2XKOC

Crystal structure of the complex of ntca with its transcriptional co- activator pipx
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
85
Chain Sequence
b'ENYLNHPTFGLLYQICSFGSKELFATLYAQRLFFLVAFDARGTRFEPIGRNEARMLVDNRLRQLRRDASLQEYNQLQQVFKQTFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLOBAL NITROGEN REGULATOR
publication title Structural Basis for the Regulation of Ntca-Dependent Transcription by Proteins Pipx and Pii.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Transcription
total genus 18
structure length 85
sequence length 86
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12058 DUF3539 Protein of unknown function (DUF3539)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.660 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xkoC01
3N5BB 2XG8D 2XKOC
chains in the Genus database with same CATH superfamily
5FLXE 1IGUA 2OTJT 2J7IA 4ELYC 2HQHA 2A37A 3HPWA 2DXCA 2F5TX 2GCXA 4C92C 1NG2A 1WJQA 3KUFA 2VC8A 1U06A 4II1A 3CCJT 2ZPEB 4C0GA 1YWPA 2E3IA 2V8KA 2MCNA 1QKXA 4C8QG 4PNOA 3H0HA 1Q7YR 1JRIA 4XTVA 5GAN4 1VQ6A 3G4SA 2YXYA 1LVKA 1M2VA 4DQ2A 4JJBA 1G3WA 1RAHB 2DZCA 5GMKl 1VIFA 4J7IA 4EDUA 4AFUC 3I55A 1CKBA 1UB4A 3TU4K 3L2RA 3MP6A 2DIGA 3CCEQ 4DEYA 1VQPQ 3HSBA 2DVEA 4A54A 3FLGA 1K73R 3OYKA 3E1SA 4C92F 1KD1C 1WFWA 3C94A 5LJ3g 2QTXA 1SKUB 3NHNA 5LJ3d 4F04B 5KYWB 5HCKA 1SF9A 3PNWC 3G71T 3VRYA 4JS4A 2K3BA 1K9MU 2DEQA 5C0MA 4M7AD 3CMAQ 4M78G 2Y4YA 2EQMA 3VKIA 3G1JA 2PQWA 1X2QA 3LWIA 5GAN3 2DRKA 5CK9A 1PCXA 3CPWS 2YT6A 1BB9A 2M9UA 1OZ2A 3CC7T 3QPHA 4DBHA 2KQWA 2JTEA 3M0PA 5CQXA 2COYA 2RI2A 3J81E 2FG0A 1S1NA 2QTVA 1AEYA 3GLXA 3MHXA 5CQYA 5GAN7 1K4US 4JZ3A 3JB9I 2JJ9A 4OB3B 4A4FA 1VQ8T 1OX8A 2OTJA 3SFMA 3MEAA 4LE9A 1K9MR 3JCMd 1I5OB 4OGCA 1V1CA 4M7AB 2NUZA 2XK0A 3CCVT 1OU9A 2DXUA 1I81A 3QBYA 2DD5A 3OB9A 4M75F 4AFQC 1Q7YC 4M7AE 8ATCB 1QKWA 4MDXA 3PMIA 2RK2A 3V8JA 2QASA 2KYMA 3EG3A 3QZ5B 1VQOQ 4GLMA 1IZ6A 1K73C 2G6FX 1D3BB 2DE0X 3QO3A 3REAB 3M0RA 1VYUA 2DK3A 1YITT 2E10A 4A63B 4HA8A 5IHIA 4JZ4A 2P0KA 2CUDA 2LJ1A 1Q82C 1VQLT 1TUCA 1PRLC 5FWCA 4C5HA 1T3SA 3G71A 2KROA 2YLBA 5GAOr 4JJDA 4IUVA 3PT9A 2JMCA 3O5ZA 4L59A 2RH2A 2X3WD 4A4KA 2XICA 4LUEA 3H6ZA 3P8DA 4RKUE 4R55A 3OA6A 1WXUA 2VWFA 4M75G 1W6XA 2BZ8A 1H3ZA 1WQ7A 1UHCA 2KVQG 1OPLA 3R6NA 2RI3A 4Z88A 4NL2A 1ZSZB 2ZCFB 3PIPA 3CC7A 4J5YA 5KCOA 2X4YA 3JSCA 4J6YA 3BW1A 3H0FA 4OMPA 1M1KR 4FW1A 1Y07A 1VQ9T 1B3QA 1PD0A 2KSSA 4FSSA 2LNHB 5CKBA 1MMGA 2MK5A 4K11A 2RHYA 1VQ8A 1OPKA 1K9MC 3M4YA 1BI1A 4QQDA 3EFOB 4LNPA 2SRCA 4E7JA 4M77F 1UHFA 1I8FA 1NE8A 2K6DA 1K0SA 2RJFA 4BDYA 2HBWA 2CZ6B 3OBYA 4F7UF 2VYTA 2ED1A 2KRNA 4J83A 1ZA2B 5LJ3e 4E7HA 1YJNT 3DB4A 2GF7A 1ZUUA 1NM7A 5FU7B 3RERA 4YTLA 2JMAA 2A28A 2FZCB 2Y90A 1P92A 2X9HA 2LNVA 1RI9A 1YN8A 2FPDA 1Y0MA 3V7RA 1MV0B 5KE3A 4PFOA 5FRNA 4QW2A 1Q81U 1XJWB 1K9AA 3CD6Q 3OYBA 5GMKi 3EG1A 1CSKA 4QQ6A 4HVUA 2J6KA 1GCQC 5FWBA 5D6YA 5IN1A 1ZHIA 2PNIA 3R6OA 3CXCS 4F17A 5KYWA 2GQIA 2J6OA 2KMTA 2PZ1A 2QQRA 4JUVA 2XG8D 1BCOA 4M77G 2KT1A 3EH2A 2YDLA 1IHWA 3CCMA 3A8HB 2EGEA 2B86A 3JCMe 4M7DB 3JCMh 2F1LA 4N4IA 5FROA 4F7UG 1UGSB 1MMAA 3SWNC 5GAMh 1ACMB 3C4SA 2E4HA 3LWHA 3IQLA 2IVWA 2QGFB 5LJ3f 1Q81R 2P4RA 3MCAB 2RB6A 2ROLA 4FIBA 2RPNA 2QQBA 3FRNA 2H3EB 3L2QA 1G83A 1VQKT 1NZ9A 1KQSS 2PUOB 4M7DE 4E7SA 4D8DA 1M1KC 3X24B 2LQKA 3SEMA 2FB7A 2FRWA 4FSXA 1X43A 5HK0A 4M7DC 2IG0A 2QA4Q 1NEGA 3UT1A 2EBPA 4CRIA 2QXFA 3FB9A 1D09B 5CVIA 2RI5A 2AKLA 5I2SA 2I0NA 4BD3A 4M7AA 5I11A 1TOVA 2EIFA 3E9GA 4CC3A 2EQIA 1TUGB 4HVVA 1I5LA 1KFZA 4CC2A 4XK8E 1OULA 1X69A 1RAFB 4J8OA 1BIBA 4BI3A 3CCLQ 1KHIA 1YCSB 1YJWQ 1YJNA 1UE9A 3C0CA 1Z9ZA 3MEUA 5KE2A 1QLYA 1VQ7T 4PLLA 2M1HA 1B07A 2DYIA 1N8RU 2DL7A 4BY6C 1Z9QA 2M0OA 1TH7A 1QVFP 2WSCE 4A4HA 3OMGA 2LCSA 1D3BA 3A1PA 3NTKA 3CCQT 3RMQA 3G6EQ 4EMHA 4E7IA 4B9WA 2XDPA 2AKKA 1MHNA 3CBMA 1ARKA 4PJOD 1C6VX 2COWA 2P0QA 3I5RA 1S72Q 2CH4W 2GNCA 4XTXA 3A98A 3VS1A 2YUQA 2JM8A 2E3HA 3OYMA 2OX7A 2X4WA 1KQ1A 4XTUA 1N8RR 4M4ZA 5GANh 4J9IA 5AYFA 3MO8A 1W2BP 1GBRA 2BE7D 2A36A 1D1CA 4ZGEB 1Q81C 2K57A 1NPRA 2KNBB 5FW9A 1U1SA 4J9CA 1BI2A 3MP8A 1ZSZA 3HRSA 3G4ST 4J9BA 2COZA 3MP1A 4B6MA 3EFSA 4C8QC 4AFZC 3SHWA 1GCPA 2DD4A 2LX9A 3I55T 1K0XA 1QQJA 2JS2A 4KRTA 3RKWA 3VJPA 1VQMQ 5GJVB 4C92D 1RADB 4R56A 3EFRA 3QKJA 3GP8A 3ZEHA 3EG9A 3THKA 4C0DB 2EW3A 1EIFA 4UC4A 7AT1B 4C5IA 3OYIA 4KBMB 2CGHA 4LDVA 3PIOA 4RCCA 4PJOE 4RTYA 2VGMA 1YI2T 3MEWA 4JS5A 3VS6A 4ZTJA 3JCMc 2E6NA 4NL3A 1YIJQ 4E6RA 2L89A 1VQ7A 3FJPA 2EQJA 2LDMA 1AWJA 4OB0B 3X26B 2HKQB 1M30A 2J6FA 4GY5A 1WYXA 4M78C 1QP3A 1H8KA 1BI3A 4C92B 2O9VA 4HCZA 4PK4A 3NTHA 1C1AA 1VQPA 1JXMA 1KC8U 4WF2A 1WLPB 5KYXB 3LLRA 3I56T 4RG2A 3EGUA 3O8VA 4XU1A 3VV0A 2L8DA 4XTYA 5DLOA 1OYXA 2DTOA 3SDZA 4C92E 2RHXA 3X20B 3BDUA 5GAMj 2ZZDA 3AHUA 2RMOA 4QVDA 3UATA 1JXOA 4WCIA 4Y91A 1X6OA 4LDYA 1TU0B 3CMAA 3S3OA 1WIEA 1N8RC 2DF6A 4M78F 1UECA 3M56A 1M8VA 4DBRA 3OYEA 1SHFA 2CP0A 3GNFB 3GBQA 1OI1A 1AZGB 2EAYA 1KC8R 5GAN2 2A08A 3META 1M3AA 3I35A 1ZBJA 3OW2P 1BI0A 1KQSA 2VXFA 4LDUA 1E6GA 3X25B 3M59A 1IHVA 1UGRB 1QW1A 1BK2A 3PFSA 1UG1A 2Y4XA 3H0IA 2IPOB 1G8XA 1UDLA 4HKEA 3CC2T 5CAIA 2EQKA 1X01A 2L3PA 1YHQQ 2M16A 4RTXA 3CC4Q 5LJ5g 4Z8AA 1KK7A 3EGDB 1RABB 2F5KA 2SEMA 1QCOA 2CP7A 3VS0A 5LJ5d 1M5Q1 2NUTB 5DY9A 1GL5A 1UFFA 4O5VA 1YI2A 1NPPA 3S3MA 2V1QA 4JJCA 5KCHA 2G3RA 4KH0B 4PKCC 4X9CA 3OYNA 2MIOA 1LJOA 4Q5WA 3ME9A 3RDVA 1YJ9Q 2YUPA 5I21A 1AWWA 2QQ9A 2JUFA 2D0QB 2ENMA 2K79A 4ZNXA 1RAAB 4JDSA 2QEXT 4MZMA 4OMOA 3GIBA 1X27A 1U8RA 1WHKA 1VQOA 4FYWB 4HT8A 2RJDA 2M02A 4RMOA 4M75C 2YHTA 2NUPB 2BKDN 1MUZA 1YWOA 3I56A 3CMEQ 2JVVA 1RLQC 4BI8B 2X3XD 4HXJA 2DL4A 5I22A 2JTMA 3M58A 4IUUA 1VQ6Q 1MNDA 3D7SB 3ASKA 1WXBA 1WPYA 5GANj 2HEQA 4DBQA 1O9SA 4BDZA 2MI6A 1MMDA 3P8BB 3VS3A 1AWXA 5GMKe 5CR2A 2HAXA 1KJWA 2DAQA 2OI3A 3L2ZA 2V8JA 4BB7A 3JV3A 2LJ0A 2DPPB 2VUBA 1UGVA 4NOYA 1Y7XA 4N0AC 2KRSA 2CZ1B 4J6XA 2OAWA 6AT1B 1UJYA 5D6WA 1PG5B 2NLUA 2OTLT 1N9RA 4PJOA 4L6V5 1RL2A 2I2LA 1U3OA 2PVGB 1E6HA 5IXBA 1VQNQ 3VS5A 3CCRT 4A4EA 1F1BB 4Z02A 4FM4B 4LN2A 1TXQA 3CC2A 5KYUB 3HTRA 4ORZA 1BIAA 1G3SA 1KHCA 3JCMJ 2DO3A 3VS2A 2EKOA 2KBTA 2K3XA 2YRVA 1CKAA 2GBQA 3RNJA 5M9OA 4XU2A 2LJ3A 3CCLT 3EHQA 2C0TA 2DNUA 3CCMT 3LX7A 1HJDA 2EYXA 2CP6A 1B7TA 1QCFA 3SB2A 3RKYA 4M77C 4IKFA 3GOXA 2HCKA 3OYDA 4C92A 2PVDB 2QEXA 2AZVA 4O6JA 3PMTA 1M90U 2CT3A 1R0BG 2E65A 3CD6A 2RQVA 2RF0A 3QWXX 1WGSA 2DTIA 2GGRA 2CUBA 3CCJQ 3A8LB 2ZGWA 4M7AF 2MYSA 2LT4A 5CKEA 1Y96B 3M0SA 2R5MA 4MMKA 4N4GA 1N5ZA 1S72T 5CKDA 2E5KA 5CKHA 2D8HA 2K9GA 1E7OA 3OS1A 4XU3A 4JRKA 2DXTA 2FPFA 1D1AA 3OS0A 4L5GA 3TEEA 2PU9B 4PJJA 1LPLA 3I5SA 1ZQ1A 4EMKB 2K3YA 5HK3A 2K5FA 3VRZA 1RACB 5LJ5e 4ME7A 2ZAEA 3V8LA 2O4XB 1WHLA 5LJ3h 1XNIA 1M90R 3NFCA 4AT1B 2KXCA 4FYVB 2WACA 4M7DD 2DZ9A 1WDXA 3HHTB 1V29B 2OTLA 3UF4A 2RHIA 2MOXA 3RMSA 1NLOC 1OOTA 3SWNB 3CCRA 2QDYB 5GAOq 4EMKC 2F69A 5HKCA 1AZEA 2RQUA 1UEBA 5I2MA 3WXMB 3KXTA 4M7AG 3OY9A 1X6BA 2RK1A 1U1TA 3EGDA 3INZA 1TTHB 4F14A 2CDTA 2FYKA 1WZOA 1UGQB 2HL3A 1BU1A 3PGGA 2A0FB 1IO6A 2DIQA 1WXTA 1AOJA 2ZPBB 5A0DA 3QG1A 3JB9D 1N9SA 3M54A 3CC7Q 3Q1JA 3CCLA 1PM3A 2EQUA 3JCMb 1D0ZA 3CBPA 5ECAA 1JQQA 2JM9A 5CIUA 3DB3A 3EH1A 4JPBW 2F2WA 4FU6A 2EYWA 1TG0A 3UDCA 1OZ3A 4RTUA 5LJ5f 1VQ8Q 5DLQE 2LTOA 4QVCA 5A2QE 3CCSQ 2QGGA 2MPXC 2E41A 2LX7A 2X4JA 3CCVQ 1VQ4T 1X6GA 1ZX6A 2NUPA 3G6EA 3LH5A 1RUWA 3OS5A 1XTDA 3UWNA 4GLKA 2XDBA 4XTZA 3QJ6A 1S72A 1UUEA 2M0YA 1OQKA 5GAN8 2LQ8A 4LXCA 2H3JA 4BY6B 3QSUA 4QT7A 4BE0A 1UGPB 3TSZA 2JOYA 2ZPIB 2DILA 1Q86U 2DA9A 4X9DA 1OV3A 1SEMA 2CS7A 2ABLA 3M55A 4C8QD 4OGEA 2EGCA 4FT2A 1YITQ 2K5IA 2PVOB 3VS4A 3PTAA 3ZFJA 2KRMA 1Y57A 2O31A 4E7KA 2WSEE 1FMWA 3CPWP 1LOJA 1SPKA 3JAME 1VQLQ 1DJ7B 3L42A 4ZN1A 1EZZB 1BCMA 3CCET 5DM7R 5KYUA 1W2BA 1VQPT 4ZN3A 2FVUA 4EIKA 3RBBB 1YHQT 3M9QA 4ANJA 1BYMA 2HKNA 3BY7A 1XOVA 1M4ZA 1Q86R 2HQXA 4HCBA 1MNEA 2HD0A 2P4TA 5CKFA 8AT1B 1JJ2P 5FU6C 1C0MA 2OAUA 2F2XA 4C8QB 2X51A 2EPDA 4EMGA 3M0TA 3JCMP 1NBEB 2YUNA 3QIIA 1RAEB 2HMAA 4OP0A 1XQHA 3LGFA 3RUXA 4M78D 1UTIA 1M27C 1VQ9Q 3CMAT 1YJ9T 4J9DA 2MAMA 5GAOl 1EFNA 4J7FA 1JB0E 2R58A 2FEIA 1WHHA 1WJSA 4C8QE 1LCKA 4FCYA 2GQVA 3UA6A 3L2WA 3JCMQ 3A8GB 1BKBA 1KD1U 2BTTA 1VQ4A 4HCCA 2X4XA 2L3RA 2LRQA 4EPCA 3QUIA 2DL5A 5C6SA 2YLCA 1KSWA 1Y96A 1YJNQ 5HY6A 1G3YA 3QYGB 3QDRB 2O88A 4WTOB 3EFOA 2K2MA 2BZXA 4M78B 5KH6A 3TSWA 4M7DG 4MZTA 4IURA 4FT4A 5A0GA 1VUBA 2DMOA 3JB9H 1G2BA 2ZPGB 1HXDA 5LJ3j 2XIDA 1K1ZA 1U5SA 2CKKA 3HKSA 2O4XA 1GCQA 5L8RE 2DRMA 4RTZA 2AK5A 2DBKA 1NJIU 5GAOm 2L3SA 1RLPC 5GAOn 3EG2A 2LMJA 1M9SA 4KUDK 1KD1R 3A5ZB 4M78E 4P5NA 3ULRB 2VB6A 3NTIA 2KAFA 2JW4A 4E7LA 1ABOA 4PJMA 4LUDA 1JBMA 3JB9G 3SWNA 1D1BA 3H41A 1FMVA 4MDWA 1VQNT 2CZ0B 3U23A 3X28B 4AMCA 5KYNA 1VQOT 3CCEA 1AD5A 1PD1A 4OMQA 2LCLA 1SHGA 2ROTA 4DEXA 4JRPA 3HFNA 3OQ5A 1YHQA 1QP2A 5EG2A 2RD1A 2MF2A 4AG1C 3CC4A 1PSFA 1I4K1 3HFOA 1MMNA 5D7UA 4LD6A 1GFDA 1QVGP 2E64A 4IIMA 5IHNA 1VQKQ 1NJIR 2NWMA 1Q7YU 3UA7A 2DJQA 4M7DA 2HZYA 2V26A 4PJLA 4FYXB 1GBQA 4XQ3A 1OEBA 1R0CB 1YJ9A 4BACA 3FJ5A 5EC7A 4M75D 2C06A 3JRZA 4KGXB 1RAIB 2DBMA 4KGZB 3HL8A 4PJOF 1PKTA 1SRMA 1K73U 1NYFA 4OB2B 1WI7A 1I1JA 2DM1A 4KT0E 3E9FA 3KFVA 1JEGA 1QVPA 1AT1B 3TVTA 1J3TA 2CP5A 2ED0A 3CMEA 4JRIA 1Q82U 4X1VA 2VASA 2DL3A 3CCUQ 2CZ7B 1JO8A 2DTHA 2CT4A 1RI0A 2QQAA 2QAZA 1VQ7Q 1YFNA 2RQRA 3M4GA 2LVMA 2P84A 1VQ5Q 4HT9A 2A3LA 2AHJB 3OSVA 3CXCP 2RNAA 2O9SA 2LC4A 4ZGJB 4J6WA 1IXDA 4QVZA 4HVWA 4M75B 1B34B 2LZ6B 1MGQA 2VVKA 3OYAA 1X2KA 3ZL7C 3CCQQ 1FMKA 2RN8A 2MMPA 4RUGA 4BI4A 3P8HA 1I0CA 2JT4A 4XAXB 4JLIA 1M3BA 3JCMW 4TVRA 2KYBA 2O2OA 3RKXA 2KY9A 3A8MB 1H3HA 5GJWB 1QWFA 4PJOG 1Q82R 2RQTA 1RAGB 4C5EA 3LW5E 4M75E 2AT1B 3JCMX 1KQSP 1D0XA 3CD6T 4RCBA 1PSEA 1VQNA 2JS0A 2D8JA 3NGPA 4PLIA 5J39A 2E6ZA 4ATOA 3S6WA 1V76A 4DA4A 3M0QA 1PC0A 3HP9A 3NMZC 3TCJA 3E2UA 3V7CA 2FL7A 3TREA 2B8AA 2VXEA 3C95A 2XHCA 2HDAA 4C8QA 2J06A 1NJIC 5GMKm 3G4SQ 4M77D 2EJ9A 2DJZA 5L23A 1QVFS 2XU8A 3UPUA 3REBB 2JNGA 4D6WA 2F2VA 2GFUA 5AT1B 3MJXA 3GPLA 3AT1B 4KULA 3I55Q 2EYZA 1HSQA 1T3LA 4RTWA 2HSPA 5GMKh 3HRTA 1HD3A 1OX9A 1NYGA 3JCMg 1SSFA 3VYGA 1WHGA 2KT8A 4C92G 2Z0WA 5GAMg 1JJ2S 2VKNA 3S3NA 2QDLA 3QDFA 3CCST 2EGAA 1KC8C 3PE0A 2LP5A 3TQ7P 2CP3A 5GAMd 1IREB 2DETA 4IUQA 4E7ZA 1WA7A 4HCKA 2R5AA 3EGXB 2DKGA 2L0AA 3L2UA 3RESA 1YI2Q 3CCJA 4MMLA 2L2PA 1N27A 2FZGB 2RO0A 4DOVA 3OSSC 3QWYA 2QA4T 4M77B 1AHJB 1W2BS 2FO0A 3HRUA 2E70A 2YRCA 4M78A 3QXEB 2J05A 4PL6A 2C0OA 4F7UB 3VS7A 1K8AU 3VYHB 1NLPC 1GRIA 3OMCA 2RJCA 1Y71A 2P0PA 3CBOA 4M7AC 2RJEA 2CH4A 3DKMA 1N6AA 2LQNA 2MWPA 1QCNA 4M77E 3H9NA 1YJWT 2ZPHB 4R0KA 2YRDA 1IGQA 3I56Q 1KQ2A 2A7YA 2C0IA 4F7UE 1M1KU 1IB8A 2KE9A 1GXIE 4RTTA 1ZLMA 5IH2A 1H92A 2XD0A 3CEYA 1GFCA 2OTJQ 1M1GA 2JN0A 1M3CA 2R57A 2AZSA 2E12A 3OYGA 3G6ET 1M2OA 3M57A 3VUZA 1YBYA 4BE1A 5KYXA 3VUBA 2L5QA 1K8AR 5GAOp 4OVAA 2EVRA 2XI9A 2XDDA 3DLLA 1PWTA 4CC7A 3OS2A 1ABQA 2RHUA 2KGTA 2ZPFB 2OJ2A 4JRQA 2EWNA 3C12A 1K76A 1M8MA 2CREA 4GBQA 3LGLA 4OMLA 2O01E 5D6XA 2DYBA 4F16A 5LJ5h 3CC2Q 1SSHA 1QVGS 2D9TA 3EG9B 3WVDB 1YP5A 3OYLA 9ATCB 5GANg 1VYTA 2E1HA 2LCCA 3CCSA 2JTFA 3RIRA 5GANd 3CCVA 2VV5A 2HQEA 3DLMA 4OMMA 1VYVA 2NYSA 5GAN6 4X34A 1X75C 2K4YA 1ZSZC 1WHJA 4J9FA 3SD4A 2MWOA 2YUOA 4B9XA 3G71Q 5FRMA 1I07A 2YWWA 2XKOC 1WJRA 3MKDA 1VQMT 5GAN5 1M1FA 2QA4A 2ECZA 1HK9A 3M53A 4C0FA 3JCMV 2QQSA 4CI0C 4OB1B 4BUGA 2QI2A 4JJNK 3OW2S 2NUTA 4E47A 4PFZA 2QEXQ 2KR3A 4JLGA 1B34A 4M75A 4KUIA 4ELZC 4Y28E 5IHKA 3QZ9B 2BZYA 4QQGA 1FXXA 1KG1A 4OMNA 1YJWA 1AWOA 1YITA 1YIJT 5KYYB 1FX7A 4RTVA 1QMCA 4OMFB 2GFAA 2M51A 2V8IA 3H8ZA 5FU7C 4MZPA 3OYCA 3OYJA 5LL6S 2CP2A 4XTWA 3T9NA 1VQLA 1WHMA 2V1RA 4E2FB 1AVZC 1OU8A 1PNJA 3M5AA 2WSFE 4V2SA 5A0LA 1TUDA 2HSEB 2IIMA 1R77A 4ZTFA 3FC3A 5GAMe 1K8AC 2GTOA 1JU5C 2CYZB 3I9QA 3KBGA 4N0AA 5J26A 2CSIA 3CPWA 4DOWA 1NEBA 4A4GA 1QVFA 3NPFA 3N5BB 5GMKj 1FYNA 4Z89A 2L3QA 4ESRA 2OTLQ 1M2VB 2EYQA 1G5VA 3G7ZA 2VGNA 4FYYB 2QG9B 1VQ9A 2EFIA 4J9HA 3CCRQ 3E19A 4PFPA 2XMFA 2E5QA 3J80E 3F70A 2KK4A 1IRXA 1M90C 4C0ZA 1JJ2A 2DX1A 5FU6B 1UJ0A 4A53A 3L2VA 3EGXA 2DERA 4QKUA 2FHDA 3OYHA 3BFMA 2BUDA 2ESWA 3CQTA 1FWZA 2PUKB 3WVEB 2RM4A 3OBWA 4J9GA 3MEVA 3JB9J 2H8HA 4M77A 3CCMQ 1Q95G 1VQMA 2YSQA 3CCUT 1T0HA 1ZBXA 4DBFA 4XU0A 3A8OB 1ZSGA 3JCMf 3J7AF 4F7UA 2KI7A 3MPUB 1O75A 4LDWA 5GAMf 5IXFA 1VQ5T 4NS5A 3V7SA 2KEAA 3CC4T 4Y92A 4M7DF 1YCYA 3EG0A 3CPFA 1LNXA 4LDXA 4IIOA 3FDRA 1H641 1PRMC 1PHTA 1SG5A 3EAEA 2LT1A 4D8KA 4AFSC 3L1AA 4BE2A 1YIJA 4KGVB 3OYYA 4VUBA 3PVLA 2W10A 2K7AA 1T0JA 1ZUKA 2AIRB 5IAYA 1MV3A 2RA2A 2RHZA 4ZGDB 3M0UA 2K5LA 1WQWA 3EHRA 3LH0A 2ATCB 4KH1B 2QYZA 2BE9B 3JB9F 1KIKA 5J3BA 1TWBA 4FW2A 4AG2C 2DFUA 3PVQA 2EYYA 2HBPA 4RG8A 5GANe 1W70A 3CMET 1D0YA 3V8KA 2EKHA 2FRYA 1YNZA 2D0NA 3BE3A 2K2VA 1VQ6T 1VQKA 2FZKB 1A0NB 1TSFA 2D6FA 1R8OB 2DEUA 5LJ5j 4EMKA 2CSQA 3LYIA 3GNGA 4PJOB 2KXDA 1ZUYA 1SRLA 2GTJA 2JXBA 1W1FA 2D1XA 1EX4A 4J9EA 2HNIA 2DVJA 3OYFA 3ER0A 4CC4B 1QVGA 3GF5A 4OF1A 3FIFA 4PJNA 4C5GA 2X35A 1PKSA 1WNLA 3QHSA 1VIEA 4FL6A 2JZ2A 2HL5C 1HYOA 1ZA1B 2QK0A 2W0ZA 5CO7A 2RQWA 2DXBA 4PJOC 2DLPA 3ZBDA 3CCUA 4C8QF 5IT9E 1TS9A 1BBZA 1VA7A 1G3TA 5GANf 1VQ5A 3RR6A 2FPEA 4C0DC 1VOMA 3OW2A 3VU3C 1Q86C 4LD9K 2BIVA 3FEOA 2EJGA 1QWEA 2LQWA 3QJYA 5CCAA 1VQ4Q 3CCQA 4IUTA 5KYYA 3URGA 3BDLA 1W4SA 2EJFA 2PTKA 1WX6A 4IUPA 2DL8A 2KDSA 3QYHB 3CXCA 4N4HA
chains in the Genus database with same CATH topology
5FLXE 4IUQA 4E7IA 2OTJT 4B9WA 2XDPA 4ELYC 3SWNB 1MHNA 2R5AA 3HPWA 2QDYB 4EMHA 5GAOq 3CCRA 3CBMA 4EMKC 2F69A 2DKGA 5HKCA 3L2UA 3RESA 4PJOD 1UEBA 2P0QA 5I2MA 3WXMB 3KXTA 3CCJA 4MMLA 2DXCA 4M7AG 1N27A 3OY9A 2F5TX 2GCXA 4C92C 2RO0A 2RK1A 1U1TA 4DOVA 3OSSC 2QA4T 1WJQA 3KUFA 3INZA 4XTXA 4M77B 1AHJB 1W2BS 2FYKA 2VC8A 3HRUA 1UGQB 2E70A 4II1A 3CCJT 2ZPEB 3PGGA 4C0GA 4M78A 2DIQA 3QXEB 2V8KA 2ZPBB 5A0DA 4PL6A 3OYMA 3QG1A 4F7UB 2X4WA 3JB9D 1KQ1A 1K8AU 4C8QG 4PNOA 3VYHB 4XTUA 1N9SA 3M54A 3Q1JA 5GANh 3CCLA 1JRIA 3OMCA 2RJCA 4XTVA 5GAN4 2EQUA 3JCMb 1Y71A 2P0PA 1VQ6A 5AYFA 3G4SA 3CBOA 3AHUA 4M7AC 3MO8A 3CBPA 2RJEA 4ZGEB 1Q81C 2K57A 1NPRA 3DKMA 1U1SA 4DQ2A 1G3WA 1N6AA 2MWPA 2DZCA 5CIUA 3DB3A 4M77E 1BI2A 5GMKl 1VIFA 3MP8A 1YJWT 4J7IA 3HRSA 3G4ST 4FU6A 2ZPHB 4EDUA 3UDCA 3I55A 3TU4K 1OZ3A 1UB4A 5LJ5f 3L2RA 1KQ2A 3MP6A 2DIGA 2A7YA 3MP1A 5DLQE 4F7UE 3EFSA 4C8QC 1M1KU 3HSBA 2DVEA 4A54A 2LTOA 3FLGA 4QVCA 5A2QE 2DD4A 2LX9A 2E41A 2X4JA 3OYKA 3E1SA 1GXIE 4C92F 3I55T 2XD0A 3CEYA 1VQ4T 1KD1C 1M1GA 3VJPA 3RKWA 3G6EA 4C92D 3C94A 4R56A 3EFRA 3QKJA 5LJ3g 3GP8A 3ZEHA 2JN0A 3OS5A 2QTXA 2R57A 1XTDA 4C0DB 5LJ3d 1EIFA 2E12A 3OYGA 4UC4A 3UWNA 3M57A 4GLKA 3VUZA 1YBYA 4C5IA 3OYIA 3G6ET 4KBMB 3QJ6A 4XTZA 3VUBA 4BE1A 2L5QA 2CGHA 3PNWC 4LDVA 5GAOp 3G71T 4OVAA 1S72A 5GAN8 2LQ8A 2XI9A 4JS4A 3PIOA 2XDDA 1K9MU 2H3JA 4BY6B 4RCCA 3DLLA 2DEQA 4PJOE 2VGMA 3QSUA 5C0MA 4M7AD 4BE0A 1YI2T 4M78G 1UGPB 3MEWA 4JS5A 1VQ8A 4ZTJA 2Y4YA 3JCMc 2JOYA 3OS2A 2EQMA 3VKIA 2RHUA 2E6NA 2ZPIB 2ZPFB 2PQWA 4NL3A 3LWIA 1Q86U 4JRQA 2EWNA 3C12A 5GAN3 3LGLA 5CK9A 4X9DA 3CPWS 2L89A 2CS7A 1VQ7A 3M55A 4C8QD 4OGEA 3FJPA 2EQJA 2O01E 4FT2A 2M9UA 2K5IA 4N4HA 1OZ2A 2PVOB 2LDMA 3CC7T 3QPHA 4OB0B 3X26B 3PTAA 4GY5A 5D6XA 4M78C 1QP3A 2KQWA 5CQXA 3ZFJA 1BI3A 4C92B 5LJ5h 4HCZA 2RI2A 3J81E 4E7KA 2WSEE 1QVGS 2D9TA 3NTHA 3WVDB 3OYLA 1LOJA 5GANg 1VQPA 3GLXA 1KC8U 3JAME 2E1HA 2LCCA 3CCSA 3MHXA 1DJ7B 2JTFA 3L42A 4WF2A 5CQYA 4ZN1A 5GAN7 3RIRA 3JB9I 5GANd 3CCVA 4OB3B 2VV5A 3LLRA 2HQEA 4RG2A 4A4FA 3DLMA 3I56T 1VQ8T 3CCET 2OTJA 5DM7R 3SFMA 3MEAA 3O8VA 4XU1A 5GAN6 3VV0A 1VQPT 4ZN3A 4X34A 3JCMd 1W2BA 1X75C 2K4YA 2FVUA 4OGCA 2L8DA 4XTYA 4M7AB 2MWOA 3SD4A 5DLOA 2XDBA 1OYXA 2DTOA 2XK0A 4B9XA 3CCVT 5FRMA 3SDZA 3M9QA 1YHQT 4C92E 2RHXA 1WJRA 2XKOC 2DXUA 1VQMT 5GAN5 1BYMA 3X20B 1M1FA 3BDUA 2QA4A 3BY7A 1XOVA 1M4ZA 1I81A 2HQXA 2ZZDA 5GAMj 1HK9A 3M53A 4QVDA 4C0FA 4HCBA 2HD0A 3JCMV 2P4TA 3QBYA 5CKFA 2QQSA 4Y91A 5FU6C 4CI0C 1X6OA 2OAUA 2DD5A 4OB1B 4BUGA 4LDYA 4C8QB 2QI2A 3CMAA 3S3OA 3OB9A 4JJNK 4EMGA 3OW2S 4M78F 1N8RC 4M75F 3M56A 3JCMP 3QIIA 3OYEA 1Q7YC 1M8VA 4OP0A 4E47A 4M75A 4JLGA 1B34A 1XQHA 3LGFA 3GNFB 4KUIA 4M78D 3RUXA 4M7AE 4MDXA 4ELZC 4Y28E 3QZ9B 3CMAT 1OI1A 1YJ9T 2MAMA 5GAOl 4QQGA 1FXXA 2EAYA 3PMIA 1KG1A 2RK2A 5GAN2 1YJWA 3META 3V8JA 1YIJT 1YITA 1KQSA 1BI0A 1FX7A 1JB0E 2R58A 4J7FA 3QZ5B 4OMFB 2GFAA 2VXFA 1WJSA 4LDUA 4C8QE 2V8IA 3H8ZA 1IZ6A 5FU7C 1K73C 1D3BB 3QO3A 4MZPA 3X25B 3M59A 3OYCA 2GQVA 3OYJA 2DK3A 1YITT 5LL6S 3L2WA 3JCMQ 2E10A 3A8GB 1UGRB 4XTWA 1BKBA 3T9NA 1QW1A 1VQ4A 1KD1U 4HCCA 3PFSA 2X4XA 2L3RA 2LRQA 2Y4XA 1VQLA 4EPCA 4HKEA 3QUIA 4HA8A 3CC2T 5CAIA 3M5AA 5C6SA 2WSFE 2EQKA 2P0KA 2YLCA 4V2SA 1X01A 1Y96A 5A0LA 1Q82C 5HY6A 1G3YA 2M16A 3QYGB 1VQLT 4ZTFA 3FC3A 5GAMe 5LJ5g 3QDRB 1K8AC 4C5HA 2F5KA 3G71A 2YLBA 5GAOr 2CYZB 5LJ5d 1M5Q1 5DY9A 3KBGA 4N0AA 5J26A 4M78B 5KH6A 4IUVA 3PT9A 4M7DG 4MZTA 4L59A 4IURA 4FT4A 4O5VA 1YI2A 1NPPA 2RH2A 1VUBA 5A0GA 3JB9H 2ZPGB 3CPWA 3S3MA 1HXDA 4DOWA 4A4KA 5KCHA 5LJ3j 2XICA 2G3RA 4X9CA 4PKCC 3H6ZA 4A4GA 3OYNA 3P8DA 1QVFA 1LJOA 2XIDA 4Q5WA 4RKUE 3ME9A 3N5BB 4R55A 2CKKA 5GMKj 3HKSA 2O4XA 3OA6A 4M75G 5L8RE 5I21A 2EYQA 1H3ZA 1WQ7A 2KVQG 2QQ9A 1NJIU 1G5VA 5GAOm 3G7ZA 2VGNA 2RI3A 2JUFA 4NL2A 2D0QB 1VQ9A 2EFIA 5GAOn 2ZCFB 1M9SA 3PIPA 3CC7A 4J5YA 5KCOA 2X4YA 4KUDK 3JSCA 3A5ZB 4M78E 4P5NA 4JDSA 3E19A 4J6YA 2QEXT 2E5QA 4MZMA 3BW1A 3NTIA 2KAFA 1Y07A 3J80E 3F70A 2KK4A 1VQ9T 4E7LA 3GIBA 1U8RA 1VQOA 1M90C 4C0ZA 1JJ2A 4HT8A 2RJDA 1JBMA 2KSSA 4RMOA 4M75C 2YHTA 5FU6B 4A53A 3L2VA 3JB9G 3SWNA 5CKBA 4MDWA 2BKDN 1VQNT 3I56A 2CZ0B 2RHYA 3X28B 2FHDA 2JVVA 3OYHA 3BFMA 2BUDA 3CCEA 3M4YA 1VQOT 1K9MC 4BI8B 1BI1A 4QQDA 1FWZA 2PUKB 3WVEB 2LCLA 2RM4A 3OBWA 4M77F 3MEVA 4E7JA 3JB9J 1I8FA 1NE8A 4JRPA 2JTMA 3HFNA 4M77A 3OQ5A 1YHQA 2RJFA 3M58A 4IUUA 4BDYA 1QP2A 5EG2A 2RD1A 1VQMA 2MF2A 3CCUT 1ZBXA 3ASKA 3CC4A 1PSFA 1WPYA 1I4K1 2CZ6B 2VYTA 3A8OB 3OBYA 4XU0A 3HFOA 3JCMf 4F7UF 5GANj 3J7AF 4J83A 4LD6A 1O9SA 4F7UA 4BDZA 1O75A 2E64A 2MI6A 4LDWA 5GAMf 5LJ3e 4E7HA 1YJNT 1VQ5T 4NS5A 3DB4A 2GF7A 3V7SA 5FU7B 3RERA 3P8BB 4YTLA 3CC4T 4M7DF 1Q7YU 5GMKe 5CR2A 1YCYA 3CPFA 2Y90A 1LNXA 2HAXA 4M7DA 1P92A 4LDXA 2LNVA 3FDRA 2DAQA 1H641 3L2ZA 2V8JA 4XQ3A 3EAEA 3V7RA 1YJ9A 4BB7A 2DPPB 2VUBA 4BACA 2LT1A 5KE3A 4NOYA 1Y7XA 4N0AC 3L1AA 4BE2A 4M75D 1YIJA 5FRNA 2C06A 3JRZA 2CZ1B 4QW2A 1Q81U 4J6XA 4PJOF 3OYYA 3HL8A 4VUBA 3OYBA 5D6WA 1K73U 2NLUA 5IAYA 2OTLT 1N9RA 4OB2B 4PJOA 5GMKi 4L6V5 2RA2A 1RL2A 2I2LA 2RHZA 4QQ6A 4ZGDB 2K5LA 1WQWA 2PVGB 4KT0E 3E9FA 3LH0A 3CCRT 4A4EA 5D6YA 1QVPA 4Z02A 5IN1A 4FM4B 1ZHIA 3R6OA 3CC2A 3JB9F 1BIAA 3CXCS 1G3SA 3CMEA 4JRIA 1Q82U 1KHCA 5J3BA 3JCMJ 2KMTA 2DO3A 2QQRA 4JUVA 2HBPA 2CZ7B 2DTHA 2EKOA 2XG8D 4RG8A 5GANe 4M77G 1RI0A 2K3XA 2QQAA 3CMET 2YRVA 3CCMA 3A8HB 3M4GA 3V8KA 2LVMA 3JCMe 4M7DB 3JCMh 4HT9A 4N4IA 2A3LA 2AHJB 3OSVA 5FROA 4F7UG 1UGSB 5M9OA 3SWNC 5GAMh 4XU2A 3CCLT 3CCMT 2K2VA 1VQ6T 3C4SA 1VQKA 2LC4A 3LWHA 4ZGJB 3LX7A 4J6WA 2IVWA 4QVZA 4M75B 1B34B 5LJ3f 1MGQA 3OYAA 2D6FA 1R8OB 2RB6A 3MCAB 4FIBA 2QQBA 3FRNA 3RKYA 4M77C 3SB2A 5LJ5j 3L2QA 4EMKA 4IKFA 3LYIA 3GNGA 3GOXA 1VQKT 2MMPA 4PJOB 1NZ9A 4BI4A 3OYDA 1KQSS 2PUOB 3P8HA 4M7DE 4C92A 4XAXB 2PVDB 4JLIA 3JCMW 4TVRA 2QEXA 2HNIA 1M1KC 3X24B 2LQKA 4O6JA 3PMTA 3RKXA 3OYFA 1M90U 2KY9A 3A8MB 3ER0A 2FB7A 3CD6A 2E65A 1QVGA 4PJOG 3GF5A 4FSXA 5HK0A 4OF1A 4C5EA 1WGSA 4M7DC 2IG0A 3LW5E 3FIFA 4M75E 3UT1A 4CRIA 2DTIA 3JCMX 2QXFA 3FB9A 5CVIA 4C5GA 3A8LB 2ZGWA 2RI5A 4M7AF 2X35A 3CD6T 4RCBA 1PSEA 1VQNA 3QHSA 1WNLA 5I2SA 2LT4A 4PLIA 5CKEA 4BD3A 5J39A 4M7AA 2E6ZA 1VIEA 4FL6A 2JZ2A 1Y96B 4ATOA 2R5MA 4MMKA 4N4GA 3S6WA 1S72T 5CKDA 2EIFA 5CKHA 4DA4A 3E9GA 5CO7A 3OS1A 4XU3A 3HP9A 2DXBA 3TCJA 4PJOC 4JRKA 3V7CA 2FL7A 3ZBDA 3CCUA 3TREA 4C8QF 2B8AA 1I5LA 5IT9E 2DXTA 2VXEA 4XK8E 3C95A 2XHCA 4J8OA 1BIBA 4C8QA 4BI3A 3OS0A 4L5GA 1KHIA 3TEEA 1G3TA 2PU9B 1YJNA 5GANf 1NJIC 1VQ5A 5GMKm 4M77D 2EJ9A 2DJZA 1QVFS 1ZQ1A 4EMKB 2XU8A 4C0DC 2K3YA 3MEUA 3VU3C 3OW2A 3UPUA 1Q86C 5KE2A 2JNGA 2K5FA 2GFUA 4D6WA 2BIVA 3FEOA 5HK3A 4LD9K 2EJGA 5LJ5e 4ME7A 1VQ7T 3V8LA 2O4XB 4PLLA 2M1HA 5LJ3h 3GPLA 1XNIA 4KULA 3NFCA 1N8RU 3QJYA 5CCAA 4BY6C 3CCQA 4IUTA 3HRTA 2WACA 5GMKh 2M0OA 1TH7A 3URGA 4M7DD 3BDLA 1SSFA 1W4SA 3JCMg 3VYGA 2WSCE 2DZ9A 2EJFA 4A4HA 4C92G 3OMGA 1D3BA 5GAMg 1JJ2S 3HHTB 3NTKA 3CCQT 4IUPA 1V29B 3S3NA 2OTLA 2RHIA 3RMQA 3CCST 2KDSA 3QYHB 1KC8C 3RMSA 3CXCA 5GAMd 1IREB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N5B B;  2XG8 D;  2XKO C; 
#chains in the Genus database with same CATH topology
 5FLX E;  1IGU A;  2OTJ T;  2J7I A;  4ELY C;  2HQH A;  2A37 A;  3HPW A;  2DXC A;  2F5T X;  2GCX A;  4C92 C;  1NG2 A;  1WJQ A;  3KUF A;  2VC8 A;  1U06 A;  4II1 A;  3CCJ T;  2ZPE B;  4C0G A;  1YWP A;  2E3I A;  2V8K A;  2MCN A;  1QKX A;  4C8Q G;  4PNO A;  3H0H A;  1Q7Y R;  1JRI A;  4XTV A;  5GAN 4;  1VQ6 A;  3G4S A;  2YXY A;  1LVK A;  1M2V A;  4DQ2 A;  4JJB A;  1G3W A;  1RAH B;  2DZC A;  5GMK l;  1VIF A;  4J7I A;  4EDU A;  4AFU C;  3I55 A;  1CKB A;  1UB4 A;  3TU4 K;  3L2R A;  3MP6 A;  2DIG A;  3CCE Q;  4DEY A;  1VQP Q;  3HSB A;  2DVE A;  4A54 A;  3FLG A;  1K73 R;  3OYK A;  3E1S A;  4C92 F;  1KD1 C;  1WFW A;  3C94 A;  5LJ3 g;  2QTX A;  1SKU B;  3NHN A;  5LJ3 d;  4F04 B;  5KYW B;  5HCK A;  1SF9 A;  3PNW C;  3G71 T;  3VRY A;  4JS4 A;  2K3B A;  1K9M U;  2DEQ A;  5C0M A;  4M7A D;  3CMA Q;  4M78 G;  2Y4Y A;  2EQM A;  3VKI A;  3G1J A;  2PQW A;  1X2Q A;  3LWI A;  5GAN 3;  2DRK A;  5CK9 A;  1PCX A;  3CPW S;  2YT6 A;  1BB9 A;  2M9U A;  1OZ2 A;  3CC7 T;  3QPH A;  4DBH A;  2KQW A;  2JTE A;  3M0P A;  5CQX A;  2COY A;  2RI2 A;  3J81 E;  2FG0 A;  1S1N A;  2QTV A;  1AEY A;  3GLX A;  3MHX A;  5CQY A;  5GAN 7;  1K4U S;  4JZ3 A;  3JB9 I;  2JJ9 A;  4OB3 B;  4A4F A;  1VQ8 T;  1OX8 A;  2OTJ A;  3SFM A;  3MEA A;  4LE9 A;  1K9M R;  3JCM d;  1I5O B;  4OGC A;  1V1C A;  4M7A B;  2NUZ A;  2XK0 A;  3CCV T;  1OU9 A;  2DXU A;  1I81 A;  3QBY A;  2DD5 A;  3OB9 A;  4M75 F;  4AFQ C;  1Q7Y C;  4M7A E;  8ATC B;  1QKW A;  4MDX A;  3PMI A;  2RK2 A;  3V8J A;  2QAS A;  2KYM A;  3EG3 A;  3QZ5 B;  1VQO Q;  4GLM A;  1IZ6 A;  1K73 C;  2G6F X;  1D3B B;  2DE0 X;  3QO3 A;  3REA B;  3M0R A;  1VYU A;  2DK3 A;  1YIT T;  2E10 A;  4A63 B;  4HA8 A;  5IHI A;  4JZ4 A;  2P0K A;  2CUD A;  2LJ1 A;  1Q82 C;  1VQL T;  1TUC A;  1PRL C;  5FWC A;  4C5H A;  1T3S A;  3G71 A;  2KRO A;  2YLB A;  5GAO r;  4JJD A;  4IUV A;  3PT9 A;  2JMC A;  3O5Z A;  4L59 A;  2RH2 A;  2X3W D;  4A4K A;  2XIC A;  4LUE A;  3H6Z A;  3P8D A;  4RKU E;  4R55 A;  3OA6 A;  1WXU A;  2VWF A;  4M75 G;  1W6X A;  2BZ8 A;  1H3Z A;  1WQ7 A;  1UHC A;  2KVQ G;  1OPL A;  3R6N A;  2RI3 A;  4Z88 A;  4NL2 A;  1ZSZ B;  2ZCF B;  3PIP A;  3CC7 A;  4J5Y A;  5KCO A;  2X4Y A;  3JSC A;  4J6Y A;  3BW1 A;  3H0F A;  4OMP A;  1M1K R;  4FW1 A;  1Y07 A;  1VQ9 T;  1B3Q A;  1PD0 A;  2KSS A;  4FSS A;  2LNH B;  5CKB A;  1MMG A;  2MK5 A;  4K11 A;  2RHY A;  1VQ8 A;  1OPK A;  1K9M C;  3M4Y A;  1BI1 A;  4QQD A;  3EFO B;  4LNP A;  2SRC A;  4E7J A;  4M77 F;  1UHF A;  1I8F A;  1NE8 A;  2K6D A;  1K0S A;  2RJF A;  4BDY A;  2HBW A;  2CZ6 B;  3OBY A;  4F7U F;  2VYT A;  2ED1 A;  2KRN A;  4J83 A;  1ZA2 B;  5LJ3 e;  4E7H A;  1YJN T;  3DB4 A;  2GF7 A;  1ZUU A;  1NM7 A;  5FU7 B;  3RER A;  4YTL A;  2JMA A;  2A28 A;  2FZC B;  2Y90 A;  1P92 A;  2X9H A;  2LNV A;  1RI9 A;  1YN8 A;  2FPD A;  1Y0M A;  3V7R A;  1MV0 B;  5KE3 A;  4PFO A;  5FRN A;  4QW2 A;  1Q81 U;  1XJW B;  1K9A A;  3CD6 Q;  3OYB A;  5GMK i;  3EG1 A;  1CSK A;  4QQ6 A;  4HVU A;  2J6K A;  1GCQ C;  5FWB A;  5D6Y A;  5IN1 A;  1ZHI A;  2PNI A;  3R6O A;  3CXC S;  4F17 A;  5KYW A;  2GQI A;  2J6O A;  2KMT A;  2PZ1 A;  2QQR A;  4JUV A;  2XG8 D;  1BCO A;  4M77 G;  2KT1 A;  3EH2 A;  2YDL A;  1IHW A;  3CCM A;  3A8H B;  2EGE A;  2B86 A;  3JCM e;  4M7D B;  3JCM h;  2F1L A;  4N4I A;  5FRO A;  4F7U G;  1UGS B;  1MMA A;  3SWN C;  5GAM h;  1ACM B;  3C4S A;  2E4H A;  3LWH A;  3IQL A;  2IVW A;  2QGF B;  5LJ3 f;  1Q81 R;  2P4R A;  3MCA B;  2RB6 A;  2ROL A;  4FIB A;  2RPN A;  2QQB A;  3FRN A;  2H3E B;  3L2Q A;  1G83 A;  1VQK T;  1NZ9 A;  1KQS S;  2PUO B;  4M7D E;  4E7S A;  4D8D A;  1M1K C;  3X24 B;  2LQK A;  3SEM A;  2FB7 A;  2FRW A;  4FSX A;  1X43 A;  5HK0 A;  4M7D C;  2IG0 A;  2QA4 Q;  1NEG A;  3UT1 A;  2EBP A;  4CRI A;  2QXF A;  3FB9 A;  1D09 B;  5CVI A;  2RI5 A;  2AKL A;  5I2S A;  2I0N A;  4BD3 A;  4M7A A;  5I11 A;  1TOV A;  2EIF A;  3E9G A;  4CC3 A;  2EQI A;  1TUG B;  4HVV A;  1I5L A;  1KFZ A;  4CC2 A;  4XK8 E;  1OUL A;  1X69 A;  1RAF B;  4J8O A;  1BIB A;  4BI3 A;  3CCL Q;  1KHI A;  1YCS B;  1YJW Q;  1YJN A;  1UE9 A;  3C0C A;  1Z9Z A;  3MEU A;  5KE2 A;  1QLY A;  1VQ7 T;  4PLL A;  2M1H A;  1B07 A;  2DYI A;  1N8R U;  2DL7 A;  4BY6 C;  1Z9Q A;  2M0O A;  1TH7 A;  1QVF P;  2WSC E;  4A4H A;  3OMG A;  2LCS A;  1D3B A;  3A1P A;  3NTK A;  3CCQ T;  3RMQ A;  3G6E Q;  4EMH A;  4E7I A;  4B9W A;  2XDP A;  2AKK A;  1MHN A;  3CBM A;  1ARK A;  4PJO D;  1C6V X;  2COW A;  2P0Q A;  3I5R A;  1S72 Q;  2CH4 W;  2GNC A;  4XTX A;  3A98 A;  3VS1 A;  2YUQ A;  2JM8 A;  2E3H A;  3OYM A;  2OX7 A;  2X4W A;  1KQ1 A;  4XTU A;  1N8R R;  4M4Z A;  5GAN h;  4J9I A;  5AYF A;  3MO8 A;  1W2B P;  1GBR A;  2BE7 D;  2A36 A;  1D1C A;  4ZGE B;  1Q81 C;  2K57 A;  1NPR A;  2KNB B;  5FW9 A;  1U1S A;  4J9C A;  1BI2 A;  3MP8 A;  1ZSZ A;  3HRS A;  3G4S T;  4J9B A;  2COZ A;  3MP1 A;  4B6M A;  3EFS A;  4C8Q C;  4AFZ C;  3SHW A;  1GCP A;  2DD4 A;  2LX9 A;  3I55 T;  1K0X A;  1QQJ A;  2JS2 A;  4KRT A;  3RKW A;  3VJP A;  1VQM Q;  5GJV B;  4C92 D;  1RAD B;  4R56 A;  3EFR A;  3QKJ A;  3GP8 A;  3ZEH A;  3EG9 A;  3THK A;  4C0D B;  2EW3 A;  1EIF A;  4UC4 A;  7AT1 B;  4C5I A;  3OYI A;  4KBM B;  2CGH A;  4LDV A;  3PIO A;  4RCC A;  4PJO E;  4RTY A;  2VGM A;  1YI2 T;  3MEW A;  4JS5 A;  3VS6 A;  4ZTJ A;  3JCM c;  2E6N A;  4NL3 A;  1YIJ Q;  4E6R A;  2L89 A;  1VQ7 A;  3FJP A;  2EQJ A;  2LDM A;  1AWJ A;  4OB0 B;  3X26 B;  2HKQ B;  1M30 A;  2J6F A;  4GY5 A;  1WYX A;  4M78 C;  1QP3 A;  1H8K A;  1BI3 A;  4C92 B;  2O9V A;  4HCZ A;  4PK4 A;  3NTH A;  1C1A A;  1VQP A;  1JXM A;  1KC8 U;  4WF2 A;  1WLP B;  5KYX B;  3LLR A;  3I56 T;  4RG2 A;  3EGU A;  3O8V A;  4XU1 A;  3VV0 A;  2L8D A;  4XTY A;  5DLO A;  1OYX A;  2DTO A;  3SDZ A;  4C92 E;  2RHX A;  3X20 B;  3BDU A;  5GAM j;  2ZZD A;  3AHU A;  2RMO A;  4QVD A;  3UAT A;  1JXO A;  4WCI A;  4Y91 A;  1X6O A;  4LDY A;  1TU0 B;  3CMA A;  3S3O A;  1WIE A;  1N8R C;  2DF6 A;  4M78 F;  1UEC A;  3M56 A;  1M8V A;  4DBR A;  3OYE A;  1SHF A;  2CP0 A;  3GNF B;  3GBQ A;  1OI1 A;  1AZG B;  2EAY A;  1KC8 R;  5GAN 2;  2A08 A;  3MET A;  1M3A A;  3I35 A;  1ZBJ A;  3OW2 P;  1BI0 A;  1KQS A;  2VXF A;  4LDU A;  1E6G A;  3X25 B;  3M59 A;  1IHV A;  1UGR B;  1QW1 A;  1BK2 A;  3PFS A;  1UG1 A;  2Y4X A;  3H0I A;  2IPO B;  1G8X A;  1UDL A;  4HKE A;  3CC2 T;  5CAI A;  2EQK A;  1X01 A;  2L3P A;  1YHQ Q;  2M16 A;  4RTX A;  3CC4 Q;  5LJ5 g;  4Z8A A;  1KK7 A;  3EGD B;  1RAB B;  2F5K A;  2SEM A;  1QCO A;  2CP7 A;  3VS0 A;  5LJ5 d;  1M5Q 1;  2NUT B;  5DY9 A;  1GL5 A;  1UFF A;  4O5V A;  1YI2 A;  1NPP A;  3S3M A;  2V1Q A;  4JJC A;  5KCH A;  2G3R A;  4KH0 B;  4PKC C;  4X9C A;  3OYN A;  2MIO A;  1LJO A;  4Q5W A;  3ME9 A;  3RDV A;  1YJ9 Q;  2YUP A;  5I21 A;  1AWW A;  2QQ9 A;  2JUF A;  2D0Q B;  2ENM A;  2K79 A;  4ZNX A;  1RAA B;  4JDS A;  2QEX T;  4MZM A;  4OMO A;  3GIB A;  1X27 A;  1U8R A;  1WHK A;  1VQO A;  4FYW B;  4HT8 A;  2RJD A;  2M02 A;  4RMO A;  4M75 C;  2YHT A;  2NUP B;  2BKD N;  1MUZ A;  1YWO A;  3I56 A;  3CME Q;  2JVV A;  1RLQ C;  4BI8 B;  2X3X D;  4HXJ A;  2DL4 A;  5I22 A;  2JTM A;  3M58 A;  4IUU A;  1VQ6 Q;  1MND A;  3D7S B;  3ASK A;  1WXB A;  1WPY A;  5GAN j;  2HEQ A;  4DBQ A;  1O9S A;  4BDZ A;  2MI6 A;  1MMD A;  3P8B B;  3VS3 A;  1AWX A;  5GMK e;  5CR2 A;  2HAX A;  1KJW A;  2DAQ A;  2OI3 A;  3L2Z A;  2V8J A;  4BB7 A;  3JV3 A;  2LJ0 A;  2DPP B;  2VUB A;  1UGV A;  4NOY A;  1Y7X A;  4N0A C;  2KRS A;  2CZ1 B;  4J6X A;  2OAW A;  6AT1 B;  1UJY A;  5D6W A;  1PG5 B;  2NLU A;  2OTL T;  1N9R A;  4PJO A;  4L6V 5;  1RL2 A;  2I2L A;  1U3O A;  2PVG B;  1E6H A;  5IXB A;  1VQN Q;  3VS5 A;  3CCR T;  4A4E A;  1F1B B;  4Z02 A;  4FM4 B;  4LN2 A;  1TXQ A;  3CC2 A;  5KYU B;  3HTR A;  4ORZ A;  1BIA A;  1G3S A;  1KHC A;  3JCM J;  2DO3 A;  3VS2 A;  2EKO A;  2KBT A;  2K3X A;  2YRV A;  1CKA A;  2GBQ A;  3RNJ A;  5M9O A;  4XU2 A;  2LJ3 A;  3CCL T;  3EHQ A;  2C0T A;  2DNU A;  3CCM T;  3LX7 A;  1HJD A;  2EYX A;  2CP6 A;  1B7T A;  1QCF A;  3SB2 A;  3RKY A;  4M77 C;  4IKF A;  3GOX A;  2HCK A;  3OYD A;  4C92 A;  2PVD B;  2QEX A;  2AZV A;  4O6J A;  3PMT A;  1M90 U;  2CT3 A;  1R0B G;  2E65 A;  3CD6 A;  2RQV A;  2RF0 A;  3QWX X;  1WGS A;  2DTI A;  2GGR A;  2CUB A;  3CCJ Q;  3A8L B;  2ZGW A;  4M7A F;  2MYS A;  2LT4 A;  5CKE A;  1Y96 B;  3M0S A;  2R5M A;  4MMK A;  4N4G A;  1N5Z A;  1S72 T;  5CKD A;  2E5K A;  5CKH A;  2D8H A;  2K9G A;  1E7O A;  3OS1 A;  4XU3 A;  4JRK A;  2DXT A;  2FPF A;  1D1A A;  3OS0 A;  4L5G A;  3TEE A;  2PU9 B;  4PJJ A;  1LPL A;  3I5S A;  1ZQ1 A;  4EMK B;  2K3Y A;  5HK3 A;  2K5F A;  3VRZ A;  1RAC B;  5LJ5 e;  4ME7 A;  2ZAE A;  3V8L A;  2O4X B;  1WHL A;  5LJ3 h;  1XNI A;  1M90 R;  3NFC A;  4AT1 B;  2KXC A;  4FYV B;  2WAC A;  4M7D D;  2DZ9 A;  1WDX A;  3HHT B;  1V29 B;  2OTL A;  3UF4 A;  2RHI A;  2MOX A;  3RMS A;  1NLO C;  1OOT A;  3SWN B;  3CCR A;  2QDY B;  5GAO q;  4EMK C;  2F69 A;  5HKC A;  1AZE A;  2RQU A;  1UEB A;  5I2M A;  3WXM B;  3KXT A;  4M7A G;  3OY9 A;  1X6B A;  2RK1 A;  1U1T A;  3EGD A;  3INZ A;  1TTH B;  4F14 A;  2CDT A;  2FYK A;  1WZO A;  1UGQ B;  2HL3 A;  1BU1 A;  3PGG A;  2A0F B;  1IO6 A;  2DIQ A;  1WXT A;  1AOJ A;  2ZPB B;  5A0D A;  3QG1 A;  3JB9 D;  1N9S A;  3M54 A;  3CC7 Q;  3Q1J A;  3CCL A;  1PM3 A;  2EQU A;  3JCM b;  1D0Z A;  3CBP A;  5ECA A;  1JQQ A;  2JM9 A;  5CIU A;  3DB3 A;  3EH1 A;  4JPB W;  2F2W A;  4FU6 A;  2EYW A;  1TG0 A;  3UDC A;  1OZ3 A;  4RTU A;  5LJ5 f;  1VQ8 Q;  5DLQ E;  2LTO A;  4QVC A;  5A2Q E;  3CCS Q;  2QGG A;  2MPX C;  2E41 A;  2LX7 A;  2X4J A;  3CCV Q;  1VQ4 T;  1X6G A;  1ZX6 A;  2NUP A;  3G6E A;  3LH5 A;  1RUW A;  3OS5 A;  1XTD A;  3UWN A;  4GLK A;  2XDB A;  4XTZ A;  3QJ6 A;  1S72 A;  1UUE A;  2M0Y A;  1OQK A;  5GAN 8;  2LQ8 A;  4LXC A;  2H3J A;  4BY6 B;  3QSU A;  4QT7 A;  4BE0 A;  1UGP B;  3TSZ A;  2JOY A;  2ZPI B;  2DIL A;  1Q86 U;  2DA9 A;  4X9D A;  1OV3 A;  1SEM A;  2CS7 A;  2ABL A;  3M55 A;  4C8Q D;  4OGE A;  2EGC A;  4FT2 A;  1YIT Q;  2K5I A;  2PVO B;  3VS4 A;  3PTA A;  3ZFJ A;  2KRM A;  1Y57 A;  2O31 A;  4E7K A;  2WSE E;  1FMW A;  3CPW P;  1LOJ A;  1SPK A;  3JAM E;  1VQL Q;  1DJ7 B;  3L42 A;  4ZN1 A;  1EZZ B;  1BCM A;  3CCE T;  5DM7 R;  5KYU A;  1W2B A;  1VQP T;  4ZN3 A;  2FVU A;  4EIK A;  3RBB B;  1YHQ T;  3M9Q A;  4ANJ A;  1BYM A;  2HKN A;  3BY7 A;  1XOV A;  1M4Z A;  1Q86 R;  2HQX A;  4HCB A;  1MNE A;  2HD0 A;  2P4T A;  5CKF A;  8AT1 B;  1JJ2 P;  5FU6 C;  1C0M A;  2OAU A;  2F2X A;  4C8Q B;  2X51 A;  2EPD A;  4EMG A;  3M0T A;  3JCM P;  1NBE B;  2YUN A;  3QII A;  1RAE B;  2HMA A;  4OP0 A;  1XQH A;  3LGF A;  3RUX A;  4M78 D;  1UTI A;  1M27 C;  1VQ9 Q;  3CMA T;  1YJ9 T;  4J9D A;  2MAM A;  5GAO l;  1EFN A;  4J7F A;  1JB0 E;  2R58 A;  2FEI A;  1WHH A;  1WJS A;  4C8Q E;  1LCK A;  4FCY A;  2GQV A;  3UA6 A;  3L2W A;  3JCM Q;  3A8G B;  1BKB A;  1KD1 U;  2BTT A;  1VQ4 A;  4HCC A;  2X4X A;  2L3R A;  2LRQ A;  4EPC A;  3QUI A;  2DL5 A;  5C6S A;  2YLC A;  1KSW A;  1Y96 A;  1YJN Q;  5HY6 A;  1G3Y A;  3QYG B;  3QDR B;  2O88 A;  4WTO B;  3EFO A;  2K2M A;  2BZX A;  4M78 B;  5KH6 A;  3TSW A;  4M7D G;  4MZT A;  4IUR A;  4FT4 A;  5A0G A;  1VUB A;  2DMO A;  3JB9 H;  1G2B A;  2ZPG B;  1HXD A;  5LJ3 j;  2XID A;  1K1Z A;  1U5S A;  2CKK A;  3HKS A;  2O4X A;  1GCQ A;  5L8R E;  2DRM A;  4RTZ A;  2AK5 A;  2DBK A;  1NJI U;  5GAO m;  2L3S A;  1RLP C;  5GAO n;  3EG2 A;  2LMJ A;  1M9S A;  4KUD K;  1KD1 R;  3A5Z B;  4M78 E;  4P5N A;  3ULR B;  2VB6 A;  3NTI A;  2KAF A;  2JW4 A;  4E7L A;  1ABO A;  4PJM A;  4LUD A;  1JBM A;  3JB9 G;  3SWN A;  1D1B A;  3H41 A;  1FMV A;  4MDW A;  1VQN T;  2CZ0 B;  3U23 A;  3X28 B;  4AMC A;  5KYN A;  1VQO T;  3CCE A;  1AD5 A;  1PD1 A;  4OMQ A;  2LCL A;  1SHG A;  2ROT A;  4DEX A;  4JRP A;  3HFN A;  3OQ5 A;  1YHQ A;  1QP2 A;  5EG2 A;  2RD1 A;  2MF2 A;  4AG1 C;  3CC4 A;  1PSF A;  1I4K 1;  3HFO A;  1MMN A;  5D7U A;  4LD6 A;  1GFD A;  1QVG P;  2E64 A;  4IIM A;  5IHN A;  1VQK Q;  1NJI R;  2NWM A;  1Q7Y U;  3UA7 A;  2DJQ A;  4M7D A;  2HZY A;  2V26 A;  4PJL A;  4FYX B;  1GBQ A;  4XQ3 A;  1OEB A;  1R0C B;  1YJ9 A;  4BAC A;  3FJ5 A;  5EC7 A;  4M75 D;  2C06 A;  3JRZ A;  4KGX B;  1RAI B;  2DBM A;  4KGZ B;  3HL8 A;  4PJO F;  1PKT A;  1SRM A;  1K73 U;  1NYF A;  4OB2 B;  1WI7 A;  1I1J A;  2DM1 A;  4KT0 E;  3E9F A;  3KFV A;  1JEG A;  1QVP A;  1AT1 B;  3TVT A;  1J3T A;  2CP5 A;  2ED0 A;  3CME A;  4JRI A;  1Q82 U;  4X1V A;  2VAS A;  2DL3 A;  3CCU Q;  2CZ7 B;  1JO8 A;  2DTH A;  2CT4 A;  1RI0 A;  2QQA A;  2QAZ A;  1VQ7 Q;  1YFN A;  2RQR A;  3M4G A;  2LVM A;  2P84 A;  1VQ5 Q;  4HT9 A;  2A3L A;  2AHJ B;  3OSV A;  3CXC P;  2RNA A;  2O9S A;  2LC4 A;  4ZGJ B;  4J6W A;  1IXD A;  4QVZ A;  4HVW A;  4M75 B;  1B34 B;  2LZ6 B;  1MGQ A;  2VVK A;  3OYA A;  1X2K A;  3ZL7 C;  3CCQ Q;  1FMK A;  2RN8 A;  2MMP A;  4RUG A;  4BI4 A;  3P8H A;  1I0C A;  2JT4 A;  4XAX B;  4JLI A;  1M3B A;  3JCM W;  4TVR A;  2KYB A;  2O2O A;  3RKX A;  2KY9 A;  3A8M B;  1H3H A;  5GJW B;  1QWF A;  4PJO G;  1Q82 R;  2RQT A;  1RAG B;  4C5E A;  3LW5 E;  4M75 E;  2AT1 B;  3JCM X;  1KQS P;  1D0X A;  3CD6 T;  4RCB A;  1PSE A;  1VQN A;  2JS0 A;  2D8J A;  3NGP A;  4PLI A;  5J39 A;  2E6Z A;  4ATO A;  3S6W A;  1V76 A;  4DA4 A;  3M0Q A;  1PC0 A;  3HP9 A;  3NMZ C;  3TCJ A;  3E2U A;  3V7C A;  2FL7 A;  3TRE A;  2B8A A;  2VXE A;  3C95 A;  2XHC A;  2HDA A;  4C8Q A;  2J06 A;  1NJI C;  5GMK m;  3G4S Q;  4M77 D;  2EJ9 A;  2DJZ A;  5L23 A;  1QVF S;  2XU8 A;  3UPU A;  3REB B;  2JNG A;  4D6W A;  2F2V A;  2GFU A;  5AT1 B;  3MJX A;  3GPL A;  3AT1 B;  4KUL A;  3I55 Q;  2EYZ A;  1HSQ A;  1T3L A;  4RTW A;  2HSP A;  5GMK h;  3HRT A;  1HD3 A;  1OX9 A;  1NYG A;  3JCM g;  1SSF A;  3VYG A;  1WHG A;  2KT8 A;  4C92 G;  2Z0W A;  5GAM g;  1JJ2 S;  2VKN A;  3S3N A;  2QDL A;  3QDF A;  3CCS T;  2EGA A;  1KC8 C;  3PE0 A;  2LP5 A;  3TQ7 P;  2CP3 A;  5GAM d;  1IRE B;  2DET A;  4IUQ A;  4E7Z A;  1WA7 A;  4HCK A;  2R5A A;  3EGX B;  2DKG A;  2L0A A;  3L2U A;  3RES A;  1YI2 Q;  3CCJ A;  4MML A;  2L2P A;  1N27 A;  2FZG B;  2RO0 A;  4DOV A;  3OSS C;  3QWY A;  2QA4 T;  4M77 B;  1AHJ B;  1W2B S;  2FO0 A;  3HRU A;  2E70 A;  2YRC A;  4M78 A;  3QXE B;  2J05 A;  4PL6 A;  2C0O A;  4F7U B;  3VS7 A;  1K8A U;  3VYH B;  1NLP C;  1GRI A;  3OMC A;  2RJC A;  1Y71 A;  2P0P A;  3CBO A;  4M7A C;  2RJE A;  2CH4 A;  3DKM A;  1N6A A;  2LQN A;  2MWP A;  1QCN A;  4M77 E;  3H9N A;  1YJW T;  2ZPH B;  4R0K A;  2YRD A;  1IGQ A;  3I56 Q;  1KQ2 A;  2A7Y A;  2C0I A;  4F7U E;  1M1K U;  1IB8 A;  2KE9 A;  1GXI E;  4RTT A;  1ZLM A;  5IH2 A;  1H92 A;  2XD0 A;  3CEY A;  1GFC A;  2OTJ Q;  1M1G A;  2JN0 A;  1M3C A;  2R57 A;  2AZS A;  2E12 A;  3OYG A;  3G6E T;  1M2O A;  3M57 A;  3VUZ A;  1YBY A;  4BE1 A;  5KYX A;  3VUB A;  2L5Q A;  1K8A R;  5GAO p;  4OVA A;  2EVR A;  2XI9 A;  2XDD A;  3DLL A;  1PWT A;  4CC7 A;  3OS2 A;  1ABQ A;  2RHU A;  2KGT A;  2ZPF B;  2OJ2 A;  4JRQ A;  2EWN A;  3C12 A;  1K76 A;  1M8M A;  2CRE A;  4GBQ A;  3LGL A;  4OML A;  2O01 E;  5D6X A;  2DYB A;  4F16 A;  5LJ5 h;  3CC2 Q;  1SSH A;  1QVG S;  2D9T A;  3EG9 B;  3WVD B;  1YP5 A;  3OYL A;  9ATC B;  5GAN g;  1VYT A;  2E1H A;  2LCC A;  3CCS A;  2JTF A;  3RIR A;  5GAN d;  3CCV A;  2VV5 A;  2HQE A;  3DLM A;  4OMM A;  1VYV A;  2NYS A;  5GAN 6;  4X34 A;  1X75 C;  2K4Y A;  1ZSZ C;  1WHJ A;  4J9F A;  3SD4 A;  2MWO A;  2YUO A;  4B9X A;  3G71 Q;  5FRM A;  1I07 A;  2YWW A;  2XKO C;  1WJR A;  3MKD A;  1VQM T;  5GAN 5;  1M1F A;  2QA4 A;  2ECZ A;  1HK9 A;  3M53 A;  4C0F A;  3JCM V;  2QQS A;  4CI0 C;  4OB1 B;  4BUG A;  2QI2 A;  4JJN K;  3OW2 S;  2NUT A;  4E47 A;  4PFZ A;  2QEX Q;  2KR3 A;  4JLG A;  1B34 A;  4M75 A;  4KUI A;  4ELZ C;  4Y28 E;  5IHK A;  3QZ9 B;  2BZY A;  4QQG A;  1FXX A;  1KG1 A;  4OMN A;  1YJW A;  1AWO A;  1YIT A;  1YIJ T;  5KYY B;  1FX7 A;  4RTV A;  1QMC A;  4OMF B;  2GFA A;  2M51 A;  2V8I A;  3H8Z A;  5FU7 C;  4MZP A;  3OYC A;  3OYJ A;  5LL6 S;  2CP2 A;  4XTW A;  3T9N A;  1VQL A;  1WHM A;  2V1R A;  4E2F B;  1AVZ C;  1OU8 A;  1PNJ A;  3M5A A;  2WSF E;  4V2S A;  5A0L A;  1TUD A;  2HSE B;  2IIM A;  1R77 A;  4ZTF A;  3FC3 A;  5GAM e;  1K8A C;  2GTO A;  1JU5 C;  2CYZ B;  3I9Q A;  3KBG A;  4N0A A;  5J26 A;  2CSI A;  3CPW A;  4DOW A;  1NEB A;  4A4G A;  1QVF A;  3NPF A;  3N5B B;  5GMK j;  1FYN A;  4Z89 A;  2L3Q A;  4ESR A;  2OTL Q;  1M2V B;  2EYQ A;  1G5V A;  3G7Z A;  2VGN A;  4FYY B;  2QG9 B;  1VQ9 A;  2EFI A;  4J9H A;  3CCR Q;  3E19 A;  4PFP A;  2XMF A;  2E5Q A;  3J80 E;  3F70 A;  2KK4 A;  1IRX A;  1M90 C;  4C0Z A;  1JJ2 A;  2DX1 A;  5FU6 B;  1UJ0 A;  4A53 A;  3L2V A;  3EGX A;  2DER A;  4QKU A;  2FHD A;  3OYH A;  3BFM A;  2BUD A;  2ESW A;  3CQT A;  1FWZ A;  2PUK B;  3WVE B;  2RM4 A;  3OBW A;  4J9G A;  3MEV A;  3JB9 J;  2H8H A;  4M77 A;  3CCM Q;  1Q95 G;  1VQM A;  2YSQ A;  3CCU T;  1T0H A;  1ZBX A;  4DBF A;  4XU0 A;  3A8O B;  1ZSG A;  3JCM f;  3J7A F;  4F7U A;  2KI7 A;  3MPU B;  1O75 A;  4LDW A;  5GAM f;  5IXF A;  1VQ5 T;  4NS5 A;  3V7S A;  2KEA A;  3CC4 T;  4Y92 A;  4M7D F;  1YCY A;  3EG0 A;  3CPF A;  1LNX A;  4LDX A;  4IIO A;  3FDR A;  1H64 1;  1PRM C;  1PHT A;  1SG5 A;  3EAE A;  2LT1 A;  4D8K A;  4AFS C;  3L1A A;  4BE2 A;  1YIJ A;  4KGV B;  3OYY A;  4VUB A;  3PVL A;  2W10 A;  2K7A A;  1T0J A;  1ZUK A;  2AIR B;  5IAY A;  1MV3 A;  2RA2 A;  2RHZ A;  4ZGD B;  3M0U A;  2K5L A;  1WQW A;  3EHR A;  3LH0 A;  2ATC B;  4KH1 B;  2QYZ A;  2BE9 B;  3JB9 F;  1KIK A;  5J3B A;  1TWB A;  4FW2 A;  4AG2 C;  2DFU A;  3PVQ A;  2EYY A;  2HBP A;  4RG8 A;  5GAN e;  1W70 A;  3CME T;  1D0Y A;  3V8K A;  2EKH A;  2FRY A;  1YNZ A;  2D0N A;  3BE3 A;  2K2V A;  1VQ6 T;  1VQK A;  2FZK B;  1A0N B;  1TSF A;  2D6F A;  1R8O B;  2DEU A;  5LJ5 j;  4EMK A;  2CSQ A;  3LYI A;  3GNG A;  4PJO B;  2KXD A;  1ZUY A;  1SRL A;  2GTJ A;  2JXB A;  1W1F A;  2D1X A;  1EX4 A;  4J9E A;  2HNI A;  2DVJ A;  3OYF A;  3ER0 A;  4CC4 B;  1QVG A;  3GF5 A;  4OF1 A;  3FIF A;  4PJN A;  4C5G A;  2X35 A;  1PKS A;  1WNL A;  3QHS A;  1VIE A;  4FL6 A;  2JZ2 A;  2HL5 C;  1HYO A;  1ZA1 B;  2QK0 A;  2W0Z A;  5CO7 A;  2RQW A;  2DXB A;  4PJO C;  2DLP A;  3ZBD A;  3CCU A;  4C8Q F;  5IT9 E;  1TS9 A;  1BBZ A;  1VA7 A;  1G3T A;  5GAN f;  1VQ5 A;  3RR6 A;  2FPE A;  4C0D C;  1VOM A;  3OW2 A;  3VU3 C;  1Q86 C;  4LD9 K;  2BIV A;  3FEO A;  2EJG A;  1QWE A;  2LQW A;  3QJY A;  5CCA A;  1VQ4 Q;  3CCQ A;  4IUT A;  5KYY A;  3URG A;  3BDL A;  1W4S A;  2EJF A;  2PTK A;  1WX6 A;  4IUP A;  2DL8 A;  2KDS A;  3QYH B;  3CXC A;  4N4H A; 
#chains in the Genus database with same CATH homology
 5FLX E;  4IUQ A;  4E7I A;  2OTJ T;  4B9W A;  2XDP A;  4ELY C;  3SWN B;  1MHN A;  2R5A A;  3HPW A;  2QDY B;  4EMH A;  5GAO q;  3CCR A;  3CBM A;  4EMK C;  2F69 A;  2DKG A;  5HKC A;  3L2U A;  3RES A;  4PJO D;  1UEB A;  2P0Q A;  5I2M A;  3WXM B;  3KXT A;  3CCJ A;  4MML A;  2DXC A;  4M7A G;  1N27 A;  3OY9 A;  2F5T X;  2GCX A;  4C92 C;  2RO0 A;  2RK1 A;  1U1T A;  4DOV A;  3OSS C;  2QA4 T;  1WJQ A;  3KUF A;  3INZ A;  4XTX A;  4M77 B;  1AHJ B;  1W2B S;  2FYK A;  2VC8 A;  3HRU A;  1UGQ B;  2E70 A;  4II1 A;  3CCJ T;  2ZPE B;  3PGG A;  4C0G A;  4M78 A;  2DIQ A;  3QXE B;  2V8K A;  2ZPB B;  5A0D A;  4PL6 A;  3OYM A;  3QG1 A;  4F7U B;  2X4W A;  3JB9 D;  1KQ1 A;  1K8A U;  4C8Q G;  4PNO A;  3VYH B;  4XTU A;  1N9S A;  3M54 A;  3Q1J A;  5GAN h;  3CCL A;  1JRI A;  3OMC A;  2RJC A;  4XTV A;  5GAN 4;  2EQU A;  3JCM b;  1Y71 A;  2P0P A;  1VQ6 A;  5AYF A;  3G4S A;  3CBO A;  3AHU A;  4M7A C;  3MO8 A;  3CBP A;  2RJE A;  4ZGE B;  1Q81 C;  2K57 A;  1NPR A;  3DKM A;  1U1S A;  4DQ2 A;  1G3W A;  1N6A A;  2MWP A;  2DZC A;  5CIU A;  3DB3 A;  4M77 E;  1BI2 A;  5GMK l;  1VIF A;  3MP8 A;  1YJW T;  4J7I A;  3HRS A;  3G4S T;  4FU6 A;  2ZPH B;  4EDU A;  3UDC A;  3I55 A;  3TU4 K;  1OZ3 A;  1UB4 A;  5LJ5 f;  3L2R A;  1KQ2 A;  3MP6 A;  2DIG A;  2A7Y A;  3MP1 A;  5DLQ E;  4F7U E;  3EFS A;  4C8Q C;  1M1K U;  3HSB A;  2DVE A;  4A54 A;  2LTO A;  3FLG A;  4QVC A;  5A2Q E;  2DD4 A;  2LX9 A;  2E41 A;  2X4J A;  3OYK A;  3E1S A;  1GXI E;  4C92 F;  3I55 T;  2XD0 A;  3CEY A;  1VQ4 T;  1KD1 C;  1M1G A;  3VJP A;  3RKW A;  3G6E A;  4C92 D;  3C94 A;  4R56 A;  3EFR A;  3QKJ A;  5LJ3 g;  3GP8 A;  3ZEH A;  2JN0 A;  3OS5 A;  2QTX A;  2R57 A;  1XTD A;  4C0D B;  5LJ3 d;  1EIF A;  2E12 A;  3OYG A;  4UC4 A;  3UWN A;  3M57 A;  4GLK A;  3VUZ A;  1YBY A;  4C5I A;  3OYI A;  3G6E T;  4KBM B;  3QJ6 A;  4XTZ A;  3VUB A;  4BE1 A;  2L5Q A;  2CGH A;  3PNW C;  4LDV A;  5GAO p;  3G71 T;  4OVA A;  1S72 A;  5GAN 8;  2LQ8 A;  2XI9 A;  4JS4 A;  3PIO A;  2XDD A;  1K9M U;  2H3J A;  4BY6 B;  4RCC A;  3DLL A;  2DEQ A;  4PJO E;  2VGM A;  3QSU A;  5C0M A;  4M7A D;  4BE0 A;  1YI2 T;  4M78 G;  1UGP B;  3MEW A;  4JS5 A;  1VQ8 A;  4ZTJ A;  2Y4Y A;  3JCM c;  2JOY A;  3OS2 A;  2EQM A;  3VKI A;  2RHU A;  2E6N A;  2ZPI B;  2ZPF B;  2PQW A;  4NL3 A;  3LWI A;  1Q86 U;  4JRQ A;  2EWN A;  3C12 A;  5GAN 3;  3LGL A;  5CK9 A;  4X9D A;  3CPW S;  2L89 A;  2CS7 A;  1VQ7 A;  3M55 A;  4C8Q D;  4OGE A;  3FJP A;  2EQJ A;  2O01 E;  4FT2 A;  2M9U A;  2K5I A;  4N4H A;  1OZ2 A;  2PVO B;  2LDM A;  3CC7 T;  3QPH A;  4OB0 B;  3X26 B;  3PTA A;  4GY5 A;  5D6X A;  4M78 C;  1QP3 A;  2KQW A;  5CQX A;  3ZFJ A;  1BI3 A;  4C92 B;  5LJ5 h;  4HCZ A;  2RI2 A;  3J81 E;  4E7K A;  2WSE E;  1QVG S;  2D9T A;  3NTH A;  3WVD B;  3OYL A;  1LOJ A;  5GAN g;  1VQP A;  3GLX A;  1KC8 U;  3JAM E;  2E1H A;  2LCC A;  3CCS A;  3MHX A;  1DJ7 B;  2JTF A;  3L42 A;  4WF2 A;  5CQY A;  4ZN1 A;  5GAN 7;  3RIR A;  3JB9 I;  5GAN d;  3CCV A;  4OB3 B;  2VV5 A;  3LLR A;  2HQE A;  4RG2 A;  4A4F A;  3DLM A;  3I56 T;  1VQ8 T;  3CCE T;  2OTJ A;  5DM7 R;  3SFM A;  3MEA A;  3O8V A;  4XU1 A;  5GAN 6;  3VV0 A;  1VQP T;  4ZN3 A;  4X34 A;  3JCM d;  1W2B A;  1X75 C;  2K4Y A;  2FVU A;  4OGC A;  2L8D A;  4XTY A;  4M7A B;  2MWO A;  3SD4 A;  5DLO A;  2XDB A;  1OYX A;  2DTO A;  2XK0 A;  4B9X A;  3CCV T;  5FRM A;  3SDZ A;  3M9Q A;  1YHQ T;  4C92 E;  2RHX A;  1WJR A;  2XKO C;  2DXU A;  1VQM T;  5GAN 5;  1BYM A;  3X20 B;  1M1F A;  3BDU A;  2QA4 A;  3BY7 A;  1XOV A;  1M4Z A;  1I81 A;  2HQX A;  2ZZD A;  5GAM j;  1HK9 A;  3M53 A;  4QVD A;  4C0F A;  4HCB A;  2HD0 A;  3JCM V;  2P4T A;  3QBY A;  5CKF A;  2QQS A;  4Y91 A;  5FU6 C;  4CI0 C;  1X6O A;  2OAU A;  2DD5 A;  4OB1 B;  4BUG A;  4LDY A;  4C8Q B;  2QI2 A;  3CMA A;  3S3O A;  3OB9 A;  4JJN K;  4EMG A;  3OW2 S;  4M78 F;  1N8R C;  4M75 F;  3M56 A;  3JCM P;  3QII A;  3OYE A;  1Q7Y C;  1M8V A;  4OP0 A;  4E47 A;  4M75 A;  4JLG A;  1B34 A;  1XQH A;  3LGF A;  3GNF B;  4KUI A;  4M78 D;  3RUX A;  4M7A E;  4MDX A;  4ELZ C;  4Y28 E;  3QZ9 B;  3CMA T;  1OI1 A;  1YJ9 T;  2MAM A;  5GAO l;  4QQG A;  1FXX A;  2EAY A;  3PMI A;  1KG1 A;  2RK2 A;  5GAN 2;  1YJW A;  3MET A;  3V8J A;  1YIJ T;  1YIT A;  1KQS A;  1BI0 A;  1FX7 A;  1JB0 E;  2R58 A;  4J7F A;  3QZ5 B;  4OMF B;  2GFA A;  2VXF A;  1WJS A;  4LDU A;  4C8Q E;  2V8I A;  3H8Z A;  1IZ6 A;  5FU7 C;  1K73 C;  1D3B B;  3QO3 A;  4MZP A;  3X25 B;  3M59 A;  3OYC A;  2GQV A;  3OYJ A;  2DK3 A;  1YIT T;  5LL6 S;  3L2W A;  3JCM Q;  2E10 A;  3A8G B;  1UGR B;  4XTW A;  1BKB A;  3T9N A;  1QW1 A;  1VQ4 A;  1KD1 U;  4HCC A;  3PFS A;  2X4X A;  2L3R A;  2LRQ A;  2Y4X A;  1VQL A;  4EPC A;  4HKE A;  3QUI A;  4HA8 A;  3CC2 T;  5CAI A;  3M5A A;  5C6S A;  2WSF E;  2EQK A;  2P0K A;  2YLC A;  4V2S A;  1X01 A;  1Y96 A;  5A0L A;  1Q82 C;  5HY6 A;  1G3Y A;  2M16 A;  3QYG B;  1VQL T;  4ZTF A;  3FC3 A;  5GAM e;  5LJ5 g;  3QDR B;  1K8A C;  4C5H A;  2F5K A;  3G71 A;  2YLB A;  5GAO r;  2CYZ B;  5LJ5 d;  1M5Q 1;  5DY9 A;  3KBG A;  4N0A A;  5J26 A;  4M78 B;  5KH6 A;  4IUV A;  3PT9 A;  4M7D G;  4MZT A;  4L59 A;  4IUR A;  4FT4 A;  4O5V A;  1YI2 A;  1NPP A;  2RH2 A;  1VUB A;  5A0G A;  3JB9 H;  2ZPG B;  3CPW A;  3S3M A;  1HXD A;  4DOW A;  4A4K A;  5KCH A;  5LJ3 j;  2XIC A;  2G3R A;  4X9C A;  4PKC C;  3H6Z A;  4A4G A;  3OYN A;  3P8D A;  1QVF A;  1LJO A;  2XID A;  4Q5W A;  4RKU E;  3ME9 A;  3N5B B;  4R55 A;  2CKK A;  5GMK j;  3HKS A;  2O4X A;  3OA6 A;  4M75 G;  5L8R E;  5I21 A;  2EYQ A;  1H3Z A;  1WQ7 A;  2KVQ G;  2QQ9 A;  1NJI U;  1G5V A;  5GAO m;  3G7Z A;  2VGN A;  2RI3 A;  2JUF A;  4NL2 A;  2D0Q B;  1VQ9 A;  2EFI A;  5GAO n;  2ZCF B;  1M9S A;  3PIP A;  3CC7 A;  4J5Y A;  5KCO A;  2X4Y A;  4KUD K;  3JSC A;  3A5Z B;  4M78 E;  4P5N A;  4JDS A;  3E19 A;  4J6Y A;  2QEX T;  2E5Q A;  4MZM A;  3BW1 A;  3NTI A;  2KAF A;  1Y07 A;  3J80 E;  3F70 A;  2KK4 A;  1VQ9 T;  4E7L A;  3GIB A;  1U8R A;  1VQO A;  1M90 C;  4C0Z A;  1JJ2 A;  4HT8 A;  2RJD A;  1JBM A;  2KSS A;  4RMO A;  4M75 C;  2YHT A;  5FU6 B;  4A53 A;  3L2V A;  3JB9 G;  3SWN A;  5CKB A;  4MDW A;  2BKD N;  1VQN T;  3I56 A;  2CZ0 B;  2RHY A;  3X28 B;  2FHD A;  2JVV A;  3OYH A;  3BFM A;  2BUD A;  3CCE A;  3M4Y A;  1VQO T;  1K9M C;  4BI8 B;  1BI1 A;  4QQD A;  1FWZ A;  2PUK B;  3WVE B;  2LCL A;  2RM4 A;  3OBW A;  4M77 F;  3MEV A;  4E7J A;  3JB9 J;  1I8F A;  1NE8 A;  4JRP A;  2JTM A;  3HFN A;  4M77 A;  3OQ5 A;  1YHQ A;  2RJF A;  3M58 A;  4IUU A;  4BDY A;  1QP2 A;  5EG2 A;  2RD1 A;  1VQM A;  2MF2 A;  3CCU T;  1ZBX A;  3ASK A;  3CC4 A;  1PSF A;  1WPY A;  1I4K 1;  2CZ6 B;  2VYT A;  3A8O B;  3OBY A;  4XU0 A;  3HFO A;  3JCM f;  4F7U F;  5GAN j;  3J7A F;  4J83 A;  4LD6 A;  1O9S A;  4F7U A;  4BDZ A;  1O75 A;  2E64 A;  2MI6 A;  4LDW A;  5GAM f;  5LJ3 e;  4E7H A;  1YJN T;  1VQ5 T;  4NS5 A;  3DB4 A;  2GF7 A;  3V7S A;  5FU7 B;  3RER A;  3P8B B;  4YTL A;  3CC4 T;  4M7D F;  1Q7Y U;  5GMK e;  5CR2 A;  1YCY A;  3CPF A;  2Y90 A;  1LNX A;  2HAX A;  4M7D A;  1P92 A;  4LDX A;  2LNV A;  3FDR A;  2DAQ A;  1H64 1;  3L2Z A;  2V8J A;  4XQ3 A;  3EAE A;  3V7R A;  1YJ9 A;  4BB7 A;  2DPP B;  2VUB A;  4BAC A;  2LT1 A;  5KE3 A;  4NOY A;  1Y7X A;  4N0A C;  3L1A A;  4BE2 A;  4M75 D;  1YIJ A;  5FRN A;  2C06 A;  3JRZ A;  2CZ1 B;  4QW2 A;  1Q81 U;  4J6X A;  4PJO F;  3OYY A;  3HL8 A;  4VUB A;  3OYB A;  5D6W A;  1K73 U;  2NLU A;  5IAY A;  2OTL T;  1N9R A;  4OB2 B;  4PJO A;  5GMK i;  4L6V 5;  2RA2 A;  1RL2 A;  2I2L A;  2RHZ A;  4QQ6 A;  4ZGD B;  2K5L A;  1WQW A;  2PVG B;  4KT0 E;  3E9F A;  3LH0 A;  3CCR T;  4A4E A;  5D6Y A;  1QVP A;  4Z02 A;  5IN1 A;  4FM4 B;  1ZHI A;  3R6O A;  3CC2 A;  3JB9 F;  1BIA A;  3CXC S;  1G3S A;  3CME A;  4JRI A;  1Q82 U;  1KHC A;  5J3B A;  3JCM J;  2KMT A;  2DO3 A;  2QQR A;  4JUV A;  2HBP A;  2CZ7 B;  2DTH A;  2EKO A;  2XG8 D;  4RG8 A;  5GAN e;  4M77 G;  1RI0 A;  2K3X A;  2QQA A;  3CME T;  2YRV A;  3CCM A;  3A8H B;  3M4G A;  3V8K A;  2LVM A;  3JCM e;  4M7D B;  3JCM h;  4HT9 A;  4N4I A;  2A3L A;  2AHJ B;  3OSV A;  5FRO A;  4F7U G;  1UGS B;  5M9O A;  3SWN C;  5GAM h;  4XU2 A;  3CCL T;  3CCM T;  2K2V A;  1VQ6 T;  3C4S A;  1VQK A;  2LC4 A;  3LWH A;  4ZGJ B;  3LX7 A;  4J6W A;  2IVW A;  4QVZ A;  4M75 B;  1B34 B;  5LJ3 f;  1MGQ A;  3OYA A;  2D6F A;  1R8O B;  2RB6 A;  3MCA B;  4FIB A;  2QQB A;  3FRN A;  3RKY A;  4M77 C;  3SB2 A;  5LJ5 j;  3L2Q A;  4EMK A;  4IKF A;  3LYI A;  3GNG A;  3GOX A;  1VQK T;  2MMP A;  4PJO B;  1NZ9 A;  4BI4 A;  3OYD A;  1KQS S;  2PUO B;  3P8H A;  4M7D E;  4C92 A;  4XAX B;  2PVD B;  4JLI A;  3JCM W;  4TVR A;  2QEX A;  2HNI A;  1M1K C;  3X24 B;  2LQK A;  4O6J A;  3PMT A;  3RKX A;  3OYF A;  1M90 U;  2KY9 A;  3A8M B;  3ER0 A;  2FB7 A;  3CD6 A;  2E65 A;  1QVG A;  4PJO G;  3GF5 A;  4FSX A;  5HK0 A;  4OF1 A;  4C5E A;  1WGS A;  4M7D C;  2IG0 A;  3LW5 E;  3FIF A;  4M75 E;  3UT1 A;  4CRI A;  2DTI A;  3JCM X;  2QXF A;  3FB9 A;  5CVI A;  4C5G A;  3A8L B;  2ZGW A;  2RI5 A;  4M7A F;  2X35 A;  3CD6 T;  4RCB A;  1PSE A;  1VQN A;  3QHS A;  1WNL A;  5I2S A;  2LT4 A;  4PLI A;  5CKE A;  4BD3 A;  5J39 A;  4M7A A;  2E6Z A;  1VIE A;  4FL6 A;  2JZ2 A;  1Y96 B;  4ATO A;  2R5M A;  4MMK A;  4N4G A;  3S6W A;  1S72 T;  5CKD A;  2EIF A;  5CKH A;  4DA4 A;  3E9G A;  5CO7 A;  3OS1 A;  4XU3 A;  3HP9 A;  2DXB A;  3TCJ A;  4PJO C;  4JRK A;  3V7C A;  2FL7 A;  3ZBD A;  3CCU A;  3TRE A;  4C8Q F;  2B8A A;  1I5L A;  5IT9 E;  2DXT A;  2VXE A;  4XK8 E;  3C95 A;  2XHC A;  4J8O A;  1BIB A;  4C8Q A;  4BI3 A;  3OS0 A;  4L5G A;  1KHI A;  3TEE A;  1G3T A;  2PU9 B;  1YJN A;  5GAN f;  1NJI C;  1VQ5 A;  5GMK m;  4M77 D;  2EJ9 A;  2DJZ A;  1QVF S;  1ZQ1 A;  4EMK B;  2XU8 A;  4C0D C;  2K3Y A;  3MEU A;  3VU3 C;  3OW2 A;  3UPU A;  1Q86 C;  5KE2 A;  2JNG A;  2K5F A;  2GFU A;  4D6W A;  2BIV A;  3FEO A;  5HK3 A;  4LD9 K;  2EJG A;  5LJ5 e;  4ME7 A;  1VQ7 T;  3V8L A;  2O4X B;  4PLL A;  2M1H A;  5LJ3 h;  3GPL A;  1XNI A;  4KUL A;  3NFC A;  1N8R U;  3QJY A;  5CCA A;  4BY6 C;  3CCQ A;  4IUT A;  3HRT A;  2WAC A;  5GMK h;  2M0O A;  1TH7 A;  3URG A;  4M7D D;  3BDL A;  1SSF A;  1W4S A;  3JCM g;  3VYG A;  2WSC E;  2DZ9 A;  2EJF A;  4A4H A;  4C92 G;  3OMG A;  1D3B A;  5GAM g;  1JJ2 S;  3HHT B;  3NTK A;  3CCQ T;  4IUP A;  1V29 B;  3S3N A;  2OTL A;  2RHI A;  3RMQ A;  3CCS T;  2KDS A;  3QYH B;  1KC8 C;  3RMS A;  3CXC A;  5GAM d;  1IRE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...