2XKOC

Crystal structure of the complex of ntca with its transcriptional co- activator pipx
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
85
Chain Sequence
ENYLNHPTFGLLYQICSFGSKELFATLYAQRLFFLVAFDARGTRFEPIGRNEARMLVDNRLRQLRRDASLQEYNQLQQVFKQTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLOBAL NITROGEN REGULATOR
publication title Structural Basis for the Regulation of Ntca-Dependent Transcription by Proteins Pipx and Pii.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Transcription
total genus 18
structure length 85
sequence length 86
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12058 DUF3539 Protein of unknown function (DUF3539)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.660 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xkoC01
3N5BB 2XG8D 2XKOC
chains in the Genus database with same CATH superfamily
4A4EA 3OYGA 3L2WA 1BCMA 2EQKA 1T0HA 1VQNQ 1H3HA 4BY6B 1VUBA 5J39A 3SDZA 1WHKA 2O9VA 2PUOB 4NOYA 2D0NA 3M55A 3HFNA 2JJ9A 1UFFA 3X25B 1X6BA 5GMKl 4XTUA 3JCMP 3FC3A 3U23A 3CCQT 1ABOA 2Y4XA 4HVWA 2DL8A 2RHIA 2ZPHB 4C0FA 1OEBA 3VS4A 4M78A 4C92G 1KQSS 2DXBA 2M1HA 5CIUA 3JCMV 2DBMA 2FL7A 1VQLQ 2DEUA 2OTLA 2EQIA 5GAOn 1JRIA 4XTYA 5LJ5f 2B8AA 1OI1A 2QA4A 1Q82R 1NE8A 1BYMA 4ANJA 2ZPIB 2HKNA 3RKYA 4J7FA 4MDWA 3CC2T 4ZGJB 3CCRT 1WI7A 2EQJA 4N0AA 1MNDA 3HFOA 3REAB 4A4HA 5FRNA 2O9SA 4FU6A 3ZL7C 2MOXA 2VKNA 3P8HA 3VYGA 4BI8B 3JCMh 1BKBA 1K73R 1FX7A 2RQTA 4PJNA 3V7SA 1KQ2A 2EPDA 1IZ6A 3VU3C 2KE9A 1U5SA 4JRQA 1VQ4T 3M54A 3CCET 1YJWT 1QWEA 2DJZA 4HCKA 5DY9A 2V26A 1ZSZC 1PD0A 2ATCB 3QJYA 5FU7C 1TXQA 4C92A 2BIVA 4L5GA 1R0CB 1I5LA 2DYBA 3M4YA 3OSVA 2NUZA 3M0RA 3X20B 4OMLA 3JCMX 2PQWA 4KBMB 4M75E 4MDXA 4IUVA 4LXCA 4LN2A 1AD5A 2P0QA 5GMKm 1KD1C 2DLPA 3MKDA 3MP1A 2ESWA 1ZSGA 4FT2A 4AFZC 3OSSC 1PHTA 2DK3A 4M77C 1XNIA 3VS1A 3BW1A 1SHFA 4PJOE 1TWBA 5GMKi 1WFWA 2M9UA 4HVVA 3OW2S 1IB8A 4ZGDB 5GAMf 1BI1A 4M77F 2AK5A 5FU7B 3ULRB 3CMEA 5LJ3j 1EX4A 5LJ3e 1QVFA 2DZ9A 1K0SA 2OAWA 1M90U 4C8QD 2ZGWA 1OQKA 1YI2A 1QW1A 1VQ8A 2L89A 3M56A 1R77A 1IXDA 1PM3A 3A8HB 1W4SA 3JB9G 2COYA 4IIMA 1WXUA 2E10A 1TU0B 2RHZA 5GAN6 3OQ5A 5CVIA 1D3BA 2PNIA 5KYXA 1AWXA 1VIEA 3PIOA 2OTLT 1H92A 4Z89A 1X01A 4RTVA 3I56A 2QA4T 3G6EA 5FU6B 3VRYA 1AHJB 1NLPC 2X3WD 4WCIA 2CSIA 1YJ9Q 3OYIA 4Y28E 3QPHA 2EW3A 2K5IA 1X75C 4J9BA 1Y57A 2IPOB 3EHRA 4E2FB 1M2OA 2RO0A 3V7RA 4F17A 1VQ6T 4L59A 1VYUA 1PKSA 5I11A 2DRMA 2P4TA 2QQ9A 4CRIA 1K9MR 3UA6A 3JCMJ 1YHQQ 4KH0B 2VC8A 3QJ6A 1M1GA 2LTOA 4JJBA 2DRKA 3JCMe 5GAMd 3CCSA 3ER0A 2X35A 5DLQE 2JNGA 3VYHB 2CZ1B 4BE2A 2SEMA 2ENMA 3EFOA 2F5KA 1CKAA 1Z9QA 4FYVB 4PJLA 4QT7A 3CCMA 3M57A 2ZPGB 3T9NA 2J6OA 2MYSA 2DE0X 1K76A 4A63B 3UWNA 4ZN3A 1LVKA 3C94A 1Q81C 1OPKA 1UHFA 8AT1B 4Y92A 2R58A 2W10A 2D8JA 5LJ3g 3CMET 5AT1B 2JUFA 2C0OA 3M58A 4HCCA 2FB7A 3RUXA 4QVCA 1LPLA 3A8MB 1IHVA 4J9EA 2GFUA 2CUDA 1VQ8T 4BI4A 1ABQA 4XU1A 3M0SA 1G5VA 3SWNC 3WVDB 2RHYA 3G4SA 3R6OA 4RTUA 4RCCA 5CQYA 3I55Q 3KFVA 3HTRA 1VQKA 3REBB 3TSZA 1M1FA 2EAYA 1JJ2S 3JCMQ 1UJ0A 3I56T 3A8GB 3G6ET 6AT1B 1YIJQ 2OX7A 3RMSA 2JS0A 2VASA 3EGDB 1M4ZA 4PJOF 1G83A 3C4SA 1VYTA 2PZ1A 1ZLMA 2KK4A 4TVRA 2KRNA 2CZ7B 2RQRA 4DA4A 3VUBA 4ZTJA 2X9HA 1K8AC 4JS4A 1EZZB 1TOVA 1CKBA 1SF9A 2GFAA 3VRZA 3JB9I 4E7HA 1V29B 2KNBB 5IXFA 3I9QA 3LH5A 3M0PA 2YRCA 2E65A 4XU2A 1B07A 2QDYB 3O8VA 1D09B 3JCMg 4M7AC 3QBYA 2HBPA 1C0MA 3G7ZA 2CDTA 1N5ZA 4M7DD 1RADB 4HKEA 3CCST 4B9WA 1C6VX 4M78D 4QQGA 4M7AF 1UGSB 4J83A 3EG9A 5CR2A 4HT9A 5GANd 4M78B 4JJNK 1T0JA 4ESRA 2K6DA 3QSUA 1M5Q1 2A37A 3CCMT 2DO3A 1KC8C 4F04B 2LNHB 1YJNA 1BIAA 2D1XA 2LJ1A 5KYUA 1G3SA 2O4XA 1NEBA 4X9DA 1I5OB 4OMMA 1KG1A 4F7UA 2LJ0A 1PCXA 3E9FA 1I81A 1H8KA 2HD0A 2DAQA 3CCVA 2YWWA 4GY5A 3CC7A 2Y4YA 4C8QG 3LX7A 4D6WA 3MEWA 2E6ZA 4E7SA 4C92D 2J6KA 1M9SA 5FRMA 1LNXA 3SEMA 3G4ST 4J9GA 4C92B 4X34A 1EFNA 1B34A 2JS2A 1N9RA 4DBQA 2XDBA 1MHNA 1VQKT 3V7CA 1W2BS 1U8RA 3QKJA 3GBQA 1W1FA 1KQSA 4QQ6A 1M27C 2QEXA 4DBRA 3QDFA 3UATA 2YUOA 2P4RA 3AHUA 4C0DB 2RB6A 1BI3A 2DIGA 4WF2A 4JLIA 1VOMA 1RI0A 3Q1JA 1M30A 2DMOA 4C8QA 3CCJT 2LZ6B 1M90R 1Q86C 1TS9A 1YCYA 2NUPA 1R0BG 5LL6S 3QG1A 3VV0A 2KXCA 2RQWA 2DD4A 1KFZA 5L8RE 1D3BB 2EGCA 5KYXB 1OZ2A 2KRSA 2MMPA 4JRKA 1YJNT 3A1PA 3OS2A 5CKBA 3NGPA 2EYZA 3CXCP 4FW2A 1T3LA 2X4YA 2K9GA 1M1KC 4IURA 1UGVA 2QXFA 2CSQA 4FIBA 3L2RA 1JXMA 3CCUQ 4XTWA 4XU3A 4PLLA 4XQ3A 2V1QA 2BZXA 1NJIU 2JT4A 4J9HA 3MP6A 3QO3A 2B86A 2KI7A 3CC4T 4B6MA 1H641 3CCVT 2QGFB 2ZPBB 3OW2A 1W6XA 1GBRA 5I2MA 3OMGA 1VA7A 2K57A 4EMKA 2HQHA 2COZA 3EG1A 3DB4A 1NLOC 1BI0A 5HCKA 3AT1B 3M4GA 1HXDA 3CBMA 1UJYA 2RJCA 2PVGB 4PNOA 4IIOA 3H0IA 4X9CA 4DQ2A 5KYWA 2J06A 4BDZA 3EFOB 1VQPQ 3E2UA 2OTJA 1MUZA 1OV3A 1UDLA 1VQOQ 1Q7YC 3VJPA 1VQNA 1ACMB 4M77E 1WNLA 1SSFA 2CP3A 1G2BA 4LDYA 4RG8A 4BI3A 1WA7A 1QVFP 3LLRA 2R57A 2JZ2A 2GTJA 3PE0A 1E6GA 3ASKA 1OX9A 4BY6C 4FW1A 3BFMA 2CP0A 4M75G 4HVUA 4O6JA 2E70A 4M7DG 3V8KA 1D0XA 5J26A 2YRVA 4ELZC 3A98A 2A36A 3ME9A 2BUDA 4E7IA 1S72Q 1Y0MA 2X4XA 2ZCFB 4RTYA 1VQLA 4LDVA 2GF7A 1YWOA 4PJJA 2RI2A 2KY9A 2A28A 2JTMA 1HJDA 2HQEA 2ZZDA 3INZA 3OYCA 1MMNA 4NL3A 2NWMA 2QK0A 1Y96A 3RNJA 4JJCA 2MI6A 3GLXA 1X6GA 4IUQA 1Q82C 2BTTA 2VXFA 4GBQA 3PT9A 1UGPB 1WXBA 3OMCA 4M75A 4IKFA 4CC2A 3WXMB 4M7DA 3DLMA 4DBHA 3I5RA 2CUBA 4QKUA 4WTOB 3A8OB 2KQWA 4OB1B 2M16A 2A3LA 3EG9B 1ZUKA 5D6YA 1U3OA 4OB3B 2OTJT 2XIDA 4NS5A 4M4ZA 2CZ6B 2IG0A 1WJRA 4MZPA 5AYFA 1QLYA 2PTKA 2FG0A 4PJMA 4ELYC 4LNPA 1LJOA 3EG3A 1BBZA 1BIBA 4KH1B 1JJ2A 1G3WA 3VUZA 2RM4A 5KYUB 3JCMb 2DTIA 3QHSA 2O4XB 4B9XA 2GNCA 4F7UB 1GFDA 2EGAA 1G8XA 3NPFA 2CP6A 2VGMA 1ZA1B 3QIIA 4FSSA 1QKXA 2QQRA 1PC0A 4CC4B 5KYYA 3H6ZA 3QDRB 2CT4A 2VB6A 3NTHA 1HD3A 3GOXA 2YT6A 2EQUA 3FIFA 5LJ3f 3BDLA 2CYZB 3S6WA 3RDVA 1VQLT 1B34B 3H41A 1AZEA 3CMAQ 4DEXA 3CD6T 2LMJA 4RG2A 4Z02A 3P8DA 1GRIA 1SRMA 2E5QA 4AG1C 2FZGB 1YJ9A 2HZYA 3MO8A 4PL6A 2M51A 2QASA 4ZGEB 3MJXA 3OYLA 5GJVB 5GAOr 1B3QA 2LVMA 3PFSA 1WQWA 5FU6C 4JRIA 5LJ5d 1SSHA 1WXTA 4FM4B 1RUWA 3M0UA 1I1JA 1YHQA 4PLIA 4OMPA 1M8VA 5A0DA 2AHJB 5GAN3 3GNFB 3QXEB 2X51A 2FPFA 2XHCA 3BE3A 4C8QB 4Q5WA 3FB9A 3E19A 2KXDA 3HHTB 1E7OA 4JDSA 5GAN7 2DETA 1YNZA 4QVZA 1VQ6Q 1SEMA 2LCLA 4ME7A 1K9MC 2NUPB 1X43A 3NHNA 4M7AE 1DJ7B 1AEYA 4JUVA 5D7UA 4LD6A 4KUDK 2JTEA 4HA8A 4AFQC 2QYZA 2HCKA 5I21A 3IQLA 1D1CA 3TVTA 2YDLA 1IRXA 1TSFA 4EPCA 5GANh 3V8LA 3JCMf 4EMKC 1UGQB 4CC3A 3SD4A 1GCQC 3CCLQ 1G3YA 2DVJA 1W2BA 1AWJA 2MWOA 2NUTA 2LQ8A 1PRLC 1W70A 4LE9A 1NJIR 4XTZA 3JB9J 1N8RU 5D6WA 2ZAEA 3GPLA 3C0CA 4CC7A 1YITQ 1VQ7Q 2DXTA 4MZTA 7AT1B 2DBKA 4KRTA 4EMKB 2DEQA 2J7IA 3CQTA 3I55A 2F69A 2XDDA 3H8ZA 4O5VA 2MPXC 1ZUUA 4MZMA 1P92A 4IUPA 1YIJA 2E4HA 3NFCA 5KYWB 1Q95G 2HL5C 1KQSP 2FEIA 1YJ9T 1QCOA 4II1A 1VQ9Q 2H3EB 3N5BB 2DYIA 4UC4A 2DD5A 3VS2A 2KAFA 4JPBW 2XD0A 4Z88A 1WDXA 5CKHA 1YHQT 2KDSA 5CK9A 5I2SA 1YI2T 2RH2A 3SHWA 4DBFA 2GTOA 2V8IA 4EMGA 2CS7A 2KBTA 1VQMQ 3FJPA 3EGUA 3BDUA 3LYIA 4J6XA 1ZBXA 4J9CA 4FYXB 1ZUYA 2GCXA 2HNIA 3F70A 4OMFB 3L2UA 2OAUA 3VS0A 4M7DC 1X2KA 1QKWA 2HKQB 2Y90A 2OI3A 5GAMg 2YUQA 3GP8A 4M78C 3CXCS 2CH4A 4KUIA 5KYNA 5M9OA 1RAIB 4Y91A 1QVGS 3PVLA 2JN0A 2NLUA 2K3YA 3RERA 3P8BB 5GANj 4M78F 2DKGA 1Y96B 5GANe 3UPUA 4F7UG 2YUNA 4FT4A 1UEBA 1ZQ1A 2EJGA 1S1NA 4N0AC 4M75D 1QMCA 4C0ZA 2EBPA 3OBWA 4M75B 1M3CA 4M7DB 1K4US 3I55T 4JS5A 1AT1B 2WSFE 5DM7R 4PJOD 3LW5E 4R0KA 1SPKA 2WACA 3E9GA 1YIJT 3EG2A 4FYWB 3TCJA 1KSWA 4Z8AA 2JMCA 4C92C 1YFNA 1NBEB 2BE9B 2HDAA 3OA6A 1MV3A 1MGQA 2AZSA 1GXIE 2LT4A 2D6FA 2A08A 4MMKA 4C92F 1V76A 2MK5A 5A2QE 5D6XA 2AIRB 5EC7A 4A4FA 2D0QB 1H3ZA 1OU8A 2JTFA 1QVFS 4C0DC 2QTXA 2HMAA 2GQVA 2MCNA 4A54A 1TTHB 3MEAA 1JU5C 5KYYB 5GAN8 5IHKA 2Z0WA 2FVUA 2LJ3A 2E12A 1M90C 4RCBA 4C5GA 2OJ2A 3CCJQ 3JAME 1QCFA 1QCNA 2XG8D 1J3TA 4EDUA 1OPLA 2G3RA 4J8OA 3CPWP 3DKMA 3NTKA 2XK0A 1PSEA 4M77G 4J9FA 1RAAB 4XTXA 3KXTA 2ZPEB 2A0FB 2YUPA 1Y71A 1MMAA 2BKDN 4QVDA 2K2MA 2O31A 3EG0A 4JZ4A 3CCUA 2DL5A 5GANg 1RI9A 4BACA 3TEEA 2EYYA 2JMAA 1D0YA 1U1TA 3I5SA 2ZPFB 1VYVA 2QTVA 2RJDA 2P84A 1ZSZA 3PNWC 1IHWA 1JEGA 1TH7A 2ROLA 2QQAA 2H8HA 3OYDA 1TUGB 3GIBA 1WJQA 4KGXB 2RI3A 4XU0A 3CC4Q 3HRSA 1KD1U 2L8DA 1VQPA 2PU9B 4M77A 2L3RA 4N4HA 5FW9A 4LUDA 5GAOm 3L2ZA 1VQOA 2LC4A 5HY6A 3G71Q 2NYSA 1RLQC 2ROTA 3H0FA 3JB9F 4OVAA 2DL7A 5HK3A 3HPWA 1I4K1 5CCAA 1O9SA 2CZ0B 1AWWA 1B7TA 1PRMC 1MV0B 4J5YA 2RK2A 1FXXA 2DJQA 5A0GA 4FYYB 2NUTB 3DB3A 3CC7T 1ARKA 2DTHA 1WYXA 1WHGA 1N8RR 2DFUA 1RAFB 1UGRB 3RMQA 2QAZA 4LDXA 1M2VA 4BB7A 3NMZC 3TQ7P 4RMOA 1D1BA 3D7SB 4AFUC 2E64A 2F5TX 2RHUA 2R5AA 4XTVA 2QG9B 4J9DA 2BE7D 2ECZA 1S72A 1VQ5Q 1O75A 4JLGA 2RJEA 2RPNA 4FCYA 2K5LA 3OYMA 2F2VA 2RK1A 3EH1A 1Y07A 2KSSA 3M53A 3LWHA 3ZFJA 1OU9A 3PVQA 3QUIA 2D9TA 3GNGA 2YRDA 2QEXT 4HCBA 1MNEA 4C8QE 4IUUA 1OULA 3CCUT 2P0KA 1UG1A 5CKEA 5IAYA 5DLOA 2DNUA 3WVEB 1WGSA 3J80E 3X24B 3PMIA 5LJ5h 2D8HA 2DERA 4JJDA 2RF0A 4XAXB 2FRWA 2KYBA 4ATOA 4C5IA 2RD1A 2KYMA 1KHCA 2L3QA 1GL5A 4PJOG 1NYGA 3M59A 2M02A 3J7AF 1VQPT 2J05A 3LGFA 3JB9H 3CCQQ 4XK8E 1VQOT 1WQ7A 1Q81U 4PFZA 3L42A 2PUKB 2JM8A 4EIKA 2CP5A 2CGHA 3HRTA 1X2QA 2HSPA 1RACB 1ZHIA 1W2BP 5CAIA 2DPPB 2COWA 3EHQA 2I2LA 2L5QA 3VS3A 1JO8A 3QYHB 3CC2Q 3CCRQ 3FDRA 1I07A 4M7AG 1M3AA 2P0PA 2XKOC 3TSWA 2HL3A 5IN1A 3SWNA 1K73C 3OYNA 3OBYA 4PK4A 1NPRA 4A4GA 3QZ9B 1X6OA 2DF6A 3TU4K 2V8JA 3X26B 1S72T 3A8LB 4PJOA 3JRZA 5GAMh 1VQ4Q 1E6HA 1V1CA 3L2VA 1TUCA 3CCEQ 1YJWQ 2QQBA 3CMAA 2R5MA 4RTZA 4F7UF 1GCPA 1WLPB 2J6FA 3FJ5A 2DM1A 3JCMc 2EWNA 2VV5A 2H3JA 2K5FA 4QW2A 1VQNT 5C0MA 3MHXA 3PMTA 1YCSB 4AFSC 2C0IA 1K8AU 5CO7A 4BDYA 5IHNA 3CD6Q 2EYQA 2E41A 2A7YA 4MMLA 1JBMA 3CXCA 4M7AA 2JW4A 3CBPA 3NTIA 1PWTA 1QVGA 3OYBA 4YTLA 1XJWB 2MAMA 1M3BA 3PTAA 2EJ9A 2KROA 1YBYA 2F2XA 5IH2A 1VQ6A 1I0CA 2E1HA 2K7AA 1VIFA 3DLLA 3LGLA 1Y7XA 5IHIA 3QWXX 5LJ5j 5LJ5e 4C8QC 1KQ1A 4GLMA 2XDPA 3RKXA 1KC8U 3VS6A 1BB9A 2F1LA 1K9AA 2EQMA 4C8QF 3CCLA 2KGTA 1NPPA 3L2QA 2K2VA 1JQQA 2M0YA 4PFPA 3FEOA 4C5EA 2OTLQ 2DXUA 3RR6A 2YSQA 4M7DE 2AT1B 4LUEA 2X4JA 4PKCC 3RIRA 3OYAA 2QA4Q 4M78E 3HL8A 2EYXA 4P5NA 3VS5A 1NZ9A 5GAOq 3QYGB 1YITA 2XICA 1VQ7A 2E3HA 2KT1A 4JZ3A 4AMCA 1IGQA 1ZSZB 1BCOA 4ZN1A 4DOWA 1RAEB 1N27A 2C0TA 3LWIA 1NJIC 3EH2A 3M0QA 3G1JA 2GGRA 4FL6A 1KIKA 5IT9E 5FWCA 4DOVA 2O88A 2LQWA 3CMAT 1KD1R 3BY7A 4HT8A 2DIQA 5HK0A 4M77D 1BU1A 1VQ9A 4M77B 1AWOA 2ED0A 1KJWA 3OYYA 2EYWA 5GAMj 1K0XA 5LJ3d 5GAMe 1QQJA 4KGZB 3RBBB 4J9IA 3CBOA 4C92E 3VS7A 4AG2C 3HRUA 4OGCA 1AVZC 3M5AA 1N6AA 1Q86U 3OYJA 2JOYA 1WHLA 2DILA 2KR3A 1WIEA 3HP9A 2CP2A 3JV3A 2GQIA 2LQKA 5GAN2 3RESA 3CMEQ 2ABLA 1VQMA 1KK7A 2V1RA 1PNJA 1M2VB 1OYXA 4A4KA 1NEGA 3JCMW 4C5HA 5LJ5g 3EFSA 3EGXA 4OF1A 1FMVA 4OB2B 1RAHB 2CKKA 2L3SA 3MEUA 2RNAA 4E7KA 2KT8A 1YI2Q 1JB0E 4OMNA 1VQ8Q 4OMOA 2QGGA 2QQSA 2WSEE 1A0NB 3OYFA 3CPWS 3OYEA 4J6WA 2DA9A 3CCLT 4K11A 1M1KU 4RTWA 1FWZA 5HKCA 1QP2A 4E7JA 1F1BB 1QP3A 5FROA 4ZTFA 1OZ3A 3M9QA 3META 1D1AA 3I56Q 3G6EQ 1TUDA 1M8MA 3JCMd 5I22A 1AOJA 2DX1A 1QVPA 1YITT 1VQ7T 2C06A 3KBGA 1IREB 4PFOA 5EG2A 2VUBA 2ED1A 2G6FX 2KVQG 2X3XD 5IXBA 3OYKA 3UF4A 5GANf 3R6NA 1GBQA 3OYHA 4F14A 3X28B 2XMFA 4GLKA 1QWFA 3HSBA 4M75C 3CCSQ 2JVVA 2CH4W 2FPDA 2FYKA 3J81E 4R56A 1VQ9T 1Q7YU 3EFRA 1ZX6A 1EIFA 2LRQA 2MWPA 1Q81R 3C12A 1SKUB 4M75F 2RA2A 3TREA 1YN8A 4PJOC 4M7DF 2BZ8A 2JXBA 2DXCA 1UE9A 2KRMA 5CKDA 3CCMQ 1CSKA 4OP0A 3VKIA 5KCHA 1ZA2B 2CREA 3FLGA 3S3NA 3PGGA 3OW2P 2EKOA 1FMKA 4KGVB 1UHCA 2L3PA 4HXJA 4R55A 5FWBA 1FMWA 1WJSA 1VQMT 3SWNB 1TG0A 2LX7A 1MMGA 2YXYA 4KT0E 3CCJA 3O5ZA 3OY9A 4PJOB 3E1SA 2EFIA 1SHGA 2RN8A 2HAXA 1WX6A 2M0OA 4NL2A 2O01E 1YWPA 1KHIA 3KUFA 4OGEA 2I0NA 2FRYA 3MCAB 3G4SQ 1WPYA 2VXEA 1U1SA 1AZGB 3OB9A 1NG2A 5GJWB 4ZNXA 1Q82U 1VQKQ 5FLXE 3ZBDA 1K8AR 2HQXA 4N4IA 4LDUA 4VUBA 4BE0A 2XU8A 2LQNA 4M7AD 4JRPA 5GAOp 3THKA 2RQVA 2SRCA 2E6NA 4M7AB 1K73U 1OX8A 5GAOl 2EKHA 3CC4A 2LDMA 5GMKh 1GFCA 2YLBA 5GAN4 2AZVA 3GF5A 1SRLA 1KC8R 2HBWA 2IIMA 3G71A 1C1AA 3UT1A 2KMTA 2CT3A 3UA7A 2PVDB 3L1AA 2MF2A 2VVKA 2LT1A 1N9SA 1RABB 3EAEA 1YJNQ 3URGA 3MPUB 2W0ZA 2DZCA 3H9NA 1NYFA 2LNVA 4BUGA 4FSXA 4LD9K 3SFMA 1UECA 2RJFA 3FRNA 3RKWA 1NM7A 1SG5A 2IVWA 1VQ5A 1UUEA 2O2OA 1T3SA 1IGUA 3CPFA 2DTOA 3CCVQ 1RLPC 3OS5A 4BD3A 3CC7Q 4ORZA 1N8RC 2LCCA 4OB0B 2LCSA 3OS1A 2MIOA 2AKLA 1LOJA 2F2WA 2VWFA 4F7UE 2VYTA 2CP7A 3V8JA 2EIFA 4J7IA 1IO6A 4E7LA 4J6YA 2AKKA 4QQDA 2L2PA 4RKUE 1MMDA 1R8OB 1JJ2P 3LH0A 2FPEA 1WHJA 1HK9A 1WHMA 1PD1A 2QEXQ 1BI2A 1XOVA 1HYOA 1Q86R 1QVGP 4F16A 3QWYA 1YP5A 2EJFA 4RTTA 1K9MU 2V8KA 2DVEA 4LDWA 5CKFA 9ATCB 1XQHA 4KULA 3EGXB 4D8DA 3JB9D 3CCQA 1FYNA 3S3MA 3S3OA 2QI2A 3A5ZB 2E5KA 2HSEB 2FZCB 1GCQA 2RI5A 2JM9A 1X69A 3G71T 3HKSA 5GMKj 3MP8A 1M1KR 4OMQA 1UB4A 1PSFA 1K1ZA 2FO0A 5GMKe 4V2SA 1PKTA 4A53A 2YHTA 1WHHA 1UTIA 3CEYA 4X1VA 5CQXA 4N4GA 8ATCB 4BE1A 1G3TA 2LP5A 2K79A 5L23A 3CC2A 4AT1B 3CCRA 2E3IA 1Z9ZA 1HSQA 3JSCA 4RTXA 5C6SA 3C95A 2QDLA 1I8FA 2L0AA 2RQUA 3PIPA 1PG5B 4L6V5 3ZEHA 5GAN5 2EGEA 2K3XA 1VQ5T 3I35A 2DL4A 5ECAA 2RHXA 2FZKB 2LX9A 4EMHA 1VQ4A 2XI9A 4CI0C 3CCEA 1YJWA 5KE3A 1X27A 4C0GA 4DEYA 2WSCE 1LCKA 1WZOA 4E7ZA 2X4WA 2K3BA 2GBQA 1ZBJA 3UDCA 1RAGB 3H0HA 1RL2A 2YLCA 1Q7YR 2K4YA 2RMOA 4M78G 4E6RA 5A0LA 2BZYA 4D8KA 5KH6A 5J3BA 1XTDA 2HEQA 3M0TA 3OS0A 4RUGA 1JXOA 1U06A 3SB2A 5KCOA 2FHDA 2PVOB 3EGDA 3CD6A 3QZ5B 2DL3A 3CPWA 2KEAA 5LJ3h 2OTJQ 1BK2A 2EVRA 4HCZA 4IUTA 5KE2A 2VGNA 1D0ZA 1OOTA 4E47A 3MEVA
chains in the Genus database with same CATH topology
3QG1A 4A4EA 2K3YA 3OYGA 3CMAT 3P8BB 5GANj 3RERA 4M78F 3L2WA 2EQKA 3BY7A 3VV0A 4HT8A 2DIQA 1Y96B 2DKGA 5GANe 4F7UG 5HK0A 3UPUA 4M77D 4BY6B 1VUBA 2DD4A 5J39A 5L8RE 4FT4A 3SDZA 1UEBA 1VQ9A 4M77B 1ZQ1A 2EJGA 1D3BB 3OYYA 5GAMj 1OZ2A 4N0AC 4M75D 5LJ3d 2MMPA 5GAMe 2PUOB 4NOYA 4JRKA 4C0ZA 3M55A 1YJNT 3HFNA 3OBWA 4M75B 3OS2A 5CKBA 3X25B 5GMKl 3CBOA 2X4YA 4C92E 4M7DB 4XTUA 3JCMP 3I55T 4JS5A 4IURA 1M1KC 3HRUA 3FC3A 2QXFA 4OGCA 2WSFE 3M5AA 3CCQT 5DM7R 4FIBA 3L2RA 4PJOD 1N6AA 2Y4XA 3LW5E 2RHIA 2ZPHB 4XTWA 4XU3A 4C0FA 4M78A 4PLLA 4XQ3A 4C92G 1Q86U 3OYJA 1KQSS 2JOYA 2DXBA 1NJIU 2M1HA 2WACA 5CIUA 3E9GA 3JCMV 3MP6A 1YIJT 3HP9A 3QO3A 3CC4T 3TCJA 1H641 3CCVT 2FL7A 2OTLA 2LQKA 4C92C 2ZPBB 3RESA 5GAN2 5GAOn 3OW2A 1VQMA 1JRIA 4XTYA 5I2MA 5LJ5f 2B8AA 1OI1A 1OYXA 3OA6A 4A4KA 2QA4A 1NE8A 1MGQA 3OMGA 1BYMA 2K57A 2ZPIB 4EMKA 4C5HA 5LJ5g 3JCMW 3RKYA 3EFSA 1GXIE 2LT4A 3DB4A 4OF1A 4OB2B 1BI0A 2CKKA 4MMKA 4C92F 4J7FA 2D6FA 4MDWA 3MEUA 4ZGJB 3CC2T 3CCRT 3M4GA 4E7KA 2EQJA 4N0AA 1JB0E 3HFOA 1HXDA 4A4HA 5A2QE 5FRNA 5D6XA 4FU6A 3CBMA 3P8HA 5LL6S 3VYGA 2RJCA 4BI8B 2PVGB 2QQSA 2D0QB 2WSEE 4PNOA 3JCMh 4A4FA 3OYFA 1BKBA 3CPWS 2JTFA 4X9CA 1QVFS 1H3ZA 1FX7A 3OYEA 4J6WA 4DQ2A 3V7SA 3CCLT 1M1KU 1KQ2A 4BDZA 4C0DC 1IZ6A 2QTXA 1FWZA 3VU3C 5HKCA 1QP2A 2GQVA 2OTJA 4E7JA 4JRQA 1VQ4T 1QP3A 3M54A 3CCET 4A54A 3MEAA 1YJWT 5FROA 1Q7YC 2DJZA 4ZTFA 1OZ3A 3M9QA 3META 5DY9A 3VJPA 5GAN8 3QJYA 5FU7C 1VQNA 2FVUA 4C92A 3JCMd 2BIVA 2E12A 1QVPA 4L5GA 4M77E 4RCBA 3M4YA 4C5GA 1M90C 1WNLA 1I5LA 3JAME 1YITT 1VQ7T 1SSFA 3OSVA 2XG8D 4LDYA 2C06A 4EDUA 3KBGA 4RG8A 2G3RA 4J8OA 4BI3A 1IREB 3X20B 3DKMA 3LLRA 2R57A 2XK0A 1PSEA 3NTKA 5EG2A 3JCMX 2PQWA 4M77G 4KBMB 2VUBA 4M75E 4XTXA 2ZPEB 3KXTA 4MDXA 4IUVA 2JZ2A 1KD1C 2P0QA 5GMKm 1Y71A 2KVQG 3ASKA 2BKDN 3MP1A 4BY6C 4QVDA 3OYKA 4FT2A 3BFMA 3OSSC 5GANf 2DK3A 4M77C 4M75G 4O6JA 1XNIA 3CCUA 3OYHA 2E70A 3X28B 3BW1A 5GANg 4M7DG 3V8KA 4GLKA 4PJOE 5J26A 2YRVA 4ELZC 4BACA 5GMKi 3ME9A 3TEEA 2BUDA 3HSBA 2M9UA 4E7IA 3OW2S 4M75C 4ZGDB 1U1TA 1BI1A 2X4XA 2ZCFB 4M77F 5GAMf 1VQLA 4LDVA 2GF7A 2JVVA 2ZPFB 5FU7B 2FYKA 3J81E 4R56A 3CMEA 1VQ9T 2RI2A 2KY9A 2RJDA 3EFRA 1Q7YU 5LJ3j 3PNWC 1EIFA 2LRQA 2MWPA 3C12A 5LJ3e 1QVFA 2DZ9A 2JTMA 4M75F 2RA2A 3TREA 1TH7A 2QQAA 4M7DF 1M90U 2HQEA 4PJOC 2ZZDA 4C8QD 2DXCA 2ZGWA 3INZA 3OYDA 1YI2A 3GIBA 1QW1A 5CKDA 3OYCA 1VQ8A 2L89A 3M56A 4NL3A 1WJQA 4OP0A 3VKIA 2RI3A 3A8HB 1W4SA 5KCHA 4XU0A 3JB9G 1Y96A 2MI6A 3HRSA 3GLXA 1KD1U 3FLGA 3S3NA 3PGGA 4IUQA 2L8DA 2EKOA 2E10A 5GAN6 2RHZA 1VQPA 1Q82C 2PU9B 2VXFA 4M77A 2L3RA 3OQ5A 4N4HA 5CVIA 4R55A 3PT9A 5GAOm 1D3BA 3L2ZA 1UGPB 1VIEA 3PIOA 1VQOA 2OTLT 1X01A 1WJSA 2LC4A 1VQMT 5HY6A 3OMCA 3SWNB 4M75A 3I56A 2QA4T 4IKFA 3G6EA 5FU6B 3JB9F 4OVAA 3WXMB 4M7DA 4KT0E 3DLMA 5HK3A 3HPWA 1AHJB 1I4K1 3CCJA 5CCAA 1O9SA 2CZ0B 4Y28E 3QPHA 3OY9A 3OYIA 2K5IA 4PJOB 3E1SA 1X75C 2EFIA 4J5YA 2RK2A 1FXXA 3A8OB 5A0GA 2HAXA 2KQWA 4OB1B 2M16A 2RO0A 2M0OA 3DB3A 4NL2A 3V7RA 3CC7T 2DTHA 2A3LA 2O01E 1VQ6T 1KHIA 3KUFA 4L59A 4OGEA 5D6YA 1UGRB 3MCAB 1WPYA 2P4TA 2QQ9A 4CRIA 4OB3B 2VXEA 2XIDA 3RMQA 2OTJT 4NS5A 4LDXA 3JCMJ 4BB7A 1U1SA 2CZ6B 2IG0A 4RMOA 1WJRA 4MZPA 5AYFA 3OB9A 2E64A 2F5TX 2RHUA 2VC8A 3QJ6A 1Q82U 1M1GA 2R5AA 4XTVA 5FLXE 3ZBDA 4ELYC 2HQXA 2LTOA 4N4IA 1LJOA 4LDUA 1S72A 1BIBA 3JCMe 1O75A 4JLGA 2RJEA 4VUBA 5GAMd 3CCSA 1JJ2A 1G3WA 3VUZA 4BE0A 2K5LA 2RM4A 2X35A 2XU8A 3ER0A 3OYMA 3JCMb 5DLQE 2RK1A 4M7AD 1Y07A 4JRPA 2DTIA 3QHSA 2JNGA 2O4XB 2KSSA 3VYHB 4B9XA 5GAOp 2CZ1B 3M53A 3LWHA 4BE2A 2E6NA 3ZFJA 4M7AB 1K73U 3QUIA 5GAOl 4F7UB 2D9TA 3GNGA 2F5KA 2QEXT 4HCBA 3CCMA 2VGMA 3M57A 2ZPGB 3QIIA 3T9NA 4C8QE 2QQRA 4IUUA 3CC4A 2LDMA 3UWNA 4ZN3A 5GMKh 3CCUT 3H6ZA 3QDRB 2P0KA 2YLBA 3NTHA 5GAN4 3C94A 5CKEA 5IAYA 5DLOA 1Q81C 3GOXA 2EQUA 3FIFA 3GF5A 5LJ3f 3BDLA 2CYZB 3WVEB 3S6WA 2R58A 1VQLT 5LJ3g 1WGSA 3CMET 1B34B 3J80E 3X24B 3PMIA 5LJ5h 3G71A 3UT1A 3CD6T 2JUFA 4RG2A 3M58A 4Z02A 3P8DA 2KMTA 2E5QA 4XAXB 4HCCA 1YJ9A 2FB7A 2PVDB 3L1AA 2MF2A 3RUXA 4QVCA 3A8MB 4ATOA 3MO8A 4PL6A 2LT1A 4C5IA 2GFUA 2RD1A 4ZGEB 3OYLA 1VQ8T 1KHCA 5GAOr 4BI4A 1N9SA 4XU1A 2LVMA 3EAEA 3PFSA 3URGA 1G5VA 3SWNC 4PJOG 1WQWA 3WVDB 5FU6C 2RHYA 2DZCA 3M59A 4JRIA 5LJ5d 3G4SA 1VQPT 3R6OA 3J7AF 4FM4B 4RCCA 2LNVA 5CQYA 4BUGA 4FSXA 4LD9K 3LGFA 3SFMA 3JB9H 1YHQA 4PLIA 2RJFA 1M8VA 3FRNA 4XK8E 3RKWA 1VQOT 1WQ7A 2AHJB 5A0DA 5GAN3 1VQKA 1M1FA 1Q81U 3GNFB 2EAYA 3L42A 3QXEB 1JJ2S 2PUKB 3JCMQ 2IVWA 2XHCA 3I56T 3A8GB 3G6ET 1VQ5A 4C8QB 2CGHA 4Q5WA 3HRTA 3FB9A 3CPFA 3E19A 3RMSA 3HHTB 2DTOA 4PJOF 1M4ZA 3OS5A 4BD3A 4JDSA 1ZHIA 5GAN7 3C4SA 5CAIA 1N8RC 4QVZA 2DPPB 2LCCA 4OB0B 2LCLA 4ME7A 3OS1A 1K9MC 4M7AE 1LOJA 1DJ7B 4JUVA 2I2LA 2KK4A 4F7UE 2VYTA 4TVRA 4LD6A 2L5QA 4KUDK 4HA8A 2CZ7B 4DA4A 3V8JA 2EIFA 3VUBA 3QYHB 4ZTJA 4J7IA 1K8AC 3FDRA 5I21A 4JS4A 4E7LA 4J6YA 4M7AG 2P0PA 2GFAA 2XKOC 4EPCA 5GANh 3JB9I 4E7HA 1V29B 4QQDA 4RKUE 5IN1A 3SWNA 3JCMf 3V8LA 1R8OB 1K73C 4EMKC 1UGQB 2E65A 4XU2A 3OYNA 2QDYB 3O8VA 3OBYA 1NPRA 3LH0A 3JCMg 3QZ9B 4A4GA 3SD4A 4M7AC 1G3YA 3QBYA 1X6OA 2HBPA 1HK9A 3TU4K 3G7ZA 2V8JA 3X26B 1S72T 3A8LB 4PJOA 3JRZA 5GAMh 4M7DD 3CCST 4HKEA 4B9WA 1W2BA 3L2VA 2MWOA 1BI2A 2QQBA 1XOVA 2LQ8A 3CMAA 4M78D 4QQGA 4M7AF 2R5MA 1UGSB 4J83A 4F7UF 5CR2A 4HT9A 5GANd 4XTZA 4M78B 4JJNK 3JB9J 3JCMc 1N8RU 3QSUA 2EWNA 1M5Q1 5D6WA 3GPLA 2EJFA 2VV5A 2H3JA 3CCMT 1K9MU 2DO3A 2K5FA 4QW2A 2DXTA 1VQNT 5C0MA 3MHXA 1KC8C 2V8KA 3PMTA 4MZTA 1YJNA 2DVEA 4LDWA 1BIAA 5CKFA 1XQHA 1K8AU 4EMKB 4KULA 2DEQA 5CO7A 4BDYA 3I55A 2EYQA 2F69A 3JB9D 1G3SA 2XDDA 2E41A 3H8ZA 2A7YA 3CCQA 2O4XA 4O5VA 4MMLA 3S3MA 3S3OA 1JBMA 2QI2A 3A5ZB 4X9DA 4MZMA 3CXCA 4M7AA 1P92A 2RI5A 1KG1A 4F7UA 3CBPA 3G71T 3E9FA 3HKSA 1I81A 3NTIA 4IUPA 3MP8A 2HD0A 5GMKj 3OYBA 1YIJA 1UB4A 4YTLA 1QVGA 1PSFA 2MAMA 2DAQA 3NFCA 5GMKe 3CCVA 3PTAA 2EJ9A 4V2SA 4GY5A 3CC7A 1YBYA 2Y4YA 1YJ9T 4A53A 4II1A 1VQ6A 2YHTA 2E1HA 3N5BB 4C8QG 3LX7A 3CEYA 1VIFA 4D6WA 3MEWA 5CQXA 2E6ZA 4N4GA 3DLLA 3LGLA 1Y7XA 4UC4A 4BE1A 1G3TA 4C92D 2DD5A 5LJ5j 2KAFA 1M9SA 3CC2A 2XD0A 5LJ5e 4C8QC 3CCRA 5FRMA 1LNXA 1KQ1A 3G4ST 4C92B 4X34A 2XDPA 3JSCA 1B34A 5C6SA 3RKXA 1KC8U 1N9RA 3C95A 1I8FA 2XDBA 5CKHA 1YHQT 1MHNA 3PIPA 2KDSA 5CK9A 1VQKT 2EQMA 4L6V5 3ZEHA 4C8QF 3V7CA 5I2SA 1YI2T 3CCLA 5GAN5 1W2BS 2RH2A 1U8RA 2K3XA 1NPPA 3QKJA 1VQ5T 3L2QA 2K2VA 2RHXA 3FEOA 2LX9A 4EMHA 1VQ4A 2XI9A 4CI0C 1KQSA 4QQ6A 4C5EA 3CCEA 2DXUA 2QEXA 1YJWA 2V8IA 4EMGA 5KE3A 2CS7A 4M7DE 3RIRA 2X4JA 4PKCC 3OYAA 4C0GA 2WSCE 3FJPA 3AHUA 3BDUA 3HL8A 3LYIA 4M78E 4J6XA 4C0DB 2X4WA 4P5NA 1ZBXA 2RB6A 3UDCA 1BI3A 1NZ9A 2DIGA 5GAOq 3QYGB 1YITA 1RL2A 2XICA 4DOVA 1VQ7A 4WF2A 2YLCA 2K4YA 4JLIA 4M78G 5A0LA 2GCXA 2HNIA 3F70A 1RI0A 4OMFB 5KH6A 3L2UA 3Q1JA 2OAUA 5J3BA 1XTDA 3OS0A 4M7DC 4C8QA 2Y90A 3SB2A 4ZN1A 5KCOA 3CCJT 2FHDA 4DOWA 5GAMg 3GP8A 2PVOB 1Q86C 1N27A 4M78C 3LWIA 3QZ5B 1NJIC 3CD6A 3CXCS 3CPWA 5LJ3h 4KUIA 5M9OA 4Y91A 4FL6A 1YCYA 4HCZA 4IUTA 5KE2A 5IT9E 1QVGS 2VGNA 4E47A 3MEVA 2JN0A 2NLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N5B B;  2XG8 D;  2XKO C; 
#chains in the Genus database with same CATH topology
 4A4E A;  3OYG A;  3L2W A;  1BCM A;  2EQK A;  1T0H A;  1VQN Q;  1H3H A;  4BY6 B;  1VUB A;  5J39 A;  3SDZ A;  1WHK A;  2O9V A;  2PUO B;  4NOY A;  2D0N A;  3M55 A;  3HFN A;  2JJ9 A;  1UFF A;  3X25 B;  1X6B A;  5GMK l;  4XTU A;  3JCM P;  3FC3 A;  3U23 A;  3CCQ T;  1ABO A;  2Y4X A;  4HVW A;  2DL8 A;  2RHI A;  2ZPH B;  4C0F A;  1OEB A;  3VS4 A;  4M78 A;  4C92 G;  1KQS S;  2DXB A;  2M1H A;  5CIU A;  3JCM V;  2DBM A;  2FL7 A;  1VQL Q;  2DEU A;  2OTL A;  2EQI A;  5GAO n;  1JRI A;  4XTY A;  5LJ5 f;  2B8A A;  1OI1 A;  2QA4 A;  1Q82 R;  1NE8 A;  1BYM A;  4ANJ A;  2ZPI B;  2HKN A;  3RKY A;  4J7F A;  4MDW A;  3CC2 T;  4ZGJ B;  3CCR T;  1WI7 A;  2EQJ A;  4N0A A;  1MND A;  3HFO A;  3REA B;  4A4H A;  5FRN A;  2O9S A;  4FU6 A;  3ZL7 C;  2MOX A;  2VKN A;  3P8H A;  3VYG A;  4BI8 B;  3JCM h;  1BKB A;  1K73 R;  1FX7 A;  2RQT A;  4PJN A;  3V7S A;  1KQ2 A;  2EPD A;  1IZ6 A;  3VU3 C;  2KE9 A;  1U5S A;  4JRQ A;  1VQ4 T;  3M54 A;  3CCE T;  1YJW T;  1QWE A;  2DJZ A;  4HCK A;  5DY9 A;  2V26 A;  1ZSZ C;  1PD0 A;  2ATC B;  3QJY A;  5FU7 C;  1TXQ A;  4C92 A;  2BIV A;  4L5G A;  1R0C B;  1I5L A;  2DYB A;  3M4Y A;  3OSV A;  2NUZ A;  3M0R A;  3X20 B;  4OML A;  3JCM X;  2PQW A;  4KBM B;  4M75 E;  4MDX A;  4IUV A;  4LXC A;  4LN2 A;  1AD5 A;  2P0Q A;  5GMK m;  1KD1 C;  2DLP A;  3MKD A;  3MP1 A;  2ESW A;  1ZSG A;  4FT2 A;  4AFZ C;  3OSS C;  1PHT A;  2DK3 A;  4M77 C;  1XNI A;  3VS1 A;  3BW1 A;  1SHF A;  4PJO E;  1TWB A;  5GMK i;  1WFW A;  2M9U A;  4HVV A;  3OW2 S;  1IB8 A;  4ZGD B;  5GAM f;  1BI1 A;  4M77 F;  2AK5 A;  5FU7 B;  3ULR B;  3CME A;  5LJ3 j;  1EX4 A;  5LJ3 e;  1QVF A;  2DZ9 A;  1K0S A;  2OAW A;  1M90 U;  4C8Q D;  2ZGW A;  1OQK A;  1YI2 A;  1QW1 A;  1VQ8 A;  2L89 A;  3M56 A;  1R77 A;  1IXD A;  1PM3 A;  3A8H B;  1W4S A;  3JB9 G;  2COY A;  4IIM A;  1WXU A;  2E10 A;  1TU0 B;  2RHZ A;  5GAN 6;  3OQ5 A;  5CVI A;  1D3B A;  2PNI A;  5KYX A;  1AWX A;  1VIE A;  3PIO A;  2OTL T;  1H92 A;  4Z89 A;  1X01 A;  4RTV A;  3I56 A;  2QA4 T;  3G6E A;  5FU6 B;  3VRY A;  1AHJ B;  1NLP C;  2X3W D;  4WCI A;  2CSI A;  1YJ9 Q;  3OYI A;  4Y28 E;  3QPH A;  2EW3 A;  2K5I A;  1X75 C;  4J9B A;  1Y57 A;  2IPO B;  3EHR A;  4E2F B;  1M2O A;  2RO0 A;  3V7R A;  4F17 A;  1VQ6 T;  4L59 A;  1VYU A;  1PKS A;  5I11 A;  2DRM A;  2P4T A;  2QQ9 A;  4CRI A;  1K9M R;  3UA6 A;  3JCM J;  1YHQ Q;  4KH0 B;  2VC8 A;  3QJ6 A;  1M1G A;  2LTO A;  4JJB A;  2DRK A;  3JCM e;  5GAM d;  3CCS A;  3ER0 A;  2X35 A;  5DLQ E;  2JNG A;  3VYH B;  2CZ1 B;  4BE2 A;  2SEM A;  2ENM A;  3EFO A;  2F5K A;  1CKA A;  1Z9Q A;  4FYV B;  4PJL A;  4QT7 A;  3CCM A;  3M57 A;  2ZPG B;  3T9N A;  2J6O A;  2MYS A;  2DE0 X;  1K76 A;  4A63 B;  3UWN A;  4ZN3 A;  1LVK A;  3C94 A;  1Q81 C;  1OPK A;  1UHF A;  8AT1 B;  4Y92 A;  2R58 A;  2W10 A;  2D8J A;  5LJ3 g;  3CME T;  5AT1 B;  2JUF A;  2C0O A;  3M58 A;  4HCC A;  2FB7 A;  3RUX A;  4QVC A;  1LPL A;  3A8M B;  1IHV A;  4J9E A;  2GFU A;  2CUD A;  1VQ8 T;  4BI4 A;  1ABQ A;  4XU1 A;  3M0S A;  1G5V A;  3SWN C;  3WVD B;  2RHY A;  3G4S A;  3R6O A;  4RTU A;  4RCC A;  5CQY A;  3I55 Q;  3KFV A;  3HTR A;  1VQK A;  3REB B;  3TSZ A;  1M1F A;  2EAY A;  1JJ2 S;  3JCM Q;  1UJ0 A;  3I56 T;  3A8G B;  3G6E T;  6AT1 B;  1YIJ Q;  2OX7 A;  3RMS A;  2JS0 A;  2VAS A;  3EGD B;  1M4Z A;  4PJO F;  1G83 A;  3C4S A;  1VYT A;  2PZ1 A;  1ZLM A;  2KK4 A;  4TVR A;  2KRN A;  2CZ7 B;  2RQR A;  4DA4 A;  3VUB A;  4ZTJ A;  2X9H A;  1K8A C;  4JS4 A;  1EZZ B;  1TOV A;  1CKB A;  1SF9 A;  2GFA A;  3VRZ A;  3JB9 I;  4E7H A;  1V29 B;  2KNB B;  5IXF A;  3I9Q A;  3LH5 A;  3M0P A;  2YRC A;  2E65 A;  4XU2 A;  1B07 A;  2QDY B;  3O8V A;  1D09 B;  3JCM g;  4M7A C;  3QBY A;  2HBP A;  1C0M A;  3G7Z A;  2CDT A;  1N5Z A;  4M7D D;  1RAD B;  4HKE A;  3CCS T;  4B9W A;  1C6V X;  4M78 D;  4QQG A;  4M7A F;  1UGS B;  4J83 A;  3EG9 A;  5CR2 A;  4HT9 A;  5GAN d;  4M78 B;  4JJN K;  1T0J A;  4ESR A;  2K6D A;  3QSU A;  1M5Q 1;  2A37 A;  3CCM T;  2DO3 A;  1KC8 C;  4F04 B;  2LNH B;  1YJN A;  1BIA A;  2D1X A;  2LJ1 A;  5KYU A;  1G3S A;  2O4X A;  1NEB A;  4X9D A;  1I5O B;  4OMM A;  1KG1 A;  4F7U A;  2LJ0 A;  1PCX A;  3E9F A;  1I81 A;  1H8K A;  2HD0 A;  2DAQ A;  3CCV A;  2YWW A;  4GY5 A;  3CC7 A;  2Y4Y A;  4C8Q G;  3LX7 A;  4D6W A;  3MEW A;  2E6Z A;  4E7S A;  4C92 D;  2J6K A;  1M9S A;  5FRM A;  1LNX A;  3SEM A;  3G4S T;  4J9G A;  4C92 B;  4X34 A;  1EFN A;  1B34 A;  2JS2 A;  1N9R A;  4DBQ A;  2XDB A;  1MHN A;  1VQK T;  3V7C A;  1W2B S;  1U8R A;  3QKJ A;  3GBQ A;  1W1F A;  1KQS A;  4QQ6 A;  1M27 C;  2QEX A;  4DBR A;  3QDF A;  3UAT A;  2YUO A;  2P4R A;  3AHU A;  4C0D B;  2RB6 A;  1BI3 A;  2DIG A;  4WF2 A;  4JLI A;  1VOM A;  1RI0 A;  3Q1J A;  1M30 A;  2DMO A;  4C8Q A;  3CCJ T;  2LZ6 B;  1M90 R;  1Q86 C;  1TS9 A;  1YCY A;  2NUP A;  1R0B G;  5LL6 S;  3QG1 A;  3VV0 A;  2KXC A;  2RQW A;  2DD4 A;  1KFZ A;  5L8R E;  1D3B B;  2EGC A;  5KYX B;  1OZ2 A;  2KRS A;  2MMP A;  4JRK A;  1YJN T;  3A1P A;  3OS2 A;  5CKB A;  3NGP A;  2EYZ A;  3CXC P;  4FW2 A;  1T3L A;  2X4Y A;  2K9G A;  1M1K C;  4IUR A;  1UGV A;  2QXF A;  2CSQ A;  4FIB A;  3L2R A;  1JXM A;  3CCU Q;  4XTW A;  4XU3 A;  4PLL A;  4XQ3 A;  2V1Q A;  2BZX A;  1NJI U;  2JT4 A;  4J9H A;  3MP6 A;  3QO3 A;  2B86 A;  2KI7 A;  3CC4 T;  4B6M A;  1H64 1;  3CCV T;  2QGF B;  2ZPB B;  3OW2 A;  1W6X A;  1GBR A;  5I2M A;  3OMG A;  1VA7 A;  2K57 A;  4EMK A;  2HQH A;  2COZ A;  3EG1 A;  3DB4 A;  1NLO C;  1BI0 A;  5HCK A;  3AT1 B;  3M4G A;  1HXD A;  3CBM A;  1UJY A;  2RJC A;  2PVG B;  4PNO A;  4IIO A;  3H0I A;  4X9C A;  4DQ2 A;  5KYW A;  2J06 A;  4BDZ A;  3EFO B;  1VQP Q;  3E2U A;  2OTJ A;  1MUZ A;  1OV3 A;  1UDL A;  1VQO Q;  1Q7Y C;  3VJP A;  1VQN A;  1ACM B;  4M77 E;  1WNL A;  1SSF A;  2CP3 A;  1G2B A;  4LDY A;  4RG8 A;  4BI3 A;  1WA7 A;  1QVF P;  3LLR A;  2R57 A;  2JZ2 A;  2GTJ A;  3PE0 A;  1E6G A;  3ASK A;  1OX9 A;  4BY6 C;  4FW1 A;  3BFM A;  2CP0 A;  4M75 G;  4HVU A;  4O6J A;  2E70 A;  4M7D G;  3V8K A;  1D0X A;  5J26 A;  2YRV A;  4ELZ C;  3A98 A;  2A36 A;  3ME9 A;  2BUD A;  4E7I A;  1S72 Q;  1Y0M A;  2X4X A;  2ZCF B;  4RTY A;  1VQL A;  4LDV A;  2GF7 A;  1YWO A;  4PJJ A;  2RI2 A;  2KY9 A;  2A28 A;  2JTM A;  1HJD A;  2HQE A;  2ZZD A;  3INZ A;  3OYC A;  1MMN A;  4NL3 A;  2NWM A;  2QK0 A;  1Y96 A;  3RNJ A;  4JJC A;  2MI6 A;  3GLX A;  1X6G A;  4IUQ A;  1Q82 C;  2BTT A;  2VXF A;  4GBQ A;  3PT9 A;  1UGP B;  1WXB A;  3OMC A;  4M75 A;  4IKF A;  4CC2 A;  3WXM B;  4M7D A;  3DLM A;  4DBH A;  3I5R A;  2CUB A;  4QKU A;  4WTO B;  3A8O B;  2KQW A;  4OB1 B;  2M16 A;  2A3L A;  3EG9 B;  1ZUK A;  5D6Y A;  1U3O A;  4OB3 B;  2OTJ T;  2XID A;  4NS5 A;  4M4Z A;  2CZ6 B;  2IG0 A;  1WJR A;  4MZP A;  5AYF A;  1QLY A;  2PTK A;  2FG0 A;  4PJM A;  4ELY C;  4LNP A;  1LJO A;  3EG3 A;  1BBZ A;  1BIB A;  4KH1 B;  1JJ2 A;  1G3W A;  3VUZ A;  2RM4 A;  5KYU B;  3JCM b;  2DTI A;  3QHS A;  2O4X B;  4B9X A;  2GNC A;  4F7U B;  1GFD A;  2EGA A;  1G8X A;  3NPF A;  2CP6 A;  2VGM A;  1ZA1 B;  3QII A;  4FSS A;  1QKX A;  2QQR A;  1PC0 A;  4CC4 B;  5KYY A;  3H6Z A;  3QDR B;  2CT4 A;  2VB6 A;  3NTH A;  1HD3 A;  3GOX A;  2YT6 A;  2EQU A;  3FIF A;  5LJ3 f;  3BDL A;  2CYZ B;  3S6W A;  3RDV A;  1VQL T;  1B34 B;  3H41 A;  1AZE A;  3CMA Q;  4DEX A;  3CD6 T;  2LMJ A;  4RG2 A;  4Z02 A;  3P8D A;  1GRI A;  1SRM A;  2E5Q A;  4AG1 C;  2FZG B;  1YJ9 A;  2HZY A;  3MO8 A;  4PL6 A;  2M51 A;  2QAS A;  4ZGE B;  3MJX A;  3OYL A;  5GJV B;  5GAO r;  1B3Q A;  2LVM A;  3PFS A;  1WQW A;  5FU6 C;  4JRI A;  5LJ5 d;  1SSH A;  1WXT A;  4FM4 B;  1RUW A;  3M0U A;  1I1J A;  1YHQ A;  4PLI A;  4OMP A;  1M8V A;  5A0D A;  2AHJ B;  5GAN 3;  3GNF B;  3QXE B;  2X51 A;  2FPF A;  2XHC A;  3BE3 A;  4C8Q B;  4Q5W A;  3FB9 A;  3E19 A;  2KXD A;  3HHT B;  1E7O A;  4JDS A;  5GAN 7;  2DET A;  1YNZ A;  4QVZ A;  1VQ6 Q;  1SEM A;  2LCL A;  4ME7 A;  1K9M C;  2NUP B;  1X43 A;  3NHN A;  4M7A E;  1DJ7 B;  1AEY A;  4JUV A;  5D7U A;  4LD6 A;  4KUD K;  2JTE A;  4HA8 A;  4AFQ C;  2QYZ A;  2HCK A;  5I21 A;  3IQL A;  1D1C A;  3TVT A;  2YDL A;  1IRX A;  1TSF A;  4EPC A;  5GAN h;  3V8L A;  3JCM f;  4EMK C;  1UGQ B;  4CC3 A;  3SD4 A;  1GCQ C;  3CCL Q;  1G3Y A;  2DVJ A;  1W2B A;  1AWJ A;  2MWO A;  2NUT A;  2LQ8 A;  1PRL C;  1W70 A;  4LE9 A;  1NJI R;  4XTZ A;  3JB9 J;  1N8R U;  5D6W A;  2ZAE A;  3GPL A;  3C0C A;  4CC7 A;  1YIT Q;  1VQ7 Q;  2DXT A;  4MZT A;  7AT1 B;  2DBK A;  4KRT A;  4EMK B;  2DEQ A;  2J7I A;  3CQT A;  3I55 A;  2F69 A;  2XDD A;  3H8Z A;  4O5V A;  2MPX C;  1ZUU A;  4MZM A;  1P92 A;  4IUP A;  1YIJ A;  2E4H A;  3NFC A;  5KYW B;  1Q95 G;  2HL5 C;  1KQS P;  2FEI A;  1YJ9 T;  1QCO A;  4II1 A;  1VQ9 Q;  2H3E B;  3N5B B;  2DYI A;  4UC4 A;  2DD5 A;  3VS2 A;  2KAF A;  4JPB W;  2XD0 A;  4Z88 A;  1WDX A;  5CKH A;  1YHQ T;  2KDS A;  5CK9 A;  5I2S A;  1YI2 T;  2RH2 A;  3SHW A;  4DBF A;  2GTO A;  2V8I A;  4EMG A;  2CS7 A;  2KBT A;  1VQM Q;  3FJP A;  3EGU A;  3BDU A;  3LYI A;  4J6X A;  1ZBX A;  4J9C A;  4FYX B;  1ZUY A;  2GCX A;  2HNI A;  3F70 A;  4OMF B;  3L2U A;  2OAU A;  3VS0 A;  4M7D C;  1X2K A;  1QKW A;  2HKQ B;  2Y90 A;  2OI3 A;  5GAM g;  2YUQ A;  3GP8 A;  4M78 C;  3CXC S;  2CH4 A;  4KUI A;  5KYN A;  5M9O A;  1RAI B;  4Y91 A;  1QVG S;  3PVL A;  2JN0 A;  2NLU A;  2K3Y A;  3RER A;  3P8B B;  5GAN j;  4M78 F;  2DKG A;  1Y96 B;  5GAN e;  3UPU A;  4F7U G;  2YUN A;  4FT4 A;  1UEB A;  1ZQ1 A;  2EJG A;  1S1N A;  4N0A C;  4M75 D;  1QMC A;  4C0Z A;  2EBP A;  3OBW A;  4M75 B;  1M3C A;  4M7D B;  1K4U S;  3I55 T;  4JS5 A;  1AT1 B;  2WSF E;  5DM7 R;  4PJO D;  3LW5 E;  4R0K A;  1SPK A;  2WAC A;  3E9G A;  1YIJ T;  3EG2 A;  4FYW B;  3TCJ A;  1KSW A;  4Z8A A;  2JMC A;  4C92 C;  1YFN A;  1NBE B;  2BE9 B;  2HDA A;  3OA6 A;  1MV3 A;  1MGQ A;  2AZS A;  1GXI E;  2LT4 A;  2D6F A;  2A08 A;  4MMK A;  4C92 F;  1V76 A;  2MK5 A;  5A2Q E;  5D6X A;  2AIR B;  5EC7 A;  4A4F A;  2D0Q B;  1H3Z A;  1OU8 A;  2JTF A;  1QVF S;  4C0D C;  2QTX A;  2HMA A;  2GQV A;  2MCN A;  4A54 A;  1TTH B;  3MEA A;  1JU5 C;  5KYY B;  5GAN 8;  5IHK A;  2Z0W A;  2FVU A;  2LJ3 A;  2E12 A;  1M90 C;  4RCB A;  4C5G A;  2OJ2 A;  3CCJ Q;  3JAM E;  1QCF A;  1QCN A;  2XG8 D;  1J3T A;  4EDU A;  1OPL A;  2G3R A;  4J8O A;  3CPW P;  3DKM A;  3NTK A;  2XK0 A;  1PSE A;  4M77 G;  4J9F A;  1RAA B;  4XTX A;  3KXT A;  2ZPE B;  2A0F B;  2YUP A;  1Y71 A;  1MMA A;  2BKD N;  4QVD A;  2K2M A;  2O31 A;  3EG0 A;  4JZ4 A;  3CCU A;  2DL5 A;  5GAN g;  1RI9 A;  4BAC A;  3TEE A;  2EYY A;  2JMA A;  1D0Y A;  1U1T A;  3I5S A;  2ZPF B;  1VYV A;  2QTV A;  2RJD A;  2P84 A;  1ZSZ A;  3PNW C;  1IHW A;  1JEG A;  1TH7 A;  2ROL A;  2QQA A;  2H8H A;  3OYD A;  1TUG B;  3GIB A;  1WJQ A;  4KGX B;  2RI3 A;  4XU0 A;  3CC4 Q;  3HRS A;  1KD1 U;  2L8D A;  1VQP A;  2PU9 B;  4M77 A;  2L3R A;  4N4H A;  5FW9 A;  4LUD A;  5GAO m;  3L2Z A;  1VQO A;  2LC4 A;  5HY6 A;  3G71 Q;  2NYS A;  1RLQ C;  2ROT A;  3H0F A;  3JB9 F;  4OVA A;  2DL7 A;  5HK3 A;  3HPW A;  1I4K 1;  5CCA A;  1O9S A;  2CZ0 B;  1AWW A;  1B7T A;  1PRM C;  1MV0 B;  4J5Y A;  2RK2 A;  1FXX A;  2DJQ A;  5A0G A;  4FYY B;  2NUT B;  3DB3 A;  3CC7 T;  1ARK A;  2DTH A;  1WYX A;  1WHG A;  1N8R R;  2DFU A;  1RAF B;  1UGR B;  3RMQ A;  2QAZ A;  4LDX A;  1M2V A;  4BB7 A;  3NMZ C;  3TQ7 P;  4RMO A;  1D1B A;  3D7S B;  4AFU C;  2E64 A;  2F5T X;  2RHU A;  2R5A A;  4XTV A;  2QG9 B;  4J9D A;  2BE7 D;  2ECZ A;  1S72 A;  1VQ5 Q;  1O75 A;  4JLG A;  2RJE A;  2RPN A;  4FCY A;  2K5L A;  3OYM A;  2F2V A;  2RK1 A;  3EH1 A;  1Y07 A;  2KSS A;  3M53 A;  3LWH A;  3ZFJ A;  1OU9 A;  3PVQ A;  3QUI A;  2D9T A;  3GNG A;  2YRD A;  2QEX T;  4HCB A;  1MNE A;  4C8Q E;  4IUU A;  1OUL A;  3CCU T;  2P0K A;  1UG1 A;  5CKE A;  5IAY A;  5DLO A;  2DNU A;  3WVE B;  1WGS A;  3J80 E;  3X24 B;  3PMI A;  5LJ5 h;  2D8H A;  2DER A;  4JJD A;  2RF0 A;  4XAX B;  2FRW A;  2KYB A;  4ATO A;  4C5I A;  2RD1 A;  2KYM A;  1KHC A;  2L3Q A;  1GL5 A;  4PJO G;  1NYG A;  3M59 A;  2M02 A;  3J7A F;  1VQP T;  2J05 A;  3LGF A;  3JB9 H;  3CCQ Q;  4XK8 E;  1VQO T;  1WQ7 A;  1Q81 U;  4PFZ A;  3L42 A;  2PUK B;  2JM8 A;  4EIK A;  2CP5 A;  2CGH A;  3HRT A;  1X2Q A;  2HSP A;  1RAC B;  1ZHI A;  1W2B P;  5CAI A;  2DPP B;  2COW A;  3EHQ A;  2I2L A;  2L5Q A;  3VS3 A;  1JO8 A;  3QYH B;  3CC2 Q;  3CCR Q;  3FDR A;  1I07 A;  4M7A G;  1M3A A;  2P0P A;  2XKO C;  3TSW A;  2HL3 A;  5IN1 A;  3SWN A;  1K73 C;  3OYN A;  3OBY A;  4PK4 A;  1NPR A;  4A4G A;  3QZ9 B;  1X6O A;  2DF6 A;  3TU4 K;  2V8J A;  3X26 B;  1S72 T;  3A8L B;  4PJO A;  3JRZ A;  5GAM h;  1VQ4 Q;  1E6H A;  1V1C A;  3L2V A;  1TUC A;  3CCE Q;  1YJW Q;  2QQB A;  3CMA A;  2R5M A;  4RTZ A;  4F7U F;  1GCP A;  1WLP B;  2J6F A;  3FJ5 A;  2DM1 A;  3JCM c;  2EWN A;  2VV5 A;  2H3J A;  2K5F A;  4QW2 A;  1VQN T;  5C0M A;  3MHX A;  3PMT A;  1YCS B;  4AFS C;  2C0I A;  1K8A U;  5CO7 A;  4BDY A;  5IHN A;  3CD6 Q;  2EYQ A;  2E41 A;  2A7Y A;  4MML A;  1JBM A;  3CXC A;  4M7A A;  2JW4 A;  3CBP A;  3NTI A;  1PWT A;  1QVG A;  3OYB A;  4YTL A;  1XJW B;  2MAM A;  1M3B A;  3PTA A;  2EJ9 A;  2KRO A;  1YBY A;  2F2X A;  5IH2 A;  1VQ6 A;  1I0C A;  2E1H A;  2K7A A;  1VIF A;  3DLL A;  3LGL A;  1Y7X A;  5IHI A;  3QWX X;  5LJ5 j;  5LJ5 e;  4C8Q C;  1KQ1 A;  4GLM A;  2XDP A;  3RKX A;  1KC8 U;  3VS6 A;  1BB9 A;  2F1L A;  1K9A A;  2EQM A;  4C8Q F;  3CCL A;  2KGT A;  1NPP A;  3L2Q A;  2K2V A;  1JQQ A;  2M0Y A;  4PFP A;  3FEO A;  4C5E A;  2OTL Q;  2DXU A;  3RR6 A;  2YSQ A;  4M7D E;  2AT1 B;  4LUE A;  2X4J A;  4PKC C;  3RIR A;  3OYA A;  2QA4 Q;  4M78 E;  3HL8 A;  2EYX A;  4P5N A;  3VS5 A;  1NZ9 A;  5GAO q;  3QYG B;  1YIT A;  2XIC A;  1VQ7 A;  2E3H A;  2KT1 A;  4JZ3 A;  4AMC A;  1IGQ A;  1ZSZ B;  1BCO A;  4ZN1 A;  4DOW A;  1RAE B;  1N27 A;  2C0T A;  3LWI A;  1NJI C;  3EH2 A;  3M0Q A;  3G1J A;  2GGR A;  4FL6 A;  1KIK A;  5IT9 E;  5FWC A;  4DOV A;  2O88 A;  2LQW A;  3CMA T;  1KD1 R;  3BY7 A;  4HT8 A;  2DIQ A;  5HK0 A;  4M77 D;  1BU1 A;  1VQ9 A;  4M77 B;  1AWO A;  2ED0 A;  1KJW A;  3OYY A;  2EYW A;  5GAM j;  1K0X A;  5LJ3 d;  5GAM e;  1QQJ A;  4KGZ B;  3RBB B;  4J9I A;  3CBO A;  4C92 E;  3VS7 A;  4AG2 C;  3HRU A;  4OGC A;  1AVZ C;  3M5A A;  1N6A A;  1Q86 U;  3OYJ A;  2JOY A;  1WHL A;  2DIL A;  2KR3 A;  1WIE A;  3HP9 A;  2CP2 A;  3JV3 A;  2GQI A;  2LQK A;  5GAN 2;  3RES A;  3CME Q;  2ABL A;  1VQM A;  1KK7 A;  2V1R A;  1PNJ A;  1M2V B;  1OYX A;  4A4K A;  1NEG A;  3JCM W;  4C5H A;  5LJ5 g;  3EFS A;  3EGX A;  4OF1 A;  1FMV A;  4OB2 B;  1RAH B;  2CKK A;  2L3S A;  3MEU A;  2RNA A;  4E7K A;  2KT8 A;  1YI2 Q;  1JB0 E;  4OMN A;  1VQ8 Q;  4OMO A;  2QGG A;  2QQS A;  2WSE E;  1A0N B;  3OYF A;  3CPW S;  3OYE A;  4J6W A;  2DA9 A;  3CCL T;  4K11 A;  1M1K U;  4RTW A;  1FWZ A;  5HKC A;  1QP2 A;  4E7J A;  1F1B B;  1QP3 A;  5FRO A;  4ZTF A;  1OZ3 A;  3M9Q A;  3MET A;  1D1A A;  3I56 Q;  3G6E Q;  1TUD A;  1M8M A;  3JCM d;  5I22 A;  1AOJ A;  2DX1 A;  1QVP A;  1YIT T;  1VQ7 T;  2C06 A;  3KBG A;  1IRE B;  4PFO A;  5EG2 A;  2VUB A;  2ED1 A;  2G6F X;  2KVQ G;  2X3X D;  5IXB A;  3OYK A;  3UF4 A;  5GAN f;  3R6N A;  1GBQ A;  3OYH A;  4F14 A;  3X28 B;  2XMF A;  4GLK A;  1QWF A;  3HSB A;  4M75 C;  3CCS Q;  2JVV A;  2CH4 W;  2FPD A;  2FYK A;  3J81 E;  4R56 A;  1VQ9 T;  1Q7Y U;  3EFR A;  1ZX6 A;  1EIF A;  2LRQ A;  2MWP A;  1Q81 R;  3C12 A;  1SKU B;  4M75 F;  2RA2 A;  3TRE A;  1YN8 A;  4PJO C;  4M7D F;  2BZ8 A;  2JXB A;  2DXC A;  1UE9 A;  2KRM A;  5CKD A;  3CCM Q;  1CSK A;  4OP0 A;  3VKI A;  5KCH A;  1ZA2 B;  2CRE A;  3FLG A;  3S3N A;  3PGG A;  3OW2 P;  2EKO A;  1FMK A;  4KGV B;  1UHC A;  2L3P A;  4HXJ A;  4R55 A;  5FWB A;  1FMW A;  1WJS A;  1VQM T;  3SWN B;  1TG0 A;  2LX7 A;  1MMG A;  2YXY A;  4KT0 E;  3CCJ A;  3O5Z A;  3OY9 A;  4PJO B;  3E1S A;  2EFI A;  1SHG A;  2RN8 A;  2HAX A;  1WX6 A;  2M0O A;  4NL2 A;  2O01 E;  1YWP A;  1KHI A;  3KUF A;  4OGE A;  2I0N A;  2FRY A;  3MCA B;  3G4S Q;  1WPY A;  2VXE A;  1U1S A;  1AZG B;  3OB9 A;  1NG2 A;  5GJW B;  4ZNX A;  1Q82 U;  1VQK Q;  5FLX E;  3ZBD A;  1K8A R;  2HQX A;  4N4I A;  4LDU A;  4VUB A;  4BE0 A;  2XU8 A;  2LQN A;  4M7A D;  4JRP A;  5GAO p;  3THK A;  2RQV A;  2SRC A;  2E6N A;  4M7A B;  1K73 U;  1OX8 A;  5GAO l;  2EKH A;  3CC4 A;  2LDM A;  5GMK h;  1GFC A;  2YLB A;  5GAN 4;  2AZV A;  3GF5 A;  1SRL A;  1KC8 R;  2HBW A;  2IIM A;  3G71 A;  1C1A A;  3UT1 A;  2KMT A;  2CT3 A;  3UA7 A;  2PVD B;  3L1A A;  2MF2 A;  2VVK A;  2LT1 A;  1N9S A;  1RAB B;  3EAE A;  1YJN Q;  3URG A;  3MPU B;  2W0Z A;  2DZC A;  3H9N A;  1NYF A;  2LNV A;  4BUG A;  4FSX A;  4LD9 K;  3SFM A;  1UEC A;  2RJF A;  3FRN A;  3RKW A;  1NM7 A;  1SG5 A;  2IVW A;  1VQ5 A;  1UUE A;  2O2O A;  1T3S A;  1IGU A;  3CPF A;  2DTO A;  3CCV Q;  1RLP C;  3OS5 A;  4BD3 A;  3CC7 Q;  4ORZ A;  1N8R C;  2LCC A;  4OB0 B;  2LCS A;  3OS1 A;  2MIO A;  2AKL A;  1LOJ A;  2F2W A;  2VWF A;  4F7U E;  2VYT A;  2CP7 A;  3V8J A;  2EIF A;  4J7I A;  1IO6 A;  4E7L A;  4J6Y A;  2AKK A;  4QQD A;  2L2P A;  4RKU E;  1MMD A;  1R8O B;  1JJ2 P;  3LH0 A;  2FPE A;  1WHJ A;  1HK9 A;  1WHM A;  1PD1 A;  2QEX Q;  1BI2 A;  1XOV A;  1HYO A;  1Q86 R;  1QVG P;  4F16 A;  3QWY A;  1YP5 A;  2EJF A;  4RTT A;  1K9M U;  2V8K A;  2DVE A;  4LDW A;  5CKF A;  9ATC B;  1XQH A;  4KUL A;  3EGX B;  4D8D A;  3JB9 D;  3CCQ A;  1FYN A;  3S3M A;  3S3O A;  2QI2 A;  3A5Z B;  2E5K A;  2HSE B;  2FZC B;  1GCQ A;  2RI5 A;  2JM9 A;  1X69 A;  3G71 T;  3HKS A;  5GMK j;  3MP8 A;  1M1K R;  4OMQ A;  1UB4 A;  1PSF A;  1K1Z A;  2FO0 A;  5GMK e;  4V2S A;  1PKT A;  4A53 A;  2YHT A;  1WHH A;  1UTI A;  3CEY A;  4X1V A;  5CQX A;  4N4G A;  8ATC B;  4BE1 A;  1G3T A;  2LP5 A;  2K79 A;  5L23 A;  3CC2 A;  4AT1 B;  3CCR A;  2E3I A;  1Z9Z A;  1HSQ A;  3JSC A;  4RTX A;  5C6S A;  3C95 A;  2QDL A;  1I8F A;  2L0A A;  2RQU A;  3PIP A;  1PG5 B;  4L6V 5;  3ZEH A;  5GAN 5;  2EGE A;  2K3X A;  1VQ5 T;  3I35 A;  2DL4 A;  5ECA A;  2RHX A;  2FZK B;  2LX9 A;  4EMH A;  1VQ4 A;  2XI9 A;  4CI0 C;  3CCE A;  1YJW A;  5KE3 A;  1X27 A;  4C0G A;  4DEY A;  2WSC E;  1LCK A;  1WZO A;  4E7Z A;  2X4W A;  2K3B A;  2GBQ A;  1ZBJ A;  3UDC A;  1RAG B;  3H0H A;  1RL2 A;  2YLC A;  1Q7Y R;  2K4Y A;  2RMO A;  4M78 G;  4E6R A;  5A0L A;  2BZY A;  4D8K A;  5KH6 A;  5J3B A;  1XTD A;  2HEQ A;  3M0T A;  3OS0 A;  4RUG A;  1JXO A;  1U06 A;  3SB2 A;  5KCO A;  2FHD A;  2PVO B;  3EGD A;  3CD6 A;  3QZ5 B;  2DL3 A;  3CPW A;  2KEA A;  5LJ3 h;  2OTJ Q;  1BK2 A;  2EVR A;  4HCZ A;  4IUT A;  5KE2 A;  2VGN A;  1D0Z A;  1OOT A;  4E47 A;  3MEV A; 
#chains in the Genus database with same CATH homology
 3QG1 A;  4A4E A;  2K3Y A;  3OYG A;  3CMA T;  3P8B B;  5GAN j;  3RER A;  4M78 F;  3L2W A;  2EQK A;  3BY7 A;  3VV0 A;  4HT8 A;  2DIQ A;  1Y96 B;  2DKG A;  5GAN e;  4F7U G;  5HK0 A;  3UPU A;  4M77 D;  4BY6 B;  1VUB A;  2DD4 A;  5J39 A;  5L8R E;  4FT4 A;  3SDZ A;  1UEB A;  1VQ9 A;  4M77 B;  1ZQ1 A;  2EJG A;  1D3B B;  3OYY A;  5GAM j;  1OZ2 A;  4N0A C;  4M75 D;  5LJ3 d;  2MMP A;  5GAM e;  2PUO B;  4NOY A;  4JRK A;  4C0Z A;  3M55 A;  1YJN T;  3HFN A;  3OBW A;  4M75 B;  3OS2 A;  5CKB A;  3X25 B;  5GMK l;  3CBO A;  2X4Y A;  4C92 E;  4M7D B;  4XTU A;  3JCM P;  3I55 T;  4JS5 A;  4IUR A;  1M1K C;  3HRU A;  3FC3 A;  2QXF A;  4OGC A;  2WSF E;  3M5A A;  3CCQ T;  5DM7 R;  4FIB A;  3L2R A;  4PJO D;  1N6A A;  2Y4X A;  3LW5 E;  2RHI A;  2ZPH B;  4XTW A;  4XU3 A;  4C0F A;  4M78 A;  4PLL A;  4XQ3 A;  4C92 G;  1Q86 U;  3OYJ A;  1KQS S;  2JOY A;  2DXB A;  1NJI U;  2M1H A;  2WAC A;  5CIU A;  3E9G A;  3JCM V;  3MP6 A;  1YIJ T;  3HP9 A;  3QO3 A;  3CC4 T;  3TCJ A;  1H64 1;  3CCV T;  2FL7 A;  2OTL A;  2LQK A;  4C92 C;  2ZPB B;  3RES A;  5GAN 2;  5GAO n;  3OW2 A;  1VQM A;  1JRI A;  4XTY A;  5I2M A;  5LJ5 f;  2B8A A;  1OI1 A;  1OYX A;  3OA6 A;  4A4K A;  2QA4 A;  1NE8 A;  1MGQ A;  3OMG A;  1BYM A;  2K57 A;  2ZPI B;  4EMK A;  4C5H A;  5LJ5 g;  3JCM W;  3RKY A;  3EFS A;  1GXI E;  2LT4 A;  3DB4 A;  4OF1 A;  4OB2 B;  1BI0 A;  2CKK A;  4MMK A;  4C92 F;  4J7F A;  2D6F A;  4MDW A;  3MEU A;  4ZGJ B;  3CC2 T;  3CCR T;  3M4G A;  4E7K A;  2EQJ A;  4N0A A;  1JB0 E;  3HFO A;  1HXD A;  4A4H A;  5A2Q E;  5FRN A;  5D6X A;  4FU6 A;  3CBM A;  3P8H A;  5LL6 S;  3VYG A;  2RJC A;  4BI8 B;  2PVG B;  2QQS A;  2D0Q B;  2WSE E;  4PNO A;  3JCM h;  4A4F A;  3OYF A;  1BKB A;  3CPW S;  2JTF A;  4X9C A;  1QVF S;  1H3Z A;  1FX7 A;  3OYE A;  4J6W A;  4DQ2 A;  3V7S A;  3CCL T;  1M1K U;  1KQ2 A;  4BDZ A;  4C0D C;  1IZ6 A;  2QTX A;  1FWZ A;  3VU3 C;  5HKC A;  1QP2 A;  2GQV A;  2OTJ A;  4E7J A;  4JRQ A;  1VQ4 T;  1QP3 A;  3M54 A;  3CCE T;  4A54 A;  3MEA A;  1YJW T;  5FRO A;  1Q7Y C;  2DJZ A;  4ZTF A;  1OZ3 A;  3M9Q A;  3MET A;  5DY9 A;  3VJP A;  5GAN 8;  3QJY A;  5FU7 C;  1VQN A;  2FVU A;  4C92 A;  3JCM d;  2BIV A;  2E12 A;  1QVP A;  4L5G A;  4M77 E;  4RCB A;  3M4Y A;  4C5G A;  1M90 C;  1WNL A;  1I5L A;  3JAM E;  1YIT T;  1VQ7 T;  1SSF A;  3OSV A;  2XG8 D;  4LDY A;  2C06 A;  4EDU A;  3KBG A;  4RG8 A;  2G3R A;  4J8O A;  4BI3 A;  1IRE B;  3X20 B;  3DKM A;  3LLR A;  2R57 A;  2XK0 A;  1PSE A;  3NTK A;  5EG2 A;  3JCM X;  2PQW A;  4M77 G;  4KBM B;  2VUB A;  4M75 E;  4XTX A;  2ZPE B;  3KXT A;  4MDX A;  4IUV A;  2JZ2 A;  1KD1 C;  2P0Q A;  5GMK m;  1Y71 A;  2KVQ G;  3ASK A;  2BKD N;  3MP1 A;  4BY6 C;  4QVD A;  3OYK A;  4FT2 A;  3BFM A;  3OSS C;  5GAN f;  2DK3 A;  4M77 C;  4M75 G;  4O6J A;  1XNI A;  3CCU A;  3OYH A;  2E70 A;  3X28 B;  3BW1 A;  5GAN g;  4M7D G;  3V8K A;  4GLK A;  4PJO E;  5J26 A;  2YRV A;  4ELZ C;  4BAC A;  5GMK i;  3ME9 A;  3TEE A;  2BUD A;  3HSB A;  2M9U A;  4E7I A;  3OW2 S;  4M75 C;  4ZGD B;  1U1T A;  1BI1 A;  2X4X A;  2ZCF B;  4M77 F;  5GAM f;  1VQL A;  4LDV A;  2GF7 A;  2JVV A;  2ZPF B;  5FU7 B;  2FYK A;  3J81 E;  4R56 A;  3CME A;  1VQ9 T;  2RI2 A;  2KY9 A;  2RJD A;  3EFR A;  1Q7Y U;  5LJ3 j;  3PNW C;  1EIF A;  2LRQ A;  2MWP A;  3C12 A;  5LJ3 e;  1QVF A;  2DZ9 A;  2JTM A;  4M75 F;  2RA2 A;  3TRE A;  1TH7 A;  2QQA A;  4M7D F;  1M90 U;  2HQE A;  4PJO C;  2ZZD A;  4C8Q D;  2DXC A;  2ZGW A;  3INZ A;  3OYD A;  1YI2 A;  3GIB A;  1QW1 A;  5CKD A;  3OYC A;  1VQ8 A;  2L89 A;  3M56 A;  4NL3 A;  1WJQ A;  4OP0 A;  3VKI A;  2RI3 A;  3A8H B;  1W4S A;  5KCH A;  4XU0 A;  3JB9 G;  1Y96 A;  2MI6 A;  3HRS A;  3GLX A;  1KD1 U;  3FLG A;  3S3N A;  3PGG A;  4IUQ A;  2L8D A;  2EKO A;  2E10 A;  5GAN 6;  2RHZ A;  1VQP A;  1Q82 C;  2PU9 B;  2VXF A;  4M77 A;  2L3R A;  3OQ5 A;  4N4H A;  5CVI A;  4R55 A;  3PT9 A;  5GAO m;  1D3B A;  3L2Z A;  1UGP B;  1VIE A;  3PIO A;  1VQO A;  2OTL T;  1X01 A;  1WJS A;  2LC4 A;  1VQM T;  5HY6 A;  3OMC A;  3SWN B;  4M75 A;  3I56 A;  2QA4 T;  4IKF A;  3G6E A;  5FU6 B;  3JB9 F;  4OVA A;  3WXM B;  4M7D A;  4KT0 E;  3DLM A;  5HK3 A;  3HPW A;  1AHJ B;  1I4K 1;  3CCJ A;  5CCA A;  1O9S A;  2CZ0 B;  4Y28 E;  3QPH A;  3OY9 A;  3OYI A;  2K5I A;  4PJO B;  3E1S A;  1X75 C;  2EFI A;  4J5Y A;  2RK2 A;  1FXX A;  3A8O B;  5A0G A;  2HAX A;  2KQW A;  4OB1 B;  2M16 A;  2RO0 A;  2M0O A;  3DB3 A;  4NL2 A;  3V7R A;  3CC7 T;  2DTH A;  2A3L A;  2O01 E;  1VQ6 T;  1KHI A;  3KUF A;  4L59 A;  4OGE A;  5D6Y A;  1UGR B;  3MCA B;  1WPY A;  2P4T A;  2QQ9 A;  4CRI A;  4OB3 B;  2VXE A;  2XID A;  3RMQ A;  2OTJ T;  4NS5 A;  4LDX A;  3JCM J;  4BB7 A;  1U1S A;  2CZ6 B;  2IG0 A;  4RMO A;  1WJR A;  4MZP A;  5AYF A;  3OB9 A;  2E64 A;  2F5T X;  2RHU A;  2VC8 A;  3QJ6 A;  1Q82 U;  1M1G A;  2R5A A;  4XTV A;  5FLX E;  3ZBD A;  4ELY C;  2HQX A;  2LTO A;  4N4I A;  1LJO A;  4LDU A;  1S72 A;  1BIB A;  3JCM e;  1O75 A;  4JLG A;  2RJE A;  4VUB A;  5GAM d;  3CCS A;  1JJ2 A;  1G3W A;  3VUZ A;  4BE0 A;  2K5L A;  2RM4 A;  2X35 A;  2XU8 A;  3ER0 A;  3OYM A;  3JCM b;  5DLQ E;  2RK1 A;  4M7A D;  1Y07 A;  4JRP A;  2DTI A;  3QHS A;  2JNG A;  2O4X B;  2KSS A;  3VYH B;  4B9X A;  5GAO p;  2CZ1 B;  3M53 A;  3LWH A;  4BE2 A;  2E6N A;  3ZFJ A;  4M7A B;  1K73 U;  3QUI A;  5GAO l;  4F7U B;  2D9T A;  3GNG A;  2F5K A;  2QEX T;  4HCB A;  3CCM A;  2VGM A;  3M57 A;  2ZPG B;  3QII A;  3T9N A;  4C8Q E;  2QQR A;  4IUU A;  3CC4 A;  2LDM A;  3UWN A;  4ZN3 A;  5GMK h;  3CCU T;  3H6Z A;  3QDR B;  2P0K A;  2YLB A;  3NTH A;  5GAN 4;  3C94 A;  5CKE A;  5IAY A;  5DLO A;  1Q81 C;  3GOX A;  2EQU A;  3FIF A;  3GF5 A;  5LJ3 f;  3BDL A;  2CYZ B;  3WVE B;  3S6W A;  2R58 A;  1VQL T;  5LJ3 g;  1WGS A;  3CME T;  1B34 B;  3J80 E;  3X24 B;  3PMI A;  5LJ5 h;  3G71 A;  3UT1 A;  3CD6 T;  2JUF A;  4RG2 A;  3M58 A;  4Z02 A;  3P8D A;  2KMT A;  2E5Q A;  4XAX B;  4HCC A;  1YJ9 A;  2FB7 A;  2PVD B;  3L1A A;  2MF2 A;  3RUX A;  4QVC A;  3A8M B;  4ATO A;  3MO8 A;  4PL6 A;  2LT1 A;  4C5I A;  2GFU A;  2RD1 A;  4ZGE B;  3OYL A;  1VQ8 T;  1KHC A;  5GAO r;  4BI4 A;  1N9S A;  4XU1 A;  2LVM A;  3EAE A;  3PFS A;  3URG A;  1G5V A;  3SWN C;  4PJO G;  1WQW A;  3WVD B;  5FU6 C;  2RHY A;  2DZC A;  3M59 A;  4JRI A;  5LJ5 d;  3G4S A;  1VQP T;  3R6O A;  3J7A F;  4FM4 B;  4RCC A;  2LNV A;  5CQY A;  4BUG A;  4FSX A;  4LD9 K;  3LGF A;  3SFM A;  3JB9 H;  1YHQ A;  4PLI A;  2RJF A;  1M8V A;  3FRN A;  4XK8 E;  3RKW A;  1VQO T;  1WQ7 A;  2AHJ B;  5A0D A;  5GAN 3;  1VQK A;  1M1F A;  1Q81 U;  3GNF B;  2EAY A;  3L42 A;  3QXE B;  1JJ2 S;  2PUK B;  3JCM Q;  2IVW A;  2XHC A;  3I56 T;  3A8G B;  3G6E T;  1VQ5 A;  4C8Q B;  2CGH A;  4Q5W A;  3HRT A;  3FB9 A;  3CPF A;  3E19 A;  3RMS A;  3HHT B;  2DTO A;  4PJO F;  1M4Z A;  3OS5 A;  4BD3 A;  4JDS A;  1ZHI A;  5GAN 7;  3C4S A;  5CAI A;  1N8R C;  4QVZ A;  2DPP B;  2LCC A;  4OB0 B;  2LCL A;  4ME7 A;  3OS1 A;  1K9M C;  4M7A E;  1LOJ A;  1DJ7 B;  4JUV A;  2I2L A;  2KK4 A;  4F7U E;  2VYT A;  4TVR A;  4LD6 A;  2L5Q A;  4KUD K;  4HA8 A;  2CZ7 B;  4DA4 A;  3V8J A;  2EIF A;  3VUB A;  3QYH B;  4ZTJ A;  4J7I A;  1K8A C;  3FDR A;  5I21 A;  4JS4 A;  4E7L A;  4J6Y A;  4M7A G;  2P0P A;  2GFA A;  2XKO C;  4EPC A;  5GAN h;  3JB9 I;  4E7H A;  1V29 B;  4QQD A;  4RKU E;  5IN1 A;  3SWN A;  3JCM f;  3V8L A;  1R8O B;  1K73 C;  4EMK C;  1UGQ B;  2E65 A;  4XU2 A;  3OYN A;  2QDY B;  3O8V A;  3OBY A;  1NPR A;  3LH0 A;  3JCM g;  3QZ9 B;  4A4G A;  3SD4 A;  4M7A C;  1G3Y A;  3QBY A;  1X6O A;  2HBP A;  1HK9 A;  3TU4 K;  3G7Z A;  2V8J A;  3X26 B;  1S72 T;  3A8L B;  4PJO A;  3JRZ A;  5GAM h;  4M7D D;  3CCS T;  4HKE A;  4B9W A;  1W2B A;  3L2V A;  2MWO A;  1BI2 A;  2QQB A;  1XOV A;  2LQ8 A;  3CMA A;  4M78 D;  4QQG A;  4M7A F;  2R5M A;  1UGS B;  4J83 A;  4F7U F;  5CR2 A;  4HT9 A;  5GAN d;  4XTZ A;  4M78 B;  4JJN K;  3JB9 J;  3JCM c;  1N8R U;  3QSU A;  2EWN A;  1M5Q 1;  5D6W A;  3GPL A;  2EJF A;  2VV5 A;  2H3J A;  3CCM T;  1K9M U;  2DO3 A;  2K5F A;  4QW2 A;  2DXT A;  1VQN T;  5C0M A;  3MHX A;  1KC8 C;  2V8K A;  3PMT A;  4MZT A;  1YJN A;  2DVE A;  4LDW A;  1BIA A;  5CKF A;  1XQH A;  1K8A U;  4EMK B;  4KUL A;  2DEQ A;  5CO7 A;  4BDY A;  3I55 A;  2EYQ A;  2F69 A;  3JB9 D;  1G3S A;  2XDD A;  2E41 A;  3H8Z A;  2A7Y A;  3CCQ A;  2O4X A;  4O5V A;  4MML A;  3S3M A;  3S3O A;  1JBM A;  2QI2 A;  3A5Z B;  4X9D A;  4MZM A;  3CXC A;  4M7A A;  1P92 A;  2RI5 A;  1KG1 A;  4F7U A;  3CBP A;  3G71 T;  3E9F A;  3HKS A;  1I81 A;  3NTI A;  4IUP A;  3MP8 A;  2HD0 A;  5GMK j;  3OYB A;  1YIJ A;  1UB4 A;  4YTL A;  1QVG A;  1PSF A;  2MAM A;  2DAQ A;  3NFC A;  5GMK e;  3CCV A;  3PTA A;  2EJ9 A;  4V2S A;  4GY5 A;  3CC7 A;  1YBY A;  2Y4Y A;  1YJ9 T;  4A53 A;  4II1 A;  1VQ6 A;  2YHT A;  2E1H A;  3N5B B;  4C8Q G;  3LX7 A;  3CEY A;  1VIF A;  4D6W A;  3MEW A;  5CQX A;  2E6Z A;  4N4G A;  3DLL A;  3LGL A;  1Y7X A;  4UC4 A;  4BE1 A;  1G3T A;  4C92 D;  2DD5 A;  5LJ5 j;  2KAF A;  1M9S A;  3CC2 A;  2XD0 A;  5LJ5 e;  4C8Q C;  3CCR A;  5FRM A;  1LNX A;  1KQ1 A;  3G4S T;  4C92 B;  4X34 A;  2XDP A;  3JSC A;  1B34 A;  5C6S A;  3RKX A;  1KC8 U;  1N9R A;  3C95 A;  1I8F A;  2XDB A;  5CKH A;  1YHQ T;  1MHN A;  3PIP A;  2KDS A;  5CK9 A;  1VQK T;  2EQM A;  4L6V 5;  3ZEH A;  4C8Q F;  3V7C A;  5I2S A;  1YI2 T;  3CCL A;  5GAN 5;  1W2B S;  2RH2 A;  1U8R A;  2K3X A;  1NPP A;  3QKJ A;  1VQ5 T;  3L2Q A;  2K2V A;  2RHX A;  3FEO A;  2LX9 A;  4EMH A;  1VQ4 A;  2XI9 A;  4CI0 C;  1KQS A;  4QQ6 A;  4C5E A;  3CCE A;  2DXU A;  2QEX A;  1YJW A;  2V8I A;  4EMG A;  5KE3 A;  2CS7 A;  4M7D E;  3RIR A;  2X4J A;  4PKC C;  3OYA A;  4C0G A;  2WSC E;  3FJP A;  3AHU A;  3BDU A;  3HL8 A;  3LYI A;  4M78 E;  4J6X A;  4C0D B;  2X4W A;  4P5N A;  1ZBX A;  2RB6 A;  3UDC A;  1BI3 A;  1NZ9 A;  2DIG A;  5GAO q;  3QYG B;  1YIT A;  1RL2 A;  2XIC A;  4DOV A;  1VQ7 A;  4WF2 A;  2YLC A;  2K4Y A;  4JLI A;  4M78 G;  5A0L A;  2GCX A;  2HNI A;  3F70 A;  1RI0 A;  4OMF B;  5KH6 A;  3L2U A;  3Q1J A;  2OAU A;  5J3B A;  1XTD A;  3OS0 A;  4M7D C;  4C8Q A;  2Y90 A;  3SB2 A;  4ZN1 A;  5KCO A;  3CCJ T;  2FHD A;  4DOW A;  5GAM g;  3GP8 A;  2PVO B;  1Q86 C;  1N27 A;  4M78 C;  3LWI A;  3QZ5 B;  1NJI C;  3CD6 A;  3CXC S;  3CPW A;  5LJ3 h;  4KUI A;  5M9O A;  4Y91 A;  4FL6 A;  1YCY A;  4HCZ A;  4IUT A;  5KE2 A;  5IT9 E;  1QVG S;  2VGN A;  4E47 A;  3MEV A;  2JN0 A;  2NLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...