1Y96B

Crystal structure of the gemin6/gemin7 heterodimer from the human smn complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
AQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Gemin6-Gemin7 Heterodimer from the Survival of Motor Neurons Complex Has an Sm Protein-like Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Gem-associated protein 6
total genus 23
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11095 Gemin7 Gem-associated protein 7 (Gemin7)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y96B00
4J6WA 2E10A 3INZA 2RD1A 1B34B 1I81A 1Y96A 3QSUA 1Y96B 3RKXA 1WQ7A 3JCMP 1LOJA 2JN0A 4A54A 3QUIA 4M77A 1H641 3JCMQ 5GANe 5GANf 3JB9G 5GANh 3JCMh 5GMKm 4JLIA 1M5Q1 4M78C 1LJOA 5LJ5f 2RB6A 2ZGWA 4M77G 1YCYA 3GIBA 3L1AA 3V8JA 4M78D 4M7DC 3QO3A 4NL2A 4C8QC 4EMKC 4XTYA 4DQ2A 3HFNA 4HT9A 1LNXA 2E41A 5LJ3g 4PNOA 4C92A 5GAMg 5GAN2 4XU3A 2CGHA 1KQ2A 1HXDA 5GAOr 4M78B 1WPYA 3RUXA 4C8QB 4EMKB 4XTUA 5GAOm 4N0AA 2EJFA 4J6XA 2Y90A 3SB2A 4EMHA 4M7AG 3V7SA 3EFSA 4F7UF 5GMKj 4C92F 2DZ9A 4XU1A 5GAOp 4M7AA 1WQWA 2VXFA 4M7DD 3JB9J 4PJOA 3V8KA 4M75F 5LJ3f 5GAMf 4M77E 4X9DA 5LJ3h 5GAMh 4EMGA 5GAN5 2DJZA 3BDUA 4JUVA 1N9RA 3JCMg 3SWNA 4M7AD 4M78A 4OP0A 5GANd 2YLCA 4QVDA 3RERA 4M7DE 3V7RA 1WNLA 4NOYA 5GAN3 4M7DG 3JCMc 4F7UE 4HT8A 4J6YA 4C8QF 4X9CA 4RCCA 3V7CA 5DY9A 4XU2A 4Y91A 2RM4A 2YHTA 4XU0A 3JB9I 2DKGA 2EAYA 5GANj 4PJOF 4M77B 2DEQA 4N0AC 3JCMe 4QVCA 3JCMb 1U1SA 2DVEA 2FB7A 3JCMV 5LJ5g 3JCMW 4M7AF 5GAOl 2DTOA 3M4GA 4C92C 4M7AB 5GAN7 4MMLA 4A53A 4M7DF 2EJGA 2E65A 4XTVA 4C92B 3JB9F 4PJOE 2DTHA 3JCMJ 4C8QA 4EMKA 5GAOq 5LJ3d 5GAMd 2DZCA 4M77F 4M77C 4M78G 5GMKl 4RCBA 1BIBA 5GMKe 3JCMX 4M77D 4C8QD 1B34A 4C92G 4NL3A 1I5LA 3FJPA 3BFMA 2EJ9A 3JB9H 1U1TA 3EFRA 5LJ3j 5GAMj 3JB9D 4M7AE 4M75B 2E1HA 3L2ZA 4M75A 3JCMf 1M8VA 4JRKA 3HFOA 4WF2A 3SWNB 3BW1A 1I8FA 4JRIA 2EWNA 5GMKh 5GANg 4J5YA 5GMKi 3JCMd 3RKWA 5LJ5j 4XQ3A 5GAOn 1X01A 3QHSA 4MMKA 4C8QE 2VXEA 2YLBA 2FYKA 4XTXA 2HNIA 2QTXA 4M75G 1I4K1 2K57A 2RA2A 2DTIA 3BY7A 4M78E 4F7UB 4HA8A 3RKYA 2DXUA 5I21A 4M7AC 3SWNC 5GAMe 2E64A 4M78F 5GAN6 5LJ3e 1JBMA 3FB9A 5LJ5d 1MGQA 1KQ1A 4M75D 5CAIA 3AHUA 4PJOB 5LJ5h 4M7DB 5LJ5e 4XTWA 4M7DA 4PJOD 3V8LA 4C92D 4C8QG 1BIAA 4M75C 5GAN8 1D3BB 4PJOG 4F7UA 1D3BA 3FIFA 3PGGA 3HSBA 4PJOC 1TH7A 2I2LA 3VU3C 2VC8A 1JRIA 4M75E 1N9SA 3RESA 1HK9A 5GAN4 4V2SA 4XTZA 4C92E 2DXTA 4F7UG 3RIRA
chains in the Genus database with same CATH superfamily
3OMGA 1SHGA 3VYHB 2CP7A 4D8KA 3U23A 4KBMB 3EAEA 1VYUA 4M77A 1QVFP 1QLYA 1QMCA 4FYYB 2ZPBB 3UA7A 1JEGA 4BI3A 3QZ9B 2QA4A 3H0IA 2GFUA 4M7AG 4Q5WA 4TVRA 4ZNXA 3QG1A 4C92F 4F04B 3CCJT 1UGQB 1QCFA 1TWBA 1I5OB 4AG2C 2O2OA 1RLPC 1VQ6A 4M7AD 2GBQA 4OP0A 3FRNA 4OB3B 4JS5A 5I22A 1V76A 1Y7XA 2J6KA 2Y4XA 1OPLA 1UGSB 1G5VA 3CMAA 2YUQA 4QVCA 3JCMW 1OOTA 2BZXA 1M3AA 5GAN7 2QQSA 2EJGA 2LZ6B 2P0QA 5GAOq 1UFFA 5C6SA 2FZGB 3MEUA 4M78G 3JV3A 3GOXA 2OAWA 3JCMX 2EVRA 4KH0B 3ZFJA 1K73U 2FL7A 5LJ3j 2A0FB 4L5GA 1ZSZC 4JPBW 3HFOA 5GANg 1NJIU 1NM7A 2EWNA 5GMKi 2FPDA 1FWZA 3PIPA 2HNIA 5CQXA 1VOMA 4F7UB 1VQKT 4E7JA 3PVQA 2MWPA 1KIKA 3PMIA 1WDXA 4A4KA 2AZSA 2CZ6B 2RJFA 4EPCA 2O4XB 2CZ1B 8ATCB 1Q7YR 3V8LA 4C92D 4ZGJB 3G6EQ 2E12A 3VRYA 4D8DA 2XMFA 2IG0A 4BD3A 3M5AA 3TSWA 1K1ZA 1YJNQ 1G3WA 2H3EB 5FW9A 1U5SA 2JN0A 2KT8A 1OZ2A 2JZ2A 4ME7A 2HD0A 3ZEHA 3ER0A 2MAMA 4AFQC 3QO3A 4NL2A 4XTYA 2O9VA 3QZ5B 2E41A 1QVGS 4M78B 2DILA 2E3HA 1PG5B 1G3YA 3ASKA 1LPLA 5GAN5 1N9RA 3NHNA 3SWNA 4LD6A 2KVQG 3J81E 4QVDA 3AT1B 1WNLA 1YFNA 1ABQA 2HSEB 3OA6A 1PD0A 2VWFA 1HSQA 1T0HA 2DEQA 4PLLA 1QP2A 4A4HA 2GQVA 5EC7A 1AWOA 1BI0A 4MMLA 2J06A 2E65A 2M0OA 4OB1B 1AZGB 1IGQA 2AKKA 2E4HA 1Q82R 1BIBA 5GMKe 2X3WD 1NE8A 3X24B 1G3SA 3R6NA 4QW2A 1K9MU 4KT0E 3I5SA 2GTOA 4QKUA 3UF4A 2O9SA 2RI5A 2K6DA 2R5AA 2CZ0B 2E70A 2RNAA 4IUVA 2QA4Q 2ZPIB 2LX7A 2YT6A 4R0KA 2E64A 5LJ3e 1JBMA 4QQ6A 3HHTB 1ZHIA 2BUDA 3M0QA 2DL3A 4DOVA 1KQSP 2F5TX 2CP5A 4FYWB 3G71Q 1RAEB 4RUGA 5D6WA 5CVIA 1NLPC 2YWWA 1D0ZA 4FW2A 5CKEA 4JJDA 2E3IA 1I07A 2FZCB 2YRCA 1D0YA 4EIKA 3JB9G 3E2UA 2QG9B 2QK0A 1ARKA 4M77G 1ZSGA 5J3BA 3UWNA 3I55A 1M1KR 1C6VX 3SEMA 1VYVA 1ZA2B 3LLRA 4C92A 2SRCA 3CCUA 4LNPA 4QQDA 3CCMA 1CSKA 4C5IA 1YP5A 2JS0A 2RH2A 3OYIA 4JDSA 1BI2A 3THKA 2CKKA 4M7DE 3CC2A 3ZBDA 2HEQA 3V7CA 2DL4A 1KQSS 2IIMA 3RDVA 4KUIA 2EBPA 1JO8A 1SRLA 2QI2A 3GBQA 3EG9B 1FYNA 5FRMA 3NTIA 1V29B 3CPWA 5AYFA 2F2WA 1GBRA 2QQBA 3EG2A 3M58A 4HKEA 2L3PA 1DJ7B 4CC4B 8AT1B 3OW2A 4NL3A 3M0PA 4RG8A 2OTLT 3EG1A 4OB0B 5GAMj 3CMAT 5I2SA 1X69A 1VQ7Q 4LDUA 5LJ5j 4DBRA 3G71A 1VIEA 3HPWA 3CCMQ 1HJDA 4OMLA 2K57A 3A98A 1AEYA 4ZN1A 3REAB 3QBYA 2JUFA 1BU1A 1PCXA 4M7AC 2ZZDA 4PKCC 2OTLA 2PQWA 4CC7A 2VASA 4F7UA 1PC0A 2LT4A 2ED0A 4PJOC 1ZUUA 3G71T 1QVFS 3H0FA 1X2QA 5J39A 5HKCA 1VQLA 3EGDA 1IXDA 1Q95G 1I81A 4LE9A 1NEGA 4FT2A 2QQRA 4BE1A 2B8AA 3JCMP 1WFWA 1MMAA 4EDUA 2KR3A 3CCQQ 3EG0A 3JCMQ 4J9GA 5GMKm 2FO0A 4XAXB 1NJIC 3OS2A 2GFAA 2RHUA 4FYVB 2OI3A 4A4FA 4XTUA 1OZ3A 2VVKA 1RI0A 2V8JA 1BI1A 3HRUA 1ACMB 1SSHA 4L6V5 3META 3EGXB 1WQWA 2M1HA 3V8KA 3G4SA 4J7FA 2LQKA 5FWCA 4AG1C 1X6BA 5KE2A 2LRQA 4J6YA 2DRKA 2QEXT 1VQLT 1Q86C 2DXCA 4A4GA 2JTFA 1M9SA 3L2QA 2EAYA 2YSQA 4AT1B 1U1SA 1QCNA 3MP1A 2DO3A 2DL5A 1VQ6T 2EYQA 1IO6A 4E7IA 1FXXA 2C0TA 2L8DA 1VQPA 4C8QD 2OTLQ 1B7TA 2CH4A 5L23A 4FSSA 1WHLA 4M75A 5GJVB 4J7IA 5AT1B 1RAFB 3H41A 3VS5A 4XQ3A 4HCZA 4FM4B 2VUBA 4O6JA 1M1KU 1WJRA 1QQJA 3CC4T 4OB2B 2Y4YA 1UGPB 3G6EA 2LJ1A 3CPFA 4P5NA 3OMCA 4FL6A 2DXUA 2HKNA 5GAMe 1WLPB 4M75D 4BY6B 2DJQA 1UE9A 3ULRB 3M0TA 1YJWT 3OYNA 2WSFE 2K3YA 2VC8A 1HK9A 2FZKB 2YUOA 1N8RC 3OYCA 2MF2A 1UJYA 1WGSA 3JCMh 3PIOA 1IRXA 2PUKB 2KT1A 2QASA 2JM9A 1G2BA 1KQ2A 2V1RA 2BE7D 2RHIA 1YIJA 3J7AF 2EQMA 2KRSA 3VRZA 4OMPA 3CD6Q 1JU5C 1IZ6A 7AT1B 2HQXA 4M7AA 2L3QA 3GNGA 2DJZA 4JUVA 3S6WA 2C0OA 1YJWA 3RERA 4RMOA 5GAN3 4ATOA 1K0SA 1TSFA 3GF5A 1K73C 2DKGA 2VKNA 5CKFA 1TG0A 3VUBA 3EGUA 1W1FA 3VS1A 4M7AF 2DVEA 2DXBA 4C0DB 3M4GA 4RTVA 4X34A 2WSCE 1NBEB 2JW4A 4A53A 3CC4A 4GLKA 5KYWB 1D0XA 2J6OA 3LWIA 4JRQA 4MDWA 2DX1A 2LCSA 4LD9K 3I35A 3FJPA 3EGDB 3QJYA 3CCJA 3A1PA 3JB9D 1K9MR 2V8IA 1SF9A 4ZGDB 4J5YA 3RKWA 4MMKA 4O5VA 2DRMA 1JXOA 1KHIA 4DBHA 1KD1R 2COWA 3QJ6A 5I21A 4ZTFA 5I11A 3OYFA 4M78F 3OBWA 1Y57A 1H3ZA 1KQ1A 2LX9A 4PLIA 2CP0A 2O01E 5J26A 3E19A 5GAN8 3C95A 4J9DA 4JJNK 2RF0A 1VQ8T 3OYJA 1RACB 3QWYA 3RESA 5GAN4 4C92E 3G7ZA 4HXJA 1AWJA 1B34B 1WHMA 1OEBA 2CP3A 4KULA 2AKLA 2KXDA 4FIBA 5KE3A 2DVJA 2C0IA 3VV0A 1M3CA 4AFZC 3L2VA 2QGFB 1KJWA 2BZYA 4ORZA 1G83A 2A7YA 3SHWA 1GCQA 1YI2T 1UDLA 2DD5A 2RQRA 4JZ3A 3CCJQ 1VQMA 4J9IA 1WHKA 5LJ3f 4BUGA 5LJ3h 2CUBA 3BDUA 3I56Q 2K3BA 1AWWA 1JB0E 3X26B 3JCMc 2KYMA 1OU8A 2RI2A 2CSQA 3QYGB 1ZSZA 3E9GA 3UA6A 5GANj 2NUPA 3OS5A 2F2VA 2AIRB 2F1LA 3CCRA 1EX4A 3CC7Q 4ZGEB 1PNJA 2AT1B 2FHDA 1AZEA 2HSPA 4ANJA 3UATA 1FMVA 3A8OB 2EIFA 3HP9A 4DEXA 5IXFA 3J80E 1ZLMA 3FJ5A 1D09B 5M9OA 4J9BA 4N4HA 3OW2S 1SG5A 2X4WA 1X01A 5CIUA 4C8QE 4DEYA 1NG2A 2RA2A 1YHQA 1GCPA 2MCNA 3L2WA 1R0CB 2XDBA 5GAN6 3N5BB 3FB9A 3H6ZA 1YNZA 3O5ZA 1PD1A 5IN1A 2PVGB 1K4US 3CCRT 3CCET 1H3HA 3RNJA 2R57A 2ZAEA 4BACA 3FIFA 2FRWA 2DEUA 3HSBA 2ZPFB 4JJCA 3PFSA 3EH1A 5IXBA 3M0UA 2LP5A 4ZN3A 3H8ZA 1Y96A 1YJNT 1KQSA 3RKXA 1WZOA 3QDFA 3UDCA 5D6YA 2EW3A 2H8HA 3M55A 4JLIA 4QT7A 4IURA 3DKMA 4M78D 4C8QC 4EMKC 1OPKA 2KMTA 1ZUYA 1HXDA 2L0AA 4MDXA 4RKUE 2DE0X 1YI2Q 2DAQA 2LJ3A 3QIIA 2HBPA 3EHRA 2EYZA 1WXUA 1ZBXA 4PJOA 4PJLA 1LCKA 3I56T 2ROLA 4LDYA 4M78A 4KH1B 2XDPA 3MP6A 4OF1A 1X75C 4XU2A 4XU0A 1XTDA 2P84A 2KEAA 1OI1A 1WXBA 2D8JA 3CBMA 2XG8D 4ESRA 3CCVT 2HMAA 4M7DF 3LYIA 1UG1A 1RLQC 2JVVA 2I0NA 1AHJB 2DZCA 4RG2A 1YN8A 2D6FA 1M90R 1U1TA 1KC8R 1MV3A 4M75B 3LGFA 2J6FA 1AWXA 3L42A 2EQJA 1HD3A 4JRIA 3VUZA 4OVAA 2YRVA 4J9FA 3CCST 1TUDA 1XQHA 2LVMA 1Z9QA 4IUPA 2DTIA 5HK3A 4PJMA 2PU9B 1VQPT 2L3SA 2KY9A 4KUDK 3TVTA 4C0GA 5LJ5d 1VQOT 1K73R 4WTOB 2PTKA 2XU8A 3VS7A 1MNEA 1KG1A 1WHHA 3PMTA 2GGRA 3OS1A 3PVLA 2C06A 3A8MB 3FDRA 3R6OA 2M0YA 4J6WA 4OMMA 1Y71A 1Y96B 3PE0A 3OQ5A 2DA9A 1RL2A 2XICA 1M5Q1 4IIMA 1LJOA 4ELZC 1RAHB 1YCYA 1J3TA 1Q86R 4E2FB 5KYWA 4PNOA 3VS2A 2RI3A 3OYHA 3EFSA 2RO0A 2PVOB 4OMFB 5CKBA 3CCEA 5GAMf 3NTKA 5GAMh 4EMGA 1WX6A 2DYIA 3H0HA 3X28B 2X4YA 1S72Q 2DFUA 3S3NA 2DETA 5FU6B 2DIGA 3JCMb 2FB7A 4OMNA 2EQKA 3CMEA 4A4EA 1I0CA 2ATCB 4KGVB 3CBOA 2XHCA 4XTVA 1FMWA 1MNDA 1FX7A 5HK0A 2K5FA 2QQ9A 2RK1A 1RI9A 4M77D 1VQKA 3E9FA 3BFMA 3CMAQ 1AT1B 1Q7YC 3F70A 1YWPA 3MCAB 2YRDA 1VUBA 3S3MA 1RABB 2D1XA 2LQ8A 2QAZA 4J9HA 3X25B 1VQ7T 3RR6A 1YITQ 2X35A 3CCMT 4RTTA 2NYSA 4C0ZA 4R56A 3DB4A 1VQPQ 3CC2Q 3LX7A 3ZL7C 4ELYC 1VQOQ 2QTVA 5CAIA 3CMET 5LJ5h 3CCVA 4PJOD 3A5ZB 4LUEA 1K8AU 5D6XA 2DM1A 4FT4A 5CKHA 2OTJT 1TH7A 2M02A 2RMOA 2A28A 4M75E 3KUFA 4V2SA 3H9NA 2E6ZA 4F7UG 3INZA 2JMCA 2RD1A 4F14A 1TTHB 3S3OA 1YBYA 3OYAA 3QUIA 4D6WA 3VS6A 3EG9A 2ZGWA 4M7DC 4XU3A 3TQ7P 5GAOm 2P4TA 2J05A 4C5EA 2EYXA 3OYYA 1E6HA 1VQ5T 1QVFA 1B07A 1R0BG 3FLGA 4OGEA 2PZ1A 2E5QA 1S72T 4F7UE 4HCKA 5IHNA 1WHJA 2QEXQ 2KGTA 4E7LA 1VQLQ 1ZSZB 3FEOA 1UHCA 4DA4A 1Q82U 3CD6A 1GFDA 2MI6A 2CH4W 1Q81U 1FMKA 1QWFA 2GNCA 4LDWA 1Z9ZA 4FYXB 1TU0B 1UGRB 2DTHA 1M1FA 1SPKA 5I2MA 1GXIE 1MMDA 2NLUA 5FU6C 1B34A 1YI2A 3MP8A 4CI0C 1BCOA 4VUBA 3L2ZA 1TS9A 1VQ5A 3JCMf 2QGGA 3M54A 4HCCA 1YITT 3CC4Q 3A8LB 1KK7A 1E6GA 4E47A 2V1QA 1GFCA 3OYGA 2EQUA 1CKAA 3VJPA 3CMEQ 1BYMA 1R77A 2HKQB 4XTWA 5LJ5e 5IHIA 5A2QE 2RJEA 4RTUA 3M53A 2WACA 1YJWQ 2OTJQ 1YITA 2R58A 3CCSA 1MV0B 2R5MA 3I55T 3EG3A 2FRYA 3KXTA 3SDZA 2JTEA 2YUPA 2PUOB 2RJDA 3QSUA 4II1A 2EGAA 1D1AA 3WVEB 3OYEA 2RJCA 5GANe 3OBYA 2K5LA 1M90C 2NWMA 2K79A 2K9GA 3GIBA 1SRMA 3V8JA 1VIFA 1X43A 3I56A 4LDVA 5FWBA 5KYYA 3TCJA 4J6XA 1NLOC 1TXQA 3CD6T 2JMAA 4F7UF 2JTMA 2K2VA 2G3RA 1C0MA 2E6NA 1VQ5Q 2W10A 2K7AA 3EFOB 2MK5A 3JCMg 2X4XA 2O31A 3E1SA 2CS7A 2QDLA 1K8AC 1RAGB 2HBWA 2YHTA 3GP8A 2JOYA 1UB4A 1T3SA 4OMQA 4C92C 2YUNA 3IQLA 2MOXA 1A0NB 1QWEA 4K11A 4IKFA 3PNWC 2EYYA 4FSXA 4E6RA 2HL3A 2GF7A 4RCBA 2KRNA 3GLXA 4B6MA 1WI7A 1WJSA 5FLXE 1JJ2A 2V8KA 5CO7A 1I8FA 5GAOn 2JS2A 1VQOA 2FEIA 3QHSA 2EKOA 3KFVA 3OSVA 1MMGA 2LMJA 1W2BS 2EQIA 4HA8A 1K9AA 1ZA1B 3MEVA 3EH2A 1HYOA 2KE9A 1MGQA 4E7ZA 1Q82C 2HZYA 1OU9A 2DL8A 3JSCA 5HCKA 1VQ8Q 2DK3A 1N9SA 2VGMA 3C12A 2M9UA 3HTRA 2PVDB 4XTZA 2HQHA 2BKDN 4A63B 2K4YA 1RAAB 5CQYA 1N8RU 1LOJA 4M4ZA 1H641 5GANf 5GANh 3L2RA 2CYZB 4IIOA 2AHJB 5LL6S 4OGCA 5EG2A 2X3XD 2KBTA 4PFZA 5GAOr 4BDYA 1ZQ1A 2EJFA 4EMHA 2Y90A 2LC4A 1M90U 4N4GA 3CPWS 1OQKA 3P8DA 1O9SA 1PSFA 3OB9A 4AMCA 5GANd 3OYBA 4NOYA 2MMPA 4C8QF 2A08A 4X9CA 1GL5A 2DBKA 4Y28E 4Z8AA 1M30A 1YJNA 1PKTA 2XIDA 4MZMA 3O8VA 3C94A 1PSEA 3CC7T 3HL8A 4M7AB 1GBQA 1M8MA 2LQWA 2MIOA 3JCMJ 4AFSC 2E5KA 1QCOA 3QXEB 1AD5A 1SSFA 1WA7A 3JB9H 2ABLA 4PJNA 1YIJQ 3GPLA 1VQ4T 1M8VA 3HRTA 2XI9A 3VYGA 3JCMd 2EGCA 4M75G 2VGNA 3C4SA 2G6FX 4B9WA 4RTYA 1JQQA 3SWNC 5DLQE 3OYLA 4C5GA 5KYXB 3CCLT 4C0FA 2MYSA 4Z02A 1QW1A 3CCRQ 2DYBA 1TOVA 3CCEQ 2MWOA 2LDMA 3DB3A 1WIEA 2KI7A 3CXCS 4BE0A 1QKXA 2OX7A 4E7KA 2E10A 2ZCFB 1ZBJA 1KSWA 1VQ9A 4PL6A 2EGEA 9ATCB 4M78C 4OMOA 2P0PA 2XDDA 2P4RA 2RN8A 2FPEA 1Q7YU 3MEAA 1LNXA 2SEMA 5IH2A 2A36A 3LH5A 1ABOA 1UTIA 3SB2A 3RBBB 4FU6A 3REBB 4LUDA 2LTOA 2O4XA 4X9DA 4MZTA 1EZZB 1WXTA 3EFOA 2XK0A 4QVZA 3OYKA 1ZUKA 1BB9A 1M1KC 2AZVA 2QEXA 1TUGB 4HVWA 1H8KA 4DBFA 3I9QA 3URGA 1QVGA 1VQ9Q 2CZ7B 1VYTA 1X27A 2KRMA 2DTOA 1X6GA 3CCVQ 1G3TA 1O75A 1VQNQ 2M16A 3I5RA 5IT9E 1GCQC 3DLMA 2IPOB 4C8QA 4EMKA 1UUEA 4C5HA 4HVUA 1YWOA 4JJBA 3M59A 2HAXA 4MZPA 4M7AE 1YIJT 4E7SA 1D1BA 4WF2A 3SWNB 1UEBA 4LXCA 4J83A 5GMKh 2QXFA 3CCSQ 2JT4A 2VXEA 2FG0A 3NGPA 1I4K1 3Q1JA 1VQKQ 3BDLA 3QWXX 1M2OA 3EHQA 4RTWA 3LGLA 4C0DC 3DLLA 4GLMA 3CCLQ 4AFUC 2X9HA 3AHUA 1CKBA 1KC8C 4PJOB 2RPNA 4N4IA 4F17A 1D3BA 1PKSA 2VB6A 1OV3A 1PM3A 4Z89A 5DLOA 4RTXA 5CK9A 1KHCA 3RIRA 1K0XA 1W2BA 1NYGA 1VQ4A 2BIVA 2MPXC 2RK2A 1RAIB 3OYDA 2XD0A 3OS0A 1YJ9T 4BY6C 1WJQA 4DQ2A 1IGUA 3M57A 1XJWB 2ZPHB 3RUXA 3RMSA 2FVUA 3V7SA 1S1NA 1W2BP 1TUCA 1N8RR 1N5ZA 4UC4A 1T0JA 2BZ8A 4M77E 3M56A 1OYXA 2KROA 4FCYA 2OTJA 3HRSA 4JZ4A 2KQWA 5DY9A 3MPUB 4Y92A 1U8RA 1VQ9T 3JCMe 5IHKA 1JXMA 3JCMV 1RADB 2BTTA 2DLPA 2X4JA 2JJ9A 1VQNT 1XNIA 2VV5A 4NS5A 4DBQA 2KK4A 4M77F 4M77C 1N27A 1M2VA 1YHQT 3EFRA 2J7IA 4HVVA 1NYFA 3BW1A 5KYNA 5FRNA 4HCBA 4CC3A 1YCSB 4DOWA 2QTXA 1KFZA 5DM7R 4M78E 2QA4T 4KGXB 2NUTB 2DMOA 3RKYA 2QDYB 1AVZC 2KNBB 4BE2A 2KSSA 5KCHA 3CC2T 2Z0WA 1QVGP 5CCAA 3NMZC 4C8QG 3M4YA 4PJOG 1VQ8A 3PGGA 3UT1A 4KRTA 2I2LA 3VU3C 1JRIA 5KYXA 3PT9A 2CUDA 5GJWB 2DIQA 4A54A 5ECAA 3NFCA 4WCIA 3CPWP 2NUZA 2LJ0A 2ENMA 1YJ9Q 3CXCP 2CP2A 3CEYA 5LJ3g 1MMNA 1GRIA 3CCUT 2A37A 4C8QB 4EMKB 4BI8B 1M3BA 3M9QA 3MEWA 1T3LA 5GMKj 2DZ9A 1IHWA 2L5QA 2VXFA 4M75F 1UHFA 2HQEA 5KYUB 2F2XA 1KD1U 1B3QA 5KYUA 3VS3A 4R55A 4CC2A 3NTHA 2D8HA 3CXCA 1Q81R 1Q86U 6AT1B 1SKUB 4M7DG 4PJJA 2RM4A 3JB9I 5KH6A 2YDLA 2CSIA 4M77B 4N0AC 3TSZA 1KD1C 2O88A 5LJ5g 2EPDA 1SHFA 3EGXA 2XKOC 1OULA 1WHGA 2AK5A 2F5KA 4C92B 3QPHA 5LJ3d 1P92A 2DPPB 4X1VA 1YHQQ 1QKWA 1V1CA 2LCLA 1PRMC 2EJ9A 1N6AA 5A0DA 2DD4A 1K76A 3CC7A 2RHZA 3C0CA 1EFNA 3CCLA 1IHVA 1X6OA 2OAUA 2F69A 1BKBA 3VS0A 2L3RA 4CRIA 3QYHB 1I1JA 1IB8A 3SFMA 2GQIA 3VKIA 5FU7B 1MHNA 3OYMA 1K9MC 5D7UA 1S72A 1BIAA 1D3BB 3NPFA 3VS4A 4GBQA 2OJ2A 2D0NA 4ZTJA 3JAME 1BI3A 3I55Q 1PHTA 4E7HA 4Y91A 1WYXA 1PWTA 4IUTA 3MJXA 3LWHA 4KGZB 1WQ7A 5HY6A 4IUUA 3CCQT 2BE9B 2HL5C 2YXYA 5LJ5f 4JRPA 2WSEE 2K3XA 1H92A 4HT9A 3HFNA 1W70A 2RQWA 5GAN2 3P8BB 3CCUQ 2CGHA 3A8GB 1W4SA 2K2MA 2NUPB 4N0AA 2JNGA 1QP3A 3PTAA 5KCOA 4M7DD 3JB9J 3T9NA 3HKSA 4LN2A 3X20B 2KYBA 5IAYA 2EFIA 2GTJA 2CT3A 1D1CA 2CP6A 2YLCA 1QVPA 4HT8A 2COYA 1LVKA 4RCCA 2P0KA 3QKJA 4GY5A 4JS4A 1VQMT 2B86A 3L2UA 1JJ2S 2M51A 1UGVA 2W0ZA 2ESWA 2EYWA 1M27C 4BI4A 5A0GA 1VQ6Q 4PJOE 4Z88A 4J9EA 2QQAA 1K8AR 3D7SB 2RQUA 5GMKl 1Y07A 2KXCA 4BB7A 3UPUA 3KBGA 3OSSC 1F1BB 1I5LA 3G1JA 2DERA 1MUZA 3ME9A 1ZX6A 3MHXA 2DBMA 4J9CA 1NZ9A 2CREA 2LQNA 2COZA 4XTXA 4JLGA 1U06A 1Y0MA 2ED1A 1JJ2P 1AOJA 3CCQA 5A0LA 2LCCA 2PNIA 4IUQA 3OY9A 4PK4A 4QQGA 3QDRB 3G4ST 4M7DB 2HDAA 4M75C 3P8HA 2DNUA 3CQTA 1G8XA 5KYYB 1U3OA 1NPPA 5L8RE 4F16A 2LNHB 1SEMA 4YTLA 5CR2A 3M0SA 1W6XA 3LW5E 2LNVA 2RHYA 2RB6A 2RHXA 5C0MA 1BCMA 3L1AA 2H3JA 1X2KA 3M0RA 2IVWA 5FROA 5GAMg 1EIFA 1IREB 4B9XA 1WPYA 1C1AA 1VQ7A 2CDTA 2KDSA 2LT1A 1M2VB 3WXMB 4XU1A 5GAOp 3FC3A 5CKDA 3CBPA 2KAFA 2VYTA 2EKHA 3V7RA 3A8HB 1E7OA 1BBZA 3SD4A 1NPRA 1VA7A 3OW2P 2D0QB 2RQTA 1UJ0A 3GNFB 1VQMQ 4XK8E 4J8OA 4PJOF 4FW1A 5GAOl 3MKDA 3WVDB 3TEEA 1RUWA 1OX9A 2HCKA 2X51A 4BDZA 1YJ9A 3JB9F 3TU4K 1OX8A 2ROTA 2DF6A 3MO8A 5GAMd 1BK2A 2RQVA 4C92G 2V26A 3RMQA 2K5IA 1M4ZA 3LH0A 1KC8U 2E1HA 2L89A 2L2PA 3JRZA 1VQ4Q 2QYZA 4JRKA 5FU7C 1XOVA 4PFPA 2GCXA 2YLBA 2FYKA 1M1GA 2FPFA 1NEBA 2ECZA 3BY7A 2NUTA 3BE3A 1PRLC 2CT4A 4LDXA 1Q81C 2JXBA 2DL7A 1R8OB 4L59A 2JM8A 3G4SQ 4M7DA 4RTZA 2A3LA 3G6ET 2D9TA 1VQNA 4PFOA 2ZPEB 1UECA 2ZPGB 1NJIR 2DXTA 3TREA
chains in the Genus database with same CATH topology
3OMGA 3VYHB 3INZA 2RD1A 3OYCA 3S3OA 1W2BA 1YBYA 4KBMB 3EAEA 3OYAA 3QUIA 2MF2A 4M77A 1WGSA 4D6WA 1VQ4A 3JCMh 2BIVA 2RK2A 3PIOA 2PUKB 2ZGWA 3OYDA 2XD0A 4M7DC 3OS0A 1YJ9T 2ZPBB 1WJQA 4BY6C 4DQ2A 3M57A 4BI3A 3QZ9B 4XU3A 2ZPHB 2QA4A 1KQ2A 2RHIA 3RUXA 1YIJA 5GAOm 3J7AF 2EQMA 2GFUA 4M7AG 2P4TA 4Q5WA 2FVUA 4TVRA 3RMSA 3V7SA 4C5EA 3QG1A 1IZ6A 2HQXA 4C92F 4M7AA 3CCJT 3OYYA 1UGQB 1VQ5T 4UC4A 4M77E 3M56A 3GNGA 1QVFA 2DJZA 4JUVA 3S6WA 1OYXA 3FLGA 1VQ6A 4M7AD 4OP0A 2OTJA 3HRSA 1YJWA 4OGEA 2E5QA 2KQWA 3FRNA 3RERA 4RMOA 5GAN3 4OB3B 4JS5A 4F7UE 1S72T 5DY9A 4ATOA 4E7LA 1Y7XA 3GF5A 1K73C 2Y4XA 1UGSB 2DKGA 1U8RA 5CKFA 1G5VA 3CMAA 3FEOA 3VUBA 4DA4A 1VQ9T 1Q82U 3JCMe 4QVCA 3CD6A 4M7AF 3JCMW 2DVEA 2DXBA 3JCMV 4C0DB 2MI6A 3M4GA 2X4JA 4X34A 2WSCE 5GAN7 1Q81U 2QQSA 4LDWA 4A53A 3CC4A 2EJGA 1VQNT 4GLKA 1XNIA 2VV5A 1UGRB 2DTHA 2P0QA 4NS5A 3LWIA 1M1FA 4JRQA 5GAOq 2KK4A 4MDWA 4M77F 5C6SA 4M77C 3MEUA 5I2MA 4M78G 1N27A 1GXIE 2NLUA 3GOXA 5FU6C 3JCMX 4LD9K 1YHQT 1B34A 1YI2A 3ZFJA 1K73U 3FJPA 3MP8A 3QJYA 4CI0C 3CCJA 2FL7A 3EFRA 4L5GA 5LJ3j 3JB9D 4VUBA 3L2ZA 2V8IA 1VQ5A 4ZGDB 3JCMf 3HFOA 5GANg 1NJIU 3BW1A 5FRNA 2EWNA 3M54A 4J5YA 5GMKi 3RKWA 4HCCA 4HCBA 1YITT 4MMKA 4O5VA 1FWZA 4DOWA 3PIPA 2HNIA 1KHIA 2QTXA 3A8LB 5CQXA 5DM7R 4M78E 4F7UB 2QA4T 4E7JA 1VQKT 3RKYA 4E47A 2MWPA 2QDYB 3PMIA 3OYGA 5I21A 3QJ6A 4BE2A 2KSSA 2EQUA 4A4KA 5KCHA 4ZTFA 3CC2T 3OYFA 4M78F 3OBWA 1H3ZA 2CZ6B 2RJFA 1KQ1A 4EPCA 3VJPA 5CCAA 2LX9A 2O4XB 4PLIA 1BYMA 2CZ1B 5LJ5e 2O01E 4XTWA 5A2QE 5J26A 3E19A 3M4YA 2RJEA 3C95A 3V8LA 4PJOG 4C92D 4C8QG 4ZGJB 3PGGA 1VQ8A 3M53A 2WACA 4JJNK 1VQ8T 2E12A 3UT1A 2I2LA 3VU3C 3OYJA 1YITA 1JRIA 2R58A 3CCSA 2R5MA 3RESA 3I55T 5GAN4 2IG0A 4BD3A 4C92E 3KXTA 3SDZA 3G7ZA 3M5AA 3PT9A 2PUOB 1B34B 2RJDA 3QSUA 4II1A 1G3WA 3WVEB 3OYEA 2DIQA 2JN0A 4A54A 1OZ2A 2RJCA 5GANe 3NFCA 2K5LA 3OBYA 2JZ2A 4KULA 4ME7A 5KE3A 4FIBA 1M90C 2HD0A 3ZEHA 3ER0A 3GIBA 3VV0A 2MAMA 3V8JA 3QO3A 4NL2A 4XTYA 1VIFA 3QZ5B 3CEYA 2E41A 5LJ3g 3L2VA 1QVGS 3CCUT 3I56A 4M78B 4C8QB 4LDVA 4EMKB 4BI8B 3TCJA 2A7YA 4J6XA 3CD6T 1YI2T 3M9QA 3MEWA 1G3YA 4F7UF 5GMKj 2JTMA 2DD5A 2DZ9A 2G3RA 2K2VA 1VQMA 2L5QA 2VXFA 2E6NA 3ASKA 4M75F 5LJ3f 4BUGA 2HQEA 5LJ3h 5GAN5 3BDUA 1N9RA 1KD1U 3JCMg 3SWNA 2X4XA 4LD6A 3E1SA 2KVQG 2CS7A 4R55A 3J81E 4QVDA 1K8AC 1JB0E 1WNLA 3NTHA 3CXCA 1Q86U 3X26B 3RIRA 3JCMc 4M7DG 3OA6A 2RI2A 2RM4A 2YHTA 3JB9I 5KH6A 3GP8A 2JOYA 3QYGB 3E9GA 1UB4A 5GANj 3OS5A 4M77B 2DEQA 4N0AC 4PLLA 1KD1C 5LJ5g 1QP2A 4A4HA 3CCRA 2GQVA 4ZGEB 4C92C 2XKOC 1BI0A 4MMLA 2E65A 2F5KA 2M0OA 4C92B 4OB1B 4IKFA 2FHDA 3PNWC 3QPHA 4FSXA 5LJ3d 1P92A 2DPPB 2GF7A 4RCBA 3A8OB 2EIFA 1BIBA 3HP9A 5GMKe 3GLXA 1NE8A 3X24B 2LCLA 1G3SA 3J80E 2EJ9A 4QW2A 1K9MU 4KT0E 1WJSA 1N6AA 5A0DA 5FLXE 1JJ2A 5M9OA 2V8KA 4N4HA 5CO7A 3OW2S 2DD4A 3CC7A 1I8FA 2RHZA 5GAOn 2X4WA 1VQOA 2RI5A 1X01A 3CCLA 3QHSA 5CIUA 2EKOA 4C8QE 1X6OA 2R5AA 3OSVA 2CZ0B 2E70A 2OAUA 2F69A 2RA2A 4IUVA 1BKBA 1YHQA 1W2BS 4HA8A 2L3RA 2ZPIB 4CRIA 3QYHB 5LJ3e 2E64A 3L2WA 5GAN6 2XDBA 3N5BB 3SFMA 1JBMA 3FB9A 3H6ZA 3MEVA 4QQ6A 5FU7B 1MHNA 1ZHIA 3HHTB 5IN1A 1MGQA 3VKIA 1Q82C 2PVGB 3OYMA 3CCRT 1K9MC 2BUDA 3CCET 1S72A 2R57A 3JSCA 1BIAA 1D3BB 4DOVA 4BACA 3FIFA 2F5TX 3HSBA 2ZPFB 3PFSA 2DK3A 1N9SA 1BI3A 2VGMA 5CVIA 3C12A 2M9UA 5D6WA 2PVDB 3JAME 4XTZA 2BKDN 4E7HA 4Y91A 2K4YA 5CKEA 4IUTA 4ZN3A 3H8ZA 5CQYA 1Y96A 3LWHA 1YJNT 1KQSA 3RKXA 1WQ7A 5HY6A 1N8RU 1LOJA 4IUUA 3UDCA 5D6YA 3CCQT 1H641 5GANf 3JB9G 5GANh 3L2RA 2CYZB 3M55A 5LJ5f 4JLIA 4JRPA 4M77G 2AHJB 2WSEE 4IURA 5J3BA 2K3XA 3UWNA 3I55A 3DKMA 4M78D 5LL6S 4C8QC 4EMKC 4OGCA 4HT9A 2KMTA 3HFNA 5EG2A 5GAN2 3P8BB 3LLRA 4C92A 2CGHA 1HXDA 3A8GB 5GAOr 5GAN8 3CCUA 4BDYA 1W4SA 4MDXA 1ZQ1A 4N0AA 2EJFA 4RKUE 2JNGA 2Y90A 2LC4A 4QQDA 1QP3A 4EMHA 4N4GA 3CPWS 3CCMA 2DAQA 1M90U 3QIIA 2HBPA 3P8DA 1ZBXA 5KCOA 3PTAA 4M7DD 4PJOA 3JB9J 3T9NA 4C5IA 3HKSA 1O9SA 3X20B 5IAYA 1PSFA 2RH2A 2EFIA 3OB9A 4JDSA 1BI2A 4LDYA 4M78A 3OYIA 3I56T 5GANd 2CKKA 2YLCA 3OYBA 2XDPA 3CC2A 4M7DE 4NOYA 3ZBDA 2MMPA 1QVPA 4HT8A 4C8QF 3MP6A 4OF1A 4RCCA 2P0KA 3QKJA 4X9CA 3V7CA 1X75C 4GY5A 4XU2A 4Y28E 4JS4A 4XU0A 1KQSS 1VQMT 1YJNA 1XTDA 4KUIA 2QI2A 3L2UA 2XIDA 4MZMA 1OI1A 3O8VA 3C94A 1PSEA 1JJ2S 3CC7T 3HL8A 3CBMA 2XG8D 4M7AB 3CCVT 4M7DF 5FRMA 4BI4A 5A0GA 3NTIA 1V29B 3LYIA 3CPWA 4PJOE 3JCMJ 2JVVA 1AHJB 5AYFA 2QQAA 2DZCA 2QQBA 3M58A 4HKEA 5GMKl 1Y07A 1DJ7B 3QXEB 1SSFA 3OW2A 4BB7A 4RG2A 3UPUA 3KBGA 3OSSC 4NL3A 2D6FA 4RG8A 1I5LA 2OTLT 3JB9H 1U1TA 4OB0B 5GAMj 3CMAT 3ME9A 4M75B 3GPLA 5I2SA 3LGFA 3MHXA 1VQ4T 1M8VA 3HRTA 3L42A 1NZ9A 2EQJA 4JRIA 3VUZA 4OVAA 2XI9A 4LDUA 3VYGA 2YRVA 5LJ5j 3JCMd 3CCST 3G71A 4ZTJA 1VIEA 3HPWA 4XTXA 1XQHA 2LVMA 4JLGA 4M75G 4IUPA 2VGNA 2K57A 2DTIA 5HK3A 3C4SA 4ZN1A 4B9WA 2PU9B 3QBYA 1VQPT 2JUFA 4M7AC 3SWNC 2KY9A 5DLQE 5A0LA 2ZZDA 3OYLA 3CCQA 4C0GA 2LCCA 4C5GA 4KUDK 4PKCC 4IUQA 2OTLA 5LJ5d 2PQWA 3OY9A 4C0FA 3CCLT 1VQOT 4Z02A 1QW1A 4QQGA 3QDRB 3G4ST 2MWOA 2LDMA 4M7DB 3DB3A 3P8HA 4M75C 2XU8A 4F7UA 1KG1A 2LT4A 3PMTA 3CXCS 3OS1A 2C06A 4PJOC 3A8MB 3G71T 3FDRA 1QVFS 1NPPA 5L8RE 4BE0A 3R6OA 4YTLA 5J39A 5HKCA 5CR2A 1VQLA 4J6WA 4E7KA 2E10A 2ZCFB 1I81A 1Y71A 1Y96B 2QQRA 4FT2A 2B8AA 4BE1A 3JCMP 1VQ9A 4EDUA 3OQ5A 4PL6A 3JCMQ 1RL2A 2XICA 5GMKm 1M5Q1 2LNVA 1LJOA 2RHYA 3LW5E 2P0PA 2RB6A 4M78C 4ELZC 2RHXA 4XAXB 1YCYA 5C0MA 2XDDA 1NJIC 3L1AA 2H3JA 3OS2A 1Q7YU 3MEAA 2GFAA 2RHUA 1LNXA 2IVWA 5FROA 5GAMg 4PNOA 1EIFA 1IREB 4B9XA 1WPYA 4A4FA 2RI3A 1VQ7A 3OYHA 4XTUA 1OZ3A 1RI0A 2V8JA 1BI1A 2KDSA 3HRUA 2LT1A 3SB2A 4FU6A 4L6V5 3EFSA 3WXMB 3META 4XU1A 2RO0A 5GAOp 1WQWA 2M1HA 2LTOA 2O4XA 2PVOB 4OMFB 3FC3A 5CKDA 5CKBA 3V8KA 3CCEA 5GAMf 3G4SA 3NTKA 4X9DA 4MZTA 5GAMh 4EMGA 3CBPA 4J7FA 2LQKA 2XK0A 4QVZA 2KAFA 2VYTA 3OYKA 1M1KC 3V7RA 3X28B 3A8HB 2X4YA 5KE2A 2LRQA 2QEXA 3SD4A 4J6YA 1NPRA 2QEXT 1VQLT 3S3NA 2D0QB 2DXCA 4A4GA 1Q86C 2JTFA 3GNFB 1M9SA 5FU6B 3URGA 4XK8E 1QVGA 4J8OA 3L2QA 2EAYA 2DIGA 4PJOF 2CZ7B 3JCMb 1U1SA 2FB7A 5GAOl 3CMEA 2EQKA 3WVDB 2DTOA 3TEEA 3TREA 4A4EA 3MP1A 1G3TA 1O75A 3CBOA 2M16A 2DO3A 2XHCA 4XTVA 4BDZA 5IT9E 1YJ9A 2EYQA 1VQ6T 3JB9F 3TU4K 3DLMA 1FX7A 4C8QA 4EMKA 4C5HA 5HK0A 3MO8A 2K5FA 2QQ9A 5GAMd 1FXXA 4E7IA 2L8DA 1VQPA 2RK1A 1N8RC 3M59A 4M77D 1VQKA 2HAXA 4MZPA 4C8QD 4C92G 3RMQA 2K5IA 1M4ZA 3E9FA 3BFMA 3LH0A 1KC8U 4M7AE 2E1HA 1YIJT 1Q7YC 3F70A 2L89A 4M75A 3JRZA 3MCAB 4J7IA 1VUBA 4JRKA 4WF2A 1UEBA 3SWNB 5GMKh 4J83A 2LQ8A 3S3MA 2QXFA 3X25B 5FU7C 1VQ7T 1XOVA 4XQ3A 4HCZA 4FM4B 2VUBA 4O6JA 2GCXA 1M1KU 2VXEA 2YLBA 1WJRA 2FYKA 1M1GA 4OB2B 3CC4T 2Y4YA 2X35A 3CCMT 1UGPB 1I4K1 3G6EA 3BY7A 3Q1JA 3CPFA 3BDLA 4C0ZA 4R56A 3DB4A 4P5NA 3OMCA 4FL6A 2DXUA 4LDXA 1Q81C 3LX7A 5GAMe 3LGLA 4ELYC 4C0DC 3DLLA 5CAIA 1R8OB 4M75D 3AHUA 3CMET 1KC8C 4L59A 4BY6B 5LJ5h 4PJOB 4N4IA 3CCVA 4M7DA 4PJOD 3A5ZB 2A3LA 3G6ET 2D9TA 1K8AU 1D3BA 5D6XA 1YJWT 4FT4A 5CKHA 1VQNA 3OYNA 1TH7A 2WSFE 2OTJT 2K3YA 2VC8A 4M75E 2ZPEB 2ZPGB 3KUFA 1HK9A 4V2SA 5DLOA 2E6ZA 2DXTA 5CK9A 4F7UG 1KHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6W A;  2E10 A;  3INZ A;  2RD1 A;  1B34 B;  1I81 A;  1Y96 A;  3QSU A;  1Y96 B;  3RKX A;  1WQ7 A;  3JCM P;  1LOJ A;  2JN0 A;  4A54 A;  3QUI A;  4M77 A;  1H64 1;  3JCM Q;  5GAN e;  5GAN f;  3JB9 G;  5GAN h;  3JCM h;  5GMK m;  4JLI A;  1M5Q 1;  4M78 C;  1LJO A;  5LJ5 f;  2RB6 A;  2ZGW A;  4M77 G;  1YCY A;  3GIB A;  3L1A A;  3V8J A;  4M78 D;  4M7D C;  3QO3 A;  4NL2 A;  4C8Q C;  4EMK C;  4XTY A;  4DQ2 A;  3HFN A;  4HT9 A;  1LNX A;  2E41 A;  5LJ3 g;  4PNO A;  4C92 A;  5GAM g;  5GAN 2;  4XU3 A;  2CGH A;  1KQ2 A;  1HXD A;  5GAO r;  4M78 B;  1WPY A;  3RUX A;  4C8Q B;  4EMK B;  4XTU A;  5GAO m;  4N0A A;  2EJF A;  4J6X A;  2Y90 A;  3SB2 A;  4EMH A;  4M7A G;  3V7S A;  3EFS A;  4F7U F;  5GMK j;  4C92 F;  2DZ9 A;  4XU1 A;  5GAO p;  4M7A A;  1WQW A;  2VXF A;  4M7D D;  3JB9 J;  4PJO A;  3V8K A;  4M75 F;  5LJ3 f;  5GAM f;  4M77 E;  4X9D A;  5LJ3 h;  5GAM h;  4EMG A;  5GAN 5;  2DJZ A;  3BDU A;  4JUV A;  1N9R A;  3JCM g;  3SWN A;  4M7A D;  4M78 A;  4OP0 A;  5GAN d;  2YLC A;  4QVD A;  3RER A;  4M7D E;  3V7R A;  1WNL A;  4NOY A;  5GAN 3;  4M7D G;  3JCM c;  4F7U E;  4HT8 A;  4J6Y A;  4C8Q F;  4X9C A;  4RCC A;  3V7C A;  5DY9 A;  4XU2 A;  4Y91 A;  2RM4 A;  2YHT A;  4XU0 A;  3JB9 I;  2DKG A;  2EAY A;  5GAN j;  4PJO F;  4M77 B;  2DEQ A;  4N0A C;  3JCM e;  4QVC A;  3JCM b;  1U1S A;  2DVE A;  2FB7 A;  3JCM V;  5LJ5 g;  3JCM W;  4M7A F;  5GAO l;  2DTO A;  3M4G A;  4C92 C;  4M7A B;  5GAN 7;  4MML A;  4A53 A;  4M7D F;  2EJG A;  2E65 A;  4XTV A;  4C92 B;  3JB9 F;  4PJO E;  2DTH A;  3JCM J;  4C8Q A;  4EMK A;  5GAO q;  5LJ3 d;  5GAM d;  2DZC A;  4M77 F;  4M77 C;  4M78 G;  5GMK l;  4RCB A;  1BIB A;  5GMK e;  3JCM X;  4M77 D;  4C8Q D;  1B34 A;  4C92 G;  4NL3 A;  1I5L A;  3FJP A;  3BFM A;  2EJ9 A;  3JB9 H;  1U1T A;  3EFR A;  5LJ3 j;  5GAM j;  3JB9 D;  4M7A E;  4M75 B;  2E1H A;  3L2Z A;  4M75 A;  3JCM f;  1M8V A;  4JRK A;  3HFO A;  4WF2 A;  3SWN B;  3BW1 A;  1I8F A;  4JRI A;  2EWN A;  5GMK h;  5GAN g;  4J5Y A;  5GMK i;  3JCM d;  3RKW A;  5LJ5 j;  4XQ3 A;  5GAO n;  1X01 A;  3QHS A;  4MMK A;  4C8Q E;  2VXE A;  2YLB A;  2FYK A;  4XTX A;  2HNI A;  2QTX A;  4M75 G;  1I4K 1;  2K57 A;  2RA2 A;  2DTI A;  3BY7 A;  4M78 E;  4F7U B;  4HA8 A;  3RKY A;  2DXU A;  5I21 A;  4M7A C;  3SWN C;  5GAM e;  2E64 A;  4M78 F;  5GAN 6;  5LJ3 e;  1JBM A;  3FB9 A;  5LJ5 d;  1MGQ A;  1KQ1 A;  4M75 D;  5CAI A;  3AHU A;  4PJO B;  5LJ5 h;  4M7D B;  5LJ5 e;  4XTW A;  4M7D A;  4PJO D;  3V8L A;  4C92 D;  4C8Q G;  1BIA A;  4M75 C;  5GAN 8;  1D3B B;  4PJO G;  4F7U A;  1D3B A;  3FIF A;  3PGG A;  3HSB A;  4PJO C;  1TH7 A;  2I2L A;  3VU3 C;  2VC8 A;  1JRI A;  4M75 E;  1N9S A;  3RES A;  1HK9 A;  5GAN 4;  4V2S A;  4XTZ A;  4C92 E;  2DXT A;  4F7U G;  3RIR A; 
#chains in the Genus database with same CATH topology
 3OMG A;  1SHG A;  3VYH B;  2CP7 A;  4D8K A;  3U23 A;  4KBM B;  3EAE A;  1VYU A;  4M77 A;  1QVF P;  1QLY A;  1QMC A;  4FYY B;  2ZPB B;  3UA7 A;  1JEG A;  4BI3 A;  3QZ9 B;  2QA4 A;  3H0I A;  2GFU A;  4M7A G;  4Q5W A;  4TVR A;  4ZNX A;  3QG1 A;  4C92 F;  4F04 B;  3CCJ T;  1UGQ B;  1QCF A;  1TWB A;  1I5O B;  4AG2 C;  2O2O A;  1RLP C;  1VQ6 A;  4M7A D;  2GBQ A;  4OP0 A;  3FRN A;  4OB3 B;  4JS5 A;  5I22 A;  1V76 A;  1Y7X A;  2J6K A;  2Y4X A;  1OPL A;  1UGS B;  1G5V A;  3CMA A;  2YUQ A;  4QVC A;  3JCM W;  1OOT A;  2BZX A;  1M3A A;  5GAN 7;  2QQS A;  2EJG A;  2LZ6 B;  2P0Q A;  5GAO q;  1UFF A;  5C6S A;  2FZG B;  3MEU A;  4M78 G;  3JV3 A;  3GOX A;  2OAW A;  3JCM X;  2EVR A;  4KH0 B;  3ZFJ A;  1K73 U;  2FL7 A;  5LJ3 j;  2A0F B;  4L5G A;  1ZSZ C;  4JPB W;  3HFO A;  5GAN g;  1NJI U;  1NM7 A;  2EWN A;  5GMK i;  2FPD A;  1FWZ A;  3PIP A;  2HNI A;  5CQX A;  1VOM A;  4F7U B;  1VQK T;  4E7J A;  3PVQ A;  2MWP A;  1KIK A;  3PMI A;  1WDX A;  4A4K A;  2AZS A;  2CZ6 B;  2RJF A;  4EPC A;  2O4X B;  2CZ1 B;  8ATC B;  1Q7Y R;  3V8L A;  4C92 D;  4ZGJ B;  3G6E Q;  2E12 A;  3VRY A;  4D8D A;  2XMF A;  2IG0 A;  4BD3 A;  3M5A A;  3TSW A;  1K1Z A;  1YJN Q;  1G3W A;  2H3E B;  5FW9 A;  1U5S A;  2JN0 A;  2KT8 A;  1OZ2 A;  2JZ2 A;  4ME7 A;  2HD0 A;  3ZEH A;  3ER0 A;  2MAM A;  4AFQ C;  3QO3 A;  4NL2 A;  4XTY A;  2O9V A;  3QZ5 B;  2E41 A;  1QVG S;  4M78 B;  2DIL A;  2E3H A;  1PG5 B;  1G3Y A;  3ASK A;  1LPL A;  5GAN 5;  1N9R A;  3NHN A;  3SWN A;  4LD6 A;  2KVQ G;  3J81 E;  4QVD A;  3AT1 B;  1WNL A;  1YFN A;  1ABQ A;  2HSE B;  3OA6 A;  1PD0 A;  2VWF A;  1HSQ A;  1T0H A;  2DEQ A;  4PLL A;  1QP2 A;  4A4H A;  2GQV A;  5EC7 A;  1AWO A;  1BI0 A;  4MML A;  2J06 A;  2E65 A;  2M0O A;  4OB1 B;  1AZG B;  1IGQ A;  2AKK A;  2E4H A;  1Q82 R;  1BIB A;  5GMK e;  2X3W D;  1NE8 A;  3X24 B;  1G3S A;  3R6N A;  4QW2 A;  1K9M U;  4KT0 E;  3I5S A;  2GTO A;  4QKU A;  3UF4 A;  2O9S A;  2RI5 A;  2K6D A;  2R5A A;  2CZ0 B;  2E70 A;  2RNA A;  4IUV A;  2QA4 Q;  2ZPI B;  2LX7 A;  2YT6 A;  4R0K A;  2E64 A;  5LJ3 e;  1JBM A;  4QQ6 A;  3HHT B;  1ZHI A;  2BUD A;  3M0Q A;  2DL3 A;  4DOV A;  1KQS P;  2F5T X;  2CP5 A;  4FYW B;  3G71 Q;  1RAE B;  4RUG A;  5D6W A;  5CVI A;  1NLP C;  2YWW A;  1D0Z A;  4FW2 A;  5CKE A;  4JJD A;  2E3I A;  1I07 A;  2FZC B;  2YRC A;  1D0Y A;  4EIK A;  3JB9 G;  3E2U A;  2QG9 B;  2QK0 A;  1ARK A;  4M77 G;  1ZSG A;  5J3B A;  3UWN A;  3I55 A;  1M1K R;  1C6V X;  3SEM A;  1VYV A;  1ZA2 B;  3LLR A;  4C92 A;  2SRC A;  3CCU A;  4LNP A;  4QQD A;  3CCM A;  1CSK A;  4C5I A;  1YP5 A;  2JS0 A;  2RH2 A;  3OYI A;  4JDS A;  1BI2 A;  3THK A;  2CKK A;  4M7D E;  3CC2 A;  3ZBD A;  2HEQ A;  3V7C A;  2DL4 A;  1KQS S;  2IIM A;  3RDV A;  4KUI A;  2EBP A;  1JO8 A;  1SRL A;  2QI2 A;  3GBQ A;  3EG9 B;  1FYN A;  5FRM A;  3NTI A;  1V29 B;  3CPW A;  5AYF A;  2F2W A;  1GBR A;  2QQB A;  3EG2 A;  3M58 A;  4HKE A;  2L3P A;  1DJ7 B;  4CC4 B;  8AT1 B;  3OW2 A;  4NL3 A;  3M0P A;  4RG8 A;  2OTL T;  3EG1 A;  4OB0 B;  5GAM j;  3CMA T;  5I2S A;  1X69 A;  1VQ7 Q;  4LDU A;  5LJ5 j;  4DBR A;  3G71 A;  1VIE A;  3HPW A;  3CCM Q;  1HJD A;  4OML A;  2K57 A;  3A98 A;  1AEY A;  4ZN1 A;  3REA B;  3QBY A;  2JUF A;  1BU1 A;  1PCX A;  4M7A C;  2ZZD A;  4PKC C;  2OTL A;  2PQW A;  4CC7 A;  2VAS A;  4F7U A;  1PC0 A;  2LT4 A;  2ED0 A;  4PJO C;  1ZUU A;  3G71 T;  1QVF S;  3H0F A;  1X2Q A;  5J39 A;  5HKC A;  1VQL A;  3EGD A;  1IXD A;  1Q95 G;  1I81 A;  4LE9 A;  1NEG A;  4FT2 A;  2QQR A;  4BE1 A;  2B8A A;  3JCM P;  1WFW A;  1MMA A;  4EDU A;  2KR3 A;  3CCQ Q;  3EG0 A;  3JCM Q;  4J9G A;  5GMK m;  2FO0 A;  4XAX B;  1NJI C;  3OS2 A;  2GFA A;  2RHU A;  4FYV B;  2OI3 A;  4A4F A;  4XTU A;  1OZ3 A;  2VVK A;  1RI0 A;  2V8J A;  1BI1 A;  3HRU A;  1ACM B;  1SSH A;  4L6V 5;  3MET A;  3EGX B;  1WQW A;  2M1H A;  3V8K A;  3G4S A;  4J7F A;  2LQK A;  5FWC A;  4AG1 C;  1X6B A;  5KE2 A;  2LRQ A;  4J6Y A;  2DRK A;  2QEX T;  1VQL T;  1Q86 C;  2DXC A;  4A4G A;  2JTF A;  1M9S A;  3L2Q A;  2EAY A;  2YSQ A;  4AT1 B;  1U1S A;  1QCN A;  3MP1 A;  2DO3 A;  2DL5 A;  1VQ6 T;  2EYQ A;  1IO6 A;  4E7I A;  1FXX A;  2C0T A;  2L8D A;  1VQP A;  4C8Q D;  2OTL Q;  1B7T A;  2CH4 A;  5L23 A;  4FSS A;  1WHL A;  4M75 A;  5GJV B;  4J7I A;  5AT1 B;  1RAF B;  3H41 A;  3VS5 A;  4XQ3 A;  4HCZ A;  4FM4 B;  2VUB A;  4O6J A;  1M1K U;  1WJR A;  1QQJ A;  3CC4 T;  4OB2 B;  2Y4Y A;  1UGP B;  3G6E A;  2LJ1 A;  3CPF A;  4P5N A;  3OMC A;  4FL6 A;  2DXU A;  2HKN A;  5GAM e;  1WLP B;  4M75 D;  4BY6 B;  2DJQ A;  1UE9 A;  3ULR B;  3M0T A;  1YJW T;  3OYN A;  2WSF E;  2K3Y A;  2VC8 A;  1HK9 A;  2FZK B;  2YUO A;  1N8R C;  3OYC A;  2MF2 A;  1UJY A;  1WGS A;  3JCM h;  3PIO A;  1IRX A;  2PUK B;  2KT1 A;  2QAS A;  2JM9 A;  1G2B A;  1KQ2 A;  2V1R A;  2BE7 D;  2RHI A;  1YIJ A;  3J7A F;  2EQM A;  2KRS A;  3VRZ A;  4OMP A;  3CD6 Q;  1JU5 C;  1IZ6 A;  7AT1 B;  2HQX A;  4M7A A;  2L3Q A;  3GNG A;  2DJZ A;  4JUV A;  3S6W A;  2C0O A;  1YJW A;  3RER A;  4RMO A;  5GAN 3;  4ATO A;  1K0S A;  1TSF A;  3GF5 A;  1K73 C;  2DKG A;  2VKN A;  5CKF A;  1TG0 A;  3VUB A;  3EGU A;  1W1F A;  3VS1 A;  4M7A F;  2DVE A;  2DXB A;  4C0D B;  3M4G A;  4RTV A;  4X34 A;  2WSC E;  1NBE B;  2JW4 A;  4A53 A;  3CC4 A;  4GLK A;  5KYW B;  1D0X A;  2J6O A;  3LWI A;  4JRQ A;  4MDW A;  2DX1 A;  2LCS A;  4LD9 K;  3I35 A;  3FJP A;  3EGD B;  3QJY A;  3CCJ A;  3A1P A;  3JB9 D;  1K9M R;  2V8I A;  1SF9 A;  4ZGD B;  4J5Y A;  3RKW A;  4MMK A;  4O5V A;  2DRM A;  1JXO A;  1KHI A;  4DBH A;  1KD1 R;  2COW A;  3QJ6 A;  5I21 A;  4ZTF A;  5I11 A;  3OYF A;  4M78 F;  3OBW A;  1Y57 A;  1H3Z A;  1KQ1 A;  2LX9 A;  4PLI A;  2CP0 A;  2O01 E;  5J26 A;  3E19 A;  5GAN 8;  3C95 A;  4J9D A;  4JJN K;  2RF0 A;  1VQ8 T;  3OYJ A;  1RAC B;  3QWY A;  3RES A;  5GAN 4;  4C92 E;  3G7Z A;  4HXJ A;  1AWJ A;  1B34 B;  1WHM A;  1OEB A;  2CP3 A;  4KUL A;  2AKL A;  2KXD A;  4FIB A;  5KE3 A;  2DVJ A;  2C0I A;  3VV0 A;  1M3C A;  4AFZ C;  3L2V A;  2QGF B;  1KJW A;  2BZY A;  4ORZ A;  1G83 A;  2A7Y A;  3SHW A;  1GCQ A;  1YI2 T;  1UDL A;  2DD5 A;  2RQR A;  4JZ3 A;  3CCJ Q;  1VQM A;  4J9I A;  1WHK A;  5LJ3 f;  4BUG A;  5LJ3 h;  2CUB A;  3BDU A;  3I56 Q;  2K3B A;  1AWW A;  1JB0 E;  3X26 B;  3JCM c;  2KYM A;  1OU8 A;  2RI2 A;  2CSQ A;  3QYG B;  1ZSZ A;  3E9G A;  3UA6 A;  5GAN j;  2NUP A;  3OS5 A;  2F2V A;  2AIR B;  2F1L A;  3CCR A;  1EX4 A;  3CC7 Q;  4ZGE B;  1PNJ A;  2AT1 B;  2FHD A;  1AZE A;  2HSP A;  4ANJ A;  3UAT A;  1FMV A;  3A8O B;  2EIF A;  3HP9 A;  4DEX A;  5IXF A;  3J80 E;  1ZLM A;  3FJ5 A;  1D09 B;  5M9O A;  4J9B A;  4N4H A;  3OW2 S;  1SG5 A;  2X4W A;  1X01 A;  5CIU A;  4C8Q E;  4DEY A;  1NG2 A;  2RA2 A;  1YHQ A;  1GCP A;  2MCN A;  3L2W A;  1R0C B;  2XDB A;  5GAN 6;  3N5B B;  3FB9 A;  3H6Z A;  1YNZ A;  3O5Z A;  1PD1 A;  5IN1 A;  2PVG B;  1K4U S;  3CCR T;  3CCE T;  1H3H A;  3RNJ A;  2R57 A;  2ZAE A;  4BAC A;  3FIF A;  2FRW A;  2DEU A;  3HSB A;  2ZPF B;  4JJC A;  3PFS A;  3EH1 A;  5IXB A;  3M0U A;  2LP5 A;  4ZN3 A;  3H8Z A;  1Y96 A;  1YJN T;  1KQS A;  3RKX A;  1WZO A;  3QDF A;  3UDC A;  5D6Y A;  2EW3 A;  2H8H A;  3M55 A;  4JLI A;  4QT7 A;  4IUR A;  3DKM A;  4M78 D;  4C8Q C;  4EMK C;  1OPK A;  2KMT A;  1ZUY A;  1HXD A;  2L0A A;  4MDX A;  4RKU E;  2DE0 X;  1YI2 Q;  2DAQ A;  2LJ3 A;  3QII A;  2HBP A;  3EHR A;  2EYZ A;  1WXU A;  1ZBX A;  4PJO A;  4PJL A;  1LCK A;  3I56 T;  2ROL A;  4LDY A;  4M78 A;  4KH1 B;  2XDP A;  3MP6 A;  4OF1 A;  1X75 C;  4XU2 A;  4XU0 A;  1XTD A;  2P84 A;  2KEA A;  1OI1 A;  1WXB A;  2D8J A;  3CBM A;  2XG8 D;  4ESR A;  3CCV T;  2HMA A;  4M7D F;  3LYI A;  1UG1 A;  1RLQ C;  2JVV A;  2I0N A;  1AHJ B;  2DZC A;  4RG2 A;  1YN8 A;  2D6F A;  1M90 R;  1U1T A;  1KC8 R;  1MV3 A;  4M75 B;  3LGF A;  2J6F A;  1AWX A;  3L42 A;  2EQJ A;  1HD3 A;  4JRI A;  3VUZ A;  4OVA A;  2YRV A;  4J9F A;  3CCS T;  1TUD A;  1XQH A;  2LVM A;  1Z9Q A;  4IUP A;  2DTI A;  5HK3 A;  4PJM A;  2PU9 B;  1VQP T;  2L3S A;  2KY9 A;  4KUD K;  3TVT A;  4C0G A;  5LJ5 d;  1VQO T;  1K73 R;  4WTO B;  2PTK A;  2XU8 A;  3VS7 A;  1MNE A;  1KG1 A;  1WHH A;  3PMT A;  2GGR A;  3OS1 A;  3PVL A;  2C06 A;  3A8M B;  3FDR A;  3R6O A;  2M0Y A;  4J6W A;  4OMM A;  1Y71 A;  1Y96 B;  3PE0 A;  3OQ5 A;  2DA9 A;  1RL2 A;  2XIC A;  1M5Q 1;  4IIM A;  1LJO A;  4ELZ C;  1RAH B;  1YCY A;  1J3T A;  1Q86 R;  4E2F B;  5KYW A;  4PNO A;  3VS2 A;  2RI3 A;  3OYH A;  3EFS A;  2RO0 A;  2PVO B;  4OMF B;  5CKB A;  3CCE A;  5GAM f;  3NTK A;  5GAM h;  4EMG A;  1WX6 A;  2DYI A;  3H0H A;  3X28 B;  2X4Y A;  1S72 Q;  2DFU A;  3S3N A;  2DET A;  5FU6 B;  2DIG A;  3JCM b;  2FB7 A;  4OMN A;  2EQK A;  3CME A;  4A4E A;  1I0C A;  2ATC B;  4KGV B;  3CBO A;  2XHC A;  4XTV A;  1FMW A;  1MND A;  1FX7 A;  5HK0 A;  2K5F A;  2QQ9 A;  2RK1 A;  1RI9 A;  4M77 D;  1VQK A;  3E9F A;  3BFM A;  3CMA Q;  1AT1 B;  1Q7Y C;  3F70 A;  1YWP A;  3MCA B;  2YRD A;  1VUB A;  3S3M A;  1RAB B;  2D1X A;  2LQ8 A;  2QAZ A;  4J9H A;  3X25 B;  1VQ7 T;  3RR6 A;  1YIT Q;  2X35 A;  3CCM T;  4RTT A;  2NYS A;  4C0Z A;  4R56 A;  3DB4 A;  1VQP Q;  3CC2 Q;  3LX7 A;  3ZL7 C;  4ELY C;  1VQO Q;  2QTV A;  5CAI A;  3CME T;  5LJ5 h;  3CCV A;  4PJO D;  3A5Z B;  4LUE A;  1K8A U;  5D6X A;  2DM1 A;  4FT4 A;  5CKH A;  2OTJ T;  1TH7 A;  2M02 A;  2RMO A;  2A28 A;  4M75 E;  3KUF A;  4V2S A;  3H9N A;  2E6Z A;  4F7U G;  3INZ A;  2JMC A;  2RD1 A;  4F14 A;  1TTH B;  3S3O A;  1YBY A;  3OYA A;  3QUI A;  4D6W A;  3VS6 A;  3EG9 A;  2ZGW A;  4M7D C;  4XU3 A;  3TQ7 P;  5GAO m;  2P4T A;  2J05 A;  4C5E A;  2EYX A;  3OYY A;  1E6H A;  1VQ5 T;  1QVF A;  1B07 A;  1R0B G;  3FLG A;  4OGE A;  2PZ1 A;  2E5Q A;  1S72 T;  4F7U E;  4HCK A;  5IHN A;  1WHJ A;  2QEX Q;  2KGT A;  4E7L A;  1VQL Q;  1ZSZ B;  3FEO A;  1UHC A;  4DA4 A;  1Q82 U;  3CD6 A;  1GFD A;  2MI6 A;  2CH4 W;  1Q81 U;  1FMK A;  1QWF A;  2GNC A;  4LDW A;  1Z9Z A;  4FYX B;  1TU0 B;  1UGR B;  2DTH A;  1M1F A;  1SPK A;  5I2M A;  1GXI E;  1MMD A;  2NLU A;  5FU6 C;  1B34 A;  1YI2 A;  3MP8 A;  4CI0 C;  1BCO A;  4VUB A;  3L2Z A;  1TS9 A;  1VQ5 A;  3JCM f;  2QGG A;  3M54 A;  4HCC A;  1YIT T;  3CC4 Q;  3A8L B;  1KK7 A;  1E6G A;  4E47 A;  2V1Q A;  1GFC A;  3OYG A;  2EQU A;  1CKA A;  3VJP A;  3CME Q;  1BYM A;  1R77 A;  2HKQ B;  4XTW A;  5LJ5 e;  5IHI A;  5A2Q E;  2RJE A;  4RTU A;  3M53 A;  2WAC A;  1YJW Q;  2OTJ Q;  1YIT A;  2R58 A;  3CCS A;  1MV0 B;  2R5M A;  3I55 T;  3EG3 A;  2FRY A;  3KXT A;  3SDZ A;  2JTE A;  2YUP A;  2PUO B;  2RJD A;  3QSU A;  4II1 A;  2EGA A;  1D1A A;  3WVE B;  3OYE A;  2RJC A;  5GAN e;  3OBY A;  2K5L A;  1M90 C;  2NWM A;  2K79 A;  2K9G A;  3GIB A;  1SRM A;  3V8J A;  1VIF A;  1X43 A;  3I56 A;  4LDV A;  5FWB A;  5KYY A;  3TCJ A;  4J6X A;  1NLO C;  1TXQ A;  3CD6 T;  2JMA A;  4F7U F;  2JTM A;  2K2V A;  2G3R A;  1C0M A;  2E6N A;  1VQ5 Q;  2W10 A;  2K7A A;  3EFO B;  2MK5 A;  3JCM g;  2X4X A;  2O31 A;  3E1S A;  2CS7 A;  2QDL A;  1K8A C;  1RAG B;  2HBW A;  2YHT A;  3GP8 A;  2JOY A;  1UB4 A;  1T3S A;  4OMQ A;  4C92 C;  2YUN A;  3IQL A;  2MOX A;  1A0N B;  1QWE A;  4K11 A;  4IKF A;  3PNW C;  2EYY A;  4FSX A;  4E6R A;  2HL3 A;  2GF7 A;  4RCB A;  2KRN A;  3GLX A;  4B6M A;  1WI7 A;  1WJS A;  5FLX E;  1JJ2 A;  2V8K A;  5CO7 A;  1I8F A;  5GAO n;  2JS2 A;  1VQO A;  2FEI A;  3QHS A;  2EKO A;  3KFV A;  3OSV A;  1MMG A;  2LMJ A;  1W2B S;  2EQI A;  4HA8 A;  1K9A A;  1ZA1 B;  3MEV A;  3EH2 A;  1HYO A;  2KE9 A;  1MGQ A;  4E7Z A;  1Q82 C;  2HZY A;  1OU9 A;  2DL8 A;  3JSC A;  5HCK A;  1VQ8 Q;  2DK3 A;  1N9S A;  2VGM A;  3C12 A;  2M9U A;  3HTR A;  2PVD B;  4XTZ A;  2HQH A;  2BKD N;  4A63 B;  2K4Y A;  1RAA B;  5CQY A;  1N8R U;  1LOJ A;  4M4Z A;  1H64 1;  5GAN f;  5GAN h;  3L2R A;  2CYZ B;  4IIO A;  2AHJ B;  5LL6 S;  4OGC A;  5EG2 A;  2X3X D;  2KBT A;  4PFZ A;  5GAO r;  4BDY A;  1ZQ1 A;  2EJF A;  4EMH A;  2Y90 A;  2LC4 A;  1M90 U;  4N4G A;  3CPW S;  1OQK A;  3P8D A;  1O9S A;  1PSF A;  3OB9 A;  4AMC A;  5GAN d;  3OYB A;  4NOY A;  2MMP A;  4C8Q F;  2A08 A;  4X9C A;  1GL5 A;  2DBK A;  4Y28 E;  4Z8A A;  1M30 A;  1YJN A;  1PKT A;  2XID A;  4MZM A;  3O8V A;  3C94 A;  1PSE A;  3CC7 T;  3HL8 A;  4M7A B;  1GBQ A;  1M8M A;  2LQW A;  2MIO A;  3JCM J;  4AFS C;  2E5K A;  1QCO A;  3QXE B;  1AD5 A;  1SSF A;  1WA7 A;  3JB9 H;  2ABL A;  4PJN A;  1YIJ Q;  3GPL A;  1VQ4 T;  1M8V A;  3HRT A;  2XI9 A;  3VYG A;  3JCM d;  2EGC A;  4M75 G;  2VGN A;  3C4S A;  2G6F X;  4B9W A;  4RTY A;  1JQQ A;  3SWN C;  5DLQ E;  3OYL A;  4C5G A;  5KYX B;  3CCL T;  4C0F A;  2MYS A;  4Z02 A;  1QW1 A;  3CCR Q;  2DYB A;  1TOV A;  3CCE Q;  2MWO A;  2LDM A;  3DB3 A;  1WIE A;  2KI7 A;  3CXC S;  4BE0 A;  1QKX A;  2OX7 A;  4E7K A;  2E10 A;  2ZCF B;  1ZBJ A;  1KSW A;  1VQ9 A;  4PL6 A;  2EGE A;  9ATC B;  4M78 C;  4OMO A;  2P0P A;  2XDD A;  2P4R A;  2RN8 A;  2FPE A;  1Q7Y U;  3MEA A;  1LNX A;  2SEM A;  5IH2 A;  2A36 A;  3LH5 A;  1ABO A;  1UTI A;  3SB2 A;  3RBB B;  4FU6 A;  3REB B;  4LUD A;  2LTO A;  2O4X A;  4X9D A;  4MZT A;  1EZZ B;  1WXT A;  3EFO A;  2XK0 A;  4QVZ A;  3OYK A;  1ZUK A;  1BB9 A;  1M1K C;  2AZV A;  2QEX A;  1TUG B;  4HVW A;  1H8K A;  4DBF A;  3I9Q A;  3URG A;  1QVG A;  1VQ9 Q;  2CZ7 B;  1VYT A;  1X27 A;  2KRM A;  2DTO A;  1X6G A;  3CCV Q;  1G3T A;  1O75 A;  1VQN Q;  2M16 A;  3I5R A;  5IT9 E;  1GCQ C;  3DLM A;  2IPO B;  4C8Q A;  4EMK A;  1UUE A;  4C5H A;  4HVU A;  1YWO A;  4JJB A;  3M59 A;  2HAX A;  4MZP A;  4M7A E;  1YIJ T;  4E7S A;  1D1B A;  4WF2 A;  3SWN B;  1UEB A;  4LXC A;  4J83 A;  5GMK h;  2QXF A;  3CCS Q;  2JT4 A;  2VXE A;  2FG0 A;  3NGP A;  1I4K 1;  3Q1J A;  1VQK Q;  3BDL A;  3QWX X;  1M2O A;  3EHQ A;  4RTW A;  3LGL A;  4C0D C;  3DLL A;  4GLM A;  3CCL Q;  4AFU C;  2X9H A;  3AHU A;  1CKB A;  1KC8 C;  4PJO B;  2RPN A;  4N4I A;  4F17 A;  1D3B A;  1PKS A;  2VB6 A;  1OV3 A;  1PM3 A;  4Z89 A;  5DLO A;  4RTX A;  5CK9 A;  1KHC A;  3RIR A;  1K0X A;  1W2B A;  1NYG A;  1VQ4 A;  2BIV A;  2MPX C;  2RK2 A;  1RAI B;  3OYD A;  2XD0 A;  3OS0 A;  1YJ9 T;  4BY6 C;  1WJQ A;  4DQ2 A;  1IGU A;  3M57 A;  1XJW B;  2ZPH B;  3RUX A;  3RMS A;  2FVU A;  3V7S A;  1S1N A;  1W2B P;  1TUC A;  1N8R R;  1N5Z A;  4UC4 A;  1T0J A;  2BZ8 A;  4M77 E;  3M56 A;  1OYX A;  2KRO A;  4FCY A;  2OTJ A;  3HRS A;  4JZ4 A;  2KQW A;  5DY9 A;  3MPU B;  4Y92 A;  1U8R A;  1VQ9 T;  3JCM e;  5IHK A;  1JXM A;  3JCM V;  1RAD B;  2BTT A;  2DLP A;  2X4J A;  2JJ9 A;  1VQN T;  1XNI A;  2VV5 A;  4NS5 A;  4DBQ A;  2KK4 A;  4M77 F;  4M77 C;  1N27 A;  1M2V A;  1YHQ T;  3EFR A;  2J7I A;  4HVV A;  1NYF A;  3BW1 A;  5KYN A;  5FRN A;  4HCB A;  4CC3 A;  1YCS B;  4DOW A;  2QTX A;  1KFZ A;  5DM7 R;  4M78 E;  2QA4 T;  4KGX B;  2NUT B;  2DMO A;  3RKY A;  2QDY B;  1AVZ C;  2KNB B;  4BE2 A;  2KSS A;  5KCH A;  3CC2 T;  2Z0W A;  1QVG P;  5CCA A;  3NMZ C;  4C8Q G;  3M4Y A;  4PJO G;  1VQ8 A;  3PGG A;  3UT1 A;  4KRT A;  2I2L A;  3VU3 C;  1JRI A;  5KYX A;  3PT9 A;  2CUD A;  5GJW B;  2DIQ A;  4A54 A;  5ECA A;  3NFC A;  4WCI A;  3CPW P;  2NUZ A;  2LJ0 A;  2ENM A;  1YJ9 Q;  3CXC P;  2CP2 A;  3CEY A;  5LJ3 g;  1MMN A;  1GRI A;  3CCU T;  2A37 A;  4C8Q B;  4EMK B;  4BI8 B;  1M3B A;  3M9Q A;  3MEW A;  1T3L A;  5GMK j;  2DZ9 A;  1IHW A;  2L5Q A;  2VXF A;  4M75 F;  1UHF A;  2HQE A;  5KYU B;  2F2X A;  1KD1 U;  1B3Q A;  5KYU A;  3VS3 A;  4R55 A;  4CC2 A;  3NTH A;  2D8H A;  3CXC A;  1Q81 R;  1Q86 U;  6AT1 B;  1SKU B;  4M7D G;  4PJJ A;  2RM4 A;  3JB9 I;  5KH6 A;  2YDL A;  2CSI A;  4M77 B;  4N0A C;  3TSZ A;  1KD1 C;  2O88 A;  5LJ5 g;  2EPD A;  1SHF A;  3EGX A;  2XKO C;  1OUL A;  1WHG A;  2AK5 A;  2F5K A;  4C92 B;  3QPH A;  5LJ3 d;  1P92 A;  2DPP B;  4X1V A;  1YHQ Q;  1QKW A;  1V1C A;  2LCL A;  1PRM C;  2EJ9 A;  1N6A A;  5A0D A;  2DD4 A;  1K76 A;  3CC7 A;  2RHZ A;  3C0C A;  1EFN A;  3CCL A;  1IHV A;  1X6O A;  2OAU A;  2F69 A;  1BKB A;  3VS0 A;  2L3R A;  4CRI A;  3QYH B;  1I1J A;  1IB8 A;  3SFM A;  2GQI A;  3VKI A;  5FU7 B;  1MHN A;  3OYM A;  1K9M C;  5D7U A;  1S72 A;  1BIA A;  1D3B B;  3NPF A;  3VS4 A;  4GBQ A;  2OJ2 A;  2D0N A;  4ZTJ A;  3JAM E;  1BI3 A;  3I55 Q;  1PHT A;  4E7H A;  4Y91 A;  1WYX A;  1PWT A;  4IUT A;  3MJX A;  3LWH A;  4KGZ B;  1WQ7 A;  5HY6 A;  4IUU A;  3CCQ T;  2BE9 B;  2HL5 C;  2YXY A;  5LJ5 f;  4JRP A;  2WSE E;  2K3X A;  1H92 A;  4HT9 A;  3HFN A;  1W70 A;  2RQW A;  5GAN 2;  3P8B B;  3CCU Q;  2CGH A;  3A8G B;  1W4S A;  2K2M A;  2NUP B;  4N0A A;  2JNG A;  1QP3 A;  3PTA A;  5KCO A;  4M7D D;  3JB9 J;  3T9N A;  3HKS A;  4LN2 A;  3X20 B;  2KYB A;  5IAY A;  2EFI A;  2GTJ A;  2CT3 A;  1D1C A;  2CP6 A;  2YLC A;  1QVP A;  4HT8 A;  2COY A;  1LVK A;  4RCC A;  2P0K A;  3QKJ A;  4GY5 A;  4JS4 A;  1VQM T;  2B86 A;  3L2U A;  1JJ2 S;  2M51 A;  1UGV A;  2W0Z A;  2ESW A;  2EYW A;  1M27 C;  4BI4 A;  5A0G A;  1VQ6 Q;  4PJO E;  4Z88 A;  4J9E A;  2QQA A;  1K8A R;  3D7S B;  2RQU A;  5GMK l;  1Y07 A;  2KXC A;  4BB7 A;  3UPU A;  3KBG A;  3OSS C;  1F1B B;  1I5L A;  3G1J A;  2DER A;  1MUZ A;  3ME9 A;  1ZX6 A;  3MHX A;  2DBM A;  4J9C A;  1NZ9 A;  2CRE A;  2LQN A;  2COZ A;  4XTX A;  4JLG A;  1U06 A;  1Y0M A;  2ED1 A;  1JJ2 P;  1AOJ A;  3CCQ A;  5A0L A;  2LCC A;  2PNI A;  4IUQ A;  3OY9 A;  4PK4 A;  4QQG A;  3QDR B;  3G4S T;  4M7D B;  2HDA A;  4M75 C;  3P8H A;  2DNU A;  3CQT A;  1G8X A;  5KYY B;  1U3O A;  1NPP A;  5L8R E;  4F16 A;  2LNH B;  1SEM A;  4YTL A;  5CR2 A;  3M0S A;  1W6X A;  3LW5 E;  2LNV A;  2RHY A;  2RB6 A;  2RHX A;  5C0M A;  1BCM A;  3L1A A;  2H3J A;  1X2K A;  3M0R A;  2IVW A;  5FRO A;  5GAM g;  1EIF A;  1IRE B;  4B9X A;  1WPY A;  1C1A A;  1VQ7 A;  2CDT A;  2KDS A;  2LT1 A;  1M2V B;  3WXM B;  4XU1 A;  5GAO p;  3FC3 A;  5CKD A;  3CBP A;  2KAF A;  2VYT A;  2EKH A;  3V7R A;  3A8H B;  1E7O A;  1BBZ A;  3SD4 A;  1NPR A;  1VA7 A;  3OW2 P;  2D0Q B;  2RQT A;  1UJ0 A;  3GNF B;  1VQM Q;  4XK8 E;  4J8O A;  4PJO F;  4FW1 A;  5GAO l;  3MKD A;  3WVD B;  3TEE A;  1RUW A;  1OX9 A;  2HCK A;  2X51 A;  4BDZ A;  1YJ9 A;  3JB9 F;  3TU4 K;  1OX8 A;  2ROT A;  2DF6 A;  3MO8 A;  5GAM d;  1BK2 A;  2RQV A;  4C92 G;  2V26 A;  3RMQ A;  2K5I A;  1M4Z A;  3LH0 A;  1KC8 U;  2E1H A;  2L89 A;  2L2P A;  3JRZ A;  1VQ4 Q;  2QYZ A;  4JRK A;  5FU7 C;  1XOV A;  4PFP A;  2GCX A;  2YLB A;  2FYK A;  1M1G A;  2FPF A;  1NEB A;  2ECZ A;  3BY7 A;  2NUT A;  3BE3 A;  1PRL C;  2CT4 A;  4LDX A;  1Q81 C;  2JXB A;  2DL7 A;  1R8O B;  4L59 A;  2JM8 A;  3G4S Q;  4M7D A;  4RTZ A;  2A3L A;  3G6E T;  2D9T A;  1VQN A;  4PFO A;  2ZPE B;  1UEC A;  2ZPG B;  1NJI R;  2DXT A;  3TRE A; 
#chains in the Genus database with same CATH homology
 3OMG A;  3VYH B;  3INZ A;  2RD1 A;  3OYC A;  3S3O A;  1W2B A;  1YBY A;  4KBM B;  3EAE A;  3OYA A;  3QUI A;  2MF2 A;  4M77 A;  1WGS A;  4D6W A;  1VQ4 A;  3JCM h;  2BIV A;  2RK2 A;  3PIO A;  2PUK B;  2ZGW A;  3OYD A;  2XD0 A;  4M7D C;  3OS0 A;  1YJ9 T;  2ZPB B;  1WJQ A;  4BY6 C;  4DQ2 A;  3M57 A;  4BI3 A;  3QZ9 B;  4XU3 A;  2ZPH B;  2QA4 A;  1KQ2 A;  2RHI A;  3RUX A;  1YIJ A;  5GAO m;  3J7A F;  2EQM A;  2GFU A;  4M7A G;  2P4T A;  4Q5W A;  2FVU A;  4TVR A;  3RMS A;  3V7S A;  4C5E A;  3QG1 A;  1IZ6 A;  2HQX A;  4C92 F;  4M7A A;  3CCJ T;  3OYY A;  1UGQ B;  1VQ5 T;  4UC4 A;  4M77 E;  3M56 A;  3GNG A;  1QVF A;  2DJZ A;  4JUV A;  3S6W A;  1OYX A;  3FLG A;  1VQ6 A;  4M7A D;  4OP0 A;  2OTJ A;  3HRS A;  1YJW A;  4OGE A;  2E5Q A;  2KQW A;  3FRN A;  3RER A;  4RMO A;  5GAN 3;  4OB3 B;  4JS5 A;  4F7U E;  1S72 T;  5DY9 A;  4ATO A;  4E7L A;  1Y7X A;  3GF5 A;  1K73 C;  2Y4X A;  1UGS B;  2DKG A;  1U8R A;  5CKF A;  1G5V A;  3CMA A;  3FEO A;  3VUB A;  4DA4 A;  1VQ9 T;  1Q82 U;  3JCM e;  4QVC A;  3CD6 A;  4M7A F;  3JCM W;  2DVE A;  2DXB A;  3JCM V;  4C0D B;  2MI6 A;  3M4G A;  2X4J A;  4X34 A;  2WSC E;  5GAN 7;  1Q81 U;  2QQS A;  4LDW A;  4A53 A;  3CC4 A;  2EJG A;  1VQN T;  4GLK A;  1XNI A;  2VV5 A;  1UGR B;  2DTH A;  2P0Q A;  4NS5 A;  3LWI A;  1M1F A;  4JRQ A;  5GAO q;  2KK4 A;  4MDW A;  4M77 F;  5C6S A;  4M77 C;  3MEU A;  5I2M A;  4M78 G;  1N27 A;  1GXI E;  2NLU A;  3GOX A;  5FU6 C;  3JCM X;  4LD9 K;  1YHQ T;  1B34 A;  1YI2 A;  3ZFJ A;  1K73 U;  3FJP A;  3MP8 A;  3QJY A;  4CI0 C;  3CCJ A;  2FL7 A;  3EFR A;  4L5G A;  5LJ3 j;  3JB9 D;  4VUB A;  3L2Z A;  2V8I A;  1VQ5 A;  4ZGD B;  3JCM f;  3HFO A;  5GAN g;  1NJI U;  3BW1 A;  5FRN A;  2EWN A;  3M54 A;  4J5Y A;  5GMK i;  3RKW A;  4HCC A;  4HCB A;  1YIT T;  4MMK A;  4O5V A;  1FWZ A;  4DOW A;  3PIP A;  2HNI A;  1KHI A;  2QTX A;  3A8L B;  5CQX A;  5DM7 R;  4M78 E;  4F7U B;  2QA4 T;  4E7J A;  1VQK T;  3RKY A;  4E47 A;  2MWP A;  2QDY B;  3PMI A;  3OYG A;  5I21 A;  3QJ6 A;  4BE2 A;  2KSS A;  2EQU A;  4A4K A;  5KCH A;  4ZTF A;  3CC2 T;  3OYF A;  4M78 F;  3OBW A;  1H3Z A;  2CZ6 B;  2RJF A;  1KQ1 A;  4EPC A;  3VJP A;  5CCA A;  2LX9 A;  2O4X B;  4PLI A;  1BYM A;  2CZ1 B;  5LJ5 e;  2O01 E;  4XTW A;  5A2Q E;  5J26 A;  3E19 A;  3M4Y A;  2RJE A;  3C95 A;  3V8L A;  4PJO G;  4C92 D;  4C8Q G;  4ZGJ B;  3PGG A;  1VQ8 A;  3M53 A;  2WAC A;  4JJN K;  1VQ8 T;  2E12 A;  3UT1 A;  2I2L A;  3VU3 C;  3OYJ A;  1YIT A;  1JRI A;  2R58 A;  3CCS A;  2R5M A;  3RES A;  3I55 T;  5GAN 4;  2IG0 A;  4BD3 A;  4C92 E;  3KXT A;  3SDZ A;  3G7Z A;  3M5A A;  3PT9 A;  2PUO B;  1B34 B;  2RJD A;  3QSU A;  4II1 A;  1G3W A;  3WVE B;  3OYE A;  2DIQ A;  2JN0 A;  4A54 A;  1OZ2 A;  2RJC A;  5GAN e;  3NFC A;  2K5L A;  3OBY A;  2JZ2 A;  4KUL A;  4ME7 A;  5KE3 A;  4FIB A;  1M90 C;  2HD0 A;  3ZEH A;  3ER0 A;  3GIB A;  3VV0 A;  2MAM A;  3V8J A;  3QO3 A;  4NL2 A;  4XTY A;  1VIF A;  3QZ5 B;  3CEY A;  2E41 A;  5LJ3 g;  3L2V A;  1QVG S;  3CCU T;  3I56 A;  4M78 B;  4C8Q B;  4LDV A;  4EMK B;  4BI8 B;  3TCJ A;  2A7Y A;  4J6X A;  3CD6 T;  1YI2 T;  3M9Q A;  3MEW A;  1G3Y A;  4F7U F;  5GMK j;  2JTM A;  2DD5 A;  2DZ9 A;  2G3R A;  2K2V A;  1VQM A;  2L5Q A;  2VXF A;  2E6N A;  3ASK A;  4M75 F;  5LJ3 f;  4BUG A;  2HQE A;  5LJ3 h;  5GAN 5;  3BDU A;  1N9R A;  1KD1 U;  3JCM g;  3SWN A;  2X4X A;  4LD6 A;  3E1S A;  2KVQ G;  2CS7 A;  4R55 A;  3J81 E;  4QVD A;  1K8A C;  1JB0 E;  1WNL A;  3NTH A;  3CXC A;  1Q86 U;  3X26 B;  3RIR A;  3JCM c;  4M7D G;  3OA6 A;  2RI2 A;  2RM4 A;  2YHT A;  3JB9 I;  5KH6 A;  3GP8 A;  2JOY A;  3QYG B;  3E9G A;  1UB4 A;  5GAN j;  3OS5 A;  4M77 B;  2DEQ A;  4N0A C;  4PLL A;  1KD1 C;  5LJ5 g;  1QP2 A;  4A4H A;  3CCR A;  2GQV A;  4ZGE B;  4C92 C;  2XKO C;  1BI0 A;  4MML A;  2E65 A;  2F5K A;  2M0O A;  4C92 B;  4OB1 B;  4IKF A;  2FHD A;  3PNW C;  3QPH A;  4FSX A;  5LJ3 d;  1P92 A;  2DPP B;  2GF7 A;  4RCB A;  3A8O B;  2EIF A;  1BIB A;  3HP9 A;  5GMK e;  3GLX A;  1NE8 A;  3X24 B;  2LCL A;  1G3S A;  3J80 E;  2EJ9 A;  4QW2 A;  1K9M U;  4KT0 E;  1WJS A;  1N6A A;  5A0D A;  5FLX E;  1JJ2 A;  5M9O A;  2V8K A;  4N4H A;  5CO7 A;  3OW2 S;  2DD4 A;  3CC7 A;  1I8F A;  2RHZ A;  5GAO n;  2X4W A;  1VQO A;  2RI5 A;  1X01 A;  3CCL A;  3QHS A;  5CIU A;  2EKO A;  4C8Q E;  1X6O A;  2R5A A;  3OSV A;  2CZ0 B;  2E70 A;  2OAU A;  2F69 A;  2RA2 A;  4IUV A;  1BKB A;  1YHQ A;  1W2B S;  4HA8 A;  2L3R A;  2ZPI B;  4CRI A;  3QYH B;  5LJ3 e;  2E64 A;  3L2W A;  5GAN 6;  2XDB A;  3N5B B;  3SFM A;  1JBM A;  3FB9 A;  3H6Z A;  3MEV A;  4QQ6 A;  5FU7 B;  1MHN A;  1ZHI A;  3HHT B;  5IN1 A;  1MGQ A;  3VKI A;  1Q82 C;  2PVG B;  3OYM A;  3CCR T;  1K9M C;  2BUD A;  3CCE T;  1S72 A;  2R57 A;  3JSC A;  1BIA A;  1D3B B;  4DOV A;  4BAC A;  3FIF A;  2F5T X;  3HSB A;  2ZPF B;  3PFS A;  2DK3 A;  1N9S A;  1BI3 A;  2VGM A;  5CVI A;  3C12 A;  2M9U A;  5D6W A;  2PVD B;  3JAM E;  4XTZ A;  2BKD N;  4E7H A;  4Y91 A;  2K4Y A;  5CKE A;  4IUT A;  4ZN3 A;  3H8Z A;  5CQY A;  1Y96 A;  3LWH A;  1YJN T;  1KQS A;  3RKX A;  1WQ7 A;  5HY6 A;  1N8R U;  1LOJ A;  4IUU A;  3UDC A;  5D6Y A;  3CCQ T;  1H64 1;  5GAN f;  3JB9 G;  5GAN h;  3L2R A;  2CYZ B;  3M55 A;  5LJ5 f;  4JLI A;  4JRP A;  4M77 G;  2AHJ B;  2WSE E;  4IUR A;  5J3B A;  2K3X A;  3UWN A;  3I55 A;  3DKM A;  4M78 D;  5LL6 S;  4C8Q C;  4EMK C;  4OGC A;  4HT9 A;  2KMT A;  3HFN A;  5EG2 A;  5GAN 2;  3P8B B;  3LLR A;  4C92 A;  2CGH A;  1HXD A;  3A8G B;  5GAO r;  5GAN 8;  3CCU A;  4BDY A;  1W4S A;  4MDX A;  1ZQ1 A;  4N0A A;  2EJF A;  4RKU E;  2JNG A;  2Y90 A;  2LC4 A;  4QQD A;  1QP3 A;  4EMH A;  4N4G A;  3CPW S;  3CCM A;  2DAQ A;  1M90 U;  3QII A;  2HBP A;  3P8D A;  1ZBX A;  5KCO A;  3PTA A;  4M7D D;  4PJO A;  3JB9 J;  3T9N A;  4C5I A;  3HKS A;  1O9S A;  3X20 B;  5IAY A;  1PSF A;  2RH2 A;  2EFI A;  3OB9 A;  4JDS A;  1BI2 A;  4LDY A;  4M78 A;  3OYI A;  3I56 T;  5GAN d;  2CKK A;  2YLC A;  3OYB A;  2XDP A;  3CC2 A;  4M7D E;  4NOY A;  3ZBD A;  2MMP A;  1QVP A;  4HT8 A;  4C8Q F;  3MP6 A;  4OF1 A;  4RCC A;  2P0K A;  3QKJ A;  4X9C A;  3V7C A;  1X75 C;  4GY5 A;  4XU2 A;  4Y28 E;  4JS4 A;  4XU0 A;  1KQS S;  1VQM T;  1YJN A;  1XTD A;  4KUI A;  2QI2 A;  3L2U A;  2XID A;  4MZM A;  1OI1 A;  3O8V A;  3C94 A;  1PSE A;  1JJ2 S;  3CC7 T;  3HL8 A;  3CBM A;  2XG8 D;  4M7A B;  3CCV T;  4M7D F;  5FRM A;  4BI4 A;  5A0G A;  3NTI A;  1V29 B;  3LYI A;  3CPW A;  4PJO E;  3JCM J;  2JVV A;  1AHJ B;  5AYF A;  2QQA A;  2DZC A;  2QQB A;  3M58 A;  4HKE A;  5GMK l;  1Y07 A;  1DJ7 B;  3QXE B;  1SSF A;  3OW2 A;  4BB7 A;  4RG2 A;  3UPU A;  3KBG A;  3OSS C;  4NL3 A;  2D6F A;  4RG8 A;  1I5L A;  2OTL T;  3JB9 H;  1U1T A;  4OB0 B;  5GAM j;  3CMA T;  3ME9 A;  4M75 B;  3GPL A;  5I2S A;  3LGF A;  3MHX A;  1VQ4 T;  1M8V A;  3HRT A;  3L42 A;  1NZ9 A;  2EQJ A;  4JRI A;  3VUZ A;  4OVA A;  2XI9 A;  4LDU A;  3VYG A;  2YRV A;  5LJ5 j;  3JCM d;  3CCS T;  3G71 A;  4ZTJ A;  1VIE A;  3HPW A;  4XTX A;  1XQH A;  2LVM A;  4JLG A;  4M75 G;  4IUP A;  2VGN A;  2K57 A;  2DTI A;  5HK3 A;  3C4S A;  4ZN1 A;  4B9W A;  2PU9 B;  3QBY A;  1VQP T;  2JUF A;  4M7A C;  3SWN C;  2KY9 A;  5DLQ E;  5A0L A;  2ZZD A;  3OYL A;  3CCQ A;  4C0G A;  2LCC A;  4C5G A;  4KUD K;  4PKC C;  4IUQ A;  2OTL A;  5LJ5 d;  2PQW A;  3OY9 A;  4C0F A;  3CCL T;  1VQO T;  4Z02 A;  1QW1 A;  4QQG A;  3QDR B;  3G4S T;  2MWO A;  2LDM A;  4M7D B;  3DB3 A;  3P8H A;  4M75 C;  2XU8 A;  4F7U A;  1KG1 A;  2LT4 A;  3PMT A;  3CXC S;  3OS1 A;  2C06 A;  4PJO C;  3A8M B;  3G71 T;  3FDR A;  1QVF S;  1NPP A;  5L8R E;  4BE0 A;  3R6O A;  4YTL A;  5J39 A;  5HKC A;  5CR2 A;  1VQL A;  4J6W A;  4E7K A;  2E10 A;  2ZCF B;  1I81 A;  1Y71 A;  1Y96 B;  2QQR A;  4FT2 A;  2B8A A;  4BE1 A;  3JCM P;  1VQ9 A;  4EDU A;  3OQ5 A;  4PL6 A;  3JCM Q;  1RL2 A;  2XIC A;  5GMK m;  1M5Q 1;  2LNV A;  1LJO A;  2RHY A;  3LW5 E;  2P0P A;  2RB6 A;  4M78 C;  4ELZ C;  2RHX A;  4XAX B;  1YCY A;  5C0M A;  2XDD A;  1NJI C;  3L1A A;  2H3J A;  3OS2 A;  1Q7Y U;  3MEA A;  2GFA A;  2RHU A;  1LNX A;  2IVW A;  5FRO A;  5GAM g;  4PNO A;  1EIF A;  1IRE B;  4B9X A;  1WPY A;  4A4F A;  2RI3 A;  1VQ7 A;  3OYH A;  4XTU A;  1OZ3 A;  1RI0 A;  2V8J A;  1BI1 A;  2KDS A;  3HRU A;  2LT1 A;  3SB2 A;  4FU6 A;  4L6V 5;  3EFS A;  3WXM B;  3MET A;  4XU1 A;  2RO0 A;  5GAO p;  1WQW A;  2M1H A;  2LTO A;  2O4X A;  2PVO B;  4OMF B;  3FC3 A;  5CKD A;  5CKB A;  3V8K A;  3CCE A;  5GAM f;  3G4S A;  3NTK A;  4X9D A;  4MZT A;  5GAM h;  4EMG A;  3CBP A;  4J7F A;  2LQK A;  2XK0 A;  4QVZ A;  2KAF A;  2VYT A;  3OYK A;  1M1K C;  3V7R A;  3X28 B;  3A8H B;  2X4Y A;  5KE2 A;  2LRQ A;  2QEX A;  3SD4 A;  4J6Y A;  1NPR A;  2QEX T;  1VQL T;  3S3N A;  2D0Q B;  2DXC A;  4A4G A;  1Q86 C;  2JTF A;  3GNF B;  1M9S A;  5FU6 B;  3URG A;  4XK8 E;  1QVG A;  4J8O A;  3L2Q A;  2EAY A;  2DIG A;  4PJO F;  2CZ7 B;  3JCM b;  1U1S A;  2FB7 A;  5GAO l;  3CME A;  2EQK A;  3WVD B;  2DTO A;  3TEE A;  3TRE A;  4A4E A;  3MP1 A;  1G3T A;  1O75 A;  3CBO A;  2M16 A;  2DO3 A;  2XHC A;  4XTV A;  4BDZ A;  5IT9 E;  1YJ9 A;  2EYQ A;  1VQ6 T;  3JB9 F;  3TU4 K;  3DLM A;  1FX7 A;  4C8Q A;  4EMK A;  4C5H A;  5HK0 A;  3MO8 A;  2K5F A;  2QQ9 A;  5GAM d;  1FXX A;  4E7I A;  2L8D A;  1VQP A;  2RK1 A;  1N8R C;  3M59 A;  4M77 D;  1VQK A;  2HAX A;  4MZP A;  4C8Q D;  4C92 G;  3RMQ A;  2K5I A;  1M4Z A;  3E9F A;  3BFM A;  3LH0 A;  1KC8 U;  4M7A E;  2E1H A;  1YIJ T;  1Q7Y C;  3F70 A;  2L89 A;  4M75 A;  3JRZ A;  3MCA B;  4J7I A;  1VUB A;  4JRK A;  4WF2 A;  1UEB A;  3SWN B;  5GMK h;  4J83 A;  2LQ8 A;  3S3M A;  2QXF A;  3X25 B;  5FU7 C;  1VQ7 T;  1XOV A;  4XQ3 A;  4HCZ A;  4FM4 B;  2VUB A;  4O6J A;  2GCX A;  1M1K U;  2VXE A;  2YLB A;  1WJR A;  2FYK A;  1M1G A;  4OB2 B;  3CC4 T;  2Y4Y A;  2X35 A;  3CCM T;  1UGP B;  1I4K 1;  3G6E A;  3BY7 A;  3Q1J A;  3CPF A;  3BDL A;  4C0Z A;  4R56 A;  3DB4 A;  4P5N A;  3OMC A;  4FL6 A;  2DXU A;  4LDX A;  1Q81 C;  3LX7 A;  5GAM e;  3LGL A;  4ELY C;  4C0D C;  3DLL A;  5CAI A;  1R8O B;  4M75 D;  3AHU A;  3CME T;  1KC8 C;  4L59 A;  4BY6 B;  5LJ5 h;  4PJO B;  4N4I A;  3CCV A;  4M7D A;  4PJO D;  3A5Z B;  2A3L A;  3G6E T;  2D9T A;  1K8A U;  1D3B A;  5D6X A;  1YJW T;  4FT4 A;  5CKH A;  1VQN A;  3OYN A;  1TH7 A;  2WSF E;  2OTJ T;  2K3Y A;  2VC8 A;  4M75 E;  2ZPE B;  2ZPG B;  3KUF A;  1HK9 A;  4V2S A;  5DLO A;  2E6Z A;  2DXT A;  5CK9 A;  4F7U G;  1KHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...