2DXCA

Recombinant thiocyanate hydrolase, fully-matured form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
PVWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiocyanate hydrolase subunit alpha
publication title Structural Basis for Catalytic Activation of Thiocyanate Hydrolase Involving Metal-Ligated Cysteine Modification
pubmed doi rcsb
source organism Thiobacillus thioparus
molecule tags Hydrolase
total genus 27
structure length 119
sequence length 119
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxcA00
2PU9B 1IREB 2WSCE 3WVDB 1UGPB 2ZZDA 1QP2A 2CYZB 1UGQB 4RKUE 3A8OB 2WSEE 2DPPB 3A8HB 2ZPHB 2PVGB 2CZ1B 4OB1B 2PVOB 3X25B 3QYGB 4XK8E 2ZCFB 2PUOB 1JB0E 3LW5E 2AHJB 4ZGDB 1PSEA 4OB2B 2CZ0B 1V29B 5L8RE 4ZGEB 2QDYB 3QXEB 2PVDB 3QZ5B 4L6V5 4OB0B 1AHJB 2ZPGB 2CZ6B 3VYHB 3VYGA 2CZ7B 4FM4B 3A8MB 1DJ7B 2DXCA 3X26B 2ZPEB 3A8LB 3QZ9B 3X28B 2DXBA 2DD5A 4ZGJB 2WSFE 2D0QB 2ZPBB 3X24B 2O01E 4KT0E 3A8GB 1UGRB 2DD4A 4Y28E 2ZPFB 3HHTB 3WVEB 4OB3B 1UGSB 3X20B 1GXIE 2ZPIB 2PUKB 1QP3A 3QYHB 1PSFA
chains in the Genus database with same CATH superfamily
1WJRA 4JLGA 2OTLQ 3CC7T 1TOVA 2ED0A 2B8AA 3OYHA 1UGQB 1OI1A 2JT4A 1IB8A 3A8HB 3MJXA 1MNEA 1V76A 2W0ZA 2OTLA 4N4GA 1UDLA 2E65A 4RG8A 3OS1A 4XTYA 1YHQQ 5CO7A 2LX9A 4J9HA 3GNFB 1D0XA 5IXFA 5DM7R 2E5QA 4A4EA 4PJOB 4ZGDB 5D6WA 3IQLA 5LJ5f 3EH2A 5GJWB 4DA4A 2M9UA 1KD1C 3JB9H 5FU6B 1M90C 2KBTA 2QEXA 1ZLMA 1KG1A 3CCJQ 1N8RC 1MUZA 4JJNK 2CKKA 5A0LA 1NM7A 2ZAEA 1EX4A 2FPFA 5GAOr 2O88A 1PD0A 4NS5A 2EQKA 5DLOA 1IHWA 4HXJA 1NJIR 5DY9A 4EDUA 1QLYA 3CCJA 2VB6A 2GFAA 1P92A 5GAN5 1DJ7B 1VQ4T 1G3YA 2AIRB 2E5KA 3VS0A 3EG3A 3OYCA 3PTAA 3I35A 5IN1A 4C5EA 1K8AC 1MMGA 3QZ9B 3EHRA 3RBBB 4PJOF 3LWHA 3JCMP 2O01E 2VKNA 2P84A 5I2SA 2FL7A 2RF0A 3G4ST 4C92D 5I22A 3PT9A 3CCRT 5GAOm 1U1TA 3MPUB 3QWYA 2L5QA 2HQHA 4A4FA 5KYYA 2EJGA 1SRMA 1BI0A 3ME9A 2X3XD 4M77C 1KK7A 2A3LA 2M1HA 1HSQA 1LOJA 2VGNA 1M8MA 2RQVA 3OSVA 1NEGA 1S72Q 5GAN3 8ATCB 3D7SB 5KYWA 2MOXA 4BDZA 2KNBB 2BZYA 1KC8R 1Q82U 1S72A 4PJNA 3JV3A 3OYDA 4KBMB 1M1KC 1U06A 4FYYB 3CCVQ 3EGXB 4L59A 3CXCP 2K5LA 1JJ2P 3LX7A 3P8DA 5GAMh 1X6BA 3SHWA 2EJ9A 3L1AA 3G7ZA 1I1JA 3CCET 3E2UA 2H8HA 2GTOA 1SHGA 4IIMA 5KE3A 1VA7A 5J3BA 1ZSZC 1R0CB 1MGQA 2BE7D 4IUQA 3URGA 2DBKA 5LL6S 3MEVA 3FJPA 4R0KA 2EYZA 3QBYA 2IVWA 3J80E 3P8HA 2QA4Q 4A63B 4BI3A 1GL5A 3RKXA 1OULA 4BD3A 2V1RA 1BKBA 1UHCA 2E4HA 2QTXA 1IRXA 3OW2A 1K73C 1BI2A 2COWA 4MZMA 3LWIA 4M75B 2QA4A 4J9DA 3M54A 2DD5A 1OPKA 2D0QB 2ZPBB 4KT0E 1ZA2B 2DD4A 2DL8A 5GMKm 4A4GA 3GLXA 1YCYA 1PD1A 2O4XB 2K7AA 2YXYA 3T9NA 4ZTJA 2JNGA 4OMQA 2EFIA 2DIGA 2RI2A 1RI9A 1HD3A 4E7ZA 2CP5A 2PUKB 2A0FB 5HKCA 2KK4A 3G6ET 1YI2Q 1VQ6T 1VQPT 1Q86R 4ANJA 2GCXA 2DL4A 2VVKA 9ATCB 3JCMc 3SB2A 3GP8A 3INZA 4M75F 1QCNA 3LH0A 1KSWA 4XTUA 1HXDA 4C92C 1YI2A 1B07A 2K3XA 3NTKA 5IT9E 4NOYA 5AT1B 4OB1B 5EC7A 2W10A 1W1FA 4Z8AA 5GAMj 5GAOp 2RK2A 4PL6A 3CCLT 3M0QA 1XNIA 3REAB 4DBRA 2OTJA 2EBPA 1R0BG 5GAN7 5FWBA 4E7HA 4JRPA 1VQ5T 4FSSA 2XG8D 4PJOE 3CBMA 2CGHA 2DZ9A 2LNVA 1UJYA 1M2OA 4HT8A 1ZUUA 1AHJB 3LGFA 3M0RA 4Y92A 4BY6C 3H9NA 5GAOl 3MHXA 1YITA 4JLIA 4F17A 4FM4B 4J6YA 2K9GA 3KBGA 4E7LA 1M2VB 5IHNA 2MAMA 3X26B 4C8QG 2RHUA 3JCMQ 2E12A 4IUTA 2DF6A 2P4TA 4B9WA 2R57A 2F2XA 1VQ9Q 2B86A 1WA7A 4X9DA 5I11A 2YRCA 3GPLA 1QCFA 3JCMW 3HKSA 4AG1C 2RJDA 1VQ9A 3ASKA 4EMKA 2OJ2A 2VWFA 5J26A 3V7CA 4ATOA 2DJZA 1N6AA 2LJ3A 1VQKA 3QDRB 2DEUA 4IIOA 2HSPA 3ULRB 3TVTA 2NYSA 3OY9A 2XD0A 1CSKA 4LDVA 2L2PA 3CCUT 4BUGA 2M0OA 1XJWB 3SWNC 3FJ5A 2RHXA 1OZ3A 1WHLA 4N0AA 1GRIA 1B7TA 3NPFA 4Q5WA 4E7JA 1GFDA 3JCMX 1IGUA 3X25B 3OA6A 2XK0A 4JDSA 2MPXC 4M77B 1VQ8Q 2KRNA 1W2BP 1K9MU 1JXOA 5GANd 3QO3A 2QQRA 4KH0B 1VQMQ 4DEYA 2EYXA 2QK0A 1VQ8A 1VQNT 5L8RE 4ELYC 5HK3A 3GIBA 4XTWA 2F1LA 2JTMA 3M0PA 1YJNT 4ORZA 2DO3A 1Y96B 1WI7A 4HKEA 4D8DA 4LDUA 5KYUB 4WTOB 5GMKl 2DVJA 2PNIA 1K1ZA 3PMTA 2RN8A 4C5GA 2L3SA 3QJ6A 1KD1U 4M77F 2EQIA 1RLPC 1FXXA 4HA8A 3MKDA 4JZ4A 4A4KA 2FPEA 2K5IA 3I56Q 4X9CA 3ZL7C 1N9RA 2RHZA 2YT6A 1ZSZB 3CCST 1WZOA 2LQKA 3H0FA 3SEMA 3NFCA 3NTIA 3J81E 4JS4A 4HVVA 4M75E 5KCOA 1NE8A 4BB7A 1AZGB 1FWZA 2F5TX 1CKAA 1MMDA 1U8RA 4OGCA 3I55Q 2A7YA 1AZEA 1LVKA 2X9HA 1K8AU 1H3ZA 4FW2A 3I9QA 1WHKA 2FYKA 1K76A 5KYXB 3CCQQ 1QQJA 2DEQA 3VKIA 4E2FB 4KGZB 1JO8A 2MMPA 1YJ9A 1QP2A 2DETA 3A8OB 2HNIA 1M27C 4OMMA 1H92A 3TSZA 1Y07A 3M56A 2NUPA 3CPWS 4M7DF 1PHTA 5LJ3d 3Q1JA 1RADB 2DYIA 4II1A 2LTOA 2Y4YA 4R55A 4M78G 1JB0E 2P0KA 1IHVA 4C0DC 1J3TA 2VASA 2CUBA 2EQUA 1M8VA 4C92B 2MI6A 1D3BA 1U5SA 3JB9G 4C8QA 1KQ2A 2GQIA 1VIEA 4XU2A 1Q82R 4WCIA 2RK1A 4LD9K 1YIJT 4MMLA 1M1KU 2E1HA 4JUVA 2L8DA 2QG9B 1NJIC 4JPBW 2DERA 2X3WD 1I8FA 2NLUA 2OAUA 2MWPA 5GAMd 1KJWA 4OP0A 2QEXT 2FHDA 4PFOA 1YJWQ 1Y71A 2J6KA 4J5YA 3A98A 1FMVA 4BY6B 2JN0A 4C92F 2O9SA 5EG2A 1TXQA 2E41A 1TUGB 3TQ7P 1YJWA 3QPHA 1B3QA 4C0FA 5M9OA 3PIPA 3CCJT 4F7UB 1Y0MA 2XICA 1K73U 4QQDA 3A1PA 2DXUA 1YBYA 4BI8B 2Y90A 5IH2A 1T3SA 3QYHB 3G71A 2D8JA 3TSWA 1JJ2S 4ESRA 4Z89A 1GCPA 3NHNA 3SDZA 1HYOA 3RMQA 3BFMA 5CIUA 2RB6A 2D1XA 2FB7A 5FRMA 2DPPB 3M57A 3RERA 3OBYA 5HK0A 1D1AA 1G3SA 4DOWA 1M3AA 3CMAQ 5D6YA 1KC8C 4P5NA 2C0OA 2PTKA 4J7FA 4DBHA 4EPCA 2Y4XA 3KXTA 1I0CA 3JAME 1VQLQ 3L2QA 4M7AG 5GAN4 2V1QA 5FW9A 3OS2A 2J05A 4F7UF 3PNWC 1LNXA 1MMNA 1WHMA 2CZ0B 3CMAA 5GJVB 4M77E 4M7DD 1NPRA 1VQLA 2IIMA 2ROLA 3RESA 1YFNA 2PVDB 4QKUA 3GF5A 3L42A 5C0MA 4TVRA 1BCOA 4JJCA 3LLRA 4MZTA 2FPDA 3FLGA 4PLIA 2KVQG 2LCLA 2CP7A 2QQAA 3EFOB 1YHQA 2NUTB 2RI3A 3I5SA 1OX9A 3BW1A 2LDMA 3C95A 1BYMA 1ZA1B 1RAHB 3C94A 4KUIA 1OYXA 3CD6Q 1QVFS 2JS2A 1OOTA 4MZPA 4E7SA 4ZGJB 2DM1A 2WSFE 4FYXB 1TUDA 4LUDA 3CPWP 2ABLA 1UGRB 3CD6A 1BB9A 1RLQC 3GNGA 1NZ9A 2M51A 4LN2A 3EGXA 3JCMg 1UGSB 4ZN3A 2QGGA 1BI1A 4DBQA 3LYIA 4J9GA 2MWOA 2C0IA 1GCQA 1N5ZA 1S1NA 3FEOA 5D7UA 4MDWA 2AKKA 3R6OA 3M53A 5J39A 5GANj 5LJ3h 1UGPB 2ZZDA 3ZFJA 3EG9A 4M78A 4PJJA 1BK2A 1YCSB 1Q86C 1O9SA 4E47A 3OSSC 1YWPA 1QMCA 1PG5B 4C0GA 2DYBA 2K2MA 4J9CA 4CI0C 3PVQA 3OB9A 4QT7A 1AWWA 2A28A 2F69A 1VYUA 2O2OA 3EAEA 4E7KA 1NG2A 2EAYA 3EG1A 2K3YA 2E10A 1ZBXA 1I4K1 2AT1B 1AD5A 2I0NA 1KQ1A 3THKA 4ZGEB 2ATCB 2WACA 2CREA 1C6VX 3R6NA 3OYMA 5GANe 2O4XA 4D6WA 1GBQA 2ZPGB 3VYHB 1G3WA 4LDYA 2KRMA 1WXTA 1KQSS 4C92E 2V8IA 4XU1A 1QVGS 5KE2A 4PFPA 2YRDA 4C0DB 3UATA 4BACA 1WXUA 2BE9B 1OV3A 3CCVA 2OTJT 1H8KA 4EMGA 2VYTA 3E9FA 4LXCA 3X28B 3VJPA 4EMKC 4Z02A 3EHQA 2RJFA 3NMZC 3JCMh 4M7DC 2X4JA 2PZ1A 4PLLA 2XKOC 2RH2A 4OMPA 1Q81R 3M5AA 4M4ZA 1WFWA 1OU8A 4BI4A 3DKMA 2L89A 3MEWA 4GLKA 1VQ4Q 4MDXA 2LCSA 1C1AA 3CBOA 1YITT 3TCJA 3E19A 3TEEA 2R5MA 1G3TA 2EQMA 2XMFA 1W2BS 3M4GA 4BDYA 2ED1A 4FL6A 5I2MA 5LJ3j 1QP3A 1M1FA 5KYYB 5GANf 3OYEA 1VQ4A 1SG5A 1JQQA 5L23A 3G4SQ 3RR6A 5CAIA 2LQ8A 4ZNXA 4F7UE 5AYFA 4M7AA 2EIFA 2OX7A 2ROTA 4BE1A 3C0CA 5CCAA 3CEYA 3E9GA 4KGXB 2DMOA 5KYWB 1VUBA 2D0NA 1M2VA 1QVFP 2FO0A 1LPLA 4IURA 1B34B 3SFMA 2DILA 2MCNA 4CC7A 2LT4A 1RL2A 1WDXA 2DKGA 1VQKT 4UC4A 2QAZA 4OMOA 1QKWA 2FVUA 3M0UA 5FROA 5LJ3e 2EW3A 3VV0A 3DB4A 3OMCA 2CT3A 4OB0B 4A54A 2KSSA 2JS0A 3C4SA 3U23A 3VS1A 1W70A 3JB9F 1HK9A 5FU7C 1OPLA 4AT1B 4RTVA 2DE0X 1WJSA 4IUVA 3CMEQ 5IXBA 2VC8A 1MHNA 1I81A 2HL5C 3CCEQ 1K9AA 5GAN8 1NBEB 3EGUA 4CC2A 1VQ8T 4N4HA 2KYBA 3RDVA 3VS4A 1SPKA 3CMEA 2QXFA 2RQUA 3OYGA 1M1GA 3CCEA 2FG0A 2A08A 1W6XA 3HHTB 4JRKA 1Q7YR 2RQWA 2YWWA 2K4YA 4FT4A 4O6JA 3JCMV 2CP6A 2HD0A 5GMKh 1GBRA 4YTLA 5GAMe 1WGSA 2DRKA 4HVWA 4J9FA 2QI2A 2JZ2A 1ARKA 1X27A 2CYZB 3LH5A 5KH6A 4GBQA 1KQSP 3ZEHA 4FIBA 3PGGA 1QVGP 1SF9A 3L2VA 3AT1B 4RCCA 4FSXA 1QWFA 2BUDA 3PE0A 1G83A 1NEBA 2QQSA 3HP9A 3P8BB 1T0JA 5LJ5g 1RAGB 3UF4A 3G6EQ 3UWNA 3CC4Q 2RJEA 3CC2T 1VQPQ 1VQ6Q 2C0TA 2GF7A 4C8QC 2CP2A 2M0YA 1WXBA 1G2BA 1PSEA 2E3IA 4OB2B 4PJOG 3V8JA 1LJOA 1UJ0A 4XU3A 5GAN6 1YJ9T 3CC4A 1VQ6A 3SD4A 2G3RA 3WXMB 1BCMA 3I5RA 2HSEB 4JJBA 5GAMf 2K5FA 4PJMA 2CZ6B 2RQTA 3EFSA 2H3JA 3CCLQ 1AT1B 2MYSA 2V8KA 1NPPA 1X2QA 3H0IA 1KC8U 4M78D 1FMWA 1JEGA 3L2UA 4B6MA 4HT9A 2RPNA 5KYXA 1Q82C 3RKWA 3CXCA 3JB9J 1PC0A 1JJ2A 1WHHA 1VQ5Q 1SSFA 3EH1A 1VQMA 1UFFA 2CSIA 4A4HA 1YNZA 3JB9D 4OMNA 3FC3A 4RTXA 2QGFB 2E70A 8AT1B 5FU6C 2QYZA 4JRQA 1M5Q1 2L3QA 5FLXE 5GMKj 2CDTA 3OYFA 2CH4W 2BZ8A 2GNCA 6AT1B 1M90U 5CQYA 1WYXA 2YUNA 2HDAA 4BE0A 1ABOA 2K6DA 2PQWA 4OF1A 4Y91A 4AMCA 1EFNA 1RACB 3OYNA 1N8RU 1SHFA 1IREB 2WSCE 2VUBA 4M7DB 2H3EB 2L3RA 2DTOA 3CPFA 2KGTA 3I56A 2J6OA 2SRCA 4J9IA 4JJDA 3VS6A 2GBQA 1RAAB 2C06A 2OAWA 3TU4K 2P0PA 1RAIB 1EIFA 4ME7A 2FZKB 4N4IA 4AFZC 1OQKA 1IGQA 1AVZC 4RUGA 4NL2A 2JTEA 5CVIA 2R58A 3CCMT 4ZTFA 3I55A 3G71T 3PMIA 2BZXA 2DIQA 3OYKA 4A53A 1K0XA 2DJQA 3CCQA 4XQ3A 1Q86U 2DK3A 3QWXX 3HRSA 2JTFA 2GTJA 2GFUA 3QZ5B 4RTWA 3VRZA 3GOXA 2HL3A 4J6WA 2FRYA 2CSQA 2DL5A 1ZQ1A 1F1BB 2COZA 2KXDA 2M02A 3HPWA 4M7AD 3A8MB 3VS3A 1R8OB 5CKFA 1C0MA 1VQNQ 3EGDA 3QG1A 1YJNQ 4K11A 3CMAT 1WX6A 1N9SA 3X24B 3VUBA 2ENMA 2QQBA 1WQWA 4M75G 2OTLT 2EYQA 4XU0A 3VS7A 1GCQC 2YHTA 3HRTA 1YJNA 1IXDA 2YRVA 4J9BA 5FU7B 1WIEA 2LRQA 1I07A 2F2VA 1YHQT 3QUIA 4M78C 1TWBA 1D0YA 2KROA 1BU1A 2EYWA 1CKBA 1O75A 1SSHA 2YUOA 4HCKA 3OS0A 2RI5A 3CCSQ 1M3BA 2QASA 3OYAA 3CQTA 1OEBA 1Z9ZA 2YLBA 2JMAA 1VOMA 1W4SA 4PJOA 1UB4A 2X4XA 3JCMd 1IO6A 1MMAA 2DLPA 1QVPA 2HBPA 4EIKA 4BE2A 4ZN1A 4XK8E 2BIVA 5GMKi 2RM4A 1I5OB 2PUOB 3HFNA 3OW2P 2KXCA 1ZUKA 2A37A 3RMSA 4GLMA 1H3HA 1YWOA 2X35A 3FRNA 3M0SA 2RO0A 4RTZA 1VQ7Q 3RIRA 2VXFA 2SEMA 3QKJA 4X1VA 5IHIA 1TH7A 4HCZA 4R56A 1M4ZA 2GGRA 2EGAA 2CS7A 1VQ7A 1XOVA 3M9QA 3VYGA 3HL8A 1D3BB 4KRTA 2O31A 4C8QB 1W2BA 3RUXA 2YUPA 3V7SA 2KY9A 1VQOQ 3M55A 5GAOn 2ECZA 2E3HA 3OYJA 3OBWA 2DXBA 3SWNB 2LNHB 2MF2A 3EG2A 4RCBA 3QDFA 3HRUA 4DQ2A 4PNOA 1VQOA 1S72T 2EJFA 2LX7A 5DLQE 1YIJQ 2MIOA 1X43A 2G6FX 1IZ6A 2F5KA 1Q81C 4OB3B 3FB9A 4L5GA 3OYLA 2JUFA 1M30A 3GBQA 4OVAA 5A0GA 1RAEB 3HSBA 1YIJA 4M7AC 1AWXA 1PRMC 3UA6A 3MCAB 2E6NA 2KEAA 3CCVT 4C8QF 2QEXQ 4HCCA 2MK5A 1U1SA 2KQWA 3M0TA 2X4YA 3G1JA 2KYMA 2NWMA 5GAOq 5GAMg 2CZ1B 1UHFA 1FX7A 4M7DE 1PM3A 2J6FA 4PKCC 4KGVB 5A0DA 2ZCFB 1I5LA 1WNLA 2YDLA 2V8JA 3LW5E 1KIKA 2QA4T 2LQNA 4M77G 1OU9A 2COYA 3UPUA 1FMKA 3J7AF 2DRMA 3JCMb 2EVRA 4J7IA 3KFVA 2QDYB 3REBB 2XIDA 4LDXA 1ZX6A 5CKHA 3KUFA 1D1BA 1XTDA 3FDRA 2HCKA 4M75A 1E6HA 3CC7Q 3MO8A 5C6SA 4C0ZA 1ZBJA 2DXCA 3S3OA 4B9XA 3A8LB 1G8XA 4XAXB 2KT8A 4D8KA 4OMFB 3CC7A 2DAQA 1ZSGA 1ACMB 3L2WA 2KT1A 1YI2T 3CBPA 1Q95G 4CC4B 5HY6A 5HCKA 1BI3A 3MEAA 4LNPA 2E64A 1B34A 4M7DG 2A36A 1K9MR 3DLMA 4RTTA 1PNJA 3DB3A 1WQ7A 4AG2C 1Q7YC 2LMJA 4C5IA 2LCCA 1ZHIA 4CC3A 1EZZB 3WVDB 1BIAA 4RTYA 1NLPC 3CMET 1H641 4RKUE 2HBWA 4J8OA 1PKTA 2ZPHB 1GFCA 1UGVA 5I21A 5KCHA 3EG9B 4C8QD 3ZBDA 2KRSA 4M78B 2PVOB 2I2LA 1TS9A 2D6FA 1BBZA 1KD1R 1VIFA 3BDUA 3VS5A 1WJQA 4N0AC 3NTHA 1M90R 3S6WA 2AZSA 1X6OA 4LUEA 3CCRQ 1N8RR 4F14A 2EGCA 2JM8A 1U3OA 4GY5A 4J9EA 1E7OA 4DEXA 1UEBA 3MP6A 3G4SA 3QXEB 1VQ9T 1N27A 4IUPA 2NUZA 3CCRA 2Z0WA 3QIIA 4C92G 2DFUA 2DNUA 2KI7A 2KDSA 5LJ5d 1K8AR 2RHIA 2BTTA 2FZGB 2LP5A 4M78F 1QKXA 3H41A 1TTHB 1UE9A 2DVEA 4PJOD 2ZPEB 4RG2A 2VV5A 5CR2A 3M59A 2QDLA 3OYIA 1YN8A 4J83A 4C8QE 3CC4T 3EG0A 4F16A 3JRZA 3JSCA 2JMCA 2ZPFB 4LD6A 1D1CA 2FEIA 1TU0B 2D8HA 2OTJQ 2AK5A 1OZ2A 4QVDA 3MEUA 2ZPIB 3F70A 2DBMA 4F7UG 1PSFA 2EPDA 2VXEA 2PU9B 3L2ZA 2EKOA 1VQMT 2D9TA 1UG1A 4QVCA 3RKYA 4AFQC 4M77A 2WSEE 3CPWA 1KFZA 3N5BB 1NLOC 2KMTA 2XDPA 1LCKA 1SRLA 1M1KR 2EWNA 2PVGB 1YITQ 4Z88A 1NJIU 5LJ3f 4PJLA 4M7AB 3V8KA 2QTVA 5IAYA 4AFUC 1PWTA 2HZYA 2IG0A 2JVVA 2CP3A 3L2RA 1Y96A 2EKHA 5KYUA 2QQ9A 3JCMe 5CQXA 2RJCA 2V26A 4RTUA 1K0SA 3NGPA 4E6RA 2X4WA 3I56T 4L6V5 1QCOA 5GAN2 4QQGA 1K73R 2CZ7B 3UDCA 1RI0A 4FW1A 1Y57A 1VQKQ 4F04B 2RMOA 4C5HA 1ZSZA 4M7AF 4NL3A 3OYBA 4M7DA 3FIFA 3G6EA 4DOVA 3I55T 4FCYA 1VQPA 4X34A 4AFSC 3M4YA 1JRIA 2IPOB 5A2QE 3V8LA 2LJ1A 4QW2A 4OMLA 3CCQT 3OQ5A 1TSFA 1T3LA 3A8GB 2LZ6B 1MV3A 4EMHA 1SEMA 1X69A 2YSQA 2RHYA 2HKQB 2FRWA 3AHUA 2FZCB 1M3CA 1Z9QA 2HEQA 1PRLC 2AZVA 3MP1A 3MP8A 4HVUA 3JCMf 1QW1A 1GXIE 3CCLA 7AT1B 1X01A 1AOJA 2DTIA 3H6ZA 2AKLA 2VGMA 2GQVA 3OW2S 2XI9A 4PJOC 4M75D 4O5VA 2F2WA 1VQ5A 1OX8A 1NYFA 1E6GA 2JW4A 5CK9A 4HCBA 3PIOA 2CH4A 1Q81U 3H8ZA 2XDBA 1VYVA 2DA9A 3QYGB 3OMGA 4E7IA 3O5ZA 4EMKB 1ZUYA 2DL3A 4MMKA 4DBFA 2ZGWA 2K57A 2AHJB 4C92A 2BKDN 2R5AA 1UTIA 2JM9A 2JJ9A 2KR3A 1TUCA 1V29B 3PVLA 4M78E 1V1CA 2DTHA 1AEYA 4J6XA 1MV0B 3C12A 5LJ5h 2CP0A 1RUWA 2CT4A 2XHCA 1UUEA 1G5VA 1TG0A 4XTXA 1YJWT 3A5ZB 1QWEA 3UT1A 3BDLA 4PFZA 5GMKe 1PKSA 3CC2Q 3QJYA 2L0AA 1QVFA 3CCUQ 2DZCA 5FRNA 4OGEA 1YJ9Q 4KULA 3CC2A 2JXBA 5CKEA 5CKDA 4RMOA 1JBMA 3CCUA 1BIBA 4IKFA 4FT2A 4LE9A 2ESWA 1FYNA 4XTVA 3VUZA 2RNAA 4Y28E 2P4RA 2YUQA 4F7UA 3JB9I 2M16A 3V7RA 4XTZA 2DX1A 5CKBA 3WVEB 3O8VA 1VQ7T 4QVZA 1WLPB 3X20B 1SKUB 2EQJA 1RAFB 2RA2A 2KAFA 1AWOA 2LC4A 3VU3C 2P0QA 5GANg 2X51A 5FWCA 3PFSA 1NYGA 2YLCA 2K79A 1WHJA 1VQLT 1VQNA 4FYWB 5KYNA 1A0NB 3VRYA 1K4US 1HJDA 3VS2A 2RD1A 2RQRA 1X6GA 1VQOT 2HAXA 1JXMA 2LQWA 2CUDA 1RABB 4KUDK 2XU8A 2HKNA 5ECAA 3S3NA 4FU6A 3LGLA 1X75C 4JS5A 1PCXA 2LVMA 1Q7YU 4V2SA 3HTRA 4QQ6A 3SWNA 3QHSA 4LDWA 2J06A 1D0ZA 1VYTA 3H0HA 1MNDA 5LJ5j 3M58A 4CRIA 2LT1A 1R77A 2EGEA 4M7AE 3EFRA 1D09B 1Y7XA 2HQXA 4M75C 3CD6T 2KE9A 3OS5A 3CCSA 3EFOA 2EYYA 2NUTA 3QSUA 4FYVB 3META 1KQSA 1WPYA 2DL7A 1AWJA 3BE3A 2E6ZA 2L3PA 1QVGA 4PK4A 3RNJA 3UA7A 1JU5C 4M77D 2JOYA 2NUPB 4VUBA 3CCMQ 3G71Q 2K2VA 3TREA 5IHKA 3BY7A 3DLLA 3S3MA 2O9VA 2LJ0A 2HQEA 2HMAA 1WHGA 1KHCA 4IUUA 3OYYA 3CXCS 1YP5A 3CCMA 2OI3A 2K3BA 3JCMJ 4WF2A 5LJ5e 1XQHA 2DXTA 1KHIA 3EGDB 3ER0A 4KH1B 1M9SA 5GANh 5D6XA 4JZ3A 1T0HA 2J7IA 5LJ3g 1ABQA 3E1SA 4JRIA 1UECA 1K9MC 4ELZC 2XDDA 1X2KA 3HFOA
chains in the Genus database with same CATH topology
1WJRA 2JZ2A 2DEQA 4JLGA 3WVDB 1BIAA 3VKIA 3CC7T 2MMPA 2B8AA 1YJ9A 3CMET 1QP2A 1H641 2CYZB 3OYHA 1UGQB 4RKUE 5KH6A 3A8OB 4J8OA 1OI1A 2HNIA 3ZEHA 3A8HB 4FIBA 2ZPHB 3PGGA 2OTLA 4N4GA 1Y07A 2E65A 3M56A 4RG8A 4XTYA 5I21A 3OS1A 5CO7A 2LX9A 4RCCA 5KCHA 4FSXA 3CPWS 4C8QD 3ZBDA 4M7DF 3GNFB 5LJ3d 4M78B 2BUDA 2PVOB 3Q1JA 2I2LA 2QQSA 3HP9A 3P8BB 5DM7R 2E5QA 2D6FA 1VIFA 3BDUA 4II1A 4A4EA 2LTOA 5LJ5g 2Y4YA 3UWNA 4R55A 1WJQA 2RJEA 4M78G 3NTHA 4N0AC 1JB0E 4ZGDB 2P0KA 2GF7A 5D6WA 4C8QC 4PJOB 5LJ5f 3S6WA 4C0DC 4DA4A 1PSEA 2M9UA 1X6OA 1KD1C 4OB2B 5FU6B 3JB9H 4PJOG 3V8JA 1LJOA 1M90C 4GY5A 4XU3A 5GAN6 2QEXA 1YJ9T 4ZTFA 3CC4A 1VQ6A 1KG1A 2EQUA 1M8VA 1UEBA 3SD4A 3MP6A 4C92B 2MI6A 1D3BA 3QXEB 2G3RA 3WXMB 3G4SA 1VQ9T 1N27A 4IUPA 3JB9G 1N8RC 4C8QA 1KQ2A 4JJNK 5GAMf 3CCRA 2K5FA 2CKKA 5A0LA 2CZ6B 3QIIA 4C92G 1VIEA 3EFSA 2H3JA 4XU2A 5GAOr 4NS5A 2EQKA 5DLOA 2RK1A 4LD9K 1YIJT 2V8KA 1NPPA 4MMLA 1KC8U 2E1HA 4M78D 5DY9A 1M1KU 2KDSA 4EDUA 3L2UA 5LJ5d 3L2VA 3CCJA 2RHIA 2GFAA 1P92A 4HT9A 4JUVA 1DJ7B 5GAN5 1VQ4T 1Q82C 2L8DA 1G3YA 3RKWA 4M78F 3OYCA 2DVEA 1NJIC 3CXCA 4PJOD 3PTAA 2ZPEB 5IN1A 4RG2A 4C5EA 3JB9J 1K8AC 1JJ2A 2VV5A 3QZ9B 5CR2A 1I8FA 2NLUA 3M59A 1SSFA 2OAUA 4PJOF 3OYIA 1VQMA 3LWHA 4A4HA 3JB9D 3JCMP 3FC3A 2O01E 2MWPA 4J83A 4OP0A 4C8QE 5GAMd 2QEXT 3CC4T 2E70A 5I2SA 2FHDA 2FL7A 3G4ST 4C92D 1Y71A 4J5YA 3JRZA 3JSCA 5FU6C 2ZPFB 4LD6A 3PT9A 4BY6B 4JRQA 3CCRT 1M5Q1 5GAOm 1U1TA 2JN0A 4C92F 2L5QA 5FLXE 4A4FA 5GMKj 2EJGA 5EG2A 2E41A 3OYFA 1YJWA 3QPHA 5M9OA 4C0FA 3PIPA 1BI0A 3CCJT 4F7UB 3ME9A 2XICA 3G71T 1M90U 5CQYA 4M77C 4QQDA 1K73U 1OZ2A 2DXUA 4QVDA 3MEUA 2ZPIB 4BE0A 1YBYA 4BI8B 2Y90A 3F70A 2A3LA 2M1HA 2PQWA 4OF1A 4Y91A 1LOJA 4F7UG 3QYHB 3G71A 3OYNA 2VGNA 2VXEA 1PSFA 1N8RU 2PU9B 1JJ2S 1IREB 2WSCE 3L2ZA 3OSVA 3SDZA 2VUBA 2EKOA 3RMQA 4M7DB 1VQMT 2D9TA 3BFMA 2L3RA 5GAN3 5CIUA 4QVCA 2DTOA 3RKYA 3CPFA 2RB6A 4M77A 2WSEE 2FB7A 3CPWA 5FRMA 2DPPB 3N5BB 4BDZA 3I56A 3M57A 3RERA 2KMTA 2XDPA 3OBYA 5HK0A 2EWNA 2PVGB 1Q82U 1S72A 2C06A 1G3SA 4DOWA 1NJIU 5LJ3f 3TU4K 3OYDA 4M7AB 4KBMB 3V8KA 2P0PA 5D6YA 1EIFA 4ME7A 1KC8C 1M1KC 5IAYA 4P5NA 4J7FA 4N4IA 4EPCA 2Y4XA 4L59A 3KXTA 2K5LA 4NL2A 3JAME 3L2QA 4M7AG 2IG0A 5GAN4 3LX7A 3P8DA 5GAMh 5CVIA 2R58A 3OS2A 2JVVA 4F7UF 3I55A 2EJ9A 3PNWC 1LNXA 3L2RA 1Y96A 3PMIA 3L1AA 3G7ZA 2CZ0B 2DIQA 3CMAA 3OYKA 3JCMe 2QQ9A 5CQXA 4A53A 2RJCA 4M77E 4M7DD 1NPRA 3CCQA 3CCET 4XQ3A 1Q86U 2DK3A 1VQLA 3HRSA 2JTFA 3RESA 2PVDB 5KE3A 2GFUA 2X4WA 3QZ5B 3GF5A 5J3BA 4L6V5 3I56T 1MGQA 3L42A 4IUQA 3URGA 5C0MA 5GAN2 4TVRA 3GOXA 4J6WA 5LL6S 3MEVA 3LLRA 4MZTA 3FLGA 4PLIA 1ZQ1A 3FJPA 2KVQG 2LCLA 3QBYA 2IVWA 3J80E 3HPWA 3P8HA 4QQGA 2QQAA 1YHQA 2RI3A 2CZ7B 3UDCA 1RI0A 4BI3A 4M7AD 3RKXA 3A8MB 3BW1A 2LDMA 4BD3A 1R8OB 3C95A 1BKBA 5CKFA 1BYMA 4C5HA 3C94A 2QTXA 3OW2A 4M7AF 4NL3A 3OYBA 4KUIA 1BI2A 1K73C 1OYXA 4M7DA 3FIFA 1QVFS 4MZMA 3G6EA 3QG1A 4M75B 4DOVA 3I55T 3LWIA 1VQPA 4X34A 2QA4A 3M4YA 3CMAT 1JRIA 3M54A 4MZPA 2DD5A 4ZGJB 5A2QE 3V8LA 4QW2A 2WSFE 1N9SA 2D0QB 2ZPBB 3X24B 4KT0E 3CCQT 3OQ5A 3VUBA 4M75G 2QQBA 1WQWA 2OTLT 3A8GB 2EYQA 1UGRB 2DD4A 4XU0A 3CD6A 4EMHA 5GMKm 4A4GA 3GNGA 3GLXA 2YHTA 2RHYA 3HRTA 1YJNA 1G5VA 2YRVA 5FU7B 1NZ9A 1YCYA 2LRQA 3AHUA 2O4XB 3JCMg 1UGSB 4ZN3A 3T9NA 4ZTJA 2JNGA 1BI1A 3MP1A 2EFIA 2DIGA 2RI2A 3LYIA 3MP8A 3QUIA 1QW1A 4M78C 3JCMf 1YHQT 3CCLA 1GXIE 2MWOA 1X01A 2DTIA 3H6ZA 3FEOA 2VGMA 1O75A 2GQVA 2PUKB 4MDWA 3OS0A 3OW2S 2XI9A 5HKCA 3R6OA 4PJOC 2KK4A 2RI5A 3G6ET 3M53A 1VQ6T 1VQPT 4M75D 5J39A 2GCXA 4O5VA 5GANj 5LJ3h 1UGPB 2ZZDA 3JCMc 3ZFJA 1VQ5A 3OYAA 4M78A 3SB2A 3GP8A 3INZA 4M75F 1Q86C 1O9SA 3LH0A 4E47A 4XTUA 3OSSC 2YLBA 5CK9A 1HXDA 4C0GA 4C92C 1YI2A 1W4SA 3PIOA 1UB4A 4HCBA 4PJOA 2K3XA 3NTKA 5IT9E 2X4XA 3JCMd 1Q81U 1QVPA 4NOYA 3H8ZA 4OB1B 4CI0C 2HBPA 2XDBA 3OB9A 4BE2A 3QYGB 2F69A 3OMGA 4XK8E 4ZN1A 2BIVA 3EAEA 5GAMj 5GAOp 4E7IA 5GMKi 2RK2A 2RM4A 4PL6A 4EMKB 3CCLT 2PUOB 3HFNA 4E7KA 4MMKA 1XNIA 2EAYA 2ZGWA 2K57A 2AHJB 2K3YA 2BKDN 4C92A 2R5AA 2E10A 2OTJA 3RMSA 1ZBXA 1I4K1 2X35A 5GAN7 3FRNA 4M78E 1V29B 2RO0A 1KQ1A 2DTHA 4J6XA 3RIRA 4ZGEB 3C12A 2VXFA 4E7HA 4JRPA 5LJ5h 3CCMT 1VQ5T 2WACA 3QKJA 2XG8D 4PJOE 3CBMA 2CGHA 2DZ9A 2LNVA 2XHCA 5GANe 3OYMA 4HT8A 2O4XA 4M7AC 1TH7A 4HCZA 4D6WA 1M4ZA 4R56A 1AHJB 2ZPGB 3LGFA 4XTXA 1YJWT 2CS7A 3A5ZB 1XOVA 3UT1A 1VQ7A 3BDLA 4BY6C 3M9QA 1G3WA 4LDYA 3VYHB 3VYGA 5GMKe 1KQSS 3QJYA 3HL8A 1D3BB 5GAOl 1QVFA 3MHXA 1YITA 4C92E 4JLIA 2V8IA 4XU1A 4C8QB 4FM4B 4J6YA 1QVGS 1W2BA 5KE2A 3KBGA 3RUXA 4C0DB 2DZCA 4E7LA 3V7SA 5FRNA 4BACA 2MAMA 4OGEA 2KY9A 3CCVA 3X26B 2OTJT 3M55A 5GAOn 4C8QG 4EMGA 3OYJA 2VYTA 3E9FA 3OBWA 2RHUA 4KULA 3X28B 3JCMQ 3VJPA 2E12A 4IUTA 2P4TA 4B9WA 3CC2A 2DXBA 2R57A 5CKEA 3SWNB 5CKDA 4RMOA 4EMKC 1JBMA 4Z02A 3CCUA 1BIBA 4X9DA 2MF2A 4IKFA 4FT2A 2RJFA 3JCMh 4M7DC 2X4JA 4RCBA 4XTVA 3VUZA 3HRUA 4PLLA 4DQ2A 4PNOA 1VQOA 2XKOC 2RH2A 2EJFA 4Y28E 4F7UA 3M5AA 1S72T 3GPLA 3JB9I 5DLQE 3JCMW 2M16A 3V7RA 4BI4A 3HKSA 3DKMA 4XTZA 2RJDA 5CKBA 3WVEB 2L89A 3O8VA 3MEWA 3ASKA 1VQ9A 1VQ7T 4GLKA 1IZ6A 2F5KA 4QVZA 4EMKA 1Q81C 4OB3B 3FB9A 4L5GA 3OYLA 3X20B 4MDXA 2JUFA 5J26A 2EQJA 2RA2A 2KAFA 3CBOA 1YITT 4OVAA 3TCJA 5A0GA 3E19A 2LC4A 3TEEA 3V7CA 2DJZA 3HSBA 4ATOA 1YIJA 1N6AA 2R5MA 3VU3C 2P0QA 1G3TA 2EQMA 5GANg 1W2BS 3M4GA 3MCAB 4BDYA 2E6NA 1VQKA 4FL6A 3QDRB 5I2MA 5LJ3j 3CCVT 1QP3A 3PFSA 1M1FA 5GANf 3OYEA 4C8QF 1VQ4A 2YLCA 4HCCA 3OY9A 1VQNA 1VQLT 2XD0A 1U1SA 4LDVA 2KQWA 3CCUT 4BUGA 5CAIA 2LQ8A 2M0OA 4F7UE 2RD1A 5AYFA 2X4YA 4M7AA 2EIFA 1VQOT 2HAXA 4BE1A 3SWNC 2RHXA 4KUDK 1OZ3A 5GAOq 5GAMg 2CZ1B 5CCAA 1FX7A 3CEYA 2XU8A 4N0AA 3E9GA 4M7DE 3S3NA 4FU6A 4Q5WA 4E7JA 4PKCC 1VUBA 3JCMX 3X25B 3OA6A 3LGLA 1X75C 4JS5A 2XK0A 4JDSA 5A0DA 2LVMA 4M77B 4IURA 1Q7YU 1B34B 3SFMA 1K9MU 5GANd 4V2SA 2ZCFB 1I5LA 1WNLA 2LT4A 3QO3A 2V8JA 2QQRA 3LW5E 1RL2A 2QA4T 2DKGA 4QQ6A 3QHSA 4LDWA 4M77G 4UC4A 3SWNA 3UPUA 1VQKT 3J7AF 5LJ5j 3M58A 4CRIA 2FVUA 2LT1A 1VQNT 1VQ8A 3JCMb 5FROA 4J7IA 5L8RE 4M7AE 3EFRA 2HQXA 1Y7XA 2QDYB 4M75C 4ELYC 5HK3A 4XTWA 3GIBA 3CD6T 2JTMA 3OS5A 5LJ3e 1YJNT 3VV0A 3CCSA 2XIDA 3QSUA 3DB4A 2DO3A 3META 3OMCA 1WPYA 1KQSA 4LDXA 4OB0B 1Y96B 4A54A 4HKEA 2KSSA 3C4SA 5CKHA 3KUFA 2E6ZA 4LDUA 1XTDA 3FDRA 1QVGA 3JB9F 1HK9A 5GMKl 4M75A 5FU7C 1WJSA 4IUVA 3MO8A 4M77D 2JOYA 3PMTA 5C6SA 4VUBA 4C0ZA 2K2VA 2DXCA 4C5GA 3CC2T 2VC8A 1MHNA 3TREA 3S3OA 4B9XA 3BY7A 1I81A 3DLLA 3QJ6A 3S3MA 1KD1U 4M77F 3A8LB 1FXXA 5GAN8 2HQEA 4HA8A 1KHCA 4XAXB 4IUUA 4A4KA 3CC7A 4OMFB 1VQ8T 2K5IA 4N4HA 2DAQA 3OYYA 3CXCS 3CMEA 3CCMA 4X9CA 3L2WA 1YI2T 1N9RA 2QXFA 2RHZA 3JCMJ 3CBPA 4WF2A 3CCST 5LJ5e 1XQHA 2LQKA 5HY6A 3OYGA 1M1GA 2DXTA 1KHIA 3NFCA 3NTIA 3CCEA 3J81E 3ER0A 1BI3A 3HHTB 4JS4A 3MEAA 1M9SA 4M75E 5KCOA 5GANh 2E64A 5D6XA 4JRKA 1NE8A 1B34A 4BB7A 4M7DG 3DLMA 1FWZA 2K4YA 4FT4A 4O6JA 2F5TX 3DB3A 3JCMV 5LJ3g 1WQ7A 3E1SA 4JRIA 2HD0A 5GMKh 1U8RA 4OGCA 4YTLA 5GAMe 1Q7YC 2A7YA 1WGSA 1K9MC 1K8AU 1H3ZA 4C5IA 2FYKA 4ELZC 2LCCA 2XDDA 1ZHIA 3HFOA 2QI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PU9 B;  1IRE B;  2WSC E;  3WVD B;  1UGP B;  2ZZD A;  1QP2 A;  2CYZ B;  1UGQ B;  4RKU E;  3A8O B;  2WSE E;  2DPP B;  3A8H B;  2ZPH B;  2PVG B;  2CZ1 B;  4OB1 B;  2PVO B;  3X25 B;  3QYG B;  4XK8 E;  2ZCF B;  2PUO B;  1JB0 E;  3LW5 E;  2AHJ B;  4ZGD B;  1PSE A;  4OB2 B;  2CZ0 B;  1V29 B;  5L8R E;  4ZGE B;  2QDY B;  3QXE B;  2PVD B;  3QZ5 B;  4L6V 5;  4OB0 B;  1AHJ B;  2ZPG B;  2CZ6 B;  3VYH B;  3VYG A;  2CZ7 B;  4FM4 B;  3A8M B;  1DJ7 B;  2DXC A;  3X26 B;  2ZPE B;  3A8L B;  3QZ9 B;  3X28 B;  2DXB A;  2DD5 A;  4ZGJ B;  2WSF E;  2D0Q B;  2ZPB B;  3X24 B;  2O01 E;  4KT0 E;  3A8G B;  1UGR B;  2DD4 A;  4Y28 E;  2ZPF B;  3HHT B;  3WVE B;  4OB3 B;  1UGS B;  3X20 B;  1GXI E;  2ZPI B;  2PUK B;  1QP3 A;  3QYH B;  1PSF A; 
#chains in the Genus database with same CATH topology
 1WJR A;  4JLG A;  2OTL Q;  3CC7 T;  1TOV A;  2ED0 A;  2B8A A;  3OYH A;  1UGQ B;  1OI1 A;  2JT4 A;  1IB8 A;  3A8H B;  3MJX A;  1MNE A;  1V76 A;  2W0Z A;  2OTL A;  4N4G A;  1UDL A;  2E65 A;  4RG8 A;  3OS1 A;  4XTY A;  1YHQ Q;  5CO7 A;  2LX9 A;  4J9H A;  3GNF B;  1D0X A;  5IXF A;  5DM7 R;  2E5Q A;  4A4E A;  4PJO B;  4ZGD B;  5D6W A;  3IQL A;  5LJ5 f;  3EH2 A;  5GJW B;  4DA4 A;  2M9U A;  1KD1 C;  3JB9 H;  5FU6 B;  1M90 C;  2KBT A;  2QEX A;  1ZLM A;  1KG1 A;  3CCJ Q;  1N8R C;  1MUZ A;  4JJN K;  2CKK A;  5A0L A;  1NM7 A;  2ZAE A;  1EX4 A;  2FPF A;  5GAO r;  2O88 A;  1PD0 A;  4NS5 A;  2EQK A;  5DLO A;  1IHW A;  4HXJ A;  1NJI R;  5DY9 A;  4EDU A;  1QLY A;  3CCJ A;  2VB6 A;  2GFA A;  1P92 A;  5GAN 5;  1DJ7 B;  1VQ4 T;  1G3Y A;  2AIR B;  2E5K A;  3VS0 A;  3EG3 A;  3OYC A;  3PTA A;  3I35 A;  5IN1 A;  4C5E A;  1K8A C;  1MMG A;  3QZ9 B;  3EHR A;  3RBB B;  4PJO F;  3LWH A;  3JCM P;  2O01 E;  2VKN A;  2P84 A;  5I2S A;  2FL7 A;  2RF0 A;  3G4S T;  4C92 D;  5I22 A;  3PT9 A;  3CCR T;  5GAO m;  1U1T A;  3MPU B;  3QWY A;  2L5Q A;  2HQH A;  4A4F A;  5KYY A;  2EJG A;  1SRM A;  1BI0 A;  3ME9 A;  2X3X D;  4M77 C;  1KK7 A;  2A3L A;  2M1H A;  1HSQ A;  1LOJ A;  2VGN A;  1M8M A;  2RQV A;  3OSV A;  1NEG A;  1S72 Q;  5GAN 3;  8ATC B;  3D7S B;  5KYW A;  2MOX A;  4BDZ A;  2KNB B;  2BZY A;  1KC8 R;  1Q82 U;  1S72 A;  4PJN A;  3JV3 A;  3OYD A;  4KBM B;  1M1K C;  1U06 A;  4FYY B;  3CCV Q;  3EGX B;  4L59 A;  3CXC P;  2K5L A;  1JJ2 P;  3LX7 A;  3P8D A;  5GAM h;  1X6B A;  3SHW A;  2EJ9 A;  3L1A A;  3G7Z A;  1I1J A;  3CCE T;  3E2U A;  2H8H A;  2GTO A;  1SHG A;  4IIM A;  5KE3 A;  1VA7 A;  5J3B A;  1ZSZ C;  1R0C B;  1MGQ A;  2BE7 D;  4IUQ A;  3URG A;  2DBK A;  5LL6 S;  3MEV A;  3FJP A;  4R0K A;  2EYZ A;  3QBY A;  2IVW A;  3J80 E;  3P8H A;  2QA4 Q;  4A63 B;  4BI3 A;  1GL5 A;  3RKX A;  1OUL A;  4BD3 A;  2V1R A;  1BKB A;  1UHC A;  2E4H A;  2QTX A;  1IRX A;  3OW2 A;  1K73 C;  1BI2 A;  2COW A;  4MZM A;  3LWI A;  4M75 B;  2QA4 A;  4J9D A;  3M54 A;  2DD5 A;  1OPK A;  2D0Q B;  2ZPB B;  4KT0 E;  1ZA2 B;  2DD4 A;  2DL8 A;  5GMK m;  4A4G A;  3GLX A;  1YCY A;  1PD1 A;  2O4X B;  2K7A A;  2YXY A;  3T9N A;  4ZTJ A;  2JNG A;  4OMQ A;  2EFI A;  2DIG A;  2RI2 A;  1RI9 A;  1HD3 A;  4E7Z A;  2CP5 A;  2PUK B;  2A0F B;  5HKC A;  2KK4 A;  3G6E T;  1YI2 Q;  1VQ6 T;  1VQP T;  1Q86 R;  4ANJ A;  2GCX A;  2DL4 A;  2VVK A;  9ATC B;  3JCM c;  3SB2 A;  3GP8 A;  3INZ A;  4M75 F;  1QCN A;  3LH0 A;  1KSW A;  4XTU A;  1HXD A;  4C92 C;  1YI2 A;  1B07 A;  2K3X A;  3NTK A;  5IT9 E;  4NOY A;  5AT1 B;  4OB1 B;  5EC7 A;  2W10 A;  1W1F A;  4Z8A A;  5GAM j;  5GAO p;  2RK2 A;  4PL6 A;  3CCL T;  3M0Q A;  1XNI A;  3REA B;  4DBR A;  2OTJ A;  2EBP A;  1R0B G;  5GAN 7;  5FWB A;  4E7H A;  4JRP A;  1VQ5 T;  4FSS A;  2XG8 D;  4PJO E;  3CBM A;  2CGH A;  2DZ9 A;  2LNV A;  1UJY A;  1M2O A;  4HT8 A;  1ZUU A;  1AHJ B;  3LGF A;  3M0R A;  4Y92 A;  4BY6 C;  3H9N A;  5GAO l;  3MHX A;  1YIT A;  4JLI A;  4F17 A;  4FM4 B;  4J6Y A;  2K9G A;  3KBG A;  4E7L A;  1M2V B;  5IHN A;  2MAM A;  3X26 B;  4C8Q G;  2RHU A;  3JCM Q;  2E12 A;  4IUT A;  2DF6 A;  2P4T A;  4B9W A;  2R57 A;  2F2X A;  1VQ9 Q;  2B86 A;  1WA7 A;  4X9D A;  5I11 A;  2YRC A;  3GPL A;  1QCF A;  3JCM W;  3HKS A;  4AG1 C;  2RJD A;  1VQ9 A;  3ASK A;  4EMK A;  2OJ2 A;  2VWF A;  5J26 A;  3V7C A;  4ATO A;  2DJZ A;  1N6A A;  2LJ3 A;  1VQK A;  3QDR B;  2DEU A;  4IIO A;  2HSP A;  3ULR B;  3TVT A;  2NYS A;  3OY9 A;  2XD0 A;  1CSK A;  4LDV A;  2L2P A;  3CCU T;  4BUG A;  2M0O A;  1XJW B;  3SWN C;  3FJ5 A;  2RHX A;  1OZ3 A;  1WHL A;  4N0A A;  1GRI A;  1B7T A;  3NPF A;  4Q5W A;  4E7J A;  1GFD A;  3JCM X;  1IGU A;  3X25 B;  3OA6 A;  2XK0 A;  4JDS A;  2MPX C;  4M77 B;  1VQ8 Q;  2KRN A;  1W2B P;  1K9M U;  1JXO A;  5GAN d;  3QO3 A;  2QQR A;  4KH0 B;  1VQM Q;  4DEY A;  2EYX A;  2QK0 A;  1VQ8 A;  1VQN T;  5L8R E;  4ELY C;  5HK3 A;  3GIB A;  4XTW A;  2F1L A;  2JTM A;  3M0P A;  1YJN T;  4ORZ A;  2DO3 A;  1Y96 B;  1WI7 A;  4HKE A;  4D8D A;  4LDU A;  5KYU B;  4WTO B;  5GMK l;  2DVJ A;  2PNI A;  1K1Z A;  3PMT A;  2RN8 A;  4C5G A;  2L3S A;  3QJ6 A;  1KD1 U;  4M77 F;  2EQI A;  1RLP C;  1FXX A;  4HA8 A;  3MKD A;  4JZ4 A;  4A4K A;  2FPE A;  2K5I A;  3I56 Q;  4X9C A;  3ZL7 C;  1N9R A;  2RHZ A;  2YT6 A;  1ZSZ B;  3CCS T;  1WZO A;  2LQK A;  3H0F A;  3SEM A;  3NFC A;  3NTI A;  3J81 E;  4JS4 A;  4HVV A;  4M75 E;  5KCO A;  1NE8 A;  4BB7 A;  1AZG B;  1FWZ A;  2F5T X;  1CKA A;  1MMD A;  1U8R A;  4OGC A;  3I55 Q;  2A7Y A;  1AZE A;  1LVK A;  2X9H A;  1K8A U;  1H3Z A;  4FW2 A;  3I9Q A;  1WHK A;  2FYK A;  1K76 A;  5KYX B;  3CCQ Q;  1QQJ A;  2DEQ A;  3VKI A;  4E2F B;  4KGZ B;  1JO8 A;  2MMP A;  1YJ9 A;  1QP2 A;  2DET A;  3A8O B;  2HNI A;  1M27 C;  4OMM A;  1H92 A;  3TSZ A;  1Y07 A;  3M56 A;  2NUP A;  3CPW S;  4M7D F;  1PHT A;  5LJ3 d;  3Q1J A;  1RAD B;  2DYI A;  4II1 A;  2LTO A;  2Y4Y A;  4R55 A;  4M78 G;  1JB0 E;  2P0K A;  1IHV A;  4C0D C;  1J3T A;  2VAS A;  2CUB A;  2EQU A;  1M8V A;  4C92 B;  2MI6 A;  1D3B A;  1U5S A;  3JB9 G;  4C8Q A;  1KQ2 A;  2GQI A;  1VIE A;  4XU2 A;  1Q82 R;  4WCI A;  2RK1 A;  4LD9 K;  1YIJ T;  4MML A;  1M1K U;  2E1H A;  4JUV A;  2L8D A;  2QG9 B;  1NJI C;  4JPB W;  2DER A;  2X3W D;  1I8F A;  2NLU A;  2OAU A;  2MWP A;  5GAM d;  1KJW A;  4OP0 A;  2QEX T;  2FHD A;  4PFO A;  1YJW Q;  1Y71 A;  2J6K A;  4J5Y A;  3A98 A;  1FMV A;  4BY6 B;  2JN0 A;  4C92 F;  2O9S A;  5EG2 A;  1TXQ A;  2E41 A;  1TUG B;  3TQ7 P;  1YJW A;  3QPH A;  1B3Q A;  4C0F A;  5M9O A;  3PIP A;  3CCJ T;  4F7U B;  1Y0M A;  2XIC A;  1K73 U;  4QQD A;  3A1P A;  2DXU A;  1YBY A;  4BI8 B;  2Y90 A;  5IH2 A;  1T3S A;  3QYH B;  3G71 A;  2D8J A;  3TSW A;  1JJ2 S;  4ESR A;  4Z89 A;  1GCP A;  3NHN A;  3SDZ A;  1HYO A;  3RMQ A;  3BFM A;  5CIU A;  2RB6 A;  2D1X A;  2FB7 A;  5FRM A;  2DPP B;  3M57 A;  3RER A;  3OBY A;  5HK0 A;  1D1A A;  1G3S A;  4DOW A;  1M3A A;  3CMA Q;  5D6Y A;  1KC8 C;  4P5N A;  2C0O A;  2PTK A;  4J7F A;  4DBH A;  4EPC A;  2Y4X A;  3KXT A;  1I0C A;  3JAM E;  1VQL Q;  3L2Q A;  4M7A G;  5GAN 4;  2V1Q A;  5FW9 A;  3OS2 A;  2J05 A;  4F7U F;  3PNW C;  1LNX A;  1MMN A;  1WHM A;  2CZ0 B;  3CMA A;  5GJV B;  4M77 E;  4M7D D;  1NPR A;  1VQL A;  2IIM A;  2ROL A;  3RES A;  1YFN A;  2PVD B;  4QKU A;  3GF5 A;  3L42 A;  5C0M A;  4TVR A;  1BCO A;  4JJC A;  3LLR A;  4MZT A;  2FPD A;  3FLG A;  4PLI A;  2KVQ G;  2LCL A;  2CP7 A;  2QQA A;  3EFO B;  1YHQ A;  2NUT B;  2RI3 A;  3I5S A;  1OX9 A;  3BW1 A;  2LDM A;  3C95 A;  1BYM A;  1ZA1 B;  1RAH B;  3C94 A;  4KUI A;  1OYX A;  3CD6 Q;  1QVF S;  2JS2 A;  1OOT A;  4MZP A;  4E7S A;  4ZGJ B;  2DM1 A;  2WSF E;  4FYX B;  1TUD A;  4LUD A;  3CPW P;  2ABL A;  1UGR B;  3CD6 A;  1BB9 A;  1RLQ C;  3GNG A;  1NZ9 A;  2M51 A;  4LN2 A;  3EGX A;  3JCM g;  1UGS B;  4ZN3 A;  2QGG A;  1BI1 A;  4DBQ A;  3LYI A;  4J9G A;  2MWO A;  2C0I A;  1GCQ A;  1N5Z A;  1S1N A;  3FEO A;  5D7U A;  4MDW A;  2AKK A;  3R6O A;  3M53 A;  5J39 A;  5GAN j;  5LJ3 h;  1UGP B;  2ZZD A;  3ZFJ A;  3EG9 A;  4M78 A;  4PJJ A;  1BK2 A;  1YCS B;  1Q86 C;  1O9S A;  4E47 A;  3OSS C;  1YWP A;  1QMC A;  1PG5 B;  4C0G A;  2DYB A;  2K2M A;  4J9C A;  4CI0 C;  3PVQ A;  3OB9 A;  4QT7 A;  1AWW A;  2A28 A;  2F69 A;  1VYU A;  2O2O A;  3EAE A;  4E7K A;  1NG2 A;  2EAY A;  3EG1 A;  2K3Y A;  2E10 A;  1ZBX A;  1I4K 1;  2AT1 B;  1AD5 A;  2I0N A;  1KQ1 A;  3THK A;  4ZGE B;  2ATC B;  2WAC A;  2CRE A;  1C6V X;  3R6N A;  3OYM A;  5GAN e;  2O4X A;  4D6W A;  1GBQ A;  2ZPG B;  3VYH B;  1G3W A;  4LDY A;  2KRM A;  1WXT A;  1KQS S;  4C92 E;  2V8I A;  4XU1 A;  1QVG S;  5KE2 A;  4PFP A;  2YRD A;  4C0D B;  3UAT A;  4BAC A;  1WXU A;  2BE9 B;  1OV3 A;  3CCV A;  2OTJ T;  1H8K A;  4EMG A;  2VYT A;  3E9F A;  4LXC A;  3X28 B;  3VJP A;  4EMK C;  4Z02 A;  3EHQ A;  2RJF A;  3NMZ C;  3JCM h;  4M7D C;  2X4J A;  2PZ1 A;  4PLL A;  2XKO C;  2RH2 A;  4OMP A;  1Q81 R;  3M5A A;  4M4Z A;  1WFW A;  1OU8 A;  4BI4 A;  3DKM A;  2L89 A;  3MEW A;  4GLK A;  1VQ4 Q;  4MDX A;  2LCS A;  1C1A A;  3CBO A;  1YIT T;  3TCJ A;  3E19 A;  3TEE A;  2R5M A;  1G3T A;  2EQM A;  2XMF A;  1W2B S;  3M4G A;  4BDY A;  2ED1 A;  4FL6 A;  5I2M A;  5LJ3 j;  1QP3 A;  1M1F A;  5KYY B;  5GAN f;  3OYE A;  1VQ4 A;  1SG5 A;  1JQQ A;  5L23 A;  3G4S Q;  3RR6 A;  5CAI A;  2LQ8 A;  4ZNX A;  4F7U E;  5AYF A;  4M7A A;  2EIF A;  2OX7 A;  2ROT A;  4BE1 A;  3C0C A;  5CCA A;  3CEY A;  3E9G A;  4KGX B;  2DMO A;  5KYW B;  1VUB A;  2D0N A;  1M2V A;  1QVF P;  2FO0 A;  1LPL A;  4IUR A;  1B34 B;  3SFM A;  2DIL A;  2MCN A;  4CC7 A;  2LT4 A;  1RL2 A;  1WDX A;  2DKG A;  1VQK T;  4UC4 A;  2QAZ A;  4OMO A;  1QKW A;  2FVU A;  3M0U A;  5FRO A;  5LJ3 e;  2EW3 A;  3VV0 A;  3DB4 A;  3OMC A;  2CT3 A;  4OB0 B;  4A54 A;  2KSS A;  2JS0 A;  3C4S A;  3U23 A;  3VS1 A;  1W70 A;  3JB9 F;  1HK9 A;  5FU7 C;  1OPL A;  4AT1 B;  4RTV A;  2DE0 X;  1WJS A;  4IUV A;  3CME Q;  5IXB A;  2VC8 A;  1MHN A;  1I81 A;  2HL5 C;  3CCE Q;  1K9A A;  5GAN 8;  1NBE B;  3EGU A;  4CC2 A;  1VQ8 T;  4N4H A;  2KYB A;  3RDV A;  3VS4 A;  1SPK A;  3CME A;  2QXF A;  2RQU A;  3OYG A;  1M1G A;  3CCE A;  2FG0 A;  2A08 A;  1W6X A;  3HHT B;  4JRK A;  1Q7Y R;  2RQW A;  2YWW A;  2K4Y A;  4FT4 A;  4O6J A;  3JCM V;  2CP6 A;  2HD0 A;  5GMK h;  1GBR A;  4YTL A;  5GAM e;  1WGS A;  2DRK A;  4HVW A;  4J9F A;  2QI2 A;  2JZ2 A;  1ARK A;  1X27 A;  2CYZ B;  3LH5 A;  5KH6 A;  4GBQ A;  1KQS P;  3ZEH A;  4FIB A;  3PGG A;  1QVG P;  1SF9 A;  3L2V A;  3AT1 B;  4RCC A;  4FSX A;  1QWF A;  2BUD A;  3PE0 A;  1G83 A;  1NEB A;  2QQS A;  3HP9 A;  3P8B B;  1T0J A;  5LJ5 g;  1RAG B;  3UF4 A;  3G6E Q;  3UWN A;  3CC4 Q;  2RJE A;  3CC2 T;  1VQP Q;  1VQ6 Q;  2C0T A;  2GF7 A;  4C8Q C;  2CP2 A;  2M0Y A;  1WXB A;  1G2B A;  1PSE A;  2E3I A;  4OB2 B;  4PJO G;  3V8J A;  1LJO A;  1UJ0 A;  4XU3 A;  5GAN 6;  1YJ9 T;  3CC4 A;  1VQ6 A;  3SD4 A;  2G3R A;  3WXM B;  1BCM A;  3I5R A;  2HSE B;  4JJB A;  5GAM f;  2K5F A;  4PJM A;  2CZ6 B;  2RQT A;  3EFS A;  2H3J A;  3CCL Q;  1AT1 B;  2MYS A;  2V8K A;  1NPP A;  1X2Q A;  3H0I A;  1KC8 U;  4M78 D;  1FMW A;  1JEG A;  3L2U A;  4B6M A;  4HT9 A;  2RPN A;  5KYX A;  1Q82 C;  3RKW A;  3CXC A;  3JB9 J;  1PC0 A;  1JJ2 A;  1WHH A;  1VQ5 Q;  1SSF A;  3EH1 A;  1VQM A;  1UFF A;  2CSI A;  4A4H A;  1YNZ A;  3JB9 D;  4OMN A;  3FC3 A;  4RTX A;  2QGF B;  2E70 A;  8AT1 B;  5FU6 C;  2QYZ A;  4JRQ A;  1M5Q 1;  2L3Q A;  5FLX E;  5GMK j;  2CDT A;  3OYF A;  2CH4 W;  2BZ8 A;  2GNC A;  6AT1 B;  1M90 U;  5CQY A;  1WYX A;  2YUN A;  2HDA A;  4BE0 A;  1ABO A;  2K6D A;  2PQW A;  4OF1 A;  4Y91 A;  4AMC A;  1EFN A;  1RAC B;  3OYN A;  1N8R U;  1SHF A;  1IRE B;  2WSC E;  2VUB A;  4M7D B;  2H3E B;  2L3R A;  2DTO A;  3CPF A;  2KGT A;  3I56 A;  2J6O A;  2SRC A;  4J9I A;  4JJD A;  3VS6 A;  2GBQ A;  1RAA B;  2C06 A;  2OAW A;  3TU4 K;  2P0P A;  1RAI B;  1EIF A;  4ME7 A;  2FZK B;  4N4I A;  4AFZ C;  1OQK A;  1IGQ A;  1AVZ C;  4RUG A;  4NL2 A;  2JTE A;  5CVI A;  2R58 A;  3CCM T;  4ZTF A;  3I55 A;  3G71 T;  3PMI A;  2BZX A;  2DIQ A;  3OYK A;  4A53 A;  1K0X A;  2DJQ A;  3CCQ A;  4XQ3 A;  1Q86 U;  2DK3 A;  3QWX X;  3HRS A;  2JTF A;  2GTJ A;  2GFU A;  3QZ5 B;  4RTW A;  3VRZ A;  3GOX A;  2HL3 A;  4J6W A;  2FRY A;  2CSQ A;  2DL5 A;  1ZQ1 A;  1F1B B;  2COZ A;  2KXD A;  2M02 A;  3HPW A;  4M7A D;  3A8M B;  3VS3 A;  1R8O B;  5CKF A;  1C0M A;  1VQN Q;  3EGD A;  3QG1 A;  1YJN Q;  4K11 A;  3CMA T;  1WX6 A;  1N9S A;  3X24 B;  3VUB A;  2ENM A;  2QQB A;  1WQW A;  4M75 G;  2OTL T;  2EYQ A;  4XU0 A;  3VS7 A;  1GCQ C;  2YHT A;  3HRT A;  1YJN A;  1IXD A;  2YRV A;  4J9B A;  5FU7 B;  1WIE A;  2LRQ A;  1I07 A;  2F2V A;  1YHQ T;  3QUI A;  4M78 C;  1TWB A;  1D0Y A;  2KRO A;  1BU1 A;  2EYW A;  1CKB A;  1O75 A;  1SSH A;  2YUO A;  4HCK A;  3OS0 A;  2RI5 A;  3CCS Q;  1M3B A;  2QAS A;  3OYA A;  3CQT A;  1OEB A;  1Z9Z A;  2YLB A;  2JMA A;  1VOM A;  1W4S A;  4PJO A;  1UB4 A;  2X4X A;  3JCM d;  1IO6 A;  1MMA A;  2DLP A;  1QVP A;  2HBP A;  4EIK A;  4BE2 A;  4ZN1 A;  4XK8 E;  2BIV A;  5GMK i;  2RM4 A;  1I5O B;  2PUO B;  3HFN A;  3OW2 P;  2KXC A;  1ZUK A;  2A37 A;  3RMS A;  4GLM A;  1H3H A;  1YWO A;  2X35 A;  3FRN A;  3M0S A;  2RO0 A;  4RTZ A;  1VQ7 Q;  3RIR A;  2VXF A;  2SEM A;  3QKJ A;  4X1V A;  5IHI A;  1TH7 A;  4HCZ A;  4R56 A;  1M4Z A;  2GGR A;  2EGA A;  2CS7 A;  1VQ7 A;  1XOV A;  3M9Q A;  3VYG A;  3HL8 A;  1D3B B;  4KRT A;  2O31 A;  4C8Q B;  1W2B A;  3RUX A;  2YUP A;  3V7S A;  2KY9 A;  1VQO Q;  3M55 A;  5GAO n;  2ECZ A;  2E3H A;  3OYJ A;  3OBW A;  2DXB A;  3SWN B;  2LNH B;  2MF2 A;  3EG2 A;  4RCB A;  3QDF A;  3HRU A;  4DQ2 A;  4PNO A;  1VQO A;  1S72 T;  2EJF A;  2LX7 A;  5DLQ E;  1YIJ Q;  2MIO A;  1X43 A;  2G6F X;  1IZ6 A;  2F5K A;  1Q81 C;  4OB3 B;  3FB9 A;  4L5G A;  3OYL A;  2JUF A;  1M30 A;  3GBQ A;  4OVA A;  5A0G A;  1RAE B;  3HSB A;  1YIJ A;  4M7A C;  1AWX A;  1PRM C;  3UA6 A;  3MCA B;  2E6N A;  2KEA A;  3CCV T;  4C8Q F;  2QEX Q;  4HCC A;  2MK5 A;  1U1S A;  2KQW A;  3M0T A;  2X4Y A;  3G1J A;  2KYM A;  2NWM A;  5GAO q;  5GAM g;  2CZ1 B;  1UHF A;  1FX7 A;  4M7D E;  1PM3 A;  2J6F A;  4PKC C;  4KGV B;  5A0D A;  2ZCF B;  1I5L A;  1WNL A;  2YDL A;  2V8J A;  3LW5 E;  1KIK A;  2QA4 T;  2LQN A;  4M77 G;  1OU9 A;  2COY A;  3UPU A;  1FMK A;  3J7A F;  2DRM A;  3JCM b;  2EVR A;  4J7I A;  3KFV A;  2QDY B;  3REB B;  2XID A;  4LDX A;  1ZX6 A;  5CKH A;  3KUF A;  1D1B A;  1XTD A;  3FDR A;  2HCK A;  4M75 A;  1E6H A;  3CC7 Q;  3MO8 A;  5C6S A;  4C0Z A;  1ZBJ A;  2DXC A;  3S3O A;  4B9X A;  3A8L B;  1G8X A;  4XAX B;  2KT8 A;  4D8K A;  4OMF B;  3CC7 A;  2DAQ A;  1ZSG A;  1ACM B;  3L2W A;  2KT1 A;  1YI2 T;  3CBP A;  1Q95 G;  4CC4 B;  5HY6 A;  5HCK A;  1BI3 A;  3MEA A;  4LNP A;  2E64 A;  1B34 A;  4M7D G;  2A36 A;  1K9M R;  3DLM A;  4RTT A;  1PNJ A;  3DB3 A;  1WQ7 A;  4AG2 C;  1Q7Y C;  2LMJ A;  4C5I A;  2LCC A;  1ZHI A;  4CC3 A;  1EZZ B;  3WVD B;  1BIA A;  4RTY A;  1NLP C;  3CME T;  1H64 1;  4RKU E;  2HBW A;  4J8O A;  1PKT A;  2ZPH B;  1GFC A;  1UGV A;  5I21 A;  5KCH A;  3EG9 B;  4C8Q D;  3ZBD A;  2KRS A;  4M78 B;  2PVO B;  2I2L A;  1TS9 A;  2D6F A;  1BBZ A;  1KD1 R;  1VIF A;  3BDU A;  3VS5 A;  1WJQ A;  4N0A C;  3NTH A;  1M90 R;  3S6W A;  2AZS A;  1X6O A;  4LUE A;  3CCR Q;  1N8R R;  4F14 A;  2EGC A;  2JM8 A;  1U3O A;  4GY5 A;  4J9E A;  1E7O A;  4DEX A;  1UEB A;  3MP6 A;  3G4S A;  3QXE B;  1VQ9 T;  1N27 A;  4IUP A;  2NUZ A;  3CCR A;  2Z0W A;  3QII A;  4C92 G;  2DFU A;  2DNU A;  2KI7 A;  2KDS A;  5LJ5 d;  1K8A R;  2RHI A;  2BTT A;  2FZG B;  2LP5 A;  4M78 F;  1QKX A;  3H41 A;  1TTH B;  1UE9 A;  2DVE A;  4PJO D;  2ZPE B;  4RG2 A;  2VV5 A;  5CR2 A;  3M59 A;  2QDL A;  3OYI A;  1YN8 A;  4J83 A;  4C8Q E;  3CC4 T;  3EG0 A;  4F16 A;  3JRZ A;  3JSC A;  2JMC A;  2ZPF B;  4LD6 A;  1D1C A;  2FEI A;  1TU0 B;  2D8H A;  2OTJ Q;  2AK5 A;  1OZ2 A;  4QVD A;  3MEU A;  2ZPI B;  3F70 A;  2DBM A;  4F7U G;  1PSF A;  2EPD A;  2VXE A;  2PU9 B;  3L2Z A;  2EKO A;  1VQM T;  2D9T A;  1UG1 A;  4QVC A;  3RKY A;  4AFQ C;  4M77 A;  2WSE E;  3CPW A;  1KFZ A;  3N5B B;  1NLO C;  2KMT A;  2XDP A;  1LCK A;  1SRL A;  1M1K R;  2EWN A;  2PVG B;  1YIT Q;  4Z88 A;  1NJI U;  5LJ3 f;  4PJL A;  4M7A B;  3V8K A;  2QTV A;  5IAY A;  4AFU C;  1PWT A;  2HZY A;  2IG0 A;  2JVV A;  2CP3 A;  3L2R A;  1Y96 A;  2EKH A;  5KYU A;  2QQ9 A;  3JCM e;  5CQX A;  2RJC A;  2V26 A;  4RTU A;  1K0S A;  3NGP A;  4E6R A;  2X4W A;  3I56 T;  4L6V 5;  1QCO A;  5GAN 2;  4QQG A;  1K73 R;  2CZ7 B;  3UDC A;  1RI0 A;  4FW1 A;  1Y57 A;  1VQK Q;  4F04 B;  2RMO A;  4C5H A;  1ZSZ A;  4M7A F;  4NL3 A;  3OYB A;  4M7D A;  3FIF A;  3G6E A;  4DOV A;  3I55 T;  4FCY A;  1VQP A;  4X34 A;  4AFS C;  3M4Y A;  1JRI A;  2IPO B;  5A2Q E;  3V8L A;  2LJ1 A;  4QW2 A;  4OML A;  3CCQ T;  3OQ5 A;  1TSF A;  1T3L A;  3A8G B;  2LZ6 B;  1MV3 A;  4EMH A;  1SEM A;  1X69 A;  2YSQ A;  2RHY A;  2HKQ B;  2FRW A;  3AHU A;  2FZC B;  1M3C A;  1Z9Q A;  2HEQ A;  1PRL C;  2AZV A;  3MP1 A;  3MP8 A;  4HVU A;  3JCM f;  1QW1 A;  1GXI E;  3CCL A;  7AT1 B;  1X01 A;  1AOJ A;  2DTI A;  3H6Z A;  2AKL A;  2VGM A;  2GQV A;  3OW2 S;  2XI9 A;  4PJO C;  4M75 D;  4O5V A;  2F2W A;  1VQ5 A;  1OX8 A;  1NYF A;  1E6G A;  2JW4 A;  5CK9 A;  4HCB A;  3PIO A;  2CH4 A;  1Q81 U;  3H8Z A;  2XDB A;  1VYV A;  2DA9 A;  3QYG B;  3OMG A;  4E7I A;  3O5Z A;  4EMK B;  1ZUY A;  2DL3 A;  4MMK A;  4DBF A;  2ZGW A;  2K57 A;  2AHJ B;  4C92 A;  2BKD N;  2R5A A;  1UTI A;  2JM9 A;  2JJ9 A;  2KR3 A;  1TUC A;  1V29 B;  3PVL A;  4M78 E;  1V1C A;  2DTH A;  1AEY A;  4J6X A;  1MV0 B;  3C12 A;  5LJ5 h;  2CP0 A;  1RUW A;  2CT4 A;  2XHC A;  1UUE A;  1G5V A;  1TG0 A;  4XTX A;  1YJW T;  3A5Z B;  1QWE A;  3UT1 A;  3BDL A;  4PFZ A;  5GMK e;  1PKS A;  3CC2 Q;  3QJY A;  2L0A A;  1QVF A;  3CCU Q;  2DZC A;  5FRN A;  4OGE A;  1YJ9 Q;  4KUL A;  3CC2 A;  2JXB A;  5CKE A;  5CKD A;  4RMO A;  1JBM A;  3CCU A;  1BIB A;  4IKF A;  4FT2 A;  4LE9 A;  2ESW A;  1FYN A;  4XTV A;  3VUZ A;  2RNA A;  4Y28 E;  2P4R A;  2YUQ A;  4F7U A;  3JB9 I;  2M16 A;  3V7R A;  4XTZ A;  2DX1 A;  5CKB A;  3WVE B;  3O8V A;  1VQ7 T;  4QVZ A;  1WLP B;  3X20 B;  1SKU B;  2EQJ A;  1RAF B;  2RA2 A;  2KAF A;  1AWO A;  2LC4 A;  3VU3 C;  2P0Q A;  5GAN g;  2X51 A;  5FWC A;  3PFS A;  1NYG A;  2YLC A;  2K79 A;  1WHJ A;  1VQL T;  1VQN A;  4FYW B;  5KYN A;  1A0N B;  3VRY A;  1K4U S;  1HJD A;  3VS2 A;  2RD1 A;  2RQR A;  1X6G A;  1VQO T;  2HAX A;  1JXM A;  2LQW A;  2CUD A;  1RAB B;  4KUD K;  2XU8 A;  2HKN A;  5ECA A;  3S3N A;  4FU6 A;  3LGL A;  1X75 C;  4JS5 A;  1PCX A;  2LVM A;  1Q7Y U;  4V2S A;  3HTR A;  4QQ6 A;  3SWN A;  3QHS A;  4LDW A;  2J06 A;  1D0Z A;  1VYT A;  3H0H A;  1MND A;  5LJ5 j;  3M58 A;  4CRI A;  2LT1 A;  1R77 A;  2EGE A;  4M7A E;  3EFR A;  1D09 B;  1Y7X A;  2HQX A;  4M75 C;  3CD6 T;  2KE9 A;  3OS5 A;  3CCS A;  3EFO A;  2EYY A;  2NUT A;  3QSU A;  4FYV B;  3MET A;  1KQS A;  1WPY A;  2DL7 A;  1AWJ A;  3BE3 A;  2E6Z A;  2L3P A;  1QVG A;  4PK4 A;  3RNJ A;  3UA7 A;  1JU5 C;  4M77 D;  2JOY A;  2NUP B;  4VUB A;  3CCM Q;  3G71 Q;  2K2V A;  3TRE A;  5IHK A;  3BY7 A;  3DLL A;  3S3M A;  2O9V A;  2LJ0 A;  2HQE A;  2HMA A;  1WHG A;  1KHC A;  4IUU A;  3OYY A;  3CXC S;  1YP5 A;  3CCM A;  2OI3 A;  2K3B A;  3JCM J;  4WF2 A;  5LJ5 e;  1XQH A;  2DXT A;  1KHI A;  3EGD B;  3ER0 A;  4KH1 B;  1M9S A;  5GAN h;  5D6X A;  4JZ3 A;  1T0H A;  2J7I A;  5LJ3 g;  1ABQ A;  3E1S A;  4JRI A;  1UEC A;  1K9M C;  4ELZ C;  2XDD A;  1X2K A;  3HFO A; 
#chains in the Genus database with same CATH homology
 1WJR A;  2JZ2 A;  2DEQ A;  4JLG A;  3WVD B;  1BIA A;  3VKI A;  3CC7 T;  2MMP A;  2B8A A;  1YJ9 A;  3CME T;  1QP2 A;  1H64 1;  2CYZ B;  3OYH A;  1UGQ B;  4RKU E;  5KH6 A;  3A8O B;  4J8O A;  1OI1 A;  2HNI A;  3ZEH A;  3A8H B;  4FIB A;  2ZPH B;  3PGG A;  2OTL A;  4N4G A;  1Y07 A;  2E65 A;  3M56 A;  4RG8 A;  4XTY A;  5I21 A;  3OS1 A;  5CO7 A;  2LX9 A;  4RCC A;  5KCH A;  4FSX A;  3CPW S;  4C8Q D;  3ZBD A;  4M7D F;  3GNF B;  5LJ3 d;  4M78 B;  2BUD A;  2PVO B;  3Q1J A;  2I2L A;  2QQS A;  3HP9 A;  3P8B B;  5DM7 R;  2E5Q A;  2D6F A;  1VIF A;  3BDU A;  4II1 A;  4A4E A;  2LTO A;  5LJ5 g;  2Y4Y A;  3UWN A;  4R55 A;  1WJQ A;  2RJE A;  4M78 G;  3NTH A;  4N0A C;  1JB0 E;  4ZGD B;  2P0K A;  2GF7 A;  5D6W A;  4C8Q C;  4PJO B;  5LJ5 f;  3S6W A;  4C0D C;  4DA4 A;  1PSE A;  2M9U A;  1X6O A;  1KD1 C;  4OB2 B;  5FU6 B;  3JB9 H;  4PJO G;  3V8J A;  1LJO A;  1M90 C;  4GY5 A;  4XU3 A;  5GAN 6;  2QEX A;  1YJ9 T;  4ZTF A;  3CC4 A;  1VQ6 A;  1KG1 A;  2EQU A;  1M8V A;  1UEB A;  3SD4 A;  3MP6 A;  4C92 B;  2MI6 A;  1D3B A;  3QXE B;  2G3R A;  3WXM B;  3G4S A;  1VQ9 T;  1N27 A;  4IUP A;  3JB9 G;  1N8R C;  4C8Q A;  1KQ2 A;  4JJN K;  5GAM f;  3CCR A;  2K5F A;  2CKK A;  5A0L A;  2CZ6 B;  3QII A;  4C92 G;  1VIE A;  3EFS A;  2H3J A;  4XU2 A;  5GAO r;  4NS5 A;  2EQK A;  5DLO A;  2RK1 A;  4LD9 K;  1YIJ T;  2V8K A;  1NPP A;  4MML A;  1KC8 U;  2E1H A;  4M78 D;  5DY9 A;  1M1K U;  2KDS A;  4EDU A;  3L2U A;  5LJ5 d;  3L2V A;  3CCJ A;  2RHI A;  2GFA A;  1P92 A;  4HT9 A;  4JUV A;  1DJ7 B;  5GAN 5;  1VQ4 T;  1Q82 C;  2L8D A;  1G3Y A;  3RKW A;  4M78 F;  3OYC A;  2DVE A;  1NJI C;  3CXC A;  4PJO D;  3PTA A;  2ZPE B;  5IN1 A;  4RG2 A;  4C5E A;  3JB9 J;  1K8A C;  1JJ2 A;  2VV5 A;  3QZ9 B;  5CR2 A;  1I8F A;  2NLU A;  3M59 A;  1SSF A;  2OAU A;  4PJO F;  3OYI A;  1VQM A;  3LWH A;  4A4H A;  3JB9 D;  3JCM P;  3FC3 A;  2O01 E;  2MWP A;  4J83 A;  4OP0 A;  4C8Q E;  5GAM d;  2QEX T;  3CC4 T;  2E70 A;  5I2S A;  2FHD A;  2FL7 A;  3G4S T;  4C92 D;  1Y71 A;  4J5Y A;  3JRZ A;  3JSC A;  5FU6 C;  2ZPF B;  4LD6 A;  3PT9 A;  4BY6 B;  4JRQ A;  3CCR T;  1M5Q 1;  5GAO m;  1U1T A;  2JN0 A;  4C92 F;  2L5Q A;  5FLX E;  4A4F A;  5GMK j;  2EJG A;  5EG2 A;  2E41 A;  3OYF A;  1YJW A;  3QPH A;  5M9O A;  4C0F A;  3PIP A;  1BI0 A;  3CCJ T;  4F7U B;  3ME9 A;  2XIC A;  3G71 T;  1M90 U;  5CQY A;  4M77 C;  4QQD A;  1K73 U;  1OZ2 A;  2DXU A;  4QVD A;  3MEU A;  2ZPI B;  4BE0 A;  1YBY A;  4BI8 B;  2Y90 A;  3F70 A;  2A3L A;  2M1H A;  2PQW A;  4OF1 A;  4Y91 A;  1LOJ A;  4F7U G;  3QYH B;  3G71 A;  3OYN A;  2VGN A;  2VXE A;  1PSF A;  1N8R U;  2PU9 B;  1JJ2 S;  1IRE B;  2WSC E;  3L2Z A;  3OSV A;  3SDZ A;  2VUB A;  2EKO A;  3RMQ A;  4M7D B;  1VQM T;  2D9T A;  3BFM A;  2L3R A;  5GAN 3;  5CIU A;  4QVC A;  2DTO A;  3RKY A;  3CPF A;  2RB6 A;  4M77 A;  2WSE E;  2FB7 A;  3CPW A;  5FRM A;  2DPP B;  3N5B B;  4BDZ A;  3I56 A;  3M57 A;  3RER A;  2KMT A;  2XDP A;  3OBY A;  5HK0 A;  2EWN A;  2PVG B;  1Q82 U;  1S72 A;  2C06 A;  1G3S A;  4DOW A;  1NJI U;  5LJ3 f;  3TU4 K;  3OYD A;  4M7A B;  4KBM B;  3V8K A;  2P0P A;  5D6Y A;  1EIF A;  4ME7 A;  1KC8 C;  1M1K C;  5IAY A;  4P5N A;  4J7F A;  4N4I A;  4EPC A;  2Y4X A;  4L59 A;  3KXT A;  2K5L A;  4NL2 A;  3JAM E;  3L2Q A;  4M7A G;  2IG0 A;  5GAN 4;  3LX7 A;  3P8D A;  5GAM h;  5CVI A;  2R58 A;  3OS2 A;  2JVV A;  4F7U F;  3I55 A;  2EJ9 A;  3PNW C;  1LNX A;  3L2R A;  1Y96 A;  3PMI A;  3L1A A;  3G7Z A;  2CZ0 B;  2DIQ A;  3CMA A;  3OYK A;  3JCM e;  2QQ9 A;  5CQX A;  4A53 A;  2RJC A;  4M77 E;  4M7D D;  1NPR A;  3CCQ A;  3CCE T;  4XQ3 A;  1Q86 U;  2DK3 A;  1VQL A;  3HRS A;  2JTF A;  3RES A;  2PVD B;  5KE3 A;  2GFU A;  2X4W A;  3QZ5 B;  3GF5 A;  5J3B A;  4L6V 5;  3I56 T;  1MGQ A;  3L42 A;  4IUQ A;  3URG A;  5C0M A;  5GAN 2;  4TVR A;  3GOX A;  4J6W A;  5LL6 S;  3MEV A;  3LLR A;  4MZT A;  3FLG A;  4PLI A;  1ZQ1 A;  3FJP A;  2KVQ G;  2LCL A;  3QBY A;  2IVW A;  3J80 E;  3HPW A;  3P8H A;  4QQG A;  2QQA A;  1YHQ A;  2RI3 A;  2CZ7 B;  3UDC A;  1RI0 A;  4BI3 A;  4M7A D;  3RKX A;  3A8M B;  3BW1 A;  2LDM A;  4BD3 A;  1R8O B;  3C95 A;  1BKB A;  5CKF A;  1BYM A;  4C5H A;  3C94 A;  2QTX A;  3OW2 A;  4M7A F;  4NL3 A;  3OYB A;  4KUI A;  1BI2 A;  1K73 C;  1OYX A;  4M7D A;  3FIF A;  1QVF S;  4MZM A;  3G6E A;  3QG1 A;  4M75 B;  4DOV A;  3I55 T;  3LWI A;  1VQP A;  4X34 A;  2QA4 A;  3M4Y A;  3CMA T;  1JRI A;  3M54 A;  4MZP A;  2DD5 A;  4ZGJ B;  5A2Q E;  3V8L A;  4QW2 A;  2WSF E;  1N9S A;  2D0Q B;  2ZPB B;  3X24 B;  4KT0 E;  3CCQ T;  3OQ5 A;  3VUB A;  4M75 G;  2QQB A;  1WQW A;  2OTL T;  3A8G B;  2EYQ A;  1UGR B;  2DD4 A;  4XU0 A;  3CD6 A;  4EMH A;  5GMK m;  4A4G A;  3GNG A;  3GLX A;  2YHT A;  2RHY A;  3HRT A;  1YJN A;  1G5V A;  2YRV A;  5FU7 B;  1NZ9 A;  1YCY A;  2LRQ A;  3AHU A;  2O4X B;  3JCM g;  1UGS B;  4ZN3 A;  3T9N A;  4ZTJ A;  2JNG A;  1BI1 A;  3MP1 A;  2EFI A;  2DIG A;  2RI2 A;  3LYI A;  3MP8 A;  3QUI A;  1QW1 A;  4M78 C;  3JCM f;  1YHQ T;  3CCL A;  1GXI E;  2MWO A;  1X01 A;  2DTI A;  3H6Z A;  3FEO A;  2VGM A;  1O75 A;  2GQV A;  2PUK B;  4MDW A;  3OS0 A;  3OW2 S;  2XI9 A;  5HKC A;  3R6O A;  4PJO C;  2KK4 A;  2RI5 A;  3G6E T;  3M53 A;  1VQ6 T;  1VQP T;  4M75 D;  5J39 A;  2GCX A;  4O5V A;  5GAN j;  5LJ3 h;  1UGP B;  2ZZD A;  3JCM c;  3ZFJ A;  1VQ5 A;  3OYA A;  4M78 A;  3SB2 A;  3GP8 A;  3INZ A;  4M75 F;  1Q86 C;  1O9S A;  3LH0 A;  4E47 A;  4XTU A;  3OSS C;  2YLB A;  5CK9 A;  1HXD A;  4C0G A;  4C92 C;  1YI2 A;  1W4S A;  3PIO A;  1UB4 A;  4HCB A;  4PJO A;  2K3X A;  3NTK A;  5IT9 E;  2X4X A;  3JCM d;  1Q81 U;  1QVP A;  4NOY A;  3H8Z A;  4OB1 B;  4CI0 C;  2HBP A;  2XDB A;  3OB9 A;  4BE2 A;  3QYG B;  2F69 A;  3OMG A;  4XK8 E;  4ZN1 A;  2BIV A;  3EAE A;  5GAM j;  5GAO p;  4E7I A;  5GMK i;  2RK2 A;  2RM4 A;  4PL6 A;  4EMK B;  3CCL T;  2PUO B;  3HFN A;  4E7K A;  4MMK A;  1XNI A;  2EAY A;  2ZGW A;  2K57 A;  2AHJ B;  2K3Y A;  2BKD N;  4C92 A;  2R5A A;  2E10 A;  2OTJ A;  3RMS A;  1ZBX A;  1I4K 1;  2X35 A;  5GAN 7;  3FRN A;  4M78 E;  1V29 B;  2RO0 A;  1KQ1 A;  2DTH A;  4J6X A;  3RIR A;  4ZGE B;  3C12 A;  2VXF A;  4E7H A;  4JRP A;  5LJ5 h;  3CCM T;  1VQ5 T;  2WAC A;  3QKJ A;  2XG8 D;  4PJO E;  3CBM A;  2CGH A;  2DZ9 A;  2LNV A;  2XHC A;  5GAN e;  3OYM A;  4HT8 A;  2O4X A;  4M7A C;  1TH7 A;  4HCZ A;  4D6W A;  1M4Z A;  4R56 A;  1AHJ B;  2ZPG B;  3LGF A;  4XTX A;  1YJW T;  2CS7 A;  3A5Z B;  1XOV A;  3UT1 A;  1VQ7 A;  3BDL A;  4BY6 C;  3M9Q A;  1G3W A;  4LDY A;  3VYH B;  3VYG A;  5GMK e;  1KQS S;  3QJY A;  3HL8 A;  1D3B B;  5GAO l;  1QVF A;  3MHX A;  1YIT A;  4C92 E;  4JLI A;  2V8I A;  4XU1 A;  4C8Q B;  4FM4 B;  4J6Y A;  1QVG S;  1W2B A;  5KE2 A;  3KBG A;  3RUX A;  4C0D B;  2DZC A;  4E7L A;  3V7S A;  5FRN A;  4BAC A;  2MAM A;  4OGE A;  2KY9 A;  3CCV A;  3X26 B;  2OTJ T;  3M55 A;  5GAO n;  4C8Q G;  4EMG A;  3OYJ A;  2VYT A;  3E9F A;  3OBW A;  2RHU A;  4KUL A;  3X28 B;  3JCM Q;  3VJP A;  2E12 A;  4IUT A;  2P4T A;  4B9W A;  3CC2 A;  2DXB A;  2R57 A;  5CKE A;  3SWN B;  5CKD A;  4RMO A;  4EMK C;  1JBM A;  4Z02 A;  3CCU A;  1BIB A;  4X9D A;  2MF2 A;  4IKF A;  4FT2 A;  2RJF A;  3JCM h;  4M7D C;  2X4J A;  4RCB A;  4XTV A;  3VUZ A;  3HRU A;  4PLL A;  4DQ2 A;  4PNO A;  1VQO A;  2XKO C;  2RH2 A;  2EJF A;  4Y28 E;  4F7U A;  3M5A A;  1S72 T;  3GPL A;  3JB9 I;  5DLQ E;  3JCM W;  2M16 A;  3V7R A;  4BI4 A;  3HKS A;  3DKM A;  4XTZ A;  2RJD A;  5CKB A;  3WVE B;  2L89 A;  3O8V A;  3MEW A;  3ASK A;  1VQ9 A;  1VQ7 T;  4GLK A;  1IZ6 A;  2F5K A;  4QVZ A;  4EMK A;  1Q81 C;  4OB3 B;  3FB9 A;  4L5G A;  3OYL A;  3X20 B;  4MDX A;  2JUF A;  5J26 A;  2EQJ A;  2RA2 A;  2KAF A;  3CBO A;  1YIT T;  4OVA A;  3TCJ A;  5A0G A;  3E19 A;  2LC4 A;  3TEE A;  3V7C A;  2DJZ A;  3HSB A;  4ATO A;  1YIJ A;  1N6A A;  2R5M A;  3VU3 C;  2P0Q A;  1G3T A;  2EQM A;  5GAN g;  1W2B S;  3M4G A;  3MCA B;  4BDY A;  2E6N A;  1VQK A;  4FL6 A;  3QDR B;  5I2M A;  5LJ3 j;  3CCV T;  1QP3 A;  3PFS A;  1M1F A;  5GAN f;  3OYE A;  4C8Q F;  1VQ4 A;  2YLC A;  4HCC A;  3OY9 A;  1VQN A;  1VQL T;  2XD0 A;  1U1S A;  4LDV A;  2KQW A;  3CCU T;  4BUG A;  5CAI A;  2LQ8 A;  2M0O A;  4F7U E;  2RD1 A;  5AYF A;  2X4Y A;  4M7A A;  2EIF A;  1VQO T;  2HAX A;  4BE1 A;  3SWN C;  2RHX A;  4KUD K;  1OZ3 A;  5GAO q;  5GAM g;  2CZ1 B;  5CCA A;  1FX7 A;  3CEY A;  2XU8 A;  4N0A A;  3E9G A;  4M7D E;  3S3N A;  4FU6 A;  4Q5W A;  4E7J A;  4PKC C;  1VUB A;  3JCM X;  3X25 B;  3OA6 A;  3LGL A;  1X75 C;  4JS5 A;  2XK0 A;  4JDS A;  5A0D A;  2LVM A;  4M77 B;  4IUR A;  1Q7Y U;  1B34 B;  3SFM A;  1K9M U;  5GAN d;  4V2S A;  2ZCF B;  1I5L A;  1WNL A;  2LT4 A;  3QO3 A;  2V8J A;  2QQR A;  3LW5 E;  1RL2 A;  2QA4 T;  2DKG A;  4QQ6 A;  3QHS A;  4LDW A;  4M77 G;  4UC4 A;  3SWN A;  3UPU A;  1VQK T;  3J7A F;  5LJ5 j;  3M58 A;  4CRI A;  2FVU A;  2LT1 A;  1VQN T;  1VQ8 A;  3JCM b;  5FRO A;  4J7I A;  5L8R E;  4M7A E;  3EFR A;  2HQX A;  1Y7X A;  2QDY B;  4M75 C;  4ELY C;  5HK3 A;  4XTW A;  3GIB A;  3CD6 T;  2JTM A;  3OS5 A;  5LJ3 e;  1YJN T;  3VV0 A;  3CCS A;  2XID A;  3QSU A;  3DB4 A;  2DO3 A;  3MET A;  3OMC A;  1WPY A;  1KQS A;  4LDX A;  4OB0 B;  1Y96 B;  4A54 A;  4HKE A;  2KSS A;  3C4S A;  5CKH A;  3KUF A;  2E6Z A;  4LDU A;  1XTD A;  3FDR A;  1QVG A;  3JB9 F;  1HK9 A;  5GMK l;  4M75 A;  5FU7 C;  1WJS A;  4IUV A;  3MO8 A;  4M77 D;  2JOY A;  3PMT A;  5C6S A;  4VUB A;  4C0Z A;  2K2V A;  2DXC A;  4C5G A;  3CC2 T;  2VC8 A;  1MHN A;  3TRE A;  3S3O A;  4B9X A;  3BY7 A;  1I81 A;  3DLL A;  3QJ6 A;  3S3M A;  1KD1 U;  4M77 F;  3A8L B;  1FXX A;  5GAN 8;  2HQE A;  4HA8 A;  1KHC A;  4XAX B;  4IUU A;  4A4K A;  3CC7 A;  4OMF B;  1VQ8 T;  2K5I A;  4N4H A;  2DAQ A;  3OYY A;  3CXC S;  3CME A;  3CCM A;  4X9C A;  3L2W A;  1YI2 T;  1N9R A;  2QXF A;  2RHZ A;  3JCM J;  3CBP A;  4WF2 A;  3CCS T;  5LJ5 e;  1XQH A;  2LQK A;  5HY6 A;  3OYG A;  1M1G A;  2DXT A;  1KHI A;  3NFC A;  3NTI A;  3CCE A;  3J81 E;  3ER0 A;  1BI3 A;  3HHT B;  4JS4 A;  3MEA A;  1M9S A;  4M75 E;  5KCO A;  5GAN h;  2E64 A;  5D6X A;  4JRK A;  1NE8 A;  1B34 A;  4BB7 A;  4M7D G;  3DLM A;  1FWZ A;  2K4Y A;  4FT4 A;  4O6J A;  2F5T X;  3DB3 A;  3JCM V;  5LJ3 g;  1WQ7 A;  3E1S A;  4JRI A;  2HD0 A;  5GMK h;  1U8R A;  4OGC A;  4YTL A;  5GAM e;  1Q7Y C;  2A7Y A;  1WGS A;  1K9M C;  1K8A U;  1H3Z A;  4C5I A;  2FYK A;  4ELZ C;  2LCC A;  2XDD A;  1ZHI A;  3HFO A;  2QI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...