1JRIA

The crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
b'QRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sm-like Archaeal Protein 1 (SmAP1)
molecule tags Structural genomics, unknown function
source organism Methanothermobacter thermautotrophicus
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
total genus 13
structure length 72
sequence length 72
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1jriA00
3BDUA 1Y96B 5LJ5h 5GAN2 2DZ9A 2FB7A 4M7DB 2E1HA 3V8JA 4J6XA 4NL3A 3QHSA 5GAMd 4C8QF 2YHTA 4EMGA 4XTXA 1WPYA 4C92B 2DEQA 3JB9D 4RCCA 4M7AD 4XTUA 4PJOE 1TH7A 1H641 2HNIA 3BW1A 3V7CA 4EMKC 3JB9H 4M77F 4M78G 4C92F 1HXDA 2K57A 2RA2A 4MMKA 4M75F 1WQWA 2DTOA 2QTXA 4PJOG 4XU0A 5GAMe 4A54A 4M75B 4N0AA 5GMKe 4M7AA 2E65A 5LJ3f 5GAN6 4C92D 3RKWA 2E64A 4C8QE 4F7UF 3QO3A 5GAOm 2I2LA 3BY7A 5GMKj 4M75D 4M78C 4M77A 5GAMj 5GAOr 4XQ3A 4XU1A 3JCMf 4XTWA 4C8QD 4C92A 3JB9F 2Y90A 1N9SA 2YLBA 2EWNA 5GAOl 2ZGWA 4XU2A 3V8KA 5GAN4 4JRKA 3RUXA 2EJFA 4M77C 4M78A 3SB2A 4Y91A 4M7DA 5CAIA 3L2ZA 1BIAA 2YLCA 4NL2A 3BFMA 3HSBA 4M77G 3INZA 4C92G 5GMKi 4N0AC 5GANh 1YCYA 4M7AC 1HK9A 3JB9I 5LJ5j 1M8VA 2DVEA 4PNOA 5GANe 4DQ2A 1LJOA 1I4K1 4M75E 4WF2A 4M7DC 1BIBA 4F7UB 3JCMW 1KQ2A 2DXTA 4X9DA 1WQ7A 4EMKA 4PJOC 5GAMf 1JRIA 3SWNB 5GAN3 2DXUA 5LJ3e 2EJGA 4F7UE 3FIFA 3RKYA 5LJ3h 3JB9G 4JLIA 4C8QB 4NOYA 4M7AG 2DKGA 1D3BA 5LJ3g 4M7DG 3RIRA 4EMKB 4XTVA 4A53A 4F7UG 1I81A 5LJ5g 4J6YA 4M7AE 5GMKm 4J5YA 4QVCA 1U1SA 3QUIA 4M75C 4PJOB 1N9RA 2FYKA 3FB9A 3SWNC 5GANj 3JCMc 3FJPA 1B34B 5GMKh 2DTIA 5GAMh 3AHUA 3QSUA 2RM4A 3RESA 3JCMP 4M78B 3M4GA 3V7RA 4HT8A 3JB9J 5DY9A 3EFSA 2JN0A 5LJ5f 5GAOp 4M7DD 1M5Q1 4M78E 4XTZA 3JCMJ 5GANg 4M77B 1LOJA 4MMLA 3JCMd 5GMKl 1B34A 3JCMe 5GAOq 5GAOn 1KQ1A 4J6WA 2VC8A 2EAYA 3HFNA 4PJOA 5GAMg 3GIBA 4M75A 4M7AB 4EMHA 1U1TA 2RB6A 2E10A 4QVDA 4PJOD 3RKXA 4XTYA 1X01A 4XU3A 3JCMh 5GAN7 4RCBA 4M78F 1MGQA 4M7AF 3RERA 1D3BB 4HA8A 4M7DF 4V2SA 2DZCA 1WNLA 4M75G 1LNXA 2E41A 3JCMV 3VU3C 4C8QA 4PJOF 3V8LA 4C8QG 3PGGA 5LJ3j 2DJZA 4OP0A 3EFRA 4M77E 3JCMX 1I5LA 4JUVA 5GANf 2CGHA 4C8QC 4C92E 2VXFA 3JCMb 2VXEA 3SWNA 5GANd 4X9CA 5I21A 4F7UA 5LJ5d 2EJ9A 5LJ5e 1JBMA 5GAN8 1I8FA 4JRIA 4C92C 5LJ3d 3V7SA 4HT9A 2DTHA 3JCMQ 3JCMg 1Y96A 4M7DE 4M77D 3L1AA 4M78D 5GAN5 2RD1A 3HFOA
chains in the Genus database with same CATH superfamily
1H8KA 4BI8B 2R57A 1M3BA 4OB1B 4DBQA 4UC4A 2HQEA 1WPYA 2ZPEB 1JQQA 2K3XA 3UATA 4M7AD 3JB9H 2QGFB 1R0CB 4BDYA 1KQSP 2YUPA 1WHJA 4PJOG 5GAMe 4M7AA 5I2MA 4C92D 3CMEA 3RKWA 1M3CA 5IXBA 1XQHA 2NUZA 1RLQC 1X6BA 5J26A 3PVLA 4ZGEB 3M53A 1WHLA 1N8RR 3HSBA 4C92G 3CMAQ 4Y92A 4M75E 4C0DB 1WJQA 4PJLA 2FVUA 1BBZA 4LD9K 3P8BB 5KE2A 4DOWA 1YFNA 4A4GA 2COYA 2K4YA 1SKUB 4J5YA 4C0DC 3OYNA 2DYIA 3QUIA 5KYYA 1N9RA 2FYKA 2JTFA 4IUVA 3EG1A 2P4RA 3CC2A 1YBYA 1HJDA 2A7YA 5CVIA 2JVVA 1KC8R 2ABLA 1E7OA 1B34A 1C0MA 2V1QA 2EAYA 4X1VA 1VQ7A 2CZ6B 1TWBA 2A36A 4EMHA 2O2OA 1UDLA 3OB9A 1X2QA 1ZUKA 2DM1A 2JJ9A 1K73C 1MMGA 1K0XA 1VQ9T 4M75G 4N4IA 3SWNA 2YWWA 1T0JA 2QEXA 4FSSA 2KE9A 2X3XD 3G6ET 3FEOA 4F04B 1Q7YC 1X69A 1AWJA 4N4HA 4KGZB 3CXCP 1ARKA 1Q81R 2XICA 1EFNA 2QGGA 4RCCA 1YWPA 3KBGA 1YJNA 4M78G 1WA7A 2JTMA 5FU7B 3HP9A 1TS9A 5CO7A 2OTJT 3CCMQ 3GNGA 1ZX6A 2M0OA 4JLGA 5GAOm 4F7UF 1VQMT 1UECA 5GAOr 1G2BA 1K76A 2L3SA 2P84A 4RTYA 5KCOA 2F2WA 3J7AF 1N6AA 2FZCB 4M77C 3RDVA 3OYAA 4KGVB 2E3HA 1PC0A 4PNOA 4HVUA 2GQIA 3G71Q 1WGSA 3GNFB 1VQMQ 1OZ3A 1KQ2A 1GFCA 1M1GA 3CCUT 5GAN3 1KHIA 3CCSA 2OAUA 3TEEA 4JLIA 3QPHA 2LNVA 2E4HA 1YN8A 4FYWB 4D8DA 1YI2Q 1VQKQ 2RI3A 2YUQA 2X4XA 2ZPGB 4E47A 3OS1A 4OGCA 3OSSC 2KY9A 1BI2A 2CP3A 3O5ZA 1OPLA 2KAFA 2MWOA 2F5KA 1K1ZA 1RABB 3CCMT 4E7SA 4DBHA 3CC4Q 2MCNA 1G3WA 4B9XA 4II1A 4PJMA 1WHMA 2DXCA 4ORZA 1I5LA 2VXFA 3OYEA 2CYZB 1O75A 1BK2A 5I11A 2RO0A 4EDUA 1QWEA 5IHNA 3C95A 2LQWA 2VVKA 2DX1A 5GAN2 4M7DB 4AFSC 3TREA 3PFSA 5GAMd 2V1RA 2YHTA 1KQSA 4PFOA 1H3ZA 4DEXA 3QYHB 1T0HA 1ABQA 1D0ZA 2J6KA 4MMKA 3CEYA 3HRSA 2HCKA 2DMOA 4A54A 4N0AA 3GPLA 1JO8A 2I2LA 3NTKA 1GXIE 3VS5A 2R5AA 3TQ7P 1TOVA 1WXTA 1JJ2A 2K79A 2EKHA 4XAXB 1CKAA 5GAOl 3INZA 2VGNA 2G6FX 1MHNA 3UT1A 3EGXA 1I4K1 1SHFA 4EMKA 2RMOA 3ULRB 1Q86C 1QMCA 4JRPA 1RAFB 2XKOC 4BI3A 1VQ4Q 2EYQA 2QA4A 1X2KA 1I81A 5IT9E 2QTVA 2VWFA 1U1SA 2OTLT 4M75C 3EGDA 2DETA 5J3BA 3PIOA 2A3LA 3X26B 3M4GA 1GFDA 4RG8A 2K3BA 2CT4A 4MDWA 1IGQA 1OQKA 2RQTA 4R56A 4D6WA 2B86A 1WYXA 3TU4K 2KSSA 1QVPA 2PVGB 1I07A 4X34A 1G3YA 1QCNA 3M54A 2DJZA 1W6XA 2VXEA 2CUBA 1GCQA 2NWMA 1HSQA 4F7UA 4C92C 5GAN5 3VYGA 3CCLT 4J83A 2ESWA 3X25B 3PIPA 2DZ9A 1RAEB 2J05A 3CCQA 2I0NA 5CKFA 4ZN1A 1KK7A 2F1LA 2XI9A 3URGA 3GP8A 4NS5A 2YUOA 3M5AA 2QG9B 2YRCA 1VQ4A 2EGAA 2RA2A 1VYUA 2OTLQ 2RHIA 4Z8AA 4PFZA 1YITT 2Y4YA 1QVGS 4QKUA 3BY7A 2HMAA 3PMIA 1ZUUA 2CDTA 1N9SA 3QJYA 2QQBA 2AHJB 2EJFA 3LH0A 4Y91A 4AMCA 1SHGA 2E3IA 2MIOA 3CC7Q 3M58A 1IREB 2OTJQ 2W0ZA 2D9TA 4OMOA 3RMSA 2KYMA 1AWWA 1V29B 1VQ9Q 4F14A 3WVEB 1RACB 4RMOA 2KBTA 4F7UE 2KNBB 2RQUA 4O6JA 4NOYA 2DKGA 3ME9A 1KG1A 3VKIA 2ATCB 1OYXA 3GF5A 1GBRA 3HTRA 3A1PA 2PTKA 1FMKA 2A08A 1VQ4T 2LCCA 5GMKm 5CKBA 2D0QB 5HY6A 2F69A 1NJIU 2YSQA 2XK0A 2KXDA 1AT1B 3JCMP 1AEYA 3EFSA 2ROLA 4FT2A 5GAOp 4KUIA 3MPUB 3CD6Q 3O8VA 1MNDA 4XTZA 3CCLA 1VQ5Q 3OS0A 5GANg 1LOJA 2JUFA 4JPBW 3CMAT 2C06A 3HFNA 1VYTA 2LQNA 4PJOA 2NLUA 2X4JA 1UGSB 1ZUYA 2J06A 3M0SA 1BCOA 1TUDA 2OAWA 4V2SA 4GLMA 4WTOB 3QZ5B 4C8QG 2F2XA 2RQVA 4PJOF 1W1FA 5LJ3j 2ENMA 3G71A 1KD1R 1FMWA 1TU0B 2LNHB 1WXBA 1QVFS 3EGUA 3CD6T 2DL5A 3S3NA 3RMQA 3CXCS 1I0CA 3VV0A 2E1HA 1X43A 5FRNA 2AK5A 1IRXA 3V7CA 1TXQA 3S3OA 2DVJA 3H0FA 3HL8A 4CC4B 1QKWA 2X35A 1KIKA 1IGUA 4E7KA 2QA4T 2YDLA 5LJ3f 2E64A 1MMNA 2DEUA 3OYCA 2Z0WA 5GJWB 1FYNA 3CCVA 1VQ8A 2NUTB 4C5GA 1WX6A 4JDSA 2DBKA 2GF7A 5CR2A 4NL2A 2L3QA 4MZMA 1K73R 5GANe 1LJOA 1IXDA 1QQJA 3LW5E 3JCMW 1K9MC 3OYFA 3EG3A 4C5HA 2VB6A 5HCKA 2YT6A 5A2QE 3DLMA 2QQAA 2CP2A 4BB7A 5I2SA 2NUPB 2RH2A 3SWNC 1NLPC 3RESA 2EQJA 2A37A 2RNAA 4R0KA 2L8DA 2YRDA 4E2FB 1OX8A 4M77B 5J39A 2DFUA 3JCMe 3P8DA 2DBMA 5KYYB 1S72T 2K3YA 1VQLT 3NMZC 4M78F 1JXMA 1BCMA 1WI7A 5ECAA 3X28B 1K73U 2ZAEA 1YIJA 3PVQA 3MKDA 4KGXB 5I21A 2Y4XA 2CH4A 4OMPA 2OJ2A 3CPWS 1Y96A 2LMJA 3JSCA 4M77D 5C0MA 3HFOA 4ELZC 1K4US 1PNJA 2EQUA 4IUTA 2K2MA 4Y28E 5HKCA 3M0QA 3VS2A 2L89A 2RHZA 3CCRT 2MWPA 1WIEA 4C8QF 1KJWA 3HKSA 2XMFA 2K6DA 2RHYA 3LLRA 3BW1A 4M77F 1HXDA 5FWCA 1Z9QA 3CBMA 2H8HA 5CQYA 3OYBA 2NYSA 3H8ZA 1U06A 3CCST 5GAMj 9ATCB 4C8QD 2O31A 1I5OB 1VIEA 1VQPQ 5GAN4 2EYYA 2P0QA 5CAIA 5GANh 1VQNQ 2P0KA 2NUPA 4LN2A 1UJYA 6AT1B 1VQ8T 3CPWA 4X9DA 5FLXE 3OA6A 1D09B 4M4ZA 2XU8A 4BY6B 3J81E 3CCSQ 2OTJA 1Q82U 4JJCA 3MO8A 2QDLA 3I35A 4QVCA 2LVMA 1VQNT 4HCCA 5GAMh 4L6V5 1N5ZA 3META 2DPPB 2X51A 4L5GA 2MI6A 1NPPA 3QG1A 1VQ6T 2EQKA 3ER0A 3JCMd 2CS7A 2RN8A 1X27A 2O9SA 4RKUE 5L23A 5GAMg 3GIBA 3C12A 2JNGA 1AVZC 1IHWA 4KULA 4ZGDB 3RERA 2FO0A 2DZCA 3E1SA 2FL7A 4MZPA 1Y7XA 2EGCA 2J6FA 1VQPA 3H0IA 2IG0A 2GFAA 4C0GA 1ZA1B 2DL4A 2JOYA 2GCXA 3PT9A 2FB7A 4JJBA 2XG8D 1VQNA 1TUCA 5FRMA 2BTTA 3JB9D 2KEAA 4FU6A 1TH7A 4EMKC 1M2VB 3EG2A 4QW2A 4XK8E 2AKLA 1WQWA 1MNEA 2LX7A 3M0PA 2CZ0B 1ZSZB 5GMKj 4M75D 3FJ5A 2A0FB 2FRWA 1YITQ 2JMCA 2DAQA 1NEBA 4Z89A 5KE3A 2EWNA 1PM3A 3QXEB 3OYIA 3E9FA 1UB4A 2AT1B 2HAXA 1NEGA 4M77G 4N0AC 2EQMA 5KYNA 3NHNA 1FXXA 2CH4W 1P92A 1WQ7A 2X4WA 1NZ9A 2O01E 5LJ3e 5CIUA 1H3HA 3CC2Q 1OPKA 4J9IA 3M9QA 3QZ9B 3C4SA 3L2UA 4XTVA 5LJ5g 3LYIA 3CCRA 2DRKA 3CCJQ 1RL2A 4QQ6A 2FPDA 8ATCB 5GANj 2E5QA 2DLPA 4HCBA 5GMKh 5D6YA 2RM4A 3DKMA 3TSZA 2CKKA 4ESRA 1D1CA 3M59A 4CRIA 1OEBA 1QP2A 1Q7YR 4IUQA 3G1JA 5IXFA 5GMKl 1QVFP 3H0HA 2A28A 1V76A 1UJ0A 3OQ5A 4PJOD 2IVWA 3JCMh 1C6VX 2VKNA 1FX7A 1S72A 2LC4A 1R77A 3V8LA 1ACMB 4M77E 2BE9B 4BY6C 2MMPA 4R55A 5DLOA 3HHTB 1JXOA 1I8FA 1KHCA 2QAZA 2PUOB 3JCMg 2COWA 4HVWA 5C6SA 2LX9A 4ANJA 2NUTA 1UGVA 3I5RA 1YIJQ 3OW2A 3L2VA 1X6OA 5KCHA 4A4FA 4XTXA 1G3SA 2AKKA 4XTUA 2OTLA 3OW2P 5KYUB 2LCLA 1VQOQ 4OB3B 1AZEA 2HKQB 4OMNA 5GMKe 5D7UA 1YHQQ 4IUPA 1K9MU 1W2BS 3OMGA 5CKHA 3CPFA 5D6WA 4XTWA 2KT8A 2PVOB 3OYGA 1UG1A 2CP7A 4OF1A 2KDSA 4XU2A 2JS0A 4LE9A 5EC7A 3LX7A 1AWOA 3H6ZA 2YLCA 2CT3A 4ZTJA 4E7HA 3L2WA 4FW1A 2IPOB 2EYXA 4DQ2A 3CBOA 2PZ1A 1HYOA 2DXTA 1J3TA 1AWXA 4LUDA 2C0OA 3FIFA 4J9FA 3TVTA 5IAYA 3HRUA 4A53A 4QQGA 2DL7A 4PJOB 3M0RA 3DLLA 3CD6A 3MJXA 3NTHA 4AFQC 2HQXA 4E7ZA 4FYYB 3CCUQ 3OYYA 1QVGA 4MMLA 5GAOn 5CKEA 1M1KC 1YP5A 3UA6A 3UWNA 3E2UA 1O9SA 2WACA 2QI2A 4M7DF 3OYMA 1E6HA 2E41A 3EH1A 3OS2A 1ZA2B 3EFRA 3MEUA 4HKEA 4JUVA 2GTOA 3QJ6A 4C92E 5GAN8 1VYVA 3V7SA 3L42A 5CCAA 1RAHB 3REBB 2RD1A 2OI3A 3BDUA 1EX4A 2PU9B 4JS5A 2B8AA 2ZPHB 2YXYA 2EW3A 4BE0A 4J6XA 1B07A 3QHSA 5FW9A 3GBQA 3L2RA 3U23A 1G3TA 3N5BB 3CPWP 1GBQA 1V1CA 1UGPB 1QKXA 4ZNXA 2F5TX 3OMCA 4RUGA 3TCJA 3OS5A 2KI7A 4RG2A 1Y57A 3NTIA 3R6NA 1VQ6Q 2LRQA 4B6MA 4DOVA 3PMTA 3M56A 4AFUC 1QLYA 1AOJA 4FM4B 3RUXA 2OX7A 4KT0E 1BIAA 4Q5WA 2EYWA 2EGEA 3LH5A 8AT1B 3JB9I 1OZ2A 2EKOA 1YITA 2W10A 3QYGB 4F7UB 2QASA 1Q7YU 3L2QA 2FZKB 3C94A 4C0FA 2DERA 4LXCA 4MDXA 4K11A 2LJ1A 1GCPA 2RQRA 1U5SA 4LDVA 1D3BA 4F16A 4RTUA 2XD0A 1Z9ZA 2K5LA 3HRTA 2LQ8A 4C0ZA 1YJNT 3MHXA 3CCQQ 3AHUA 3FJPA 1SRMA 1VQPT 5DY9A 2JN0A 2RJEA 4PJJA 1B3QA 2HDAA 3ZEHA 4VUBA 5CQXA 4PLIA 1YJ9A 3G4SA 5GAOq 2QEXT 1NPRA 4JRQA 2E10A 4AG2C 4XTYA 1Y71A 3QWYA 5KYUA 4RTWA 1JU5C 1WNLA 4Z88A 2JW4A 4AT1B 2COZA 1GRIA 3EFOB 3WXMB 2YUNA 3EAEA 1VQKA 2CGHA 4C8QC 5GANd 4IKFA 1VQ6A 1TG0A 5LJ5d 3S3MA 1PG5B 2RHXA 1H92A 4FT4A 3EGXB 4M7DE 1Q82R 1NBEB 2P4TA 2X4YA 5IH2A 3CC2T 4ATOA 4L59A 3MP6A 3M0TA 5IN1A 3VYHB 2SEMA 3MEVA 2ROTA 1N8RC 1Q95G 2C0IA 3CCEA 2DA9A 5DLQE 2DIGA 2E70A 4QVZA 4XU1A 3JCMf 2K5FA 2Y90A 1HD3A 2HBWA 5DM7R 2XDBA 1OU9A 2ZGWA 3TSWA 1M1KU 4OMLA 4M7DA 4TVRA 4FW2A 1W2BA 2M9UA 3RR6A 1YCYA 4BUGA 3SHWA 3G4SQ 2PNIA 2KVQG 1Q86U 3QIIA 5AT1B 3BE3A 3VUZA 2DXBA 4MZTA 1XJWB 2ECZA 4M7AG 1BI1A 1M3AA 3RIRA 4A4KA 1GL5A 3OSVA 1R0BG 2ED1A 4BE2A 3D7SB 1YNZA 3JCMc 1G83A 4HT8A 3MEAA 1PSFA 5LJ5f 2RQWA 2LDMA 3OW2S 2KR3A 1YIJT 1BKBA 4RTXA 5FU7C 1LPLA 3JRZA 4O5VA 1VQLA 1UGRB 1ZQ1A 4RCBA 3MEWA 3JAME 1TUGB 3CCMA 1PD1A 3VU3C 4A4HA 1M2OA 5HK3A 1YCSB 2HD0A 2FEIA 1K8AC 1I1JA 5D6XA 3RBBB 3GOXA 1M30A 2R58A 3EHQA 2KRSA 2WSEE 5LJ5h 3FRNA 3M55A 4OB0B 3OYHA 3E9GA 2FPEA 1B7TA 3A8GB 4RTZA 1PCXA 3RNJA 1AZGB 5A0DA 4OMMA 1NJIC 1K9MR 2K7AA 4BACA 3CCVQ 1IB8A 2E6ZA 3QDRB 2QDYB 1WJRA 2D0NA 3CCUA 3PTAA 4XU0A 1X6GA 3REAB 1ZLMA 2JMAA 1WHGA 4XQ3A 1IZ6A 2KXCA 3CCJT 1VOMA 1KSWA 2BKDN 4J8OA 3CCVT 2DJQA 3SDZA 3I5SA 5GMKi 2E12A 4FSXA 2JXBA 2RK1A 2O4XA 1JB0E 3DB4A 5GAMf 3SWNB 1GCQC 1W4SA 3VRZA 3CC4T 1SEMA 2SRCA 1KQSS 2BUDA 1UHCA 1OI1A 3ZFJA 4BD3A 1ZSGA 3OYJA 3H41A 2M02A 4M7AE 1SSHA 4HCKA 2VYTA 3A98A 3KUFA 1B34B 3QSUA 3G6EA 1Q81U 1AD5A 2RJDA 3THKA 1N27A 3MP1A 3A8OB 3I9QA 3P8HA 3CC7A 4PKCC 4BE1A 1X75C 2FZGB 2X9HA 3G71T 4WCIA 1VQ9A 2LT1A 3KXTA 5CK9A 5GAN7 1PKSA 1QVFA 3SD4A 1CKBA 2FRYA 3CMAA 5KH6A 1WDXA 4X9CA 3UA7A 3QWXX 5IHKA 3ZL7C 3JCMQ 1RUWA 2LT4A 1Y96B 2LCSA 1UE9A 5LL6S 2MYSA 2HSEB 4LDUA 1PRLC 2JM9A 1UFFA 2HBPA 1QW1A 1WHKA 1M8MA 4FIBA 2CZ1B 2C0TA 3QKJA 2PQWA 1K8AU 3A8HB 4JS4A 4M75B 4B9WA 1WXUA 2E65A 1VQOA 3A8MB 3KFVA 3QO3A 2KMTA 4M77A 2LP5A 1MV0B 2RI5A 2RK2A 2JTEA 3G6EQ 2XDDA 2KYBA 5AYFA 2J7IA 2L0AA 4EPCA 1M1KR 2CP0A 4IIMA 4M78A 3CCEQ 4PLLA 4DEYA 3MCAB 4GBQA 3M57A 2DVEA 5L8RE 1FMVA 2JZ2A 3CMET 1NLOC 1Q81C 4PJOC 1JRIA 2EJGA 3PNWC 3BDLA 3RKYA 1G8XA 2D8HA 4C8QB 4M7DG 1VQ5T 3CCQT 4J6YA 3LWIA 1JJ2P 1ZBJA 5IHIA 2DTIA 3UF4A 4N4GA 1PD0A 2ED0A 4CI0C 2KRNA 2ZZDA 3VS1A 4M7DD 1Y07A 1M5Q1 4A4EA 1PHTA 1EZZB 3JCMJ 1TTHB 1XTDA 4Z02A 3OBWA 1YWOA 1QVGP 2RB6A 4QVDA 2EQIA 3CQTA 1G5VA 4GLKA 2DK3A 3JCMb 2QQRA 4LD6A 2IIMA 2M51A 5LJ5e 5LJ3d 2DTHA 1RAIB 3CC7T 1F1BB 2HEQA 3LWHA 1ABOA 2HKNA 3I56T 3WVDB 3EHRA 1PRMC 2HNIA 1YI2T 3QBYA 2DD5A 2LZ6B 2PUKB 2K57A 2O9VA 1S1NA 1NYFA 4AFZC 3UDCA 4YTLA 4J9CA 3VS4A 2JT4A 5GAN6 1M90C 3GLXA 2MK5A 1OULA 2BIVA 4C92A 3CC4A 2FG0A 3C0CA 3EG9B 2VV5A 2YRVA 1U3OA 3F70A 4C5IA 4BDZA 2K2VA 2L3RA 5KYXB 3UPUA 4FL6A 2EPDA 3CCLQ 2HQHA 2MPXC 4M7AC 1HK9A 4DA4A 3CCRQ 3OYDA 1JEGA 3CCJA 4J7IA 2QXFA 2DXUA 3EFOA 5GJVB 1QCOA 1Q82C 3ASKA 2ZPBB 2F2VA 1PSEA 3S6WA 2CZ7B 1W70A 3JB9J 1JJ2S 1TSFA 4E7JA 2EIFA 2ZCFB 4OB2B 4CC3A 2DF6A 2RF0A 2D8JA 1YHQA 1RI9A 4OGEA 2V8JA 1D0XA 1Q86R 4A63B 3PE0A 3RKXA 1VQ7Q 1QP3A 1X01A 1T3SA 2RJCA 2MAMA 1D3BB 4GY5A 3JCMV 1LNXA 2L5QA 3PGGA 3JV3A 1N8RU 2LTOA 3ZBDA 3A5ZB 2RPNA 3OY9A 3NGPA 2QEXQ 2EJ9A 3J80E 2H3JA 1M1FA 4KUDK 1CSKA 1VIFA 4M78D 3L1AA 1BU1A 2CUDA 2LQKA 3FLGA 1YHQT 2BZ8A 3CBPA 5CKDA 3OBYA 2DILA 3LGLA 4NL3A 3I56Q 2MF2A 1NM7A 1H641 2G3RA 1KC8C 2CREA 4M75F 1YJNQ 2HL5C 1YJWT 4M7AF 3I55T 2WSCE 4M78C 2CSIA 1Y0MA 1MV3A 4CC2A 3G7ZA 2VASA 3EH2A 4LDWA 2ZPIB 2EYZA 3V8KA 2O88A 1RAGB 4ZTFA 3VRYA 3OYLA 1E6GA 3BFMA 3DB3A 5KYWA 1C1AA 3EGDB 2VUBA 5HK0A 2JM8A 3EG0A 1VQMA 4BI4A 3VUBA 2QK0A 1BIBA 3OYKA 1UEBA 1K8AR 1M90U 3M0UA 2AZVA 4OMFB 2WSFE 1MUZA 3M4YA 5LJ3g 3CCET 4EMKB 4LDXA 4PK4A 4F7UG 2GGRA 2KK4A 5M9OA 2BZXA 1YI2A 2KRMA 4P5NA 3E19A 4PL6A 3FB9A 2LJ0A 4J9DA 1FWZA 1ZSZC 3QDFA 2BE7D 5A0LA 2DYBA 5KYXA 3VS0A 3VS6A 1NJIR 3AT1B 4CC7A 2GTJA 2VGMA 2J6OA 2P0PA 4E6RA 2DO3A 2XDPA 1AHJB 2HL3A 4RTVA 1UTIA 3I55Q 1YJWQ 2E6NA 1U1TA 1WHHA 4IUUA 1VQKT 1MGQA 4OVAA 1SG5A 1VQLQ 1VUBA 1VQ7T 1D0YA 2QQ9A 5FU6B 3FC3A 2KROA 4DBFA 1JBMA 4JRIA 4HT9A 3G4ST 1YJ9T 1WZOA 4JZ4A 4WF2A 2EBPA 5KYWB 1K0SA 5FU6C 3V8JA 2L3PA 3CMEQ 4PFPA 4HXJA 3VJPA 4EMGA 1BI0A 2DEQA 4PJOE 2RHUA 3SFMA 2JS2A 1VQ5A 4FYXB 2DTOA 1S72Q 1KD1C 4J9EA 4C8QE 1M4ZA 1OU8A 1M27C 2GFUA 1KFZA 3JB9F 4C5EA 2ZPFB 2YLBA 3Q1JA 1BB9A 2D1XA 3A8LB 5FROA 1MMDA 1XNIA 4J9GA 1BI3A 3SB2A 4DBRA 1QCFA 4RTTA 3CXCA 2AZSA 5EG2A 1U8RA 1ZBXA 4ZGJB 5LJ5j 1M8VA 2V8KA 3IQLA 1UGQB 4ME7A 3I55A 2QYZA 1YJWA 4LUEA 3MP8A 1VA7A 2E5KA 2QA4Q 4J7FA 1VQOT 1RI0A 1W2BP 3X24B 1WLPB 4KRTA 4JJNK 1D1AA 1IO6A 1YJ9Q 2DD4A 4E7IA 4LDYA 1SRLA 3FDRA 2CSQA 2R5MA 1M9SA 2CP5A 4M78B 2X3WD 3V7RA 4OMQA 1UHFA 3T9NA 3NFCA 1KC8U 2KQWA 2DE0X 1KQ1A 2LJ3A 1VQ8Q 4LNPA 4ZN3A 4M75A 1LVKA 2K9GA 1NG2A 2AIRB 1UUEA 4KH0B 3NPFA 4XU3A 4OP0A 3JCMX 1DJ7B 1A0NB 1RLPC 2KT1A 5A0GA 4E7LA 1BYMA 1IHVA 4HCZA 3VS7A 2MOXA 4QT7A 1SF9A 1RADB 4J9BA 2D6FA 2HSPA 4FCYA 3EG9A 1LCKA 2DL8A 4C92B 1K9AA 1ZSZA 2EVRA 2DRMA 2PVDB 2FHDA 4C92F 3R6OA 1T3LA 1WJSA 2V8IA 1SSFA 2QTXA 2L2PA 1M2VA 4KH1B 1PKTA 4AG1C 3X20B 2H3EB 2M16A 2RJFA 2BZYA 4JRKA 3VS3A 1QWFA 7AT1B 3L2ZA 1D1BA 4JJDA 2QQSA 2XIDA 4IIOA 3SEMA 5FWBA 4M7DC 1NYGA 2M0YA 3LGFA 4QQDA 4D8KA 2V26A 1R8OB 5LJ3h 3JB9G 3I56A 2K5IA 1RAAB 1WFWA 2O4XB 4FYVB 3H9NA 2M1HA 4J9HA 1OOTA 2DIQA 2HZYA 1OV3A 2CP6A 4M78E 4PJNA 4ELYC 3HPWA 2DL3A 2GNCA 1SPKA 2GQVA 4F17A 4J6WA 2VC8A 2EFIA 1M90R 4M7AB 1NE8A 1MMAA 4IURA 4HVVA 2KGTA 1XOVA 4HA8A 4EIKA 4KBMB 4C8QA 1KD1U 2RI2A 1OX9A 5GANf 2FPFA 2DNUA 1PWTA 5I22A 2GBQA 2XHCA 1EIFA 4JZ3A 1ZHIA
chains in the Genus database with same CATH topology
3RMQA 3BDUA 3CC7T 3LWHA 3CXCS 2PU9B 4JS5A 2B8AA 2ZPHB 3VV0A 4BI8B 2E1HA 2R57A 4BE0A 4J6XA 4OB1B 3QHSA 4UC4A 3I56T 3WVDB 5FRNA 2HQEA 1WPYA 2ZPEB 2K3XA 3L2RA 4M7AD 3JB9H 2HNIA 1G3TA 3V7CA 3N5BB 1YI2T 3QBYA 3S3OA 2DD5A 2PUKB 3HL8A 4BDYA 2K57A 2X35A 3UDCA 1UGPB 4YTLA 4E7KA 4PJOG 5GAMe 4M7AA 2QA4T 5LJ3f 5I2MA 5GAN6 4C92D 3CMEA 2F5TX 3RKWA 2E64A 1M90C 1XQHA 3GLXA 3OMCA 3TCJA 3OS5A 4RG2A 2BIVA 3OYCA 3NTIA 4C92A 5J26A 3CC4A 2LRQA 4DOVA 3CCVA 2VV5A 3PMTA 3M56A 4ZGEB 1VQ8A 2YRVA 3F70A 4C5IA 4BDZA 2K2VA 2L3RA 3M53A 4FM4B 3RUXA 4JDSA 4KT0E 4C5GA 3UPUA 4FL6A 2GF7A 5CR2A 4NL2A 1BIAA 4Q5WA 3HSBA 4C92G 4M7AC 4MZMA 1HK9A 1OZ2A 3JB9I 5GANe 2EKOA 4DA4A 1LJOA 3OYDA 1YITA 4M75E 3CCJA 3LW5E 4F7UB 3QYGB 4J7IA 4C0DB 3JCMW 1Q7YU 3L2QA 1K9MC 1WJQA 2QXFA 3OYFA 2FVUA 3C94A 2DXUA 4C0FA 4C5HA 4LD9K 4MDXA 3P8BB 5KE2A 4DOWA 4LDVA 1D3BA 5A2QE 2XD0A 4A4GA 1Q82C 3ASKA 2ZPBB 2K5LA 3DLMA 3HRTA 2QQAA 2K4YA 4BB7A 2LQ8A 4C0ZA 4J5YA 4C0DC 5I2SA 3OYNA 1YJNT 3QUIA 1N9RA 2FYKA 1PSEA 2RH2A 2JTFA 3MHXA 4IUVA 3S6WA 3SWNC 3AHUA 3FJPA 2CZ7B 3RESA 2EQJA 3CC2A 1YBYA 3JB9J 1JJ2S 1VQPT 5DY9A 2JN0A 2A7YA 5CVIA 2L8DA 2RJEA 4E7JA 2EIFA 2ZCFB 4OB2B 3ZEHA 2JVVA 4VUBA 1YHQA 5CQXA 4PLIA 4M77B 5J39A 3G4SA 5GAOq 4OGEA 1B34A 3JCMe 2QEXT 3P8DA 1YJ9A 1NPRA 2EAYA 2V8JA 4JRQA 1VQ7A 1S72T 2CZ6B 4EMHA 2K3YA 2E10A 3RKXA 4XTYA 1QP3A 1X01A 3OB9A 1VQLT 4M78F 1Y71A 2RJCA 2MAMA 1K73C 1D3BB 4GY5A 1VQ9T 3JCMV 1WNLA 4M75G 1LNXA 3X28B 1K73U 2L5QA 3WXMB 3PGGA 3EAEA 1N8RU 1VQKA 4N4IA 2CGHA 4C8QC 2LTOA 3SWNA 5GANd 1YIJA 3ZBDA 4IKFA 3A5ZB 2Y4XA 5I21A 1VQ6A 5LJ5d 3OY9A 3S3MA 2EJ9A 2RHXA 3J80E 4FT4A 3CPWS 2H3JA 1M1FA 4KUDK 1Y96A 2QEXA 4M7DE 3JSCA 1VIFA 3L1AA 4M77D 3FLGA 4M78D 2LQKA 5C0MA 3HFOA 4ELZC 3G6ET 1YHQT 3FEOA 1Q7YC 2P4TA 3CBPA 5CKDA 2EQUA 2X4YA 3OBYA 3LGLA 4IUTA 4N4HA 4Y28E 5HKCA 2L89A 2RHZA 3CCRT 2MWPA 4NL3A 3CC2T 2MF2A 4ATOA 4L59A 4C8QF 3MP6A 3HKSA 2XICA 5IN1A 3VYHB 2RHYA 4RCCA 3LLRA 3BW1A 1H641 2G3RA 3KBGA 3MEVA 4M77F 4M78G 1YJNA 1HXDA 1KC8C 2JTMA 4M75F 3HP9A 5FU7B 3CBMA 1N8RC 5CO7A 1YJWT 4M7AF 3CCEA 2OTJT 3I55T 5DLQE 3GNGA 5CQYA 2M0OA 4JLGA 5GAOm 3OYBA 4F7UF 2DIGA 2E70A 1VQMT 3H8ZA 3CCST 5GAMj 5GAOr 2WSCE 4M78C 4QVZA 4XU1A 3JCMf 4C8QD 2K5FA 5KCOA 2Y90A 3J7AF 3G7ZA 5DM7R 2XDBA 1VIEA 1N6AA 4LDWA 2ZGWA 2ZPIB 3V8KA 5GAN4 1M1KU 4M77C 4M7DA 4TVRA 2P0QA 5CAIA 4ZTFA 3OYLA 3BFMA 3DB3A 1W2BA 2M9UA 3OYAA 2VUBA 5GANh 1YCYA 4BUGA 5HK0A 2P0KA 1VQMA 4PNOA 2KVQG 4BI4A 1Q86U 3QIIA 1VQ8T 1WGSA 3GNFB 3VUBA 1BIBA 3CPWA 1OZ3A 1KQ2A 1M1GA 3VUZA 4X9DA 1UEBA 2DXBA 3OYKA 3CCUT 5FLXE 5GAN3 1KHIA 3OA6A 3CCSA 1M90U 4MZTA 2OAUA 2XU8A 4JLIA 3TEEA 3QPHA 2LNVA 4OMFB 2WSFE 4BY6B 4M7AG 1BI1A 3J81E 3M4YA 5LJ3g 3CCET 2OTJA 3RIRA 4A4KA 4EMKB 1Q82U 4LDXA 4F7UG 2RI3A 2KK4A 3OSVA 5M9OA 3MO8A 4BE2A 2X4XA 1YI2A 4QVCA 4P5NA 2LVMA 2ZPGB 4E47A 3OS1A 1VQNT 3E19A 4OGCA 4PL6A 3FB9A 4HCCA 3JCMc 5GAMh 1FWZA 4L6V5 5A0LA 3META 4HT8A 3OSSC 3MEAA 2KY9A 1BI2A 1PSFA 2DPPB 4L5GA 5LJ5f 2MWOA 2KAFA 2LDMA 2MI6A 1NPPA 2VGMA 3QG1A 3OW2S 1VQ6T 2P0PA 2EQKA 3ER0A 1YIJT 1BKBA 2DO3A 2F5KA 3JCMd 2CS7A 2XDPA 1AHJB 4RKUE 3CCMT 5GAMg 5FU7C 3GIBA 3C12A 4O5VA 3JRZA 2E6NA 1U1TA 2JNGA 1VQLA 4IUUA 1UGRB 1ZQ1A 1G3WA 4RCBA 1VQKT 1MGQA 4OVAA 3MEWA 4KULA 4B9XA 4ZGDB 3JAME 1VUBA 3RERA 3CCMA 2DZCA 3VU3C 4II1A 3E1SA 1VQ7T 2FL7A 2DXCA 4A4HA 4MZPA 1I5LA 1Y7XA 2QQ9A 5HK3A 5FU6B 2HD0A 2VXFA 3OYEA 1K8AC 2CYZB 1O75A 3FC3A 1JBMA 4JRIA 2RO0A 5D6XA 4EDUA 1VQPA 2IG0A 3G6EA 3GOXA 4HT9A 3G4ST 1YJ9T 2GFAA 4C0GA 2R58A 4WF2A 3C95A 2JOYA 2GCXA 2WSEE 3PT9A 3FRNA 3M55A 5LJ5h 5GAN2 2FB7A 4OB0B 3OYHA 4M7DB 2XG8D 1VQNA 3E9GA 5FU6C 3TREA 3PFSA 3V8JA 3A8GB 5FRMA 5GAMd 3VJPA 5A0DA 2YHTA 4EMGA 1BI0A 1KQSA 3JB9D 2DEQA 1NJIC 1H3ZA 4FU6A 4PJOE 1TH7A 3QYHB 4EMKC 4BACA 4QW2A 2E6ZA 2RHUA 3QDRB 4XK8E 4MMKA 2QDYB 3CEYA 1WJRA 3HRSA 3SFMA 1VQ5A 3CCUA 1WQWA 2DTOA 3PTAA 4XU0A 4A54A 4N0AA 3GPLA 1KD1C 4C8QE 1M4ZA 2CZ0B 2I2LA 5GMKj 3NTKA 4M75D 2GFUA 1GXIE 4XQ3A 1IZ6A 2DAQA 3JB9F 4C5EA 2R5AA 2ZPFB 5KE3A 2YLBA 2EWNA 3Q1JA 3QXEB 3CCJT 1JJ2A 3A8LB 3OYIA 4XAXB 5FROA 4J8OA 2BKDN 5GAOl 1XNIA 3E9FA 1UB4A 1BI3A 3SB2A 3CCVT 2HAXA 3SDZA 4M77G 3INZA 3CXCA 5GMKi 4N0AC 2VGNA 2EQMA 5EG2A 1U8RA 1ZBXA 4ZGJB 5LJ5j 1M8VA 1MHNA 2E12A 2V8KA 4FSXA 3UT1A 1UGQB 4ME7A 2RK1A 1I4K1 2O4XA 1FXXA 3I55A 1JB0E 1YJWA 3DB4A 4EMKA 1P92A 1WQ7A 2X4WA 3SWNB 1NZ9A 1W4SA 5GAMf 3CC4T 2O01E 3MP8A 5LJ3e 5CIUA 1Q86C 4JRPA 1KQSS 2BUDA 1OI1A 2XKOC 3ZFJA 4BD3A 4J7FA 4BI3A 3OYJA 2EYQA 1VQOT 1RI0A 2QA4A 3X24B 3M9QA 3QZ9B 3C4SA 3L2UA 4XTVA 5LJ5g 1I81A 3LYIA 4JJNK 4M7AE 5IT9E 3CCRA 2VYTA 1RL2A 1U1SA 4QQ6A 2DD4A 2OTLT 4M75C 4E7IA 4LDYA 5GANj 2E5QA 3FDRA 3KUFA 4HCBA 5GMKh 1B34B 3QSUA 5D6YA 5J3BA 2R5MA 3PIOA 2RM4A 1M9SA 3DKMA 2CKKA 2A3LA 4M78B 1Q81U 3X26B 3M4GA 3V7RA 2RJDA 3M59A 4CRIA 1N27A 3MP1A 4RG8A 1QP2A 3T9NA 3A8OB 4IUQA 3NFCA 3P8HA 3CC7A 4MDWA 4PKCC 4BE1A 1KC8U 2KQWA 1X75C 5GMKl 1KQ1A 3G71T 4R56A 1VQ9A 2LT1A 4D6WA 4M75A 4ZN3A 3KXTA 3OQ5A 5CK9A 4PJOD 3TU4K 2IVWA 2KSSA 4XU3A 3JCMh 5GAN7 1QVPA 1QVFA 3SD4A 1FX7A 2PVGB 4X34A 1G3YA 1S72A 2LC4A 3CMAA 3V8LA 3M54A 2DJZA 4OP0A 3JCMX 4M77E 5KH6A 1DJ7B 4BY6C 2MMPA 2VXEA 4R55A 4X9CA 5DLOA 3HHTB 4F7UA 5A0GA 4E7LA 1BYMA 4HCZA 1I8FA 4C92C 1KHCA 2PUOB 3JCMg 3JCMQ 5GAN5 2LT4A 1Y96B 5C6SA 3VYGA 3CCLT 2LX9A 4J83A 3X25B 3PIPA 2DZ9A 2D6FA 5LL6S 4LDUA 3OW2A 3CCQA 3L2VA 1X6OA 5CKFA 5KCHA 4A4FA 4ZN1A 4XTXA 3URGA 4C92B 2HBPA 2XI9A 1G3SA 1QW1A 4FIBA 4NS5A 3GP8A 4XTUA 2OTLA 2PVDB 2FHDA 3M5AA 2CZ1B 4C92F 2LCLA 1WJSA 3R6OA 2V8IA 1VQ4A 3QKJA 2RA2A 1SSFA 2PQWA 2RHIA 3A8HB 4OB3B 1K8AU 2QTXA 4JS4A 5GMKe 4M75B 4IUPA 2E65A 4B9WA 1VQOA 1YITT 1W2BS 1K9MU 2Y4YA 3A8MB 1QVGS 3QO3A 3OMGA 2KMTA 3BY7A 5CKHA 3CPFA 4M77A 2RI5A 2RK2A 3PMIA 4XTWA 5D6WA 3X20B 2M16A 1N9SA 2RJFA 2PVOB 3QJYA 2XDDA 3OYGA 2QQBA 2AHJB 4OF1A 5AYFA 2KDSA 4XU2A 4EPCA 4JRKA 2EJFA 3LX7A 3H6ZA 3LH0A 4M78A 4Y91A 4PLLA 3L2ZA 2YLCA 3MCAB 4ZTJA 3M58A 1IREB 3L2WA 4E7HA 3M57A 2QQSA 2XIDA 2DVEA 5L8RE 2D9TA 4DQ2A 2JZ2A 3CBOA 3RMSA 3CMET 1V29B 4M7DC 1Q81C 3LGFA 2DXTA 4PJOC 3WVEB 1JRIA 4QQDA 4RMOA 2EJGA 3PNWC 3BDLA 4F7UE 1R8OB 3FIFA 3RKYA 5LJ3h 3JB9G 4O6JA 4C8QB 4NOYA 2DKGA 3ME9A 5IAYA 1KG1A 3VKIA 1OYXA 3GF5A 3I56A 4M7DG 3HRUA 1VQ5T 4A53A 2K5IA 2O4XB 3CCQT 4J6YA 1VQ4T 2LCCA 3LWIA 5GMKm 5CKBA 2D0QB 5HY6A 2F69A 1NJIU 4QQGA 4PJOB 2M1HA 2XK0A 2DTIA 3DLLA 3JCMP 4N4GA 3CD6A 4CI0C 2DIQA 2ZZDA 3EFSA 4FT2A 3NTHA 5GAOp 4M7DD 1Y07A 4KUIA 1M5Q1 4M78E 3O8VA 4A4EA 4XTZA 3CCLA 2HQXA 4ELYC 3OS0A 3JCMJ 3OYYA 5GANg 1QVGA 3HPWA 1LOJA 2GQVA 4MMLA 2JUFA 5GAOn 4J6WA 1XTDA 2VC8A 2EFIA 5CKEA 3HFNA 4Z02A 1M1KC 2C06A 3CMAT 3OBWA 2NLUA 4PJOA 2X4JA 4M7AB 1NE8A 2RB6A 3UWNA 4QVDA 1UGSB 4IURA 1XOVA 1O9SA 2WACA 2QI2A 4HA8A 4M7DF 4V2SA 3OYMA 1G5VA 4KBMB 2E41A 3QZ5B 4C8QA 4C8QG 4PJOF 5LJ3j 3OS2A 3G71A 1KD1U 4GLKA 3EFRA 2RI2A 3MEUA 4HKEA 2DK3A 4JUVA 5GANf 3JCMb 3QJ6A 4C92E 2QQRA 4LD6A 1QVFS 5LJ5e 5GAN8 2XHCA 5LJ3d 1EIFA 3L42A 3V7SA 2DTHA 3CD6T 5CCAA 1ZHIA 2RD1A 3S3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDU A;  1Y96 B;  5LJ5 h;  5GAN 2;  2DZ9 A;  2FB7 A;  4M7D B;  2E1H A;  3V8J A;  4J6X A;  4NL3 A;  3QHS A;  5GAM d;  4C8Q F;  2YHT A;  4EMG A;  4XTX A;  1WPY A;  4C92 B;  2DEQ A;  3JB9 D;  4RCC A;  4M7A D;  4XTU A;  4PJO E;  1TH7 A;  1H64 1;  2HNI A;  3BW1 A;  3V7C A;  4EMK C;  3JB9 H;  4M77 F;  4M78 G;  4C92 F;  1HXD A;  2K57 A;  2RA2 A;  4MMK A;  4M75 F;  1WQW A;  2DTO A;  2QTX A;  4PJO G;  4XU0 A;  5GAM e;  4A54 A;  4M75 B;  4N0A A;  5GMK e;  4M7A A;  2E65 A;  5LJ3 f;  5GAN 6;  4C92 D;  3RKW A;  2E64 A;  4C8Q E;  4F7U F;  3QO3 A;  5GAO m;  2I2L A;  3BY7 A;  5GMK j;  4M75 D;  4M78 C;  4M77 A;  5GAM j;  5GAO r;  4XQ3 A;  4XU1 A;  3JCM f;  4XTW A;  4C8Q D;  4C92 A;  3JB9 F;  2Y90 A;  1N9S A;  2YLB A;  2EWN A;  5GAO l;  2ZGW A;  4XU2 A;  3V8K A;  5GAN 4;  4JRK A;  3RUX A;  2EJF A;  4M77 C;  4M78 A;  3SB2 A;  4Y91 A;  4M7D A;  5CAI A;  3L2Z A;  1BIA A;  2YLC A;  4NL2 A;  3BFM A;  3HSB A;  4M77 G;  3INZ A;  4C92 G;  5GMK i;  4N0A C;  5GAN h;  1YCY A;  4M7A C;  1HK9 A;  3JB9 I;  5LJ5 j;  1M8V A;  2DVE A;  4PNO A;  5GAN e;  4DQ2 A;  1LJO A;  1I4K 1;  4M75 E;  4WF2 A;  4M7D C;  1BIB A;  4F7U B;  3JCM W;  1KQ2 A;  2DXT A;  4X9D A;  1WQ7 A;  4EMK A;  4PJO C;  5GAM f;  1JRI A;  3SWN B;  5GAN 3;  2DXU A;  5LJ3 e;  2EJG A;  4F7U E;  3FIF A;  3RKY A;  5LJ3 h;  3JB9 G;  4JLI A;  4C8Q B;  4NOY A;  4M7A G;  2DKG A;  1D3B A;  5LJ3 g;  4M7D G;  3RIR A;  4EMK B;  4XTV A;  4A53 A;  4F7U G;  1I81 A;  5LJ5 g;  4J6Y A;  4M7A E;  5GMK m;  4J5Y A;  4QVC A;  1U1S A;  3QUI A;  4M75 C;  4PJO B;  1N9R A;  2FYK A;  3FB9 A;  3SWN C;  5GAN j;  3JCM c;  3FJP A;  1B34 B;  5GMK h;  2DTI A;  5GAM h;  3AHU A;  3QSU A;  2RM4 A;  3RES A;  3JCM P;  4M78 B;  3M4G A;  3V7R A;  4HT8 A;  3JB9 J;  5DY9 A;  3EFS A;  2JN0 A;  5LJ5 f;  5GAO p;  4M7D D;  1M5Q 1;  4M78 E;  4XTZ A;  3JCM J;  5GAN g;  4M77 B;  1LOJ A;  4MML A;  3JCM d;  5GMK l;  1B34 A;  3JCM e;  5GAO q;  5GAO n;  1KQ1 A;  4J6W A;  2VC8 A;  2EAY A;  3HFN A;  4PJO A;  5GAM g;  3GIB A;  4M75 A;  4M7A B;  4EMH A;  1U1T A;  2RB6 A;  2E10 A;  4QVD A;  4PJO D;  3RKX A;  4XTY A;  1X01 A;  4XU3 A;  3JCM h;  5GAN 7;  4RCB A;  4M78 F;  1MGQ A;  4M7A F;  3RER A;  1D3B B;  4HA8 A;  4M7D F;  4V2S A;  2DZC A;  1WNL A;  4M75 G;  1LNX A;  2E41 A;  3JCM V;  3VU3 C;  4C8Q A;  4PJO F;  3V8L A;  4C8Q G;  3PGG A;  5LJ3 j;  2DJZ A;  4OP0 A;  3EFR A;  4M77 E;  3JCM X;  1I5L A;  4JUV A;  5GAN f;  2CGH A;  4C8Q C;  4C92 E;  2VXF A;  3JCM b;  2VXE A;  3SWN A;  5GAN d;  4X9C A;  5I21 A;  4F7U A;  5LJ5 d;  2EJ9 A;  5LJ5 e;  1JBM A;  5GAN 8;  1I8F A;  4JRI A;  4C92 C;  5LJ3 d;  3V7S A;  4HT9 A;  2DTH A;  3JCM Q;  3JCM g;  1Y96 A;  4M7D E;  4M77 D;  3L1A A;  4M78 D;  5GAN 5;  2RD1 A;  3HFO A; 
#chains in the Genus database with same CATH topology
 1H8K A;  4BI8 B;  2R57 A;  1M3B A;  4OB1 B;  4DBQ A;  4UC4 A;  2HQE A;  1WPY A;  2ZPE B;  1JQQ A;  2K3X A;  3UAT A;  4M7A D;  3JB9 H;  2QGF B;  1R0C B;  4BDY A;  1KQS P;  2YUP A;  1WHJ A;  4PJO G;  5GAM e;  4M7A A;  5I2M A;  4C92 D;  3CME A;  3RKW A;  1M3C A;  5IXB A;  1XQH A;  2NUZ A;  1RLQ C;  1X6B A;  5J26 A;  3PVL A;  4ZGE B;  3M53 A;  1WHL A;  1N8R R;  3HSB A;  4C92 G;  3CMA Q;  4Y92 A;  4M75 E;  4C0D B;  1WJQ A;  4PJL A;  2FVU A;  1BBZ A;  4LD9 K;  3P8B B;  5KE2 A;  4DOW A;  1YFN A;  4A4G A;  2COY A;  2K4Y A;  1SKU B;  4J5Y A;  4C0D C;  3OYN A;  2DYI A;  3QUI A;  5KYY A;  1N9R A;  2FYK A;  2JTF A;  4IUV A;  3EG1 A;  2P4R A;  3CC2 A;  1YBY A;  1HJD A;  2A7Y A;  5CVI A;  2JVV A;  1KC8 R;  2ABL A;  1E7O A;  1B34 A;  1C0M A;  2V1Q A;  2EAY A;  4X1V A;  1VQ7 A;  2CZ6 B;  1TWB A;  2A36 A;  4EMH A;  2O2O A;  1UDL A;  3OB9 A;  1X2Q A;  1ZUK A;  2DM1 A;  2JJ9 A;  1K73 C;  1MMG A;  1K0X A;  1VQ9 T;  4M75 G;  4N4I A;  3SWN A;  2YWW A;  1T0J A;  2QEX A;  4FSS A;  2KE9 A;  2X3X D;  3G6E T;  3FEO A;  4F04 B;  1Q7Y C;  1X69 A;  1AWJ A;  4N4H A;  4KGZ B;  3CXC P;  1ARK A;  1Q81 R;  2XIC A;  1EFN A;  2QGG A;  4RCC A;  1YWP A;  3KBG A;  1YJN A;  4M78 G;  1WA7 A;  2JTM A;  5FU7 B;  3HP9 A;  1TS9 A;  5CO7 A;  2OTJ T;  3CCM Q;  3GNG A;  1ZX6 A;  2M0O A;  4JLG A;  5GAO m;  4F7U F;  1VQM T;  1UEC A;  5GAO r;  1G2B A;  1K76 A;  2L3S A;  2P84 A;  4RTY A;  5KCO A;  2F2W A;  3J7A F;  1N6A A;  2FZC B;  4M77 C;  3RDV A;  3OYA A;  4KGV B;  2E3H A;  1PC0 A;  4PNO A;  4HVU A;  2GQI A;  3G71 Q;  1WGS A;  3GNF B;  1VQM Q;  1OZ3 A;  1KQ2 A;  1GFC A;  1M1G A;  3CCU T;  5GAN 3;  1KHI A;  3CCS A;  2OAU A;  3TEE A;  4JLI A;  3QPH A;  2LNV A;  2E4H A;  1YN8 A;  4FYW B;  4D8D A;  1YI2 Q;  1VQK Q;  2RI3 A;  2YUQ A;  2X4X A;  2ZPG B;  4E47 A;  3OS1 A;  4OGC A;  3OSS C;  2KY9 A;  1BI2 A;  2CP3 A;  3O5Z A;  1OPL A;  2KAF A;  2MWO A;  2F5K A;  1K1Z A;  1RAB B;  3CCM T;  4E7S A;  4DBH A;  3CC4 Q;  2MCN A;  1G3W A;  4B9X A;  4II1 A;  4PJM A;  1WHM A;  2DXC A;  4ORZ A;  1I5L A;  2VXF A;  3OYE A;  2CYZ B;  1O75 A;  1BK2 A;  5I11 A;  2RO0 A;  4EDU A;  1QWE A;  5IHN A;  3C95 A;  2LQW A;  2VVK A;  2DX1 A;  5GAN 2;  4M7D B;  4AFS C;  3TRE A;  3PFS A;  5GAM d;  2V1R A;  2YHT A;  1KQS A;  4PFO A;  1H3Z A;  4DEX A;  3QYH B;  1T0H A;  1ABQ A;  1D0Z A;  2J6K A;  4MMK A;  3CEY A;  3HRS A;  2HCK A;  2DMO A;  4A54 A;  4N0A A;  3GPL A;  1JO8 A;  2I2L A;  3NTK A;  1GXI E;  3VS5 A;  2R5A A;  3TQ7 P;  1TOV A;  1WXT A;  1JJ2 A;  2K79 A;  2EKH A;  4XAX B;  1CKA A;  5GAO l;  3INZ A;  2VGN A;  2G6F X;  1MHN A;  3UT1 A;  3EGX A;  1I4K 1;  1SHF A;  4EMK A;  2RMO A;  3ULR B;  1Q86 C;  1QMC A;  4JRP A;  1RAF B;  2XKO C;  4BI3 A;  1VQ4 Q;  2EYQ A;  2QA4 A;  1X2K A;  1I81 A;  5IT9 E;  2QTV A;  2VWF A;  1U1S A;  2OTL T;  4M75 C;  3EGD A;  2DET A;  5J3B A;  3PIO A;  2A3L A;  3X26 B;  3M4G A;  1GFD A;  4RG8 A;  2K3B A;  2CT4 A;  4MDW A;  1IGQ A;  1OQK A;  2RQT A;  4R56 A;  4D6W A;  2B86 A;  1WYX A;  3TU4 K;  2KSS A;  1QVP A;  2PVG B;  1I07 A;  4X34 A;  1G3Y A;  1QCN A;  3M54 A;  2DJZ A;  1W6X A;  2VXE A;  2CUB A;  1GCQ A;  2NWM A;  1HSQ A;  4F7U A;  4C92 C;  5GAN 5;  3VYG A;  3CCL T;  4J83 A;  2ESW A;  3X25 B;  3PIP A;  2DZ9 A;  1RAE B;  2J05 A;  3CCQ A;  2I0N A;  5CKF A;  4ZN1 A;  1KK7 A;  2F1L A;  2XI9 A;  3URG A;  3GP8 A;  4NS5 A;  2YUO A;  3M5A A;  2QG9 B;  2YRC A;  1VQ4 A;  2EGA A;  2RA2 A;  1VYU A;  2OTL Q;  2RHI A;  4Z8A A;  4PFZ A;  1YIT T;  2Y4Y A;  1QVG S;  4QKU A;  3BY7 A;  2HMA A;  3PMI A;  1ZUU A;  2CDT A;  1N9S A;  3QJY A;  2QQB A;  2AHJ B;  2EJF A;  3LH0 A;  4Y91 A;  4AMC A;  1SHG A;  2E3I A;  2MIO A;  3CC7 Q;  3M58 A;  1IRE B;  2OTJ Q;  2W0Z A;  2D9T A;  4OMO A;  3RMS A;  2KYM A;  1AWW A;  1V29 B;  1VQ9 Q;  4F14 A;  3WVE B;  1RAC B;  4RMO A;  2KBT A;  4F7U E;  2KNB B;  2RQU A;  4O6J A;  4NOY A;  2DKG A;  3ME9 A;  1KG1 A;  3VKI A;  2ATC B;  1OYX A;  3GF5 A;  1GBR A;  3HTR A;  3A1P A;  2PTK A;  1FMK A;  2A08 A;  1VQ4 T;  2LCC A;  5GMK m;  5CKB A;  2D0Q B;  5HY6 A;  2F69 A;  1NJI U;  2YSQ A;  2XK0 A;  2KXD A;  1AT1 B;  3JCM P;  1AEY A;  3EFS A;  2ROL A;  4FT2 A;  5GAO p;  4KUI A;  3MPU B;  3CD6 Q;  3O8V A;  1MND A;  4XTZ A;  3CCL A;  1VQ5 Q;  3OS0 A;  5GAN g;  1LOJ A;  2JUF A;  4JPB W;  3CMA T;  2C06 A;  3HFN A;  1VYT A;  2LQN A;  4PJO A;  2NLU A;  2X4J A;  1UGS B;  1ZUY A;  2J06 A;  3M0S A;  1BCO A;  1TUD A;  2OAW A;  4V2S A;  4GLM A;  4WTO B;  3QZ5 B;  4C8Q G;  2F2X A;  2RQV A;  4PJO F;  1W1F A;  5LJ3 j;  2ENM A;  3G71 A;  1KD1 R;  1FMW A;  1TU0 B;  2LNH B;  1WXB A;  1QVF S;  3EGU A;  3CD6 T;  2DL5 A;  3S3N A;  3RMQ A;  3CXC S;  1I0C A;  3VV0 A;  2E1H A;  1X43 A;  5FRN A;  2AK5 A;  1IRX A;  3V7C A;  1TXQ A;  3S3O A;  2DVJ A;  3H0F A;  3HL8 A;  4CC4 B;  1QKW A;  2X35 A;  1KIK A;  1IGU A;  4E7K A;  2QA4 T;  2YDL A;  5LJ3 f;  2E64 A;  1MMN A;  2DEU A;  3OYC A;  2Z0W A;  5GJW B;  1FYN A;  3CCV A;  1VQ8 A;  2NUT B;  4C5G A;  1WX6 A;  4JDS A;  2DBK A;  2GF7 A;  5CR2 A;  4NL2 A;  2L3Q A;  4MZM A;  1K73 R;  5GAN e;  1LJO A;  1IXD A;  1QQJ A;  3LW5 E;  3JCM W;  1K9M C;  3OYF A;  3EG3 A;  4C5H A;  2VB6 A;  5HCK A;  2YT6 A;  5A2Q E;  3DLM A;  2QQA A;  2CP2 A;  4BB7 A;  5I2S A;  2NUP B;  2RH2 A;  3SWN C;  1NLP C;  3RES A;  2EQJ A;  2A37 A;  2RNA A;  4R0K A;  2L8D A;  2YRD A;  4E2F B;  1OX8 A;  4M77 B;  5J39 A;  2DFU A;  3JCM e;  3P8D A;  2DBM A;  5KYY B;  1S72 T;  2K3Y A;  1VQL T;  3NMZ C;  4M78 F;  1JXM A;  1BCM A;  1WI7 A;  5ECA A;  3X28 B;  1K73 U;  2ZAE A;  1YIJ A;  3PVQ A;  3MKD A;  4KGX B;  5I21 A;  2Y4X A;  2CH4 A;  4OMP A;  2OJ2 A;  3CPW S;  1Y96 A;  2LMJ A;  3JSC A;  4M77 D;  5C0M A;  3HFO A;  4ELZ C;  1K4U S;  1PNJ A;  2EQU A;  4IUT A;  2K2M A;  4Y28 E;  5HKC A;  3M0Q A;  3VS2 A;  2L89 A;  2RHZ A;  3CCR T;  2MWP A;  1WIE A;  4C8Q F;  1KJW A;  3HKS A;  2XMF A;  2K6D A;  2RHY A;  3LLR A;  3BW1 A;  4M77 F;  1HXD A;  5FWC A;  1Z9Q A;  3CBM A;  2H8H A;  5CQY A;  3OYB A;  2NYS A;  3H8Z A;  1U06 A;  3CCS T;  5GAM j;  9ATC B;  4C8Q D;  2O31 A;  1I5O B;  1VIE A;  1VQP Q;  5GAN 4;  2EYY A;  2P0Q A;  5CAI A;  5GAN h;  1VQN Q;  2P0K A;  2NUP A;  4LN2 A;  1UJY A;  6AT1 B;  1VQ8 T;  3CPW A;  4X9D A;  5FLX E;  3OA6 A;  1D09 B;  4M4Z A;  2XU8 A;  4BY6 B;  3J81 E;  3CCS Q;  2OTJ A;  1Q82 U;  4JJC A;  3MO8 A;  2QDL A;  3I35 A;  4QVC A;  2LVM A;  1VQN T;  4HCC A;  5GAM h;  4L6V 5;  1N5Z A;  3MET A;  2DPP B;  2X51 A;  4L5G A;  2MI6 A;  1NPP A;  3QG1 A;  1VQ6 T;  2EQK A;  3ER0 A;  3JCM d;  2CS7 A;  2RN8 A;  1X27 A;  2O9S A;  4RKU E;  5L23 A;  5GAM g;  3GIB A;  3C12 A;  2JNG A;  1AVZ C;  1IHW A;  4KUL A;  4ZGD B;  3RER A;  2FO0 A;  2DZC A;  3E1S A;  2FL7 A;  4MZP A;  1Y7X A;  2EGC A;  2J6F A;  1VQP A;  3H0I A;  2IG0 A;  2GFA A;  4C0G A;  1ZA1 B;  2DL4 A;  2JOY A;  2GCX A;  3PT9 A;  2FB7 A;  4JJB A;  2XG8 D;  1VQN A;  1TUC A;  5FRM A;  2BTT A;  3JB9 D;  2KEA A;  4FU6 A;  1TH7 A;  4EMK C;  1M2V B;  3EG2 A;  4QW2 A;  4XK8 E;  2AKL A;  1WQW A;  1MNE A;  2LX7 A;  3M0P A;  2CZ0 B;  1ZSZ B;  5GMK j;  4M75 D;  3FJ5 A;  2A0F B;  2FRW A;  1YIT Q;  2JMC A;  2DAQ A;  1NEB A;  4Z89 A;  5KE3 A;  2EWN A;  1PM3 A;  3QXE B;  3OYI A;  3E9F A;  1UB4 A;  2AT1 B;  2HAX A;  1NEG A;  4M77 G;  4N0A C;  2EQM A;  5KYN A;  3NHN A;  1FXX A;  2CH4 W;  1P92 A;  1WQ7 A;  2X4W A;  1NZ9 A;  2O01 E;  5LJ3 e;  5CIU A;  1H3H A;  3CC2 Q;  1OPK A;  4J9I A;  3M9Q A;  3QZ9 B;  3C4S A;  3L2U A;  4XTV A;  5LJ5 g;  3LYI A;  3CCR A;  2DRK A;  3CCJ Q;  1RL2 A;  4QQ6 A;  2FPD A;  8ATC B;  5GAN j;  2E5Q A;  2DLP A;  4HCB A;  5GMK h;  5D6Y A;  2RM4 A;  3DKM A;  3TSZ A;  2CKK A;  4ESR A;  1D1C A;  3M59 A;  4CRI A;  1OEB A;  1QP2 A;  1Q7Y R;  4IUQ A;  3G1J A;  5IXF A;  5GMK l;  1QVF P;  3H0H A;  2A28 A;  1V76 A;  1UJ0 A;  3OQ5 A;  4PJO D;  2IVW A;  3JCM h;  1C6V X;  2VKN A;  1FX7 A;  1S72 A;  2LC4 A;  1R77 A;  3V8L A;  1ACM B;  4M77 E;  2BE9 B;  4BY6 C;  2MMP A;  4R55 A;  5DLO A;  3HHT B;  1JXO A;  1I8F A;  1KHC A;  2QAZ A;  2PUO B;  3JCM g;  2COW A;  4HVW A;  5C6S A;  2LX9 A;  4ANJ A;  2NUT A;  1UGV A;  3I5R A;  1YIJ Q;  3OW2 A;  3L2V A;  1X6O A;  5KCH A;  4A4F A;  4XTX A;  1G3S A;  2AKK A;  4XTU A;  2OTL A;  3OW2 P;  5KYU B;  2LCL A;  1VQO Q;  4OB3 B;  1AZE A;  2HKQ B;  4OMN A;  5GMK e;  5D7U A;  1YHQ Q;  4IUP A;  1K9M U;  1W2B S;  3OMG A;  5CKH A;  3CPF A;  5D6W A;  4XTW A;  2KT8 A;  2PVO B;  3OYG A;  1UG1 A;  2CP7 A;  4OF1 A;  2KDS A;  4XU2 A;  2JS0 A;  4LE9 A;  5EC7 A;  3LX7 A;  1AWO A;  3H6Z A;  2YLC A;  2CT3 A;  4ZTJ A;  4E7H A;  3L2W A;  4FW1 A;  2IPO B;  2EYX A;  4DQ2 A;  3CBO A;  2PZ1 A;  1HYO A;  2DXT A;  1J3T A;  1AWX A;  4LUD A;  2C0O A;  3FIF A;  4J9F A;  3TVT A;  5IAY A;  3HRU A;  4A53 A;  4QQG A;  2DL7 A;  4PJO B;  3M0R A;  3DLL A;  3CD6 A;  3MJX A;  3NTH A;  4AFQ C;  2HQX A;  4E7Z A;  4FYY B;  3CCU Q;  3OYY A;  1QVG A;  4MML A;  5GAO n;  5CKE A;  1M1K C;  1YP5 A;  3UA6 A;  3UWN A;  3E2U A;  1O9S A;  2WAC A;  2QI2 A;  4M7D F;  3OYM A;  1E6H A;  2E41 A;  3EH1 A;  3OS2 A;  1ZA2 B;  3EFR A;  3MEU A;  4HKE A;  4JUV A;  2GTO A;  3QJ6 A;  4C92 E;  5GAN 8;  1VYV A;  3V7S A;  3L42 A;  5CCA A;  1RAH B;  3REB B;  2RD1 A;  2OI3 A;  3BDU A;  1EX4 A;  2PU9 B;  4JS5 A;  2B8A A;  2ZPH B;  2YXY A;  2EW3 A;  4BE0 A;  4J6X A;  1B07 A;  3QHS A;  5FW9 A;  3GBQ A;  3L2R A;  3U23 A;  1G3T A;  3N5B B;  3CPW P;  1GBQ A;  1V1C A;  1UGP B;  1QKX A;  4ZNX A;  2F5T X;  3OMC A;  4RUG A;  3TCJ A;  3OS5 A;  2KI7 A;  4RG2 A;  1Y57 A;  3NTI A;  3R6N A;  1VQ6 Q;  2LRQ A;  4B6M A;  4DOV A;  3PMT A;  3M56 A;  4AFU C;  1QLY A;  1AOJ A;  4FM4 B;  3RUX A;  2OX7 A;  4KT0 E;  1BIA A;  4Q5W A;  2EYW A;  2EGE A;  3LH5 A;  8AT1 B;  3JB9 I;  1OZ2 A;  2EKO A;  1YIT A;  2W10 A;  3QYG B;  4F7U B;  2QAS A;  1Q7Y U;  3L2Q A;  2FZK B;  3C94 A;  4C0F A;  2DER A;  4LXC A;  4MDX A;  4K11 A;  2LJ1 A;  1GCP A;  2RQR A;  1U5S A;  4LDV A;  1D3B A;  4F16 A;  4RTU A;  2XD0 A;  1Z9Z A;  2K5L A;  3HRT A;  2LQ8 A;  4C0Z A;  1YJN T;  3MHX A;  3CCQ Q;  3AHU A;  3FJP A;  1SRM A;  1VQP T;  5DY9 A;  2JN0 A;  2RJE A;  4PJJ A;  1B3Q A;  2HDA A;  3ZEH A;  4VUB A;  5CQX A;  4PLI A;  1YJ9 A;  3G4S A;  5GAO q;  2QEX T;  1NPR A;  4JRQ A;  2E10 A;  4AG2 C;  4XTY A;  1Y71 A;  3QWY A;  5KYU A;  4RTW A;  1JU5 C;  1WNL A;  4Z88 A;  2JW4 A;  4AT1 B;  2COZ A;  1GRI A;  3EFO B;  3WXM B;  2YUN A;  3EAE A;  1VQK A;  2CGH A;  4C8Q C;  5GAN d;  4IKF A;  1VQ6 A;  1TG0 A;  5LJ5 d;  3S3M A;  1PG5 B;  2RHX A;  1H92 A;  4FT4 A;  3EGX B;  4M7D E;  1Q82 R;  1NBE B;  2P4T A;  2X4Y A;  5IH2 A;  3CC2 T;  4ATO A;  4L59 A;  3MP6 A;  3M0T A;  5IN1 A;  3VYH B;  2SEM A;  3MEV A;  2ROT A;  1N8R C;  1Q95 G;  2C0I A;  3CCE A;  2DA9 A;  5DLQ E;  2DIG A;  2E70 A;  4QVZ A;  4XU1 A;  3JCM f;  2K5F A;  2Y90 A;  1HD3 A;  2HBW A;  5DM7 R;  2XDB A;  1OU9 A;  2ZGW A;  3TSW A;  1M1K U;  4OML A;  4M7D A;  4TVR A;  4FW2 A;  1W2B A;  2M9U A;  3RR6 A;  1YCY A;  4BUG A;  3SHW A;  3G4S Q;  2PNI A;  2KVQ G;  1Q86 U;  3QII A;  5AT1 B;  3BE3 A;  3VUZ A;  2DXB A;  4MZT A;  1XJW B;  2ECZ A;  4M7A G;  1BI1 A;  1M3A A;  3RIR A;  4A4K A;  1GL5 A;  3OSV A;  1R0B G;  2ED1 A;  4BE2 A;  3D7S B;  1YNZ A;  3JCM c;  1G83 A;  4HT8 A;  3MEA A;  1PSF A;  5LJ5 f;  2RQW A;  2LDM A;  3OW2 S;  2KR3 A;  1YIJ T;  1BKB A;  4RTX A;  5FU7 C;  1LPL A;  3JRZ A;  4O5V A;  1VQL A;  1UGR B;  1ZQ1 A;  4RCB A;  3MEW A;  3JAM E;  1TUG B;  3CCM A;  1PD1 A;  3VU3 C;  4A4H A;  1M2O A;  5HK3 A;  1YCS B;  2HD0 A;  2FEI A;  1K8A C;  1I1J A;  5D6X A;  3RBB B;  3GOX A;  1M30 A;  2R58 A;  3EHQ A;  2KRS A;  2WSE E;  5LJ5 h;  3FRN A;  3M55 A;  4OB0 B;  3OYH A;  3E9G A;  2FPE A;  1B7T A;  3A8G B;  4RTZ A;  1PCX A;  3RNJ A;  1AZG B;  5A0D A;  4OMM A;  1NJI C;  1K9M R;  2K7A A;  4BAC A;  3CCV Q;  1IB8 A;  2E6Z A;  3QDR B;  2QDY B;  1WJR A;  2D0N A;  3CCU A;  3PTA A;  4XU0 A;  1X6G A;  3REA B;  1ZLM A;  2JMA A;  1WHG A;  4XQ3 A;  1IZ6 A;  2KXC A;  3CCJ T;  1VOM A;  1KSW A;  2BKD N;  4J8O A;  3CCV T;  2DJQ A;  3SDZ A;  3I5S A;  5GMK i;  2E12 A;  4FSX A;  2JXB A;  2RK1 A;  2O4X A;  1JB0 E;  3DB4 A;  5GAM f;  3SWN B;  1GCQ C;  1W4S A;  3VRZ A;  3CC4 T;  1SEM A;  2SRC A;  1KQS S;  2BUD A;  1UHC A;  1OI1 A;  3ZFJ A;  4BD3 A;  1ZSG A;  3OYJ A;  3H41 A;  2M02 A;  4M7A E;  1SSH A;  4HCK A;  2VYT A;  3A98 A;  3KUF A;  1B34 B;  3QSU A;  3G6E A;  1Q81 U;  1AD5 A;  2RJD A;  3THK A;  1N27 A;  3MP1 A;  3A8O B;  3I9Q A;  3P8H A;  3CC7 A;  4PKC C;  4BE1 A;  1X75 C;  2FZG B;  2X9H A;  3G71 T;  4WCI A;  1VQ9 A;  2LT1 A;  3KXT A;  5CK9 A;  5GAN 7;  1PKS A;  1QVF A;  3SD4 A;  1CKB A;  2FRY A;  3CMA A;  5KH6 A;  1WDX A;  4X9C A;  3UA7 A;  3QWX X;  5IHK A;  3ZL7 C;  3JCM Q;  1RUW A;  2LT4 A;  1Y96 B;  2LCS A;  1UE9 A;  5LL6 S;  2MYS A;  2HSE B;  4LDU A;  1PRL C;  2JM9 A;  1UFF A;  2HBP A;  1QW1 A;  1WHK A;  1M8M A;  4FIB A;  2CZ1 B;  2C0T A;  3QKJ A;  2PQW A;  1K8A U;  3A8H B;  4JS4 A;  4M75 B;  4B9W A;  1WXU A;  2E65 A;  1VQO A;  3A8M B;  3KFV A;  3QO3 A;  2KMT A;  4M77 A;  2LP5 A;  1MV0 B;  2RI5 A;  2RK2 A;  2JTE A;  3G6E Q;  2XDD A;  2KYB A;  5AYF A;  2J7I A;  2L0A A;  4EPC A;  1M1K R;  2CP0 A;  4IIM A;  4M78 A;  3CCE Q;  4PLL A;  4DEY A;  3MCA B;  4GBQ A;  3M57 A;  2DVE A;  5L8R E;  1FMV A;  2JZ2 A;  3CME T;  1NLO C;  1Q81 C;  4PJO C;  1JRI A;  2EJG A;  3PNW C;  3BDL A;  3RKY A;  1G8X A;  2D8H A;  4C8Q B;  4M7D G;  1VQ5 T;  3CCQ T;  4J6Y A;  3LWI A;  1JJ2 P;  1ZBJ A;  5IHI A;  2DTI A;  3UF4 A;  4N4G A;  1PD0 A;  2ED0 A;  4CI0 C;  2KRN A;  2ZZD A;  3VS1 A;  4M7D D;  1Y07 A;  1M5Q 1;  4A4E A;  1PHT A;  1EZZ B;  3JCM J;  1TTH B;  1XTD A;  4Z02 A;  3OBW A;  1YWO A;  1QVG P;  2RB6 A;  4QVD A;  2EQI A;  3CQT A;  1G5V A;  4GLK A;  2DK3 A;  3JCM b;  2QQR A;  4LD6 A;  2IIM A;  2M51 A;  5LJ5 e;  5LJ3 d;  2DTH A;  1RAI B;  3CC7 T;  1F1B B;  2HEQ A;  3LWH A;  1ABO A;  2HKN A;  3I56 T;  3WVD B;  3EHR A;  1PRM C;  2HNI A;  1YI2 T;  3QBY A;  2DD5 A;  2LZ6 B;  2PUK B;  2K57 A;  2O9V A;  1S1N A;  1NYF A;  4AFZ C;  3UDC A;  4YTL A;  4J9C A;  3VS4 A;  2JT4 A;  5GAN 6;  1M90 C;  3GLX A;  2MK5 A;  1OUL A;  2BIV A;  4C92 A;  3CC4 A;  2FG0 A;  3C0C A;  3EG9 B;  2VV5 A;  2YRV A;  1U3O A;  3F70 A;  4C5I A;  4BDZ A;  2K2V A;  2L3R A;  5KYX B;  3UPU A;  4FL6 A;  2EPD A;  3CCL Q;  2HQH A;  2MPX C;  4M7A C;  1HK9 A;  4DA4 A;  3CCR Q;  3OYD A;  1JEG A;  3CCJ A;  4J7I A;  2QXF A;  2DXU A;  3EFO A;  5GJV B;  1QCO A;  1Q82 C;  3ASK A;  2ZPB B;  2F2V A;  1PSE A;  3S6W A;  2CZ7 B;  1W70 A;  3JB9 J;  1JJ2 S;  1TSF A;  4E7J A;  2EIF A;  2ZCF B;  4OB2 B;  4CC3 A;  2DF6 A;  2RF0 A;  2D8J A;  1YHQ A;  1RI9 A;  4OGE A;  2V8J A;  1D0X A;  1Q86 R;  4A63 B;  3PE0 A;  3RKX A;  1VQ7 Q;  1QP3 A;  1X01 A;  1T3S A;  2RJC A;  2MAM A;  1D3B B;  4GY5 A;  3JCM V;  1LNX A;  2L5Q A;  3PGG A;  3JV3 A;  1N8R U;  2LTO A;  3ZBD A;  3A5Z B;  2RPN A;  3OY9 A;  3NGP A;  2QEX Q;  2EJ9 A;  3J80 E;  2H3J A;  1M1F A;  4KUD K;  1CSK A;  1VIF A;  4M78 D;  3L1A A;  1BU1 A;  2CUD A;  2LQK A;  3FLG A;  1YHQ T;  2BZ8 A;  3CBP A;  5CKD A;  3OBY A;  2DIL A;  3LGL A;  4NL3 A;  3I56 Q;  2MF2 A;  1NM7 A;  1H64 1;  2G3R A;  1KC8 C;  2CRE A;  4M75 F;  1YJN Q;  2HL5 C;  1YJW T;  4M7A F;  3I55 T;  2WSC E;  4M78 C;  2CSI A;  1Y0M A;  1MV3 A;  4CC2 A;  3G7Z A;  2VAS A;  3EH2 A;  4LDW A;  2ZPI B;  2EYZ A;  3V8K A;  2O88 A;  1RAG B;  4ZTF A;  3VRY A;  3OYL A;  1E6G A;  3BFM A;  3DB3 A;  5KYW A;  1C1A A;  3EGD B;  2VUB A;  5HK0 A;  2JM8 A;  3EG0 A;  1VQM A;  4BI4 A;  3VUB A;  2QK0 A;  1BIB A;  3OYK A;  1UEB A;  1K8A R;  1M90 U;  3M0U A;  2AZV A;  4OMF B;  2WSF E;  1MUZ A;  3M4Y A;  5LJ3 g;  3CCE T;  4EMK B;  4LDX A;  4PK4 A;  4F7U G;  2GGR A;  2KK4 A;  5M9O A;  2BZX A;  1YI2 A;  2KRM A;  4P5N A;  3E19 A;  4PL6 A;  3FB9 A;  2LJ0 A;  4J9D A;  1FWZ A;  1ZSZ C;  3QDF A;  2BE7 D;  5A0L A;  2DYB A;  5KYX A;  3VS0 A;  3VS6 A;  1NJI R;  3AT1 B;  4CC7 A;  2GTJ A;  2VGM A;  2J6O A;  2P0P A;  4E6R A;  2DO3 A;  2XDP A;  1AHJ B;  2HL3 A;  4RTV A;  1UTI A;  3I55 Q;  1YJW Q;  2E6N A;  1U1T A;  1WHH A;  4IUU A;  1VQK T;  1MGQ A;  4OVA A;  1SG5 A;  1VQL Q;  1VUB A;  1VQ7 T;  1D0Y A;  2QQ9 A;  5FU6 B;  3FC3 A;  2KRO A;  4DBF A;  1JBM A;  4JRI A;  4HT9 A;  3G4S T;  1YJ9 T;  1WZO A;  4JZ4 A;  4WF2 A;  2EBP A;  5KYW B;  1K0S A;  5FU6 C;  3V8J A;  2L3P A;  3CME Q;  4PFP A;  4HXJ A;  3VJP A;  4EMG A;  1BI0 A;  2DEQ A;  4PJO E;  2RHU A;  3SFM A;  2JS2 A;  1VQ5 A;  4FYX B;  2DTO A;  1S72 Q;  1KD1 C;  4J9E A;  4C8Q E;  1M4Z A;  1OU8 A;  1M27 C;  2GFU A;  1KFZ A;  3JB9 F;  4C5E A;  2ZPF B;  2YLB A;  3Q1J A;  1BB9 A;  2D1X A;  3A8L B;  5FRO A;  1MMD A;  1XNI A;  4J9G A;  1BI3 A;  3SB2 A;  4DBR A;  1QCF A;  4RTT A;  3CXC A;  2AZS A;  5EG2 A;  1U8R A;  1ZBX A;  4ZGJ B;  5LJ5 j;  1M8V A;  2V8K A;  3IQL A;  1UGQ B;  4ME7 A;  3I55 A;  2QYZ A;  1YJW A;  4LUE A;  3MP8 A;  1VA7 A;  2E5K A;  2QA4 Q;  4J7F A;  1VQO T;  1RI0 A;  1W2B P;  3X24 B;  1WLP B;  4KRT A;  4JJN K;  1D1A A;  1IO6 A;  1YJ9 Q;  2DD4 A;  4E7I A;  4LDY A;  1SRL A;  3FDR A;  2CSQ A;  2R5M A;  1M9S A;  2CP5 A;  4M78 B;  2X3W D;  3V7R A;  4OMQ A;  1UHF A;  3T9N A;  3NFC A;  1KC8 U;  2KQW A;  2DE0 X;  1KQ1 A;  2LJ3 A;  1VQ8 Q;  4LNP A;  4ZN3 A;  4M75 A;  1LVK A;  2K9G A;  1NG2 A;  2AIR B;  1UUE A;  4KH0 B;  3NPF A;  4XU3 A;  4OP0 A;  3JCM X;  1DJ7 B;  1A0N B;  1RLP C;  2KT1 A;  5A0G A;  4E7L A;  1BYM A;  1IHV A;  4HCZ A;  3VS7 A;  2MOX A;  4QT7 A;  1SF9 A;  1RAD B;  4J9B A;  2D6F A;  2HSP A;  4FCY A;  3EG9 A;  1LCK A;  2DL8 A;  4C92 B;  1K9A A;  1ZSZ A;  2EVR A;  2DRM A;  2PVD B;  2FHD A;  4C92 F;  3R6O A;  1T3L A;  1WJS A;  2V8I A;  1SSF A;  2QTX A;  2L2P A;  1M2V A;  4KH1 B;  1PKT A;  4AG1 C;  3X20 B;  2H3E B;  2M16 A;  2RJF A;  2BZY A;  4JRK A;  3VS3 A;  1QWF A;  7AT1 B;  3L2Z A;  1D1B A;  4JJD A;  2QQS A;  2XID A;  4IIO A;  3SEM A;  5FWB A;  4M7D C;  1NYG A;  2M0Y A;  3LGF A;  4QQD A;  4D8K A;  2V26 A;  1R8O B;  5LJ3 h;  3JB9 G;  3I56 A;  2K5I A;  1RAA B;  1WFW A;  2O4X B;  4FYV B;  3H9N A;  2M1H A;  4J9H A;  1OOT A;  2DIQ A;  2HZY A;  1OV3 A;  2CP6 A;  4M78 E;  4PJN A;  4ELY C;  3HPW A;  2DL3 A;  2GNC A;  1SPK A;  2GQV A;  4F17 A;  4J6W A;  2VC8 A;  2EFI A;  1M90 R;  4M7A B;  1NE8 A;  1MMA A;  4IUR A;  4HVV A;  2KGT A;  1XOV A;  4HA8 A;  4EIK A;  4KBM B;  4C8Q A;  1KD1 U;  2RI2 A;  1OX9 A;  5GAN f;  2FPF A;  2DNU A;  1PWT A;  5I22 A;  2GBQ A;  2XHC A;  1EIF A;  4JZ3 A;  1ZHI A; 
#chains in the Genus database with same CATH homology
 3RMQ A;  3BDU A;  3CC7 T;  3LWH A;  3CXC S;  2PU9 B;  4JS5 A;  2B8A A;  2ZPH B;  3VV0 A;  4BI8 B;  2E1H A;  2R57 A;  4BE0 A;  4J6X A;  4OB1 B;  3QHS A;  4UC4 A;  3I56 T;  3WVD B;  5FRN A;  2HQE A;  1WPY A;  2ZPE B;  2K3X A;  3L2R A;  4M7A D;  3JB9 H;  2HNI A;  1G3T A;  3V7C A;  3N5B B;  1YI2 T;  3QBY A;  3S3O A;  2DD5 A;  2PUK B;  3HL8 A;  4BDY A;  2K57 A;  2X35 A;  3UDC A;  1UGP B;  4YTL A;  4E7K A;  4PJO G;  5GAM e;  4M7A A;  2QA4 T;  5LJ3 f;  5I2M A;  5GAN 6;  4C92 D;  3CME A;  2F5T X;  3RKW A;  2E64 A;  1M90 C;  1XQH A;  3GLX A;  3OMC A;  3TCJ A;  3OS5 A;  4RG2 A;  2BIV A;  3OYC A;  3NTI A;  4C92 A;  5J26 A;  3CC4 A;  2LRQ A;  4DOV A;  3CCV A;  2VV5 A;  3PMT A;  3M56 A;  4ZGE B;  1VQ8 A;  2YRV A;  3F70 A;  4C5I A;  4BDZ A;  2K2V A;  2L3R A;  3M53 A;  4FM4 B;  3RUX A;  4JDS A;  4KT0 E;  4C5G A;  3UPU A;  4FL6 A;  2GF7 A;  5CR2 A;  4NL2 A;  1BIA A;  4Q5W A;  3HSB A;  4C92 G;  4M7A C;  4MZM A;  1HK9 A;  1OZ2 A;  3JB9 I;  5GAN e;  2EKO A;  4DA4 A;  1LJO A;  3OYD A;  1YIT A;  4M75 E;  3CCJ A;  3LW5 E;  4F7U B;  3QYG B;  4J7I A;  4C0D B;  3JCM W;  1Q7Y U;  3L2Q A;  1K9M C;  1WJQ A;  2QXF A;  3OYF A;  2FVU A;  3C94 A;  2DXU A;  4C0F A;  4C5H A;  4LD9 K;  4MDX A;  3P8B B;  5KE2 A;  4DOW A;  4LDV A;  1D3B A;  5A2Q E;  2XD0 A;  4A4G A;  1Q82 C;  3ASK A;  2ZPB B;  2K5L A;  3DLM A;  3HRT A;  2QQA A;  2K4Y A;  4BB7 A;  2LQ8 A;  4C0Z A;  4J5Y A;  4C0D C;  5I2S A;  3OYN A;  1YJN T;  3QUI A;  1N9R A;  2FYK A;  1PSE A;  2RH2 A;  2JTF A;  3MHX A;  4IUV A;  3S6W A;  3SWN C;  3AHU A;  3FJP A;  2CZ7 B;  3RES A;  2EQJ A;  3CC2 A;  1YBY A;  3JB9 J;  1JJ2 S;  1VQP T;  5DY9 A;  2JN0 A;  2A7Y A;  5CVI A;  2L8D A;  2RJE A;  4E7J A;  2EIF A;  2ZCF B;  4OB2 B;  3ZEH A;  2JVV A;  4VUB A;  1YHQ A;  5CQX A;  4PLI A;  4M77 B;  5J39 A;  3G4S A;  5GAO q;  4OGE A;  1B34 A;  3JCM e;  2QEX T;  3P8D A;  1YJ9 A;  1NPR A;  2EAY A;  2V8J A;  4JRQ A;  1VQ7 A;  1S72 T;  2CZ6 B;  4EMH A;  2K3Y A;  2E10 A;  3RKX A;  4XTY A;  1QP3 A;  1X01 A;  3OB9 A;  1VQL T;  4M78 F;  1Y71 A;  2RJC A;  2MAM A;  1K73 C;  1D3B B;  4GY5 A;  1VQ9 T;  3JCM V;  1WNL A;  4M75 G;  1LNX A;  3X28 B;  1K73 U;  2L5Q A;  3WXM B;  3PGG A;  3EAE A;  1N8R U;  1VQK A;  4N4I A;  2CGH A;  4C8Q C;  2LTO A;  3SWN A;  5GAN d;  1YIJ A;  3ZBD A;  4IKF A;  3A5Z B;  2Y4X A;  5I21 A;  1VQ6 A;  5LJ5 d;  3OY9 A;  3S3M A;  2EJ9 A;  2RHX A;  3J80 E;  4FT4 A;  3CPW S;  2H3J A;  1M1F A;  4KUD K;  1Y96 A;  2QEX A;  4M7D E;  3JSC A;  1VIF A;  3L1A A;  4M77 D;  3FLG A;  4M78 D;  2LQK A;  5C0M A;  3HFO A;  4ELZ C;  3G6E T;  1YHQ T;  3FEO A;  1Q7Y C;  2P4T A;  3CBP A;  5CKD A;  2EQU A;  2X4Y A;  3OBY A;  3LGL A;  4IUT A;  4N4H A;  4Y28 E;  5HKC A;  2L89 A;  2RHZ A;  3CCR T;  2MWP A;  4NL3 A;  3CC2 T;  2MF2 A;  4ATO A;  4L59 A;  4C8Q F;  3MP6 A;  3HKS A;  2XIC A;  5IN1 A;  3VYH B;  2RHY A;  4RCC A;  3LLR A;  3BW1 A;  1H64 1;  2G3R A;  3KBG A;  3MEV A;  4M77 F;  4M78 G;  1YJN A;  1HXD A;  1KC8 C;  2JTM A;  4M75 F;  3HP9 A;  5FU7 B;  3CBM A;  1N8R C;  5CO7 A;  1YJW T;  4M7A F;  3CCE A;  2OTJ T;  3I55 T;  5DLQ E;  3GNG A;  5CQY A;  2M0O A;  4JLG A;  5GAO m;  3OYB A;  4F7U F;  2DIG A;  2E70 A;  1VQM T;  3H8Z A;  3CCS T;  5GAM j;  5GAO r;  2WSC E;  4M78 C;  4QVZ A;  4XU1 A;  3JCM f;  4C8Q D;  2K5F A;  5KCO A;  2Y90 A;  3J7A F;  3G7Z A;  5DM7 R;  2XDB A;  1VIE A;  1N6A A;  4LDW A;  2ZGW A;  2ZPI B;  3V8K A;  5GAN 4;  1M1K U;  4M77 C;  4M7D A;  4TVR A;  2P0Q A;  5CAI A;  4ZTF A;  3OYL A;  3BFM A;  3DB3 A;  1W2B A;  2M9U A;  3OYA A;  2VUB A;  5GAN h;  1YCY A;  4BUG A;  5HK0 A;  2P0K A;  1VQM A;  4PNO A;  2KVQ G;  4BI4 A;  1Q86 U;  3QII A;  1VQ8 T;  1WGS A;  3GNF B;  3VUB A;  1BIB A;  3CPW A;  1OZ3 A;  1KQ2 A;  1M1G A;  3VUZ A;  4X9D A;  1UEB A;  2DXB A;  3OYK A;  3CCU T;  5FLX E;  5GAN 3;  1KHI A;  3OA6 A;  3CCS A;  1M90 U;  4MZT A;  2OAU A;  2XU8 A;  4JLI A;  3TEE A;  3QPH A;  2LNV A;  4OMF B;  2WSF E;  4BY6 B;  4M7A G;  1BI1 A;  3J81 E;  3M4Y A;  5LJ3 g;  3CCE T;  2OTJ A;  3RIR A;  4A4K A;  4EMK B;  1Q82 U;  4LDX A;  4F7U G;  2RI3 A;  2KK4 A;  3OSV A;  5M9O A;  3MO8 A;  4BE2 A;  2X4X A;  1YI2 A;  4QVC A;  4P5N A;  2LVM A;  2ZPG B;  4E47 A;  3OS1 A;  1VQN T;  3E19 A;  4OGC A;  4PL6 A;  3FB9 A;  4HCC A;  3JCM c;  5GAM h;  1FWZ A;  4L6V 5;  5A0L A;  3MET A;  4HT8 A;  3OSS C;  3MEA A;  2KY9 A;  1BI2 A;  1PSF A;  2DPP B;  4L5G A;  5LJ5 f;  2MWO A;  2KAF A;  2LDM A;  2MI6 A;  1NPP A;  2VGM A;  3QG1 A;  3OW2 S;  1VQ6 T;  2P0P A;  2EQK A;  3ER0 A;  1YIJ T;  1BKB A;  2DO3 A;  2F5K A;  3JCM d;  2CS7 A;  2XDP A;  1AHJ B;  4RKU E;  3CCM T;  5GAM g;  5FU7 C;  3GIB A;  3C12 A;  4O5V A;  3JRZ A;  2E6N A;  1U1T A;  2JNG A;  1VQL A;  4IUU A;  1UGR B;  1ZQ1 A;  1G3W A;  4RCB A;  1VQK T;  1MGQ A;  4OVA A;  3MEW A;  4KUL A;  4B9X A;  4ZGD B;  3JAM E;  1VUB A;  3RER A;  3CCM A;  2DZC A;  3VU3 C;  4II1 A;  3E1S A;  1VQ7 T;  2FL7 A;  2DXC A;  4A4H A;  4MZP A;  1I5L A;  1Y7X A;  2QQ9 A;  5HK3 A;  5FU6 B;  2HD0 A;  2VXF A;  3OYE A;  1K8A C;  2CYZ B;  1O75 A;  3FC3 A;  1JBM A;  4JRI A;  2RO0 A;  5D6X A;  4EDU A;  1VQP A;  2IG0 A;  3G6E A;  3GOX A;  4HT9 A;  3G4S T;  1YJ9 T;  2GFA A;  4C0G A;  2R58 A;  4WF2 A;  3C95 A;  2JOY A;  2GCX A;  2WSE E;  3PT9 A;  3FRN A;  3M55 A;  5LJ5 h;  5GAN 2;  2FB7 A;  4OB0 B;  3OYH A;  4M7D B;  2XG8 D;  1VQN A;  3E9G A;  5FU6 C;  3TRE A;  3PFS A;  3V8J A;  3A8G B;  5FRM A;  5GAM d;  3VJP A;  5A0D A;  2YHT A;  4EMG A;  1BI0 A;  1KQS A;  3JB9 D;  2DEQ A;  1NJI C;  1H3Z A;  4FU6 A;  4PJO E;  1TH7 A;  3QYH B;  4EMK C;  4BAC A;  4QW2 A;  2E6Z A;  2RHU A;  3QDR B;  4XK8 E;  4MMK A;  2QDY B;  3CEY A;  1WJR A;  3HRS A;  3SFM A;  1VQ5 A;  3CCU A;  1WQW A;  2DTO A;  3PTA A;  4XU0 A;  4A54 A;  4N0A A;  3GPL A;  1KD1 C;  4C8Q E;  1M4Z A;  2CZ0 B;  2I2L A;  5GMK j;  3NTK A;  4M75 D;  2GFU A;  1GXI E;  4XQ3 A;  1IZ6 A;  2DAQ A;  3JB9 F;  4C5E A;  2R5A A;  2ZPF B;  5KE3 A;  2YLB A;  2EWN A;  3Q1J A;  3QXE B;  3CCJ T;  1JJ2 A;  3A8L B;  3OYI A;  4XAX B;  5FRO A;  4J8O A;  2BKD N;  5GAO l;  1XNI A;  3E9F A;  1UB4 A;  1BI3 A;  3SB2 A;  3CCV T;  2HAX A;  3SDZ A;  4M77 G;  3INZ A;  3CXC A;  5GMK i;  4N0A C;  2VGN A;  2EQM A;  5EG2 A;  1U8R A;  1ZBX A;  4ZGJ B;  5LJ5 j;  1M8V A;  1MHN A;  2E12 A;  2V8K A;  4FSX A;  3UT1 A;  1UGQ B;  4ME7 A;  2RK1 A;  1I4K 1;  2O4X A;  1FXX A;  3I55 A;  1JB0 E;  1YJW A;  3DB4 A;  4EMK A;  1P92 A;  1WQ7 A;  2X4W A;  3SWN B;  1NZ9 A;  1W4S A;  5GAM f;  3CC4 T;  2O01 E;  3MP8 A;  5LJ3 e;  5CIU A;  1Q86 C;  4JRP A;  1KQS S;  2BUD A;  1OI1 A;  2XKO C;  3ZFJ A;  4BD3 A;  4J7F A;  4BI3 A;  3OYJ A;  2EYQ A;  1VQO T;  1RI0 A;  2QA4 A;  3X24 B;  3M9Q A;  3QZ9 B;  3C4S A;  3L2U A;  4XTV A;  5LJ5 g;  1I81 A;  3LYI A;  4JJN K;  4M7A E;  5IT9 E;  3CCR A;  2VYT A;  1RL2 A;  1U1S A;  4QQ6 A;  2DD4 A;  2OTL T;  4M75 C;  4E7I A;  4LDY A;  5GAN j;  2E5Q A;  3FDR A;  3KUF A;  4HCB A;  5GMK h;  1B34 B;  3QSU A;  5D6Y A;  5J3B A;  2R5M A;  3PIO A;  2RM4 A;  1M9S A;  3DKM A;  2CKK A;  2A3L A;  4M78 B;  1Q81 U;  3X26 B;  3M4G A;  3V7R A;  2RJD A;  3M59 A;  4CRI A;  1N27 A;  3MP1 A;  4RG8 A;  1QP2 A;  3T9N A;  3A8O B;  4IUQ A;  3NFC A;  3P8H A;  3CC7 A;  4MDW A;  4PKC C;  4BE1 A;  1KC8 U;  2KQW A;  1X75 C;  5GMK l;  1KQ1 A;  3G71 T;  4R56 A;  1VQ9 A;  2LT1 A;  4D6W A;  4M75 A;  4ZN3 A;  3KXT A;  3OQ5 A;  5CK9 A;  4PJO D;  3TU4 K;  2IVW A;  2KSS A;  4XU3 A;  3JCM h;  5GAN 7;  1QVP A;  1QVF A;  3SD4 A;  1FX7 A;  2PVG B;  4X34 A;  1G3Y A;  1S72 A;  2LC4 A;  3CMA A;  3V8L A;  3M54 A;  2DJZ A;  4OP0 A;  3JCM X;  4M77 E;  5KH6 A;  1DJ7 B;  4BY6 C;  2MMP A;  2VXE A;  4R55 A;  4X9C A;  5DLO A;  3HHT B;  4F7U A;  5A0G A;  4E7L A;  1BYM A;  4HCZ A;  1I8F A;  4C92 C;  1KHC A;  2PUO B;  3JCM g;  3JCM Q;  5GAN 5;  2LT4 A;  1Y96 B;  5C6S A;  3VYG A;  3CCL T;  2LX9 A;  4J83 A;  3X25 B;  3PIP A;  2DZ9 A;  2D6F A;  5LL6 S;  4LDU A;  3OW2 A;  3CCQ A;  3L2V A;  1X6O A;  5CKF A;  5KCH A;  4A4F A;  4ZN1 A;  4XTX A;  3URG A;  4C92 B;  2HBP A;  2XI9 A;  1G3S A;  1QW1 A;  4FIB A;  4NS5 A;  3GP8 A;  4XTU A;  2OTL A;  2PVD B;  2FHD A;  3M5A A;  2CZ1 B;  4C92 F;  2LCL A;  1WJS A;  3R6O A;  2V8I A;  1VQ4 A;  3QKJ A;  2RA2 A;  1SSF A;  2PQW A;  2RHI A;  3A8H B;  4OB3 B;  1K8A U;  2QTX A;  4JS4 A;  5GMK e;  4M75 B;  4IUP A;  2E65 A;  4B9W A;  1VQO A;  1YIT T;  1W2B S;  1K9M U;  2Y4Y A;  3A8M B;  1QVG S;  3QO3 A;  3OMG A;  2KMT A;  3BY7 A;  5CKH A;  3CPF A;  4M77 A;  2RI5 A;  2RK2 A;  3PMI A;  4XTW A;  5D6W A;  3X20 B;  2M16 A;  1N9S A;  2RJF A;  2PVO B;  3QJY A;  2XDD A;  3OYG A;  2QQB A;  2AHJ B;  4OF1 A;  5AYF A;  2KDS A;  4XU2 A;  4EPC A;  4JRK A;  2EJF A;  3LX7 A;  3H6Z A;  3LH0 A;  4M78 A;  4Y91 A;  4PLL A;  3L2Z A;  2YLC A;  3MCA B;  4ZTJ A;  3M58 A;  1IRE B;  3L2W A;  4E7H A;  3M57 A;  2QQS A;  2XID A;  2DVE A;  5L8R E;  2D9T A;  4DQ2 A;  2JZ2 A;  3CBO A;  3RMS A;  3CME T;  1V29 B;  4M7D C;  1Q81 C;  3LGF A;  2DXT A;  4PJO C;  3WVE B;  1JRI A;  4QQD A;  4RMO A;  2EJG A;  3PNW C;  3BDL A;  4F7U E;  1R8O B;  3FIF A;  3RKY A;  5LJ3 h;  3JB9 G;  4O6J A;  4C8Q B;  4NOY A;  2DKG A;  3ME9 A;  5IAY A;  1KG1 A;  3VKI A;  1OYX A;  3GF5 A;  3I56 A;  4M7D G;  3HRU A;  1VQ5 T;  4A53 A;  2K5I A;  2O4X B;  3CCQ T;  4J6Y A;  1VQ4 T;  2LCC A;  3LWI A;  5GMK m;  5CKB A;  2D0Q B;  5HY6 A;  2F69 A;  1NJI U;  4QQG A;  4PJO B;  2M1H A;  2XK0 A;  2DTI A;  3DLL A;  3JCM P;  4N4G A;  3CD6 A;  4CI0 C;  2DIQ A;  2ZZD A;  3EFS A;  4FT2 A;  3NTH A;  5GAO p;  4M7D D;  1Y07 A;  4KUI A;  1M5Q 1;  4M78 E;  3O8V A;  4A4E A;  4XTZ A;  3CCL A;  2HQX A;  4ELY C;  3OS0 A;  3JCM J;  3OYY A;  5GAN g;  1QVG A;  3HPW A;  1LOJ A;  2GQV A;  4MML A;  2JUF A;  5GAO n;  4J6W A;  1XTD A;  2VC8 A;  2EFI A;  5CKE A;  3HFN A;  4Z02 A;  1M1K C;  2C06 A;  3CMA T;  3OBW A;  2NLU A;  4PJO A;  2X4J A;  4M7A B;  1NE8 A;  2RB6 A;  3UWN A;  4QVD A;  1UGS B;  4IUR A;  1XOV A;  1O9S A;  2WAC A;  2QI2 A;  4HA8 A;  4M7D F;  4V2S A;  3OYM A;  1G5V A;  4KBM B;  2E41 A;  3QZ5 B;  4C8Q A;  4C8Q G;  4PJO F;  5LJ3 j;  3OS2 A;  3G71 A;  1KD1 U;  4GLK A;  3EFR A;  2RI2 A;  3MEU A;  4HKE A;  2DK3 A;  4JUV A;  5GAN f;  3JCM b;  3QJ6 A;  4C92 E;  2QQR A;  4LD6 A;  1QVF S;  5LJ5 e;  5GAN 8;  2XHC A;  5LJ3 d;  1EIF A;  3L42 A;  3V7S A;  2DTH A;  3CD6 T;  5CCA A;  1ZHI A;  2RD1 A;  3S3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...