1Y96B

Crystal structure of the gemin6/gemin7 heterodimer from the human smn complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
AQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Gem-associated protein 6
publication title The Gemin6-Gemin7 Heterodimer from the Survival of Motor Neurons Complex Has an Sm Protein-like Structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11095 Gemin7 Gem-associated protein 7 (Gemin7)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y96B00
1B34A 2YLBA 4M78D 3EFSA 1LNXA 2I2LA 4EMKC 2K57A 5GAMg 4EMKB 3JCMW 4M78G 5GMKh 5GAMe 3SWNA 3JB9G 4JLIA 3V7SA 3JB9I 2YHTA 4EMHA 5GAMf 2DTOA 4M78B 4XTWA 5GAN5 2EJ9A 4HT9A 3FJPA 3JCMJ 3RERA 1N9RA 4M78E 1BIAA 2HNIA 4MMLA 1TH7A 3PGGA 3RKWA 1I8FA 4WF2A 2YLCA 4X9CA 2EAYA 1BIBA 2CGHA 4M75D 2JN0A 1B34B 1HXDA 4V2SA 3JCMh 4HT8A 4A53A 3SWNC 3HSBA 1WQWA 2DZ9A 2EJGA 5LJ3h 1JRIA 3SWNB 4DQ2A 5GMKl 3VU3C 1H641 4M7AA 5LJ3j 3V7RA 3JCMg 4EMGA 1Y96A 2DXUA 2Y90A 3RIRA 4C8QD 1U1TA 4RCBA 3HFOA 1JBMA 4M7DA 4XTZA 3V8LA 2DEQA 4JUVA 5GMKj 4M7AF 3RUXA 2DKGA 4C92A 4M78C 2FB7A 4M75A 4M7DF 1YCYA 2RA2A 4M7AD 2DVEA 3HFNA 3RKXA 3JCMV 4C92F 4J6XA 1LOJA 5I21A 4OP0A 4M7AG 1HK9A 3FB9A 5GAN3 1X01A 2VXFA 4M75F 4M7DD 3JCMd 2E64A 2DXTA 2E41A 1M8VA 4XTXA 4XTVA 4C8QA 4C92D 4RCCA 5LJ3d 4M7DG 4M7AC 3L2ZA 1WPYA 3SB2A 4C92G 4M77A 1I5LA 4M7AB 4JRKA 5GAOq 4NL3A 5GAOl 1Y96B 5DY9A 4M75G 4C8QF 5LJ5h 4MMKA 4X9DA 5GAN4 4N0AA 1I81A 4M7AE 4XQ3A 4XU0A 5LJ5j 4M7DB 4M77F 4C92C 5GAN2 3FIFA 1MGQA 1KQ1A 4NL2A 3AHUA 1U1SA 4C92B 5LJ3g 3JCMe 4M75C 4M7DE 3BFMA 2VXEA 5GANh 4C8QG 5LJ3e 4M75B 2E10A 3INZA 4M77D 4C92E 4PJOD 4XU2A 3BY7A 1I4K1 2QTXA 3QO3A 4HA8A 4PJOG 3JCMf 2VC8A 4M77G 4M75E 5GMKm 4J5YA 4PNOA 5LJ3f 5GMKe 3JCMQ 5GANg 4C8QC 5GAOp 2RB6A 5GAOn 4C8QB 4J6YA 2E65A 5GAN7 4M77C 3JCMX 5GAN6 2EWNA 3JCMP 4XU3A 4PJOB 4XTYA 3QHSA 3V8JA 1LJOA 4M77B 4C8QE 5GAMh 3QSUA 4Y91A 4JRIA 5LJ5d 2DJZA 5GAMj 4PJOE 2FYKA 5GANj 1WNLA 4M77E 4PJOA 2ZGWA 3M4GA 2EJFA 2RM4A 3JB9D 3JB9H 3V8KA 4F7UG 4XU1A 5GAOr 4M7DC 1M5Q1 5GANd 4PJOF 3RKYA 3JCMc 4QVDA 1D3BB 4EMKA 4XTUA 4A54A 3GIBA 3EFRA 4NOYA 2DTIA 3L1AA 5LJ5g 3BDUA 4F7UB 1D3BA 3BW1A 5LJ5e 4J6WA 5GAOm 4F7UE 4QVCA 1KQ2A 5CAIA 4F7UA 4M78A 1WQ7A 2DTHA 3V7CA 5LJ5f 5GAN8 5GAMd 2E1HA 5GANe 2DZCA 2RD1A 4PJOC 3QUIA 4F7UF 4M78F 3RESA 3JCMb 3JB9F 5GANf 5GMKi 1N9SA 4N0AC 3JB9J
chains in the Genus database with same CATH superfamily
4E7ZA 3PMIA 1K9MU 1D1BA 2MYSA 1VQMQ 3OYBA 4LUDA 3HRUA 4PFPA 1U8RA 1KC8U 4CRIA 3EH1A 3CCJQ 3GNGA 4AT1B 2EQJA 1W1FA 2G3RA 2EGCA 4C5EA 2L8DA 2LC4A 3LWIA 1JRIA 1M3CA 3PMTA 3EG1A 1VYTA 1ZQ1A 4FT4A 3CXCP 3L2QA 2M9UA 5FU7C 3MEAA 5KYUB 3R6NA 2E5KA 3A1PA 3JCMd 2DXTA 3CBOA 2PZ1A 3SB2A 1VQKT 1WXTA 3RR6A 3EGDB 4M75G 3ASKA 4MMKA 4E7SA 1EIFA 2C06A 3QDFA 4XU0A 4FYXB 4OGCA 3CCUA 2COYA 4OMMA 1X2KA 2FO0A 4RG2A 1GCQA 1K4US 3JCMf 1NLOC 2V8KA 5FLXE 4M77G 4PNOA 4IKFA 2GNCA 4MZMA 3EG9B 4EDUA 2MOXA 3M0UA 1Y7XA 4R55A 4O6JA 3QJYA 2ATCB 3V8KA 4F7UG 2J6OA 2MPXC 4XU1A 4E2FB 3GNFB 1M5Q1 5GANd 4OB1B 4PJOF 1FMWA 4E7HA 3GIBA 2QDLA 3M56A 2A7YA 3LWHA 2FZGB 2MWOA 1FYNA 1P92A 1VQKQ 1C6VX 1IREB 4F17A 3SEMA 4JZ4A 1VYVA 2L2PA 1M90U 2RHYA 3REAB 5I2SA 1IGQA 1NBEB 3QUIA 1WHLA 3RESA 3JCMb 4KRTA 5GANf 2MCNA 3LLRA 3CCQA 2MWPA 2QK0A 5GAMg 1G3TA 1D1CA 3C94A 2GTOA 5GAMe 4MDXA 2RJEA 3C12A 2EYWA 2L3RA 1HYOA 1NZ9A 4JLGA 1VQ9T 2MF2A 4DOWA 1TH7A 1WJQA 4IIOA 1EZZB 4M75D 5HCKA 1Q7YU 2QDYB 1UG1A 2RI2A 2XDDA 2NLUA 2C0TA 3A5ZB 1RI0A 3HFOA 5KCHA 4XTZA 3V8LA 3OW2S 5CR2A 2ZAEA 2JXBA 1WFWA 4IIMA 1R77A 1F1BB 2RK2A 3RKXA 3JCMV 2CZ6B 1ZSZB 4BDZA 4XK8E 1VQ9Q 4C92G 2KXDA 2K3YA 1M3AA 3GBQA 4XQ3A 3X26B 2KRMA 2CUDA 3E1SA 3QWYA 4WTOB 2RO0A 1UEBA 4XU2A 2RHUA 1RUWA 2B86A 3QYHB 3UT1A 2X35A 1Q86R 5GAN7 3KXTA 1Q81R 2ROTA 1YWOA 5GAMj 5D6XA 4PJOE 3A8MB 4YTLA 3X20B 3TSZA 3JB9H 1QVPA 4LE9A 3TCJA 4PL6A 1XQHA 1D3BB 4BUGA 1RABB 2ROLA 3EFOA 3L1AA 5LJ5g 1U06A 2RK1A 3OY9A 2QQBA 5LJ5e 4J6WA 2NUPA 1WJSA 4B9XA 4F7UA 4LN2A 1UHCA 2DL4A 2KRSA 4PJOC 1NPPA 1QWFA 4JRPA 1T0JA 2AIRB 1AT1B 5GMKi 3G4ST 3CPWA 4ZGJB 1B34A 2YLBA 4PKCC 3N5BB 3RDVA 5A0GA 2DL8A 3GLXA 1GCQC 1NLPC 2J6KA 3I9QA 2HCKA 4E6RA 1M2OA 2YWWA 3HPWA 3M57A 5J3BA 2AZVA 3OYEA 3T9NA 2QQ9A 2GBQA 1N8RU 5KYNA 5DLQE 2KEAA 3SWNC 3CCET 2A37A 1UE9A 4IUVA 4AFSC 2JJ9A 1TU0B 3G4SQ 1BU1A 1UUEA 1KD1R 1SHFA 4CC3A 2EKOA 4BE0A 3CMAT 2NUZA 2ZPBB 1RAAB 4LDXA 3ULRB 1MMNA 3EG2A 1UJYA 3OYJA 3MP6A 2LRQA 1M1KR 1WZOA 2E64A 1M8VA 3M0SA 2VB6A 2L89A 1YIJA 1QQJA 4RTYA 2LCCA 2AHJB 5LJ5j 4M7DB 4OB3B 3A8GB 1JJ2P 3BFMA 2LX7A 1UGRB 2QG9B 2F69A 3CCEQ 3INZA 2KAFA 3DLLA 1WGSA 2X4WA 2P0KA 3OYKA 3S3MA 5FWCA 1JB0E 2JM8A 4C8QB 3OYLA 2K7AA 2PNIA 5GAN6 2JOYA 1W70A 2HKNA 5FROA 3ME9A 3CMAQ 2SEMA 4Y91A 1ZA2B 2MI6A 2DJZA 4BY6B 1YHQA 3L2RA 2CP7A 2EBPA 1K73R 4B9WA 3CCLA 2HQXA 1JXMA 1OULA 2ZPIB 3BDUA 2DERA 3CCMT 4M78A 2V8IA 3DB3A 2E1HA 1Y0MA 3CCSA 2RHIA 1K8AU 3JB9F 2OTLT 3HL8A 1Q82C 2VV5A 5C0MA 2DA9A 2DBMA 1ARKA 3M55A 4JRQA 1NPRA 1QCNA 4BE1A 1OPLA 4J9GA 5GAN5 2EJ9A 3CEYA 3JCMJ 1PSFA 3OS0A 1UFFA 2RMOA 1B3QA 3CCMQ 1SRLA 3NHNA 1HXDA 3EGXA 2KE9A 3JRZA 1A0NB 2E70A 2M02A 3J7AF 2QTVA 2W0ZA 1Y96A 1MV3A 2FPEA 2OTLQ 4AFUC 1K76A 2ZPGB 2LX9A 2RA2A 2L3SA 3VS2A 5DLOA 2CUBA 1VQ7A 2KBTA 1VQ5T 4OB2B 4QQ6A 3G7ZA 2K9GA 1NG2A 4J8OA 3CCVA 1VQOA 1WPYA 1G3YA 3H0IA 4M7AB 1D1AA 3HHTB 5GAOl 5DY9A 2PU9B 3MJXA 2H3EB 4N0AA 2O9VA 3URGA 5LJ3g 2CP3A 1QVFP 5LJ3e 2K5IA 1I4K1 3QO3A 2VC8A 4OMNA 1PG5B 2DMOA 1XTDA 3ER0A 3CCRT 2K5LA 2RB6A 1CKAA 1K0SA 2HQHA 3QZ5B 2D8HA 2EYQA 4JRIA 5CIUA 2DIGA 2L0AA 4OVAA 3CXCA 2DXBA 2J7IA 1KSWA 3HRTA 2QGGA 2LNHB 2YT6A 3VUZA 3EHQA 5LL6S 5KE3A 5IT9E 4Z02A 2CT4A 2QYZA 1KQ2A 5CAIA 3Q1JA 5CQXA 3A98A 4XAXB 1VQ6Q 4KH1B 2MIOA 2XKOC 3VS0A 3CCRQ 3JB9I 4HCCA 5J26A 3META 3CMET 4OMQA 5IHIA 2I2LA 2DD5A 1JJ2S 3UA6A 3LGFA 2P84A 5IXFA 1PD1A 4VUBA 1HSQA 2HL5C 1OU8A 3R6OA 4C0DB 1TWBA 4M78E 2QGFB 1FMKA 3FEOA 4X1VA 1S72T 2JT4A 1ZA1B 2E3IA 4NS5A 5FU6C 4PFZA 2EJGA 5LJ3j 1X6BA 4GLKA 2EYZA 2EQUA 3CD6A 3L2UA 3HKSA 1X6OA 2PUOB 2K3BA 2RI3A 2EPDA 1ZUKA 4M78C 2LQ8A 2OTJA 5M9OA 5KYWA 4LNPA 4ZGDB 2RI5A 1LOJA 1GRIA 3NTKA 4M7DD 2E41A 5KYXB 4XTVA 4AMCA 2QA4A 1UECA 1YBYA 1QKWA 2FPFA 3D7SB 5CQYA 2DL3A 3JCMe 4KGVB 3PVQA 2VXEA 4CC4B 4M75B 3U23A 4PJOG 3JAME 3JCMQ 2OX7A 4QT7A 4J6YA 3TQ7P 4M77B 2FVUA 2O9SA 3TVTA 2EVRA 1GFDA 3DLMA 1ZBXA 1OQKA 4ZGEB 5GAOr 4OMPA 3EFOB 2L3QA 3MHXA 4OF1A 1W4SA 1VQ4T 4F7UB 3BW1A 4PJMA 4ZN3A 4KBMB 5GANe 1G2BA 2DRMA 4N0AC 2CH4A 2WACA 3JCMW 3I5RA 1QVFS 2DFUA 2RH2A 3F70A 4BI4A 3OA6A 1IZ6A 1YJWT 4ZN1A 3OW2P 3OYDA 2CS7A 1BIAA 1HD3A 1VQ4Q 4MMLA 2DILA 3RKWA 4AFQC 3CBMA 1NYGA 2D8JA 2DE0X 1YNZA 2DZ9A 4A4KA 3GPLA 5GMKl 2QQRA 2DXUA 2PVDB 2F1LA 4HCBA 1K0XA 4M7DF 4M7AD 4MZPA 3HFNA 1YP5A 4MDWA 1X01A 1ZSZC 1YJWQ 2DO3A 2M16A 3EG0A 2HDAA 3M58A 5HK3A 2E4HA 2JZ2A 4C8QF 1AZEA 1I81A 2GCXA 2R5AA 4C92B 3O5ZA 1UDLA 3I35A 4KUDK 3G71T 4KULA 2LZ6B 1VQ8A 5GANj 3DB4A 3MPUB 1TXQA 1YITT 4DBRA 5A0DA 1E7OA 2E65A 4XTYA 5GAMh 3PTAA 1TG0A 4RTXA 1VQNT 4PJOA 1JO8A 3M4GA 3WVDB 2EQMA 1BK2A 2DBKA 1AZGB 3TSWA 4JJCA 2KNBB 2RN8A 4E7LA 1SHGA 2KRNA 4TVRA 8ATCB 4RG8A 2LTOA 3NGPA 3X25B 1MUZA 2O4XA 3UDCA 3G71Q 1G83A 1PRLC 3EH2A 3KBGA 5KYYB 1PHTA 3LH0A 4F04B 1YITQ 1W6XA 4FYYB 2BIVA 3IQLA 1GFCA 4ATOA 1YN8A 2YUQA 4M4ZA 3SWNA 2QEXT 1VQNQ 1Q82R 4R56A 1VQLT 5IH2A 1C1AA 1YJNA 3EGXB 1MNDA 3VS3A 2CGHA 1T3LA 4V2SA 1RL2A 3LYIA 4HXJA 2GF7A 4OB0B 1M3BA 2YSQA 5D7UA 4OMLA 1FX7A 2QXFA 3QBYA 3VU3C 1H641 4GBQA 3UA7A 4UC4A 2Y90A 1JEGA 3I56A 1JBMA 4DOVA 4M7AF 3J80E 2V1RA 3M59A 2QEXQ 2NUTA 5CKDA 4L5GA 4IUUA 1VQLQ 3C4SA 2RQUA 3PIOA 2KYMA 1GBQA 3CMEA 2EYXA 4KGZB 5LJ5h 3P8DA 4X9DA 2GQVA 3UWNA 1ZLMA 1SKUB 1QKXA 2K2VA 1MGQA 1OZ2A 3OYIA 2ABLA 1PKTA 1UGPB 4M77D 4RTUA 1UGSB 1DJ7B 2BZXA 4C8QC 1ZHIA 1PSEA 1S72A 1OPKA 4KGXB 3QHSA 2L3PA 4BY6C 5I22A 4JZ3A 5CKFA 4A4FA 1VQ7Q 1BCOA 2RHZA 2A3LA 1OZ3A 1ACMB 1BI3A 2D0QB 2CREA 3NMZC 3MP1A 5IN1A 1OX9A 1Q95G 4A54A 3EFRA 1Q86U 2O31A 3TREA 4C5HA 3G6ET 2SRCA 2CZ1B 1Q81U 2KROA 1SRMA 2CP5A 3OS2A 1QVFA 1NEBA 2EGEA 2HZYA 4PJJA 1B7TA 4Z88A 4J9HA 2DRKA 4M78G 3MCAB 3MEWA 4JLIA 2O88A 4J7FA 4QVZA 1WXBA 2BE9B 1AD5A 1KG1A 1JU5C 3JV3A 4DA4A 5FU7B 1NE8A 1QMCA 2XI9A 3G6EQ 2FHDA 2K4YA 3SFMA 2LQKA 4ELZC 2LJ1A 1M30A 2ZPHB 4DQ2A 2PTKA 1AWXA 2J6FA 1VYUA 1WJRA 4L6V5 1VQPA 1YCYA 3CC2A 1Y07A 1OOTA 3WXMB 1YI2A 4ZNXA 1AWJA 1KQSS 3FB9A 2YXYA 2VXFA 3CC7A 3M0PA 4M75F 2KVQG 2LT4A 4AG1C 1WXUA 4C92D 2YRDA 4M7AC 1VQMA 3J81E 1B07A 1I5LA 3OYAA 1VIEA 1H8KA 1KD1U 3A8OB 3NTHA 1NJIC 4M77F 1KJWA 2P4RA 5IHKA 2MK5A 1WHJA 1VA7A 3CCJA 1M1KU 1FMVA 4E47A 1ZBJA 2LJ3A 3VS5A 2VASA 4HCZA 1M2VB 4PLIA 4LXCA 2I0NA 4DBHA 1PWTA 2EQKA 3I55T 1CSKA 1K9MC 1FWZA 2ZGWA 5IXBA 2HBWA 4NOYA 2DTIA 1KC8C 3CC4T 1IHWA 2XDBA 2R57A 5CVIA 4J9CA 2DVJA 2KI7A 4FYWB 1K73U 1KHCA 1I0CA 3SHWA 3OB9A 3OYNA 3EFSA 1BI0A 4EMKB 1WHKA 3I55Q 4R0KA 2CKKA 4EMHA 2YUOA 4DEYA 4ZTJA 4C0DC 1Y57A 8AT1B 1QVGS 1PD0A 2D1XA 1OV3A 5GJVB 2LQNA 5KYUA 2ESWA 3CC4Q 2YLCA 3LX7A 1IGUA 2QQSA 1YJ9T 1VQKA 5LJ3h 4J9FA 4EMGA 2HBPA 3MEVA 1RAGB 1H3ZA 2O01E 2AK5A 1MNEA 3H6ZA 2FB7A 3VYHB 4OGEA 4C92F 2F2VA 2JUFA 3M5AA 4OP0A 5D6YA 2LDMA 4ZTFA 2EIFA 3C95A 3L2ZA 3OW2A 2PVGB 3ZL7C 1KFZA 2RF0A 5GAN2 3AHUA 1YJ9Q 4M75C 3OYGA 1M90C 3A8HB 5FRMA 4D8KA 3ZFJA 3H0FA 1K1ZA 2HMAA 2ZPEB 1TUCA 4M77C 3JCMP 2CH4W 4XU3A 4PJOB 4ELYC 4FL6A 3PT9A 3PE0A 1JXOA 3CCUT 1BKBA 4WCIA 4XTUA 1PKSA 2JW4A 2O4XB 1MMAA 2X4XA 3M0RA 1VQ6T 2A0FB 2DYIA 2NWMA 3GF5A 1VQ9A 4C5GA 1MV0B 2DX1A 4X34A 1FXXA 4F14A 1GCPA 3OYYA 1Q7YC 2F5KA 1N27A 5FRNA 3CBPA 3OYFA 3E2UA 2YUPA 3QXEB 2MMPA 1H92A 2KYBA 3V7SA 1AHJB 2G6FX 2COZA 4KUIA 3CCUQ 1IB8A 1I1JA 3VUBA 3VS1A 1PC0A 2LMJA 2EW3A 3CQTA 2FRWA 1G3WA 2KK4A 3M9QA 2BTTA 1UHFA 4E7KA 1ZSZA 3JCMh 4DBFA 1IO6A 3VYGA 3CCQT 3HSBA 1SSHA 2CP0A 1HJDA 4FW1A 1EFNA 4FSXA 2H8HA 3HTRA 5KE2A 4JJBA 4P5NA 4BD3A 2EGAA 3EG3A 2DVEA 5I21A 4DEXA 2CP6A 4C0FA 2JNGA 4XTXA 1TUGB 1YFNA 3VJPA 2XD0A 4BI8B 2FL7A 2DD4A 2KXCA 5GAOq 2XG8D 4C92C 4FU6A 3CCQQ 5GANh 4FW2A 2E6ZA 4B6MA 2H3JA 2DL7A 4ESRA 3H41A 4J5YA 4A4EA 3EHRA 5GAOp 2X51A 3FLGA 3OBWA 3V8JA 2VWFA 3QSUA 2VUBA 2JS0A 2VYTA 1U3OA 1WNLA 4RKUE 3G4SA 4J83A 4ORZA 1PRMC 4O5VA 4QVDA 2GFUA 4D8DA 2KSSA 2RNAA 5CO7A 2DPPB 2LCSA 2MAMA 3QIIA 1N8RC 2DL5A 1D0YA 3CCEA 3AT1B 4RTTA 2RQRA 2X3WD 5GMKh 5C6SA 4LDYA 4Y28E 2NUPB 2E12A 1M9SA 3CMAA 4XTWA 4HT9A 2ZPFB 2AKLA 6AT1B 3P8BB 2LNVA 4PJNA 2YRVA 1V29B 2JTMA 1VOMA 3CPFA 5KH6A 3THKA 3G1JA 1B34B 2GQIA 1TOVA 2QAZA 3SDZA 3MKDA 4K11A 1U1TA 2HEQA 4M7DA 3OQ5A 2EKHA 3RNJA 3UPUA 2XMFA 2Z0WA 3H0HA 1PM3A 4C8QA 4RCCA 2X3XD 2LT1A 2XDPA 4N4IA 1OYXA 2BE7D 4D6WA 2KT1A 4CI0C 1S1NA 1SF9A 2RQWA 2OAWA 4PJOD 3FDRA 4Q5WA 1BBZA 2NYSA 3L42A 1M8MA 3CCMA 4N4HA 3H8ZA 1NJIR 5GMKe 2OJ2A 1VQPQ 1X69A 1QCFA 3I5SA 1K8AC 1QCOA 3CC2Q 2YRCA 1YIJT 3MEUA 3CC7Q 2OTLA 2RM4A 1D0XA 1V76A 2OAUA 3CPWS 2DNUA 2FG0A 3VRZA 4DBQA 1K9MR 4CC2A 3HRSA 1G5VA 4J7IA 1OU9A 4QVCA 3E9FA 4KT0E 2DEUA 2A28A 1WQ7A 2JS2A 1OI1A 5GAN8 3OYCA 1SSFA 1KC8R 2V8JA 3ZBDA 4A4GA 1YHQT 3EAEA 4JJDA 5FU6B 3OMGA 4J9BA 2C0OA 4LDWA 3CCLT 1J3TA 3QPHA 5L23A 4J9DA 1YIJQ 2PUKB 1WDXA 1W2BP 3M0QA 3GOXA 1XJWB 1KIKA 2KT8A 2RPNA 1U5SA 1RLQC 4M78B 2K6DA 4GY5A 1X75C 3VV0A 3RERA 2DETA 1V1CA 3O8VA 1VQ5A 3CCST 3S3OA 2CP2A 1JJ2A 1KQSP 2F5TX 4OMOA 4A4HA 4HT8A 4A53A 2LVMA 1M1GA 1R0BG 2VKNA 4BDYA 1M4ZA 4M7AA 3LW5E 1LCKA 1Q82U 5CCAA 1YHQQ 4RCBA 5A2QE 1QWEA 2DEQA 5GMKj 3NTIA 4L59A 1VQ6A 4FIBA 1WX6A 4RTWA 3CCLQ 1SPKA 1MMDA 3CCRA 1O9SA 2X4YA 2CSIA 2ZCFB 3X24B 1KK7A 1Y96B 4FM4B 3CCSQ 4NL2A 4M7DE 1Y71A 1RI9A 2HL3A 2KGTA 4HA8A 4PK4A 1C0MA 1VQ7T 2P0PA 3HP9A 2LP5A 2HAXA 2KQWA 4C8QE 1M90R 3CCVT 1VQOT 1AWWA 2FZKB 4IUTA 3S3NA 1NEGA 1UGVA 4M7DC 2KR3A 2K79A 4ME7A 4C5IA 3SD4A 3FRNA 1N6AA 5GAOm 5AYFA 2PVOB 1WLPB 4II1A 5CKEA 1ZUUA 1QVGP 3OS5A 4RMOA 2Y4YA 1OEBA 2QQAA 4EMKC 4AFZC 1LNXA 4BI3A 2ENMA 3OYHA 1ABOA 3CCVQ 2IIMA 3JB9G 1N5ZA 1VQOQ 5A0LA 4RTZA 3TU4K 2K2MA 1Q7YR 2YHTA 3RMQA 3VS7A 3RMSA 3RBBB 3QDRB 1TUDA 1BYMA 1UJ0A 3KUFA 1MHNA 2HNIA 1NM7A 4EIKA 1I8FA 4X9CA 3UF4A 5KYXA 1YCSB 1WHHA 4IUPA 1CKBA 4LD9K 2JVVA 3RIRA 3PNWC 4FT2A 2D9TA 7AT1B 2HKQB 2VGNA 2VVKA 1ZSGA 2YDLA 4GLMA 4M75A 2X9HA 3A8LB 2DLPA 4KH0B 4M77A 5GAN4 2JTFA 1W2BS 4M7AE 4HKEA 1IXDA 3CD6T 3FIFA 3CXCS 4QQGA 1VQ4A 2BZ8A 2BKDN 5KYWB 4PLLA 2OTJT 2V1QA 1GL5A 4JJNK 1M1FA 4N4GA 4JS4A 2Y4XA 3C0CA 2IG0A 1H3HA 2R5MA 1XNIA 1KHIA 4BB7A 2WSFE 2QA4T 1R0CB 2EJFA 3MP8A 2J05A 3JB9D 2YUNA 4BE2A 3NPFA 2DF6A 2EFIA 4J9IA 3RKYA 5ECAA 2AT1B 5HY6A 3VS6A 1G8XA 2E5QA 3CD6Q 1BCMA 1YJWA 2XU8A 5GAMd 2ECZA 4C0ZA 9ATCB 2DZCA 5EC7A 2LCLA 2HSEB 2FZCB 4F16A 1I5OB 4F7UF 2OTJQ 2D0NA 1RAFB 4M78D 1MMGA 2K57A 1N8RR 4IUQA 1RLPC 5IHNA 2XICA 1O75A 1RAEB 2QA4Q 2CZ0B 2J06A 1X2QA 5GAMf 3QKJA 4MZTA 4LDUA 2RJCA 3JSCA 3LGLA 4HCKA 1N9RA 4RUGA 1M27C 1QW1A 2D6FA 5IAYA 1D0ZA 2A08A 2BUDA 3BE3A 1QP3A 2JN0A 4HVWA 5DM7R 1BI1A 1OX8A 2K3XA 3P8HA 3S6WA 3G71A 2DKGA 4C92A 2DAQA 1I07A 1YITA 1WI7A 5L8RE 1AVZC 2DM1A 2X4JA 2C0IA 3DKMA 5I2MA 1QP2A 3BDLA 4CC7A 1E6GA 2QASA 4JRKA 1VQNA 4NL3A 3ZEHA 4EPCA 3OBYA 3EGDA 2LJ0A 1KQ1A 2IPOB 3L2WA 3H9NA 4E7JA 2CDTA 3M54A 3JCMc 2RQTA 5GMKm 3WVEB 4M75E 2HSPA 2M0YA 2RJDA 4PJLA 1SEMA 2EWNA 2ED1A 3EG9A 2CYZB 3TEEA 5KYYA 5LJ5d 4M77E 5EG2A 1Z9QA 1K8AR 4LD6A 2QEXA 2XK0A 1VQ8T 1VQLA 4F7UE 3MO8A 2DTHA 5LJ5f 1VIFA 2V26A 2CZ7B 5I11A 4E7IA 4A63B 1PCXA 3PIPA 2L5QA 4M78F 2R58A 2W10A 5HK0A 2P4TA 2A36A 3QWXX 1LPLA 2RHXA 5J39A 3OMCA 2CSQA 4JS5A 4QW2A 2EQIA 2ED0A 1BI2A 3VRYA 2DYBA 3OS1A 3FJPA 5D6WA 1X43A 5CKHA 2WSEE 1X27A 3QJ6A 1VQ8Q 4HVVA 4WF2A 2EAYA 3GP8A 5GJWB 4IURA 1WQWA 1AEYA 3SWNB 3FJ5A 4LDVA 4JDSA 2WSCE 2E6NA 4JUVA 3RUXA 1RAIB 1PNJA 2JMAA 1YJNT 1HK9A 1W2BA 4M7DG 2M0OA 2GFAA 2JTEA 1VUBA 2PQWA 2BZYA 2XIDA 1LVKA 1VQ5Q 2HD0A 3E9GA 1AOJA 2COWA 3I56T 1Q86C 3UATA 3M0TA 1EX4A 4C8QG 1Q81C 1KQSA 3EGUA 4C92E 1UB4A 2NUTB 3BY7A 3CPWP 3G6EA 3QZ9B 4ANJA 4J9EA 1BB9A 4FYVB 1ZX6A 3JCMX 5HKCA 1IRXA 1YJNQ 2FPDA 4HVUA 1ZUYA 1T0HA 3OSSC 2KY9A 1T3SA 4QQDA 3QYGB 2O2OA 1D3BA 1WHMA 2ZZDA 3I56Q 2FRYA 4LUEA 1G3SA 2HQEA 3V7CA 1ABQA 5FW9A 4JPBW 2DJQA 1XOVA 2AZSA 1WA7A 2DXCA 1N9SA 3OSVA 3JB9J 1R8OB 2QI2A 5AT1B 5CKBA 2JM9A 3CMEQ 1RAHB 2F2XA 1TTHB 2DTOA 2F2WA 2IVWA 2P0QA 3PGGA 4OMFB 2EYYA 1BIBA 1UGQB 1Z9ZA 2B8AA 1KD1C 1QLYA 2VGMA 1S72Q 3V7RA 3JCMg 1AWOA 4C8QD 1M1KC 1QVGA 2K5FA 4Y92A 2E3HA 4PFOA 2M1HA 1K9AA 4RTVA 4J6XA 3M53A 4M7AG 5CK9A 2JMCA 5GAN3 1M2VA 5LJ3d 3I55A 2RQVA 4Z89A 1TS9A 1JQQA 3X28B 1UTIA 2RJFA 1RACB 1U1SA 2KDSA 1D09B 2FEIA 4BACA 1VQPT 2GTJA 3QG1A 2E10A 3NFCA 4Z8AA 2CT3A 2QTXA 3CC4A 2OI3A 1E6HA 3CC2T 1YI2T 5GANg 5LJ3f 2GGRA 3VKIA 5GAOn 1IHVA 2DK3A 5FWBA 1K73C 3CC7T 3L2VA 4AG2C 3KFVA 1LJOA 2XHCA 1VQMT 2M51A 4FCYA 2FYKA 1GXIE 2DIQA 2AKKA 1WIEA 3PFSA 4QKUA 1GBRA 4FSSA 4C0GA 1RADB 2KMTA 4EMKA 1NJIU 3LH5A 3CCJT 1WHGA 3M4YA 1SG5A 5KCOA 1YWPA 3VS4A 1NYFA 3OYMA 1WYXA 3E19A 1TSFA 3PVLA 3REBB 1X6GA 2RD1A 2LQWA 3FC3A 1YI2Q 1YJ9A
chains in the Genus database with same CATH topology
2QQAA 3META 3OB9A 4EMKC 3OYNA 3EFSA 1LNXA 2I2LA 2DD5A 3PMIA 4BI3A 1BI0A 1K9MU 4EMKB 1JJ2S 3OYHA 3JB9G 3OYBA 3LGFA 5A0LA 3TU4K 2CKKA 3HRUA 2YHTA 4VUBA 3RMQA 4EMHA 1U8RA 1KC8U 4ZTJA 4C0DC 3R6OA 3RMSA 1QVGS 3QDRB 4CRIA 1BYMA 4C0DB 3KUFA 1MHNA 4M78E 3GNGA 3FEOA 2HNIA 1S72T 2EQJA 1I8FA 2YLCA 3LX7A 4X9CA 2QQSA 2G3RA 4C5EA 1YJ9T 2L8DA 2LC4A 4NS5A 5FU6C 3LWIA 1VQKA 5LJ3h 4IUPA 2EJGA 1JRIA 3PMTA 5LJ3j 4GLKA 4EMGA 4LD9K 2EQUA 2JVVA 3RIRA 3L2UA 3HKSA 3CD6A 2HBPA 3PNWC 3MEVA 4FT2A 2D9TA 1H3ZA 1X6OA 2O01E 2PUOB 1ZQ1A 2RI3A 2VGNA 4FT4A 3H6ZA 4M78C 2LQ8A 3L2QA 2FB7A 4M75A 3VYHB 2M9UA 4OGEA 2OTJA 5M9OA 5FU7C 4ZGDB 3MEAA 2RI5A 4C92F 3M5AA 1LOJA 2JUFA 4OP0A 3NTKA 2LDMA 3A8LB 5D6YA 3JCMd 4ZTFA 2EIFA 2DXTA 2E41A 4M7DD 4XTVA 3CBOA 3C95A 3L2ZA 3SB2A 4M77A 1VQKT 2QA4A 4M75G 3OW2A 1YBYA 3ASKA 4MMKA 5GAN4 1EIFA 2JTFA 1W2BS 2C06A 4HKEA 2PVGB 4XU0A 4OGCA 3CCUA 3CD6T 4M7AE 5GAN2 3FIFA 5CQYA 3CXCS 3AHUA 3JCMe 4M75C 4QQGA 3OYGA 2VXEA 4RG2A 4M75B 1VQ4A 1M90C 2BKDN 3A8HB 5FRMA 3JAME 4PJOG 3JCMf 2V8KA 4PLLA 4M77G 3ZFJA 5FLXE 2OTJT 4PNOA 4IKFA 3JCMQ 4MZMA 2ZPEB 4J6YA 4JJNK 1M1FA 4M77C 4N4GA 4JS4A 2Y4XA 3JCMP 4XU3A 4PJOB 2IG0A 4FL6A 4EDUA 4M77B 2R5MA 3PT9A 4ELYC 1XNIA 1KHIA 4BB7A 2FVUA 2WSFE 2QA4T 1Y7XA 3DLMA 4R55A 1ZBXA 2EJFA 3MP8A 4O6JA 3JB9D 3QJYA 3V8KA 4F7UG 4ZGEB 4XU1A 4BE2A 3GNFB 5GAOr 3CCUT 1M5Q1 1BKBA 5GANd 3MHXA 2EFIA 4OB1B 4OF1A 4PJOF 3RKYA 4E7HA 3M56A 4XTUA 1W4SA 2A7YA 3LWHA 3GIBA 2MWOA 1P92A 5HY6A 2O4XB 1VQ4T 2X4XA 1IREB 4F7UB 3BW1A 1VQ6T 2E5QA 3GF5A 1YJWA 1M90U 2XU8A 4C5GA 1VQ9A 2RHYA 4ZN3A 5I2SA 5GAMd 4X34A 4C0ZA 1FXXA 4KBMB 5GANe 2DZCA 2LCLA 3QUIA 4F7UF 3RESA 3JCMb 3OYYA 5GANf 1Q7YC 3LLRA 4N0AC 2F5KA 1N27A 3CCQA 5FRNA 2MWPA 3CBPA 4M78D 3OYFA 3QXEB 2K57A 2MMPA 1G3TA 2WACA 5GAMg 3JCMW 3C94A 1QVFS 5GAMe 4IUQA 4MDXA 2RJEA 2XICA 1O75A 3C12A 3V7SA 1AHJB 2L3RA 2CZ0B 5GAMf 3QKJA 4MZTA 4LDUA 2RH2A 3F70A 4BI4A 4KUIA 3OA6A 2RJCA 1NZ9A 1IZ6A 3JSCA 4JLGA 3LGLA 1VQ9T 4ZN1A 1YJWT 3VUBA 3OYDA 2CS7A 2MF2A 1N9RA 4DOWA 1BIAA 2D6FA 1QW1A 1G3WA 2KK4A 4MMLA 3M9QA 5IAYA 4E7KA 1TH7A 1WJQA 2BUDA 3RKWA 3CBMA 1QP3A 2JN0A 4M75D 3JCMh 3VYGA 3CCQT 5DM7R 3HSBA 1BI1A 2DZ9A 4A4KA 3GPLA 1Q7YU 2QDYB 5GMKl 2RI2A 2XDDA 2QQRA 2DXUA 2NLUA 2PVDB 3A5ZB 4HCBA 1RI0A 2K3XA 3HFOA 5KCHA 4XTZA 3P8HA 4FSXA 3V8LA 5CR2A 3OW2S 5KE2A 3S6WA 3G71A 2DKGA 4C92A 4P5NA 4BD3A 2DAQA 4M7DF 4M7AD 2RK2A 2DVEA 4MZPA 3HFNA 3RKXA 1YITA 5L8RE 3JCMV 5I21A 2CZ6B 4C0FA 2JNGA 1X01A 2X4JA 3DKMA 4MDWA 5I2MA 1QP2A 4XTXA 4BDZA 4XK8E 3BDLA 3VJPA 2XD0A 2DO3A 4BI8B 2M16A 5HK3A 3M58A 2FL7A 4C92G 2DD4A 4JRKA 2JZ2A 5GAOq 2K3YA 4NL3A 1VQNA 4C8QF 3ZEHA 2XG8D 4EPCA 1I81A 4XQ3A 2GCXA 3X26B 3OBYA 4C92C 4FU6A 2R5AA 1KQ1A 3E1SA 4C92B 4KUDK 3L2WA 4E7JA 3G71T 2RO0A 5GANh 2E6ZA 1UEBA 3M54A 4KULA 1VQ8A 2H3JA 3DB4A 2RHUA 4XU2A 3JCMc 3WVEB 5GMKm 5GANj 4M75E 1YITT 3QYHB 4J5YA 3UT1A 4A4EA 5A0DA 5GAOp 2X35A 2RJDA 2E65A 3FLGA 5GAN7 3KXTA 2EWNA 3OBWA 4XTYA 3V8JA 5GAMh 3PTAA 3QSUA 2CYZB 2VUBA 3TEEA 5LJ5d 5GAMj 5D6XA 4PJOE 2VYTA 1WNLA 4M77E 4RKUE 3A8MB 4YTLA 3X20B 3M4GA 3G4SA 4J83A 5EG2A 4PJOA 3WVDB 3JB9H 1QVPA 2EQMA 3TCJA 4PL6A 4O5VA 4LD6A 4PJOD 1XQHA 4QVDA 2GFUA 1D3BB 4TVRA 4BUGA 2QEXA 2KSSA 4E7LA 3L1AA 5LJ5g 5CO7A 2RK1A 2XK0A 3OY9A 2QQBA 4RG8A 5LJ5e 2DPPB 2LTOA 4J6WA 1VQ8T 1WJSA 3X25B 1VQLA 2O4XA 2MAMA 4B9XA 4F7UE 3UDCA 3MO8A 4F7UA 2DTHA 5LJ5f 3QIIA 1VIFA 2CZ7B 1N8RC 3KBGA 4E7IA 4PJOC 3LH0A 1NPPA 2L5QA 4M78F 3PIPA 4JRPA 1Q81C 2R58A 2BIVA 5GMKi 5HK0A 2P4TA 3G4ST 3CPWA 4ATOA 4ZGJB 1B34A 2YLBA 4PKCC 3CCEA 2RHXA 3N5BB 5J39A 3OMCA 5GMKh 5A0GA 3SWNA 3GLXA 5C6SA 4QW2A 2QEXT 4JS5A 4LDYA 4Y28E 4HCCA 1BI2A 2E12A 1M9SA 3OS1A 3HPWA 3M57A 4R56A 3CMAA 1VQLT 4XTWA 5J3BA 4HT9A 3OYEA 3FJPA 2ZPFB 5D6WA 5CKHA 3P8BB 2LNVA 2WSEE 1YJNA 2YRVA 1V29B 3QJ6A 2JTMA 3T9NA 2QQ9A 4WF2A 2EAYA 3CPFA 2CGHA 5KH6A 1N8RU 1B34B 4V2SA 5DLQE 1RL2A 3LYIA 3GP8A 2GF7A 4OB0B 3SWNC 4IURA 3SDZA 1WQWA 1FX7A 2QXFA 3CCET 3QBYA 3SWNB 3VU3C 1H641 4IUVA 4LDVA 2Y90A 4JDSA 4UC4A 3I56A 1U1TA 2WSCE 1JBMA 2E6NA 4M7DA 4DOVA 4JUVA 4M7AF 3OQ5A 3RUXA 3J80E 2EKOA 4BE0A 3CMAT 3UPUA 3M59A 2ZPBB 4LDXA 1YJNT 3OYJA 3MP6A 1HK9A 2LRQA 5CKDA 2E64A 1M8VA 1W2BA 4C8QA 4L5GA 4IUUA 2M0OA 4RCCA 4M7DG 2GFAA 3C4SA 1VUBA 2L89A 2PQWA 3PIOA 1YIJA 2XIDA 3CMEA 2LT1A 2XDPA 2HD0A 4N4IA 1OYXA 5LJ5h 2LCCA 3P8DA 4X9DA 3E9GA 2AHJB 5LJ5j 2GQVA 3UWNA 3I56T 4M7DB 4OB3B 2K2VA 4D6WA 1MGQA 1OZ2A 3A8GB 1Q86C 3OYIA 4CI0C 3BFMA 1UGRB 4C8QG 1UGPB 2F69A 3FDRA 3INZA 2KAFA 4M77D 4Q5WA 1UGSB 1UB4A 4C92E 3BY7A 3L42A 1KQSA 3G6EA 3QZ9B 3CCMA 1DJ7B 4N4HA 3DLLA 1WGSA 2X4WA 2P0KA 3H8ZA 5GMKe 3OYKA 3S3MA 4C8QC 3CMET 1JB0E 1ZHIA 1PSEA 4C8QB 3OYLA 1S72A 1K8AC 3JCMX 5GAN6 2JOYA 5FROA 3ME9A 3QHSA 4BY6C 4Y91A 5CKFA 4A4FA 2MI6A 5HKCA 1YIJT 2DJZA 4BY6B 1YHQA 2RHZA 3MEUA 2A3LA 1OZ3A 3L2RA 2OTLA 2RM4A 1BI3A 2D0QB 4B9WA 3MP1A 3OSSC 5IN1A 3CCLA 2HQXA 2KY9A 2OAUA 3CPWS 4QQDA 4A54A 3QYGB 3EFRA 2ZPIB 3BDUA 1Q86U 3TREA 1D3BA 4C5HA 3HRSA 3G6ET 2ZZDA 3CCMT 1G5VA 4J7IA 2CZ1B 1Q81U 4QVCA 3E9FA 4KT0E 4M78A 1WQ7A 1G3SA 2HQEA 1OI1A 2V8IA 3DB3A 3V7CA 2E1HA 5GAN8 3OYCA 1SSFA 2V8JA 3ZBDA 3OS2A 3CCSA 2RHIA 1XOVA 4A4GA 1K8AU 1QVFA 3JB9F 1YHQT 2DXCA 1N9SA 3EAEA 3OSVA 3JB9J 2OTLT 1R8OB 3HL8A 5FU6B 1Q82C 3OMGA 2QI2A 2VV5A 4LDWA 3CCLT 4M78G 3MCAB 3QPHA 3MEWA 5CKBA 4JLIA 5C0MA 2PUKB 3M55A 4JRQA 1NPRA 4J7FA 4BE1A 3GOXA 4QVZA 2DTOA 1KG1A 4M78B 2IVWA 5GAN5 2EJ9A 4GY5A 3CEYA 1X75C 3VV0A 4DA4A 3JCMJ 5FU7B 1NE8A 3RERA 1PSFA 3OS0A 2P0QA 3O8VA 2XI9A 1VQ5A 3PGGA 2FHDA 4OMFB 3CCST 3S3OA 2K4YA 3SFMA 1JJ2A 1BIBA 2LQKA 4ELZC 1UGQB 1HXDA 2B8AA 2F5TX 4A4HA 1KD1C 4HT8A 4A53A 2VGMA 2LVMA 3JRZA 1M1GA 4BDYA 2E70A 2ZPHB 4DQ2A 3J7AF 1M4ZA 4M7AA 3V7RA 3JCMg 1Y96A 3LW5E 1Q82U 4C8QD 5CCAA 1M1KC 4RCBA 1QVGA 2K5FA 5A2QE 2DEQA 5GMKj 3NTIA 1WJRA 4L59A 4L6V5 1VQPA 1VQ6A 4FIBA 2M1HA 2ZPGB 1YCYA 2LX9A 2RA2A 3CC2A 1Y07A 3WXMB 1YI2A 5DLOA 4J6XA 3CCRA 3M53A 1O9SA 2X4YA 5CK9A 1KQSS 1VQ7A 3FB9A 5GAN3 4M7AG 2VXFA 3CC7A 4M75F 1VQ5T 2KVQG 4OB2B 2LT4A 3G7ZA 4QQ6A 2ZCFB 3X24B 4C92D 5LJ3d 3I55A 4J8OA 3CCVA 4M7AC 1VQOA 1WPYA 1G3YA 3J81E 1VQMA 1I5LA 4M7AB 3OYAA 1VIEA 3HHTB 1Y96B 5DY9A 2PU9B 3X28B 3A8OB 3NTHA 4FM4B 5GAOl 1KD1U 4N0AA 1NJIC 2RJFA 4M77F 3URGA 4NL2A 1U1SA 2KDSA 5LJ3g 4M7DE 1Y71A 4BACA 3CCJA 1VQPT 3QG1A 5LJ3e 1M1KU 2E10A 2K5IA 3NFCA 4E47A 1I4K1 2QTXA 3QO3A 4HA8A 3CC4A 2VC8A 3CC2T 1YI2T 1XTDA 5GANg 5LJ3f 4HCZA 3VKIA 3ER0A 1VQ7T 3CCRT 2K5LA 2RB6A 5GAOn 2P0PA 4PLIA 2DK3A 1K73C 3CC7T 3HP9A 3L2VA 2HAXA 3QZ5B 2EYQA 2KQWA 2EQKA 1LJOA 2XHCA 4C8QE 3I55T 3CCVT 4JRIA 1VQMT 1VQOT 5CIUA 2FYKA 2DIGA 4IUTA 4OVAA 3CXCA 3S3NA 1FWZA 2DXBA 2ZGWA 2DIQA 1K9MC 1GXIE 3PFSA 3HRTA 4M7DC 4C0GA 2KMTA 4ME7A 3SD4A 4C5IA 3FRNA 4EMKA 1NJIU 4NOYA 2DTIA 3VUZA 3CCJT 1KC8C 5LL6S 3M4YA 1N6AA 5KE3A 5KCOA 5IT9E 5GAOm 3CC4T 4Z02A 2XDBA 3OYMA 5AYFA 1KQ2A 2PVOB 2R57A 5CAIA 5CVIA 1VQNT 4II1A 3Q1JA 3E19A 5CKEA 5CQXA 4XAXB 2RD1A 3OS5A 2XKOC 4RMOA 1K73U 1YJ9A 2Y4YA 3FC3A 1KHCA 3JB9I 5J26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B34 A;  2YLB A;  4M78 D;  3EFS A;  1LNX A;  2I2L A;  4EMK C;  2K57 A;  5GAM g;  4EMK B;  3JCM W;  4M78 G;  5GMK h;  5GAM e;  3SWN A;  3JB9 G;  4JLI A;  3V7S A;  3JB9 I;  2YHT A;  4EMH A;  5GAM f;  2DTO A;  4M78 B;  4XTW A;  5GAN 5;  2EJ9 A;  4HT9 A;  3FJP A;  3JCM J;  3RER A;  1N9R A;  4M78 E;  1BIA A;  2HNI A;  4MML A;  1TH7 A;  3PGG A;  3RKW A;  1I8F A;  4WF2 A;  2YLC A;  4X9C A;  2EAY A;  1BIB A;  2CGH A;  4M75 D;  2JN0 A;  1B34 B;  1HXD A;  4V2S A;  3JCM h;  4HT8 A;  4A53 A;  3SWN C;  3HSB A;  1WQW A;  2DZ9 A;  2EJG A;  5LJ3 h;  1JRI A;  3SWN B;  4DQ2 A;  5GMK l;  3VU3 C;  1H64 1;  4M7A A;  5LJ3 j;  3V7R A;  3JCM g;  4EMG A;  1Y96 A;  2DXU A;  2Y90 A;  3RIR A;  4C8Q D;  1U1T A;  4RCB A;  3HFO A;  1JBM A;  4M7D A;  4XTZ A;  3V8L A;  2DEQ A;  4JUV A;  5GMK j;  4M7A F;  3RUX A;  2DKG A;  4C92 A;  4M78 C;  2FB7 A;  4M75 A;  4M7D F;  1YCY A;  2RA2 A;  4M7A D;  2DVE A;  3HFN A;  3RKX A;  3JCM V;  4C92 F;  4J6X A;  1LOJ A;  5I21 A;  4OP0 A;  4M7A G;  1HK9 A;  3FB9 A;  5GAN 3;  1X01 A;  2VXF A;  4M75 F;  4M7D D;  3JCM d;  2E64 A;  2DXT A;  2E41 A;  1M8V A;  4XTX A;  4XTV A;  4C8Q A;  4C92 D;  4RCC A;  5LJ3 d;  4M7D G;  4M7A C;  3L2Z A;  1WPY A;  3SB2 A;  4C92 G;  4M77 A;  1I5L A;  4M7A B;  4JRK A;  5GAO q;  4NL3 A;  5GAO l;  1Y96 B;  5DY9 A;  4M75 G;  4C8Q F;  5LJ5 h;  4MMK A;  4X9D A;  5GAN 4;  4N0A A;  1I81 A;  4M7A E;  4XQ3 A;  4XU0 A;  5LJ5 j;  4M7D B;  4M77 F;  4C92 C;  5GAN 2;  3FIF A;  1MGQ A;  1KQ1 A;  4NL2 A;  3AHU A;  1U1S A;  4C92 B;  5LJ3 g;  3JCM e;  4M75 C;  4M7D E;  3BFM A;  2VXE A;  5GAN h;  4C8Q G;  5LJ3 e;  4M75 B;  2E10 A;  3INZ A;  4M77 D;  4C92 E;  4PJO D;  4XU2 A;  3BY7 A;  1I4K 1;  2QTX A;  3QO3 A;  4HA8 A;  4PJO G;  3JCM f;  2VC8 A;  4M77 G;  4M75 E;  5GMK m;  4J5Y A;  4PNO A;  5LJ3 f;  5GMK e;  3JCM Q;  5GAN g;  4C8Q C;  5GAO p;  2RB6 A;  5GAO n;  4C8Q B;  4J6Y A;  2E65 A;  5GAN 7;  4M77 C;  3JCM X;  5GAN 6;  2EWN A;  3JCM P;  4XU3 A;  4PJO B;  4XTY A;  3QHS A;  3V8J A;  1LJO A;  4M77 B;  4C8Q E;  5GAM h;  3QSU A;  4Y91 A;  4JRI A;  5LJ5 d;  2DJZ A;  5GAM j;  4PJO E;  2FYK A;  5GAN j;  1WNL A;  4M77 E;  4PJO A;  2ZGW A;  3M4G A;  2EJF A;  2RM4 A;  3JB9 D;  3JB9 H;  3V8K A;  4F7U G;  4XU1 A;  5GAO r;  4M7D C;  1M5Q 1;  5GAN d;  4PJO F;  3RKY A;  3JCM c;  4QVD A;  1D3B B;  4EMK A;  4XTU A;  4A54 A;  3GIB A;  3EFR A;  4NOY A;  2DTI A;  3L1A A;  5LJ5 g;  3BDU A;  4F7U B;  1D3B A;  3BW1 A;  5LJ5 e;  4J6W A;  5GAO m;  4F7U E;  4QVC A;  1KQ2 A;  5CAI A;  4F7U A;  4M78 A;  1WQ7 A;  2DTH A;  3V7C A;  5LJ5 f;  5GAN 8;  5GAM d;  2E1H A;  5GAN e;  2DZC A;  2RD1 A;  4PJO C;  3QUI A;  4F7U F;  4M78 F;  3RES A;  3JCM b;  3JB9 F;  5GAN f;  5GMK i;  1N9S A;  4N0A C;  3JB9 J; 
#chains in the Genus database with same CATH topology
 4E7Z A;  3PMI A;  1K9M U;  1D1B A;  2MYS A;  1VQM Q;  3OYB A;  4LUD A;  3HRU A;  4PFP A;  1U8R A;  1KC8 U;  4CRI A;  3EH1 A;  3CCJ Q;  3GNG A;  4AT1 B;  2EQJ A;  1W1F A;  2G3R A;  2EGC A;  4C5E A;  2L8D A;  2LC4 A;  3LWI A;  1JRI A;  1M3C A;  3PMT A;  3EG1 A;  1VYT A;  1ZQ1 A;  4FT4 A;  3CXC P;  3L2Q A;  2M9U A;  5FU7 C;  3MEA A;  5KYU B;  3R6N A;  2E5K A;  3A1P A;  3JCM d;  2DXT A;  3CBO A;  2PZ1 A;  3SB2 A;  1VQK T;  1WXT A;  3RR6 A;  3EGD B;  4M75 G;  3ASK A;  4MMK A;  4E7S A;  1EIF A;  2C06 A;  3QDF A;  4XU0 A;  4FYX B;  4OGC A;  3CCU A;  2COY A;  4OMM A;  1X2K A;  2FO0 A;  4RG2 A;  1GCQ A;  1K4U S;  3JCM f;  1NLO C;  2V8K A;  5FLX E;  4M77 G;  4PNO A;  4IKF A;  2GNC A;  4MZM A;  3EG9 B;  4EDU A;  2MOX A;  3M0U A;  1Y7X A;  4R55 A;  4O6J A;  3QJY A;  2ATC B;  3V8K A;  4F7U G;  2J6O A;  2MPX C;  4XU1 A;  4E2F B;  3GNF B;  1M5Q 1;  5GAN d;  4OB1 B;  4PJO F;  1FMW A;  4E7H A;  3GIB A;  2QDL A;  3M56 A;  2A7Y A;  3LWH A;  2FZG B;  2MWO A;  1FYN A;  1P92 A;  1VQK Q;  1C6V X;  1IRE B;  4F17 A;  3SEM A;  4JZ4 A;  1VYV A;  2L2P A;  1M90 U;  2RHY A;  3REA B;  5I2S A;  1IGQ A;  1NBE B;  3QUI A;  1WHL A;  3RES A;  3JCM b;  4KRT A;  5GAN f;  2MCN A;  3LLR A;  3CCQ A;  2MWP A;  2QK0 A;  5GAM g;  1G3T A;  1D1C A;  3C94 A;  2GTO A;  5GAM e;  4MDX A;  2RJE A;  3C12 A;  2EYW A;  2L3R A;  1HYO A;  1NZ9 A;  4JLG A;  1VQ9 T;  2MF2 A;  4DOW A;  1TH7 A;  1WJQ A;  4IIO A;  1EZZ B;  4M75 D;  5HCK A;  1Q7Y U;  2QDY B;  1UG1 A;  2RI2 A;  2XDD A;  2NLU A;  2C0T A;  3A5Z B;  1RI0 A;  3HFO A;  5KCH A;  4XTZ A;  3V8L A;  3OW2 S;  5CR2 A;  2ZAE A;  2JXB A;  1WFW A;  4IIM A;  1R77 A;  1F1B B;  2RK2 A;  3RKX A;  3JCM V;  2CZ6 B;  1ZSZ B;  4BDZ A;  4XK8 E;  1VQ9 Q;  4C92 G;  2KXD A;  2K3Y A;  1M3A A;  3GBQ A;  4XQ3 A;  3X26 B;  2KRM A;  2CUD A;  3E1S A;  3QWY A;  4WTO B;  2RO0 A;  1UEB A;  4XU2 A;  2RHU A;  1RUW A;  2B86 A;  3QYH B;  3UT1 A;  2X35 A;  1Q86 R;  5GAN 7;  3KXT A;  1Q81 R;  2ROT A;  1YWO A;  5GAM j;  5D6X A;  4PJO E;  3A8M B;  4YTL A;  3X20 B;  3TSZ A;  3JB9 H;  1QVP A;  4LE9 A;  3TCJ A;  4PL6 A;  1XQH A;  1D3B B;  4BUG A;  1RAB B;  2ROL A;  3EFO A;  3L1A A;  5LJ5 g;  1U06 A;  2RK1 A;  3OY9 A;  2QQB A;  5LJ5 e;  4J6W A;  2NUP A;  1WJS A;  4B9X A;  4F7U A;  4LN2 A;  1UHC A;  2DL4 A;  2KRS A;  4PJO C;  1NPP A;  1QWF A;  4JRP A;  1T0J A;  2AIR B;  1AT1 B;  5GMK i;  3G4S T;  3CPW A;  4ZGJ B;  1B34 A;  2YLB A;  4PKC C;  3N5B B;  3RDV A;  5A0G A;  2DL8 A;  3GLX A;  1GCQ C;  1NLP C;  2J6K A;  3I9Q A;  2HCK A;  4E6R A;  1M2O A;  2YWW A;  3HPW A;  3M57 A;  5J3B A;  2AZV A;  3OYE A;  3T9N A;  2QQ9 A;  2GBQ A;  1N8R U;  5KYN A;  5DLQ E;  2KEA A;  3SWN C;  3CCE T;  2A37 A;  1UE9 A;  4IUV A;  4AFS C;  2JJ9 A;  1TU0 B;  3G4S Q;  1BU1 A;  1UUE A;  1KD1 R;  1SHF A;  4CC3 A;  2EKO A;  4BE0 A;  3CMA T;  2NUZ A;  2ZPB B;  1RAA B;  4LDX A;  3ULR B;  1MMN A;  3EG2 A;  1UJY A;  3OYJ A;  3MP6 A;  2LRQ A;  1M1K R;  1WZO A;  2E64 A;  1M8V A;  3M0S A;  2VB6 A;  2L89 A;  1YIJ A;  1QQJ A;  4RTY A;  2LCC A;  2AHJ B;  5LJ5 j;  4M7D B;  4OB3 B;  3A8G B;  1JJ2 P;  3BFM A;  2LX7 A;  1UGR B;  2QG9 B;  2F69 A;  3CCE Q;  3INZ A;  2KAF A;  3DLL A;  1WGS A;  2X4W A;  2P0K A;  3OYK A;  3S3M A;  5FWC A;  1JB0 E;  2JM8 A;  4C8Q B;  3OYL A;  2K7A A;  2PNI A;  5GAN 6;  2JOY A;  1W70 A;  2HKN A;  5FRO A;  3ME9 A;  3CMA Q;  2SEM A;  4Y91 A;  1ZA2 B;  2MI6 A;  2DJZ A;  4BY6 B;  1YHQ A;  3L2R A;  2CP7 A;  2EBP A;  1K73 R;  4B9W A;  3CCL A;  2HQX A;  1JXM A;  1OUL A;  2ZPI B;  3BDU A;  2DER A;  3CCM T;  4M78 A;  2V8I A;  3DB3 A;  2E1H A;  1Y0M A;  3CCS A;  2RHI A;  1K8A U;  3JB9 F;  2OTL T;  3HL8 A;  1Q82 C;  2VV5 A;  5C0M A;  2DA9 A;  2DBM A;  1ARK A;  3M55 A;  4JRQ A;  1NPR A;  1QCN A;  4BE1 A;  1OPL A;  4J9G A;  5GAN 5;  2EJ9 A;  3CEY A;  3JCM J;  1PSF A;  3OS0 A;  1UFF A;  2RMO A;  1B3Q A;  3CCM Q;  1SRL A;  3NHN A;  1HXD A;  3EGX A;  2KE9 A;  3JRZ A;  1A0N B;  2E70 A;  2M02 A;  3J7A F;  2QTV A;  2W0Z A;  1Y96 A;  1MV3 A;  2FPE A;  2OTL Q;  4AFU C;  1K76 A;  2ZPG B;  2LX9 A;  2RA2 A;  2L3S A;  3VS2 A;  5DLO A;  2CUB A;  1VQ7 A;  2KBT A;  1VQ5 T;  4OB2 B;  4QQ6 A;  3G7Z A;  2K9G A;  1NG2 A;  4J8O A;  3CCV A;  1VQO A;  1WPY A;  1G3Y A;  3H0I A;  4M7A B;  1D1A A;  3HHT B;  5GAO l;  5DY9 A;  2PU9 B;  3MJX A;  2H3E B;  4N0A A;  2O9V A;  3URG A;  5LJ3 g;  2CP3 A;  1QVF P;  5LJ3 e;  2K5I A;  1I4K 1;  3QO3 A;  2VC8 A;  4OMN A;  1PG5 B;  2DMO A;  1XTD A;  3ER0 A;  3CCR T;  2K5L A;  2RB6 A;  1CKA A;  1K0S A;  2HQH A;  3QZ5 B;  2D8H A;  2EYQ A;  4JRI A;  5CIU A;  2DIG A;  2L0A A;  4OVA A;  3CXC A;  2DXB A;  2J7I A;  1KSW A;  3HRT A;  2QGG A;  2LNH B;  2YT6 A;  3VUZ A;  3EHQ A;  5LL6 S;  5KE3 A;  5IT9 E;  4Z02 A;  2CT4 A;  2QYZ A;  1KQ2 A;  5CAI A;  3Q1J A;  5CQX A;  3A98 A;  4XAX B;  1VQ6 Q;  4KH1 B;  2MIO A;  2XKO C;  3VS0 A;  3CCR Q;  3JB9 I;  4HCC A;  5J26 A;  3MET A;  3CME T;  4OMQ A;  5IHI A;  2I2L A;  2DD5 A;  1JJ2 S;  3UA6 A;  3LGF A;  2P84 A;  5IXF A;  1PD1 A;  4VUB A;  1HSQ A;  2HL5 C;  1OU8 A;  3R6O A;  4C0D B;  1TWB A;  4M78 E;  2QGF B;  1FMK A;  3FEO A;  4X1V A;  1S72 T;  2JT4 A;  1ZA1 B;  2E3I A;  4NS5 A;  5FU6 C;  4PFZ A;  2EJG A;  5LJ3 j;  1X6B A;  4GLK A;  2EYZ A;  2EQU A;  3CD6 A;  3L2U A;  3HKS A;  1X6O A;  2PUO B;  2K3B A;  2RI3 A;  2EPD A;  1ZUK A;  4M78 C;  2LQ8 A;  2OTJ A;  5M9O A;  5KYW A;  4LNP A;  4ZGD B;  2RI5 A;  1LOJ A;  1GRI A;  3NTK A;  4M7D D;  2E41 A;  5KYX B;  4XTV A;  4AMC A;  2QA4 A;  1UEC A;  1YBY A;  1QKW A;  2FPF A;  3D7S B;  5CQY A;  2DL3 A;  3JCM e;  4KGV B;  3PVQ A;  2VXE A;  4CC4 B;  4M75 B;  3U23 A;  4PJO G;  3JAM E;  3JCM Q;  2OX7 A;  4QT7 A;  4J6Y A;  3TQ7 P;  4M77 B;  2FVU A;  2O9S A;  3TVT A;  2EVR A;  1GFD A;  3DLM A;  1ZBX A;  1OQK A;  4ZGE B;  5GAO r;  4OMP A;  3EFO B;  2L3Q A;  3MHX A;  4OF1 A;  1W4S A;  1VQ4 T;  4F7U B;  3BW1 A;  4PJM A;  4ZN3 A;  4KBM B;  5GAN e;  1G2B A;  2DRM A;  4N0A C;  2CH4 A;  2WAC A;  3JCM W;  3I5R A;  1QVF S;  2DFU A;  2RH2 A;  3F70 A;  4BI4 A;  3OA6 A;  1IZ6 A;  1YJW T;  4ZN1 A;  3OW2 P;  3OYD A;  2CS7 A;  1BIA A;  1HD3 A;  1VQ4 Q;  4MML A;  2DIL A;  3RKW A;  4AFQ C;  3CBM A;  1NYG A;  2D8J A;  2DE0 X;  1YNZ A;  2DZ9 A;  4A4K A;  3GPL A;  5GMK l;  2QQR A;  2DXU A;  2PVD B;  2F1L A;  4HCB A;  1K0X A;  4M7D F;  4M7A D;  4MZP A;  3HFN A;  1YP5 A;  4MDW A;  1X01 A;  1ZSZ C;  1YJW Q;  2DO3 A;  2M16 A;  3EG0 A;  2HDA A;  3M58 A;  5HK3 A;  2E4H A;  2JZ2 A;  4C8Q F;  1AZE A;  1I81 A;  2GCX A;  2R5A A;  4C92 B;  3O5Z A;  1UDL A;  3I35 A;  4KUD K;  3G71 T;  4KUL A;  2LZ6 B;  1VQ8 A;  5GAN j;  3DB4 A;  3MPU B;  1TXQ A;  1YIT T;  4DBR A;  5A0D A;  1E7O A;  2E65 A;  4XTY A;  5GAM h;  3PTA A;  1TG0 A;  4RTX A;  1VQN T;  4PJO A;  1JO8 A;  3M4G A;  3WVD B;  2EQM A;  1BK2 A;  2DBK A;  1AZG B;  3TSW A;  4JJC A;  2KNB B;  2RN8 A;  4E7L A;  1SHG A;  2KRN A;  4TVR A;  8ATC B;  4RG8 A;  2LTO A;  3NGP A;  3X25 B;  1MUZ A;  2O4X A;  3UDC A;  3G71 Q;  1G83 A;  1PRL C;  3EH2 A;  3KBG A;  5KYY B;  1PHT A;  3LH0 A;  4F04 B;  1YIT Q;  1W6X A;  4FYY B;  2BIV A;  3IQL A;  1GFC A;  4ATO A;  1YN8 A;  2YUQ A;  4M4Z A;  3SWN A;  2QEX T;  1VQN Q;  1Q82 R;  4R56 A;  1VQL T;  5IH2 A;  1C1A A;  1YJN A;  3EGX B;  1MND A;  3VS3 A;  2CGH A;  1T3L A;  4V2S A;  1RL2 A;  3LYI A;  4HXJ A;  2GF7 A;  4OB0 B;  1M3B A;  2YSQ A;  5D7U A;  4OML A;  1FX7 A;  2QXF A;  3QBY A;  3VU3 C;  1H64 1;  4GBQ A;  3UA7 A;  4UC4 A;  2Y90 A;  1JEG A;  3I56 A;  1JBM A;  4DOV A;  4M7A F;  3J80 E;  2V1R A;  3M59 A;  2QEX Q;  2NUT A;  5CKD A;  4L5G A;  4IUU A;  1VQL Q;  3C4S A;  2RQU A;  3PIO A;  2KYM A;  1GBQ A;  3CME A;  2EYX A;  4KGZ B;  5LJ5 h;  3P8D A;  4X9D A;  2GQV A;  3UWN A;  1ZLM A;  1SKU B;  1QKX A;  2K2V A;  1MGQ A;  1OZ2 A;  3OYI A;  2ABL A;  1PKT A;  1UGP B;  4M77 D;  4RTU A;  1UGS B;  1DJ7 B;  2BZX A;  4C8Q C;  1ZHI A;  1PSE A;  1S72 A;  1OPK A;  4KGX B;  3QHS A;  2L3P A;  4BY6 C;  5I22 A;  4JZ3 A;  5CKF A;  4A4F A;  1VQ7 Q;  1BCO A;  2RHZ A;  2A3L A;  1OZ3 A;  1ACM B;  1BI3 A;  2D0Q B;  2CRE A;  3NMZ C;  3MP1 A;  5IN1 A;  1OX9 A;  1Q95 G;  4A54 A;  3EFR A;  1Q86 U;  2O31 A;  3TRE A;  4C5H A;  3G6E T;  2SRC A;  2CZ1 B;  1Q81 U;  2KRO A;  1SRM A;  2CP5 A;  3OS2 A;  1QVF A;  1NEB A;  2EGE A;  2HZY A;  4PJJ A;  1B7T A;  4Z88 A;  4J9H A;  2DRK A;  4M78 G;  3MCA B;  3MEW A;  4JLI A;  2O88 A;  4J7F A;  4QVZ A;  1WXB A;  2BE9 B;  1AD5 A;  1KG1 A;  1JU5 C;  3JV3 A;  4DA4 A;  5FU7 B;  1NE8 A;  1QMC A;  2XI9 A;  3G6E Q;  2FHD A;  2K4Y A;  3SFM A;  2LQK A;  4ELZ C;  2LJ1 A;  1M30 A;  2ZPH B;  4DQ2 A;  2PTK A;  1AWX A;  2J6F A;  1VYU A;  1WJR A;  4L6V 5;  1VQP A;  1YCY A;  3CC2 A;  1Y07 A;  1OOT A;  3WXM B;  1YI2 A;  4ZNX A;  1AWJ A;  1KQS S;  3FB9 A;  2YXY A;  2VXF A;  3CC7 A;  3M0P A;  4M75 F;  2KVQ G;  2LT4 A;  4AG1 C;  1WXU A;  4C92 D;  2YRD A;  4M7A C;  1VQM A;  3J81 E;  1B07 A;  1I5L A;  3OYA A;  1VIE A;  1H8K A;  1KD1 U;  3A8O B;  3NTH A;  1NJI C;  4M77 F;  1KJW A;  2P4R A;  5IHK A;  2MK5 A;  1WHJ A;  1VA7 A;  3CCJ A;  1M1K U;  1FMV A;  4E47 A;  1ZBJ A;  2LJ3 A;  3VS5 A;  2VAS A;  4HCZ A;  1M2V B;  4PLI A;  4LXC A;  2I0N A;  4DBH A;  1PWT A;  2EQK A;  3I55 T;  1CSK A;  1K9M C;  1FWZ A;  2ZGW A;  5IXB A;  2HBW A;  4NOY A;  2DTI A;  1KC8 C;  3CC4 T;  1IHW A;  2XDB A;  2R57 A;  5CVI A;  4J9C A;  2DVJ A;  2KI7 A;  4FYW B;  1K73 U;  1KHC A;  1I0C A;  3SHW A;  3OB9 A;  3OYN A;  3EFS A;  1BI0 A;  4EMK B;  1WHK A;  3I55 Q;  4R0K A;  2CKK A;  4EMH A;  2YUO A;  4DEY A;  4ZTJ A;  4C0D C;  1Y57 A;  8AT1 B;  1QVG S;  1PD0 A;  2D1X A;  1OV3 A;  5GJV B;  2LQN A;  5KYU A;  2ESW A;  3CC4 Q;  2YLC A;  3LX7 A;  1IGU A;  2QQS A;  1YJ9 T;  1VQK A;  5LJ3 h;  4J9F A;  4EMG A;  2HBP A;  3MEV A;  1RAG B;  1H3Z A;  2O01 E;  2AK5 A;  1MNE A;  3H6Z A;  2FB7 A;  3VYH B;  4OGE A;  4C92 F;  2F2V A;  2JUF A;  3M5A A;  4OP0 A;  5D6Y A;  2LDM A;  4ZTF A;  2EIF A;  3C95 A;  3L2Z A;  3OW2 A;  2PVG B;  3ZL7 C;  1KFZ A;  2RF0 A;  5GAN 2;  3AHU A;  1YJ9 Q;  4M75 C;  3OYG A;  1M90 C;  3A8H B;  5FRM A;  4D8K A;  3ZFJ A;  3H0F A;  1K1Z A;  2HMA A;  2ZPE B;  1TUC A;  4M77 C;  3JCM P;  2CH4 W;  4XU3 A;  4PJO B;  4ELY C;  4FL6 A;  3PT9 A;  3PE0 A;  1JXO A;  3CCU T;  1BKB A;  4WCI A;  4XTU A;  1PKS A;  2JW4 A;  2O4X B;  1MMA A;  2X4X A;  3M0R A;  1VQ6 T;  2A0F B;  2DYI A;  2NWM A;  3GF5 A;  1VQ9 A;  4C5G A;  1MV0 B;  2DX1 A;  4X34 A;  1FXX A;  4F14 A;  1GCP A;  3OYY A;  1Q7Y C;  2F5K A;  1N27 A;  5FRN A;  3CBP A;  3OYF A;  3E2U A;  2YUP A;  3QXE B;  2MMP A;  1H92 A;  2KYB A;  3V7S A;  1AHJ B;  2G6F X;  2COZ A;  4KUI A;  3CCU Q;  1IB8 A;  1I1J A;  3VUB A;  3VS1 A;  1PC0 A;  2LMJ A;  2EW3 A;  3CQT A;  2FRW A;  1G3W A;  2KK4 A;  3M9Q A;  2BTT A;  1UHF A;  4E7K A;  1ZSZ A;  3JCM h;  4DBF A;  1IO6 A;  3VYG A;  3CCQ T;  3HSB A;  1SSH A;  2CP0 A;  1HJD A;  4FW1 A;  1EFN A;  4FSX A;  2H8H A;  3HTR A;  5KE2 A;  4JJB A;  4P5N A;  4BD3 A;  2EGA A;  3EG3 A;  2DVE A;  5I21 A;  4DEX A;  2CP6 A;  4C0F A;  2JNG A;  4XTX A;  1TUG B;  1YFN A;  3VJP A;  2XD0 A;  4BI8 B;  2FL7 A;  2DD4 A;  2KXC A;  5GAO q;  2XG8 D;  4C92 C;  4FU6 A;  3CCQ Q;  5GAN h;  4FW2 A;  2E6Z A;  4B6M A;  2H3J A;  2DL7 A;  4ESR A;  3H41 A;  4J5Y A;  4A4E A;  3EHR A;  5GAO p;  2X51 A;  3FLG A;  3OBW A;  3V8J A;  2VWF A;  3QSU A;  2VUB A;  2JS0 A;  2VYT A;  1U3O A;  1WNL A;  4RKU E;  3G4S A;  4J83 A;  4ORZ A;  1PRM C;  4O5V A;  4QVD A;  2GFU A;  4D8D A;  2KSS A;  2RNA A;  5CO7 A;  2DPP B;  2LCS A;  2MAM A;  3QII A;  1N8R C;  2DL5 A;  1D0Y A;  3CCE A;  3AT1 B;  4RTT A;  2RQR A;  2X3W D;  5GMK h;  5C6S A;  4LDY A;  4Y28 E;  2NUP B;  2E12 A;  1M9S A;  3CMA A;  4XTW A;  4HT9 A;  2ZPF B;  2AKL A;  6AT1 B;  3P8B B;  2LNV A;  4PJN A;  2YRV A;  1V29 B;  2JTM A;  1VOM A;  3CPF A;  5KH6 A;  3THK A;  3G1J A;  1B34 B;  2GQI A;  1TOV A;  2QAZ A;  3SDZ A;  3MKD A;  4K11 A;  1U1T A;  2HEQ A;  4M7D A;  3OQ5 A;  2EKH A;  3RNJ A;  3UPU A;  2XMF A;  2Z0W A;  3H0H A;  1PM3 A;  4C8Q A;  4RCC A;  2X3X D;  2LT1 A;  2XDP A;  4N4I A;  1OYX A;  2BE7 D;  4D6W A;  2KT1 A;  4CI0 C;  1S1N A;  1SF9 A;  2RQW A;  2OAW A;  4PJO D;  3FDR A;  4Q5W A;  1BBZ A;  2NYS A;  3L42 A;  1M8M A;  3CCM A;  4N4H A;  3H8Z A;  1NJI R;  5GMK e;  2OJ2 A;  1VQP Q;  1X69 A;  1QCF A;  3I5S A;  1K8A C;  1QCO A;  3CC2 Q;  2YRC A;  1YIJ T;  3MEU A;  3CC7 Q;  2OTL A;  2RM4 A;  1D0X A;  1V76 A;  2OAU A;  3CPW S;  2DNU A;  2FG0 A;  3VRZ A;  4DBQ A;  1K9M R;  4CC2 A;  3HRS A;  1G5V A;  4J7I A;  1OU9 A;  4QVC A;  3E9F A;  4KT0 E;  2DEU A;  2A28 A;  1WQ7 A;  2JS2 A;  1OI1 A;  5GAN 8;  3OYC A;  1SSF A;  1KC8 R;  2V8J A;  3ZBD A;  4A4G A;  1YHQ T;  3EAE A;  4JJD A;  5FU6 B;  3OMG A;  4J9B A;  2C0O A;  4LDW A;  3CCL T;  1J3T A;  3QPH A;  5L23 A;  4J9D A;  1YIJ Q;  2PUK B;  1WDX A;  1W2B P;  3M0Q A;  3GOX A;  1XJW B;  1KIK A;  2KT8 A;  2RPN A;  1U5S A;  1RLQ C;  4M78 B;  2K6D A;  4GY5 A;  1X75 C;  3VV0 A;  3RER A;  2DET A;  1V1C A;  3O8V A;  1VQ5 A;  3CCS T;  3S3O A;  2CP2 A;  1JJ2 A;  1KQS P;  2F5T X;  4OMO A;  4A4H A;  4HT8 A;  4A53 A;  2LVM A;  1M1G A;  1R0B G;  2VKN A;  4BDY A;  1M4Z A;  4M7A A;  3LW5 E;  1LCK A;  1Q82 U;  5CCA A;  1YHQ Q;  4RCB A;  5A2Q E;  1QWE A;  2DEQ A;  5GMK j;  3NTI A;  4L59 A;  1VQ6 A;  4FIB A;  1WX6 A;  4RTW A;  3CCL Q;  1SPK A;  1MMD A;  3CCR A;  1O9S A;  2X4Y A;  2CSI A;  2ZCF B;  3X24 B;  1KK7 A;  1Y96 B;  4FM4 B;  3CCS Q;  4NL2 A;  4M7D E;  1Y71 A;  1RI9 A;  2HL3 A;  2KGT A;  4HA8 A;  4PK4 A;  1C0M A;  1VQ7 T;  2P0P A;  3HP9 A;  2LP5 A;  2HAX A;  2KQW A;  4C8Q E;  1M90 R;  3CCV T;  1VQO T;  1AWW A;  2FZK B;  4IUT A;  3S3N A;  1NEG A;  1UGV A;  4M7D C;  2KR3 A;  2K79 A;  4ME7 A;  4C5I A;  3SD4 A;  3FRN A;  1N6A A;  5GAO m;  5AYF A;  2PVO B;  1WLP B;  4II1 A;  5CKE A;  1ZUU A;  1QVG P;  3OS5 A;  4RMO A;  2Y4Y A;  1OEB A;  2QQA A;  4EMK C;  4AFZ C;  1LNX A;  4BI3 A;  2ENM A;  3OYH A;  1ABO A;  3CCV Q;  2IIM A;  3JB9 G;  1N5Z A;  1VQO Q;  5A0L A;  4RTZ A;  3TU4 K;  2K2M A;  1Q7Y R;  2YHT A;  3RMQ A;  3VS7 A;  3RMS A;  3RBB B;  3QDR B;  1TUD A;  1BYM A;  1UJ0 A;  3KUF A;  1MHN A;  2HNI A;  1NM7 A;  4EIK A;  1I8F A;  4X9C A;  3UF4 A;  5KYX A;  1YCS B;  1WHH A;  4IUP A;  1CKB A;  4LD9 K;  2JVV A;  3RIR A;  3PNW C;  4FT2 A;  2D9T A;  7AT1 B;  2HKQ B;  2VGN A;  2VVK A;  1ZSG A;  2YDL A;  4GLM A;  4M75 A;  2X9H A;  3A8L B;  2DLP A;  4KH0 B;  4M77 A;  5GAN 4;  2JTF A;  1W2B S;  4M7A E;  4HKE A;  1IXD A;  3CD6 T;  3FIF A;  3CXC S;  4QQG A;  1VQ4 A;  2BZ8 A;  2BKD N;  5KYW B;  4PLL A;  2OTJ T;  2V1Q A;  1GL5 A;  4JJN K;  1M1F A;  4N4G A;  4JS4 A;  2Y4X A;  3C0C A;  2IG0 A;  1H3H A;  2R5M A;  1XNI A;  1KHI A;  4BB7 A;  2WSF E;  2QA4 T;  1R0C B;  2EJF A;  3MP8 A;  2J05 A;  3JB9 D;  2YUN A;  4BE2 A;  3NPF A;  2DF6 A;  2EFI A;  4J9I A;  3RKY A;  5ECA A;  2AT1 B;  5HY6 A;  3VS6 A;  1G8X A;  2E5Q A;  3CD6 Q;  1BCM A;  1YJW A;  2XU8 A;  5GAM d;  2ECZ A;  4C0Z A;  9ATC B;  2DZC A;  5EC7 A;  2LCL A;  2HSE B;  2FZC B;  4F16 A;  1I5O B;  4F7U F;  2OTJ Q;  2D0N A;  1RAF B;  4M78 D;  1MMG A;  2K57 A;  1N8R R;  4IUQ A;  1RLP C;  5IHN A;  2XIC A;  1O75 A;  1RAE B;  2QA4 Q;  2CZ0 B;  2J06 A;  1X2Q A;  5GAM f;  3QKJ A;  4MZT A;  4LDU A;  2RJC A;  3JSC A;  3LGL A;  4HCK A;  1N9R A;  4RUG A;  1M27 C;  1QW1 A;  2D6F A;  5IAY A;  1D0Z A;  2A08 A;  2BUD A;  3BE3 A;  1QP3 A;  2JN0 A;  4HVW A;  5DM7 R;  1BI1 A;  1OX8 A;  2K3X A;  3P8H A;  3S6W A;  3G71 A;  2DKG A;  4C92 A;  2DAQ A;  1I07 A;  1YIT A;  1WI7 A;  5L8R E;  1AVZ C;  2DM1 A;  2X4J A;  2C0I A;  3DKM A;  5I2M A;  1QP2 A;  3BDL A;  4CC7 A;  1E6G A;  2QAS A;  4JRK A;  1VQN A;  4NL3 A;  3ZEH A;  4EPC A;  3OBY A;  3EGD A;  2LJ0 A;  1KQ1 A;  2IPO B;  3L2W A;  3H9N A;  4E7J A;  2CDT A;  3M54 A;  3JCM c;  2RQT A;  5GMK m;  3WVE B;  4M75 E;  2HSP A;  2M0Y A;  2RJD A;  4PJL A;  1SEM A;  2EWN A;  2ED1 A;  3EG9 A;  2CYZ B;  3TEE A;  5KYY A;  5LJ5 d;  4M77 E;  5EG2 A;  1Z9Q A;  1K8A R;  4LD6 A;  2QEX A;  2XK0 A;  1VQ8 T;  1VQL A;  4F7U E;  3MO8 A;  2DTH A;  5LJ5 f;  1VIF A;  2V26 A;  2CZ7 B;  5I11 A;  4E7I A;  4A63 B;  1PCX A;  3PIP A;  2L5Q A;  4M78 F;  2R58 A;  2W10 A;  5HK0 A;  2P4T A;  2A36 A;  3QWX X;  1LPL A;  2RHX A;  5J39 A;  3OMC A;  2CSQ A;  4JS5 A;  4QW2 A;  2EQI A;  2ED0 A;  1BI2 A;  3VRY A;  2DYB A;  3OS1 A;  3FJP A;  5D6W A;  1X43 A;  5CKH A;  2WSE E;  1X27 A;  3QJ6 A;  1VQ8 Q;  4HVV A;  4WF2 A;  2EAY A;  3GP8 A;  5GJW B;  4IUR A;  1WQW A;  1AEY A;  3SWN B;  3FJ5 A;  4LDV A;  4JDS A;  2WSC E;  2E6N A;  4JUV A;  3RUX A;  1RAI B;  1PNJ A;  2JMA A;  1YJN T;  1HK9 A;  1W2B A;  4M7D G;  2M0O A;  2GFA A;  2JTE A;  1VUB A;  2PQW A;  2BZY A;  2XID A;  1LVK A;  1VQ5 Q;  2HD0 A;  3E9G A;  1AOJ A;  2COW A;  3I56 T;  1Q86 C;  3UAT A;  3M0T A;  1EX4 A;  4C8Q G;  1Q81 C;  1KQS A;  3EGU A;  4C92 E;  1UB4 A;  2NUT B;  3BY7 A;  3CPW P;  3G6E A;  3QZ9 B;  4ANJ A;  4J9E A;  1BB9 A;  4FYV B;  1ZX6 A;  3JCM X;  5HKC A;  1IRX A;  1YJN Q;  2FPD A;  4HVU A;  1ZUY A;  1T0H A;  3OSS C;  2KY9 A;  1T3S A;  4QQD A;  3QYG B;  2O2O A;  1D3B A;  1WHM A;  2ZZD A;  3I56 Q;  2FRY A;  4LUE A;  1G3S A;  2HQE A;  3V7C A;  1ABQ A;  5FW9 A;  4JPB W;  2DJQ A;  1XOV A;  2AZS A;  1WA7 A;  2DXC A;  1N9S A;  3OSV A;  3JB9 J;  1R8O B;  2QI2 A;  5AT1 B;  5CKB A;  2JM9 A;  3CME Q;  1RAH B;  2F2X A;  1TTH B;  2DTO A;  2F2W A;  2IVW A;  2P0Q A;  3PGG A;  4OMF B;  2EYY A;  1BIB A;  1UGQ B;  1Z9Z A;  2B8A A;  1KD1 C;  1QLY A;  2VGM A;  1S72 Q;  3V7R A;  3JCM g;  1AWO A;  4C8Q D;  1M1K C;  1QVG A;  2K5F A;  4Y92 A;  2E3H A;  4PFO A;  2M1H A;  1K9A A;  4RTV A;  4J6X A;  3M53 A;  4M7A G;  5CK9 A;  2JMC A;  5GAN 3;  1M2V A;  5LJ3 d;  3I55 A;  2RQV A;  4Z89 A;  1TS9 A;  1JQQ A;  3X28 B;  1UTI A;  2RJF A;  1RAC B;  1U1S A;  2KDS A;  1D09 B;  2FEI A;  4BAC A;  1VQP T;  2GTJ A;  3QG1 A;  2E10 A;  3NFC A;  4Z8A A;  2CT3 A;  2QTX A;  3CC4 A;  2OI3 A;  1E6H A;  3CC2 T;  1YI2 T;  5GAN g;  5LJ3 f;  2GGR A;  3VKI A;  5GAO n;  1IHV A;  2DK3 A;  5FWB A;  1K73 C;  3CC7 T;  3L2V A;  4AG2 C;  3KFV A;  1LJO A;  2XHC A;  1VQM T;  2M51 A;  4FCY A;  2FYK A;  1GXI E;  2DIQ A;  2AKK A;  1WIE A;  3PFS A;  4QKU A;  1GBR A;  4FSS A;  4C0G A;  1RAD B;  2KMT A;  4EMK A;  1NJI U;  3LH5 A;  3CCJ T;  1WHG A;  3M4Y A;  1SG5 A;  5KCO A;  1YWP A;  3VS4 A;  1NYF A;  3OYM A;  1WYX A;  3E19 A;  1TSF A;  3PVL A;  3REB B;  1X6G A;  2RD1 A;  2LQW A;  3FC3 A;  1YI2 Q;  1YJ9 A; 
#chains in the Genus database with same CATH homology
 2QQA A;  3MET A;  3OB9 A;  4EMK C;  3OYN A;  3EFS A;  1LNX A;  2I2L A;  2DD5 A;  3PMI A;  4BI3 A;  1BI0 A;  1K9M U;  4EMK B;  1JJ2 S;  3OYH A;  3JB9 G;  3OYB A;  3LGF A;  5A0L A;  3TU4 K;  2CKK A;  3HRU A;  2YHT A;  4VUB A;  3RMQ A;  4EMH A;  1U8R A;  1KC8 U;  4ZTJ A;  4C0D C;  3R6O A;  3RMS A;  1QVG S;  3QDR B;  4CRI A;  1BYM A;  4C0D B;  3KUF A;  1MHN A;  4M78 E;  3GNG A;  3FEO A;  2HNI A;  1S72 T;  2EQJ A;  1I8F A;  2YLC A;  3LX7 A;  4X9C A;  2QQS A;  2G3R A;  4C5E A;  1YJ9 T;  2L8D A;  2LC4 A;  4NS5 A;  5FU6 C;  3LWI A;  1VQK A;  5LJ3 h;  4IUP A;  2EJG A;  1JRI A;  3PMT A;  5LJ3 j;  4GLK A;  4EMG A;  4LD9 K;  2EQU A;  2JVV A;  3RIR A;  3L2U A;  3HKS A;  3CD6 A;  2HBP A;  3PNW C;  3MEV A;  4FT2 A;  2D9T A;  1H3Z A;  1X6O A;  2O01 E;  2PUO B;  1ZQ1 A;  2RI3 A;  2VGN A;  4FT4 A;  3H6Z A;  4M78 C;  2LQ8 A;  3L2Q A;  2FB7 A;  4M75 A;  3VYH B;  2M9U A;  4OGE A;  2OTJ A;  5M9O A;  5FU7 C;  4ZGD B;  3MEA A;  2RI5 A;  4C92 F;  3M5A A;  1LOJ A;  2JUF A;  4OP0 A;  3NTK A;  2LDM A;  3A8L B;  5D6Y A;  3JCM d;  4ZTF A;  2EIF A;  2DXT A;  2E41 A;  4M7D D;  4XTV A;  3CBO A;  3C95 A;  3L2Z A;  3SB2 A;  4M77 A;  1VQK T;  2QA4 A;  4M75 G;  3OW2 A;  1YBY A;  3ASK A;  4MMK A;  5GAN 4;  1EIF A;  2JTF A;  1W2B S;  2C06 A;  4HKE A;  2PVG B;  4XU0 A;  4OGC A;  3CCU A;  3CD6 T;  4M7A E;  5GAN 2;  3FIF A;  5CQY A;  3CXC S;  3AHU A;  3JCM e;  4M75 C;  4QQG A;  3OYG A;  2VXE A;  4RG2 A;  4M75 B;  1VQ4 A;  1M90 C;  2BKD N;  3A8H B;  5FRM A;  3JAM E;  4PJO G;  3JCM f;  2V8K A;  4PLL A;  4M77 G;  3ZFJ A;  5FLX E;  2OTJ T;  4PNO A;  4IKF A;  3JCM Q;  4MZM A;  2ZPE B;  4J6Y A;  4JJN K;  1M1F A;  4M77 C;  4N4G A;  4JS4 A;  2Y4X A;  3JCM P;  4XU3 A;  4PJO B;  2IG0 A;  4FL6 A;  4EDU A;  4M77 B;  2R5M A;  3PT9 A;  4ELY C;  1XNI A;  1KHI A;  4BB7 A;  2FVU A;  2WSF E;  2QA4 T;  1Y7X A;  3DLM A;  4R55 A;  1ZBX A;  2EJF A;  3MP8 A;  4O6J A;  3JB9 D;  3QJY A;  3V8K A;  4F7U G;  4ZGE B;  4XU1 A;  4BE2 A;  3GNF B;  5GAO r;  3CCU T;  1M5Q 1;  1BKB A;  5GAN d;  3MHX A;  2EFI A;  4OB1 B;  4OF1 A;  4PJO F;  3RKY A;  4E7H A;  3M56 A;  4XTU A;  1W4S A;  2A7Y A;  3LWH A;  3GIB A;  2MWO A;  1P92 A;  5HY6 A;  2O4X B;  1VQ4 T;  2X4X A;  1IRE B;  4F7U B;  3BW1 A;  1VQ6 T;  2E5Q A;  3GF5 A;  1YJW A;  1M90 U;  2XU8 A;  4C5G A;  1VQ9 A;  2RHY A;  4ZN3 A;  5I2S A;  5GAM d;  4X34 A;  4C0Z A;  1FXX A;  4KBM B;  5GAN e;  2DZC A;  2LCL A;  3QUI A;  4F7U F;  3RES A;  3JCM b;  3OYY A;  5GAN f;  1Q7Y C;  3LLR A;  4N0A C;  2F5K A;  1N27 A;  3CCQ A;  5FRN A;  2MWP A;  3CBP A;  4M78 D;  3OYF A;  3QXE B;  2K57 A;  2MMP A;  1G3T A;  2WAC A;  5GAM g;  3JCM W;  3C94 A;  1QVF S;  5GAM e;  4IUQ A;  4MDX A;  2RJE A;  2XIC A;  1O75 A;  3C12 A;  3V7S A;  1AHJ B;  2L3R A;  2CZ0 B;  5GAM f;  3QKJ A;  4MZT A;  4LDU A;  2RH2 A;  3F70 A;  4BI4 A;  4KUI A;  3OA6 A;  2RJC A;  1NZ9 A;  1IZ6 A;  3JSC A;  4JLG A;  3LGL A;  1VQ9 T;  4ZN1 A;  1YJW T;  3VUB A;  3OYD A;  2CS7 A;  2MF2 A;  1N9R A;  4DOW A;  1BIA A;  2D6F A;  1QW1 A;  1G3W A;  2KK4 A;  4MML A;  3M9Q A;  5IAY A;  4E7K A;  1TH7 A;  1WJQ A;  2BUD A;  3RKW A;  3CBM A;  1QP3 A;  2JN0 A;  4M75 D;  3JCM h;  3VYG A;  3CCQ T;  5DM7 R;  3HSB A;  1BI1 A;  2DZ9 A;  4A4K A;  3GPL A;  1Q7Y U;  2QDY B;  5GMK l;  2RI2 A;  2XDD A;  2QQR A;  2DXU A;  2NLU A;  2PVD B;  3A5Z B;  4HCB A;  1RI0 A;  2K3X A;  3HFO A;  5KCH A;  4XTZ A;  3P8H A;  4FSX A;  3V8L A;  5CR2 A;  3OW2 S;  5KE2 A;  3S6W A;  3G71 A;  2DKG A;  4C92 A;  4P5N A;  4BD3 A;  2DAQ A;  4M7D F;  4M7A D;  2RK2 A;  2DVE A;  4MZP A;  3HFN A;  3RKX A;  1YIT A;  5L8R E;  3JCM V;  5I21 A;  2CZ6 B;  4C0F A;  2JNG A;  1X01 A;  2X4J A;  3DKM A;  4MDW A;  5I2M A;  1QP2 A;  4XTX A;  4BDZ A;  4XK8 E;  3BDL A;  3VJP A;  2XD0 A;  2DO3 A;  4BI8 B;  2M16 A;  5HK3 A;  3M58 A;  2FL7 A;  4C92 G;  2DD4 A;  4JRK A;  2JZ2 A;  5GAO q;  2K3Y A;  4NL3 A;  1VQN A;  4C8Q F;  3ZEH A;  2XG8 D;  4EPC A;  1I81 A;  4XQ3 A;  2GCX A;  3X26 B;  3OBY A;  4C92 C;  4FU6 A;  2R5A A;  1KQ1 A;  3E1S A;  4C92 B;  4KUD K;  3L2W A;  4E7J A;  3G71 T;  2RO0 A;  5GAN h;  2E6Z A;  1UEB A;  3M54 A;  4KUL A;  1VQ8 A;  2H3J A;  3DB4 A;  2RHU A;  4XU2 A;  3JCM c;  3WVE B;  5GMK m;  5GAN j;  4M75 E;  1YIT T;  3QYH B;  4J5Y A;  3UT1 A;  4A4E A;  5A0D A;  5GAO p;  2X35 A;  2RJD A;  2E65 A;  3FLG A;  5GAN 7;  3KXT A;  2EWN A;  3OBW A;  4XTY A;  3V8J A;  5GAM h;  3PTA A;  3QSU A;  2CYZ B;  2VUB A;  3TEE A;  5LJ5 d;  5GAM j;  5D6X A;  4PJO E;  2VYT A;  1WNL A;  4M77 E;  4RKU E;  3A8M B;  4YTL A;  3X20 B;  3M4G A;  3G4S A;  4J83 A;  5EG2 A;  4PJO A;  3WVD B;  3JB9 H;  1QVP A;  2EQM A;  3TCJ A;  4PL6 A;  4O5V A;  4LD6 A;  4PJO D;  1XQH A;  4QVD A;  2GFU A;  1D3B B;  4TVR A;  4BUG A;  2QEX A;  2KSS A;  4E7L A;  3L1A A;  5LJ5 g;  5CO7 A;  2RK1 A;  2XK0 A;  3OY9 A;  2QQB A;  4RG8 A;  5LJ5 e;  2DPP B;  2LTO A;  4J6W A;  1VQ8 T;  1WJS A;  3X25 B;  1VQL A;  2O4X A;  2MAM A;  4B9X A;  4F7U E;  3UDC A;  3MO8 A;  4F7U A;  2DTH A;  5LJ5 f;  3QII A;  1VIF A;  2CZ7 B;  1N8R C;  3KBG A;  4E7I A;  4PJO C;  3LH0 A;  1NPP A;  2L5Q A;  4M78 F;  3PIP A;  4JRP A;  1Q81 C;  2R58 A;  2BIV A;  5GMK i;  5HK0 A;  2P4T A;  3G4S T;  3CPW A;  4ATO A;  4ZGJ B;  1B34 A;  2YLB A;  4PKC C;  3CCE A;  2RHX A;  3N5B B;  5J39 A;  3OMC A;  5GMK h;  5A0G A;  3SWN A;  3GLX A;  5C6S A;  4QW2 A;  2QEX T;  4JS5 A;  4LDY A;  4Y28 E;  4HCC A;  1BI2 A;  2E12 A;  1M9S A;  3OS1 A;  3HPW A;  3M57 A;  4R56 A;  3CMA A;  1VQL T;  4XTW A;  5J3B A;  4HT9 A;  3OYE A;  3FJP A;  2ZPF B;  5D6W A;  5CKH A;  3P8B B;  2LNV A;  2WSE E;  1YJN A;  2YRV A;  1V29 B;  3QJ6 A;  2JTM A;  3T9N A;  2QQ9 A;  4WF2 A;  2EAY A;  3CPF A;  2CGH A;  5KH6 A;  1N8R U;  1B34 B;  4V2S A;  5DLQ E;  1RL2 A;  3LYI A;  3GP8 A;  2GF7 A;  4OB0 B;  3SWN C;  4IUR A;  3SDZ A;  1WQW A;  1FX7 A;  2QXF A;  3CCE T;  3QBY A;  3SWN B;  3VU3 C;  1H64 1;  4IUV A;  4LDV A;  2Y90 A;  4JDS A;  4UC4 A;  3I56 A;  1U1T A;  2WSC E;  1JBM A;  2E6N A;  4M7D A;  4DOV A;  4JUV A;  4M7A F;  3OQ5 A;  3RUX A;  3J80 E;  2EKO A;  4BE0 A;  3CMA T;  3UPU A;  3M59 A;  2ZPB B;  4LDX A;  1YJN T;  3OYJ A;  3MP6 A;  1HK9 A;  2LRQ A;  5CKD A;  2E64 A;  1M8V A;  1W2B A;  4C8Q A;  4L5G A;  4IUU A;  2M0O A;  4RCC A;  4M7D G;  2GFA A;  3C4S A;  1VUB A;  2L89 A;  2PQW A;  3PIO A;  1YIJ A;  2XID A;  3CME A;  2LT1 A;  2XDP A;  2HD0 A;  4N4I A;  1OYX A;  5LJ5 h;  2LCC A;  3P8D A;  4X9D A;  3E9G A;  2AHJ B;  5LJ5 j;  2GQV A;  3UWN A;  3I56 T;  4M7D B;  4OB3 B;  2K2V A;  4D6W A;  1MGQ A;  1OZ2 A;  3A8G B;  1Q86 C;  3OYI A;  4CI0 C;  3BFM A;  1UGR B;  4C8Q G;  1UGP B;  2F69 A;  3FDR A;  3INZ A;  2KAF A;  4M77 D;  4Q5W A;  1UGS B;  1UB4 A;  4C92 E;  3BY7 A;  3L42 A;  1KQS A;  3G6E A;  3QZ9 B;  3CCM A;  1DJ7 B;  4N4H A;  3DLL A;  1WGS A;  2X4W A;  2P0K A;  3H8Z A;  5GMK e;  3OYK A;  3S3M A;  4C8Q C;  3CME T;  1JB0 E;  1ZHI A;  1PSE A;  4C8Q B;  3OYL A;  1S72 A;  1K8A C;  3JCM X;  5GAN 6;  2JOY A;  5FRO A;  3ME9 A;  3QHS A;  4BY6 C;  4Y91 A;  5CKF A;  4A4F A;  2MI6 A;  5HKC A;  1YIJ T;  2DJZ A;  4BY6 B;  1YHQ A;  2RHZ A;  3MEU A;  2A3L A;  1OZ3 A;  3L2R A;  2OTL A;  2RM4 A;  1BI3 A;  2D0Q B;  4B9W A;  3MP1 A;  3OSS C;  5IN1 A;  3CCL A;  2HQX A;  2KY9 A;  2OAU A;  3CPW S;  4QQD A;  4A54 A;  3QYG B;  3EFR A;  2ZPI B;  3BDU A;  1Q86 U;  3TRE A;  1D3B A;  4C5H A;  3HRS A;  3G6E T;  2ZZD A;  3CCM T;  1G5V A;  4J7I A;  2CZ1 B;  1Q81 U;  4QVC A;  3E9F A;  4KT0 E;  4M78 A;  1WQ7 A;  1G3S A;  2HQE A;  1OI1 A;  2V8I A;  3DB3 A;  3V7C A;  2E1H A;  5GAN 8;  3OYC A;  1SSF A;  2V8J A;  3ZBD A;  3OS2 A;  3CCS A;  2RHI A;  1XOV A;  4A4G A;  1K8A U;  1QVF A;  3JB9 F;  1YHQ T;  2DXC A;  1N9S A;  3EAE A;  3OSV A;  3JB9 J;  2OTL T;  1R8O B;  3HL8 A;  5FU6 B;  1Q82 C;  3OMG A;  2QI2 A;  2VV5 A;  4LDW A;  3CCL T;  4M78 G;  3MCA B;  3QPH A;  3MEW A;  5CKB A;  4JLI A;  5C0M A;  2PUK B;  3M55 A;  4JRQ A;  1NPR A;  4J7F A;  4BE1 A;  3GOX A;  4QVZ A;  2DTO A;  1KG1 A;  4M78 B;  2IVW A;  5GAN 5;  2EJ9 A;  4GY5 A;  3CEY A;  1X75 C;  3VV0 A;  4DA4 A;  3JCM J;  5FU7 B;  1NE8 A;  3RER A;  1PSF A;  3OS0 A;  2P0Q A;  3O8V A;  2XI9 A;  1VQ5 A;  3PGG A;  2FHD A;  4OMF B;  3CCS T;  3S3O A;  2K4Y A;  3SFM A;  1JJ2 A;  1BIB A;  2LQK A;  4ELZ C;  1UGQ B;  1HXD A;  2B8A A;  2F5T X;  4A4H A;  1KD1 C;  4HT8 A;  4A53 A;  2VGM A;  2LVM A;  3JRZ A;  1M1G A;  4BDY A;  2E70 A;  2ZPH B;  4DQ2 A;  3J7A F;  1M4Z A;  4M7A A;  3V7R A;  3JCM g;  1Y96 A;  3LW5 E;  1Q82 U;  4C8Q D;  5CCA A;  1M1K C;  4RCB A;  1QVG A;  2K5F A;  5A2Q E;  2DEQ A;  5GMK j;  3NTI A;  1WJR A;  4L59 A;  4L6V 5;  1VQP A;  1VQ6 A;  4FIB A;  2M1H A;  2ZPG B;  1YCY A;  2LX9 A;  2RA2 A;  3CC2 A;  1Y07 A;  3WXM B;  1YI2 A;  5DLO A;  4J6X A;  3CCR A;  3M53 A;  1O9S A;  2X4Y A;  5CK9 A;  1KQS S;  1VQ7 A;  3FB9 A;  5GAN 3;  4M7A G;  2VXF A;  3CC7 A;  4M75 F;  1VQ5 T;  2KVQ G;  4OB2 B;  2LT4 A;  3G7Z A;  4QQ6 A;  2ZCF B;  3X24 B;  4C92 D;  5LJ3 d;  3I55 A;  4J8O A;  3CCV A;  4M7A C;  1VQO A;  1WPY A;  1G3Y A;  3J81 E;  1VQM A;  1I5L A;  4M7A B;  3OYA A;  1VIE A;  3HHT B;  1Y96 B;  5DY9 A;  2PU9 B;  3X28 B;  3A8O B;  3NTH A;  4FM4 B;  5GAO l;  1KD1 U;  4N0A A;  1NJI C;  2RJF A;  4M77 F;  3URG A;  4NL2 A;  1U1S A;  2KDS A;  5LJ3 g;  4M7D E;  1Y71 A;  4BAC A;  3CCJ A;  1VQP T;  3QG1 A;  5LJ3 e;  1M1K U;  2E10 A;  2K5I A;  3NFC A;  4E47 A;  1I4K 1;  2QTX A;  3QO3 A;  4HA8 A;  3CC4 A;  2VC8 A;  3CC2 T;  1YI2 T;  1XTD A;  5GAN g;  5LJ3 f;  4HCZ A;  3VKI A;  3ER0 A;  1VQ7 T;  3CCR T;  2K5L A;  2RB6 A;  5GAO n;  2P0P A;  4PLI A;  2DK3 A;  1K73 C;  3CC7 T;  3HP9 A;  3L2V A;  2HAX A;  3QZ5 B;  2EYQ A;  2KQW A;  2EQK A;  1LJO A;  2XHC A;  4C8Q E;  3I55 T;  3CCV T;  4JRI A;  1VQM T;  1VQO T;  5CIU A;  2FYK A;  2DIG A;  4IUT A;  4OVA A;  3CXC A;  3S3N A;  1FWZ A;  2DXB A;  2ZGW A;  2DIQ A;  1K9M C;  1GXI E;  3PFS A;  3HRT A;  4M7D C;  4C0G A;  2KMT A;  4ME7 A;  3SD4 A;  4C5I A;  3FRN A;  4EMK A;  1NJI U;  4NOY A;  2DTI A;  3VUZ A;  3CCJ T;  1KC8 C;  5LL6 S;  3M4Y A;  1N6A A;  5KE3 A;  5KCO A;  5IT9 E;  5GAO m;  3CC4 T;  4Z02 A;  2XDB A;  3OYM A;  5AYF A;  1KQ2 A;  2PVO B;  2R57 A;  5CAI A;  5CVI A;  1VQN T;  4II1 A;  3Q1J A;  3E19 A;  5CKE A;  5CQX A;  4XAX B;  2RD1 A;  3OS5 A;  2XKO C;  4RMO A;  1K73 U;  1YJ9 A;  2Y4Y A;  3FC3 A;  1KHC A;  3JB9 I;  5J26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...