1Y96B

Crystal structure of the gemin6/gemin7 heterodimer from the human smn complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
AQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gem-associated protein 6
publication title The Gemin6-Gemin7 Heterodimer from the Survival of Motor Neurons Complex Has an Sm Protein-like Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 23
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11095 Gemin7 Gem-associated protein 7 (Gemin7)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y96B00
4EMGA 1Y96B 2E1HA 1JBMA 4QVCA 3QUIA 3JCMe 4M77A 4XU3A 1KQ1A 5GAMe 4M77F 1U1SA 1WQWA 3JCMg 4XTYA 4A53A 4C92G 3JB9D 5GAMg 2EJGA 1N9SA 4M7DC 3RESA 4XU0A 4M75G 3RIRA 4M78C 3JB9J 3SB2A 3SWNA 1I8FA 3JCMX 4HT8A 3GIBA 3JCMd 4A54A 4RCBA 5GAMd 3RKWA 4C92E 5LJ5h 2RB6A 4QVDA 5LJ5f 2YHTA 4MMKA 4XTVA 3JCMP 4EMKB 4M7DG 3V7SA 4J5YA 4M78G 5LJ5j 4M7DB 4C92A 4XTWA 5LJ3e 1B34A 1LJOA 2DVEA 4PJOG 2VC8A 5DY9A 4DQ2A 4M7AG 5LJ3g 2DZ9A 4M75A 2CGHA 4M7AB 4WF2A 3AHUA 4M7DE 3HSBA 3JCMJ 4M78E 1TH7A 3V7CA 3EFRA 2I2LA 4C8QA 4RCCA 1WQ7A 5LJ3d 2RD1A 2EJ9A 4MMLA 4C8QF 5GAOn 5GAOm 1JRIA 4M7AE 3V7RA 4PJOE 2VXFA 1WPYA 4M77D 2RA2A 1LNXA 4M78A 4JRIA 1X01A 1D3BA 2DTOA 3BY7A 4XU2A 4EMKC 1KQ2A 2EJFA 5CAIA 4PJOA 4N0AC 3JB9G 5GAN2 3QHSA 5LJ3f 2QTXA 4Y91A 5GMKi 1HK9A 1Y96A 3BDUA 5GMKm 5LJ3j 5GAN3 2E65A 4XTZA 1H641 3VU3C 3QSUA 4HA8A 5GANe 2HNIA 2VXEA 4JRKA 3PGGA 3M4GA 4NL2A 4C92F 3JCMh 4F7UG 4OP0A 4XU1A 1I4K1 4XQ3A 3JCMf 4F7UB 5GAMh 5GANg 5GAMf 5GAN6 1HXDA 4M75F 4M75D 5GAMj 3JB9H 2EWNA 5GMKe 5GANd 3RERA 1M8VA 4JUVA 4EMKA 4M77C 3JCMQ 2YLCA 4F7UE 2DKGA 2FYKA 4C8QD 4M7DA 3HFOA 4M7DF 3HFNA 4N0AA 4M78F 3JCMb 1M5Q1 1I5LA 5GAN8 2DEQA 3SWNC 4M7AA 4M77G 4J6XA 5GANf 4PJOF 4NL3A 4M7AF 4M77B 1BIAA 5LJ3h 5GAOq 1MGQA 5GANj 5GAN5 5GAN4 1LOJA 1YCYA 2E41A 3FJPA 3RUXA 3QO3A 5LJ5e 3SWNB 4X9CA 3V8KA 4JLIA 2JN0A 4M77E 2DJZA 5LJ5g 5GAN7 1N9RA 4C92D 3L2ZA 3EFSA 4M75C 2DXTA 3JCMW 2Y90A 3FIFA 3BFMA 4XTUA 3RKXA 4EMHA 5LJ5d 3JB9F 3FB9A 4XTXA 3V8JA 3L1AA 3RKYA 3V8LA 4C92B 1WNLA 4C8QC 4M7AC 2E10A 1B34B 2ZGWA 4V2SA 4M75B 5GAOl 3JCMV 4M7DD 3JCMc 4J6WA 2K57A 5GAOr 4M78D 2DTHA 2YLBA 3BW1A 4F7UA 2FB7A 4HT9A 4C8QG 3INZA 2DTIA 4F7UF 1U1TA 5GANh 3JB9I 4C8QB 2DZCA 1I81A 5I21A 1BIBA 2RM4A 4M7AD 4PJOD 2E64A 4M75E 4M78B 4NOYA 1D3BB 4PNOA 5GAOp 4J6YA 4PJOB 4PJOC 4C92C 2EAYA 4C8QE 5GMKh 5GMKj 4X9DA 2DXUA 5GMKl
chains in the Genus database with same CATH superfamily
1FXXA 2LP5A 2E1HA 4RKUE 4QVCA 3I9QA 1WDXA 3M0TA 4C92G 2JXBA 1KD1U 2YUOA 3SB2A 3R6NA 1Q86U 5GAMd 2WSCE 1YN8A 1YIJA 2BE7D 3CCJQ 1M27C 2CDTA 1K8AR 1NLOC 3AT1B 4XTWA 2LZ6B 2RQVA 2VC8A 5CO7A 1T0HA 2D9TA 5HKCA 2IVWA 1OZ3A 4RTYA 2RA2A 3CBPA 4RTTA 3EG9A 2X4XA 2HBWA 3VKIA 1IO6A 3CPWS 4C0FA 2QTXA 4Y91A 3G1JA 5GMKi 3KFVA 2K3XA 1MUZA 2C0TA 3MEAA 3EAEA 2VXEA 4JRKA 3L2WA 4BDZA 3JCMh 2JMCA 4OVAA 1QW1A 3CCQT 2GQIA 4L5GA 2HMAA 4MDWA 1FWZA 5KCHA 4HCCA 1WXUA 1ZSZC 3OW2S 1U06A 1PKSA 3QPHA 4FW1A 4M77G 3E9GA 1YHQA 1Q81R 2LX7A 2R5AA 4LE9A 3OYJA 2XIDA 1TU0B 4C5GA 5LJ5g 4RUGA 1SRLA 5A0LA 5M9OA 3JRZA 2K3YA 3C95A 3CC4T 3E2UA 2WACA 1WJSA 1NEBA 4C92B 1ACMB 1X69A 3REAB 3NHNA 3EHQA 4M78D 4CC7A 3UA6A 2JW4A 4F7UF 1JJ2P 2DZCA 3QZ5B 4Y28E 1C0MA 2CUBA 3EGXA 2JOYA 3OYKA 4IUTA 4J6YA 1YI2A 3OMGA 1VQOQ 4ZTFA 4PK4A 2NUPB 2EGEA 2HZYA 2DXUA 2QDLA 1PD1A 5FWBA 2EBPA 1K73C 1UHFA 4D8KA 4XU0A 1KQSP 4M78C 3M53A 2G3RA 4QVDA 5LJ5f 1UECA 1ABQA 1GFCA 2GGRA 5LJ5j 2LQNA 4O6JA 2V8IA 5IN1A 1YJ9T 1NG2A 2DZ9A 3S6WA 3PNWC 4WF2A 2RK2A 3AHUA 2LJ3A 2HSPA 4C8QA 3ASKA 1NJIC 1MMGA 5GAOn 5CVIA 1WPYA 1LNXA 2KMTA 2C06A 4N0AC 1KJWA 3OBWA 3QBYA 1M3BA 3CMEQ 4BUGA 1VIFA 2GFAA 1QVGP 4E7LA 1GXIE 4XQ3A 3LGLA 2F2VA 4D6WA 1QVFP 4AG1C 2LJ1A 2PTKA 3NFCA 4RTXA 2DPPB 3HFOA 2V8JA 1VQ4A 2DL7A 2KYMA 4PJOF 4BY6C 1AZEA 4IIMA 4LDUA 1I07A 1K4US 2DJQA 1YCYA 2J05A 2E41A 3QWXX 4II1A 2KAFA 3CD6T 2W0ZA 4KH1B 4LDXA 1UEBA 1PWTA 2LQ8A 2E3IA 1D1BA 1BI1A 2HAXA 2YRDA 4IIOA 6AT1B 2PU9B 4FYXB 3CC2A 4RTWA 3I56Q 1YJNT 1RLQC 2DF6A 1SPKA 3MCAB 3H9NA 2DIQA 1V76A 4DOWA 2JJ9A 2DTIA 3I55A 1YIJT 3L2RA 4OMQA 3HHTB 3HKSA 2YXYA 3M0QA 1N8RC 2GTJA 4FSSA 1TSFA 1VQLA 1MMAA 1Q86R 2KT1A 3P8HA 3SWNA 1SHGA 5KYWB 2AIRB 2RQTA 1OZ2A 1Y7XA 3DB4A 1HD3A 3VS3A 4DEXA 3NTKA 4EMKB 5IH2A 3DB3A 2LNVA 1YITQ 5DY9A 2L89A 1F1BB 3HSBA 4C8QF 4M7AE 4M78A 1VQ6A 1SF9A 1SHFA 2FL7A 1PSFA 4X1VA 2O31A 2D8HA 3OB9A 5LJ3f 4JJDA 1YJWQ 2QQAA 5GAN3 2CP7A 3FRNA 5LJ3j 1YHQT 1YNZA 2DIGA 4QW2A 2E65A 3S3MA 4F17A 3QSUA 1QKXA 4F7UG 3OYCA 1IB8A 3N5BB 1I1JA 2J6FA 1IHVA 4GLMA 1M90C 4N0AA 3PFSA 3PTAA 2DM1A 3PIPA 4OGEA 3MP8A 2PQWA 4QVZA 5GANf 4EIKA 2ATCB 5LJ3h 5GANj 1NPRA 1WJQA 1EZZB 1WA7A 1VQNA 1MMDA 3RUXA 1Q82U 2L5QA 4HVVA 2BTTA 3L2ZA 1YI2T 2AZSA 1O9SA 4J9GA 3ULRB 3RKYA 3TVTA 1WGSA 3M9QA 5GAOr 3GLXA 1X43A 1WIEA 3F70A 3NGPA 5GANh 2DMOA 1W2BP 2ZPEB 2OTJQ 3VS5A 4LDYA 1K9MU 3P8BB 5CR2A 2CS7A 3JCMQ 1WX6A 2DK3A 2GBQA 1TWBA 1KQ1A 1UGSB 1WHJA 1U1SA 3OBYA 3MEWA 1TG0A 3TEEA 4HT8A 3JCMX 4DEYA 1X2QA 1QP2A 2HDAA 4ME7A 1HYOA 2YWWA 4XTVA 4MMKA 3OYFA 4J5YA 1SEMA 2KVQG 1XJWB 4PJOG 1E7OA 2K7AA 4DOVA 4M7DE 2RN8A 5FU6C 3META 3EFRA 1WQ7A 2YDLA 2EJ9A 4AFQC 4FL6A 3BDLA 1X01A 4XU2A 3EG0A 3QDRB 5AYFA 2EPDA 1VOMA 1H641 2PVDB 2HL5C 2CZ0B 2OTLQ 4FYYB 1RAFB 1PNJA 4GBQA 2P4TA 4BD3A 3CC2T 3SHWA 1UJ0A 1B3QA 1TOVA 1M9SA 2RHUA 3LH5A 4JJBA 4C0GA 2RHYA 2ABLA 3M5AA 2LJ0A 1HSQA 1LOJA 1V1CA 3CQTA 1GL5A 5LJ5e 1B7TA 1GCPA 2F1LA 5D6WA 3ZL7C 2PNIA 2R58A 1RAGB 1RL2A 1G8XA 2ED0A 2MK5A 4PL6A 1VQLT 4J6WA 5C6SA 4QKUA 1R8OB 3H6ZA 1NBEB 4C8QG 1WZOA 4CI0C 5I21A 4A4KA 1S72T 1RAAB 1Q81U 4PJOB 1JBMA 3QUIA 1VQ8Q 1J3TA 3GNGA 3CPWA 2PZ1A 1M2VA 2K5FA 4D8DA 1VQ6T 3CCJA 1KIKA 1K76A 4C92E 5IHIA 1WHMA 2LMJA 2MWOA 3TCJA 1UGVA 4M7AB 4PFPA 8ATCB 3OW2A 3O5ZA 2EYXA 2RD1A 1ZUYA 1ABOA 3M55A 1PRMC 1D09B 1C6VX 2LT1A 4GLKA 4DBQA 2RJDA 3BE3A 2LVMA 3M0PA 1M1FA 3THKA 1BB9A 2ESWA 3RBBB 1A0NB 4ZGDB 1D0YA 3OY9A 1VQNT 5GMKm 5FWCA 4OP0A 4JJNK 4DA4A 3JB9H 1OX8A 2RQRA 1M4ZA 1UGQB 2ZCFB 4E7SA 2EQMA 2RQWA 1K9AA 3C4SA 5KH6A 3EH2A 1JQQA 1MMNA 4PJLA 5KE2A 1K73R 2CP6A 2K9GA 4LXCA 2QEXQ 3QO3A 2DRKA 1QWEA 2V1QA 4JLIA 4M77E 4X9CA 2DJZA 4JRPA 4JS5A 2KT8A 1IHWA 2DA9A 5KYNA 2YUNA 4XTXA 3V8LA 5IT9E 4OMPA 1YP5A 3VS4A 3L2UA 2COZA 3JCMc 1VQ9Q 2DD4A 2O88A 1RAHB 5KYYB 2FB7A 3L42A 3OA6A 2CT3A 3M0SA 4M7AD 1NJIR 4AG2C 1VQOA 1D1CA 1YWOA 2AZVA 3GBQA 3QXEB 2EYQA 5GMKh 1YCSB 1LVKA 2EKOA 5IHNA 2DBKA 1EX4A 3JCMg 3GP8A 1R77A 5FU7B 2GQVA 2E4HA 1I8FA 4AT1B 4A54A 2O9SA 4RCBA 1M2OA 3HL8A 1M3CA 4M7AC 2WSEE 1C1AA 1OPKA 3V7SA 3CC7Q 4M7DB 4N4IA 2RO0A 4LUEA 3MP1A 2RI3A 1QLYA 3V7CA 3CCVQ 1YBYA 4KBMB 3EFOB 1N27A 1KQ2A 1JEGA 4FU6A 2EQKA 1W4SA 1Y96A 2JMAA 4FIBA 2HNIA 4L6V5 3JCMf 3G6EA 5LL6S 4M75F 1TXQA 2EKHA 4WCIA 3CCQQ 4J83A 3OYEA 3L2QA 3VV0A 2DKGA 4C0DC 1OULA 4ESRA 2X4YA 4KUDK 3OYBA 1H3ZA 5GAN8 1XNIA 2DL4A 3MKDA 1N8RR 3LLRA 1XQHA 3P8DA 3X24B 3I56A 2AKLA 3CXCP 2KRMA 1ZUUA 3H0FA 5LJ5d 3JB9F 3L1AA 2D1XA 1Y07A 1B34B 3DKMA 5A0DA 4M7DD 3MEVA 2RJFA 3INZA 2F5TX 3CCJT 2NLUA 1KHIA 3OS1A 3J81E 3UT1A 4M75E 2SRCA 3OYYA 1AVZC 4BE0A 1PSEA 2FZKB 5A2QE 2Z0WA 3ZFJA 1BCMA 5FU7C 1JJ2S 2O9VA 4HCBA 1VQKQ 2VV5A 4M7DC 1RLPC 3RESA 1G83A 4J9EA 2CH4W 1N5ZA 1AWOA 1MHNA 3RKWA 2VGNA 3M4YA 2C0OA 5FRNA 3EGUA 1WHHA 3VYHB 1KQSS 1X75C 1OX9A 1GRIA 5KYUB 3FC3A 4OMOA 2NUTB 1YJ9Q 3NPFA 5CKDA 3OSVA 4KH0B 4KRTA 3VS0A 5FRMA 2X3WD 4MMLA 2CZ7B 3FEOA 1RI0A 1I5OB 1YJWA 4KT0E 2GTOA 2KNBB 5CQXA 2P84A 3OS2A 1UE9A 5CKBA 1NZ9A 1VQMA 3CCEA 5KYXB 5J26A 5GAMh 2MF2A 3MEUA 5D6XA 3TU4K 2L2PA 4R55A 2VB6A 1PG5B 2DVJA 2DEUA 4WTOB 4F7UE 1QVGS 2DX1A 1M5Q1 4LD9K 5D6YA 1FX7A 4R0KA 4M77B 3RMQA 1NLPC 2R5MA 3CCLA 3A98A 1VQOT 3NMZC 1IGUA 3CD6Q 2X9HA 4C92D 4Z02A 3UATA 1FMVA 1X6GA 1QVPA 4P5NA 1WLPB 3GF5A 2OTJA 2JM9A 2QK0A 1VQPT 1VQ5T 1K0XA 2GFUA 3LWIA 2BE9B 1YIJQ 1W6XA 5I22A 4HCKA 4E47A 3CMAT 4C92C 4HXJA 1Q7YC 5GMKl 5I2SA 4ZGJB 1ZSZA 1M30A 4N4HA 4M75G 4QQGA 2WSFE 4IKFA 3PE0A 2O2OA 2L8DA 2C0IA 1AEYA 5KCOA 2HKNA 2ZAEA 1KC8C 3S3OA 2QQRA 2EYWA 2J6OA 2DXBA 4DQ2A 2V8KA 5HK0A 5LJ3g 1SRMA 2EQIA 3TSWA 1TUGB 2AKKA 3EG2A 3G6ET 2KQWA 2VKNA 4R56A 2BZYA 1G3WA 2LQKA 3EGDB 1JRIA 4PJOE 3SD4A 4M77D 1QP3A 1PM3A 8AT1B 1D3BA 3OS5A 2JVVA 4OMFB 3JAME 1WHKA 3JB9G 3I5RA 2F2WA 1AHJB 1HK9A 3OQ5A 3KUFA 2OTLA 3GPLA 3VYGA 3PMIA 3M4GA 4NL2A 5GANg 4XU1A 4N4GA 2QG9B 3I56T 2GNCA 2K5IA 4CC4B 4DBRA 4M77C 2MMPA 1FYNA 2B86A 5CKHA 3JCMb 2GCXA 2OI3A 1G3SA 3WVEB 2DLPA 4J6XA 3OYLA 3ZEHA 4E7HA 5GAOq 5GAN4 2MWPA 2DBMA 3MP6A 2O4XB 4PJNA 4RTVA 3CCSQ 2QA4A 4PFZA 4JRQA 1P92A 4FM4B 3PIOA 1AZGB 4M75B 4ZNXA 4KUIA 3RMSA 1NPPA 2M0OA 3BW1A 2M16A 3HRTA 4BE1A 3RNJA 1RUWA 1BBZA 9ATCB 1RI9A 5GAOp 4J9CA 4C8QE 1K73U 1VQ8A 1GCQC 1W2BS 3M54A 1VQ7Q 3JCMe 2E3HA 2JM8A 3VS1A 5FLXE 3QJYA 1YJWT 1ZA2B 2P4RA 1W1FA 2YHTA 1K1ZA 1VQMT 2DL3A 3CCET 4C92A 2EGCA 1NJIU 3CCRQ 2CSQA 3T9NA 1E6GA 2VWFA 2KGTA 3UWNA 3SEMA 1KSWA 3H0IA 2KK4A 4EMKC 2M9UA 3ER0A 2COYA 3EG1A 4BI8B 5CAIA 4KULA 4FYWB 3QHSA 2NUPA 3VS6A 3I35A 3JSCA 1T3LA 3BDUA 2BKDN 2JNGA 3VU3C 1TTHB 3CCLT 2YRVA 2RHIA 4FYVB 1IRXA 4F7UB 4J9BA 3E19A 4E7JA 5GAN6 2M02A 4M75D 2CT4A 2MAMA 5I2MA 2RK1A 2QQSA 1M8VA 4JUVA 2ECZA 1T3SA 2L3QA 5IHKA 3CC2Q 3G4SA 4M78F 4CC3A 2H3EB 2NWMA 3ZBDA 1VQ4T 2QEXA 2OTJT 4J7FA 3L2VA 5GAN5 1SSFA 1Q7YU 2ZPHB 1BI3A 3CCMA 1BI0A 2P0QA 1CKAA 2AT1B 2V26A 4LD6A 3RDVA 2CUDA 1X2KA 1GBQA 4M75C 3A8HB 3BFMA 2EGAA 1M1KC 2E6NA 2YUQA 3RKXA 2KR3A 4EMHA 1OV3A 1NM7A 1ZHIA 2A37A 2CZ6B 2R57A 1QCNA 1ZUKA 1U1TA 2KYBA 2E5QA 1PD0A 1PCXA 2PUOB 5CK9A 3I55T 3MO8A 4BI3A 3EG9B 4ELZC 1S72Q 1N8RU 1TS9A 2E12A 2VGMA 2CP5A 4XU3A 2EIFA 1WJRA 2A28A 3RIRA 1UFFA 3JB9J 4HCZA 4OB0B 3CC7A 3G71A 4AMCA 1KD1C 2KY9A 3CCUQ 1GCQA 3CCVA 2QI2A 4RG8A 2GF7A 2CGHA 1H3HA 2QAZA 2BZ8A 2F5KA 4OB1B 2JS0A 2QGGA 3M56A 1BU1A 4E6RA 2KBTA 3BY7A 2EJFA 4VUBA 2DETA 3QYHB 2YT6A 4C5HA 2LQWA 4RG2A 4B9WA 3OYHA 1I4K1 3CCQA 1VQNQ 2DL5A 1M90U 1G5VA 5KYWA 1XOVA 2W10A 2X4WA 3EGXB 4EMKA 1AD5A 2QA4T 1Z9QA 1JXMA 1VYTA 3GNFB 3C0CA 3TREA 3HFNA 2KXDA 2QQ9A 1WXBA 2RI5A 2QASA 4J9HA 3SFMA 1MGQA 1Z9ZA 4OMLA 2FG0A 1JB0E 2RMOA 2F2XA 1JJ2A 3MHXA 2X35A 4Z89A 2LX9A 3QKJA 3LW5E 4J9IA 4ANJA 4A63B 1NEGA 4FSXA 3J80E 2XICA 3FJ5A 3VRYA 2DFUA 4V2SA 2NYSA 2FRYA 3CEYA 1FMKA 3LH0A 2BIVA 1KQSA 4J7IA 4C8QB 4JZ4A 4PJOD 5CKFA 4NOYA 2AK5A 4RTUA 2DXCA 1IGQA 3UDCA 5GMKj 2FZCB 1VQKA 4RMOA 1UJYA 2JS2A 5AT1B 3FDRA 4EPCA 1N9SA 1X27A 1UUEA 2JTEA 1I0CA 4A4HA 3JCMd 2M51A 2YRCA 4PJOC 2MOXA 5C0MA 1MV0B 2HKQB 4M78G 1BKBA 4O5VA 4Z88A 5LJ3e 1WI7A 2XDDA 2RJEA 1QVGA 4JZ3A 3X28B 5IXFA 1TH7A 1YFNA 4PLIA 2VUBA 4OMMA 4QT7A 2OAUA 3REBB 2EYYA 3MJXA 2YSQA 5J3BA 1FMWA 1OI1A 3EHRA 3G4ST 1VYVA 3HPWA 5GAN2 2CP0A 4RTZA 2QEXT 1U3OA 5DLOA 3TQ7P 3CCMT 5GANe 4FT4A 1SG5A 2XKOC 5HCKA 4AFSC 2CP2A 2EWNA 4YTLA 1ZX6A 3NTHA 1EIFA 4C8QD 4PFOA 2EFIA 1OYXA 2KROA 3CMEA 1Q7YR 5DM7R 1BI2A 3PT9A 1IXDA 5A0GA 4XK8E 1MNEA 3LX7A 1R0BG 5L23A 2X3XD 2FPDA 3SWNB 1ARKA 2JN0A 3OS0A 3M0UA 3TSZA 2KEAA 2P0KA 2MPXC 2DXTA 3JCMW 3QJ6A 1QWFA 2JT4A 4FCYA 2KSSA 1KC8R 4M4ZA 4C8QC 2E10A 3C94A 1V29B 1UDLA 3CXCS 2O01E 2EQJA 1PC0A 3CC7T 3G71T 1WHLA 2RM4A 4OB3B 2X4JA 2E64A 4M78B 1PRLC 1UB4A 1E6HA 2EAYA 4OB2B 1M8MA 3CCVT 1RAEB 3A1PA 4EMGA 2OJ2A 1H92A 2LCCA 1WQWA 1QQJA 5J39A 2OX7A 5GAMg 2DE0X 7AT1B 3CC4Q 3FLGA 1TUDA 2MI6A 4LN2A 2PVOB 2LT4A 1AT1B 2ROTA 4ZN1A 4X34A 2BZXA 3U23A 2HD0A 3S3NA 3JCMJ 3CPWP 2QDYB 2LDMA 4RCCA 4IUQA 1SSHA 2DNUA 4K11A 4DBFA 2DO3A 4PJOA 1OPLA 4ZN3A 3J7AF 3VJPA 1YITA 2JTFA 1S1NA 3QG1A 3LWHA 1D1AA 2QQBA 1M90R 5I11A 1OU8A 4BY6B 2HBPA 3OW2P 1KG1A 5GAMf 5GAMj 2K6DA 3H0HA 4LDWA 2YLCA 1G2BA 2FYKA 2IG0A 1UTIA 1VA7A 2MYSA 3A8GB 1Y71A 1WFWA 1I5LA 2DEQA 3SWNC 4M7AA 2LCSA 1BIAA 1U8RA 2ZPBB 1OOTA 1AWWA 1W2BA 1LCKA 3CCSA 2Y4XA 5EC7A 2Y90A 1MNDA 1NE8A 3CBMA 4FT2A 4ORZA 1VQKT 2J06A 1Q82C 3FB9A 3V8JA 1M1GA 2QTVA 4DBHA 5HK3A 1AWXA 4HT9A 3MPUB 2KI7A 4J9FA 1VQPQ 1I81A 1VQ5Q 1QVFS 2QYZA 1UGRB 2RQUA 5D7UA 3OYAA 4J8OA 2VYTA 2RI2A 1ZBJA 4PNOA 3D7SB 3GOXA 1GFDA 2HEQA 1VQ7A 2X51A 2RPNA 3CMAQ 2KRNA 4A4GA 2A0FB 1XTDA 1K9MC 2J6KA 1KK7A 3QDFA 4XTYA 1RABB 2EJGA 1YJNQ 2XK0A 1DJ7B 2K4YA 1PHTA 2DILA 1RADB 5LJ5h 5L8RE 5DLQE 3CCRA 4J9DA 2FRWA 4LUDA 1G3YA 2CKKA 3G7ZA 1VIEA 2AHJB 3QYGB 3OYNA 2DVEA 2MCNA 1BK2A 3KXTA 5KYYA 4LDVA 2HSEB 2I2LA 2XG8D 5LJ3d 3H41A 3G6EQ 2DYBA 5GAOm 1GBRA 4QQ6A 4F14A 1OQKA 2HQXA 4JS4A 1M1KR 4IURA 3CMET 4ELYC 5CCAA 3LGFA 3PGGA 1WXTA 2B8AA 2VASA 3E9FA 4C0ZA 5GMKe 2LCLA 5GANd 3RERA 2HQHA 3HRSA 1K8AC 4M7DA 1X6OA 3OMCA 5CQYA 2HCKA 5FROA 2A3LA 2LNHB 4AFUC 1KFZA 2J7IA 4M7AF 1OU9A 2YUPA 1IREB 1M2VB 2LTOA 3EFOA 4B9XA 4EDUA 1JXOA 1YHQQ 2F69A 4KGXB 4BACA 2DD5A 2RH2A 1KD1R 1WNLA 5CKEA 4CRIA 2H8HA 1U5SA 2RF0A 4PLLA 2RHXA 2ZPFB 1S72A 1BIBA 4F16A 4HVWA 3DLLA 3HP9A 2CZ1B 2E6ZA 1RAIB 2FZGB 2L3PA 2Y4YA 2FO0A 4HKEA 2E70A 3EG3A 1YI2Q 2CH4A 1Q81C 3VS7A 5FU6B 2PVGB 2K2MA 1QMCA 1NYFA 3CCUA 2XMFA 2RB6A 3O8VA 2OAWA 1YITT 1VQMQ 3CCEQ 1B34A 4A4FA 2H3JA 2JZ2A 4XAXB 4E7IA 1VUBA 3C12A 3PMTA 3VRZA 4BB7A 3M0RA 1PKTA 3V7RA 3WXMB 3A8MB 2MIOA 4JRIA 2DTOA 2A7YA 2DL8A 2K79A 1JU5C 3EH1A 4MZTA 2KE9A 3R6OA 3PVLA 2IIMA 2KRSA 2FPFA 3CCLQ 2PUKB 3CCST 3A8LB 1H8KA 1HXDA 2K5LA 4IUUA 4CC2A 1O75A 3OSSC 2XDPA 1ZLMA 1SKUB 4M7DF 2COWA 2RJCA 5KYUA 2NUTA 2K3BA 2LC4A 1X6BA 2JTMA 1VQ4Q 2JUFA 4JLGA 2KDSA 3FJPA 3CBOA 4IUVA 3LYIA 5GAN7 1QCOA 1VQ7T 4ZGEB 3EFSA 3UF4A 4XTUA 5GJWB 4A4EA 4KGZB 4FW2A 2K57A 5KYXA 2YLBA 4UC4A 2CYZB 2P0PA 4MZPA 3X25B 1T0JA 3CCRT 2DAQA 3I55Q 2XU8A 4C5EA 3Q1JA 1ZA1B 2QXFA 3RR6A 5KE3A 1Y96B 4M77A 1QCFA 4JJCA 5GAMe 1D0XA 4A53A 1VQ9A 3JB9D 2FEIA 1R0CB 4E7KA 1KC8U 2D0QB 2L3SA 1VQLQ 2DERA 3JCMP 4MDXA 5EG2A 3UPUA 2HQEA 4NS5A 1LJOA 4M7AG 1K8AU 1ZSGA 2IPOB 4LNPA 1KHCA 4M78E 2V1RA 4PJMA 4E7ZA 3X20B 4Z8AA 2NUZA 3OYMA 3HRUA 5FW9A 1D0ZA 1UGPB 2EYZA 4OF1A 3M59A 2A36A 3IQLA 1WYXA 3NTIA 4JDSA 1VQ6Q 3I5SA 3HTRA 3QWYA 4XTZA 1JO8A 1VYUA 1Q86C 2OTLT 4C92F 2E5KA 4JPBW 2K2VA 4PKCC 3WVDB 1G3TA 2D0NA 3CXCA 1UG1A 4ZTJA 1IZ6A 2VVKA 1ZBXA 2HL3A 3E1SA 2QA4Q 3DLMA 4NL3A 1CSKA 4OMNA 4B6MA 5IXBA 2XI9A 3EGDA 4OGCA 3V8KA 3VUZA 4BI4A 3QZ9B 4C5IA 3FIFA 2QGFB 4GY5A 2L3RA 3OYDA 3SDZA 1Y57A 1LPLA 3JV3A 5HY6A 3VUBA 1EFNA 3CPFA 2I0NA 5GAOl 3JCMV 2XDBA 4BE2A 2CSIA 3UA7A 3JB9I 2FHDA 3CCUT 1BCOA 4QQDA 4BDYA 1BYMA 1TUCA 4TVRA 3ME9A 3PVQA 2ROLA 1WHGA 2RNAA 4X9DA 3M58A 2XHCA 3CC4A 1RACB 1OEBA 4IUPA 1VQ8T 1AOJA 1W70A 4M77F 4HVUA 1B07A 2ZPIB 3GIBA 2L0AA 2O4XA 2M1HA 1HJDA 4M7DG 3QIIA 2BUDA 3A8OB 3KBGA 4M75A 1UHCA 2FPEA 2VXFA 2ENMA 2RHZA 2FVUA 3OYIA 4ATOA 2CREA 3G4SQ 4C0DB 1NYGA 1Q82R 5IAYA 1YJ9A 1CKBA 4HA8A 3CCMQ 1N6AA 1M3AA 1ZQ1A 2DRMA 4L59A 5CIUA 2ZZDA 3OYGA 2EW3A 2XD0A 1QKWA 3VS2A 1QVFA 2DYIA 2ED1A 3A5ZB 1AWJA 3H8ZA 2ZPGB 1K9MR 5GJVB 2EQUA 1ZSZB 1M1KU 3URGA 3X26B 4PJJA 4Y92A 2A08A 1N9RA 2SEMA 4F04B 2M0YA 4AFZC 2ZGWA 1VQ9T 1YWPA 4MZMA 1VQ5A 1VQPA 2EVRA 1Q95G 2CP3A 2DTHA 4F7UA 4KGVB 4Q5WA 5ECAA 1Y0MA 2G6FX 3G71Q 3CMAA 3CD6A 1D3BB 1MV3A 3M57A 2D6FA 2D8JA 4E2FB 2LRQA 1K0SA 2KXCA 1YJNA
chains in the Genus database with same CATH topology
1FXXA 4RKUE 1XTDA 2E1HA 1JBMA 3M54A 3QUIA 4QVCA 3JCMe 1W2BS 1K9MC 4C92G 3GNGA 4XTYA 2EJGA 3CPWA 2XK0A 5FLXE 1KD1U 2K5FA 1DJ7B 2K4YA 3SB2A 1VQ6T 3CCJA 3QJYA 1YJWT 1Q86U 5GAMd 2WSCE 4C92E 1YIJA 5LJ5h 2YHTA 5L8RE 5DLQE 3CCRA 1VQMT 1G3YA 2CKKA 2MWOA 1VIEA 2AHJB 3G7ZA 3QYGB 4XTWA 4C92A 3TCJA 3OYNA 3CCET 1NJIU 2DVEA 2VC8A 5CO7A 4M7AB 3T9NA 3KXTA 3UWNA 4LDVA 3OW2A 2I2LA 2D9TA 2XG8D 5LJ3d 2RD1A 5HKCA 5GAOm 3M55A 2IVWA 1OZ3A 2KK4A 2RA2A 3CBPA 4QQ6A 4EMKC 2M9UA 2X4XA 2LT1A 3ER0A 4GLKA 3VKIA 2RJDA 4KULA 4BI8B 5CAIA 2HQXA 3CPWS 3QHSA 4C0FA 4JS4A 4IURA 2QTXA 3CMET 3JSCA 2LVMA 4Y91A 5GMKi 3BDUA 1M1FA 4ELYC 2BKDN 5CCAA 2JNGA 3VU3C 2K3XA 3LGFA 4ZGDB 3MEAA 3CCLT 2YRVA 3EAEA 2VXEA 4JRKA 2RHIA 3PGGA 5GMKm 3OY9A 3L2WA 3JCMh 4BDZA 4OP0A 4JJNK 4F7UB 2B8AA 3E19A 4E7JA 4OVAA 1QW1A 5GAN6 4DA4A 4M75D 3E9FA 3CCQT 4L5GA 3JB9H 4C0ZA 2MAMA 5GMKe 2LCLA 5I2MA 2RK1A 2QQSA 5GANd 3RERA 4MDWA 4JUVA 1FWZA 5KCHA 1M8VA 1M4ZA 1UGQB 2ZCFB 3HRSA 1K8AC 4HCCA 4M7DA 1X6OA 3OMCA 2EQMA 3G4SA 3OW2S 4M78F 5CQYA 5FROA 2A3LA 3ZBDA 3C4SA 5KH6A 1VQ4T 4M77G 3QPHA 2QEXA 3E9GA 4M7AF 4J7FA 2OTJT 3L2VA 1YHQA 5GAN5 1SSFA 5KE2A 1Q7YU 1IREB 2R5AA 1BI3A 2ZPHB 3CCMA 1BI0A 2P0QA 3OYJA 2XIDA 4LD6A 3QO3A 2LTOA 4B9XA 4EDUA 4X9CA 4JLIA 4M77E 4C5GA 2DJZA 5LJ5g 4JRPA 2F69A 4JS5A 4BACA 2DD5A 3A8HB 4M75C 5A0LA 5M9OA 3JRZA 3BFMA 2K3YA 1M1KC 2E6NA 3C95A 2RH2A 3RKXA 3CC4T 4EMHA 2WACA 1WJSA 4XTXA 3V8LA 4C92B 1WNLA 5CKEA 4CRIA 5IT9E 3L2UA 1ZHIA 2CZ6B 2R57A 3JCMc 2DD4A 4M78D 4PLLA 2FB7A 2RHXA 2ZPFB 3L42A 4F7UF 1U1TA 3OA6A 2E5QA 1S72A 2DZCA 4M7AD 2PUOB 1BIBA 5CK9A 3QZ5B 4Y28E 3I55T 1VQOA 3MO8A 2JOYA 3OYKA 3DLLA 4BI3A 4IUTA 3QXEB 4ELZC 1N8RU 2EYQA 3HP9A 4J6YA 1YI2A 5GMKh 2CZ1B 2E6ZA 2Y4YA 3OMGA 4ZTFA 2E12A 2VGMA 2EKOA 2DXUA 4HKEA 2E70A 1Q81C 4XU3A 2EIFA 1WJRA 3JCMg 3GP8A 1K73C 4XU0A 3RIRA 4M78C 2GQVA 5FU6B 2PVGB 1I8FA 3M53A 4HCZA 4OB0B 5FU7B 3CC7A 4A54A 3G71A 4RCBA 3CCUA 3HL8A 4M7AC 2RB6A 2G3RA 2WSEE 4QVDA 5LJ5f 3O8VA 1KD1C 2KY9A 3V7SA 5LJ5j 4M7DB 1YITT 4O6JA 2V8IA 1B34A 5IN1A 4A4FA 3CCVA 1YJ9T 2QI2A 2H3JA 4RG8A 2GF7A 2DZ9A 2JZ2A 2CGHA 3S6WA 4XAXB 2F5KA 3PNWC 2RK2A 4OB1B 4WF2A 4N4IA 3AHUA 2RO0A 3MP1A 4E7IA 2RI3A 1VUBA 3V7CA 3C12A 1YBYA 3PMTA 3M56A 4C8QA 3ASKA 4BB7A 1NJIC 4KBMB 5GAOn 5CVIA 3V7RA 3WXMB 1WPYA 1LNXA 2KMTA 3A8MB 1N27A 2DTOA 4JRIA 3BY7A 1KQ2A 2EJFA 2A7YA 4VUBA 4FU6A 2EQKA 2C06A 4N0AC 4MZTA 3QYHB 1W4SA 3OBWA 1Y96A 3R6OA 3QBYA 4BUGA 4FIBA 1VIFA 4C5HA 2GFAA 2HNIA 4RG2A 4E7LA 4B9WA 3OYHA 1GXIE 4L6V5 3JCMf 1I4K1 4XQ3A 2PUKB 3CCQA 3LGLA 3CCST 1M90U 3G6EA 3A8LB 5LL6S 1G5VA 1HXDA 2K5LA 4IUUA 4M75F 1XOVA 1O75A 2X4WA 4D6WA 3OSSC 2XDPA 4J83A 3OYEA 4EMKA 3NFCA 3L2QA 3VV0A 2QA4T 2DKGA 4C0DC 2DPPB 3HFOA 3GNFB 2V8JA 3TREA 4M7DF 3HFNA 1VQ4A 2RJCA 2X4YA 4KUDK 3OYBA 1H3ZA 5GAN8 1XNIA 2QQ9A 4PJOF 2RI5A 2LC4A 3SFMA 4BY6C 2JTMA 1MGQA 2JUFA 4JLGA 4LDUA 3LLRA 1XQHA 1JB0E 1YCYA 2KDSA 2E41A 4II1A 3FJPA 1JJ2A 2KAFA 3CBOA 3MHXA 3P8DA 4IUVA 2X35A 3CD6T 2LX9A 3LYIA 3QKJA 3X24B 3LW5E 5GAN7 3I56A 4LDXA 1VQ7T 1UEBA 4ZGEB 3EFSA 2LQ8A 2HAXA 1BI1A 4FSXA 2PU9B 3J80E 4XTUA 3CC2A 2XICA 1YJNT 5LJ5d 3JB9F 3L1AA 4A4EA 3MCAB 1Y07A 1B34B 4V2SA 2DIQA 3DKMA 5A0DA 4M7DD 2K57A 3CEYA 4DOWA 2YLBA 3MEVA 2RJFA 3LH0A 2BIVA 4UC4A 3INZA 2DTIA 2F5TX 3I55A 2NLUA 4J7IA 4C8QB 2CYZB 2P0PA 1KHIA 3OS1A 3J81E 3UT1A 5CKFA 1VQNT 1YIJT 4MZPA 4PJOD 3L2RA 4M75E 3X25B 4NOYA 3OYYA 3CCRT 2DXCA 2DAQA 3HHTB 4BE0A 2XU8A 3HKSA 1PSEA 4C5EA 5A2QE 3ZFJA 3Q1JA 2QXFA 3UDCA 5GMKj 5FU7C 4RMOA 5KE3A 1JJ2S 1VQKA 1Y96B 1N8RC 4M77A 4HCBA 5GAMe 4A53A 1VQ9A 3JB9D 3FDRA 1VQLA 4EPCA 2VV5A 1N9SA 4M7DC 3RESA 4E7KA 3P8HA 1KC8U 2D0QB 3SWNA 4A4HA 3JCMd 1OZ2A 1Y7XA 3DB4A 1MHNA 3RKWA 3JCMP 4PJOC 5C0MA 2VGNA 4MDXA 3NTKA 4EMKB 3M4YA 4M78G 5FRNA 3DB3A 5EG2A 1BKBA 2HQEA 2LNVA 4NS5A 4O5VA 3VYHB 3UPUA 1KQSS 5LJ3e 1X75C 1LJOA 2XDDA 5DY9A 4M7AG 2RJEA 1K8AU 3FC3A 2L89A 1QVGA 3X28B 3HSBA 1KHCA 4M78E 5CKDA 1TH7A 3OSVA 4PLIA 2VUBA 5FRMA 4MMLA 2OAUA 2CZ7B 4C8QF 4M7AE 3X20B 3FEOA 4M78A 1RI0A 3OYMA 3HRUA 1VQ6A 2FL7A 5J3BA 1UGPB 1YJWA 4KT0E 1PSFA 1OI1A 3M59A 4OF1A 5CQXA 3HPWA 3G4ST 3OB9A 3NTIA 5GAN2 3OS2A 5LJ3f 4JDSA 1VQMA 5CKBA 1NZ9A 2QQAA 5GAN3 5LJ3j 3FRNA 5DLOA 2QEXT 3CCEA 1YHQT 2DIGA 4QW2A 2E65A 4XTZA 3S3MA 3CCMT 3QSUA 5GANe 1Q86C 4FT4A 2OTLT 4F7UG 4C92F 5J26A 3OYCA 5GAMh 2K2VA 4PKCC 2MF2A 3MEUA 3N5BB 2XKOC 5D6XA 3WVDB 3TU4K 1G3TA 2EWNA 4R55A 3CXCA 4ZTJA 1IZ6A 4YTLA 3CCJT 3NTHA 4F7UE 1QVGS 1EIFA 1ZBXA 3E1SA 4C8QD 1M90C 4N0AA 3PFSA 2EFIA 3PTAA 1M5Q1 3DLMA 3PIPA 1OYXA 3MP8A 4OGEA 4LD9K 5D6YA 2PQWA 3CMEA 4QVZA 5DM7R 1FX7A 5GANf 4NL3A 4M77B 5LJ3h 3RMQA 5GANj 1BI2A 3PT9A 1NPRA 5A0GA 2R5MA 4XK8E 3LX7A 3CCLA 2XI9A 1WJQA 1VQNA 1VQOT 1KQSA 4OGCA 3RUXA 3SWNB 1Q82U 2L5QA 3V8KA 2JN0A 3VUZA 3OS0A 4BI4A 4C92D 1YI2T 3L2ZA 3QZ9B 4C5IA 2P0KA 2DXTA 3JCMW 3FIFA 3QJ6A 4Z02A 4GY5A 2L3RA 3OYDA 1O9SA 3SDZA 3VUBA 2KSSA 5HY6A 3RKYA 4C8QC 1WGSA 3CPFA 1QVPA 2E10A 3C94A 1V29B 3M9QA 4P5NA 5GAOl 3JCMV 2O01E 3CXCS 3GF5A 2EQJA 3GLXA 5GAOr 2XDBA 2OTJA 1VQ5T 1VQPT 4BE2A 3CC7T 3JB9I 3F70A 5GANh 2FHDA 2GFUA 3G71T 4OB3B 2RM4A 3CCUT 2ZPEB 2X4JA 2E64A 3LWIA 4M78B 1UB4A 4QQDA 4LDYA 4E47A 4BDYA 1K9MU 3CMAT 1BYMA 4C92C 2EAYA 4OB2B 3P8BB 3ME9A 4TVRA 3CCVT 5CR2A 2CS7A 3JCMQ 4X9DA 3M58A 2XHCA 5GMKl 1Q7YC 4EMGA 1VQ8T 2DK3A 4IUPA 3CC4A 5I2SA 1KQ1A 2LCCA 1UGSB 4M77F 1U1SA 1WQWA 4ZGJB 5J39A 5GAMg 4N4HA 3OBYA 3MEWA 4M75G 3FLGA 2ZPIB 3TEEA 4HT8A 3JCMX 2MI6A 3GIBA 4QQGA 2WSFE 1QP2A 2O4XA 4IKFA 2M1HA 2PVOB 4ME7A 2LT4A 2L8DA 4XTVA 4MMKA 4ZN1A 3OYFA 4M7DG 4J5YA 4X34A 5KCOA 1KC8C 3QIIA 2BUDA 3S3OA 3A8OB 2KVQG 3KBGA 2QQRA 4PJOG 2DXBA 3JB9J 4DQ2A 2V8KA 5HK0A 5LJ3g 4M75A 4DOVA 4M7DE 2HD0A 3S3NA 3JCMJ 3G6ET 2KQWA 2QDYB 3META 3EFRA 2LDMA 5FU6C 4RCCA 1WQ7A 4R56A 1G3WA 2EJ9A 2LQKA 4IUQA 1JRIA 4PJOE 3SD4A 2VXFA 1QP3A 4FL6A 4M77D 3BDLA 2RHZA 1X01A 1D3BA 2FVUA 3OS5A 4XU2A 2JVVA 4OMFB 2DO3A 3JAME 4PJOA 3OYIA 3QDRB 3JB9G 4ATOA 5AYFA 4ZN3A 3J7AF 4C0DB 1AHJB 3VJPA 1HK9A 1YITA 2JTFA 3OQ5A 5IAYA 3KUFA 2OTLA 3QG1A 3LWHA 1H641 3GPLA 2QQBA 1YJ9A 2PVDB 4HA8A 3VYGA 3PMIA 3M4GA 4NL2A 4BY6B 1N6AA 5GANg 4XU1A 2HBPA 4N4GA 2CZ0B 1ZQ1A 1KG1A 5GAMf 3I56T 5GAMj 2K5IA 4L59A 5CIUA 2P4TA 2ZZDA 4BD3A 3CC2T 4LDWA 4M77C 3OYGA 2YLCA 2MMPA 2FYKA 2IG0A 1M9SA 2RHUA 2XD0A 3A8GB 5CKHA 3JCMb 2GCXA 1QVFA 4C0GA 1G3SA 1Y71A 1I5LA 3A5ZB 2DEQA 3WVEB 3SWNC 2RHYA 4M7AA 4J6XA 3OYLA 3ZEHA 3H8ZA 4E7HA 1BIAA 2ZPGB 3M5AA 5GAOq 1U8RA 5GAN4 2EQUA 1LOJA 2MWPA 1M1KU 2ZPBB 3URGA 5LJ5e 3X26B 1W2BA 3CCSA 3MP6A 2Y4XA 1N9RA 2O4XB 2Y90A 5D6WA 1NE8A 3CBMA 2R58A 4FT2A 1VQKT 1Q82C 2QA4A 3FB9A 4JRQA 3V8JA 1P92A 1M1GA 1RL2A 4FM4B 2ZGWA 3PIOA 1VQ9T 5HK3A 4MZMA 4PL6A 1VQPA 4M75B 3RMSA 4KUIA 1VQ5A 1VQLT 4J6WA 5C6SA 1NPPA 2M0OA 1R8OB 2DTHA 2M16A 3BW1A 3H6ZA 4F7UA 4HT9A 3HRTA 4C8QG 4BE1A 4Q5WA 4CI0C 1I81A 5I21A 4A4KA 1QVFS 1UGRB 3OYAA 3CMAA 4J8OA 1S72T 3CD6A 2VYTA 1D3BB 2RI2A 4PNOA 5GAOp 3GOXA 3M57A 1Q81U 2D6FA 4PJOB 1VQ7A 4C8QE 2LRQA 1K73U 1VQ8A 4A4GA 1YJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMG A;  1Y96 B;  2E1H A;  1JBM A;  4QVC A;  3QUI A;  3JCM e;  4M77 A;  4XU3 A;  1KQ1 A;  5GAM e;  4M77 F;  1U1S A;  1WQW A;  3JCM g;  4XTY A;  4A53 A;  4C92 G;  3JB9 D;  5GAM g;  2EJG A;  1N9S A;  4M7D C;  3RES A;  4XU0 A;  4M75 G;  3RIR A;  4M78 C;  3JB9 J;  3SB2 A;  3SWN A;  1I8F A;  3JCM X;  4HT8 A;  3GIB A;  3JCM d;  4A54 A;  4RCB A;  5GAM d;  3RKW A;  4C92 E;  5LJ5 h;  2RB6 A;  4QVD A;  5LJ5 f;  2YHT A;  4MMK A;  4XTV A;  3JCM P;  4EMK B;  4M7D G;  3V7S A;  4J5Y A;  4M78 G;  5LJ5 j;  4M7D B;  4C92 A;  4XTW A;  5LJ3 e;  1B34 A;  1LJO A;  2DVE A;  4PJO G;  2VC8 A;  5DY9 A;  4DQ2 A;  4M7A G;  5LJ3 g;  2DZ9 A;  4M75 A;  2CGH A;  4M7A B;  4WF2 A;  3AHU A;  4M7D E;  3HSB A;  3JCM J;  4M78 E;  1TH7 A;  3V7C A;  3EFR A;  2I2L A;  4C8Q A;  4RCC A;  1WQ7 A;  5LJ3 d;  2RD1 A;  2EJ9 A;  4MML A;  4C8Q F;  5GAO n;  5GAO m;  1JRI A;  4M7A E;  3V7R A;  4PJO E;  2VXF A;  1WPY A;  4M77 D;  2RA2 A;  1LNX A;  4M78 A;  4JRI A;  1X01 A;  1D3B A;  2DTO A;  3BY7 A;  4XU2 A;  4EMK C;  1KQ2 A;  2EJF A;  5CAI A;  4PJO A;  4N0A C;  3JB9 G;  5GAN 2;  3QHS A;  5LJ3 f;  2QTX A;  4Y91 A;  5GMK i;  1HK9 A;  1Y96 A;  3BDU A;  5GMK m;  5LJ3 j;  5GAN 3;  2E65 A;  4XTZ A;  1H64 1;  3VU3 C;  3QSU A;  4HA8 A;  5GAN e;  2HNI A;  2VXE A;  4JRK A;  3PGG A;  3M4G A;  4NL2 A;  4C92 F;  3JCM h;  4F7U G;  4OP0 A;  4XU1 A;  1I4K 1;  4XQ3 A;  3JCM f;  4F7U B;  5GAM h;  5GAN g;  5GAM f;  5GAN 6;  1HXD A;  4M75 F;  4M75 D;  5GAM j;  3JB9 H;  2EWN A;  5GMK e;  5GAN d;  3RER A;  1M8V A;  4JUV A;  4EMK A;  4M77 C;  3JCM Q;  2YLC A;  4F7U E;  2DKG A;  2FYK A;  4C8Q D;  4M7D A;  3HFO A;  4M7D F;  3HFN A;  4N0A A;  4M78 F;  3JCM b;  1M5Q 1;  1I5L A;  5GAN 8;  2DEQ A;  3SWN C;  4M7A A;  4M77 G;  4J6X A;  5GAN f;  4PJO F;  4NL3 A;  4M7A F;  4M77 B;  1BIA A;  5LJ3 h;  5GAO q;  1MGQ A;  5GAN j;  5GAN 5;  5GAN 4;  1LOJ A;  1YCY A;  2E41 A;  3FJP A;  3RUX A;  3QO3 A;  5LJ5 e;  3SWN B;  4X9C A;  3V8K A;  4JLI A;  2JN0 A;  4M77 E;  2DJZ A;  5LJ5 g;  5GAN 7;  1N9R A;  4C92 D;  3L2Z A;  3EFS A;  4M75 C;  2DXT A;  3JCM W;  2Y90 A;  3FIF A;  3BFM A;  4XTU A;  3RKX A;  4EMH A;  5LJ5 d;  3JB9 F;  3FB9 A;  4XTX A;  3V8J A;  3L1A A;  3RKY A;  3V8L A;  4C92 B;  1WNL A;  4C8Q C;  4M7A C;  2E10 A;  1B34 B;  2ZGW A;  4V2S A;  4M75 B;  5GAO l;  3JCM V;  4M7D D;  3JCM c;  4J6W A;  2K57 A;  5GAO r;  4M78 D;  2DTH A;  2YLB A;  3BW1 A;  4F7U A;  2FB7 A;  4HT9 A;  4C8Q G;  3INZ A;  2DTI A;  4F7U F;  1U1T A;  5GAN h;  3JB9 I;  4C8Q B;  2DZC A;  1I81 A;  5I21 A;  1BIB A;  2RM4 A;  4M7A D;  4PJO D;  2E64 A;  4M75 E;  4M78 B;  4NOY A;  1D3B B;  4PNO A;  5GAO p;  4J6Y A;  4PJO B;  4PJO C;  4C92 C;  2EAY A;  4C8Q E;  5GMK h;  5GMK j;  4X9D A;  2DXU A;  5GMK l; 
#chains in the Genus database with same CATH topology
 1FXX A;  2LP5 A;  2E1H A;  4RKU E;  4QVC A;  3I9Q A;  1WDX A;  3M0T A;  4C92 G;  2JXB A;  1KD1 U;  2YUO A;  3SB2 A;  3R6N A;  1Q86 U;  5GAM d;  2WSC E;  1YN8 A;  1YIJ A;  2BE7 D;  3CCJ Q;  1M27 C;  2CDT A;  1K8A R;  1NLO C;  3AT1 B;  4XTW A;  2LZ6 B;  2RQV A;  2VC8 A;  5CO7 A;  1T0H A;  2D9T A;  5HKC A;  2IVW A;  1OZ3 A;  4RTY A;  2RA2 A;  3CBP A;  4RTT A;  3EG9 A;  2X4X A;  2HBW A;  3VKI A;  1IO6 A;  3CPW S;  4C0F A;  2QTX A;  4Y91 A;  3G1J A;  5GMK i;  3KFV A;  2K3X A;  1MUZ A;  2C0T A;  3MEA A;  3EAE A;  2VXE A;  4JRK A;  3L2W A;  4BDZ A;  3JCM h;  2JMC A;  4OVA A;  1QW1 A;  3CCQ T;  2GQI A;  4L5G A;  2HMA A;  4MDW A;  1FWZ A;  5KCH A;  4HCC A;  1WXU A;  1ZSZ C;  3OW2 S;  1U06 A;  1PKS A;  3QPH A;  4FW1 A;  4M77 G;  3E9G A;  1YHQ A;  1Q81 R;  2LX7 A;  2R5A A;  4LE9 A;  3OYJ A;  2XID A;  1TU0 B;  4C5G A;  5LJ5 g;  4RUG A;  1SRL A;  5A0L A;  5M9O A;  3JRZ A;  2K3Y A;  3C95 A;  3CC4 T;  3E2U A;  2WAC A;  1WJS A;  1NEB A;  4C92 B;  1ACM B;  1X69 A;  3REA B;  3NHN A;  3EHQ A;  4M78 D;  4CC7 A;  3UA6 A;  2JW4 A;  4F7U F;  1JJ2 P;  2DZC A;  3QZ5 B;  4Y28 E;  1C0M A;  2CUB A;  3EGX A;  2JOY A;  3OYK A;  4IUT A;  4J6Y A;  1YI2 A;  3OMG A;  1VQO Q;  4ZTF A;  4PK4 A;  2NUP B;  2EGE A;  2HZY A;  2DXU A;  2QDL A;  1PD1 A;  5FWB A;  2EBP A;  1K73 C;  1UHF A;  4D8K A;  4XU0 A;  1KQS P;  4M78 C;  3M53 A;  2G3R A;  4QVD A;  5LJ5 f;  1UEC A;  1ABQ A;  1GFC A;  2GGR A;  5LJ5 j;  2LQN A;  4O6J A;  2V8I A;  5IN1 A;  1YJ9 T;  1NG2 A;  2DZ9 A;  3S6W A;  3PNW C;  4WF2 A;  2RK2 A;  3AHU A;  2LJ3 A;  2HSP A;  4C8Q A;  3ASK A;  1NJI C;  1MMG A;  5GAO n;  5CVI A;  1WPY A;  1LNX A;  2KMT A;  2C06 A;  4N0A C;  1KJW A;  3OBW A;  3QBY A;  1M3B A;  3CME Q;  4BUG A;  1VIF A;  2GFA A;  1QVG P;  4E7L A;  1GXI E;  4XQ3 A;  3LGL A;  2F2V A;  4D6W A;  1QVF P;  4AG1 C;  2LJ1 A;  2PTK A;  3NFC A;  4RTX A;  2DPP B;  3HFO A;  2V8J A;  1VQ4 A;  2DL7 A;  2KYM A;  4PJO F;  4BY6 C;  1AZE A;  4IIM A;  4LDU A;  1I07 A;  1K4U S;  2DJQ A;  1YCY A;  2J05 A;  2E41 A;  3QWX X;  4II1 A;  2KAF A;  3CD6 T;  2W0Z A;  4KH1 B;  4LDX A;  1UEB A;  1PWT A;  2LQ8 A;  2E3I A;  1D1B A;  1BI1 A;  2HAX A;  2YRD A;  4IIO A;  6AT1 B;  2PU9 B;  4FYX B;  3CC2 A;  4RTW A;  3I56 Q;  1YJN T;  1RLQ C;  2DF6 A;  1SPK A;  3MCA B;  3H9N A;  2DIQ A;  1V76 A;  4DOW A;  2JJ9 A;  2DTI A;  3I55 A;  1YIJ T;  3L2R A;  4OMQ A;  3HHT B;  3HKS A;  2YXY A;  3M0Q A;  1N8R C;  2GTJ A;  4FSS A;  1TSF A;  1VQL A;  1MMA A;  1Q86 R;  2KT1 A;  3P8H A;  3SWN A;  1SHG A;  5KYW B;  2AIR B;  2RQT A;  1OZ2 A;  1Y7X A;  3DB4 A;  1HD3 A;  3VS3 A;  4DEX A;  3NTK A;  4EMK B;  5IH2 A;  3DB3 A;  2LNV A;  1YIT Q;  5DY9 A;  2L89 A;  1F1B B;  3HSB A;  4C8Q F;  4M7A E;  4M78 A;  1VQ6 A;  1SF9 A;  1SHF A;  2FL7 A;  1PSF A;  4X1V A;  2O31 A;  2D8H A;  3OB9 A;  5LJ3 f;  4JJD A;  1YJW Q;  2QQA A;  5GAN 3;  2CP7 A;  3FRN A;  5LJ3 j;  1YHQ T;  1YNZ A;  2DIG A;  4QW2 A;  2E65 A;  3S3M A;  4F17 A;  3QSU A;  1QKX A;  4F7U G;  3OYC A;  1IB8 A;  3N5B B;  1I1J A;  2J6F A;  1IHV A;  4GLM A;  1M90 C;  4N0A A;  3PFS A;  3PTA A;  2DM1 A;  3PIP A;  4OGE A;  3MP8 A;  2PQW A;  4QVZ A;  5GAN f;  4EIK A;  2ATC B;  5LJ3 h;  5GAN j;  1NPR A;  1WJQ A;  1EZZ B;  1WA7 A;  1VQN A;  1MMD A;  3RUX A;  1Q82 U;  2L5Q A;  4HVV A;  2BTT A;  3L2Z A;  1YI2 T;  2AZS A;  1O9S A;  4J9G A;  3ULR B;  3RKY A;  3TVT A;  1WGS A;  3M9Q A;  5GAO r;  3GLX A;  1X43 A;  1WIE A;  3F70 A;  3NGP A;  5GAN h;  2DMO A;  1W2B P;  2ZPE B;  2OTJ Q;  3VS5 A;  4LDY A;  1K9M U;  3P8B B;  5CR2 A;  2CS7 A;  3JCM Q;  1WX6 A;  2DK3 A;  2GBQ A;  1TWB A;  1KQ1 A;  1UGS B;  1WHJ A;  1U1S A;  3OBY A;  3MEW A;  1TG0 A;  3TEE A;  4HT8 A;  3JCM X;  4DEY A;  1X2Q A;  1QP2 A;  2HDA A;  4ME7 A;  1HYO A;  2YWW A;  4XTV A;  4MMK A;  3OYF A;  4J5Y A;  1SEM A;  2KVQ G;  1XJW B;  4PJO G;  1E7O A;  2K7A A;  4DOV A;  4M7D E;  2RN8 A;  5FU6 C;  3MET A;  3EFR A;  1WQ7 A;  2YDL A;  2EJ9 A;  4AFQ C;  4FL6 A;  3BDL A;  1X01 A;  4XU2 A;  3EG0 A;  3QDR B;  5AYF A;  2EPD A;  1VOM A;  1H64 1;  2PVD B;  2HL5 C;  2CZ0 B;  2OTL Q;  4FYY B;  1RAF B;  1PNJ A;  4GBQ A;  2P4T A;  4BD3 A;  3CC2 T;  3SHW A;  1UJ0 A;  1B3Q A;  1TOV A;  1M9S A;  2RHU A;  3LH5 A;  4JJB A;  4C0G A;  2RHY A;  2ABL A;  3M5A A;  2LJ0 A;  1HSQ A;  1LOJ A;  1V1C A;  3CQT A;  1GL5 A;  5LJ5 e;  1B7T A;  1GCP A;  2F1L A;  5D6W A;  3ZL7 C;  2PNI A;  2R58 A;  1RAG B;  1RL2 A;  1G8X A;  2ED0 A;  2MK5 A;  4PL6 A;  1VQL T;  4J6W A;  5C6S A;  4QKU A;  1R8O B;  3H6Z A;  1NBE B;  4C8Q G;  1WZO A;  4CI0 C;  5I21 A;  4A4K A;  1S72 T;  1RAA B;  1Q81 U;  4PJO B;  1JBM A;  3QUI A;  1VQ8 Q;  1J3T A;  3GNG A;  3CPW A;  2PZ1 A;  1M2V A;  2K5F A;  4D8D A;  1VQ6 T;  3CCJ A;  1KIK A;  1K76 A;  4C92 E;  5IHI A;  1WHM A;  2LMJ A;  2MWO A;  3TCJ A;  1UGV A;  4M7A B;  4PFP A;  8ATC B;  3OW2 A;  3O5Z A;  2EYX A;  2RD1 A;  1ZUY A;  1ABO A;  3M55 A;  1PRM C;  1D09 B;  1C6V X;  2LT1 A;  4GLK A;  4DBQ A;  2RJD A;  3BE3 A;  2LVM A;  3M0P A;  1M1F A;  3THK A;  1BB9 A;  2ESW A;  3RBB B;  1A0N B;  4ZGD B;  1D0Y A;  3OY9 A;  1VQN T;  5GMK m;  5FWC A;  4OP0 A;  4JJN K;  4DA4 A;  3JB9 H;  1OX8 A;  2RQR A;  1M4Z A;  1UGQ B;  2ZCF B;  4E7S A;  2EQM A;  2RQW A;  1K9A A;  3C4S A;  5KH6 A;  3EH2 A;  1JQQ A;  1MMN A;  4PJL A;  5KE2 A;  1K73 R;  2CP6 A;  2K9G A;  4LXC A;  2QEX Q;  3QO3 A;  2DRK A;  1QWE A;  2V1Q A;  4JLI A;  4M77 E;  4X9C A;  2DJZ A;  4JRP A;  4JS5 A;  2KT8 A;  1IHW A;  2DA9 A;  5KYN A;  2YUN A;  4XTX A;  3V8L A;  5IT9 E;  4OMP A;  1YP5 A;  3VS4 A;  3L2U A;  2COZ A;  3JCM c;  1VQ9 Q;  2DD4 A;  2O88 A;  1RAH B;  5KYY B;  2FB7 A;  3L42 A;  3OA6 A;  2CT3 A;  3M0S A;  4M7A D;  1NJI R;  4AG2 C;  1VQO A;  1D1C A;  1YWO A;  2AZV A;  3GBQ A;  3QXE B;  2EYQ A;  5GMK h;  1YCS B;  1LVK A;  2EKO A;  5IHN A;  2DBK A;  1EX4 A;  3JCM g;  3GP8 A;  1R77 A;  5FU7 B;  2GQV A;  2E4H A;  1I8F A;  4AT1 B;  4A54 A;  2O9S A;  4RCB A;  1M2O A;  3HL8 A;  1M3C A;  4M7A C;  2WSE E;  1C1A A;  1OPK A;  3V7S A;  3CC7 Q;  4M7D B;  4N4I A;  2RO0 A;  4LUE A;  3MP1 A;  2RI3 A;  1QLY A;  3V7C A;  3CCV Q;  1YBY A;  4KBM B;  3EFO B;  1N27 A;  1KQ2 A;  1JEG A;  4FU6 A;  2EQK A;  1W4S A;  1Y96 A;  2JMA A;  4FIB A;  2HNI A;  4L6V 5;  3JCM f;  3G6E A;  5LL6 S;  4M75 F;  1TXQ A;  2EKH A;  4WCI A;  3CCQ Q;  4J83 A;  3OYE A;  3L2Q A;  3VV0 A;  2DKG A;  4C0D C;  1OUL A;  4ESR A;  2X4Y A;  4KUD K;  3OYB A;  1H3Z A;  5GAN 8;  1XNI A;  2DL4 A;  3MKD A;  1N8R R;  3LLR A;  1XQH A;  3P8D A;  3X24 B;  3I56 A;  2AKL A;  3CXC P;  2KRM A;  1ZUU A;  3H0F A;  5LJ5 d;  3JB9 F;  3L1A A;  2D1X A;  1Y07 A;  1B34 B;  3DKM A;  5A0D A;  4M7D D;  3MEV A;  2RJF A;  3INZ A;  2F5T X;  3CCJ T;  2NLU A;  1KHI A;  3OS1 A;  3J81 E;  3UT1 A;  4M75 E;  2SRC A;  3OYY A;  1AVZ C;  4BE0 A;  1PSE A;  2FZK B;  5A2Q E;  2Z0W A;  3ZFJ A;  1BCM A;  5FU7 C;  1JJ2 S;  2O9V A;  4HCB A;  1VQK Q;  2VV5 A;  4M7D C;  1RLP C;  3RES A;  1G83 A;  4J9E A;  2CH4 W;  1N5Z A;  1AWO A;  1MHN A;  3RKW A;  2VGN A;  3M4Y A;  2C0O A;  5FRN A;  3EGU A;  1WHH A;  3VYH B;  1KQS S;  1X75 C;  1OX9 A;  1GRI A;  5KYU B;  3FC3 A;  4OMO A;  2NUT B;  1YJ9 Q;  3NPF A;  5CKD A;  3OSV A;  4KH0 B;  4KRT A;  3VS0 A;  5FRM A;  2X3W D;  4MML A;  2CZ7 B;  3FEO A;  1RI0 A;  1I5O B;  1YJW A;  4KT0 E;  2GTO A;  2KNB B;  5CQX A;  2P84 A;  3OS2 A;  1UE9 A;  5CKB A;  1NZ9 A;  1VQM A;  3CCE A;  5KYX B;  5J26 A;  5GAM h;  2MF2 A;  3MEU A;  5D6X A;  3TU4 K;  2L2P A;  4R55 A;  2VB6 A;  1PG5 B;  2DVJ A;  2DEU A;  4WTO B;  4F7U E;  1QVG S;  2DX1 A;  1M5Q 1;  4LD9 K;  5D6Y A;  1FX7 A;  4R0K A;  4M77 B;  3RMQ A;  1NLP C;  2R5M A;  3CCL A;  3A98 A;  1VQO T;  3NMZ C;  1IGU A;  3CD6 Q;  2X9H A;  4C92 D;  4Z02 A;  3UAT A;  1FMV A;  1X6G A;  1QVP A;  4P5N A;  1WLP B;  3GF5 A;  2OTJ A;  2JM9 A;  2QK0 A;  1VQP T;  1VQ5 T;  1K0X A;  2GFU A;  3LWI A;  2BE9 B;  1YIJ Q;  1W6X A;  5I22 A;  4HCK A;  4E47 A;  3CMA T;  4C92 C;  4HXJ A;  1Q7Y C;  5GMK l;  5I2S A;  4ZGJ B;  1ZSZ A;  1M30 A;  4N4H A;  4M75 G;  4QQG A;  2WSF E;  4IKF A;  3PE0 A;  2O2O A;  2L8D A;  2C0I A;  1AEY A;  5KCO A;  2HKN A;  2ZAE A;  1KC8 C;  3S3O A;  2QQR A;  2EYW A;  2J6O A;  2DXB A;  4DQ2 A;  2V8K A;  5HK0 A;  5LJ3 g;  1SRM A;  2EQI A;  3TSW A;  1TUG B;  2AKK A;  3EG2 A;  3G6E T;  2KQW A;  2VKN A;  4R56 A;  2BZY A;  1G3W A;  2LQK A;  3EGD B;  1JRI A;  4PJO E;  3SD4 A;  4M77 D;  1QP3 A;  1PM3 A;  8AT1 B;  1D3B A;  3OS5 A;  2JVV A;  4OMF B;  3JAM E;  1WHK A;  3JB9 G;  3I5R A;  2F2W A;  1AHJ B;  1HK9 A;  3OQ5 A;  3KUF A;  2OTL A;  3GPL A;  3VYG A;  3PMI A;  3M4G A;  4NL2 A;  5GAN g;  4XU1 A;  4N4G A;  2QG9 B;  3I56 T;  2GNC A;  2K5I A;  4CC4 B;  4DBR A;  4M77 C;  2MMP A;  1FYN A;  2B86 A;  5CKH A;  3JCM b;  2GCX A;  2OI3 A;  1G3S A;  3WVE B;  2DLP A;  4J6X A;  3OYL A;  3ZEH A;  4E7H A;  5GAO q;  5GAN 4;  2MWP A;  2DBM A;  3MP6 A;  2O4X B;  4PJN A;  4RTV A;  3CCS Q;  2QA4 A;  4PFZ A;  4JRQ A;  1P92 A;  4FM4 B;  3PIO A;  1AZG B;  4M75 B;  4ZNX A;  4KUI A;  3RMS A;  1NPP A;  2M0O A;  3BW1 A;  2M16 A;  3HRT A;  4BE1 A;  3RNJ A;  1RUW A;  1BBZ A;  9ATC B;  1RI9 A;  5GAO p;  4J9C A;  4C8Q E;  1K73 U;  1VQ8 A;  1GCQ C;  1W2B S;  3M54 A;  1VQ7 Q;  3JCM e;  2E3H A;  2JM8 A;  3VS1 A;  5FLX E;  3QJY A;  1YJW T;  1ZA2 B;  2P4R A;  1W1F A;  2YHT A;  1K1Z A;  1VQM T;  2DL3 A;  3CCE T;  4C92 A;  2EGC A;  1NJI U;  3CCR Q;  2CSQ A;  3T9N A;  1E6G A;  2VWF A;  2KGT A;  3UWN A;  3SEM A;  1KSW A;  3H0I A;  2KK4 A;  4EMK C;  2M9U A;  3ER0 A;  2COY A;  3EG1 A;  4BI8 B;  5CAI A;  4KUL A;  4FYW B;  3QHS A;  2NUP A;  3VS6 A;  3I35 A;  3JSC A;  1T3L A;  3BDU A;  2BKD N;  2JNG A;  3VU3 C;  1TTH B;  3CCL T;  2YRV A;  2RHI A;  4FYV B;  1IRX A;  4F7U B;  4J9B A;  3E19 A;  4E7J A;  5GAN 6;  2M02 A;  4M75 D;  2CT4 A;  2MAM A;  5I2M A;  2RK1 A;  2QQS A;  1M8V A;  4JUV A;  2ECZ A;  1T3S A;  2L3Q A;  5IHK A;  3CC2 Q;  3G4S A;  4M78 F;  4CC3 A;  2H3E B;  2NWM A;  3ZBD A;  1VQ4 T;  2QEX A;  2OTJ T;  4J7F A;  3L2V A;  5GAN 5;  1SSF A;  1Q7Y U;  2ZPH B;  1BI3 A;  3CCM A;  1BI0 A;  2P0Q A;  1CKA A;  2AT1 B;  2V26 A;  4LD6 A;  3RDV A;  2CUD A;  1X2K A;  1GBQ A;  4M75 C;  3A8H B;  3BFM A;  2EGA A;  1M1K C;  2E6N A;  2YUQ A;  3RKX A;  2KR3 A;  4EMH A;  1OV3 A;  1NM7 A;  1ZHI A;  2A37 A;  2CZ6 B;  2R57 A;  1QCN A;  1ZUK A;  1U1T A;  2KYB A;  2E5Q A;  1PD0 A;  1PCX A;  2PUO B;  5CK9 A;  3I55 T;  3MO8 A;  4BI3 A;  3EG9 B;  4ELZ C;  1S72 Q;  1N8R U;  1TS9 A;  2E12 A;  2VGM A;  2CP5 A;  4XU3 A;  2EIF A;  1WJR A;  2A28 A;  3RIR A;  1UFF A;  3JB9 J;  4HCZ A;  4OB0 B;  3CC7 A;  3G71 A;  4AMC A;  1KD1 C;  2KY9 A;  3CCU Q;  1GCQ A;  3CCV A;  2QI2 A;  4RG8 A;  2GF7 A;  2CGH A;  1H3H A;  2QAZ A;  2BZ8 A;  2F5K A;  4OB1 B;  2JS0 A;  2QGG A;  3M56 A;  1BU1 A;  4E6R A;  2KBT A;  3BY7 A;  2EJF A;  4VUB A;  2DET A;  3QYH B;  2YT6 A;  4C5H A;  2LQW A;  4RG2 A;  4B9W A;  3OYH A;  1I4K 1;  3CCQ A;  1VQN Q;  2DL5 A;  1M90 U;  1G5V A;  5KYW A;  1XOV A;  2W10 A;  2X4W A;  3EGX B;  4EMK A;  1AD5 A;  2QA4 T;  1Z9Q A;  1JXM A;  1VYT A;  3GNF B;  3C0C A;  3TRE A;  3HFN A;  2KXD A;  2QQ9 A;  1WXB A;  2RI5 A;  2QAS A;  4J9H A;  3SFM A;  1MGQ A;  1Z9Z A;  4OML A;  2FG0 A;  1JB0 E;  2RMO A;  2F2X A;  1JJ2 A;  3MHX A;  2X35 A;  4Z89 A;  2LX9 A;  3QKJ A;  3LW5 E;  4J9I A;  4ANJ A;  4A63 B;  1NEG A;  4FSX A;  3J80 E;  2XIC A;  3FJ5 A;  3VRY A;  2DFU A;  4V2S A;  2NYS A;  2FRY A;  3CEY A;  1FMK A;  3LH0 A;  2BIV A;  1KQS A;  4J7I A;  4C8Q B;  4JZ4 A;  4PJO D;  5CKF A;  4NOY A;  2AK5 A;  4RTU A;  2DXC A;  1IGQ A;  3UDC A;  5GMK j;  2FZC B;  1VQK A;  4RMO A;  1UJY A;  2JS2 A;  5AT1 B;  3FDR A;  4EPC A;  1N9S A;  1X27 A;  1UUE A;  2JTE A;  1I0C A;  4A4H A;  3JCM d;  2M51 A;  2YRC A;  4PJO C;  2MOX A;  5C0M A;  1MV0 B;  2HKQ B;  4M78 G;  1BKB A;  4O5V A;  4Z88 A;  5LJ3 e;  1WI7 A;  2XDD A;  2RJE A;  1QVG A;  4JZ3 A;  3X28 B;  5IXF A;  1TH7 A;  1YFN A;  4PLI A;  2VUB A;  4OMM A;  4QT7 A;  2OAU A;  3REB B;  2EYY A;  3MJX A;  2YSQ A;  5J3B A;  1FMW A;  1OI1 A;  3EHR A;  3G4S T;  1VYV A;  3HPW A;  5GAN 2;  2CP0 A;  4RTZ A;  2QEX T;  1U3O A;  5DLO A;  3TQ7 P;  3CCM T;  5GAN e;  4FT4 A;  1SG5 A;  2XKO C;  5HCK A;  4AFS C;  2CP2 A;  2EWN A;  4YTL A;  1ZX6 A;  3NTH A;  1EIF A;  4C8Q D;  4PFO A;  2EFI A;  1OYX A;  2KRO A;  3CME A;  1Q7Y R;  5DM7 R;  1BI2 A;  3PT9 A;  1IXD A;  5A0G A;  4XK8 E;  1MNE A;  3LX7 A;  1R0B G;  5L23 A;  2X3X D;  2FPD A;  3SWN B;  1ARK A;  2JN0 A;  3OS0 A;  3M0U A;  3TSZ A;  2KEA A;  2P0K A;  2MPX C;  2DXT A;  3JCM W;  3QJ6 A;  1QWF A;  2JT4 A;  4FCY A;  2KSS A;  1KC8 R;  4M4Z A;  4C8Q C;  2E10 A;  3C94 A;  1V29 B;  1UDL A;  3CXC S;  2O01 E;  2EQJ A;  1PC0 A;  3CC7 T;  3G71 T;  1WHL A;  2RM4 A;  4OB3 B;  2X4J A;  2E64 A;  4M78 B;  1PRL C;  1UB4 A;  1E6H A;  2EAY A;  4OB2 B;  1M8M A;  3CCV T;  1RAE B;  3A1P A;  4EMG A;  2OJ2 A;  1H92 A;  2LCC A;  1WQW A;  1QQJ A;  5J39 A;  2OX7 A;  5GAM g;  2DE0 X;  7AT1 B;  3CC4 Q;  3FLG A;  1TUD A;  2MI6 A;  4LN2 A;  2PVO B;  2LT4 A;  1AT1 B;  2ROT A;  4ZN1 A;  4X34 A;  2BZX A;  3U23 A;  2HD0 A;  3S3N A;  3JCM J;  3CPW P;  2QDY B;  2LDM A;  4RCC A;  4IUQ A;  1SSH A;  2DNU A;  4K11 A;  4DBF A;  2DO3 A;  4PJO A;  1OPL A;  4ZN3 A;  3J7A F;  3VJP A;  1YIT A;  2JTF A;  1S1N A;  3QG1 A;  3LWH A;  1D1A A;  2QQB A;  1M90 R;  5I11 A;  1OU8 A;  4BY6 B;  2HBP A;  3OW2 P;  1KG1 A;  5GAM f;  5GAM j;  2K6D A;  3H0H A;  4LDW A;  2YLC A;  1G2B A;  2FYK A;  2IG0 A;  1UTI A;  1VA7 A;  2MYS A;  3A8G B;  1Y71 A;  1WFW A;  1I5L A;  2DEQ A;  3SWN C;  4M7A A;  2LCS A;  1BIA A;  1U8R A;  2ZPB B;  1OOT A;  1AWW A;  1W2B A;  1LCK A;  3CCS A;  2Y4X A;  5EC7 A;  2Y90 A;  1MND A;  1NE8 A;  3CBM A;  4FT2 A;  4ORZ A;  1VQK T;  2J06 A;  1Q82 C;  3FB9 A;  3V8J A;  1M1G A;  2QTV A;  4DBH A;  5HK3 A;  1AWX A;  4HT9 A;  3MPU B;  2KI7 A;  4J9F A;  1VQP Q;  1I81 A;  1VQ5 Q;  1QVF S;  2QYZ A;  1UGR B;  2RQU A;  5D7U A;  3OYA A;  4J8O A;  2VYT A;  2RI2 A;  1ZBJ A;  4PNO A;  3D7S B;  3GOX A;  1GFD A;  2HEQ A;  1VQ7 A;  2X51 A;  2RPN A;  3CMA Q;  2KRN A;  4A4G A;  2A0F B;  1XTD A;  1K9M C;  2J6K A;  1KK7 A;  3QDF A;  4XTY A;  1RAB B;  2EJG A;  1YJN Q;  2XK0 A;  1DJ7 B;  2K4Y A;  1PHT A;  2DIL A;  1RAD B;  5LJ5 h;  5L8R E;  5DLQ E;  3CCR A;  4J9D A;  2FRW A;  4LUD A;  1G3Y A;  2CKK A;  3G7Z A;  1VIE A;  2AHJ B;  3QYG B;  3OYN A;  2DVE A;  2MCN A;  1BK2 A;  3KXT A;  5KYY A;  4LDV A;  2HSE B;  2I2L A;  2XG8 D;  5LJ3 d;  3H41 A;  3G6E Q;  2DYB A;  5GAO m;  1GBR A;  4QQ6 A;  4F14 A;  1OQK A;  2HQX A;  4JS4 A;  1M1K R;  4IUR A;  3CME T;  4ELY C;  5CCA A;  3LGF A;  3PGG A;  1WXT A;  2B8A A;  2VAS A;  3E9F A;  4C0Z A;  5GMK e;  2LCL A;  5GAN d;  3RER A;  2HQH A;  3HRS A;  1K8A C;  4M7D A;  1X6O A;  3OMC A;  5CQY A;  2HCK A;  5FRO A;  2A3L A;  2LNH B;  4AFU C;  1KFZ A;  2J7I A;  4M7A F;  1OU9 A;  2YUP A;  1IRE B;  1M2V B;  2LTO A;  3EFO A;  4B9X A;  4EDU A;  1JXO A;  1YHQ Q;  2F69 A;  4KGX B;  4BAC A;  2DD5 A;  2RH2 A;  1KD1 R;  1WNL A;  5CKE A;  4CRI A;  2H8H A;  1U5S A;  2RF0 A;  4PLL A;  2RHX A;  2ZPF B;  1S72 A;  1BIB A;  4F16 A;  4HVW A;  3DLL A;  3HP9 A;  2CZ1 B;  2E6Z A;  1RAI B;  2FZG B;  2L3P A;  2Y4Y A;  2FO0 A;  4HKE A;  2E70 A;  3EG3 A;  1YI2 Q;  2CH4 A;  1Q81 C;  3VS7 A;  5FU6 B;  2PVG B;  2K2M A;  1QMC A;  1NYF A;  3CCU A;  2XMF A;  2RB6 A;  3O8V A;  2OAW A;  1YIT T;  1VQM Q;  3CCE Q;  1B34 A;  4A4F A;  2H3J A;  2JZ2 A;  4XAX B;  4E7I A;  1VUB A;  3C12 A;  3PMT A;  3VRZ A;  4BB7 A;  3M0R A;  1PKT A;  3V7R A;  3WXM B;  3A8M B;  2MIO A;  4JRI A;  2DTO A;  2A7Y A;  2DL8 A;  2K79 A;  1JU5 C;  3EH1 A;  4MZT A;  2KE9 A;  3R6O A;  3PVL A;  2IIM A;  2KRS A;  2FPF A;  3CCL Q;  2PUK B;  3CCS T;  3A8L B;  1H8K A;  1HXD A;  2K5L A;  4IUU A;  4CC2 A;  1O75 A;  3OSS C;  2XDP A;  1ZLM A;  1SKU B;  4M7D F;  2COW A;  2RJC A;  5KYU A;  2NUT A;  2K3B A;  2LC4 A;  1X6B A;  2JTM A;  1VQ4 Q;  2JUF A;  4JLG A;  2KDS A;  3FJP A;  3CBO A;  4IUV A;  3LYI A;  5GAN 7;  1QCO A;  1VQ7 T;  4ZGE B;  3EFS A;  3UF4 A;  4XTU A;  5GJW B;  4A4E A;  4KGZ B;  4FW2 A;  2K57 A;  5KYX A;  2YLB A;  4UC4 A;  2CYZ B;  2P0P A;  4MZP A;  3X25 B;  1T0J A;  3CCR T;  2DAQ A;  3I55 Q;  2XU8 A;  4C5E A;  3Q1J A;  1ZA1 B;  2QXF A;  3RR6 A;  5KE3 A;  1Y96 B;  4M77 A;  1QCF A;  4JJC A;  5GAM e;  1D0X A;  4A53 A;  1VQ9 A;  3JB9 D;  2FEI A;  1R0C B;  4E7K A;  1KC8 U;  2D0Q B;  2L3S A;  1VQL Q;  2DER A;  3JCM P;  4MDX A;  5EG2 A;  3UPU A;  2HQE A;  4NS5 A;  1LJO A;  4M7A G;  1K8A U;  1ZSG A;  2IPO B;  4LNP A;  1KHC A;  4M78 E;  2V1R A;  4PJM A;  4E7Z A;  3X20 B;  4Z8A A;  2NUZ A;  3OYM A;  3HRU A;  5FW9 A;  1D0Z A;  1UGP B;  2EYZ A;  4OF1 A;  3M59 A;  2A36 A;  3IQL A;  1WYX A;  3NTI A;  4JDS A;  1VQ6 Q;  3I5S A;  3HTR A;  3QWY A;  4XTZ A;  1JO8 A;  1VYU A;  1Q86 C;  2OTL T;  4C92 F;  2E5K A;  4JPB W;  2K2V A;  4PKC C;  3WVD B;  1G3T A;  2D0N A;  3CXC A;  1UG1 A;  4ZTJ A;  1IZ6 A;  2VVK A;  1ZBX A;  2HL3 A;  3E1S A;  2QA4 Q;  3DLM A;  4NL3 A;  1CSK A;  4OMN A;  4B6M A;  5IXB A;  2XI9 A;  3EGD A;  4OGC A;  3V8K A;  3VUZ A;  4BI4 A;  3QZ9 B;  4C5I A;  3FIF A;  2QGF B;  4GY5 A;  2L3R A;  3OYD A;  3SDZ A;  1Y57 A;  1LPL A;  3JV3 A;  5HY6 A;  3VUB A;  1EFN A;  3CPF A;  2I0N A;  5GAO l;  3JCM V;  2XDB A;  4BE2 A;  2CSI A;  3UA7 A;  3JB9 I;  2FHD A;  3CCU T;  1BCO A;  4QQD A;  4BDY A;  1BYM A;  1TUC A;  4TVR A;  3ME9 A;  3PVQ A;  2ROL A;  1WHG A;  2RNA A;  4X9D A;  3M58 A;  2XHC A;  3CC4 A;  1RAC B;  1OEB A;  4IUP A;  1VQ8 T;  1AOJ A;  1W70 A;  4M77 F;  4HVU A;  1B07 A;  2ZPI B;  3GIB A;  2L0A A;  2O4X A;  2M1H A;  1HJD A;  4M7D G;  3QII A;  2BUD A;  3A8O B;  3KBG A;  4M75 A;  1UHC A;  2FPE A;  2VXF A;  2ENM A;  2RHZ A;  2FVU A;  3OYI A;  4ATO A;  2CRE A;  3G4S Q;  4C0D B;  1NYG A;  1Q82 R;  5IAY A;  1YJ9 A;  1CKB A;  4HA8 A;  3CCM Q;  1N6A A;  1M3A A;  1ZQ1 A;  2DRM A;  4L59 A;  5CIU A;  2ZZD A;  3OYG A;  2EW3 A;  2XD0 A;  1QKW A;  3VS2 A;  1QVF A;  2DYI A;  2ED1 A;  3A5Z B;  1AWJ A;  3H8Z A;  2ZPG B;  1K9M R;  5GJV B;  2EQU A;  1ZSZ B;  1M1K U;  3URG A;  3X26 B;  4PJJ A;  4Y92 A;  2A08 A;  1N9R A;  2SEM A;  4F04 B;  2M0Y A;  4AFZ C;  2ZGW A;  1VQ9 T;  1YWP A;  4MZM A;  1VQ5 A;  1VQP A;  2EVR A;  1Q95 G;  2CP3 A;  2DTH A;  4F7U A;  4KGV B;  4Q5W A;  5ECA A;  1Y0M A;  2G6F X;  3G71 Q;  3CMA A;  3CD6 A;  1D3B B;  1MV3 A;  3M57 A;  2D6F A;  2D8J A;  4E2F B;  2LRQ A;  1K0S A;  2KXC A;  1YJN A; 
#chains in the Genus database with same CATH homology
 1FXX A;  4RKU E;  1XTD A;  2E1H A;  1JBM A;  3M54 A;  3QUI A;  4QVC A;  3JCM e;  1W2B S;  1K9M C;  4C92 G;  3GNG A;  4XTY A;  2EJG A;  3CPW A;  2XK0 A;  5FLX E;  1KD1 U;  2K5F A;  1DJ7 B;  2K4Y A;  3SB2 A;  1VQ6 T;  3CCJ A;  3QJY A;  1YJW T;  1Q86 U;  5GAM d;  2WSC E;  4C92 E;  1YIJ A;  5LJ5 h;  2YHT A;  5L8R E;  5DLQ E;  3CCR A;  1VQM T;  1G3Y A;  2CKK A;  2MWO A;  1VIE A;  2AHJ B;  3G7Z A;  3QYG B;  4XTW A;  4C92 A;  3TCJ A;  3OYN A;  3CCE T;  1NJI U;  2DVE A;  2VC8 A;  5CO7 A;  4M7A B;  3T9N A;  3KXT A;  3UWN A;  4LDV A;  3OW2 A;  2I2L A;  2D9T A;  2XG8 D;  5LJ3 d;  2RD1 A;  5HKC A;  5GAO m;  3M55 A;  2IVW A;  1OZ3 A;  2KK4 A;  2RA2 A;  3CBP A;  4QQ6 A;  4EMK C;  2M9U A;  2X4X A;  2LT1 A;  3ER0 A;  4GLK A;  3VKI A;  2RJD A;  4KUL A;  4BI8 B;  5CAI A;  2HQX A;  3CPW S;  3QHS A;  4C0F A;  4JS4 A;  4IUR A;  2QTX A;  3CME T;  3JSC A;  2LVM A;  4Y91 A;  5GMK i;  3BDU A;  1M1F A;  4ELY C;  2BKD N;  5CCA A;  2JNG A;  3VU3 C;  2K3X A;  3LGF A;  4ZGD B;  3MEA A;  3CCL T;  2YRV A;  3EAE A;  2VXE A;  4JRK A;  2RHI A;  3PGG A;  5GMK m;  3OY9 A;  3L2W A;  3JCM h;  4BDZ A;  4OP0 A;  4JJN K;  4F7U B;  2B8A A;  3E19 A;  4E7J A;  4OVA A;  1QW1 A;  5GAN 6;  4DA4 A;  4M75 D;  3E9F A;  3CCQ T;  4L5G A;  3JB9 H;  4C0Z A;  2MAM A;  5GMK e;  2LCL A;  5I2M A;  2RK1 A;  2QQS A;  5GAN d;  3RER A;  4MDW A;  4JUV A;  1FWZ A;  5KCH A;  1M8V A;  1M4Z A;  1UGQ B;  2ZCF B;  3HRS A;  1K8A C;  4HCC A;  4M7D A;  1X6O A;  3OMC A;  2EQM A;  3G4S A;  3OW2 S;  4M78 F;  5CQY A;  5FRO A;  2A3L A;  3ZBD A;  3C4S A;  5KH6 A;  1VQ4 T;  4M77 G;  3QPH A;  2QEX A;  3E9G A;  4M7A F;  4J7F A;  2OTJ T;  3L2V A;  1YHQ A;  5GAN 5;  1SSF A;  5KE2 A;  1Q7Y U;  1IRE B;  2R5A A;  1BI3 A;  2ZPH B;  3CCM A;  1BI0 A;  2P0Q A;  3OYJ A;  2XID A;  4LD6 A;  3QO3 A;  2LTO A;  4B9X A;  4EDU A;  4X9C A;  4JLI A;  4M77 E;  4C5G A;  2DJZ A;  5LJ5 g;  4JRP A;  2F69 A;  4JS5 A;  4BAC A;  2DD5 A;  3A8H B;  4M75 C;  5A0L A;  5M9O A;  3JRZ A;  3BFM A;  2K3Y A;  1M1K C;  2E6N A;  3C95 A;  2RH2 A;  3RKX A;  3CC4 T;  4EMH A;  2WAC A;  1WJS A;  4XTX A;  3V8L A;  4C92 B;  1WNL A;  5CKE A;  4CRI A;  5IT9 E;  3L2U A;  1ZHI A;  2CZ6 B;  2R57 A;  3JCM c;  2DD4 A;  4M78 D;  4PLL A;  2FB7 A;  2RHX A;  2ZPF B;  3L42 A;  4F7U F;  1U1T A;  3OA6 A;  2E5Q A;  1S72 A;  2DZC A;  4M7A D;  2PUO B;  1BIB A;  5CK9 A;  3QZ5 B;  4Y28 E;  3I55 T;  1VQO A;  3MO8 A;  2JOY A;  3OYK A;  3DLL A;  4BI3 A;  4IUT A;  3QXE B;  4ELZ C;  1N8R U;  2EYQ A;  3HP9 A;  4J6Y A;  1YI2 A;  5GMK h;  2CZ1 B;  2E6Z A;  2Y4Y A;  3OMG A;  4ZTF A;  2E12 A;  2VGM A;  2EKO A;  2DXU A;  4HKE A;  2E70 A;  1Q81 C;  4XU3 A;  2EIF A;  1WJR A;  3JCM g;  3GP8 A;  1K73 C;  4XU0 A;  3RIR A;  4M78 C;  2GQV A;  5FU6 B;  2PVG B;  1I8F A;  3M53 A;  4HCZ A;  4OB0 B;  5FU7 B;  3CC7 A;  4A54 A;  3G71 A;  4RCB A;  3CCU A;  3HL8 A;  4M7A C;  2RB6 A;  2G3R A;  2WSE E;  4QVD A;  5LJ5 f;  3O8V A;  1KD1 C;  2KY9 A;  3V7S A;  5LJ5 j;  4M7D B;  1YIT T;  4O6J A;  2V8I A;  1B34 A;  5IN1 A;  4A4F A;  3CCV A;  1YJ9 T;  2QI2 A;  2H3J A;  4RG8 A;  2GF7 A;  2DZ9 A;  2JZ2 A;  2CGH A;  3S6W A;  4XAX B;  2F5K A;  3PNW C;  2RK2 A;  4OB1 B;  4WF2 A;  4N4I A;  3AHU A;  2RO0 A;  3MP1 A;  4E7I A;  2RI3 A;  1VUB A;  3V7C A;  3C12 A;  1YBY A;  3PMT A;  3M56 A;  4C8Q A;  3ASK A;  4BB7 A;  1NJI C;  4KBM B;  5GAO n;  5CVI A;  3V7R A;  3WXM B;  1WPY A;  1LNX A;  2KMT A;  3A8M B;  1N27 A;  2DTO A;  4JRI A;  3BY7 A;  1KQ2 A;  2EJF A;  2A7Y A;  4VUB A;  4FU6 A;  2EQK A;  2C06 A;  4N0A C;  4MZT A;  3QYH B;  1W4S A;  3OBW A;  1Y96 A;  3R6O A;  3QBY A;  4BUG A;  4FIB A;  1VIF A;  4C5H A;  2GFA A;  2HNI A;  4RG2 A;  4E7L A;  4B9W A;  3OYH A;  1GXI E;  4L6V 5;  3JCM f;  1I4K 1;  4XQ3 A;  2PUK B;  3CCQ A;  3LGL A;  3CCS T;  1M90 U;  3G6E A;  3A8L B;  5LL6 S;  1G5V A;  1HXD A;  2K5L A;  4IUU A;  4M75 F;  1XOV A;  1O75 A;  2X4W A;  4D6W A;  3OSS C;  2XDP A;  4J83 A;  3OYE A;  4EMK A;  3NFC A;  3L2Q A;  3VV0 A;  2QA4 T;  2DKG A;  4C0D C;  2DPP B;  3HFO A;  3GNF B;  2V8J A;  3TRE A;  4M7D F;  3HFN A;  1VQ4 A;  2RJC A;  2X4Y A;  4KUD K;  3OYB A;  1H3Z A;  5GAN 8;  1XNI A;  2QQ9 A;  4PJO F;  2RI5 A;  2LC4 A;  3SFM A;  4BY6 C;  2JTM A;  1MGQ A;  2JUF A;  4JLG A;  4LDU A;  3LLR A;  1XQH A;  1JB0 E;  1YCY A;  2KDS A;  2E41 A;  4II1 A;  3FJP A;  1JJ2 A;  2KAF A;  3CBO A;  3MHX A;  3P8D A;  4IUV A;  2X35 A;  3CD6 T;  2LX9 A;  3LYI A;  3QKJ A;  3X24 B;  3LW5 E;  5GAN 7;  3I56 A;  4LDX A;  1VQ7 T;  1UEB A;  4ZGE B;  3EFS A;  2LQ8 A;  2HAX A;  1BI1 A;  4FSX A;  2PU9 B;  3J80 E;  4XTU A;  3CC2 A;  2XIC A;  1YJN T;  5LJ5 d;  3JB9 F;  3L1A A;  4A4E A;  3MCA B;  1Y07 A;  1B34 B;  4V2S A;  2DIQ A;  3DKM A;  5A0D A;  4M7D D;  2K57 A;  3CEY A;  4DOW A;  2YLB A;  3MEV A;  2RJF A;  3LH0 A;  2BIV A;  4UC4 A;  3INZ A;  2DTI A;  2F5T X;  3I55 A;  2NLU A;  4J7I A;  4C8Q B;  2CYZ B;  2P0P A;  1KHI A;  3OS1 A;  3J81 E;  3UT1 A;  5CKF A;  1VQN T;  1YIJ T;  4MZP A;  4PJO D;  3L2R A;  4M75 E;  3X25 B;  4NOY A;  3OYY A;  3CCR T;  2DXC A;  2DAQ A;  3HHT B;  4BE0 A;  2XU8 A;  3HKS A;  1PSE A;  4C5E A;  5A2Q E;  3ZFJ A;  3Q1J A;  2QXF A;  3UDC A;  5GMK j;  5FU7 C;  4RMO A;  5KE3 A;  1JJ2 S;  1VQK A;  1Y96 B;  1N8R C;  4M77 A;  4HCB A;  5GAM e;  4A53 A;  1VQ9 A;  3JB9 D;  3FDR A;  1VQL A;  4EPC A;  2VV5 A;  1N9S A;  4M7D C;  3RES A;  4E7K A;  3P8H A;  1KC8 U;  2D0Q B;  3SWN A;  4A4H A;  3JCM d;  1OZ2 A;  1Y7X A;  3DB4 A;  1MHN A;  3RKW A;  3JCM P;  4PJO C;  5C0M A;  2VGN A;  4MDX A;  3NTK A;  4EMK B;  3M4Y A;  4M78 G;  5FRN A;  3DB3 A;  5EG2 A;  1BKB A;  2HQE A;  2LNV A;  4NS5 A;  4O5V A;  3VYH B;  3UPU A;  1KQS S;  5LJ3 e;  1X75 C;  1LJO A;  2XDD A;  5DY9 A;  4M7A G;  2RJE A;  1K8A U;  3FC3 A;  2L89 A;  1QVG A;  3X28 B;  3HSB A;  1KHC A;  4M78 E;  5CKD A;  1TH7 A;  3OSV A;  4PLI A;  2VUB A;  5FRM A;  4MML A;  2OAU A;  2CZ7 B;  4C8Q F;  4M7A E;  3X20 B;  3FEO A;  4M78 A;  1RI0 A;  3OYM A;  3HRU A;  1VQ6 A;  2FL7 A;  5J3B A;  1UGP B;  1YJW A;  4KT0 E;  1PSF A;  1OI1 A;  3M59 A;  4OF1 A;  5CQX A;  3HPW A;  3G4S T;  3OB9 A;  3NTI A;  5GAN 2;  3OS2 A;  5LJ3 f;  4JDS A;  1VQM A;  5CKB A;  1NZ9 A;  2QQA A;  5GAN 3;  5LJ3 j;  3FRN A;  5DLO A;  2QEX T;  3CCE A;  1YHQ T;  2DIG A;  4QW2 A;  2E65 A;  4XTZ A;  3S3M A;  3CCM T;  3QSU A;  5GAN e;  1Q86 C;  4FT4 A;  2OTL T;  4F7U G;  4C92 F;  5J26 A;  3OYC A;  5GAM h;  2K2V A;  4PKC C;  2MF2 A;  3MEU A;  3N5B B;  2XKO C;  5D6X A;  3WVD B;  3TU4 K;  1G3T A;  2EWN A;  4R55 A;  3CXC A;  4ZTJ A;  1IZ6 A;  4YTL A;  3CCJ T;  3NTH A;  4F7U E;  1QVG S;  1EIF A;  1ZBX A;  3E1S A;  4C8Q D;  1M90 C;  4N0A A;  3PFS A;  2EFI A;  3PTA A;  1M5Q 1;  3DLM A;  3PIP A;  1OYX A;  3MP8 A;  4OGE A;  4LD9 K;  5D6Y A;  2PQW A;  3CME A;  4QVZ A;  5DM7 R;  1FX7 A;  5GAN f;  4NL3 A;  4M77 B;  5LJ3 h;  3RMQ A;  5GAN j;  1BI2 A;  3PT9 A;  1NPR A;  5A0G A;  2R5M A;  4XK8 E;  3LX7 A;  3CCL A;  2XI9 A;  1WJQ A;  1VQN A;  1VQO T;  1KQS A;  4OGC A;  3RUX A;  3SWN B;  1Q82 U;  2L5Q A;  3V8K A;  2JN0 A;  3VUZ A;  3OS0 A;  4BI4 A;  4C92 D;  1YI2 T;  3L2Z A;  3QZ9 B;  4C5I A;  2P0K A;  2DXT A;  3JCM W;  3FIF A;  3QJ6 A;  4Z02 A;  4GY5 A;  2L3R A;  3OYD A;  1O9S A;  3SDZ A;  3VUB A;  2KSS A;  5HY6 A;  3RKY A;  4C8Q C;  1WGS A;  3CPF A;  1QVP A;  2E10 A;  3C94 A;  1V29 B;  3M9Q A;  4P5N A;  5GAO l;  3JCM V;  2O01 E;  3CXC S;  3GF5 A;  2EQJ A;  3GLX A;  5GAO r;  2XDB A;  2OTJ A;  1VQ5 T;  1VQP T;  4BE2 A;  3CC7 T;  3JB9 I;  3F70 A;  5GAN h;  2FHD A;  2GFU A;  3G71 T;  4OB3 B;  2RM4 A;  3CCU T;  2ZPE B;  2X4J A;  2E64 A;  3LWI A;  4M78 B;  1UB4 A;  4QQD A;  4LDY A;  4E47 A;  4BDY A;  1K9M U;  3CMA T;  1BYM A;  4C92 C;  2EAY A;  4OB2 B;  3P8B B;  3ME9 A;  4TVR A;  3CCV T;  5CR2 A;  2CS7 A;  3JCM Q;  4X9D A;  3M58 A;  2XHC A;  5GMK l;  1Q7Y C;  4EMG A;  1VQ8 T;  2DK3 A;  4IUP A;  3CC4 A;  5I2S A;  1KQ1 A;  2LCC A;  1UGS B;  4M77 F;  1U1S A;  1WQW A;  4ZGJ B;  5J39 A;  5GAM g;  4N4H A;  3OBY A;  3MEW A;  4M75 G;  3FLG A;  2ZPI B;  3TEE A;  4HT8 A;  3JCM X;  2MI6 A;  3GIB A;  4QQG A;  2WSF E;  1QP2 A;  2O4X A;  4IKF A;  2M1H A;  2PVO B;  4ME7 A;  2LT4 A;  2L8D A;  4XTV A;  4MMK A;  4ZN1 A;  3OYF A;  4M7D G;  4J5Y A;  4X34 A;  5KCO A;  1KC8 C;  3QII A;  2BUD A;  3S3O A;  3A8O B;  2KVQ G;  3KBG A;  2QQR A;  4PJO G;  2DXB A;  3JB9 J;  4DQ2 A;  2V8K A;  5HK0 A;  5LJ3 g;  4M75 A;  4DOV A;  4M7D E;  2HD0 A;  3S3N A;  3JCM J;  3G6E T;  2KQW A;  2QDY B;  3MET A;  3EFR A;  2LDM A;  5FU6 C;  4RCC A;  1WQ7 A;  4R56 A;  1G3W A;  2EJ9 A;  2LQK A;  4IUQ A;  1JRI A;  4PJO E;  3SD4 A;  2VXF A;  1QP3 A;  4FL6 A;  4M77 D;  3BDL A;  2RHZ A;  1X01 A;  1D3B A;  2FVU A;  3OS5 A;  4XU2 A;  2JVV A;  4OMF B;  2DO3 A;  3JAM E;  4PJO A;  3OYI A;  3QDR B;  3JB9 G;  4ATO A;  5AYF A;  4ZN3 A;  3J7A F;  4C0D B;  1AHJ B;  3VJP A;  1HK9 A;  1YIT A;  2JTF A;  3OQ5 A;  5IAY A;  3KUF A;  2OTL A;  3QG1 A;  3LWH A;  1H64 1;  3GPL A;  2QQB A;  1YJ9 A;  2PVD B;  4HA8 A;  3VYG A;  3PMI A;  3M4G A;  4NL2 A;  4BY6 B;  1N6A A;  5GAN g;  4XU1 A;  2HBP A;  4N4G A;  2CZ0 B;  1ZQ1 A;  1KG1 A;  5GAM f;  3I56 T;  5GAM j;  2K5I A;  4L59 A;  5CIU A;  2P4T A;  2ZZD A;  4BD3 A;  3CC2 T;  4LDW A;  4M77 C;  3OYG A;  2YLC A;  2MMP A;  2FYK A;  2IG0 A;  1M9S A;  2RHU A;  2XD0 A;  3A8G B;  5CKH A;  3JCM b;  2GCX A;  1QVF A;  4C0G A;  1G3S A;  1Y71 A;  1I5L A;  3A5Z B;  2DEQ A;  3WVE B;  3SWN C;  2RHY A;  4M7A A;  4J6X A;  3OYL A;  3ZEH A;  3H8Z A;  4E7H A;  1BIA A;  2ZPG B;  3M5A A;  5GAO q;  1U8R A;  5GAN 4;  2EQU A;  1LOJ A;  2MWP A;  1M1K U;  2ZPB B;  3URG A;  5LJ5 e;  3X26 B;  1W2B A;  3CCS A;  3MP6 A;  2Y4X A;  1N9R A;  2O4X B;  2Y90 A;  5D6W A;  1NE8 A;  3CBM A;  2R58 A;  4FT2 A;  1VQK T;  1Q82 C;  2QA4 A;  3FB9 A;  4JRQ A;  3V8J A;  1P92 A;  1M1G A;  1RL2 A;  4FM4 B;  2ZGW A;  3PIO A;  1VQ9 T;  5HK3 A;  4MZM A;  4PL6 A;  1VQP A;  4M75 B;  3RMS A;  4KUI A;  1VQ5 A;  1VQL T;  4J6W A;  5C6S A;  1NPP A;  2M0O A;  1R8O B;  2DTH A;  2M16 A;  3BW1 A;  3H6Z A;  4F7U A;  4HT9 A;  3HRT A;  4C8Q G;  4BE1 A;  4Q5W A;  4CI0 C;  1I81 A;  5I21 A;  4A4K A;  1QVF S;  1UGR B;  3OYA A;  3CMA A;  4J8O A;  1S72 T;  3CD6 A;  2VYT A;  1D3B B;  2RI2 A;  4PNO A;  5GAO p;  3GOX A;  3M57 A;  1Q81 U;  2D6F A;  4PJO B;  1VQ7 A;  4C8Q E;  2LRQ A;  1K73 U;  1VQ8 A;  4A4G A;  1YJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...