1Y96B

Crystal structure of the gemin6/gemin7 heterodimer from the human smn complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
AQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gem-associated protein 6
publication title The Gemin6-Gemin7 Heterodimer from the Survival of Motor Neurons Complex Has an Sm Protein-like Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 23
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11095 Gemin7 Gem-associated protein 7 (Gemin7)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y96B00
5GANf 3M4GA 2QTXA 3L1AA 5GANd 5GAMg 5GAOm 3JB9F 4HT9A 4PJOC 4MMLA 4C8QD 3HFNA 4OP0A 3JCMX 1I8FA 2VXEA 5GAOn 3V7SA 5GAMe 1LJOA 1WNLA 1U1SA 1Y96B 4EMGA 4XU3A 3RERA 5GAN8 1H641 5GAN6 3JCMQ 4JRKA 5GAN7 3RIRA 3RKXA 4M78B 2RM4A 1U1TA 5GMKl 4M78D 5GAOr 2K57A 4M7AB 4JUVA 5GAN5 4M7AD 2DXUA 4QVCA 4DQ2A 3RKWA 3GIBA 4JLIA 4M7DD 5LJ3h 1WPYA 4X9DA 4C92A 5GAMh 4XTUA 4C92E 3SWNB 1MGQA 5LJ3j 1TH7A 5GAMj 2FB7A 3JCMf 5GAOq 4PJOA 3JCMd 4M77F 3QO3A 4C92C 1B34B 1WQ7A 3JCMV 3JB9D 4M75A 2YLCA 2JN0A 2DXTA 5LJ3g 1N9SA 4M75E 4C92G 5GANg 4C8QB 4F7UA 2HNIA 4XU0A 3AHUA 4F7UE 2DVEA 2E10A 3FJPA 3RESA 2DZCA 2RA2A 2RB6A 4XTVA 2EJFA 2VC8A 4XQ3A 4M75C 4XTWA 4X9CA 3FIFA 4PJOG 2DEQA 4NL2A 5I21A 5GMKi 1BIBA 3BFMA 2ZGWA 4M75G 5LJ5f 3RUXA 5LJ5d 3JCMc 4EMKB 3BW1A 4PJOF 4M7DB 4F7UG 2CGHA 4RCBA 4J6WA 5LJ3e 2EAYA 4M78E 3JB9H 1M8VA 5GANh 4M7AE 1LNXA 3EFSA 3QHSA 1D3BA 5GANj 4M77B 5GAMd 4XTYA 4M78C 4M77D 4F7UF 2I2LA 2EJ9A 5GAOl 5GAN4 2YHTA 4M7AC 3QSUA 2FYKA 4RCCA 1BIAA 2RD1A 4EMHA 3JB9I 4M78G 4N0AC 4J6XA 2DJZA 2DTIA 2E41A 3JCMP 1B34A 4XTZA 1JRIA 4M7AG 3SWNC 3SB2A 4NOYA 1WQWA 4C8QA 3RKYA 3HFOA 4C8QE 2EJGA 4JRIA 4C92F 1Y96A 1YCYA 4XU1A 5GANe 5GMKm 1N9RA 3V7CA 3JCMh 4PJOB 1JBMA 4PJOD 4C8QC 3JCMb 4M78A 5DY9A 1I81A 3VU3C 4HT8A 3JCMW 1KQ2A 4M7AA 3BDUA 4M75D 4EMKA 3HSBA 1KQ1A 4M7DA 4C8QG 4M75F 2E65A 5LJ3f 4F7UB 4M7DE 2DKGA 4N0AA 5LJ3d 3QUIA 5GAMf 3JCMJ 3V8LA 5CAIA 3INZA 1I5LA 5GMKe 3SWNA 3JCMg 4A53A 3JB9J 4EMKC 4M77A 4M7DC 2YLBA 1M5Q1 3L2ZA 3PGGA 2E64A 4J6YA 4M77E 4C8QF 3JCMe 5GAOp 1X01A 2VXFA 4WF2A 3EFRA 3V8KA 5LJ5h 4A54A 5GAN2 4M7DG 4XTXA 5GAN3 4M77C 4HA8A 5LJ5j 2Y90A 4C92B 1HK9A 4M78F 5GMKh 4V2SA 4C92D 4NL3A 2E1HA 4PNOA 4M7AF 3FB9A 4M77G 1D3BB 5GMKj 2DTOA 4M7DF 1HXDA 1LOJA 4J5YA 5LJ5g 2DTHA 3JB9G 3BY7A 4MMKA 4M75B 4Y91A 3V7RA 4PJOE 3V8JA 5LJ5e 2DZ9A 4XU2A 2EWNA 4QVDA 1I4K1
chains in the Genus database with same CATH superfamily
5GAOm 4HVUA 1FMWA 1OYXA 4J9HA 5GAOn 5KE2A 1YJ9Q 2CS7A 3E1SA 1V76A 3LWIA 1QKWA 2LTOA 4M78B 1YITQ 2RQVA 4RTWA 4GLMA 2KI7A 4JLIA 1FXXA 3MEVA 2E12A 4BE0A 2NUTA 2CT3A 1Q82U 2DEUA 1Q95G 3OYBA 4M75A 3EFOB 3PMIA 1BCOA 3VJPA 1F1BB 5GANe 2VC8A 2MIOA 2E3IA 1T0HA 3TSZA 3NPFA 3RUXA 2A37A 3UT1A 5HK3A 2LCCA 2JJ9A 1M8VA 1NLPC 5GANh 1EX4A 5CK9A 1VQ9A 3EH1A 1P92A 1GCPA 2EJ9A 3UDCA 5GAN4 1ZUKA 3I56T 2XIDA 4M78G 1W2BA 1QCNA 3E19A 2C0IA 3CPWA 4MZPA 2EKHA 2DVJA 4R0KA 4JRIA 2K2VA 2XDBA 4XU1A 5CQXA 3VKIA 3VRYA 3M58A 5DY9A 5ECAA 2BTTA 4OB2B 2FEIA 4F7UB 1WZOA 1WJRA 2JMAA 2KXCA 4PFPA 3OYIA 2C0TA 5CQYA 1BI3A 4C0FA 1UB4A 4WF2A 3FC3A 5CCAA 2YUNA 3CC7Q 3G71Q 3QIIA 1PCXA 2O2OA 2F5KA 2QASA 4C0DC 1RADB 2E5QA 3D7SB 3CPWS 2K6DA 2LJ1A 3TEEA 5FU6B 4MDWA 5KYWA 4DOWA 3L1AA 5GANd 4HT9A 3JAME 3JSCA 1NJIR 2CUDA 2F1LA 2F69A 4XU3A 4DEYA 4C5HA 1RAAB 2K57A 3CCLT 3CD6Q 2ZAEA 1D1BA 1SRMA 4GLKA 5GAMj 1O75A 1ZHIA 3L42A 3GBQA 2V1RA 2X3XD 2C0OA 4EIKA 3OYEA 1X75C 5LJ3g 4L6V5 2JM9A 1XJWB 2RMOA 1NBEB 3H9NA 1AWJA 3BFMA 3TSWA 1LCKA 4PJOF 3LX7A 1UJYA 2CGHA 1JQQA 2MI6A 4J6WA 2QA4A 2EQJA 3DB3A 3P8DA 1R0CB 2KVQG 1WXBA 1VQNQ 3QG1A 1D1CA 4N0AC 3BDLA 3OSSC 1B07A 1JRIA 1K9MU 3SWNC 1VQKT 4LD6A 1RAHB 3CCET 3CBMA 1N8RC 4C8QA 1PRLC 3O5ZA 4YTLA 2M1HA 5D6YA 1NJIU 3QWYA 4Z88A 4M78A 2GTOA 2QEXT 1M1FA 2EQUA 4MZMA 4N4HA 4PK4A 2OJ2A 3UPUA 1RI9A 3HSBA 1VA7A 2BZ8A 5GAMf 2HDAA 4FW1A 3CCVT 3JB9J 1MNEA 3QKJA 4LE9A 1PM3A 5CKEA 2DMOA 3H41A 5GAN3 3EFOA 5I22A 4M77C 1NLOC 4OMNA 1VQMQ 1ZA1B 1X6GA 1ZUUA 2EKOA 3FEOA 2FPFA 4JJNK 3JB9G 1Q81U 3N5BB 1X27A 4Y91A 3KBGA 2BIVA 2AZSA 2EPDA 5LJ5e 3L2WA 2CREA 2F2VA 3S3OA 2QTXA 2MCNA 4C0GA 1UEBA 1AWXA 2CP2A 1BCMA 2E3HA 4LDVA 1IXDA 4E2FB 3MJXA 4JJBA 2O9VA 2XHCA 2LDMA 3HPWA 5L8RE 4LUDA 3ASKA 1AEYA 3J80E 2CUBA 4C92C 2DFUA 1ARKA 3CCUA 4FCYA 2KAFA 4F7UA 2HNIA 4OMLA 2DVEA 2AHJB 2M0YA 4X9CA 4NL2A 4PJNA 5J39A 1VQMT 2KRSA 2DAQA 1YI2Q 1VQPT 1G3TA 1UGRB 2CH4W 4HCBA 2FPDA 3CMAT 4Y92A 1NM7A 2G3RA 1VQ5Q 2OAWA 1D0XA 4ZGDB 3QHSA 1X2KA 2COWA 3I5SA 2I2LA 1VQ8T 3QZ9B 3QSUA 4PJLA 2DJZA 1QKXA 2OI3A 3JCMP 4PJMA 3OYNA 3G6EQ 1B7TA 1U5SA 2GCXA 5GMKm 4OMOA 3OB9A 2DILA 4PJOD 1YCSB 3X26B 1SPKA 3I55A 1KK7A 2X3WD 2L0AA 3RDVA 3X20B 3C12A 4LDUA 1OU8A 3FJ5A 3OYKA 3RR6A 1M5Q1 4M77E 4OB0B 2RI2A 1X01A 2IPOB 3CCMT 4RMOA 4QQGA 2ED0A 4F17A 3Q1JA 3RNJA 4OGEA 3M53A 2DM1A 4CC2A 1Q7YR 4ESRA 2OTLA 3BY7A 4MMKA 1MV0B 2NYSA 3M59A 2XI9A 5KYXB 2XMFA 3M4YA 2MAMA 2IVWA 1GRIA 3JCMX 2D6FA 1WNLA 3OYLA 5D7UA 2RHYA 1VQ6A 1FWZA 2YDLA 1GXIE 2MOXA 3CCJT 3OW2A 5GAOr 1QP3A 1W4SA 3RKWA 4HCZA 3GIBA 3OYGA 1Y7XA 3MEWA 4C92E 5LJ3j 1H3ZA 1S72A 1ZSZC 3QZ5B 1WHLA 3QO3A 4HXJA 3G7ZA 3MCAB 4KGZB 1VYTA 2K7AA 2YLCA 1Y57A 2JN0A 1VQOT 4BACA 3AHUA 2ZPIB 4QVZA 3ZEHA 2YUPA 1EZZB 2DEQA 4J9DA 3QDFA 1J3TA 2YRVA 2HAXA 2MWPA 2AT1B 4M7DB 2KT8A 4RCBA 3SEMA 4PL6A 5A0GA 1KQSP 4J7FA 4PLIA 1PD0A 3QYHB 4M7AC 4Y28E 2K5FA 2DL7A 3PIPA 3KFVA 2DTIA 2MF2A 2PVGB 1Q7YU 4LD9K 1M3BA 2YT6A 1ABQA 2AKLA 3RKYA 1LVKA 3CCQQ 2ED1A 4BI3A 1M1KU 4RTZA 2KBTA 1KJWA 4XAXB 2JXBA 1T3LA 5LJ3f 3SD4A 1BB9A 1TUDA 3OS2A 5CAIA 3JCMg 1DJ7B 1YN8A 4J6YA 2JM8A 4L5GA 2YWWA 4M7DG 4XTXA 1QP2A 2EGAA 2DPPB 2RJFA 2Y90A 1WJSA 3PMTA 4KGXB 3CMEQ 1KFZA 4LDYA 4J9FA 1AT1B 1WI7A 2RHXA 4M75B 1N27A 4ZNXA 1JEGA 5I2MA 2X51A 1TUGB 1YNZA 1YBYA 1C0MA 3DKMA 3V7SA 5GAMe 1QVGS 4JZ3A 3RERA 2IG0A 3UF4A 1G3WA 2FG0A 1FYNA 2VV5A 4P5NA 1WHMA 3C95A 2J6FA 4M4ZA 5GAMh 2LCSA 3HRTA 1VQ9T 1S1NA 2FB7A 2O9SA 2ZZDA 2DK3A 3EG9A 5AT1B 2QXFA 1IGUA 2Y4XA 1M90C 2CDTA 4IKFA 2FZGB 1XNIA 2K9GA 4M75G 1FMKA 3WVEB 1KQSA 1G5VA 2RHZA 3M9QA 4AFZC 4M7AE 3QWXX 3EFSA 1OPLA 4OMMA 2FYKA 4JRPA 5KYXA 2JW4A 1B34A 2RPNA 3BE3A 2O31A 2VGMA 1PD1A 2X4XA 1VQ7A 3V7CA 1YIJA 2D0NA 2GQIA 2CZ0B 2BE9B 2KR3A 3C0CA 4OB1B 1YJWA 1SSHA 2DETA 5M9OA 2LQ8A 4EMKC 3L2ZA 2DA9A 2R5AA 1BU1A 1G83A 1Q82R 2HEQA 2WSEE 4CC7A 1D3BB 2PQWA 3VV0A 2L8DA 2DF6A 3CBOA 5D6XA 2DLPA 4QVDA 3TREA 1TSFA 3EAEA 2RQWA 4OB3B 2VGNA 1WX6A 2I0NA 3ZFJA 4E7HA 1LJOA 1R8OB 4B9XA 1Q82C 1KHCA 4FYYB 2CP5A 1U1TA 4AFSC 1UECA 1K8AR 5GAN5 4E7SA 4IIOA 2LX9A 2DYIA 3CCRA 5IXFA 2A08A 3NGPA 4FYWB 1MGQA 2QA4T 1TH7A 4HCKA 2QDYB 2CP7A 2GGRA 2YRDA 4C8QB 3I56Q 2GBQA 2EJFA 2QAZA 1UDLA 2LZ6B 2L2PA 2HZYA 3CXCS 4BI4A 1HSQA 1IO6A 2JUFA 2E5KA 1D0ZA 1WYXA 4RTTA 2LC4A 1BIAA 2DL5A 5IXBA 1Q86R 1NPPA 1EFNA 3LW5E 1EIFA 2E70A 2L3QA 1WIEA 4TVRA 2O4XB 2DX1A 1WFWA 2PZ1A 1JU5C 3MP6A 4PJOB 3VS0A 1YP5A 2KRMA 1UTIA 3BDUA 3HRUA 4C8QG 3A1PA 1QVPA 1GBRA 3M5AA 1AVZC 4II1A 5HCKA 1K8AU 3EG0A 4KUDK 2XD0A 1JJ2P 5LL6S 1PG5B 3OMGA 2RHUA 2V8IA 1ZLMA 3M0PA 1ZBJA 1X6OA 5IT9E 4UC4A 4AMCA 1VQ4A 2ZCFB 3CCLQ 3H8ZA 3NHNA 3URGA 1YFNA 2ZPBB 2EWNA 2EW3A 1KC8U 3CCUT 2KMTA 4A4HA 2RNAA 1QVFP 3OMCA 1KD1R 4XK8E 2KYMA 2X9HA 2VWFA 2ROTA 5LJ3h 1WPYA 2P0PA 1Q86U 1K9MR 2A0FB 3CBPA 1W2BS 4RTYA 3JCMf 2OTLQ 4JS4A 1WQ7A 3MHXA 3CC2A 5GANg 2DL4A 2A3LA 3HHTB 4VUBA 4C5EA 2LQNA 2KRNA 2ZPHB 4XTWA 2A7YA 1VQKQ 3CC4A 3CCEQ 3SDZA 1K9MC 4F7UG 3I55T 2WACA 2BZXA 2MPXC 3FLGA 1LNXA 1D3BA 2QEXQ 4XTYA 2FRWA 2ENMA 4M78C 1NJIC 2YHTA 1NEGA 2XK0A 1I5OB 3E9FA 3JB9I 3F70A 1OI1A 1K76A 2KXDA 4XTZA 3CCVQ 3SB2A 4E7IA 1Q81R 1MMGA 3QBYA 2FRYA 1YWPA 3HFOA 4HCCA 4E7JA 5DM7R 3JCMb 2OTJA 3PT9A 5DLOA 2OTLT 5KE3A 3OBYA 1KD1U 4HVWA 5LJ3d 3QUIA 4BY6B 5CKBA 1W6XA 4KH1B 2ZPFB 1Q81C 2DYBA 1JJ2A 3GNGA 3JRZA 2DJQA 1U3OA 2VXFA 2P0QA 3MP1A 2K5IA 1VQ6T 2SRCA 1IREB 1IB8A 1BBZA 1MV3A 2GQVA 4LXCA 1UGQB 1E7OA 3HP9A 3GLXA 1S72T 2L5QA 2P4TA 3OYDA 2DZ9A 1AHJB 1UHCA 4IUUA 2C06A 5KYNA 3PNWC 1RACB 5GAN7 3R6NA 1T3SA 4KBMB 2DL8A 2HL5C 4C5IA 2O4XA 2CSIA 5I2SA 1VQPQ 4PJOA 3CMAQ 4M77F 2P0KA 2V8JA 1PSEA 2QG9B 1QMCA 1IHVA 1RI0A 5CKDA 4C5GA 1VQ8Q 4XU0A 4IIMA 1QLYA 2DZCA 2RA2A 4XQ3A 2K2MA 1AWWA 4KRTA 5FU6C 3G1JA 3HKSA 1YHQA 4O6JA 1WJQA 4M78E 2CZ7B 1PHTA 1TS9A 3I35A 4E7LA 2A36A 2M02A 4C0ZA 1YJ9A 1N8RU 3CCST 4RCCA 1SKUB 4A4EA 2GNCA 4J6XA 3GP8A 3ULRB 4BDYA 2HMAA 3ZBDA 1YITA 1K4US 4FSSA 5FW9A 1AOJA 1RLQC 4QKUA 3CCMQ 4C92F 2DXCA 1YCYA 2EGEA 2RI5A 1KIKA 1N9RA 3VS1A 1I81A 3PVLA 2EYZA 2Z0WA 4ZTFA 1XOVA 3V8LA 1K73U 1NE8A 4M77A 1SHGA 4FYVB 2E6ZA 2HBPA 3ER0A 2LVMA 3A8GB 4CRIA 2YXYA 4HA8A 4Q5WA 2L3RA 3RBBB 3CCJQ 2LNVA 2WSCE 5LJ5g 1SEMA 1BK2A 2IIMA 5HKCA 2QDLA 1N6AA 4XTUA 3EG9B 4KGVB 3JB9F 4MMLA 2B8AA 3H6ZA 2VXEA 4D8DA 3QDRB 2L3SA 1YJNA 2LNHB 1M3AA 2JOYA 3A5ZB 4RG8A 1VQOQ 3RIRA 5I11A 2ZPGB 2AIRB 4C92A 3G4ST 4Z89A 3ME9A 3QXEB 1K9AA 4ATOA 1B34B 2J05A 1QCFA 1X43A 2DRMA 1D0YA 3CC7A 3G71A 2DIGA 1M1KR 2RH2A 3WVDB 4IURA 5IHNA 1Q7YC 2Y4YA 1OULA 2COZA 3JCMc 4QT7A 1VQ7T 1YIJT 1NYGA 1SF9A 1PRMC 5CKHA 1RAGB 4BE2A 1YJWT 1C6VX 1GFCA 1RLPC 4M77D 1E6GA 4A63B 2HSPA 3VS5A 2LT4A 1M1KC 2HBWA 2M9UA 2K3YA 4J9IA 5KYUB 3CD6A 4NOYA 3HRSA 2QQSA 2K3BA 3EH2A 2XDPA 2CSQA 3JCMh 1JBMA 2DERA 3VU3C 2ESWA 2H3EB 3IQLA 4JLGA 2EFIA 2E65A 4ELZC 3OY9A 3A8MB 3OW2S 4A53A 3S3MA 2K79A 3VS3A 2GFUA 3WXMB 4O5VA 1OZ3A 3OYFA 4C92D 5FU7B 3OSVA 1OPKA 4M7AF 2QI2A 1O9SA 2CP6A 1VQNA 1M8MA 3CCRT 4RG2A 2LT1A 3H0FA 3EG3A 3V8JA 1VQ9Q 3PVQA 2MYSA 3CCSA 4B6MA 3QJYA 3THKA 1I0CA 4R56A 3HFNA 2LX7A 1MMAA 4EMGA 1Y96B 4IUVA 1H641 2J6OA 4J9EA 4DEXA 5KH6A 2QQAA 1BKBA 2EIFA 5A0LA 2R5MA 1OQKA 2VVKA 3X24B 4AT1B 2YRCA 1QCOA 1TWBA 3JCMd 4MZTA 3ZL7C 2CH4A 1X6BA 4PJJA 1BI1A 4DOVA 5A2QE 1V1CA 1Z9ZA 4ORZA 3JB9D 2DXTA 1FMVA 1PNJA 1IZ6A 4ANJA 1NZ9A 2JTEA 2DL3A 5HY6A 2MK5A 2X4JA 4D8KA 1IGQA 3FRNA 2CYZB 1G2BA 2DBMA 5IN1A 2KY9A 3JB9H 2RK2A 2JS2A 3OYCA 4K11A 5CR2A 5GAOl 1SHFA 5IHKA 4EMHA 3EGXA 3E9GA 2LP5A 4F04B 3M55A 4DBHA 4ELYC 3CC2Q 2VKNA 1K0SA 3C4SA 5C6SA 5IH2A 2J6KA 4AG2C 3HTRA 1VQ4T 3G4SA 2RI3A 2ROLA 3EHRA 3NMZC 4KUIA 1OV3A 2HQXA 3UA6A 4LNPA 5FWCA 4M7DC 3PGGA 4ZN1A 2HCKA 1ZUYA 2RHIA 2A28A 1M9SA 4KH0B 2FPEA 2RO0A 2DNUA 3X25B 1YI2A 3TVTA 2RN8A 3OS5A 5LJ5j 4B9WA 1VQ5A 3FB9A 2CZ6B 5GMKj 4M7DF 3EGUA 1HXDA 1I1JA 3CEYA 4QQDA 1KG1A 2LJ3A 3MPUB 2QA4Q 2HL3A 3P8BB 1NYFA 1I4K1 2JVVA 3M4GA 1A0NB 3MEUA 5GAMg 3G6EA 3NTKA 2LQWA 4J9GA 3CC2T 4CC4B 1AZEA 1KQSS 3OS1A 2ABLA 4JRKA 1MNDA 3CC4T 1ZBXA 4M7AD 4LUEA 5KYUA 3VYHB 1WLPB 2AZVA 4CI0C 1AZGB 2ECZA 3QYGB 1Y07A 2B86A 3X28B 2CZ1B 3LH5A 3NTHA 2FZCB 5L23A 1M4ZA 1M1GA 1UFFA 1W2BP 3M57A 3LLRA 2PVDB 3CPWP 2HD0A 4M75C 2QTVA 2LRQA 1X69A 1YWOA 5I21A 5GMKi 2HQHA 5LJ5f 4OMQA 1CKAA 2BE7D 4HVVA 3MO8A 2LJ0A 3VS6A 2OTJT 2GF7A 1HJDA 2DXBA 3I5RA 2M51A 3LYIA 3VRZA 3H0IA 4BDZA 4C0DB 4R55A 1C1AA 2KGTA 3FDRA 1K8AC 1VQLT 2DRKA 1KHIA 2HKNA 2XU8A 1Y96A 1KC8R 1B3QA 4FYXB 1X2QA 2VUBA 2JZ2A 4J83A 2PNIA 1ACMB 4EMKA 5IAYA 1KQ1A 2AK5A 4M7DE 5FROA 2KK4A 4A4GA 1I5LA 3DLLA 1OZ2A 1ZQ1A 1U8RA 2SEMA 2VYTA 2E64A 2W0ZA 2EYQA 3CCUQ 3V8KA 1KC8C 3OYMA 1QWEA 2GTJA 4JDSA 4NS5A 3CPFA 2HSEB 4X34A 2BKDN 2KSSA 4OF1A 1PKSA 1GCQA 2QGFB 5FRNA 4LN2A 3V7RA 3QJ6A 1PWTA 2DD4A 3R6OA 1Q86C 1MMDA 1M30A 1I8FA 1U1SA 3CCQA 1UGSB 5GAN8 2RJCA 5GAN6 1RAEB 2VASA 2JTMA 3TCJA 4JUVA 2DXUA 1BYMA 2R57A 4DQ2A 4M7DD 4QW2A 1YHQT 3SWNB 5FRMA 1BI0A 3I55Q 1H92A 3JCMV 1YJ9T 3M0SA 4M75E 2V1QA 2PU9B 3S3NA 5LJ3e 2E10A 3M0TA 3REBB 4PJOG 1YITT 4A4FA 1YJNQ 3CMEA 1Z9QA 1ZSGA 2MMPA 2ZGWA 3A8LB 4ZGJB 2RJEA 1M2VB 1VIFA 1SRLA 1ZA2B 3M56A 5IHIA 1RL2A 3KUFA 4M77B 2EQIA 2QGGA 8AT1B 4GY5A 2KQWA 1WDXA 2COYA 1TU0B 1QW1A 1ZX6A 3L2RA 1KD1C 3QPHA 2EYYA 4IUQA 4RKUE 3VYGA 1Y0MA 1VQ6Q 2LQKA 1W1FA 4C8QC 3U23A 3T9NA 1JXMA 4M75D 2K5LA 1WXUA 2XICA 1VIEA 4FW2A 2NUPB 2K3XA 1MUZA 1M3CA 2V8KA 2E4HA 2EQKA 3EHQA 1S72Q 4C8QF 2W10A 4HKEA 1YJNT 3EFRA 1MHNA 4C92B 4M78F 1T0JA 3LGFA 2RQTA 4M77G 3O8VA 1LOJA 4FT4A 4AFQC 2RQUA 1RAFB 2KNBB 3M0UA 4DBRA 1OX9A 4FL6A 1HK9A 3SHWA 5KCHA 5CVIA 4PJOC 1BI2A 3CC7T 4OP0A 3G71T 1G3YA 1IRXA 3JCMQ 1VYVA 4AFUC 1VQLA 5GMKl 1TUCA 1N8RR 1PSFA 4N4IA 4DBFA 2L89A 2RJDA 4ME7A 1VUBA 4JZ4A 1PC0A 3L2QA 5KYYB 3VS7A 4CC3A 1N9SA 4C92G 3TQ7P 2RQRA 3CCSQ 1UHFA 8ATCB 3RESA 1QVFA 3CD6T 3TU4K 3M0RA 1UGPB 4IUTA 1K73R 1JJ2S 1RUWA 2OX7A 1RAIB 4F7UF 3A8HB 1E6HA 1WGSA 2CP0A 2FHDA 5DLQE 9ATCB 2RD1A 5AYFA 1UUEA 1K73C 4C8QE 5J3BA 1OOTA 3PTAA 3M0QA 3SFMA 3H0HA 4D6WA 5C0MA 4E47A 4HT8A 3JCMW 1VQNT 3REAB 1WXTA 2F5TX 5GJWB 1QVFS 2PVOB 1AD5A 1UE9A 4N0AA 3JCMJ 3INZA 2CKKA 5GMKe 3SWNA 4KULA 3I56A 3NTIA 4JS5A 2R58A 2JTFA 4FM4B 2EBPA 5LJ5h 2V26A 1ZSZB 3UATA 3OW2P 5GMKh 2E1HA 3RMSA 1QQJA 4PFZA 3L2VA 1JXOA 3DLMA 4MDXA 1UGVA 1U06A 2X35A 3G4SQ 4PJOE 1M2VA 1ABOA 1SSFA 4C8QD 2LMJA 2KYBA 4BY6C 2X4YA 1TTHB 2XKOC 4M78D 3RMQA 4EPCA 4M7AB 3NFCA 3P8HA 3KXTA 2ATCB 3M54A 4X9DA 1WA7A 2M0OA 1VQ7Q 1YIJQ 3S6WA 4OVAA 5GAOq 3EGXB 3OYYA 3PIOA 2JMCA 1YJWQ 2JS0A 1G8XA 2YUOA 4Z8AA 2NUPA 4F7UE 1GBQA 4XTVA 3LWHA 5J26A 4J7IA 1BIBA 2EYXA 3CCLA 1FX7A 3OYJA 5LJ5d 2J06A 1QVGP 2EAYA 1NPRA 2YUQA 3J81E 2DIQA 2O88A 5GANj 1CKBA 4LDWA 2EQMA 4L59A 4WCIA 2XDDA 4M7AG 3MEAA 2NLUA 2L3PA 1YI2T 3C94A 1OX8A 2E6NA 1IHWA 1VQ5T 1WHHA 1OEBA 1AWOA 1KQ2A 1H8KA 4E7KA 3OQ5A 3EG2A 3CCRQ 2DKGA 2DE0X 1D09B 4FSXA 3G6ET 2EVRA 3PE0A 2FVUA 1UG1A 5KYYA 4KT0E 3JCMe 5GAOp 2X4WA 1VQKA 1K0XA 4FU6A 3CCEA 5GAN2 2M16A 1D1AA 4PLLA 4V2SA 4NL3A 2QQ9A 4LDXA 1M27C 2P84A 2QEXA 5CO7A 4F16A 5EG2A 2FZKB 2FL7A 4XU2A 2P4RA 1QWFA 2RK1A 5GANf 3CCVA 1WHKA 2QQBA 3EGDB 4BI8B 1RABB 4BD3A 1M2OA 3RKXA 2QK0A 4QVCA 1TXQA 3A98A 2K4YA 1XQHA 4JJCA 3MKDA 1TG0A 1NEBA 4N4GA 2D1XA 4OMPA 4IUPA 2XG8D 2WSFE 1Y71A 1W70A 2AKKA 4EDUA 2RB6A 3OA6A 3FIFA 2KT1A 5A0DA 2D9TA 3VUBA 2QQRA 1QVGA 5CIUA 2JT4A 3LGLA 4EMKB 1ZSZA 1GFDA 4BUGA 1VQ4Q 2O01E 3GNFB 1TOVA 2PUOB 2DO3A 2E41A 5HK0A 1XTDA 1HYOA 2JNGA 4FT2A 2DD5A 1WQWA 1VQMA 2HKQB 2LCLA 4A4KA 1VQPA 1GL5A 2CP3A 2NUTB 4OMFB 3CMAA 1JB0E 2G6FX 4M7AA 1I07A 4GBQA 1VQ8A 1R0BG 3VS4A 4ZTJA 3CXCP 2GFAA 2YLBA 2NUZA 3CQTA 3CCQT 4A54A 1WHJA 4PFOA 1PKTA 4RTUA 1HD3A 3EG1A 2H3JA 1M90R 2D0QB 2PTKA 2CT4A 2YSQA 4PNOA 6AT1B 1LPLA 4AG1C 3CC4Q 3A8OB 4J5YA 2DTHA 2FO0A 3HL8A 1N5ZA 4OGCA 2F2XA 1V29B 4FIBA 4E7ZA 4DBQA 4E6RA 2DBKA 2ZPEB 3CCMA 2KE9A 4RUGA 5D6WA 2RM4A 3CMET 3E2UA 2PUKB 2BZYA 1MMNA 1K1ZA 3GF5A 3L2UA 1VYUA 2D8HA 4JRQA 3OYHA 5GJVB 2HQEA 4F14A 3GPLA 2OTJQ 5FU7C 3UA7A 4ZN3A 4X1VA 4BB7A 3OYAA 2J7IA 3FJPA 4J9CA 1UJ0A 2KDSA 2D8JA 3CCJA 2EGCA 4QQ6A 1VQLQ 4JJDA 2F2WA 3BW1A 2BUDA 2RF0A 5KYWB 3I9QA 3DB4A 3JV3A 3LH0A 5GAMd 3AT1B 4Z02A 4DA4A 3VS2A 1M90U 4J8OA 1VQOA 3VUZA 5FLXE 4BE1A 2KEAA 2EYWA 3EGDA 1JO8A 4RTXA 1CSKA 2EJGA 3META 4J9BA 3GOXA 1NG2A 3OBWA 7AT1B 2H8HA 2KROA 4M7DA 4M75F 3PFSA 2MWOA 3CXCA 1GCQC 2OAUA 2QYZA 2NWMA 1KSWA 5FWBA 4ZGEB 4RTVA 1OU9A 2VB6A 5CKFA 5EC7A 5KCOA 4WTOB 2DTOA 3J7AF 1G3SA 3MP8A 1R77A 1H3HA 1VOMA 3OS0A 1WHGA 1SG5A 1YHQQ 4JPBW 4PKCC 3UWNA
chains in the Genus database with same CATH topology
5KCHA 5CVIA 5GAOm 3JB9F 1YBYA 4PJOC 4MMLA 2B8AA 1BI2A 3DKMA 3H6ZA 4OP0A 1OYXA 2VXEA 5GAOn 3QDRB 3V7SA 5GAMe 2CS7A 1G3YA 5KE2A 3E1SA 1YJNA 2JOYA 3A5ZB 4RG8A 1QVGS 3RERA 2IG0A 3JCMQ 1G3WA 3LWIA 1VQLA 3RIRA 2VV5A 2LTOA 4M78B 5GMKl 4P5NA 2ZPGB 3C95A 4JLIA 1FXXA 4C92A 1PSFA 4N4IA 5GAMh 3G4ST 2L89A 3HRTA 3MEVA 2E12A 4BE0A 1VQ9T 2RJDA 4ME7A 2FB7A 1VUBA 3ME9A 3QXEB 3L2QA 2ZZDA 1B34B 1Q82U 4ATOA 3OYBA 2DK3A 4M75A 3CC7A 3PMIA 1N9SA 3G71A 4C92G 3VJPA 2DIGA 3RESA 2QXFA 2RH2A 5GANe 1QVFA 2VC8A 1M90C 2Y4XA 3CD6T 3TU4K 4IKFA 3WVDB 4IURA 1XNIA 1UGPB 4IUTA 4M75G 3RUXA 3WVEB 2Y4YA 1Q7YC 3JCMc 1VQ7T 3UT1A 5HK3A 1YIJT 1KQSA 2LCCA 1G5VA 2RHZA 3M9QA 1M8VA 5GANh 1JJ2S 1VQ9A 5CK9A 5CKHA 4M7AE 4BE2A 1P92A 3EFSA 1YJWT 4M77D 4F7UF 2EJ9A 3UDCA 3A8HB 1WGSA 5DLQE 2FHDA 2LT4A 5GAN4 2FYKA 3I56T 1M1KC 2RD1A 2XIDA 5AYFA 4JRPA 4M78G 2M9UA 2K3YA 1W2BA 1B34A 3E19A 3CPWA 3CD6A 4MZPA 4NOYA 3HRSA 1K73C 2QQSA 4C8QE 4JRIA 2K2VA 2XDBA 2VGMA 5J3BA 2X4XA 4XU1A 5CQXA 2XDPA 3VKIA 3PTAA 1VQ7A 3V7CA 3JCMh 1YIJA 1JBMA 2CZ0B 3SFMA 4D6WA 3M58A 3VU3C 5DY9A 5C0MA 4E47A 4HT8A 3JCMW 1VQNT 2F5TX 4JLGA 4OB1B 4OB2B 1YJWA 2EFIA 2PVOB 1QVFS 2E65A 4ELZC 4F7UB 3OY9A 1WJRA 4N0AA 5M9OA 3JCMJ 3INZA 2CKKA 5GMKe 3OYIA 3A8MB 4KULA 3SWNA 3NTIA 4A53A 5CQYA 3I56A 2LQ8A 4JS5A 3OW2S 4EMKC 3S3MA 1BI3A 3L2ZA 2GFUA 2R58A 2JTFA 4C0FA 1UB4A 4FM4B 4O5VA 1OZ3A 4WF2A 3WXMB 5LJ5h 3FC3A 5CCAA 2R5AA 3QIIA 3OYFA 5GMKh 4C92D 2E1HA 5FU7B 3OSVA 3RMSA 2WSEE 4M7AF 2F5KA 2QI2A 1D3BB 1O9SA 2PQWA 3L2VA 3VV0A 2L8DA 4C0DC 1VQNA 3DLMA 3CCRT 4MDXA 3CBOA 4RG2A 2E5QA 2LT1A 5D6XA 2X35A 3CPWS 4PJOE 3V8JA 3TEEA 4QVDA 5FU6B 4MDWA 3TREA 4DOWA 3L1AA 5GANd 3CCSA 3EAEA 3JAME 4HT9A 3JSCA 3QJYA 1SSFA 4OB3B 2VGNA 4C8QD 3HFNA 4R56A 3ZFJA 4E7HA 1LJOA 1Y96B 4EMGA 1R8OB 2F69A 4IUVA 4XU3A 4C5HA 1H641 4B9XA 1KHCA 1Q82C 1BYMA 5KH6A 4BY6C 1U1TA 2X4YA 2XKOC 4M78D 2K57A 3RMQA 4EPCA 2QQAA 4M7AB 3CCLT 1BKBA 2EIFA 5GAN5 3NFCA 3P8HA 3KXTA 2LX9A 5A0LA 2R5MA 3M54A 4X9DA 3CCRA 4GLKA 3X24B 1MGQA 2QA4T 2M0OA 1TH7A 5GAMj 1O75A 3S6WA 1ZHIA 4OVAA 3OYYA 3L42A 3JCMd 4MZTA 5GAOq 3PIOA 2QDYB 1BI1A 4DOVA 5A2QE 3JB9D 3OYEA 1X75C 2DXTA 5LJ3g 4L6V5 4C8QB 1IZ6A 4F7UE 1NZ9A 4XTVA 4M7DF 2EJFA 5HY6A 3LWHA 2X4JA 5J26A 4J7IA 1BIBA 3BFMA 3FRNA 3CCLA 2CYZB 1FX7A 3OYJA 5LJ5d 4PJOF 3LX7A 3CXCS 2CGHA 2MI6A 4J6WA 5IN1A 2KY9A 2EAYA 3JB9H 2RK2A 4BI4A 2QA4A 1NPRA 2EQJA 3DB3A 3P8DA 2KVQG 3J81E 2JUFA 2DIQA 5GANj 3OYCA 5CR2A 5GAOl 3QG1A 4LDWA 2EQMA 4L59A 2LC4A 1BIAA 4EMHA 4N0AC 3BDLA 3E9GA 3OSSC 2XDDA 4M7AG 1JRIA 1K9MU 3SWNC 1VQKT 1NPPA 3M55A 4LD6A 4ELYC 3MEAA 2NLUA 3CCET 3LW5E 1YI2T 3CBMA 1EIFA 2E70A 4TVRA 4C8QA 3C94A 2O4XB 1N8RC 2E6NA 4YTLA 3MP6A 2M1HA 5D6YA 3C4SA 5C6SA 1VQ5T 4PJOB 1NJIU 1VQ4T 4M78A 2RI3A 3G4SA 1M1FA 2EQUA 4MZMA 4N4HA 2QEXT 1KQ2A 3UPUA 4E7KA 3BDUA 3OQ5A 3HRUA 3HSBA 4KUIA 4C8QG 1QVPA 2DKGA 5GAMf 2HQXA 3M5AA 4II1A 1K8AU 3CCVT 3JB9J 4FSXA 3QKJA 3G6ET 4M7DC 3PGGA 4KUDK 4ZN1A 2XD0A 2FVUA 3JCMe 4KT0E 5GAOp 1VQKA 2X4WA 5CKEA 2RHIA 4FU6A 5LL6S 3CCEA 1M9SA 3X25B 2RO0A 5GAN2 1YI2A 5GAN3 4M77C 3OS5A 3OMGA 5LJ5j 2M16A 4PLLA 4V2SA 2RHUA 4NL3A 2V8IA 4B9WA 1VQ5A 3FB9A 1X6OA 2CZ6B 2QQ9A 4UC4A 5GMKj 5IT9E 1VQ4A 1HXDA 2EKOA 3CEYA 4LDXA 2ZCFB 2QEXA 3FEOA 5CO7A 4QQDA 5EG2A 4JJNK 3JB9G 1KG1A 1Q81U 3N5BB 3H8ZA 4Y91A 3KBGA 2BIVA 3URGA 2FL7A 4XU2A 2ZPBB 5LJ5e 3L2WA 2EWNA 2RK1A 3P8BB 1I4K1 5GANf 2JVVA 3M4GA 3CCVA 3S3OA 2QQBA 2QTXA 3MEUA 5GAMg 4C0GA 3NTKA 3G6EA 1UEBA 3CCUT 4BI8B 3CC2T 2KMTA 4A4HA 1KQSS 3OMCA 3OS1A 4JRKA 4XK8E 4BD3A 4LDVA 3RKXA 3CC4T 1ZBXA 4M7AD 3VYHB 4QVCA 5LJ3h 2K4YA 1WPYA 1XQHA 2P0PA 2XHCA 2LDMA 3HPWA 5L8RE 1Q86U 3ASKA 3CBPA 4N4GA 4CI0C 1W2BS 3QYGB 4IUPA 1Y07A 3JCMf 3J80E 3X28B 2CZ1B 4C92C 2XG8D 3NTHA 2WSFE 4JS4A 1WQ7A 3CCUA 1M4ZA 3MHXA 1M1GA 2KAFA 3CC2A 1Y71A 5GANg 4F7UA 2A3LA 2HNIA 3HHTB 3LLRA 3M57A 2PVDB 2DVEA 4VUBA 4C5EA 2AHJB 4EDUA 2RB6A 3OA6A 2HD0A 2ZPHB 4M75C 4X9CA 3FIFA 4XTWA 2LRQA 4NL2A 5J39A 5A0DA 5I21A 5GMKi 2A7YA 2D9TA 3VUBA 1VQMT 3CC4A 2DAQA 2QQRA 3SDZA 5LJ5f 1K9MC 1VQPT 1G3TA 1UGRB 1QVGA 5CIUA 3LGLA 4EMKB 3MO8A 4F7UG 4HCBA 3CMAT 3I55T 2WACA 2OTJT 2G3RA 2GF7A 3FLGA 4BUGA 1LNXA 2O01E 4ZGDB 3QHSA 1D3BA 2DXBA 3GNFB 4XTYA 4M78C 1NJIC 2I2LA 2YHTA 3QZ9B 1VQ8T 3QSUA 3LYIA 2PUOB 2DO3A 2XK0A 3E9FA 3JB9I 3F70A 4BDZA 2DJZA 1OI1A 2E41A 3JCMP 4C0DB 4XTZA 5HK0A 4R55A 3SB2A 3OYNA 4E7IA 1XTDA 2JNGA 4FT2A 2DD5A 3FDRA 1WQWA 3QBYA 1K8AC 1VQMA 1VQLT 2LCLA 1KHIA 3HFOA 4M7DD 2GCXA 4A4KA 2XU8A 4HCCA 1Y96A 5GMKm 1VQPA 4E7JA 3OB9A 5DM7R 4PJOD 2VUBA 2JZ2A 4OMFB 3X26B 3I55A 3CMAA 3JCMb 1JB0E 2OTJA 3PT9A 4J83A 1KC8U 5DLOA 2OTLT 4M7AA 3X20B 5KE3A 3C12A 4LDUA 1KQ1A 4EMKA 3OBYA 5IAYA 1KD1U 4M7DE 5FROA 2KK4A 5LJ3d 3QUIA 4BY6B 1VQ8A 4A4GA 1I5LA 5CKBA 3DLLA 1OZ2A 3OYKA 4ZTJA 1ZQ1A 2ZPFB 1Q81C 1U8RA 1JJ2A 2GFAA 1M5Q1 2YLBA 2VYTA 2E64A 3GNGA 3JRZA 4M77E 4OB0B 2RI2A 1X01A 2VXFA 2EYQA 3CCQT 3V8KA 3CCMT 2P0QA 3MP1A 4A54A 1KC8C 4RMOA 2K5IA 3OYMA 4QQGA 1VQ6T 2H3JA 4JDSA 4NS5A 2D0QB 3CPFA 1IREB 4PNOA 3Q1JA 2GQVA 4OGEA 2BKDN 2KSSA 3M53A 4X34A 3A8OB 4OF1A 1UGQB 4J5YA 2OTLA 2DTHA 3HP9A 3BY7A 3GLXA 4MMKA 5FRNA 1S72T 3M59A 2XI9A 2L5QA 2P4TA 3V7RA 2DZ9A 1AHJB 3HL8A 2DD4A 3QJ6A 3OYDA 4OGCA 3M4YA 3R6OA 1V29B 2MAMA 1Q86C 4FIBA 2IVWA 3JCMX 1I8FA 2D6FA 2ZPEB 1WNLA 1U1SA 3CCQA 4IUUA 3OYLA 3CCMA 2C06A 1UGSB 5GAN8 3PNWC 2RJCA 5GAN6 2RHYA 3G71T 1FWZA 1VQ6A 1GXIE 5GAN7 3CCJT 5D6WA 3OW2A 2RM4A 3CMET 5GAOr 2JTMA 2PUKB 3TCJA 4JUVA 1QP3A 4KBMB 2DXUA 1W4SA 3GF5A 2R57A 3RKWA 4HCZA 4QW2A 4C5IA 4DQ2A 3OYGA 3L2UA 1Y7XA 1YHQT 3GIBA 2O4XA 3MEWA 4JRQA 4C92E 3SWNB 5I2SA 5FRMA 5LJ3j 1H3ZA 3OYHA 1S72A 2HQEA 3GPLA 4PJOA 1BI0A 3QZ5B 4M77F 3QO3A 2P0KA 2V8JA 3G7ZA 3MCAB 1PSEA 5FU7C 3JCMV 1YJ9T 4ZN3A 2YLCA 2JN0A 4BB7A 1VQOT 3OYAA 1RI0A 4M75E 4BACA 5CKDA 4C5GA 3AHUA 4XU0A 2PU9B 2ZPIB 3S3NA 4QVZA 3FJPA 2E10A 3ZEHA 5LJ3e 2DZCA 2RA2A 4XQ3A 1YITT 4PJOG 2KDSA 4A4FA 2DEQA 3CCJA 3CMEA 5FU6C 2YRVA 2MMPA 2ZGWA 3A8LB 4ZGJB 4QQ6A 2HAXA 2MWPA 2RJEA 3HKSA 3BW1A 1YHQA 4M7DB 1VIFA 4RCBA 2BUDA 4O6JA 1WJQA 4M78E 4PL6A 5A0GA 2CZ7B 4J7FA 4PLIA 3M56A 3DB4A 1RL2A 3KUFA 3QYHB 4M77B 3LH0A 5GAMd 4Z02A 4E7LA 4DA4A 4C0ZA 4GY5A 1YJ9A 1N8RU 1M90U 2KQWA 3CCST 4M7AC 4Y28E 4J8OA 4RCCA 1QW1A 2K5FA 3VUZA 1VQOA 3L2RA 4A4EA 3PIPA 4J6XA 5FLXE 2DTIA 2MF2A 2PVGB 3GP8A 1Q7YU 1KD1C 4BE1A 3CC7T 3QPHA 4BDYA 4LD9K 3ZBDA 1YITA 4IUQA 4RKUE 3RKYA 3VYGA 2EJGA 3META 4C92F 3GOXA 2DXCA 1YCYA 2RI5A 3OBWA 1N9RA 2LQKA 4C8QC 1I81A 4BI3A 1M1KU 3T9NA 2K5LA 2XICA 4M75D 4XAXB 4M7DA 1VIEA 4M75F 3PFSA 5LJ3f 3SD4A 2MWOA 4ZTFA 1XOVA 2K3XA 2V8KA 3V8LA 5CAIA 2EQKA 3OS2A 1K73U 3CXCA 3JCMg 1DJ7B 2OAUA 1NE8A 4M77A 4C8QF 4J6YA 4ZGEB 4HKEA 2E6ZA 1YJNT 4L5GA 3EFRA 1MHNA 2HBPA 4M7DG 4XTXA 3ER0A 1QP2A 2LVMA 3A8GB 4CRIA 4HA8A 2DPPB 2RJFA 2Y90A 4C92B 4M78F 4Q5WA 5CKFA 2L3RA 3LGFA 4M77G 2LNVA 5KCOA 1WJSA 2DTOA 3PMTA 3O8VA 2WSCE 4LDYA 3J7AF 1G3SA 1LOJA 3MP8A 5LJ5g 3OS0A 4FT4A 2RHXA 4M75B 1N27A 5HKCA 1N6AA 4PKCC 5I2MA 4XTUA 3UWNA 4FL6A 1HK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN f;  3M4G A;  2QTX A;  3L1A A;  5GAN d;  5GAM g;  5GAO m;  3JB9 F;  4HT9 A;  4PJO C;  4MML A;  4C8Q D;  3HFN A;  4OP0 A;  3JCM X;  1I8F A;  2VXE A;  5GAO n;  3V7S A;  5GAM e;  1LJO A;  1WNL A;  1U1S A;  1Y96 B;  4EMG A;  4XU3 A;  3RER A;  5GAN 8;  1H64 1;  5GAN 6;  3JCM Q;  4JRK A;  5GAN 7;  3RIR A;  3RKX A;  4M78 B;  2RM4 A;  1U1T A;  5GMK l;  4M78 D;  5GAO r;  2K57 A;  4M7A B;  4JUV A;  5GAN 5;  4M7A D;  2DXU A;  4QVC A;  4DQ2 A;  3RKW A;  3GIB A;  4JLI A;  4M7D D;  5LJ3 h;  1WPY A;  4X9D A;  4C92 A;  5GAM h;  4XTU A;  4C92 E;  3SWN B;  1MGQ A;  5LJ3 j;  1TH7 A;  5GAM j;  2FB7 A;  3JCM f;  5GAO q;  4PJO A;  3JCM d;  4M77 F;  3QO3 A;  4C92 C;  1B34 B;  1WQ7 A;  3JCM V;  3JB9 D;  4M75 A;  2YLC A;  2JN0 A;  2DXT A;  5LJ3 g;  1N9S A;  4M75 E;  4C92 G;  5GAN g;  4C8Q B;  4F7U A;  2HNI A;  4XU0 A;  3AHU A;  4F7U E;  2DVE A;  2E10 A;  3FJP A;  3RES A;  2DZC A;  2RA2 A;  2RB6 A;  4XTV A;  2EJF A;  2VC8 A;  4XQ3 A;  4M75 C;  4XTW A;  4X9C A;  3FIF A;  4PJO G;  2DEQ A;  4NL2 A;  5I21 A;  5GMK i;  1BIB A;  3BFM A;  2ZGW A;  4M75 G;  5LJ5 f;  3RUX A;  5LJ5 d;  3JCM c;  4EMK B;  3BW1 A;  4PJO F;  4M7D B;  4F7U G;  2CGH A;  4RCB A;  4J6W A;  5LJ3 e;  2EAY A;  4M78 E;  3JB9 H;  1M8V A;  5GAN h;  4M7A E;  1LNX A;  3EFS A;  3QHS A;  1D3B A;  5GAN j;  4M77 B;  5GAM d;  4XTY A;  4M78 C;  4M77 D;  4F7U F;  2I2L A;  2EJ9 A;  5GAO l;  5GAN 4;  2YHT A;  4M7A C;  3QSU A;  2FYK A;  4RCC A;  1BIA A;  2RD1 A;  4EMH A;  3JB9 I;  4M78 G;  4N0A C;  4J6X A;  2DJZ A;  2DTI A;  2E41 A;  3JCM P;  1B34 A;  4XTZ A;  1JRI A;  4M7A G;  3SWN C;  3SB2 A;  4NOY A;  1WQW A;  4C8Q A;  3RKY A;  3HFO A;  4C8Q E;  2EJG A;  4JRI A;  4C92 F;  1Y96 A;  1YCY A;  4XU1 A;  5GAN e;  5GMK m;  1N9R A;  3V7C A;  3JCM h;  4PJO B;  1JBM A;  4PJO D;  4C8Q C;  3JCM b;  4M78 A;  5DY9 A;  1I81 A;  3VU3 C;  4HT8 A;  3JCM W;  1KQ2 A;  4M7A A;  3BDU A;  4M75 D;  4EMK A;  3HSB A;  1KQ1 A;  4M7D A;  4C8Q G;  4M75 F;  2E65 A;  5LJ3 f;  4F7U B;  4M7D E;  2DKG A;  4N0A A;  5LJ3 d;  3QUI A;  5GAM f;  3JCM J;  3V8L A;  5CAI A;  3INZ A;  1I5L A;  5GMK e;  3SWN A;  3JCM g;  4A53 A;  3JB9 J;  4EMK C;  4M77 A;  4M7D C;  2YLB A;  1M5Q 1;  3L2Z A;  3PGG A;  2E64 A;  4J6Y A;  4M77 E;  4C8Q F;  3JCM e;  5GAO p;  1X01 A;  2VXF A;  4WF2 A;  3EFR A;  3V8K A;  5LJ5 h;  4A54 A;  5GAN 2;  4M7D G;  4XTX A;  5GAN 3;  4M77 C;  4HA8 A;  5LJ5 j;  2Y90 A;  4C92 B;  1HK9 A;  4M78 F;  5GMK h;  4V2S A;  4C92 D;  4NL3 A;  2E1H A;  4PNO A;  4M7A F;  3FB9 A;  4M77 G;  1D3B B;  5GMK j;  2DTO A;  4M7D F;  1HXD A;  1LOJ A;  4J5Y A;  5LJ5 g;  2DTH A;  3JB9 G;  3BY7 A;  4MMK A;  4M75 B;  4Y91 A;  3V7R A;  4PJO E;  3V8J A;  5LJ5 e;  2DZ9 A;  4XU2 A;  2EWN A;  4QVD A;  1I4K 1; 
#chains in the Genus database with same CATH topology
 5GAO m;  4HVU A;  1FMW A;  1OYX A;  4J9H A;  5GAO n;  5KE2 A;  1YJ9 Q;  2CS7 A;  3E1S A;  1V76 A;  3LWI A;  1QKW A;  2LTO A;  4M78 B;  1YIT Q;  2RQV A;  4RTW A;  4GLM A;  2KI7 A;  4JLI A;  1FXX A;  3MEV A;  2E12 A;  4BE0 A;  2NUT A;  2CT3 A;  1Q82 U;  2DEU A;  1Q95 G;  3OYB A;  4M75 A;  3EFO B;  3PMI A;  1BCO A;  3VJP A;  1F1B B;  5GAN e;  2VC8 A;  2MIO A;  2E3I A;  1T0H A;  3TSZ A;  3NPF A;  3RUX A;  2A37 A;  3UT1 A;  5HK3 A;  2LCC A;  2JJ9 A;  1M8V A;  1NLP C;  5GAN h;  1EX4 A;  5CK9 A;  1VQ9 A;  3EH1 A;  1P92 A;  1GCP A;  2EJ9 A;  3UDC A;  5GAN 4;  1ZUK A;  3I56 T;  2XID A;  4M78 G;  1W2B A;  1QCN A;  3E19 A;  2C0I A;  3CPW A;  4MZP A;  2EKH A;  2DVJ A;  4R0K A;  4JRI A;  2K2V A;  2XDB A;  4XU1 A;  5CQX A;  3VKI A;  3VRY A;  3M58 A;  5DY9 A;  5ECA A;  2BTT A;  4OB2 B;  2FEI A;  4F7U B;  1WZO A;  1WJR A;  2JMA A;  2KXC A;  4PFP A;  3OYI A;  2C0T A;  5CQY A;  1BI3 A;  4C0F A;  1UB4 A;  4WF2 A;  3FC3 A;  5CCA A;  2YUN A;  3CC7 Q;  3G71 Q;  3QII A;  1PCX A;  2O2O A;  2F5K A;  2QAS A;  4C0D C;  1RAD B;  2E5Q A;  3D7S B;  3CPW S;  2K6D A;  2LJ1 A;  3TEE A;  5FU6 B;  4MDW A;  5KYW A;  4DOW A;  3L1A A;  5GAN d;  4HT9 A;  3JAM E;  3JSC A;  1NJI R;  2CUD A;  2F1L A;  2F69 A;  4XU3 A;  4DEY A;  4C5H A;  1RAA B;  2K57 A;  3CCL T;  3CD6 Q;  2ZAE A;  1D1B A;  1SRM A;  4GLK A;  5GAM j;  1O75 A;  1ZHI A;  3L42 A;  3GBQ A;  2V1R A;  2X3X D;  2C0O A;  4EIK A;  3OYE A;  1X75 C;  5LJ3 g;  4L6V 5;  2JM9 A;  1XJW B;  2RMO A;  1NBE B;  3H9N A;  1AWJ A;  3BFM A;  3TSW A;  1LCK A;  4PJO F;  3LX7 A;  1UJY A;  2CGH A;  1JQQ A;  2MI6 A;  4J6W A;  2QA4 A;  2EQJ A;  3DB3 A;  3P8D A;  1R0C B;  2KVQ G;  1WXB A;  1VQN Q;  3QG1 A;  1D1C A;  4N0A C;  3BDL A;  3OSS C;  1B07 A;  1JRI A;  1K9M U;  3SWN C;  1VQK T;  4LD6 A;  1RAH B;  3CCE T;  3CBM A;  1N8R C;  4C8Q A;  1PRL C;  3O5Z A;  4YTL A;  2M1H A;  5D6Y A;  1NJI U;  3QWY A;  4Z88 A;  4M78 A;  2GTO A;  2QEX T;  1M1F A;  2EQU A;  4MZM A;  4N4H A;  4PK4 A;  2OJ2 A;  3UPU A;  1RI9 A;  3HSB A;  1VA7 A;  2BZ8 A;  5GAM f;  2HDA A;  4FW1 A;  3CCV T;  3JB9 J;  1MNE A;  3QKJ A;  4LE9 A;  1PM3 A;  5CKE A;  2DMO A;  3H41 A;  5GAN 3;  3EFO A;  5I22 A;  4M77 C;  1NLO C;  4OMN A;  1VQM Q;  1ZA1 B;  1X6G A;  1ZUU A;  2EKO A;  3FEO A;  2FPF A;  4JJN K;  3JB9 G;  1Q81 U;  3N5B B;  1X27 A;  4Y91 A;  3KBG A;  2BIV A;  2AZS A;  2EPD A;  5LJ5 e;  3L2W A;  2CRE A;  2F2V A;  3S3O A;  2QTX A;  2MCN A;  4C0G A;  1UEB A;  1AWX A;  2CP2 A;  1BCM A;  2E3H A;  4LDV A;  1IXD A;  4E2F B;  3MJX A;  4JJB A;  2O9V A;  2XHC A;  2LDM A;  3HPW A;  5L8R E;  4LUD A;  3ASK A;  1AEY A;  3J80 E;  2CUB A;  4C92 C;  2DFU A;  1ARK A;  3CCU A;  4FCY A;  2KAF A;  4F7U A;  2HNI A;  4OML A;  2DVE A;  2AHJ B;  2M0Y A;  4X9C A;  4NL2 A;  4PJN A;  5J39 A;  1VQM T;  2KRS A;  2DAQ A;  1YI2 Q;  1VQP T;  1G3T A;  1UGR B;  2CH4 W;  4HCB A;  2FPD A;  3CMA T;  4Y92 A;  1NM7 A;  2G3R A;  1VQ5 Q;  2OAW A;  1D0X A;  4ZGD B;  3QHS A;  1X2K A;  2COW A;  3I5S A;  2I2L A;  1VQ8 T;  3QZ9 B;  3QSU A;  4PJL A;  2DJZ A;  1QKX A;  2OI3 A;  3JCM P;  4PJM A;  3OYN A;  3G6E Q;  1B7T A;  1U5S A;  2GCX A;  5GMK m;  4OMO A;  3OB9 A;  2DIL A;  4PJO D;  1YCS B;  3X26 B;  1SPK A;  3I55 A;  1KK7 A;  2X3W D;  2L0A A;  3RDV A;  3X20 B;  3C12 A;  4LDU A;  1OU8 A;  3FJ5 A;  3OYK A;  3RR6 A;  1M5Q 1;  4M77 E;  4OB0 B;  2RI2 A;  1X01 A;  2IPO B;  3CCM T;  4RMO A;  4QQG A;  2ED0 A;  4F17 A;  3Q1J A;  3RNJ A;  4OGE A;  3M53 A;  2DM1 A;  4CC2 A;  1Q7Y R;  4ESR A;  2OTL A;  3BY7 A;  4MMK A;  1MV0 B;  2NYS A;  3M59 A;  2XI9 A;  5KYX B;  2XMF A;  3M4Y A;  2MAM A;  2IVW A;  1GRI A;  3JCM X;  2D6F A;  1WNL A;  3OYL A;  5D7U A;  2RHY A;  1VQ6 A;  1FWZ A;  2YDL A;  1GXI E;  2MOX A;  3CCJ T;  3OW2 A;  5GAO r;  1QP3 A;  1W4S A;  3RKW A;  4HCZ A;  3GIB A;  3OYG A;  1Y7X A;  3MEW A;  4C92 E;  5LJ3 j;  1H3Z A;  1S72 A;  1ZSZ C;  3QZ5 B;  1WHL A;  3QO3 A;  4HXJ A;  3G7Z A;  3MCA B;  4KGZ B;  1VYT A;  2K7A A;  2YLC A;  1Y57 A;  2JN0 A;  1VQO T;  4BAC A;  3AHU A;  2ZPI B;  4QVZ A;  3ZEH A;  2YUP A;  1EZZ B;  2DEQ A;  4J9D A;  3QDF A;  1J3T A;  2YRV A;  2HAX A;  2MWP A;  2AT1 B;  4M7D B;  2KT8 A;  4RCB A;  3SEM A;  4PL6 A;  5A0G A;  1KQS P;  4J7F A;  4PLI A;  1PD0 A;  3QYH B;  4M7A C;  4Y28 E;  2K5F A;  2DL7 A;  3PIP A;  3KFV A;  2DTI A;  2MF2 A;  2PVG B;  1Q7Y U;  4LD9 K;  1M3B A;  2YT6 A;  1ABQ A;  2AKL A;  3RKY A;  1LVK A;  3CCQ Q;  2ED1 A;  4BI3 A;  1M1K U;  4RTZ A;  2KBT A;  1KJW A;  4XAX B;  2JXB A;  1T3L A;  5LJ3 f;  3SD4 A;  1BB9 A;  1TUD A;  3OS2 A;  5CAI A;  3JCM g;  1DJ7 B;  1YN8 A;  4J6Y A;  2JM8 A;  4L5G A;  2YWW A;  4M7D G;  4XTX A;  1QP2 A;  2EGA A;  2DPP B;  2RJF A;  2Y90 A;  1WJS A;  3PMT A;  4KGX B;  3CME Q;  1KFZ A;  4LDY A;  4J9F A;  1AT1 B;  1WI7 A;  2RHX A;  4M75 B;  1N27 A;  4ZNX A;  1JEG A;  5I2M A;  2X51 A;  1TUG B;  1YNZ A;  1YBY A;  1C0M A;  3DKM A;  3V7S A;  5GAM e;  1QVG S;  4JZ3 A;  3RER A;  2IG0 A;  3UF4 A;  1G3W A;  2FG0 A;  1FYN A;  2VV5 A;  4P5N A;  1WHM A;  3C95 A;  2J6F A;  4M4Z A;  5GAM h;  2LCS A;  3HRT A;  1VQ9 T;  1S1N A;  2FB7 A;  2O9S A;  2ZZD A;  2DK3 A;  3EG9 A;  5AT1 B;  2QXF A;  1IGU A;  2Y4X A;  1M90 C;  2CDT A;  4IKF A;  2FZG B;  1XNI A;  2K9G A;  4M75 G;  1FMK A;  3WVE B;  1KQS A;  1G5V A;  2RHZ A;  3M9Q A;  4AFZ C;  4M7A E;  3QWX X;  3EFS A;  1OPL A;  4OMM A;  2FYK A;  4JRP A;  5KYX A;  2JW4 A;  1B34 A;  2RPN A;  3BE3 A;  2O31 A;  2VGM A;  1PD1 A;  2X4X A;  1VQ7 A;  3V7C A;  1YIJ A;  2D0N A;  2GQI A;  2CZ0 B;  2BE9 B;  2KR3 A;  3C0C A;  4OB1 B;  1YJW A;  1SSH A;  2DET A;  5M9O A;  2LQ8 A;  4EMK C;  3L2Z A;  2DA9 A;  2R5A A;  1BU1 A;  1G83 A;  1Q82 R;  2HEQ A;  2WSE E;  4CC7 A;  1D3B B;  2PQW A;  3VV0 A;  2L8D A;  2DF6 A;  3CBO A;  5D6X A;  2DLP A;  4QVD A;  3TRE A;  1TSF A;  3EAE A;  2RQW A;  4OB3 B;  2VGN A;  1WX6 A;  2I0N A;  3ZFJ A;  4E7H A;  1LJO A;  1R8O B;  4B9X A;  1Q82 C;  1KHC A;  4FYY B;  2CP5 A;  1U1T A;  4AFS C;  1UEC A;  1K8A R;  5GAN 5;  4E7S A;  4IIO A;  2LX9 A;  2DYI A;  3CCR A;  5IXF A;  2A08 A;  3NGP A;  4FYW B;  1MGQ A;  2QA4 T;  1TH7 A;  4HCK A;  2QDY B;  2CP7 A;  2GGR A;  2YRD A;  4C8Q B;  3I56 Q;  2GBQ A;  2EJF A;  2QAZ A;  1UDL A;  2LZ6 B;  2L2P A;  2HZY A;  3CXC S;  4BI4 A;  1HSQ A;  1IO6 A;  2JUF A;  2E5K A;  1D0Z A;  1WYX A;  4RTT A;  2LC4 A;  1BIA A;  2DL5 A;  5IXB A;  1Q86 R;  1NPP A;  1EFN A;  3LW5 E;  1EIF A;  2E70 A;  2L3Q A;  1WIE A;  4TVR A;  2O4X B;  2DX1 A;  1WFW A;  2PZ1 A;  1JU5 C;  3MP6 A;  4PJO B;  3VS0 A;  1YP5 A;  2KRM A;  1UTI A;  3BDU A;  3HRU A;  4C8Q G;  3A1P A;  1QVP A;  1GBR A;  3M5A A;  1AVZ C;  4II1 A;  5HCK A;  1K8A U;  3EG0 A;  4KUD K;  2XD0 A;  1JJ2 P;  5LL6 S;  1PG5 B;  3OMG A;  2RHU A;  2V8I A;  1ZLM A;  3M0P A;  1ZBJ A;  1X6O A;  5IT9 E;  4UC4 A;  4AMC A;  1VQ4 A;  2ZCF B;  3CCL Q;  3H8Z A;  3NHN A;  3URG A;  1YFN A;  2ZPB B;  2EWN A;  2EW3 A;  1KC8 U;  3CCU T;  2KMT A;  4A4H A;  2RNA A;  1QVF P;  3OMC A;  1KD1 R;  4XK8 E;  2KYM A;  2X9H A;  2VWF A;  2ROT A;  5LJ3 h;  1WPY A;  2P0P A;  1Q86 U;  1K9M R;  2A0F B;  3CBP A;  1W2B S;  4RTY A;  3JCM f;  2OTL Q;  4JS4 A;  1WQ7 A;  3MHX A;  3CC2 A;  5GAN g;  2DL4 A;  2A3L A;  3HHT B;  4VUB A;  4C5E A;  2LQN A;  2KRN A;  2ZPH B;  4XTW A;  2A7Y A;  1VQK Q;  3CC4 A;  3CCE Q;  3SDZ A;  1K9M C;  4F7U G;  3I55 T;  2WAC A;  2BZX A;  2MPX C;  3FLG A;  1LNX A;  1D3B A;  2QEX Q;  4XTY A;  2FRW A;  2ENM A;  4M78 C;  1NJI C;  2YHT A;  1NEG A;  2XK0 A;  1I5O B;  3E9F A;  3JB9 I;  3F70 A;  1OI1 A;  1K76 A;  2KXD A;  4XTZ A;  3CCV Q;  3SB2 A;  4E7I A;  1Q81 R;  1MMG A;  3QBY A;  2FRY A;  1YWP A;  3HFO A;  4HCC A;  4E7J A;  5DM7 R;  3JCM b;  2OTJ A;  3PT9 A;  5DLO A;  2OTL T;  5KE3 A;  3OBY A;  1KD1 U;  4HVW A;  5LJ3 d;  3QUI A;  4BY6 B;  5CKB A;  1W6X A;  4KH1 B;  2ZPF B;  1Q81 C;  2DYB A;  1JJ2 A;  3GNG A;  3JRZ A;  2DJQ A;  1U3O A;  2VXF A;  2P0Q A;  3MP1 A;  2K5I A;  1VQ6 T;  2SRC A;  1IRE B;  1IB8 A;  1BBZ A;  1MV3 A;  2GQV A;  4LXC A;  1UGQ B;  1E7O A;  3HP9 A;  3GLX A;  1S72 T;  2L5Q A;  2P4T A;  3OYD A;  2DZ9 A;  1AHJ B;  1UHC A;  4IUU A;  2C06 A;  5KYN A;  3PNW C;  1RAC B;  5GAN 7;  3R6N A;  1T3S A;  4KBM B;  2DL8 A;  2HL5 C;  4C5I A;  2O4X A;  2CSI A;  5I2S A;  1VQP Q;  4PJO A;  3CMA Q;  4M77 F;  2P0K A;  2V8J A;  1PSE A;  2QG9 B;  1QMC A;  1IHV A;  1RI0 A;  5CKD A;  4C5G A;  1VQ8 Q;  4XU0 A;  4IIM A;  1QLY A;  2DZC A;  2RA2 A;  4XQ3 A;  2K2M A;  1AWW A;  4KRT A;  5FU6 C;  3G1J A;  3HKS A;  1YHQ A;  4O6J A;  1WJQ A;  4M78 E;  2CZ7 B;  1PHT A;  1TS9 A;  3I35 A;  4E7L A;  2A36 A;  2M02 A;  4C0Z A;  1YJ9 A;  1N8R U;  3CCS T;  4RCC A;  1SKU B;  4A4E A;  2GNC A;  4J6X A;  3GP8 A;  3ULR B;  4BDY A;  2HMA A;  3ZBD A;  1YIT A;  1K4U S;  4FSS A;  5FW9 A;  1AOJ A;  1RLQ C;  4QKU A;  3CCM Q;  4C92 F;  2DXC A;  1YCY A;  2EGE A;  2RI5 A;  1KIK A;  1N9R A;  3VS1 A;  1I81 A;  3PVL A;  2EYZ A;  2Z0W A;  4ZTF A;  1XOV A;  3V8L A;  1K73 U;  1NE8 A;  4M77 A;  1SHG A;  4FYV B;  2E6Z A;  2HBP A;  3ER0 A;  2LVM A;  3A8G B;  4CRI A;  2YXY A;  4HA8 A;  4Q5W A;  2L3R A;  3RBB B;  3CCJ Q;  2LNV A;  2WSC E;  5LJ5 g;  1SEM A;  1BK2 A;  2IIM A;  5HKC A;  2QDL A;  1N6A A;  4XTU A;  3EG9 B;  4KGV B;  3JB9 F;  4MML A;  2B8A A;  3H6Z A;  2VXE A;  4D8D A;  3QDR B;  2L3S A;  1YJN A;  2LNH B;  1M3A A;  2JOY A;  3A5Z B;  4RG8 A;  1VQO Q;  3RIR A;  5I11 A;  2ZPG B;  2AIR B;  4C92 A;  3G4S T;  4Z89 A;  3ME9 A;  3QXE B;  1K9A A;  4ATO A;  1B34 B;  2J05 A;  1QCF A;  1X43 A;  2DRM A;  1D0Y A;  3CC7 A;  3G71 A;  2DIG A;  1M1K R;  2RH2 A;  3WVD B;  4IUR A;  5IHN A;  1Q7Y C;  2Y4Y A;  1OUL A;  2COZ A;  3JCM c;  4QT7 A;  1VQ7 T;  1YIJ T;  1NYG A;  1SF9 A;  1PRM C;  5CKH A;  1RAG B;  4BE2 A;  1YJW T;  1C6V X;  1GFC A;  1RLP C;  4M77 D;  1E6G A;  4A63 B;  2HSP A;  3VS5 A;  2LT4 A;  1M1K C;  2HBW A;  2M9U A;  2K3Y A;  4J9I A;  5KYU B;  3CD6 A;  4NOY A;  3HRS A;  2QQS A;  2K3B A;  3EH2 A;  2XDP A;  2CSQ A;  3JCM h;  1JBM A;  2DER A;  3VU3 C;  2ESW A;  2H3E B;  3IQL A;  4JLG A;  2EFI A;  2E65 A;  4ELZ C;  3OY9 A;  3A8M B;  3OW2 S;  4A53 A;  3S3M A;  2K79 A;  3VS3 A;  2GFU A;  3WXM B;  4O5V A;  1OZ3 A;  3OYF A;  4C92 D;  5FU7 B;  3OSV A;  1OPK A;  4M7A F;  2QI2 A;  1O9S A;  2CP6 A;  1VQN A;  1M8M A;  3CCR T;  4RG2 A;  2LT1 A;  3H0F A;  3EG3 A;  3V8J A;  1VQ9 Q;  3PVQ A;  2MYS A;  3CCS A;  4B6M A;  3QJY A;  3THK A;  1I0C A;  4R56 A;  3HFN A;  2LX7 A;  1MMA A;  4EMG A;  1Y96 B;  4IUV A;  1H64 1;  2J6O A;  4J9E A;  4DEX A;  5KH6 A;  2QQA A;  1BKB A;  2EIF A;  5A0L A;  2R5M A;  1OQK A;  2VVK A;  3X24 B;  4AT1 B;  2YRC A;  1QCO A;  1TWB A;  3JCM d;  4MZT A;  3ZL7 C;  2CH4 A;  1X6B A;  4PJJ A;  1BI1 A;  4DOV A;  5A2Q E;  1V1C A;  1Z9Z A;  4ORZ A;  3JB9 D;  2DXT A;  1FMV A;  1PNJ A;  1IZ6 A;  4ANJ A;  1NZ9 A;  2JTE A;  2DL3 A;  5HY6 A;  2MK5 A;  2X4J A;  4D8K A;  1IGQ A;  3FRN A;  2CYZ B;  1G2B A;  2DBM A;  5IN1 A;  2KY9 A;  3JB9 H;  2RK2 A;  2JS2 A;  3OYC A;  4K11 A;  5CR2 A;  5GAO l;  1SHF A;  5IHK A;  4EMH A;  3EGX A;  3E9G A;  2LP5 A;  4F04 B;  3M55 A;  4DBH A;  4ELY C;  3CC2 Q;  2VKN A;  1K0S A;  3C4S A;  5C6S A;  5IH2 A;  2J6K A;  4AG2 C;  3HTR A;  1VQ4 T;  3G4S A;  2RI3 A;  2ROL A;  3EHR A;  3NMZ C;  4KUI A;  1OV3 A;  2HQX A;  3UA6 A;  4LNP A;  5FWC A;  4M7D C;  3PGG A;  4ZN1 A;  2HCK A;  1ZUY A;  2RHI A;  2A28 A;  1M9S A;  4KH0 B;  2FPE A;  2RO0 A;  2DNU A;  3X25 B;  1YI2 A;  3TVT A;  2RN8 A;  3OS5 A;  5LJ5 j;  4B9W A;  1VQ5 A;  3FB9 A;  2CZ6 B;  5GMK j;  4M7D F;  3EGU A;  1HXD A;  1I1J A;  3CEY A;  4QQD A;  1KG1 A;  2LJ3 A;  3MPU B;  2QA4 Q;  2HL3 A;  3P8B B;  1NYF A;  1I4K 1;  2JVV A;  3M4G A;  1A0N B;  3MEU A;  5GAM g;  3G6E A;  3NTK A;  2LQW A;  4J9G A;  3CC2 T;  4CC4 B;  1AZE A;  1KQS S;  3OS1 A;  2ABL A;  4JRK A;  1MND A;  3CC4 T;  1ZBX A;  4M7A D;  4LUE A;  5KYU A;  3VYH B;  1WLP B;  2AZV A;  4CI0 C;  1AZG B;  2ECZ A;  3QYG B;  1Y07 A;  2B86 A;  3X28 B;  2CZ1 B;  3LH5 A;  3NTH A;  2FZC B;  5L23 A;  1M4Z A;  1M1G A;  1UFF A;  1W2B P;  3M57 A;  3LLR A;  2PVD B;  3CPW P;  2HD0 A;  4M75 C;  2QTV A;  2LRQ A;  1X69 A;  1YWO A;  5I21 A;  5GMK i;  2HQH A;  5LJ5 f;  4OMQ A;  1CKA A;  2BE7 D;  4HVV A;  3MO8 A;  2LJ0 A;  3VS6 A;  2OTJ T;  2GF7 A;  1HJD A;  2DXB A;  3I5R A;  2M51 A;  3LYI A;  3VRZ A;  3H0I A;  4BDZ A;  4C0D B;  4R55 A;  1C1A A;  2KGT A;  3FDR A;  1K8A C;  1VQL T;  2DRK A;  1KHI A;  2HKN A;  2XU8 A;  1Y96 A;  1KC8 R;  1B3Q A;  4FYX B;  1X2Q A;  2VUB A;  2JZ2 A;  4J83 A;  2PNI A;  1ACM B;  4EMK A;  5IAY A;  1KQ1 A;  2AK5 A;  4M7D E;  5FRO A;  2KK4 A;  4A4G A;  1I5L A;  3DLL A;  1OZ2 A;  1ZQ1 A;  1U8R A;  2SEM A;  2VYT A;  2E64 A;  2W0Z A;  2EYQ A;  3CCU Q;  3V8K A;  1KC8 C;  3OYM A;  1QWE A;  2GTJ A;  4JDS A;  4NS5 A;  3CPF A;  2HSE B;  4X34 A;  2BKD N;  2KSS A;  4OF1 A;  1PKS A;  1GCQ A;  2QGF B;  5FRN A;  4LN2 A;  3V7R A;  3QJ6 A;  1PWT A;  2DD4 A;  3R6O A;  1Q86 C;  1MMD A;  1M30 A;  1I8F A;  1U1S A;  3CCQ A;  1UGS B;  5GAN 8;  2RJC A;  5GAN 6;  1RAE B;  2VAS A;  2JTM A;  3TCJ A;  4JUV A;  2DXU A;  1BYM A;  2R57 A;  4DQ2 A;  4M7D D;  4QW2 A;  1YHQ T;  3SWN B;  5FRM A;  1BI0 A;  3I55 Q;  1H92 A;  3JCM V;  1YJ9 T;  3M0S A;  4M75 E;  2V1Q A;  2PU9 B;  3S3N A;  5LJ3 e;  2E10 A;  3M0T A;  3REB B;  4PJO G;  1YIT T;  4A4F A;  1YJN Q;  3CME A;  1Z9Q A;  1ZSG A;  2MMP A;  2ZGW A;  3A8L B;  4ZGJ B;  2RJE A;  1M2V B;  1VIF A;  1SRL A;  1ZA2 B;  3M56 A;  5IHI A;  1RL2 A;  3KUF A;  4M77 B;  2EQI A;  2QGG A;  8AT1 B;  4GY5 A;  2KQW A;  1WDX A;  2COY A;  1TU0 B;  1QW1 A;  1ZX6 A;  3L2R A;  1KD1 C;  3QPH A;  2EYY A;  4IUQ A;  4RKU E;  3VYG A;  1Y0M A;  1VQ6 Q;  2LQK A;  1W1F A;  4C8Q C;  3U23 A;  3T9N A;  1JXM A;  4M75 D;  2K5L A;  1WXU A;  2XIC A;  1VIE A;  4FW2 A;  2NUP B;  2K3X A;  1MUZ A;  1M3C A;  2V8K A;  2E4H A;  2EQK A;  3EHQ A;  1S72 Q;  4C8Q F;  2W10 A;  4HKE A;  1YJN T;  3EFR A;  1MHN A;  4C92 B;  4M78 F;  1T0J A;  3LGF A;  2RQT A;  4M77 G;  3O8V A;  1LOJ A;  4FT4 A;  4AFQ C;  2RQU A;  1RAF B;  2KNB B;  3M0U A;  4DBR A;  1OX9 A;  4FL6 A;  1HK9 A;  3SHW A;  5KCH A;  5CVI A;  4PJO C;  1BI2 A;  3CC7 T;  4OP0 A;  3G71 T;  1G3Y A;  1IRX A;  3JCM Q;  1VYV A;  4AFU C;  1VQL A;  5GMK l;  1TUC A;  1N8R R;  1PSF A;  4N4I A;  4DBF A;  2L89 A;  2RJD A;  4ME7 A;  1VUB A;  4JZ4 A;  1PC0 A;  3L2Q A;  5KYY B;  3VS7 A;  4CC3 A;  1N9S A;  4C92 G;  3TQ7 P;  2RQR A;  3CCS Q;  1UHF A;  8ATC B;  3RES A;  1QVF A;  3CD6 T;  3TU4 K;  3M0R A;  1UGP B;  4IUT A;  1K73 R;  1JJ2 S;  1RUW A;  2OX7 A;  1RAI B;  4F7U F;  3A8H B;  1E6H A;  1WGS A;  2CP0 A;  2FHD A;  5DLQ E;  9ATC B;  2RD1 A;  5AYF A;  1UUE A;  1K73 C;  4C8Q E;  5J3B A;  1OOT A;  3PTA A;  3M0Q A;  3SFM A;  3H0H A;  4D6W A;  5C0M A;  4E47 A;  4HT8 A;  3JCM W;  1VQN T;  3REA B;  1WXT A;  2F5T X;  5GJW B;  1QVF S;  2PVO B;  1AD5 A;  1UE9 A;  4N0A A;  3JCM J;  3INZ A;  2CKK A;  5GMK e;  3SWN A;  4KUL A;  3I56 A;  3NTI A;  4JS5 A;  2R58 A;  2JTF A;  4FM4 B;  2EBP A;  5LJ5 h;  2V26 A;  1ZSZ B;  3UAT A;  3OW2 P;  5GMK h;  2E1H A;  3RMS A;  1QQJ A;  4PFZ A;  3L2V A;  1JXO A;  3DLM A;  4MDX A;  1UGV A;  1U06 A;  2X35 A;  3G4S Q;  4PJO E;  1M2V A;  1ABO A;  1SSF A;  4C8Q D;  2LMJ A;  2KYB A;  4BY6 C;  2X4Y A;  1TTH B;  2XKO C;  4M78 D;  3RMQ A;  4EPC A;  4M7A B;  3NFC A;  3P8H A;  3KXT A;  2ATC B;  3M54 A;  4X9D A;  1WA7 A;  2M0O A;  1VQ7 Q;  1YIJ Q;  3S6W A;  4OVA A;  5GAO q;  3EGX B;  3OYY A;  3PIO A;  2JMC A;  1YJW Q;  2JS0 A;  1G8X A;  2YUO A;  4Z8A A;  2NUP A;  4F7U E;  1GBQ A;  4XTV A;  3LWH A;  5J26 A;  4J7I A;  1BIB A;  2EYX A;  3CCL A;  1FX7 A;  3OYJ A;  5LJ5 d;  2J06 A;  1QVG P;  2EAY A;  1NPR A;  2YUQ A;  3J81 E;  2DIQ A;  2O88 A;  5GAN j;  1CKB A;  4LDW A;  2EQM A;  4L59 A;  4WCI A;  2XDD A;  4M7A G;  3MEA A;  2NLU A;  2L3P A;  1YI2 T;  3C94 A;  1OX8 A;  2E6N A;  1IHW A;  1VQ5 T;  1WHH A;  1OEB A;  1AWO A;  1KQ2 A;  1H8K A;  4E7K A;  3OQ5 A;  3EG2 A;  3CCR Q;  2DKG A;  2DE0 X;  1D09 B;  4FSX A;  3G6E T;  2EVR A;  3PE0 A;  2FVU A;  1UG1 A;  5KYY A;  4KT0 E;  3JCM e;  5GAO p;  2X4W A;  1VQK A;  1K0X A;  4FU6 A;  3CCE A;  5GAN 2;  2M16 A;  1D1A A;  4PLL A;  4V2S A;  4NL3 A;  2QQ9 A;  4LDX A;  1M27 C;  2P84 A;  2QEX A;  5CO7 A;  4F16 A;  5EG2 A;  2FZK B;  2FL7 A;  4XU2 A;  2P4R A;  1QWF A;  2RK1 A;  5GAN f;  3CCV A;  1WHK A;  2QQB A;  3EGD B;  4BI8 B;  1RAB B;  4BD3 A;  1M2O A;  3RKX A;  2QK0 A;  4QVC A;  1TXQ A;  3A98 A;  2K4Y A;  1XQH A;  4JJC A;  3MKD A;  1TG0 A;  1NEB A;  4N4G A;  2D1X A;  4OMP A;  4IUP A;  2XG8 D;  2WSF E;  1Y71 A;  1W70 A;  2AKK A;  4EDU A;  2RB6 A;  3OA6 A;  3FIF A;  2KT1 A;  5A0D A;  2D9T A;  3VUB A;  2QQR A;  1QVG A;  5CIU A;  2JT4 A;  3LGL A;  4EMK B;  1ZSZ A;  1GFD A;  4BUG A;  1VQ4 Q;  2O01 E;  3GNF B;  1TOV A;  2PUO B;  2DO3 A;  2E41 A;  5HK0 A;  1XTD A;  1HYO A;  2JNG A;  4FT2 A;  2DD5 A;  1WQW A;  1VQM A;  2HKQ B;  2LCL A;  4A4K A;  1VQP A;  1GL5 A;  2CP3 A;  2NUT B;  4OMF B;  3CMA A;  1JB0 E;  2G6F X;  4M7A A;  1I07 A;  4GBQ A;  1VQ8 A;  1R0B G;  3VS4 A;  4ZTJ A;  3CXC P;  2GFA A;  2YLB A;  2NUZ A;  3CQT A;  3CCQ T;  4A54 A;  1WHJ A;  4PFO A;  1PKT A;  4RTU A;  1HD3 A;  3EG1 A;  2H3J A;  1M90 R;  2D0Q B;  2PTK A;  2CT4 A;  2YSQ A;  4PNO A;  6AT1 B;  1LPL A;  4AG1 C;  3CC4 Q;  3A8O B;  4J5Y A;  2DTH A;  2FO0 A;  3HL8 A;  1N5Z A;  4OGC A;  2F2X A;  1V29 B;  4FIB A;  4E7Z A;  4DBQ A;  4E6R A;  2DBK A;  2ZPE B;  3CCM A;  2KE9 A;  4RUG A;  5D6W A;  2RM4 A;  3CME T;  3E2U A;  2PUK B;  2BZY A;  1MMN A;  1K1Z A;  3GF5 A;  3L2U A;  1VYU A;  2D8H A;  4JRQ A;  3OYH A;  5GJV B;  2HQE A;  4F14 A;  3GPL A;  2OTJ Q;  5FU7 C;  3UA7 A;  4ZN3 A;  4X1V A;  4BB7 A;  3OYA A;  2J7I A;  3FJP A;  4J9C A;  1UJ0 A;  2KDS A;  2D8J A;  3CCJ A;  2EGC A;  4QQ6 A;  1VQL Q;  4JJD A;  2F2W A;  3BW1 A;  2BUD A;  2RF0 A;  5KYW B;  3I9Q A;  3DB4 A;  3JV3 A;  3LH0 A;  5GAM d;  3AT1 B;  4Z02 A;  4DA4 A;  3VS2 A;  1M90 U;  4J8O A;  1VQO A;  3VUZ A;  5FLX E;  4BE1 A;  2KEA A;  2EYW A;  3EGD A;  1JO8 A;  4RTX A;  1CSK A;  2EJG A;  3MET A;  4J9B A;  3GOX A;  1NG2 A;  3OBW A;  7AT1 B;  2H8H A;  2KRO A;  4M7D A;  4M75 F;  3PFS A;  2MWO A;  3CXC A;  1GCQ C;  2OAU A;  2QYZ A;  2NWM A;  1KSW A;  5FWB A;  4ZGE B;  4RTV A;  1OU9 A;  2VB6 A;  5CKF A;  5EC7 A;  5KCO A;  4WTO B;  2DTO A;  3J7A F;  1G3S A;  3MP8 A;  1R77 A;  1H3H A;  1VOM A;  3OS0 A;  1WHG A;  1SG5 A;  1YHQ Q;  4JPB W;  4PKC C;  3UWN A; 
#chains in the Genus database with same CATH homology
 5KCH A;  5CVI A;  5GAO m;  3JB9 F;  1YBY A;  4PJO C;  4MML A;  2B8A A;  1BI2 A;  3DKM A;  3H6Z A;  4OP0 A;  1OYX A;  2VXE A;  5GAO n;  3QDR B;  3V7S A;  5GAM e;  2CS7 A;  1G3Y A;  5KE2 A;  3E1S A;  1YJN A;  2JOY A;  3A5Z B;  4RG8 A;  1QVG S;  3RER A;  2IG0 A;  3JCM Q;  1G3W A;  3LWI A;  1VQL A;  3RIR A;  2VV5 A;  2LTO A;  4M78 B;  5GMK l;  4P5N A;  2ZPG B;  3C95 A;  4JLI A;  1FXX A;  4C92 A;  1PSF A;  4N4I A;  5GAM h;  3G4S T;  2L89 A;  3HRT A;  3MEV A;  2E12 A;  4BE0 A;  1VQ9 T;  2RJD A;  4ME7 A;  2FB7 A;  1VUB A;  3ME9 A;  3QXE B;  3L2Q A;  2ZZD A;  1B34 B;  1Q82 U;  4ATO A;  3OYB A;  2DK3 A;  4M75 A;  3CC7 A;  3PMI A;  1N9S A;  3G71 A;  4C92 G;  3VJP A;  2DIG A;  3RES A;  2QXF A;  2RH2 A;  5GAN e;  1QVF A;  2VC8 A;  1M90 C;  2Y4X A;  3CD6 T;  3TU4 K;  4IKF A;  3WVD B;  4IUR A;  1XNI A;  1UGP B;  4IUT A;  4M75 G;  3RUX A;  3WVE B;  2Y4Y A;  1Q7Y C;  3JCM c;  1VQ7 T;  3UT1 A;  5HK3 A;  1YIJ T;  1KQS A;  2LCC A;  1G5V A;  2RHZ A;  3M9Q A;  1M8V A;  5GAN h;  1JJ2 S;  1VQ9 A;  5CK9 A;  5CKH A;  4M7A E;  4BE2 A;  1P92 A;  3EFS A;  1YJW T;  4M77 D;  4F7U F;  2EJ9 A;  3UDC A;  3A8H B;  1WGS A;  5DLQ E;  2FHD A;  2LT4 A;  5GAN 4;  2FYK A;  3I56 T;  1M1K C;  2RD1 A;  2XID A;  5AYF A;  4JRP A;  4M78 G;  2M9U A;  2K3Y A;  1W2B A;  1B34 A;  3E19 A;  3CPW A;  3CD6 A;  4MZP A;  4NOY A;  3HRS A;  1K73 C;  2QQS A;  4C8Q E;  4JRI A;  2K2V A;  2XDB A;  2VGM A;  5J3B A;  2X4X A;  4XU1 A;  5CQX A;  2XDP A;  3VKI A;  3PTA A;  1VQ7 A;  3V7C A;  3JCM h;  1YIJ A;  1JBM A;  2CZ0 B;  3SFM A;  4D6W A;  3M58 A;  3VU3 C;  5DY9 A;  5C0M A;  4E47 A;  4HT8 A;  3JCM W;  1VQN T;  2F5T X;  4JLG A;  4OB1 B;  4OB2 B;  1YJW A;  2EFI A;  2PVO B;  1QVF S;  2E65 A;  4ELZ C;  4F7U B;  3OY9 A;  1WJR A;  4N0A A;  5M9O A;  3JCM J;  3INZ A;  2CKK A;  5GMK e;  3OYI A;  3A8M B;  4KUL A;  3SWN A;  3NTI A;  4A53 A;  5CQY A;  3I56 A;  2LQ8 A;  4JS5 A;  3OW2 S;  4EMK C;  3S3M A;  1BI3 A;  3L2Z A;  2GFU A;  2R58 A;  2JTF A;  4C0F A;  1UB4 A;  4FM4 B;  4O5V A;  1OZ3 A;  4WF2 A;  3WXM B;  5LJ5 h;  3FC3 A;  5CCA A;  2R5A A;  3QII A;  3OYF A;  5GMK h;  4C92 D;  2E1H A;  5FU7 B;  3OSV A;  3RMS A;  2WSE E;  4M7A F;  2F5K A;  2QI2 A;  1D3B B;  1O9S A;  2PQW A;  3L2V A;  3VV0 A;  2L8D A;  4C0D C;  1VQN A;  3DLM A;  3CCR T;  4MDX A;  3CBO A;  4RG2 A;  2E5Q A;  2LT1 A;  5D6X A;  2X35 A;  3CPW S;  4PJO E;  3V8J A;  3TEE A;  4QVD A;  5FU6 B;  4MDW A;  3TRE A;  4DOW A;  3L1A A;  5GAN d;  3CCS A;  3EAE A;  3JAM E;  4HT9 A;  3JSC A;  3QJY A;  1SSF A;  4OB3 B;  2VGN A;  4C8Q D;  3HFN A;  4R56 A;  3ZFJ A;  4E7H A;  1LJO A;  1Y96 B;  4EMG A;  1R8O B;  2F69 A;  4IUV A;  4XU3 A;  4C5H A;  1H64 1;  4B9X A;  1KHC A;  1Q82 C;  1BYM A;  5KH6 A;  4BY6 C;  1U1T A;  2X4Y A;  2XKO C;  4M78 D;  2K57 A;  3RMQ A;  4EPC A;  2QQA A;  4M7A B;  3CCL T;  1BKB A;  2EIF A;  5GAN 5;  3NFC A;  3P8H A;  3KXT A;  2LX9 A;  5A0L A;  2R5M A;  3M54 A;  4X9D A;  3CCR A;  4GLK A;  3X24 B;  1MGQ A;  2QA4 T;  2M0O A;  1TH7 A;  5GAM j;  1O75 A;  3S6W A;  1ZHI A;  4OVA A;  3OYY A;  3L42 A;  3JCM d;  4MZT A;  5GAO q;  3PIO A;  2QDY B;  1BI1 A;  4DOV A;  5A2Q E;  3JB9 D;  3OYE A;  1X75 C;  2DXT A;  5LJ3 g;  4L6V 5;  4C8Q B;  1IZ6 A;  4F7U E;  1NZ9 A;  4XTV A;  4M7D F;  2EJF A;  5HY6 A;  3LWH A;  2X4J A;  5J26 A;  4J7I A;  1BIB A;  3BFM A;  3FRN A;  3CCL A;  2CYZ B;  1FX7 A;  3OYJ A;  5LJ5 d;  4PJO F;  3LX7 A;  3CXC S;  2CGH A;  2MI6 A;  4J6W A;  5IN1 A;  2KY9 A;  2EAY A;  3JB9 H;  2RK2 A;  4BI4 A;  2QA4 A;  1NPR A;  2EQJ A;  3DB3 A;  3P8D A;  2KVQ G;  3J81 E;  2JUF A;  2DIQ A;  5GAN j;  3OYC A;  5CR2 A;  5GAO l;  3QG1 A;  4LDW A;  2EQM A;  4L59 A;  2LC4 A;  1BIA A;  4EMH A;  4N0A C;  3BDL A;  3E9G A;  3OSS C;  2XDD A;  4M7A G;  1JRI A;  1K9M U;  3SWN C;  1VQK T;  1NPP A;  3M55 A;  4LD6 A;  4ELY C;  3MEA A;  2NLU A;  3CCE T;  3LW5 E;  1YI2 T;  3CBM A;  1EIF A;  2E70 A;  4TVR A;  4C8Q A;  3C94 A;  2O4X B;  1N8R C;  2E6N A;  4YTL A;  3MP6 A;  2M1H A;  5D6Y A;  3C4S A;  5C6S A;  1VQ5 T;  4PJO B;  1NJI U;  1VQ4 T;  4M78 A;  2RI3 A;  3G4S A;  1M1F A;  2EQU A;  4MZM A;  4N4H A;  2QEX T;  1KQ2 A;  3UPU A;  4E7K A;  3BDU A;  3OQ5 A;  3HRU A;  3HSB A;  4KUI A;  4C8Q G;  1QVP A;  2DKG A;  5GAM f;  2HQX A;  3M5A A;  4II1 A;  1K8A U;  3CCV T;  3JB9 J;  4FSX A;  3QKJ A;  3G6E T;  4M7D C;  3PGG A;  4KUD K;  4ZN1 A;  2XD0 A;  2FVU A;  3JCM e;  4KT0 E;  5GAO p;  1VQK A;  2X4W A;  5CKE A;  2RHI A;  4FU6 A;  5LL6 S;  3CCE A;  1M9S A;  3X25 B;  2RO0 A;  5GAN 2;  1YI2 A;  5GAN 3;  4M77 C;  3OS5 A;  3OMG A;  5LJ5 j;  2M16 A;  4PLL A;  4V2S A;  2RHU A;  4NL3 A;  2V8I A;  4B9W A;  1VQ5 A;  3FB9 A;  1X6O A;  2CZ6 B;  2QQ9 A;  4UC4 A;  5GMK j;  5IT9 E;  1VQ4 A;  1HXD A;  2EKO A;  3CEY A;  4LDX A;  2ZCF B;  2QEX A;  3FEO A;  5CO7 A;  4QQD A;  5EG2 A;  4JJN K;  3JB9 G;  1KG1 A;  1Q81 U;  3N5B B;  3H8Z A;  4Y91 A;  3KBG A;  2BIV A;  3URG A;  2FL7 A;  4XU2 A;  2ZPB B;  5LJ5 e;  3L2W A;  2EWN A;  2RK1 A;  3P8B B;  1I4K 1;  5GAN f;  2JVV A;  3M4G A;  3CCV A;  3S3O A;  2QQB A;  2QTX A;  3MEU A;  5GAM g;  4C0G A;  3NTK A;  3G6E A;  1UEB A;  3CCU T;  4BI8 B;  3CC2 T;  2KMT A;  4A4H A;  1KQS S;  3OMC A;  3OS1 A;  4JRK A;  4XK8 E;  4BD3 A;  4LDV A;  3RKX A;  3CC4 T;  1ZBX A;  4M7A D;  3VYH B;  4QVC A;  5LJ3 h;  2K4Y A;  1WPY A;  1XQH A;  2P0P A;  2XHC A;  2LDM A;  3HPW A;  5L8R E;  1Q86 U;  3ASK A;  3CBP A;  4N4G A;  4CI0 C;  1W2B S;  3QYG B;  4IUP A;  1Y07 A;  3JCM f;  3J80 E;  3X28 B;  2CZ1 B;  4C92 C;  2XG8 D;  3NTH A;  2WSF E;  4JS4 A;  1WQ7 A;  3CCU A;  1M4Z A;  3MHX A;  1M1G A;  2KAF A;  3CC2 A;  1Y71 A;  5GAN g;  4F7U A;  2A3L A;  2HNI A;  3HHT B;  3LLR A;  3M57 A;  2PVD B;  2DVE A;  4VUB A;  4C5E A;  2AHJ B;  4EDU A;  2RB6 A;  3OA6 A;  2HD0 A;  2ZPH B;  4M75 C;  4X9C A;  3FIF A;  4XTW A;  2LRQ A;  4NL2 A;  5J39 A;  5A0D A;  5I21 A;  5GMK i;  2A7Y A;  2D9T A;  3VUB A;  1VQM T;  3CC4 A;  2DAQ A;  2QQR A;  3SDZ A;  5LJ5 f;  1K9M C;  1VQP T;  1G3T A;  1UGR B;  1QVG A;  5CIU A;  3LGL A;  4EMK B;  3MO8 A;  4F7U G;  4HCB A;  3CMA T;  3I55 T;  2WAC A;  2OTJ T;  2G3R A;  2GF7 A;  3FLG A;  4BUG A;  1LNX A;  2O01 E;  4ZGD B;  3QHS A;  1D3B A;  2DXB A;  3GNF B;  4XTY A;  4M78 C;  1NJI C;  2I2L A;  2YHT A;  3QZ9 B;  1VQ8 T;  3QSU A;  3LYI A;  2PUO B;  2DO3 A;  2XK0 A;  3E9F A;  3JB9 I;  3F70 A;  4BDZ A;  2DJZ A;  1OI1 A;  2E41 A;  3JCM P;  4C0D B;  4XTZ A;  5HK0 A;  4R55 A;  3SB2 A;  3OYN A;  4E7I A;  1XTD A;  2JNG A;  4FT2 A;  2DD5 A;  3FDR A;  1WQW A;  3QBY A;  1K8A C;  1VQM A;  1VQL T;  2LCL A;  1KHI A;  3HFO A;  4M7D D;  2GCX A;  4A4K A;  2XU8 A;  4HCC A;  1Y96 A;  5GMK m;  1VQP A;  4E7J A;  3OB9 A;  5DM7 R;  4PJO D;  2VUB A;  2JZ2 A;  4OMF B;  3X26 B;  3I55 A;  3CMA A;  3JCM b;  1JB0 E;  2OTJ A;  3PT9 A;  4J83 A;  1KC8 U;  5DLO A;  2OTL T;  4M7A A;  3X20 B;  5KE3 A;  3C12 A;  4LDU A;  1KQ1 A;  4EMK A;  3OBY A;  5IAY A;  1KD1 U;  4M7D E;  5FRO A;  2KK4 A;  5LJ3 d;  3QUI A;  4BY6 B;  1VQ8 A;  4A4G A;  1I5L A;  5CKB A;  3DLL A;  1OZ2 A;  3OYK A;  4ZTJ A;  1ZQ1 A;  2ZPF B;  1Q81 C;  1U8R A;  1JJ2 A;  2GFA A;  1M5Q 1;  2YLB A;  2VYT A;  2E64 A;  3GNG A;  3JRZ A;  4M77 E;  4OB0 B;  2RI2 A;  1X01 A;  2VXF A;  2EYQ A;  3CCQ T;  3V8K A;  3CCM T;  2P0Q A;  3MP1 A;  4A54 A;  1KC8 C;  4RMO A;  2K5I A;  3OYM A;  4QQG A;  1VQ6 T;  2H3J A;  4JDS A;  4NS5 A;  2D0Q B;  3CPF A;  1IRE B;  4PNO A;  3Q1J A;  2GQV A;  4OGE A;  2BKD N;  2KSS A;  3M53 A;  4X34 A;  3A8O B;  4OF1 A;  1UGQ B;  4J5Y A;  2OTL A;  2DTH A;  3HP9 A;  3BY7 A;  3GLX A;  4MMK A;  5FRN A;  1S72 T;  3M59 A;  2XI9 A;  2L5Q A;  2P4T A;  3V7R A;  2DZ9 A;  1AHJ B;  3HL8 A;  2DD4 A;  3QJ6 A;  3OYD A;  4OGC A;  3M4Y A;  3R6O A;  1V29 B;  2MAM A;  1Q86 C;  4FIB A;  2IVW A;  3JCM X;  1I8F A;  2D6F A;  2ZPE B;  1WNL A;  1U1S A;  3CCQ A;  4IUU A;  3OYL A;  3CCM A;  2C06 A;  1UGS B;  5GAN 8;  3PNW C;  2RJC A;  5GAN 6;  2RHY A;  3G71 T;  1FWZ A;  1VQ6 A;  1GXI E;  5GAN 7;  3CCJ T;  5D6W A;  3OW2 A;  2RM4 A;  3CME T;  5GAO r;  2JTM A;  2PUK B;  3TCJ A;  4JUV A;  1QP3 A;  4KBM B;  2DXU A;  1W4S A;  3GF5 A;  2R57 A;  3RKW A;  4HCZ A;  4QW2 A;  4C5I A;  4DQ2 A;  3OYG A;  3L2U A;  1Y7X A;  1YHQ T;  3GIB A;  2O4X A;  3MEW A;  4JRQ A;  4C92 E;  3SWN B;  5I2S A;  5FRM A;  5LJ3 j;  1H3Z A;  3OYH A;  1S72 A;  2HQE A;  3GPL A;  4PJO A;  1BI0 A;  3QZ5 B;  4M77 F;  3QO3 A;  2P0K A;  2V8J A;  3G7Z A;  3MCA B;  1PSE A;  5FU7 C;  3JCM V;  1YJ9 T;  4ZN3 A;  2YLC A;  2JN0 A;  4BB7 A;  1VQO T;  3OYA A;  1RI0 A;  4M75 E;  4BAC A;  5CKD A;  4C5G A;  3AHU A;  4XU0 A;  2PU9 B;  2ZPI B;  3S3N A;  4QVZ A;  3FJP A;  2E10 A;  3ZEH A;  5LJ3 e;  2DZC A;  2RA2 A;  4XQ3 A;  1YIT T;  4PJO G;  2KDS A;  4A4F A;  2DEQ A;  3CCJ A;  3CME A;  5FU6 C;  2YRV A;  2MMP A;  2ZGW A;  3A8L B;  4ZGJ B;  4QQ6 A;  2HAX A;  2MWP A;  2RJE A;  3HKS A;  3BW1 A;  1YHQ A;  4M7D B;  1VIF A;  4RCB A;  2BUD A;  4O6J A;  1WJQ A;  4M78 E;  4PL6 A;  5A0G A;  2CZ7 B;  4J7F A;  4PLI A;  3M56 A;  3DB4 A;  1RL2 A;  3KUF A;  3QYH B;  4M77 B;  3LH0 A;  5GAM d;  4Z02 A;  4E7L A;  4DA4 A;  4C0Z A;  4GY5 A;  1YJ9 A;  1N8R U;  1M90 U;  2KQW A;  3CCS T;  4M7A C;  4Y28 E;  4J8O A;  4RCC A;  1QW1 A;  2K5F A;  3VUZ A;  1VQO A;  3L2R A;  4A4E A;  3PIP A;  4J6X A;  5FLX E;  2DTI A;  2MF2 A;  2PVG B;  3GP8 A;  1Q7Y U;  1KD1 C;  4BE1 A;  3CC7 T;  3QPH A;  4BDY A;  4LD9 K;  3ZBD A;  1YIT A;  4IUQ A;  4RKU E;  3RKY A;  3VYG A;  2EJG A;  3MET A;  4C92 F;  3GOX A;  2DXC A;  1YCY A;  2RI5 A;  3OBW A;  1N9R A;  2LQK A;  4C8Q C;  1I81 A;  4BI3 A;  1M1K U;  3T9N A;  2K5L A;  2XIC A;  4M75 D;  4XAX B;  4M7D A;  1VIE A;  4M75 F;  3PFS A;  5LJ3 f;  3SD4 A;  2MWO A;  4ZTF A;  1XOV A;  2K3X A;  2V8K A;  3V8L A;  5CAI A;  2EQK A;  3OS2 A;  1K73 U;  3CXC A;  3JCM g;  1DJ7 B;  2OAU A;  1NE8 A;  4M77 A;  4C8Q F;  4J6Y A;  4ZGE B;  4HKE A;  2E6Z A;  1YJN T;  4L5G A;  3EFR A;  1MHN A;  2HBP A;  4M7D G;  4XTX A;  3ER0 A;  1QP2 A;  2LVM A;  3A8G B;  4CRI A;  4HA8 A;  2DPP B;  2RJF A;  2Y90 A;  4C92 B;  4M78 F;  4Q5W A;  5CKF A;  2L3R A;  3LGF A;  4M77 G;  2LNV A;  5KCO A;  1WJS A;  2DTO A;  3PMT A;  3O8V A;  2WSC E;  4LDY A;  3J7A F;  1G3S A;  1LOJ A;  3MP8 A;  5LJ5 g;  3OS0 A;  4FT4 A;  2RHX A;  4M75 B;  1N27 A;  5HKC A;  1N6A A;  4PKC C;  5I2M A;  4XTU A;  3UWN A;  4FL6 A;  1HK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...