1Y96B

Crystal structure of the gemin6/gemin7 heterodimer from the human smn complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
b'AQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gem-associated protein 6
publication title The Gemin6-Gemin7 Heterodimer from the Survival of Motor Neurons Complex Has an Sm Protein-like Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 23
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11095 Gemin7 Gem-associated protein 7 (Gemin7)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y96B00
4XTXA 4M7DB 4F7UE 2DXTA 5CAIA 5GMKj 4M7DA 1I8FA 4XTUA 3QSUA 4M78E 1LJOA 3HSBA 4QVCA 5GMKm 4J6YA 2DTOA 2ZGWA 4HT9A 3JB9F 3JCMP 5LJ3f 4V2SA 4PJOD 2DXUA 4PJOE 3L2ZA 5GAN3 4WF2A 2EJFA 3JB9H 1BIAA 1MGQA 1LOJA 3BFMA 2RA2A 2YHTA 1I4K1 4XTVA 4C92F 3BY7A 5I21A 1WPYA 3EFSA 1WQWA 3PGGA 5LJ5d 1I81A 1KQ1A 2E1HA 3JCMg 5GMKl 5LJ5g 3JCMd 5GANg 4X9DA 5GANd 3RESA 3AHUA 2FB7A 4C8QB 1M8VA 4JLIA 4C8QA 1YCYA 4M77F 2DTHA 5LJ5j 3RKWA 5GANj 2EJGA 2E41A 4NL2A 1LNXA 1TH7A 4XU2A 4N0AC 4C92D 2EAYA 3V7SA 3SB2A 4C92E 1HXDA 4M78D 2K57A 5GAN5 4M7AD 4JRKA 2YLCA 4M7DF 2DVEA 4M75D 4XQ3A 4J5YA 3JCMV 5GAMe 4EMGA 1HK9A 4M75E 5GMKi 5GAOq 4M78C 4M7AC 2HNIA 5GMKe 4JUVA 4M75C 4F7UG 4M7AE 3JCMQ 2RM4A 4M78G 3SWNC 5GAN8 5GAN6 4PJOC 4M75G 5LJ3d 2EWNA 4QVDA 5LJ3g 2E10A 4PJOG 4PJOB 3JCMW 4HT8A 1B34B 1X01A 1BIBA 1B34A 2Y90A 4PNOA 2DKGA 3V7CA 4C8QF 5LJ3j 4NL3A 1M5Q1 3V7RA 2QTXA 2VXFA 3BW1A 2FYKA 4N0AA 4HA8A 5GAOr 2I2LA 4XU0A 2VXEA 4EMKC 3GIBA 4F7UB 3JCMe 3JCMf 5LJ5e 3JB9D 4F7UA 5GANe 3JCMX 4Y91A 1WNLA 4C92C 5GAMf 4X9CA 4M78B 2DTIA 3QO3A 4M78A 3FIFA 1I5LA 1U1TA 4M77D 4XTZA 3RKYA 4M75A 4M77E 3EFRA 4C92G 4NOYA 3SWNB 2JN0A 3FB9A 2VC8A 4M77C 3SWNA 3HFOA 4MMKA 5GAN2 3JB9G 4M7AG 1N9SA 4PJOA 2RD1A 3BDUA 2DEQA 2DZCA 1JRIA 3JB9I 4M77G 4M7DD 1WQ7A 4M7DE 3L1AA 4J6XA 3JCMh 5LJ5h 3V8JA 2EJ9A 5GANh 5GAOm 2E64A 5GAMh 4M7DC 4XU3A 4J6WA 3INZA 4MMLA 1U1SA 4A53A 5GMKh 1D3BB 1D3BA 3V8KA 1Y96B 4EMKB 5GAN4 4EMKA 1KQ2A 1Y96A 5LJ3e 4M7DG 5LJ5f 4C92B 5GANf 4OP0A 2E65A 3V8LA 4C92A 3JCMb 4M7AF 4DQ2A 3RKXA 4F7UF 3JCMJ 5GAOl 4M7AB 4M7AA 5GAOp 3M4GA 4M75B 3JB9J 4A54A 4C8QD 4M78F 4XU1A 3QUIA 5DY9A 3VU3C 3RUXA 4C8QE 2CGHA 2RB6A 4JRIA 4M77B 3QHSA 4M75F 4RCCA 4M77A 4XTWA 5GAMd 3RIRA 5GAMg 3RERA 4C8QC 5GAOn 2DJZA 3JCMc 2DZ9A 1JBMA 3HFNA 4PJOF 5GAN7 4EMHA 2YLBA 1N9RA 1H641 4RCBA 5GAMj 3FJPA 4C8QG 4XTYA 5LJ3h
chains in the Genus database with same CATH superfamily
5CAIA 1MV3A 2ATCB 1Y71A 4M78E 2LCSA 3HSBA 1PWTA 4RG8A 3CCSA 1BIAA 2LNHB 2RJEA 3GNGA 1YITQ 2CREA 3CD6A 3EFSA 3GBQA 5GANg 3MEUA 3EGDA 4F04B 1MV0B 4JLIA 1YWPA 4HVUA 1H3HA 2RN8A 1OYXA 3LX7A 3G6EQ 3VUBA 1QVFA 1YHQA 2EAYA 4RTYA 3SB2A 1KSWA 4X1VA 5GAN5 3CC2T 5GAOq 4KUIA 3I55A 1NEGA 3C95A 3OYJA 2B8AA 3QKJA 2ZPBB 3M5AA 5LJ3d 1M1FA 1WZOA 3MKDA 1WJSA 3CCMT 3OYFA 4C8QF 4FW2A 2CSIA 2DFUA 1OOTA 2VXEA 5IXFA 3JCMf 2LT1A 4F14A 1S72Q 1M90C 4OVAA 2JOYA 2WACA 4IUVA 4J8OA 1IHWA 3OB9A 4KH0B 1I07A 2J6FA 3JCMh 2DX1A 1VQMT 3CCQQ 3UDCA 1D3BA 2XHCA 3META 4E2FB 5GJWB 3OA6A 1KFZA 3S3NA 3A5ZB 2YUPA 4ELZC 2XU8A 3RNJA 1CSKA 1JBMA 1U8RA 2QASA 4P5NA 4BY6B 2EW3A 3PT9A 4GLKA 2QAZA 2ZGWA 4FW1A 1UDLA 1YJ9A 1VQ8Q 2DIQA 1ZBJA 2M51A 2V26A 2ENMA 3M58A 5M9OA 2HQEA 1TG0A 2ZPGB 3QDFA 3UWNA 2R5AA 1TXQA 2ECZA 3H0FA 4N0AC 4TVRA 3KUFA 1PRLC 1YP5A 4M7DF 2KVQG 4J5YA 5KCOA 3E19A 4WCIA 3JRZA 2MOXA 4M78C 2YRCA 1GCPA 2FHDA 2ZPFB 2DVJA 3L2UA 1VQMQ 1VQ7Q 4QVDA 3G4SQ 4KULA 4R0KA 4JLGA 4OMMA 4CC3A 4OF1A 2JMCA 1BIBA 1FXXA 1K9MU 4HXJA 2M1HA 2KQWA 1AEYA 4IIMA 1SG5A 4JRQA 2K3YA 2LQNA 4J7IA 4F7UB 5LJ5e 2H3JA 1WHGA 1PG5B 3MHXA 2LJ3A 2C0OA 1KD1U 3ZL7C 2D0QB 1KQSP 4M77C 4PJMA 3CCVT 1NJIC 2DXBA 3SEMA 4KBMB 2PVOB 3G6EA 3L2VA 1K73C 4DBFA 3FC3A 4MMLA 3VRYA 2E70A 4EMKA 5LJ5f 1HYOA 5CKDA 1BK2A 4FSXA 4PK4A 3M4GA 4A54A 4JDSA 3QUIA 5HKCA 1VQ5Q 1ZSZB 4RCCA 1OULA 5GAMg 3NFCA 2FL7A 5HCKA 2KRMA 3P8HA 1KHCA 2FRYA 4ANJA 2YSQA 3PMIA 2DXTA 2Y4YA 2C0TA 3HTRA 1S72A 4V2SA 2DXUA 2P0QA 4Q5WA 4RKUE 4BD3A 4PFOA 2LQ8A 2OTLQ 3OYDA 4BE0A 2LC4A 4C92F 2VASA 8ATCB 5GANd 5GMKl 2JMAA 3T9NA 1VYUA 2FB7A 4C8QB 1X69A 2A08A 2XKOC 2DRMA 4NL2A 1G5VA 3CCQA 3WVEB 1OV3A 2EVRA 3I35A 4F17A 2R57A 4LD6A 4FCYA 2P4TA 2NYSA 3CCJA 1Q95G 1ZSGA 2H3EB 2JNGA 2M16A 3E2UA 3OMCA 1JU5C 2DIGA 1VQ6Q 2MWOA 1NPRA 2MWPA 1JQQA 2K5LA 2D6FA 1RACB 5CR2A 2P84A 2K6DA 1VYVA 5D6XA 4JJBA 2B86A 3H9NA 2WSEE 3CCEQ 3BW1A 3EFOA 2ROTA 2D8HA 1TOVA 2JM9A 3OY9A 2KMTA 2DTIA 3CMEQ 3O5ZA 3OYCA 2O2OA 4AG1C 2JN0A 4MMKA 3M55A 2PVDB 9ATCB 3ASKA 4RG2A 2RHUA 4XAXB 2FPEA 1X6OA 2KGTA 2DK3A 2KRNA 2DLPA 8AT1B 3HRUA 4EIKA 4AG2C 1UGVA 3NTIA 2MAMA 1N27A 1KC8C 1PRMC 4M7AB 1AWJA 1EZZB 5KYWA 5GAOp 1VQ7A 2FZGB 5EC7A 4LN2A 3QSUA 3RUXA 4ATOA 3RIRA 4R56A 3OYBA 4J9EA 1N9RA 1X75C 2KEAA 2HMAA 1YNZA 2WSCE 3CEYA 2DE0X 2DJQA 1Q7YC 1KQSS 4M7DB 4DBRA 4YTLA 4JJDA 1JXMA 4UC4A 3WVDB 2LZ6B 1OI1A 1HJDA 5AT1B 1WPYA 4AMCA 3HHTB 1V76A 2CDTA 1BI3A 2EYWA 2E41A 3RDVA 5A0DA 1TH7A 4XU2A 3CCST 4XK8E 4CC2A 1WHLA 2YLCA 1EX4A 2EYYA 4M75D 1QVGP 4M75E 3CCRA 1NJIR 2OTJQ 2JTMA 2E12A 2M9UA 4J9IA 1IREB 3SWNC 1KQSA 3I5SA 1YHQT 1GFCA 5HY6A 1BCMA 3G71Q 1M2VB 3A8GB 1KIKA 5LJ3j 1VYTA 2KROA 2EQJA 2ZAEA 1M4ZA 1PNJA 3I55T 3H8ZA 3CXCP 1Y07A 2OTLA 3REBB 3QO3A 1J3TA 2GBQA 4CI0C 3EHQA 4NS5A 2DEQA 2K9GA 4E7KA 2KSSA 2CH4A 2RJDA 1QVFP 3PVQA 2E6ZA 2QQRA 2E3IA 3CPWP 2XDPA 1PM3A 4IUQA 2CZ0B 1VQ6A 3M4YA 4C92B 4KGXB 2COZA 2NUZA 3L2WA 1Q82C 1Y0MA 1M1GA 2C06A 1D0XA 5GAMd 3QHSA 3EGXB 3RERA 2BIVA 1VIEA 4MDWA 5KYUB 5KYNA 2CP7A 3JCMc 2CP3A 2V1QA 3DB4A 5GAN7 3CD6Q 1YN8A 3ER0A 3CCEA 1ABOA 4M4ZA 1RABB 3C94A 4FM4B 5LJ3h 1PKSA 4C0FA 1MMDA 2PZ1A 2QDLA 4QVCA 2JM8A 2PUOB 5KYXB 4OMNA 3CMEA 2EBPA 2K3BA 3OS0A 2BKDN 4FU6A 3WXMB 5I21A 4Z02A 1GFDA 1JEGA 1W6XA 1U3OA 3PIPA 3AHUA 5A0LA 2KT1A 2GF7A 3BDLA 3MEVA 1M1KU 2DF6A 1YJ9T 4OB0B 1B07A 3IQLA 2NWMA 2O01E 4E6RA 3VS0A 3LW5E 2YT6A 3JAME 1TS9A 2W0ZA 3JCMV 2JXBA 5GMKe 4F7UG 2QQ9A 1BB9A 1UGSB 1B7TA 2FRWA 2QQBA 1IRXA 2QI2A 3AT1B 2DRKA 3CCUT 2LVMA 3UT1A 4NL3A 5IN1A 1X2KA 3HRTA 4OMOA 3X24B 2VXFA 5IHKA 1KC8R 2K2MA 2V8IA 1WGSA 2OX7A 4F7UA 3CMAA 2XMFA 2RPNA 3FDRA 3UF4A 7AT1B 3TSWA 1TSFA 1G3WA 2BE9B 2KYBA 1Q7YR 1RAEB 1RAAB 1QVGS 1TUCA 1WQ7A 5CKFA 1WLPB 3FRNA 1TUGB 1FYNA 3OYNA 2D9TA 1ZLMA 3Q1JA 1K76A 3TREA 5GMKh 4A63B 3PFSA 2RK1A 1Y96B 2D0NA 2PTKA 4MZMA 2EYXA 4OP0A 4C0DB 4L6V5 3GP8A 5C6SA 1V29B 3G6ET 3JSCA 2LP5A 3VU3C 1UTIA 2DMOA 1BI2A 2RB6A 2L5QA 4M75F 1ZSZA 3CXCS 3G71A 1WHMA 3SHWA 5GAOn 4PFPA 4PJOF 4JZ4A 1OEBA 1T3LA 4C8QG 3PIOA 4JS4A 1FMVA 1Q86U 1QCFA 1LJOA 2KT8A 1QVGA 1QVFS 1SKUB 1TWBA 4BE1A 1UB4A 2RA2A 1ABQA 3CPWS 1GRIA 2E1HA 4QQDA 2HCKA 3LGFA 2EQIA 4C8QA 4GY5A 2MCNA 1GBQA 5GANj 2Z0WA 1S72T 1LNXA 3KXTA 2IIMA 4M78D 3CXCA 2CH4W 1E7OA 1UG1A 2JTFA 2DYIA 2GCXA 4RMOA 2KXDA 4O6JA 3CCQT 4DBHA 4FSSA 2E10A 1JO8A 3DLMA 4HCBA 2EGEA 4PL6A 1VQ4Q 5IH2A 2CUDA 1IGQA 3SD4A 1Q82R 3J7AF 4RTUA 2DD5A 3JCMe 3CPWA 1M1KR 1YJNQ 5J39A 2AZSA 2VV5A 4PLLA 1NZ9A 2NLUA 1U1TA 2HL3A 4M77D 4M77E 3EFRA 3J81E 3GPLA 4M7AG 2DD4A 4OB3B 2A36A 3L2QA 1VQ8T 2AIRB 5GANh 2CUBA 3S6WA 3URGA 1U1SA 4M7DG 4KUDK 2LMJA 5FU7B 3V8LA 2HD0A 2RI5A 3MO8A 5GAOl 4M7AA 4MZPA 3VS4A 1XQHA 2DO3A 2KDSA 4WTOB 3R6NA 1UFFA 5A0GA 1W2BP 1U06A 5KCHA 2ED1A 3HPWA 4D8KA 1M3AA 4M7DA 4HVVA 4DOWA 4J9CA 1H3ZA 1QLYA 4O5VA 1UJ0A 5CIUA 1VQ7T 1A0NB 4Z8AA 3G4ST 2V8JA 1NEBA 3KFVA 3NTKA 2MK5A 1G83A 4J9BA 4KGVB 1NG2A 1MGQA 3CCJQ 2LT4A 3QWXX 4PKCC 5IHIA 1R8OB 3RESA 2CKKA 3VS7A 2RJFA 2OJ2A 4PFZA 2L0AA 1YFNA 2RK2A 2R5MA 1YI2Q 2W10A 3UA7A 3QIIA 1ZQ1A 4ZTFA 1Q86R 5CKHA 4M7AC 2RH2A 2X51A 1SEMA 4DEXA 2EWNA 1K9MC 2F2VA 2JS0A 2LJ0A 2HAXA 2EFIA 3M0QA 1T0JA 2A7YA 4BI8B 1M2VA 2QA4Q 3C12A 2AKLA 2DEUA 3E1SA 1VQ5T 1QVPA 1WXUA 1IZ6A 2RHYA 1NYFA 3GIBA 2A0FB 1KD1C 1JXOA 1M2OA 1WNLA 4X9CA 3LH5A 4A4EA 3VRZA 2YUQA 4LE9A 4LXCA 3DB3A 4C92G 2DILA 2LQWA 4PJOB 3HFOA 4E7IA 1UGRB 1SHFA 3TEEA 2F5TX 1W70A 3MJXA 1VQLQ 3QJYA 3L1AA 4J6XA 2BZ8A 4KRTA 2RQRA 2OTLT 1ZBXA 1M9SA 2JS2A 4DA4A 4DEYA 3UPUA 1V1CA 1VQOQ 4C92A 3LWIA 4LDVA 3M0TA 3QYHB 2AKKA 4M78F 4HKEA 4XTWA 1GL5A 4HVWA 2GNCA 3EGXA 1VQ4A 3H0HA 5KYUA 2DZ9A 2RHZA 4A4FA 4B6MA 4RCBA 5GAMj 1R77A 3M0PA 1VQ6T 5FU6C 2CP6A 1Q81U 4XTUA 5IXBA 1YJNA 3LYIA 4D6WA 4J9HA 2BZYA 4HT9A 5KYXA 2BTTA 1PD1A 2VUBA 3PVLA 5GAN3 3BE3A 3CCRQ 3CCET 4ZTJA 1WQWA 3CPFA 4B9WA 5LJ5g 4M77F 3OYYA 3OYHA 2JT4A 3QDRB 3CMET 2MI6A 3EG3A 1JJ2A 3QXEB 1W2BS 4XQ3A 2MIOA 2I0NA 1PSEA 2D1XA 2DAQA 2MYSA 1E6GA 1W4SA 2P0KA 3OYLA 1D1BA 2EQKA 2MPXC 1B34B 3M0RA 1QCOA 1CKAA 2L3PA 2XI9A 2DNUA 4RTVA 4EMKC 2LNVA 4FIBA 3MCAB 3JB9D 3R6OA 3EG2A 3A8MB 1NYGA 3N5BB 2LDMA 4DOVA 2DL8A 2DBKA 3E9FA 4QVZA 3M57A 1UEBA 2LRQA 1W2BA 1RLPC 1YI2A 3TQ7P 3VYHB 3M56A 1N8RU 4C5EA 2HKQB 2RI3A 2DPPB 1Y96A 2E5QA 2J6OA 2KRSA 5CVIA 1M8VA 1IXDA 4KT0E 1FWZA 1S1NA 2J06A 2QA4A 1K0XA 3TSZA 3ME9A 1OX8A 1H641 1AOJA 2K2VA 3FJPA 4BI3A 2OTJT 1AZEA 4XTYA 3OS5A 1VQNQ 2QG9B 4FYXB 2LCLA 3CC4Q 1BI1A 5KE2A 3G71T 1K9MR 2O88A 1XTDA 3QPHA 4IIOA 4C5HA 1QP2A 2LJ1A 3JB9H 2YHTA 4HCZA 3EGUA 1KQ1A 3S3OA 1C0MA 1VQLA 2YRVA 2DTHA 1AT1B 1KD1R 2XG8D 3QG1A 4JRPA 2KYMA 2CYZB 1NLOC 1R0CB 2HZYA 3GLXA 1VQOA 2RQVA 1I0CA 2IVWA 1E6HA 3PE0A 1PSFA 4CC4B 4FL6A 5GJVB 3CCLQ 3CMAQ 3OYAA 1QCNA 2RM4A 2PVGB 2HSPA 1BKBA 2A37A 1H92A 2R58A 4EDUA 2E5KA 1YIJQ 4OMQA 4QT7A 4HT8A 2DYBA 1OZ2A 2DKGA 2HKNA 4OB2B 2HQHA 3V7RA 5FROA 3M9QA 2EIFA 2FZCB 3CD6T 2AK5A 4M78B 3GNFB 3FIFA 1AD5A 1QMCA 2MF2A 1TTHB 4JPBW 3M53A 1N9SA 2QGGA 2RD1A 1QKXA 3RMSA 1JRIA 2XK0A 3RMQA 2HBPA 2KXCA 1NBEB 3E9GA 2K4YA 5DLOA 2NUTB 4LD9K 3VUZA 1QQJA 5LJ3e 1HD3A 3CC7Q 3F70A 1UHFA 5LL6S 4QQGA 3OBWA 2CGHA 3RBBB 4M77B 2RI2A 2O9VA 1Y57A 3VKIA 1XNIA 2LX9A 4ELYC 2J05A 1SSHA 4EMHA 1OPLA 1UGQB 4E7LA 3VJPA 1RAHB 4F7UE 1Z9QA 1NLPC 1OZ3A 3LLRA 5GMKm 5CQYA 3QWYA 1N8RR 5LJ3f 3DLLA 4A4HA 2DL4A 3L2ZA 2RF0A 4BUGA 3BFMA 4XTVA 1LOJA 2LQKA 4FYWB 3A8OB 4RTTA 2O31A 5LJ5d 2JVVA 3EAEA 3NHNA 3JB9F 1M1KC 2YWWA 1WXTA 1YWOA 1UHCA 2ZPIB 4GLMA 3KBGA 3QJ6A 2EJGA 2XICA 2VVKA 2H8HA 3VV0A 1QWFA 4A4GA 1O9SA 2PU9B 5GMKi 1HK9A 4IUPA 1ZA1B 1CKBA 1G3SA 4OGEA 1BU1A 2X4JA 3EH1A 4MDXA 4EPCA 4M75G 1WXBA 1MMGA 4QKUA 4PJOG 1VQNA 1BYMA 1UGPB 3CC4A 4HA8A 5CKEA 2CT4A 2ZCFB 3QYGB 4Y91A 2RQTA 4L59A 1I5LA 2HDAA 4IUTA 3RKYA 4M75A 1OQKA 1RUWA 4LNPA 4PJOA 1MMNA 2KY9A 1X6GA 2GQIA 4E7ZA 2KE9A 4C5GA 4BY6C 4PJJA 2AT1B 5FRNA 1WX6A 1SPKA 4JS5A 1ZUUA 4E7SA 2QEXQ 3CCLA 1O75A 1KHIA 1R0BG 2DXCA 2FO0A 2LCCA 1YJWQ 1YIJA 4N4HA 2RMOA 3NPFA 1Q86C 1AWXA 5CKBA 3X26B 3OYGA 1VQ9A 1VQ4T 3QZ9B 3OYKA 1GCQA 1AZGB 3ZBDA 2X3XD 1U5SA 1AVZC 5DLQE 3EH2A 4Z89A 2BE7D 2YXYA 1ZUKA 3PMTA 1WJRA 1YJNT 3HKSA 1D0YA 1ARKA 3EG0A 3M54A 1T0HA 2O4XB 3RKWA 3OYMA 5EG2A 1GXIE 4Y28E 2ROLA 1HXDA 4M7AD 3CC7A 4JRKA 4M7AE 1VQKQ 1RI9A 3J80E 2EGAA 2L89A 5FWBA 5GAN6 2HBWA 2RHIA 2CP5A 4RTZA 2FEIA 4LDXA 4R55A 3V7CA 1B34A 4PNOA 3THKA 1M5Q1 3M0UA 2CS7A 2KR3A 2CT3A 4XU0A 1VQPQ 1QKWA 2GFUA 2QDYB 5GANe 1K8AU 1C1AA 3TU4K 3ZFJA 4ZGDB 3HP9A 3SWNB 1ZSZC 2VC8A 2ZPEB 3I56Q 1M3CA 3L2RA 4J9FA 4OGCA 1MHNA 1OU8A 1XJWB 1D1CA 2GQVA 2RNAA 1X27A 2QYZA 3CCJT 4IKFA 4XU3A 1JJ2P 3OSSC 2C0IA 4PJNA 4CC7A 2VKNA 1MNEA 5GANf 1FMWA 5HK0A 4RTXA 2IPOB 5KE3A 4XU1A 2ZPHB 5DY9A 1YI2T 4KGZB 1RAFB 3FLGA 1SF9A 4C8QC 2D8JA 1KK7A 3LH0A 1BCOA 3OW2P 2EGCA 1EFNA 1KJWA 5J3BA 4L5GA 4MZTA 2M02A 1UECA 2Y4XA 3H6ZA 4J6YA 4BI4A 2V8KA 2L3SA 2QA4T 1Z9ZA 1LPLA 2G6FX 3P8DA 2F1LA 2EKHA 2HEQA 1G3TA 5FW9A 4LDYA 1I81A 3JCMg 5KYYB 1MNDA 1VUBA 2PNIA 3CQTA 4HCCA 5L8RE 1WIEA 5A2QE 2A28A 2PQWA 4C92D 1K1ZA 4C92E 2QEXA 2F5KA 1XOVA 2CP0A 2HQXA 1VQLT 1M30A 4JUVA 3I9QA 1YJWA 4BACA 2CP2A 4M78G 2OAUA 2LTOA 3A98A 2LX7A 1N6AA 1VQOT 4FYYB 2CZ6B 2QQSA 2QGFB 3SDZA 3GF5A 1IB8A 4N0AA 2L3QA 4HCKA 5J26A 2EKOA 1TUDA 4OB1B 4M78A 1I1JA 2K7AA 3NMZC 3OYEA 4PLIA 1K0SA 4NOYA 5GAN2 5CK9A 1RAGB 3CC2Q 2JTEA 1M90U 3JB9I 4M77G 1M8MA 1C6VX 4M7DC 3CCRT 2NUTA 4J83A 1VQKA 2HL5C 3EG9B 3NTHA 1ZUYA 3CCMQ 4Z88A 3RKXA 3C0CA 3JCMJ 4IURA 2L3RA 4M75B 3JB9J 2NUPB 2XDBA 4M7AF 1K8AR 1W1FA 1OX9A 4IUUA 4M77A 3HFNA 1Q81C 4D8DA 4PJLA 3VS5A 2QXFA 2M0OA 1VQPA 5D7UA 4VUBA 1QW1A 3CCUA 2MMPA 2ZZDA 1HSQA 2DTOA 2VGMA 3JCMP 2DL5A 3HL8A 3PNWC 4WF2A 4BE2A 3I56A 1JJ2S 5D6YA 1M27C 3PGGA 2WSFE 4C0ZA 1UE9A 4X9DA 4ME7A 2SRCA 4N4GA 5LJ5j 2X4YA 3HRSA 3X20B 1WHHA 3OSVA 6AT1B 2VGNA 2VWFA 4LUDA 4AFQC 4ZN1A 2K57A 4J9GA 3GOXA 2DVEA 5GAMe 2QK0A 4EMGA 3OW2S 1YITA 5I22A 3JCMQ 2DBMA 2ESWA 4K11A 3C4SA 3A8LB 2BZXA 2K5IA 1SSFA 1F1BB 5I11A 5CQXA 4C92C 4ZNXA 5GAMf 4E47A 1WHKA 4GBQA 2EYQA 1KG1A 5CCAA 1VQNT 4E7JA 4RTWA 3H0IA 1K9AA 3CC4T 1RLQC 1N8RC 1SRLA 3OW2A 3U23A 5LJ5h 1NJIU 1PC0A 1MUZA 3A8HB 5GAMh 5GAOm 5IAYA 3MPUB 2DETA 2PUKB 2E3HA 1K73U 3V8KA 4J7FA 2P0PA 4AFUC 1OPKA 1DJ7B 3OYIA 3MP6A 1RADB 1EIFA 1QP3A 2VB6A 3VYGA 3CCLT 3CMAT 4XTXA 4AFZC 3REAB 1M90R 3CCVQ 4C0GA 1BI0A 1YIJT 2X35A 1AWWA 5C0MA 4CRIA 3L42A 2OI3A 3RR6A 4BDZA 3EHRA 1NPPA 3BY7A 3CC2A 3JCMd 2COWA 2K79A 1OU9A 2L8DA 3EGDB 3ZEHA 1ZHIA 2RO0A 2GTOA 4FT2A 1P92A 1VQ9T 3G1JA 2O4XA 3S3MA 3M59A 5DM7R 3V7SA 4JJNK 4LDUA 1PCXA 3CCMA 1VQ8A 2YRDA 3SFMA 2G3RA 3EG1A 5GAN8 1WYXA 2FG0A 5FLXE 3TVTA 3VS2A 2O9SA 3JV3A 4ZN3A 3CC7T 1X01A 2Y90A 1D09B 2JZ2A 1FX7A 2QTXA 3PTAA 1FMKA 3X28B 5GAOr 1QWEA 5HK3A 3JCMX 4DBQA 2SEMA 1RL2A 4C0DC 4B9XA 1H8KA 1VQMA 1NE8A 1Q81R 4XTZA 3G4SA 2QQAA 4JJCA 1K4US 3VS1A 2X4XA 3SWNA 3JB9G 4JZ3A 1LCKA 2DZCA 1B3QA 3MEAA 4X34A 3VS6A 4RUGA 3V8JA 2EJ9A 5IT9E 2GFAA 4J6WA 2KAFA 4ORZA 1BBZA 1D3BB 1ACMB 3CBMA 1KQ2A 2JW4A 1PD0A 2E65A 3QBYA 4LDWA 3JCMb 1AHJB 1VQ9Q 2DERA 1I5OB 2ED0A 1KC8U 2CSQA 1LVKA 2DJZA 4QW2A 2YLBA 3CBPA 5I2MA 2AZVA 3M0SA 2M0YA 2OAWA 4F16A 3OS1A 1RI0A 1Q7YU 5FRMA 4PJOD 1VA7A 1VQ5A 4PJOE 2AHJB 1SRMA 3MEWA 5CO7A 4ZGJB 1K73R 3QZ5B 3OS2A 3D7SB 5KYYA 4LUEA 1YCYA 1T3SA 2F2WA 1WDXA 3VS3A 2BUDA 5FU6B 1IO6A 1PKTA 1Y7XA 4FT4A 2HNIA 2J7IA 2X3WD 1WFWA 2JUFA 1AWOA 1NM7A 3X25B 1WA7A 2GTJA 4KH1B 5LJ3g 4FYVB 1X43A 4OMPA 5FWCA 3NGPA 1WI7A 2QEXT 2FZKB 1SHGA 3CCVA 2FYKA 3OMGA 3UATA 2A3LA 1YJWT 4QQ6A 2P4RA 2KK4A 2X9HA 2YUOA 5FU7C 1ZA2B 2EQMA 1UUEA 2ABLA 2K5FA 4BDYA 1N5ZA 3CCSQ 3FB9A 4II1A 4ZGEB 3BDUA 4E7HA 4OMFB 3LWHA 1TU0B 1JB0E 2YUNA 2F69A 2E64A 2COYA 2JJ9A 3INZA 3MP1A 1VOMA 1YHQQ 1M3BA 1X2QA 4EMKB 4A4KA 3EG9A 4DQ2A 4Y92A 4C8QD 4C8QE 3I55Q 2NUPA 1G8XA 4JRIA 5ECAA 1VQKT 1Q82U 3I5RA 2F2XA 1YBYA 4J9DA 3TCJA 3ULRB 2YDLA 1PHTA 5AYFA 3FJ5A 5GMKj 1RAIB 1I8FA 2DL7A 1G2BA 3A1PA 2KBTA 2RQWA 2RQUA 4OMLA 1VIFA 2EJFA 2FPFA 3P8BB 3FEOA 1I4K1 2DA9A 1VQPT 2KNBB 2GGRA 1IHVA 3I56T 2HSEB 4AT1B 2L2PA 3LGLA 2RJCA 4M75C 3DKMA 2FPDA 4PJOC 2EQUA 2IG0A 2EYZA 2XIDA 5I2SA 3JCMW 2EPDA 3MP8A 2XDDA 4ESRA 2J6KA 1K8AC 1YITT 3EFOB 5D6WA 5L23A 2I2LA 1WHJA 1G3YA 2QTVA 2V1RA 2OTJA 3O8VA 2K3XA 1WJQA 2XD0A 3UA6A 1YJ9Q 4AFSC 1X6BA 2CZ7B 5KH6A 1GBRA 2FVUA 1D1AA 1D0ZA 3G7ZA 1IGUA 4N4IA 3OQ5A 4M7DD 3CBOA 4M7DE 1UJYA 2CZ1B 2VYTA 2KI7A 4A53A 2DL3A 5IHNA 5GAN4 1ZX6A 2E4HA 3CCUQ 1GCQC 4F7UF 5KYWB 2E6NA 2X4WA 2RHXA 3H41A 1YCSB 4C5IA 1MMAA 3OBYA 4BB7A 2DM1A
chains in the Genus database with same CATH topology
5CAIA 4C0FA 1VQPA 1Y71A 4VUBA 1QW1A 3CCUA 2LCLA 2MMPA 2ZZDA 4M78E 3HSBA 4QVCA 1BI1A 5KE2A 2PUOB 3G71T 2DTOA 3CMEA 2VGMA 3OS0A 3JCMP 1XTDA 3QPHA 4C5HA 3HL8A 2BKDN 1QP2A 3PNWC 4WF2A 4RG8A 3CCSA 3JB9H 4BE2A 4FU6A 1BIAA 3WXMB 2YHTA 2RJEA 4HCZA 5I21A 3I56A 1JJ2S 3GNGA 5D6YA 4Z02A 3CD6A 3EFSA 3PGGA 1KQ1A 2WSFE 4C0ZA 5GANg 4X9DA 3MEUA 4ME7A 3PIPA 3S3OA 5A0LA 1VQLA 3AHUA 4JLIA 2GF7A 2YRVA 4N4GA 2DTHA 2XG8D 3QG1A 2X4YA 3BDLA 3HRSA 3MEVA 2CYZB 5LJ5j 1OYXA 4JRPA 3X20B 1M1KU 3LX7A 3VUBA 1YJ9T 1QVFA 3OSVA 4OB0B 1YHQA 2VGNA 2EAYA 3GLXA 3SB2A 2O01E 3LW5E 4ZN1A 2K57A 3JAME 1VQOA 5GAN5 3CC2T 3GOXA 2DVEA 5GAMe 2IVWA 3JCMV 5GAOq 4EMGA 1PSFA 4KUIA 3OW2S 4FL6A 1YITA 5GMKe 4F7UG 3I55A 3C95A 3OYAA 3OYJA 2QQ9A 3JCMQ 2RM4A 1UGSB 2B8AA 3QKJA 2PVGB 2ZPBB 1BKBA 3M5AA 5LJ3d 2QQBA 2QI2A 2R58A 4EDUA 1K73U 3C4SA 1M1FA 3A8LB 3CCUT 2LVMA 1WJSA 3CCMT 4HT8A 3UT1A 1OZ2A 4NL3A 2K5IA 5IN1A 2DKGA 3HRTA 4C8QF 3OYFA 4OB2B 3X24B 1SSFA 3V7RA 2VXFA 5FROA 3M9QA 2VXEA 2V8IA 1WGSA 2EIFA 5CQXA 3JCMf 2LT1A 4F7UA 3CMAA 3CD6T 4C92C 5GAMf 4M78B 3GNFB 4E47A 3FIFA 2EYQA 3FDRA 1KG1A 2MF2A 5CCAA 1G3WA 1M90C 4OVAA 2JOYA 4E7JA 2WACA 1VQNT 3M53A 4IUVA 1N9SA 4J8OA 2RD1A 3CC4T 3RMSA 1QVGS 1N8RC 1JRIA 2XK0A 3RMQA 3OB9A 1WQ7A 2HBPA 5CKFA 3FRNA 3OW2A 3JCMh 3E9GA 5LJ5h 1NJIU 2K4YA 2D9TA 3OYNA 3A8HB 5DLOA 5GAMh 5GAOm 1VQMT 3Q1JA 5IAYA 2PUKB 3UDCA 3TREA 5GMKh 3PFSA 4LD9K 1D3BA 2RK1A 1Y96B 2XHCA 3META 4J7FA 3V8KA 3VUZA 5LJ3e 2P0PA 3OA6A 4MZMA 4OP0A 4C0DB 4L6V5 1DJ7B 3F70A 3OYIA 3MP6A 3GP8A 5C6SA 5LL6S 3S3NA 1V29B 3A5ZB 3G6ET 3JSCA 4QQGA 3VU3C 3OBWA 1EIFA 2CGHA 1QP3A 1BI2A 2RB6A 2L5QA 4M75F 2RI2A 4M77B 4ELZC 2XU8A 3VKIA 1XNIA 2LX9A 4ELYC 5GAOn 1JBMA 4PJOF 1U8RA 4EMHA 3VYGA 4C8QG 3PIOA 1UGQB 3CCLT 4P5NA 4JS4A 3CMAT 4E7LA 4XTXA 3VJPA 4BY6B 4F7UE 1Q86U 3PT9A 1OZ3A 4C0GA 3LLRA 1LJOA 4GLKA 1BI0A 5GMKm 2ZGWA 1YIJT 2X35A 5CQYA 5LJ3f 5C0MA 4CRIA 3L42A 4A4HA 3DLLA 1YJ9A 1QVGA 3L2ZA 2DIQA 1QVFS 4BDZA 4BUGA 3BFMA 4XTVA 1LOJA 1UB4A 2RA2A 2LQKA 1NPPA 4BE1A 3BY7A 3CC2A 3A8OB 3CPWS 3JCMd 2L8DA 3M58A 5LJ5d 2JVVA 2E1HA 2HQEA 3EAEA 5M9OA 1M1KC 3JB9F 4QQDA 3ZEHA 2ZPGB 1ZHIA 2RO0A 3LGFA 4C8QA 3UWNA 2ZPIB 4GY5A 4FT2A 1P92A 2R5AA 3KBGA 3QJ6A 2EJGA 5GANj 2XICA 1LNXA 2O4XA 3S3MA 1VQ9T 1S72T 3KXTA 3VV0A 4N0AC 3M59A 5DM7R 3V7SA 4TVRA 4JJNK 3KUFA 4M78D 4LDUA 4A4GA 1O9SA 2KVQG 2PU9B 3CCMA 5GMKi 1VQ8A 4M7DF 4J5YA 5KCOA 3E19A 3CXCA 1HK9A 3SFMA 2G3RA 3JRZA 4IUPA 1G3SA 4M78C 4OGEA 2FHDA 2X4JA 2ZPFB 2JTFA 2GCXA 4RMOA 5GAN8 3L2UA 4O6JA 3CCQT 4MDXA 4EPCA 4M75G 4QVDA 5FLXE 4KULA 2E10A 3DLMA 4JLGA 4PJOG 4HCBA 4PL6A 3CC7T 4ZN3A 4OF1A 1X01A 1BIBA 2Y90A 1VQNA 1BYMA 1FXXA 2JZ2A 1UGPB 1K9MU 1FX7A 2QTXA 3PTAA 3CC4A 2M1HA 2KQWA 3X28B 4HA8A 5CKEA 3SD4A 2K3YA 4JRQA 5GAOr 3J7AF 2ZCFB 2DD5A 3QYGB 4J7IA 4F7UB 5LJ5e 2H3JA 5HK3A 3JCMe 4Y91A 3JCMX 1RL2A 4C0DC 5J39A 4L59A 3MHXA 2VV5A 4PLLA 4B9XA 1NZ9A 1VQMA 1I5LA 1NE8A 2NLUA 1U1TA 4IUTA 4M77D 4XTZA 3RKYA 4M75A 4M77E 1KD1U 3G4SA 2QQAA 3EFRA 2D0QB 3J81E 4M77C 2X4XA 3SWNA 3GPLA 4PJOA 3CCVT 3JB9G 4M7AG 2KY9A 2DD4A 1NJIC 2DXBA 2DZCA 4OB3B 4KBMB 2PVOB 3MEAA 4X34A 3G6EA 3L2QA 1VQ8T 3L2VA 3V8JA 2EJ9A 4C5GA 5GANh 1K73C 4BY6C 5IT9E 2GFAA 3S6WA 3FC3A 4J6WA 4MMLA 3URGA 2KAFA 1U1SA 5FRNA 4JS5A 1D3BB 2E70A 4M7DG 3CBMA 4EMKA 1KQ2A 4KUDK 5LJ5f 3CCLA 5FU7B 4LDWA 1O75A 2E65A 3QBYA 3V8LA 5CKDA 4FSXA 3JCMb 1AHJB 1KHIA 2HD0A 2RI5A 3MO8A 5GAOl 4M7AA 4MZPA 2DXCA 3M4GA 4A54A 4JDSA 3QUIA 5HKCA 1XQHA 2DO3A 2LCCA 2KDSA 4RCCA 1YIJA 4N4HA 5GAMg 1KC8U 2DJZA 2FL7A 3NFCA 5A0GA 4QW2A 1Q86C 5KCHA 3P8HA 5CKBA 3X26B 2YLBA 3CBPA 5I2MA 3OYGA 1KHCA 3HPWA 3PMIA 2DXTA 2Y4YA 4M7DA 4DOWA 1H3ZA 4O5VA 5CIUA 1VQ7T 3OS1A 3G4ST 2V8JA 1RI0A 1VQ9A 1Q7YU 5FRMA 1S72A 3NTKA 4V2SA 4PJOD 1VQ4T 2DXUA 2P0QA 3QZ9B 4Q5WA 4RKUE 3OYKA 1VQ5A 4BD3A 4PJOE 2LQ8A 1MGQA 2AHJB 3ZBDA 2LT4A 3MEWA 3OYDA 2LC4A 4C92F 5CO7A 4ZGJB 4BE0A 3QZ5B 4PKCC 3OS2A 5DLQE 5GANd 5GMKl 1R8OB 3RESA 3T9NA 2FB7A 4C8QB 3G71A 2CKKA 1YCYA 3PMTA 1WJRA 1YJNT 2XKOC 3HKSA 2RJFA 3M54A 2O4XB 3RKWA 4NL2A 1G5VA 3CCQA 3OYMA 5EG2A 2BUDA 3WVEB 1GXIE 2RK2A 4Y28E 5FU6B 2R5MA 2R57A 1HXDA 4LD6A 3CC7A 3QIIA 4JRKA 2P4TA 4M7AD 4M7AE 3CCJA 1Y7XA 4FT4A 1ZQ1A 4ZTFA 2JNGA 2M16A 3J80E 5CKHA 3OMCA 2HNIA 4M7AC 2DIGA 2RH2A 2MWOA 1NPRA 2JUFA 2MWPA 2K5LA 2D6FA 2L89A 3X25B 5GAN6 2RHIA 2EWNA 5LJ3g 5CR2A 1K9MC 2HAXA 2EFIA 2QEXT 5D6XA 3CPWA 4LDXA 4PJOB 2A7YA 4BI8B 4R55A 3V7CA 1B34A 3C12A 4PNOA 1M5Q1 3CCVA 2WSEE 3BW1A 2FYKA 3OMGA 2CS7A 3E1SA 1VQ5T 1QVPA 2A3LA 1IZ6A 2RHYA 1YJWT 4XU0A 4QQ6A 3GIBA 1KD1C 2GFUA 2QDYB 5GANe 3OY9A 1WNLA 1K8AU 2KK4A 5FU7C 4X9CA 2KMTA 2DTIA 2EQMA 4A4EA 3TU4K 3ZFJA 4ZGDB 3HP9A 3DB3A 3OYCA 2K5FA 4BDYA 4C92G 3SWNB 2JN0A 3FB9A 2VC8A 4II1A 2ZPEB 3HFOA 4MMKA 4ZGEB 1UGRB 4E7IA 3L2RA 1MHNA 3BDUA 4OGCA 4E7HA 4OMFB 2GQVA 2F5TX 3M55A 2PVDB 3TEEA 3LWHA 1JB0E 3QJYA 3L1AA 4J6XA 3ASKA 4RG2A 2RHUA 2OTLT 1ZBXA 1M9SA 2F69A 2E64A 3CCJT 4IKFA 4XAXB 4XU3A 3INZA 1X6OA 3MP1A 3OSSC 2DK3A 4DA4A 3UPUA 4EMKB 4A4KA 3HRUA 5GANf 3NTIA 4C92A 2MAMA 3LWIA 4DQ2A 1N27A 4LDVA 5HK0A 1KC8C 4M7AB 5GAOp 1VQ7A 5KE3A 3QYHB 4C8QD 4M78F 2ZPHB 4HKEA 4XU1A 5DY9A 3RUXA 4C8QE 1YI2T 4JRIA 4XTWA 3QSUA 4ATOA 3RIRA 3FLGA 4R56A 4C8QC 1VQ4A 3OYBA 2DZ9A 3LH0A 2RHZA 1Q82U 4A4FA 1VQKT 1YBYA 3TCJA 1N9RA 4RCBA 5GAMj 1X75C 1VQ6T 5AYFA 5J3BA 2WSCE 3CEYA 4L5GA 4MZTA 5FU6C 1Q7YC 5GMKj 1Q81U 1KQSS 4M7DB 1I8FA 4XTUA 2Y4XA 1YJNA 3LYIA 4D6WA 4YTLA 3H6ZA 4J6YA 4UC4A 4BI4A 2V8KA 4HT9A 4FM4B 2QA4T 1VIFA 2VUBA 5GAN3 3P8DA 2EJFA 3WVDB 3P8BB 1OI1A 3FEOA 1G3TA 1I4K1 3CCET 4ZTJA 1WPYA 4LDYA 3HHTB 1WQWA 3CPFA 1I81A 3JCMg 4B9WA 1BI3A 5LJ5g 1VQPT 1VUBA 3CXCS 4HCCA 4M77F 3OYYA 5L8RE 3OYHA 2E41A 3QDRB 5A2QE 3CMET 5A0DA 2MI6A 1TH7A 4XU2A 2PQWA 4C92D 3CCST 4XK8E 1JJ2A 4C92E 3QXEB 2QEXA 3I56T 2F5KA 1W2BS 2YLCA 1XOVA 4M75D 4XQ3A 4M75E 3CCRA 3LGLA 2HQXA 1VQLT 2JTMA 2RJCA 4JUVA 1PSEA 2E12A 4M75C 3DKMA 2M9UA 1YJWA 2DAQA 1IREB 4BACA 4M78G 3SWNC 2OAUA 4PJOC 2LTOA 2EQUA 1W4SA 2IG0A 1KQSA 1YHQT 2P0KA 5HY6A 2XIDA 3OYLA 1N6AA 2EQKA 5I2SA 3JCMW 1VQOT 1B34B 2CZ6B 3A8GB 3MP8A 2XDDA 2QQSA 5LJ3j 3SDZA 3GF5A 2EQJA 1K8AC 1YITT 1M4ZA 2XI9A 4N0AA 5D6WA 3I55T 2I2LA 5J26A 3H8ZA 2EKOA 1G3YA 2LNVA 4EMKC 2OTJA 4FIBA 3MCAB 3JB9D 1Y07A 3O8VA 3R6OA 2OTLA 3A8MB 3QO3A 4M78A 2K3XA 1WJQA 3N5BB 2LDMA 4OB1B 4CI0C 4DOVA 2XD0A 3OYEA 4PLIA 2CZ7B 5KH6A 4NOYA 2FVUA 5CK9A 5GAN2 3E9FA 3G7ZA 4NS5A 2DEQA 4N4IA 4QVZA 1M90U 3M57A 3JB9I 3OQ5A 2KSSA 4M77G 1UEBA 2LRQA 4E7KA 1W2BA 4M7DD 3CBOA 4M7DE 2RJDA 1YI2A 3VYHB 2CZ1B 3M56A 3CCRT 1N8RU 4M7DC 2E6ZA 2QQRA 4C5EA 2VYTA 4J83A 1VQKA 4A53A 2XDPA 4IUQA 2RI3A 5GAN4 2DPPB 1Y96A 2CZ0B 3NTHA 1VQ6A 3M4YA 4C92B 2E5QA 3RKXA 4F7UF 3JCMJ 4IURA 2L3RA 2E6NA 4M75B 3JB9J 5CVIA 3L2WA 1M8VA 1Q82C 2XDBA 2X4WA 1M1GA 2C06A 4M7AF 4KT0E 4IUUA 3QHSA 5GAMd 1FWZA 4M77A 3RERA 2BIVA 2RHXA 1VIEA 2QA4A 4MDWA 3JCMc 4C5IA 3ME9A 3DB4A 3HFNA 3OBYA 4BB7A 5GAN7 1Q81C 3ER0A 3CCEA 1H641 2K2VA 4BI3A 3FJPA 2OTJT 3C94A 2QXFA 4XTYA 2M0OA 3OS5A 5LJ3h
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTX A;  4M7D B;  4F7U E;  2DXT A;  5CAI A;  5GMK j;  4M7D A;  1I8F A;  4XTU A;  3QSU A;  4M78 E;  1LJO A;  3HSB A;  4QVC A;  5GMK m;  4J6Y A;  2DTO A;  2ZGW A;  4HT9 A;  3JB9 F;  3JCM P;  5LJ3 f;  4V2S A;  4PJO D;  2DXU A;  4PJO E;  3L2Z A;  5GAN 3;  4WF2 A;  2EJF A;  3JB9 H;  1BIA A;  1MGQ A;  1LOJ A;  3BFM A;  2RA2 A;  2YHT A;  1I4K 1;  4XTV A;  4C92 F;  3BY7 A;  5I21 A;  1WPY A;  3EFS A;  1WQW A;  3PGG A;  5LJ5 d;  1I81 A;  1KQ1 A;  2E1H A;  3JCM g;  5GMK l;  5LJ5 g;  3JCM d;  5GAN g;  4X9D A;  5GAN d;  3RES A;  3AHU A;  2FB7 A;  4C8Q B;  1M8V A;  4JLI A;  4C8Q A;  1YCY A;  4M77 F;  2DTH A;  5LJ5 j;  3RKW A;  5GAN j;  2EJG A;  2E41 A;  4NL2 A;  1LNX A;  1TH7 A;  4XU2 A;  4N0A C;  4C92 D;  2EAY A;  3V7S A;  3SB2 A;  4C92 E;  1HXD A;  4M78 D;  2K57 A;  5GAN 5;  4M7A D;  4JRK A;  2YLC A;  4M7D F;  2DVE A;  4M75 D;  4XQ3 A;  4J5Y A;  3JCM V;  5GAM e;  4EMG A;  1HK9 A;  4M75 E;  5GMK i;  5GAO q;  4M78 C;  4M7A C;  2HNI A;  5GMK e;  4JUV A;  4M75 C;  4F7U G;  4M7A E;  3JCM Q;  2RM4 A;  4M78 G;  3SWN C;  5GAN 8;  5GAN 6;  4PJO C;  4M75 G;  5LJ3 d;  2EWN A;  4QVD A;  5LJ3 g;  2E10 A;  4PJO G;  4PJO B;  3JCM W;  4HT8 A;  1B34 B;  1X01 A;  1BIB A;  1B34 A;  2Y90 A;  4PNO A;  2DKG A;  3V7C A;  4C8Q F;  5LJ3 j;  4NL3 A;  1M5Q 1;  3V7R A;  2QTX A;  2VXF A;  3BW1 A;  2FYK A;  4N0A A;  4HA8 A;  5GAO r;  2I2L A;  4XU0 A;  2VXE A;  4EMK C;  3GIB A;  4F7U B;  3JCM e;  3JCM f;  5LJ5 e;  3JB9 D;  4F7U A;  5GAN e;  3JCM X;  4Y91 A;  1WNL A;  4C92 C;  5GAM f;  4X9C A;  4M78 B;  2DTI A;  3QO3 A;  4M78 A;  3FIF A;  1I5L A;  1U1T A;  4M77 D;  4XTZ A;  3RKY A;  4M75 A;  4M77 E;  3EFR A;  4C92 G;  4NOY A;  3SWN B;  2JN0 A;  3FB9 A;  2VC8 A;  4M77 C;  3SWN A;  3HFO A;  4MMK A;  5GAN 2;  3JB9 G;  4M7A G;  1N9S A;  4PJO A;  2RD1 A;  3BDU A;  2DEQ A;  2DZC A;  1JRI A;  3JB9 I;  4M77 G;  4M7D D;  1WQ7 A;  4M7D E;  3L1A A;  4J6X A;  3JCM h;  5LJ5 h;  3V8J A;  2EJ9 A;  5GAN h;  5GAO m;  2E64 A;  5GAM h;  4M7D C;  4XU3 A;  4J6W A;  3INZ A;  4MML A;  1U1S A;  4A53 A;  5GMK h;  1D3B B;  1D3B A;  3V8K A;  1Y96 B;  4EMK B;  5GAN 4;  4EMK A;  1KQ2 A;  1Y96 A;  5LJ3 e;  4M7D G;  5LJ5 f;  4C92 B;  5GAN f;  4OP0 A;  2E65 A;  3V8L A;  4C92 A;  3JCM b;  4M7A F;  4DQ2 A;  3RKX A;  4F7U F;  3JCM J;  5GAO l;  4M7A B;  4M7A A;  5GAO p;  3M4G A;  4M75 B;  3JB9 J;  4A54 A;  4C8Q D;  4M78 F;  4XU1 A;  3QUI A;  5DY9 A;  3VU3 C;  3RUX A;  4C8Q E;  2CGH A;  2RB6 A;  4JRI A;  4M77 B;  3QHS A;  4M75 F;  4RCC A;  4M77 A;  4XTW A;  5GAM d;  3RIR A;  5GAM g;  3RER A;  4C8Q C;  5GAO n;  2DJZ A;  3JCM c;  2DZ9 A;  1JBM A;  3HFN A;  4PJO F;  5GAN 7;  4EMH A;  2YLB A;  1N9R A;  1H64 1;  4RCB A;  5GAM j;  3FJP A;  4C8Q G;  4XTY A;  5LJ3 h; 
#chains in the Genus database with same CATH topology
 5CAI A;  1MV3 A;  2ATC B;  1Y71 A;  4M78 E;  2LCS A;  3HSB A;  1PWT A;  4RG8 A;  3CCS A;  1BIA A;  2LNH B;  2RJE A;  3GNG A;  1YIT Q;  2CRE A;  3CD6 A;  3EFS A;  3GBQ A;  5GAN g;  3MEU A;  3EGD A;  4F04 B;  1MV0 B;  4JLI A;  1YWP A;  4HVU A;  1H3H A;  2RN8 A;  1OYX A;  3LX7 A;  3G6E Q;  3VUB A;  1QVF A;  1YHQ A;  2EAY A;  4RTY A;  3SB2 A;  1KSW A;  4X1V A;  5GAN 5;  3CC2 T;  5GAO q;  4KUI A;  3I55 A;  1NEG A;  3C95 A;  3OYJ A;  2B8A A;  3QKJ A;  2ZPB B;  3M5A A;  5LJ3 d;  1M1F A;  1WZO A;  3MKD A;  1WJS A;  3CCM T;  3OYF A;  4C8Q F;  4FW2 A;  2CSI A;  2DFU A;  1OOT A;  2VXE A;  5IXF A;  3JCM f;  2LT1 A;  4F14 A;  1S72 Q;  1M90 C;  4OVA A;  2JOY A;  2WAC A;  4IUV A;  4J8O A;  1IHW A;  3OB9 A;  4KH0 B;  1I07 A;  2J6F A;  3JCM h;  2DX1 A;  1VQM T;  3CCQ Q;  3UDC A;  1D3B A;  2XHC A;  3MET A;  4E2F B;  5GJW B;  3OA6 A;  1KFZ A;  3S3N A;  3A5Z B;  2YUP A;  4ELZ C;  2XU8 A;  3RNJ A;  1CSK A;  1JBM A;  1U8R A;  2QAS A;  4P5N A;  4BY6 B;  2EW3 A;  3PT9 A;  4GLK A;  2QAZ A;  2ZGW A;  4FW1 A;  1UDL A;  1YJ9 A;  1VQ8 Q;  2DIQ A;  1ZBJ A;  2M51 A;  2V26 A;  2ENM A;  3M58 A;  5M9O A;  2HQE A;  1TG0 A;  2ZPG B;  3QDF A;  3UWN A;  2R5A A;  1TXQ A;  2ECZ A;  3H0F A;  4N0A C;  4TVR A;  3KUF A;  1PRL C;  1YP5 A;  4M7D F;  2KVQ G;  4J5Y A;  5KCO A;  3E19 A;  4WCI A;  3JRZ A;  2MOX A;  4M78 C;  2YRC A;  1GCP A;  2FHD A;  2ZPF B;  2DVJ A;  3L2U A;  1VQM Q;  1VQ7 Q;  4QVD A;  3G4S Q;  4KUL A;  4R0K A;  4JLG A;  4OMM A;  4CC3 A;  4OF1 A;  2JMC A;  1BIB A;  1FXX A;  1K9M U;  4HXJ A;  2M1H A;  2KQW A;  1AEY A;  4IIM A;  1SG5 A;  4JRQ A;  2K3Y A;  2LQN A;  4J7I A;  4F7U B;  5LJ5 e;  2H3J A;  1WHG A;  1PG5 B;  3MHX A;  2LJ3 A;  2C0O A;  1KD1 U;  3ZL7 C;  2D0Q B;  1KQS P;  4M77 C;  4PJM A;  3CCV T;  1NJI C;  2DXB A;  3SEM A;  4KBM B;  2PVO B;  3G6E A;  3L2V A;  1K73 C;  4DBF A;  3FC3 A;  4MML A;  3VRY A;  2E70 A;  4EMK A;  5LJ5 f;  1HYO A;  5CKD A;  1BK2 A;  4FSX A;  4PK4 A;  3M4G A;  4A54 A;  4JDS A;  3QUI A;  5HKC A;  1VQ5 Q;  1ZSZ B;  4RCC A;  1OUL A;  5GAM g;  3NFC A;  2FL7 A;  5HCK A;  2KRM A;  3P8H A;  1KHC A;  2FRY A;  4ANJ A;  2YSQ A;  3PMI A;  2DXT A;  2Y4Y A;  2C0T A;  3HTR A;  1S72 A;  4V2S A;  2DXU A;  2P0Q A;  4Q5W A;  4RKU E;  4BD3 A;  4PFO A;  2LQ8 A;  2OTL Q;  3OYD A;  4BE0 A;  2LC4 A;  4C92 F;  2VAS A;  8ATC B;  5GAN d;  5GMK l;  2JMA A;  3T9N A;  1VYU A;  2FB7 A;  4C8Q B;  1X69 A;  2A08 A;  2XKO C;  2DRM A;  4NL2 A;  1G5V A;  3CCQ A;  3WVE B;  1OV3 A;  2EVR A;  3I35 A;  4F17 A;  2R57 A;  4LD6 A;  4FCY A;  2P4T A;  2NYS A;  3CCJ A;  1Q95 G;  1ZSG A;  2H3E B;  2JNG A;  2M16 A;  3E2U A;  3OMC A;  1JU5 C;  2DIG A;  1VQ6 Q;  2MWO A;  1NPR A;  2MWP A;  1JQQ A;  2K5L A;  2D6F A;  1RAC B;  5CR2 A;  2P84 A;  2K6D A;  1VYV A;  5D6X A;  4JJB A;  2B86 A;  3H9N A;  2WSE E;  3CCE Q;  3BW1 A;  3EFO A;  2ROT A;  2D8H A;  1TOV A;  2JM9 A;  3OY9 A;  2KMT A;  2DTI A;  3CME Q;  3O5Z A;  3OYC A;  2O2O A;  4AG1 C;  2JN0 A;  4MMK A;  3M55 A;  2PVD B;  9ATC B;  3ASK A;  4RG2 A;  2RHU A;  4XAX B;  2FPE A;  1X6O A;  2KGT A;  2DK3 A;  2KRN A;  2DLP A;  8AT1 B;  3HRU A;  4EIK A;  4AG2 C;  1UGV A;  3NTI A;  2MAM A;  1N27 A;  1KC8 C;  1PRM C;  4M7A B;  1AWJ A;  1EZZ B;  5KYW A;  5GAO p;  1VQ7 A;  2FZG B;  5EC7 A;  4LN2 A;  3QSU A;  3RUX A;  4ATO A;  3RIR A;  4R56 A;  3OYB A;  4J9E A;  1N9R A;  1X75 C;  2KEA A;  2HMA A;  1YNZ A;  2WSC E;  3CEY A;  2DE0 X;  2DJQ A;  1Q7Y C;  1KQS S;  4M7D B;  4DBR A;  4YTL A;  4JJD A;  1JXM A;  4UC4 A;  3WVD B;  2LZ6 B;  1OI1 A;  1HJD A;  5AT1 B;  1WPY A;  4AMC A;  3HHT B;  1V76 A;  2CDT A;  1BI3 A;  2EYW A;  2E41 A;  3RDV A;  5A0D A;  1TH7 A;  4XU2 A;  3CCS T;  4XK8 E;  4CC2 A;  1WHL A;  2YLC A;  1EX4 A;  2EYY A;  4M75 D;  1QVG P;  4M75 E;  3CCR A;  1NJI R;  2OTJ Q;  2JTM A;  2E12 A;  2M9U A;  4J9I A;  1IRE B;  3SWN C;  1KQS A;  3I5S A;  1YHQ T;  1GFC A;  5HY6 A;  1BCM A;  3G71 Q;  1M2V B;  3A8G B;  1KIK A;  5LJ3 j;  1VYT A;  2KRO A;  2EQJ A;  2ZAE A;  1M4Z A;  1PNJ A;  3I55 T;  3H8Z A;  3CXC P;  1Y07 A;  2OTL A;  3REB B;  3QO3 A;  1J3T A;  2GBQ A;  4CI0 C;  3EHQ A;  4NS5 A;  2DEQ A;  2K9G A;  4E7K A;  2KSS A;  2CH4 A;  2RJD A;  1QVF P;  3PVQ A;  2E6Z A;  2QQR A;  2E3I A;  3CPW P;  2XDP A;  1PM3 A;  4IUQ A;  2CZ0 B;  1VQ6 A;  3M4Y A;  4C92 B;  4KGX B;  2COZ A;  2NUZ A;  3L2W A;  1Q82 C;  1Y0M A;  1M1G A;  2C06 A;  1D0X A;  5GAM d;  3QHS A;  3EGX B;  3RER A;  2BIV A;  1VIE A;  4MDW A;  5KYU B;  5KYN A;  2CP7 A;  3JCM c;  2CP3 A;  2V1Q A;  3DB4 A;  5GAN 7;  3CD6 Q;  1YN8 A;  3ER0 A;  3CCE A;  1ABO A;  4M4Z A;  1RAB B;  3C94 A;  4FM4 B;  5LJ3 h;  1PKS A;  4C0F A;  1MMD A;  2PZ1 A;  2QDL A;  4QVC A;  2JM8 A;  2PUO B;  5KYX B;  4OMN A;  3CME A;  2EBP A;  2K3B A;  3OS0 A;  2BKD N;  4FU6 A;  3WXM B;  5I21 A;  4Z02 A;  1GFD A;  1JEG A;  1W6X A;  1U3O A;  3PIP A;  3AHU A;  5A0L A;  2KT1 A;  2GF7 A;  3BDL A;  3MEV A;  1M1K U;  2DF6 A;  1YJ9 T;  4OB0 B;  1B07 A;  3IQL A;  2NWM A;  2O01 E;  4E6R A;  3VS0 A;  3LW5 E;  2YT6 A;  3JAM E;  1TS9 A;  2W0Z A;  3JCM V;  2JXB A;  5GMK e;  4F7U G;  2QQ9 A;  1BB9 A;  1UGS B;  1B7T A;  2FRW A;  2QQB A;  1IRX A;  2QI2 A;  3AT1 B;  2DRK A;  3CCU T;  2LVM A;  3UT1 A;  4NL3 A;  5IN1 A;  1X2K A;  3HRT A;  4OMO A;  3X24 B;  2VXF A;  5IHK A;  1KC8 R;  2K2M A;  2V8I A;  1WGS A;  2OX7 A;  4F7U A;  3CMA A;  2XMF A;  2RPN A;  3FDR A;  3UF4 A;  7AT1 B;  3TSW A;  1TSF A;  1G3W A;  2BE9 B;  2KYB A;  1Q7Y R;  1RAE B;  1RAA B;  1QVG S;  1TUC A;  1WQ7 A;  5CKF A;  1WLP B;  3FRN A;  1TUG B;  1FYN A;  3OYN A;  2D9T A;  1ZLM A;  3Q1J A;  1K76 A;  3TRE A;  5GMK h;  4A63 B;  3PFS A;  2RK1 A;  1Y96 B;  2D0N A;  2PTK A;  4MZM A;  2EYX A;  4OP0 A;  4C0D B;  4L6V 5;  3GP8 A;  5C6S A;  1V29 B;  3G6E T;  3JSC A;  2LP5 A;  3VU3 C;  1UTI A;  2DMO A;  1BI2 A;  2RB6 A;  2L5Q A;  4M75 F;  1ZSZ A;  3CXC S;  3G71 A;  1WHM A;  3SHW A;  5GAO n;  4PFP A;  4PJO F;  4JZ4 A;  1OEB A;  1T3L A;  4C8Q G;  3PIO A;  4JS4 A;  1FMV A;  1Q86 U;  1QCF A;  1LJO A;  2KT8 A;  1QVG A;  1QVF S;  1SKU B;  1TWB A;  4BE1 A;  1UB4 A;  2RA2 A;  1ABQ A;  3CPW S;  1GRI A;  2E1H A;  4QQD A;  2HCK A;  3LGF A;  2EQI A;  4C8Q A;  4GY5 A;  2MCN A;  1GBQ A;  5GAN j;  2Z0W A;  1S72 T;  1LNX A;  3KXT A;  2IIM A;  4M78 D;  3CXC A;  2CH4 W;  1E7O A;  1UG1 A;  2JTF A;  2DYI A;  2GCX A;  4RMO A;  2KXD A;  4O6J A;  3CCQ T;  4DBH A;  4FSS A;  2E10 A;  1JO8 A;  3DLM A;  4HCB A;  2EGE A;  4PL6 A;  1VQ4 Q;  5IH2 A;  2CUD A;  1IGQ A;  3SD4 A;  1Q82 R;  3J7A F;  4RTU A;  2DD5 A;  3JCM e;  3CPW A;  1M1K R;  1YJN Q;  5J39 A;  2AZS A;  2VV5 A;  4PLL A;  1NZ9 A;  2NLU A;  1U1T A;  2HL3 A;  4M77 D;  4M77 E;  3EFR A;  3J81 E;  3GPL A;  4M7A G;  2DD4 A;  4OB3 B;  2A36 A;  3L2Q A;  1VQ8 T;  2AIR B;  5GAN h;  2CUB A;  3S6W A;  3URG A;  1U1S A;  4M7D G;  4KUD K;  2LMJ A;  5FU7 B;  3V8L A;  2HD0 A;  2RI5 A;  3MO8 A;  5GAO l;  4M7A A;  4MZP A;  3VS4 A;  1XQH A;  2DO3 A;  2KDS A;  4WTO B;  3R6N A;  1UFF A;  5A0G A;  1W2B P;  1U06 A;  5KCH A;  2ED1 A;  3HPW A;  4D8K A;  1M3A A;  4M7D A;  4HVV A;  4DOW A;  4J9C A;  1H3Z A;  1QLY A;  4O5V A;  1UJ0 A;  5CIU A;  1VQ7 T;  1A0N B;  4Z8A A;  3G4S T;  2V8J A;  1NEB A;  3KFV A;  3NTK A;  2MK5 A;  1G83 A;  4J9B A;  4KGV B;  1NG2 A;  1MGQ A;  3CCJ Q;  2LT4 A;  3QWX X;  4PKC C;  5IHI A;  1R8O B;  3RES A;  2CKK A;  3VS7 A;  2RJF A;  2OJ2 A;  4PFZ A;  2L0A A;  1YFN A;  2RK2 A;  2R5M A;  1YI2 Q;  2W10 A;  3UA7 A;  3QII A;  1ZQ1 A;  4ZTF A;  1Q86 R;  5CKH A;  4M7A C;  2RH2 A;  2X51 A;  1SEM A;  4DEX A;  2EWN A;  1K9M C;  2F2V A;  2JS0 A;  2LJ0 A;  2HAX A;  2EFI A;  3M0Q A;  1T0J A;  2A7Y A;  4BI8 B;  1M2V A;  2QA4 Q;  3C12 A;  2AKL A;  2DEU A;  3E1S A;  1VQ5 T;  1QVP A;  1WXU A;  1IZ6 A;  2RHY A;  1NYF A;  3GIB A;  2A0F B;  1KD1 C;  1JXO A;  1M2O A;  1WNL A;  4X9C A;  3LH5 A;  4A4E A;  3VRZ A;  2YUQ A;  4LE9 A;  4LXC A;  3DB3 A;  4C92 G;  2DIL A;  2LQW A;  4PJO B;  3HFO A;  4E7I A;  1UGR B;  1SHF A;  3TEE A;  2F5T X;  1W70 A;  3MJX A;  1VQL Q;  3QJY A;  3L1A A;  4J6X A;  2BZ8 A;  4KRT A;  2RQR A;  2OTL T;  1ZBX A;  1M9S A;  2JS2 A;  4DA4 A;  4DEY A;  3UPU A;  1V1C A;  1VQO Q;  4C92 A;  3LWI A;  4LDV A;  3M0T A;  3QYH B;  2AKK A;  4M78 F;  4HKE A;  4XTW A;  1GL5 A;  4HVW A;  2GNC A;  3EGX A;  1VQ4 A;  3H0H A;  5KYU A;  2DZ9 A;  2RHZ A;  4A4F A;  4B6M A;  4RCB A;  5GAM j;  1R77 A;  3M0P A;  1VQ6 T;  5FU6 C;  2CP6 A;  1Q81 U;  4XTU A;  5IXB A;  1YJN A;  3LYI A;  4D6W A;  4J9H A;  2BZY A;  4HT9 A;  5KYX A;  2BTT A;  1PD1 A;  2VUB A;  3PVL A;  5GAN 3;  3BE3 A;  3CCR Q;  3CCE T;  4ZTJ A;  1WQW A;  3CPF A;  4B9W A;  5LJ5 g;  4M77 F;  3OYY A;  3OYH A;  2JT4 A;  3QDR B;  3CME T;  2MI6 A;  3EG3 A;  1JJ2 A;  3QXE B;  1W2B S;  4XQ3 A;  2MIO A;  2I0N A;  1PSE A;  2D1X A;  2DAQ A;  2MYS A;  1E6G A;  1W4S A;  2P0K A;  3OYL A;  1D1B A;  2EQK A;  2MPX C;  1B34 B;  3M0R A;  1QCO A;  1CKA A;  2L3P A;  2XI9 A;  2DNU A;  4RTV A;  4EMK C;  2LNV A;  4FIB A;  3MCA B;  3JB9 D;  3R6O A;  3EG2 A;  3A8M B;  1NYG A;  3N5B B;  2LDM A;  4DOV A;  2DL8 A;  2DBK A;  3E9F A;  4QVZ A;  3M57 A;  1UEB A;  2LRQ A;  1W2B A;  1RLP C;  1YI2 A;  3TQ7 P;  3VYH B;  3M56 A;  1N8R U;  4C5E A;  2HKQ B;  2RI3 A;  2DPP B;  1Y96 A;  2E5Q A;  2J6O A;  2KRS A;  5CVI A;  1M8V A;  1IXD A;  4KT0 E;  1FWZ A;  1S1N A;  2J06 A;  2QA4 A;  1K0X A;  3TSZ A;  3ME9 A;  1OX8 A;  1H64 1;  1AOJ A;  2K2V A;  3FJP A;  4BI3 A;  2OTJ T;  1AZE A;  4XTY A;  3OS5 A;  1VQN Q;  2QG9 B;  4FYX B;  2LCL A;  3CC4 Q;  1BI1 A;  5KE2 A;  3G71 T;  1K9M R;  2O88 A;  1XTD A;  3QPH A;  4IIO A;  4C5H A;  1QP2 A;  2LJ1 A;  3JB9 H;  2YHT A;  4HCZ A;  3EGU A;  1KQ1 A;  3S3O A;  1C0M A;  1VQL A;  2YRV A;  2DTH A;  1AT1 B;  1KD1 R;  2XG8 D;  3QG1 A;  4JRP A;  2KYM A;  2CYZ B;  1NLO C;  1R0C B;  2HZY A;  3GLX A;  1VQO A;  2RQV A;  1I0C A;  2IVW A;  1E6H A;  3PE0 A;  1PSF A;  4CC4 B;  4FL6 A;  5GJV B;  3CCL Q;  3CMA Q;  3OYA A;  1QCN A;  2RM4 A;  2PVG B;  2HSP A;  1BKB A;  2A37 A;  1H92 A;  2R58 A;  4EDU A;  2E5K A;  1YIJ Q;  4OMQ A;  4QT7 A;  4HT8 A;  2DYB A;  1OZ2 A;  2DKG A;  2HKN A;  4OB2 B;  2HQH A;  3V7R A;  5FRO A;  3M9Q A;  2EIF A;  2FZC B;  3CD6 T;  2AK5 A;  4M78 B;  3GNF B;  3FIF A;  1AD5 A;  1QMC A;  2MF2 A;  1TTH B;  4JPB W;  3M53 A;  1N9S A;  2QGG A;  2RD1 A;  1QKX A;  3RMS A;  1JRI A;  2XK0 A;  3RMQ A;  2HBP A;  2KXC A;  1NBE B;  3E9G A;  2K4Y A;  5DLO A;  2NUT B;  4LD9 K;  3VUZ A;  1QQJ A;  5LJ3 e;  1HD3 A;  3CC7 Q;  3F70 A;  1UHF A;  5LL6 S;  4QQG A;  3OBW A;  2CGH A;  3RBB B;  4M77 B;  2RI2 A;  2O9V A;  1Y57 A;  3VKI A;  1XNI A;  2LX9 A;  4ELY C;  2J05 A;  1SSH A;  4EMH A;  1OPL A;  1UGQ B;  4E7L A;  3VJP A;  1RAH B;  4F7U E;  1Z9Q A;  1NLP C;  1OZ3 A;  3LLR A;  5GMK m;  5CQY A;  3QWY A;  1N8R R;  5LJ3 f;  3DLL A;  4A4H A;  2DL4 A;  3L2Z A;  2RF0 A;  4BUG A;  3BFM A;  4XTV A;  1LOJ A;  2LQK A;  4FYW B;  3A8O B;  4RTT A;  2O31 A;  5LJ5 d;  2JVV A;  3EAE A;  3NHN A;  3JB9 F;  1M1K C;  2YWW A;  1WXT A;  1YWO A;  1UHC A;  2ZPI B;  4GLM A;  3KBG A;  3QJ6 A;  2EJG A;  2XIC A;  2VVK A;  2H8H A;  3VV0 A;  1QWF A;  4A4G A;  1O9S A;  2PU9 B;  5GMK i;  1HK9 A;  4IUP A;  1ZA1 B;  1CKB A;  1G3S A;  4OGE A;  1BU1 A;  2X4J A;  3EH1 A;  4MDX A;  4EPC A;  4M75 G;  1WXB A;  1MMG A;  4QKU A;  4PJO G;  1VQN A;  1BYM A;  1UGP B;  3CC4 A;  4HA8 A;  5CKE A;  2CT4 A;  2ZCF B;  3QYG B;  4Y91 A;  2RQT A;  4L59 A;  1I5L A;  2HDA A;  4IUT A;  3RKY A;  4M75 A;  1OQK A;  1RUW A;  4LNP A;  4PJO A;  1MMN A;  2KY9 A;  1X6G A;  2GQI A;  4E7Z A;  2KE9 A;  4C5G A;  4BY6 C;  4PJJ A;  2AT1 B;  5FRN A;  1WX6 A;  1SPK A;  4JS5 A;  1ZUU A;  4E7S A;  2QEX Q;  3CCL A;  1O75 A;  1KHI A;  1R0B G;  2DXC A;  2FO0 A;  2LCC A;  1YJW Q;  1YIJ A;  4N4H A;  2RMO A;  3NPF A;  1Q86 C;  1AWX A;  5CKB A;  3X26 B;  3OYG A;  1VQ9 A;  1VQ4 T;  3QZ9 B;  3OYK A;  1GCQ A;  1AZG B;  3ZBD A;  2X3X D;  1U5S A;  1AVZ C;  5DLQ E;  3EH2 A;  4Z89 A;  2BE7 D;  2YXY A;  1ZUK A;  3PMT A;  1WJR A;  1YJN T;  3HKS A;  1D0Y A;  1ARK A;  3EG0 A;  3M54 A;  1T0H A;  2O4X B;  3RKW A;  3OYM A;  5EG2 A;  1GXI E;  4Y28 E;  2ROL A;  1HXD A;  4M7A D;  3CC7 A;  4JRK A;  4M7A E;  1VQK Q;  1RI9 A;  3J80 E;  2EGA A;  2L89 A;  5FWB A;  5GAN 6;  2HBW A;  2RHI A;  2CP5 A;  4RTZ A;  2FEI A;  4LDX A;  4R55 A;  3V7C A;  1B34 A;  4PNO A;  3THK A;  1M5Q 1;  3M0U A;  2CS7 A;  2KR3 A;  2CT3 A;  4XU0 A;  1VQP Q;  1QKW A;  2GFU A;  2QDY B;  5GAN e;  1K8A U;  1C1A A;  3TU4 K;  3ZFJ A;  4ZGD B;  3HP9 A;  3SWN B;  1ZSZ C;  2VC8 A;  2ZPE B;  3I56 Q;  1M3C A;  3L2R A;  4J9F A;  4OGC A;  1MHN A;  1OU8 A;  1XJW B;  1D1C A;  2GQV A;  2RNA A;  1X27 A;  2QYZ A;  3CCJ T;  4IKF A;  4XU3 A;  1JJ2 P;  3OSS C;  2C0I A;  4PJN A;  4CC7 A;  2VKN A;  1MNE A;  5GAN f;  1FMW A;  5HK0 A;  4RTX A;  2IPO B;  5KE3 A;  4XU1 A;  2ZPH B;  5DY9 A;  1YI2 T;  4KGZ B;  1RAF B;  3FLG A;  1SF9 A;  4C8Q C;  2D8J A;  1KK7 A;  3LH0 A;  1BCO A;  3OW2 P;  2EGC A;  1EFN A;  1KJW A;  5J3B A;  4L5G A;  4MZT A;  2M02 A;  1UEC A;  2Y4X A;  3H6Z A;  4J6Y A;  4BI4 A;  2V8K A;  2L3S A;  2QA4 T;  1Z9Z A;  1LPL A;  2G6F X;  3P8D A;  2F1L A;  2EKH A;  2HEQ A;  1G3T A;  5FW9 A;  4LDY A;  1I81 A;  3JCM g;  5KYY B;  1MND A;  1VUB A;  2PNI A;  3CQT A;  4HCC A;  5L8R E;  1WIE A;  5A2Q E;  2A28 A;  2PQW A;  4C92 D;  1K1Z A;  4C92 E;  2QEX A;  2F5K A;  1XOV A;  2CP0 A;  2HQX A;  1VQL T;  1M30 A;  4JUV A;  3I9Q A;  1YJW A;  4BAC A;  2CP2 A;  4M78 G;  2OAU A;  2LTO A;  3A98 A;  2LX7 A;  1N6A A;  1VQO T;  4FYY B;  2CZ6 B;  2QQS A;  2QGF B;  3SDZ A;  3GF5 A;  1IB8 A;  4N0A A;  2L3Q A;  4HCK A;  5J26 A;  2EKO A;  1TUD A;  4OB1 B;  4M78 A;  1I1J A;  2K7A A;  3NMZ C;  3OYE A;  4PLI A;  1K0S A;  4NOY A;  5GAN 2;  5CK9 A;  1RAG B;  3CC2 Q;  2JTE A;  1M90 U;  3JB9 I;  4M77 G;  1M8M A;  1C6V X;  4M7D C;  3CCR T;  2NUT A;  4J83 A;  1VQK A;  2HL5 C;  3EG9 B;  3NTH A;  1ZUY A;  3CCM Q;  4Z88 A;  3RKX A;  3C0C A;  3JCM J;  4IUR A;  2L3R A;  4M75 B;  3JB9 J;  2NUP B;  2XDB A;  4M7A F;  1K8A R;  1W1F A;  1OX9 A;  4IUU A;  4M77 A;  3HFN A;  1Q81 C;  4D8D A;  4PJL A;  3VS5 A;  2QXF A;  2M0O A;  1VQP A;  5D7U A;  4VUB A;  1QW1 A;  3CCU A;  2MMP A;  2ZZD A;  1HSQ A;  2DTO A;  2VGM A;  3JCM P;  2DL5 A;  3HL8 A;  3PNW C;  4WF2 A;  4BE2 A;  3I56 A;  1JJ2 S;  5D6Y A;  1M27 C;  3PGG A;  2WSF E;  4C0Z A;  1UE9 A;  4X9D A;  4ME7 A;  2SRC A;  4N4G A;  5LJ5 j;  2X4Y A;  3HRS A;  3X20 B;  1WHH A;  3OSV A;  6AT1 B;  2VGN A;  2VWF A;  4LUD A;  4AFQ C;  4ZN1 A;  2K57 A;  4J9G A;  3GOX A;  2DVE A;  5GAM e;  2QK0 A;  4EMG A;  3OW2 S;  1YIT A;  5I22 A;  3JCM Q;  2DBM A;  2ESW A;  4K11 A;  3C4S A;  3A8L B;  2BZX A;  2K5I A;  1SSF A;  1F1B B;  5I11 A;  5CQX A;  4C92 C;  4ZNX A;  5GAM f;  4E47 A;  1WHK A;  4GBQ A;  2EYQ A;  1KG1 A;  5CCA A;  1VQN T;  4E7J A;  4RTW A;  3H0I A;  1K9A A;  3CC4 T;  1RLQ C;  1N8R C;  1SRL A;  3OW2 A;  3U23 A;  5LJ5 h;  1NJI U;  1PC0 A;  1MUZ A;  3A8H B;  5GAM h;  5GAO m;  5IAY A;  3MPU B;  2DET A;  2PUK B;  2E3H A;  1K73 U;  3V8K A;  4J7F A;  2P0P A;  4AFU C;  1OPK A;  1DJ7 B;  3OYI A;  3MP6 A;  1RAD B;  1EIF A;  1QP3 A;  2VB6 A;  3VYG A;  3CCL T;  3CMA T;  4XTX A;  4AFZ C;  3REA B;  1M90 R;  3CCV Q;  4C0G A;  1BI0 A;  1YIJ T;  2X35 A;  1AWW A;  5C0M A;  4CRI A;  3L42 A;  2OI3 A;  3RR6 A;  4BDZ A;  3EHR A;  1NPP A;  3BY7 A;  3CC2 A;  3JCM d;  2COW A;  2K79 A;  1OU9 A;  2L8D A;  3EGD B;  3ZEH A;  1ZHI A;  2RO0 A;  2GTO A;  4FT2 A;  1P92 A;  1VQ9 T;  3G1J A;  2O4X A;  3S3M A;  3M59 A;  5DM7 R;  3V7S A;  4JJN K;  4LDU A;  1PCX A;  3CCM A;  1VQ8 A;  2YRD A;  3SFM A;  2G3R A;  3EG1 A;  5GAN 8;  1WYX A;  2FG0 A;  5FLX E;  3TVT A;  3VS2 A;  2O9S A;  3JV3 A;  4ZN3 A;  3CC7 T;  1X01 A;  2Y90 A;  1D09 B;  2JZ2 A;  1FX7 A;  2QTX A;  3PTA A;  1FMK A;  3X28 B;  5GAO r;  1QWE A;  5HK3 A;  3JCM X;  4DBQ A;  2SEM A;  1RL2 A;  4C0D C;  4B9X A;  1H8K A;  1VQM A;  1NE8 A;  1Q81 R;  4XTZ A;  3G4S A;  2QQA A;  4JJC A;  1K4U S;  3VS1 A;  2X4X A;  3SWN A;  3JB9 G;  4JZ3 A;  1LCK A;  2DZC A;  1B3Q A;  3MEA A;  4X34 A;  3VS6 A;  4RUG A;  3V8J A;  2EJ9 A;  5IT9 E;  2GFA A;  4J6W A;  2KAF A;  4ORZ A;  1BBZ A;  1D3B B;  1ACM B;  3CBM A;  1KQ2 A;  2JW4 A;  1PD0 A;  2E65 A;  3QBY A;  4LDW A;  3JCM b;  1AHJ B;  1VQ9 Q;  2DER A;  1I5O B;  2ED0 A;  1KC8 U;  2CSQ A;  1LVK A;  2DJZ A;  4QW2 A;  2YLB A;  3CBP A;  5I2M A;  2AZV A;  3M0S A;  2M0Y A;  2OAW A;  4F16 A;  3OS1 A;  1RI0 A;  1Q7Y U;  5FRM A;  4PJO D;  1VA7 A;  1VQ5 A;  4PJO E;  2AHJ B;  1SRM A;  3MEW A;  5CO7 A;  4ZGJ B;  1K73 R;  3QZ5 B;  3OS2 A;  3D7S B;  5KYY A;  4LUE A;  1YCY A;  1T3S A;  2F2W A;  1WDX A;  3VS3 A;  2BUD A;  5FU6 B;  1IO6 A;  1PKT A;  1Y7X A;  4FT4 A;  2HNI A;  2J7I A;  2X3W D;  1WFW A;  2JUF A;  1AWO A;  1NM7 A;  3X25 B;  1WA7 A;  2GTJ A;  4KH1 B;  5LJ3 g;  4FYV B;  1X43 A;  4OMP A;  5FWC A;  3NGP A;  1WI7 A;  2QEX T;  2FZK B;  1SHG A;  3CCV A;  2FYK A;  3OMG A;  3UAT A;  2A3L A;  1YJW T;  4QQ6 A;  2P4R A;  2KK4 A;  2X9H A;  2YUO A;  5FU7 C;  1ZA2 B;  2EQM A;  1UUE A;  2ABL A;  2K5F A;  4BDY A;  1N5Z A;  3CCS Q;  3FB9 A;  4II1 A;  4ZGE B;  3BDU A;  4E7H A;  4OMF B;  3LWH A;  1TU0 B;  1JB0 E;  2YUN A;  2F69 A;  2E64 A;  2COY A;  2JJ9 A;  3INZ A;  3MP1 A;  1VOM A;  1YHQ Q;  1M3B A;  1X2Q A;  4EMK B;  4A4K A;  3EG9 A;  4DQ2 A;  4Y92 A;  4C8Q D;  4C8Q E;  3I55 Q;  2NUP A;  1G8X A;  4JRI A;  5ECA A;  1VQK T;  1Q82 U;  3I5R A;  2F2X A;  1YBY A;  4J9D A;  3TCJ A;  3ULR B;  2YDL A;  1PHT A;  5AYF A;  3FJ5 A;  5GMK j;  1RAI B;  1I8F A;  2DL7 A;  1G2B A;  3A1P A;  2KBT A;  2RQW A;  2RQU A;  4OML A;  1VIF A;  2EJF A;  2FPF A;  3P8B B;  3FEO A;  1I4K 1;  2DA9 A;  1VQP T;  2KNB B;  2GGR A;  1IHV A;  3I56 T;  2HSE B;  4AT1 B;  2L2P A;  3LGL A;  2RJC A;  4M75 C;  3DKM A;  2FPD A;  4PJO C;  2EQU A;  2IG0 A;  2EYZ A;  2XID A;  5I2S A;  3JCM W;  2EPD A;  3MP8 A;  2XDD A;  4ESR A;  2J6K A;  1K8A C;  1YIT T;  3EFO B;  5D6W A;  5L23 A;  2I2L A;  1WHJ A;  1G3Y A;  2QTV A;  2V1R A;  2OTJ A;  3O8V A;  2K3X A;  1WJQ A;  2XD0 A;  3UA6 A;  1YJ9 Q;  4AFS C;  1X6B A;  2CZ7 B;  5KH6 A;  1GBR A;  2FVU A;  1D1A A;  1D0Z A;  3G7Z A;  1IGU A;  4N4I A;  3OQ5 A;  4M7D D;  3CBO A;  4M7D E;  1UJY A;  2CZ1 B;  2VYT A;  2KI7 A;  4A53 A;  2DL3 A;  5IHN A;  5GAN 4;  1ZX6 A;  2E4H A;  3CCU Q;  1GCQ C;  4F7U F;  5KYW B;  2E6N A;  2X4W A;  2RHX A;  3H41 A;  1YCS B;  4C5I A;  1MMA A;  3OBY A;  4BB7 A;  2DM1 A; 
#chains in the Genus database with same CATH homology
 5CAI A;  4C0F A;  1VQP A;  1Y71 A;  4VUB A;  1QW1 A;  3CCU A;  2LCL A;  2MMP A;  2ZZD A;  4M78 E;  3HSB A;  4QVC A;  1BI1 A;  5KE2 A;  2PUO B;  3G71 T;  2DTO A;  3CME A;  2VGM A;  3OS0 A;  3JCM P;  1XTD A;  3QPH A;  4C5H A;  3HL8 A;  2BKD N;  1QP2 A;  3PNW C;  4WF2 A;  4RG8 A;  3CCS A;  3JB9 H;  4BE2 A;  4FU6 A;  1BIA A;  3WXM B;  2YHT A;  2RJE A;  4HCZ A;  5I21 A;  3I56 A;  1JJ2 S;  3GNG A;  5D6Y A;  4Z02 A;  3CD6 A;  3EFS A;  3PGG A;  1KQ1 A;  2WSF E;  4C0Z A;  5GAN g;  4X9D A;  3MEU A;  4ME7 A;  3PIP A;  3S3O A;  5A0L A;  1VQL A;  3AHU A;  4JLI A;  2GF7 A;  2YRV A;  4N4G A;  2DTH A;  2XG8 D;  3QG1 A;  2X4Y A;  3BDL A;  3HRS A;  3MEV A;  2CYZ B;  5LJ5 j;  1OYX A;  4JRP A;  3X20 B;  1M1K U;  3LX7 A;  3VUB A;  1YJ9 T;  1QVF A;  3OSV A;  4OB0 B;  1YHQ A;  2VGN A;  2EAY A;  3GLX A;  3SB2 A;  2O01 E;  3LW5 E;  4ZN1 A;  2K57 A;  3JAM E;  1VQO A;  5GAN 5;  3CC2 T;  3GOX A;  2DVE A;  5GAM e;  2IVW A;  3JCM V;  5GAO q;  4EMG A;  1PSF A;  4KUI A;  3OW2 S;  4FL6 A;  1YIT A;  5GMK e;  4F7U G;  3I55 A;  3C95 A;  3OYA A;  3OYJ A;  2QQ9 A;  3JCM Q;  2RM4 A;  1UGS B;  2B8A A;  3QKJ A;  2PVG B;  2ZPB B;  1BKB A;  3M5A A;  5LJ3 d;  2QQB A;  2QI2 A;  2R58 A;  4EDU A;  1K73 U;  3C4S A;  1M1F A;  3A8L B;  3CCU T;  2LVM A;  1WJS A;  3CCM T;  4HT8 A;  3UT1 A;  1OZ2 A;  4NL3 A;  2K5I A;  5IN1 A;  2DKG A;  3HRT A;  4C8Q F;  3OYF A;  4OB2 B;  3X24 B;  1SSF A;  3V7R A;  2VXF A;  5FRO A;  3M9Q A;  2VXE A;  2V8I A;  1WGS A;  2EIF A;  5CQX A;  3JCM f;  2LT1 A;  4F7U A;  3CMA A;  3CD6 T;  4C92 C;  5GAM f;  4M78 B;  3GNF B;  4E47 A;  3FIF A;  2EYQ A;  3FDR A;  1KG1 A;  2MF2 A;  5CCA A;  1G3W A;  1M90 C;  4OVA A;  2JOY A;  4E7J A;  2WAC A;  1VQN T;  3M53 A;  4IUV A;  1N9S A;  4J8O A;  2RD1 A;  3CC4 T;  3RMS A;  1QVG S;  1N8R C;  1JRI A;  2XK0 A;  3RMQ A;  3OB9 A;  1WQ7 A;  2HBP A;  5CKF A;  3FRN A;  3OW2 A;  3JCM h;  3E9G A;  5LJ5 h;  1NJI U;  2K4Y A;  2D9T A;  3OYN A;  3A8H B;  5DLO A;  5GAM h;  5GAO m;  1VQM T;  3Q1J A;  5IAY A;  2PUK B;  3UDC A;  3TRE A;  5GMK h;  3PFS A;  4LD9 K;  1D3B A;  2RK1 A;  1Y96 B;  2XHC A;  3MET A;  4J7F A;  3V8K A;  3VUZ A;  5LJ3 e;  2P0P A;  3OA6 A;  4MZM A;  4OP0 A;  4C0D B;  4L6V 5;  1DJ7 B;  3F70 A;  3OYI A;  3MP6 A;  3GP8 A;  5C6S A;  5LL6 S;  3S3N A;  1V29 B;  3A5Z B;  3G6E T;  3JSC A;  4QQG A;  3VU3 C;  3OBW A;  1EIF A;  2CGH A;  1QP3 A;  1BI2 A;  2RB6 A;  2L5Q A;  4M75 F;  2RI2 A;  4M77 B;  4ELZ C;  2XU8 A;  3VKI A;  1XNI A;  2LX9 A;  4ELY C;  5GAO n;  1JBM A;  4PJO F;  1U8R A;  4EMH A;  3VYG A;  4C8Q G;  3PIO A;  1UGQ B;  3CCL T;  4P5N A;  4JS4 A;  3CMA T;  4E7L A;  4XTX A;  3VJP A;  4BY6 B;  4F7U E;  1Q86 U;  3PT9 A;  1OZ3 A;  4C0G A;  3LLR A;  1LJO A;  4GLK A;  1BI0 A;  5GMK m;  2ZGW A;  1YIJ T;  2X35 A;  5CQY A;  5LJ3 f;  5C0M A;  4CRI A;  3L42 A;  4A4H A;  3DLL A;  1YJ9 A;  1QVG A;  3L2Z A;  2DIQ A;  1QVF S;  4BDZ A;  4BUG A;  3BFM A;  4XTV A;  1LOJ A;  1UB4 A;  2RA2 A;  2LQK A;  1NPP A;  4BE1 A;  3BY7 A;  3CC2 A;  3A8O B;  3CPW S;  3JCM d;  2L8D A;  3M58 A;  5LJ5 d;  2JVV A;  2E1H A;  2HQE A;  3EAE A;  5M9O A;  1M1K C;  3JB9 F;  4QQD A;  3ZEH A;  2ZPG B;  1ZHI A;  2RO0 A;  3LGF A;  4C8Q A;  3UWN A;  2ZPI B;  4GY5 A;  4FT2 A;  1P92 A;  2R5A A;  3KBG A;  3QJ6 A;  2EJG A;  5GAN j;  2XIC A;  1LNX A;  2O4X A;  3S3M A;  1VQ9 T;  1S72 T;  3KXT A;  3VV0 A;  4N0A C;  3M59 A;  5DM7 R;  3V7S A;  4TVR A;  4JJN K;  3KUF A;  4M78 D;  4LDU A;  4A4G A;  1O9S A;  2KVQ G;  2PU9 B;  3CCM A;  5GMK i;  1VQ8 A;  4M7D F;  4J5Y A;  5KCO A;  3E19 A;  3CXC A;  1HK9 A;  3SFM A;  2G3R A;  3JRZ A;  4IUP A;  1G3S A;  4M78 C;  4OGE A;  2FHD A;  2X4J A;  2ZPF B;  2JTF A;  2GCX A;  4RMO A;  5GAN 8;  3L2U A;  4O6J A;  3CCQ T;  4MDX A;  4EPC A;  4M75 G;  4QVD A;  5FLX E;  4KUL A;  2E10 A;  3DLM A;  4JLG A;  4PJO G;  4HCB A;  4PL6 A;  3CC7 T;  4ZN3 A;  4OF1 A;  1X01 A;  1BIB A;  2Y90 A;  1VQN A;  1BYM A;  1FXX A;  2JZ2 A;  1UGP B;  1K9M U;  1FX7 A;  2QTX A;  3PTA A;  3CC4 A;  2M1H A;  2KQW A;  3X28 B;  4HA8 A;  5CKE A;  3SD4 A;  2K3Y A;  4JRQ A;  5GAO r;  3J7A F;  2ZCF B;  2DD5 A;  3QYG B;  4J7I A;  4F7U B;  5LJ5 e;  2H3J A;  5HK3 A;  3JCM e;  4Y91 A;  3JCM X;  1RL2 A;  4C0D C;  5J39 A;  4L59 A;  3MHX A;  2VV5 A;  4PLL A;  4B9X A;  1NZ9 A;  1VQM A;  1I5L A;  1NE8 A;  2NLU A;  1U1T A;  4IUT A;  4M77 D;  4XTZ A;  3RKY A;  4M75 A;  4M77 E;  1KD1 U;  3G4S A;  2QQA A;  3EFR A;  2D0Q B;  3J81 E;  4M77 C;  2X4X A;  3SWN A;  3GPL A;  4PJO A;  3CCV T;  3JB9 G;  4M7A G;  2KY9 A;  2DD4 A;  1NJI C;  2DXB A;  2DZC A;  4OB3 B;  4KBM B;  2PVO B;  3MEA A;  4X34 A;  3G6E A;  3L2Q A;  1VQ8 T;  3L2V A;  3V8J A;  2EJ9 A;  4C5G A;  5GAN h;  1K73 C;  4BY6 C;  5IT9 E;  2GFA A;  3S6W A;  3FC3 A;  4J6W A;  4MML A;  3URG A;  2KAF A;  1U1S A;  5FRN A;  4JS5 A;  1D3B B;  2E70 A;  4M7D G;  3CBM A;  4EMK A;  1KQ2 A;  4KUD K;  5LJ5 f;  3CCL A;  5FU7 B;  4LDW A;  1O75 A;  2E65 A;  3QBY A;  3V8L A;  5CKD A;  4FSX A;  3JCM b;  1AHJ B;  1KHI A;  2HD0 A;  2RI5 A;  3MO8 A;  5GAO l;  4M7A A;  4MZP A;  2DXC A;  3M4G A;  4A54 A;  4JDS A;  3QUI A;  5HKC A;  1XQH A;  2DO3 A;  2LCC A;  2KDS A;  4RCC A;  1YIJ A;  4N4H A;  5GAM g;  1KC8 U;  2DJZ A;  2FL7 A;  3NFC A;  5A0G A;  4QW2 A;  1Q86 C;  5KCH A;  3P8H A;  5CKB A;  3X26 B;  2YLB A;  3CBP A;  5I2M A;  3OYG A;  1KHC A;  3HPW A;  3PMI A;  2DXT A;  2Y4Y A;  4M7D A;  4DOW A;  1H3Z A;  4O5V A;  5CIU A;  1VQ7 T;  3OS1 A;  3G4S T;  2V8J A;  1RI0 A;  1VQ9 A;  1Q7Y U;  5FRM A;  1S72 A;  3NTK A;  4V2S A;  4PJO D;  1VQ4 T;  2DXU A;  2P0Q A;  3QZ9 B;  4Q5W A;  4RKU E;  3OYK A;  1VQ5 A;  4BD3 A;  4PJO E;  2LQ8 A;  1MGQ A;  2AHJ B;  3ZBD A;  2LT4 A;  3MEW A;  3OYD A;  2LC4 A;  4C92 F;  5CO7 A;  4ZGJ B;  4BE0 A;  3QZ5 B;  4PKC C;  3OS2 A;  5DLQ E;  5GAN d;  5GMK l;  1R8O B;  3RES A;  3T9N A;  2FB7 A;  4C8Q B;  3G71 A;  2CKK A;  1YCY A;  3PMT A;  1WJR A;  1YJN T;  2XKO C;  3HKS A;  2RJF A;  3M54 A;  2O4X B;  3RKW A;  4NL2 A;  1G5V A;  3CCQ A;  3OYM A;  5EG2 A;  2BUD A;  3WVE B;  1GXI E;  2RK2 A;  4Y28 E;  5FU6 B;  2R5M A;  2R57 A;  1HXD A;  4LD6 A;  3CC7 A;  3QII A;  4JRK A;  2P4T A;  4M7A D;  4M7A E;  3CCJ A;  1Y7X A;  4FT4 A;  1ZQ1 A;  4ZTF A;  2JNG A;  2M16 A;  3J80 E;  5CKH A;  3OMC A;  2HNI A;  4M7A C;  2DIG A;  2RH2 A;  2MWO A;  1NPR A;  2JUF A;  2MWP A;  2K5L A;  2D6F A;  2L89 A;  3X25 B;  5GAN 6;  2RHI A;  2EWN A;  5LJ3 g;  5CR2 A;  1K9M C;  2HAX A;  2EFI A;  2QEX T;  5D6X A;  3CPW A;  4LDX A;  4PJO B;  2A7Y A;  4BI8 B;  4R55 A;  3V7C A;  1B34 A;  3C12 A;  4PNO A;  1M5Q 1;  3CCV A;  2WSE E;  3BW1 A;  2FYK A;  3OMG A;  2CS7 A;  3E1S A;  1VQ5 T;  1QVP A;  2A3L A;  1IZ6 A;  2RHY A;  1YJW T;  4XU0 A;  4QQ6 A;  3GIB A;  1KD1 C;  2GFU A;  2QDY B;  5GAN e;  3OY9 A;  1WNL A;  1K8A U;  2KK4 A;  5FU7 C;  4X9C A;  2KMT A;  2DTI A;  2EQM A;  4A4E A;  3TU4 K;  3ZFJ A;  4ZGD B;  3HP9 A;  3DB3 A;  3OYC A;  2K5F A;  4BDY A;  4C92 G;  3SWN B;  2JN0 A;  3FB9 A;  2VC8 A;  4II1 A;  2ZPE B;  3HFO A;  4MMK A;  4ZGE B;  1UGR B;  4E7I A;  3L2R A;  1MHN A;  3BDU A;  4OGC A;  4E7H A;  4OMF B;  2GQV A;  2F5T X;  3M55 A;  2PVD B;  3TEE A;  3LWH A;  1JB0 E;  3QJY A;  3L1A A;  4J6X A;  3ASK A;  4RG2 A;  2RHU A;  2OTL T;  1ZBX A;  1M9S A;  2F69 A;  2E64 A;  3CCJ T;  4IKF A;  4XAX B;  4XU3 A;  3INZ A;  1X6O A;  3MP1 A;  3OSS C;  2DK3 A;  4DA4 A;  3UPU A;  4EMK B;  4A4K A;  3HRU A;  5GAN f;  3NTI A;  4C92 A;  2MAM A;  3LWI A;  4DQ2 A;  1N27 A;  4LDV A;  5HK0 A;  1KC8 C;  4M7A B;  5GAO p;  1VQ7 A;  5KE3 A;  3QYH B;  4C8Q D;  4M78 F;  2ZPH B;  4HKE A;  4XU1 A;  5DY9 A;  3RUX A;  4C8Q E;  1YI2 T;  4JRI A;  4XTW A;  3QSU A;  4ATO A;  3RIR A;  3FLG A;  4R56 A;  4C8Q C;  1VQ4 A;  3OYB A;  2DZ9 A;  3LH0 A;  2RHZ A;  1Q82 U;  4A4F A;  1VQK T;  1YBY A;  3TCJ A;  1N9R A;  4RCB A;  5GAM j;  1X75 C;  1VQ6 T;  5AYF A;  5J3B A;  2WSC E;  3CEY A;  4L5G A;  4MZT A;  5FU6 C;  1Q7Y C;  5GMK j;  1Q81 U;  1KQS S;  4M7D B;  1I8F A;  4XTU A;  2Y4X A;  1YJN A;  3LYI A;  4D6W A;  4YTL A;  3H6Z A;  4J6Y A;  4UC4 A;  4BI4 A;  2V8K A;  4HT9 A;  4FM4 B;  2QA4 T;  1VIF A;  2VUB A;  5GAN 3;  3P8D A;  2EJF A;  3WVD B;  3P8B B;  1OI1 A;  3FEO A;  1G3T A;  1I4K 1;  3CCE T;  4ZTJ A;  1WPY A;  4LDY A;  3HHT B;  1WQW A;  3CPF A;  1I81 A;  3JCM g;  4B9W A;  1BI3 A;  5LJ5 g;  1VQP T;  1VUB A;  3CXC S;  4HCC A;  4M77 F;  3OYY A;  5L8R E;  3OYH A;  2E41 A;  3QDR B;  5A2Q E;  3CME T;  5A0D A;  2MI6 A;  1TH7 A;  4XU2 A;  2PQW A;  4C92 D;  3CCS T;  4XK8 E;  1JJ2 A;  4C92 E;  3QXE B;  2QEX A;  3I56 T;  2F5K A;  1W2B S;  2YLC A;  1XOV A;  4M75 D;  4XQ3 A;  4M75 E;  3CCR A;  3LGL A;  2HQX A;  1VQL T;  2JTM A;  2RJC A;  4JUV A;  1PSE A;  2E12 A;  4M75 C;  3DKM A;  2M9U A;  1YJW A;  2DAQ A;  1IRE B;  4BAC A;  4M78 G;  3SWN C;  2OAU A;  4PJO C;  2LTO A;  2EQU A;  1W4S A;  2IG0 A;  1KQS A;  1YHQ T;  2P0K A;  5HY6 A;  2XID A;  3OYL A;  1N6A A;  2EQK A;  5I2S A;  3JCM W;  1VQO T;  1B34 B;  2CZ6 B;  3A8G B;  3MP8 A;  2XDD A;  2QQS A;  5LJ3 j;  3SDZ A;  3GF5 A;  2EQJ A;  1K8A C;  1YIT T;  1M4Z A;  2XI9 A;  4N0A A;  5D6W A;  3I55 T;  2I2L A;  5J26 A;  3H8Z A;  2EKO A;  1G3Y A;  2LNV A;  4EMK C;  2OTJ A;  4FIB A;  3MCA B;  3JB9 D;  1Y07 A;  3O8V A;  3R6O A;  2OTL A;  3A8M B;  3QO3 A;  4M78 A;  2K3X A;  1WJQ A;  3N5B B;  2LDM A;  4OB1 B;  4CI0 C;  4DOV A;  2XD0 A;  3OYE A;  4PLI A;  2CZ7 B;  5KH6 A;  4NOY A;  2FVU A;  5CK9 A;  5GAN 2;  3E9F A;  3G7Z A;  4NS5 A;  2DEQ A;  4N4I A;  4QVZ A;  1M90 U;  3M57 A;  3JB9 I;  3OQ5 A;  2KSS A;  4M77 G;  1UEB A;  2LRQ A;  4E7K A;  1W2B A;  4M7D D;  3CBO A;  4M7D E;  2RJD A;  1YI2 A;  3VYH B;  2CZ1 B;  3M56 A;  3CCR T;  1N8R U;  4M7D C;  2E6Z A;  2QQR A;  4C5E A;  2VYT A;  4J83 A;  1VQK A;  4A53 A;  2XDP A;  4IUQ A;  2RI3 A;  5GAN 4;  2DPP B;  1Y96 A;  2CZ0 B;  3NTH A;  1VQ6 A;  3M4Y A;  4C92 B;  2E5Q A;  3RKX A;  4F7U F;  3JCM J;  4IUR A;  2L3R A;  2E6N A;  4M75 B;  3JB9 J;  5CVI A;  3L2W A;  1M8V A;  1Q82 C;  2XDB A;  2X4W A;  1M1G A;  2C06 A;  4M7A F;  4KT0 E;  4IUU A;  3QHS A;  5GAM d;  1FWZ A;  4M77 A;  3RER A;  2BIV A;  2RHX A;  1VIE A;  2QA4 A;  4MDW A;  3JCM c;  4C5I A;  3ME9 A;  3DB4 A;  3HFN A;  3OBY A;  4BB7 A;  5GAN 7;  1Q81 C;  3ER0 A;  3CCE A;  1H64 1;  2K2V A;  4BI3 A;  3FJP A;  2OTJ T;  3C94 A;  2QXF A;  4XTY A;  2M0O A;  3OS5 A;  5LJ3 h; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...