3OB9A

Structure of the human msl3 chromo-barrel domain at 2.5 angstrom resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
EGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDENRRLQRKLARKAVAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Male-specific lethal 3-like 1 (Drosophila), isoform CRA_c
publication title Structure of the human MSL3 chromo-barrel domain at 2.5 Angstrom resolution
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 19
structure length 89
sequence length 89
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ob9A01
4ZTFA 2F5KA 2PQWA 2QQRA 2XK0A 2RHYA 2DIQA 2EFIA 2R5AA 3UT1A 3OYHA 2XDPA 4C5IA 2L89A 3MP8A 1G5VA 3CEYA 2O4XB 4IURA 1SSFA 2RI3A 4IUPA 5J39A 3OYAA 2R57A 3MP1A 3DLMA 3ME9A 2JZ2A 3QIIA 4PLIA 3OYJA 4NS5A 2CKKA 5FRNA 2DIGA 2EKOA 5KH6A 5IN1A 2VYTA 3OYMA 4BDZA 4E7HA 3PMTA 3KUFA 5J26A 4C5EA 2BUDA 4OVAA 4QQGA 1OI1A 3OMGA 3Q1JA 5D6YA 3PFSA 3OYEA 5CIUA 2M16A 3OS1A 3PNWC 2RHXA 3NTHA 3DB4A 4BE1A 2RO0A 4LD6A 2EQMA 2RI5A 4Z02A 3QJ6A 4BE0A 2LTOA 2X4XA 3GOXA 3OS0A 2K3XA 3LGLA 4RG2A 2RJDA 2X35A 3OA6A 3LGFA 3S6WA 2YRVA 4N4IA 4QW2A 5M9OA 3OS2A 4PL6A 3NTIA 3OYFA 2GFAA 2RJEA 2BIVA 3ZEHA 1WGSA 5FRMA 3FC3A 3FLGA 2O4XA 3P8DA 3L2WA 3NTKA 2E5QA 2RI2A 2HQXA 3OQ5A 3FDRA 4BDYA 3E9GA 4BE2A 3OYCA 4E7IA 2FHDA 3E9FA 4X34A 3L2VA 3BDLA 3SD4A 2EQJA 2B8AA 2RJFA 3MEUA 3F70A 4PLLA 4E7KA 5KE3A 4A4HA 5C6SA 2X4WA 3UWNA 2L8DA 4HCZA 2NLUA 3META 3C4SA 2RHUA 3QBYA 1N27A 3MEAA 4N4GA 5KCHA 4FL6A 1WJRA 3S3MA 4CRIA 1KHCA 3LLRA 3P8HA 3OYIA 4IKFA 2BKDN 2LCCA 2JTFA 5KE2A 3H6ZA 4IUVA 4II1A 2HQEA 4N4HA 1H3ZA 2WACA 4B9XA 5D6WA 3OY9A 3S3NA 3MP6A 4Q5WA 4C5GA 2P0KA 5D6XA 5FROA 4A4GA 5C0MA 3OYBA 3L2UA 1RI0A 2K3YA 3QKJA 2DAQA 3OMCA 3L2QA 2GFUA 3PMIA 3EAEA 4A4FA 3O8VA 2L3RA 1OYXA 2M1HA 2QQSA 2MWPA 3OYDA 4BD3A 4A4EA 4QVZA 4ZTJA 4E7JA 3LH0A 2R58A 4BACA 4E7LA 2MWOA 3OB9A 2E6NA 2RJCA 3ASKA 4C5HA 2G3RA 3S3OA 2LVMA 1OZ2A 2D9TA 3MEWA 3L2RA 2R5MA 2RHZA 3MEVA 2M0OA 3L42A 2LRQA 4B9WA 1OZ3A 4FU6A 2LDMA 3H8ZA 3OYGA 3DB3A 4IUUA 4EDUA 2GF7A 1XNIA 3LYIA 4UC4A 2EQKA 2X4YA 2IG0A 3M9QA 2EQUA 4QQDA 4QQ6A 1MHNA 4GY5A 3OYLA 3OYNA 1WJQA 5KCOA 3OYKA 5IAYA 1WJSA 3LX7A 4IUTA 3FEOA 4IUQA 4L59A 2RHIA 3MO8A
chains in the Genus database with same CATH superfamily
2FRYA 4M75F 2KI7A 2GTJA 2XDDA 5FU7C 5GAN2 4RKUE 2MPXC 3TQ7P 4J9CA 4XTYA 1V1CA 1D0ZA 2EYXA 1GXIE 3QDFA 1QVFP 4PJOF 3G1JA 3OYMA 4OB1B 3D7SB 1PWTA 5CQYA 2QQ9A 1RUWA 1JU5C 1HSQA 3X28B 2KXDA 1GFDA 4K11A 1GRIA 2G6FX 5LJ5d 1WFWA 1TS9A 2RQRA 3GPLA 1PD1A 3OS2A 1FX7A 4BI3A 1T0JA 4OB0B 1KD1C 4M7DA 2WSCE 4M4ZA 1BI2A 1GBRA 3UDCA 4LD9K 2OJ2A 5GAMf 1UGSB 2JTMA 2L3SA 2J7IA 3CCLA 5KE3A 3UPUA 5C6SA 1K4US 1WHJA 3CC2A 2E41A 1UGPB 5GMKj 5GAN8 3N5BB 4D8DA 4M75D 3NGPA 4HA8A 1B34A 4F7UF 3OYIA 4ZGJB 1PSEA 2NUTA 2LMJA 3CBMA 5C0MA 3L2UA 5LJ3e 5FU7B 3GNFB 3CMET 1QVFS 3ZL7C 2CH4A 4PJOD 3I55T 2M51A 2ZAEA 4X9CA 2PTKA 3HRSA 4C0FA 1BIAA 2F5TX 2EBPA 4M7AG 2BZ8A 2ZPBB 1E6GA 1IRXA 1K9MC 1K0SA 3CCMQ 1VQ9A 3M0RA 1WDXA 4PJNA 1MHNA 4IIOA 4M77C 3A8MB 2FYKA 1VQKT 4L59A 2LP5A 1AWWA 3CCET 2EYWA 1VQ8T 2R5AA 1KQ1A 2L89A 1G5VA 2ECZA 2O4XB 3QWXX 1VQ5A 3HP9A 2GNCA 4NL2A 2R57A 2M9UA 2F2XA 2EKOA 3VS6A 2YUNA 5GAOr 1YHQQ 1Q86U 4R56A 4RG8A 4LD6A 4LDXA 2V8IA 1TH7A 2CP6A 1YJWQ 1M3BA 1TTHB 3OS0A 4C8QA 2EGCA 4QW2A 2DLPA 2X51A 3PVQA 3HSBA 3AT1B 3VS0A 4F17A 4ZN1A 5DLQE 1TSFA 2BZXA 3EGXB 3E9FA 1W70A 2H8HA 4X34A 2DTHA 1VA7A 1KK7A 1M90U 4ELZC 1AEYA 2CZ0B 1KQSA 4MZTA 1WI7A 2Y90A 3VS5A 1BB9A 1YWPA 3M0SA 4KULA 1NJIR 3BY7A 3EG9B 2VVKA 2FG0A 3CQTA 1HYOA 2ENMA 4FYXB 1I4K1 1RAAB 1YJNT 5HK0A 3MP6A 4LE9A 2JS0A 4AG2C 1Z9ZA 3TEEA 2LJ3A 1NLPC 5FLXE 2RQUA 3CCVT 3C0CA 2RH2A 2MWPA 1AWOA 1ZHIA 4L5GA 4QVZA 2XICA 1I5LA 3OB9A 5HKCA 2P0PA 5GAN5 3HHTB 1MUZA 4C0GA 1CSKA 2YRDA 2E65A 4E47A 2EQUA 2ROTA 4QQ6A 1AZEA 2OI3A 1D3BA 2EVRA 2EIFA 5KCOA 4HT8A 2QYZA 3FEOA 5LJ3d 3NMZC 4M78D 1QWFA 5GAOm 2YWWA 1D1CA 4CC3A 3OYAA 1W2BA 4XTVA 3TVTA 1AD5A 2HBWA 4LN2A 4C92C 3I9QA 5A0DA 2AKKA 5CVIA 4FM4B 2HL3A 4D8KA 2EYZA 1YFNA 3PNWC 3V8JA 1JBMA 5AT1B 2DERA 4DBRA 1QKWA 4GBQA 3QPHA 3LGFA 1KD1R 1M5Q1 4J5YA 1BU1A 3CMEA 3J80E 1UDLA 1K1ZA 5EC7A 1AZGB 2CT3A 2DX1A 2FZKB 4M7AF 2YUQA 3BW1A 1IXDA 5KYXB 2K2VA 1PCXA 2X9HA 2DXTA 2KT1A 3QBYA 3G71Q 1ARKA 1EX4A 1VQKA 1H92A 3CCEA 2WACA 2A7YA 2E3IA 3RNJA 1VQ8A 4C92E 2CZ7B 1SSHA 3GBQA 2A37A 8AT1B 5LJ5g 1N9RA 4OMQA 3REAB 5DLOA 5CO7A 1PRMC 2PU9B 2EWNA 4C92B 1K9MR 4C8QG 1OX8A 2DRMA 3UATA 1UECA 2MWOA 3EGDA 3ASKA 3S3OA 3RESA 3PIOA 4JPBW 2D8HA 1NG2A 4DOWA 1K0XA 4OMLA 2LDMA 2CSQA 3LYIA 1MV3A 4FT2A 3HPWA 4GY5A 1KQSS 2FO0A 4PJOC 3EFSA 1Y96B 1KFZA 2ED1A 2QA4A 1MNDA 1PD0A 1X6BA 4M7AD 5GMKl 1Y7XA 5GANf 3DLMA 1VQOQ 5FRNA 4EMKA 3KUFA 3PFSA 3OS1A 3A5ZB 4BE1A 4DQ2A 2FPFA 3EFOA 2DILA 1U1TA 1IREB 1RACB 2DF6A 3A8LB 1YJNA 2A36A 4N4IA 2DXBA 8ATCB 2CP5A 3OYFA 3OW2A 4RTTA 1EFNA 4M75E 2KR3A 3JB9G 3I55Q 3FC3A 3CCVA 1M2VA 2HQXA 1SHFA 2QTVA 1XQHA 1Q7YC 5IXBA 3L2VA 1X75C 3BDLA 3CCSQ 4OGCA 2B8AA 3MEUA 4M75B 4OB2B 3JB9H 2VWFA 4M78A 3QYGB 2LJ1A 5LJ5j 4PJOE 3CCMT 4M7DF 1W4SA 1BI1A 3PTAA 3VJPA 2J6KA 1LNXA 3G4SQ 4IUVA 5GAOl 4PJOB 4C0DC 2C0TA 2KQWA 3OY9A 4A4GA 4PK4A 2CZ1B 4Z88A 3EAEA 1YBYA 4HVUA 2VXFA 3RBBB 2JNGA 5GMKh 1YHQT 2QK0A 4E2FB 3MEWA 4J9HA 1EZZB 2DK3A 2SEMA 1KG1A 1RAHB 4B9WA 2EJGA 1M8MA 3I56T 2X4JA 3BE3A 1XTDA 5IH2A 2KVQG 4LUEA 4AFQC 4BUGA 2EPDA 3HTRA 5HCKA 1R8OB 4F7UE 1B07A 1WZOA 2AKLA 2XK0A 4C5IA 4J7IA 5AYFA 1R77A 3JCMg 4F7UB 3MP1A 1QVPA 1GCQA 1R0BG 5KH6A 1OI1A 2K3BA 2LCLA 2RHXA 1PC0A 5CR2A 3HFOA 1TU0B 1M1KU 3H0IA 1C6VX 2HNIA 4C0DB 2KDSA 2KRMA 3CC7T 1RAFB 3CCJQ 3JSCA 1ZSZA 3CXCP 1PHTA 3OQ5A 2GQVA 4C8QF 5LJ3g 1MMNA 2DVEA 1XOVA 3M56A 2EQJA 3M0UA 2QEXT 1QP3A 5KYYB 3EG3A 1NZ9A 1V76A 2LZ6B 4P5NA 2RQTA 2KSSA 4OMOA 1QVFA 1OULA 2QGGA 4AT1B 1UE9A 2C0IA 4ZNXA 2HDAA 2KBTA 1VUBA 2A28A 4CC2A 1TUGB 1RI0A 1VOMA 2OTLT 4AFZC 3V8LA 4O5VA 2JOYA 1I07A 2O01E 3GP8A 5GAOp 1NEGA 1ZA2B 2DYIA 1VYTA 3CD6T 4WTOB 3JAME 1X01A 3OYLA 2PNIA 1D0XA 4PJLA 3OYKA 1WJSA 3MEAA 3SWNC 3MO8A 1ABQA 2J6FA 2CS7A 4M78G 3UT1A 2K5FA 1T0HA 2XDPA 3A1PA 3MPUB 3RKWA 4C8QD 2K6DA 3SFMA 4FW2A 4RCBA 3THKA 4FCYA 4BDZA 2VYTA 3PMTA 4R55A 3CCMA 4N0AC 5A2QE 2JM9A 4XU1A 3FB9A 4JS5A 2P4TA 1UHCA 1MMGA 3HRUA 5LJ3j 3CCUT 4D6WA 1I1JA 2MF2A 3VS2A 2A0FB 1Q7YR 4NL3A 5CKFA 1QCOA 2JT4A 2KYBA 3NTKA 4KH0B 2BE7D 1TUCA 3OYCA 2F2VA 3E1SA 3FJPA 1YHQA 4WF2A 4JUVA 1YJWA 2DNUA 2ED0A 2MCNA 4XU0A 1ZUKA 4FL6A 1WJRA 2AK5A 3PT9A 3JB9D 3SWNB 2RMOA 5HY6A 3OSSC 4M77A 3M55A 3UA6A 3J81E 4XTWA 4A4FA 1VQOT 2DMOA 4VUBA 3RKXA 3OYDA 2SRCA 1WQWA 4ZTJA 2CSIA 1JRIA 1NM7A 1WHKA 4M7AE 1AHJB 2Z0WA 4J9BA 4UC4A 5DM7R 4JJDA 3JB9J 2NUPB 3SB2A 4M7AB 2Y4YA 1OU8A 3A8HB 2XMFA 1AOJA 5GAN3 5IHIA 3MP8A 3EFRA 3CEYA 1X2KA 1X69A 3CCST 2YRCA 2COZA 3EH2A 1JQQA 4PJJA 4AFUC 2KRNA 3EGUA 4C5EA 2H3EB 1C1AA 3KFVA 2RQWA 3JCMP 3BDUA 1SRLA 3G4ST 5GANe 2ROLA 1O9SA 2X4XA 2MIOA 1M1FA 1ZQ1A 1V29B 2CT4A 5CK9A 3JCMQ 4Z8AA 3C94A 2RJEA 2RNAA 2V8KA 3M53A 5I22A 4JJNK 3L2WA 1NJIU 4M7DC 4BDYA 3TCJA 2K9GA 3SHWA 1QMCA 1YITQ 3GIBA 2ESWA 1NYGA 1FMKA 2KYMA 4RUGA 4ORZA 3NHNA 1MV0B 3I56Q 4HCZA 1QKXA 2JXBA 2JVVA 2DJQA 1Q95G 4LDWA 2CREA 5KYXA 1KHCA 2BKDN 2DZCA 2HQEA 1VYUA 3E19A 5L23A 2P0KA 4M78F 4PFZA 1NPRA 3V7SA 4FSSA 1FMVA 4BI8B 5GMKe 5LJ5h 2E4HA 2VASA 3INZA 4A4EA 2XU8A 2K5IA 3G71A 1NEBA 2JJ9A 3MEVA 5EG2A 1M2OA 3DB3A 1WYXA 4M7DE 3M5AA 2DXCA 3CC7Q 3CCJT 4ZTFA 2F5KA 1YI2Q 1D1AA 2DIQA 3OYHA 1K73C 1UJYA 1B3QA 4M7DB 3IQLA 4KT0E 2FPEA 2PVDB 1NE8A 2CUBA 2OAWA 1Z9QA 4PLIA 3EG1A 2QEXQ 2KY9A 1KD1U 2LCSA 1SHGA 2HEQA 1VQ4Q 4J83A 2RF0A 4M77G 2KEAA 2YT6A 4OMFB 1O75A 3RDVA 4Y92A 4B6MA 3OSVA 1B34B 3JCMb 1K8AC 2DPPB 2RB6A 2KROA 2E70A 1SKUB 2NUTB 3P8BB 2OTLQ 2GFAA 2DKGA 1Y07A 3M57A 1VQOA 3J7AF 3M58A 3VU3C 5GAMg 1G2BA 3E9GA 3QJYA 4ZN3A 2LNHB 2RM4A 2DL4A 1S72Q 4HVVA 4XK8E 5I2MA 4A4HA 1MMDA 2C0OA 4RTUA 3CD6Q 5GANd 1OPKA 3KXTA 1VQ6Q 3RR6A 3JCMW 4AFSC 1UGVA 2EYYA 1BYMA 1K9MU 3SDZA 2J6OA 4FYVB 1W6XA 3I55A 4C5GA 2AT1B 5FU6B 5IHKA 2L3PA 4RTZA 2K3YA 3HRTA 3EHQA 2GBQA 3M0QA 3QZ9B 1YIJQ 3CCSA 1OYXA 7AT1B 1OV3A 2DZ9A 5GAOn 4RMOA 2BE9B 4C8QE 1PNJA 3A98A 2ZPHB 2EJFA 1RI9A 2WSEE 2D9TA 1PM3A 1YN8A 4XQ3A 3CCUQ 3U23A 1VQNQ 3G4SA 4C0ZA 4EDUA 4FT4A 3L2ZA 5KYUA 1WQ7A 3VRYA 4C8QB 2OX7A 1RAGB 4IUQA 1KIKA 1SG5A 5CKDA 2PVOB 2LC4A 3CMAT 1DJ7B 4IURA 4RCCA 4M75C 1YP5A 4HCBA 5I21A 3JCMh 2P4RA 1G3SA 1SEMA 3PVLA 2FB7A 2RD1A 3CC4Q 4MMLA 2JW4A 4QT7A 1BCMA 1KC8C 5CIUA 5GAMj 1X27A 3TSWA 1AWJA 1YJ9T 4E7SA 1U8RA 1QVGA 2XKOC 4F14A 3GOXA 2DRKA 1LCKA 2YRVA 1M1GA 1U06A 2E64A 3NTIA 4OMMA 2F2WA 2D0QB 2IPOB 4RTYA 2BIVA 3JRZA 5FWCA 4JDSA 3LWHA 1QW1A 1WIEA 1SPKA 1XJWB 2DJZA 2OTJQ 5KYWA 2HD0A 2E5KA 1ZX6A 5LJ3h 1QQJA 1K73U 1UG1A 4J7FA 3UWNA 2JTEA 1G3TA 2DTIA 5KCHA 3G6ET 2FZGB 2RQVA 1D3BB 3P8HA 1BCOA 3CCJA 4ME7A 3RMSA 2EGEA 2HL5C 1R0CB 4ANJA 4PKCC 1T3SA 3CBPA 4F16A 3G7ZA 3L2QA 2L3RA 3R6NA 1HJDA 2DD5A 5HK3A 2MI6A 1N6AA 2QQBA 3CXCA 5CKEA 4E7JA 2V1QA 5GAN7 4M77F 4KGXB 2HQHA 2LT4A 1OZ3A 3OYGA 4IUUA 1TXQA 2F1LA 1IHWA 1XNIA 2IG0A 3I35A 1D1BA 4KUIA 2P84A 1K73R 1WJQA 1X43A 5IAYA 3LX7A 1I81A 4IUTA 2MOXA 1IGQA 3VKIA 4QKUA 4EPCA 3JB9I 1YITT 4IUPA 2DXUA 4EMHA 2VKNA 3A8OB 1QVGP 2HSEB 3FIFA 4RTWA 4OVAA 2NUZA 1RL2A 1K8AR 4J9EA 3TU4K 2M16A 1ZSGA 1I5OB 1YWOA 1BBZA 2MYSA 2LQNA 1N5ZA 1VQ7Q 3LGLA 1S1NA 2E3HA 2O2OA 5CCAA 2JMAA 1VQPQ 2YLBA 3ZBDA 4KBMB 2YHTA 2QTXA 1IGUA 4V2SA 2RI2A 3JCMJ 2JUFA 2LQKA 3CPWP 1JJ2P 2DL8A 4M77D 5GJWB 1JB0E 3VS3A 3EGDB 4CC4B 3O5ZA 2QASA 4M78C 1JEGA 2Y4XA 5GAN6 1Q81C 1RLQC 1UGQB 2KK4A 1AVZC 3CC2T 1YI2T 4MDXA 2K79A 4JRIA 1H3ZA 2W0ZA 3VS4A 1VIFA 1VQMQ 1N8RC 4Q5WA 1KC8U 2PUOB 3OYBA 4A4KA 4F7UG 1QVGS 1P92A 3VS7A 1AWXA 2W10A 2JN0A 2EGAA 4F04B 2DEUA 1VQ4T 3LH0A 3C12A 4EMKB 4LXCA 2EYQA 1PKTA 2LRQA 2ZCFB 3M0PA 3CCQQ 3EFOB 3QYHB 4N0AA 1E6HA 2O9SA 3OYNA 2DYBA 3HFNA 2PQWA 1JJ2S 3CPWS 5GANg 1M9SA 2D1XA 4M78E 1UFFA 1M2VB 2QAZA 1EIFA 2KE9A 1S72T 1KC8R 3ME9A 2GTOA 3CBOA 1GCQC 4JZ4A 4MMKA 5CKBA 5IN1A 1U3OA 2ZPFB 4M78B 2QDLA 4PJMA 1Q7YU 3OMGA 4XAXB 4EMGA 2VXEA 1UJ0A 2E1HA 1VQ6T 2PZ1A 3NTHA 4DBQA 1D09B 1GFCA 2HCKA 3CXCS 4JRPA 2RJDA 3JB9F 2X35A 5LL6S 4A63B 3S6WA 1YIJT 4MDWA 5M9OA 4PL6A 4ELYC 4HCKA 1FXXA 2E10A 3ZFJA 2O4XA 1ZSZC 1WLPB 2KXCA 3X26B 4X1VA 1WPYA 2EKHA 1Q86C 2RK1A 1NBEB 1PKSA 3EG2A 1UB4A 3X24B 1GBQA 5CQXA 1BI3A 4OMPA 3UF4A 2D6FA 2BZYA 1VQNT 4KGZB 2X3XD 3META 3GF5A 4M7AC 1AT1B 2L5QA 2DFUA 2XHCA 4CRIA 2VC8A 4HVWA 2EW3A 4C92D 2XD0A 1PSFA 4DEXA 5D6WA 4BI4A 5FROA 2DL3A 1TWBA 1BK2A 4J6YA 3QKJA 3CMAQ 4KGVB 1TUDA 2BTTA 4JJBA 1YITA 3PMIA 1TG0A 1G8XA 1M90C 3O8VA 1JO8A 3URGA 3CC4T 2QDYB 3EGXA 4FYYB 1NPPA 2A08A 3EH1A 4HXJA 5GANj 3I56A 2XDBA 2FRWA 1YJ9Q 1N9SA 1QLYA 1M3CA 2ABLA 3EG9A 3AHUA 2LX7A 2L2PA 3QJ6A 2PUKB 2RHYA 1Q81U 1Q82C 1E7OA 2RA2A 3JCMe 1ZA1B 1ZSZB 2RI3A 2OTJT 3DLLA 3QIIA 2CP3A 2V26A 4ATOA 1N8RU 2VUBA 2CYZB 5J26A 2BUDA 1M27C 3WXMB 3G6EQ 1BIBA 2M02A 2RO0A 5KYNA 2QQAA 4Z02A 4JLGA 3RERA 2LTOA 3CC7A 4RG2A 5J3BA 1KSWA 1YI2A 1LPLA 2COWA 1X6OA 2D8JA 3OA6A 3WVEB 1PG5B 2DD4A 2ZPEB 3CCRQ 1YNZA 5FRMA 2GCXA 2QEXA 2O88A 1M3AA 3M0TA 3V7RA 4A53A 5GAMh 3SD4A 1VQ4A 2ZPIB 1Q81R 4DBHA 3QSUA 2L0AA 2P0QA 1VYVA 4PLLA 4LDYA 3I5RA 4J8OA 4CI0C 4N4GA 3RMQA 1N8RR 2CGHA 1I0CA 2OTLA 3VS1A 2OAUA 4FYWB 5IT9E 1VQLQ 3HKSA 2O9VA 3RKYA 3TREA 4J9DA 3ER0A 1RAIB 2KRSA 1UGRB 4AG1C 1S72A 2JM8A 3H41A 5LJ5f 4BACA 3CD6A 4OP0A 4RTXA 4J9GA 2R5MA 3X20B 1VQ6A 2RHZA 1SF9A 1ACMB 4ESRA 4E7ZA 1LVKA 2KMTA 1VQ7T 1WHMA 4CC7A 4MZMA 1VQPT 4ZGEB 1H3HA 1K9AA 1J3TA 1YIJA 1QWEA 4HKEA 2H3JA 2IIMA 2K4YA 2IVWA 2DE0X 1SSFA 1MMAA 2QA4T 2JZ2A 4EIKA 4C92A 3VYGA 1OOTA 3CCUA 2ZPGB 4QQGA 1VQNA 4O6JA 3Q1JA 2NYSA 4L6V5 3SEMA 3CCLQ 3DB4A 3V8KA 3E2UA 4M77E 5GMKm 3BFMA 3CC2Q 1WA7A 1VQMT 5FU6C 3VRZA 1HD3A 2E6ZA 2KT8A 1M30A 1Y96A 3OYYA 2FZCB 4M77B 3JCMd 4DOVA 1Q86R 4XTZA 1B7TA 1MNEA 2LNVA 2X3WD 4KH1B 1ZUYA 3QHSA 1KQ2A 3CC4A 3FDRA 3L1AA 2K7AA 1RABB 4LUDA 2JS2A 2O31A 1Q82U 5CAIA 3CCQT 4C8QC 2L8DA 2AZSA 3C4SA 1WXUA 2RHUA 4PFPA 3QO3A 2JMCA 5IXFA 3S3MA 1MGQA 4JRKA 4GLKA 2DL7A 1YCYA 3RIRA 2ZGWA 1VQ9Q 2V8JA 4M7DG 4DBFA 2PVGB 1M90R 2HAXA 2V1RA 2VGNA 3EG0A 2DBKA 2OTJA 1FWZA 3T9NA 2LQ8A 3FRNA 1VQ5Q 3MJXA 2CZ6B 1CKBA 4M75A 2G3RA 3VUBA 1VIEA 2CP7A 1UUEA 2MAMA 2VV5A 2XIDA 2HSPA 1A0NB 2K57A 3V7CA 4FU6A 2YXYA 3TSZA 1Q82R 5FWBA 1G83A 1C0MA 1RLPC 4YTLA 4PJOA 4QVDA 4NOYA 2QI2A 2KNBB 5D7UA 4DA4A 3CPFA 3NPFA 1CKAA 1F1BB 3GNGA 3OYJA 4FW1A 2QGFB 1KQSP 2AIRB 1FYNA 2DIGA 1WX6A 3JCMV 2EQIA 3JCMf 5D6YA 1RADB 3OYEA 3QG1A 2RI5A 3OBYA 3PE0A 5IHNA 3WVDB 1QP2A 2MK5A 1IO6A 4PFOA 3QDRB 5ECAA 2DM1A 2MMPA 1RAEB 4PNOA 4Y91A 3C95A 1JXOA 1H8KA 2AZVA 3P8DA 2E5QA 1W1FA 2VB6A 4F7UA 2YUOA 1UEBA 2K5LA 5I11A 2RJFA 4MZPA 4BY6C 3LWIA 4JS4A 2RPNA 2FEIA 2C06A 5LJ3f 4ZGDB 3RUXA 1M1KC 1VQ7A 4OMNA 3GLXA 1N27A 1NLOC 1VQPA 2QG9B 2E12A 3LLRA 5KE2A 4N4HA 4X9DA 4C92G 4BB7A 2DL5A 5D6XA 2LQWA 1W2BP 2NWMA 2CH4W 3OMCA 4LNPA 5DY9A 2GFUA 2DEQA 2K2MA 1TOVA 2GGRA 3MCAB 5A0LA 2XI9A 2HBPA 3MHXA 4C5HA 1JJ2A 3CPWA 5KYYA 5GAN4 1ZBXA 3JV3A 2EJ9A 1G3WA 3PIPA 2QXFA 3L42A 4J6WA 1ZBJA 4QQDA 1VQMA 3H0FA 3CCRT 2QQRA 3H0HA 1K8AU 1BKBA 1LJOA 3M54A 5GANh 3CMEQ 2LX9A 1IHVA 2DBMA 3QUIA 4OF1A 4XU3A 1LOJA 1ZUUA 4XU2A 3EHRA 3JCMX 4NS5A 4E7HA 4BY6B 1WXTA 3X25B 1U1SA 1IB8A 3CCQA 1KJWA 9ATCB 1OX9A 4OGEA 2EQMA 5A0GA 4BE0A 2K3XA 1W2BS 1VQLT 1UTIA 3I5SA 3LH5A 1VQKQ 2LT1A 4M75G 2L3QA 2DA9A 3CCEQ 1JXMA 1VQ8Q 5GAMe 1WGSA 3H9NA 3FLGA 5CKHA 2DVJA 2B86A 4EMKC 4E7IA 2FHDA 4XTXA 3M59A 1G3YA 4PJOG 2VGMA 3KBGA 2KGTA 4OB3B 4E7KA 2ZZDA 3M4GA 1BI0A 5KYUB 5GAOq 1YJWT 4IKFA 2LCCA 1Y57A 3H6ZA 1QCFA 1WXBA 4LDVA 5I2SA 4RTVA 3VV0A 2DTOA 1YCSB 5FW9A 2DAQA 1M8VA 4A54A 2QA4Q 2XG8D 2CUDA 2FL7A 4Y28E 2M1HA 2QQSA 4HT9A 3DKMA 1WHHA 3M4YA 4J9IA 1Y0MA 2E6NA 2HZYA 3CCLT 3L2RA 2CDTA 2M0OA 3JCMc 4M7DD 1ZLMA 2GF7A 4FIBA 1GCPA 3QWYA 3QXEB 5LJ5e 3OW2P 1WHGA 1OPLA 3ZEHA 2RHIA 3CMAA 3SWNA 4JJCA 4DEYA 4KRTA 2EFIA 5GJVB 4HCCA 1YJNQ 2RN8A 1HK9A 2ATCB 2DO3A 4QVCA 3REBB 5J39A 5KYWB 2YDLA 3CCVQ 2CKKA 4WCIA 1YJ9A 4GLMA 4R0KA 2YLCA 1OQKA 3OBWA 2FPDA 2FVUA 4JRQA 3VYHB 1OU9A 1VQ9T 5GMKi 2NUPA 4IIMA 4C92F 4JZ3A 4TVRA 3PGGA 2J05A 2LJ0A 4JLIA 4M7AA 4LDUA 4E6RA 3R6OA 3NFCA 2EAYA 1WHLA 2J06A 1OEBA 3LW5E 1VQ5T 1H641 5L8RE 4BE2A 3FJ5A 3QZ5B 2COYA 1M1KR 1X6GA 4Z89A 2CP2A 3VUZA 1PRLC 3ULRB 3F70A 3G6EA 1D0YA 1Y71A 2X4WA 2D0NA 3OW2S 1ABOA 2DETA 2I0NA 3HL8A 4AMCA 2NLUA 3UA7A 1M4ZA 1FMWA 3A8GB 1WNLA 4J9FA 2F69A 2JTFA 4FSXA 6AT1B 4II1A 3CCRA 2M0YA 2CP0A 4B9XA 1NJIC 3S3NA 1IZ6A 5GAMd 2AHJB 1HXDA 4J6XA 1T3LA 1K76A 2I2LA 3MKDA 1NYFA 1X2QA 1U5SA 4BD3A 2R58A 4KUDK 4E7LA 1QCNA 2RJCA 2HMAA 2LVMA 1OZ2A 2YSQA 2RK2A 2YUPA 1UHFA 3H8ZA 1I8FA 2EQKA 2X4YA 3M9QA 3G71T 3OS5A 1KHIA 1VQLA 2HKNA 1GL5A 2GQIA 1SRMA 4XTUA 2KAFA 2HKQB 2WSFE 2A3LA
chains in the Genus database with same CATH topology
4M75F 4HKEA 2XDDA 2XK0A 2H3JA 2PVOB 2K4YA 2LC4A 5FU7C 4C5IA 5GAN2 4RKUE 4J7IA 5AYFA 2IVWA 3CMAT 1DJ7B 1SSFA 4IURA 4RCCA 4XTYA 3JCMg 2QA4T 4M75C 4F7UB 4HCBA 3MP1A 5I21A 1QVPA 2JZ2A 3JCMh 1G3SA 1GXIE 2FB7A 4C92A 2RD1A 4PJOF 4MMLA 3VYGA 5KH6A 3OYMA 3CCUA 4OB1B 2ZPGB 4QQGA 1VQNA 4O6JA 1OI1A 3Q1JA 1KC8C 2LCLA 5CQYA 2QQ9A 5CIUA 5GAMj 4L6V5 2RHXA 3X28B 3DB4A 1YJ9T 3V8KA 4M77E 5GMKm 1U8RA 5CR2A 1QVGA 3HFOA 5LJ5d 3BFMA 2XKOC 3GOXA 1M1KU 1VQMT 5FU6C 2HNIA 4C0DB 2E6ZA 2KDSA 2YRVA 1M1GA 3GPLA 1Y96A 2E64A 3OYYA 3NTIA 3OS2A 1FX7A 3CC7T 4BI3A 2D0QB 4M77B 3JCMd 2BIVA 3JRZA 4DOVA 4JDSA 4OB0B 4XTZA 3LWHA 1QW1A 2LNVA 1KD1C 4M7DA 2WSCE 3JSCA 3QHSA 1KQ2A 3CC4A 1BI2A 3FDRA 3L1AA 3OQ5A 2GQVA 2DJZA 4C8QF 3UDCA 5LJ3g 2DVEA 4LD9K 1XOVA 3M56A 2HD0A 2EQJA 2QEXT 5LJ3h 1QP3A 5GAMf 1UGSB 2JTMA 1NZ9A 3CCLA 4P5NA 5KE3A 1K73U 1Q82U 3UPUA 5C6SA 4J7FA 2KSSA 1QVFA 5CAIA 3UWNA 4C8QC 3CCQT 3CC2A 1G3TA 2E41A 2L8DA 2DTIA 1UGPB 3C4SA 2RHUA 5GMKj 5GAN8 5KCHA 3G6ET 3N5BB 3QO3A 4M75D 3S3MA 4HA8A 1D3BB 1B34A 1MGQA 3P8HA 4JRKA 4F7UF 3OYIA 4GLKA 4ZGJB 3RIRA 1YCYA 2ZGWA 1PSEA 2V8JA 3CCJA 4M7DG 1VUBA 2PVGB 4ME7A 3RMSA 2HAXA 3CBMA 5C0MA 3L2UA 1RI0A 4PKCC 5FU7B 5LJ3e 3CBPA 3GNFB 2OTLT 3CMET 2VGNA 3G7ZA 1QVFS 1FWZA 3L2QA 3V8LA 2OTJA 4O5VA 3T9NA 4PJOD 3I55T 2LQ8A 4X9CA 2L3RA 2JOYA 2DD5A 3FRNA 2O01E 5HK3A 3GP8A 3HRSA 2MI6A 4C0FA 5GAOp 1N6AA 1BIAA 2QQBA 2F5TX 3CXCA 5CKEA 4E7JA 2CZ6B 1YIJA 4M75A 2G3RA 4M7AG 3VUBA 1VIEA 2MAMA 2VV5A 2XIDA 2ZPBB 5GAN7 4M77F 1K9MC 2K57A 2LT4A 3V7CA 1OZ3A 4FU6A 3OYGA 3CD6T 4IUUA 1XNIA 1VQ9A 2IG0A 3JAME 1X01A 1MHNA 3OYLA 4KUIA 1WJQA 3A8MB 2FYKA 4M77C 1WJSA 3LX7A 1I81A 4IUTA 4L59A 4YTLA 3MEAA 5IAYA 4QVDA 3SWNC 3MO8A 4PJOA 3CCET 1VQ8T 4NOYA 2CS7A 2QI2A 2R5AA 4M78G 3UT1A 3VKIA 1KQ1A 2K5FA 2XDPA 3RKWA 4C8QD 2L89A 1G5VA 2O4XB 4EPCA 1VQ5A 4DA4A 3CPFA 3HP9A 4NL2A 3JB9I 1YITT 4IUPA 2DXUA 3SFMA 4RCBA 4EMHA 2R57A 2M9UA 3GNGA 3OYJA 3A8OB 2DIGA 2EKOA 3FIFA 4BDZA 2VYTA 3PMTA 3JCMV 3JCMf 4R55A 4OVAA 3CCMA 5GAOr 4N0AC 5D6YA 1Q86U 1RL2A 5A2QE 4XU1A 4R56A 3OYEA 2M16A 3FB9A 3TU4K 4JS5A 3QG1A 4RG8A 2P4TA 3HRUA 4LD6A 4LDXA 2V8IA 1TH7A 2RI5A 3OBYA 5LJ3j 3CCUT 4D6WA 3OS0A 3WVDB 4C8QA 1QP2A 3LGLA 5CCAA 2MF2A 3QDRB 2MMPA 2YLBA 4QW2A 3ZBDA 4PNOA 4Y91A 3C95A 3HSBA 4KBMB 4NL3A 2YHTA 2QTXA 5CKFA 4ZN1A 3P8DA 5DLQE 3NTKA 2E5QA 4V2SA 2RI2A 3JCMJ 3OYCA 2JUFA 2LQKA 3E9FA 4F7UA 4X34A 2DTHA 1UEBA 3E1SA 1JB0E 2K5LA 3FJPA 4M77D 1YHQA 1M90U 2RJFA 4MZPA 4BY6C 4ELZC 4WF2A 3LWIA 2CZ0B 4JS4A 4M78C 1KQSA 4MZTA 4JUVA 2C06A 1YJWA 5LJ3f 4ZGDB 2Y90A 3RUXA 1M1KC 2Y4XA 4XU0A 5GAN6 1Q81C 1VQ7A 4KULA 3GLXA 1N27A 3BY7A 4FL6A 1WJRA 1VQPA 2E12A 1UGQB 2KK4A 3LLRA 3PT9A 5KE2A 3JB9D 3CC2T 1YI2T 4MDXA 4N4HA 4JRIA 1I4K1 4X9DA 3SWNB 4C92G 1H3ZA 4BB7A 1VIFA 1YJNT 5HY6A 3MP6A 4Q5WA 5HK0A 1N8RC 5D6XA 2PUOB 3OYBA 1KC8U 3OSSC 4A4KA 4F7UG 4M77A 1QVGS 3TEEA 1P92A 3OMCA 5DY9A 2GFUA 3M55A 5FLXE 3J81E 2DEQA 4XTWA 3CCVT 4A4FA 1VQOT 4VUBA 3RKXA 2RH2A 3OYDA 2JN0A 2MWPA 1ZHIA 4L5GA 3MCAB 5A0LA 2XI9A 4QVZA 1WQWA 2HBPA 4ZTJA 1VQ4T 2XICA 3LH0A 1I5LA 3C12A 3MHXA 3OB9A 4EMKB 2P0PA 4C5HA 3HHTB 5HKCA 5GAN5 3CPWA 1JJ2A 5GAN4 1ZBXA 1JRIA 1VQKT 4M7AE 2EJ9A 1AHJB 1G3WA 3PIPA 2QXFA 3L42A 2EYQA 2LRQA 4C0GA 4J6WA 2ZCFB 2E65A 3QYHB 4N0AA 4UC4A 5DM7R 4E47A 2EQUA 4QQDA 4QQ6A 3JB9J 1VQMA 1D3BA 3SB2A 3OYNA 2EIFA 5KCOA 4HT8A 3FEOA 4M7AB 2Y4YA 3CCRT 5LJ3d 3HFNA 2PQWA 2QQRA 4M78D 1JJ2S 3CPWS 1BKBA 3A8HB 5GANg 1K8AU 5GAOm 1LJOA 3M54A 1M9SA 3MP8A 3EFRA 3CEYA 4M78E 5GAN3 5GANh 3CCST 2LX9A 1EIFA 3OYAA 4XTVA 1S72T 1W2BA 3QUIA 4OF1A 4XU3A 1LOJA 3ME9A 4XU2A 3JCMX 3CBOA 4NS5A 4C92C 4MMKA 5CKBA 4E7HA 5IN1A 4BY6B 5A0DA 5CVIA 3X25B 2ZPFB 4M78B 1U1SA 4C5EA 4FM4B 1Q7YU 3OMGA 4XAXB 4EMGA 3CCQA 2VXEA 2E1HA 1VQ6T 3PNWC 3NTHA 3JCMP 3BDUA 2EQMA 4OGEA 1JBMA 3V8JA 5A0GA 3G4ST 3CXCS 4JRPA 4BE0A 5GANe 2X4XA 1O9SA 2K3XA 1W2BS 1VQLT 2RJDA 1M1FA 2X35A 3JB9F 5LL6S 3QPHA 1ZQ1A 1V29B 3LGFA 3S6WA 5CK9A 1M5Q1 1YIJT 4MDWA 5M9OA 4PL6A 3JCMQ 2LT1A 4J5YA 4M75G 4ELYC 3C94A 2RJEA 3CMEA 1FXXA 2V8KA 3M53A 3J80E 5GAMe 1WGSA 4JJNK 2E10A 3FLGA 5CKHA 2O4XA 3ZFJA 3L2WA 1NJIU 4M7DC 4EMKC 4BDYA 3X26B 3TCJA 4E7IA 2FHDA 1WPYA 4XTXA 3M59A 1Q86C 3GIBA 2RK1A 1G3YA 1UB4A 3X24B 5CQXA 1BI3A 4M7AF 4PJOG 2D6FA 2VGMA 3KBGA 3BW1A 4OB3B 4E7KA 2ZZDA 1VQNT 2K2VA 2DXTA 4HCZA 3META 3QBYA 2JVVA 3GF5A 3M4GA 1BI0A 4M7AC 4LDWA 2L5QA 2XHCA 4CRIA 5GAOq 2VC8A 1KHCA 1YJWT 1VQKA 4IKFA 2BKDN 2LCCA 2DZCA 3H6ZA 4C92D 2XD0A 2HQEA 4LDVA 1PSFA 2WACA 3E19A 5I2SA 2A7YA 5D6WA 3CCEA 3VV0A 1VQ8A 2P0KA 4BI4A 5FROA 4C92E 4M78F 2DTOA 1NPRA 2CZ7B 4J6YA 3V7SA 3QKJA 1M8VA 2DAQA 5LJ5g 4A54A 1N9RA 1YITA 3PMIA 2XG8D 1M90C 4BI8B 5GMKe 2FL7A 5LJ5h 3O8VA 5DLOA 4Y28E 2M1HA 2QQSA 5CO7A 2QDYB 3DKMA 3URGA 3CC4T 4HT9A 2PU9B 3INZA 4A4EA 2EWNA 3M4YA 4C92B 4C8QG 1NPPA 2XU8A 2MWOA 5GANj 2E6NA 3ASKA 3I56A 2K5IA 2XDBA 3S3OA 3G71A 3L2RA 3CCLT 3RESA 3PIOA 4DOWA 1N9SA 3MEVA 2M0OA 5EG2A 3JCMc 2LDMA 4M7DD 3DB3A 2GF7A 4FIBA 3LYIA 4FT2A 4M7DE 3HPWA 3QXEB 4GY5A 3AHUA 5LJ5e 1KQSS 3M5AA 4PJOC 3ZEHA 2RHIA 3QJ6A 2DXCA 3EFSA 3SWNA 3CMAA 1Y96B 3CCJT 4ZTFA 2F5KA 2QA4A 2PUKB 2RHYA 2DIQA 2EFIA 4HCCA 3OYHA 1Q81U 1K73C 1Q82C 2RA2A 1HK9A 4M7DB 3JCMe 2DO3A 2RI3A 4KT0E 2OTJT 3DLLA 4QVCA 4M7AD 2PVDB 1NE8A 5J39A 5GMKl 1Y7XA 5GANf 3DLMA 3QIIA 4PLIA 2KY9A 2CKKA 1KD1U 5FRNA 1N8RU 1YJ9A 4ATOA 2VUBA 4EMKA 3KUFA 2CYZB 5J26A 2BUDA 4J83A 3PFSA 2YLCA 3OS1A 3OBWA 3A5ZB 4M77G 3WXMB 1BIBA 4BE1A 2RO0A 2FVUA 4OMFB 1O75A 4DQ2A 2QQAA 4Z02A 4JLGA 4JRQA 3OSVA 3VYHB 3RERA 1B34B 2LTOA 3JCMb 3CC7A 1VQ9T 5GMKi 1K8AC 2DPPB 1U1TA 2RB6A 4RG2A 1IREB 5J3BA 1YI2A 3A8LB 4C92F 1X6OA 4TVRA 2E70A 3PGGA 3WVEB 3OA6A 3P8BB 1YJNA 4JLIA 4N4IA 4M7AA 4LDUA 2DXBA 3R6OA 2DD4A 2GFAA 2ZPEB 2EAYA 3NFCA 3OYFA 3OW2A 4M75E 2DKGA 3JB9G 5FRMA 1Y07A 3FC3A 3CCVA 2GCXA 3M57A 2QEXA 3LW5E 3M58A 3VU3C 5GAMg 1VQOA 1VQ5T 3J7AF 2HQXA 1H641 3V7RA 5L8RE 4A53A 3E9GA 4BE2A 3QJYA 3QZ5B 4ZN3A 1XQHA 1Q7YC 2RM4A 5GAMh 3L2VA 1X75C 3BDLA 3SD4A 1VQ4A 2ZPIB 3VUZA 4OGCA 3QSUA 2B8AA 2P0QA 3MEUA 4M75B 4OB2B 3F70A 4PLLA 3G6EA 3JB9H 4M78A 3QYGB 4XK8E 5LJ5j 5I2MA 4LDYA 4A4HA 3CCMT 4PJOE 1Y71A 4J8OA 2X4WA 4CI0C 3OW2S 3HL8A 4M7DF 2NLUA 5GANd 4N4GA 1M4ZA 1W4SA 3RMQA 3KXTA 1BI1A 3A8GB 1WNLA 3PTAA 3JCMW 2CGHA 1BYMA 3VJPA 1K9MU 1LNXA 3SDZA 2F69A 2JTFA 4FSXA 2OTLA 4IUVA 5GAOl 4II1A 4C0DC 3CCRA 4PJOB 2KQWA 2OAUA 4B9XA 5IT9E 1NJIC 3S3NA 3OY9A 3I55A 4C5GA 1IZ6A 3HKSA 4A4GA 5FU6B 5GAMd 2AHJB 2K3YA 3HRTA 3QZ9B 3RKYA 1HXDA 4J6XA 3TREA 3ER0A 2CZ1B 3CCSA 3EAEA 1YBYA 2I2LA 1UGRB 1S72A 1OYXA 2DZ9A 2VXFA 4BD3A 5GAOn 4RMOA 2JNGA 5GMKh 5LJ5f 2R58A 1YHQT 4BACA 4C8QE 4E7LA 4KUDK 4OP0A 2RJCA 2ZPHB 2EJFA 3CD6A 2WSEE 2LVMA 1OZ2A 2D9TA 3MEWA 2R5MA 2DK3A 3X20B 2RK2A 1VQ6A 2RHZA 1KG1A 4XQ3A 4B9WA 2EJGA 3H8ZA 2KMTA 1VQ7T 3G4SA 4C0ZA 4EDUA 4FT4A 3I56T 4MZMA 1I8FA 2EQKA 2X4YA 2X4JA 3L2ZA 3M9QA 3G71T 1WQ7A 1KHIA 1XTDA 3OS5A 4C8QB 1VQPT 4ZGEB 1VQLA 2KVQG 4BUGA 4IUQA 4XTUA 2KAFA 3OYKA 4F7UE 2WSFE 1R8OB 5CKDA 2A3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZTF A;  2F5K A;  2PQW A;  2QQR A;  2XK0 A;  2RHY A;  2DIQ A;  2EFI A;  2R5A A;  3UT1 A;  3OYH A;  2XDP A;  4C5I A;  2L89 A;  3MP8 A;  1G5V A;  3CEY A;  2O4X B;  4IUR A;  1SSF A;  2RI3 A;  4IUP A;  5J39 A;  3OYA A;  2R57 A;  3MP1 A;  3DLM A;  3ME9 A;  2JZ2 A;  3QII A;  4PLI A;  3OYJ A;  4NS5 A;  2CKK A;  5FRN A;  2DIG A;  2EKO A;  5KH6 A;  5IN1 A;  2VYT A;  3OYM A;  4BDZ A;  4E7H A;  3PMT A;  3KUF A;  5J26 A;  4C5E A;  2BUD A;  4OVA A;  4QQG A;  1OI1 A;  3OMG A;  3Q1J A;  5D6Y A;  3PFS A;  3OYE A;  5CIU A;  2M16 A;  3OS1 A;  3PNW C;  2RHX A;  3NTH A;  3DB4 A;  4BE1 A;  2RO0 A;  4LD6 A;  2EQM A;  2RI5 A;  4Z02 A;  3QJ6 A;  4BE0 A;  2LTO A;  2X4X A;  3GOX A;  3OS0 A;  2K3X A;  3LGL A;  4RG2 A;  2RJD A;  2X35 A;  3OA6 A;  3LGF A;  3S6W A;  2YRV A;  4N4I A;  4QW2 A;  5M9O A;  3OS2 A;  4PL6 A;  3NTI A;  3OYF A;  2GFA A;  2RJE A;  2BIV A;  3ZEH A;  1WGS A;  5FRM A;  3FC3 A;  3FLG A;  2O4X A;  3P8D A;  3L2W A;  3NTK A;  2E5Q A;  2RI2 A;  2HQX A;  3OQ5 A;  3FDR A;  4BDY A;  3E9G A;  4BE2 A;  3OYC A;  4E7I A;  2FHD A;  3E9F A;  4X34 A;  3L2V A;  3BDL A;  3SD4 A;  2EQJ A;  2B8A A;  2RJF A;  3MEU A;  3F70 A;  4PLL A;  4E7K A;  5KE3 A;  4A4H A;  5C6S A;  2X4W A;  3UWN A;  2L8D A;  4HCZ A;  2NLU A;  3MET A;  3C4S A;  2RHU A;  3QBY A;  1N27 A;  3MEA A;  4N4G A;  5KCH A;  4FL6 A;  1WJR A;  3S3M A;  4CRI A;  1KHC A;  3LLR A;  3P8H A;  3OYI A;  4IKF A;  2BKD N;  2LCC A;  2JTF A;  5KE2 A;  3H6Z A;  4IUV A;  4II1 A;  2HQE A;  4N4H A;  1H3Z A;  2WAC A;  4B9X A;  5D6W A;  3OY9 A;  3S3N A;  3MP6 A;  4Q5W A;  4C5G A;  2P0K A;  5D6X A;  5FRO A;  4A4G A;  5C0M A;  3OYB A;  3L2U A;  1RI0 A;  2K3Y A;  3QKJ A;  2DAQ A;  3OMC A;  3L2Q A;  2GFU A;  3PMI A;  3EAE A;  4A4F A;  3O8V A;  2L3R A;  1OYX A;  2M1H A;  2QQS A;  2MWP A;  3OYD A;  4BD3 A;  4A4E A;  4QVZ A;  4ZTJ A;  4E7J A;  3LH0 A;  2R58 A;  4BAC A;  4E7L A;  2MWO A;  3OB9 A;  2E6N A;  2RJC A;  3ASK A;  4C5H A;  2G3R A;  3S3O A;  2LVM A;  1OZ2 A;  2D9T A;  3MEW A;  3L2R A;  2R5M A;  2RHZ A;  3MEV A;  2M0O A;  3L42 A;  2LRQ A;  4B9W A;  1OZ3 A;  4FU6 A;  2LDM A;  3H8Z A;  3OYG A;  3DB3 A;  4IUU A;  4EDU A;  2GF7 A;  1XNI A;  3LYI A;  4UC4 A;  2EQK A;  2X4Y A;  2IG0 A;  3M9Q A;  2EQU A;  4QQD A;  4QQ6 A;  1MHN A;  4GY5 A;  3OYL A;  3OYN A;  1WJQ A;  5KCO A;  3OYK A;  5IAY A;  1WJS A;  3LX7 A;  4IUT A;  3FEO A;  4IUQ A;  4L59 A;  2RHI A;  3MO8 A; 
#chains in the Genus database with same CATH topology
 2FRY A;  4M75 F;  2KI7 A;  2GTJ A;  2XDD A;  5FU7 C;  5GAN 2;  4RKU E;  2MPX C;  3TQ7 P;  4J9C A;  4XTY A;  1V1C A;  1D0Z A;  2EYX A;  1GXI E;  3QDF A;  1QVF P;  4PJO F;  3G1J A;  3OYM A;  4OB1 B;  3D7S B;  1PWT A;  5CQY A;  2QQ9 A;  1RUW A;  1JU5 C;  1HSQ A;  3X28 B;  2KXD A;  1GFD A;  4K11 A;  1GRI A;  2G6F X;  5LJ5 d;  1WFW A;  1TS9 A;  2RQR A;  3GPL A;  1PD1 A;  3OS2 A;  1FX7 A;  4BI3 A;  1T0J A;  4OB0 B;  1KD1 C;  4M7D A;  2WSC E;  4M4Z A;  1BI2 A;  1GBR A;  3UDC A;  4LD9 K;  2OJ2 A;  5GAM f;  1UGS B;  2JTM A;  2L3S A;  2J7I A;  3CCL A;  5KE3 A;  3UPU A;  5C6S A;  1K4U S;  1WHJ A;  3CC2 A;  2E41 A;  1UGP B;  5GMK j;  5GAN 8;  3N5B B;  4D8D A;  4M75 D;  3NGP A;  4HA8 A;  1B34 A;  4F7U F;  3OYI A;  4ZGJ B;  1PSE A;  2NUT A;  2LMJ A;  3CBM A;  5C0M A;  3L2U A;  5LJ3 e;  5FU7 B;  3GNF B;  3CME T;  1QVF S;  3ZL7 C;  2CH4 A;  4PJO D;  3I55 T;  2M51 A;  2ZAE A;  4X9C A;  2PTK A;  3HRS A;  4C0F A;  1BIA A;  2F5T X;  2EBP A;  4M7A G;  2BZ8 A;  2ZPB B;  1E6G A;  1IRX A;  1K9M C;  1K0S A;  3CCM Q;  1VQ9 A;  3M0R A;  1WDX A;  4PJN A;  1MHN A;  4IIO A;  4M77 C;  3A8M B;  2FYK A;  1VQK T;  4L59 A;  2LP5 A;  1AWW A;  3CCE T;  2EYW A;  1VQ8 T;  2R5A A;  1KQ1 A;  2L89 A;  1G5V A;  2ECZ A;  2O4X B;  3QWX X;  1VQ5 A;  3HP9 A;  2GNC A;  4NL2 A;  2R57 A;  2M9U A;  2F2X A;  2EKO A;  3VS6 A;  2YUN A;  5GAO r;  1YHQ Q;  1Q86 U;  4R56 A;  4RG8 A;  4LD6 A;  4LDX A;  2V8I A;  1TH7 A;  2CP6 A;  1YJW Q;  1M3B A;  1TTH B;  3OS0 A;  4C8Q A;  2EGC A;  4QW2 A;  2DLP A;  2X51 A;  3PVQ A;  3HSB A;  3AT1 B;  3VS0 A;  4F17 A;  4ZN1 A;  5DLQ E;  1TSF A;  2BZX A;  3EGX B;  3E9F A;  1W70 A;  2H8H A;  4X34 A;  2DTH A;  1VA7 A;  1KK7 A;  1M90 U;  4ELZ C;  1AEY A;  2CZ0 B;  1KQS A;  4MZT A;  1WI7 A;  2Y90 A;  3VS5 A;  1BB9 A;  1YWP A;  3M0S A;  4KUL A;  1NJI R;  3BY7 A;  3EG9 B;  2VVK A;  2FG0 A;  3CQT A;  1HYO A;  2ENM A;  4FYX B;  1I4K 1;  1RAA B;  1YJN T;  5HK0 A;  3MP6 A;  4LE9 A;  2JS0 A;  4AG2 C;  1Z9Z A;  3TEE A;  2LJ3 A;  1NLP C;  5FLX E;  2RQU A;  3CCV T;  3C0C A;  2RH2 A;  2MWP A;  1AWO A;  1ZHI A;  4L5G A;  4QVZ A;  2XIC A;  1I5L A;  3OB9 A;  5HKC A;  2P0P A;  5GAN 5;  3HHT B;  1MUZ A;  4C0G A;  1CSK A;  2YRD A;  2E65 A;  4E47 A;  2EQU A;  2ROT A;  4QQ6 A;  1AZE A;  2OI3 A;  1D3B A;  2EVR A;  2EIF A;  5KCO A;  4HT8 A;  2QYZ A;  3FEO A;  5LJ3 d;  3NMZ C;  4M78 D;  1QWF A;  5GAO m;  2YWW A;  1D1C A;  4CC3 A;  3OYA A;  1W2B A;  4XTV A;  3TVT A;  1AD5 A;  2HBW A;  4LN2 A;  4C92 C;  3I9Q A;  5A0D A;  2AKK A;  5CVI A;  4FM4 B;  2HL3 A;  4D8K A;  2EYZ A;  1YFN A;  3PNW C;  3V8J A;  1JBM A;  5AT1 B;  2DER A;  4DBR A;  1QKW A;  4GBQ A;  3QPH A;  3LGF A;  1KD1 R;  1M5Q 1;  4J5Y A;  1BU1 A;  3CME A;  3J80 E;  1UDL A;  1K1Z A;  5EC7 A;  1AZG B;  2CT3 A;  2DX1 A;  2FZK B;  4M7A F;  2YUQ A;  3BW1 A;  1IXD A;  5KYX B;  2K2V A;  1PCX A;  2X9H A;  2DXT A;  2KT1 A;  3QBY A;  3G71 Q;  1ARK A;  1EX4 A;  1VQK A;  1H92 A;  3CCE A;  2WAC A;  2A7Y A;  2E3I A;  3RNJ A;  1VQ8 A;  4C92 E;  2CZ7 B;  1SSH A;  3GBQ A;  2A37 A;  8AT1 B;  5LJ5 g;  1N9R A;  4OMQ A;  3REA B;  5DLO A;  5CO7 A;  1PRM C;  2PU9 B;  2EWN A;  4C92 B;  1K9M R;  4C8Q G;  1OX8 A;  2DRM A;  3UAT A;  1UEC A;  2MWO A;  3EGD A;  3ASK A;  3S3O A;  3RES A;  3PIO A;  4JPB W;  2D8H A;  1NG2 A;  4DOW A;  1K0X A;  4OML A;  2LDM A;  2CSQ A;  3LYI A;  1MV3 A;  4FT2 A;  3HPW A;  4GY5 A;  1KQS S;  2FO0 A;  4PJO C;  3EFS A;  1Y96 B;  1KFZ A;  2ED1 A;  2QA4 A;  1MND A;  1PD0 A;  1X6B A;  4M7A D;  5GMK l;  1Y7X A;  5GAN f;  3DLM A;  1VQO Q;  5FRN A;  4EMK A;  3KUF A;  3PFS A;  3OS1 A;  3A5Z B;  4BE1 A;  4DQ2 A;  2FPF A;  3EFO A;  2DIL A;  1U1T A;  1IRE B;  1RAC B;  2DF6 A;  3A8L B;  1YJN A;  2A36 A;  4N4I A;  2DXB A;  8ATC B;  2CP5 A;  3OYF A;  3OW2 A;  4RTT A;  1EFN A;  4M75 E;  2KR3 A;  3JB9 G;  3I55 Q;  3FC3 A;  3CCV A;  1M2V A;  2HQX A;  1SHF A;  2QTV A;  1XQH A;  1Q7Y C;  5IXB A;  3L2V A;  1X75 C;  3BDL A;  3CCS Q;  4OGC A;  2B8A A;  3MEU A;  4M75 B;  4OB2 B;  3JB9 H;  2VWF A;  4M78 A;  3QYG B;  2LJ1 A;  5LJ5 j;  4PJO E;  3CCM T;  4M7D F;  1W4S A;  1BI1 A;  3PTA A;  3VJP A;  2J6K A;  1LNX A;  3G4S Q;  4IUV A;  5GAO l;  4PJO B;  4C0D C;  2C0T A;  2KQW A;  3OY9 A;  4A4G A;  4PK4 A;  2CZ1 B;  4Z88 A;  3EAE A;  1YBY A;  4HVU A;  2VXF A;  3RBB B;  2JNG A;  5GMK h;  1YHQ T;  2QK0 A;  4E2F B;  3MEW A;  4J9H A;  1EZZ B;  2DK3 A;  2SEM A;  1KG1 A;  1RAH B;  4B9W A;  2EJG A;  1M8M A;  3I56 T;  2X4J A;  3BE3 A;  1XTD A;  5IH2 A;  2KVQ G;  4LUE A;  4AFQ C;  4BUG A;  2EPD A;  3HTR A;  5HCK A;  1R8O B;  4F7U E;  1B07 A;  1WZO A;  2AKL A;  2XK0 A;  4C5I A;  4J7I A;  5AYF A;  1R77 A;  3JCM g;  4F7U B;  3MP1 A;  1QVP A;  1GCQ A;  1R0B G;  5KH6 A;  1OI1 A;  2K3B A;  2LCL A;  2RHX A;  1PC0 A;  5CR2 A;  3HFO A;  1TU0 B;  1M1K U;  3H0I A;  1C6V X;  2HNI A;  4C0D B;  2KDS A;  2KRM A;  3CC7 T;  1RAF B;  3CCJ Q;  3JSC A;  1ZSZ A;  3CXC P;  1PHT A;  3OQ5 A;  2GQV A;  4C8Q F;  5LJ3 g;  1MMN A;  2DVE A;  1XOV A;  3M56 A;  2EQJ A;  3M0U A;  2QEX T;  1QP3 A;  5KYY B;  3EG3 A;  1NZ9 A;  1V76 A;  2LZ6 B;  4P5N A;  2RQT A;  2KSS A;  4OMO A;  1QVF A;  1OUL A;  2QGG A;  4AT1 B;  1UE9 A;  2C0I A;  4ZNX A;  2HDA A;  2KBT A;  1VUB A;  2A28 A;  4CC2 A;  1TUG B;  1RI0 A;  1VOM A;  2OTL T;  4AFZ C;  3V8L A;  4O5V A;  2JOY A;  1I07 A;  2O01 E;  3GP8 A;  5GAO p;  1NEG A;  1ZA2 B;  2DYI A;  1VYT A;  3CD6 T;  4WTO B;  3JAM E;  1X01 A;  3OYL A;  2PNI A;  1D0X A;  4PJL A;  3OYK A;  1WJS A;  3MEA A;  3SWN C;  3MO8 A;  1ABQ A;  2J6F A;  2CS7 A;  4M78 G;  3UT1 A;  2K5F A;  1T0H A;  2XDP A;  3A1P A;  3MPU B;  3RKW A;  4C8Q D;  2K6D A;  3SFM A;  4FW2 A;  4RCB A;  3THK A;  4FCY A;  4BDZ A;  2VYT A;  3PMT A;  4R55 A;  3CCM A;  4N0A C;  5A2Q E;  2JM9 A;  4XU1 A;  3FB9 A;  4JS5 A;  2P4T A;  1UHC A;  1MMG A;  3HRU A;  5LJ3 j;  3CCU T;  4D6W A;  1I1J A;  2MF2 A;  3VS2 A;  2A0F B;  1Q7Y R;  4NL3 A;  5CKF A;  1QCO A;  2JT4 A;  2KYB A;  3NTK A;  4KH0 B;  2BE7 D;  1TUC A;  3OYC A;  2F2V A;  3E1S A;  3FJP A;  1YHQ A;  4WF2 A;  4JUV A;  1YJW A;  2DNU A;  2ED0 A;  2MCN A;  4XU0 A;  1ZUK A;  4FL6 A;  1WJR A;  2AK5 A;  3PT9 A;  3JB9 D;  3SWN B;  2RMO A;  5HY6 A;  3OSS C;  4M77 A;  3M55 A;  3UA6 A;  3J81 E;  4XTW A;  4A4F A;  1VQO T;  2DMO A;  4VUB A;  3RKX A;  3OYD A;  2SRC A;  1WQW A;  4ZTJ A;  2CSI A;  1JRI A;  1NM7 A;  1WHK A;  4M7A E;  1AHJ B;  2Z0W A;  4J9B A;  4UC4 A;  5DM7 R;  4JJD A;  3JB9 J;  2NUP B;  3SB2 A;  4M7A B;  2Y4Y A;  1OU8 A;  3A8H B;  2XMF A;  1AOJ A;  5GAN 3;  5IHI A;  3MP8 A;  3EFR A;  3CEY A;  1X2K A;  1X69 A;  3CCS T;  2YRC A;  2COZ A;  3EH2 A;  1JQQ A;  4PJJ A;  4AFU C;  2KRN A;  3EGU A;  4C5E A;  2H3E B;  1C1A A;  3KFV A;  2RQW A;  3JCM P;  3BDU A;  1SRL A;  3G4S T;  5GAN e;  2ROL A;  1O9S A;  2X4X A;  2MIO A;  1M1F A;  1ZQ1 A;  1V29 B;  2CT4 A;  5CK9 A;  3JCM Q;  4Z8A A;  3C94 A;  2RJE A;  2RNA A;  2V8K A;  3M53 A;  5I22 A;  4JJN K;  3L2W A;  1NJI U;  4M7D C;  4BDY A;  3TCJ A;  2K9G A;  3SHW A;  1QMC A;  1YIT Q;  3GIB A;  2ESW A;  1NYG A;  1FMK A;  2KYM A;  4RUG A;  4ORZ A;  3NHN A;  1MV0 B;  3I56 Q;  4HCZ A;  1QKX A;  2JXB A;  2JVV A;  2DJQ A;  1Q95 G;  4LDW A;  2CRE A;  5KYX A;  1KHC A;  2BKD N;  2DZC A;  2HQE A;  1VYU A;  3E19 A;  5L23 A;  2P0K A;  4M78 F;  4PFZ A;  1NPR A;  3V7S A;  4FSS A;  1FMV A;  4BI8 B;  5GMK e;  5LJ5 h;  2E4H A;  2VAS A;  3INZ A;  4A4E A;  2XU8 A;  2K5I A;  3G71 A;  1NEB A;  2JJ9 A;  3MEV A;  5EG2 A;  1M2O A;  3DB3 A;  1WYX A;  4M7D E;  3M5A A;  2DXC A;  3CC7 Q;  3CCJ T;  4ZTF A;  2F5K A;  1YI2 Q;  1D1A A;  2DIQ A;  3OYH A;  1K73 C;  1UJY A;  1B3Q A;  4M7D B;  3IQL A;  4KT0 E;  2FPE A;  2PVD B;  1NE8 A;  2CUB A;  2OAW A;  1Z9Q A;  4PLI A;  3EG1 A;  2QEX Q;  2KY9 A;  1KD1 U;  2LCS A;  1SHG A;  2HEQ A;  1VQ4 Q;  4J83 A;  2RF0 A;  4M77 G;  2KEA A;  2YT6 A;  4OMF B;  1O75 A;  3RDV A;  4Y92 A;  4B6M A;  3OSV A;  1B34 B;  3JCM b;  1K8A C;  2DPP B;  2RB6 A;  2KRO A;  2E70 A;  1SKU B;  2NUT B;  3P8B B;  2OTL Q;  2GFA A;  2DKG A;  1Y07 A;  3M57 A;  1VQO A;  3J7A F;  3M58 A;  3VU3 C;  5GAM g;  1G2B A;  3E9G A;  3QJY A;  4ZN3 A;  2LNH B;  2RM4 A;  2DL4 A;  1S72 Q;  4HVV A;  4XK8 E;  5I2M A;  4A4H A;  1MMD A;  2C0O A;  4RTU A;  3CD6 Q;  5GAN d;  1OPK A;  3KXT A;  1VQ6 Q;  3RR6 A;  3JCM W;  4AFS C;  1UGV A;  2EYY A;  1BYM A;  1K9M U;  3SDZ A;  2J6O A;  4FYV B;  1W6X A;  3I55 A;  4C5G A;  2AT1 B;  5FU6 B;  5IHK A;  2L3P A;  4RTZ A;  2K3Y A;  3HRT A;  3EHQ A;  2GBQ A;  3M0Q A;  3QZ9 B;  1YIJ Q;  3CCS A;  1OYX A;  7AT1 B;  1OV3 A;  2DZ9 A;  5GAO n;  4RMO A;  2BE9 B;  4C8Q E;  1PNJ A;  3A98 A;  2ZPH B;  2EJF A;  1RI9 A;  2WSE E;  2D9T A;  1PM3 A;  1YN8 A;  4XQ3 A;  3CCU Q;  3U23 A;  1VQN Q;  3G4S A;  4C0Z A;  4EDU A;  4FT4 A;  3L2Z A;  5KYU A;  1WQ7 A;  3VRY A;  4C8Q B;  2OX7 A;  1RAG B;  4IUQ A;  1KIK A;  1SG5 A;  5CKD A;  2PVO B;  2LC4 A;  3CMA T;  1DJ7 B;  4IUR A;  4RCC A;  4M75 C;  1YP5 A;  4HCB A;  5I21 A;  3JCM h;  2P4R A;  1G3S A;  1SEM A;  3PVL A;  2FB7 A;  2RD1 A;  3CC4 Q;  4MML A;  2JW4 A;  4QT7 A;  1BCM A;  1KC8 C;  5CIU A;  5GAM j;  1X27 A;  3TSW A;  1AWJ A;  1YJ9 T;  4E7S A;  1U8R A;  1QVG A;  2XKO C;  4F14 A;  3GOX A;  2DRK A;  1LCK A;  2YRV A;  1M1G A;  1U06 A;  2E64 A;  3NTI A;  4OMM A;  2F2W A;  2D0Q B;  2IPO B;  4RTY A;  2BIV A;  3JRZ A;  5FWC A;  4JDS A;  3LWH A;  1QW1 A;  1WIE A;  1SPK A;  1XJW B;  2DJZ A;  2OTJ Q;  5KYW A;  2HD0 A;  2E5K A;  1ZX6 A;  5LJ3 h;  1QQJ A;  1K73 U;  1UG1 A;  4J7F A;  3UWN A;  2JTE A;  1G3T A;  2DTI A;  5KCH A;  3G6E T;  2FZG B;  2RQV A;  1D3B B;  3P8H A;  1BCO A;  3CCJ A;  4ME7 A;  3RMS A;  2EGE A;  2HL5 C;  1R0C B;  4ANJ A;  4PKC C;  1T3S A;  3CBP A;  4F16 A;  3G7Z A;  3L2Q A;  2L3R A;  3R6N A;  1HJD A;  2DD5 A;  5HK3 A;  2MI6 A;  1N6A A;  2QQB A;  3CXC A;  5CKE A;  4E7J A;  2V1Q A;  5GAN 7;  4M77 F;  4KGX B;  2HQH A;  2LT4 A;  1OZ3 A;  3OYG A;  4IUU A;  1TXQ A;  2F1L A;  1IHW A;  1XNI A;  2IG0 A;  3I35 A;  1D1B A;  4KUI A;  2P84 A;  1K73 R;  1WJQ A;  1X43 A;  5IAY A;  3LX7 A;  1I81 A;  4IUT A;  2MOX A;  1IGQ A;  3VKI A;  4QKU A;  4EPC A;  3JB9 I;  1YIT T;  4IUP A;  2DXU A;  4EMH A;  2VKN A;  3A8O B;  1QVG P;  2HSE B;  3FIF A;  4RTW A;  4OVA A;  2NUZ A;  1RL2 A;  1K8A R;  4J9E A;  3TU4 K;  2M16 A;  1ZSG A;  1I5O B;  1YWO A;  1BBZ A;  2MYS A;  2LQN A;  1N5Z A;  1VQ7 Q;  3LGL A;  1S1N A;  2E3H A;  2O2O A;  5CCA A;  2JMA A;  1VQP Q;  2YLB A;  3ZBD A;  4KBM B;  2YHT A;  2QTX A;  1IGU A;  4V2S A;  2RI2 A;  3JCM J;  2JUF A;  2LQK A;  3CPW P;  1JJ2 P;  2DL8 A;  4M77 D;  5GJW B;  1JB0 E;  3VS3 A;  3EGD B;  4CC4 B;  3O5Z A;  2QAS A;  4M78 C;  1JEG A;  2Y4X A;  5GAN 6;  1Q81 C;  1RLQ C;  1UGQ B;  2KK4 A;  1AVZ C;  3CC2 T;  1YI2 T;  4MDX A;  2K79 A;  4JRI A;  1H3Z A;  2W0Z A;  3VS4 A;  1VIF A;  1VQM Q;  1N8R C;  4Q5W A;  1KC8 U;  2PUO B;  3OYB A;  4A4K A;  4F7U G;  1QVG S;  1P92 A;  3VS7 A;  1AWX A;  2W10 A;  2JN0 A;  2EGA A;  4F04 B;  2DEU A;  1VQ4 T;  3LH0 A;  3C12 A;  4EMK B;  4LXC A;  2EYQ A;  1PKT A;  2LRQ A;  2ZCF B;  3M0P A;  3CCQ Q;  3EFO B;  3QYH B;  4N0A A;  1E6H A;  2O9S A;  3OYN A;  2DYB A;  3HFN A;  2PQW A;  1JJ2 S;  3CPW S;  5GAN g;  1M9S A;  2D1X A;  4M78 E;  1UFF A;  1M2V B;  2QAZ A;  1EIF A;  2KE9 A;  1S72 T;  1KC8 R;  3ME9 A;  2GTO A;  3CBO A;  1GCQ C;  4JZ4 A;  4MMK A;  5CKB A;  5IN1 A;  1U3O A;  2ZPF B;  4M78 B;  2QDL A;  4PJM A;  1Q7Y U;  3OMG A;  4XAX B;  4EMG A;  2VXE A;  1UJ0 A;  2E1H A;  1VQ6 T;  2PZ1 A;  3NTH A;  4DBQ A;  1D09 B;  1GFC A;  2HCK A;  3CXC S;  4JRP A;  2RJD A;  3JB9 F;  2X35 A;  5LL6 S;  4A63 B;  3S6W A;  1YIJ T;  4MDW A;  5M9O A;  4PL6 A;  4ELY C;  4HCK A;  1FXX A;  2E10 A;  3ZFJ A;  2O4X A;  1ZSZ C;  1WLP B;  2KXC A;  3X26 B;  4X1V A;  1WPY A;  2EKH A;  1Q86 C;  2RK1 A;  1NBE B;  1PKS A;  3EG2 A;  1UB4 A;  3X24 B;  1GBQ A;  5CQX A;  1BI3 A;  4OMP A;  3UF4 A;  2D6F A;  2BZY A;  1VQN T;  4KGZ B;  2X3X D;  3MET A;  3GF5 A;  4M7A C;  1AT1 B;  2L5Q A;  2DFU A;  2XHC A;  4CRI A;  2VC8 A;  4HVW A;  2EW3 A;  4C92 D;  2XD0 A;  1PSF A;  4DEX A;  5D6W A;  4BI4 A;  5FRO A;  2DL3 A;  1TWB A;  1BK2 A;  4J6Y A;  3QKJ A;  3CMA Q;  4KGV B;  1TUD A;  2BTT A;  4JJB A;  1YIT A;  3PMI A;  1TG0 A;  1G8X A;  1M90 C;  3O8V A;  1JO8 A;  3URG A;  3CC4 T;  2QDY B;  3EGX A;  4FYY B;  1NPP A;  2A08 A;  3EH1 A;  4HXJ A;  5GAN j;  3I56 A;  2XDB A;  2FRW A;  1YJ9 Q;  1N9S A;  1QLY A;  1M3C A;  2ABL A;  3EG9 A;  3AHU A;  2LX7 A;  2L2P A;  3QJ6 A;  2PUK B;  2RHY A;  1Q81 U;  1Q82 C;  1E7O A;  2RA2 A;  3JCM e;  1ZA1 B;  1ZSZ B;  2RI3 A;  2OTJ T;  3DLL A;  3QII A;  2CP3 A;  2V26 A;  4ATO A;  1N8R U;  2VUB A;  2CYZ B;  5J26 A;  2BUD A;  1M27 C;  3WXM B;  3G6E Q;  1BIB A;  2M02 A;  2RO0 A;  5KYN A;  2QQA A;  4Z02 A;  4JLG A;  3RER A;  2LTO A;  3CC7 A;  4RG2 A;  5J3B A;  1KSW A;  1YI2 A;  1LPL A;  2COW A;  1X6O A;  2D8J A;  3OA6 A;  3WVE B;  1PG5 B;  2DD4 A;  2ZPE B;  3CCR Q;  1YNZ A;  5FRM A;  2GCX A;  2QEX A;  2O88 A;  1M3A A;  3M0T A;  3V7R A;  4A53 A;  5GAM h;  3SD4 A;  1VQ4 A;  2ZPI B;  1Q81 R;  4DBH A;  3QSU A;  2L0A A;  2P0Q A;  1VYV A;  4PLL A;  4LDY A;  3I5R A;  4J8O A;  4CI0 C;  4N4G A;  3RMQ A;  1N8R R;  2CGH A;  1I0C A;  2OTL A;  3VS1 A;  2OAU A;  4FYW B;  5IT9 E;  1VQL Q;  3HKS A;  2O9V A;  3RKY A;  3TRE A;  4J9D A;  3ER0 A;  1RAI B;  2KRS A;  1UGR B;  4AG1 C;  1S72 A;  2JM8 A;  3H41 A;  5LJ5 f;  4BAC A;  3CD6 A;  4OP0 A;  4RTX A;  4J9G A;  2R5M A;  3X20 B;  1VQ6 A;  2RHZ A;  1SF9 A;  1ACM B;  4ESR A;  4E7Z A;  1LVK A;  2KMT A;  1VQ7 T;  1WHM A;  4CC7 A;  4MZM A;  1VQP T;  4ZGE B;  1H3H A;  1K9A A;  1J3T A;  1YIJ A;  1QWE A;  4HKE A;  2H3J A;  2IIM A;  2K4Y A;  2IVW A;  2DE0 X;  1SSF A;  1MMA A;  2QA4 T;  2JZ2 A;  4EIK A;  4C92 A;  3VYG A;  1OOT A;  3CCU A;  2ZPG B;  4QQG A;  1VQN A;  4O6J A;  3Q1J A;  2NYS A;  4L6V 5;  3SEM A;  3CCL Q;  3DB4 A;  3V8K A;  3E2U A;  4M77 E;  5GMK m;  3BFM A;  3CC2 Q;  1WA7 A;  1VQM T;  5FU6 C;  3VRZ A;  1HD3 A;  2E6Z A;  2KT8 A;  1M30 A;  1Y96 A;  3OYY A;  2FZC B;  4M77 B;  3JCM d;  4DOV A;  1Q86 R;  4XTZ A;  1B7T A;  1MNE A;  2LNV A;  2X3W D;  4KH1 B;  1ZUY A;  3QHS A;  1KQ2 A;  3CC4 A;  3FDR A;  3L1A A;  2K7A A;  1RAB B;  4LUD A;  2JS2 A;  2O31 A;  1Q82 U;  5CAI A;  3CCQ T;  4C8Q C;  2L8D A;  2AZS A;  3C4S A;  1WXU A;  2RHU A;  4PFP A;  3QO3 A;  2JMC A;  5IXF A;  3S3M A;  1MGQ A;  4JRK A;  4GLK A;  2DL7 A;  1YCY A;  3RIR A;  2ZGW A;  1VQ9 Q;  2V8J A;  4M7D G;  4DBF A;  2PVG B;  1M90 R;  2HAX A;  2V1R A;  2VGN A;  3EG0 A;  2DBK A;  2OTJ A;  1FWZ A;  3T9N A;  2LQ8 A;  3FRN A;  1VQ5 Q;  3MJX A;  2CZ6 B;  1CKB A;  4M75 A;  2G3R A;  3VUB A;  1VIE A;  2CP7 A;  1UUE A;  2MAM A;  2VV5 A;  2XID A;  2HSP A;  1A0N B;  2K57 A;  3V7C A;  4FU6 A;  2YXY A;  3TSZ A;  1Q82 R;  5FWB A;  1G83 A;  1C0M A;  1RLP C;  4YTL A;  4PJO A;  4QVD A;  4NOY A;  2QI2 A;  2KNB B;  5D7U A;  4DA4 A;  3CPF A;  3NPF A;  1CKA A;  1F1B B;  3GNG A;  3OYJ A;  4FW1 A;  2QGF B;  1KQS P;  2AIR B;  1FYN A;  2DIG A;  1WX6 A;  3JCM V;  2EQI A;  3JCM f;  5D6Y A;  1RAD B;  3OYE A;  3QG1 A;  2RI5 A;  3OBY A;  3PE0 A;  5IHN A;  3WVD B;  1QP2 A;  2MK5 A;  1IO6 A;  4PFO A;  3QDR B;  5ECA A;  2DM1 A;  2MMP A;  1RAE B;  4PNO A;  4Y91 A;  3C95 A;  1JXO A;  1H8K A;  2AZV A;  3P8D A;  2E5Q A;  1W1F A;  2VB6 A;  4F7U A;  2YUO A;  1UEB A;  2K5L A;  5I11 A;  2RJF A;  4MZP A;  4BY6 C;  3LWI A;  4JS4 A;  2RPN A;  2FEI A;  2C06 A;  5LJ3 f;  4ZGD B;  3RUX A;  1M1K C;  1VQ7 A;  4OMN A;  3GLX A;  1N27 A;  1NLO C;  1VQP A;  2QG9 B;  2E12 A;  3LLR A;  5KE2 A;  4N4H A;  4X9D A;  4C92 G;  4BB7 A;  2DL5 A;  5D6X A;  2LQW A;  1W2B P;  2NWM A;  2CH4 W;  3OMC A;  4LNP A;  5DY9 A;  2GFU A;  2DEQ A;  2K2M A;  1TOV A;  2GGR A;  3MCA B;  5A0L A;  2XI9 A;  2HBP A;  3MHX A;  4C5H A;  1JJ2 A;  3CPW A;  5KYY A;  5GAN 4;  1ZBX A;  3JV3 A;  2EJ9 A;  1G3W A;  3PIP A;  2QXF A;  3L42 A;  4J6W A;  1ZBJ A;  4QQD A;  1VQM A;  3H0F A;  3CCR T;  2QQR A;  3H0H A;  1K8A U;  1BKB A;  1LJO A;  3M54 A;  5GAN h;  3CME Q;  2LX9 A;  1IHV A;  2DBM A;  3QUI A;  4OF1 A;  4XU3 A;  1LOJ A;  1ZUU A;  4XU2 A;  3EHR A;  3JCM X;  4NS5 A;  4E7H A;  4BY6 B;  1WXT A;  3X25 B;  1U1S A;  1IB8 A;  3CCQ A;  1KJW A;  9ATC B;  1OX9 A;  4OGE A;  2EQM A;  5A0G A;  4BE0 A;  2K3X A;  1W2B S;  1VQL T;  1UTI A;  3I5S A;  3LH5 A;  1VQK Q;  2LT1 A;  4M75 G;  2L3Q A;  2DA9 A;  3CCE Q;  1JXM A;  1VQ8 Q;  5GAM e;  1WGS A;  3H9N A;  3FLG A;  5CKH A;  2DVJ A;  2B86 A;  4EMK C;  4E7I A;  2FHD A;  4XTX A;  3M59 A;  1G3Y A;  4PJO G;  2VGM A;  3KBG A;  2KGT A;  4OB3 B;  4E7K A;  2ZZD A;  3M4G A;  1BI0 A;  5KYU B;  5GAO q;  1YJW T;  4IKF A;  2LCC A;  1Y57 A;  3H6Z A;  1QCF A;  1WXB A;  4LDV A;  5I2S A;  4RTV A;  3VV0 A;  2DTO A;  1YCS B;  5FW9 A;  2DAQ A;  1M8V A;  4A54 A;  2QA4 Q;  2XG8 D;  2CUD A;  2FL7 A;  4Y28 E;  2M1H A;  2QQS A;  4HT9 A;  3DKM A;  1WHH A;  3M4Y A;  4J9I A;  1Y0M A;  2E6N A;  2HZY A;  3CCL T;  3L2R A;  2CDT A;  2M0O A;  3JCM c;  4M7D D;  1ZLM A;  2GF7 A;  4FIB A;  1GCP A;  3QWY A;  3QXE B;  5LJ5 e;  3OW2 P;  1WHG A;  1OPL A;  3ZEH A;  2RHI A;  3CMA A;  3SWN A;  4JJC A;  4DEY A;  4KRT A;  2EFI A;  5GJV B;  4HCC A;  1YJN Q;  2RN8 A;  1HK9 A;  2ATC B;  2DO3 A;  4QVC A;  3REB B;  5J39 A;  5KYW B;  2YDL A;  3CCV Q;  2CKK A;  4WCI A;  1YJ9 A;  4GLM A;  4R0K A;  2YLC A;  1OQK A;  3OBW A;  2FPD A;  2FVU A;  4JRQ A;  3VYH B;  1OU9 A;  1VQ9 T;  5GMK i;  2NUP A;  4IIM A;  4C92 F;  4JZ3 A;  4TVR A;  3PGG A;  2J05 A;  2LJ0 A;  4JLI A;  4M7A A;  4LDU A;  4E6R A;  3R6O A;  3NFC A;  2EAY A;  1WHL A;  2J06 A;  1OEB A;  3LW5 E;  1VQ5 T;  1H64 1;  5L8R E;  4BE2 A;  3FJ5 A;  3QZ5 B;  2COY A;  1M1K R;  1X6G A;  4Z89 A;  2CP2 A;  3VUZ A;  1PRL C;  3ULR B;  3F70 A;  3G6E A;  1D0Y A;  1Y71 A;  2X4W A;  2D0N A;  3OW2 S;  1ABO A;  2DET A;  2I0N A;  3HL8 A;  4AMC A;  2NLU A;  3UA7 A;  1M4Z A;  1FMW A;  3A8G B;  1WNL A;  4J9F A;  2F69 A;  2JTF A;  4FSX A;  6AT1 B;  4II1 A;  3CCR A;  2M0Y A;  2CP0 A;  4B9X A;  1NJI C;  3S3N A;  1IZ6 A;  5GAM d;  2AHJ B;  1HXD A;  4J6X A;  1T3L A;  1K76 A;  2I2L A;  3MKD A;  1NYF A;  1X2Q A;  1U5S A;  4BD3 A;  2R58 A;  4KUD K;  4E7L A;  1QCN A;  2RJC A;  2HMA A;  2LVM A;  1OZ2 A;  2YSQ A;  2RK2 A;  2YUP A;  1UHF A;  3H8Z A;  1I8F A;  2EQK A;  2X4Y A;  3M9Q A;  3G71 T;  3OS5 A;  1KHI A;  1VQL A;  2HKN A;  1GL5 A;  2GQI A;  1SRM A;  4XTU A;  2KAF A;  2HKQ B;  2WSF E;  2A3L A; 
#chains in the Genus database with same CATH homology
 4M75 F;  4HKE A;  2XDD A;  2XK0 A;  2H3J A;  2PVO B;  2K4Y A;  2LC4 A;  5FU7 C;  4C5I A;  5GAN 2;  4RKU E;  4J7I A;  5AYF A;  2IVW A;  3CMA T;  1DJ7 B;  1SSF A;  4IUR A;  4RCC A;  4XTY A;  3JCM g;  2QA4 T;  4M75 C;  4F7U B;  4HCB A;  3MP1 A;  5I21 A;  1QVP A;  2JZ2 A;  3JCM h;  1G3S A;  1GXI E;  2FB7 A;  4C92 A;  2RD1 A;  4PJO F;  4MML A;  3VYG A;  5KH6 A;  3OYM A;  3CCU A;  4OB1 B;  2ZPG B;  4QQG A;  1VQN A;  4O6J A;  1OI1 A;  3Q1J A;  1KC8 C;  2LCL A;  5CQY A;  2QQ9 A;  5CIU A;  5GAM j;  4L6V 5;  2RHX A;  3X28 B;  3DB4 A;  1YJ9 T;  3V8K A;  4M77 E;  5GMK m;  1U8R A;  5CR2 A;  1QVG A;  3HFO A;  5LJ5 d;  3BFM A;  2XKO C;  3GOX A;  1M1K U;  1VQM T;  5FU6 C;  2HNI A;  4C0D B;  2E6Z A;  2KDS A;  2YRV A;  1M1G A;  3GPL A;  1Y96 A;  2E64 A;  3OYY A;  3NTI A;  3OS2 A;  1FX7 A;  3CC7 T;  4BI3 A;  2D0Q B;  4M77 B;  3JCM d;  2BIV A;  3JRZ A;  4DOV A;  4JDS A;  4OB0 B;  4XTZ A;  3LWH A;  1QW1 A;  2LNV A;  1KD1 C;  4M7D A;  2WSC E;  3JSC A;  3QHS A;  1KQ2 A;  3CC4 A;  1BI2 A;  3FDR A;  3L1A A;  3OQ5 A;  2GQV A;  2DJZ A;  4C8Q F;  3UDC A;  5LJ3 g;  2DVE A;  4LD9 K;  1XOV A;  3M56 A;  2HD0 A;  2EQJ A;  2QEX T;  5LJ3 h;  1QP3 A;  5GAM f;  1UGS B;  2JTM A;  1NZ9 A;  3CCL A;  4P5N A;  5KE3 A;  1K73 U;  1Q82 U;  3UPU A;  5C6S A;  4J7F A;  2KSS A;  1QVF A;  5CAI A;  3UWN A;  4C8Q C;  3CCQ T;  3CC2 A;  1G3T A;  2E41 A;  2L8D A;  2DTI A;  1UGP B;  3C4S A;  2RHU A;  5GMK j;  5GAN 8;  5KCH A;  3G6E T;  3N5B B;  3QO3 A;  4M75 D;  3S3M A;  4HA8 A;  1D3B B;  1B34 A;  1MGQ A;  3P8H A;  4JRK A;  4F7U F;  3OYI A;  4GLK A;  4ZGJ B;  3RIR A;  1YCY A;  2ZGW A;  1PSE A;  2V8J A;  3CCJ A;  4M7D G;  1VUB A;  2PVG B;  4ME7 A;  3RMS A;  2HAX A;  3CBM A;  5C0M A;  3L2U A;  1RI0 A;  4PKC C;  5FU7 B;  5LJ3 e;  3CBP A;  3GNF B;  2OTL T;  3CME T;  2VGN A;  3G7Z A;  1QVF S;  1FWZ A;  3L2Q A;  3V8L A;  2OTJ A;  4O5V A;  3T9N A;  4PJO D;  3I55 T;  2LQ8 A;  4X9C A;  2L3R A;  2JOY A;  2DD5 A;  3FRN A;  2O01 E;  5HK3 A;  3GP8 A;  3HRS A;  2MI6 A;  4C0F A;  5GAO p;  1N6A A;  1BIA A;  2QQB A;  2F5T X;  3CXC A;  5CKE A;  4E7J A;  2CZ6 B;  1YIJ A;  4M75 A;  2G3R A;  4M7A G;  3VUB A;  1VIE A;  2MAM A;  2VV5 A;  2XID A;  2ZPB B;  5GAN 7;  4M77 F;  1K9M C;  2K57 A;  2LT4 A;  3V7C A;  1OZ3 A;  4FU6 A;  3OYG A;  3CD6 T;  4IUU A;  1XNI A;  1VQ9 A;  2IG0 A;  3JAM E;  1X01 A;  1MHN A;  3OYL A;  4KUI A;  1WJQ A;  3A8M B;  2FYK A;  4M77 C;  1WJS A;  3LX7 A;  1I81 A;  4IUT A;  4L59 A;  4YTL A;  3MEA A;  5IAY A;  4QVD A;  3SWN C;  3MO8 A;  4PJO A;  3CCE T;  1VQ8 T;  4NOY A;  2CS7 A;  2QI2 A;  2R5A A;  4M78 G;  3UT1 A;  3VKI A;  1KQ1 A;  2K5F A;  2XDP A;  3RKW A;  4C8Q D;  2L89 A;  1G5V A;  2O4X B;  4EPC A;  1VQ5 A;  4DA4 A;  3CPF A;  3HP9 A;  4NL2 A;  3JB9 I;  1YIT T;  4IUP A;  2DXU A;  3SFM A;  4RCB A;  4EMH A;  2R57 A;  2M9U A;  3GNG A;  3OYJ A;  3A8O B;  2DIG A;  2EKO A;  3FIF A;  4BDZ A;  2VYT A;  3PMT A;  3JCM V;  3JCM f;  4R55 A;  4OVA A;  3CCM A;  5GAO r;  4N0A C;  5D6Y A;  1Q86 U;  1RL2 A;  5A2Q E;  4XU1 A;  4R56 A;  3OYE A;  2M16 A;  3FB9 A;  3TU4 K;  4JS5 A;  3QG1 A;  4RG8 A;  2P4T A;  3HRU A;  4LD6 A;  4LDX A;  2V8I A;  1TH7 A;  2RI5 A;  3OBY A;  5LJ3 j;  3CCU T;  4D6W A;  3OS0 A;  3WVD B;  4C8Q A;  1QP2 A;  3LGL A;  5CCA A;  2MF2 A;  3QDR B;  2MMP A;  2YLB A;  4QW2 A;  3ZBD A;  4PNO A;  4Y91 A;  3C95 A;  3HSB A;  4KBM B;  4NL3 A;  2YHT A;  2QTX A;  5CKF A;  4ZN1 A;  3P8D A;  5DLQ E;  3NTK A;  2E5Q A;  4V2S A;  2RI2 A;  3JCM J;  3OYC A;  2JUF A;  2LQK A;  3E9F A;  4F7U A;  4X34 A;  2DTH A;  1UEB A;  3E1S A;  1JB0 E;  2K5L A;  3FJP A;  4M77 D;  1YHQ A;  1M90 U;  2RJF A;  4MZP A;  4BY6 C;  4ELZ C;  4WF2 A;  3LWI A;  2CZ0 B;  4JS4 A;  4M78 C;  1KQS A;  4MZT A;  4JUV A;  2C06 A;  1YJW A;  5LJ3 f;  4ZGD B;  2Y90 A;  3RUX A;  1M1K C;  2Y4X A;  4XU0 A;  5GAN 6;  1Q81 C;  1VQ7 A;  4KUL A;  3GLX A;  1N27 A;  3BY7 A;  4FL6 A;  1WJR A;  1VQP A;  2E12 A;  1UGQ B;  2KK4 A;  3LLR A;  3PT9 A;  5KE2 A;  3JB9 D;  3CC2 T;  1YI2 T;  4MDX A;  4N4H A;  4JRI A;  1I4K 1;  4X9D A;  3SWN B;  4C92 G;  1H3Z A;  4BB7 A;  1VIF A;  1YJN T;  5HY6 A;  3MP6 A;  4Q5W A;  5HK0 A;  1N8R C;  5D6X A;  2PUO B;  3OYB A;  1KC8 U;  3OSS C;  4A4K A;  4F7U G;  4M77 A;  1QVG S;  3TEE A;  1P92 A;  3OMC A;  5DY9 A;  2GFU A;  3M55 A;  5FLX E;  3J81 E;  2DEQ A;  4XTW A;  3CCV T;  4A4F A;  1VQO T;  4VUB A;  3RKX A;  2RH2 A;  3OYD A;  2JN0 A;  2MWP A;  1ZHI A;  4L5G A;  3MCA B;  5A0L A;  2XI9 A;  4QVZ A;  1WQW A;  2HBP A;  4ZTJ A;  1VQ4 T;  2XIC A;  3LH0 A;  1I5L A;  3C12 A;  3MHX A;  3OB9 A;  4EMK B;  2P0P A;  4C5H A;  3HHT B;  5HKC A;  5GAN 5;  3CPW A;  1JJ2 A;  5GAN 4;  1ZBX A;  1JRI A;  1VQK T;  4M7A E;  2EJ9 A;  1AHJ B;  1G3W A;  3PIP A;  2QXF A;  3L42 A;  2EYQ A;  2LRQ A;  4C0G A;  4J6W A;  2ZCF B;  2E65 A;  3QYH B;  4N0A A;  4UC4 A;  5DM7 R;  4E47 A;  2EQU A;  4QQD A;  4QQ6 A;  3JB9 J;  1VQM A;  1D3B A;  3SB2 A;  3OYN A;  2EIF A;  5KCO A;  4HT8 A;  3FEO A;  4M7A B;  2Y4Y A;  3CCR T;  5LJ3 d;  3HFN A;  2PQW A;  2QQR A;  4M78 D;  1JJ2 S;  3CPW S;  1BKB A;  3A8H B;  5GAN g;  1K8A U;  5GAO m;  1LJO A;  3M54 A;  1M9S A;  3MP8 A;  3EFR A;  3CEY A;  4M78 E;  5GAN 3;  5GAN h;  3CCS T;  2LX9 A;  1EIF A;  3OYA A;  4XTV A;  1S72 T;  1W2B A;  3QUI A;  4OF1 A;  4XU3 A;  1LOJ A;  3ME9 A;  4XU2 A;  3JCM X;  3CBO A;  4NS5 A;  4C92 C;  4MMK A;  5CKB A;  4E7H A;  5IN1 A;  4BY6 B;  5A0D A;  5CVI A;  3X25 B;  2ZPF B;  4M78 B;  1U1S A;  4C5E A;  4FM4 B;  1Q7Y U;  3OMG A;  4XAX B;  4EMG A;  3CCQ A;  2VXE A;  2E1H A;  1VQ6 T;  3PNW C;  3NTH A;  3JCM P;  3BDU A;  2EQM A;  4OGE A;  1JBM A;  3V8J A;  5A0G A;  3G4S T;  3CXC S;  4JRP A;  4BE0 A;  5GAN e;  2X4X A;  1O9S A;  2K3X A;  1W2B S;  1VQL T;  2RJD A;  1M1F A;  2X35 A;  3JB9 F;  5LL6 S;  3QPH A;  1ZQ1 A;  1V29 B;  3LGF A;  3S6W A;  5CK9 A;  1M5Q 1;  1YIJ T;  4MDW A;  5M9O A;  4PL6 A;  3JCM Q;  2LT1 A;  4J5Y A;  4M75 G;  4ELY C;  3C94 A;  2RJE A;  3CME A;  1FXX A;  2V8K A;  3M53 A;  3J80 E;  5GAM e;  1WGS A;  4JJN K;  2E10 A;  3FLG A;  5CKH A;  2O4X A;  3ZFJ A;  3L2W A;  1NJI U;  4M7D C;  4EMK C;  4BDY A;  3X26 B;  3TCJ A;  4E7I A;  2FHD A;  1WPY A;  4XTX A;  3M59 A;  1Q86 C;  3GIB A;  2RK1 A;  1G3Y A;  1UB4 A;  3X24 B;  5CQX A;  1BI3 A;  4M7A F;  4PJO G;  2D6F A;  2VGM A;  3KBG A;  3BW1 A;  4OB3 B;  4E7K A;  2ZZD A;  1VQN T;  2K2V A;  2DXT A;  4HCZ A;  3MET A;  3QBY A;  2JVV A;  3GF5 A;  3M4G A;  1BI0 A;  4M7A C;  4LDW A;  2L5Q A;  2XHC A;  4CRI A;  5GAO q;  2VC8 A;  1KHC A;  1YJW T;  1VQK A;  4IKF A;  2BKD N;  2LCC A;  2DZC A;  3H6Z A;  4C92 D;  2XD0 A;  2HQE A;  4LDV A;  1PSF A;  2WAC A;  3E19 A;  5I2S A;  2A7Y A;  5D6W A;  3CCE A;  3VV0 A;  1VQ8 A;  2P0K A;  4BI4 A;  5FRO A;  4C92 E;  4M78 F;  2DTO A;  1NPR A;  2CZ7 B;  4J6Y A;  3V7S A;  3QKJ A;  1M8V A;  2DAQ A;  5LJ5 g;  4A54 A;  1N9R A;  1YIT A;  3PMI A;  2XG8 D;  1M90 C;  4BI8 B;  5GMK e;  2FL7 A;  5LJ5 h;  3O8V A;  5DLO A;  4Y28 E;  2M1H A;  2QQS A;  5CO7 A;  2QDY B;  3DKM A;  3URG A;  3CC4 T;  4HT9 A;  2PU9 B;  3INZ A;  4A4E A;  2EWN A;  3M4Y A;  4C92 B;  4C8Q G;  1NPP A;  2XU8 A;  2MWO A;  5GAN j;  2E6N A;  3ASK A;  3I56 A;  2K5I A;  2XDB A;  3S3O A;  3G71 A;  3L2R A;  3CCL T;  3RES A;  3PIO A;  4DOW A;  1N9S A;  3MEV A;  2M0O A;  5EG2 A;  3JCM c;  2LDM A;  4M7D D;  3DB3 A;  2GF7 A;  4FIB A;  3LYI A;  4FT2 A;  4M7D E;  3HPW A;  3QXE B;  4GY5 A;  3AHU A;  5LJ5 e;  1KQS S;  3M5A A;  4PJO C;  3ZEH A;  2RHI A;  3QJ6 A;  2DXC A;  3EFS A;  3SWN A;  3CMA A;  1Y96 B;  3CCJ T;  4ZTF A;  2F5K A;  2QA4 A;  2PUK B;  2RHY A;  2DIQ A;  2EFI A;  4HCC A;  3OYH A;  1Q81 U;  1K73 C;  1Q82 C;  2RA2 A;  1HK9 A;  4M7D B;  3JCM e;  2DO3 A;  2RI3 A;  4KT0 E;  2OTJ T;  3DLL A;  4QVC A;  4M7A D;  2PVD B;  1NE8 A;  5J39 A;  5GMK l;  1Y7X A;  5GAN f;  3DLM A;  3QII A;  4PLI A;  2KY9 A;  2CKK A;  1KD1 U;  5FRN A;  1N8R U;  1YJ9 A;  4ATO A;  2VUB A;  4EMK A;  3KUF A;  2CYZ B;  5J26 A;  2BUD A;  4J83 A;  3PFS A;  2YLC A;  3OS1 A;  3OBW A;  3A5Z B;  4M77 G;  3WXM B;  1BIB A;  4BE1 A;  2RO0 A;  2FVU A;  4OMF B;  1O75 A;  4DQ2 A;  2QQA A;  4Z02 A;  4JLG A;  4JRQ A;  3OSV A;  3VYH B;  3RER A;  1B34 B;  2LTO A;  3JCM b;  3CC7 A;  1VQ9 T;  5GMK i;  1K8A C;  2DPP B;  1U1T A;  2RB6 A;  4RG2 A;  1IRE B;  5J3B A;  1YI2 A;  3A8L B;  4C92 F;  1X6O A;  4TVR A;  2E70 A;  3PGG A;  3WVE B;  3OA6 A;  3P8B B;  1YJN A;  4JLI A;  4N4I A;  4M7A A;  4LDU A;  2DXB A;  3R6O A;  2DD4 A;  2GFA A;  2ZPE B;  2EAY A;  3NFC A;  3OYF A;  3OW2 A;  4M75 E;  2DKG A;  3JB9 G;  5FRM A;  1Y07 A;  3FC3 A;  3CCV A;  2GCX A;  3M57 A;  2QEX A;  3LW5 E;  3M58 A;  3VU3 C;  5GAM g;  1VQO A;  1VQ5 T;  3J7A F;  2HQX A;  1H64 1;  3V7R A;  5L8R E;  4A53 A;  3E9G A;  4BE2 A;  3QJY A;  3QZ5 B;  4ZN3 A;  1XQH A;  1Q7Y C;  2RM4 A;  5GAM h;  3L2V A;  1X75 C;  3BDL A;  3SD4 A;  1VQ4 A;  2ZPI B;  3VUZ A;  4OGC A;  3QSU A;  2B8A A;  2P0Q A;  3MEU A;  4M75 B;  4OB2 B;  3F70 A;  4PLL A;  3G6E A;  3JB9 H;  4M78 A;  3QYG B;  4XK8 E;  5LJ5 j;  5I2M A;  4LDY A;  4A4H A;  3CCM T;  4PJO E;  1Y71 A;  4J8O A;  2X4W A;  4CI0 C;  3OW2 S;  3HL8 A;  4M7D F;  2NLU A;  5GAN d;  4N4G A;  1M4Z A;  1W4S A;  3RMQ A;  3KXT A;  1BI1 A;  3A8G B;  1WNL A;  3PTA A;  3JCM W;  2CGH A;  1BYM A;  3VJP A;  1K9M U;  1LNX A;  3SDZ A;  2F69 A;  2JTF A;  4FSX A;  2OTL A;  4IUV A;  5GAO l;  4II1 A;  4C0D C;  3CCR A;  4PJO B;  2KQW A;  2OAU A;  4B9X A;  5IT9 E;  1NJI C;  3S3N A;  3OY9 A;  3I55 A;  4C5G A;  1IZ6 A;  3HKS A;  4A4G A;  5FU6 B;  5GAM d;  2AHJ B;  2K3Y A;  3HRT A;  3QZ9 B;  3RKY A;  1HXD A;  4J6X A;  3TRE A;  3ER0 A;  2CZ1 B;  3CCS A;  3EAE A;  1YBY A;  2I2L A;  1UGR B;  1S72 A;  1OYX A;  2DZ9 A;  2VXF A;  4BD3 A;  5GAO n;  4RMO A;  2JNG A;  5GMK h;  5LJ5 f;  2R58 A;  1YHQ T;  4BAC A;  4C8Q E;  4E7L A;  4KUD K;  4OP0 A;  2RJC A;  2ZPH B;  2EJF A;  3CD6 A;  2WSE E;  2LVM A;  1OZ2 A;  2D9T A;  3MEW A;  2R5M A;  2DK3 A;  3X20 B;  2RK2 A;  1VQ6 A;  2RHZ A;  1KG1 A;  4XQ3 A;  4B9W A;  2EJG A;  3H8Z A;  2KMT A;  1VQ7 T;  3G4S A;  4C0Z A;  4EDU A;  4FT4 A;  3I56 T;  4MZM A;  1I8F A;  2EQK A;  2X4Y A;  2X4J A;  3L2Z A;  3M9Q A;  3G71 T;  1WQ7 A;  1KHI A;  1XTD A;  3OS5 A;  4C8Q B;  1VQP T;  4ZGE B;  1VQL A;  2KVQ G;  4BUG A;  4IUQ A;  4XTU A;  2KAF A;  3OYK A;  4F7U E;  2WSF E;  1R8O B;  5CKD A;  2A3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...