  4C0F A;  3EH2 A;  5A0D A;  3M55 A;  1AVZ C;  2E10 A;  3NMZ C;  2FPF A;  5FRM A;  3C95 A;  1QVF A;  3S6W A;  2DIG A;  3OYF A;  4HCB A;  1G8X A;  2CP6 A;  2RJE A;  4M7D E;  3LWI A;  2GQV A;  3OSS C;  2JW4 A;  4X1V A;  2A3L A;  2X3X D;  1YCY A;  4QKU A;  1PSF A;  3V8K A;  2BE9 B;  2EQJ A;  4ELZ C;  4C92 A;  2QQ9 A;  2MMP A;  2D8H A;  2IG0 A;  2BUD A;  4FYX B;  1JXM A;  1J3T A;  1UE9 A;  1WJS A;  2FEI A;  2HZY A;  3QUI A;  2VV5 A;  4M77 C;  5D6W A;  1Z9Q A;  3OYB A;  3OYE A;  3G4S Q;  2DA9 A;  3V7R A;  1E7O A;  2D6F A;  3UT1 A;  4BI8 B;  3VRY A;  1YJN A;  4M7A F;  3OW2 S;  2Y90 A;  1K1Z A;  1M2V A;  3E2U A;  2ATC B;  4O6J A;  1SSH A;  2DBK A;  3S3M A;  1VYT A;  1FX7 A;  1QLY A;  1D1B A;  1X01 A;  4JRK A;  1WHG A;  4EMH A;  3GIB A;  3EGD B;  2V8I A;  3P8H A;  4PKC C;  5KE3 A;  2K5L A;  1RLQ C;  1M27 C;  4BY6 B;  2EVR A;  2WAC A;  5LJ3 e;  4M75 F;  1D0Y A;  1RLP C;  3HRT A;  3PGG A;  1PKT A;  1D09 B;  1VQO Q;  3TRE A;  1X2K A;  1EZZ B;  2JMA A;  4PJO E;  2LJ3 A;  3QWX X;  2LNH B;  3LYI A;  5KYY A;  3FEO A;  4F7U E;  1ZUK A;  2GTO A;  2JVV A;  2QTV A;  3RKX A;  4L5G A;  3G71 Q;  2SRC A;  1S72 T;  4GY5 A;  1VQM Q;  4HVV A;  2YUO A;  4RUG A;  3P8B B;  4F14 A;  4OB3 B;  2J6O A;  4KBM B;  5KYN A;  5GJV B;  2MWP A;  4JJB A;  3JB9 D;  1MMD A;  1WA7 A;  4JRI A;  1VQP Q;  1MMN A;  2F69 A;  1VQ6 T;  1M8M A;  2C06 A;  3VUZ A;  2LRQ A;  2EIF A;  2JNG A;  3UWN A;  2M16 A;  4N0A C;  5IHI A;  2OTJ Q;  3RBB B;  1ZHI A;  3JCM P;  2DLP A;  1UJY A;  1KSW A;  1ACM B;  3I35 A;  1OZ2 A;  3H0F A;  4XAX B;  4J9D A;  2FZC B;  5HY6 A;  2DBM A;  1Y57 A;  2CP7 A;  2VAS A;  5CKB A;  4KUI A;  1YIT T;  2DTH A;  3PT9 A;  4OB1 B;  4AFU C;  3CCR T;  1OPL A;  2LNV A;  5IHK A;  2FPE A;  4PJL A;  5KYX A;  2LCC A;  1OQK A;  3EG2 A;  2KXC A;  2YSQ A;  1GFC A;  3QXE B;  2DXU A;  5KYU B;  3CD6 T;  4C8Q C;  2VXE A;  2EJG A;  2QAS A;  2A28 A;  2AIR B;  2XDP A;  1R0C B;  2K5I A;  2BZ8 A;  4RTU A;  4ZGJ B;  3G6E Q;  2E5Q A;  3CCE T;  5CKD A;  4E7H A;  3EGX A;  4IUR A;  2RI2 A;  3MEA A;  4QT7 A;  2V8J A;  2DJQ A;  2AZV A;  1RAH B;  4E6R A;  1Y71 A;  4HA8 A;  1D3B B;  2KRO A;  2EGA A;  3MEU A;  4B9W A;  2E65 A;  5GAN 8;  2H8H A;  4M75 A;  3CME T;  3EG3 A;  1MHN A;  1Y07 A;  3EG9 A;  1ZQ1 A;  1QW1 A;  4R0K A;  5GAM d;  2RQV A;  3UDC A;  1QKW A;  2DVE A;  2VB6 A;  2HL3 A;  4M7D C;  1B34 B;  3PMI A;  2W10 A;  3A8H B;  1IHV A;  4A4F A;  4M78 D;  3M56 A;  2JT4 A;  1SHG A;  4ME7 A;  3OS5 A;  2E41 A;  3I56 Q;  2J6F A;  1D0X A;  3CMA A;  3EFO B;  1SPK A;  2E5K A;  1BCM A;  1MGQ A;  2XIC A;  5GMK h;  1QCF A;  4RTY A;  2L5Q A;  4XTX A;  2XID A;  2P4T A;  3C0C A;  2MK5 A;  2W0Z A;  4J9B A;  1K73 C;  4LUD A;  3D7S B;  1VQ8 T;  3BFM A;  3CPW P;  1TUC A;  3FB9 A;  4LDW A;  1OX9 A;  1YI2 A;  2OAU A;  3PVQ A;  3GF5 A;  3QSU A;  2LQN A;  3RUX A;  3JCM Q;  4A54 A;  2EPD A;  4J9G A;  2LCL A;  5KCO A;  2RHI A;  5CAI A;  2K2V A;  3CCL A;  4M77 G;  1K73 R;  5A0L A;  1PD0 A;  4RG8 A;  2DET A;  1VQ9 A;  3CC4 A;  1GL5 A;  3HTR A;  1UEC A;  2HSE B;  3CCV A;  3CCU T;  2O9S A;  2EW3 A;  4ORZ A;  1N5Z A;  3MEW A;  2AKL A;  3JCM e;  2YLC A;  1M1K C;  3JCM c;  4X34 A;  1YHQ T;  2RNA A;  4JPB W;  5J26 A;  2F5T X;  2OJ2 A;  4EMK B;  1I07 A;  1UFF A;  4WF2 A;  1WXU A;  2EBP A;  4AG2 C;  3V8L A;  1X6G A;  1O75 A;  5LJ5 j;  1YBY A;  2DD5 A;  2LP5 A;  4C92 D;  2D1X A;  2NUZ A;  1WX6 A;  1M1K R;  3CEY A;  1JU5 C;  5GAN 2;  1TSF A;  3JCM W;  3CCM Q;  3FJP A;  2HCK A;  3QWY A;  4TVR A;  3OYN A;  3PNW C;  1OUL A;  4J7I A;  3VS1 A;  1VQ4 Q;  2O31 A;  4HT8 A;  2LX7 A;  3QJ6 A;  2E70 A;  1UDL A;  1YJW T;  1WQ7 A;  4QQD A;  4Y91 A;  4EDU A;  1KC8 R;  1JBM A;  2JN0 A;  4LUE A;  1NZ9 A;  3WVE B;  2IIM A;  2E3I A;  2EJF A;  5HKC A;  3VKI A;  4ZN3 A;  1VQL Q;  3I55 T;  4ZGD B;  3A8L B;  4AFZ C;  1I0C A;  3CC2 Q;  5KYY B;  3ZL7 C;  5D6X A;  2DXC A;  2XK0 A;  3L42 A;  1VQN A;  2LZ6 B;  3A8M B;  3OBY A;  4JLG A;  2MAM A;  3CBO A;  1LPL A;  1RAI B;  3LGF A;  1PWT A;  1PG5 B;  3HRS A;  1MV0 B;  3CPF A;  1PC0 A;  4C8Q G;  2HAX A;  3VS2 A;  2GQI A;  2HBW A;  4PLL A;  2QQR A;  3QBY A;  3LH0 A;  4FW1 A;  2D0Q B;  5GAO q;  3OYI A;  2ROT A;  2ED0 A;  2O88 A;  1VYV A;  3MEV A;  1CKB A;  2A08 A;  1P92 A;  1YP5 A;  1QWF A;  2LMJ A;  3OYC A;  2Z0W A;  4XK8 E;  2PTK A;  1PKS A;  5HK0 A;  3CCJ Q;  1Q95 G;  5J3B A;  1Y96 B;  4QVD A;  4DOW A;  1BB9 A;  1IHW A;  2DE0 X;  2DL5 A;  5KYX B;  4RTT A;  1BU1 A;  5ECA A;  1YI2 Q;  2JTM A;  2VGM A;  2XI9 A;  3ZFJ A;  1M1K U;  2QA4 Q;  1AWW A;  3V8J A;  3EFS A;  5M9O A;  3OW2 A;  5KCH A;  2DEU A;  2DL7 A;  4L59 A;  2RM4 A;  4M7D G;  2AKK A;  2J7I A;  2R5M A;  3CPW S;  3HSB A;  1PNJ A;  1VQ7 T;  1GBR A;  2KBT A;  1KC8 U;  2BE7 D;  4M7A D;  3DB4 A;  2K57 A;  4DQ2 A;  2QDY B;  1KQS S;  1UJ0 A;  4BUG A;  4PFO A;  3OYJ A;  1KD1 C;  2RH2 A;  4JUV A;  1Q86 R;  3LW5 E;  4RTW A;  2OX7 A;  5IAY A;  3HRU A;  4II1 A;  2KI7 A;  3WXM B;  3OW2 P;  1WPY A;  3EG9 B;  1X69 A;  3AT1 B;  4M75 D;  1D0Z A;  5FRO A;  4A53 A;  2MWO A;  4IKF A;  1MUZ A;  1X6B A;  2NWM A;  2G6F X;  4BDZ A;  4PJM A;  3G4S A;  4PFP A;  5FRN A;  3JRZ A;  3E1S A;  3L1A A;  5KYU A;  1TWB A;  3M0U A;  1U06 A;  2EYX A;  1G83 A;  1RAG B;  4XTV A;  1UUE A;  4P5N A;  2F2V A;  5A2Q E;  4OP0 A;  1T0J A;  3E9G A;  1WHJ A;  2DF6 A;  2CH4 A;  5EC7 A;  4F7U G;  4FYY B;  3VS4 A;  4ESR A;  3MP6 A;  3RR6 A;  1WLP B;  1IRX A;  1VQK A;  1VQO A;  3NGP A;  4E2F B;  5GAN 4;  1D3B A;  2A36 A;  3O5Z A;  1Q81 C;  5IN1 A;  1SG5 A;  2RPN A;  2CZ1 B;  1UHF A;  4EMG A;  3TU4 K;  3G71 A;  2QAZ A;  1VIE A;  4F16 A;  1H8K A;  3JB9 J;  2ROL A;  2JZ2 A;  1SSF A;  3I9Q A;  2E6N A;  2KT8 A;  3QZ5 B;  1E6H A;  1Q82 U;  1VQ5 Q;  3JCM X;  2QEX Q;  2K7A A;  1VQP A;  4HVU A;  1ZBJ A;  4Q5W A;  2K3B A;  4JRQ A;  1QCO A;  4NL2 A;  2DO3 A;  1QCN A;  4FSS A;  4E47 A;  1JJ2 P;  1YIJ T;  1YJN T;  4OML A;  4DBF A;  4DBR A;  2RJC A;  2DK3 A;  4HKE A;  1Q86 U;  1GFD A;  3SFM A;  3X26 B;  1MMG A;  3OYD A;  1KQ2 A;  1UG1 A;  2RN8 A;  4J9C A;  4N4G A;  1FXX A;  2O01 E;  1OI1 A;  2RK1 A;  2ZPH B;  2PVG B;  4XU2 A;  3QDR B;  2YUP A;  2HMA A;  3H41 A;  3EAE A;  3EHQ A;  1AZG B;  2VVK A;  2DVJ A;  1W1F A;  1IRE B;  1M4Z A;  2LX9 A;  4E7Z A;  2XKO C;  3G7Z A;  2RI3 A;  1N8R U;  1YWO A;  1TH7 A;  3G6E A;  2GFA A;  2LTO A;  4M7A C;  1NLO C;  1ZUY A;  1MV3 A;  4J83 A;  4LDV A;  4OMM A;  3NTI A;  1K8A C;  3V7C A;  4PJJ A;  5C6S A;  2ZPB B;  2JM8 A;  3X24 B;  1QVP A;  4EPC A;  4M75 C;  4C0D B;  2CDT A;  2MF2 A;  4EMK A;  2MYS A;  3M0R A;  4PL6 A;  3CBP A;  3EGU A;  1KK7 A;  5GMK i;  2SEM A;  4IUV A;  4PLI A;  3HHT B; 
#chains in the Genus database with same CATH homology
 1FMK A;  1GCP A;  2H8H A;  4HCK A;  2RQU A;  3EG3 A;  4RTV A;  2JMC A;  1YN8 A;  4R0K A;  2RQV A;  2YUQ A;  3M0P A;  5GJW B;  1PRM C;  4OMP A;  1QKW A;  1OPK A;  4J9H A;  4Z8A A;  1K76 A;  3TVT A;  1NG2 A;  2ESW A;  2W10 A;  5FW9 A;  2MIO A;  1OEB A;  2KGT A;  2JT4 A;  3NPF A;  1SHG A;  2HSP A;  4DEX A;  1OOT A;  1M3A A;  5IXF A;  2FRW A;  2J6F A;  1UTI A;  1U5S A;  1PRL C;  1SPK A;  2E5K A;  3R6N A;  3TSW A;  1RUW A;  3TSZ A;  2D0N A;  1QCF A;  2B86 A;  4RTY A;  1WXT A;  1HD3 A;  1GCQ A;  4DEY A;  3C0C A;  4HXJ A;  1NM7 A;  1Z9Z A;  2W0Z A;  4J9B A;  3GBQ A;  4LUD A;  2KR3 A;  1TUC A;  3UA6 A;  1K0X A;  3PVQ A;  2J05 A;  2LQN A;  1B3Q A;  2DL4 A;  1BK2 A;  1QKX A;  4JZ4 A;  2YT6 A;  4WCI A;  2EPD A;  3SHW A;  4J9G A;  2L3Q A;  2QDL A;  1SRM A;  1ZX6 A;  1ABO A;  1QWE A;  2RF0 A;  3VS5 A;  2CH4 W;  1I1J A;  1GL5 A;  1UEC A;  4KRT A;  3NHN A;  2O9S A;  2EW3 A;  4ORZ A;  4CC7 A;  2GNC A;  1N5Z A;  1WYX A;  2OAW A;  2DRM A;  2AKL A;  1AWJ A;  1AOJ A;  2RNA A;  4JPB W;  1JO8 A;  3VS6 A;  2OJ2 A;  1I07 A;  1UFF A;  4JZ3 A;  4D8K A;  1WXU A;  2EBP A;  4AG2 C;  5I22 A;  1X6G A;  2FPD A;  2O2O A;  3EG0 A;  1SEM A;  4IIO A;  5L23 A;  2JTE A;  2LP5 A;  2D1X A;  2NUZ A;  1WX6 A;  3VRZ A;  1LCK A;  1JU5 C;  2DL3 A;  2V1R A;  2JM9 A;  2DRK A;  1YCS B;  1X2Q A;  2PNI A;  3ULR B;  2JS2 A;  1X43 A;  1ZLM A;  2HCK A;  3QWY A;  4HVW A;  1JEG A;  4JJD A;  4RTZ A;  2LJ1 A;  3VS1 A;  2O31 A;  2AK5 A;  4AFS C;  2LX7 A;  2AZS A;  1VA7 A;  1NEB A;  1H92 A;  2KEA A;  1UDL A;  1UHC A;  2A37 A;  1GRI A;  4LUE A;  3I5S A;  2IIM A;  1SHF A;  4OMO A;  2V1Q A;  2L0A A;  2L3S A;  5FWB A;  1WI7 A;  2KXD A;  2J06 A;  1X27 A;  2F2W A;  4AFZ C;  1I0C A;  1NEG A;  3CQT A;  3PVL A;  1AD5 A;  3ZL7 C;  4ZNX A;  2CSI A;  1PHT A;  1GCQ C;  1EFN A;  1FYN A;  2KYM A;  2ECZ A;  3A98 A;  4AG1 C;  2C0T A;  2LZ6 B;  3EG1 A;  1AWX A;  1XOV A;  1YWP A;  1BBZ A;  4F17 A;  1PWT A;  3M0S A;  1MV0 B;  3VS2 A;  1CKA A;  2GQI A;  5FWC A;  5IHN A;  3I5R A;  2HBW A;  3JV3 A;  2VWF A;  3UF4 A;  3KFV A;  1YNZ A;  2CT3 A;  3THK A;  4LE9 A;  1TG0 A;  1B07 A;  2ROT A;  4AFQ C;  2GTJ A;  2ED0 A;  2KYB A;  5IH2 A;  2DX1 A;  2O88 A;  1H3H A;  2KRN A;  1VYV A;  2C0I A;  4Y92 A;  4GBQ A;  4M4Z A;  1K9A A;  2MCN A;  1CKB A;  2A08 A;  3H0I A;  3VS0 A;  3M0T A;  1YP5 A;  1QWF A;  1AEY A;  1M30 A;  1V1C A;  2I0N A;  2LMJ A;  4OMN A;  2PTK A;  1PKS A;  5HCK A;  2P4R A;  5I11 A;  1BB9 A;  2DE0 X;  4A63 B;  2DL5 A;  4J9E A;  1BU1 A;  4RTT A;  5ECA A;  2LCS A;  1G2B A;  2GGR A;  1Y0M A;  1AWW A;  1W70 A;  4J9F A;  3VS3 A;  2EYY A;  2EQI A;  2DL7 A;  2RQT A;  4D8D A;  4GLM A;  1HSQ A;  2DIL A;  3PE0 A;  2AKK A;  2J7I A;  1CSK A;  3RNJ A;  2CT4 A;  4IIM A;  2K2M A;  1PNJ A;  1GBR A;  1NYF A;  2EGC A;  2K9G A;  3EHR A;  2KBT A;  2DM1 A;  2HEQ A;  2GBQ A;  3FJ5 A;  2EGE A;  1K0S A;  3LH5 A;  3IQL A;  4JJC A;  1ZSG A;  4K11 A;  1UJ0 A;  1KFZ A;  2PZ1 A;  2RMO A;  2CSQ A;  3REA B;  4CC3 A;  1RI9 A;  4RTW A;  1AVZ C;  3NMZ C;  2FPF A;  1X69 A;  2DYB A;  1MUZ A;  2O9V A;  1X6B A;  2NWM A;  1TUD A;  2G6F X;  4EIK A;  2RQR A;  2DL8 A;  4Z89 A;  1M3C A;  3VS7 A;  2J6K A;  2JW4 A;  2X3X D;  4X1V A;  2CRE A;  2FG0 A;  1UGV A;  4Z88 A;  1T3L A;  1SRL A;  1S1N A;  2BZX A;  2BTT A;  3M0U A;  1U06 A;  2EYX A;  4RTX A;  1G83 A;  1JXO A;  2D8H A;  1UUE A;  1JXM A;  2F2V A;  1T0J A;  1J3T A;  1UE9 A;  2KE9 A;  2DF6 A;  2FEI A;  2CH4 A;  5EC7 A;  1Z9Q A;  3VS4 A;  4OMQ A;  1A0N B;  2DA9 A;  2ED1 A;  1E7O A;  4ESR A;  1WLP B;  3VRY A;  1AZE A;  2YUN A;  1WFW A;  3NGP A;  1WIE A;  2X3W D;  1K1Z A;  1SSH A;  2A36 A;  2DBK A;  3O5Z A;  2RPN A;  1VYT A;  1UHF A;  1QLY A;  1JQQ A;  1RLQ C;  1M27 C;  2DNU A;  2EVR A;  1GBQ A;  4F16 A;  1HJD A;  1RLP C;  1H8K A;  3U23 A;  1PKT A;  1OV3 A;  2ROL A;  3I9Q A;  2KT8 A;  1X2K A;  2JMA A;  1E6H A;  2LJ3 A;  3QWX X;  3REB B;  4J9I A;  2LNH B;  2BZY A;  2K79 A;  2K7A A;  4HVU A;  3SEM A;  1ZUK A;  2GTO A;  1ZBJ A;  2KRS A;  2SRC A;  2K3B A;  4HVV A;  2YUO A;  4RUG A;  4F14 A;  4FSS A;  1T3S A;  2JS0 A;  2EYW A;  1NYG A;  4OML A;  2J6O A;  4CC4 B;  4LNP A;  1IO6 A;  1NLP C;  2CUB A;  5GJV B;  4JJB A;  1VYU A;  1ZUU A;  1GFD A;  1WA7 A;  2L2P A;  1M8M A;  1UG1 A;  2RN8 A;  4J9C A;  2KT1 A;  5IXB A;  5IHI A;  1KIK A;  3RBB B;  3M0Q A;  2M0Y A;  3UAT A;  2YDL A;  2KNB B;  1WXB A;  2YUP A;  3H41 A;  2DLP A;  2FO0 A;  2RQW A;  2ENM A;  1UJY A;  3EHQ A;  1AZG B;  2VVK A;  1KSW A;  1W1F A;  1KJW A;  2DVJ A;  3I35 A;  3UA7 A;  2C0O A;  3H0F A;  4J9D A;  2FRY A;  2DBM A;  2EKH A;  1Y57 A;  1YWO A;  2HDA A;  1AWO A;  4CC2 A;  3H0H A;  2EYZ A;  2OI3 A;  2LQW A;  4AFU C;  2K6D A;  1OPL A;  2ABL A;  1NLO C;  1ZUY A;  1MV3 A;  5IHK A;  2FPE A;  2M51 A;  2JXB A;  3EG2 A;  4OMM A;  2KXC A;  2YSQ A;  1GFC A;  2VKN A;  2XMF A;  2L3P A;  1K4U S;  2LJ0 A;  2A28 A;  1M3B A;  1WDX A;  1ABQ A;  2DMO A;  2CUD A;  2JM8 A;  4RTU A;  2BZ8 A;  2F2X A;  1W6X A;  4LN2 A;  2CDT A;  4QT7 A;  3M0R A;  1U3O A;  2DJQ A;  2AZV A;  3EGU A;  1E6G A;  4E6R A;  1ARK A;  2SEM A;  2D8J A;  2MOX A;  2KRM A;  1T0H A;  2KRO A;  2EGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...