1JRIA

The crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
QRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Sm-like Archaeal Protein 1 (SmAP1)
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 13
structure length 72
sequence length 72
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1jriA00
2DKGA 3QHSA 4C8QG 3RUXA 4XTZA 1N9RA 2HNIA 4M75E 5GAOr 5GAN6 5GAN5 4M75B 2DXUA 1KQ1A 3JB9D 4M75D 3JB9G 3JB9H 1HK9A 4M75G 2DTOA 4M78F 2EWNA 4PJOE 3JCMg 4WF2A 5GAMe 4PJOB 1Y96A 4Y91A 5GAOl 4M77C 2YHTA 3V8KA 4PJOD 2DZ9A 3JCMQ 2YLBA 3JB9I 5GAMg 3HSBA 4PJOG 1Y96B 2QTXA 3JCMc 5GAN4 3JCMJ 1B34A 4M77A 5GAMh 2Y90A 5I21A 1I4K1 2RA2A 2RM4A 3V7SA 4C92F 4QVDA 1B34B 4C8QE 4M77B 3SWNC 5GAOp 5GMKi 2YLCA 3GIBA 5LJ3f 2FYKA 4M77D 4XU1A 3JCMX 5GAOn 5GMKl 3JCMf 4M77G 4F7UF 3SWNA 1U1TA 4JRIA 4JUVA 4M7AC 5GANf 4NL3A 2VXEA 2DZCA 1I8FA 5LJ3e 4M7AA 3JCMe 5GMKe 3BFMA 2E10A 4J6WA 4EMGA 3FB9A 4DQ2A 4M7AE 2EJGA 3JB9F 4X9DA 2DVEA 4M7AB 1BIBA 1LJOA 3PGGA 3BDUA 4M75F 5LJ3d 2K57A 4X9CA 4XTWA 1HXDA 4M78C 3JCMV 4A54A 4PNOA 3JCMh 2EJ9A 2ZGWA 3JCMd 5LJ3j 4M7AD 4MMKA 4M7AG 4M7DC 5GMKj 5GAOm 4PJOF 4M78A 4MMLA 5GANj 3JCMW 3RESA 4NL2A 3EFRA 5LJ5f 3QUIA 4M77E 4M7DA 2DTHA 4XTUA 2EAYA 3RKWA 3INZA 4M78B 4XTVA 3V7RA 4M7DE 3M4GA 4C92C 1LNXA 4M7DB 4M78D 1M8VA 5LJ5e 3BY7A 4V2SA 4M7DD 3QO3A 3FJPA 5CAIA 3JB9J 1YCYA 4C92A 3SB2A 5GAN2 1X01A 4M7DG 4C8QF 3JCMP 5GMKm 4RCCA 3SWNB 2VC8A 3HFNA 5LJ5d 2DEQA 3L1AA 2E41A 4C92B 2E1HA 1I81A 4EMKC 5GANe 5LJ3g 4F7UA 3HFOA 4C92D 5LJ5j 3QSUA 5LJ3h 3FIFA 5GANg 2E64A 4EMKA 3V7CA 5GMKh 1BIAA 5GANd 2FB7A 2EJFA 1JRIA 5GANh 3V8JA 1TH7A 4J6XA 4EMKB 2DTIA 4M7AF 4JLIA 3EFSA 4J6YA 1M5Q1 1U1SA 4M78E 4NOYA 4RCBA 5DY9A 4PJOC 3BW1A 4XU2A 1H641 2DJZA 4XQ3A 5GAMf 2E65A 4M78G 1WQ7A 4PJOA 1D3BA 1I5LA 2CGHA 4M77F 2I2LA 4XU3A 5LJ5g 1WQWA 4EMHA 3JCMb 1LOJA 1D3BB 4C92E 4M7DF 4N0AC 1KQ2A 1MGQA 4A53A 5LJ5h 1WPYA 3RIRA 4C8QC 5GAN8 3RERA 4XTXA 4XTYA 4JRKA 4QVCA 5GAMd 4XU0A 4N0AA 4J5YA 4C92G 3RKYA 4F7UE 4C8QA 2DXTA 4HA8A 3V8LA 4OP0A 3RKXA 3VU3C 4F7UB 5GAMj 5GAN7 4M75C 5GAN3 5GAOq 4HT9A 1JBMA 1WNLA 2RB6A 4C8QB 2VXFA 4F7UG 2RD1A 4HT8A 3L2ZA 2JN0A 3AHUA 4C8QD 4M75A 1N9SA
chains in the Genus database with same CATH superfamily
3QHSA 2RQTA 1N9RA 1K9MR 4PJLA 3X25B 2LX7A 1QWFA 2DTOA 4Z89A 4HVUA 2CSIA 4PLLA 4OB2B 3UATA 2A28A 1MUZA 1ZA2B 4CC4B 2HCKA 2EQJA 2Y4XA 3TQ7P 1V29B 3CCUQ 4B6MA 1B34B 4WCIA 4CC2A 1YWPA 1H8KA 5GMKl 1G2BA 3META 2QEXT 2V26A 2F2XA 2JMAA 1VQLQ 1VQ6Q 2RO0A 1ZUUA 2MI6A 1RAFB 2KRSA 2JTFA 3OYIA 4XTWA 1VQOA 1YIJQ 4UC4A 3JCMh 2RQWA 2JW4A 3KUFA 1Q86U 4M7DA 2K5LA 3V7RA 2HL3A 3CC4Q 2DA9A 4C92A 1G3TA 1OZ3A 2E41A 2K5FA 3EG0A 5LJ5j 2CH4W 2CT3A 2F69A 3EG3A 2D6FA 1TS9A 4OMMA 4Z88A 1ZSZC 4FIBA 2JMCA 5C6SA 1O9SA 4LE9A 3PTAA 4BE0A 5A0GA 1AHJB 2EYZA 3CCJT 2E5QA 8ATCB 2KQWA 4KUDK 2KGTA 3I55Q 2RQRA 2V8KA 4KBMB 4M77F 1EZZB 4PJMA 1D3BB 4C92E 2K4YA 4J9GA 1QVFP 3OYGA 4JRKA 3LWHA 1G8XA 3VU3C 2PVOB 1OQKA 1CKBA 5GAN3 4M75C 1JU5C 2ZAEA 2RQUA 4PK4A 2JN0A 2D0NA 1JXOA 3AHUA 1BBZA 4PLIA 1C0MA 2DRKA 1OX9A 5GAN5 2QYZA 4JZ4A 2O4XA 4AG1C 1XOVA 3MO8A 2V1QA 1OZ2A 2V8JA 4PJOD 4PJOG 3E19A 3P8DA 2NUTA 4J8OA 1UEBA 2ED0A 5L23A 2GFUA 1M90C 2GBQA 4M77D 2A08A 2QGFB 4OF1A 4M77G 4BE2A 1TWBA 4ZTFA 1O75A 2WSCE 1YN8A 2NYSA 3CMAA 5D6XA 1MMDA 3ULRB 4PJJA 4MMKA 3UA6A 3CCQA 1G3WA 4JS5A 4PFZA 4OMFB 3EH1A 2G3RA 2EAYA 3I56A 2RJFA 2HAXA 2VV5A 2QQRA 7AT1B 4M7DB 1Q95G 3C0CA 1BYMA 3QO3A 2P0QA 1Q7YU 1RAIB 1UHCA 2GTOA 3JB9J 3I5SA 3SWNB 3I5RA 4C92B 3CQTA 2NWMA 4BI8B 2LTOA 1YJ9Q 4E47A 2MWPA 4D6WA 2K2VA 3ZBDA 4FYXB 1M1KU 4M78G 1BKBA 1IXDA 1GFDA 2I2LA 2XMFA 4XK8E 2MPXC 2DYIA 2DVJA 1X69A 1K4US 2KT8A 2PUOB 2L0AA 1KHIA 3PIPA 2I0NA 2KSSA 3I56T 4MZPA 1W2BA 1KG1A 1K73U 4JLGA 4KULA 2LJ0A 5A0DA 2YUOA 4QVZA 1VA7A 1X6GA 2X51A 3NTIA 4XTZA 5IH2A 2D8HA 5GAN6 5GJWB 2YT6A 1QVFA 2O4XB 3EG9A 5FLXE 2EPDA 4BY6B 1FMWA 4J7FA 4BB7A 3H6ZA 2IPOB 2YLBA 2EIFA 3REBB 1M1KC 4M77A 1WIEA 2EQUA 2Y90A 3QZ5B 2NUTB 4QVDA 3SWNC 4A4EA 3OW2P 2XK0A 4RG2A 4HCBA 3SHWA 4QW2A 4HCKA 1T3SA 4JUVA 5FU7B 1ZQ1A 3H8ZA 4ZGEB 2XG8D 3JCMe 3IQLA 5IHKA 4R56A 1QW1A 1OPKA 4B9XA 2CZ6B 4F16A 4X34A 3QKJA 5KE3A 1D0XA 4HVVA 2FVUA 1UDLA 1K0XA 4M77E 2FO0A 1MV3A 5LJ5e 4V2SA 2VGMA 1NPPA 2JOYA 1VQKQ 4LNPA 3G4SQ 2LCLA 2RK2A 3C94A 4LDYA 3VS7A 4LXCA 3VS1A 2MIOA 2PTKA 4EIKA 2HMAA 5IHIA 5FRNA 2R5MA 3CC7A 3OYJA 4F14A 3VS0A 2YSQA 4E7HA 1W4SA 1FX7A 2VWFA 4RG8A 3MPUB 2OTJA 2DRMA 2YXYA 5GAMf 2L3SA 2J06A 2J05A 2AKLA 2HSEB 3QJYA 2KE9A 4QVCA 2VKNA 1VOMA 1AVZC 1N6AA 1U06A 1YI2Q 1U5SA 1QMCA 2RPNA 1M3BA 3M5AA 3VRYA 5IN1A 1E6HA 4PJOB 2CP6A 1WHKA 1VQPA 3CC7T 2AKKA 3CMAQ 3EG9B 3HSBA 1WHLA 1M27C 5GAN4 2O2OA 3E2UA 1SEMA 4DBRA 4OMOA 2OTJT 4M77B 3CCQQ 3GIBA 3VJPA 2KAFA 1WI7A 2BZYA 4JRIA 4KH0B 4FT4A 2DZCA 4FYVB 2HZYA 2FG0A 4YTLA 1BIBA 4M75F 2K57A 5CQYA 1HXDA 2GQIA 3JRZA 2EYWA 2X3WD 4F04B 3OW2A 3QWYA 4XTUA 1Q82C 2DLPA 3AT1B 2K9GA 2COZA 2GTJA 5CKEA 1E6GA 4FYYB 3G71T 3FLGA 1X43A 4AG2C 2K2MA 2R58A 2X3XD 3X28B 3HFOA 1ZBXA 2VGNA 1RUWA 5GANg 4GBQA 2EGCA 3VS3A 5J39A 2P4TA 3OYNA 1AWXA 4C5EA 4BI3A 4QKUA 1ZHIA 4PJOC 4FSSA 4XU2A 3VS5A 2CYZB 2JVVA 2HKNA 1YJWA 2G6FX 4JDSA 1VQLA 1AZGB 1VQ6A 3QPHA 4B9WA 5D7UA 3VKIA 4XU3A 1M1GA 1GXIE 1YIJA 2JXBA 3HRTA 2IVWA 2AZVA 3L2RA 2HD0A 2PQWA 1WXTA 5GAN7 2EQIA 5GAOq 1VQ9T 4WTOB 1VQNQ 4K11A 2QA4A 4F7UG 3CC4A 2KK4A 4PKCC 4TVRA 5IT9E 3RUXA 1MMNA 2O31A 4E7JA 2ROTA 1VYUA 3JB9H 2EWNA 1N8RU 1V76A 2JT4A 1OOTA 3P8BB 3CCUT 1F1BB 1C1AA 1R8OB 1NJIU 1ACMB 2QDLA 1YCSB 3EGXA 1W2BS 2H3EB 5GAMh 2X4XA 3T9NA 1OX8A 2OI3A 1KC8R 3I55A 3EHQA 3JCMf 1VQ6T 2XDPA 1U1TA 1PKTA 1ZUKA 2LCCA 2YUNA 1YIJT 2CP7A 2DD5A 4FU6A 3MP6A 2KDSA 3BFMA 2DM1A 3FB9A 4DQ2A 3BDUA 4M78C 5HKCA 4BD3A 1K9MC 3PMTA 3J7AF 3CC4T 1PC0A 1MNEA 4LD6A 1NBEB 3JCMW 5LJ5f 2MK5A 2LZ6B 1FWZA 2M02A 1M8VA 2LP5A 3CPFA 1K76A 1RADB 2EW3A 3F70A 1R0CB 2RJEA 5GMKm 3M0TA 2LMJA 2YRCA 3CCSQ 1GCPA 3V7CA 4BDYA 3S3MA 1JRIA 1NPRA 3GBQA 3I55T 1UHFA 2QDYB 3VUZA 4JJBA 3REAB 2CH4A 1KHCA 3BW1A 4FSXA 1WQ7A 1KQSP 2CGHA 1WHGA 1C6VX 2FRWA 1G83A 1EIFA 1ZLMA 2KMTA 4C92G 2L8DA 1VQPQ 2H3JA 2ZPBB 3RKXA 2XI9A 2J6OA 3L2ZA 2HL5C 1M3AA 2BE7D 3M0SA 4M75E 3RBBB 3OYFA 5IAYA 1FMVA 3ME9A 1OV3A 2KXDA 1BI0A 2C0TA 1UE9A 3TVTA 3JCMQ 1YJ9A 1UFFA 2F5TX 2ZZDA 2M51A 4II1A 1TUCA 2WACA 5KYWA 1Q81R 3EFOA 4OB0B 5IXFA 1RABB 1UGVA 4QT7A 3JCMX 2L5QA 5M9OA 3L42A 4M7AC 1WXUA 4E7SA 2OAUA 4LUDA 4HXJA 1YHQT 2KR3A 2F2VA 3MCAB 5AT1B 5IHNA 1AZEA 3JCMV 2XD0A 3A8MB 2EJ9A 1KFZA 4J9DA 1WJSA 4A4HA 3PVQA 2BE9B 2O9SA 3CBMA 2NUZA 3FJPA 1G3SA 2AIRB 2DBMA 1YJWQ 1NEBA 1M4ZA 2DD4A 4OMNA 2BZXA 1Y0MA 5I11A 3OBWA 1U3OA 3PT9A 2FB7A 1MMGA 2DTIA 4JLIA 1YP5A 1U1SA 4J6YA 1PM3A 2E4HA 3NMZC 1JXMA 1TU0B 1QVPA 2QA4Q 3GP8A 1UUEA 1GCQA 3OYDA 1LOJA 5LJ5h 1WZOA 3X20B 3CXCP 3RERA 3D7SB 1X2KA 3RKYA 1PG5B 2MMPA 4F7UB 4OP0A 3OS1A 1K8AR 4Z8AA 2LQWA 1I1JA 4OGCA 4E7KA 4OVAA 2YRVA 4BACA 1JJ2P 3S3OA 1VQKA 3G4SA 1AD5A 2K7AA 5GAMe 1VQOT 1M90U 2EGEA 4ZN3A 2A37A 1IB8A 1W1FA 3JB9I 3CPWP 2ED1A 5I21A 3PVLA 3GNGA 4HKEA 4FYWB 2M1HA 2LJ3A 5KYWB 2FYKA 1QVGP 3JSCA 3EFOB 5CKHA 1SRLA 4FW2A 2CT4A 2LVMA 4RMOA 3JB9F 1RAHB 4KGZB 3UT1A 3HRSA 2YDLA 4ZN1A 4CI0C 1KD1R 4DEYA 4AFZC 1IZ6A 5GANj 2RHXA 2J6KA 3KXTA 4ANJA 2RF0A 2P0KA 4MDXA 3G4ST 1YI2A 2H8HA 2M9UA 2SRCA 4DA4A 3BY7A 4L6V5 1KSWA 2V1RA 4C8QF 1ARKA 3CCMQ 2LJ1A 2DEQA 4LD9K 1NYFA 2GQVA 5I22A 3VUBA 2F2WA 2EFIA 2VB6A 1PRMC 1MMAA 5DY9A 2D0QB 3NPFA 1H641 1WFWA 2FPFA 2J7IA 2KEAA 3DKMA 3H0IA 2FPDA 1FMKA 3M56A 1M1FA 3QIIA 4N4IA 4A4GA 2GFAA 1B3QA 4NS5A 2CUBA 1Y57A 1MNDA 3OYMA 2BZ8A 1S1NA 4IURA 1JBMA 1WNLA 1YI2T 2WSFE 1NLOC 9ATCB 3OY9A 4C8QD 2DO3A 3MJXA 4C8QG 2QI2A 2JJ9A 5GAOr 4KRTA 2BTTA 3CMAT 2DBKA 2SEMA 4RTVA 3MP1A 2OJ2A 5CR2A 4Y28E 5LL6S 3CXCA 1HYOA 4RTUA 1XJWB 3UF4A 2DZ9A 4C0DB 3CCQT 4AT1B 4IUUA 4ZNXA 1QCOA 4J83A 4F17A 1Q86R 2RA2A 2DL4A 2RM4A 1X27A 3M9QA 1K1ZA 2DYBA 3M57A 5GAOn 1SSHA 4AFQC 2XHCA 3C12A 4P5NA 2KRMA 1ABQA 2GGRA 2X4JA 2R57A 3CPWA 1N5ZA 3JCMP 1LJOA 5DLOA 2DNUA 1VQNA 2CP5A 4M7DC 4FW1A 4E7IA 2QK0A 3C4SA 4KGVB 1PD1A 2MAMA 1QVGA 2CREA 1UG1A 1A0NB 4E7LA 4MZMA 4C92C 4Y92A 3MEUA 3P8HA 3PMIA 2KBTA 2NLUA 3OMCA 1PCXA 3CCJQ 2GNCA 2PUKB 1WGSA 1SSFA 1XNIA 5ECAA 5LJ3g 2K3XA 5C0MA 2R5AA 4EMKA 1NG2A 3OBYA 3LGLA 2E5KA 4M7AF 1AWWA 3EFSA 1VQ8A 1H3HA 1HJDA 3CCLQ 3C95A 1TXQA 4KGXB 4ME7A 3ZEHA 3E9GA 4E6RA 1RLPC 1W6XA 1G3YA 4D8DA 4RTXA 5GAN8 1JQQA 4D8KA 5FRMA 5A0LA 2EBPA 4C8QA 1VYTA 4KUIA 2DXBA 1QP3A 2XICA 3EG2A 3CMEQ 2EYQA 2MCNA 3OYEA 4BY6C 2DPPB 3GOXA 3CCRQ 4J7IA 1D0ZA 2KY9A 1OPLA 3TCJA 3CCSA 2V8IA 4FT2A 5GAOl 3V8KA 2AK5A 2COYA 2QTXA 2QQ9A 3N5BB 3JAME 1I4K1 2VASA 6AT1B 5FU7C 3V7SA 3OS2A 3G6EQ 4C8QE 1LVKA 4QQGA 4EPCA 1H3ZA 2DL8A 1WDXA 2E6NA 2VXEA 4N4HA 1Q7YR 4C5GA 1M2OA 2JM9A 1Q82U 1BI2A 1AEYA 2KRNA 4LDWA 2QASA 3JCMg 3PGGA 4HCCA 4A54A 3CCVQ 2RMOA 4DOVA 2OTLA 3NTHA 2RNAA 4PJNA 1D1BA 4MMLA 5EG2A 1P92A 1LCKA 4XTVA 1I5OB 1NEGA 5FU6B 4E2FB 3PIOA 4DBQA 1OYXA 1EFNA 2XU8A 1X01A 3X26B 3G1JA 4JPBW 3CCEQ 3H41A 1KC8C 4HVWA 2MOXA 3TSZA 2LX9A 2E12A 3CD6Q 1AOJA 2P0PA 3M0QA 4EMKB 1K73R 2KYBA 2W10A 2JS0A 1M5Q1 1OI1A 1X2QA 2P84A 4HCZA 1GBQA 2C06A 4IUTA 4O6JA 1TG0A 2KNBB 4OMQA 3G7ZA 1VQPT 4RTTA 1KJWA 3KFVA 4XTYA 4N0AA 1D0YA 4HA8A 4A4FA 1V1CA 3LH0A 5IXBA 4C8QB 2A3LA 3A8GB 3QYGB 2DKGA 1TTHB 3CBOA 4LUEA 4M75D 4IUVA 1Y7XA 4M75G 1JO8A 2HKQB 4Y91A 4M77C 1VQ7A 2DK3A 1PSEA 3CC2Q 3JCMc 2EQMA 3ER0A 2CS7A 2LC4A 2ZPEB 2F5KA 4J9CA 5D6YA 2LQNA 1K9MU 4C0FA 3OMGA 2X4YA 2RHIA 1M2VA 4M7AE 3H9NA 2DVEA 5LJ3d 1IGQA 2L3QA 5KCHA 2P4RA 2DE0X 1UGPB 5GMKj 1W70A 3BDLA 2LDMA 3TREA 3RDVA 2EGAA 1DJ7B 1YJWT 3M4GA 5HK3A 3M58A 1VQLT 3TSWA 4LDXA 1VQ8Q 3I35A 2DETA 1OU9A 3PNWC 3JV3A 1QVFS 1Q81C 1NLPC 1WJRA 1VQ5Q 2Y4YA 1M3CA 2KROA 3LH5A 4AFSC 4DBFA 2QA4T 1XTDA 3R6NA 2EJFA 5CK9A 3EGDA 1RAGB 4J6XA 3UDCA 1ZSZA 3LGFA 2DJZA 4XQ3A 4L5GA 1NM7A 2QG9B 5D6WA 2JTMA 2VUBA 1OEBA 1YJNQ 4M7DF 1KQ2A 1XQHA 1MGQA 3L2VA 3OSVA 4N4GA 1UTIA 2AHJB 1D1AA 1WHMA 1IREB 2DXTA 2ENMA 2CZ1B 4CC3A 2RB6A 4EDUA 3A5ZB 2VXFA 2E3IA 3A8HB 2RI5A 4M75A 4XAXB 1QCFA 2DAQA 2L89A 2FL7A 3CCMA 1PSFA 3MEWA 5KCOA 3L2WA 3M54A 4M4ZA 1VQ4A 2L3PA 1NE8A 4LN2A 2DEUA 2YHTA 3LW5E 2RJCA 3U23A 1S72A 4J9BA 4RTZA 2LRQA 2OTLQ 2XIDA 4KT0E 3O5ZA 3OYLA 2HDAA 3RR6A 5GANf 5HY6A 3WVDB 1K8AC 2MWOA 2QQBA 4J6WA 3S3NA 3M0PA 2HSPA 3QG1A 3ZFJA 1M2VB 4X9CA 5LJ3j 2BKDN 2ATCB 3RESA 4Q5WA 3EGXB 2DL3A 4QQ6A 3INZA 3CCMT 1QKXA 4BI4A 1J3TA 1ZA1B 1YWOA 2KI7A 2QEXA 1WA7A 3HFNA 3DB3A 1PNJA 4JS4A 3QSUA 3QJ6A 2CP2A 5GANd 1YNZA 1TH7A 2DIGA 1TUGB 3EGDB 2IG0A 4RCBA 1ZX6A 2E70A 1VQ9Q 1ZSZB 5EC7A 1YITQ 1KD1C 3HPWA 3M4YA 2O88A 2LCSA 3PE0A 2FZKB 4ZTJA 4ZGDB 1N8RR 4R0KA 3LWIA 3QBYA 1YJ9T 3QYHB 3LX7A 2QQSA 2YWWA 1NJIR 2YRDA 1VQ7Q 1RI0A 1M8MA 3OW2S 4DOWA 2PU9B 2LQ8A 1VIFA 1WHHA 1QKWA 2QXFA 3FDRA 5CO7A 4CRIA 2DL5A 2HNIA 1AWJA 3VS6A 3CCJA 3RNJA 4M75B 2XKOC 3EAEA 1VUBA 2DX1A 4MDWA 3LYIA 2RI3A 2LNVA 2KT1A 5FROA 3SDZA 5KYUA 1PRLC 2D9TA 4JRPA 2HEQA 3J81E 3A8LB 4AFUC 1SHGA 3H0FA 3CCLA 2A0FB 2YLCA 1SRMA 1K0SA 1BI3A 1Z9QA 3SWNA 4FL6A 1KQSA 5CIUA 4DEXA 1I8FA 3HTRA 2K79A 1HSQA 3M0RA 5GMKe 4OB3B 3URGA 3BE3A 3VV0A 4BE1A 4RKUE 1U8RA 1AT1B 5KYXA 2O9VA 3X24B 1RLQC 5CVIA 3CMEA 4PJOF 1N27A 2CDTA 1W2BP 5HK0A 4JZ3A 2DTHA 3RKWA 2QTVA 1X6BA 4M7DE 3CCRA 2EVRA 2ROLA 2VYTA 3SB2A 4PFPA 1Q86C 2MYSA 1PHTA 3HL8A 3L2UA 4CC7A 2VC8A 5DM7R 8AT1B 1QQJA 1I81A 2FHDA 5HCKA 3RMSA 1IHVA 3FC3A 4ESRA 3CCLT 1IHWA 3G6EA 5GANh 1WYXA 3FRNA 3M55A 1H92A 2DL7A 1VIEA 1VQKT 5KE2A 1BCMA 4LDVA 3M0UA 1BK2A 2DXCA 4VUBA 2RHUA 3H0HA 1WQWA 2MF2A 3HHTB 1UB4A 2CUDA 3CCVA 1KIKA 2B86A 1VQ4Q 3CMET 1QLYA 2RJDA 5J26A 3OB9A 3HRUA 5J3BA 2HQEA 2RI2A 1S72Q 3CCRT 1QCNA 1GFCA 4PL6A 3VYGA 2LQKA 2YUQA 1UGSB 3VS2A 4J9FA 2DXUA 3VS4A 3CCEA 3JB9D 1VQMQ 3JB9G 2M0OA 2JTEA 4OMLA 4M78F 4FM4B 4E7ZA 5KYNA 4GLKA 3G6ET 4OMPA 2GF7A 5GAMg 3CD6A 1YHQQ 5KYUB 2FEIA 3UWNA 3OS0A 3QDRB 3GNFB 1X6OA 3CCVT 2WSEE 1RAEB 5LJ3e 3UA7A 2CP3A 2LNHB 4EMGA 4FCYA 4X9DA 2QEXQ 4KH1B 3OS5A 1WX6A 4PNOA 1T0HA 2AZSA 5CKDA 5KYXB 2DFUA 4ZGJB 5GAOm 1UECA 2AT1B 3DB4A 3QUIA 5CKBA 2ZPGB 3CCET 1LNXA 3EHRA 4M78D 1JJ2A 4MZTA 2ECZA 1B7TA 5KYYA 5CAIA 1K9AA 1B07A 2DJQA 3OSSC 4J9EA 3LLRA 3CD6T 3WVEB 3CC2A 4O5VA 3I9QA 1D1CA 2E64A 4LDUA 1Q7YC 1BIAA 4R55A 4A63B 1RAAB 2RH2A 3MP8A 3NTKA 2D8JA 4NOYA 2RHYA 1Y71A 3TEEA 1Y07A 1I07A 1GCQC 4PJOA 1I5LA 3JCMb 2J6FA 4L59A 1M90R 3RIRA 2A7YA 2LT4A 2HQHA 4J5YA 2E3HA 1VQOQ 4HT9A 2PNIA 1FYNA 2K3YA 4IIMA 2L3RA 4JJCA 4XU0A 2O01E 2CP0A 4IUQA 3OYAA 4C0DC 1VQ5A 4IIOA 1K73C 3CC2T 1KK7A 2ZPFB 4PJOE 3MEAA 1Y96A 1VQNT 3SEMA 3JCMJ 3QWXX 4PFOA 4OGEA 2PVGB 2EQKA 2RHZA 2CSQA 3KBGA 2K6DA 3NGPA 3FJ5A 3OYKA 3UPUA 1YJNA 2ZCFB 1PD0A 1NYGA 2ESWA 4JJNK 2X35A 1WJQA 4M7AD 2RN8A 2ZGWA 4M7AG 4BDZA 1EX4A 1G5VA 4M78A 1VQ8T 1ZSGA 2HBPA 5FWBA 3OYHA 4C0GA 2HQXA 5DLQE 2QAZA 1KC8U 1KQSS 1VQ5T 1IO6A 5AYFA 1YCYA 1E7OA 1M9SA 5KH6A 3A1PA 5GAN2 4JRQA 2JUFA 1UGQB 5KYYB 3THKA 3NHNA 2EKOA 4BUGA 5GANe 4J9HA 3SFMA 1R77A 4ORZA 3OA6A 1MHNA 2NUPA 4ATOA 3QDFA 2FZCB 1SKUB 4M78E 2XDDA 1YJNT 3M53A 1CSKA 3Q1JA 3EG1A 2E65A 3CCST 1M1KR 3ASKA 3G71A 5LJ5g 2FZGB 3S6WA 5GAMd 2D1XA 3V8LA 5I2SA 3MEVA 4RUGA 1CKAA 4HT8A 2RD1A 1BU1A 1NZ9A 3GF5A 1AWOA 2F1LA 2K5IA 1R0BG 3I56Q 1HK9A 1SPKA 1TSFA 1SHFA 1RACB 4WF2A 2DILA 2E6ZA 5FWCA 2OTLT 1OULA 2EKHA 1GL5A 1Y96B 1HD3A 1UJYA 1Z9ZA 4AMCA 3CBPA 5GAOp 1VQ9A 2DIQA 4JJDA 1YITA 5LJ3f 5CCAA 4XU1A 5A2QE 4F7UF 4OB1B 3QZ9B 4IKFA 1PWTA 3DLMA 2FPEA 3E1SA 1PKSA 4M7AA 2C0IA 2K3BA 3HP9A 2E10A 2OX7A 4RTYA 1ABOA 3NFCA 3MKDA 2OAWA 3CCUA 5FU6C 2W0ZA 4Z02A 2Z0WA 1UGRB 4NL2A 3EFRA 1Q81U 2PVDB 4M78B 3ZL7C 1X75C 1IRXA 2COWA 2KYMA 2VVKA 4A4KA 4DBHA 3PFSA 3CXCS 3L1AA 2E1HA 4GY5A 3OYCA 4EMKC 1QWEA 2XDBA 3FIFA 2BIVA 5GMKh 1YITT 1UJ0A 2M16A 3R6OA 1FXXA 1WHJA 2NUPB 1JJ2S 1VYVA 1T0JA 2IIMA 2QGGA 1I0CA 3HKSA 1RI9A 1BB9A 2KXCA 1SG5A 4EMHA 1VQ7T 3CPWS 2PZ1A 2JZ2A 4C8QC 2ABLA 4XTXA 2QQAA 3OQ5A 3E9FA 1SF9A 4ELYC 5GAMj 1QVGS 3OYBA 4QQDA 2L2PA 3L2QA 1KQ1A 5FW9A 4C5HA 3A98A 5CQXA 3TU4K 4RTWA 1Q82R 2DF6A 2JS2A 2HBWA 1B34A 2BUDA 2GCXA 1K8AU 4C92F 1LPLA 1T3LA 1N8RC 2CKKA 2JM8A 3CC7Q 1WXBA 5GMKi 3CEYA 1TOVA 1NJIC 4C5IA 2DERA 1TUDA 4NL3A 2OTJQ 4J9IA 1YBYA 3FEOA 2EJGA 2KVQG 5CKFA 5L8RE 4M7AB 1D09B 1WLPB 1ZUYA 3JCMd 3M59A 3GPLA 2X4WA 3J80E 2RQVA 5GJVB 4GLMA 3MHXA 3A8OB 3DLLA 1BCOA 2X9HA 5I2MA 2C0OA 1IGUA 4C0ZA 1VQMA 2RK1A 3SD4A 4M7DD 4M7DG 3GLXA 2CZ0B 1RL2A 4RCCA 4ELZC 5LJ5d 3RMQA 2ZPHB 1M30A 3O8VA 4F7UA 1YHQA 4C92D 3G71Q 5LJ3h 1KD1U 1BI1A 3V8JA 1JB0E 2EYXA 2EYYA 1OU8A 2B8AA 2CZ7B 2A36A 3EH2A 1VQ4T 1D3BA 3EGUA 2YUPA 1MV0B 2M0YA 2FRYA 4N0AC 2LT1A 3OYYA 1QP2A 4A53A 1S72T 1WPYA 4IUPA 1ZBJA 1GBRA 2DMOA 1GRIA 4F7UE 2JNGA 1YFNA 2ZPIB 3VYHB 3QXEB 3VRZA 1VQMT 4X1VA 1JEGA 3WXMB 1N9SA
chains in the Genus database with same CATH topology
4PKCC 4TVRA 3QHSA 2LQKA 3OYEA 3RUXA 4BY6C 5IT9E 1N9RA 1UGSB 2DPPB 3GOXA 3X25B 2DXUA 4E7JA 4J7IA 3CCEA 3JB9D 2KY9A 3TCJA 3JB9G 2M0OA 3JB9H 3CCSA 2DTOA 4M78F 2EWNA 4FM4B 1N8RU 2V8IA 3P8BB 4FT2A 3CCUT 4PLLA 4OB2B 4GLKA 5GAOl 3G6ET 3V8KA 1R8OB 2GF7A 1NJIU 5GAMg 3CD6A 2QTXA 1W2BS 2QQ9A 5GAMh 3N5BB 3JAME 2X4XA 1I4K1 2EQJA 2Y4XA 3UWNA 1V29B 5FU7C 3V7SA 3OS0A 3OS2A 3QDRB 1B34B 4C8QE 3T9NA 3GNFB 4QQGA 1X6OA 4EPCA 1VQ6T 3I55A 5GMKl 3META 3JCMf 1H3ZA 2XDPA 1U1TA 2QEXT 2E6NA 2LCCA 2VXEA 4N4HA 3CCVT 1YIJT 2DD5A 2WSEE 4FU6A 5LJ3e 3MP6A 2KDSA 3BFMA 4C5GA 2RO0A 2MI6A 3FB9A 4DQ2A 4EMGA 1BI2A 1Q82U 4LDWA 2JTFA 4X9DA 3JCMg 3PGGA 3BDUA 3OS5A 3OYIA 4HCCA 4A54A 4XTWA 1VQOA 4M78C 4UC4A 5HKCA 4PNOA 3JCMh 3PMTA 4BD3A 4DOVA 3KUFA 1K9MC 5CKDA 2OTLA 3J7AF 3CC4T 3NTHA 4ZGJB 4LD6A 4MMLA 5GAOm 1Q86U 3JCMW 5EG2A 1P92A 5LJ5f 3DB4A 3QUIA 4M7DA 5CKBA 2K5LA 4XTVA 3V7RA 2ZPGB 1FWZA 3CCET 1LNXA 5FU6B 4M78D 1JJ2A 1M8VA 3CPFA 4MZTA 3PIOA 1OYXA 5CAIA 3OSSC 2XU8A 4C92A 1G3TA 1X01A 1OZ3A 3F70A 3X26B 2RJEA 3LLRA 5GMKm 2E41A 3CD6T 3WVEB 2K5FA 3CC2A 4O5VA 1KC8C 5LJ5j 2F69A 2D6FA 2E64A 2LX9A 4LDUA 3V7CA 1Q7YC 1BIAA 2E12A 4R55A 4BDYA 3S3MA 1JRIA 4FIBA 5C6SA 1O9SA 3PTAA 1NPRA 2P0PA 4BE0A 2RH2A 3MP8A 4EMKB 3NTKA 3I55T 5A0GA 1AHJB 1M5Q1 1OI1A 4NOYA 3CCJT 2QDYB 3VUZA 2RHYA 1Y71A 3TEEA 1Y07A 4HCZA 2E5QA 3BW1A 1KHCA 2KQWA 4FSXA 2C06A 4KUDK 4IUTA 4O6JA 4PJOA 1WQ7A 2V8KA 1I5LA 2CGHA 4KBMB 4M77F 3JCMb 3G7ZA 1VQPT 1D3BB 4L59A 4C92E 2K4YA 3RIRA 1EIFA 2A7YA 2LT4A 4XTYA 4JRKA 3OYGA 3LWHA 4N0AA 2KMTA 4J5YA 4C92G 2L8DA 4HA8A 4A4FA 3VU3C 2H3JA 2PVOB 2ZPBB 3RKXA 2XI9A 4M75C 5GAN3 4HT9A 3LH0A 2K3YA 4C8QB 2A3LA 3L2ZA 3A8GB 2JN0A 2L3RA 3AHUA 3QYGB 4XU0A 2DKGA 2O01E 4PLIA 3CBOA 4M75E 5GAN5 4IUQA 3OYAA 4C0DC 3OYFA 5IAYA 2O4XA 1VQ5A 4M75D 1XOVA 3CC2T 1K73C 4IUVA 3MO8A 1Y7XA 4M75G 2ZPFB 3ME9A 4PJOE 1OZ2A 3MEAA 1Y96A 4Y91A 1VQNT 2V8JA 4M77C 1VQ7A 1BI0A 4PJOD 3JCMQ 2DK3A 1PSEA 1YJ9A 4PJOG 3E19A 3P8DA 4J8OA 3JCMc 2EQMA 1UEBA 3JCMJ 2F5TX 2ZZDA 4II1A 2WACA 3ER0A 2GFUA 4OB0B 2CS7A 2LC4A 2ZPEB 1M90C 4OGEA 4M77D 3JCMX 2F5KA 2PVGB 2L5QA 2EQKA 2RHZA 4OF1A 5D6YA 4M77G 5M9OA 3L42A 4BE2A 3KBGA 4M7AC 1K9MU 4ZTFA 4C0FA 3OMGA 1O75A 2OAUA 3OYKA 3UPUA 1YJNA 2WSCE 2ZCFB 2X4YA 2RHIA 1YHQT 3CMAA 5D6XA 3MCAB 4M7AE 4JJNK 2DVEA 5LJ3d 3JCMV 2X35A 2XD0A 1WJQA 3A8MB 5KCHA 4M7AD 2EJ9A 2ZGWA 4MMKA 4M7AG 4BDZA 3CCQA 1UGPB 1G3WA 5GMKj 1G5VA 1WJSA 4JS5A 4M78A 3BDLA 1VQ8T 4OMFB 4A4HA 2HBPA 2LDMA 3TREA 2G3RA 3OYHA 2EAYA 4C0GA 3I56A 2HQXA 1DJ7B 2RJFA 5DLQE 2HAXA 2VV5A 1YJWT 3M4GA 5HK3A 2QQRA 3M58A 1KC8U 1KQSS 1VQ5T 1VQLT 4LDXA 4M7DB 5AYFA 1BYMA 3QO3A 3CBMA 2P0QA 3FJPA 1Q7YU 3JB9J 1YCYA 5KH6A 1G3SA 1M9SA 5GAN2 4JRQA 3PNWC 2JUFA 1QVFS 1Q81C 3SWNB 1UGQB 1WJRA 2EKOA 4C92B 4BUGA 1M4ZA 5GANe 2DD4A 2Y4YA 4BI8B 3SFMA 2LTOA 2QA4T 3OBWA 1XTDA 1MHNA 3PT9A 2FB7A 2EJFA 3OA6A 5CK9A 4BE1A 4ATOA 4E47A 2MWPA 4J6XA 4D6WA 3UDCA 2DTIA 4JLIA 4J6YA 1U1SA 4M78E 2K2VA 2XDDA 3ZBDA 3LGFA 1YJNT 1QVPA 3M53A 3GP8A 2DJZA 4XQ3A 3Q1JA 1M1KU 2E65A 4L5GA 4M78G 3CCST 5D6WA 2JTMA 1BKBA 3ASKA 2I2LA 2VUBA 3G71A 5LJ5g 4XK8E 3OYDA 1LOJA 4M7DF 1KQ2A 1XQHA 1MGQA 5LJ5h 3L2VA 3X20B 3OSVA 3RERA 3S6WA 4N4GA 2AHJB 2PUOB 5GAMd 3RKYA 2MMPA 1KHIA 1IREB 2DXTA 2KSSA 3V8LA 4OP0A 4F7UB 5I2SA 3MEVA 2CZ1B 3PIPA 4MZPA 3OS1A 3I56T 1W2BA 1KG1A 1K73U 4JLGA 2RB6A 4KULA 3A5ZB 2VXFA 4EDUA 4OGCA 2RD1A 4HT8A 5A0DA 1NZ9A 4QVZA 3A8HB 2RI5A 4M75A 4XAXB 3GF5A 4OVAA 4E7KA 2YRVA 4BACA 2K5IA 4XTZA 3NTIA 2DAQA 2L89A 5GAN6 3S3OA 2FL7A 1VQKA 3CCMA 1PSFA 3MEWA 5KCOA 3L2WA 3G4SA 3M54A 1HK9A 1VQ4A 1NE8A 1QVFA 2O4XB 4WF2A 5GAMe 5FLXE 1VQOT 4BY6B 2E6ZA 1M90U 4J7FA 4ZN3A 2YHTA 2OTLT 4BB7A 3H6ZA 2YLBA 3LW5E 3JB9I 2RJCA 1S72A 1Y96B 2EIFA 1M1KC 4M77A 2EQUA 2Y90A 5I21A 3QZ5B 4QVDA 2LRQA 3GNGA 4HKEA 1U8RA 3CBPA 3SWNC 4A4EA 2XIDA 5GAOp 2M1HA 4KT0E 1VQ9A 2DIQA 1YITA 2XK0A 5LJ3f 2FYKA 4RG2A 4XU1A 3JSCA 5CCAA 5A2QE 3OYLA 5CKHA 4HCBA 4F7UF 4OB1B 3QZ9B 4QW2A 4JUVA 4IKFA 5GANf 5HY6A 3DLMA 3WVDB 5FU7B 1ZQ1A 1K8AC 3H8ZA 4ZGEB 2XG8D 2MWOA 3E1SA 2LVMA 2QQBA 3JCMe 4RMOA 4M7AA 3HP9A 2E10A 4J6WA 3S3NA 4R56A 1QW1A 3JB9F 4B9XA 3NFCA 3QG1A 2CZ6B 3ZFJA 3UT1A 4X9CA 3HRSA 3CCUA 4X34A 4ZN1A 3QKJA 2BKDN 4CI0C 5LJ3j 5FU6C 5KE3A 4Z02A 1IZ6A 2FVUA 5GANj 1UGRB 2RHXA 3EFRA 4NL2A 3RESA 4Q5WA 4M77E 2PVDB 3KXTA 2P0KA 1Q81U 4QQ6A 3INZA 4M78B 4MDXA 3CCMT 1X75C 3G4ST 1YI2A 2M9UA 4BI4A 4DA4A 5LJ5e 3BY7A 4V2SA 4L6V5 2VGMA 4A4KA 2QEXA 4C8QF 1NPPA 2JOYA 3PFSA 3JCMP 3CXCS 3HFNA 2DEQA 3L1AA 2LCLA 2E1HA 2RK2A 3C94A 4GY5A 4LDYA 4EMKC 3OYCA 4LD9K 3DB3A 4JS4A 3QSUA 2GQVA 3QJ6A 2XDBA 3FIFA 2BIVA 5FRNA 5GMKh 5GANd 2R5MA 3CC7A 3OYJA 1YITT 1TH7A 3VUBA 2M16A 2DIGA 2EFIA 3R6OA 1FXXA 4E7HA 1JJ2S 1W4SA 1FX7A 2IG0A 4RCBA 4RG8A 2D0QB 5DY9A 2E70A 2OTJA 5GAMf 1H641 3DKMA 1KD1C 3HPWA 3HKSA 3M4YA 3M56A 4ZTJA 1M1FA 3QIIA 4N4IA 4EMHA 4A4GA 2GFAA 4ZGDB 3CPWS 4NS5A 3QJYA 3LWIA 3QBYA 1VQ7T 1YJ9T 2JZ2A 3QYHB 4C8QC 3LX7A 2QQSA 4XTXA 2QQAA 4QVCA 3OYMA 3OQ5A 3E9FA 1RI0A 4ELYC 3OW2S 5GAMj 4DOWA 2PU9B 1QVGS 4IURA 1JBMA 1WNLA 2LQ8A 1YI2T 2WSFE 1VIFA 1N6AA 3OY9A 3OYBA 4C8QD 2DO3A 4QQDA 4CRIA 2QXFA 3FDRA 5CO7A 2QI2A 4C8QG 2HNIA 3CCJA 5GAOr 4M75B 3L2QA 1KQ1A 2XKOC 3CMAT 3EAEA 1VUBA 4C5HA 4MDWA 5CQXA 3TU4K 3MP1A 5CR2A 3LYIA 3M5AA 2RI3A 4Y28E 5IN1A 5LL6S 3CXCA 4PJOB 2LNVA 5FROA 3SDZA 1VQPA 3CC7T 2DZ9A 4C0DB 4JRPA 2D9TA 3CCQT 4IUUA 3HSBA 3J81E 5GAN4 1B34A 4J83A 2BUDA 2GCXA 1K8AU 2RA2A 3A8LB 2RM4A 4C92F 2OTJT 1N8RC 3CCLA 2CKKA 4M77B 3M9QA 5GMKi 2YLCA 3CEYA 3GIBA 3M57A 2KAFA 3VJPA 5GAOn 1BI3A 1NJIC 4C5IA 3SWNA 4JRIA 2XHCA 3C12A 4FL6A 4NL3A 1KQSA 4FT4A 5CIUA 4P5NA 2DZCA 1I8FA 2X4JA 5GMKe 1YBYA 4OB3B 3FEOA 2R57A 3URGA 2EJGA 3VV0A 3CPWA 2KVQG 5CKFA 1BIBA 1LJOA 4M75F 4RKUE 4YTLA 5L8RE 2K57A 4M7AB 5CQYA 1HXDA 5DLOA 3M59A 3JCMd 1VQNA 3X24B 3JRZA 3GPLA 2X4WA 4M7DC 3J80E 4E7IA 5CVIA 3CMEA 4PJOF 3C4SA 1N27A 3A8OB 3MHXA 3DLLA 3OW2A 2MAMA 5I2MA 5HK0A 1QVGA 2DTHA 4XTUA 1Q82C 3RKWA 4E7LA 4MZMA 4M7DE 5CKEA 4C92C 3MEUA 3CCRA 3P8HA 3PMIA 4C0ZA 1VQMA 2NLUA 2RK1A 3OMCA 2VYTA 3SD4A 4M7DD 3G71T 3FLGA 4M7DG 3SB2A 1Q86C 3GLXA 2CZ0B 1RL2A 3HL8A 4RCCA 3L2UA 2PUKB 1WGSA 1SSFA 2VC8A 4ELZC 5LJ5d 3RMQA 5DM7R 2ZPHB 1XNIA 1I81A 2R58A 3O8VA 3X28B 2FHDA 4F7UA 5LJ3g 3HFOA 2K3XA 1ZBXA 3RMSA 4C92D 1YHQA 2VGNA 5LJ3h 5C0MA 3FC3A 5GANg 2R5AA 4EMKA 3CCLT 1KD1U 3G6EA 1BI1A 5GANh 3FRNA 3LGLA 3OBYA 3V8JA 5J39A 1JB0E 2P4TA 4M7AF 3OYNA 3M55A 3EFSA 4C5EA 1VQ8A 4BI3A 2B8AA 1ZHIA 4PJOC 1VIEA 1VQKT 2CZ7B 3C95A 5KE2A 4XU2A 2CYZB 2JVVA 1YJWA 4LDVA 4JDSA 1VQLA 1VQ4T 4ME7A 1D3BA 1VQ6A 3QPHA 2DXCA 4VUBA 3ZEHA 4B9WA 2RHUA 3VKIA 4XU3A 3E9GA 1M1GA 1WQWA 2MF2A 1GXIE 3HHTB 1UB4A 1YIJA 1G3YA 4N0AC 2LT1A 3OYYA 1QP2A 3HRTA 2IVWA 1WPYA 4A53A 3CCVA 1S72T 4IUPA 3L2RA 5GAN8 3CMET 2RJDA 2HD0A 5J26A 5FRMA 3OB9A 5A0LA 2PQWA 4F7UE 2JNGA 3HRUA 5J3BA 4C8QA 5GAN7 4KUIA 2DXBA 5GAOq 1VQ9T 2HQEA 2RI2A 2ZPIB 3VYHB 2QA4A 3QXEB 3CCRT 1QP3A 2XICA 4F7UG 1VQMT 3CC4A 2EYQA 3WXMB 4PL6A 2KK4A 3VYGA 1N9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKG A;  3QHS A;  4C8Q G;  3RUX A;  4XTZ A;  1N9R A;  2HNI A;  4M75 E;  5GAO r;  5GAN 6;  5GAN 5;  4M75 B;  2DXU A;  1KQ1 A;  3JB9 D;  4M75 D;  3JB9 G;  3JB9 H;  1HK9 A;  4M75 G;  2DTO A;  4M78 F;  2EWN A;  4PJO E;  3JCM g;  4WF2 A;  5GAM e;  4PJO B;  1Y96 A;  4Y91 A;  5GAO l;  4M77 C;  2YHT A;  3V8K A;  4PJO D;  2DZ9 A;  3JCM Q;  2YLB A;  3JB9 I;  5GAM g;  3HSB A;  4PJO G;  1Y96 B;  2QTX A;  3JCM c;  5GAN 4;  3JCM J;  1B34 A;  4M77 A;  5GAM h;  2Y90 A;  5I21 A;  1I4K 1;  2RA2 A;  2RM4 A;  3V7S A;  4C92 F;  4QVD A;  1B34 B;  4C8Q E;  4M77 B;  3SWN C;  5GAO p;  5GMK i;  2YLC A;  3GIB A;  5LJ3 f;  2FYK A;  4M77 D;  4XU1 A;  3JCM X;  5GAO n;  5GMK l;  3JCM f;  4M77 G;  4F7U F;  3SWN A;  1U1T A;  4JRI A;  4JUV A;  4M7A C;  5GAN f;  4NL3 A;  2VXE A;  2DZC A;  1I8F A;  5LJ3 e;  4M7A A;  3JCM e;  5GMK e;  3BFM A;  2E10 A;  4J6W A;  4EMG A;  3FB9 A;  4DQ2 A;  4M7A E;  2EJG A;  3JB9 F;  4X9D A;  2DVE A;  4M7A B;  1BIB A;  1LJO A;  3PGG A;  3BDU A;  4M75 F;  5LJ3 d;  2K57 A;  4X9C A;  4XTW A;  1HXD A;  4M78 C;  3JCM V;  4A54 A;  4PNO A;  3JCM h;  2EJ9 A;  2ZGW A;  3JCM d;  5LJ3 j;  4M7A D;  4MMK A;  4M7A G;  4M7D C;  5GMK j;  5GAO m;  4PJO F;  4M78 A;  4MML A;  5GAN j;  3JCM W;  3RES A;  4NL2 A;  3EFR A;  5LJ5 f;  3QUI A;  4M77 E;  4M7D A;  2DTH A;  4XTU A;  2EAY A;  3RKW A;  3INZ A;  4M78 B;  4XTV A;  3V7R A;  4M7D E;  3M4G A;  4C92 C;  1LNX A;  4M7D B;  4M78 D;  1M8V A;  5LJ5 e;  3BY7 A;  4V2S A;  4M7D D;  3QO3 A;  3FJP A;  5CAI A;  3JB9 J;  1YCY A;  4C92 A;  3SB2 A;  5GAN 2;  1X01 A;  4M7D G;  4C8Q F;  3JCM P;  5GMK m;  4RCC A;  3SWN B;  2VC8 A;  3HFN A;  5LJ5 d;  2DEQ A;  3L1A A;  2E41 A;  4C92 B;  2E1H A;  1I81 A;  4EMK C;  5GAN e;  5LJ3 g;  4F7U A;  3HFO A;  4C92 D;  5LJ5 j;  3QSU A;  5LJ3 h;  3FIF A;  5GAN g;  2E64 A;  4EMK A;  3V7C A;  5GMK h;  1BIA A;  5GAN d;  2FB7 A;  2EJF A;  1JRI A;  5GAN h;  3V8J A;  1TH7 A;  4J6X A;  4EMK B;  2DTI A;  4M7A F;  4JLI A;  3EFS A;  4J6Y A;  1M5Q 1;  1U1S A;  4M78 E;  4NOY A;  4RCB A;  5DY9 A;  4PJO C;  3BW1 A;  4XU2 A;  1H64 1;  2DJZ A;  4XQ3 A;  5GAM f;  2E65 A;  4M78 G;  1WQ7 A;  4PJO A;  1D3B A;  1I5L A;  2CGH A;  4M77 F;  2I2L A;  4XU3 A;  5LJ5 g;  1WQW A;  4EMH A;  3JCM b;  1LOJ A;  1D3B B;  4C92 E;  4M7D F;  4N0A C;  1KQ2 A;  1MGQ A;  4A53 A;  5LJ5 h;  1WPY A;  3RIR A;  4C8Q C;  5GAN 8;  3RER A;  4XTX A;  4XTY A;  4JRK A;  4QVC A;  5GAM d;  4XU0 A;  4N0A A;  4J5Y A;  4C92 G;  3RKY A;  4F7U E;  4C8Q A;  2DXT A;  4HA8 A;  3V8L A;  4OP0 A;  3RKX A;  3VU3 C;  4F7U B;  5GAM j;  5GAN 7;  4M75 C;  5GAN 3;  5GAO q;  4HT9 A;  1JBM A;  1WNL A;  2RB6 A;  4C8Q B;  2VXF A;  4F7U G;  2RD1 A;  4HT8 A;  3L2Z A;  2JN0 A;  3AHU A;  4C8Q D;  4M75 A;  1N9S A; 
#chains in the Genus database with same CATH topology
 3QHS A;  2RQT A;  1N9R A;  1K9M R;  4PJL A;  3X25 B;  2LX7 A;  1QWF A;  2DTO A;  4Z89 A;  4HVU A;  2CSI A;  4PLL A;  4OB2 B;  3UAT A;  2A28 A;  1MUZ A;  1ZA2 B;  4CC4 B;  2HCK A;  2EQJ A;  2Y4X A;  3TQ7 P;  1V29 B;  3CCU Q;  4B6M A;  1B34 B;  4WCI A;  4CC2 A;  1YWP A;  1H8K A;  5GMK l;  1G2B A;  3MET A;  2QEX T;  2V26 A;  2F2X A;  2JMA A;  1VQL Q;  1VQ6 Q;  2RO0 A;  1ZUU A;  2MI6 A;  1RAF B;  2KRS A;  2JTF A;  3OYI A;  4XTW A;  1VQO A;  1YIJ Q;  4UC4 A;  3JCM h;  2RQW A;  2JW4 A;  3KUF A;  1Q86 U;  4M7D A;  2K5L A;  3V7R A;  2HL3 A;  3CC4 Q;  2DA9 A;  4C92 A;  1G3T A;  1OZ3 A;  2E41 A;  2K5F A;  3EG0 A;  5LJ5 j;  2CH4 W;  2CT3 A;  2F69 A;  3EG3 A;  2D6F A;  1TS9 A;  4OMM A;  4Z88 A;  1ZSZ C;  4FIB A;  2JMC A;  5C6S A;  1O9S A;  4LE9 A;  3PTA A;  4BE0 A;  5A0G A;  1AHJ B;  2EYZ A;  3CCJ T;  2E5Q A;  8ATC B;  2KQW A;  4KUD K;  2KGT A;  3I55 Q;  2RQR A;  2V8K A;  4KBM B;  4M77 F;  1EZZ B;  4PJM A;  1D3B B;  4C92 E;  2K4Y A;  4J9G A;  1QVF P;  3OYG A;  4JRK A;  3LWH A;  1G8X A;  3VU3 C;  2PVO B;  1OQK A;  1CKB A;  5GAN 3;  4M75 C;  1JU5 C;  2ZAE A;  2RQU A;  4PK4 A;  2JN0 A;  2D0N A;  1JXO A;  3AHU A;  1BBZ A;  4PLI A;  1C0M A;  2DRK A;  1OX9 A;  5GAN 5;  2QYZ A;  4JZ4 A;  2O4X A;  4AG1 C;  1XOV A;  3MO8 A;  2V1Q A;  1OZ2 A;  2V8J A;  4PJO D;  4PJO G;  3E19 A;  3P8D A;  2NUT A;  4J8O A;  1UEB A;  2ED0 A;  5L23 A;  2GFU A;  1M90 C;  2GBQ A;  4M77 D;  2A08 A;  2QGF B;  4OF1 A;  4M77 G;  4BE2 A;  1TWB A;  4ZTF A;  1O75 A;  2WSC E;  1YN8 A;  2NYS A;  3CMA A;  5D6X A;  1MMD A;  3ULR B;  4PJJ A;  4MMK A;  3UA6 A;  3CCQ A;  1G3W A;  4JS5 A;  4PFZ A;  4OMF B;  3EH1 A;  2G3R A;  2EAY A;  3I56 A;  2RJF A;  2HAX A;  2VV5 A;  2QQR A;  7AT1 B;  4M7D B;  1Q95 G;  3C0C A;  1BYM A;  3QO3 A;  2P0Q A;  1Q7Y U;  1RAI B;  1UHC A;  2GTO A;  3JB9 J;  3I5S A;  3SWN B;  3I5R A;  4C92 B;  3CQT A;  2NWM A;  4BI8 B;  2LTO A;  1YJ9 Q;  4E47 A;  2MWP A;  4D6W A;  2K2V A;  3ZBD A;  4FYX B;  1M1K U;  4M78 G;  1BKB A;  1IXD A;  1GFD A;  2I2L A;  2XMF A;  4XK8 E;  2MPX C;  2DYI A;  2DVJ A;  1X69 A;  1K4U S;  2KT8 A;  2PUO B;  2L0A A;  1KHI A;  3PIP A;  2I0N A;  2KSS A;  3I56 T;  4MZP A;  1W2B A;  1KG1 A;  1K73 U;  4JLG A;  4KUL A;  2LJ0 A;  5A0D A;  2YUO A;  4QVZ A;  1VA7 A;  1X6G A;  2X51 A;  3NTI A;  4XTZ A;  5IH2 A;  2D8H A;  5GAN 6;  5GJW B;  2YT6 A;  1QVF A;  2O4X B;  3EG9 A;  5FLX E;  2EPD A;  4BY6 B;  1FMW A;  4J7F A;  4BB7 A;  3H6Z A;  2IPO B;  2YLB A;  2EIF A;  3REB B;  1M1K C;  4M77 A;  1WIE A;  2EQU A;  2Y90 A;  3QZ5 B;  2NUT B;  4QVD A;  3SWN C;  4A4E A;  3OW2 P;  2XK0 A;  4RG2 A;  4HCB A;  3SHW A;  4QW2 A;  4HCK A;  1T3S A;  4JUV A;  5FU7 B;  1ZQ1 A;  3H8Z A;  4ZGE B;  2XG8 D;  3JCM e;  3IQL A;  5IHK A;  4R56 A;  1QW1 A;  1OPK A;  4B9X A;  2CZ6 B;  4F16 A;  4X34 A;  3QKJ A;  5KE3 A;  1D0X A;  4HVV A;  2FVU A;  1UDL A;  1K0X A;  4M77 E;  2FO0 A;  1MV3 A;  5LJ5 e;  4V2S A;  2VGM A;  1NPP A;  2JOY A;  1VQK Q;  4LNP A;  3G4S Q;  2LCL A;  2RK2 A;  3C94 A;  4LDY A;  3VS7 A;  4LXC A;  3VS1 A;  2MIO A;  2PTK A;  4EIK A;  2HMA A;  5IHI A;  5FRN A;  2R5M A;  3CC7 A;  3OYJ A;  4F14 A;  3VS0 A;  2YSQ A;  4E7H A;  1W4S A;  1FX7 A;  2VWF A;  4RG8 A;  3MPU B;  2OTJ A;  2DRM A;  2YXY A;  5GAM f;  2L3S A;  2J06 A;  2J05 A;  2AKL A;  2HSE B;  3QJY A;  2KE9 A;  4QVC A;  2VKN A;  1VOM A;  1AVZ C;  1N6A A;  1U06 A;  1YI2 Q;  1U5S A;  1QMC A;  2RPN A;  1M3B A;  3M5A A;  3VRY A;  5IN1 A;  1E6H A;  4PJO B;  2CP6 A;  1WHK A;  1VQP A;  3CC7 T;  2AKK A;  3CMA Q;  3EG9 B;  3HSB A;  1WHL A;  1M27 C;  5GAN 4;  2O2O A;  3E2U A;  1SEM A;  4DBR A;  4OMO A;  2OTJ T;  4M77 B;  3CCQ Q;  3GIB A;  3VJP A;  2KAF A;  1WI7 A;  2BZY A;  4JRI A;  4KH0 B;  4FT4 A;  2DZC A;  4FYV B;  2HZY A;  2FG0 A;  4YTL A;  1BIB A;  4M75 F;  2K57 A;  5CQY A;  1HXD A;  2GQI A;  3JRZ A;  2EYW A;  2X3W D;  4F04 B;  3OW2 A;  3QWY A;  4XTU A;  1Q82 C;  2DLP A;  3AT1 B;  2K9G A;  2COZ A;  2GTJ A;  5CKE A;  1E6G A;  4FYY B;  3G71 T;  3FLG A;  1X43 A;  4AG2 C;  2K2M A;  2R58 A;  2X3X D;  3X28 B;  3HFO A;  1ZBX A;  2VGN A;  1RUW A;  5GAN g;  4GBQ A;  2EGC A;  3VS3 A;  5J39 A;  2P4T A;  3OYN A;  1AWX A;  4C5E A;  4BI3 A;  4QKU A;  1ZHI A;  4PJO C;  4FSS A;  4XU2 A;  3VS5 A;  2CYZ B;  2JVV A;  2HKN A;  1YJW A;  2G6F X;  4JDS A;  1VQL A;  1AZG B;  1VQ6 A;  3QPH A;  4B9W A;  5D7U A;  3VKI A;  4XU3 A;  1M1G A;  1GXI E;  1YIJ A;  2JXB A;  3HRT A;  2IVW A;  2AZV A;  3L2R A;  2HD0 A;  2PQW A;  1WXT A;  5GAN 7;  2EQI A;  5GAO q;  1VQ9 T;  4WTO B;  1VQN Q;  4K11 A;  2QA4 A;  4F7U G;  3CC4 A;  2KK4 A;  4PKC C;  4TVR A;  5IT9 E;  3RUX A;  1MMN A;  2O31 A;  4E7J A;  2ROT A;  1VYU A;  3JB9 H;  2EWN A;  1N8R U;  1V76 A;  2JT4 A;  1OOT A;  3P8B B;  3CCU T;  1F1B B;  1C1A A;  1R8O B;  1NJI U;  1ACM B;  2QDL A;  1YCS B;  3EGX A;  1W2B S;  2H3E B;  5GAM h;  2X4X A;  3T9N A;  1OX8 A;  2OI3 A;  1KC8 R;  3I55 A;  3EHQ A;  3JCM f;  1VQ6 T;  2XDP A;  1U1T A;  1PKT A;  1ZUK A;  2LCC A;  2YUN A;  1YIJ T;  2CP7 A;  2DD5 A;  4FU6 A;  3MP6 A;  2KDS A;  3BFM A;  2DM1 A;  3FB9 A;  4DQ2 A;  3BDU A;  4M78 C;  5HKC A;  4BD3 A;  1K9M C;  3PMT A;  3J7A F;  3CC4 T;  1PC0 A;  1MNE A;  4LD6 A;  1NBE B;  3JCM W;  5LJ5 f;  2MK5 A;  2LZ6 B;  1FWZ A;  2M02 A;  1M8V A;  2LP5 A;  3CPF A;  1K76 A;  1RAD B;  2EW3 A;  3F70 A;  1R0C B;  2RJE A;  5GMK m;  3M0T A;  2LMJ A;  2YRC A;  3CCS Q;  1GCP A;  3V7C A;  4BDY A;  3S3M A;  1JRI A;  1NPR A;  3GBQ A;  3I55 T;  1UHF A;  2QDY B;  3VUZ A;  4JJB A;  3REA B;  2CH4 A;  1KHC A;  3BW1 A;  4FSX A;  1WQ7 A;  1KQS P;  2CGH A;  1WHG A;  1C6V X;  2FRW A;  1G83 A;  1EIF A;  1ZLM A;  2KMT A;  4C92 G;  2L8D A;  1VQP Q;  2H3J A;  2ZPB B;  3RKX A;  2XI9 A;  2J6O A;  3L2Z A;  2HL5 C;  1M3A A;  2BE7 D;  3M0S A;  4M75 E;  3RBB B;  3OYF A;  5IAY A;  1FMV A;  3ME9 A;  1OV3 A;  2KXD A;  1BI0 A;  2C0T A;  1UE9 A;  3TVT A;  3JCM Q;  1YJ9 A;  1UFF A;  2F5T X;  2ZZD A;  2M51 A;  4II1 A;  1TUC A;  2WAC A;  5KYW A;  1Q81 R;  3EFO A;  4OB0 B;  5IXF A;  1RAB B;  1UGV A;  4QT7 A;  3JCM X;  2L5Q A;  5M9O A;  3L42 A;  4M7A C;  1WXU A;  4E7S A;  2OAU A;  4LUD A;  4HXJ A;  1YHQ T;  2KR3 A;  2F2V A;  3MCA B;  5AT1 B;  5IHN A;  1AZE A;  3JCM V;  2XD0 A;  3A8M B;  2EJ9 A;  1KFZ A;  4J9D A;  1WJS A;  4A4H A;  3PVQ A;  2BE9 B;  2O9S A;  3CBM A;  2NUZ A;  3FJP A;  1G3S A;  2AIR B;  2DBM A;  1YJW Q;  1NEB A;  1M4Z A;  2DD4 A;  4OMN A;  2BZX A;  1Y0M A;  5I11 A;  3OBW A;  1U3O A;  3PT9 A;  2FB7 A;  1MMG A;  2DTI A;  4JLI A;  1YP5 A;  1U1S A;  4J6Y A;  1PM3 A;  2E4H A;  3NMZ C;  1JXM A;  1TU0 B;  1QVP A;  2QA4 Q;  3GP8 A;  1UUE A;  1GCQ A;  3OYD A;  1LOJ A;  5LJ5 h;  1WZO A;  3X20 B;  3CXC P;  3RER A;  3D7S B;  1X2K A;  3RKY A;  1PG5 B;  2MMP A;  4F7U B;  4OP0 A;  3OS1 A;  1K8A R;  4Z8A A;  2LQW A;  1I1J A;  4OGC A;  4E7K A;  4OVA A;  2YRV A;  4BAC A;  1JJ2 P;  3S3O A;  1VQK A;  3G4S A;  1AD5 A;  2K7A A;  5GAM e;  1VQO T;  1M90 U;  2EGE A;  4ZN3 A;  2A37 A;  1IB8 A;  1W1F A;  3JB9 I;  3CPW P;  2ED1 A;  5I21 A;  3PVL A;  3GNG A;  4HKE A;  4FYW B;  2M1H A;  2LJ3 A;  5KYW B;  2FYK A;  1QVG P;  3JSC A;  3EFO B;  5CKH A;  1SRL A;  4FW2 A;  2CT4 A;  2LVM A;  4RMO A;  3JB9 F;  1RAH B;  4KGZ B;  3UT1 A;  3HRS A;  2YDL A;  4ZN1 A;  4CI0 C;  1KD1 R;  4DEY A;  4AFZ C;  1IZ6 A;  5GAN j;  2RHX A;  2J6K A;  3KXT A;  4ANJ A;  2RF0 A;  2P0K A;  4MDX A;  3G4S T;  1YI2 A;  2H8H A;  2M9U A;  2SRC A;  4DA4 A;  3BY7 A;  4L6V 5;  1KSW A;  2V1R A;  4C8Q F;  1ARK A;  3CCM Q;  2LJ1 A;  2DEQ A;  4LD9 K;  1NYF A;  2GQV A;  5I22 A;  3VUB A;  2F2W A;  2EFI A;  2VB6 A;  1PRM C;  1MMA A;  5DY9 A;  2D0Q B;  3NPF A;  1H64 1;  1WFW A;  2FPF A;  2J7I A;  2KEA A;  3DKM A;  3H0I A;  2FPD A;  1FMK A;  3M56 A;  1M1F A;  3QII A;  4N4I A;  4A4G A;  2GFA A;  1B3Q A;  4NS5 A;  2CUB A;  1Y57 A;  1MND A;  3OYM A;  2BZ8 A;  1S1N A;  4IUR A;  1JBM A;  1WNL A;  1YI2 T;  2WSF E;  1NLO C;  9ATC B;  3OY9 A;  4C8Q D;  2DO3 A;  3MJX A;  4C8Q G;  2QI2 A;  2JJ9 A;  5GAO r;  4KRT A;  2BTT A;  3CMA T;  2DBK A;  2SEM A;  4RTV A;  3MP1 A;  2OJ2 A;  5CR2 A;  4Y28 E;  5LL6 S;  3CXC A;  1HYO A;  4RTU A;  1XJW B;  3UF4 A;  2DZ9 A;  4C0D B;  3CCQ T;  4AT1 B;  4IUU A;  4ZNX A;  1QCO A;  4J83 A;  4F17 A;  1Q86 R;  2RA2 A;  2DL4 A;  2RM4 A;  1X27 A;  3M9Q A;  1K1Z A;  2DYB A;  3M57 A;  5GAO n;  1SSH A;  4AFQ C;  2XHC A;  3C12 A;  4P5N A;  2KRM A;  1ABQ A;  2GGR A;  2X4J A;  2R57 A;  3CPW A;  1N5Z A;  3JCM P;  1LJO A;  5DLO A;  2DNU A;  1VQN A;  2CP5 A;  4M7D C;  4FW1 A;  4E7I A;  2QK0 A;  3C4S A;  4KGV B;  1PD1 A;  2MAM A;  1QVG A;  2CRE A;  1UG1 A;  1A0N B;  4E7L A;  4MZM A;  4C92 C;  4Y92 A;  3MEU A;  3P8H A;  3PMI A;  2KBT A;  2NLU A;  3OMC A;  1PCX A;  3CCJ Q;  2GNC A;  2PUK B;  1WGS A;  1SSF A;  1XNI A;  5ECA A;  5LJ3 g;  2K3X A;  5C0M A;  2R5A A;  4EMK A;  1NG2 A;  3OBY A;  3LGL A;  2E5K A;  4M7A F;  1AWW A;  3EFS A;  1VQ8 A;  1H3H A;  1HJD A;  3CCL Q;  3C95 A;  1TXQ A;  4KGX B;  4ME7 A;  3ZEH A;  3E9G A;  4E6R A;  1RLP C;  1W6X A;  1G3Y A;  4D8D A;  4RTX A;  5GAN 8;  1JQQ A;  4D8K A;  5FRM A;  5A0L A;  2EBP A;  4C8Q A;  1VYT A;  4KUI A;  2DXB A;  1QP3 A;  2XIC A;  3EG2 A;  3CME Q;  2EYQ A;  2MCN A;  3OYE A;  4BY6 C;  2DPP B;  3GOX A;  3CCR Q;  4J7I A;  1D0Z A;  2KY9 A;  1OPL A;  3TCJ A;  3CCS A;  2V8I A;  4FT2 A;  5GAO l;  3V8K A;  2AK5 A;  2COY A;  2QTX A;  2QQ9 A;  3N5B B;  3JAM E;  1I4K 1;  2VAS A;  6AT1 B;  5FU7 C;  3V7S A;  3OS2 A;  3G6E Q;  4C8Q E;  1LVK A;  4QQG A;  4EPC A;  1H3Z A;  2DL8 A;  1WDX A;  2E6N A;  2VXE A;  4N4H A;  1Q7Y R;  4C5G A;  1M2O A;  2JM9 A;  1Q82 U;  1BI2 A;  1AEY A;  2KRN A;  4LDW A;  2QAS A;  3JCM g;  3PGG A;  4HCC A;  4A54 A;  3CCV Q;  2RMO A;  4DOV A;  2OTL A;  3NTH A;  2RNA A;  4PJN A;  1D1B A;  4MML A;  5EG2 A;  1P92 A;  1LCK A;  4XTV A;  1I5O B;  1NEG A;  5FU6 B;  4E2F B;  3PIO A;  4DBQ A;  1OYX A;  1EFN A;  2XU8 A;  1X01 A;  3X26 B;  3G1J A;  4JPB W;  3CCE Q;  3H41 A;  1KC8 C;  4HVW A;  2MOX A;  3TSZ A;  2LX9 A;  2E12 A;  3CD6 Q;  1AOJ A;  2P0P A;  3M0Q A;  4EMK B;  1K73 R;  2KYB A;  2W10 A;  2JS0 A;  1M5Q 1;  1OI1 A;  1X2Q A;  2P84 A;  4HCZ A;  1GBQ A;  2C06 A;  4IUT A;  4O6J A;  1TG0 A;  2KNB B;  4OMQ A;  3G7Z A;  1VQP T;  4RTT A;  1KJW A;  3KFV A;  4XTY A;  4N0A A;  1D0Y A;  4HA8 A;  4A4F A;  1V1C A;  3LH0 A;  5IXB A;  4C8Q B;  2A3L A;  3A8G B;  3QYG B;  2DKG A;  1TTH B;  3CBO A;  4LUE A;  4M75 D;  4IUV A;  1Y7X A;  4M75 G;  1JO8 A;  2HKQ B;  4Y91 A;  4M77 C;  1VQ7 A;  2DK3 A;  1PSE A;  3CC2 Q;  3JCM c;  2EQM A;  3ER0 A;  2CS7 A;  2LC4 A;  2ZPE B;  2F5K A;  4J9C A;  5D6Y A;  2LQN A;  1K9M U;  4C0F A;  3OMG A;  2X4Y A;  2RHI A;  1M2V A;  4M7A E;  3H9N A;  2DVE A;  5LJ3 d;  1IGQ A;  2L3Q A;  5KCH A;  2P4R A;  2DE0 X;  1UGP B;  5GMK j;  1W70 A;  3BDL A;  2LDM A;  3TRE A;  3RDV A;  2EGA A;  1DJ7 B;  1YJW T;  3M4G A;  5HK3 A;  3M58 A;  1VQL T;  3TSW A;  4LDX A;  1VQ8 Q;  3I35 A;  2DET A;  1OU9 A;  3PNW C;  3JV3 A;  1QVF S;  1Q81 C;  1NLP C;  1WJR A;  1VQ5 Q;  2Y4Y A;  1M3C A;  2KRO A;  3LH5 A;  4AFS C;  4DBF A;  2QA4 T;  1XTD A;  3R6N A;  2EJF A;  5CK9 A;  3EGD A;  1RAG B;  4J6X A;  3UDC A;  1ZSZ A;  3LGF A;  2DJZ A;  4XQ3 A;  4L5G A;  1NM7 A;  2QG9 B;  5D6W A;  2JTM A;  2VUB A;  1OEB A;  1YJN Q;  4M7D F;  1KQ2 A;  1XQH A;  1MGQ A;  3L2V A;  3OSV A;  4N4G A;  1UTI A;  2AHJ B;  1D1A A;  1WHM A;  1IRE B;  2DXT A;  2ENM A;  2CZ1 B;  4CC3 A;  2RB6 A;  4EDU A;  3A5Z B;  2VXF A;  2E3I A;  3A8H B;  2RI5 A;  4M75 A;  4XAX B;  1QCF A;  2DAQ A;  2L89 A;  2FL7 A;  3CCM A;  1PSF A;  3MEW A;  5KCO A;  3L2W A;  3M54 A;  4M4Z A;  1VQ4 A;  2L3P A;  1NE8 A;  4LN2 A;  2DEU A;  2YHT A;  3LW5 E;  2RJC A;  3U23 A;  1S72 A;  4J9B A;  4RTZ A;  2LRQ A;  2OTL Q;  2XID A;  4KT0 E;  3O5Z A;  3OYL A;  2HDA A;  3RR6 A;  5GAN f;  5HY6 A;  3WVD B;  1K8A C;  2MWO A;  2QQB A;  4J6W A;  3S3N A;  3M0P A;  2HSP A;  3QG1 A;  3ZFJ A;  1M2V B;  4X9C A;  5LJ3 j;  2BKD N;  2ATC B;  3RES A;  4Q5W A;  3EGX B;  2DL3 A;  4QQ6 A;  3INZ A;  3CCM T;  1QKX A;  4BI4 A;  1J3T A;  1ZA1 B;  1YWO A;  2KI7 A;  2QEX A;  1WA7 A;  3HFN A;  3DB3 A;  1PNJ A;  4JS4 A;  3QSU A;  3QJ6 A;  2CP2 A;  5GAN d;  1YNZ A;  1TH7 A;  2DIG A;  1TUG B;  3EGD B;  2IG0 A;  4RCB A;  1ZX6 A;  2E70 A;  1VQ9 Q;  1ZSZ B;  5EC7 A;  1YIT Q;  1KD1 C;  3HPW A;  3M4Y A;  2O88 A;  2LCS A;  3PE0 A;  2FZK B;  4ZTJ A;  4ZGD B;  1N8R R;  4R0K A;  3LWI A;  3QBY A;  1YJ9 T;  3QYH B;  3LX7 A;  2QQS A;  2YWW A;  1NJI R;  2YRD A;  1VQ7 Q;  1RI0 A;  1M8M A;  3OW2 S;  4DOW A;  2PU9 B;  2LQ8 A;  1VIF A;  1WHH A;  1QKW A;  2QXF A;  3FDR A;  5CO7 A;  4CRI A;  2DL5 A;  2HNI A;  1AWJ A;  3VS6 A;  3CCJ A;  3RNJ A;  4M75 B;  2XKO C;  3EAE A;  1VUB A;  2DX1 A;  4MDW A;  3LYI A;  2RI3 A;  2LNV A;  2KT1 A;  5FRO A;  3SDZ A;  5KYU A;  1PRL C;  2D9T A;  4JRP A;  2HEQ A;  3J81 E;  3A8L B;  4AFU C;  1SHG A;  3H0F A;  3CCL A;  2A0F B;  2YLC A;  1SRM A;  1K0S A;  1BI3 A;  1Z9Q A;  3SWN A;  4FL6 A;  1KQS A;  5CIU A;  4DEX A;  1I8F A;  3HTR A;  2K79 A;  1HSQ A;  3M0R A;  5GMK e;  4OB3 B;  3URG A;  3BE3 A;  3VV0 A;  4BE1 A;  4RKU E;  1U8R A;  1AT1 B;  5KYX A;  2O9V A;  3X24 B;  1RLQ C;  5CVI A;  3CME A;  4PJO F;  1N27 A;  2CDT A;  1W2B P;  5HK0 A;  4JZ3 A;  2DTH A;  3RKW A;  2QTV A;  1X6B A;  4M7D E;  3CCR A;  2EVR A;  2ROL A;  2VYT A;  3SB2 A;  4PFP A;  1Q86 C;  2MYS A;  1PHT A;  3HL8 A;  3L2U A;  4CC7 A;  2VC8 A;  5DM7 R;  8AT1 B;  1QQJ A;  1I81 A;  2FHD A;  5HCK A;  3RMS A;  1IHV A;  3FC3 A;  4ESR A;  3CCL T;  1IHW A;  3G6E A;  5GAN h;  1WYX A;  3FRN A;  3M55 A;  1H92 A;  2DL7 A;  1VIE A;  1VQK T;  5KE2 A;  1BCM A;  4LDV A;  3M0U A;  1BK2 A;  2DXC A;  4VUB A;  2RHU A;  3H0H A;  1WQW A;  2MF2 A;  3HHT B;  1UB4 A;  2CUD A;  3CCV A;  1KIK A;  2B86 A;  1VQ4 Q;  3CME T;  1QLY A;  2RJD A;  5J26 A;  3OB9 A;  3HRU A;  5J3B A;  2HQE A;  2RI2 A;  1S72 Q;  3CCR T;  1QCN A;  1GFC A;  4PL6 A;  3VYG A;  2LQK A;  2YUQ A;  1UGS B;  3VS2 A;  4J9F A;  2DXU A;  3VS4 A;  3CCE A;  3JB9 D;  1VQM Q;  3JB9 G;  2M0O A;  2JTE A;  4OML A;  4M78 F;  4FM4 B;  4E7Z A;  5KYN A;  4GLK A;  3G6E T;  4OMP A;  2GF7 A;  5GAM g;  3CD6 A;  1YHQ Q;  5KYU B;  2FEI A;  3UWN A;  3OS0 A;  3QDR B;  3GNF B;  1X6O A;  3CCV T;  2WSE E;  1RAE B;  5LJ3 e;  3UA7 A;  2CP3 A;  2LNH B;  4EMG A;  4FCY A;  4X9D A;  2QEX Q;  4KH1 B;  3OS5 A;  1WX6 A;  4PNO A;  1T0H A;  2AZS A;  5CKD A;  5KYX B;  2DFU A;  4ZGJ B;  5GAO m;  1UEC A;  2AT1 B;  3DB4 A;  3QUI A;  5CKB A;  2ZPG B;  3CCE T;  1LNX A;  3EHR A;  4M78 D;  1JJ2 A;  4MZT A;  2ECZ A;  1B7T A;  5KYY A;  5CAI A;  1K9A A;  1B07 A;  2DJQ A;  3OSS C;  4J9E A;  3LLR A;  3CD6 T;  3WVE B;  3CC2 A;  4O5V A;  3I9Q A;  1D1C A;  2E64 A;  4LDU A;  1Q7Y C;  1BIA A;  4R55 A;  4A63 B;  1RAA B;  2RH2 A;  3MP8 A;  3NTK A;  2D8J A;  4NOY A;  2RHY A;  1Y71 A;  3TEE A;  1Y07 A;  1I07 A;  1GCQ C;  4PJO A;  1I5L A;  3JCM b;  2J6F A;  4L59 A;  1M90 R;  3RIR A;  2A7Y A;  2LT4 A;  2HQH A;  4J5Y A;  2E3H A;  1VQO Q;  4HT9 A;  2PNI A;  1FYN A;  2K3Y A;  4IIM A;  2L3R A;  4JJC A;  4XU0 A;  2O01 E;  2CP0 A;  4IUQ A;  3OYA A;  4C0D C;  1VQ5 A;  4IIO A;  1K73 C;  3CC2 T;  1KK7 A;  2ZPF B;  4PJO E;  3MEA A;  1Y96 A;  1VQN T;  3SEM A;  3JCM J;  3QWX X;  4PFO A;  4OGE A;  2PVG B;  2EQK A;  2RHZ A;  2CSQ A;  3KBG A;  2K6D A;  3NGP A;  3FJ5 A;  3OYK A;  3UPU A;  1YJN A;  2ZCF B;  1PD0 A;  1NYG A;  2ESW A;  4JJN K;  2X35 A;  1WJQ A;  4M7A D;  2RN8 A;  2ZGW A;  4M7A G;  4BDZ A;  1EX4 A;  1G5V A;  4M78 A;  1VQ8 T;  1ZSG A;  2HBP A;  5FWB A;  3OYH A;  4C0G A;  2HQX A;  5DLQ E;  2QAZ A;  1KC8 U;  1KQS S;  1VQ5 T;  1IO6 A;  5AYF A;  1YCY A;  1E7O A;  1M9S A;  5KH6 A;  3A1P A;  5GAN 2;  4JRQ A;  2JUF A;  1UGQ B;  5KYY B;  3THK A;  3NHN A;  2EKO A;  4BUG A;  5GAN e;  4J9H A;  3SFM A;  1R77 A;  4ORZ A;  3OA6 A;  1MHN A;  2NUP A;  4ATO A;  3QDF A;  2FZC B;  1SKU B;  4M78 E;  2XDD A;  1YJN T;  3M53 A;  1CSK A;  3Q1J A;  3EG1 A;  2E65 A;  3CCS T;  1M1K R;  3ASK A;  3G71 A;  5LJ5 g;  2FZG B;  3S6W A;  5GAM d;  2D1X A;  3V8L A;  5I2S A;  3MEV A;  4RUG A;  1CKA A;  4HT8 A;  2RD1 A;  1BU1 A;  1NZ9 A;  3GF5 A;  1AWO A;  2F1L A;  2K5I A;  1R0B G;  3I56 Q;  1HK9 A;  1SPK A;  1TSF A;  1SHF A;  1RAC B;  4WF2 A;  2DIL A;  2E6Z A;  5FWC A;  2OTL T;  1OUL A;  2EKH A;  1GL5 A;  1Y96 B;  1HD3 A;  1UJY A;  1Z9Z A;  4AMC A;  3CBP A;  5GAO p;  1VQ9 A;  2DIQ A;  4JJD A;  1YIT A;  5LJ3 f;  5CCA A;  4XU1 A;  5A2Q E;  4F7U F;  4OB1 B;  3QZ9 B;  4IKF A;  1PWT A;  3DLM A;  2FPE A;  3E1S A;  1PKS A;  4M7A A;  2C0I A;  2K3B A;  3HP9 A;  2E10 A;  2OX7 A;  4RTY A;  1ABO A;  3NFC A;  3MKD A;  2OAW A;  3CCU A;  5FU6 C;  2W0Z A;  4Z02 A;  2Z0W A;  1UGR B;  4NL2 A;  3EFR A;  1Q81 U;  2PVD B;  4M78 B;  3ZL7 C;  1X75 C;  1IRX A;  2COW A;  2KYM A;  2VVK A;  4A4K A;  4DBH A;  3PFS A;  3CXC S;  3L1A A;  2E1H A;  4GY5 A;  3OYC A;  4EMK C;  1QWE A;  2XDB A;  3FIF A;  2BIV A;  5GMK h;  1YIT T;  1UJ0 A;  2M16 A;  3R6O A;  1FXX A;  1WHJ A;  2NUP B;  1JJ2 S;  1VYV A;  1T0J A;  2IIM A;  2QGG A;  1I0C A;  3HKS A;  1RI9 A;  1BB9 A;  2KXC A;  1SG5 A;  4EMH A;  1VQ7 T;  3CPW S;  2PZ1 A;  2JZ2 A;  4C8Q C;  2ABL A;  4XTX A;  2QQA A;  3OQ5 A;  3E9F A;  1SF9 A;  4ELY C;  5GAM j;  1QVG S;  3OYB A;  4QQD A;  2L2P A;  3L2Q A;  1KQ1 A;  5FW9 A;  4C5H A;  3A98 A;  5CQX A;  3TU4 K;  4RTW A;  1Q82 R;  2DF6 A;  2JS2 A;  2HBW A;  1B34 A;  2BUD A;  2GCX A;  1K8A U;  4C92 F;  1LPL A;  1T3L A;  1N8R C;  2CKK A;  2JM8 A;  3CC7 Q;  1WXB A;  5GMK i;  3CEY A;  1TOV A;  1NJI C;  4C5I A;  2DER A;  1TUD A;  4NL3 A;  2OTJ Q;  4J9I A;  1YBY A;  3FEO A;  2EJG A;  2KVQ G;  5CKF A;  5L8R E;  4M7A B;  1D09 B;  1WLP B;  1ZUY A;  3JCM d;  3M59 A;  3GPL A;  2X4W A;  3J80 E;  2RQV A;  5GJV B;  4GLM A;  3MHX A;  3A8O B;  3DLL A;  1BCO A;  2X9H A;  5I2M A;  2C0O A;  1IGU A;  4C0Z A;  1VQM A;  2RK1 A;  3SD4 A;  4M7D D;  4M7D G;  3GLX A;  2CZ0 B;  1RL2 A;  4RCC A;  4ELZ C;  5LJ5 d;  3RMQ A;  2ZPH B;  1M30 A;  3O8V A;  4F7U A;  1YHQ A;  4C92 D;  3G71 Q;  5LJ3 h;  1KD1 U;  1BI1 A;  3V8J A;  1JB0 E;  2EYX A;  2EYY A;  1OU8 A;  2B8A A;  2CZ7 B;  2A36 A;  3EH2 A;  1VQ4 T;  1D3B A;  3EGU A;  2YUP A;  1MV0 B;  2M0Y A;  2FRY A;  4N0A C;  2LT1 A;  3OYY A;  1QP2 A;  4A53 A;  1S72 T;  1WPY A;  4IUP A;  1ZBJ A;  1GBR A;  2DMO A;  1GRI A;  4F7U E;  2JNG A;  1YFN A;  2ZPI B;  3VYH B;  3QXE B;  3VRZ A;  1VQM T;  4X1V A;  1JEG A;  3WXM B;  1N9S A; 
#chains in the Genus database with same CATH homology
 4PKC C;  4TVR A;  3QHS A;  2LQK A;  3OYE A;  3RUX A;  4BY6 C;  5IT9 E;  1N9R A;  1UGS B;  2DPP B;  3GOX A;  3X25 B;  2DXU A;  4E7J A;  4J7I A;  3CCE A;  3JB9 D;  2KY9 A;  3TCJ A;  3JB9 G;  2M0O A;  3JB9 H;  3CCS A;  2DTO A;  4M78 F;  2EWN A;  4FM4 B;  1N8R U;  2V8I A;  3P8B B;  4FT2 A;  3CCU T;  4PLL A;  4OB2 B;  4GLK A;  5GAO l;  3G6E T;  3V8K A;  1R8O B;  2GF7 A;  1NJI U;  5GAM g;  3CD6 A;  2QTX A;  1W2B S;  2QQ9 A;  5GAM h;  3N5B B;  3JAM E;  2X4X A;  1I4K 1;  2EQJ A;  2Y4X A;  3UWN A;  1V29 B;  5FU7 C;  3V7S A;  3OS0 A;  3OS2 A;  3QDR B;  1B34 B;  4C8Q E;  3T9N A;  3GNF B;  4QQG A;  1X6O A;  4EPC A;  1VQ6 T;  3I55 A;  5GMK l;  3MET A;  3JCM f;  1H3Z A;  2XDP A;  1U1T A;  2QEX T;  2E6N A;  2LCC A;  2VXE A;  4N4H A;  3CCV T;  1YIJ T;  2DD5 A;  2WSE E;  4FU6 A;  5LJ3 e;  3MP6 A;  2KDS A;  3BFM A;  4C5G A;  2RO0 A;  2MI6 A;  3FB9 A;  4DQ2 A;  4EMG A;  1BI2 A;  1Q82 U;  4LDW A;  2JTF A;  4X9D A;  3JCM g;  3PGG A;  3BDU A;  3OS5 A;  3OYI A;  4HCC A;  4A54 A;  4XTW A;  1VQO A;  4M78 C;  4UC4 A;  5HKC A;  4PNO A;  3JCM h;  3PMT A;  4BD3 A;  4DOV A;  3KUF A;  1K9M C;  5CKD A;  2OTL A;  3J7A F;  3CC4 T;  3NTH A;  4ZGJ B;  4LD6 A;  4MML A;  5GAO m;  1Q86 U;  3JCM W;  5EG2 A;  1P92 A;  5LJ5 f;  3DB4 A;  3QUI A;  4M7D A;  5CKB A;  2K5L A;  4XTV A;  3V7R A;  2ZPG B;  1FWZ A;  3CCE T;  1LNX A;  5FU6 B;  4M78 D;  1JJ2 A;  1M8V A;  3CPF A;  4MZT A;  3PIO A;  1OYX A;  5CAI A;  3OSS C;  2XU8 A;  4C92 A;  1G3T A;  1X01 A;  1OZ3 A;  3F70 A;  3X26 B;  2RJE A;  3LLR A;  5GMK m;  2E41 A;  3CD6 T;  3WVE B;  2K5F A;  3CC2 A;  4O5V A;  1KC8 C;  5LJ5 j;  2F69 A;  2D6F A;  2E64 A;  2LX9 A;  4LDU A;  3V7C A;  1Q7Y C;  1BIA A;  2E12 A;  4R55 A;  4BDY A;  3S3M A;  1JRI A;  4FIB A;  5C6S A;  1O9S A;  3PTA A;  1NPR A;  2P0P A;  4BE0 A;  2RH2 A;  3MP8 A;  4EMK B;  3NTK A;  3I55 T;  5A0G A;  1AHJ B;  1M5Q 1;  1OI1 A;  4NOY A;  3CCJ T;  2QDY B;  3VUZ A;  2RHY A;  1Y71 A;  3TEE A;  1Y07 A;  4HCZ A;  2E5Q A;  3BW1 A;  1KHC A;  2KQW A;  4FSX A;  2C06 A;  4KUD K;  4IUT A;  4O6J A;  4PJO A;  1WQ7 A;  2V8K A;  1I5L A;  2CGH A;  4KBM B;  4M77 F;  3JCM b;  3G7Z A;  1VQP T;  1D3B B;  4L59 A;  4C92 E;  2K4Y A;  3RIR A;  1EIF A;  2A7Y A;  2LT4 A;  4XTY A;  4JRK A;  3OYG A;  3LWH A;  4N0A A;  2KMT A;  4J5Y A;  4C92 G;  2L8D A;  4HA8 A;  4A4F A;  3VU3 C;  2H3J A;  2PVO B;  2ZPB B;  3RKX A;  2XI9 A;  4M75 C;  5GAN 3;  4HT9 A;  3LH0 A;  2K3Y A;  4C8Q B;  2A3L A;  3L2Z A;  3A8G B;  2JN0 A;  2L3R A;  3AHU A;  3QYG B;  4XU0 A;  2DKG A;  2O01 E;  4PLI A;  3CBO A;  4M75 E;  5GAN 5;  4IUQ A;  3OYA A;  4C0D C;  3OYF A;  5IAY A;  2O4X A;  1VQ5 A;  4M75 D;  1XOV A;  3CC2 T;  1K73 C;  4IUV A;  3MO8 A;  1Y7X A;  4M75 G;  2ZPF B;  3ME9 A;  4PJO E;  1OZ2 A;  3MEA A;  1Y96 A;  4Y91 A;  1VQN T;  2V8J A;  4M77 C;  1VQ7 A;  1BI0 A;  4PJO D;  3JCM Q;  2DK3 A;  1PSE A;  1YJ9 A;  4PJO G;  3E19 A;  3P8D A;  4J8O A;  3JCM c;  2EQM A;  1UEB A;  3JCM J;  2F5T X;  2ZZD A;  4II1 A;  2WAC A;  3ER0 A;  2GFU A;  4OB0 B;  2CS7 A;  2LC4 A;  2ZPE B;  1M90 C;  4OGE A;  4M77 D;  3JCM X;  2F5K A;  2PVG B;  2L5Q A;  2EQK A;  2RHZ A;  4OF1 A;  5D6Y A;  4M77 G;  5M9O A;  3L42 A;  4BE2 A;  3KBG A;  4M7A C;  1K9M U;  4ZTF A;  4C0F A;  3OMG A;  1O75 A;  2OAU A;  3OYK A;  3UPU A;  1YJN A;  2WSC E;  2ZCF B;  2X4Y A;  2RHI A;  1YHQ T;  3CMA A;  5D6X A;  3MCA B;  4M7A E;  4JJN K;  2DVE A;  5LJ3 d;  3JCM V;  2X35 A;  2XD0 A;  1WJQ A;  3A8M B;  5KCH A;  4M7A D;  2EJ9 A;  2ZGW A;  4MMK A;  4M7A G;  4BDZ A;  3CCQ A;  1UGP B;  1G3W A;  5GMK j;  1G5V A;  1WJS A;  4JS5 A;  4M78 A;  3BDL A;  1VQ8 T;  4OMF B;  4A4H A;  2HBP A;  2LDM A;  3TRE A;  2G3R A;  3OYH A;  2EAY A;  4C0G A;  3I56 A;  2HQX A;  1DJ7 B;  2RJF A;  5DLQ E;  2HAX A;  2VV5 A;  1YJW T;  3M4G A;  5HK3 A;  2QQR A;  3M58 A;  1KC8 U;  1KQS S;  1VQ5 T;  1VQL T;  4LDX A;  4M7D B;  5AYF A;  1BYM A;  3QO3 A;  3CBM A;  2P0Q A;  3FJP A;  1Q7Y U;  3JB9 J;  1YCY A;  5KH6 A;  1G3S A;  1M9S A;  5GAN 2;  4JRQ A;  3PNW C;  2JUF A;  1QVF S;  1Q81 C;  3SWN B;  1UGQ B;  1WJR A;  2EKO A;  4C92 B;  4BUG A;  1M4Z A;  5GAN e;  2DD4 A;  2Y4Y A;  4BI8 B;  3SFM A;  2LTO A;  2QA4 T;  3OBW A;  1XTD A;  1MHN A;  3PT9 A;  2FB7 A;  2EJF A;  3OA6 A;  5CK9 A;  4BE1 A;  4ATO A;  4E47 A;  2MWP A;  4J6X A;  4D6W A;  3UDC A;  2DTI A;  4JLI A;  4J6Y A;  1U1S A;  4M78 E;  2K2V A;  2XDD A;  3ZBD A;  3LGF A;  1YJN T;  1QVP A;  3M53 A;  3GP8 A;  2DJZ A;  4XQ3 A;  3Q1J A;  1M1K U;  2E65 A;  4L5G A;  4M78 G;  3CCS T;  5D6W A;  2JTM A;  1BKB A;  3ASK A;  2I2L A;  2VUB A;  3G71 A;  5LJ5 g;  4XK8 E;  3OYD A;  1LOJ A;  4M7D F;  1KQ2 A;  1XQH A;  1MGQ A;  5LJ5 h;  3L2V A;  3X20 B;  3OSV A;  3RER A;  3S6W A;  4N4G A;  2AHJ B;  2PUO B;  5GAM d;  3RKY A;  2MMP A;  1KHI A;  1IRE B;  2DXT A;  2KSS A;  3V8L A;  4OP0 A;  4F7U B;  5I2S A;  3MEV A;  2CZ1 B;  3PIP A;  4MZP A;  3OS1 A;  3I56 T;  1W2B A;  1KG1 A;  1K73 U;  4JLG A;  2RB6 A;  4KUL A;  3A5Z B;  2VXF A;  4EDU A;  4OGC A;  2RD1 A;  4HT8 A;  5A0D A;  1NZ9 A;  4QVZ A;  3A8H B;  2RI5 A;  4M75 A;  4XAX B;  3GF5 A;  4OVA A;  4E7K A;  2YRV A;  4BAC A;  2K5I A;  4XTZ A;  3NTI A;  2DAQ A;  2L89 A;  5GAN 6;  3S3O A;  2FL7 A;  1VQK A;  3CCM A;  1PSF A;  3MEW A;  5KCO A;  3L2W A;  3G4S A;  3M54 A;  1HK9 A;  1VQ4 A;  1NE8 A;  1QVF A;  2O4X B;  4WF2 A;  5GAM e;  5FLX E;  1VQO T;  4BY6 B;  2E6Z A;  1M90 U;  4J7F A;  4ZN3 A;  2YHT A;  2OTL T;  4BB7 A;  3H6Z A;  2YLB A;  3LW5 E;  3JB9 I;  2RJC A;  1S72 A;  1Y96 B;  2EIF A;  1M1K C;  4M77 A;  2EQU A;  2Y90 A;  5I21 A;  3QZ5 B;  4QVD A;  2LRQ A;  3GNG A;  4HKE A;  1U8R A;  3CBP A;  3SWN C;  4A4E A;  2XID A;  5GAO p;  2M1H A;  4KT0 E;  1VQ9 A;  2DIQ A;  1YIT A;  2XK0 A;  5LJ3 f;  2FYK A;  4RG2 A;  4XU1 A;  3JSC A;  5CCA A;  5A2Q E;  3OYL A;  5CKH A;  4HCB A;  4F7U F;  4OB1 B;  3QZ9 B;  4QW2 A;  4JUV A;  4IKF A;  5GAN f;  5HY6 A;  3DLM A;  3WVD B;  5FU7 B;  1ZQ1 A;  1K8A C;  3H8Z A;  4ZGE B;  2XG8 D;  2MWO A;  3E1S A;  2LVM A;  2QQB A;  3JCM e;  4RMO A;  4M7A A;  3HP9 A;  2E10 A;  4J6W A;  3S3N A;  4R56 A;  1QW1 A;  3JB9 F;  4B9X A;  3NFC A;  3QG1 A;  2CZ6 B;  3ZFJ A;  3UT1 A;  4X9C A;  3HRS A;  3CCU A;  4X34 A;  4ZN1 A;  3QKJ A;  2BKD N;  4CI0 C;  5LJ3 j;  5FU6 C;  5KE3 A;  4Z02 A;  1IZ6 A;  2FVU A;  5GAN j;  1UGR B;  2RHX A;  3EFR A;  4NL2 A;  3RES A;  4Q5W A;  4M77 E;  2PVD B;  3KXT A;  2P0K A;  1Q81 U;  4QQ6 A;  3INZ A;  4M78 B;  4MDX A;  3CCM T;  1X75 C;  3G4S T;  1YI2 A;  2M9U A;  4BI4 A;  4DA4 A;  5LJ5 e;  3BY7 A;  4V2S A;  4L6V 5;  2VGM A;  4A4K A;  2QEX A;  4C8Q F;  1NPP A;  2JOY A;  3PFS A;  3JCM P;  3CXC S;  3HFN A;  2DEQ A;  3L1A A;  2LCL A;  2E1H A;  2RK2 A;  3C94 A;  4GY5 A;  4LDY A;  4EMK C;  3OYC A;  4LD9 K;  3DB3 A;  4JS4 A;  3QSU A;  2GQV A;  3QJ6 A;  2XDB A;  3FIF A;  2BIV A;  5FRN A;  5GMK h;  5GAN d;  2R5M A;  3CC7 A;  3OYJ A;  1YIT T;  1TH7 A;  3VUB A;  2M16 A;  2DIG A;  2EFI A;  3R6O A;  1FXX A;  4E7H A;  1JJ2 S;  1W4S A;  1FX7 A;  2IG0 A;  4RCB A;  4RG8 A;  2D0Q B;  5DY9 A;  2E70 A;  2OTJ A;  5GAM f;  1H64 1;  3DKM A;  1KD1 C;  3HPW A;  3HKS A;  3M4Y A;  3M56 A;  4ZTJ A;  1M1F A;  3QII A;  4N4I A;  4EMH A;  4A4G A;  2GFA A;  4ZGD B;  3CPW S;  4NS5 A;  3QJY A;  3LWI A;  3QBY A;  1VQ7 T;  1YJ9 T;  2JZ2 A;  3QYH B;  4C8Q C;  3LX7 A;  2QQS A;  4XTX A;  2QQA A;  4QVC A;  3OYM A;  3OQ5 A;  3E9F A;  1RI0 A;  4ELY C;  3OW2 S;  5GAM j;  4DOW A;  2PU9 B;  1QVG S;  4IUR A;  1JBM A;  1WNL A;  2LQ8 A;  1YI2 T;  2WSF E;  1VIF A;  1N6A A;  3OY9 A;  3OYB A;  4C8Q D;  2DO3 A;  4QQD A;  4CRI A;  2QXF A;  3FDR A;  5CO7 A;  2QI2 A;  4C8Q G;  2HNI A;  3CCJ A;  5GAO r;  4M75 B;  3L2Q A;  1KQ1 A;  2XKO C;  3CMA T;  3EAE A;  1VUB A;  4C5H A;  4MDW A;  5CQX A;  3TU4 K;  3MP1 A;  5CR2 A;  3LYI A;  3M5A A;  2RI3 A;  4Y28 E;  5IN1 A;  5LL6 S;  3CXC A;  4PJO B;  2LNV A;  5FRO A;  3SDZ A;  1VQP A;  3CC7 T;  2DZ9 A;  4C0D B;  4JRP A;  2D9T A;  3CCQ T;  4IUU A;  3HSB A;  3J81 E;  5GAN 4;  1B34 A;  4J83 A;  2BUD A;  2GCX A;  1K8A U;  2RA2 A;  3A8L B;  2RM4 A;  4C92 F;  2OTJ T;  1N8R C;  3CCL A;  2CKK A;  4M77 B;  3M9Q A;  5GMK i;  2YLC A;  3CEY A;  3GIB A;  3M57 A;  2KAF A;  3VJP A;  5GAO n;  1BI3 A;  1NJI C;  4C5I A;  3SWN A;  4JRI A;  2XHC A;  3C12 A;  4FL6 A;  4NL3 A;  1KQS A;  4FT4 A;  5CIU A;  4P5N A;  2DZC A;  1I8F A;  2X4J A;  5GMK e;  1YBY A;  4OB3 B;  3FEO A;  2R57 A;  3URG A;  2EJG A;  3VV0 A;  3CPW A;  2KVQ G;  5CKF A;  1BIB A;  1LJO A;  4M75 F;  4RKU E;  4YTL A;  5L8R E;  2K57 A;  4M7A B;  5CQY A;  1HXD A;  5DLO A;  3M59 A;  3JCM d;  1VQN A;  3X24 B;  3JRZ A;  3GPL A;  2X4W A;  4M7D C;  3J80 E;  4E7I A;  5CVI A;  3CME A;  4PJO F;  3C4S A;  1N27 A;  3A8O B;  3MHX A;  3DLL A;  3OW2 A;  2MAM A;  5I2M A;  5HK0 A;  1QVG A;  2DTH A;  4XTU A;  1Q82 C;  3RKW A;  4E7L A;  4MZM A;  4M7D E;  5CKE A;  4C92 C;  3MEU A;  3CCR A;  3P8H A;  3PMI A;  4C0Z A;  1VQM A;  2NLU A;  2RK1 A;  3OMC A;  2VYT A;  3SD4 A;  4M7D D;  3G71 T;  3FLG A;  4M7D G;  3SB2 A;  1Q86 C;  3GLX A;  2CZ0 B;  1RL2 A;  3HL8 A;  4RCC A;  3L2U A;  2PUK B;  1WGS A;  1SSF A;  2VC8 A;  4ELZ C;  5LJ5 d;  3RMQ A;  5DM7 R;  2ZPH B;  1XNI A;  1I81 A;  2R58 A;  3O8V A;  3X28 B;  2FHD A;  4F7U A;  5LJ3 g;  3HFO A;  2K3X A;  1ZBX A;  3RMS A;  4C92 D;  1YHQ A;  2VGN A;  5LJ3 h;  5C0M A;  3FC3 A;  5GAN g;  2R5A A;  4EMK A;  3CCL T;  1KD1 U;  3G6E A;  1BI1 A;  5GAN h;  3FRN A;  3LGL A;  3OBY A;  3V8J A;  5J39 A;  1JB0 E;  2P4T A;  4M7A F;  3OYN A;  3M55 A;  3EFS A;  4C5E A;  1VQ8 A;  4BI3 A;  2B8A A;  1ZHI A;  4PJO C;  1VIE A;  1VQK T;  2CZ7 B;  3C95 A;  5KE2 A;  4XU2 A;  2CYZ B;  2JVV A;  1YJW A;  4LDV A;  4JDS A;  1VQL A;  1VQ4 T;  4ME7 A;  1D3B A;  1VQ6 A;  3QPH A;  2DXC A;  4VUB A;  3ZEH A;  4B9W A;  2RHU A;  3VKI A;  4XU3 A;  3E9G A;  1M1G A;  1WQW A;  2MF2 A;  1GXI E;  3HHT B;  1UB4 A;  1YIJ A;  1G3Y A;  4N0A C;  2LT1 A;  3OYY A;  1QP2 A;  3HRT A;  2IVW A;  1WPY A;  4A53 A;  3CCV A;  1S72 T;  4IUP A;  3L2R A;  5GAN 8;  3CME T;  2RJD A;  2HD0 A;  5J26 A;  5FRM A;  3OB9 A;  5A0L A;  2PQW A;  4F7U E;  2JNG A;  3HRU A;  5J3B A;  4C8Q A;  5GAN 7;  4KUI A;  2DXB A;  5GAO q;  1VQ9 T;  2HQE A;  2RI2 A;  2ZPI B;  3VYH B;  2QA4 A;  3QXE B;  3CCR T;  1QP3 A;  2XIC A;  4F7U G;  1VQM T;  3CC4 A;  2EYQ A;  3WXM B;  4PL6 A;  2KK4 A;  3VYG A;  1N9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...