2XKOC

Crystal structure of the complex of ntca with its transcriptional co- activator pipx
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
85
Chain Sequence
ENYLNHPTFGLLYQICSFGSKELFATLYAQRLFFLVAFDARGTRFEPIGRNEARMLVDNRLRQLRRDASLQEYNQLQQVFKQTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords GLOBAL NITROGEN REGULATOR
publication title Structural Basis for the Regulation of Ntca-Dependent Transcription by Proteins Pipx and Pii.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 18
structure length 85
sequence length 86
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12058 DUF3539 Protein of unknown function (DUF3539)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.660 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xkoC01
2XG8D 3N5BB 2XKOC
chains in the Genus database with same CATH superfamily
4PJOD 1G3WA 4OB0B 3E19A 2VVKA 2LC4A 3CC2T 4PJJA 4EMHA 4IUTA 3WVDB 3HRTA 5GAOm 5LJ5f 4BB7A 5GMKh 3V8KA 4C5HA 1QP3A 1WXTA 2DYIA 3OYGA 2BUDA 1M90U 2XG8D 1YHQA 1B7TA 2KGTA 9ATCB 3JCMW 4XAXB 5GAOr 2DTOA 1OPKA 3E9FA 3OYYA 1ABQA 2I0NA 2QA4Q 4LNPA 4E7KA 1RAGB 1M3BA 1BYMA 3CMEA 5GMKj 1WIEA 2CKKA 4A4FA 3FDRA 1YIJQ 1H92A 5CQXA 2R5MA 5GAOn 3CD6T 1B3QA 3EH1A 3M54A 3MEWA 4PJOF 2RQVA 2RI2A 2HD0A 2YT6A 1D1BA 1PRLC 1K73U 4DBHA 1GXIE 4J9DA 4OMNA 4LDWA 4OGEA 4JJCA 3G6EA 1WI7A 3CC4A 4Y28E 2E6ZA 1VQNQ 2R57A 2LTOA 1JB0E 2YUPA 1U1TA 5GAMg 1IHVA 2CP7A 3H0IA 4OMFB 1RABB 2KBTA 5HY6A 2NUPB 1QVGA 4FL6A 3MCAB 3JB9D 2DF6A 4B9WA 1VQKT 2NUZA 4P5NA 1VYTA 1PSFA 2NLUA 4MZPA 3CCMQ 4M75D 4GBQA 1ZUKA 4RTYA 1GCPA 1K8AC 3PVQA 2KXDA 2DD5A 1IRXA 1VQPQ 4IIMA 3RIRA 4RTUA 2XDBA 3I5RA 2IIMA 2V8KA 2J6FA 2OJ2A 2XKOC 1YJNQ 2CS7A 4M7AG 3C4SA 2V26A 2A36A 3FEOA 2DIQA 3RBBB 1UDLA 2E70A 1T0HA 4DEYA 3MKDA 3NTHA 3C0CA 2X35A 1NE8A 5LJ3e 2YRCA 5KYXB 1JJ2A 3VRYA 3CCJQ 3CCUQ 3MP8A 3VS2A 3JCMe 2HSPA 2AKKA 1PHTA 2QDYB 4C92E 1S72T 4RUGA 1VQOQ 4V2SA 2WSEE 5KCOA 2PUOB 5FU7B 1BBZA 4M7DG 1RUWA 2LJ0A 3JRZA 3V7CA 2HEQA 4XQ3A 3TU4K 1BIAA 1WXUA 2RJFA 4M78C 2DAQA 1YHQT 4FYVB 2DTIA 4KUDK 2LQ8A 2NYSA 1YN8A 3L42A 2F1LA 1T0JA 4ANJA 5HKCA 2MI6A 2J6OA 5GANd 1QW1A 1OYXA 2HDAA 1K76A 1MNEA 1X2KA 2AHJB 1Z9QA 1WA7A 1XJWB 4BD3A 4BE1A 2DEQA 4FYWB 5IXBA 2KRNA 3CC7Q 2DK3A 1VQ9T 3UATA 4DOWA 4IUPA 2B8AA 3RKXA 3CCRA 4BY6C 2V8JA 3JB9H 4R0KA 5LJ3g 4CI0C 2HBWA 2HQXA 3ZEHA 1LNXA 4FU6A 2RQWA 3JCMg 1V29B 3CMAA 2HCKA 1NYFA 2EAYA 2QQBA 2JZ2A 1NJIU 3LH0A 1SRMA 1OX8A 1JU5C 1WHLA 4PJOE 1H3HA 2XU8A 4KBMB 2SRCA 2EW3A 5D6YA 3SDZA 3GPLA 2DNUA 5LJ3h 1I07A 8ATCB 3CCSQ 3M0QA 2HBPA 1PSEA 5IHIA 3JCMh 4B6MA 4ZN3A 2A3LA 2DJZA 4XU0A 4M7DA 2ABLA 1E6GA 2LP5A 1UGSB 1UGQB 3M0TA 3QBYA 1B07A 3QO3A 3OYDA 4FM4B 4JLIA 1NPRA 2FYKA 2W10A 1F1BB 2K5IA 3PIOA 3C94A 1HJDA 1PKSA 1BB9A 3INZA 1VQ5A 3QYHB 2BE9B 3OYFA 2FO0A 5LJ3j 5GMKm 1H8KA 1WHGA 1ZX6A 2X4JA 1I5OB 4DEXA 3CXCA 4M78A 3UT1A 4OMLA 5CKFA 1WHJA 2LJ1A 3F70A 3G1JA 2FG0A 1D0XA 2KK4A 2W0ZA 1A0NB 2O88A 1XQHA 3MEVA 3DLMA 3CC2Q 1UHFA 1RADB 3G7ZA 2OI3A 2QXFA 4F17A 1YWOA 3JSCA 1YJ9Q 3OS2A 4MMLA 4C0DB 4C92C 1IGQA 3OYAA 2X4YA 3OS1A 3OYBA 4F7UF 5IAYA 5CIUA 1RI0A 2VGMA 4C0GA 4E7SA 5A0GA 1NJIR 1M30A 1M2OA 1ZQ1A 2EIFA 2QA4T 5A0DA 1UJ0A 2QYZA 2EGEA 4J9BA 2A0FB 1ARKA 3EGUA 5CK9A 4K11A 2A28A 1UTIA 3BY7A 2KRSA 2QAZA 1X6GA 1VQ7A 1AVZC 4AFZC 2KNBB 3QG1A 4JS5A 1RAAB 4WTOB 1Q95G 1OU8A 1KD1R 1ZBXA 3EHQA 1VQNT 2DD4A 3QKJA 1AD5A 2LT1A 3NHNA 2PQWA 3A8LB 2DILA 3UDCA 4ZGDB 1C6VX 1YJWA 2K5LA 5GANe 1NBEB 4F14A 4O6JA 1FXXA 1YI2A 4FYYB 2DXTA 2CDTA 3OBWA 1ZUYA 3CMAT 5GAOl 2DKGA 4IUUA 3OYNA 2XDPA 3AT1B 1MNDA 1Q7YU 3BDLA 1OOTA 2E65A 4MZMA 4ESRA 2GBQA 3QJYA 1VQPT 3QSUA 4PJOC 2DPPB 1FX7A 1KK7A 1TXQA 1X69A 1YBYA 1YJNT 2JUFA 2QGGA 4F16A 4M7DB 2CSQA 4M78F 4C92A 1QKWA 1MMAA 3PT9A 1PM3A 1E6HA 1TOVA 4LD6A 2EVRA 3A98A 1BKBA 1VQ5T 3D7SB 2F2XA 1FMVA 3VV0A 3J7AF 3A8HB 1KQ2A 3CCJT 3CCUT 4C5IA 4E7LA 5FU6B 1J3TA 4DBFA 2X3XD 3HP9A 2A7YA 4FSXA 2QTXA 2ROLA 2CT4A 4JRKA 1X6BA 4FIBA 3QIIA 3OW2P 5GANg 1WJSA 2QQAA 1C1AA 2BIVA 2VGNA 1X43A 1GBRA 2QEXA 1W1FA 5C0MA 3OA6A 5GANh 3V7RA 5GAOq 2XDDA 3ASKA 1YHQQ 1BU1A 2X3WD 2LQWA 1K73C 3J81E 2PZ1A 3ZL7C 1N5ZA 3S3NA 2DTHA 2YXYA 3TSWA 2D1XA 3EFSA 2LDMA 3R6OA 2M9UA 2C06A 4J7FA 2EJFA 2K2MA 5J3BA 2V1QA 2VB6A 3CMEQ 4M75C 1ZA2B 3CPWP 2DL8A 2EKHA 5GANj 2EKOA 2HL5C 4JRQA 2KVQG 4F7UE 3I56A 4PJOA 2D9TA 2EGCA 3OW2S 3G4SA 2DRKA 3LH5A 3UF4A 3MEAA 3M9QA 4J6XA 1PRMC 4LXCA 3G6EQ 3CC4Q 3OS5A 2FZKB 3GLXA 2PTKA 3O8VA 3WVEB 1K9MU 2M0YA 2ZPBB 3JCMb 1N9SA 1N8RU 3VS7A 1TG0A 1W70A 6AT1B 1QKXA 3RKYA 3H0HA 1UE9A 4QQDA 4RTTA 2O31A 1RAFB 1WNLA 5IXFA 2QQSA 2F5TX 4JJBA 1BCMA 1X27A 2K3BA 4ZGEB 3CPWS 3X24B 4GLMA 2Y4XA 2MYSA 4KRTA 1RLPC 2DETA 2QK0A 3CXCS 3LWIA 3M0SA 1ZSGA 1SEMA 1VA7A 5J39A 5KYNA 2F2VA 4C92B 2XMFA 1M8MA 5GAN4 4RTVA 3I5SA 5CKBA 1CKAA 4WCIA 1PG5B 1RL2A 1ABOA 1I4K1 1M3CA 5IHKA 3M58A 3QWYA 1PD1A 4M78E 2K6DA 1HD3A 4M77D 1YJ9T 4M75A 5J26A 2EYYA 1O75A 1GL5A 1WHKA 1SHFA 5IN1A 2YHTA 1QQJA 2RNAA 2DX1A 3EG2A 3GOXA 3NPFA 1VYVA 2KE9A 1Q81U 1PD0A 2M1HA 2M0OA 1VQ4A 4J7IA 2RHXA 1PC0A 2ENMA 1IO6A 5IT9E 2JTMA 2JOYA 2EQUA 2DEUA 1D1CA 4C5GA 5IHNA 3EG0A 5LJ3f 5CVIA 3HFNA 1SHGA 2BTTA 2VASA 3QWXX 1M27C 2FPFA 2EQKA 2K5FA 3JCMf 3JB9I 3QXEB 4ELZC 2E41A 1NJIC 2ZPIB 2ATCB 4KGVB 2D8HA 2OTJA 1XOVA 4L59A 4J9GA 4PJNA 3I56T 4PJOB 1HXDA 5L8RE 3NGPA 2VV5A 1NZ9A 3CCRQ 2WSCE 2HQEA 2HAXA 1O9SA 2RJCA 3A1PA 4EMKC 2RK1A 4F7UG 1VYUA 3CMAQ 1W6XA 3R6NA 1KD1C 2JM9A 5C6SA 2LX9A 4IIOA 3NMZC 4OMQA 3H6ZA 1UJYA 1RAIB 3H8ZA 5GJVB 1KSWA 1M90R 4J6YA 1IXDA 2D6FA 1UUEA 4UC4A 1YITA 2PUKB 2JW4A 2RPNA 4FW2A 2YLBA 2G6FX 2DYBA 1XTDA 2C0TA 3QDFA 3OSVA 3S3OA 1TSFA 1NEGA 5FW9A 3DB4A 4AFUC 4LD9K 1QLYA 4C0ZA 4R56A 1VQ5Q 1UGRB 2LNHB 2FEIA 3JB9F 4RG2A 1G5VA 1OEBA 1TS9A 3VU3C 1QP2A 1S1NA 3P8BB 1BCOA 1K73R 4M75F 4C8QD 1JRIA 4II1A 1WDXA 3SB2A 3RKWA 4A4EA 3SFMA 4AFSC 4J6WA 2ZAEA 2GGRA 3VS3A 1TH7A 1TWBA 3HHTB 8AT1B 3EHRA 4DQ2A 2YUNA 2FPEA 3H9NA 2BZXA 1GFDA 2DRMA 2K9GA 2O4XA 1NPPA 1SSHA 1R0BG 2EGAA 4PLLA 3MO8A 4M75B 3CBMA 5HCKA 1PKTA 1SG5A 4DA4A 2P4TA 4L5GA 4OVAA 4F7UA 3OMGA 4M78G 3JCMV 1SF9A 2CH4W 2K2VA 1SSFA 3LGLA 2F5KA 3CQTA 4HCBA 3RESA 5EG2A 2DZ9A 4Z02A 1VQ4T 2RQUA 1ZHIA 2JS2A 1M2VA 2BKDN 3CMET 4OMMA 4KGZB 3RDVA 1MHNA 4XTUA 2IVWA 1LPLA 4LDXA 2MK5A 1QVFP 3TCJA 3H0FA 2CGHA 1G3YA 2JT4A 1VQ7Q 2KT8A 3CCQA 4FT4A 2CREA 2MWOA 3JCMQ 3G6ET 3OW2A 1B34A 4BE2A 2BZYA 3CC4T 4J5YA 2YSQA 2LCCA 1Q7YC 1IREB 4VUBA 4BE0A 2DM1A 1D09B 3M4YA 1YJWQ 3VJPA 1ACMB 1TU0B 4IKFA 1YI2Q 5I21A 2P4RA 4LE9A 2G3RA 3LYIA 2PVGB 2LMJA 4X34A 1PNJA 2QASA 3GF5A 4CRIA 2KAFA 2RJDA 2RK2A 5KYWA 1VQ6A 1KC8U 3JCMJ 1Y57A 4XTXA 4J9CA 2EYXA 3QPHA 1I0CA 1VQLA 5LL6S 1N9RA 2OAWA 1IGUA 3CPWA 1QVFS 4JJNK 4A4GA 2GFUA 2KT1A 1TTHB 1YITT 2XHCA 1MUZA 4HVUA 2HKNA 2DXUA 3M0RA 3RERA 2AK5A 4N4IA 3LW5E 5GANf 2OTLA 4N4HA 3NTKA 4BDZA 2B86A 1UEBA 4C0FA 2RN8A 2JJ9A 1H641 1D1AA 1K9AA 3L2ZA 2D0QB 2MPXC 1JQQA 2QQ9A 2ZPHB 2D0NA 2CT3A 3EG1A 1K1ZA 4XU2A 4IUVA 5HK0A 1OU9A 3HRUA 2C0OA 3JCMX 3N5BB 4RKUE 2VUBA 1AZEA 1WHMA 4AMCA 2J6KA 1GFCA 4M7AD 4ORZA 1AHJB 1LJOA 2H8HA 3G71A 1Z9ZA 3X28B 3JV3A 1Y07A 4J8OA 4XTYA 4C92G 2LJ3A 1KIKA 2MMPA 2DBKA 2O4XB 2QEXQ 3A8GB 4M75E 1ZA1B 2LNVA 2DL4A 4JPBW 2RB6A 3VUBA 1EZZB 4MDXA 3VYHB 5I2MA 1WQWA 4F7UB 2KRMA 1YP5A 3QJ6A 3JCMP 1WZOA 3HL8A 4HVVA 1MV0B 3M59A 1ZSZC 4PK4A 2EYWA 3M56A 1M3AA 2D8JA 1M2VB 2L3PA 3L2QA 1K9MC 3A8MB 3RUXA 3X26B 2YRVA 2R5AA 3OY9A 1N8RC 2E10A 4HVWA 4OF1A 4L6V5 3I56Q 2COYA 3CCRT 2DA9A 3G4SQ 3CCQT 1JXOA 1WJRA 3T9NA 3KFVA 1B34B 2FL7A 1M4ZA 1WJQA 2FHDA 3SD4A 3L2WA 5CR2A 3OB9A 2EQMA 1W2BP 3ZFJA 2DE0X 3VS0A 2CP6A 1PWTA 3LGFA 3RNJA 2HKQB 3CCEA 3CPFA 3X25B 3META 2KYMA 5DLOA 2J06A 1WFWA 4KULA 2CSIA 1TUDA 3PVLA 4E6RA 2CP0A 4X1VA 1N27A 4PJOG 4M77C 4QQGA 2CUDA 4CC7A 4OMOA 1T3SA 4HCKA 1AT1B 1VQ6T 4N0AC 1D3BA 5KH6A 3KUFA 3E1SA 5KYUA 1VQLT 1OPLA 2RM4A 1FMWA 2CZ6B 5GAMd 2DFUA 3I55A 3JCMc 2RJEA 2P0PA 1JO8A 2ESWA 2AZVA 4YTLA 2KSSA 1DJ7B 2E5QA 3MP1A 4M78B 1M90C 1BI1A 4M4ZA 4HKEA 2IPOB 3GIBA 3OYEA 5CAIA 4FCYA 2JMAA 3CEYA 2YWWA 1W2BS 2X51A 4LDUA 3MHXA 1ZBJA 3QUIA 1ZLMA 4B9XA 3L2VA 2XD0A 3FB9A 2VXEA 4Q5WA 1ZSZA 5FWCA 2NUTA 2E3HA 2K3XA 2KI7A 4BI8B 4KH1B 5CKEA 1GCQC 2LVMA 2EFIA 2NWMA 4Z8AA 1EFNA 1VQMA 3G71T 1IZ6A 2FVUA 4BY6B 3SWNC 1Q7YR 5CO7A 3OQ5A 1VQ4Q 2LQNA 4XTVA 1G8XA 4ZTFA 3JB9G 3CD6A 2ZPFB 2XK0A 3JB9J 2RI5A 1VQ7T 1KG1A 1FMKA 4JRIA 4NL3A 2OAUA 1OULA 2JXBA 4M75G 3OYMA 2CUBA 2PVOB 3M0PA 2JS0A 2VWFA 3UPUA 2QQRA 4M77A 3EH2A 2X4WA 2CH4A 5LJ5d 3URGA 2OTJQ 1YJWT 1EX4A 1KQSP 4N0AA 2RH2A 3ZBDA 4X9CA 7AT1B 1YI2T 2NUPA 2L0AA 3HRSA 4XU3A 3FC3A 2X4XA 4JUVA 3OYCA 4E7JA 4DOVA 1VQKA 3GNGA 4R55A 5CKHA 2K3YA 1AWOA 4ME7A 4OGCA 2J05A 1BK2A 3EG3A 4PFPA 1HK9A 2EWNA 4C8QC 2KYBA 3PMTA 2ED0A 3O5ZA 3S6WA 3EFRA 1GBQA 2LX7A 3BFMA 4BUGA 3BW1A 4NL2A 3OYLA 4QW2A 1G83A 1YITQ 2JM8A 1QVFA 2YUOA 2RHZA 4J9IA 4E47A 5CKDA 1RI9A 1E7OA 5KCHA 2DJQA 4HXJA 2E64A 4E7ZA 5GAN6 5FRMA 1VQ8A 1D3BB 1GCQA 3EGDA 2HSEB 1RAEB 2L5QA 5KYUB 3CCVA 1KQSS 3I55T 1EIFA 2HL3A 4BDYA 4A53A 2JNGA 3LWHA 2QG9B 3SWNA 3A8OB 4GLKA 1U5SA 2KROA 2RHUA 1S72A 4JZ4A 3SEMA 3C12A 2DL7A 4BACA 1LVKA 3DKMA 3M5AA 3SHWA 2JMCA 3CCLA 2BE7D 3KBGA 1K9MR 2FPDA 1ZSZB 3UWNA 1K4US 3OYKA 1VIFA 1K0SA 2NUTB 2QEXT 1ZUUA 1N8RR 2SEMA 1VIEA 2QGFB 2L3RA 2KR3A 2HNIA 3RR6A 2CP5A 3U23A 1VQMT 3PIPA 5KE2A 2RMOA 5AYFA 2RA2A 1I5LA 1TUGB 1NYGA 1G2BA 3M4GA 2IG0A 2L3SA 3ME9A 3QZ5B 2HQHA 5GMKl 4MZTA 3PNWC 4M77F 4C0DC 3LLRA 5KE3A 4C8QA 1XNIA 2H3JA 2XIDA 2CZ1B 1VQ9A 2V1RA 3I35A 1MMDA 4RTZA 3G4ST 1AEYA 3CBOA 1RLQC 4DBRA 3CCQQ 1Q86U 3FJ5A 1UGVA 2RHIA 2O2OA 3VS5A 5GAN8 1RAHB 1AOJA 4M77B 5D6WA 1YNZA 2KY9A 2QTVA 3S3MA 2VC8A 4XTWA 1KC8C 5GAN3 5I11A 3OBYA 2AZSA 5A0LA 1MMGA 3E9GA 1Q82U 2CP2A 2GCXA 2LT4A 1Y0MA 1NEBA 4RTWA 1OZ3A 2DXBA 3MJXA 5LJ5e 1V1CA 1UFFA 3IQLA 4D8DA 2XI9A 5GAMh 1N6AA 3REBB 1AZGB 2DMOA 4J83A 1Q81R 2P0QA 5GMKi 1VQ6Q 4M7AC 4ELYC 3RMQA 1VQLQ 2GFAA 4IURA 4JJDA 3PE0A 1WX6A 2P84A 4J9HA 1U06A 1M1KU 3OMCA 1MGQA 4RCCA 5GAMj 2OTLQ 1VQ8T 4AG1C 3EGDB 3CCVT 5CQYA 3EFOA 1W2BA 4EIKA 2DVEA 2R58A 4MMKA 3OS0A 3PFSA 1NG2A 2ZPGB 4M7DC 3SWNB 5GAN2 1X01A 1G3SA 4WF2A 1HSQA 1YCYA 4DBQA 2YRDA 5I22A 2PNIA 1UB4A 1BI3A 3THKA 4CC2A 1Q86R 3GP8A 1H3ZA 4D6WA 3UA6A 5ECAA 4C5EA 1KQ1A 2WACA 3G71Q 3TSZA 3M0UA 3CCLT 2K79A 2L3QA 2VKNA 2HMAA 2EJ9A 2QDLA 3REAB 2YDLA 5CCAA 2QA4A 4AT1B 4EMKA 5LJ5g 5FU6C 5GAN5 1OV3A 4PFOA 2A08A 3FJPA 1QVPA 3OSSC 1JBMA 1Q82R 1YIJA 4C8QF 4F04B 4LUDA 2AKLA 2ZGWA 4AG2C 2RQRA 2MAMA 2RQTA 2FZCB 1OZ2A 5LJ5h 4TVRA 3GBQA 3M55A 2CYZB 2OX7A 2H3EB 1VQNA 4Y92A 1AWXA 4X9DA 4C8QB 2OTJT 3NTIA 2LCLA 4FSSA 4O5VA 1M9SA 2DO3A 4M7AA 1Y7XA 1AWJA 2E12A 4LN2A 3UA7A 4NOYA 2GQVA 1V76A 4HT9A 1M1KR 3I9QA 3FLGA 3DB3A 1MMNA 3PTAA 4JS4A 4ZTJA 4XTZA 5FWBA 1I8FA 5LJ5j 2AT1B 2E1HA 2MOXA 4A54A 4M77E 3CCMA 3NFCA 1WLPB 2DL5A 2EQJA 1D0YA 3FIFA 5DM7R 4PKCC 1X6OA 2KQWA 2ECZA 2RHYA 2Y4YA 2Y90A 1VQPA 2GTJA 3CCEQ 3ER0A 1K0XA 1YJNA 5FROA 5DLQE 3MPUB 4OP0A 1QMCA 1R77A 2EQIA 3M53A 3LX7A 1KD1U 4LDVA 3DLLA 1NM7A 4CC3A 1K8AU 4Z89A 4KUIA 2CZ7B 2EYZA 1WGSA 2KXCA 3I55Q 4A63B 3PMIA 1KQSA 2L89A 2LZ6B 2KDSA 1C0MA 3CCJA 3CCUA 1M8VA 2MCNA 5A2QE 5GAOp 1VQOA 2JTEA 2MF2A 4NS5A 1WHHA 3QHSA 4EPCA 1U3OA 4A4KA 3EFOB 5IH2A 3VRZA 2RO0A 2CZ0B 1SKUB 4HCZA 1YFNA 1R8OB 2YLCA 3ULRB 2LCSA 2QI2A 1TUCA 2C0IA 1KJWA 1UHCA 1QVGP 4LDYA 4RMOA 3EGXA 1BI0A 1UG1A 5I2SA 1YCSB 4BI4A 1Y96A 1VQMQ 4PJLA 1M1GA 3CBPA 3WXMB 4E2FB 1U1SA 4OB3B 3VKIA 4M7DD 3TQ7P 4KGXB 1NLOC 4EMKB 1PCXA 1KC8R 4OB2B 3FRNA 2E4HA 1YIJT 1QWFA 4OMPA 5FRNA 3L1AA 3CC7A 2EPDA 3CD6Q 5M9OA 2L8DA 5KYYA 4M7AF 1LCKA 2ZCFB 1UGPB 1QCFA 5EC7A 1HYOA 4PJMA 3C95A 4QQ6A 1CSKA 2FRYA 3PGGA 4CC4B 4E7HA 4M78D 1K8AR 2LQKA 4ZN1A 2ROTA 3OYHA 4C8QE 1QWEA 2M16A 3RMSA 2COWA 1KHCA 2DZCA 3V8LA 1JJ2P 2MIOA 1QVGS 3AHUA 4M7AB 3OYJA 1BIBA 2K57A 2DIGA 2AIRB 2RI3A 3CCSA 1T3LA 2DLPA 2MWPA 2VXFA 3EG9A 4MDWA 4M7DF 1MV3A 1R0CB 4FT2A 2EJGA 2JVVA 1VQKQ 4QT7A 3CCMT 2M51A 3MEUA 4ZNXA 4QVDA 1UECA 5KYWB 1KHIA 4J9FA 1IHWA 1M5Q1 2RF0A 3E2UA 1QCOA 4HT8A 4M77G 1KFZA 1FWZA 4PFZA 2DERA 1SRLA 2L2PA 4QVZA 3HKSA 2LRQA 1WPYA 4ZGJB 4HA8A 3M57A 4N4GA 2JN0A 4Z88A 3MP6A 2KEAA 2YUQA 4RTXA 1WXBA 1G3TA 5L23A 2OTLT 3X20B 3QZ9B 1VQ8Q 1X75C 1JJ2S 4D8KA 3CCVQ 4KH0B 1AWWA 4IUQA 3CC2A 1JEGA 2O9SA 4PNOA 1Q81C 2DL3A 4RG8A 2GQIA 1YJ9A 1LOJA 5GAN7 1VQOT 2A37A 1S72Q 1M1FA 2Z0WA 2FRWA 2ED1A 2PU9B 2DXCA 3JAME 3TEEA 4HCCA 2PVDB 4PLIA 3CCLQ 4KT0E 2KMTA 2X9HA 3KXTA 3EAEA 1WYXA 2I2LA 3A5ZB 2E6NA 3EGXB 4XU1A 1VUBA 5FU7C 1VOMA 2F2WA 3BE3A 3P8DA 1Y96B 1X2QA 2EYQA 5FLXE 3HSBA 4BI3A 1NLPC 4Y91A 1Q86C 2XICA 3VS1A 3L2UA 2P0KA 2VYTA 1IB8A 2CP3A 1W4SA 1YWPA 5D7UA 3QDRB 3HPWA 4JLGA 5GMKe 4JZ3A 4FYXB 2WSFE 3P8HA 4C92D 5AT1B 2GF7A 1BI2A 4PL6A 3CC7T 5GAMf 1CKBA 3VUZA 2FZGB 2FB7A 2ZZDA 4GY5A 4JDSA 3VYGA 5KYYB 1VQ9Q 1Q82C 3CXCP 4FW1A 4XK8E 1RACB 5D6XA 3J80E 2O01E 2M02A 4AFQC 4EMGA 1OI1A 1SPKA 2HZYA 3VS6A 5DY9A 1JXMA 4J9EA 1U8RA 1QCNA 4JRPA 5HK3A 3V8JA 1D0ZA 4RCBA 3QYGB 4M7AE 3Q1JA 2DBMA 1P92A 2E3IA 2RD1A 3CCET 3CCST 2O9VA 3TREA 1I81A 3V7SA 3EG9B 4C8QG 1Y71A 4LUEA 3BDUA 2ZPEB 2E5KA 3HTRA 2EBPA 3VS4A 3TVTA 5LJ3d 1FYNA 1M1KC 1OX9A 4C92F 2J7IA 3JCMd 4E7IA 2K7AA 4ATOA 4A4HA 1I1JA 2K4YA 3HFOA 1WQ7A 4OB1B 3H41A 1GRIA 5GJWB 5KYXA 2JTFA 4M7DE 2GNCA 1OQKA 2COZA 2F69A 3GNFB 4QVCA 2GTOA 2V8IA 4EDUA 3OYIA 4QKUA 3L2RA 2DVJA 5GAMe 2BZ8A
chains in the Genus database with same CATH topology
4PJOD 2QQ9A 3HP9A 2ZPHB 2A7YA 1G3WA 2DVEA 2R58A 2QTXA 3E19A 4FSXA 4MMKA 4OB0B 3PFSA 2LC4A 3OS0A 4JRKA 2ZPGB 3CC2T 4FIBA 4XU2A 3QIIA 3SWNB 1X01A 1G3SA 4IUVA 5HK0A 5GAN2 3HRUA 5GANg 4WF2A 3JCMX 3N5BB 4EMHA 4M7DC 1WJSA 4IUTA 4RKUE 2QQAA 3WVDB 2VUBA 1YCYA 3HRTA 5GAOm 5LJ5f 4M7AD 4BB7A 5GMKh 2BIVA 1UB4A 1BI3A 3V8KA 4C5HA 1AHJB 1LJOA 1QP3A 3OYGA 2BUDA 1M90U 2VGNA 3GP8A 3G71A 1H3ZA 4D6WA 2XG8D 3X28B 1YHQA 1Y07A 3JCMW 4C5EA 4J8OA 4XAXB 2QEXA 4XTYA 4C92G 1KQ1A 2WACA 5C0MA 2MMPA 3OA6A 5GAOr 5GANh 3V7RA 5GAOq 2XDDA 3ASKA 3CCLT 2DTOA 2O4XB 2EJ9A 3A8GB 3E9FA 3OYYA 4M75E 2LNVA 5CCAA 2QA4A 4EMKA 5LJ5g 5FU6C 5GAN5 3J81E 2RB6A 1K73C 3S3NA 3VUBA 2DTHA 3FJPA 1QVPA 3OSSC 1JBMA 3VYHB 5I2MA 4MDXA 4E7KA 1YIJA 4C8QF 1QVGA 1WQWA 3EFSA 4F7UB 3QJ6A 1BYMA 2LDMA 3CMEA 2ZGWA 5GMKj 2CKKA 3R6OA 2M9UA 4A4FA 2C06A 4J7FA 2EJFA 3FDRA 3HL8A 5CQXA 5J3BA 2R5MA 2MAMA 5GAOn 3M59A 3CD6T 3M54A 3MEWA 4M75C 4PJOF 2RI2A 3M56A 2HD0A 1OZ2A 5LJ5h 4TVRA 3M55A 2CYZB 3L2QA 1K9MC 1K73U 3A8MB 5GANj 2EKOA 4JRQA 2KVQG 4F7UE 3I56A 1VQNA 2D9TA 3RUXA 3X26B 4PJOA 2YRVA 1GXIE 2R5AA 4LDWA 4OGEA 3OY9A 3G6EA 3OW2S 3G4SA 4X9DA 1N8RC 3CC4A 2E10A 4Y28E 2E6ZA 4OF1A 2R57A 3MEAA 4L6V5 3M9QA 4C8QB 3NTIA 2LCLA 4J6XA 2LTOA 1JB0E 4O5VA 2OTJT 1M9SA 3CCRT 2DO3A 3OS5A 4M7AA 3CCQT 1WJRA 1Y7XA 3T9NA 3GLXA 2E12A 1B34B 1U1TA 3O8VA 2FL7A 3WVEB 1M4ZA 5GAMg 1K9MU 1WJQA 4NOYA 2GQVA 2FHDA 4OMFB 3SD4A 4HT9A 3FLGA 3DB3A 2ZPBB 5HY6A 3PTAA 4JS4A 4FL6A 3MCAB 3OB9A 2EQMA 4XTZA 1I8FA 5LJ5j 5CR2A 3JCMb 3L2WA 3JB9D 1N9SA 2E1HA 3ZFJA 1N8RU 4A54A 4M77E 3CCMA 3NFCA 4B9WA 3LGFA 1VQKT 2EQJA 3FIFA 5DM7R 3CCEA 4P5NA 1PSFA 2NLUA 1X6OA 4MZPA 4PKCC 3RKYA 2KQWA 3CPFA 4M75D 3X25B 2RHYA 2Y4YA 3META 2Y90A 5DLOA 1VQPA 4QQDA 1K8AC 3ER0A 4KULA 2DD5A 1N27A 1WNLA 4PJOG 2QQSA 3RIRA 5FROA 1YJNA 2XDBA 5DLQE 2F5TX 4M77C 4QQGA 2V8KA 4ZGEB 3CPWS 3X24B 4OP0A 2XKOC 4PJOC 1VQ6T 4N0AC 2Y4XA 2CS7A 1D3BA 5KH6A 3M53A 3KUFA 3LX7A 1KD1U 3E1SA 3C4SA 4LDVA 3LWIA 3CXCS 3DLLA 1VQLT 2RM4A 4M7AG 2CZ6B 5GAMd 3FEOA 2DIQA 3JCMc 3I55A 2RJEA 1K8AU 2P0PA 4KUIA 5J39A 2E70A 2CZ7B 4YTLA 1WGSA 2KSSA 1DJ7B 2E5QA 3NTHA 4C92B 3PMIA 3MP1A 4M78B 5GAN4 1M90C 1BI1A 1KQSA 2L89A 2X35A 1NE8A 4HKEA 2KDSA 1M8VA 5CKBA 3CCJA 3CCUA 3GIBA 3OYEA 5LJ3e 1JJ2A 5CAIA 5A2QE 3CEYA 1RL2A 5GAOp 1I4K1 1VQOA 1W2BS 4LDUA 2MF2A 4NS5A 3MP8A 3JCMe 3MHXA 3M58A 2QDYB 3QUIA 4C92E 1S72T 4B9XA 4M78E 3L2VA 3QHSA 2XD0A 4V2SA 4EPCA 3FB9A 2VXEA 2WSEE 4Q5WA 2PUOB 4A4KA 5KCOA 4M77D 1YJ9T 5FU7B 4M75A 4M7DG 5J26A 2RO0A 1O75A 2CZ0B 4HCZA 3JRZA 5IN1A 1R8OB 2YLCA 2K3XA 3V7CA 5CKEA 2YHTA 4BI8B 4XQ3A 2QI2A 3TU4K 1BIAA 2RJFA 2LVMA 3GOXA 2EFIA 4M78C 4LDYA 4RMOA 2DAQA 1VQMA 1Q81U 1BI0A 3G71T 1IZ6A 2FVUA 2M1HA 2M0OA 5I2SA 1YHQT 4BI4A 2DTIA 4BY6B 1VQ4A 4J7IA 2RHXA 4KUDK 1Y96A 2LQ8A 5IT9E 2JTMA 3SWNC 1M1GA 3CBPA 5CO7A 3WXMB 2JOYA 3L42A 3OQ5A 1U1SA 2EQUA 5HKCA 4OB3B 3VKIA 4M7DD 2MI6A 5GANd 1QW1A 4C5GA 4XTVA 4ZTFA 1OYXA 4EMKB 4OB2B 3JB9G 3CD6A 2ZPFB 2XK0A 3FRNA 1YIJT 3JB9J 5LJ3f 5CVIA 2RI5A 2AHJB 3HFNA 5FRNA 1VQ7T 1KG1A 3L1AA 4JRIA 4BD3A 3CC7A 4BE1A 2DEQA 4NL3A 2EQKA 2K5FA 2OAUA 2L8DA 5M9OA 3JCMf 4M7AF 2ZCFB 4M75G 3JB9I 3QXEB 4ELZC 3OYMA 2E41A 1UGPB 1NJIC 2ZPIB 2PVOB 2DK3A 3C95A 1VQ9T 2OTJA 4QQ6A 4DOWA 1XOVA 4IUPA 4L59A 2B8AA 3UPUA 2QQRA 4M77A 3RKXA 3CCRA 2X4WA 3PGGA 4BY6C 3I56T 2V8JA 4E7HA 4M78D 4PJOB 3JB9H 1HXDA 5LJ5d 2LQKA 3URGA 1YJWT 4ZN1A 5LJ3g 5L8RE 4CI0C 4N0AA 3OYHA 2HQXA 1NZ9A 2RH2A 2VV5A 2WSCE 3ZBDA 2M16A 3ZEHA 3RMSA 4C8QE 4X9CA 2HQEA 1LNXA 4FU6A 2HAXA 1KHCA 1O9SA 2DZCA 3JCMg 3V8LA 1V29B 2RJCA 3CMAA 1YI2T 2EAYA 2QQBA 1QVGS 2JZ2A 4M7AB 2RK1A 3HRSA 4XU3A 4EMKC 3OYJA 3FC3A 1NJIU 3AHUA 1BIBA 3LH0A 2K57A 2DIGA 2X4XA 4JUVA 4F7UG 3OYCA 4PJOE 4E7JA 4DOVA 1VQKA 3GNGA 2RI3A 2XU8A 4KBMB 4R55A 3CCSA 5CKHA 1KD1C 2K3YA 5D6YA 4ME7A 3SDZA 2MWPA 4OGCA 2VXFA 5LJ3h 5C6SA 3GPLA 4MDWA 4M7DF 2LX9A 2EJGA 2JVVA 4FT2A 1HK9A 2EWNA 3H6ZA 4C8QC 2HBPA 1PSEA 3CCMT 3JCMh 4ZN3A 2A3LA 2DJZA 3PMTA 3H8ZA 4XU0A 4M7DA 3S6WA 3EFRA 1UGSB 1UGQB 3MEUA 3QBYA 4J6YA 4QVDA 3QO3A 3BFMA 2D6FA 1KHIA 3BW1A 4BUGA 4NL2A 3OYDA 4FM4B 4UC4A 3OYLA 1YITA 4JLIA 2PUKB 1NPRA 1M5Q1 2FYKA 4QW2A 2YLBA 2K5IA 3PIOA 3C94A 1XTDA 4HT8A 1QVFA 2RHZA 4M77G 4E47A 5CKDA 1FWZA 3INZA 3OSVA 3S3OA 1VQ5A 3QYHB 3DB4A 4QVZA 5KCHA 3HKSA 4LD9K 3OYFA 5LJ3j 5GMKm 2E64A 2LRQA 4C0ZA 1WPYA 2X4JA 4HA8A 5GAN6 4ZGJB 3M57A 4N4GA 4R56A 5FRMA 1VQ8A 1UGRB 1D3BB 2JN0A 3CXCA 4M78A 3UT1A 3JB9F 3MP6A 2L5QA 4RG2A 5CKFA 3CCVA 1G3TA 1KQSS 1G5VA 3VU3C 3I55T 2OTLT 3X20B 1EIFA 1QP2A 3F70A 3QZ9B 4BDYA 4A53A 1X75C 1JJ2S 2JNGA 3LWHA 2KK4A 3P8BB 4IUQA 3SWNA 3A8OB 3CC2A 4GLKA 4M75F 4PNOA 1JRIA 4C8QD 4II1A 3SB2A 1Q81C 3RKWA 1XQHA 4A4EA 2RHUA 3SFMA 3MEVA 4J6WA 3DLMA 1S72A 4RG8A 3G7ZA 1TH7A 3HHTB 1YJ9A 1LOJA 2QXFA 3C12A 5GAN7 1VQOT 4DQ2A 1M1FA 4BACA 3JSCA 3DKMA 4ZTJA 3M5AA 2PU9B 3OS2A 4MMLA 4C0DB 3CCLA 4C92C 3KBGA 2O4XA 2DXCA 1NPPA 3JAME 3TEEA 4PLLA 4HCCA 3OYAA 3UWNA 3MO8A 2X4YA 4M75B 2PVDB 3OS1A 3OYBA 3OYKA 1VIFA 3CBMA 4PLIA 4F7UF 5IAYA 4KT0E 2QEXT 2KMTA 5CIUA 1RI0A 3KXTA 4DA4A 2VGMA 1VIEA 2P4TA 4L5GA 4C0GA 4OVAA 5A0GA 3EAEA 4F7UA 3OMGA 4M78G 2L3RA 1ZQ1A 3JCMV 2HNIA 2EIFA 2K2VA 2QA4T 5A0DA 2I2LA 3A5ZB 1SSFA 1VQMT 3LGLA 3PIPA 2E6NA 2F5KA 4XU1A 1VUBA 4HCBA 3RESA 5KE2A 5EG2A 2DZ9A 5AYFA 5FU7C 4Z02A 1VQ4T 2RA2A 1ZHIA 5FLXE 3P8DA 1Y96B 2EYQA 5CK9A 3HSBA 2BKDN 1I5LA 4BI3A 4Y91A 3CMET 1Q86C 2XICA 3M4GA 2IG0A 3BY7A 1MHNA 4XTUA 3ME9A 3L2UA 1VQ7A 3QZ5B 2IVWA 2P0KA 5GMKl 4MZTA 2VYTA 3PNWC 4M77F 4C0DC 4LDXA 1W4SA 3LLRA 3QG1A 5KE3A 4C8QA 3TCJA 4JS5A 2CGHA 1XNIA 1G3YA 2H3JA 3QDRB 3HPWA 2XIDA 4JLGA 5GMKe 1ZBXA 2CZ1B 2WSFE 3P8HA 4C92D 1VQ9A 1VQNT 2GF7A 1BI2A 4PL6A 2DD4A 3CCQA 3CC7T 4FT4A 2MWOA 3QKJA 5GAMf 3JCMQ 3G6ET 3VUZA 3OW2A 1B34A 4BE2A 2FB7A 3G4ST 3CC4T 3CBOA 2LT1A 4J5YA 2ZZDA 4GY5A 4JDSA 2PQWA 3A8LB 3UDCA 3VYGA 4ZGDB 1Q82C 1YJWA 1Q86U 2K5LA 4XK8E 5D6XA 3J80E 2O01E 2RHIA 2LCCA 4EMGA 5GANe 1Q7YC 1IREB 1OI1A 4VUBA 4BE0A 5DY9A 5GAN8 4O6JA 1U8RA 3M4YA 1FXXA 1YI2A 3VJPA 4M77B 5D6WA 4JRPA 2KY9A 5HK3A 3S3MA 3V8JA 2VC8A 4XTWA 4IKFA 2DXTA 1KC8C 5I21A 5GAN3 4RCBA 2G3RA 3LYIA 2PVGB 3OBYA 3OBWA 3CMAT 5A0LA 3QYGB 5GAOl 3E9GA 4X34A 1Q82U 4M7AE 2DKGA 3Q1JA 4IUUA 3OYNA 2GCXA 2LT4A 1P92A 2RD1A 2XDPA 1Q7YU 3CCET 3GF5A 3BDLA 4CRIA 1OZ3A 2DXBA 2E65A 3CCST 5LJ5e 2KAFA 1I81A 2RJDA 3QJYA 2RK2A 4MZMA 3TREA 3V7SA 1VQPT 3QSUA 2DPPB 4C8QG 1Y71A 3BDUA 1FX7A 2XI9A 2ZPEB 5GAMh 1VQ6A 1N6AA 1YBYA 1KC8U 3JCMJ 4XTXA 1YJNT 3QPHA 5LJ3d 2JUFA 1VQLA 5LL6S 1N9RA 4J83A 1M1KC 4M7DB 2P0QA 5GMKi 3CPWA 4M7AC 1QVFS 4C92F 4JJNK 4A4GA 4M78F 2GFUA 4ELYC 3JCMd 1YITT 4E7IA 3RMQA 2GFAA 2XHCA 4IURA 4A4HA 4ATOA 2K4YA 4C92A 3HFOA 1WQ7A 2DXUA 4OB1B 3PT9A 3RERA 4N4IA 4LD6A 3LW5E 2JTFA 4M7DE 1BKBA 1VQ5T 5GANf 2OTLA 4N4HA 3NTKA 4BDZA 1UEBA 4C0FA 1M1KU 3OMCA 3VV0A 1MGQA 4RCCA 3A8HB 3J7AF 2F69A 3GNFB 4QVCA 5GAMj 1KQ2A 1H641 1VQ8T 3CCJT 3CCUT 4C5IA 3L2ZA 2D0QB 2V8IA 4EDUA 3OYIA 4E7LA 3CCVT 5FU6B 3L2RA 3JCMP 5CQYA 5GAMe 1W2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XG8 D;  3N5B B;  2XKO C; 
#chains in the Genus database with same CATH topology
 4PJO D;  1G3W A;  4OB0 B;  3E19 A;  2VVK A;  2LC4 A;  3CC2 T;  4PJJ A;  4EMH A;  4IUT A;  3WVD B;  3HRT A;  5GAO m;  5LJ5 f;  4BB7 A;  5GMK h;  3V8K A;  4C5H A;  1QP3 A;  1WXT A;  2DYI A;  3OYG A;  2BUD A;  1M90 U;  2XG8 D;  1YHQ A;  1B7T A;  2KGT A;  9ATC B;  3JCM W;  4XAX B;  5GAO r;  2DTO A;  1OPK A;  3E9F A;  3OYY A;  1ABQ A;  2I0N A;  2QA4 Q;  4LNP A;  4E7K A;  1RAG B;  1M3B A;  1BYM A;  3CME A;  5GMK j;  1WIE A;  2CKK A;  4A4F A;  3FDR A;  1YIJ Q;  1H92 A;  5CQX A;  2R5M A;  5GAO n;  3CD6 T;  1B3Q A;  3EH1 A;  3M54 A;  3MEW A;  4PJO F;  2RQV A;  2RI2 A;  2HD0 A;  2YT6 A;  1D1B A;  1PRL C;  1K73 U;  4DBH A;  1GXI E;  4J9D A;  4OMN A;  4LDW A;  4OGE A;  4JJC A;  3G6E A;  1WI7 A;  3CC4 A;  4Y28 E;  2E6Z A;  1VQN Q;  2R57 A;  2LTO A;  1JB0 E;  2YUP A;  1U1T A;  5GAM g;  1IHV A;  2CP7 A;  3H0I A;  4OMF B;  1RAB B;  2KBT A;  5HY6 A;  2NUP B;  1QVG A;  4FL6 A;  3MCA B;  3JB9 D;  2DF6 A;  4B9W A;  1VQK T;  2NUZ A;  4P5N A;  1VYT A;  1PSF A;  2NLU A;  4MZP A;  3CCM Q;  4M75 D;  4GBQ A;  1ZUK A;  4RTY A;  1GCP A;  1K8A C;  3PVQ A;  2KXD A;  2DD5 A;  1IRX A;  1VQP Q;  4IIM A;  3RIR A;  4RTU A;  2XDB A;  3I5R A;  2IIM A;  2V8K A;  2J6F A;  2OJ2 A;  2XKO C;  1YJN Q;  2CS7 A;  4M7A G;  3C4S A;  2V26 A;  2A36 A;  3FEO A;  2DIQ A;  3RBB B;  1UDL A;  2E70 A;  1T0H A;  4DEY A;  3MKD A;  3NTH A;  3C0C A;  2X35 A;  1NE8 A;  5LJ3 e;  2YRC A;  5KYX B;  1JJ2 A;  3VRY A;  3CCJ Q;  3CCU Q;  3MP8 A;  3VS2 A;  3JCM e;  2HSP A;  2AKK A;  1PHT A;  2QDY B;  4C92 E;  1S72 T;  4RUG A;  1VQO Q;  4V2S A;  2WSE E;  5KCO A;  2PUO B;  5FU7 B;  1BBZ A;  4M7D G;  1RUW A;  2LJ0 A;  3JRZ A;  3V7C A;  2HEQ A;  4XQ3 A;  3TU4 K;  1BIA A;  1WXU A;  2RJF A;  4M78 C;  2DAQ A;  1YHQ T;  4FYV B;  2DTI A;  4KUD K;  2LQ8 A;  2NYS A;  1YN8 A;  3L42 A;  2F1L A;  1T0J A;  4ANJ A;  5HKC A;  2MI6 A;  2J6O A;  5GAN d;  1QW1 A;  1OYX A;  2HDA A;  1K76 A;  1MNE A;  1X2K A;  2AHJ B;  1Z9Q A;  1WA7 A;  1XJW B;  4BD3 A;  4BE1 A;  2DEQ A;  4FYW B;  5IXB A;  2KRN A;  3CC7 Q;  2DK3 A;  1VQ9 T;  3UAT A;  4DOW A;  4IUP A;  2B8A A;  3RKX A;  3CCR A;  4BY6 C;  2V8J A;  3JB9 H;  4R0K A;  5LJ3 g;  4CI0 C;  2HBW A;  2HQX A;  3ZEH A;  1LNX A;  4FU6 A;  2RQW A;  3JCM g;  1V29 B;  3CMA A;  2HCK A;  1NYF A;  2EAY A;  2QQB A;  2JZ2 A;  1NJI U;  3LH0 A;  1SRM A;  1OX8 A;  1JU5 C;  1WHL A;  4PJO E;  1H3H A;  2XU8 A;  4KBM B;  2SRC A;  2EW3 A;  5D6Y A;  3SDZ A;  3GPL A;  2DNU A;  5LJ3 h;  1I07 A;  8ATC B;  3CCS Q;  3M0Q A;  2HBP A;  1PSE A;  5IHI A;  3JCM h;  4B6M A;  4ZN3 A;  2A3L A;  2DJZ A;  4XU0 A;  4M7D A;  2ABL A;  1E6G A;  2LP5 A;  1UGS B;  1UGQ B;  3M0T A;  3QBY A;  1B07 A;  3QO3 A;  3OYD A;  4FM4 B;  4JLI A;  1NPR A;  2FYK A;  2W10 A;  1F1B B;  2K5I A;  3PIO A;  3C94 A;  1HJD A;  1PKS A;  1BB9 A;  3INZ A;  1VQ5 A;  3QYH B;  2BE9 B;  3OYF A;  2FO0 A;  5LJ3 j;  5GMK m;  1H8K A;  1WHG A;  1ZX6 A;  2X4J A;  1I5O B;  4DEX A;  3CXC A;  4M78 A;  3UT1 A;  4OML A;  5CKF A;  1WHJ A;  2LJ1 A;  3F70 A;  3G1J A;  2FG0 A;  1D0X A;  2KK4 A;  2W0Z A;  1A0N B;  2O88 A;  1XQH A;  3MEV A;  3DLM A;  3CC2 Q;  1UHF A;  1RAD B;  3G7Z A;  2OI3 A;  2QXF A;  4F17 A;  1YWO A;  3JSC A;  1YJ9 Q;  3OS2 A;  4MML A;  4C0D B;  4C92 C;  1IGQ A;  3OYA A;  2X4Y A;  3OS1 A;  3OYB A;  4F7U F;  5IAY A;  5CIU A;  1RI0 A;  2VGM A;  4C0G A;  4E7S A;  5A0G A;  1NJI R;  1M30 A;  1M2O A;  1ZQ1 A;  2EIF A;  2QA4 T;  5A0D A;  1UJ0 A;  2QYZ A;  2EGE A;  4J9B A;  2A0F B;  1ARK A;  3EGU A;  5CK9 A;  4K11 A;  2A28 A;  1UTI A;  3BY7 A;  2KRS A;  2QAZ A;  1X6G A;  1VQ7 A;  1AVZ C;  4AFZ C;  2KNB B;  3QG1 A;  4JS5 A;  1RAA B;  4WTO B;  1Q95 G;  1OU8 A;  1KD1 R;  1ZBX A;  3EHQ A;  1VQN T;  2DD4 A;  3QKJ A;  1AD5 A;  2LT1 A;  3NHN A;  2PQW A;  3A8L B;  2DIL A;  3UDC A;  4ZGD B;  1C6V X;  1YJW A;  2K5L A;  5GAN e;  1NBE B;  4F14 A;  4O6J A;  1FXX A;  1YI2 A;  4FYY B;  2DXT A;  2CDT A;  3OBW A;  1ZUY A;  3CMA T;  5GAO l;  2DKG A;  4IUU A;  3OYN A;  2XDP A;  3AT1 B;  1MND A;  1Q7Y U;  3BDL A;  1OOT A;  2E65 A;  4MZM A;  4ESR A;  2GBQ A;  3QJY A;  1VQP T;  3QSU A;  4PJO C;  2DPP B;  1FX7 A;  1KK7 A;  1TXQ A;  1X69 A;  1YBY A;  1YJN T;  2JUF A;  2QGG A;  4F16 A;  4M7D B;  2CSQ A;  4M78 F;  4C92 A;  1QKW A;  1MMA A;  3PT9 A;  1PM3 A;  1E6H A;  1TOV A;  4LD6 A;  2EVR A;  3A98 A;  1BKB A;  1VQ5 T;  3D7S B;  2F2X A;  1FMV A;  3VV0 A;  3J7A F;  3A8H B;  1KQ2 A;  3CCJ T;  3CCU T;  4C5I A;  4E7L A;  5FU6 B;  1J3T A;  4DBF A;  2X3X D;  3HP9 A;  2A7Y A;  4FSX A;  2QTX A;  2ROL A;  2CT4 A;  4JRK A;  1X6B A;  4FIB A;  3QII A;  3OW2 P;  5GAN g;  1WJS A;  2QQA A;  1C1A A;  2BIV A;  2VGN A;  1X43 A;  1GBR A;  2QEX A;  1W1F A;  5C0M A;  3OA6 A;  5GAN h;  3V7R A;  5GAO q;  2XDD A;  3ASK A;  1YHQ Q;  1BU1 A;  2X3W D;  2LQW A;  1K73 C;  3J81 E;  2PZ1 A;  3ZL7 C;  1N5Z A;  3S3N A;  2DTH A;  2YXY A;  3TSW A;  2D1X A;  3EFS A;  2LDM A;  3R6O A;  2M9U A;  2C06 A;  4J7F A;  2EJF A;  2K2M A;  5J3B A;  2V1Q A;  2VB6 A;  3CME Q;  4M75 C;  1ZA2 B;  3CPW P;  2DL8 A;  2EKH A;  5GAN j;  2EKO A;  2HL5 C;  4JRQ A;  2KVQ G;  4F7U E;  3I56 A;  4PJO A;  2D9T A;  2EGC A;  3OW2 S;  3G4S A;  2DRK A;  3LH5 A;  3UF4 A;  3MEA A;  3M9Q A;  4J6X A;  1PRM C;  4LXC A;  3G6E Q;  3CC4 Q;  3OS5 A;  2FZK B;  3GLX A;  2PTK A;  3O8V A;  3WVE B;  1K9M U;  2M0Y A;  2ZPB B;  3JCM b;  1N9S A;  1N8R U;  3VS7 A;  1TG0 A;  1W70 A;  6AT1 B;  1QKX A;  3RKY A;  3H0H A;  1UE9 A;  4QQD A;  4RTT A;  2O31 A;  1RAF B;  1WNL A;  5IXF A;  2QQS A;  2F5T X;  4JJB A;  1BCM A;  1X27 A;  2K3B A;  4ZGE B;  3CPW S;  3X24 B;  4GLM A;  2Y4X A;  2MYS A;  4KRT A;  1RLP C;  2DET A;  2QK0 A;  3CXC S;  3LWI A;  3M0S A;  1ZSG A;  1SEM A;  1VA7 A;  5J39 A;  5KYN A;  2F2V A;  4C92 B;  2XMF A;  1M8M A;  5GAN 4;  4RTV A;  3I5S A;  5CKB A;  1CKA A;  4WCI A;  1PG5 B;  1RL2 A;  1ABO A;  1I4K 1;  1M3C A;  5IHK A;  3M58 A;  3QWY A;  1PD1 A;  4M78 E;  2K6D A;  1HD3 A;  4M77 D;  1YJ9 T;  4M75 A;  5J26 A;  2EYY A;  1O75 A;  1GL5 A;  1WHK A;  1SHF A;  5IN1 A;  2YHT A;  1QQJ A;  2RNA A;  2DX1 A;  3EG2 A;  3GOX A;  3NPF A;  1VYV A;  2KE9 A;  1Q81 U;  1PD0 A;  2M1H A;  2M0O A;  1VQ4 A;  4J7I A;  2RHX A;  1PC0 A;  2ENM A;  1IO6 A;  5IT9 E;  2JTM A;  2JOY A;  2EQU A;  2DEU A;  1D1C A;  4C5G A;  5IHN A;  3EG0 A;  5LJ3 f;  5CVI A;  3HFN A;  1SHG A;  2BTT A;  2VAS A;  3QWX X;  1M27 C;  2FPF A;  2EQK A;  2K5F A;  3JCM f;  3JB9 I;  3QXE B;  4ELZ C;  2E41 A;  1NJI C;  2ZPI B;  2ATC B;  4KGV B;  2D8H A;  2OTJ A;  1XOV A;  4L59 A;  4J9G A;  4PJN A;  3I56 T;  4PJO B;  1HXD A;  5L8R E;  3NGP A;  2VV5 A;  1NZ9 A;  3CCR Q;  2WSC E;  2HQE A;  2HAX A;  1O9S A;  2RJC A;  3A1P A;  4EMK C;  2RK1 A;  4F7U G;  1VYU A;  3CMA Q;  1W6X A;  3R6N A;  1KD1 C;  2JM9 A;  5C6S A;  2LX9 A;  4IIO A;  3NMZ C;  4OMQ A;  3H6Z A;  1UJY A;  1RAI B;  3H8Z A;  5GJV B;  1KSW A;  1M90 R;  4J6Y A;  1IXD A;  2D6F A;  1UUE A;  4UC4 A;  1YIT A;  2PUK B;  2JW4 A;  2RPN A;  4FW2 A;  2YLB A;  2G6F X;  2DYB A;  1XTD A;  2C0T A;  3QDF A;  3OSV A;  3S3O A;  1TSF A;  1NEG A;  5FW9 A;  3DB4 A;  4AFU C;  4LD9 K;  1QLY A;  4C0Z A;  4R56 A;  1VQ5 Q;  1UGR B;  2LNH B;  2FEI A;  3JB9 F;  4RG2 A;  1G5V A;  1OEB A;  1TS9 A;  3VU3 C;  1QP2 A;  1S1N A;  3P8B B;  1BCO A;  1K73 R;  4M75 F;  4C8Q D;  1JRI A;  4II1 A;  1WDX A;  3SB2 A;  3RKW A;  4A4E A;  3SFM A;  4AFS C;  4J6W A;  2ZAE A;  2GGR A;  3VS3 A;  1TH7 A;  1TWB A;  3HHT B;  8AT1 B;  3EHR A;  4DQ2 A;  2YUN A;  2FPE A;  3H9N A;  2BZX A;  1GFD A;  2DRM A;  2K9G A;  2O4X A;  1NPP A;  1SSH A;  1R0B G;  2EGA A;  4PLL A;  3MO8 A;  4M75 B;  3CBM A;  5HCK A;  1PKT A;  1SG5 A;  4DA4 A;  2P4T A;  4L5G A;  4OVA A;  4F7U A;  3OMG A;  4M78 G;  3JCM V;  1SF9 A;  2CH4 W;  2K2V A;  1SSF A;  3LGL A;  2F5K A;  3CQT A;  4HCB A;  3RES A;  5EG2 A;  2DZ9 A;  4Z02 A;  1VQ4 T;  2RQU A;  1ZHI A;  2JS2 A;  1M2V A;  2BKD N;  3CME T;  4OMM A;  4KGZ B;  3RDV A;  1MHN A;  4XTU A;  2IVW A;  1LPL A;  4LDX A;  2MK5 A;  1QVF P;  3TCJ A;  3H0F A;  2CGH A;  1G3Y A;  2JT4 A;  1VQ7 Q;  2KT8 A;  3CCQ A;  4FT4 A;  2CRE A;  2MWO A;  3JCM Q;  3G6E T;  3OW2 A;  1B34 A;  4BE2 A;  2BZY A;  3CC4 T;  4J5Y A;  2YSQ A;  2LCC A;  1Q7Y C;  1IRE B;  4VUB A;  4BE0 A;  2DM1 A;  1D09 B;  3M4Y A;  1YJW Q;  3VJP A;  1ACM B;  1TU0 B;  4IKF A;  1YI2 Q;  5I21 A;  2P4R A;  4LE9 A;  2G3R A;  3LYI A;  2PVG B;  2LMJ A;  4X34 A;  1PNJ A;  2QAS A;  3GF5 A;  4CRI A;  2KAF A;  2RJD A;  2RK2 A;  5KYW A;  1VQ6 A;  1KC8 U;  3JCM J;  1Y57 A;  4XTX A;  4J9C A;  2EYX A;  3QPH A;  1I0C A;  1VQL A;  5LL6 S;  1N9R A;  2OAW A;  1IGU A;  3CPW A;  1QVF S;  4JJN K;  4A4G A;  2GFU A;  2KT1 A;  1TTH B;  1YIT T;  2XHC A;  1MUZ A;  4HVU A;  2HKN A;  2DXU A;  3M0R A;  3RER A;  2AK5 A;  4N4I A;  3LW5 E;  5GAN f;  2OTL A;  4N4H A;  3NTK A;  4BDZ A;  2B86 A;  1UEB A;  4C0F A;  2RN8 A;  2JJ9 A;  1H64 1;  1D1A A;  1K9A A;  3L2Z A;  2D0Q B;  2MPX C;  1JQQ A;  2QQ9 A;  2ZPH B;  2D0N A;  2CT3 A;  3EG1 A;  1K1Z A;  4XU2 A;  4IUV A;  5HK0 A;  1OU9 A;  3HRU A;  2C0O A;  3JCM X;  3N5B B;  4RKU E;  2VUB A;  1AZE A;  1WHM A;  4AMC A;  2J6K A;  1GFC A;  4M7A D;  4ORZ A;  1AHJ B;  1LJO A;  2H8H A;  3G71 A;  1Z9Z A;  3X28 B;  3JV3 A;  1Y07 A;  4J8O A;  4XTY A;  4C92 G;  2LJ3 A;  1KIK A;  2MMP A;  2DBK A;  2O4X B;  2QEX Q;  3A8G B;  4M75 E;  1ZA1 B;  2LNV A;  2DL4 A;  4JPB W;  2RB6 A;  3VUB A;  1EZZ B;  4MDX A;  3VYH B;  5I2M A;  1WQW A;  4F7U B;  2KRM A;  1YP5 A;  3QJ6 A;  3JCM P;  1WZO A;  3HL8 A;  4HVV A;  1MV0 B;  3M59 A;  1ZSZ C;  4PK4 A;  2EYW A;  3M56 A;  1M3A A;  2D8J A;  1M2V B;  2L3P A;  3L2Q A;  1K9M C;  3A8M B;  3RUX A;  3X26 B;  2YRV A;  2R5A A;  3OY9 A;  1N8R C;  2E10 A;  4HVW A;  4OF1 A;  4L6V 5;  3I56 Q;  2COY A;  3CCR T;  2DA9 A;  3G4S Q;  3CCQ T;  1JXO A;  1WJR A;  3T9N A;  3KFV A;  1B34 B;  2FL7 A;  1M4Z A;  1WJQ A;  2FHD A;  3SD4 A;  3L2W A;  5CR2 A;  3OB9 A;  2EQM A;  1W2B P;  3ZFJ A;  2DE0 X;  3VS0 A;  2CP6 A;  1PWT A;  3LGF A;  3RNJ A;  2HKQ B;  3CCE A;  3CPF A;  3X25 B;  3MET A;  2KYM A;  5DLO A;  2J06 A;  1WFW A;  4KUL A;  2CSI A;  1TUD A;  3PVL A;  4E6R A;  2CP0 A;  4X1V A;  1N27 A;  4PJO G;  4M77 C;  4QQG A;  2CUD A;  4CC7 A;  4OMO A;  1T3S A;  4HCK A;  1AT1 B;  1VQ6 T;  4N0A C;  1D3B A;  5KH6 A;  3KUF A;  3E1S A;  5KYU A;  1VQL T;  1OPL A;  2RM4 A;  1FMW A;  2CZ6 B;  5GAM d;  2DFU A;  3I55 A;  3JCM c;  2RJE A;  2P0P A;  1JO8 A;  2ESW A;  2AZV A;  4YTL A;  2KSS A;  1DJ7 B;  2E5Q A;  3MP1 A;  4M78 B;  1M90 C;  1BI1 A;  4M4Z A;  4HKE A;  2IPO B;  3GIB A;  3OYE A;  5CAI A;  4FCY A;  2JMA A;  3CEY A;  2YWW A;  1W2B S;  2X51 A;  4LDU A;  3MHX A;  1ZBJ A;  3QUI A;  1ZLM A;  4B9X A;  3L2V A;  2XD0 A;  3FB9 A;  2VXE A;  4Q5W A;  1ZSZ A;  5FWC A;  2NUT A;  2E3H A;  2K3X A;  2KI7 A;  4BI8 B;  4KH1 B;  5CKE A;  1GCQ C;  2LVM A;  2EFI A;  2NWM A;  4Z8A A;  1EFN A;  1VQM A;  3G71 T;  1IZ6 A;  2FVU A;  4BY6 B;  3SWN C;  1Q7Y R;  5CO7 A;  3OQ5 A;  1VQ4 Q;  2LQN A;  4XTV A;  1G8X A;  4ZTF A;  3JB9 G;  3CD6 A;  2ZPF B;  2XK0 A;  3JB9 J;  2RI5 A;  1VQ7 T;  1KG1 A;  1FMK A;  4JRI A;  4NL3 A;  2OAU A;  1OUL A;  2JXB A;  4M75 G;  3OYM A;  2CUB A;  2PVO B;  3M0P A;  2JS0 A;  2VWF A;  3UPU A;  2QQR A;  4M77 A;  3EH2 A;  2X4W A;  2CH4 A;  5LJ5 d;  3URG A;  2OTJ Q;  1YJW T;  1EX4 A;  1KQS P;  4N0A A;  2RH2 A;  3ZBD A;  4X9C A;  7AT1 B;  1YI2 T;  2NUP A;  2L0A A;  3HRS A;  4XU3 A;  3FC3 A;  2X4X A;  4JUV A;  3OYC A;  4E7J A;  4DOV A;  1VQK A;  3GNG A;  4R55 A;  5CKH A;  2K3Y A;  1AWO A;  4ME7 A;  4OGC A;  2J05 A;  1BK2 A;  3EG3 A;  4PFP A;  1HK9 A;  2EWN A;  4C8Q C;  2KYB A;  3PMT A;  2ED0 A;  3O5Z A;  3S6W A;  3EFR A;  1GBQ A;  2LX7 A;  3BFM A;  4BUG A;  3BW1 A;  4NL2 A;  3OYL A;  4QW2 A;  1G83 A;  1YIT Q;  2JM8 A;  1QVF A;  2YUO A;  2RHZ A;  4J9I A;  4E47 A;  5CKD A;  1RI9 A;  1E7O A;  5KCH A;  2DJQ A;  4HXJ A;  2E64 A;  4E7Z A;  5GAN 6;  5FRM A;  1VQ8 A;  1D3B B;  1GCQ A;  3EGD A;  2HSE B;  1RAE B;  2L5Q A;  5KYU B;  3CCV A;  1KQS S;  3I55 T;  1EIF A;  2HL3 A;  4BDY A;  4A53 A;  2JNG A;  3LWH A;  2QG9 B;  3SWN A;  3A8O B;  4GLK A;  1U5S A;  2KRO A;  2RHU A;  1S72 A;  4JZ4 A;  3SEM A;  3C12 A;  2DL7 A;  4BAC A;  1LVK A;  3DKM A;  3M5A A;  3SHW A;  2JMC A;  3CCL A;  2BE7 D;  3KBG A;  1K9M R;  2FPD A;  1ZSZ B;  3UWN A;  1K4U S;  3OYK A;  1VIF A;  1K0S A;  2NUT B;  2QEX T;  1ZUU A;  1N8R R;  2SEM A;  1VIE A;  2QGF B;  2L3R A;  2KR3 A;  2HNI A;  3RR6 A;  2CP5 A;  3U23 A;  1VQM T;  3PIP A;  5KE2 A;  2RMO A;  5AYF A;  2RA2 A;  1I5L A;  1TUG B;  1NYG A;  1G2B A;  3M4G A;  2IG0 A;  2L3S A;  3ME9 A;  3QZ5 B;  2HQH A;  5GMK l;  4MZT A;  3PNW C;  4M77 F;  4C0D C;  3LLR A;  5KE3 A;  4C8Q A;  1XNI A;  2H3J A;  2XID A;  2CZ1 B;  1VQ9 A;  2V1R A;  3I35 A;  1MMD A;  4RTZ A;  3G4S T;  1AEY A;  3CBO A;  1RLQ C;  4DBR A;  3CCQ Q;  1Q86 U;  3FJ5 A;  1UGV A;  2RHI A;  2O2O A;  3VS5 A;  5GAN 8;  1RAH B;  1AOJ A;  4M77 B;  5D6W A;  1YNZ A;  2KY9 A;  2QTV A;  3S3M A;  2VC8 A;  4XTW A;  1KC8 C;  5GAN 3;  5I11 A;  3OBY A;  2AZS A;  5A0L A;  1MMG A;  3E9G A;  1Q82 U;  2CP2 A;  2GCX A;  2LT4 A;  1Y0M A;  1NEB A;  4RTW A;  1OZ3 A;  2DXB A;  3MJX A;  5LJ5 e;  1V1C A;  1UFF A;  3IQL A;  4D8D A;  2XI9 A;  5GAM h;  1N6A A;  3REB B;  1AZG B;  2DMO A;  4J83 A;  1Q81 R;  2P0Q A;  5GMK i;  1VQ6 Q;  4M7A C;  4ELY C;  3RMQ A;  1VQL Q;  2GFA A;  4IUR A;  4JJD A;  3PE0 A;  1WX6 A;  2P84 A;  4J9H A;  1U06 A;  1M1K U;  3OMC A;  1MGQ A;  4RCC A;  5GAM j;  2OTL Q;  1VQ8 T;  4AG1 C;  3EGD B;  3CCV T;  5CQY A;  3EFO A;  1W2B A;  4EIK A;  2DVE A;  2R58 A;  4MMK A;  3OS0 A;  3PFS A;  1NG2 A;  2ZPG B;  4M7D C;  3SWN B;  5GAN 2;  1X01 A;  1G3S A;  4WF2 A;  1HSQ A;  1YCY A;  4DBQ A;  2YRD A;  5I22 A;  2PNI A;  1UB4 A;  1BI3 A;  3THK A;  4CC2 A;  1Q86 R;  3GP8 A;  1H3Z A;  4D6W A;  3UA6 A;  5ECA A;  4C5E A;  1KQ1 A;  2WAC A;  3G71 Q;  3TSZ A;  3M0U A;  3CCL T;  2K79 A;  2L3Q A;  2VKN A;  2HMA A;  2EJ9 A;  2QDL A;  3REA B;  2YDL A;  5CCA A;  2QA4 A;  4AT1 B;  4EMK A;  5LJ5 g;  5FU6 C;  5GAN 5;  1OV3 A;  4PFO A;  2A08 A;  3FJP A;  1QVP A;  3OSS C;  1JBM A;  1Q82 R;  1YIJ A;  4C8Q F;  4F04 B;  4LUD A;  2AKL A;  2ZGW A;  4AG2 C;  2RQR A;  2MAM A;  2RQT A;  2FZC B;  1OZ2 A;  5LJ5 h;  4TVR A;  3GBQ A;  3M55 A;  2CYZ B;  2OX7 A;  2H3E B;  1VQN A;  4Y92 A;  1AWX A;  4X9D A;  4C8Q B;  2OTJ T;  3NTI A;  2LCL A;  4FSS A;  4O5V A;  1M9S A;  2DO3 A;  4M7A A;  1Y7X A;  1AWJ A;  2E12 A;  4LN2 A;  3UA7 A;  4NOY A;  2GQV A;  1V76 A;  4HT9 A;  1M1K R;  3I9Q A;  3FLG A;  3DB3 A;  1MMN A;  3PTA A;  4JS4 A;  4ZTJ A;  4XTZ A;  5FWB A;  1I8F A;  5LJ5 j;  2AT1 B;  2E1H A;  2MOX A;  4A54 A;  4M77 E;  3CCM A;  3NFC A;  1WLP B;  2DL5 A;  2EQJ A;  1D0Y A;  3FIF A;  5DM7 R;  4PKC C;  1X6O A;  2KQW A;  2ECZ A;  2RHY A;  2Y4Y A;  2Y90 A;  1VQP A;  2GTJ A;  3CCE Q;  3ER0 A;  1K0X A;  1YJN A;  5FRO A;  5DLQ E;  3MPU B;  4OP0 A;  1QMC A;  1R77 A;  2EQI A;  3M53 A;  3LX7 A;  1KD1 U;  4LDV A;  3DLL A;  1NM7 A;  4CC3 A;  1K8A U;  4Z89 A;  4KUI A;  2CZ7 B;  2EYZ A;  1WGS A;  2KXC A;  3I55 Q;  4A63 B;  3PMI A;  1KQS A;  2L89 A;  2LZ6 B;  2KDS A;  1C0M A;  3CCJ A;  3CCU A;  1M8V A;  2MCN A;  5A2Q E;  5GAO p;  1VQO A;  2JTE A;  2MF2 A;  4NS5 A;  1WHH A;  3QHS A;  4EPC A;  1U3O A;  4A4K A;  3EFO B;  5IH2 A;  3VRZ A;  2RO0 A;  2CZ0 B;  1SKU B;  4HCZ A;  1YFN A;  1R8O B;  2YLC A;  3ULR B;  2LCS A;  2QI2 A;  1TUC A;  2C0I A;  1KJW A;  1UHC A;  1QVG P;  4LDY A;  4RMO A;  3EGX A;  1BI0 A;  1UG1 A;  5I2S A;  1YCS B;  4BI4 A;  1Y96 A;  1VQM Q;  4PJL A;  1M1G A;  3CBP A;  3WXM B;  4E2F B;  1U1S A;  4OB3 B;  3VKI A;  4M7D D;  3TQ7 P;  4KGX B;  1NLO C;  4EMK B;  1PCX A;  1KC8 R;  4OB2 B;  3FRN A;  2E4H A;  1YIJ T;  1QWF A;  4OMP A;  5FRN A;  3L1A A;  3CC7 A;  2EPD A;  3CD6 Q;  5M9O A;  2L8D A;  5KYY A;  4M7A F;  1LCK A;  2ZCF B;  1UGP B;  1QCF A;  5EC7 A;  1HYO A;  4PJM A;  3C95 A;  4QQ6 A;  1CSK A;  2FRY A;  3PGG A;  4CC4 B;  4E7H A;  4M78 D;  1K8A R;  2LQK A;  4ZN1 A;  2ROT A;  3OYH A;  4C8Q E;  1QWE A;  2M16 A;  3RMS A;  2COW A;  1KHC A;  2DZC A;  3V8L A;  1JJ2 P;  2MIO A;  1QVG S;  3AHU A;  4M7A B;  3OYJ A;  1BIB A;  2K57 A;  2DIG A;  2AIR B;  2RI3 A;  3CCS A;  1T3L A;  2DLP A;  2MWP A;  2VXF A;  3EG9 A;  4MDW A;  4M7D F;  1MV3 A;  1R0C B;  4FT2 A;  2EJG A;  2JVV A;  1VQK Q;  4QT7 A;  3CCM T;  2M51 A;  3MEU A;  4ZNX A;  4QVD A;  1UEC A;  5KYW B;  1KHI A;  4J9F A;  1IHW A;  1M5Q 1;  2RF0 A;  3E2U A;  1QCO A;  4HT8 A;  4M77 G;  1KFZ A;  1FWZ A;  4PFZ A;  2DER A;  1SRL A;  2L2P A;  4QVZ A;  3HKS A;  2LRQ A;  1WPY A;  4ZGJ B;  4HA8 A;  3M57 A;  4N4G A;  2JN0 A;  4Z88 A;  3MP6 A;  2KEA A;  2YUQ A;  4RTX A;  1WXB A;  1G3T A;  5L23 A;  2OTL T;  3X20 B;  3QZ9 B;  1VQ8 Q;  1X75 C;  1JJ2 S;  4D8K A;  3CCV Q;  4KH0 B;  1AWW A;  4IUQ A;  3CC2 A;  1JEG A;  2O9S A;  4PNO A;  1Q81 C;  2DL3 A;  4RG8 A;  2GQI A;  1YJ9 A;  1LOJ A;  5GAN 7;  1VQO T;  2A37 A;  1S72 Q;  1M1F A;  2Z0W A;  2FRW A;  2ED1 A;  2PU9 B;  2DXC A;  3JAM E;  3TEE A;  4HCC A;  2PVD B;  4PLI A;  3CCL Q;  4KT0 E;  2KMT A;  2X9H A;  3KXT A;  3EAE A;  1WYX A;  2I2L A;  3A5Z B;  2E6N A;  3EGX B;  4XU1 A;  1VUB A;  5FU7 C;  1VOM A;  2F2W A;  3BE3 A;  3P8D A;  1Y96 B;  1X2Q A;  2EYQ A;  5FLX E;  3HSB A;  4BI3 A;  1NLP C;  4Y91 A;  1Q86 C;  2XIC A;  3VS1 A;  3L2U A;  2P0K A;  2VYT A;  1IB8 A;  2CP3 A;  1W4S A;  1YWP A;  5D7U A;  3QDR B;  3HPW A;  4JLG A;  5GMK e;  4JZ3 A;  4FYX B;  2WSF E;  3P8H A;  4C92 D;  5AT1 B;  2GF7 A;  1BI2 A;  4PL6 A;  3CC7 T;  5GAM f;  1CKB A;  3VUZ A;  2FZG B;  2FB7 A;  2ZZD A;  4GY5 A;  4JDS A;  3VYG A;  5KYY B;  1VQ9 Q;  1Q82 C;  3CXC P;  4FW1 A;  4XK8 E;  1RAC B;  5D6X A;  3J80 E;  2O01 E;  2M02 A;  4AFQ C;  4EMG A;  1OI1 A;  1SPK A;  2HZY A;  3VS6 A;  5DY9 A;  1JXM A;  4J9E A;  1U8R A;  1QCN A;  4JRP A;  5HK3 A;  3V8J A;  1D0Z A;  4RCB A;  3QYG B;  4M7A E;  3Q1J A;  2DBM A;  1P92 A;  2E3I A;  2RD1 A;  3CCE T;  3CCS T;  2O9V A;  3TRE A;  1I81 A;  3V7S A;  3EG9 B;  4C8Q G;  1Y71 A;  4LUE A;  3BDU A;  2ZPE B;  2E5K A;  3HTR A;  2EBP A;  3VS4 A;  3TVT A;  5LJ3 d;  1FYN A;  1M1K C;  1OX9 A;  4C92 F;  2J7I A;  3JCM d;  4E7I A;  2K7A A;  4ATO A;  4A4H A;  1I1J A;  2K4Y A;  3HFO A;  1WQ7 A;  4OB1 B;  3H41 A;  1GRI A;  5GJW B;  5KYX A;  2JTF A;  4M7D E;  2GNC A;  1OQK A;  2COZ A;  2F69 A;  3GNF B;  4QVC A;  2GTO A;  2V8I A;  4EDU A;  3OYI A;  4QKU A;  3L2R A;  2DVJ A;  5GAM e;  2BZ8 A; 
#chains in the Genus database with same CATH homology
 4PJO D;  2QQ9 A;  3HP9 A;  2ZPH B;  2A7Y A;  1G3W A;  2DVE A;  2R58 A;  2QTX A;  3E19 A;  4FSX A;  4MMK A;  4OB0 B;  3PFS A;  2LC4 A;  3OS0 A;  4JRK A;  2ZPG B;  3CC2 T;  4FIB A;  4XU2 A;  3QII A;  3SWN B;  1X01 A;  1G3S A;  4IUV A;  5HK0 A;  5GAN 2;  3HRU A;  5GAN g;  4WF2 A;  3JCM X;  3N5B B;  4EMH A;  4M7D C;  1WJS A;  4IUT A;  4RKU E;  2QQA A;  3WVD B;  2VUB A;  1YCY A;  3HRT A;  5GAO m;  5LJ5 f;  4M7A D;  4BB7 A;  5GMK h;  2BIV A;  1UB4 A;  1BI3 A;  3V8K A;  4C5H A;  1AHJ B;  1LJO A;  1QP3 A;  3OYG A;  2BUD A;  1M90 U;  2VGN A;  3GP8 A;  3G71 A;  1H3Z A;  4D6W A;  2XG8 D;  3X28 B;  1YHQ A;  1Y07 A;  3JCM W;  4C5E A;  4J8O A;  4XAX B;  2QEX A;  4XTY A;  4C92 G;  1KQ1 A;  2WAC A;  5C0M A;  2MMP A;  3OA6 A;  5GAO r;  5GAN h;  3V7R A;  5GAO q;  2XDD A;  3ASK A;  3CCL T;  2DTO A;  2O4X B;  2EJ9 A;  3A8G B;  3E9F A;  3OYY A;  4M75 E;  2LNV A;  5CCA A;  2QA4 A;  4EMK A;  5LJ5 g;  5FU6 C;  5GAN 5;  3J81 E;  2RB6 A;  1K73 C;  3S3N A;  3VUB A;  2DTH A;  3FJP A;  1QVP A;  3OSS C;  1JBM A;  3VYH B;  5I2M A;  4MDX A;  4E7K A;  1YIJ A;  4C8Q F;  1QVG A;  1WQW A;  3EFS A;  4F7U B;  3QJ6 A;  1BYM A;  2LDM A;  3CME A;  2ZGW A;  5GMK j;  2CKK A;  3R6O A;  2M9U A;  4A4F A;  2C06 A;  4J7F A;  2EJF A;  3FDR A;  3HL8 A;  5CQX A;  5J3B A;  2R5M A;  2MAM A;  5GAO n;  3M59 A;  3CD6 T;  3M54 A;  3MEW A;  4M75 C;  4PJO F;  2RI2 A;  3M56 A;  2HD0 A;  1OZ2 A;  5LJ5 h;  4TVR A;  3M55 A;  2CYZ B;  3L2Q A;  1K9M C;  1K73 U;  3A8M B;  5GAN j;  2EKO A;  4JRQ A;  2KVQ G;  4F7U E;  3I56 A;  1VQN A;  2D9T A;  3RUX A;  3X26 B;  4PJO A;  2YRV A;  1GXI E;  2R5A A;  4LDW A;  4OGE A;  3OY9 A;  3G6E A;  3OW2 S;  3G4S A;  4X9D A;  1N8R C;  3CC4 A;  2E10 A;  4Y28 E;  2E6Z A;  4OF1 A;  2R57 A;  3MEA A;  4L6V 5;  3M9Q A;  4C8Q B;  3NTI A;  2LCL A;  4J6X A;  2LTO A;  1JB0 E;  4O5V A;  2OTJ T;  1M9S A;  3CCR T;  2DO3 A;  3OS5 A;  4M7A A;  3CCQ T;  1WJR A;  1Y7X A;  3T9N A;  3GLX A;  2E12 A;  1B34 B;  1U1T A;  3O8V A;  2FL7 A;  3WVE B;  1M4Z A;  5GAM g;  1K9M U;  1WJQ A;  4NOY A;  2GQV A;  2FHD A;  4OMF B;  3SD4 A;  4HT9 A;  3FLG A;  3DB3 A;  2ZPB B;  5HY6 A;  3PTA A;  4JS4 A;  4FL6 A;  3MCA B;  3OB9 A;  2EQM A;  4XTZ A;  1I8F A;  5LJ5 j;  5CR2 A;  3JCM b;  3L2W A;  3JB9 D;  1N9S A;  2E1H A;  3ZFJ A;  1N8R U;  4A54 A;  4M77 E;  3CCM A;  3NFC A;  4B9W A;  3LGF A;  1VQK T;  2EQJ A;  3FIF A;  5DM7 R;  3CCE A;  4P5N A;  1PSF A;  2NLU A;  1X6O A;  4MZP A;  4PKC C;  3RKY A;  2KQW A;  3CPF A;  4M75 D;  3X25 B;  2RHY A;  2Y4Y A;  3MET A;  2Y90 A;  5DLO A;  1VQP A;  4QQD A;  1K8A C;  3ER0 A;  4KUL A;  2DD5 A;  1N27 A;  1WNL A;  4PJO G;  2QQS A;  3RIR A;  5FRO A;  1YJN A;  2XDB A;  5DLQ E;  2F5T X;  4M77 C;  4QQG A;  2V8K A;  4ZGE B;  3CPW S;  3X24 B;  4OP0 A;  2XKO C;  4PJO C;  1VQ6 T;  4N0A C;  2Y4X A;  2CS7 A;  1D3B A;  5KH6 A;  3M53 A;  3KUF A;  3LX7 A;  1KD1 U;  3E1S A;  3C4S A;  4LDV A;  3LWI A;  3CXC S;  3DLL A;  1VQL T;  2RM4 A;  4M7A G;  2CZ6 B;  5GAM d;  3FEO A;  2DIQ A;  3JCM c;  3I55 A;  2RJE A;  1K8A U;  2P0P A;  4KUI A;  5J39 A;  2E70 A;  2CZ7 B;  4YTL A;  1WGS A;  2KSS A;  1DJ7 B;  2E5Q A;  3NTH A;  4C92 B;  3PMI A;  3MP1 A;  4M78 B;  5GAN 4;  1M90 C;  1BI1 A;  1KQS A;  2L89 A;  2X35 A;  1NE8 A;  4HKE A;  2KDS A;  1M8V A;  5CKB A;  3CCJ A;  3CCU A;  3GIB A;  3OYE A;  5LJ3 e;  1JJ2 A;  5CAI A;  5A2Q E;  3CEY A;  1RL2 A;  5GAO p;  1I4K 1;  1VQO A;  1W2B S;  4LDU A;  2MF2 A;  4NS5 A;  3MP8 A;  3JCM e;  3MHX A;  3M58 A;  2QDY B;  3QUI A;  4C92 E;  1S72 T;  4B9X A;  4M78 E;  3L2V A;  3QHS A;  2XD0 A;  4V2S A;  4EPC A;  3FB9 A;  2VXE A;  2WSE E;  4Q5W A;  2PUO B;  4A4K A;  5KCO A;  4M77 D;  1YJ9 T;  5FU7 B;  4M75 A;  4M7D G;  5J26 A;  2RO0 A;  1O75 A;  2CZ0 B;  4HCZ A;  3JRZ A;  5IN1 A;  1R8O B;  2YLC A;  2K3X A;  3V7C A;  5CKE A;  2YHT A;  4BI8 B;  4XQ3 A;  2QI2 A;  3TU4 K;  1BIA A;  2RJF A;  2LVM A;  3GOX A;  2EFI A;  4M78 C;  4LDY A;  4RMO A;  2DAQ A;  1VQM A;  1Q81 U;  1BI0 A;  3G71 T;  1IZ6 A;  2FVU A;  2M1H A;  2M0O A;  5I2S A;  1YHQ T;  4BI4 A;  2DTI A;  4BY6 B;  1VQ4 A;  4J7I A;  2RHX A;  4KUD K;  1Y96 A;  2LQ8 A;  5IT9 E;  2JTM A;  3SWN C;  1M1G A;  3CBP A;  5CO7 A;  3WXM B;  2JOY A;  3L42 A;  3OQ5 A;  1U1S A;  2EQU A;  5HKC A;  4OB3 B;  3VKI A;  4M7D D;  2MI6 A;  5GAN d;  1QW1 A;  4C5G A;  4XTV A;  4ZTF A;  1OYX A;  4EMK B;  4OB2 B;  3JB9 G;  3CD6 A;  2ZPF B;  2XK0 A;  3FRN A;  1YIJ T;  3JB9 J;  5LJ3 f;  5CVI A;  2RI5 A;  2AHJ B;  3HFN A;  5FRN A;  1VQ7 T;  1KG1 A;  3L1A A;  4JRI A;  4BD3 A;  3CC7 A;  4BE1 A;  2DEQ A;  4NL3 A;  2EQK A;  2K5F A;  2OAU A;  2L8D A;  5M9O A;  3JCM f;  4M7A F;  2ZCF B;  4M75 G;  3JB9 I;  3QXE B;  4ELZ C;  3OYM A;  2E41 A;  1UGP B;  1NJI C;  2ZPI B;  2PVO B;  2DK3 A;  3C95 A;  1VQ9 T;  2OTJ A;  4QQ6 A;  4DOW A;  1XOV A;  4IUP A;  4L59 A;  2B8A A;  3UPU A;  2QQR A;  4M77 A;  3RKX A;  3CCR A;  2X4W A;  3PGG A;  4BY6 C;  3I56 T;  2V8J A;  4E7H A;  4M78 D;  4PJO B;  3JB9 H;  1HXD A;  5LJ5 d;  2LQK A;  3URG A;  1YJW T;  4ZN1 A;  5LJ3 g;  5L8R E;  4CI0 C;  4N0A A;  3OYH A;  2HQX A;  1NZ9 A;  2RH2 A;  2VV5 A;  2WSC E;  3ZBD A;  2M16 A;  3ZEH A;  3RMS A;  4C8Q E;  4X9C A;  2HQE A;  1LNX A;  4FU6 A;  2HAX A;  1KHC A;  1O9S A;  2DZC A;  3JCM g;  3V8L A;  1V29 B;  2RJC A;  3CMA A;  1YI2 T;  2EAY A;  2QQB A;  1QVG S;  2JZ2 A;  4M7A B;  2RK1 A;  3HRS A;  4XU3 A;  4EMK C;  3OYJ A;  3FC3 A;  1NJI U;  3AHU A;  1BIB A;  3LH0 A;  2K57 A;  2DIG A;  2X4X A;  4JUV A;  4F7U G;  3OYC A;  4PJO E;  4E7J A;  4DOV A;  1VQK A;  3GNG A;  2RI3 A;  2XU8 A;  4KBM B;  4R55 A;  3CCS A;  5CKH A;  1KD1 C;  2K3Y A;  5D6Y A;  4ME7 A;  3SDZ A;  2MWP A;  4OGC A;  2VXF A;  5LJ3 h;  5C6S A;  3GPL A;  4MDW A;  4M7D F;  2LX9 A;  2EJG A;  2JVV A;  4FT2 A;  1HK9 A;  2EWN A;  3H6Z A;  4C8Q C;  2HBP A;  1PSE A;  3CCM T;  3JCM h;  4ZN3 A;  2A3L A;  2DJZ A;  3PMT A;  3H8Z A;  4XU0 A;  4M7D A;  3S6W A;  3EFR A;  1UGS B;  1UGQ B;  3MEU A;  3QBY A;  4J6Y A;  4QVD A;  3QO3 A;  3BFM A;  2D6F A;  1KHI A;  3BW1 A;  4BUG A;  4NL2 A;  3OYD A;  4FM4 B;  4UC4 A;  3OYL A;  1YIT A;  4JLI A;  2PUK B;  1NPR A;  1M5Q 1;  2FYK A;  4QW2 A;  2YLB A;  2K5I A;  3PIO A;  3C94 A;  1XTD A;  4HT8 A;  1QVF A;  2RHZ A;  4M77 G;  4E47 A;  5CKD A;  1FWZ A;  3INZ A;  3OSV A;  3S3O A;  1VQ5 A;  3QYH B;  3DB4 A;  4QVZ A;  5KCH A;  3HKS A;  4LD9 K;  3OYF A;  5LJ3 j;  5GMK m;  2E64 A;  2LRQ A;  4C0Z A;  1WPY A;  2X4J A;  4HA8 A;  5GAN 6;  4ZGJ B;  3M57 A;  4N4G A;  4R56 A;  5FRM A;  1VQ8 A;  1UGR B;  1D3B B;  2JN0 A;  3CXC A;  4M78 A;  3UT1 A;  3JB9 F;  3MP6 A;  2L5Q A;  4RG2 A;  5CKF A;  3CCV A;  1G3T A;  1KQS S;  1G5V A;  3VU3 C;  3I55 T;  2OTL T;  3X20 B;  1EIF A;  1QP2 A;  3F70 A;  3QZ9 B;  4BDY A;  4A53 A;  1X75 C;  1JJ2 S;  2JNG A;  3LWH A;  2KK4 A;  3P8B B;  4IUQ A;  3SWN A;  3A8O B;  3CC2 A;  4GLK A;  4M75 F;  4PNO A;  1JRI A;  4C8Q D;  4II1 A;  3SB2 A;  1Q81 C;  3RKW A;  1XQH A;  4A4E A;  2RHU A;  3SFM A;  3MEV A;  4J6W A;  3DLM A;  1S72 A;  4RG8 A;  3G7Z A;  1TH7 A;  3HHT B;  1YJ9 A;  1LOJ A;  2QXF A;  3C12 A;  5GAN 7;  1VQO T;  4DQ2 A;  1M1F A;  4BAC A;  3JSC A;  3DKM A;  4ZTJ A;  3M5A A;  2PU9 B;  3OS2 A;  4MML A;  4C0D B;  3CCL A;  4C92 C;  3KBG A;  2O4X A;  2DXC A;  1NPP A;  3JAM E;  3TEE A;  4PLL A;  4HCC A;  3OYA A;  3UWN A;  3MO8 A;  2X4Y A;  4M75 B;  2PVD B;  3OS1 A;  3OYB A;  3OYK A;  1VIF A;  3CBM A;  4PLI A;  4F7U F;  5IAY A;  4KT0 E;  2QEX T;  2KMT A;  5CIU A;  1RI0 A;  3KXT A;  4DA4 A;  2VGM A;  1VIE A;  2P4T A;  4L5G A;  4C0G A;  4OVA A;  5A0G A;  3EAE A;  4F7U A;  3OMG A;  4M78 G;  2L3R A;  1ZQ1 A;  3JCM V;  2HNI A;  2EIF A;  2K2V A;  2QA4 T;  5A0D A;  2I2L A;  3A5Z B;  1SSF A;  1VQM T;  3LGL A;  3PIP A;  2E6N A;  2F5K A;  4XU1 A;  1VUB A;  4HCB A;  3RES A;  5KE2 A;  5EG2 A;  2DZ9 A;  5AYF A;  5FU7 C;  4Z02 A;  1VQ4 T;  2RA2 A;  1ZHI A;  5FLX E;  3P8D A;  1Y96 B;  2EYQ A;  5CK9 A;  3HSB A;  2BKD N;  1I5L A;  4BI3 A;  4Y91 A;  3CME T;  1Q86 C;  2XIC A;  3M4G A;  2IG0 A;  3BY7 A;  1MHN A;  4XTU A;  3ME9 A;  3L2U A;  1VQ7 A;  3QZ5 B;  2IVW A;  2P0K A;  5GMK l;  4MZT A;  2VYT A;  3PNW C;  4M77 F;  4C0D C;  4LDX A;  1W4S A;  3LLR A;  3QG1 A;  5KE3 A;  4C8Q A;  3TCJ A;  4JS5 A;  2CGH A;  1XNI A;  1G3Y A;  2H3J A;  3QDR B;  3HPW A;  2XID A;  4JLG A;  5GMK e;  1ZBX A;  2CZ1 B;  2WSF E;  3P8H A;  4C92 D;  1VQ9 A;  1VQN T;  2GF7 A;  1BI2 A;  4PL6 A;  2DD4 A;  3CCQ A;  3CC7 T;  4FT4 A;  2MWO A;  3QKJ A;  5GAM f;  3JCM Q;  3G6E T;  3VUZ A;  3OW2 A;  1B34 A;  4BE2 A;  2FB7 A;  3G4S T;  3CC4 T;  3CBO A;  2LT1 A;  4J5Y A;  2ZZD A;  4GY5 A;  4JDS A;  2PQW A;  3A8L B;  3UDC A;  3VYG A;  4ZGD B;  1Q82 C;  1YJW A;  1Q86 U;  2K5L A;  4XK8 E;  5D6X A;  3J80 E;  2O01 E;  2RHI A;  2LCC A;  4EMG A;  5GAN e;  1Q7Y C;  1IRE B;  1OI1 A;  4VUB A;  4BE0 A;  5DY9 A;  5GAN 8;  4O6J A;  1U8R A;  3M4Y A;  1FXX A;  1YI2 A;  3VJP A;  4M77 B;  5D6W A;  4JRP A;  2KY9 A;  5HK3 A;  3S3M A;  3V8J A;  2VC8 A;  4XTW A;  4IKF A;  2DXT A;  1KC8 C;  5I21 A;  5GAN 3;  4RCB A;  2G3R A;  3LYI A;  2PVG B;  3OBY A;  3OBW A;  3CMA T;  5A0L A;  3QYG B;  5GAO l;  3E9G A;  4X34 A;  1Q82 U;  4M7A E;  2DKG A;  3Q1J A;  4IUU A;  3OYN A;  2GCX A;  2LT4 A;  1P92 A;  2RD1 A;  2XDP A;  1Q7Y U;  3CCE T;  3GF5 A;  3BDL A;  4CRI A;  1OZ3 A;  2DXB A;  2E65 A;  3CCS T;  5LJ5 e;  2KAF A;  1I81 A;  2RJD A;  3QJY A;  2RK2 A;  4MZM A;  3TRE A;  3V7S A;  1VQP T;  3QSU A;  2DPP B;  4C8Q G;  1Y71 A;  3BDU A;  1FX7 A;  2XI9 A;  2ZPE B;  5GAM h;  1VQ6 A;  1N6A A;  1YBY A;  1KC8 U;  3JCM J;  4XTX A;  1YJN T;  3QPH A;  5LJ3 d;  2JUF A;  1VQL A;  5LL6 S;  1N9R A;  4J83 A;  1M1K C;  4M7D B;  2P0Q A;  5GMK i;  3CPW A;  4M7A C;  1QVF S;  4C92 F;  4JJN K;  4A4G A;  4M78 F;  2GFU A;  4ELY C;  3JCM d;  1YIT T;  4E7I A;  3RMQ A;  2GFA A;  2XHC A;  4IUR A;  4A4H A;  4ATO A;  2K4Y A;  4C92 A;  3HFO A;  1WQ7 A;  2DXU A;  4OB1 B;  3PT9 A;  3RER A;  4N4I A;  4LD6 A;  3LW5 E;  2JTF A;  4M7D E;  1BKB A;  1VQ5 T;  5GAN f;  2OTL A;  4N4H A;  3NTK A;  4BDZ A;  1UEB A;  4C0F A;  1M1K U;  3OMC A;  3VV0 A;  1MGQ A;  4RCC A;  3A8H B;  3J7A F;  2F69 A;  3GNF B;  4QVC A;  5GAM j;  1KQ2 A;  1H64 1;  1VQ8 T;  3CCJ T;  3CCU T;  4C5I A;  3L2Z A;  2D0Q B;  2V8I A;  4EDU A;  3OYI A;  4E7L A;  3CCV T;  5FU6 B;  3L2R A;  3JCM P;  5CQY A;  5GAM e;  1W2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...