2DXCA

Recombinant thiocyanate hydrolase, fully-matured form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
b'PVWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiocyanate hydrolase subunit alpha
molecule tags Hydrolase
source organism Thiobacillus thioparus
publication title Structural Basis for Catalytic Activation of Thiocyanate Hydrolase Involving Metal-Ligated Cysteine Modification
pubmed doi rcsb
total genus 27
structure length 119
sequence length 119
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxcA00
2ZPEB 2PVOB 1UGRB 3QZ9B 4Y28E 3X26B 1UGQB 2AHJB 3A8LB 1GXIE 2ZPBB 3HHTB 3X20B 2CZ0B 1DJ7B 4OB3B 1V29B 4XK8E 2CYZB 2PUKB 2WSEE 3LW5E 4OB2B 2WSFE 3A8GB 1UGSB 3QYHB 4KT0E 1PSFA 2PU9B 1QP3A 2CZ1B 4L6V5 3WVEB 1AHJB 4ZGDB 4ZGEB 2ZCFB 2D0QB 1PSEA 2ZPFB 2CZ7B 2DD5A 3A8MB 4OB0B 3A8OB 3WVDB 2PUOB 4RKUE 2ZZDA 2DPPB 3A8HB 5L8RE 2DD4A 2ZPHB 3X25B 2ZPIB 1IREB 1QP2A 2DXCA 4OB1B 4FM4B 3VYHB 2PVGB 2PVDB 4ZGJB 2QDYB 2CZ6B 3VYGA 3X24B 2ZPGB 3QZ5B 1JB0E 2DXBA 3X28B 2WSCE 2O01E 1UGPB 3QXEB 3QYGB
chains in the Genus database with same CATH superfamily
3QZ9B 4CC2A 1YITA 1N8RR 3O8VA 2J06A 4PL6A 4AFZC 1WJQA 4ZGDB 3OYAA 4MZMA 3A8MB 3EGUA 1AWXA 5FLXE 5DLOA 2M0YA 4LDUA 5CKEA 1YWPA 4M7AE 3CXCA 4C5EA 3HRTA 1KK7A 1BI2A 3A5ZB 1M1KU 1WHHA 3NTKA 1KC8C 2GFUA 2JM8A 1MNEA 4JRIA 2ED0A 4HVWA 3S6WA 1WJRA 1WGSA 3MEUA 3LWHA 1K8AC 2LDMA 2HD0A 2F2XA 4F04B 1Q7YC 4M7DC 2PU9B 1Y71A 3JCMV 4IIMA 3CCUA 1WYXA 1UGVA 3H6ZA 1AVZC 1D0ZA 3FB9A 3X25B 1WQWA 1Q7YU 2MK5A 2RK2A 3M58A 1M2VB 1FMVA 2EGAA 4PJMA 1QVFS 2K4YA 1NJIU 3D7SB 3OYEA 1FWZA 2EGEA 4A63B 5FU6C 4M78A 5HY6A 2E5QA 4KT0E 4WF2A 3L2QA 2K6DA 5GMKi 1U3OA 4E47A 1VQ7Q 4AFUC 2BE7D 1SHFA 3PTAA 2XDBA 1YIJA 3J7AF 2YLCA 3GBQA 1AZEA 2JN0A 3AT1B 2GTJA 2BKDN 2EQKA 4AT1B 3VRYA 1I5OB 2HMAA 4F7UE 1WDXA 1NYFA 1LVKA 4M7DF 2BZ8A 5FU7B 4X9CA 2OTLA 5LJ3j 5GANj 4J9FA 3A8OB 4B9WA 3A8HB 1YJNQ 5LJ3g 2C0TA 3X24B 5GAOn 5FRMA 2A3LA 3J80E 1VQNA 2NWMA 1VQNQ 1VQOT 3OYCA 2XK0A 1VIEA 5HK0A 2FPEA 4HKEA 4C0ZA 5IXFA 1RUWA 3EG0A 1R0BG 3JCMd 2ZPFB 1VQMQ 4ELZC 1H3ZA 2ZPIB 1ZUKA 2L8DA 3VYGA 2Z0WA 3QJ6A 3EGDA 3CCMT 5CIUA 4J83A 2G6FX 2QQBA 1W2BP 1IXDA 2KEAA 2JM9A 3A8LB 5GMKe 2Y4XA 1SRMA 3EGXB 1P92A 1YFNA 4M7AF 2NUZA 2CSIA 4OB0B 3EFOA 5CVIA 1UDLA 4BACA 1T3SA 3EHQA 2QQRA 3SWNB 1W2BA 3CMAT 2KGTA 3GIBA 2LNVA 2LQKA 3PVLA 2E1HA 2H3JA 3C12A 1KJWA 2B86A 1YN8A 2EYXA 1I07A 1WX6A 2YT6A 2VVKA 5GAN8 1PWTA 5J39A 2O9VA 3CCUQ 2P4RA 4EDUA 4ESRA 2O31A 1HYOA 2L3RA 1WPYA 1HSQA 4FYYB 1M5Q1 1ZSZA 3LWIA 1ZA2B 4X9DA 2WSFE 3GF5A 1D1AA 1K76A 2EQMA 1I8FA 8ATCB 3QWYA 2EYWA 5EC7A 4BE2A 1ARKA 3CCJT 4DEYA 3CCVA 2VV5A 3X28B 1YCSB 1Q86R 2FB7A 1Q81C 1WI7A 3MPUB 3INZA 3JCMe 5M9OA 4A4HA 2EKOA 4EMHA 3H8ZA 4JUVA 4L6V5 1OX9A 4A53A 2DIGA 3OW2P 9ATCB 4HT9A 2VYTA 2DYIA 2OAWA 2RJCA 4FYXB 1QKXA 4EMGA 1YJWQ 3HSBA 4ANJA 1RI0A 3HRUA 3JB9J 1FMKA 1N8RC 2M02A 4HCBA 2ZPBB 1JXOA 1VQ6T 3H9NA 5KYXB 1KHCA 2DK3A 2YLBA 1C1AA 3M0RA 3QO3A 4C8QC 3RMSA 2HL3A 1JXMA 3BY7A 3E9FA 2E41A 2X4WA 2SEMA 1RAFB 2J6OA 2LRQA 2L3SA 1OPLA 2MYSA 1KC8R 3OBWA 3OB9A 1I0CA 1NLOC 1M27C 3JCMg 3QJYA 4LN2A 5GAN4 2K9GA 3THKA 2YUPA 3CXCP 4ORZA 2DZCA 2KE9A 2FZKB 4XTYA 3I35A 1VA7A 2PZ1A 1QW1A 3QIIA 4M77A 1M90R 3L42A 3REBB 2FEIA 4A4FA 2QQ9A 5KYWA 2JZ2A 4J6WA 2L3QA 3VS5A 2DL5A 2F69A 4LDXA 1WZOA 1YIJQ 2KI7A 2CKKA 3JB9F 2A37A 1G3SA 5KYXA 3NTIA 4J9IA 2DTOA 2EYZA 4XTZA 1MMDA 2ZGWA 3E2UA 1SKUB 1K0XA 3X26B 1GFCA 2DL3A 2BE9B 4J9GA 3F70A 3OYNA 3S3OA 4C0GA 4DOVA 1VQ5Q 2HBWA 3M4YA 2FZCB 1NZ9A 2BIVA 1XOVA 2X35A 4JZ3A 2RHXA 2DMOA 1VQOA 2DILA 2KT1A 1Q86C 4C8QG 4RTWA 1TWBA 3KBGA 3UPUA 3GNFB 2AT1B 3JSCA 2LX7A 3N5BB 4J6YA 2P0PA 3CPWS 1N9SA 2XDPA 2DJQA 1PSFA 3HP9A 2DVJA 4HT8A 1FXXA 2L89A 5A0LA 1RAAB 3FLGA 1ZHIA 4O6JA 5I2MA 1MHNA 2M1HA 2YUQA 1YI2Q 3JCMb 4PJOB 5GAMf 3CCQA 4GY5A 1T0HA 2LT1A 3JCMP 2YDLA 2EVRA 1NPRA 3DLMA 1MMNA 3CC7Q 2D0NA 2XU8A 3I9QA 4Z89A 1ZSZC 1VQPA 3M4GA 3CC4Q 1RL2A 2RO0A 2JUFA 1PKSA 3E19A 1VQ9Q 1ZUUA 2OJ2A 1RLPC 3V7RA 3HFOA 5A0DA 4OMLA 1W2BS 5LJ3d 3SWNA 1NEBA 4BY6B 2DL4A 4OMOA 2L2PA 2J6FA 1NYGA 3DKMA 3I55Q 1KD1R 3QG1A 4P5NA 5D6WA 3OY9A 2FVUA 4DQ2A 2K2VA 4M7DG 2ED1A 4C8QB 2QASA 2ZPEB 1E6GA 1CKBA 4PKCC 3CPWP 4HCZA 3CC2Q 1E6HA 2MPXC 2OX7A 1YHQT 2RH2A 1H3HA 5GJVB 2LCCA 3VUZA 2VWFA 3P8HA 5FROA 1D3BA 1HD3A 1UJYA 4JRKA 1UGPB 3QXEB 2RPNA 1FMWA 3CCVQ 3X20B 1VQLQ 3VUBA 4MZTA 4RG8A 3L2VA 3ASKA 2P4TA 1KD1U 5CKFA 2DAQA 5FW9A 3JCMh 3JB9D 4PJJA 1YJWA 1OULA 1X6GA 2GCXA 1Q81R 3CC2T 5KE2A 4PLIA 2R58A 1VQ6A 3CMEA 1B34B 4NOYA 4K11A 3I56A 4LXCA 4MZPA 3OYFA 3JRZA 5GAOm 3G4SA 2Y4YA 4BE1A 2NUTB 1K4US 1VQLT 1D1CA 3ULRB 2P84A 2EPDA 3I55T 1OOTA 3M0UA 1KC8U 3LGFA 1X43A 1YCYA 3CMAA 4FU6A 3CD6Q 5GANf 1Q82R 3S3MA 2ABLA 2HCKA 2DNUA 2XD0A 1KFZA 1KQ1A 4M77C 1OU9A 2LJ3A 4R0KA 3TSWA 4TVRA 2SRCA 1WXTA 1Q86U 5HK3A 2GQVA 5CQXA 2EFIA 2GBQA 2R5AA 1OQKA 3OS5A 2YXYA 1K8AU 3KXTA 4BI8B 2NUPB 3HFNA 4QVZA 5GAMd 4ZTFA 4BDZA 1IGQA 5C6SA 2C06A 2CGHA 3R6NA 5LJ5f 1K1ZA 4D8KA 2RQUA 1SG5A 1ZUYA 1BBZA 2COYA 5LJ5g 5C0MA 1IHVA 4DBRA 1WQ7A 1YITT 1AWWA 1X01A 3OMCA 4FSSA 2X4YA 2MIOA 4FW2A 1I1JA 3PGGA 4VUBA 2RA2A 1X27A 2CS7A 2VB6A 4C8QD 2QGFB 2CP3A 4OP0A 4BD3A 5GANe 4M75G 4F16A 1RACB 3Q1JA 3G6EA 3M0TA 3E1SA 5AYFA 8AT1B 1YI2T 3OYBA 3EFRA 2W10A 4CI0C 1M3CA 1G8XA 4RMOA 5I2SA 2K2MA 2KDSA 2XI9A 1BKBA 1Y96B 2ATCB 1SEMA 1UHCA 2D8JA 1M8VA 4RTVA 3TSZA 3CQTA 1SHGA 5CAIA 3ZEHA 2FPFA 2O4XA 3VJPA 1VQ7A 2HKQB 3CCRA 2ESWA 3RMQA 2NUPA 5GAN6 2O4XB 2EAYA 4DBQA 2RHUA 2RHYA 1VQ4T 2GQIA 3OYYA 4LD6A 3VKIA 3PFSA 1VQ9A 1BCMA 4MMKA 2EKHA 4JRQA 4C92D 4OGEA 1M3AA 1NEGA 2DERA 1R8OB 2JOYA 2DD5A 2E6ZA 4GBQA 4CC7A 2RQRA 2LMJA 4LE9A 3BFMA 3CCQQ 2YUOA 4LDVA 3GOXA 1YIJT 3EFOB 3EGDB 3OYHA 4M78D 7AT1B 1U06A 1V29B 3QKJA 2HEQA 3FDRA 4M7DD 4BI3A 3CBPA 2X4XA 2DXTA 1NJIR 2OTJA 1K73R 3DB3A 2L3PA 1ACMB 3LH5A 2KXCA 4OMPA 2P0QA 1VQ8T 2EGCA 5LJ5j 3A1PA 1PG5B 3CCSQ 2PQWA 4OMNA 1YBYA 3QPHA 1UG1A 2BZXA 1Y57A 1IGUA 2FRWA 4JRPA 4CRIA 4C0FA 4KH1B 4ELYC 1AHJB 5AT1B 2LJ1A 1K9MR 4Z88A 3AHUA 4QVCA 5I21A 2EYQA 5DLQE 1VQ6Q 2EQUA 2OI3A 2ZZDA 5D6YA 3HRSA 4DEXA 2RI3A 1B07A 4PK4A 2CH4W 4J9BA 1KQSP 3EG3A 2KRNA 5KYYB 2RQTA 3M0QA 4PLLA 3REAB 2QDLA 4PNOA 2AKKA 3UATA 4FT4A 4PFOA 2RB6A 1IRXA 2EYYA 5A2QE 3KFVA 4X1VA 3CCQT 1X2KA 3RIRA 3M9QA 3TU4K 3I55A 2DVEA 3BDUA 3SD4A 2O9SA 1KQSS 1XTDA 3CCUT 5A0GA 1IHWA 4QQ6A 3RDVA 5J3BA 2VGNA 3G7ZA 4FSXA 4C92C 1AT1B 4RCBA 1M2OA 5KH6A 2FPDA 3JCMX 1M90C 1I5LA 4EMKA 1VQ4Q 4BE0A 4M78B 3JB9I 2COWA 3LH0A 4DA4A 3TQ7P 4M75E 3CCEQ 3JB9H 2EJFA 2HSEB 1XJWB 3CCET 2DXBA 4IUUA 3C95A 2P0KA 4M77G 4KH0B 5HCKA 2LX9A 4IUQA 3HPWA 4BY6C 1SSFA 1Q82U 4V2SA 2R5MA 1PD1A 3JCMc 4JJDA 3C94A 2OTLT 2MAMA 3CD6A 3V7SA 3KUFA 2K5FA 3QWXX 3VS7A 2M9UA 2CZ6B 1QKWA 4OMQA 1EIFA 1YNZA 3G71A 3CCST 4II1A 3CXCS 4KGXB 2H3EB 1VQOQ 1GXIE 4IURA 3OYIA 1N5ZA 4RTTA 3LX7A 1YJNA 1JEGA 2LVMA 5KYNA 1YJWT 5CK9A 2CREA 1YJNT 2JMAA 3DLLA 2LJ0A 4M78F 1BK2A 1MV3A 3C4SA 3CCMA 1D3BB 2CT4A 4FCYA 1N6AA 2NLUA 1MV0B 1UGSB 3M5AA 1XQHA 2ROTA 3VS3A 1TG0A 1Q7YR 2KXDA 5GAOl 5GANg 2X9HA 3FJ5A 3M0SA 1TXQA 2E10A 1QVFP 3MCAB 2MWOA 2E6NA 1U1SA 4C92F 5D6XA 1M4ZA 2D8HA 4C8QA 2K3XA 1BIBA 1Q95G 1XNIA 4J5YA 1ABOA 3RNJA 1U5SA 1WJSA 4OB2B 3SWNC 3CC4A 2JTFA 3OYLA 2RK1A 2K7AA 3H41A 1G3WA 2CZ7B 2MOXA 2X51A 1KD1C 3JCMW 2K3YA 1SSHA 3V7CA 3FJPA 2RN8A 4EMKB 4B9XA 2KT8A 2E3HA 1JB0E 4BUGA 4ZN3A 2E65A 3EHRA 5IHIA 1ZA1B 1QMCA 1RAEB 2QAZA 2RJEA 4F7UA 2YUNA 2DF6A 1U8RA 4A54A 3PT9A 3LLRA 4MDWA 1F1BB 3OYGA 4M7AD 3JB9G 1TS9A 3FRNA 2VUBA 5KYUB 1VQ8A 2XG8D 3MP1A 3OBYA 4RUGA 4MMLA 2BUDA 4PJOA 1X6OA 1TH7A 2O01E 4XU0A 3U23A 4RTYA 5KYYA 2CZ0B 1N9RA 3NTHA 4M4ZA 1PHTA 2RJDA 3OA6A 2G3RA 2RHZA 1UB4A 2BTTA 3SFMA 3META 4JJBA 4XAXB 3FEOA 4FIBA 2KVQG 2DXUA 3V8LA 2RD1A 1UGRB 1WHJA 1EX4A 4AFSC 4A4KA 1GCQA 1RAHB 1Y0MA 4PJOG 3OYJA 1MMAA 4E7LA 2DRKA 1EFNA 3WVDB 4JJNK 1J3TA 4ZTJA 3UA6A 1GRIA 3VYHB 1M3BA 2CDTA 5GANh 4AFQC 4JLGA 1BCOA 4E7KA 2VXFA 1G83A 4Z02A 4R55A 5GAN2 1PD0A 1YJ9T 4JS4A 1VQ9T 4AMCA 4F14A 5KYWB 3RBBB 1V76A 5GAN3 2A28A 4M7AB 3NGPA 2E12A 2GFAA 2EJGA 1OX8A 3CPWA 3PNWC 4J9DA 3OS1A 1W4SA 2K57A 2DETA 4AG1C 1QVGA 3M53A 4J9EA 4JS5A 1O75A 2RJFA 2QA4A 2YRCA 1JBMA 3CD6T 3NHNA 4M77D 2QA4T 1S1NA 1LOJA 5J26A 1K9MC 3UT1A 2OTJT 1M1KC 1AZGB 1NM7A 4FYWB 2WACA 3RERA 4PJOC 2EBPA 4M77E 1H92A 1IO6A 4E7SA 2DO3A 2DTIA 2A08A 4O5VA 2AIRB 3UA7A 2E64A 2FYKA 1T0JA 1MNDA 3TCJA 3JCMJ 1UJ0A 1ABQA 1UEBA 4M7AC 3OW2S 2KRSA 1PSEA 1JU5C 2PUOB 3E9GA 4F17A 2XDDA 2DXCA 1WHLA 3L2WA 5CQYA 1TSFA 3H0HA 2GTOA 4HVVA 4PJOD 4D8DA 3QYGB 4ZGJB 2J6KA 1UECA 3EGXA 4BDYA 1AD5A 1WLPB 2ENMA 2HDAA 4Y28E 5CR2A 2HNIA 1WXBA 1VQLA 2LQ8A 4N4HA 4PJLA 5GAN7 5GMKm 1S72T 1BIAA 1W70A 1Z9ZA 4QVDA 2RI2A 3SB2A 1WFWA 5LJ3e 2GF7A 1H641 3CCLT 3URGA 1YHQQ 1M90U 3P8BB 3CCLA 3WVEB 3JAME 3CC4T 1Z9QA 4E2FB 3RKYA 1NPPA 1WHKA 3VS1A 2D9TA 1LJOA 4J8OA 2QG9B 4FT2A 5GAN5 2M0OA 3T9NA 4E7HA 2COZA 2DA9A 2DPPB 4A4EA 3HKSA 2M16A 1SPKA 2K79A 4AG2C 1ZBJA 4OVAA 2HQEA 4ZNXA 4DBFA 2FHDA 1Q81U 2ZCFB 2ECZA 4M75B 3PIOA 4RKUE 5GMKj 2CP2A 3CC7T 2LT4A 5LL6S 2JT4A 4YTLA 1OZ3A 3UF4A 4IIOA 3PMIA 3G71T 3CCSA 2JNGA 1JJ2S 3IQLA 1QVGS 4ME7A 2KNBB 3QYHB 4C8QF 1VQ5T 2X4JA 3VV0A 3A98A 5KYUA 4Y91A 4M75A 1X75C 2JMCA 5KE3A 4HCKA 4M77F 1PCXA 5HKCA 5DM7R 4JZ4A 2PVDB 4F7UB 3MEVA 1X6BA 4RG2A 3QZ5B 2C0OA 2LQWA 1G2BA 2W0ZA 3G1JA 4FYVB 2DRMA 3NMZC 1MUZA 3CBMA 1K73U 4QT7A 3EFSA 1T3LA 5FRNA 5I11A 2FL7A 4PJNA 3L2RA 2ZPHB 5IAYA 4L5GA 1AWOA 2HBPA 4C5GA 2PVGB 5FU6B 4C92A 2RI5A 3FC3A 2OAUA 2ROLA 4HXJA 3CMAQ 4CC4B 2FRYA 3J81E 4C0DC 1HXDA 2LTOA 2XHCA 2KBTA 1M1GA 3MKDA 3VU3C 4HCCA 4KUDK 2F2VA 2I2LA 2DL8A 4N0AA 1LPLA 4J7FA 3EG2A 3WXMB 5FU7C 1OV3A 1GBRA 5FWBA 3TREA 4RTZA 3BDLA 4JJCA 2I0NA 2MWPA 2XMFA 4C92G 2EJ9A 3NFCA 2CP6A 1D1BA 1GBQA 1PM3A 1RAGB 4F7UG 4M75C 1B3QA 1M30A 4M7AG 2K5LA 3OS2A 4X34A 2MMPA 1MMGA 1JO8A 1PRLC 2HL5C 3ZFJA 2DFUA 3MP8A 1NLPC 2QEXT 2BZYA 4LDYA 2CP7A 1CKAA 2F1LA 1R0CB 1ZX6A 1G3TA 2JS0A 5CKHA 5LJ3h 4M75D 3G6EQ 3ME9A 4M7DB 4C8QE 3QDFA 2AHJB 3OSSC 4HVUA 4E6RA 1QVFA 2PUKB 3EH1A 1KQ2A 2QTVA 2FG0A 4GLMA 2JS2A 1RAIB 3RKXA 2YHTA 1I4K1 1VQPT 4JPBW 4XTVA 5IH2A 1BI0A 5GAMe 1VQ7T 2VASA 3GP8A 4M75F 1UHFA 3BE3A 3M56A 2IG0A 5LJ5e 2OTJQ 1VUBA 4IUPA 4ZGEB 5FWCA 3EAEA 4R56A 2MCNA 2A7YA 1VYVA 3QBYA 1FYNA 3H0FA 4C5IA 2V1QA 2DIQA 1OU8A 3QHSA 1UUEA 5GAOr 4NS5A 2XKOC 4KRTA 2K3BA 4D6WA 3I5SA 2KYMA 2MI6A 1JJ2P 1M1KR 3PE0A 2CUDA 1QWFA 2GGRA 1X2QA 1BI3A 4RTXA 1PRMC 2XIDA 2E5KA 5KCOA 4E7ZA 2HKNA 4M77B 1VQKQ 1WA7A 3OYMA 2IIMA 3OW2A 1YHQA 1IREB 2X3WD 3ER0A 2QDYB 1VQNT 1D0XA 3QSUA 3GPLA 2DJZA 1YITQ 3UWNA 2F5TX 2PVOB 4L59A 2E4HA 4M7DE 4FL6A 2A0FB 2HZYA 6AT1B 1DJ7B 3OQ5A 4XK8E 2HSPA 2V8IA 4M78E 1KG1A 4JLIA 3EG9B 3CCMQ 3V8JA 3CC2A 1VQMT 1WIEA 4PFZA 1VQMA 1G5VA 2FZGB 4BI4A 4C92E 3SDZA 4GLKA 3OMGA 4XU1A 2E70A 3CPFA 3OYKA 2LC4A 1NE8A 1VYTA 3M57A 5GAMh 1KQSA 1QQJA 2CP0A 5IN1A 1JRIA 1QCFA 3ZL7C 1C0MA 4PFPA 2RHIA 2PTKA 3VS2A 1VQKA 1VQKT 3PVQA 2DM1A 2KR3A 5IT9E 1QWEA 4XU3A 2JTMA 3VS4A 1WNLA 1M9SA 4KGVB 1MGQA 2YRDA 4A4GA 5GAMg 3CCEA 3M0PA 1GCQC 1OZ2A 1LCKA 3HTRA 2J05A 2V8KA 1RADB 2RM4A 1QVPA 3R6OA 5L23A 2DLPA 4N0AC 5LJ5h 1D09B 2MF2A 2F5KA 2VGMA 1K73C 3CCVT 4XQ3A 4XTUA 1I81A 2ZPGB 4ATOA 4IKFA 2L5QA 4MDXA 1GL5A 3CC7A 1UE9A 2CYZB 2LQNA 2HAXA 2KAFA 4WCIA 3MO8A 3BW1A 1EZZB 1JJ2A 1VQ5A 1HK9A 1N8RU 3L1AA 1H8KA 2X3XD 4C92B 3TEEA 2HQXA 3V8KA 2KRMA 4EIKA 3G6ET 2VXEA 2L0AA 1VYUA 5LJ3f 1OPKA 2D1XA 2O88A 1TU0B 4LUEA 2QXFA 4C5HA 2QTXA 2O2OA 1RI9A 4OF1A 4QQGA 4LDWA 1V1CA 2DL7A 1VIFA 3HL8A 2K5IA 4RTUA 3CCRT 3EH2A 3C0CA 5D7UA 1KIKA 2DE0X 4XU2A 5ECAA 5EG2A 1M8MA 3M55A 1YJ9A 3PMTA 1W6XA 2OTLQ 2PNIA 3A8GB 2ZAEA 2DX1A 1BI1A 4PJOF 2M51A 1FX7A 1AEYA 4NL3A 1E7OA 2KK4A 1KHIA 1Y7XA 5CKBA 3G4SQ 1TUCA 2J7IA 2KY9A 5GAOq 1TUDA 2CP5A 4XTWA 2AK5A 3CMEQ 3MJXA 2F2WA 2LP5A 4J9HA 4XTXA 1M2VA 3VS0A 4OB3B 2CUBA 2LCSA 2D0QB 5GMKl 3RR6A 5CO7A 4IUTA 1IB8A 5L8RE 1IZ6A 1SF9A 4J6XA 1QP2A 2DTHA 4Q5WA 1VQPQ 1RLQC 1VOMA 4HA8A 1W1FA 2QGGA 4WTOB 2XICA 2R57A 3RKWA 1O9SA 5IHKA 1LNXA 2KYBA 1BU1A 4DBHA 3G71Q 1YWOA 2RF0A 3LW5E 2A36A 4UC4A 3L2ZA 1K8AR 5CCAA 4N4IA 2RQWA 4IUVA 1PC0A 1B7TA 2DZ9A 3H0IA 4QKUA 2QEXA 2YSQA 2QEXQ 3MP6A 3VRZA 2JW4A 3DB4A 3PIPA 3OYDA 1GFDA 5I22A 3I56T 5CKDA 4QW2A 1KSWA 1OYXA 2QI2A 4KUIA 5DY9A 1JQQA 4EMKC 4E7IA 3GNGA 4KULA 1TOVA 1UFFA 2DBMA 3QUIA 1NBEB 4OGCA 2V1RA 5LJ5d 1PKTA 1D0YA 3OSVA 4M7AA 1VQ8Q 2WSCE 2CT3A 4FW1A 1M1FA 3EG9A 2AZSA 4RCCA 1ZQ1A 2Y90A 1A0NB 2AZVA 1QVGP 4LNPA 3OS0A 2QQSA 2E3IA 1HJDA 4DOWA 1QP3A 3RUXA 3CCRQ 1WHGA 3VS6A 5GANd 3M54A 2D6FA 1GCPA 2EIFA 3TVTA 5IXBA 3UDCA 1OI1A 1K9AA 2AKLA 4LD9K 2V8JA 4KGZB 2YWWA 4PJOE 2QK0A 4NL2A 3LGLA 1SRLA 1UTIA 2CZ1B 1ZLMA 1NJIC 2DKGA 2QYZA 4BB7A 1K0SA 3SEMA 3ZBDA 5IHNA 2DEUA 1AWJA 3CCJA 1BYMA 2RNAA 3NPFA 4M78C 4J7IA 2NUTA 2H8HA 1OEBA 4C0DB 2IPOB 3L2UA 3CCJQ 2EW3A 4M78G 3LYIA 2VKNA 4EPCA 1RABB 3I56Q 4B6MA 1B34A 2CSQA 1QCNA 1YI2A 4KBMB 3JCMQ 4CC3A 5GAOp 2QQAA 2YRVA 2DEQA 3CMET 1K9MU 4E7JA 3I5RA 3QDRB 4LUDA 2VC8A 2B8AA 2LZ6B 1Q82C 2CH4A 3G4ST 4J9CA 4ZN1A 1NG2A 2RMOA 2KMTA 4N4GA 1Y07A 1ZBXA 2EWNA 2LCLA 3M59A 2KSSA 1AOJA 1S72A 1VQ4A 2DYBA 5GMKh 4OB1B 3SHWA 1PNJA 4M7DA 3CBOA 2QA4Q 1ZSGA 3HHTB 4Z8AA 3JCMf 4JDSA 2RQVA 1C6VX 2KROA 2NYSA 2JVVA 1ZSZB 4F7UF 1R77A 1WXUA 2LNHB 2IVWA 5GAMj 2DBKA 2JXBA 3MEAA 1N27A 3JV3A 2FO0A 4FM4B 3MHXA 2V26A 1CSKA 1X69A 2HQHA 1YP5A 1Y96A 2JJ9A 3MEWA 3FIFA 4QQDA 1BB9A 2EQJA 5GJWB 1UGQB 2GNCA 1TUGB 1WHMA 2EQIA 2KQWA 3EG1A 4OMMA 3GLXA 4OMFB 3CEYA 1QCOA 2C0IA 2WSEE 4Y92A 3P8DA 3S3NA 5KCHA 1YJ9Q 1QLYA 3CCLQ 2DD4A 3O5ZA 1U1TA 1G3YA 1S72Q 2JTEA 3RESA 1TTHB
chains in the Genus database with same CATH topology
2PVOB 3QZ9B 4L59A 4M7DE 4FL6A 1YITA 3X20B 2CZ0B 1DJ7B 3O8VA 3VUBA 3OQ5A 4MZTA 4XK8E 1N9RA 3NTHA 2V8IA 4M78E 4RG8A 1KG1A 4PL6A 3L2VA 4JLIA 3ASKA 1WJQA 2P4TA 4ZGDB 3OYAA 4MZMA 2RJDA 3V8JA 2G3RA 3OA6A 2RHZA 3A8MB 1KD1U 5CKFA 1VQ5T 1UB4A 2DAQA 5FLXE 5DLOA 4LDUA 5CKEA 3JCMh 3CXCA 4C5EA 3HRTA 3JB9D 1YJWA 4M7AE 1BI2A 3A5ZB 3CC2A 1M1KU 1VQMT 3NTKA 1KC8C 3SFMA 2GCXA 2GFUA 3META 4XAXB 5KE2A 3FEOA 4FIBA 4JRIA 4PLIA 3CC2T 1VQMA 2R58A 1VQ6A 3CMEA 2KVQG 1B34B 2DXUA 3S6WA 2RD1A 1UGRB 3V8LA 1WJRA 1WGSA 3MEUA 4NOYA 4BI4A 3I56A 4C92E 3LWHA 1K8AC 3SDZA 4MZPA 2LDMA 2HD0A 3JRZA 4A4KA 5GAOm 3OYFA 4GLKA 3OMGA 1Q7YC 4M7DC 2PU9B 1Y71A 4XU1A 4PJOG 2Y4YA 3JCMV 3OYJA 3G4SA 3CCUA 2E70A 4BE1A 4E7LA 3CPFA 3OYKA 3WVDB 1VQLT 2LC4A 4JJNK 1NE8A 3H6ZA 3M57A 3I55T 3FB9A 3X25B 1KC8U 1WQWA 5GAMh 4ZTJA 3LGFA 1Q7YU 2RK2A 3VYHB 1KQSA 1YCYA 5IN1A 3M58A 1JRIA 4FU6A 4JLGA 5GANh 3CMAA 1QVFS 5GANf 4E7KA 3S3MA 2VXFA 2RHIA 2XD0A 2K4YA 4Z02A 4R55A 1NJIU 3OYEA 1FWZA 1KQ1A 1VQKA 5GAN2 5FU6C 4M77C 4M78A 5HY6A 1YJ9T 2E5QA 4JRKA 4KT0E 4JS4A 1VQKT 4WF2A 1VQ9T 3L2QA 5IT9E 4XU3A 4TVRA 5GMKi 2JTMA 1Q86U 4E47A 5HK3A 1WNLA 2GQVA 5CQXA 5GAN3 2EFIA 3PTAA 4M7AB 1M9SA 2XDBA 1MGQA 2E12A 2R5AA 2GFAA 3OS5A 1YIJA 2EJGA 3J7AF 1K8AU 2YLCA 3KXTA 4BI8B 3PNWC 2JN0A 4A4GA 5GAMg 3CPWA 3HFNA 3CCEA 2BKDN 4QVZA 1W4SA 2EQKA 5GAMd 3OS1A 4ZTFA 2K57A 1OZ2A 4BDZA 1QVGA 5C6SA 2C06A 2CGHA 2V8KA 3M53A 4F7UE 5LJ5f 4JS5A 3AHUA 1O75A 2RJFA 2RM4A 1QVPA 3R6OA 4M7DF 5FU7B 4X9CA 2OTLA 2QA4A 1JBMA 5LJ3j 5GANj 3CD6T 4N0AC 4M77D 5LJ5h 5LJ5g 3A8OB 4B9WA 2MF2A 3A8HB 2QA4T 2F5KA 2VGMA 5C0MA 1LOJA 5J26A 1K73C 1K9MC 3CCVT 4XQ3A 4XTUA 3UT1A 1I81A 2OTJT 1M1KC 5LJ3g 3X24B 2ZPGB 4ATOA 4IKFA 2WACA 1WQ7A 3RERA 5GAOn 4M77E 1YITT 4PJOC 2L5QA 5FRMA 4MDXA 2A3LA 3J80E 3CC7A 2DO3A 2DTIA 1X01A 4O5VA 3OMCA 1VQNA 2X4YA 1VQOT 2E64A 3OYCA 2XK0A 2FYKA 1VIEA 3TCJA 5HK0A 2CYZB 3JCMJ 3PGGA 4VUBA 2HAXA 2RA2A 4HKEA 2KAFA 4C0ZA 2CS7A 4C8QD 1UEBA 4M7AC 3MO8A 3OW2S 3BW1A 4BD3A 4OP0A 5GANe 3JCMd 4M75G 1JJ2A 1PSEA 1HK9A 2ZPFB 1N8RU 3L1AA 3Q1JA 1VQ5A 2PUOB 3G6EA 4C92B 3TEEA 2HQXA 3V8KA 4ELZC 1H3ZA 2ZPIB 3E1SA 2L8DA 3E9GA 5AYFA 2XDDA 1YI2T 3OYBA 2DXCA 3EFRA 3G6ET 3VYGA 3L2WA 2VXEA 3QJ6A 4CI0C 5CQYA 3CCMT 5CIUA 4RMOA 4PJOD 5I2SA 4J83A 5LJ3f 2QQBA 2KDSA 3QYGB 4ZGJB 2XI9A 4BDYA 3A8LB 1BKBA 1Y96B 2QXFA 4Y28E 3UWNA 5CR2A 1M8VA 4C5HA 2HNIA 2QTXA 5GMKe 2Y4XA 5CAIA 1VQLA 3ZEHA 2LQ8A 2O4XA 4N4HA 4OF1A 1P92A 4QQGA 3VJPA 5GAN7 5GMKm 1S72T 1BIAA 1VQ7A 4LDWA 4M7AF 4OB0B 1VIFA 3HL8A 2K5IA 4QVDA 3CCRA 2RI2A 5CVIA 3RMQA 3SB2A 5GAN6 2O4XB 2EAYA 5LJ3e 4BACA 2GF7A 1H641 2RHUA 3CCLT 3CCRT 3URGA 2QQRA 2RHYA 3SWNB 1VQ4T 1M90U 1W2BA 3P8BB 3CCLA 4XU2A 5EG2A 3OYYA 3CMAT 4LD6A 3M55A 3WVEB 3VKIA 3JAME 3PMTA 3CC4T 1YJ9A 3PFSA 3GIBA 2LNVA 2LQKA 3RKYA 2E1HA 1NPPA 1VQ9A 2H3JA 3C12A 4MMKA 4JRQA 3A8GB 4C92D 4OGEA 2D9TA 1LJOA 4J8OA 1BI1A 4FT2A 4PJOF 5GAN5 2M0OA 3T9NA 4E7HA 1R8OB 2JOYA 1FX7A 2DD5A 2E6ZA 5GAN8 4NL3A 2KK4A 1KHIA 1Y7XA 2DPPB 5CKBA 5J39A 4A4EA 3HKSA 2M16A 4EDUA 2KY9A 5GAOq 3BFMA 4LDVA 2L3RA 3GOXA 1WPYA 4XTWA 1YIJT 3OYHA 1M5Q1 4M78D 4XTXA 4OB3B 4OVAA 3LWIA 1V29B 3QKJA 4X9DA 2WSFE 2HQEA 3GF5A 2EQMA 3FDRA 1I8FA 4M7DD 2FHDA 4BI3A 3CBPA 4BE2A 1Q81U 2ZCFB 2D0QB 4M75B 5GMKl 2X4XA 2DXTA 2OTJA 5CO7A 4IUTA 3DB3A 4RKUE 5GMKj 3PIOA 5L8RE 1IZ6A 3CCJT 4J6XA 1QP2A 2P0QA 2DTHA 4Q5WA 3CC7T 1VQ8T 4HA8A 5LJ5j 3CCVA 2VV5A 3X28B 2LT4A 2PQWA 5LL6S 2XICA 2R57A 1YBYA 4YTLA 3RKWA 3QPHA 1OZ3A 1O9SA 2FB7A 1LNXA 1Q81C 3PMIA 3G71T 3CCSA 2JNGA 3INZA 1JJ2S 3JCMe 5M9OA 4A4HA 1QVGS 3LW5E 4ME7A 2EKOA 3QYHB 4UC4A 4C8QF 4CRIA 4EMHA 4JRPA 3H8ZA 2X4JA 3L2ZA 4JUVA 3VV0A 4C0FA 4L6V5 4ELYC 1AHJB 5CCAA 4N4IA 4IUVA 4Y91A 4M75A 1X75C 4QVCA 4A53A 2DZ9A 2EYQA 5DLQE 2DIGA 2EQUA 2ZZDA 5D6YA 5I21A 5KE3A 4HT9A 3HRSA 4M77F 5HKCA 5DM7R 2RI3A 2VYTA 2RJCA 2QEXA 2PVDB 4F7UB 3MEVA 4EMGA 3MP6A 4RG2A 3DB4A 3HSBA 3PIPA 3QZ5B 3OYDA 1RI0A 3I56T 3HRUA 3JB9J 4PLLA 1N8RC 5CKDA 4PNOA 4QW2A 4HCBA 2ZPBB 1VQ6T 4FT4A 1KHCA 2DK3A 1OYXA 2YLBA 2RB6A 5A2QE 3QO3A 4C8QC 2QI2A 4KUIA 3CBMA 5DY9A 3RMSA 3CCQT 3RIRA 1K73U 3M9QA 3TU4K 3BY7A 3E9FA 2DVEA 2E41A 3BDUA 3EFSA 4EMKC 3I55A 2X4WA 3SD4A 4E7IA 3GNGA 2LRQA 4KULA 5FRNA 1KQSS 1XTDA 2FL7A 3CCUT 3L2RA 3QUIA 5A0GA 2ZPHB 4QQ6A 4OGCA 5IAYA 5J3BA 2VGNA 3OB9A 2HBPA 3OBWA 4L5GA 3G7ZA 4C5GA 2PVGB 5LJ5d 3OSVA 5FU6B 4FSXA 4M7AA 4C92C 3JCMg 3QJYA 4C92A 5GAN4 2WSCE 2RI5A 4RCBA 5KH6A 2DZCA 3FC3A 2OAUA 1M1FA 4RCCA 1ZQ1A 2Y90A 3JCMX 4XTYA 1M90C 1I5LA 1QW1A 3QIIA 4M77A 4EMKA 3OS0A 3L42A 2QQSA 1G5VA 4DOWA 4M78B 3JB9I 1QP3A 3RUXA 3J81E 3QXEB 4A4FA 4C0DC 4BE0A 2QQ9A 3LH0A 2JZ2A 4J6WA 4DA4A 1HXDA 2LTOA 5GANd 2XHCA 3M54A 4M75E 2D6FA 3JB9H 1M1GA 2F69A 3VU3C 2EJFA 4HCCA 4KUDK 4LDXA 2I2LA 2EIFA 2CKKA 3JB9F 4N0AA 3CCET 1G3SA 4J7FA 2DXBA 3UDCA 3NTIA 4IUUA 1OI1A 2DTOA 4XTZA 3WXMB 3C95A 5FU7C 2P0KA 2ZGWA 4LD9K 4M77G 3X26B 2V8JA 3TREA 2LX9A 3BDLA 4IUQA 4PJOE 3HPWA 3OYNA 3F70A 4NL2A 3LGLA 3S3OA 4C0GA 4BY6C 2CZ1B 1SSFA 4DOVA 1Q82U 2MWPA 4C92G 2EJ9A 3NFCA 2DKGA 1NJIC 4BB7A 4V2SA 2R5MA 3JCMc 3C94A 3M4YA 2OTLT 2MAMA 3CD6A 3ZBDA 1NZ9A 3V7SA 2BIVA 1XOVA 3KUFA 2K5FA 2M9UA 2X35A 4F7UG 4M75C 2CZ6B 3CCJA 2RHXA 1EIFA 4M7AG 3G71A 3CCST 1VQOA 1BYMA 1Q86C 4II1A 4C8QG 3CXCS 2K5LA 4M78C 4J7IA 3OS2A 4C0DB 4X34A 2MMPA 3KBGA 3GNFB 3L2UA 3UPUA 1GXIE 3JSCA 4IURA 3N5BB 4J6YA 2P0PA 3CPWS 1N9SA 3OYIA 4M78G 3LYIA 2XDPA 4EPCA 1PSFA 3ZFJA 3LX7A 1YJNA 3HP9A 1B34A 2LVMA 3MP8A 1YJWT 4HT8A 1YI2A 1FXXA 2L89A 4KBMB 4LDYA 5CK9A 2QEXT 5A0LA 3JCMQ 1YJNT 1G3TA 5GAOp 3FLGA 1ZHIA 5CKHA 2QQAA 2YRVA 2DEQA 5LJ3h 3CMET 4E7JA 1K9MU 3QDRB 4M75D 4O6JA 3DLLA 5I2MA 1MHNA 3ME9A 2M1HA 4M7DB 4C8QE 2VC8A 2B8AA 4M78F 3JCMb 3C4SA 2AHJB 3OSSC 5GAMf 3CCMA 3CCQA 1D3BB 1Q82C 4PJOB 4GY5A 3G4ST 2LT1A 3JCMP 1N6AA 2PUKB 4ZN1A 2NLUA 1QVFA 1UGSB 3M5AA 1KQ2A 1XQHA 2KMTA 4N4GA 1Y07A 1ZBXA 1NPRA 2EWNA 3DLMA 3RKXA 2LCLA 1I4K1 2YHTA 1VQPT 4XTVA 3M59A 5GAOl 2KSSA 2XU8A 1BI0A 5GAMe 5GANg 1VQ7T 1S72A 3GP8A 1VQ4A 2E10A 5GMKh 1VQPA 3M4GA 3MCAB 4OB1B 2MWOA 4M75F 1RL2A 2RO0A 2JUFA 3E19A 2E6NA 1U1SA 3M56A 4C92F 2IG0A 5D6XA 1M4ZA 5LJ5e 1VUBA 4IUPA 2K3XA 1BIBA 4J5YA 1XNIA 3EAEA 4C8QA 4ZGEB 3V7RA 3HFOA 5A0DA 3CBOA 4R56A 1W2BS 4M7DA 5LJ3d 3HHTB 3JCMf 2A7YA 4JDSA 3SWNA 4BY6B 3QBYA 1WJSA 4OB2B 3SWNC 3CC4A 2JTFA 4C5IA 2JVVA 3OYLA 2DIQA 2RK1A 3DKMA 4F7UF 1G3WA 2CZ7B 3QHSA 5GAOr 2IVWA 5GAMj 3JCMW 2K3YA 4NS5A 2XKOC 1KD1C 3V7CA 3FJPA 3QG1A 3MEAA 1N27A 4P5NA 5D6WA 3OY9A 2FVUA 3MHXA 4FM4B 4EMKB 4B9XA 4D6WA 4DQ2A 1JB0E 1Y96A 2K2VA 2E65A 2MI6A 4BUGA 4ZN3A 4M7DG 3MEWA 4C8QB 3FIFA 1BI3A 2ZPEB 4QQDA 2EQJA 1UGQB 2KQWA 2RJEA 3GLXA 4OMFB 3CEYA 2WSEE 4PKCC 2XIDA 4F7UA 4HCZA 5KCOA 3P8DA 4M77B 4A54A 1U8RA 3S3NA 3PT9A 1YHQT 3LLRA 4MDWA 2RH2A 5KCHA 3OYMA 3OYGA 3JB9G 4M7AD 3FRNA 2VUBA 3OW2A 1VQ8A 2DD4A 1YHQA 2XG8D 2LCCA 3VUZA 3MP1A 1IREB 3OBYA 3P8HA 1U1TA 3ER0A 2QDYB 4MMLA 5FROA 2BUDA 1D3BA 1G3YA 3GPLA 2DJZA 1VQNT 3QSUA 4PJOA 1X6OA 1TH7A 2O01E 3RESA 4XU0A 1UGPB 2F5TX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPE B;  2PVO B;  1UGR B;  3QZ9 B;  4Y28 E;  3X26 B;  1UGQ B;  2AHJ B;  3A8L B;  1GXI E;  2ZPB B;  3HHT B;  3X20 B;  2CZ0 B;  1DJ7 B;  4OB3 B;  1V29 B;  4XK8 E;  2CYZ B;  2PUK B;  2WSE E;  3LW5 E;  4OB2 B;  2WSF E;  3A8G B;  1UGS B;  3QYH B;  4KT0 E;  1PSF A;  2PU9 B;  1QP3 A;  2CZ1 B;  4L6V 5;  3WVE B;  1AHJ B;  4ZGD B;  4ZGE B;  2ZCF B;  2D0Q B;  1PSE A;  2ZPF B;  2CZ7 B;  2DD5 A;  3A8M B;  4OB0 B;  3A8O B;  3WVD B;  2PUO B;  4RKU E;  2ZZD A;  2DPP B;  3A8H B;  5L8R E;  2DD4 A;  2ZPH B;  3X25 B;  2ZPI B;  1IRE B;  1QP2 A;  2DXC A;  4OB1 B;  4FM4 B;  3VYH B;  2PVG B;  2PVD B;  4ZGJ B;  2QDY B;  2CZ6 B;  3VYG A;  3X24 B;  2ZPG B;  3QZ5 B;  1JB0 E;  2DXB A;  3X28 B;  2WSC E;  2O01 E;  1UGP B;  3QXE B;  3QYG B; 
#chains in the Genus database with same CATH topology
 3QZ9 B;  4CC2 A;  1YIT A;  1N8R R;  3O8V A;  2J06 A;  4PL6 A;  4AFZ C;  1WJQ A;  4ZGD B;  3OYA A;  4MZM A;  3A8M B;  3EGU A;  1AWX A;  5FLX E;  5DLO A;  2M0Y A;  4LDU A;  5CKE A;  1YWP A;  4M7A E;  3CXC A;  4C5E A;  3HRT A;  1KK7 A;  1BI2 A;  3A5Z B;  1M1K U;  1WHH A;  3NTK A;  1KC8 C;  2GFU A;  2JM8 A;  1MNE A;  4JRI A;  2ED0 A;  4HVW A;  3S6W A;  1WJR A;  1WGS A;  3MEU A;  3LWH A;  1K8A C;  2LDM A;  2HD0 A;  2F2X A;  4F04 B;  1Q7Y C;  4M7D C;  2PU9 B;  1Y71 A;  3JCM V;  4IIM A;  3CCU A;  1WYX A;  1UGV A;  3H6Z A;  1AVZ C;  1D0Z A;  3FB9 A;  3X25 B;  1WQW A;  1Q7Y U;  2MK5 A;  2RK2 A;  3M58 A;  1M2V B;  1FMV A;  2EGA A;  4PJM A;  1QVF S;  2K4Y A;  1NJI U;  3D7S B;  3OYE A;  1FWZ A;  2EGE A;  4A63 B;  5FU6 C;  4M78 A;  5HY6 A;  2E5Q A;  4KT0 E;  4WF2 A;  3L2Q A;  2K6D A;  5GMK i;  1U3O A;  4E47 A;  1VQ7 Q;  4AFU C;  2BE7 D;  1SHF A;  3PTA A;  2XDB A;  1YIJ A;  3J7A F;  2YLC A;  3GBQ A;  1AZE A;  2JN0 A;  3AT1 B;  2GTJ A;  2BKD N;  2EQK A;  4AT1 B;  3VRY A;  1I5O B;  2HMA A;  4F7U E;  1WDX A;  1NYF A;  1LVK A;  4M7D F;  2BZ8 A;  5FU7 B;  4X9C A;  2OTL A;  5LJ3 j;  5GAN j;  4J9F A;  3A8O B;  4B9W A;  3A8H B;  1YJN Q;  5LJ3 g;  2C0T A;  3X24 B;  5GAO n;  5FRM A;  2A3L A;  3J80 E;  1VQN A;  2NWM A;  1VQN Q;  1VQO T;  3OYC A;  2XK0 A;  1VIE A;  5HK0 A;  2FPE A;  4HKE A;  4C0Z A;  5IXF A;  1RUW A;  3EG0 A;  1R0B G;  3JCM d;  2ZPF B;  1VQM Q;  4ELZ C;  1H3Z A;  2ZPI B;  1ZUK A;  2L8D A;  3VYG A;  2Z0W A;  3QJ6 A;  3EGD A;  3CCM T;  5CIU A;  4J83 A;  2G6F X;  2QQB A;  1W2B P;  1IXD A;  2KEA A;  2JM9 A;  3A8L B;  5GMK e;  2Y4X A;  1SRM A;  3EGX B;  1P92 A;  1YFN A;  4M7A F;  2NUZ A;  2CSI A;  4OB0 B;  3EFO A;  5CVI A;  1UDL A;  4BAC A;  1T3S A;  3EHQ A;  2QQR A;  3SWN B;  1W2B A;  3CMA T;  2KGT A;  3GIB A;  2LNV A;  2LQK A;  3PVL A;  2E1H A;  2H3J A;  3C12 A;  1KJW A;  2B86 A;  1YN8 A;  2EYX A;  1I07 A;  1WX6 A;  2YT6 A;  2VVK A;  5GAN 8;  1PWT A;  5J39 A;  2O9V A;  3CCU Q;  2P4R A;  4EDU A;  4ESR A;  2O31 A;  1HYO A;  2L3R A;  1WPY A;  1HSQ A;  4FYY B;  1M5Q 1;  1ZSZ A;  3LWI A;  1ZA2 B;  4X9D A;  2WSF E;  3GF5 A;  1D1A A;  1K76 A;  2EQM A;  1I8F A;  8ATC B;  3QWY A;  2EYW A;  5EC7 A;  4BE2 A;  1ARK A;  3CCJ T;  4DEY A;  3CCV A;  2VV5 A;  3X28 B;  1YCS B;  1Q86 R;  2FB7 A;  1Q81 C;  1WI7 A;  3MPU B;  3INZ A;  3JCM e;  5M9O A;  4A4H A;  2EKO A;  4EMH A;  3H8Z A;  4JUV A;  4L6V 5;  1OX9 A;  4A53 A;  2DIG A;  3OW2 P;  9ATC B;  4HT9 A;  2VYT A;  2DYI A;  2OAW A;  2RJC A;  4FYX B;  1QKX A;  4EMG A;  1YJW Q;  3HSB A;  4ANJ A;  1RI0 A;  3HRU A;  3JB9 J;  1FMK A;  1N8R C;  2M02 A;  4HCB A;  2ZPB B;  1JXO A;  1VQ6 T;  3H9N A;  5KYX B;  1KHC A;  2DK3 A;  2YLB A;  1C1A A;  3M0R A;  3QO3 A;  4C8Q C;  3RMS A;  2HL3 A;  1JXM A;  3BY7 A;  3E9F A;  2E41 A;  2X4W A;  2SEM A;  1RAF B;  2J6O A;  2LRQ A;  2L3S A;  1OPL A;  2MYS A;  1KC8 R;  3OBW A;  3OB9 A;  1I0C A;  1NLO C;  1M27 C;  3JCM g;  3QJY A;  4LN2 A;  5GAN 4;  2K9G A;  3THK A;  2YUP A;  3CXC P;  4ORZ A;  2DZC A;  2KE9 A;  2FZK B;  4XTY A;  3I35 A;  1VA7 A;  2PZ1 A;  1QW1 A;  3QII A;  4M77 A;  1M90 R;  3L42 A;  3REB B;  2FEI A;  4A4F A;  2QQ9 A;  5KYW A;  2JZ2 A;  4J6W A;  2L3Q A;  3VS5 A;  2DL5 A;  2F69 A;  4LDX A;  1WZO A;  1YIJ Q;  2KI7 A;  2CKK A;  3JB9 F;  2A37 A;  1G3S A;  5KYX A;  3NTI A;  4J9I A;  2DTO A;  2EYZ A;  4XTZ A;  1MMD A;  2ZGW A;  3E2U A;  1SKU B;  1K0X A;  3X26 B;  1GFC A;  2DL3 A;  2BE9 B;  4J9G A;  3F70 A;  3OYN A;  3S3O A;  4C0G A;  4DOV A;  1VQ5 Q;  2HBW A;  3M4Y A;  2FZC B;  1NZ9 A;  2BIV A;  1XOV A;  2X35 A;  4JZ3 A;  2RHX A;  2DMO A;  1VQO A;  2DIL A;  2KT1 A;  1Q86 C;  4C8Q G;  4RTW A;  1TWB A;  3KBG A;  3UPU A;  3GNF B;  2AT1 B;  3JSC A;  2LX7 A;  3N5B B;  4J6Y A;  2P0P A;  3CPW S;  1N9S A;  2XDP A;  2DJQ A;  1PSF A;  3HP9 A;  2DVJ A;  4HT8 A;  1FXX A;  2L89 A;  5A0L A;  1RAA B;  3FLG A;  1ZHI A;  4O6J A;  5I2M A;  1MHN A;  2M1H A;  2YUQ A;  1YI2 Q;  3JCM b;  4PJO B;  5GAM f;  3CCQ A;  4GY5 A;  1T0H A;  2LT1 A;  3JCM P;  2YDL A;  2EVR A;  1NPR A;  3DLM A;  1MMN A;  3CC7 Q;  2D0N A;  2XU8 A;  3I9Q A;  4Z89 A;  1ZSZ C;  1VQP A;  3M4G A;  3CC4 Q;  1RL2 A;  2RO0 A;  2JUF A;  1PKS A;  3E19 A;  1VQ9 Q;  1ZUU A;  2OJ2 A;  1RLP C;  3V7R A;  3HFO A;  5A0D A;  4OML A;  1W2B S;  5LJ3 d;  3SWN A;  1NEB A;  4BY6 B;  2DL4 A;  4OMO A;  2L2P A;  2J6F A;  1NYG A;  3DKM A;  3I55 Q;  1KD1 R;  3QG1 A;  4P5N A;  5D6W A;  3OY9 A;  2FVU A;  4DQ2 A;  2K2V A;  4M7D G;  2ED1 A;  4C8Q B;  2QAS A;  2ZPE B;  1E6G A;  1CKB A;  4PKC C;  3CPW P;  4HCZ A;  3CC2 Q;  1E6H A;  2MPX C;  2OX7 A;  1YHQ T;  2RH2 A;  1H3H A;  5GJV B;  2LCC A;  3VUZ A;  2VWF A;  3P8H A;  5FRO A;  1D3B A;  1HD3 A;  1UJY A;  4JRK A;  1UGP B;  3QXE B;  2RPN A;  1FMW A;  3CCV Q;  3X20 B;  1VQL Q;  3VUB A;  4MZT A;  4RG8 A;  3L2V A;  3ASK A;  2P4T A;  1KD1 U;  5CKF A;  2DAQ A;  5FW9 A;  3JCM h;  3JB9 D;  4PJJ A;  1YJW A;  1OUL A;  1X6G A;  2GCX A;  1Q81 R;  3CC2 T;  5KE2 A;  4PLI A;  2R58 A;  1VQ6 A;  3CME A;  1B34 B;  4NOY A;  4K11 A;  3I56 A;  4LXC A;  4MZP A;  3OYF A;  3JRZ A;  5GAO m;  3G4S A;  2Y4Y A;  4BE1 A;  2NUT B;  1K4U S;  1VQL T;  1D1C A;  3ULR B;  2P84 A;  2EPD A;  3I55 T;  1OOT A;  3M0U A;  1KC8 U;  3LGF A;  1X43 A;  1YCY A;  3CMA A;  4FU6 A;  3CD6 Q;  5GAN f;  1Q82 R;  3S3M A;  2ABL A;  2HCK A;  2DNU A;  2XD0 A;  1KFZ A;  1KQ1 A;  4M77 C;  1OU9 A;  2LJ3 A;  4R0K A;  3TSW A;  4TVR A;  2SRC A;  1WXT A;  1Q86 U;  5HK3 A;  2GQV A;  5CQX A;  2EFI A;  2GBQ A;  2R5A A;  1OQK A;  3OS5 A;  2YXY A;  1K8A U;  3KXT A;  4BI8 B;  2NUP B;  3HFN A;  4QVZ A;  5GAM d;  4ZTF A;  4BDZ A;  1IGQ A;  5C6S A;  2C06 A;  2CGH A;  3R6N A;  5LJ5 f;  1K1Z A;  4D8K A;  2RQU A;  1SG5 A;  1ZUY A;  1BBZ A;  2COY A;  5LJ5 g;  5C0M A;  1IHV A;  4DBR A;  1WQ7 A;  1YIT T;  1AWW A;  1X01 A;  3OMC A;  4FSS A;  2X4Y A;  2MIO A;  4FW2 A;  1I1J A;  3PGG A;  4VUB A;  2RA2 A;  1X27 A;  2CS7 A;  2VB6 A;  4C8Q D;  2QGF B;  2CP3 A;  4OP0 A;  4BD3 A;  5GAN e;  4M75 G;  4F16 A;  1RAC B;  3Q1J A;  3G6E A;  3M0T A;  3E1S A;  5AYF A;  8AT1 B;  1YI2 T;  3OYB A;  3EFR A;  2W10 A;  4CI0 C;  1M3C A;  1G8X A;  4RMO A;  5I2S A;  2K2M A;  2KDS A;  2XI9 A;  1BKB A;  1Y96 B;  2ATC B;  1SEM A;  1UHC A;  2D8J A;  1M8V A;  4RTV A;  3TSZ A;  3CQT A;  1SHG A;  5CAI A;  3ZEH A;  2FPF A;  2O4X A;  3VJP A;  1VQ7 A;  2HKQ B;  3CCR A;  2ESW A;  3RMQ A;  2NUP A;  5GAN 6;  2O4X B;  2EAY A;  4DBQ A;  2RHU A;  2RHY A;  1VQ4 T;  2GQI A;  3OYY A;  4LD6 A;  3VKI A;  3PFS A;  1VQ9 A;  1BCM A;  4MMK A;  2EKH A;  4JRQ A;  4C92 D;  4OGE A;  1M3A A;  1NEG A;  2DER A;  1R8O B;  2JOY A;  2DD5 A;  2E6Z A;  4GBQ A;  4CC7 A;  2RQR A;  2LMJ A;  4LE9 A;  3BFM A;  3CCQ Q;  2YUO A;  4LDV A;  3GOX A;  1YIJ T;  3EFO B;  3EGD B;  3OYH A;  4M78 D;  7AT1 B;  1U06 A;  1V29 B;  3QKJ A;  2HEQ A;  3FDR A;  4M7D D;  4BI3 A;  3CBP A;  2X4X A;  2DXT A;  1NJI R;  2OTJ A;  1K73 R;  3DB3 A;  2L3P A;  1ACM B;  3LH5 A;  2KXC A;  4OMP A;  2P0Q A;  1VQ8 T;  2EGC A;  5LJ5 j;  3A1P A;  1PG5 B;  3CCS Q;  2PQW A;  4OMN A;  1YBY A;  3QPH A;  1UG1 A;  2BZX A;  1Y57 A;  1IGU A;  2FRW A;  4JRP A;  4CRI A;  4C0F A;  4KH1 B;  4ELY C;  1AHJ B;  5AT1 B;  2LJ1 A;  1K9M R;  4Z88 A;  3AHU A;  4QVC A;  5I21 A;  2EYQ A;  5DLQ E;  1VQ6 Q;  2EQU A;  2OI3 A;  2ZZD A;  5D6Y A;  3HRS A;  4DEX A;  2RI3 A;  1B07 A;  4PK4 A;  2CH4 W;  4J9B A;  1KQS P;  3EG3 A;  2KRN A;  5KYY B;  2RQT A;  3M0Q A;  4PLL A;  3REA B;  2QDL A;  4PNO A;  2AKK A;  3UAT A;  4FT4 A;  4PFO A;  2RB6 A;  1IRX A;  2EYY A;  5A2Q E;  3KFV A;  4X1V A;  3CCQ T;  1X2K A;  3RIR A;  3M9Q A;  3TU4 K;  3I55 A;  2DVE A;  3BDU A;  3SD4 A;  2O9S A;  1KQS S;  1XTD A;  3CCU T;  5A0G A;  1IHW A;  4QQ6 A;  3RDV A;  5J3B A;  2VGN A;  3G7Z A;  4FSX A;  4C92 C;  1AT1 B;  4RCB A;  1M2O A;  5KH6 A;  2FPD A;  3JCM X;  1M90 C;  1I5L A;  4EMK A;  1VQ4 Q;  4BE0 A;  4M78 B;  3JB9 I;  2COW A;  3LH0 A;  4DA4 A;  3TQ7 P;  4M75 E;  3CCE Q;  3JB9 H;  2EJF A;  2HSE B;  1XJW B;  3CCE T;  2DXB A;  4IUU A;  3C95 A;  2P0K A;  4M77 G;  4KH0 B;  5HCK A;  2LX9 A;  4IUQ A;  3HPW A;  4BY6 C;  1SSF A;  1Q82 U;  4V2S A;  2R5M A;  1PD1 A;  3JCM c;  4JJD A;  3C94 A;  2OTL T;  2MAM A;  3CD6 A;  3V7S A;  3KUF A;  2K5F A;  3QWX X;  3VS7 A;  2M9U A;  2CZ6 B;  1QKW A;  4OMQ A;  1EIF A;  1YNZ A;  3G71 A;  3CCS T;  4II1 A;  3CXC S;  4KGX B;  2H3E B;  1VQO Q;  1GXI E;  4IUR A;  3OYI A;  1N5Z A;  4RTT A;  3LX7 A;  1YJN A;  1JEG A;  2LVM A;  5KYN A;  1YJW T;  5CK9 A;  2CRE A;  1YJN T;  2JMA A;  3DLL A;  2LJ0 A;  4M78 F;  1BK2 A;  1MV3 A;  3C4S A;  3CCM A;  1D3B B;  2CT4 A;  4FCY A;  1N6A A;  2NLU A;  1MV0 B;  1UGS B;  3M5A A;  1XQH A;  2ROT A;  3VS3 A;  1TG0 A;  1Q7Y R;  2KXD A;  5GAO l;  5GAN g;  2X9H A;  3FJ5 A;  3M0S A;  1TXQ A;  2E10 A;  1QVF P;  3MCA B;  2MWO A;  2E6N A;  1U1S A;  4C92 F;  5D6X A;  1M4Z A;  2D8H A;  4C8Q A;  2K3X A;  1BIB A;  1Q95 G;  1XNI A;  4J5Y A;  1ABO A;  3RNJ A;  1U5S A;  1WJS A;  4OB2 B;  3SWN C;  3CC4 A;  2JTF A;  3OYL A;  2RK1 A;  2K7A A;  3H41 A;  1G3W A;  2CZ7 B;  2MOX A;  2X51 A;  1KD1 C;  3JCM W;  2K3Y A;  1SSH A;  3V7C A;  3FJP A;  2RN8 A;  4EMK B;  4B9X A;  2KT8 A;  2E3H A;  1JB0 E;  4BUG A;  4ZN3 A;  2E65 A;  3EHR A;  5IHI A;  1ZA1 B;  1QMC A;  1RAE B;  2QAZ A;  2RJE A;  4F7U A;  2YUN A;  2DF6 A;  1U8R A;  4A54 A;  3PT9 A;  3LLR A;  4MDW A;  1F1B B;  3OYG A;  4M7A D;  3JB9 G;  1TS9 A;  3FRN A;  2VUB A;  5KYU B;  1VQ8 A;  2XG8 D;  3MP1 A;  3OBY A;  4RUG A;  4MML A;  2BUD A;  4PJO A;  1X6O A;  1TH7 A;  2O01 E;  4XU0 A;  3U23 A;  4RTY A;  5KYY A;  2CZ0 B;  1N9R A;  3NTH A;  4M4Z A;  1PHT A;  2RJD A;  3OA6 A;  2G3R A;  2RHZ A;  1UB4 A;  2BTT A;  3SFM A;  3MET A;  4JJB A;  4XAX B;  3FEO A;  4FIB A;  2KVQ G;  2DXU A;  3V8L A;  2RD1 A;  1UGR B;  1WHJ A;  1EX4 A;  4AFS C;  4A4K A;  1GCQ A;  1RAH B;  1Y0M A;  4PJO G;  3OYJ A;  1MMA A;  4E7L A;  2DRK A;  1EFN A;  3WVD B;  4JJN K;  1J3T A;  4ZTJ A;  3UA6 A;  1GRI A;  3VYH B;  1M3B A;  2CDT A;  5GAN h;  4AFQ C;  4JLG A;  1BCO A;  4E7K A;  2VXF A;  1G83 A;  4Z02 A;  4R55 A;  5GAN 2;  1PD0 A;  1YJ9 T;  4JS4 A;  1VQ9 T;  4AMC A;  4F14 A;  5KYW B;  3RBB B;  1V76 A;  5GAN 3;  2A28 A;  4M7A B;  3NGP A;  2E12 A;  2GFA A;  2EJG A;  1OX8 A;  3CPW A;  3PNW C;  4J9D A;  3OS1 A;  1W4S A;  2K57 A;  2DET A;  4AG1 C;  1QVG A;  3M53 A;  4J9E A;  4JS5 A;  1O75 A;  2RJF A;  2QA4 A;  2YRC A;  1JBM A;  3CD6 T;  3NHN A;  4M77 D;  2QA4 T;  1S1N A;  1LOJ A;  5J26 A;  1K9M C;  3UT1 A;  2OTJ T;  1M1K C;  1AZG B;  1NM7 A;  4FYW B;  2WAC A;  3RER A;  4PJO C;  2EBP A;  4M77 E;  1H92 A;  1IO6 A;  4E7S A;  2DO3 A;  2DTI A;  2A08 A;  4O5V A;  2AIR B;  3UA7 A;  2E64 A;  2FYK A;  1T0J A;  1MND A;  3TCJ A;  3JCM J;  1UJ0 A;  1ABQ A;  1UEB A;  4M7A C;  3OW2 S;  2KRS A;  1PSE A;  1JU5 C;  2PUO B;  3E9G A;  4F17 A;  2XDD A;  2DXC A;  1WHL A;  3L2W A;  5CQY A;  1TSF A;  3H0H A;  2GTO A;  4HVV A;  4PJO D;  4D8D A;  3QYG B;  4ZGJ B;  2J6K A;  1UEC A;  3EGX A;  4BDY A;  1AD5 A;  1WLP B;  2ENM A;  2HDA A;  4Y28 E;  5CR2 A;  2HNI A;  1WXB A;  1VQL A;  2LQ8 A;  4N4H A;  4PJL A;  5GAN 7;  5GMK m;  1S72 T;  1BIA A;  1W70 A;  1Z9Z A;  4QVD A;  2RI2 A;  3SB2 A;  1WFW A;  5LJ3 e;  2GF7 A;  1H64 1;  3CCL T;  3URG A;  1YHQ Q;  1M90 U;  3P8B B;  3CCL A;  3WVE B;  3JAM E;  3CC4 T;  1Z9Q A;  4E2F B;  3RKY A;  1NPP A;  1WHK A;  3VS1 A;  2D9T A;  1LJO A;  4J8O A;  2QG9 B;  4FT2 A;  5GAN 5;  2M0O A;  3T9N A;  4E7H A;  2COZ A;  2DA9 A;  2DPP B;  4A4E A;  3HKS A;  2M16 A;  1SPK A;  2K79 A;  4AG2 C;  1ZBJ A;  4OVA A;  2HQE A;  4ZNX A;  4DBF A;  2FHD A;  1Q81 U;  2ZCF B;  2ECZ A;  4M75 B;  3PIO A;  4RKU E;  5GMK j;  2CP2 A;  3CC7 T;  2LT4 A;  5LL6 S;  2JT4 A;  4YTL A;  1OZ3 A;  3UF4 A;  4IIO A;  3PMI A;  3G71 T;  3CCS A;  2JNG A;  1JJ2 S;  3IQL A;  1QVG S;  4ME7 A;  2KNB B;  3QYH B;  4C8Q F;  1VQ5 T;  2X4J A;  3VV0 A;  3A98 A;  5KYU A;  4Y91 A;  4M75 A;  1X75 C;  2JMC A;  5KE3 A;  4HCK A;  4M77 F;  1PCX A;  5HKC A;  5DM7 R;  4JZ4 A;  2PVD B;  4F7U B;  3MEV A;  1X6B A;  4RG2 A;  3QZ5 B;  2C0O A;  2LQW A;  1G2B A;  2W0Z A;  3G1J A;  4FYV B;  2DRM A;  3NMZ C;  1MUZ A;  3CBM A;  1K73 U;  4QT7 A;  3EFS A;  1T3L A;  5FRN A;  5I11 A;  2FL7 A;  4PJN A;  3L2R A;  2ZPH B;  5IAY A;  4L5G A;  1AWO A;  2HBP A;  4C5G A;  2PVG B;  5FU6 B;  4C92 A;  2RI5 A;  3FC3 A;  2OAU A;  2ROL A;  4HXJ A;  3CMA Q;  4CC4 B;  2FRY A;  3J81 E;  4C0D C;  1HXD A;  2LTO A;  2XHC A;  2KBT A;  1M1G A;  3MKD A;  3VU3 C;  4HCC A;  4KUD K;  2F2V A;  2I2L A;  2DL8 A;  4N0A A;  1LPL A;  4J7F A;  3EG2 A;  3WXM B;  5FU7 C;  1OV3 A;  1GBR A;  5FWB A;  3TRE A;  4RTZ A;  3BDL A;  4JJC A;  2I0N A;  2MWP A;  2XMF A;  4C92 G;  2EJ9 A;  3NFC A;  2CP6 A;  1D1B A;  1GBQ A;  1PM3 A;  1RAG B;  4F7U G;  4M75 C;  1B3Q A;  1M30 A;  4M7A G;  2K5L A;  3OS2 A;  4X34 A;  2MMP A;  1MMG A;  1JO8 A;  1PRL C;  2HL5 C;  3ZFJ A;  2DFU A;  3MP8 A;  1NLP C;  2QEX T;  2BZY A;  4LDY A;  2CP7 A;  1CKA A;  2F1L A;  1R0C B;  1ZX6 A;  1G3T A;  2JS0 A;  5CKH A;  5LJ3 h;  4M75 D;  3G6E Q;  3ME9 A;  4M7D B;  4C8Q E;  3QDF A;  2AHJ B;  3OSS C;  4HVU A;  4E6R A;  1QVF A;  2PUK B;  3EH1 A;  1KQ2 A;  2QTV A;  2FG0 A;  4GLM A;  2JS2 A;  1RAI B;  3RKX A;  2YHT A;  1I4K 1;  1VQP T;  4JPB W;  4XTV A;  5IH2 A;  1BI0 A;  5GAM e;  1VQ7 T;  2VAS A;  3GP8 A;  4M75 F;  1UHF A;  3BE3 A;  3M56 A;  2IG0 A;  5LJ5 e;  2OTJ Q;  1VUB A;  4IUP A;  4ZGE B;  5FWC A;  3EAE A;  4R56 A;  2MCN A;  2A7Y A;  1VYV A;  3QBY A;  1FYN A;  3H0F A;  4C5I A;  2V1Q A;  2DIQ A;  1OU8 A;  3QHS A;  1UUE A;  5GAO r;  4NS5 A;  2XKO C;  4KRT A;  2K3B A;  4D6W A;  3I5S A;  2KYM A;  2MI6 A;  1JJ2 P;  1M1K R;  3PE0 A;  2CUD A;  1QWF A;  2GGR A;  1X2Q A;  1BI3 A;  4RTX A;  1PRM C;  2XID A;  2E5K A;  5KCO A;  4E7Z A;  2HKN A;  4M77 B;  1VQK Q;  1WA7 A;  3OYM A;  2IIM A;  3OW2 A;  1YHQ A;  1IRE B;  2X3W D;  3ER0 A;  2QDY B;  1VQN T;  1D0X A;  3QSU A;  3GPL A;  2DJZ A;  1YIT Q;  3UWN A;  2F5T X;  2PVO B;  4L59 A;  2E4H A;  4M7D E;  4FL6 A;  2A0F B;  2HZY A;  6AT1 B;  1DJ7 B;  3OQ5 A;  4XK8 E;  2HSP A;  2V8I A;  4M78 E;  1KG1 A;  4JLI A;  3EG9 B;  3CCM Q;  3V8J A;  3CC2 A;  1VQM T;  1WIE A;  4PFZ A;  1VQM A;  1G5V A;  2FZG B;  4BI4 A;  4C92 E;  3SDZ A;  4GLK A;  3OMG A;  4XU1 A;  2E70 A;  3CPF A;  3OYK A;  2LC4 A;  1NE8 A;  1VYT A;  3M57 A;  5GAM h;  1KQS A;  1QQJ A;  2CP0 A;  5IN1 A;  1JRI A;  1QCF A;  3ZL7 C;  1C0M A;  4PFP A;  2RHI A;  2PTK A;  3VS2 A;  1VQK A;  1VQK T;  3PVQ A;  2DM1 A;  2KR3 A;  5IT9 E;  1QWE A;  4XU3 A;  2JTM A;  3VS4 A;  1WNL A;  1M9S A;  4KGV B;  1MGQ A;  2YRD A;  4A4G A;  5GAM g;  3CCE A;  3M0P A;  1GCQ C;  1OZ2 A;  1LCK A;  3HTR A;  2J05 A;  2V8K A;  1RAD B;  2RM4 A;  1QVP A;  3R6O A;  5L23 A;  2DLP A;  4N0A C;  5LJ5 h;  1D09 B;  2MF2 A;  2F5K A;  2VGM A;  1K73 C;  3CCV T;  4XQ3 A;  4XTU A;  1I81 A;  2ZPG B;  4ATO A;  4IKF A;  2L5Q A;  4MDX A;  1GL5 A;  3CC7 A;  1UE9 A;  2CYZ B;  2LQN A;  2HAX A;  2KAF A;  4WCI A;  3MO8 A;  3BW1 A;  1EZZ B;  1JJ2 A;  1VQ5 A;  1HK9 A;  1N8R U;  3L1A A;  1H8K A;  2X3X D;  4C92 B;  3TEE A;  2HQX A;  3V8K A;  2KRM A;  4EIK A;  3G6E T;  2VXE A;  2L0A A;  1VYU A;  5LJ3 f;  1OPK A;  2D1X A;  2O88 A;  1TU0 B;  4LUE A;  2QXF A;  4C5H A;  2QTX A;  2O2O A;  1RI9 A;  4OF1 A;  4QQG A;  4LDW A;  1V1C A;  2DL7 A;  1VIF A;  3HL8 A;  2K5I A;  4RTU A;  3CCR T;  3EH2 A;  3C0C A;  5D7U A;  1KIK A;  2DE0 X;  4XU2 A;  5ECA A;  5EG2 A;  1M8M A;  3M55 A;  1YJ9 A;  3PMT A;  1W6X A;  2OTL Q;  2PNI A;  3A8G B;  2ZAE A;  2DX1 A;  1BI1 A;  4PJO F;  2M51 A;  1FX7 A;  1AEY A;  4NL3 A;  1E7O A;  2KK4 A;  1KHI A;  1Y7X A;  5CKB A;  3G4S Q;  1TUC A;  2J7I A;  2KY9 A;  5GAO q;  1TUD A;  2CP5 A;  4XTW A;  2AK5 A;  3CME Q;  3MJX A;  2F2W A;  2LP5 A;  4J9H A;  4XTX A;  1M2V A;  3VS0 A;  4OB3 B;  2CUB A;  2LCS A;  2D0Q B;  5GMK l;  3RR6 A;  5CO7 A;  4IUT A;  1IB8 A;  5L8R E;  1IZ6 A;  1SF9 A;  4J6X A;  1QP2 A;  2DTH A;  4Q5W A;  1VQP Q;  1RLQ C;  1VOM A;  4HA8 A;  1W1F A;  2QGG A;  4WTO B;  2XIC A;  2R57 A;  3RKW A;  1O9S A;  5IHK A;  1LNX A;  2KYB A;  1BU1 A;  4DBH A;  3G71 Q;  1YWO A;  2RF0 A;  3LW5 E;  2A36 A;  4UC4 A;  3L2Z A;  1K8A R;  5CCA A;  4N4I A;  2RQW A;  4IUV A;  1PC0 A;  1B7T A;  2DZ9 A;  3H0I A;  4QKU A;  2QEX A;  2YSQ A;  2QEX Q;  3MP6 A;  3VRZ A;  2JW4 A;  3DB4 A;  3PIP A;  3OYD A;  1GFD A;  5I22 A;  3I56 T;  5CKD A;  4QW2 A;  1KSW A;  1OYX A;  2QI2 A;  4KUI A;  5DY9 A;  1JQQ A;  4EMK C;  4E7I A;  3GNG A;  4KUL A;  1TOV A;  1UFF A;  2DBM A;  3QUI A;  1NBE B;  4OGC A;  2V1R A;  5LJ5 d;  1PKT A;  1D0Y A;  3OSV A;  4M7A A;  1VQ8 Q;  2WSC E;  2CT3 A;  4FW1 A;  1M1F A;  3EG9 A;  2AZS A;  4RCC A;  1ZQ1 A;  2Y90 A;  1A0N B;  2AZV A;  1QVG P;  4LNP A;  3OS0 A;  2QQS A;  2E3I A;  1HJD A;  4DOW A;  1QP3 A;  3RUX A;  3CCR Q;  1WHG A;  3VS6 A;  5GAN d;  3M54 A;  2D6F A;  1GCP A;  2EIF A;  3TVT A;  5IXB A;  3UDC A;  1OI1 A;  1K9A A;  2AKL A;  4LD9 K;  2V8J A;  4KGZ B;  2YWW A;  4PJO E;  2QK0 A;  4NL2 A;  3LGL A;  1SRL A;  1UTI A;  2CZ1 B;  1ZLM A;  1NJI C;  2DKG A;  2QYZ A;  4BB7 A;  1K0S A;  3SEM A;  3ZBD A;  5IHN A;  2DEU A;  1AWJ A;  3CCJ A;  1BYM A;  2RNA A;  3NPF A;  4M78 C;  4J7I A;  2NUT A;  2H8H A;  1OEB A;  4C0D B;  2IPO B;  3L2U A;  3CCJ Q;  2EW3 A;  4M78 G;  3LYI A;  2VKN A;  4EPC A;  1RAB B;  3I56 Q;  4B6M A;  1B34 A;  2CSQ A;  1QCN A;  1YI2 A;  4KBM B;  3JCM Q;  4CC3 A;  5GAO p;  2QQA A;  2YRV A;  2DEQ A;  3CME T;  1K9M U;  4E7J A;  3I5R A;  3QDR B;  4LUD A;  2VC8 A;  2B8A A;  2LZ6 B;  1Q82 C;  2CH4 A;  3G4S T;  4J9C A;  4ZN1 A;  1NG2 A;  2RMO A;  2KMT A;  4N4G A;  1Y07 A;  1ZBX A;  2EWN A;  2LCL A;  3M59 A;  2KSS A;  1AOJ A;  1S72 A;  1VQ4 A;  2DYB A;  5GMK h;  4OB1 B;  3SHW A;  1PNJ A;  4M7D A;  3CBO A;  2QA4 Q;  1ZSG A;  3HHT B;  4Z8A A;  3JCM f;  4JDS A;  2RQV A;  1C6V X;  2KRO A;  2NYS A;  2JVV A;  1ZSZ B;  4F7U F;  1R77 A;  1WXU A;  2LNH B;  2IVW A;  5GAM j;  2DBK A;  2JXB A;  3MEA A;  1N27 A;  3JV3 A;  2FO0 A;  4FM4 B;  3MHX A;  2V26 A;  1CSK A;  1X69 A;  2HQH A;  1YP5 A;  1Y96 A;  2JJ9 A;  3MEW A;  3FIF A;  4QQD A;  1BB9 A;  2EQJ A;  5GJW B;  1UGQ B;  2GNC A;  1TUG B;  1WHM A;  2EQI A;  2KQW A;  3EG1 A;  4OMM A;  3GLX A;  4OMF B;  3CEY A;  1QCO A;  2C0I A;  2WSE E;  4Y92 A;  3P8D A;  3S3N A;  5KCH A;  1YJ9 Q;  1QLY A;  3CCL Q;  2DD4 A;  3O5Z A;  1U1T A;  1G3Y A;  1S72 Q;  2JTE A;  3RES A;  1TTH B; 
#chains in the Genus database with same CATH homology
 2PVO B;  3QZ9 B;  4L59 A;  4M7D E;  4FL6 A;  1YIT A;  3X20 B;  2CZ0 B;  1DJ7 B;  3O8V A;  3VUB A;  3OQ5 A;  4MZT A;  4XK8 E;  1N9R A;  3NTH A;  2V8I A;  4M78 E;  4RG8 A;  1KG1 A;  4PL6 A;  3L2V A;  4JLI A;  3ASK A;  1WJQ A;  2P4T A;  4ZGD B;  3OYA A;  4MZM A;  2RJD A;  3V8J A;  2G3R A;  3OA6 A;  2RHZ A;  3A8M B;  1KD1 U;  5CKF A;  1VQ5 T;  1UB4 A;  2DAQ A;  5FLX E;  5DLO A;  4LDU A;  5CKE A;  3JCM h;  3CXC A;  4C5E A;  3HRT A;  3JB9 D;  1YJW A;  4M7A E;  1BI2 A;  3A5Z B;  3CC2 A;  1M1K U;  1VQM T;  3NTK A;  1KC8 C;  3SFM A;  2GCX A;  2GFU A;  3MET A;  4XAX B;  5KE2 A;  3FEO A;  4FIB A;  4JRI A;  4PLI A;  3CC2 T;  1VQM A;  2R58 A;  1VQ6 A;  3CME A;  2KVQ G;  1B34 B;  2DXU A;  3S6W A;  2RD1 A;  1UGR B;  3V8L A;  1WJR A;  1WGS A;  3MEU A;  4NOY A;  4BI4 A;  3I56 A;  4C92 E;  3LWH A;  1K8A C;  3SDZ A;  4MZP A;  2LDM A;  2HD0 A;  3JRZ A;  4A4K A;  5GAO m;  3OYF A;  4GLK A;  3OMG A;  1Q7Y C;  4M7D C;  2PU9 B;  1Y71 A;  4XU1 A;  4PJO G;  2Y4Y A;  3JCM V;  3OYJ A;  3G4S A;  3CCU A;  2E70 A;  4BE1 A;  4E7L A;  3CPF A;  3OYK A;  3WVD B;  1VQL T;  2LC4 A;  4JJN K;  1NE8 A;  3H6Z A;  3M57 A;  3I55 T;  3FB9 A;  3X25 B;  1KC8 U;  1WQW A;  5GAM h;  4ZTJ A;  3LGF A;  1Q7Y U;  2RK2 A;  3VYH B;  1KQS A;  1YCY A;  5IN1 A;  3M58 A;  1JRI A;  4FU6 A;  4JLG A;  5GAN h;  3CMA A;  1QVF S;  5GAN f;  4E7K A;  3S3M A;  2VXF A;  2RHI A;  2XD0 A;  2K4Y A;  4Z02 A;  4R55 A;  1NJI U;  3OYE A;  1FWZ A;  1KQ1 A;  1VQK A;  5GAN 2;  5FU6 C;  4M77 C;  4M78 A;  5HY6 A;  1YJ9 T;  2E5Q A;  4JRK A;  4KT0 E;  4JS4 A;  1VQK T;  4WF2 A;  1VQ9 T;  3L2Q A;  5IT9 E;  4XU3 A;  4TVR A;  5GMK i;  2JTM A;  1Q86 U;  4E47 A;  5HK3 A;  1WNL A;  2GQV A;  5CQX A;  5GAN 3;  2EFI A;  3PTA A;  4M7A B;  1M9S A;  2XDB A;  1MGQ A;  2E12 A;  2R5A A;  2GFA A;  3OS5 A;  1YIJ A;  2EJG A;  3J7A F;  1K8A U;  2YLC A;  3KXT A;  4BI8 B;  3PNW C;  2JN0 A;  4A4G A;  5GAM g;  3CPW A;  3HFN A;  3CCE A;  2BKD N;  4QVZ A;  1W4S A;  2EQK A;  5GAM d;  3OS1 A;  4ZTF A;  2K57 A;  1OZ2 A;  4BDZ A;  1QVG A;  5C6S A;  2C06 A;  2CGH A;  2V8K A;  3M53 A;  4F7U E;  5LJ5 f;  4JS5 A;  3AHU A;  1O75 A;  2RJF A;  2RM4 A;  1QVP A;  3R6O A;  4M7D F;  5FU7 B;  4X9C A;  2OTL A;  2QA4 A;  1JBM A;  5LJ3 j;  5GAN j;  3CD6 T;  4N0A C;  4M77 D;  5LJ5 h;  5LJ5 g;  3A8O B;  4B9W A;  2MF2 A;  3A8H B;  2QA4 T;  2F5K A;  2VGM A;  5C0M A;  1LOJ A;  5J26 A;  1K73 C;  1K9M C;  3CCV T;  4XQ3 A;  4XTU A;  3UT1 A;  1I81 A;  2OTJ T;  1M1K C;  5LJ3 g;  3X24 B;  2ZPG B;  4ATO A;  4IKF A;  2WAC A;  1WQ7 A;  3RER A;  5GAO n;  4M77 E;  1YIT T;  4PJO C;  2L5Q A;  5FRM A;  4MDX A;  2A3L A;  3J80 E;  3CC7 A;  2DO3 A;  2DTI A;  1X01 A;  4O5V A;  3OMC A;  1VQN A;  2X4Y A;  1VQO T;  2E64 A;  3OYC A;  2XK0 A;  2FYK A;  1VIE A;  3TCJ A;  5HK0 A;  2CYZ B;  3JCM J;  3PGG A;  4VUB A;  2HAX A;  2RA2 A;  4HKE A;  2KAF A;  4C0Z A;  2CS7 A;  4C8Q D;  1UEB A;  4M7A C;  3MO8 A;  3OW2 S;  3BW1 A;  4BD3 A;  4OP0 A;  5GAN e;  3JCM d;  4M75 G;  1JJ2 A;  1PSE A;  1HK9 A;  2ZPF B;  1N8R U;  3L1A A;  3Q1J A;  1VQ5 A;  2PUO B;  3G6E A;  4C92 B;  3TEE A;  2HQX A;  3V8K A;  4ELZ C;  1H3Z A;  2ZPI B;  3E1S A;  2L8D A;  3E9G A;  5AYF A;  2XDD A;  1YI2 T;  3OYB A;  2DXC A;  3EFR A;  3G6E T;  3VYG A;  3L2W A;  2VXE A;  3QJ6 A;  4CI0 C;  5CQY A;  3CCM T;  5CIU A;  4RMO A;  4PJO D;  5I2S A;  4J83 A;  5LJ3 f;  2QQB A;  2KDS A;  3QYG B;  4ZGJ B;  2XI9 A;  4BDY A;  3A8L B;  1BKB A;  1Y96 B;  2QXF A;  4Y28 E;  3UWN A;  5CR2 A;  1M8V A;  4C5H A;  2HNI A;  2QTX A;  5GMK e;  2Y4X A;  5CAI A;  1VQL A;  3ZEH A;  2LQ8 A;  2O4X A;  4N4H A;  4OF1 A;  1P92 A;  4QQG A;  3VJP A;  5GAN 7;  5GMK m;  1S72 T;  1BIA A;  1VQ7 A;  4LDW A;  4M7A F;  4OB0 B;  1VIF A;  3HL8 A;  2K5I A;  4QVD A;  3CCR A;  2RI2 A;  5CVI A;  3RMQ A;  3SB2 A;  5GAN 6;  2O4X B;  2EAY A;  5LJ3 e;  4BAC A;  2GF7 A;  1H64 1;  2RHU A;  3CCL T;  3CCR T;  3URG A;  2QQR A;  2RHY A;  3SWN B;  1VQ4 T;  1M90 U;  1W2B A;  3P8B B;  3CCL A;  4XU2 A;  5EG2 A;  3OYY A;  3CMA T;  4LD6 A;  3M55 A;  3WVE B;  3VKI A;  3JAM E;  3PMT A;  3CC4 T;  1YJ9 A;  3PFS A;  3GIB A;  2LNV A;  2LQK A;  3RKY A;  2E1H A;  1NPP A;  1VQ9 A;  2H3J A;  3C12 A;  4MMK A;  4JRQ A;  3A8G B;  4C92 D;  4OGE A;  2D9T A;  1LJO A;  4J8O A;  1BI1 A;  4FT2 A;  4PJO F;  5GAN 5;  2M0O A;  3T9N A;  4E7H A;  1R8O B;  2JOY A;  1FX7 A;  2DD5 A;  2E6Z A;  5GAN 8;  4NL3 A;  2KK4 A;  1KHI A;  1Y7X A;  2DPP B;  5CKB A;  5J39 A;  4A4E A;  3HKS A;  2M16 A;  4EDU A;  2KY9 A;  5GAO q;  3BFM A;  4LDV A;  2L3R A;  3GOX A;  1WPY A;  4XTW A;  1YIJ T;  3OYH A;  1M5Q 1;  4M78 D;  4XTX A;  4OB3 B;  4OVA A;  3LWI A;  1V29 B;  3QKJ A;  4X9D A;  2WSF E;  2HQE A;  3GF5 A;  2EQM A;  3FDR A;  1I8F A;  4M7D D;  2FHD A;  4BI3 A;  3CBP A;  4BE2 A;  1Q81 U;  2ZCF B;  2D0Q B;  4M75 B;  5GMK l;  2X4X A;  2DXT A;  2OTJ A;  5CO7 A;  4IUT A;  3DB3 A;  4RKU E;  5GMK j;  3PIO A;  5L8R E;  1IZ6 A;  3CCJ T;  4J6X A;  1QP2 A;  2P0Q A;  2DTH A;  4Q5W A;  3CC7 T;  1VQ8 T;  4HA8 A;  5LJ5 j;  3CCV A;  2VV5 A;  3X28 B;  2LT4 A;  2PQW A;  5LL6 S;  2XIC A;  2R57 A;  1YBY A;  4YTL A;  3RKW A;  3QPH A;  1OZ3 A;  1O9S A;  2FB7 A;  1LNX A;  1Q81 C;  3PMI A;  3G71 T;  3CCS A;  2JNG A;  3INZ A;  1JJ2 S;  3JCM e;  5M9O A;  4A4H A;  1QVG S;  3LW5 E;  4ME7 A;  2EKO A;  3QYH B;  4UC4 A;  4C8Q F;  4CRI A;  4EMH A;  4JRP A;  3H8Z A;  2X4J A;  3L2Z A;  4JUV A;  3VV0 A;  4C0F A;  4L6V 5;  4ELY C;  1AHJ B;  5CCA A;  4N4I A;  4IUV A;  4Y91 A;  4M75 A;  1X75 C;  4QVC A;  4A53 A;  2DZ9 A;  2EYQ A;  5DLQ E;  2DIG A;  2EQU A;  2ZZD A;  5D6Y A;  5I21 A;  5KE3 A;  4HT9 A;  3HRS A;  4M77 F;  5HKC A;  5DM7 R;  2RI3 A;  2VYT A;  2RJC A;  2QEX A;  2PVD B;  4F7U B;  3MEV A;  4EMG A;  3MP6 A;  4RG2 A;  3DB4 A;  3HSB A;  3PIP A;  3QZ5 B;  3OYD A;  1RI0 A;  3I56 T;  3HRU A;  3JB9 J;  4PLL A;  1N8R C;  5CKD A;  4PNO A;  4QW2 A;  4HCB A;  2ZPB B;  1VQ6 T;  4FT4 A;  1KHC A;  2DK3 A;  1OYX A;  2YLB A;  2RB6 A;  5A2Q E;  3QO3 A;  4C8Q C;  2QI2 A;  4KUI A;  3CBM A;  5DY9 A;  3RMS A;  3CCQ T;  3RIR A;  1K73 U;  3M9Q A;  3TU4 K;  3BY7 A;  3E9F A;  2DVE A;  2E41 A;  3BDU A;  3EFS A;  4EMK C;  3I55 A;  2X4W A;  3SD4 A;  4E7I A;  3GNG A;  2LRQ A;  4KUL A;  5FRN A;  1KQS S;  1XTD A;  2FL7 A;  3CCU T;  3L2R A;  3QUI A;  5A0G A;  2ZPH B;  4QQ6 A;  4OGC A;  5IAY A;  5J3B A;  2VGN A;  3OB9 A;  2HBP A;  3OBW A;  4L5G A;  3G7Z A;  4C5G A;  2PVG B;  5LJ5 d;  3OSV A;  5FU6 B;  4FSX A;  4M7A A;  4C92 C;  3JCM g;  3QJY A;  4C92 A;  5GAN 4;  2WSC E;  2RI5 A;  4RCB A;  5KH6 A;  2DZC A;  3FC3 A;  2OAU A;  1M1F A;  4RCC A;  1ZQ1 A;  2Y90 A;  3JCM X;  4XTY A;  1M90 C;  1I5L A;  1QW1 A;  3QII A;  4M77 A;  4EMK A;  3OS0 A;  3L42 A;  2QQS A;  1G5V A;  4DOW A;  4M78 B;  3JB9 I;  1QP3 A;  3RUX A;  3J81 E;  3QXE B;  4A4F A;  4C0D C;  4BE0 A;  2QQ9 A;  3LH0 A;  2JZ2 A;  4J6W A;  4DA4 A;  1HXD A;  2LTO A;  5GAN d;  2XHC A;  3M54 A;  4M75 E;  2D6F A;  3JB9 H;  1M1G A;  2F69 A;  3VU3 C;  2EJF A;  4HCC A;  4KUD K;  4LDX A;  2I2L A;  2EIF A;  2CKK A;  3JB9 F;  4N0A A;  3CCE T;  1G3S A;  4J7F A;  2DXB A;  3UDC A;  3NTI A;  4IUU A;  1OI1 A;  2DTO A;  4XTZ A;  3WXM B;  3C95 A;  5FU7 C;  2P0K A;  2ZGW A;  4LD9 K;  4M77 G;  3X26 B;  2V8J A;  3TRE A;  2LX9 A;  3BDL A;  4IUQ A;  4PJO E;  3HPW A;  3OYN A;  3F70 A;  4NL2 A;  3LGL A;  3S3O A;  4C0G A;  4BY6 C;  2CZ1 B;  1SSF A;  4DOV A;  1Q82 U;  2MWP A;  4C92 G;  2EJ9 A;  3NFC A;  2DKG A;  1NJI C;  4BB7 A;  4V2S A;  2R5M A;  3JCM c;  3C94 A;  3M4Y A;  2OTL T;  2MAM A;  3CD6 A;  3ZBD A;  1NZ9 A;  3V7S A;  2BIV A;  1XOV A;  3KUF A;  2K5F A;  2M9U A;  2X35 A;  4F7U G;  4M75 C;  2CZ6 B;  3CCJ A;  2RHX A;  1EIF A;  4M7A G;  3G71 A;  3CCS T;  1VQO A;  1BYM A;  1Q86 C;  4II1 A;  4C8Q G;  3CXC S;  2K5L A;  4M78 C;  4J7I A;  3OS2 A;  4C0D B;  4X34 A;  2MMP A;  3KBG A;  3GNF B;  3L2U A;  3UPU A;  1GXI E;  3JSC A;  4IUR A;  3N5B B;  4J6Y A;  2P0P A;  3CPW S;  1N9S A;  3OYI A;  4M78 G;  3LYI A;  2XDP A;  4EPC A;  1PSF A;  3ZFJ A;  3LX7 A;  1YJN A;  3HP9 A;  1B34 A;  2LVM A;  3MP8 A;  1YJW T;  4HT8 A;  1YI2 A;  1FXX A;  2L89 A;  4KBM B;  4LDY A;  5CK9 A;  2QEX T;  5A0L A;  3JCM Q;  1YJN T;  1G3T A;  5GAO p;  3FLG A;  1ZHI A;  5CKH A;  2QQA A;  2YRV A;  2DEQ A;  5LJ3 h;  3CME T;  4E7J A;  1K9M U;  3QDR B;  4M75 D;  4O6J A;  3DLL A;  5I2M A;  1MHN A;  3ME9 A;  2M1H A;  4M7D B;  4C8Q E;  2VC8 A;  2B8A A;  4M78 F;  3JCM b;  3C4S A;  2AHJ B;  3OSS C;  5GAM f;  3CCM A;  3CCQ A;  1D3B B;  1Q82 C;  4PJO B;  4GY5 A;  3G4S T;  2LT1 A;  3JCM P;  1N6A A;  2PUK B;  4ZN1 A;  2NLU A;  1QVF A;  1UGS B;  3M5A A;  1KQ2 A;  1XQH A;  2KMT A;  4N4G A;  1Y07 A;  1ZBX A;  1NPR A;  2EWN A;  3DLM A;  3RKX A;  2LCL A;  1I4K 1;  2YHT A;  1VQP T;  4XTV A;  3M59 A;  5GAO l;  2KSS A;  2XU8 A;  1BI0 A;  5GAM e;  5GAN g;  1VQ7 T;  1S72 A;  3GP8 A;  1VQ4 A;  2E10 A;  5GMK h;  1VQP A;  3M4G A;  3MCA B;  4OB1 B;  2MWO A;  4M75 F;  1RL2 A;  2RO0 A;  2JUF A;  3E19 A;  2E6N A;  1U1S A;  3M56 A;  4C92 F;  2IG0 A;  5D6X A;  1M4Z A;  5LJ5 e;  1VUB A;  4IUP A;  2K3X A;  1BIB A;  4J5Y A;  1XNI A;  3EAE A;  4C8Q A;  4ZGE B;  3V7R A;  3HFO A;  5A0D A;  3CBO A;  4R56 A;  1W2B S;  4M7D A;  5LJ3 d;  3HHT B;  3JCM f;  2A7Y A;  4JDS A;  3SWN A;  4BY6 B;  3QBY A;  1WJS A;  4OB2 B;  3SWN C;  3CC4 A;  2JTF A;  4C5I A;  2JVV A;  3OYL A;  2DIQ A;  2RK1 A;  3DKM A;  4F7U F;  1G3W A;  2CZ7 B;  3QHS A;  5GAO r;  2IVW A;  5GAM j;  3JCM W;  2K3Y A;  4NS5 A;  2XKO C;  1KD1 C;  3V7C A;  3FJP A;  3QG1 A;  3MEA A;  1N27 A;  4P5N A;  5D6W A;  3OY9 A;  2FVU A;  3MHX A;  4FM4 B;  4EMK B;  4B9X A;  4D6W A;  4DQ2 A;  1JB0 E;  1Y96 A;  2K2V A;  2E65 A;  2MI6 A;  4BUG A;  4ZN3 A;  4M7D G;  3MEW A;  4C8Q B;  3FIF A;  1BI3 A;  2ZPE B;  4QQD A;  2EQJ A;  1UGQ B;  2KQW A;  2RJE A;  3GLX A;  4OMF B;  3CEY A;  2WSE E;  4PKC C;  2XID A;  4F7U A;  4HCZ A;  5KCO A;  3P8D A;  4M77 B;  4A54 A;  1U8R A;  3S3N A;  3PT9 A;  1YHQ T;  3LLR A;  4MDW A;  2RH2 A;  5KCH A;  3OYM A;  3OYG A;  3JB9 G;  4M7A D;  3FRN A;  2VUB A;  3OW2 A;  1VQ8 A;  2DD4 A;  1YHQ A;  2XG8 D;  2LCC A;  3VUZ A;  3MP1 A;  1IRE B;  3OBY A;  3P8H A;  1U1T A;  3ER0 A;  2QDY B;  4MML A;  5FRO A;  2BUD A;  1D3B A;  1G3Y A;  3GPL A;  2DJZ A;  1VQN T;  3QSU A;  4PJO A;  1X6O A;  1TH7 A;  2O01 E;  3RES A;  4XU0 A;  1UGP B;  2F5T X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...