3OB9A

Structure of the human msl3 chromo-barrel domain at 2.5 angstrom resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
EGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDENRRLQRKLARKAVAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Male-specific lethal 3-like 1 (Drosophila), isoform CRA_c
publication title Structure of the human MSL3 chromo-barrel domain at 2.5 Angstrom resolution
rcsb
source organism Homo sapiens
total genus 19
structure length 89
sequence length 89
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ob9A01
1OZ3A 3OMGA 2QQRA 2R5MA 2BIVA 4IUUA 2GFAA 2RHZA 4IUQA 3OYEA 2EQJA 1WJSA 2R5AA 2LVMA 4OVAA 4N4HA 5J26A 3OYHA 2R58A 4C5HA 2JZ2A 4QW2A 3L2QA 2X4XA 2EQMA 2R57A 3ME9A 4UC4A 4X34A 4BACA 3MEUA 2HQXA 3KUFA 3OYGA 3QIIA 3OYJA 5FRNA 3H6ZA 3OS2A 5D6WA 3OYCA 2B8AA 2X35A 1SSFA 1XNIA 2K3XA 3M9QA 4EDUA 3BDLA 3LGFA 4II1A 4QQGA 3ZEHA 3H8ZA 4IKFA 3ASKA 4QQDA 2RJDA 3S6WA 3META 4HCZA 5KCHA 4Z02A 1WJQA 1RI0A 2LCCA 2WACA 3LH0A 2EQUA 4B9XA 5KE3A 2L89A 2RHYA 3OS1A 2L8DA 1KHCA 2XK0A 3PMTA 2NLUA 3NTKA 2P0KA 4IURA 4C5GA 2FHDA 2L3RA 1H3ZA 1WJRA 4CRIA 2RHUA 3L2RA 4BD3A 5C0MA 5M9OA 4BDZA 2VYTA 5D6YA 4C5EA 4NS5A 5D6XA 4A4EA 4E7KA 2EFIA 4C5IA 2RI5A 5KE2A 3Q1JA 4B9WA 4ZTJA 4QQ6A 3QKJA 3OQ5A 4A4FA 1OZ2A 2RI3A 3FEOA 2O4XB 3MP6A 3O8VA 4LD6A 4GY5A 2CKKA 4N4IA 4PLLA 2BKDN 2RJEA 3QJ6A 5FROA 3S3OA 1G5VA 2BUDA 2O4XA 3UWNA 2E6NA 2JTFA 2G3RA 3OYDA 4BE2A 3E9FA 3OS0A 3L2WA 2LTOA 2DIQA 4PL6A 4A4GA 2E5QA 2RHIA 3DLMA 3OYLA 2MWOA 2LRQA 3L2VA 2GFUA 3LYIA 5KH6A 2QQSA 3OA6A 3OY9A 4QVZA 3FC3A 4RG2A 4BDYA 3P8HA 4L59A 5IAYA 2F5KA 3NTHA 4IUVA 5CIUA 2RJFA 2X4YA 2LDMA 4BE1A 3C4SA 3GOXA 5FRMA 3OYAA 2K3YA 3L42A 3QBYA 4BE0A 2YRVA 3LX7A 2RJCA 3MEWA 2EKOA 3MP8A 4FL6A 4IUTA 2RI2A 2PQWA 3OYMA 4E7IA 4A4HA 4Q5WA 3FDRA 3OYIA 5IN1A 3LLRA 3OMCA 4IUPA 3L2UA 2IG0A 2X4WA 1N27A 3SD4A 3MP1A 4FU6A 1WGSA 3P8DA 1OYXA 2RHXA 3CEYA 3MO8A 2EQKA 2DIGA 3NTIA 3S3NA 3OYBA 3MEVA 2DAQA 4PLIA 3DB3A 3FLGA 3OB9A 3E9GA 1OI1A 4ZTFA 5KCOA 3LGLA 3OYFA 2M16A 3PNWC 3PMIA 4E7LA 2RO0A 3MEAA 4N4GA 1MHNA 2XDPA 4E7JA 3PFSA 3DB4A 2MWPA 4E7HA 5C6SA 2M1HA 3UT1A 2HQEA 2M0OA 3S3MA 3EAEA 3OYKA 5J39A 3F70A 2GF7A 2D9TA 3OYNA
chains in the Genus database with same CATH superfamily
2DTHA 1JJ2S 1D3BB 2DILA 2QXFA 1YCSB 1OOTA 1VOMA 1TG0A 1AHJB 1QVPA 1WXBA 1KFZA 3LH5A 5CK9A 4HCBA 4NL2A 2M9UA 3RNJA 2M02A 4M7DA 2J6OA 1VQLQ 3N5BB 3NPFA 4DBHA 1X6OA 1RL2A 3RERA 2JVVA 4E2FB 1PD0A 2XK0A 4M78A 2DE0X 4J6XA 1KQ1A 2RN8A 1Y07A 1K4US 2PUKB 1VQ6A 1PNJA 4IIMA 2E12A 2OAWA 3QXEB 1MV3A 1Y71A 5GMKi 1D0ZA 1X2QA 3ER0A 1PRLC 3G6ET 1Q86R 4GY5A 2JXBA 4PLLA 3V7SA 1UGSB 6AT1B 1R77A 2K5IA 2DFUA 4BE2A 1ZA2B 1H3HA 4XU0A 4E47A 3L2VA 3QWYA 2CUDA 1WIEA 4QVZA 4F17A 4PJOD 1U3OA 2MMPA 3JCMV 1ARKA 2E65A 3I56A 5KYXA 2P84A 3OYAA 3QBYA 3HHTB 5FWCA 3E19A 2C0TA 4BUGA 4DQ2A 1BI1A 3CCSA 4JS5A 2DL7A 2HCKA 2YHTA 4HVVA 3CCLT 2JOYA 3M0RA 5FWBA 2KYMA 2DBKA 3CC2T 2LMJA 1GCQC 2HDAA 4E7JA 1YCYA 2PU9B 4FSSA 3JCMX 2DL8A 1SSHA 1VQPA 1RAFB 5I22A 1OZ3A 2AZVA 1OPKA 1XOVA 3V8JA 1VQKQ 4HVUA 4M77E 3JB9F 4N4HA 1Y57A 3X26B 1VQNT 4HVWA 2X4XA 4ATOA 2QG9B 2D1XA 4X34A 5GAOq 3CCVA 3KUFA 1D0XA 1NZ9A 3TSZA 1YITA 2KI7A 1WDXA 1E6HA 4J7FA 2SRCA 5IXBA 1WJQA 1UGPB 1QVFP 1G3YA 4JZ4A 2JT4A 2BZ8A 4DBFA 3PMTA 2JN0A 1IXDA 1G2BA 2RHUA 1YP5A 3VRYA 1PSEA 3WXMB 1YIJA 4QQ6A 1WX6A 3O8VA 5FU7B 2BKDN 2G6FX 3ZBDA 1EFNA 2EJFA 1PRMC 1UEBA 5J3BA 4AMCA 2A7YA 4E7ZA 5GAOn 1WHJA 1GL5A 2YLBA 1YI2T 4MZTA 2LC4A 2E64A 1ZBJA 4M77C 2E6ZA 3VV0A 4A63B 3CMAT 1K9AA 2V1RA 4BE1A 5GAN4 2OTLT 3RIRA 1MMGA 3JCMh 3MEWA 2EKOA 2FZGB 3VS2A 2DETA 2KMTA 4FYWB 3LLRA 2F2WA 2YDLA 3M0PA 4LDYA 4TVRA 5IT9E 2YWWA 1Q82U 2GTOA 1C6VX 1W6XA 3PFSA 1W2BP 3DB4A 4C8QE 2A37A 5C6SA 2L2PA 1FX7A 3M0SA 4C92E 5LJ3h 1UECA 2BIVA 1M1KU 2HD0A 3H9NA 3CC4A 4PKCC 2HNIA 2HQHA 1I1JA 2O01E 3INZA 3CCQT 3TU4K 4LN2A 3CCLQ 3EHQA 1U06A 3EG1A 1VQ4Q 1C1AA 3OYCA 4RCBA 1CKBA 2DXBA 1WXTA 3PE0A 1JXMA 2EJGA 3CBMA 1BIBA 1WFWA 1ABOA 3OW2P 3HSBA 5CVIA 1B7TA 4C5EA 4A4EA 4F7UF 1VQOA 2QA4A 1VQNQ 4D8DA 3Q1JA 3KFVA 4M7AB 1KHIA 1UJYA 3OQ5A 2JM8A 2W10A 4J83A 2Y4YA 4N4IA 4F7UA 4FCYA 2XD0A 4KBMB 2FZKB 1NM7A 3UWNA 4J9FA 1Y96B 5LJ3e 3JB9D 1LJOA 2HKNA 4MDXA 1B34B 4F14A 2E5QA 2ZAEA 1N9SA 3VS4A 3EFSA 3RR6A 3CCUA 4BDYA 3A8LB 2JS2A 3M58A 3G71T 2FRYA 3RKYA 3E1SA 4V2SA 7AT1B 1KSWA 2KYBA 5CQYA 3PTAA 4OB2B 4WF2A 1UG1A 4FIBA 4JRKA 1ZSZA 1D3BA 3JCMW 3FLGA 1M8VA 2D8HA 3LGLA 1VQ7T 2MAMA 1TSFA 1VIFA 2RO0A 3GPLA 1MHNA 2FYKA 3M56A 1YJWT 5CKFA 1K0XA 4BI8B 2HQEA 2OTLQ 2YLCA 2YT6A 1EIFA 2JNGA 1S1NA 3ZL7C 3EGDA 1QVGP 4FYXB 2OTJQ 2DL4A 5AT1B 4LNPA 4ELYC 3RESA 3OYGA 2X35A 1M8MA 2BZYA 1JBMA 1PG5B 4OMMA 1TS9A 1BK2A 2RJDA 2K5LA 2EYYA 1IRXA 4ELZC 3CCEA 2RHYA 3LWHA 1KC8U 1Z9ZA 3GLXA 3OSVA 3NTKA 4M75D 4BB7A 2MYSA 2RQWA 2NUTA 3V7CA 1QVFS 2RI5A 4BI3A 2V8KA 3A5ZB 3EFOB 2W0ZA 4M7DG 2VB6A 1HJDA 4XQ3A 1V76A 2E6NA 4M78G 1AD5A 2RHIA 3C12A 1KIKA 5IHNA 3C94A 4D8KA 1N9RA 4L6V5 3UA6A 2FG0A 4IUVA 3BW1A 1IGQA 2COWA 3V7RA 5KYYA 3LX7A 2MF2A 1M3BA 4FL6A 1ZQ1A 3LW5E 2ZCFB 3TSWA 3GBQA 4PNOA 2XMFA 5GAN2 3I35A 4FW2A 1K1ZA 2LJ1A 4FU6A 4XTWA 5GAN3 5DLQE 3CCSQ 1RABB 2DL3A 4E7LA 2HL5C 5KYWB 2XICA 1WPYA 2RB6A 3G71Q 2ESWA 4RG8A 4E7HA 2M1HA 5I21A 4JLGA 4EMKA 2I2LA 3OMGA 2QQRA 2WSEE 2GFAA 2DJZA 5GMKl 2LVMA 4OVAA 2NYSA 1W2BS 1E6GA 1G3SA 1VUBA 4L5GA 4N0AA 4M77B 1EX4A 1AWWA 5FRNA 1K9MU 2E10A 3H6ZA 1DJ7B 1SSFA 3HRUA 1VQ5A 2E3HA 4BI4A 3CCVQ 1VQLT 4JJDA 1N6AA 5KYUB 3META 1M4ZA 2CH4A 1YITQ 1YJWQ 2L89A 1WI7A 3I55A 4C5GA 1YWPA 2J7IA 4GLKA 2E70A 3QDRB 4HXJA 1QP3A 2F2XA 4CRIA 2ATCB 4OB1B 2V26A 3UF4A 4X1VA 3VYGA 2J05A 1LNXA 5FU6C 3OW2S 1VQ8A 2DVJA 1X27A 1YIJQ 4PJOF 1TOVA 2E5KA 3S3OA 5GAN6 1NLPC 2L3QA 5LJ5h 3VJPA 2X51A 1IZ6A 3TQ7P 2G3RA 3QHSA 2EKHA 4LDVA 4PJOA 3HRTA 3VS5A 3FRNA 3OYLA 5GAMj 3CC2A 1TWBA 1M27C 2RJFA 4LXCA 3M4GA 3BDUA 1YJNT 4PFOA 4M77G 3RKXA 4BE0A 1AT1B 2H8HA 2RQVA 1VQMA 2K2VA 2PQWA 1T0JA 1X01A 2CT3A 3CD6A 3IQLA 3A8MB 3P8DA 4WCIA 3WVEB 4DOVA 2SEMA 2EQKA 1YBYA 3SWNB 1IREB 4Z89A 4M4ZA 1WQWA 4OGEA 2QEXT 3OYYA 1I5LA 3GIBA 1QMCA 1WHHA 1Y7XA 5LJ5e 2CS7A 4D6WA 2M0OA 2GBQA 3EAEA 1FXXA 1WYXA 1VQKT 3F70A 4JRQA 1OX9A 3M0QA 1V29B 1N8RC 4C0ZA 2M0YA 2LP5A 3HPWA 2GGRA 3OYHA 1YJ9A 3CCRT 4M7DE 3G1JA 5KYNA 2KDSA 4UC4A 3CC4Q 2KE9A 2DEUA 4M78E 2KR3A 3ZEHA 2PZ1A 1M3AA 1QVGS 2A28A 1HK9A 5FW9A 1I5OB 1MMDA 4JLIA 2EQUA 4FW1A 4J9IA 4KUDK 1BU1A 1VIEA 3VRZA 3CCJT 1YI2A 5CKEA 3TCJA 3L2RA 4BD3A 3CMAA 1AWXA 4C5IA 2L3PA 1TH7A 4HCCA 4ZTJA 2KXCA 3CMEQ 1GFDA 2KRSA 3QKJA 3HRSA 3MP6A 1VQOQ 1BYMA 4JRPA 2FB7A 3CPWA 3MCAB 4JDSA 2BUDA 1MMNA 2M51A 2MOXA 3G4ST 1VYTA 3J81E 2ZPBB 1QWEA 1AZEA 2VV5A 1WQ7A 1GBQA 4QKUA 4ZGDB 2C0OA 4C8QG 4ORZA 2DZ9A 2QQSA 1K0SA 2AK5A 4C92G 2CUBA 4OGCA 4M7DC 3CCUQ 2NUPA 2KY9A 2D0NA 2RA2A 3MP8A 1B3QA 3OS5A 4M78C 1OU8A 4Y91A 4O6JA 1WHMA 4XU2A 4IUPA 1N27A 3JCMd 1NEGA 8ATCB 2RHXA 1LPLA 2KEAA 2X3WD 2DIGA 1I07A 3VS0A 2DAQA 3M55A 3NMZC 1CSKA 2X4JA 1E7OA 5GAOm 1SRMA 1AWOA 3CCMQ 2VGMA 2OJ2A 2EBPA 1YJNQ 4ZGEB 2HBPA 1UGQB 2D9TA 2H3EB 3R6NA 4PJNA 2L3SA 4IUUA 1BB9A 2XDDA 1VQ4T 4KGVB 2R57A 3M54A 2LCLA 2K9GA 3QIIA 3VYHB 4EMGA 1GCQA 4EPCA 2A3LA 1ZLMA 3EG9A 2QEXQ 2J06A 1WZOA 1N8RR 1ZSGA 1S72A 1KHCA 4J6WA 2MK5A 4DBRA 2P0KA 2DTOA 4R56A 5M9OA 4BDZA 2Y4XA 3MJXA 5CR2A 2EFIA 3CCRQ 2HAXA 4FYYB 2HSPA 4HCKA 1OV3A 3CBOA 2EAYA 2HL3A 3LWIA 3QWXX 1LOJA 2JTFA 1MMAA 3VS7A 4A4GA 2EIFA 4M7AD 1VQ7A 3CCJQ 2O31A 2V8JA 4KH0B 3M53A 1OEBA 2WSCE 2P4TA 2X9HA 2LDMA 1TUDA 4B6MA 1OULA 1NE8A 2RNAA 3RUXA 2K7AA 3G4SQ 1MNEA 3CEYA 4QT7A 1G83A 2CSQA 4PLIA 2VXEA 2ECZA 2FL7A 3OYFA 1BCOA 2CSIA 1QW1A 5FU6B 3FB9A 2XDPA 2FO0A 1QCNA 3A8OB 2RQRA 2O2OA 5A0LA 1QVFA 3M4YA 3GF5A 2PVOB 1D1CA 4RTWA 2OTJT 5J26A 4J7IA 4OB0B 2RK1A 2IIMA 4M75F 3CPWS 4BACA 1JXOA 1I4K1 1I81A 4MZMA 1XNIA 1BCMA 4II1A 4M75A 1ZHIA 5HY6A 1JEGA 3EG3A 1OQKA 1M2VB 1JB0E 1X6BA 4WTOB 1Q7YC 3JCMc 3VUZA 4JRIA 4IURA 2EJ9A 1H3ZA 3EGXB 3I55Q 4F7UE 2ENMA 1RACB 2L5QA 3JCMQ 2HSEB 1X43A 4B9WA 5GMKj 1X6GA 4IIOA 2O4XB 1YHQA 5CKBA 3CPFA 2CZ7B 2V8IA 1Q81C 2RQUA 1VQ9A 3HP9A 2DYBA 2D8JA 3RMSA 2KGTA 2KRMA 2ZPIB 3PT9A 3PVLA 3I9QA 2HMAA 3QO3A 2CDTA 2HEQA 2QQAA 2H3JA 4FM4B 1NPPA 3JCMb 1W70A 3SWNC 3WVDB 1RAIB 1R0CB 1PHTA 5CIUA 1W2BA 2X4YA 2DTIA 3GOXA 1YNZA 3L42A 3VU3C 1MNDA 4IUTA 1M90C 5GAMg 3QZ5B 4RKUE 3ZFJA 2YUNA 4LDUA 4RTUA 4PJOG 3L2UA 3CCST 4XTUA 3U23A 4C8QC 3CD6Q 1I8FA 4C92C 5EG2A 4OF1A 1OI1A 2VWFA 4F04B 2CP2A 2PVDB 1VQLA 3PMIA 1OPLA 5GAMd 1BBZA 1M1FA 2F5TX 3CC7A 2QQBA 1QWFA 2YSQA 2DEQA 2YUOA 4MMLA 3OW2A 2MCNA 2GF7A 1VQPT 2CH4W 2DYIA 3X28B 4XTXA 3CXCP 2HBWA 3CCVT 4M7DB 5IH2A 3BDLA 3QPHA 2CREA 1YITT 1IGUA 4M78B 4Z02A 1Y0MA 3OS1A 4M77D 1MUZA 4XU3A 2NLUA 2KBTA 2DA9A 2XG8D 3VUBA 3X24B 1YIJT 1ZUKA 4NL3A 1PC0A 2P0QA 2KT1A 2OI3A 4P5NA 3JCMJ 5FROA 3QJ6A 4AFQC 1Q7YR 2E4HA 1KQSP 2LNHB 1B07A 4XAXB 3L2WA 1F1BB 5IXFA 2CP6A 3SFMA 4HKEA 2LRQA 1UB4A 3P8BB 2FPEA 4KUIA 4Y92A 1W1FA 5GANg 1VQ6Q 2J6FA 2CP7A 1JJ2P 4LD9K 1PCXA 1Q81R 3OBYA 2GQIA 1QP2A 4ZNXA 1VQKA 3OYIA 2IG0A 3TREA 1QVGA 3SD4A 5GANd 1PWTA 1NYGA 3EHRA 1Z9QA 3MO8A 1UFFA 3M0UA 5DM7R 4RTVA 1UJ0A 1Q86U 4ZTFA 2VC8A 4JJCA 2PTKA 3PNWC 1TXQA 1M90R 2QK0A 1SG5A 2AKLA 4PJLA 2QTVA 3I56Q 1NG2A 1U5SA 3SDZA 2QGGA 3OYNA 2HZYA 1BI3A 4HT9A 5IHKA 2KK4A 2ROTA 5IHIA 3CC4T 2JZ2A 2EW3A 2JMAA 3M0TA 4RTTA 3EG0A 2D6FA 3HTRA 2HQXA 3OYJA 1T0HA 4Z88A 4JS4A 3M9QA 3R6OA 4X9CA 1KC8C 2IVWA 3VS3A 3L2ZA 3ASKA 2MI6A 2EPDA 3QUIA 3VS6A 3LH0A 1XJWB 1ZUYA 2RK2A 3PIOA 4JZ3A 4GBQA 3EH2A 3TVTA 4ESRA 8AT1B 1VQPQ 2FEIA 1WJRA 3JCMP 4FSXA 5D6XA 3CMET 4E7KA 2EYZA 4OMQA 1VQOT 4RTXA 2QA4T 3G6EA 2ZPEB 4PJOE 2RI3A 1WLPB 1GBRA 4EMKC 1K8AC 4LDWA 1G5VA 2QYZA 2DD4A 1KG1A 1QCFA 2VVKA 1KD1C 1QKXA 3E9FA 2GQVA 2LTOA 3J80E 4PL6A 1NJIC 4N0AC 1NBEB 2JM9A 1H8KA 4AT1B 3CCUT 3JAME 3THKA 5A0GA 5GAMf 2K3BA 5GAOr 1EZZB 3JB9G 1XQHA 3D7SB 2KRNA 2LT4A 4XU1A 5I2MA 2JUFA 2CZ1B 2RH2A 4EIKA 1R8OB 2DVEA 1X69A 2LNVA 3FIFA 3CCLA 1VQ4A 3NTIA 3L1AA 1TUCA 1N8RU 2BTTA 1RAHB 4JJBA 2LZ6B 3CCMT 1KJWA 4N4GA 5HK3A 1U1TA 2MPXC 3A8GB 3S3MA 4OMOA 4PJOC 4XTZA 4R0KA 2DMOA 2RHZA 4AG2C 1WJSA 2R5AA 2JW4A 1K9MC 1VQNA 4Z8AA 2K5FA 2ZPGB 3HKSA 1WHKA 3RMQA 2XI9A 2ED0A 1UGRB 4K11A 2F2VA 1OU9A 2DRKA 4ZN1A 1NEBA 1K73C 4PJJA 3H8ZA 5GAOp 2KSSA 3BE3A 4HCZA 2LCCA 1UUEA 3CCET 5D7UA 2NUZA 4C8QB 3QSUA 2K6DA 2LX9A 1D0YA 4C92B 3MPUB 2HKQB 2VYTA 2ZPHB 4M7AF 3KBGA 5KE2A 2E1HA 2VASA 1KC8R 4F7UB 1OZ2A 1GRIA 4M75G 2ZGWA 1YWOA 1MGQA 5DY9A 2EWNA 4M7AA 1YHQQ 2RD1A 5GANf 4MDWA 1O75A 1VQ9Q 1RAAB 3JB9J 1Y96A 4OMPA 5KH6A 4OMLA 1B34A 4YTLA 2XIDA 1NLOC 3FC3A 5IAYA 2F5KA 3NTHA 3REBB 4DOWA 2OTLA 4J9EA 1K8AR 1MV0B 3H41A 2YRVA 3VS1A 1K76A 2QA4Q 3AT1B 3OSSC 4LUEA 5GANj 1PD1A 1KD1R 5GAN5 4PK4A 4A4HA 3FDRA 2OTJA 3URGA 4C0GA 4J9CA 1NJIR 2QTXA 1ZSZB 1WGSA 2XKOC 1UTIA 2PUOB 1Q95G 1FMWA 4M7DF 3DB3A 3OB9A 3V8LA 2A36A 3JCMg 1GXIE 3JB9I 4X9DA 3NFCA 4M78F 2CP5A 2LQNA 1SHGA 2AZSA 4F7UG 3EGDB 4DEYA 3CC7Q 2YUPA 4MMKA 3NGPA 2P4RA 4RCCA 2R58A 3CCQA 4OMFB 1D09B 3I5RA 5GAOl 2EQMA 4R55A 2QQ9A 4KGZB 5GJVB 1G3TA 3TEEA 5DLOA 4ZGJB 1VQ5T 4QQGA 5LJ3g 1FWZA 4J8OA 4QQDA 4DBQA 2LJ3A 1JO8A 3RBBB 4B9XA 2L8DA 1K9MR 4KGXB 2NUTB 3I55T 2IPOB 4GLMA 3PVQA 1O9SA 3C0CA 5C0MA 5D6YA 5LJ3d 1NYFA 4CC2A 4NS5A 1K73R 4AG1C 1VA7A 3BFMA 3UATA 3FEOA 2LQKA 3X25B 3SHWA 1VQ8T 4LD6A 3EFOA 1RLQC 2K2MA 2DL5A 1RLPC 1WHLA 2DIQA 3CCEQ 1PM3A 1SRLA 1BKBA 2K4YA 4A4KA 2PNIA 1JRIA 3OY9A 2D0QB 2F69A 3G71A 5KYYB 1C0MA 2DZCA 2A08A 3E2UA 3C4SA 2RI2A 1VQMT 3OYMA 1R0BG 1JQQA 4KRTA 2QGFB 3CD6T 4NOYA 3KXTA 4LUDA 2AIRB 1M9SA 2KROA 3DLLA 1SPKA 4ME7A 2XU8A 1D1AA 1PKSA 2COYA 2Z0WA 3FJPA 1YJWA 3MKDA 2XHCA 4EMKB 5L8RE 1RAGB 5KYWA 2LT1A 1UDLA 2EYQA 2DXTA 5A2QE 2MIOA 2FRWA 4IUQA 2EGAA 1Q7YU 4M77F 1SEMA 4M75E 2VGNA 1U1SA 4QW2A 3RKWA 3L2QA 1YJ9T 5CKDA 2LCSA 5GMKh 3PIPA 2KAFA 1IHVA 5D6WA 2B8AA 4M77A 4EDUA 3LGFA 3UDCA 3S6WA 4KULA 3EFRA 1SF9A 5KYUA 2O9VA 2E41A 1Q81U 4M7DD 3M57A 2L3RA 2LQWA 1UE9A 1T3LA 3DKMA 4CC4B 4M78D 1X75C 3EGUA 2LJ0A 5HKCA 4DEXA 4PJMA 2PVGB 2GNCA 3JV3A 2QASA 2CKKA 4J5YA 4OB3B 3RDVA 3G6EQ 2DNUA 4PJOB 1VQ5Q 1A0NB 3QDFA 1QKWA 4DA4A 4CC7A 1KK7A 1M90U 2KNBB 3M59A 3H0HA 5GAN8 5CAIA 2GFUA 1VQ6T 2YRCA 5HCKA 1AOJA 4RG2A 2NWMA 2QDLA 5GMKe 1YFNA 2VUBA 1M1GA 1W4SA 4M75C 4EMHA 4OP0A 2OX7A 4RTYA 4O5VA 2RJCA 1QCOA 1LCKA 1VQ8Q 2ZPFB 3CBPA 5IN1A 1BI0A 3JCMf 2ZZDA 3MP1A 3JB9H 3OYBA 2JTEA 2COZA 1IO6A 3SWNA 1M30A 4BY6C 1UGVA 2M16A 4C0FA 4C0DB 3CC2Q 3JCMe 3I56T 4A54A 2FVUA 5LL6S 2MWPA 1UHFA 2FPDA 4C8QF 2CP3A 4C92F 1VQMQ 1TTHB 1D1BA 9ATCB 3J7AF 4C8QA 5HK0A 1ABQA 1Q82C 5LJ3f 2BE7D 3CMEA 2YRDA 4AFZC 5AYFA 4C92A 4RUGA 5GJWB 1FMVA 5I11A 4J6YA 5GAN7 1TUGB 2BE9B 5KCHA 1NPRA 1M1KC 4J9BA 2WACA 3X20B 5KE3A 2DXCA 1S72T 3UA7A 5LJ3j 1VYUA 2OAUA 2FHDA 4CC3A 2QAZA 2KT8A 3H0FA 2RF0A 2CT4A 2BZXA 1OX8A 2ABLA 5I2SA 2CZ0B 1YJ9Q 1AEYA 4JUVA 2KXDA 2EGEA 2AHJB 2DXUA 3BY7A 2J6KA 2A0FB 1FMKA 2DO3A 4QVDA 1RADB 3OS0A 2C06A 1WXUA 2C0IA 3DLMA 1ZSZC 1HYOA 3T9NA 3LYIA 5CKHA 2DF6A 1ACMB 2NUPB 5CCAA 3CCMA 1WNLA 3A98A 1YI2Q 4Y28E 4A53A 1M3CA 5ECAA 2RMOA 1YJNA 5LJ5g 1RI9A 1AWJA 4LE9A 3CMAQ 5A0DA 5FRMA 2K3YA 1CKAA 4M7AG 1HXDA 4F16A 3QJYA 2RM4A 1XTDA 2I0NA 2DX1A 5LJ5d 3S3NA 3MEVA 3CXCA 3GP8A 2JTMA 5KYXB 5KCOA 1HD3A 2QEXA 2DM1A 3G7ZA 3MEAA 3VKIA 4AFSC 3OYKA 2EYWA 3OYEA 1RAEB 1GFCA 1N5ZA 3CCRA 3C95A 3ME9A 2CP0A 1VYVA 3MEUA 2EYXA 1JU5C 3CCQQ 2K3XA 3EG9B 2KVQG 4IKFA 3HFNA 4MZPA 2FPFA 4HA8A 1KQSA 1KQ2A 2DRMA 2KQWA 1P92A 1K8AU 3CCJA 4RMOA 2CZ6B 1Q82R 1RUWA 4ZN3A 1KD1U 4PFZA 1NJIU 5CO7A 1JJ2A 3AHUA 2DK3A 4C8QD 3QYGB 2AT1B 1M1KR 1YHQT 1M2OA 4C92D 2K57A 3G4SA 4XK8E 2DKGA 2AKKA 1VQ9T 3OYDA 1AVZC 2DLPA 2EVRA 1HSQA 4E7SA 3GNGA 5GAMh 2VXFA 1FYNA 4HT8A 1S72Q 3M5AA 3OA6A 2O88A 4L59A 3GNFB 3QYHB 1ZBXA 5CQXA 2XDBA 4XTYA 2O9SA 2JS0A 1H92A 2EQIA 4Q5WA 1AZGB 4J9HA 1Q86C 1OYXA 2CYZB 3H0IA 1PKTA 5GMKm 4JPBW 2V1QA 2F1LA 1VQ7Q 4JJNK 1TU0B 2EGCA 3EH1A 2L0AA 3HL8A 1V1CA 2LX7A 4RTZA 5FU7C 2RQTA 3CC7T 1WHGA 1K73U 4CI0C 2E3IA 1ZUUA 2R5MA 5L23A 1T3SA 2EQJA 5GAMe 2YXYA 4C5HA 4FT4A 3O5ZA 2DERA 4VUBA 2DBMA 3OS2A 4M75B 1I0CA 3EG2A 3ULRB 5EC7A 2QDYB 4E6RA 4J9DA 1RI0A 4FYVB 1ZX6A 2ROLA 2JMCA 1QLYA 2ED1A 2VKNA 1M2VA 1QQJA 1J3TA 1IHWA 3HFOA 1BIAA 1H641 3JRZA 2DPPB 5FLXE 4M7AE 1G8XA 1GCPA 3EGXA 4BY6B 3FJ5A 2GCXA 3V8KA 4A4FA 2CGHA 5GANh 3UPUA 4KT0E 2RJEA 3SB2A 2O4XA 1G3WA 3CQTA 4AFUC 2P0PA 3CXCS 4FT2A 4PFPA 3QZ9B 4OMNA 3REAB 5LJ5f 2GTJA 1WA7A 2X3XD 2MWOA 3A1PA 3I5SA 1SHFA 1ZA1B 2FZCB 3P8HA 2B86A 2LQ8A 4XTVA 1BI2A 2DD5A 2DJQA 2YUQA 4C0DC 3SEMA 2JJ9A 3CPWP 4E7IA 2K79A 1LVKA 1YN8A 4ANJA 5LJ5j 3OMCA 2X4WA 4J9GA 3A8HB 3JSCA 2Y90A 2QI2A 2RPNA 1UHCA 1M5Q1 4LDXA 4QVCA 3E9GA 1IB8A 1U8RA 1SKUB 3QG1A 1KQSS 1X2KA 3PGGA 4M7AC 3NHNA 1PSFA 5GANe 2WSFE 3MHXA 3UT1A 3OBWA 5J39A 4KH1B
chains in the Genus database with same CATH topology
1VQPT 3OMGA 5A2QE 2QQRA 2WSEE 2GFAA 4IUQA 2DTHA 2DJZA 1D3BB 5GMKl 2LVMA 2QXFA 4OVAA 1Q7YU 3X28B 4XTXA 1W2BS 4M77F 4M75E 2VGNA 1U1SA 4QW2A 3RKWA 3L2QA 1YJ9T 1AHJB 5CKDA 1QVPA 1G3SA 1VUBA 4L5GA 4N0AA 4M77B 5GMKh 3PIPA 5FRNA 1K9MU 2KAFA 2E10A 3H6ZA 3CCVT 1DJ7B 5D6WA 2B8AA 5CK9A 1SSFA 3HRUA 4NL2A 1VQ5A 4HCBA 4M7DB 4BI4A 4M77A 4EDUA 3BDLA 3LGFA 3QPHA 2M9UA 3UDCA 3OW2A 1VQLT 1N6AA 4M7DA 1YITT 3S6WA 3META 3N5BB 3EFRA 1M4ZA 4KULA 4M78B 4Z02A 1X6OA 1RL2A 2L89A 3OS1A 3RERA 2JVVA 4M77D 2E41A 2XK0A 4M78A 4XU3A 1Q81U 3I55A 4J6XA 1KQ1A 2NLUA 4M7DD 1Y07A 4C5GA 3M57A 2PUKB 4GLKA 1VQ6A 2E70A 2L3RA 2E12A 1QP3A 2XG8D 3QDRB 3QXEB 3VUBA 4CRIA 3X24B 3DKMA 4OB1B 4M78D 1X75C 1Y71A 1YIJT 5GMKi 4NL3A 5HKCA 3VYGA 2PVGB 1LNXA 5FU6C 3OW2S 1VQ8A 3ER0A 2P0QA 3G6ET 4PJOF 4GY5A 2CKKA 4J5YA 4OB3B 4P5NA 4PLLA 3QJ6A 5FROA 3V7SA 3JCMJ 3S3OA 5GAN6 4PJOB 5LJ5h 3VJPA 1UGSB 1IZ6A 2K5IA 2G3RA 4XAXB 4DA4A 3CCST 3QHSA 4LDVA 4BE2A 1M90U 4PJOA 3HRTA 3L2WA 3FRNA 4XU0A 3OYLA 3M59A 4HKEA 3SFMA 4E47A 2LRQA 5CAIA 1UB4A 2GFUA 3P8BB 5GAN8 3L2VA 4KUIA 5GAMj 1VQ6T 3CC2A 5GANg 4QVZA 4RG2A 5GMKe 2MMPA 4PJOD 2VUBA 1M1GA 3JCMV 1W4SA 2E65A 3I56A 2RJFA 4M75C 3M4GA 4EMHA 4OP0A 3BDUA 1YJNT 4LD9K 4M77G 3RKXA 3OYAA 3QBYA 3OBYA 3HHTB 4BE0A 1QP2A 3E19A 4O5VA 2RJCA 1VQMA 4BUGA 1VQKA 2K2VA 2PQWA 1X01A 4DQ2A 1BI1A 2ZPFB 3CBPA 3CCSA 3CD6A 4JS5A 3OYIA 5IN1A 1BI0A 3JCMf 2IG0A 3TREA 3A8MB 1QVGA 3SD4A 5GANd 2ZZDA 3MP1A 3P8DA 2YHTA 3WVEB 4DOVA 3MO8A 2EQKA 3CCLT 1YBYA 2JOYA 3SWNB 3JB9H 1IREB 5DM7R 3OYBA 1Q86U 4ZTFA 2VC8A 3SWNA 1WQWA 3CC2T 4BY6C 2M16A 3PNWC 4OGEA 4C0FA 4C0DB 2QEXT 3JCMe 3OYYA 4E7JA 1I5LA 3I56T 1YCYA 2PU9B 4A54A 1Y7XA 2FVUA 3GIBA 3JCMX 5LL6S 2MWPA 5LJ5e 2CS7A 4C8QF 2M0OA 4D6WA 3EAEA 3SDZA 1FXXA 1VQPA 1VQKT 3F70A 4JRQA 3OYNA 1OZ3A 4C92F 1V29B 1N8RC 1XOVA 3V8JA 4C0ZA 1BI3A 4HT9A 2KK4A 3HPWA 4M77E 4N4HA 3J7AF 3JB9F 4C8QA 5HK0A 3OYHA 1YJ9A 3X26B 1Q82C 5LJ3f 3CC4T 2JZ2A 3CMEA 3CCRT 1VQNT 2D6FA 2X4XA 4M7DE 5AYFA 2KDSA 4UC4A 4C92A 4ATOA 4X34A 3CCVA 5GAOq 2HQXA 3KUFA 3OYJA 4JS4A 3M9QA 3R6OA 1NZ9A 4M78E 4X9CA 4J6YA 5GAN7 1KC8C 2IVWA 3ZEHA 1YITA 1QVGS 3L2ZA 3ASKA 1JJ2S 2MI6A 1HK9A 4J7FA 3QUIA 5KCHA 1NPRA 1WJQA 1M1KC 2WACA 1UGPB 2EQUA 3LH0A 4JLIA 2RK2A 3X20B 5KE3A 3PIOA 4KUDK 1G3YA 1VIEA 3PMTA 2DXCA 1S72T 3CCJT 5LJ3j 2JN0A 1YI2A 2OAUA 2FHDA 5CKEA 1WJRA 3TCJA 2RHUA 3L2RA 4BD3A 3JCMP 1PSEA 4FSXA 3WXMB 3CMAA 1YIJA 5D6XA 3CMET 4E7KA 4C5IA 1TH7A 2CZ0B 5I2SA 1VQOT 4ZTJA 1VQ9T 4HCCA 2QA4T 3G6EA 4QQ6A 3QKJA 2ZPEB 4PJOE 2RI3A 4JUVA 3HRSA 3MP6A 1BYMA 3O8VA 4JRPA 2FB7A 4EMKC 3CPWA 3MCAB 4JDSA 5FU7B 1K8AC 2BKDN 2AHJB 3ZBDA 4LDWA 1G5VA 2BUDA 2DXUA 3BY7A 2EJFA 1UEBA 2DD4A 3J81E 3G4ST 2ZPBB 5J3BA 1KG1A 2DO3A 4QVDA 1KD1C 3E9FA 3OS0A 2GQVA 2LTOA 2VV5A 4PL6A 3J80E 2A7YA 2C06A 1WQ7A 3DLMA 4ZGDB 1NJIC 5GAOn 4N0AC 4C8QG 3T9NA 3LYIA 2DZ9A 2QQSA 2YLBA 1YI2T 5CKHA 4MZTA 2LC4A 5CCAA 4C92G 2E64A 3CCMA 3CCUT 1WNLA 4M77C 4OGCA 3JAME 4Y28E 2E6ZA 4A53A 3VV0A 5GAMf 5A0GA 5GAOr 1YJNA 3CMAT 5LJ5g 3JB9G 4M7DC 1XQHA 5GAN4 4BE1A 2KY9A 3CD6T 5A0DA 5FRMA 2RA2A 2K3YA 3RIRA 2OTLT 3JCMh 3MEWA 2LT4A 2EKOA 3MP8A 4XU1A 2JUFA 5I2MA 4M7AG 3OS5A 4M78C 2CZ1B 4Y91A 2RH2A 1HXDA 4O6JA 2KMTA 4XU2A 1JJ2A 1R8OB 2DVEA 3LLRA 4IUPA 3QJYA 2RM4A 1N27A 1XTDA 3JCMd 2LNVA 3FIFA 3CCLA 2RHXA 1VQ4A 2DIGA 3NTIA 5LJ5d 3S3NA 4LDYA 3L1AA 3MEVA 4TVRA 2DAQA 3CXCA 5IT9E 1N8RU 3M55A 3GP8A 2JTMA 5KCOA 2X4JA 1Q82U 2QEXA 3CCMT 3G7ZA 3MEAA 4N4GA 3VKIA 5GAOm 5HK3A 1U1TA 3PFSA 2VGMA 3DB4A 4C8QE 3A8GB 5C6SA 4ZGEB 3S3MA 4PJOC 1FX7A 4C92E 3OYKA 2HBPA 2D9TA 1UGQB 5LJ3h 4XTZA 2BIVA 4IUUA 2RHZA 3OYEA 1M1KU 2HD0A 1WJSA 2R5AA 2XDDA 1K9MC 3CC4A 3CCRA 1VQNA 4PKCC 2HNIA 2K5FA 2ZPGB 3HKSA 3RMQA 1VQ4T 3C95A 2R57A 3ME9A 2O01E 3INZA 3CCQT 3M54A 2LCLA 3TU4K 2XI9A 3MEUA 1UGRB 3QIIA 3VYHB 3OYCA 4RCBA 4EMGA 2K3XA 4ZN1A 1K73C 4EPCA 2A3LA 2KVQG 3H8ZA 4IKFA 2DXBA 5GAOp 2KSSA 3HFNA 4MZPA 4HA8A 4HCZA 1KQSA 2LCCA 1KQ2A 2EJGA 2KQWA 3CBMA 1BIBA 1S72A 3CCET 1KHCA 1P92A 4J6WA 1K8AU 3CCJA 3AHUA 4RMOA 4C8QB 3QSUA 2CZ6B 3HSBA 2LX9A 2P0KA 2DTOA 4ZN3A 5CVIA 4R56A 4C92B 1KD1U 5M9OA 4BDZA 2VYTA 4C5EA 2Y4XA 2ZPHB 4A4EA 5CO7A 4F7UF 2EFIA 5CR2A 1VQOA 3KBGA 2QA4A 1NJIU 5KE2A 2E1HA 2DK3A 3Q1JA 2HAXA 4F7UB 4M7AB 1KHIA 3OQ5A 1OZ2A 4C8QD 4M75G 3QYGB 2ZGWA 4J83A 1YHQT 2Y4YA 1MGQA 4N4IA 2EWNA 5DY9A 3CBOA 4C92D 4F7UA 4KBMB 2K57A 2XD0A 4M7AA 3G4SA 4XK8E 2DKGA 3UWNA 2EAYA 1Y96B 2RD1A 5LJ3e 1LOJA 3LWIA 5GANf 1LJOA 2JTFA 3OYDA 3JB9D 4MDWA 4MDXA 1B34B 1O75A 4A4GA 3JB9J 1Y96A 2E5QA 2EIFA 3GNGA 4M7AD 5GAMh 1N9SA 2VXFA 4HT8A 3EFSA 5KH6A 1B34A 3M5AA 4YTLA 3OA6A 3CCUA 1VQ7A 2XIDA 2V8JA 3FC3A 4BDYA 4L59A 5IAYA 3A8LB 3GNFB 3QYHB 3M53A 2WSCE 1ZBXA 2P4TA 3M58A 2F5KA 3G71T 3NTHA 5CQXA 4DOWA 2XDBA 2OTLA 2LDMA 3RKYA 4XTYA 3E1SA 4V2SA 2YRVA 3OSSC 5CQYA 3PTAA 5GANj 4OB2B 4WF2A 1NE8A 5GAN5 4A4HA 4Q5WA 3FDRA 3RUXA 3URGA 2OTJA 4C0GA 2QTXA 1Q86C 1WGSA 1OYXA 2XKOC 3CEYA 2CYZB 4M7AF 4FIBA 4JRKA 2PUOB 1D3BA 3JCMW 4M7DF 4PLIA 3DB3A 3FLGA 2VXEA 3OB9A 3V8LA 1GXIE 2FL7A 3JCMg 1M8VA 5GMKm 3LGLA 3OYFA 1VQ7T 3JB9I 2MAMA 1QW1A 1VIFA 2RO0A 4X9DA 3NFCA 3FB9A 5FU6B 3GPLA 1MHNA 2XDPA 4M78F 2FYKA 4JJNK 3M56A 3A8OB 1YJWT 3HL8A 5A0LA 5CKFA 5FU7C 1QVFA 4F7UG 4BI8B 3M4YA 3CC7T 2HQEA 1K73U 3GF5A 2YLCA 4CI0C 2R5MA 1EIFA 2PVOB 2JNGA 4MMKA 2OTJT 2EQJA 5J26A 5GAMe 4J7IA 4RCCA 2R58A 4C5HA 4FT4A 3CCQA 4OB0B 4OMFB 5GAOl 2RK1A 2EQMA 4M75F 4ELYC 4R55A 3CPWS 2QQ9A 3RESA 4BACA 1G3TA 1I4K1 4VUBA 3OYGA 3TEEA 3OS2A 4M75B 1I81A 2X35A 4MZMA 1XNIA 5DLOA 4ZGJB 1JBMA 1VQ5T 4II1A 4QQGA 5LJ3g 4M75A 1FWZA 4J8OA 1ZHIA 5HY6A 4QQDA 2QDYB 2RJDA 2K5LA 1RI0A 1JB0E 4ELZC 4B9XA 3CCEA 1Q7YC 2RHYA 3LWHA 1KC8U 2L8DA 3JCMc 3GLXA 3OSVA 3VUZA 3NTKA 4JRIA 4M75D 3HFOA 4IURA 1BIAA 1H641 3I55T 4BB7A 2EJ9A 1H3ZA 3JRZA 2DPPB 1O9SA 5FLXE 2DXTA 5C0MA 5D6YA 4F7UE 4M7AE 5LJ3d 3V7CA 2L5QA 4NS5A 3JCMQ 1QVFS 4BY6B 2RI5A 4BI3A 2V8KA 2GCXA 3A5ZB 3V8KA 4B9WA 3BFMA 4A4FA 5GMKj 3FEOA 2CGHA 2LQKA 2O4XB 5CKBA 3CPFA 3X25B 5GANh 1YHQA 1VQ8T 3UPUA 4LD6A 4M7DG 2CZ7B 2V8IA 4KT0E 2RJEA 3SB2A 1Q81C 2O4XA 4XQ3A 3HP9A 1VQ9A 1G3WA 2E6NA 3RMSA 2P0PA 3PT9A 2ZPIB 4M78G 3CXCS 4FT2A 3QO3A 2DIQA 2RHIA 3QZ9B 5LJ5f 2QQAA 2H3JA 2MWOA 1NPPA 3C12A 4FM4B 1BKBA 2K4YA 4A4KA 3WVDB 3SWNC 3JCMb 1JRIA 3C94A 1N9RA 3OY9A 4L6V5 2D0QB 2F69A 3P8HA 3G71A 2LQ8A 4XTVA 4IUVA 1BI2A 3BW1A 5CIUA 2DZCA 2X4YA 1W2BA 2DTIA 2DD5A 3C4SA 3V7RA 3GOXA 4C0DC 3L42A 3VU3C 3LX7A 2MF2A 4IUTA 4FL6A 1ZQ1A 1M90C 3LW5E 2RI2A 1VQMT 2ZCFB 3OYMA 5GAMg 3QZ5B 4RKUE 3ZFJA 4E7IA 4LDUA 4PNOA 4PJOG 3OMCA 5LJ5j 5GAN2 2X4WA 4NOYA 4XTUA 3L2UA 3A8HB 3JSCA 3KXTA 4C8QC 4FU6A 4XTWA 2Y90A 5GAN3 5DLQE 1M9SA 2QI2A 1I8FA 3DLLA 4C92C 5EG2A 1M5Q1 4OF1A 4ME7A 4LDXA 4QVCA 2XU8A 3E9GA 1OI1A 1U8RA 2PVDB 3QG1A 1VQLA 3PMIA 4E7LA 1KQSS 3FJPA 3PGGA 5GAMd 4M7AC 1YJWA 2XHCA 1PSFA 2XICA 5GANe 4EMKB 1M1FA 1WPYA 2F5TX 2RB6A 3CC7A 2QQBA 4RG8A 5L8RE 2WSFE 4E7HA 2M1HA 3MHXA 3UT1A 5I21A 2DEQA 3OBWA 4JLGA 2I2LA 2LT1A 4MMLA 4EMKA 5J39A 2GF7A 2EYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OZ3 A;  3OMG A;  2QQR A;  2R5M A;  2BIV A;  4IUU A;  2GFA A;  2RHZ A;  4IUQ A;  3OYE A;  2EQJ A;  1WJS A;  2R5A A;  2LVM A;  4OVA A;  4N4H A;  5J26 A;  3OYH A;  2R58 A;  4C5H A;  2JZ2 A;  4QW2 A;  3L2Q A;  2X4X A;  2EQM A;  2R57 A;  3ME9 A;  4UC4 A;  4X34 A;  4BAC A;  3MEU A;  2HQX A;  3KUF A;  3OYG A;  3QII A;  3OYJ A;  5FRN A;  3H6Z A;  3OS2 A;  5D6W A;  3OYC A;  2B8A A;  2X35 A;  1SSF A;  1XNI A;  2K3X A;  3M9Q A;  4EDU A;  3BDL A;  3LGF A;  4II1 A;  4QQG A;  3ZEH A;  3H8Z A;  4IKF A;  3ASK A;  4QQD A;  2RJD A;  3S6W A;  3MET A;  4HCZ A;  5KCH A;  4Z02 A;  1WJQ A;  1RI0 A;  2LCC A;  2WAC A;  3LH0 A;  2EQU A;  4B9X A;  5KE3 A;  2L89 A;  2RHY A;  3OS1 A;  2L8D A;  1KHC A;  2XK0 A;  3PMT A;  2NLU A;  3NTK A;  2P0K A;  4IUR A;  4C5G A;  2FHD A;  2L3R A;  1H3Z A;  1WJR A;  4CRI A;  2RHU A;  3L2R A;  4BD3 A;  5C0M A;  5M9O A;  4BDZ A;  2VYT A;  5D6Y A;  4C5E A;  4NS5 A;  5D6X A;  4A4E A;  4E7K A;  2EFI A;  4C5I A;  2RI5 A;  5KE2 A;  3Q1J A;  4B9W A;  4ZTJ A;  4QQ6 A;  3QKJ A;  3OQ5 A;  4A4F A;  1OZ2 A;  2RI3 A;  3FEO A;  2O4X B;  3MP6 A;  3O8V A;  4LD6 A;  4GY5 A;  2CKK A;  4N4I A;  4PLL A;  2BKD N;  2RJE A;  3QJ6 A;  5FRO A;  3S3O A;  1G5V A;  2BUD A;  2O4X A;  3UWN A;  2E6N A;  2JTF A;  2G3R A;  3OYD A;  4BE2 A;  3E9F A;  3OS0 A;  3L2W A;  2LTO A;  2DIQ A;  4PL6 A;  4A4G A;  2E5Q A;  2RHI A;  3DLM A;  3OYL A;  2MWO A;  2LRQ A;  3L2V A;  2GFU A;  3LYI A;  5KH6 A;  2QQS A;  3OA6 A;  3OY9 A;  4QVZ A;  3FC3 A;  4RG2 A;  4BDY A;  3P8H A;  4L59 A;  5IAY A;  2F5K A;  3NTH A;  4IUV A;  5CIU A;  2RJF A;  2X4Y A;  2LDM A;  4BE1 A;  3C4S A;  3GOX A;  5FRM A;  3OYA A;  2K3Y A;  3L42 A;  3QBY A;  4BE0 A;  2YRV A;  3LX7 A;  2RJC A;  3MEW A;  2EKO A;  3MP8 A;  4FL6 A;  4IUT A;  2RI2 A;  2PQW A;  3OYM A;  4E7I A;  4A4H A;  4Q5W A;  3FDR A;  3OYI A;  5IN1 A;  3LLR A;  3OMC A;  4IUP A;  3L2U A;  2IG0 A;  2X4W A;  1N27 A;  3SD4 A;  3MP1 A;  4FU6 A;  1WGS A;  3P8D A;  1OYX A;  2RHX A;  3CEY A;  3MO8 A;  2EQK A;  2DIG A;  3NTI A;  3S3N A;  3OYB A;  3MEV A;  2DAQ A;  4PLI A;  3DB3 A;  3FLG A;  3OB9 A;  3E9G A;  1OI1 A;  4ZTF A;  5KCO A;  3LGL A;  3OYF A;  2M16 A;  3PNW C;  3PMI A;  4E7L A;  2RO0 A;  3MEA A;  4N4G A;  1MHN A;  2XDP A;  4E7J A;  3PFS A;  3DB4 A;  2MWP A;  4E7H A;  5C6S A;  2M1H A;  3UT1 A;  2HQE A;  2M0O A;  3S3M A;  3EAE A;  3OYK A;  5J39 A;  3F70 A;  2GF7 A;  2D9T A;  3OYN A; 
#chains in the Genus database with same CATH topology
 2DTH A;  1JJ2 S;  1D3B B;  2DIL A;  2QXF A;  1YCS B;  1OOT A;  1VOM A;  1TG0 A;  1AHJ B;  1QVP A;  1WXB A;  1KFZ A;  3LH5 A;  5CK9 A;  4HCB A;  4NL2 A;  2M9U A;  3RNJ A;  2M02 A;  4M7D A;  2J6O A;  1VQL Q;  3N5B B;  3NPF A;  4DBH A;  1X6O A;  1RL2 A;  3RER A;  2JVV A;  4E2F B;  1PD0 A;  2XK0 A;  4M78 A;  2DE0 X;  4J6X A;  1KQ1 A;  2RN8 A;  1Y07 A;  1K4U S;  2PUK B;  1VQ6 A;  1PNJ A;  4IIM A;  2E12 A;  2OAW A;  3QXE B;  1MV3 A;  1Y71 A;  5GMK i;  1D0Z A;  1X2Q A;  3ER0 A;  1PRL C;  3G6E T;  1Q86 R;  4GY5 A;  2JXB A;  4PLL A;  3V7S A;  1UGS B;  6AT1 B;  1R77 A;  2K5I A;  2DFU A;  4BE2 A;  1ZA2 B;  1H3H A;  4XU0 A;  4E47 A;  3L2V A;  3QWY A;  2CUD A;  1WIE A;  4QVZ A;  4F17 A;  4PJO D;  1U3O A;  2MMP A;  3JCM V;  1ARK A;  2E65 A;  3I56 A;  5KYX A;  2P84 A;  3OYA A;  3QBY A;  3HHT B;  5FWC A;  3E19 A;  2C0T A;  4BUG A;  4DQ2 A;  1BI1 A;  3CCS A;  4JS5 A;  2DL7 A;  2HCK A;  2YHT A;  4HVV A;  3CCL T;  2JOY A;  3M0R A;  5FWB A;  2KYM A;  2DBK A;  3CC2 T;  2LMJ A;  1GCQ C;  2HDA A;  4E7J A;  1YCY A;  2PU9 B;  4FSS A;  3JCM X;  2DL8 A;  1SSH A;  1VQP A;  1RAF B;  5I22 A;  1OZ3 A;  2AZV A;  1OPK A;  1XOV A;  3V8J A;  1VQK Q;  4HVU A;  4M77 E;  3JB9 F;  4N4H A;  1Y57 A;  3X26 B;  1VQN T;  4HVW A;  2X4X A;  4ATO A;  2QG9 B;  2D1X A;  4X34 A;  5GAO q;  3CCV A;  3KUF A;  1D0X A;  1NZ9 A;  3TSZ A;  1YIT A;  2KI7 A;  1WDX A;  1E6H A;  4J7F A;  2SRC A;  5IXB A;  1WJQ A;  1UGP B;  1QVF P;  1G3Y A;  4JZ4 A;  2JT4 A;  2BZ8 A;  4DBF A;  3PMT A;  2JN0 A;  1IXD A;  1G2B A;  2RHU A;  1YP5 A;  3VRY A;  1PSE A;  3WXM B;  1YIJ A;  4QQ6 A;  1WX6 A;  3O8V A;  5FU7 B;  2BKD N;  2G6F X;  3ZBD A;  1EFN A;  2EJF A;  1PRM C;  1UEB A;  5J3B A;  4AMC A;  2A7Y A;  4E7Z A;  5GAO n;  1WHJ A;  1GL5 A;  2YLB A;  1YI2 T;  4MZT A;  2LC4 A;  2E64 A;  1ZBJ A;  4M77 C;  2E6Z A;  3VV0 A;  4A63 B;  3CMA T;  1K9A A;  2V1R A;  4BE1 A;  5GAN 4;  2OTL T;  3RIR A;  1MMG A;  3JCM h;  3MEW A;  2EKO A;  2FZG B;  3VS2 A;  2DET A;  2KMT A;  4FYW B;  3LLR A;  2F2W A;  2YDL A;  3M0P A;  4LDY A;  4TVR A;  5IT9 E;  2YWW A;  1Q82 U;  2GTO A;  1C6V X;  1W6X A;  3PFS A;  1W2B P;  3DB4 A;  4C8Q E;  2A37 A;  5C6S A;  2L2P A;  1FX7 A;  3M0S A;  4C92 E;  5LJ3 h;  1UEC A;  2BIV A;  1M1K U;  2HD0 A;  3H9N A;  3CC4 A;  4PKC C;  2HNI A;  2HQH A;  1I1J A;  2O01 E;  3INZ A;  3CCQ T;  3TU4 K;  4LN2 A;  3CCL Q;  3EHQ A;  1U06 A;  3EG1 A;  1VQ4 Q;  1C1A A;  3OYC A;  4RCB A;  1CKB A;  2DXB A;  1WXT A;  3PE0 A;  1JXM A;  2EJG A;  3CBM A;  1BIB A;  1WFW A;  1ABO A;  3OW2 P;  3HSB A;  5CVI A;  1B7T A;  4C5E A;  4A4E A;  4F7U F;  1VQO A;  2QA4 A;  1VQN Q;  4D8D A;  3Q1J A;  3KFV A;  4M7A B;  1KHI A;  1UJY A;  3OQ5 A;  2JM8 A;  2W10 A;  4J83 A;  2Y4Y A;  4N4I A;  4F7U A;  4FCY A;  2XD0 A;  4KBM B;  2FZK B;  1NM7 A;  3UWN A;  4J9F A;  1Y96 B;  5LJ3 e;  3JB9 D;  1LJO A;  2HKN A;  4MDX A;  1B34 B;  4F14 A;  2E5Q A;  2ZAE A;  1N9S A;  3VS4 A;  3EFS A;  3RR6 A;  3CCU A;  4BDY A;  3A8L B;  2JS2 A;  3M58 A;  3G71 T;  2FRY A;  3RKY A;  3E1S A;  4V2S A;  7AT1 B;  1KSW A;  2KYB A;  5CQY A;  3PTA A;  4OB2 B;  4WF2 A;  1UG1 A;  4FIB A;  4JRK A;  1ZSZ A;  1D3B A;  3JCM W;  3FLG A;  1M8V A;  2D8H A;  3LGL A;  1VQ7 T;  2MAM A;  1TSF A;  1VIF A;  2RO0 A;  3GPL A;  1MHN A;  2FYK A;  3M56 A;  1YJW T;  5CKF A;  1K0X A;  4BI8 B;  2HQE A;  2OTL Q;  2YLC A;  2YT6 A;  1EIF A;  2JNG A;  1S1N A;  3ZL7 C;  3EGD A;  1QVG P;  4FYX B;  2OTJ Q;  2DL4 A;  5AT1 B;  4LNP A;  4ELY C;  3RES A;  3OYG A;  2X35 A;  1M8M A;  2BZY A;  1JBM A;  1PG5 B;  4OMM A;  1TS9 A;  1BK2 A;  2RJD A;  2K5L A;  2EYY A;  1IRX A;  4ELZ C;  3CCE A;  2RHY A;  3LWH A;  1KC8 U;  1Z9Z A;  3GLX A;  3OSV A;  3NTK A;  4M75 D;  4BB7 A;  2MYS A;  2RQW A;  2NUT A;  3V7C A;  1QVF S;  2RI5 A;  4BI3 A;  2V8K A;  3A5Z B;  3EFO B;  2W0Z A;  4M7D G;  2VB6 A;  1HJD A;  4XQ3 A;  1V76 A;  2E6N A;  4M78 G;  1AD5 A;  2RHI A;  3C12 A;  1KIK A;  5IHN A;  3C94 A;  4D8K A;  1N9R A;  4L6V 5;  3UA6 A;  2FG0 A;  4IUV A;  3BW1 A;  1IGQ A;  2COW A;  3V7R A;  5KYY A;  3LX7 A;  2MF2 A;  1M3B A;  4FL6 A;  1ZQ1 A;  3LW5 E;  2ZCF B;  3TSW A;  3GBQ A;  4PNO A;  2XMF A;  5GAN 2;  3I35 A;  4FW2 A;  1K1Z A;  2LJ1 A;  4FU6 A;  4XTW A;  5GAN 3;  5DLQ E;  3CCS Q;  1RAB B;  2DL3 A;  4E7L A;  2HL5 C;  5KYW B;  2XIC A;  1WPY A;  2RB6 A;  3G71 Q;  2ESW A;  4RG8 A;  4E7H A;  2M1H A;  5I21 A;  4JLG A;  4EMK A;  2I2L A;  3OMG A;  2QQR A;  2WSE E;  2GFA A;  2DJZ A;  5GMK l;  2LVM A;  4OVA A;  2NYS A;  1W2B S;  1E6G A;  1G3S A;  1VUB A;  4L5G A;  4N0A A;  4M77 B;  1EX4 A;  1AWW A;  5FRN A;  1K9M U;  2E10 A;  3H6Z A;  1DJ7 B;  1SSF A;  3HRU A;  1VQ5 A;  2E3H A;  4BI4 A;  3CCV Q;  1VQL T;  4JJD A;  1N6A A;  5KYU B;  3MET A;  1M4Z A;  2CH4 A;  1YIT Q;  1YJW Q;  2L89 A;  1WI7 A;  3I55 A;  4C5G A;  1YWP A;  2J7I A;  4GLK A;  2E70 A;  3QDR B;  4HXJ A;  1QP3 A;  2F2X A;  4CRI A;  2ATC B;  4OB1 B;  2V26 A;  3UF4 A;  4X1V A;  3VYG A;  2J05 A;  1LNX A;  5FU6 C;  3OW2 S;  1VQ8 A;  2DVJ A;  1X27 A;  1YIJ Q;  4PJO F;  1TOV A;  2E5K A;  3S3O A;  5GAN 6;  1NLP C;  2L3Q A;  5LJ5 h;  3VJP A;  2X51 A;  1IZ6 A;  3TQ7 P;  2G3R A;  3QHS A;  2EKH A;  4LDV A;  4PJO A;  3HRT A;  3VS5 A;  3FRN A;  3OYL A;  5GAM j;  3CC2 A;  1TWB A;  1M27 C;  2RJF A;  4LXC A;  3M4G A;  3BDU A;  1YJN T;  4PFO A;  4M77 G;  3RKX A;  4BE0 A;  1AT1 B;  2H8H A;  2RQV A;  1VQM A;  2K2V A;  2PQW A;  1T0J A;  1X01 A;  2CT3 A;  3CD6 A;  3IQL A;  3A8M B;  3P8D A;  4WCI A;  3WVE B;  4DOV A;  2SEM A;  2EQK A;  1YBY A;  3SWN B;  1IRE B;  4Z89 A;  4M4Z A;  1WQW A;  4OGE A;  2QEX T;  3OYY A;  1I5L A;  3GIB A;  1QMC A;  1WHH A;  1Y7X A;  5LJ5 e;  2CS7 A;  4D6W A;  2M0O A;  2GBQ A;  3EAE A;  1FXX A;  1WYX A;  1VQK T;  3F70 A;  4JRQ A;  1OX9 A;  3M0Q A;  1V29 B;  1N8R C;  4C0Z A;  2M0Y A;  2LP5 A;  3HPW A;  2GGR A;  3OYH A;  1YJ9 A;  3CCR T;  4M7D E;  3G1J A;  5KYN A;  2KDS A;  4UC4 A;  3CC4 Q;  2KE9 A;  2DEU A;  4M78 E;  2KR3 A;  3ZEH A;  2PZ1 A;  1M3A A;  1QVG S;  2A28 A;  1HK9 A;  5FW9 A;  1I5O B;  1MMD A;  4JLI A;  2EQU A;  4FW1 A;  4J9I A;  4KUD K;  1BU1 A;  1VIE A;  3VRZ A;  3CCJ T;  1YI2 A;  5CKE A;  3TCJ A;  3L2R A;  4BD3 A;  3CMA A;  1AWX A;  4C5I A;  2L3P A;  1TH7 A;  4HCC A;  4ZTJ A;  2KXC A;  3CME Q;  1GFD A;  2KRS A;  3QKJ A;  3HRS A;  3MP6 A;  1VQO Q;  1BYM A;  4JRP A;  2FB7 A;  3CPW A;  3MCA B;  4JDS A;  2BUD A;  1MMN A;  2M51 A;  2MOX A;  3G4S T;  1VYT A;  3J81 E;  2ZPB B;  1QWE A;  1AZE A;  2VV5 A;  1WQ7 A;  1GBQ A;  4QKU A;  4ZGD B;  2C0O A;  4C8Q G;  4ORZ A;  2DZ9 A;  2QQS A;  1K0S A;  2AK5 A;  4C92 G;  2CUB A;  4OGC A;  4M7D C;  3CCU Q;  2NUP A;  2KY9 A;  2D0N A;  2RA2 A;  3MP8 A;  1B3Q A;  3OS5 A;  4M78 C;  1OU8 A;  4Y91 A;  4O6J A;  1WHM A;  4XU2 A;  4IUP A;  1N27 A;  3JCM d;  1NEG A;  8ATC B;  2RHX A;  1LPL A;  2KEA A;  2X3W D;  2DIG A;  1I07 A;  3VS0 A;  2DAQ A;  3M55 A;  3NMZ C;  1CSK A;  2X4J A;  1E7O A;  5GAO m;  1SRM A;  1AWO A;  3CCM Q;  2VGM A;  2OJ2 A;  2EBP A;  1YJN Q;  4ZGE B;  2HBP A;  1UGQ B;  2D9T A;  2H3E B;  3R6N A;  4PJN A;  2L3S A;  4IUU A;  1BB9 A;  2XDD A;  1VQ4 T;  4KGV B;  2R57 A;  3M54 A;  2LCL A;  2K9G A;  3QII A;  3VYH B;  4EMG A;  1GCQ A;  4EPC A;  2A3L A;  1ZLM A;  3EG9 A;  2QEX Q;  2J06 A;  1WZO A;  1N8R R;  1ZSG A;  1S72 A;  1KHC A;  4J6W A;  2MK5 A;  4DBR A;  2P0K A;  2DTO A;  4R56 A;  5M9O A;  4BDZ A;  2Y4X A;  3MJX A;  5CR2 A;  2EFI A;  3CCR Q;  2HAX A;  4FYY B;  2HSP A;  4HCK A;  1OV3 A;  3CBO A;  2EAY A;  2HL3 A;  3LWI A;  3QWX X;  1LOJ A;  2JTF A;  1MMA A;  3VS7 A;  4A4G A;  2EIF A;  4M7A D;  1VQ7 A;  3CCJ Q;  2O31 A;  2V8J A;  4KH0 B;  3M53 A;  1OEB A;  2WSC E;  2P4T A;  2X9H A;  2LDM A;  1TUD A;  4B6M A;  1OUL A;  1NE8 A;  2RNA A;  3RUX A;  2K7A A;  3G4S Q;  1MNE A;  3CEY A;  4QT7 A;  1G83 A;  2CSQ A;  4PLI A;  2VXE A;  2ECZ A;  2FL7 A;  3OYF A;  1BCO A;  2CSI A;  1QW1 A;  5FU6 B;  3FB9 A;  2XDP A;  2FO0 A;  1QCN A;  3A8O B;  2RQR A;  2O2O A;  5A0L A;  1QVF A;  3M4Y A;  3GF5 A;  2PVO B;  1D1C A;  4RTW A;  2OTJ T;  5J26 A;  4J7I A;  4OB0 B;  2RK1 A;  2IIM A;  4M75 F;  3CPW S;  4BAC A;  1JXO A;  1I4K 1;  1I81 A;  4MZM A;  1XNI A;  1BCM A;  4II1 A;  4M75 A;  1ZHI A;  5HY6 A;  1JEG A;  3EG3 A;  1OQK A;  1M2V B;  1JB0 E;  1X6B A;  4WTO B;  1Q7Y C;  3JCM c;  3VUZ A;  4JRI A;  4IUR A;  2EJ9 A;  1H3Z A;  3EGX B;  3I55 Q;  4F7U E;  2ENM A;  1RAC B;  2L5Q A;  3JCM Q;  2HSE B;  1X43 A;  4B9W A;  5GMK j;  1X6G A;  4IIO A;  2O4X B;  1YHQ A;  5CKB A;  3CPF A;  2CZ7 B;  2V8I A;  1Q81 C;  2RQU A;  1VQ9 A;  3HP9 A;  2DYB A;  2D8J A;  3RMS A;  2KGT A;  2KRM A;  2ZPI B;  3PT9 A;  3PVL A;  3I9Q A;  2HMA A;  3QO3 A;  2CDT A;  2HEQ A;  2QQA A;  2H3J A;  4FM4 B;  1NPP A;  3JCM b;  1W70 A;  3SWN C;  3WVD B;  1RAI B;  1R0C B;  1PHT A;  5CIU A;  1W2B A;  2X4Y A;  2DTI A;  3GOX A;  1YNZ A;  3L42 A;  3VU3 C;  1MND A;  4IUT A;  1M90 C;  5GAM g;  3QZ5 B;  4RKU E;  3ZFJ A;  2YUN A;  4LDU A;  4RTU A;  4PJO G;  3L2U A;  3CCS T;  4XTU A;  3U23 A;  4C8Q C;  3CD6 Q;  1I8F A;  4C92 C;  5EG2 A;  4OF1 A;  1OI1 A;  2VWF A;  4F04 B;  2CP2 A;  2PVD B;  1VQL A;  3PMI A;  1OPL A;  5GAM d;  1BBZ A;  1M1F A;  2F5T X;  3CC7 A;  2QQB A;  1QWF A;  2YSQ A;  2DEQ A;  2YUO A;  4MML A;  3OW2 A;  2MCN A;  2GF7 A;  1VQP T;  2CH4 W;  2DYI A;  3X28 B;  4XTX A;  3CXC P;  2HBW A;  3CCV T;  4M7D B;  5IH2 A;  3BDL A;  3QPH A;  2CRE A;  1YIT T;  1IGU A;  4M78 B;  4Z02 A;  1Y0M A;  3OS1 A;  4M77 D;  1MUZ A;  4XU3 A;  2NLU A;  2KBT A;  2DA9 A;  2XG8 D;  3VUB A;  3X24 B;  1YIJ T;  1ZUK A;  4NL3 A;  1PC0 A;  2P0Q A;  2KT1 A;  2OI3 A;  4P5N A;  3JCM J;  5FRO A;  3QJ6 A;  4AFQ C;  1Q7Y R;  2E4H A;  1KQS P;  2LNH B;  1B07 A;  4XAX B;  3L2W A;  1F1B B;  5IXF A;  2CP6 A;  3SFM A;  4HKE A;  2LRQ A;  1UB4 A;  3P8B B;  2FPE A;  4KUI A;  4Y92 A;  1W1F A;  5GAN g;  1VQ6 Q;  2J6F A;  2CP7 A;  1JJ2 P;  4LD9 K;  1PCX A;  1Q81 R;  3OBY A;  2GQI A;  1QP2 A;  4ZNX A;  1VQK A;  3OYI A;  2IG0 A;  3TRE A;  1QVG A;  3SD4 A;  5GAN d;  1PWT A;  1NYG A;  3EHR A;  1Z9Q A;  3MO8 A;  1UFF A;  3M0U A;  5DM7 R;  4RTV A;  1UJ0 A;  1Q86 U;  4ZTF A;  2VC8 A;  4JJC A;  2PTK A;  3PNW C;  1TXQ A;  1M90 R;  2QK0 A;  1SG5 A;  2AKL A;  4PJL A;  2QTV A;  3I56 Q;  1NG2 A;  1U5S A;  3SDZ A;  2QGG A;  3OYN A;  2HZY A;  1BI3 A;  4HT9 A;  5IHK A;  2KK4 A;  2ROT A;  5IHI A;  3CC4 T;  2JZ2 A;  2EW3 A;  2JMA A;  3M0T A;  4RTT A;  3EG0 A;  2D6F A;  3HTR A;  2HQX A;  3OYJ A;  1T0H A;  4Z88 A;  4JS4 A;  3M9Q A;  3R6O A;  4X9C A;  1KC8 C;  2IVW A;  3VS3 A;  3L2Z A;  3ASK A;  2MI6 A;  2EPD A;  3QUI A;  3VS6 A;  3LH0 A;  1XJW B;  1ZUY A;  2RK2 A;  3PIO A;  4JZ3 A;  4GBQ A;  3EH2 A;  3TVT A;  4ESR A;  8AT1 B;  1VQP Q;  2FEI A;  1WJR A;  3JCM P;  4FSX A;  5D6X A;  3CME T;  4E7K A;  2EYZ A;  4OMQ A;  1VQO T;  4RTX A;  2QA4 T;  3G6E A;  2ZPE B;  4PJO E;  2RI3 A;  1WLP B;  1GBR A;  4EMK C;  1K8A C;  4LDW A;  1G5V A;  2QYZ A;  2DD4 A;  1KG1 A;  1QCF A;  2VVK A;  1KD1 C;  1QKX A;  3E9F A;  2GQV A;  2LTO A;  3J80 E;  4PL6 A;  1NJI C;  4N0A C;  1NBE B;  2JM9 A;  1H8K A;  4AT1 B;  3CCU T;  3JAM E;  3THK A;  5A0G A;  5GAM f;  2K3B A;  5GAO r;  1EZZ B;  3JB9 G;  1XQH A;  3D7S B;  2KRN A;  2LT4 A;  4XU1 A;  5I2M A;  2JUF A;  2CZ1 B;  2RH2 A;  4EIK A;  1R8O B;  2DVE A;  1X69 A;  2LNV A;  3FIF A;  3CCL A;  1VQ4 A;  3NTI A;  3L1A A;  1TUC A;  1N8R U;  2BTT A;  1RAH B;  4JJB A;  2LZ6 B;  3CCM T;  1KJW A;  4N4G A;  5HK3 A;  1U1T A;  2MPX C;  3A8G B;  3S3M A;  4OMO A;  4PJO C;  4XTZ A;  4R0K A;  2DMO A;  2RHZ A;  4AG2 C;  1WJS A;  2R5A A;  2JW4 A;  1K9M C;  1VQN A;  4Z8A A;  2K5F A;  2ZPG B;  3HKS A;  1WHK A;  3RMQ A;  2XI9 A;  2ED0 A;  1UGR B;  4K11 A;  2F2V A;  1OU9 A;  2DRK A;  4ZN1 A;  1NEB A;  1K73 C;  4PJJ A;  3H8Z A;  5GAO p;  2KSS A;  3BE3 A;  4HCZ A;  2LCC A;  1UUE A;  3CCE T;  5D7U A;  2NUZ A;  4C8Q B;  3QSU A;  2K6D A;  2LX9 A;  1D0Y A;  4C92 B;  3MPU B;  2HKQ B;  2VYT A;  2ZPH B;  4M7A F;  3KBG A;  5KE2 A;  2E1H A;  2VAS A;  1KC8 R;  4F7U B;  1OZ2 A;  1GRI A;  4M75 G;  2ZGW A;  1YWO A;  1MGQ A;  5DY9 A;  2EWN A;  4M7A A;  1YHQ Q;  2RD1 A;  5GAN f;  4MDW A;  1O75 A;  1VQ9 Q;  1RAA B;  3JB9 J;  1Y96 A;  4OMP A;  5KH6 A;  4OML A;  1B34 A;  4YTL A;  2XID A;  1NLO C;  3FC3 A;  5IAY A;  2F5K A;  3NTH A;  3REB B;  4DOW A;  2OTL A;  4J9E A;  1K8A R;  1MV0 B;  3H41 A;  2YRV A;  3VS1 A;  1K76 A;  2QA4 Q;  3AT1 B;  3OSS C;  4LUE A;  5GAN j;  1PD1 A;  1KD1 R;  5GAN 5;  4PK4 A;  4A4H A;  3FDR A;  2OTJ A;  3URG A;  4C0G A;  4J9C A;  1NJI R;  2QTX A;  1ZSZ B;  1WGS A;  2XKO C;  1UTI A;  2PUO B;  1Q95 G;  1FMW A;  4M7D F;  3DB3 A;  3OB9 A;  3V8L A;  2A36 A;  3JCM g;  1GXI E;  3JB9 I;  4X9D A;  3NFC A;  4M78 F;  2CP5 A;  2LQN A;  1SHG A;  2AZS A;  4F7U G;  3EGD B;  4DEY A;  3CC7 Q;  2YUP A;  4MMK A;  3NGP A;  2P4R A;  4RCC A;  2R58 A;  3CCQ A;  4OMF B;  1D09 B;  3I5R A;  5GAO l;  2EQM A;  4R55 A;  2QQ9 A;  4KGZ B;  5GJV B;  1G3T A;  3TEE A;  5DLO A;  4ZGJ B;  1VQ5 T;  4QQG A;  5LJ3 g;  1FWZ A;  4J8O A;  4QQD A;  4DBQ A;  2LJ3 A;  1JO8 A;  3RBB B;  4B9X A;  2L8D A;  1K9M R;  4KGX B;  2NUT B;  3I55 T;  2IPO B;  4GLM A;  3PVQ A;  1O9S A;  3C0C A;  5C0M A;  5D6Y A;  5LJ3 d;  1NYF A;  4CC2 A;  4NS5 A;  1K73 R;  4AG1 C;  1VA7 A;  3BFM A;  3UAT A;  3FEO A;  2LQK A;  3X25 B;  3SHW A;  1VQ8 T;  4LD6 A;  3EFO A;  1RLQ C;  2K2M A;  2DL5 A;  1RLP C;  1WHL A;  2DIQ A;  3CCE Q;  1PM3 A;  1SRL A;  1BKB A;  2K4Y A;  4A4K A;  2PNI A;  1JRI A;  3OY9 A;  2D0Q B;  2F69 A;  3G71 A;  5KYY B;  1C0M A;  2DZC A;  2A08 A;  3E2U A;  3C4S A;  2RI2 A;  1VQM T;  3OYM A;  1R0B G;  1JQQ A;  4KRT A;  2QGF B;  3CD6 T;  4NOY A;  3KXT A;  4LUD A;  2AIR B;  1M9S A;  2KRO A;  3DLL A;  1SPK A;  4ME7 A;  2XU8 A;  1D1A A;  1PKS A;  2COY A;  2Z0W A;  3FJP A;  1YJW A;  3MKD A;  2XHC A;  4EMK B;  5L8R E;  1RAG B;  5KYW A;  2LT1 A;  1UDL A;  2EYQ A;  2DXT A;  5A2Q E;  2MIO A;  2FRW A;  4IUQ A;  2EGA A;  1Q7Y U;  4M77 F;  1SEM A;  4M75 E;  2VGN A;  1U1S A;  4QW2 A;  3RKW A;  3L2Q A;  1YJ9 T;  5CKD A;  2LCS A;  5GMK h;  3PIP A;  2KAF A;  1IHV A;  5D6W A;  2B8A A;  4M77 A;  4EDU A;  3LGF A;  3UDC A;  3S6W A;  4KUL A;  3EFR A;  1SF9 A;  5KYU A;  2O9V A;  2E41 A;  1Q81 U;  4M7D D;  3M57 A;  2L3R A;  2LQW A;  1UE9 A;  1T3L A;  3DKM A;  4CC4 B;  4M78 D;  1X75 C;  3EGU A;  2LJ0 A;  5HKC A;  4DEX A;  4PJM A;  2PVG B;  2GNC A;  3JV3 A;  2QAS A;  2CKK A;  4J5Y A;  4OB3 B;  3RDV A;  3G6E Q;  2DNU A;  4PJO B;  1VQ5 Q;  1A0N B;  3QDF A;  1QKW A;  4DA4 A;  4CC7 A;  1KK7 A;  1M90 U;  2KNB B;  3M59 A;  3H0H A;  5GAN 8;  5CAI A;  2GFU A;  1VQ6 T;  2YRC A;  5HCK A;  1AOJ A;  4RG2 A;  2NWM A;  2QDL A;  5GMK e;  1YFN A;  2VUB A;  1M1G A;  1W4S A;  4M75 C;  4EMH A;  4OP0 A;  2OX7 A;  4RTY A;  4O5V A;  2RJC A;  1QCO A;  1LCK A;  1VQ8 Q;  2ZPF B;  3CBP A;  5IN1 A;  1BI0 A;  3JCM f;  2ZZD A;  3MP1 A;  3JB9 H;  3OYB A;  2JTE A;  2COZ A;  1IO6 A;  3SWN A;  1M30 A;  4BY6 C;  1UGV A;  2M16 A;  4C0F A;  4C0D B;  3CC2 Q;  3JCM e;  3I56 T;  4A54 A;  2FVU A;  5LL6 S;  2MWP A;  1UHF A;  2FPD A;  4C8Q F;  2CP3 A;  4C92 F;  1VQM Q;  1TTH B;  1D1B A;  9ATC B;  3J7A F;  4C8Q A;  5HK0 A;  1ABQ A;  1Q82 C;  5LJ3 f;  2BE7 D;  3CME A;  2YRD A;  4AFZ C;  5AYF A;  4C92 A;  4RUG A;  5GJW B;  1FMV A;  5I11 A;  4J6Y A;  5GAN 7;  1TUG B;  2BE9 B;  5KCH A;  1NPR A;  1M1K C;  4J9B A;  2WAC A;  3X20 B;  5KE3 A;  2DXC A;  1S72 T;  3UA7 A;  5LJ3 j;  1VYU A;  2OAU A;  2FHD A;  4CC3 A;  2QAZ A;  2KT8 A;  3H0F A;  2RF0 A;  2CT4 A;  2BZX A;  1OX8 A;  2ABL A;  5I2S A;  2CZ0 B;  1YJ9 Q;  1AEY A;  4JUV A;  2KXD A;  2EGE A;  2AHJ B;  2DXU A;  3BY7 A;  2J6K A;  2A0F B;  1FMK A;  2DO3 A;  4QVD A;  1RAD B;  3OS0 A;  2C06 A;  1WXU A;  2C0I A;  3DLM A;  1ZSZ C;  1HYO A;  3T9N A;  3LYI A;  5CKH A;  2DF6 A;  1ACM B;  2NUP B;  5CCA A;  3CCM A;  1WNL A;  3A98 A;  1YI2 Q;  4Y28 E;  4A53 A;  1M3C A;  5ECA A;  2RMO A;  1YJN A;  5LJ5 g;  1RI9 A;  1AWJ A;  4LE9 A;  3CMA Q;  5A0D A;  5FRM A;  2K3Y A;  1CKA A;  4M7A G;  1HXD A;  4F16 A;  3QJY A;  2RM4 A;  1XTD A;  2I0N A;  2DX1 A;  5LJ5 d;  3S3N A;  3MEV A;  3CXC A;  3GP8 A;  2JTM A;  5KYX B;  5KCO A;  1HD3 A;  2QEX A;  2DM1 A;  3G7Z A;  3MEA A;  3VKI A;  4AFS C;  3OYK A;  2EYW A;  3OYE A;  1RAE B;  1GFC A;  1N5Z A;  3CCR A;  3C95 A;  3ME9 A;  2CP0 A;  1VYV A;  3MEU A;  2EYX A;  1JU5 C;  3CCQ Q;  2K3X A;  3EG9 B;  2KVQ G;  4IKF A;  3HFN A;  4MZP A;  2FPF A;  4HA8 A;  1KQS A;  1KQ2 A;  2DRM A;  2KQW A;  1P92 A;  1K8A U;  3CCJ A;  4RMO A;  2CZ6 B;  1Q82 R;  1RUW A;  4ZN3 A;  1KD1 U;  4PFZ A;  1NJI U;  5CO7 A;  1JJ2 A;  3AHU A;  2DK3 A;  4C8Q D;  3QYG B;  2AT1 B;  1M1K R;  1YHQ T;  1M2O A;  4C92 D;  2K57 A;  3G4S A;  4XK8 E;  2DKG A;  2AKK A;  1VQ9 T;  3OYD A;  1AVZ C;  2DLP A;  2EVR A;  1HSQ A;  4E7S A;  3GNG A;  5GAM h;  2VXF A;  1FYN A;  4HT8 A;  1S72 Q;  3M5A A;  3OA6 A;  2O88 A;  4L59 A;  3GNF B;  3QYH B;  1ZBX A;  5CQX A;  2XDB A;  4XTY A;  2O9S A;  2JS0 A;  1H92 A;  2EQI A;  4Q5W A;  1AZG B;  4J9H A;  1Q86 C;  1OYX A;  2CYZ B;  3H0I A;  1PKT A;  5GMK m;  4JPB W;  2V1Q A;  2F1L A;  1VQ7 Q;  4JJN K;  1TU0 B;  2EGC A;  3EH1 A;  2L0A A;  3HL8 A;  1V1C A;  2LX7 A;  4RTZ A;  5FU7 C;  2RQT A;  3CC7 T;  1WHG A;  1K73 U;  4CI0 C;  2E3I A;  1ZUU A;  2R5M A;  5L23 A;  1T3S A;  2EQJ A;  5GAM e;  2YXY A;  4C5H A;  4FT4 A;  3O5Z A;  2DER A;  4VUB A;  2DBM A;  3OS2 A;  4M75 B;  1I0C A;  3EG2 A;  3ULR B;  5EC7 A;  2QDY B;  4E6R A;  4J9D A;  1RI0 A;  4FYV B;  1ZX6 A;  2ROL A;  2JMC A;  1QLY A;  2ED1 A;  2VKN A;  1M2V A;  1QQJ A;  1J3T A;  1IHW A;  3HFO A;  1BIA A;  1H64 1;  3JRZ A;  2DPP B;  5FLX E;  4M7A E;  1G8X A;  1GCP A;  3EGX A;  4BY6 B;  3FJ5 A;  2GCX A;  3V8K A;  4A4F A;  2CGH A;  5GAN h;  3UPU A;  4KT0 E;  2RJE A;  3SB2 A;  2O4X A;  1G3W A;  3CQT A;  4AFU C;  2P0P A;  3CXC S;  4FT2 A;  4PFP A;  3QZ9 B;  4OMN A;  3REA B;  5LJ5 f;  2GTJ A;  1WA7 A;  2X3X D;  2MWO A;  3A1P A;  3I5S A;  1SHF A;  1ZA1 B;  2FZC B;  3P8H A;  2B86 A;  2LQ8 A;  4XTV A;  1BI2 A;  2DD5 A;  2DJQ A;  2YUQ A;  4C0D C;  3SEM A;  2JJ9 A;  3CPW P;  4E7I A;  2K79 A;  1LVK A;  1YN8 A;  4ANJ A;  5LJ5 j;  3OMC A;  2X4W A;  4J9G A;  3A8H B;  3JSC A;  2Y90 A;  2QI2 A;  2RPN A;  1UHC A;  1M5Q 1;  4LDX A;  4QVC A;  3E9G A;  1IB8 A;  1U8R A;  1SKU B;  3QG1 A;  1KQS S;  1X2K A;  3PGG A;  4M7A C;  3NHN A;  1PSF A;  5GAN e;  2WSF E;  3MHX A;  3UT1 A;  3OBW A;  5J39 A;  4KH1 B; 
#chains in the Genus database with same CATH homology
 1VQP T;  3OMG A;  5A2Q E;  2QQR A;  2WSE E;  2GFA A;  4IUQ A;  2DTH A;  2DJZ A;  1D3B B;  5GMK l;  2LVM A;  2QXF A;  4OVA A;  1Q7Y U;  3X28 B;  4XTX A;  1W2B S;  4M77 F;  4M75 E;  2VGN A;  1U1S A;  4QW2 A;  3RKW A;  3L2Q A;  1YJ9 T;  1AHJ B;  5CKD A;  1QVP A;  1G3S A;  1VUB A;  4L5G A;  4N0A A;  4M77 B;  5GMK h;  3PIP A;  5FRN A;  1K9M U;  2KAF A;  2E10 A;  3H6Z A;  3CCV T;  1DJ7 B;  5D6W A;  2B8A A;  5CK9 A;  1SSF A;  3HRU A;  4NL2 A;  1VQ5 A;  4HCB A;  4M7D B;  4BI4 A;  4M77 A;  4EDU A;  3BDL A;  3LGF A;  3QPH A;  2M9U A;  3UDC A;  3OW2 A;  1VQL T;  1N6A A;  4M7D A;  1YIT T;  3S6W A;  3MET A;  3N5B B;  3EFR A;  1M4Z A;  4KUL A;  4M78 B;  4Z02 A;  1X6O A;  1RL2 A;  2L89 A;  3OS1 A;  3RER A;  2JVV A;  4M77 D;  2E41 A;  2XK0 A;  4M78 A;  4XU3 A;  1Q81 U;  3I55 A;  4J6X A;  1KQ1 A;  2NLU A;  4M7D D;  1Y07 A;  4C5G A;  3M57 A;  2PUK B;  4GLK A;  1VQ6 A;  2E70 A;  2L3R A;  2E12 A;  1QP3 A;  2XG8 D;  3QDR B;  3QXE B;  3VUB A;  4CRI A;  3X24 B;  3DKM A;  4OB1 B;  4M78 D;  1X75 C;  1Y71 A;  1YIJ T;  5GMK i;  4NL3 A;  5HKC A;  3VYG A;  2PVG B;  1LNX A;  5FU6 C;  3OW2 S;  1VQ8 A;  3ER0 A;  2P0Q A;  3G6E T;  4PJO F;  4GY5 A;  2CKK A;  4J5Y A;  4OB3 B;  4P5N A;  4PLL A;  3QJ6 A;  5FRO A;  3V7S A;  3JCM J;  3S3O A;  5GAN 6;  4PJO B;  5LJ5 h;  3VJP A;  1UGS B;  1IZ6 A;  2K5I A;  2G3R A;  4XAX B;  4DA4 A;  3CCS T;  3QHS A;  4LDV A;  4BE2 A;  1M90 U;  4PJO A;  3HRT A;  3L2W A;  3FRN A;  4XU0 A;  3OYL A;  3M59 A;  4HKE A;  3SFM A;  4E47 A;  2LRQ A;  5CAI A;  1UB4 A;  2GFU A;  3P8B B;  5GAN 8;  3L2V A;  4KUI A;  5GAM j;  1VQ6 T;  3CC2 A;  5GAN g;  4QVZ A;  4RG2 A;  5GMK e;  2MMP A;  4PJO D;  2VUB A;  1M1G A;  3JCM V;  1W4S A;  2E65 A;  3I56 A;  2RJF A;  4M75 C;  3M4G A;  4EMH A;  4OP0 A;  3BDU A;  1YJN T;  4LD9 K;  4M77 G;  3RKX A;  3OYA A;  3QBY A;  3OBY A;  3HHT B;  4BE0 A;  1QP2 A;  3E19 A;  4O5V A;  2RJC A;  1VQM A;  4BUG A;  1VQK A;  2K2V A;  2PQW A;  1X01 A;  4DQ2 A;  1BI1 A;  2ZPF B;  3CBP A;  3CCS A;  3CD6 A;  4JS5 A;  3OYI A;  5IN1 A;  1BI0 A;  3JCM f;  2IG0 A;  3TRE A;  3A8M B;  1QVG A;  3SD4 A;  5GAN d;  2ZZD A;  3MP1 A;  3P8D A;  2YHT A;  3WVE B;  4DOV A;  3MO8 A;  2EQK A;  3CCL T;  1YBY A;  2JOY A;  3SWN B;  3JB9 H;  1IRE B;  5DM7 R;  3OYB A;  1Q86 U;  4ZTF A;  2VC8 A;  3SWN A;  1WQW A;  3CC2 T;  4BY6 C;  2M16 A;  3PNW C;  4OGE A;  4C0F A;  4C0D B;  2QEX T;  3JCM e;  3OYY A;  4E7J A;  1I5L A;  3I56 T;  1YCY A;  2PU9 B;  4A54 A;  1Y7X A;  2FVU A;  3GIB A;  3JCM X;  5LL6 S;  2MWP A;  5LJ5 e;  2CS7 A;  4C8Q F;  2M0O A;  4D6W A;  3EAE A;  3SDZ A;  1FXX A;  1VQP A;  1VQK T;  3F70 A;  4JRQ A;  3OYN A;  1OZ3 A;  4C92 F;  1V29 B;  1N8R C;  1XOV A;  3V8J A;  4C0Z A;  1BI3 A;  4HT9 A;  2KK4 A;  3HPW A;  4M77 E;  4N4H A;  3J7A F;  3JB9 F;  4C8Q A;  5HK0 A;  3OYH A;  1YJ9 A;  3X26 B;  1Q82 C;  5LJ3 f;  3CC4 T;  2JZ2 A;  3CME A;  3CCR T;  1VQN T;  2D6F A;  2X4X A;  4M7D E;  5AYF A;  2KDS A;  4UC4 A;  4C92 A;  4ATO A;  4X34 A;  3CCV A;  5GAO q;  2HQX A;  3KUF A;  3OYJ A;  4JS4 A;  3M9Q A;  3R6O A;  1NZ9 A;  4M78 E;  4X9C A;  4J6Y A;  5GAN 7;  1KC8 C;  2IVW A;  3ZEH A;  1YIT A;  1QVG S;  3L2Z A;  3ASK A;  1JJ2 S;  2MI6 A;  1HK9 A;  4J7F A;  3QUI A;  5KCH A;  1NPR A;  1WJQ A;  1M1K C;  2WAC A;  1UGP B;  2EQU A;  3LH0 A;  4JLI A;  2RK2 A;  3X20 B;  5KE3 A;  3PIO A;  4KUD K;  1G3Y A;  1VIE A;  3PMT A;  2DXC A;  1S72 T;  3CCJ T;  5LJ3 j;  2JN0 A;  1YI2 A;  2OAU A;  2FHD A;  5CKE A;  1WJR A;  3TCJ A;  2RHU A;  3L2R A;  4BD3 A;  3JCM P;  1PSE A;  4FSX A;  3WXM B;  3CMA A;  1YIJ A;  5D6X A;  3CME T;  4E7K A;  4C5I A;  1TH7 A;  2CZ0 B;  5I2S A;  1VQO T;  4ZTJ A;  1VQ9 T;  4HCC A;  2QA4 T;  3G6E A;  4QQ6 A;  3QKJ A;  2ZPE B;  4PJO E;  2RI3 A;  4JUV A;  3HRS A;  3MP6 A;  1BYM A;  3O8V A;  4JRP A;  2FB7 A;  4EMK C;  3CPW A;  3MCA B;  4JDS A;  5FU7 B;  1K8A C;  2BKD N;  2AHJ B;  3ZBD A;  4LDW A;  1G5V A;  2BUD A;  2DXU A;  3BY7 A;  2EJF A;  1UEB A;  2DD4 A;  3J81 E;  3G4S T;  2ZPB B;  5J3B A;  1KG1 A;  2DO3 A;  4QVD A;  1KD1 C;  3E9F A;  3OS0 A;  2GQV A;  2LTO A;  2VV5 A;  4PL6 A;  3J80 E;  2A7Y A;  2C06 A;  1WQ7 A;  3DLM A;  4ZGD B;  1NJI C;  5GAO n;  4N0A C;  4C8Q G;  3T9N A;  3LYI A;  2DZ9 A;  2QQS A;  2YLB A;  1YI2 T;  5CKH A;  4MZT A;  2LC4 A;  5CCA A;  4C92 G;  2E64 A;  3CCM A;  3CCU T;  1WNL A;  4M77 C;  4OGC A;  3JAM E;  4Y28 E;  2E6Z A;  4A53 A;  3VV0 A;  5GAM f;  5A0G A;  5GAO r;  1YJN A;  3CMA T;  5LJ5 g;  3JB9 G;  4M7D C;  1XQH A;  5GAN 4;  4BE1 A;  2KY9 A;  3CD6 T;  5A0D A;  5FRM A;  2RA2 A;  2K3Y A;  3RIR A;  2OTL T;  3JCM h;  3MEW A;  2LT4 A;  2EKO A;  3MP8 A;  4XU1 A;  2JUF A;  5I2M A;  4M7A G;  3OS5 A;  4M78 C;  2CZ1 B;  4Y91 A;  2RH2 A;  1HXD A;  4O6J A;  2KMT A;  4XU2 A;  1JJ2 A;  1R8O B;  2DVE A;  3LLR A;  4IUP A;  3QJY A;  2RM4 A;  1N27 A;  1XTD A;  3JCM d;  2LNV A;  3FIF A;  3CCL A;  2RHX A;  1VQ4 A;  2DIG A;  3NTI A;  5LJ5 d;  3S3N A;  4LDY A;  3L1A A;  3MEV A;  4TVR A;  2DAQ A;  3CXC A;  5IT9 E;  1N8R U;  3M55 A;  3GP8 A;  2JTM A;  5KCO A;  2X4J A;  1Q82 U;  2QEX A;  3CCM T;  3G7Z A;  3MEA A;  4N4G A;  3VKI A;  5GAO m;  5HK3 A;  1U1T A;  3PFS A;  2VGM A;  3DB4 A;  4C8Q E;  3A8G B;  5C6S A;  4ZGE B;  3S3M A;  4PJO C;  1FX7 A;  4C92 E;  3OYK A;  2HBP A;  2D9T A;  1UGQ B;  5LJ3 h;  4XTZ A;  2BIV A;  4IUU A;  2RHZ A;  3OYE A;  1M1K U;  2HD0 A;  1WJS A;  2R5A A;  2XDD A;  1K9M C;  3CC4 A;  3CCR A;  1VQN A;  4PKC C;  2HNI A;  2K5F A;  2ZPG B;  3HKS A;  3RMQ A;  1VQ4 T;  3C95 A;  2R57 A;  3ME9 A;  2O01 E;  3INZ A;  3CCQ T;  3M54 A;  2LCL A;  3TU4 K;  2XI9 A;  3MEU A;  1UGR B;  3QII A;  3VYH B;  3OYC A;  4RCB A;  4EMG A;  2K3X A;  4ZN1 A;  1K73 C;  4EPC A;  2A3L A;  2KVQ G;  3H8Z A;  4IKF A;  2DXB A;  5GAO p;  2KSS A;  3HFN A;  4MZP A;  4HA8 A;  4HCZ A;  1KQS A;  2LCC A;  1KQ2 A;  2EJG A;  2KQW A;  3CBM A;  1BIB A;  1S72 A;  3CCE T;  1KHC A;  1P92 A;  4J6W A;  1K8A U;  3CCJ A;  3AHU A;  4RMO A;  4C8Q B;  3QSU A;  2CZ6 B;  3HSB A;  2LX9 A;  2P0K A;  2DTO A;  4ZN3 A;  5CVI A;  4R56 A;  4C92 B;  1KD1 U;  5M9O A;  4BDZ A;  2VYT A;  4C5E A;  2Y4X A;  2ZPH B;  4A4E A;  5CO7 A;  4F7U F;  2EFI A;  5CR2 A;  1VQO A;  3KBG A;  2QA4 A;  1NJI U;  5KE2 A;  2E1H A;  2DK3 A;  3Q1J A;  2HAX A;  4F7U B;  4M7A B;  1KHI A;  3OQ5 A;  1OZ2 A;  4C8Q D;  4M75 G;  3QYG B;  2ZGW A;  4J83 A;  1YHQ T;  2Y4Y A;  1MGQ A;  4N4I A;  2EWN A;  5DY9 A;  3CBO A;  4C92 D;  4F7U A;  4KBM B;  2K57 A;  2XD0 A;  4M7A A;  3G4S A;  4XK8 E;  2DKG A;  3UWN A;  2EAY A;  1Y96 B;  2RD1 A;  5LJ3 e;  1LOJ A;  3LWI A;  5GAN f;  1LJO A;  2JTF A;  3OYD A;  3JB9 D;  4MDW A;  4MDX A;  1B34 B;  1O75 A;  4A4G A;  3JB9 J;  1Y96 A;  2E5Q A;  2EIF A;  3GNG A;  4M7A D;  5GAM h;  1N9S A;  2VXF A;  4HT8 A;  3EFS A;  5KH6 A;  1B34 A;  3M5A A;  4YTL A;  3OA6 A;  3CCU A;  1VQ7 A;  2XID A;  2V8J A;  3FC3 A;  4BDY A;  4L59 A;  5IAY A;  3A8L B;  3GNF B;  3QYH B;  3M53 A;  2WSC E;  1ZBX A;  2P4T A;  3M58 A;  2F5K A;  3G71 T;  3NTH A;  5CQX A;  4DOW A;  2XDB A;  2OTL A;  2LDM A;  3RKY A;  4XTY A;  3E1S A;  4V2S A;  2YRV A;  3OSS C;  5CQY A;  3PTA A;  5GAN j;  4OB2 B;  4WF2 A;  1NE8 A;  5GAN 5;  4A4H A;  4Q5W A;  3FDR A;  3RUX A;  3URG A;  2OTJ A;  4C0G A;  2QTX A;  1Q86 C;  1WGS A;  1OYX A;  2XKO C;  3CEY A;  2CYZ B;  4M7A F;  4FIB A;  4JRK A;  2PUO B;  1D3B A;  3JCM W;  4M7D F;  4PLI A;  3DB3 A;  3FLG A;  2VXE A;  3OB9 A;  3V8L A;  1GXI E;  2FL7 A;  3JCM g;  1M8V A;  5GMK m;  3LGL A;  3OYF A;  1VQ7 T;  3JB9 I;  2MAM A;  1QW1 A;  1VIF A;  2RO0 A;  4X9D A;  3NFC A;  3FB9 A;  5FU6 B;  3GPL A;  1MHN A;  2XDP A;  4M78 F;  2FYK A;  4JJN K;  3M56 A;  3A8O B;  1YJW T;  3HL8 A;  5A0L A;  5CKF A;  5FU7 C;  1QVF A;  4F7U G;  4BI8 B;  3M4Y A;  3CC7 T;  2HQE A;  1K73 U;  3GF5 A;  2YLC A;  4CI0 C;  2R5M A;  1EIF A;  2PVO B;  2JNG A;  4MMK A;  2OTJ T;  2EQJ A;  5J26 A;  5GAM e;  4J7I A;  4RCC A;  2R58 A;  4C5H A;  4FT4 A;  3CCQ A;  4OB0 B;  4OMF B;  5GAO l;  2RK1 A;  2EQM A;  4M75 F;  4ELY C;  4R55 A;  3CPW S;  2QQ9 A;  3RES A;  4BAC A;  1G3T A;  1I4K 1;  4VUB A;  3OYG A;  3TEE A;  3OS2 A;  4M75 B;  1I81 A;  2X35 A;  4MZM A;  1XNI A;  5DLO A;  4ZGJ B;  1JBM A;  1VQ5 T;  4II1 A;  4QQG A;  5LJ3 g;  4M75 A;  1FWZ A;  4J8O A;  1ZHI A;  5HY6 A;  4QQD A;  2QDY B;  2RJD A;  2K5L A;  1RI0 A;  1JB0 E;  4ELZ C;  4B9X A;  3CCE A;  1Q7Y C;  2RHY A;  3LWH A;  1KC8 U;  2L8D A;  3JCM c;  3GLX A;  3OSV A;  3VUZ A;  3NTK A;  4JRI A;  4M75 D;  3HFO A;  4IUR A;  1BIA A;  1H64 1;  3I55 T;  4BB7 A;  2EJ9 A;  1H3Z A;  3JRZ A;  2DPP B;  1O9S A;  5FLX E;  2DXT A;  5C0M A;  5D6Y A;  4F7U E;  4M7A E;  5LJ3 d;  3V7C A;  2L5Q A;  4NS5 A;  3JCM Q;  1QVF S;  4BY6 B;  2RI5 A;  4BI3 A;  2V8K A;  2GCX A;  3A5Z B;  3V8K A;  4B9W A;  3BFM A;  4A4F A;  5GMK j;  3FEO A;  2CGH A;  2LQK A;  2O4X B;  5CKB A;  3CPF A;  3X25 B;  5GAN h;  1YHQ A;  1VQ8 T;  3UPU A;  4LD6 A;  4M7D G;  2CZ7 B;  2V8I A;  4KT0 E;  2RJE A;  3SB2 A;  1Q81 C;  2O4X A;  4XQ3 A;  3HP9 A;  1VQ9 A;  1G3W A;  2E6N A;  3RMS A;  2P0P A;  3PT9 A;  2ZPI B;  4M78 G;  3CXC S;  4FT2 A;  3QO3 A;  2DIQ A;  2RHI A;  3QZ9 B;  5LJ5 f;  2QQA A;  2H3J A;  2MWO A;  1NPP A;  3C12 A;  4FM4 B;  1BKB A;  2K4Y A;  4A4K A;  3WVD B;  3SWN C;  3JCM b;  1JRI A;  3C94 A;  1N9R A;  3OY9 A;  4L6V 5;  2D0Q B;  2F69 A;  3P8H A;  3G71 A;  2LQ8 A;  4XTV A;  4IUV A;  1BI2 A;  3BW1 A;  5CIU A;  2DZC A;  2X4Y A;  1W2B A;  2DTI A;  2DD5 A;  3C4S A;  3V7R A;  3GOX A;  4C0D C;  3L42 A;  3VU3 C;  3LX7 A;  2MF2 A;  4IUT A;  4FL6 A;  1ZQ1 A;  1M90 C;  3LW5 E;  2RI2 A;  1VQM T;  2ZCF B;  3OYM A;  5GAM g;  3QZ5 B;  4RKU E;  3ZFJ A;  4E7I A;  4LDU A;  4PNO A;  4PJO G;  3OMC A;  5LJ5 j;  5GAN 2;  2X4W A;  4NOY A;  4XTU A;  3L2U A;  3A8H B;  3JSC A;  3KXT A;  4C8Q C;  4FU6 A;  4XTW A;  2Y90 A;  5GAN 3;  5DLQ E;  1M9S A;  2QI2 A;  1I8F A;  3DLL A;  4C92 C;  5EG2 A;  1M5Q 1;  4OF1 A;  4ME7 A;  4LDX A;  4QVC A;  2XU8 A;  3E9G A;  1OI1 A;  1U8R A;  2PVD B;  3QG1 A;  1VQL A;  3PMI A;  4E7L A;  1KQS S;  3FJP A;  3PGG A;  5GAM d;  4M7A C;  1YJW A;  2XHC A;  1PSF A;  2XIC A;  5GAN e;  4EMK B;  1M1F A;  1WPY A;  2F5T X;  2RB6 A;  3CC7 A;  2QQB A;  4RG8 A;  5L8R E;  2WSF E;  4E7H A;  2M1H A;  3MHX A;  3UT1 A;  5I21 A;  2DEQ A;  3OBW A;  4JLG A;  2I2L A;  2LT1 A;  4MML A;  4EMK A;  5J39 A;  2GF7 A;  2EYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...