1Y96B

Crystal structure of the gemin6/gemin7 heterodimer from the human smn complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
AQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Gemin6-Gemin7 Heterodimer from the Survival of Motor Neurons Complex Has an Sm Protein-like Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Gem-associated protein 6
total genus 23
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11095 Gemin7 Gem-associated protein 7 (Gemin7)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y96B00
2HNIA 2DTIA 2YHTA 4M78F 4N0AC 4X9DA 4C92B 3L1AA 5GANj 5GANh 4PJOB 3VU3C 3JCMP 2VXEA 5LJ5g 3QO3A 5GANe 1BIAA 4OP0A 1D3BA 2E64A 2VXFA 4XTYA 4C92G 4EMKC 4M78D 2DKGA 3HSBA 3BW1A 1WPYA 2ZGWA 3JB9F 4M7AD 4XU3A 2E10A 5LJ3j 4M7AC 5GMKe 3FB9A 2DZCA 4A53A 4PJOF 3BDUA 4M7DG 3SWNC 1H641 2K57A 3JB9G 3SWNA 4Y91A 4J6XA 4MMLA 4M77E 5GAMf 4EMGA 4EMKA 5LJ5e 5I21A 2DTOA 4JUVA 5DY9A 5LJ3h 5LJ3g 4PJOD 1MGQA 1WQWA 5GANd 2DJZA 4V2SA 1JBMA 4C92D 3L2ZA 4M75E 4M78G 5GAN5 3JCMc 3V7CA 3EFSA 4J6WA 4WF2A 5LJ3f 5GMKm 3JCMh 2DTHA 2E1HA 3JCMb 5GMKj 2VC8A 3RKWA 2FB7A 4MMKA 1YCYA 4A54A 5GAMg 4M7DD 4M75C 5GAN3 2DXTA 4XU0A 1KQ1A 4C8QB 3RERA 1X01A 4F7UA 3V8JA 3JCMf 4C8QC 1D3BB 4XTZA 4C8QA 4NOYA 1B34B 4M77D 1HXDA 4JRKA 4C92A 3QUIA 4PJOE 2EJGA 3JCMV 4M78A 3V7SA 1Y96B 3FJPA 2RD1A 4EMHA 4C8QF 3HFOA 4F7UG 2Y90A 4QVDA 3GIBA 2I2LA 4M7AG 4NL3A 4F7UB 4M75F 4HA8A 3V8KA 4C8QE 1LJOA 4M7DE 1LNXA 4RCCA 2E65A 1I81A 3SB2A 2DEQA 2RA2A 4M78E 4M77F 5GAOn 2EJFA 5GAOm 3JB9I 4M7AE 2DZ9A 5GAOq 3JCMW 4F7UF 5GAN8 5GANf 4M75B 3JCMJ 5GAN6 4XTXA 2RM4A 4HT8A 5GAOp 5LJ5d 4M7DA 4XU2A 3QHSA 4M7AA 3HFNA 4QVCA 4XQ3A 2EJ9A 4XU1A 4M77B 2YLBA 3EFRA 2YLCA 5GAMj 4X9CA 1N9RA 4C8QD 5GAMh 1I8FA 5LJ5j 3INZA 5LJ5h 5GAN2 1TH7A 3RKXA 5GAMe 2EWNA 3FIFA 1N9SA 5LJ5f 1BIBA 3RUXA 3JCMd 4M7DC 3QSUA 4PJOA 2FYKA 1HK9A 4M77G 4XTUA 1U1TA 3AHUA 4HT9A 3BFMA 1WQ7A 4NL2A 1WNLA 3V7RA 4JLIA 5GMKh 3BY7A 5GMKi 5GAOl 3JB9H 5GAN7 5LJ3d 4C92C 4M75G 4XTVA 5LJ3e 1JRIA 4M7AF 3JCMQ 1M8VA 2DVEA 3M4GA 4C92E 4J5YA 3JB9D 1KQ2A 4PJOC 2QTXA 2RB6A 4M75A 4C8QG 5CAIA 5GAN4 1U1SA 4EMKB 3JCMe 4RCBA 2JN0A 4PJOG 3RESA 4M77C 3RKYA 5GAMd 5GAOr 1I5LA 4M7DF 1B34A 1I4K1 4M77A 3PGGA 3SWNB 4M7AB 2E41A 4N0AA 4XTWA 5GMKl 3JCMX 1Y96A 4M78B 3JCMg 2CGHA 4C92F 1LOJA 4PNOA 4M78C 3RIRA 4JRIA 5GANg 4DQ2A 1M5Q1 4M75D 3JB9J 4M7DB 3V8LA 2DXUA 4J6YA 2EAYA 4F7UE
chains in the Genus database with same CATH superfamily
3I56Q 2QQAA 3EG1A 4N0AC 3OYLA 4AFUC 2RQWA 4JS5A 4JZ4A 2LT1A 2CP6A 5CVIA 2GFUA 3DB4A 2L5QA 3CCET 2JTEA 3CC7Q 1H641 3JB9G 4XK8E 3S3NA 2RHIA 2MAMA 1YN8A 2O01E 5LJ3h 4KUDK 5LJ3g 5FW9A 1VIFA 3SEMA 1QVGP 1S72Q 3J7AF 4C92D 4M78G 3EGDA 1MHNA 2K3BA 4ZGDB 4WF2A 4IUVA 2DTHA 5KYNA 3CCUQ 4DEXA 4M75C 4BUGA 2K5IA 5GAN3 2DXTA 2KNBB 3U23A 1RI9A 2DXBA 7AT1B 3CMAQ 2Y4XA 1SF9A 3QUIA 4M78A 1RAEB 2DBKA 2LP5A 3OYNA 1O9SA 2EPDA 3V8KA 1QLYA 1NEGA 2GGRA 3O5ZA 1VA7A 3LH0A 4BE1A 4M7AE 2JOYA 3I9QA 2EYYA 2IVWA 4E47A 5KCOA 4HT8A 2A3LA 1WLPB 4M7DA 2CZ6B 1D09B 3VYGA 2K2MA 1VQ7A 4XU1A 4M7AA 2LTOA 2P0QA 1QVGA 4IKFA 1N9RA 2AHJB 5LJ5j 1VQOA 4HCCA 4FIBA 4KGVB 3QIIA 4J9FA 1Y57A 3BFMA 3JB9H 3M9QA 2DYBA 4LDWA 2DVEA 3CCVT 4OMOA 3VYHB 1VQ5A 2LC4A 1N8RC 4RCBA 3RKYA 1G2BA 1QWEA 1ZLMA 3VS2A 3VRYA 2C0IA 1Q82U 3LYIA 1M5Q1 1UGRB 3C4SA 4PJMA 3S3OA 1KD1U 1QVPA 2COWA 4F7UE 2ZPGB 2LCLA 1M1FA 2R57A 3UF4A 1VYTA 1OPLA 4EPCA 3JCMP 3GNGA 1K9MU 2LJ0A 2DYIA 5CKDA 2P0KA 2RO0A 3G71Q 4Y92A 3M0SA 4PJOF 3BDUA 1JEGA 3G6EQ 4Y91A 1VQ6T 5ECAA 4PJOD 1AD5A 1PHTA 4DBHA 1VQNQ 1PM3A 1RLQC 3M4YA 1LCKA 2DX1A 2R5MA 3O8VA 3CCRA 2CYZB 2LX7A 3GP8A 1WXUA 1NJIC 4FM4B 2GFAA 3QG1A 1B34B 2XDPA 3VS4A 1JB0E 3UA7A 4CI0C 2KQWA 2LQWA 3EH2A 4JRQA 5D6YA 4CC3A 4EIKA 4RCCA 3VS6A 1W1FA 4A63B 3EFOB 2HQHA 2EJFA 5GAOq 3KFVA 3LWHA 2AK5A 2P4RA 3CC4A 3QHSA 4CC4B 4XQ3A 4OMPA 4LNPA 1KFZA 3CCMQ 5HK3A 3OS0A 2GNCA 5GAN2 1R0CB 1WHLA 1Q86C 4D8DA 2X9HA 2CH4W 5LJ3d 3CXCP 1M3BA 4C0DB 4Z89A 4DOWA 2O4XB 2L2PA 2GCXA 2OI3A 1BB9A 2E6NA 3RMSA 1IRXA 1VQ4Q 4E7ZA 4M7AB 3G1JA 3OS5A 1VYVA 5I11A 4PNOA 4LD9K 4RTZA 3S3MA 1NYGA 4OMLA 4GLMA 3E19A 2CH4A 2HNIA 2VGMA 4M78F 4KBMB 1MNDA 2WSCE 2KBTA 1TUDA 3CC7A 2VXFA 3TSZA 2DKGA 4D8KA 3JB9F 2X51A 1Q86U 3MJXA 2LX9A 4QKUA 4PKCC 3FB9A 1WJSA 2RJCA 2Z0WA 2PVOB 4MMLA 2AKKA 3PVQA 5J3BA 1IB8A 1GFCA 3EG2A 3A8LB 4E7HA 1WQWA 3OY9A 3GBQA 2DILA 4J6WA 2BZ8A 1KHIA 1K8AC 2ZCFB 2RHUA 4N4IA 3PFSA 3TEEA 3VS5A 3G4ST 3E9FA 2KI7A 5L8RE 3HRUA 1A0NB 1AWOA 4PFOA 3DB3A 1MMNA 1VQ7T 1SHGA 2GQVA 3LH5A 2EQKA 3GLXA 2L89A 4DA4A 4FSSA 3X24B 4IUUA 3HFNA 3IQLA 2LQ8A 3L2WA 2ROTA 1UUEA 3JCMd 1GCQA 1V29B 4XTUA 2CDTA 4JLIA 1VQ6A 4X34A 4XTVA 2CP0A 3THKA 2DL7A 1M4ZA 3EH1A 5CIUA 4MDWA 4QT7A 2ZPIB 1TWBA 2HD0A 3H0IA 1SSHA 5I2SA 2CP2A 4M7DB 3OB9A 1NM7A 1GFDA 3CC2A 1FWZA 2DD4A 1PD0A 2GTOA 1KD1C 4A4EA 1IHWA 2XG8D 3VV0A 1WHJA 1BU1A 5GANe 2C0OA 3PVLA 2ZGWA 4QVZA 1AT1B 4KH0B 2E10A 4GY5A 2RQTA 1WGSA 4AFZC 4ZGEB 1LVKA 1G3TA 2PVGB 1RAHB 1FMKA 2MOXA 2DM1A 4V2SA 2YDLA 1YJNT 3VKIA 3PE0A 2K6DA 2RF0A 3J81E 1GBQA 4QQDA 5KE3A 1D1CA 5GAMg 1YJWQ 1I1JA 3A8HB 2FPEA 1X01A 3V8JA 4IIOA 3NPFA 4LDVA 5FWCA 1VQKQ 1IHVA 2GQIA 3X25B 2SRCA 1BK2A 1X2QA 1KQSP 4J7IA 4JJCA 4HXJA 1UJYA 4M7DE 2KDSA 2FG0A 2KAFA 1Z9QA 1ZSZB 3CMEQ 3CCMA 5A0DA 1KQSS 2CSQA 1YITT 2MCNA 1KC8C 1UHFA 4M77B 4UC4A 3QWXX 2G6FX 4F14A 5GAMj 3HRSA 2ZPHB 2EQJA 3CCVQ 3AHUA 1PNJA 2DMOA 2LNVA 2RMOA 3CXCS 4C92E 2A36A 4J5YA 4PJOC 3H41A 1PSFA 4M7DF 3OW2A 3NHNA 4RG8A 2G3RA 2QK0A 4C92F 2EYQA 3MEVA 3URGA 2YWWA 4FYYB 1VUBA 5CQYA 2E70A 2J6KA 1RI0A 1OOTA 2CS7A 2W10A 2COZA 3NGPA 3QO3A 2VB6A 5I2MA 3ZBDA 1D3BA 3SHWA 1CKBA 4HVWA 3BW1A 2V8JA 2QYZA 2E5KA 2IIMA 2ZZDA 2DBMA 4JJDA 1SRLA 2AKLA 1GCPA 2GBQA 3OYYA 4PFZA 2HKNA 2KT8A 3PMTA 5GANd 3QKJA 5IXFA 2D8HA 1VQNT 2OTLA 2CT4A 5GMKj 1IO6A 2FB7A 2E3HA 2K9GA 3QJYA 4C0DC 3OYCA 2A08A 2MI6A 3OYEA 2HL3A 1D1AA 3WXMB 1VQLQ 1VQKT 1YIJT 2EJGA 1ZQ1A 4Z02A 4BDYA 2EW3A 3C0CA 4RTUA 3I5SA 2FRYA 5IN1A 2X4WA 3SB2A 5HCKA 3CC2T 1QVFS 1W70A 3G6EA 1ZBJA 4M77F 1YJWA 1OX8A 1M2VA 4F7UF 4FW1A 3CCEQ 1WDXA 2V26A 5IHKA 2EJ9A 2QG9B 1VQNA 2FEIA 1P92A 1OX9A 3OYHA 3RDVA 4KGZB 1WQ7A 3UPUA 4C92C 1WHHA 2QA4A 3HP9A 1ZUYA 2BIVA 1Q95G 2HBWA 3R6NA 1KIKA 3EG3A 2DRKA 2QXFA 1YJ9A 1VQMA 4L59A 1FYNA 4JRIA 3JB9J 3PTAA 4RUGA 3I5RA 2DTIA 2K5FA 4X9DA 4R55A 5DLQE 1NPPA 3VU3C 5LJ5g 3M57A 4FCYA 2KXCA 3OBWA 2KRSA 2YUOA 4N4GA 3GOXA 2RPNA 1ZBXA 2Y4YA 3WVDB 3G7ZA 1TG0A 3VS7A 1D0XA 4A4GA 3MEAA 3SFMA 4HVVA 5KYWA 5GAMf 1S72A 1ZSZA 3OMGA 2QQSA 1MGQA 1SEMA 4BACA 1X27A 3CBOA 4R0KA 5GMKm 2E1HA 3C12A 3RKWA 8ATCB 1YCYA 2E3IA 1AWWA 2DL4A 3KXTA 4Z8AA 3VS0A 2KVQG 3VJPA 2CP5A 4L6V5 1WHGA 4F7UB 4C8QE 1XQHA 3M53A 1BCOA 1AWJA 1IZ6A 3ULRB 5KYWB 1K0SA 2IG0A 1HSQA 2YUPA 4PK4A 1W2BS 5FRNA 3RKXA 2QQ9A 2EWNA 2ABLA 2L3SA 1HK9A 5HY6A 1Q7YU 4OMNA 3NTKA 3CC2Q 3NTIA 2A28A 1YWPA 2ZAEA 4O6JA 3JCMQ 1RAGB 1WJRA 1NLPC 1U1SA 1J3TA 1UJ0A 4B9XA 1YITQ 2L0AA 3G71T 1BBZA 3SWNB 3OW2P 5KCHA 2NUPA 3UDCA 1ABOA 3OYBA 4IUPA 4Z88A 3QZ5B 4ORZA 4C0GA 3QDRB 1UHCA 2HAXA 2JT4A 5HK0A 2HSEB 2XI9A 1PC0A 3OW2S 2QA4Q 2IPOB 2O2OA 3RBBB 3VS1A 5FRMA 4P5NA 1B3QA 3HSBA 4EMKC 3UATA 3TREA 2LCCA 1QCNA 4BD3A 1NJIU 1VQMQ 1YJ9Q 2CP3A 2VYTA 2DRMA 4J9DA 1OULA 3CPWP 4AG1C 4ME7A 5CKHA 4KGXB 1TUCA 1AEYA 4HVUA 4XAXB 1UTIA 4BI8B 3M54A 1IXDA 1ZX6A 2KRNA 3DLLA 5IHNA 5EG2A 4NOYA 4M77D 1K9MC 2V1QA 4PJJA 1Y96B 1GRIA 5CK9A 5CKFA 2VASA 2X3WD 1LNXA 1VQPA 2CZ7B 2RA2A 1WZOA 5J26A 1MMDA 1QMCA 4DBQA 5GAOm 1YBYA 2QEXA 4XTXA 4ZN3A 3OA6A 5KYXB 2EKHA 3EFRA 2HDAA 1Q81C 3CMAT 4A4FA 2AIRB 3EG9B 3MHXA 1VQ5T 1I07A 3M0UA 4NL2A 1VQ5Q 2PTKA 4J9IA 3CCSQ 4RTWA 1G3YA 4II1A 1HD3A 1ABQA 1E6GA 3M4GA 2XHCA 2RB6A 5FU7B 2JM9A 5GJWB 3C95A 1I5LA 3D7SB 4M77A 3A5ZB 1GBRA 5CCAA 1KHCA 2JZ2A 2FVUA 1IGQA 1PKTA 4AT1B 2XDBA 4RTXA 2QAZA 4PL6A 3M0PA 1XTDA 3HKSA 1BKBA 3DKMA 4PJNA 1EX4A 2F2VA 2QI2A 2QQBA 2JS0A 2CREA 1AZEA 2K3XA 3S6WA 4N4HA 2FZCB 3AT1B 4M7DG 2VUBA 3ZL7C 3CD6T 1FXXA 3SWNA 1UGPB 4FYXB 5CO7A 3MP8A 2RQUA 1BCMA 2DJZA 1JBMA 2P4TA 3JCMc 2NUZA 1YWOA 1TOVA 3OYAA 1JQQA 1ACMB 3UWNA 3HPWA 4C8QA 2OTJT 4JRKA 4QQGA 1TU0B 2MIOA 3A8MB 3PIOA 1VQ4A 1F1BB 4KUIA 2X4XA 3OSVA 2L3QA 2CUDA 5A2QE 2BE9B 2RJFA 2DEQA 2RQRA 4M78E 1PCXA 2M0YA 1O75A 2RI5A 4BI4A 5GAN8 1KSWA 2P84A 1YNZA 4TVRA 1H3HA 2CT3A 4HCZA 1R77A 2O88A 2JNGA 3MP1A 2OAUA 2OTLT 2LZ6B 5GJVB 1U5SA 5LJ5f 1OEBA 3PNWC 4HT9A 4LN2A 2DEUA 5GMKi 1UFFA 3CMAA 2DPPB 4KH1B 2DNUA 1X75C 1KQ2A 2WACA 4IIMA 3META 4A4KA 2EBPA 5FU7C 3JCMe 2D1XA 1U8RA 5GAOr 4RTTA 4OMQA 2D0QB 2CSIA 4N0AA 1Y96A 4J8OA 1XOVA 2CZ0B 1PD1A 2A37A 3OMCA 4PFPA 1ZSGA 5AT1B 3X20B 1JXMA 2EGAA 1QP2A 4OMMA 3CCLA 4E7IA 2JM8A 2RI2A 4OP0A 3LX7A 3BDLA 1YP5A 4M7AD 4XU3A 1M3CA 1W2BA 5GMKe 2DZCA 4BE2A 2MWOA 1T3SA 2LQNA 2DETA 4OB1B 3NMZC 1G3SA 2PUOB 1B7TA 1PKSA 2EVRA 4BB7A 5C6SA 4O5VA 1WJQA 4DOVA 3EHQA 3EFSA 2XK0A 1K73C 1G8XA 5A0GA 4ANJA 2CKKA 4FYVB 3ER0A 4PJOE 1EIFA 2GF7A 2RHZA 2RK2A 5FU6C 1M1KC 4NL3A 3HTRA 3FLGA 1JJ2S 1I0CA 2K5LA 1RUWA 2H3JA 3JB9I 3EGXB 1PG5B 5FWBA 5GANf 4M75B 2SEMA 3T9NA 4QVCA 1KC8R 2YLBA 5KYUA 2M16A 2NWMA 1QP3A 3OQ5A 4DBFA 1Q7YC 1BYMA 4JS4A 5I22A 4M7DC 1K4US 2GTJA 1WA7A 3H9NA 4RG2A 1Z9ZA 2HQXA 2WSEE 4M75G 5LJ3e 3JB9D 2KYMA 2MMPA 2XICA 1X6GA 2L3PA 1TUGB 2OAWA 4E7SA 3M59A 2KE9A 3CCJA 1ZA2B 3OYDA 3PGGA 5C0MA 4FSXA 3JCMX 3QZ9B 1M1GA 2QA4T 1VYUA 2LVMA 2J6FA 4HKEA 1ZUKA 5LL6S 1VQPT 1G83A 2DF6A 4IURA 2DFUA 5GANj 2X35A 2VXEA 4F16A 5IAYA 1WFWA 4GLKA 2DD5A 4XTYA 4M78D 2RNAA 1PRMC 3X28B 1WXBA 2HZYA 5A0LA 3E9GA 2DJQA 1MV3A 2B86A 1HYOA 4EMGA 2W0ZA 5LJ5e 3I55T 2F1LA 2RHXA 1AZGB 4WTOB 4E2FB 3CCRT 1AOJA 2HKQB 2J7IA 3I35A 1D3BB 4OB3B 5KYYB 2HBPA 1QCOA 3M0QA 4ZTFA 2NYSA 3N5BB 1UDLA 1BI2A 4QVDA 1U3OA 5FU6B 4M75F 1UECA 4E7KA 4LDUA 2OJ2A 3KUFA 4C0FA 1X69A 2F5KA 2DK3A 2EQUA 3ZEHA 2K7AA 1YI2T 3CC4T 5GAOp 1QVGS 3MCAB 1H8KA 3FC3A 1T0HA 2D8JA 2HCKA 3OYKA 1NBEB 9ATCB 1VOMA 1YJNA 1KJWA 3CCST 4L5GA 1K9AA 2FZGB 5CQXA 5D6WA 1WIEA 2BTTA 2ED0A 5CAIA 3CCUA 2LT4A 4KULA 1NJIR 4PJOG 4M77C 4JLGA 2ZPFB 4JPBW 2E41A 3L2RA 1VQ4T 2DIQA 3DLMA 1SHFA 2CGHA 3CMET 3CCUT 2PZ1A 4MZTA 2QEXQ 1Y7XA 4FL6A 2LJ3A 2ECZA 4RTYA 1N6AA 3CMEA 4Y28E 2QDYB 4DBRA 2YRCA 2E4HA 4PJOB 1UB4A 3R6OA 2RQVA 4JJNK 1KD1R 3EHRA 2ROLA 2YT6A 3OBYA 2J6OA 1W2BP 3PT9A 3SWNC 1WX6A 2K57A 4ZGJB 1M90U 1WI7A 4ZTJA 1Q7YR 4OMFB 3CPFA 4M75E 5KYXA 2M1HA 1IREB 3A1PA 1JU5C 1WHMA 3JCMb 2JVVA 1XNIA 1EFNA 1ZUUA 2KEAA 3CD6Q 1N27A 4XU0A 4BE0A 3H0FA 4C8QC 3LGLA 3H6ZA 1PSEA 1WHKA 2RD1A 1SSFA 1M2OA 3SD4A 1UE9A 1AHJB 2PVDB 4QQ6A 5KE2A 2B8AA 2VVKA 4CC2A 1RACB 1QWFA 2RJDA 4D6WA 2EYWA 3P8HA 1QW1A 1FMVA 4J9GA 4CC7A 3NFCA 2K4YA 2O31A 2MYSA 1U06A 3CCLT 1Q81R 3INZA 1BI3A 1MMAA 1N9SA 4A4HA 2JMAA 4LE9A 1YITA 4E7LA 3LW5E 2X4YA 5L23A 4ESRA 1VQPQ 4M7AF 1NZ9A 4E7JA 1GCQC 3CCLQ 3CXCA 2XU8A 4BDZA 2M9UA 3QYGB 4XTWA 5GMKl 4M78B 3RIRA 2J06A 1FMWA 4DQ2A 4LDXA 1RAAB 2DL8A 1YJNQ 8AT1B 1TSFA 2YHTA 4C92B 3M55A 3L1AA 2NUPB 2HMAA 4FU6A 3I56A 1OV3A 1BIAA 5EC7A 3E1SA 1X43A 2R58A 5LJ3j 2X4JA 1DJ7B 2EGEA 3CC4Q 5FLXE 1N8RU 2YUQA 1OU9A 4J6XA 1T0JA 2OX7A 1IGUA 2DTOA 3TSWA 1QCFA 1VQ9T 3CPWS 4PLLA 1MV0B 5GAN5 4HCKA 1YHQA 5LJ3f 4AMCA 4FT2A 2C06A 2OTLQ 4MZMA 3G4SA 4JRPA 1OZ3A 1KQ1A 1C6VX 1WXTA 2EQIA 3FDRA 4XTZA 5DLOA 4RTVA 1HXDA 4C92A 3P8BB 2H8HA 2KXDA 2M51A 1QVFP 3HL8A 2F2WA 3GIBA 5FROA 1TS9A 2RJEA 1M1KR 2JW4A 4HA8A 1CKAA 1I81A 6AT1B 1K73U 1M3AA 1Q82C 2JMCA 2DZ9A 3CD6A 1TXQA 3EGUA 2VV5A 1SPKA 2RK1A 3CCEA 4OB0B 2YLCA 2JS2A 1I8FA 1RABB 1TH7A 1OYXA 3FIFA 4PJOA 3KBGA 3L2QA 2FYKA 2VWFA 4IUTA 1NPRA 1VQ7Q 3HRTA 5GAN7 2YXYA 2JTMA 2DERA 1KG1A 5CKEA 1VQOQ 4M75A 1M9SA 5GAN4 4EMKB 2KK4A 1B34A 1I4K1 3GPLA 1YIJA 4AG2C 2BZYA 2HSPA 3ZFJA 4JDSA 1N5ZA 2DA9A 1LOJA 1C0MA 4M78C 5GANg 1AVZC 3TCJA 3V8LA 3TU4K 4J6YA 1K8AR 1OQKA 1M1KU 3SDZA 4EDUA 2PU9B 1M90R 1W4SA 2LNHB 2COYA 1OPKA 1ZHIA 4ZNXA 3LWIA 2MK5A 2XDDA 1H92A 4M7AC 2ESWA 5AYFA 4RMOA 1YIJQ 1R8OB 1X6BA 2DO3A 4YTLA 2KGTA 4JUVA 2EYXA 3EFOA 1YHQT 1HJDA 1M30A 3ASKA 1FX7A 3JCMh 4LXCA 1S72T 3FJ5A 3EG9A 1N8RR 1VQ9A 3L2VA 4J9EA 3RR6A 4F7UA 2HEQA 2K79A 3JSCA 1VQKA 2I0NA 2MWPA 3QDFA 4RKUE 2RH2A 4EMHA 4KRTA 2R5AA 4C8QF 2P0PA 1MMGA 3QJ6A 3BE3A 3UT1A 4FYWB 2VKNA 3CQTA 4LUEA 1VIEA 1UEBA 3H8ZA 1RLPC 3G4SQ 3JCMW 2K2VA 3CCMT 2EYZA 5LJ5d 5KYYA 2AT1B 1KC8U 2XKOC 1JO8A 4C8QD 1W6XA 3CCSA 1JXOA 2M02A 4LDYA 4KT0E 2DAQA 3FRNA 4VUBA 3RUXA 3QSUA 3MO8A 5GMKh 1PRLC 2NLUA 2M0OA 4OB2B 4C5HA 4ELZC 1LPLA 2VGNA 5GAMd 1VQ8A 2E6ZA 4DEYA 1S1NA 3QBYA 2BZXA 2ENMA 1VQLA 3L42A 2KYBA 2FZKB 3QXEB 3MKDA 1I5OB 2EIFA 3OYMA 2HL5C 2KRMA 2XIDA 2EFIA 4ATOA 2EQMA 4C5IA 4LD6A 4MDXA 3E2UA 1M8MA 1SRMA 3REAB 2XMFA 1NE8A 1OZ2A 3A98A 3M0RA 1ARKA 4AFSC 4J9BA 2O9VA 1VQ8T 1TTHB 4ELYC 4X1VA 5IT9E 4A54A 1M2VB 1ZSZC 5M9OA 2CP7A 3P8DA 3LLRA 4C8QB 2V1RA 3MP6A 1PWTA 2A0FB 3MEUA 1OI1A 4PLIA 1RADB 3FJPA 1YJWT 3HFOA 3CEYA 2J05A 4PJLA 2FL7A 5GAOn 2LRQA 4OVAA 3A8OB 2C0TA 1R0BG 3RMQA 3RNJA 3LGFA 2NUTB 2ZPBB 1VQOT 3C94A 2E12A 4J9CA 5GAMe 1YFNA 1C1AA 3OYJA 3I55A 1VQ8Q 4M77G 4WCIA 1U1TA 2JJ9A 2YRVA 3JAME 1K1ZA 2DE0X 4ZN1A 2FPFA 3BY7A 4CRIA 3M5AA 1E7OA 2A7YA 2YUNA 1QKXA 3QYHB 1VQ6Q 2KT1A 4C8QG 3OYIA 2BUDA 4C5GA 2CUBA 1RL2A 4B9WA 4K11A 2BKDN 2EAYA 1YI2A 2D6FA 2FHDA 1CSKA 1BI1A 1UGVA 1Y71A 1K9MR 1YHQQ 4F17A 1G5VA 1QKWA 2DLPA 2DXCA 2QDLA 3CC7T 2E64A 1M90C 4AFQC 4OF1A 3OSSC 2LCSA 1WPYA 1NEBA 4HCBA 4A53A 2FRWA 2MF2A 2LMJA 1Q82R 3L2UA 2O4XA 4EMKA 1SKUB 2WSFE 4OGCA 5DY9A 5I21A 2CZ1B 1E6HA 4J83A 1YCSB 2D0NA 1VQ9Q 1X6OA 1UG1A 3CBMA 3V7CA 1UGQB 3QPHA 2QASA 3HHTB 3EGDB 5IHIA 4M7DD 4JJBA 1JJ2A 3X26B 3RERA 4IUQA 3PIPA 1NYFA 1T3LA 1B07A 2FPDA 3TQ7P 2OTJA 5DM7R 3GF5A 1VQMT 1YJ9T 5CKBA 3V7SA 3CCJQ 2V8IA 2LQKA 2JXBA 1EZZB 4F7UG 2I2LA 2KROA 2QGGA 2KR3A 3VUZA 1KK7A 2L8DA 3MEWA 3CCRQ 2E65A 5CR2A 4C0ZA 1RAIB 2QEXT 5HKCA 2KSSA 3WVEB 2MPXC 4GBQA 3I55Q 1QQJA 2HQEA 4FW2A 1UGSB 2PUKB 2QGFB 4XU2A 1XJWB 3M0TA 5KYUB 3G6ET 3CBPA 4X9CA 1K73R 4JZ3A 3OS2A 3OYFA 1BIBA 3JRZA 2F2XA 5KH6A 2PNIA 4BI3A 3OYGA 1WNLA 4Q5WA 3OS1A 5GAOl 4FT4A 4MZPA 3EAEA 3Q1JA 1M8VA 2ED1A 2H3EB 1Y0MA 2QTXA 4BY6B 3TVTA 5IXBA 4F04B 1D0ZA 2JN0A 2L3RA 1MNEA 5D7UA 1RAFB 1M27C 2DIGA 2FO0A 5J39A 4M4ZA 2ATCB 3EGXA 1QVFA 2KY9A 1ZA1B 2AZVA 3F70A 1NG2A 3GNFB 2D9TA 4QW2A 1SG5A 3I56T 3ME9A 5GANh 4J7FA 2RI3A 4C92G 2RN8A 3FEOA 2NUTA 2O9SA 1V76A 1K8AU 2DL5A 3VUBA 3QWYA 1Q81U 2K3YA 2F5TX 3M58A 3JV3A 2XD0A 1Q86R 2EGCA 4LUDA 4M77E 4J9HA 1GL5A 3NTHA 3L2ZA 1MUZA 3VS3A 2VC8A 4MMKA 2DVJA 3REBB 3J80E 3JCMf 2PQWA 4OGEA 1K0XA 2QTVA 2EKOA 3M56A 3JCMV 2E5QA 1VQLT 3CCVA 2Y90A 2ZPEB 2DL3A 4M7AG 1NLOC 1LJOA 1K76A 1D1BA 2LJ1A 1H3ZA 2YRDA 4NS5A 1GXIE 4R56A 3CCQA 2F69A 3JCMJ 5GAN6 3CPWA 2RM4A 1D0YA 4E6RA 2OTJQ 5IH2A 3UA6A 1X2KA 2LDMA 1BI0A 1V1CA 5GAMh 2RHYA 5LJ5h 3PMIA 3VRZA 3MPUB 2YSQA 1JJ2P 1AWXA 1WYXA 3EG0A 3V7RA 3H0HA 1G3WA 1JRIA 5D6XA 2JTFA 3A8GB 3CCQQ 4BY6C 3RESA 3CCJT 2KMTA 3G71A 2BE7D 1YI2Q 3JCMg 2AZSA 2X3XD 2JUFA 2QQRA 1Y07A 4M75D 1KQSA 2V8KA 4C5EA 3CCQT 2DXUA 1OU8A 4B6MA
chains in the Genus database with same CATH topology
1M1KU 3SDZA 4EDUA 2PU9B 2QQAA 5CQYA 1W4SA 3X20B 4N0AC 2E70A 3OYLA 1RI0A 4JS5A 1QP2A 2CS7A 2LT1A 3CCLA 4E7IA 3QO3A 5I2MA 2RI2A 3ZBDA 5CVIA 4OP0A 3LX7A 1D3BA 3BDLA 1ZHIA 3LWIA 3BW1A 2GFUA 2XDDA 3DB4A 4M7AD 2V8JA 4XU3A 1W2BA 2L5QA 4M7AC 5GMKe 2DZCA 2ZZDA 2MWOA 4BE2A 3CCET 5AYFA 1H641 4RMOA 4XK8E 3S3NA 3JB9G 1R8OB 2RHIA 4OB1B 2MAMA 1G3SA 2DO3A 2PUOB 4YTLA 3OYYA 2O01E 4JUVA 5LJ3h 4KUDK 5LJ3g 1VIFA 3PMTA 5GANd 3QKJA 4BB7A 4C92D 3J7AF 5C6SA 4M78G 1YHQT 4O5VA 1WJQA 1VQNT 4DOVA 3ASKA 1FX7A 1MHNA 3EFSA 4ZGDB 4WF2A 2OTLA 4IUVA 2DTHA 3JCMh 5GMKj 1S72T 2FB7A 2XK0A 1K73C 4M75C 3QJYA 4BUGA 4C0DC 2K5IA 5A0GA 5GAN3 3OYCA 2MI6A 2DXTA 1VQ9A 3OYEA 3L2VA 3WXMB 4F7UA 2CKKA 2DXBA 3JSCA 1VQKA 3ER0A 1VQKT 2MWPA 1YIJT 2Y4XA 4RKUE 3QUIA 4PJOE 2EJGA 2RH2A 4M78A 1ZQ1A 4EMHA 4Z02A 1EIFA 2GF7A 2R5AA 2P0PA 4C8QF 4BDYA 3OYNA 2RHZA 1O9SA 3QJ6A 2RK2A 5FU6C 3UT1A 4NL3A 1M1KC 5IN1A 2X4WA 3V8KA 3FLGA 1JJ2S 3SB2A 3CC2T 1QVFS 1VIEA 3G6EA 2K5LA 1UEBA 4M77F 1YJWA 2H3JA 3LH0A 3H8ZA 3JB9I 4BE1A 4M7AE 4M7DG 2JOYA 3JCMW 4F7UF 2IVWA 5GANf 4M75B 2K2VA 4E47A 3CCMT 5KCOA 4HT8A 5LJ5d 2A3LA 4M7DA 2CZ6B 3VYGA 3T9NA 4QVCA 1VQ7A 2EJ9A 4XU1A 4M7AA 2YLBA 2LTOA 2M16A 1KC8U 1VQNA 2P0QA 1QVGA 2XKOC 4IKFA 1N9RA 4C8QD 1QP3A 2AHJB 3OQ5A 5LJ5j 3CCSA 4LDYA 4FIBA 1VQOA 1Q7YC 4HCCA 1BYMA 4JS4A 4KT0E 1P92A 2DAQA 3FRNA 4VUBA 3RUXA 3OYHA 3QSUA 4M7DC 3QIIA 3BFMA 3MO8A 1WQ7A 3JB9H 5GMKh 4RG2A 3UPUA 2HQXA 2WSEE 3M9QA 4M75G 4C92C 4LDWA 5LJ3e 2NLUA 2M0OA 2DVEA 4OB2B 3JB9D 2QA4A 2MMPA 3HP9A 2XICA 3CCVT 3VYHB 1VQ5A 4C5HA 2LC4A 2BIVA 1N8RC 4RCBA 3RKYA 2VGNA 3M59A 4ELZC 5GAMd 1VQ8A 3CCJA 2E6ZA 3OYDA 3PGGA 5C0MA 4FSXA 3JCMX 2QXFA 3QZ9B 1M1GA 1YJ9A 1VQMA 3QBYA 4L59A 4JRIA 3LYIA 2QA4T 1M5Q1 1UGRB 3C4SA 3L42A 3JB9J 1Q82U 1VQLA 2LVMA 3PTAA 3S3OA 1KD1U 1QVPA 4F7UE 3QXEB 4HKEA 2EIFA 3OYMA 5LL6S 2DTIA 2ZPGB 2K5FA 2XIDA 2LCLA 1VQPT 1M1FA 2EFIA 2R57A 4X9DA 4R55A 4IURA 4ATOA 5GANj 5DLQE 4EPCA 2X35A 1NPPA 3VU3C 3JCMP 2EQMA 2VXEA 3GNGA 3M57A 5LJ5g 1K9MU 3OBWA 5CKDA 5IAYA 2P0KA 2RO0A 4GLKA 2DD5A 4N4GA 4XTYA 3GOXA 4M78D 4C5IA 3X28B 4LD6A 1ZBXA 2Y4YA 4MDXA 3WVDB 3G7ZA 5A0LA 3E9GA 4PJOF 3BDUA 4Y91A 1VQ6T 4A4GA 3MEAA 3SFMA 1S72A 5GAMf 4EMGA 1NE8A 1OZ2A 5LJ5e 3I55T 3OMGA 2QQSA 4PJOD 1MGQA 4BACA 2RHXA 3M4YA 2R5MA 3O8VA 3CBOA 1VQ8T 4ELYC 3CCRA 2CYZB 5GMKm 3CCRT 2E1HA 5IT9E 3C12A 3RKWA 3GP8A 1YCYA 4A54A 5M9OA 1NJIC 3P8DA 4FM4B 2GFAA 3LLRA 4C8QB 3KXTA 3QG1A 3MP6A 1D3BB 4OB3B 1B34B 2XDPA 2HBPA 3MEUA 2KVQG 1OI1A 1JB0E 4ZTFA 4PLIA 3VJPA 3FJPA 3N5BB 1BI2A 4L6V5 1YJWT 4CI0C 2KQWA 3CEYA 3HFOA 4QVDA 4JRQA 5D6YA 5FU6B 4F7UB 4M75F 4C8QE 1XQHA 4RCCA 4E7KA 2FL7A 4LDUA 3M53A 5GAOn 3KUFA 2EJFA 4C0FA 1IZ6A 2F5KA 5GAOq 2DK3A 2LRQA 4OVAA 2EQUA 3A8OB 3ZEHA 3LWHA 3RMQA 1YI2T 3CC4T 2IG0A 5GAOp 3LGFA 1QVGS 3CC4A 3QHSA 2ZPBB 4XQ3A 3MCAB 3FC3A 5HK3A 1VQOT 3OS0A 1W2BS 5FRNA 5GAN2 3C94A 2E12A 3RKXA 5GAMe 2QQ9A 3OYKA 2EWNA 1Q86C 3OYJA 3I55A 1HK9A 4M77G 5HY6A 1U1TA 2YRVA 3JAME 4ZN1A 3BY7A 1YJNA 4CRIA 3M5AA 1Q7YU 3NTKA 5LJ3d 3NTIA 3CCST 4L5GA 2A7YA 4O6JA 3JCMQ 4C0DB 3QYHB 5CQXA 5D6WA 4DOWA 2O4XB 1WJRA 4C8QG 3OYIA 5CAIA 3CCUA 1U1SA 2GCXA 2BUDA 2LT4A 4KULA 4C5GA 4B9XA 4PJOG 4M77C 2E6NA 3RMSA 4JLGA 2ZPFB 3G71T 1RL2A 3SWNB 4M7AB 2E41A 3OS5A 3L2RA 1VQ4T 2DIQA 3DLMA 5KCHA 3UDCA 2CGHA 3CMET 4PNOA 4B9WA 4IUPA 3OYBA 3CCUT 4LD9K 2BKDN 3QZ5B 4MZTA 4C0GA 3QDRB 3S3MA 2EAYA 3E19A 1Y7XA 4FL6A 1YI2A 2HAXA 2D6FA 2FHDA 2HNIA 1BI1A 2VGMA 1N6AA 4M78F 5HK0A 1Y71A 3CMEA 4Y28E 2QDYB 2XI9A 4KBMB 3OW2S 2WSCE 1G5VA 4PJOB 1UB4A 5FRMA 4P5NA 3CC7A 2DXCA 3R6OA 3CC7T 2VXFA 2E64A 1M90C 3HSBA 4JJNK 4EMKC 2DKGA 3OSSC 4OF1A 1WPYA 3JB9F 3TREA 2LCCA 1Q86U 2LX9A 4BD3A 4HCBA 4PKCC 1NJIU 3FB9A 3OBYA 4A53A 2MF2A 3PT9A 1WJSA 3SWNC 4ZGJB 2K57A 2RJCA 3L2UA 2VYTA 2PVOB 4MMLA 1M90U 2O4XA 4ZTJA 5J3BA 4EMKA 2WSFE 4OGCA 3A8LB 5DY9A 2CZ1B 5I21A 4E7HA 1WQWA 4J83A 4ME7A 4OMFB 5CKHA 3CPFA 4M75E 3OY9A 1X6OA 3CBMA 3V7CA 2M1HA 1IREB 4J6WA 1UGQB 3QPHA 4XAXB 3JCMb 2JVVA 1XNIA 3HHTB 4M7DD 1KHIA 1JJ2A 1N27A 4BI8B 3X26B 1K8AC 4XU0A 4IUQA 4BE0A 3M54A 3RERA 2ZCFB 3PIPA 4C8QC 3LGLA 3DLLA 3H6ZA 1PSEA 2RHUA 5EG2A 4N4IA 4NOYA 2OTJA 4M77D 3PFSA 5DM7R 3GF5A 1K9MC 1VQMT 1YJ9T 3TEEA 5CKBA 3V7SA 1Y96B 2RD1A 2V8IA 5CK9A 2LQKA 5CKFA 3G4ST 3E9FA 4F7UG 1SSFA 2I2LA 5L8RE 3SD4A 3HRUA 1AHJB 3VUZA 2PVDB 4QQ6A 2L8DA 3MEWA 1LNXA 2E65A 3DB3A 5CR2A 5KE2A 1VQPA 2B8AA 2CZ7B 1VQ7T 2GQVA 2RA2A 2EQKA 3GLXA 2RJDA 5J26A 2L89A 4C0ZA 5GAOm 1YBYA 4DA4A 2QEXA 3X24B 4D6WA 3P8HA 5HKCA 2KSSA 2QEXT 3WVEB 4XTXA 1QW1A 2HQEA 4IUUA 4ZN3A 1UGSB 2PUKB 4XU2A 3OA6A 3HFNA 3G6ET 3CBPA 3NFCA 2LQ8A 2K4YA 3L2WA 3EFRA 3CCLT 4X9CA 1Q81C 3CMAT 3INZA 1BI3A 4A4FA 3OS2A 3OYFA 3JCMd 4A4HA 1N9SA 1BIBA 3JRZA 5KH6A 1V29B 3MHXA 4BI3A 1YITA 4XTUA 4E7LA 3OYGA 1VQ5T 3LW5E 4NL2A 2X4YA 1WNLA 4Q5WA 4JLIA 3OS1A 5GAOl 4FT4A 1G3YA 4II1A 4MZPA 3EAEA 4X34A 4XTVA 1VQ6A 3Q1JA 4M7AF 1NZ9A 1M8VA 4E7JA 1M4ZA 3M4GA 2XHCA 2QTXA 2RB6A 5FU7B 4BY6B 5CIUA 3CXCA 4MDWA 2XU8A 3C95A 2JN0A 2L3RA 1I5LA 2ZPIB 4M77A 4BDZA 3A5ZB 2M9UA 2HD0A 3QYGB 4XTWA 5GMKl 2DIGA 5CCAA 4M78B 3RIRA 4DQ2A 5J39A 5I2SA 4LDXA 1KHCA 2JZ2A 4M7DB 1QVFA 2FVUA 2KY9A 3OB9A 3CC2A 2YHTA 3F70A 1FWZA 4C92B 2XDBA 2DD4A 3GNFB 2D9TA 3L1AA 3M55A 4PL6A 4FU6A 4QW2A 3ME9A 1XTDA 4A4EA 3I56T 3I56A 5GANh 1KD1C 2XG8D 3HKSA 3VV0A 1BKBA 4J7FA 3DKMA 5GANe 1BIAA 2QI2A 3E1SA 2RI3A 2QQBA 4C92G 5GANg 3FEOA 2R58A 2ZGWA 4QVZA 2E10A 1K8AU 4GY5A 2X4JA 3VUBA 5LJ3j 2K3XA 3S6WA 4N4HA 1Q81U 1DJ7B 2K3YA 5FLXE 2VUBA 2F5TX 1WGSA 3M58A 1N8RU 2XD0A 1FXXA 3CD6T 3SWNA 4ZGEB 1UGPB 4J6XA 1G3TA 5CO7A 4M77E 2PVGB 2DTOA 3MP8A 1VQ9T 2DJZA 3NTHA 1JBMA 4V2SA 1YJNT 2P4TA 3L2ZA 4PLLA 3VKIA 5GAN5 3CPWS 1YHQA 3JCMc 3J81E 5LJ3f 4QQDA 4FT2A 5KE3A 2VC8A 4MMKA 5GAMg 3OYAA 2C06A 3A8HB 4MZMA 3G4SA 4JRPA 1OZ3A 1KQ1A 3UWNA 3J80E 1X01A 3V8JA 3JCMf 3FDRA 3HPWA 2PQWA 4OGEA 4XTZA 4C8QA 5DLOA 2OTJT 1HXDA 4JRKA 4QQGA 3P8BB 2EKOA 4LDVA 4C92A 3M56A 3A8MB 3JCMV 2E5QA 3PIOA 1VQ4A 3X25B 1VQLT 3CCVA 3HL8A 4KUIA 2Y90A 3GIBA 5FROA 2ZPEB 4M7AG 2RJEA 2X4XA 3OSVA 4J7IA 5A2QE 4HA8A 1LJOA 4M7DE 2KDSA 1I81A 2RJFA 1K73U 1H3ZA 2DEQA 4NS5A 1Q82C 1GXIE 2KAFA 4M78E 4R56A 2DZ9A 3CD6A 3CCQA 1O75A 2RI5A 4BI4A 5GAN8 2VV5A 3CCMA 2F69A 3JCMJ 5GAN6 3CPWA 2RM4A 4TVRA 5A0DA 4HCZA 1KQSS 1YITT 1KC8C 2JNGA 3MP1A 4M77B 2RK1A 2LDMA 4UC4A 3CCEA 4OB0B 2YLCA 1BI0A 5GAMj 2OAUA 3HRSA 5GAMh 2OTLT 1I8FA 2ZPHB 2RHYA 5LJ5h 1TH7A 2EQJA 1OYXA 3PMIA 3FIFA 4PJOA 5LJ5f 3KBGA 3L2QA 2FYKA 3PNWC 4IUTA 3AHUA 4HT9A 3V7RA 5GMKi 1NPRA 2LNVA 3HRTA 5GAN7 1G3WA 3CMAA 1JRIA 2DPPB 5D6XA 3CXCS 2JTFA 2JTMA 3A8GB 1X75C 4C92E 1KQ2A 2WACA 4J5YA 3META 5CKEA 4A4KA 4PJOC 1KG1A 4M75A 1M9SA 5GAN4 5FU7C 4BY6C 1PSFA 4EMKB 3JCMe 4M7DF 2KK4A 3RESA 3CCJT 1U8RA 2KMTA 5GAOr 3G71A 3OW2A 1B34A 1I4K1 3GPLA 1YIJA 2D0QB 4N0AA 3ZFJA 4JDSA 1Y96A 2G3RA 4RG8A 3JCMg 4C92F 1LOJA 4J8OA 4M78C 2JUFA 2QQRA 1XOVA 1Y07A 2EYQA 3MEVA 4M75D 2CZ0B 3URGA 2V8KA 1KQSA 4C5EA 3CCQT 3TCJA 2DXUA 3V8LA 3TU4K 4J6YA 3OMCA 1VUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HNI A;  2DTI A;  2YHT A;  4M78 F;  4N0A C;  4X9D A;  4C92 B;  3L1A A;  5GAN j;  5GAN h;  4PJO B;  3VU3 C;  3JCM P;  2VXE A;  5LJ5 g;  3QO3 A;  5GAN e;  1BIA A;  4OP0 A;  1D3B A;  2E64 A;  2VXF A;  4XTY A;  4C92 G;  4EMK C;  4M78 D;  2DKG A;  3HSB A;  3BW1 A;  1WPY A;  2ZGW A;  3JB9 F;  4M7A D;  4XU3 A;  2E10 A;  5LJ3 j;  4M7A C;  5GMK e;  3FB9 A;  2DZC A;  4A53 A;  4PJO F;  3BDU A;  4M7D G;  3SWN C;  1H64 1;  2K57 A;  3JB9 G;  3SWN A;  4Y91 A;  4J6X A;  4MML A;  4M77 E;  5GAM f;  4EMG A;  4EMK A;  5LJ5 e;  5I21 A;  2DTO A;  4JUV A;  5DY9 A;  5LJ3 h;  5LJ3 g;  4PJO D;  1MGQ A;  1WQW A;  5GAN d;  2DJZ A;  4V2S A;  1JBM A;  4C92 D;  3L2Z A;  4M75 E;  4M78 G;  5GAN 5;  3JCM c;  3V7C A;  3EFS A;  4J6W A;  4WF2 A;  5LJ3 f;  5GMK m;  3JCM h;  2DTH A;  2E1H A;  3JCM b;  5GMK j;  2VC8 A;  3RKW A;  2FB7 A;  4MMK A;  1YCY A;  4A54 A;  5GAM g;  4M7D D;  4M75 C;  5GAN 3;  2DXT A;  4XU0 A;  1KQ1 A;  4C8Q B;  3RER A;  1X01 A;  4F7U A;  3V8J A;  3JCM f;  4C8Q C;  1D3B B;  4XTZ A;  4C8Q A;  4NOY A;  1B34 B;  4M77 D;  1HXD A;  4JRK A;  4C92 A;  3QUI A;  4PJO E;  2EJG A;  3JCM V;  4M78 A;  3V7S A;  1Y96 B;  3FJP A;  2RD1 A;  4EMH A;  4C8Q F;  3HFO A;  4F7U G;  2Y90 A;  4QVD A;  3GIB A;  2I2L A;  4M7A G;  4NL3 A;  4F7U B;  4M75 F;  4HA8 A;  3V8K A;  4C8Q E;  1LJO A;  4M7D E;  1LNX A;  4RCC A;  2E65 A;  1I81 A;  3SB2 A;  2DEQ A;  2RA2 A;  4M78 E;  4M77 F;  5GAO n;  2EJF A;  5GAO m;  3JB9 I;  4M7A E;  2DZ9 A;  5GAO q;  3JCM W;  4F7U F;  5GAN 8;  5GAN f;  4M75 B;  3JCM J;  5GAN 6;  4XTX A;  2RM4 A;  4HT8 A;  5GAO p;  5LJ5 d;  4M7D A;  4XU2 A;  3QHS A;  4M7A A;  3HFN A;  4QVC A;  4XQ3 A;  2EJ9 A;  4XU1 A;  4M77 B;  2YLB A;  3EFR A;  2YLC A;  5GAM j;  4X9C A;  1N9R A;  4C8Q D;  5GAM h;  1I8F A;  5LJ5 j;  3INZ A;  5LJ5 h;  5GAN 2;  1TH7 A;  3RKX A;  5GAM e;  2EWN A;  3FIF A;  1N9S A;  5LJ5 f;  1BIB A;  3RUX A;  3JCM d;  4M7D C;  3QSU A;  4PJO A;  2FYK A;  1HK9 A;  4M77 G;  4XTU A;  1U1T A;  3AHU A;  4HT9 A;  3BFM A;  1WQ7 A;  4NL2 A;  1WNL A;  3V7R A;  4JLI A;  5GMK h;  3BY7 A;  5GMK i;  5GAO l;  3JB9 H;  5GAN 7;  5LJ3 d;  4C92 C;  4M75 G;  4XTV A;  5LJ3 e;  1JRI A;  4M7A F;  3JCM Q;  1M8V A;  2DVE A;  3M4G A;  4C92 E;  4J5Y A;  3JB9 D;  1KQ2 A;  4PJO C;  2QTX A;  2RB6 A;  4M75 A;  4C8Q G;  5CAI A;  5GAN 4;  1U1S A;  4EMK B;  3JCM e;  4RCB A;  2JN0 A;  4PJO G;  3RES A;  4M77 C;  3RKY A;  5GAM d;  5GAO r;  1I5L A;  4M7D F;  1B34 A;  1I4K 1;  4M77 A;  3PGG A;  3SWN B;  4M7A B;  2E41 A;  4N0A A;  4XTW A;  5GMK l;  3JCM X;  1Y96 A;  4M78 B;  3JCM g;  2CGH A;  4C92 F;  1LOJ A;  4PNO A;  4M78 C;  3RIR A;  4JRI A;  5GAN g;  4DQ2 A;  1M5Q 1;  4M75 D;  3JB9 J;  4M7D B;  3V8L A;  2DXU A;  4J6Y A;  2EAY A;  4F7U E; 
#chains in the Genus database with same CATH topology
 3I56 Q;  2QQA A;  3EG1 A;  4N0A C;  3OYL A;  4AFU C;  2RQW A;  4JS5 A;  4JZ4 A;  2LT1 A;  2CP6 A;  5CVI A;  2GFU A;  3DB4 A;  2L5Q A;  3CCE T;  2JTE A;  3CC7 Q;  1H64 1;  3JB9 G;  4XK8 E;  3S3N A;  2RHI A;  2MAM A;  1YN8 A;  2O01 E;  5LJ3 h;  4KUD K;  5LJ3 g;  5FW9 A;  1VIF A;  3SEM A;  1QVG P;  1S72 Q;  3J7A F;  4C92 D;  4M78 G;  3EGD A;  1MHN A;  2K3B A;  4ZGD B;  4WF2 A;  4IUV A;  2DTH A;  5KYN A;  3CCU Q;  4DEX A;  4M75 C;  4BUG A;  2K5I A;  5GAN 3;  2DXT A;  2KNB B;  3U23 A;  1RI9 A;  2DXB A;  7AT1 B;  3CMA Q;  2Y4X A;  1SF9 A;  3QUI A;  4M78 A;  1RAE B;  2DBK A;  2LP5 A;  3OYN A;  1O9S A;  2EPD A;  3V8K A;  1QLY A;  1NEG A;  2GGR A;  3O5Z A;  1VA7 A;  3LH0 A;  4BE1 A;  4M7A E;  2JOY A;  3I9Q A;  2EYY A;  2IVW A;  4E47 A;  5KCO A;  4HT8 A;  2A3L A;  1WLP B;  4M7D A;  2CZ6 B;  1D09 B;  3VYG A;  2K2M A;  1VQ7 A;  4XU1 A;  4M7A A;  2LTO A;  2P0Q A;  1QVG A;  4IKF A;  1N9R A;  2AHJ B;  5LJ5 j;  1VQO A;  4HCC A;  4FIB A;  4KGV B;  3QII A;  4J9F A;  1Y57 A;  3BFM A;  3JB9 H;  3M9Q A;  2DYB A;  4LDW A;  2DVE A;  3CCV T;  4OMO A;  3VYH B;  1VQ5 A;  2LC4 A;  1N8R C;  4RCB A;  3RKY A;  1G2B A;  1QWE A;  1ZLM A;  3VS2 A;  3VRY A;  2C0I A;  1Q82 U;  3LYI A;  1M5Q 1;  1UGR B;  3C4S A;  4PJM A;  3S3O A;  1KD1 U;  1QVP A;  2COW A;  4F7U E;  2ZPG B;  2LCL A;  1M1F A;  2R57 A;  3UF4 A;  1VYT A;  1OPL A;  4EPC A;  3JCM P;  3GNG A;  1K9M U;  2LJ0 A;  2DYI A;  5CKD A;  2P0K A;  2RO0 A;  3G71 Q;  4Y92 A;  3M0S A;  4PJO F;  3BDU A;  1JEG A;  3G6E Q;  4Y91 A;  1VQ6 T;  5ECA A;  4PJO D;  1AD5 A;  1PHT A;  4DBH A;  1VQN Q;  1PM3 A;  1RLQ C;  3M4Y A;  1LCK A;  2DX1 A;  2R5M A;  3O8V A;  3CCR A;  2CYZ B;  2LX7 A;  3GP8 A;  1WXU A;  1NJI C;  4FM4 B;  2GFA A;  3QG1 A;  1B34 B;  2XDP A;  3VS4 A;  1JB0 E;  3UA7 A;  4CI0 C;  2KQW A;  2LQW A;  3EH2 A;  4JRQ A;  5D6Y A;  4CC3 A;  4EIK A;  4RCC A;  3VS6 A;  1W1F A;  4A63 B;  3EFO B;  2HQH A;  2EJF A;  5GAO q;  3KFV A;  3LWH A;  2AK5 A;  2P4R A;  3CC4 A;  3QHS A;  4CC4 B;  4XQ3 A;  4OMP A;  4LNP A;  1KFZ A;  3CCM Q;  5HK3 A;  3OS0 A;  2GNC A;  5GAN 2;  1R0C B;  1WHL A;  1Q86 C;  4D8D A;  2X9H A;  2CH4 W;  5LJ3 d;  3CXC P;  1M3B A;  4C0D B;  4Z89 A;  4DOW A;  2O4X B;  2L2P A;  2GCX A;  2OI3 A;  1BB9 A;  2E6N A;  3RMS A;  1IRX A;  1VQ4 Q;  4E7Z A;  4M7A B;  3G1J A;  3OS5 A;  1VYV A;  5I11 A;  4PNO A;  4LD9 K;  4RTZ A;  3S3M A;  1NYG A;  4OML A;  4GLM A;  3E19 A;  2CH4 A;  2HNI A;  2VGM A;  4M78 F;  4KBM B;  1MND A;  2WSC E;  2KBT A;  1TUD A;  3CC7 A;  2VXF A;  3TSZ A;  2DKG A;  4D8K A;  3JB9 F;  2X51 A;  1Q86 U;  3MJX A;  2LX9 A;  4QKU A;  4PKC C;  3FB9 A;  1WJS A;  2RJC A;  2Z0W A;  2PVO B;  4MML A;  2AKK A;  3PVQ A;  5J3B A;  1IB8 A;  1GFC A;  3EG2 A;  3A8L B;  4E7H A;  1WQW A;  3OY9 A;  3GBQ A;  2DIL A;  4J6W A;  2BZ8 A;  1KHI A;  1K8A C;  2ZCF B;  2RHU A;  4N4I A;  3PFS A;  3TEE A;  3VS5 A;  3G4S T;  3E9F A;  2KI7 A;  5L8R E;  3HRU A;  1A0N B;  1AWO A;  4PFO A;  3DB3 A;  1MMN A;  1VQ7 T;  1SHG A;  2GQV A;  3LH5 A;  2EQK A;  3GLX A;  2L89 A;  4DA4 A;  4FSS A;  3X24 B;  4IUU A;  3HFN A;  3IQL A;  2LQ8 A;  3L2W A;  2ROT A;  1UUE A;  3JCM d;  1GCQ A;  1V29 B;  4XTU A;  2CDT A;  4JLI A;  1VQ6 A;  4X34 A;  4XTV A;  2CP0 A;  3THK A;  2DL7 A;  1M4Z A;  3EH1 A;  5CIU A;  4MDW A;  4QT7 A;  2ZPI B;  1TWB A;  2HD0 A;  3H0I A;  1SSH A;  5I2S A;  2CP2 A;  4M7D B;  3OB9 A;  1NM7 A;  1GFD A;  3CC2 A;  1FWZ A;  2DD4 A;  1PD0 A;  2GTO A;  1KD1 C;  4A4E A;  1IHW A;  2XG8 D;  3VV0 A;  1WHJ A;  1BU1 A;  5GAN e;  2C0O A;  3PVL A;  2ZGW A;  4QVZ A;  1AT1 B;  4KH0 B;  2E10 A;  4GY5 A;  2RQT A;  1WGS A;  4AFZ C;  4ZGE B;  1LVK A;  1G3T A;  2PVG B;  1RAH B;  1FMK A;  2MOX A;  2DM1 A;  4V2S A;  2YDL A;  1YJN T;  3VKI A;  3PE0 A;  2K6D A;  2RF0 A;  3J81 E;  1GBQ A;  4QQD A;  5KE3 A;  1D1C A;  5GAM g;  1YJW Q;  1I1J A;  3A8H B;  2FPE A;  1X01 A;  3V8J A;  4IIO A;  3NPF A;  4LDV A;  5FWC A;  1VQK Q;  1IHV A;  2GQI A;  3X25 B;  2SRC A;  1BK2 A;  1X2Q A;  1KQS P;  4J7I A;  4JJC A;  4HXJ A;  1UJY A;  4M7D E;  2KDS A;  2FG0 A;  2KAF A;  1Z9Q A;  1ZSZ B;  3CME Q;  3CCM A;  5A0D A;  1KQS S;  2CSQ A;  1YIT T;  2MCN A;  1KC8 C;  1UHF A;  4M77 B;  4UC4 A;  3QWX X;  2G6F X;  4F14 A;  5GAM j;  3HRS A;  2ZPH B;  2EQJ A;  3CCV Q;  3AHU A;  1PNJ A;  2DMO A;  2LNV A;  2RMO A;  3CXC S;  4C92 E;  2A36 A;  4J5Y A;  4PJO C;  3H41 A;  1PSF A;  4M7D F;  3OW2 A;  3NHN A;  4RG8 A;  2G3R A;  2QK0 A;  4C92 F;  2EYQ A;  3MEV A;  3URG A;  2YWW A;  4FYY B;  1VUB A;  5CQY A;  2E70 A;  2J6K A;  1RI0 A;  1OOT A;  2CS7 A;  2W10 A;  2COZ A;  3NGP A;  3QO3 A;  2VB6 A;  5I2M A;  3ZBD A;  1D3B A;  3SHW A;  1CKB A;  4HVW A;  3BW1 A;  2V8J A;  2QYZ A;  2E5K A;  2IIM A;  2ZZD A;  2DBM A;  4JJD A;  1SRL A;  2AKL A;  1GCP A;  2GBQ A;  3OYY A;  4PFZ A;  2HKN A;  2KT8 A;  3PMT A;  5GAN d;  3QKJ A;  5IXF A;  2D8H A;  1VQN T;  2OTL A;  2CT4 A;  5GMK j;  1IO6 A;  2FB7 A;  2E3H A;  2K9G A;  3QJY A;  4C0D C;  3OYC A;  2A08 A;  2MI6 A;  3OYE A;  2HL3 A;  1D1A A;  3WXM B;  1VQL Q;  1VQK T;  1YIJ T;  2EJG A;  1ZQ1 A;  4Z02 A;  4BDY A;  2EW3 A;  3C0C A;  4RTU A;  3I5S A;  2FRY A;  5IN1 A;  2X4W A;  3SB2 A;  5HCK A;  3CC2 T;  1QVF S;  1W70 A;  3G6E A;  1ZBJ A;  4M77 F;  1YJW A;  1OX8 A;  1M2V A;  4F7U F;  4FW1 A;  3CCE Q;  1WDX A;  2V26 A;  5IHK A;  2EJ9 A;  2QG9 B;  1VQN A;  2FEI A;  1P92 A;  1OX9 A;  3OYH A;  3RDV A;  4KGZ B;  1WQ7 A;  3UPU A;  4C92 C;  1WHH A;  2QA4 A;  3HP9 A;  1ZUY A;  2BIV A;  1Q95 G;  2HBW A;  3R6N A;  1KIK A;  3EG3 A;  2DRK A;  2QXF A;  1YJ9 A;  1VQM A;  4L59 A;  1FYN A;  4JRI A;  3JB9 J;  3PTA A;  4RUG A;  3I5R A;  2DTI A;  2K5F A;  4X9D A;  4R55 A;  5DLQ E;  1NPP A;  3VU3 C;  5LJ5 g;  3M57 A;  4FCY A;  2KXC A;  3OBW A;  2KRS A;  2YUO A;  4N4G A;  3GOX A;  2RPN A;  1ZBX A;  2Y4Y A;  3WVD B;  3G7Z A;  1TG0 A;  3VS7 A;  1D0X A;  4A4G A;  3MEA A;  3SFM A;  4HVV A;  5KYW A;  5GAM f;  1S72 A;  1ZSZ A;  3OMG A;  2QQS A;  1MGQ A;  1SEM A;  4BAC A;  1X27 A;  3CBO A;  4R0K A;  5GMK m;  2E1H A;  3C12 A;  3RKW A;  8ATC B;  1YCY A;  2E3I A;  1AWW A;  2DL4 A;  3KXT A;  4Z8A A;  3VS0 A;  2KVQ G;  3VJP A;  2CP5 A;  4L6V 5;  1WHG A;  4F7U B;  4C8Q E;  1XQH A;  3M53 A;  1BCO A;  1AWJ A;  1IZ6 A;  3ULR B;  5KYW B;  1K0S A;  2IG0 A;  1HSQ A;  2YUP A;  4PK4 A;  1W2B S;  5FRN A;  3RKX A;  2QQ9 A;  2EWN A;  2ABL A;  2L3S A;  1HK9 A;  5HY6 A;  1Q7Y U;  4OMN A;  3NTK A;  3CC2 Q;  3NTI A;  2A28 A;  1YWP A;  2ZAE A;  4O6J A;  3JCM Q;  1RAG B;  1WJR A;  1NLP C;  1U1S A;  1J3T A;  1UJ0 A;  4B9X A;  1YIT Q;  2L0A A;  3G71 T;  1BBZ A;  3SWN B;  3OW2 P;  5KCH A;  2NUP A;  3UDC A;  1ABO A;  3OYB A;  4IUP A;  4Z88 A;  3QZ5 B;  4ORZ A;  4C0G A;  3QDR B;  1UHC A;  2HAX A;  2JT4 A;  5HK0 A;  2HSE B;  2XI9 A;  1PC0 A;  3OW2 S;  2QA4 Q;  2IPO B;  2O2O A;  3RBB B;  3VS1 A;  5FRM A;  4P5N A;  1B3Q A;  3HSB A;  4EMK C;  3UAT A;  3TRE A;  2LCC A;  1QCN A;  4BD3 A;  1NJI U;  1VQM Q;  1YJ9 Q;  2CP3 A;  2VYT A;  2DRM A;  4J9D A;  1OUL A;  3CPW P;  4AG1 C;  4ME7 A;  5CKH A;  4KGX B;  1TUC A;  1AEY A;  4HVU A;  4XAX B;  1UTI A;  4BI8 B;  3M54 A;  1IXD A;  1ZX6 A;  2KRN A;  3DLL A;  5IHN A;  5EG2 A;  4NOY A;  4M77 D;  1K9M C;  2V1Q A;  4PJJ A;  1Y96 B;  1GRI A;  5CK9 A;  5CKF A;  2VAS A;  2X3W D;  1LNX A;  1VQP A;  2CZ7 B;  2RA2 A;  1WZO A;  5J26 A;  1MMD A;  1QMC A;  4DBQ A;  5GAO m;  1YBY A;  2QEX A;  4XTX A;  4ZN3 A;  3OA6 A;  5KYX B;  2EKH A;  3EFR A;  2HDA A;  1Q81 C;  3CMA T;  4A4F A;  2AIR B;  3EG9 B;  3MHX A;  1VQ5 T;  1I07 A;  3M0U A;  4NL2 A;  1VQ5 Q;  2PTK A;  4J9I A;  3CCS Q;  4RTW A;  1G3Y A;  4II1 A;  1HD3 A;  1ABQ A;  1E6G A;  3M4G A;  2XHC A;  2RB6 A;  5FU7 B;  2JM9 A;  5GJW B;  3C95 A;  1I5L A;  3D7S B;  4M77 A;  3A5Z B;  1GBR A;  5CCA A;  1KHC A;  2JZ2 A;  2FVU A;  1IGQ A;  1PKT A;  4AT1 B;  2XDB A;  4RTX A;  2QAZ A;  4PL6 A;  3M0P A;  1XTD A;  3HKS A;  1BKB A;  3DKM A;  4PJN A;  1EX4 A;  2F2V A;  2QI2 A;  2QQB A;  2JS0 A;  2CRE A;  1AZE A;  2K3X A;  3S6W A;  4N4H A;  2FZC B;  3AT1 B;  4M7D G;  2VUB A;  3ZL7 C;  3CD6 T;  1FXX A;  3SWN A;  1UGP B;  4FYX B;  5CO7 A;  3MP8 A;  2RQU A;  1BCM A;  2DJZ A;  1JBM A;  2P4T A;  3JCM c;  2NUZ A;  1YWO A;  1TOV A;  3OYA A;  1JQQ A;  1ACM B;  3UWN A;  3HPW A;  4C8Q A;  2OTJ T;  4JRK A;  4QQG A;  1TU0 B;  2MIO A;  3A8M B;  3PIO A;  1VQ4 A;  1F1B B;  4KUI A;  2X4X A;  3OSV A;  2L3Q A;  2CUD A;  5A2Q E;  2BE9 B;  2RJF A;  2DEQ A;  2RQR A;  4M78 E;  1PCX A;  2M0Y A;  1O75 A;  2RI5 A;  4BI4 A;  5GAN 8;  1KSW A;  2P84 A;  1YNZ A;  4TVR A;  1H3H A;  2CT3 A;  4HCZ A;  1R77 A;  2O88 A;  2JNG A;  3MP1 A;  2OAU A;  2OTL T;  2LZ6 B;  5GJV B;  1U5S A;  5LJ5 f;  1OEB A;  3PNW C;  4HT9 A;  4LN2 A;  2DEU A;  5GMK i;  1UFF A;  3CMA A;  2DPP B;  4KH1 B;  2DNU A;  1X75 C;  1KQ2 A;  2WAC A;  4IIM A;  3MET A;  4A4K A;  2EBP A;  5FU7 C;  3JCM e;  2D1X A;  1U8R A;  5GAO r;  4RTT A;  4OMQ A;  2D0Q B;  2CSI A;  4N0A A;  1Y96 A;  4J8O A;  1XOV A;  2CZ0 B;  1PD1 A;  2A37 A;  3OMC A;  4PFP A;  1ZSG A;  5AT1 B;  3X20 B;  1JXM A;  2EGA A;  1QP2 A;  4OMM A;  3CCL A;  4E7I A;  2JM8 A;  2RI2 A;  4OP0 A;  3LX7 A;  3BDL A;  1YP5 A;  4M7A D;  4XU3 A;  1M3C A;  1W2B A;  5GMK e;  2DZC A;  4BE2 A;  2MWO A;  1T3S A;  2LQN A;  2DET A;  4OB1 B;  3NMZ C;  1G3S A;  2PUO B;  1B7T A;  1PKS A;  2EVR A;  4BB7 A;  5C6S A;  4O5V A;  1WJQ A;  4DOV A;  3EHQ A;  3EFS A;  2XK0 A;  1K73 C;  1G8X A;  5A0G A;  4ANJ A;  2CKK A;  4FYV B;  3ER0 A;  4PJO E;  1EIF A;  2GF7 A;  2RHZ A;  2RK2 A;  5FU6 C;  1M1K C;  4NL3 A;  3HTR A;  3FLG A;  1JJ2 S;  1I0C A;  2K5L A;  1RUW A;  2H3J A;  3JB9 I;  3EGX B;  1PG5 B;  5FWB A;  5GAN f;  4M75 B;  2SEM A;  3T9N A;  4QVC A;  1KC8 R;  2YLB A;  5KYU A;  2M16 A;  2NWM A;  1QP3 A;  3OQ5 A;  4DBF A;  1Q7Y C;  1BYM A;  4JS4 A;  5I22 A;  4M7D C;  1K4U S;  2GTJ A;  1WA7 A;  3H9N A;  4RG2 A;  1Z9Z A;  2HQX A;  2WSE E;  4M75 G;  5LJ3 e;  3JB9 D;  2KYM A;  2MMP A;  2XIC A;  1X6G A;  2L3P A;  1TUG B;  2OAW A;  4E7S A;  3M59 A;  2KE9 A;  3CCJ A;  1ZA2 B;  3OYD A;  3PGG A;  5C0M A;  4FSX A;  3JCM X;  3QZ9 B;  1M1G A;  2QA4 T;  1VYU A;  2LVM A;  2J6F A;  4HKE A;  1ZUK A;  5LL6 S;  1VQP T;  1G83 A;  2DF6 A;  4IUR A;  2DFU A;  5GAN j;  2X35 A;  2VXE A;  4F16 A;  5IAY A;  1WFW A;  4GLK A;  2DD5 A;  4XTY A;  4M78 D;  2RNA A;  1PRM C;  3X28 B;  1WXB A;  2HZY A;  5A0L A;  3E9G A;  2DJQ A;  1MV3 A;  2B86 A;  1HYO A;  4EMG A;  2W0Z A;  5LJ5 e;  3I55 T;  2F1L A;  2RHX A;  1AZG B;  4WTO B;  4E2F B;  3CCR T;  1AOJ A;  2HKQ B;  2J7I A;  3I35 A;  1D3B B;  4OB3 B;  5KYY B;  2HBP A;  1QCO A;  3M0Q A;  4ZTF A;  2NYS A;  3N5B B;  1UDL A;  1BI2 A;  4QVD A;  1U3O A;  5FU6 B;  4M75 F;  1UEC A;  4E7K A;  4LDU A;  2OJ2 A;  3KUF A;  4C0F A;  1X69 A;  2F5K A;  2DK3 A;  2EQU A;  3ZEH A;  2K7A A;  1YI2 T;  3CC4 T;  5GAO p;  1QVG S;  3MCA B;  1H8K A;  3FC3 A;  1T0H A;  2D8J A;  2HCK A;  3OYK A;  1NBE B;  9ATC B;  1VOM A;  1YJN A;  1KJW A;  3CCS T;  4L5G A;  1K9A A;  2FZG B;  5CQX A;  5D6W A;  1WIE A;  2BTT A;  2ED0 A;  5CAI A;  3CCU A;  2LT4 A;  4KUL A;  1NJI R;  4PJO G;  4M77 C;  4JLG A;  2ZPF B;  4JPB W;  2E41 A;  3L2R A;  1VQ4 T;  2DIQ A;  3DLM A;  1SHF A;  2CGH A;  3CME T;  3CCU T;  2PZ1 A;  4MZT A;  2QEX Q;  1Y7X A;  4FL6 A;  2LJ3 A;  2ECZ A;  4RTY A;  1N6A A;  3CME A;  4Y28 E;  2QDY B;  4DBR A;  2YRC A;  2E4H A;  4PJO B;  1UB4 A;  3R6O A;  2RQV A;  4JJN K;  1KD1 R;  3EHR A;  2ROL A;  2YT6 A;  3OBY A;  2J6O A;  1W2B P;  3PT9 A;  3SWN C;  1WX6 A;  2K57 A;  4ZGJ B;  1M90 U;  1WI7 A;  4ZTJ A;  1Q7Y R;  4OMF B;  3CPF A;  4M75 E;  5KYX A;  2M1H A;  1IRE B;  3A1P A;  1JU5 C;  1WHM A;  3JCM b;  2JVV A;  1XNI A;  1EFN A;  1ZUU A;  2KEA A;  3CD6 Q;  1N27 A;  4XU0 A;  4BE0 A;  3H0F A;  4C8Q C;  3LGL A;  3H6Z A;  1PSE A;  1WHK A;  2RD1 A;  1SSF A;  1M2O A;  3SD4 A;  1UE9 A;  1AHJ B;  2PVD B;  4QQ6 A;  5KE2 A;  2B8A A;  2VVK A;  4CC2 A;  1RAC B;  1QWF A;  2RJD A;  4D6W A;  2EYW A;  3P8H A;  1QW1 A;  1FMV A;  4J9G A;  4CC7 A;  3NFC A;  2K4Y A;  2O31 A;  2MYS A;  1U06 A;  3CCL T;  1Q81 R;  3INZ A;  1BI3 A;  1MMA A;  1N9S A;  4A4H A;  2JMA A;  4LE9 A;  1YIT A;  4E7L A;  3LW5 E;  2X4Y A;  5L23 A;  4ESR A;  1VQP Q;  4M7A F;  1NZ9 A;  4E7J A;  1GCQ C;  3CCL Q;  3CXC A;  2XU8 A;  4BDZ A;  2M9U A;  3QYG B;  4XTW A;  5GMK l;  4M78 B;  3RIR A;  2J06 A;  1FMW A;  4DQ2 A;  4LDX A;  1RAA B;  2DL8 A;  1YJN Q;  8AT1 B;  1TSF A;  2YHT A;  4C92 B;  3M55 A;  3L1A A;  2NUP B;  2HMA A;  4FU6 A;  3I56 A;  1OV3 A;  1BIA A;  5EC7 A;  3E1S A;  1X43 A;  2R58 A;  5LJ3 j;  2X4J A;  1DJ7 B;  2EGE A;  3CC4 Q;  5FLX E;  1N8R U;  2YUQ A;  1OU9 A;  4J6X A;  1T0J A;  2OX7 A;  1IGU A;  2DTO A;  3TSW A;  1QCF A;  1VQ9 T;  3CPW S;  4PLL A;  1MV0 B;  5GAN 5;  4HCK A;  1YHQ A;  5LJ3 f;  4AMC A;  4FT2 A;  2C06 A;  2OTL Q;  4MZM A;  3G4S A;  4JRP A;  1OZ3 A;  1KQ1 A;  1C6V X;  1WXT A;  2EQI A;  3FDR A;  4XTZ A;  5DLO A;  4RTV A;  1HXD A;  4C92 A;  3P8B B;  2H8H A;  2KXD A;  2M51 A;  1QVF P;  3HL8 A;  2F2W A;  3GIB A;  5FRO A;  1TS9 A;  2RJE A;  1M1K R;  2JW4 A;  4HA8 A;  1CKA A;  1I81 A;  6AT1 B;  1K73 U;  1M3A A;  1Q82 C;  2JMC A;  2DZ9 A;  3CD6 A;  1TXQ A;  3EGU A;  2VV5 A;  1SPK A;  2RK1 A;  3CCE A;  4OB0 B;  2YLC A;  2JS2 A;  1I8F A;  1RAB B;  1TH7 A;  1OYX A;  3FIF A;  4PJO A;  3KBG A;  3L2Q A;  2FYK A;  2VWF A;  4IUT A;  1NPR A;  1VQ7 Q;  3HRT A;  5GAN 7;  2YXY A;  2JTM A;  2DER A;  1KG1 A;  5CKE A;  1VQO Q;  4M75 A;  1M9S A;  5GAN 4;  4EMK B;  2KK4 A;  1B34 A;  1I4K 1;  3GPL A;  1YIJ A;  4AG2 C;  2BZY A;  2HSP A;  3ZFJ A;  4JDS A;  1N5Z A;  2DA9 A;  1LOJ A;  1C0M A;  4M78 C;  5GAN g;  1AVZ C;  3TCJ A;  3V8L A;  3TU4 K;  4J6Y A;  1K8A R;  1OQK A;  1M1K U;  3SDZ A;  4EDU A;  2PU9 B;  1M90 R;  1W4S A;  2LNH B;  2COY A;  1OPK A;  1ZHI A;  4ZNX A;  3LWI A;  2MK5 A;  2XDD A;  1H92 A;  4M7A C;  2ESW A;  5AYF A;  4RMO A;  1YIJ Q;  1R8O B;  1X6B A;  2DO3 A;  4YTL A;  2KGT A;  4JUV A;  2EYX A;  3EFO A;  1YHQ T;  1HJD A;  1M30 A;  3ASK A;  1FX7 A;  3JCM h;  4LXC A;  1S72 T;  3FJ5 A;  3EG9 A;  1N8R R;  1VQ9 A;  3L2V A;  4J9E A;  3RR6 A;  4F7U A;  2HEQ A;  2K79 A;  3JSC A;  1VQK A;  2I0N A;  2MWP A;  3QDF A;  4RKU E;  2RH2 A;  4EMH A;  4KRT A;  2R5A A;  4C8Q F;  2P0P A;  1MMG A;  3QJ6 A;  3BE3 A;  3UT1 A;  4FYW B;  2VKN A;  3CQT A;  4LUE A;  1VIE A;  1UEB A;  3H8Z A;  1RLP C;  3G4S Q;  3JCM W;  2K2V A;  3CCM T;  2EYZ A;  5LJ5 d;  5KYY A;  2AT1 B;  1KC8 U;  2XKO C;  1JO8 A;  4C8Q D;  1W6X A;  3CCS A;  1JXO A;  2M02 A;  4LDY A;  4KT0 E;  2DAQ A;  3FRN A;  4VUB A;  3RUX A;  3QSU A;  3MO8 A;  5GMK h;  1PRL C;  2NLU A;  2M0O A;  4OB2 B;  4C5H A;  4ELZ C;  1LPL A;  2VGN A;  5GAM d;  1VQ8 A;  2E6Z A;  4DEY A;  1S1N A;  3QBY A;  2BZX A;  2ENM A;  1VQL A;  3L42 A;  2KYB A;  2FZK B;  3QXE B;  3MKD A;  1I5O B;  2EIF A;  3OYM A;  2HL5 C;  2KRM A;  2XID A;  2EFI A;  4ATO A;  2EQM A;  4C5I A;  4LD6 A;  4MDX A;  3E2U A;  1M8M A;  1SRM A;  3REA B;  2XMF A;  1NE8 A;  1OZ2 A;  3A98 A;  3M0R A;  1ARK A;  4AFS C;  4J9B A;  2O9V A;  1VQ8 T;  1TTH B;  4ELY C;  4X1V A;  5IT9 E;  4A54 A;  1M2V B;  1ZSZ C;  5M9O A;  2CP7 A;  3P8D A;  3LLR A;  4C8Q B;  2V1R A;  3MP6 A;  1PWT A;  2A0F B;  3MEU A;  1OI1 A;  4PLI A;  1RAD B;  3FJP A;  1YJW T;  3HFO A;  3CEY A;  2J05 A;  4PJL A;  2FL7 A;  5GAO n;  2LRQ A;  4OVA A;  3A8O B;  2C0T A;  1R0B G;  3RMQ A;  3RNJ A;  3LGF A;  2NUT B;  2ZPB B;  1VQO T;  3C94 A;  2E12 A;  4J9C A;  5GAM e;  1YFN A;  1C1A A;  3OYJ A;  3I55 A;  1VQ8 Q;  4M77 G;  4WCI A;  1U1T A;  2JJ9 A;  2YRV A;  3JAM E;  1K1Z A;  2DE0 X;  4ZN1 A;  2FPF A;  3BY7 A;  4CRI A;  3M5A A;  1E7O A;  2A7Y A;  2YUN A;  1QKX A;  3QYH B;  1VQ6 Q;  2KT1 A;  4C8Q G;  3OYI A;  2BUD A;  4C5G A;  2CUB A;  1RL2 A;  4B9W A;  4K11 A;  2BKD N;  2EAY A;  1YI2 A;  2D6F A;  2FHD A;  1CSK A;  1BI1 A;  1UGV A;  1Y71 A;  1K9M R;  1YHQ Q;  4F17 A;  1G5V A;  1QKW A;  2DLP A;  2DXC A;  2QDL A;  3CC7 T;  2E64 A;  1M90 C;  4AFQ C;  4OF1 A;  3OSS C;  2LCS A;  1WPY A;  1NEB A;  4HCB A;  4A53 A;  2FRW A;  2MF2 A;  2LMJ A;  1Q82 R;  3L2U A;  2O4X A;  4EMK A;  1SKU B;  2WSF E;  4OGC A;  5DY9 A;  5I21 A;  2CZ1 B;  1E6H A;  4J83 A;  1YCS B;  2D0N A;  1VQ9 Q;  1X6O A;  1UG1 A;  3CBM A;  3V7C A;  1UGQ B;  3QPH A;  2QAS A;  3HHT B;  3EGD B;  5IHI A;  4M7D D;  4JJB A;  1JJ2 A;  3X26 B;  3RER A;  4IUQ A;  3PIP A;  1NYF A;  1T3L A;  1B07 A;  2FPD A;  3TQ7 P;  2OTJ A;  5DM7 R;  3GF5 A;  1VQM T;  1YJ9 T;  5CKB A;  3V7S A;  3CCJ Q;  2V8I A;  2LQK A;  2JXB A;  1EZZ B;  4F7U G;  2I2L A;  2KRO A;  2QGG A;  2KR3 A;  3VUZ A;  1KK7 A;  2L8D A;  3MEW A;  3CCR Q;  2E65 A;  5CR2 A;  4C0Z A;  1RAI B;  2QEX T;  5HKC A;  2KSS A;  3WVE B;  2MPX C;  4GBQ A;  3I55 Q;  1QQJ A;  2HQE A;  4FW2 A;  1UGS B;  2PUK B;  2QGF B;  4XU2 A;  1XJW B;  3M0T A;  5KYU B;  3G6E T;  3CBP A;  4X9C A;  1K73 R;  4JZ3 A;  3OS2 A;  3OYF A;  1BIB A;  3JRZ A;  2F2X A;  5KH6 A;  2PNI A;  4BI3 A;  3OYG A;  1WNL A;  4Q5W A;  3OS1 A;  5GAO l;  4FT4 A;  4MZP A;  3EAE A;  3Q1J A;  1M8V A;  2ED1 A;  2H3E B;  1Y0M A;  2QTX A;  4BY6 B;  3TVT A;  5IXB A;  4F04 B;  1D0Z A;  2JN0 A;  2L3R A;  1MNE A;  5D7U A;  1RAF B;  1M27 C;  2DIG A;  2FO0 A;  5J39 A;  4M4Z A;  2ATC B;  3EGX A;  1QVF A;  2KY9 A;  1ZA1 B;  2AZV A;  3F70 A;  1NG2 A;  3GNF B;  2D9T A;  4QW2 A;  1SG5 A;  3I56 T;  3ME9 A;  5GAN h;  4J7F A;  2RI3 A;  4C92 G;  2RN8 A;  3FEO A;  2NUT A;  2O9S A;  1V76 A;  1K8A U;  2DL5 A;  3VUB A;  3QWY A;  1Q81 U;  2K3Y A;  2F5T X;  3M58 A;  3JV3 A;  2XD0 A;  1Q86 R;  2EGC A;  4LUD A;  4M77 E;  4J9H A;  1GL5 A;  3NTH A;  3L2Z A;  1MUZ A;  3VS3 A;  2VC8 A;  4MMK A;  2DVJ A;  3REB B;  3J80 E;  3JCM f;  2PQW A;  4OGE A;  1K0X A;  2QTV A;  2EKO A;  3M56 A;  3JCM V;  2E5Q A;  1VQL T;  3CCV A;  2Y90 A;  2ZPE B;  2DL3 A;  4M7A G;  1NLO C;  1LJO A;  1K76 A;  1D1B A;  2LJ1 A;  1H3Z A;  2YRD A;  4NS5 A;  1GXI E;  4R56 A;  3CCQ A;  2F69 A;  3JCM J;  5GAN 6;  3CPW A;  2RM4 A;  1D0Y A;  4E6R A;  2OTJ Q;  5IH2 A;  3UA6 A;  1X2K A;  2LDM A;  1BI0 A;  1V1C A;  5GAM h;  2RHY A;  5LJ5 h;  3PMI A;  3VRZ A;  3MPU B;  2YSQ A;  1JJ2 P;  1AWX A;  1WYX A;  3EG0 A;  3V7R A;  3H0H A;  1G3W A;  1JRI A;  5D6X A;  2JTF A;  3A8G B;  3CCQ Q;  4BY6 C;  3RES A;  3CCJ T;  2KMT A;  3G71 A;  2BE7 D;  1YI2 Q;  3JCM g;  2AZS A;  2X3X D;  2JUF A;  2QQR A;  1Y07 A;  4M75 D;  1KQS A;  2V8K A;  4C5E A;  3CCQ T;  2DXU A;  1OU8 A;  4B6M A; 
#chains in the Genus database with same CATH homology
 1M1K U;  3SDZ A;  4EDU A;  2PU9 B;  2QQA A;  5CQY A;  1W4S A;  3X20 B;  4N0A C;  2E70 A;  3OYL A;  1RI0 A;  4JS5 A;  1QP2 A;  2CS7 A;  2LT1 A;  3CCL A;  4E7I A;  3QO3 A;  5I2M A;  2RI2 A;  3ZBD A;  5CVI A;  4OP0 A;  3LX7 A;  1D3B A;  3BDL A;  1ZHI A;  3LWI A;  3BW1 A;  2GFU A;  2XDD A;  3DB4 A;  4M7A D;  2V8J A;  4XU3 A;  1W2B A;  2L5Q A;  4M7A C;  5GMK e;  2DZC A;  2ZZD A;  2MWO A;  4BE2 A;  3CCE T;  5AYF A;  1H64 1;  4RMO A;  4XK8 E;  3S3N A;  3JB9 G;  1R8O B;  2RHI A;  4OB1 B;  2MAM A;  1G3S A;  2DO3 A;  2PUO B;  4YTL A;  3OYY A;  2O01 E;  4JUV A;  5LJ3 h;  4KUD K;  5LJ3 g;  1VIF A;  3PMT A;  5GAN d;  3QKJ A;  4BB7 A;  4C92 D;  3J7A F;  5C6S A;  4M78 G;  1YHQ T;  4O5V A;  1WJQ A;  1VQN T;  4DOV A;  3ASK A;  1FX7 A;  1MHN A;  3EFS A;  4ZGD B;  4WF2 A;  2OTL A;  4IUV A;  2DTH A;  3JCM h;  5GMK j;  1S72 T;  2FB7 A;  2XK0 A;  1K73 C;  4M75 C;  3QJY A;  4BUG A;  4C0D C;  2K5I A;  5A0G A;  5GAN 3;  3OYC A;  2MI6 A;  2DXT A;  1VQ9 A;  3OYE A;  3L2V A;  3WXM B;  4F7U A;  2CKK A;  2DXB A;  3JSC A;  1VQK A;  3ER0 A;  1VQK T;  2MWP A;  1YIJ T;  2Y4X A;  4RKU E;  3QUI A;  4PJO E;  2EJG A;  2RH2 A;  4M78 A;  1ZQ1 A;  4EMH A;  4Z02 A;  1EIF A;  2GF7 A;  2R5A A;  2P0P A;  4C8Q F;  4BDY A;  3OYN A;  2RHZ A;  1O9S A;  3QJ6 A;  2RK2 A;  5FU6 C;  3UT1 A;  4NL3 A;  1M1K C;  5IN1 A;  2X4W A;  3V8K A;  3FLG A;  1JJ2 S;  3SB2 A;  3CC2 T;  1QVF S;  1VIE A;  3G6E A;  2K5L A;  1UEB A;  4M77 F;  1YJW A;  2H3J A;  3LH0 A;  3H8Z A;  3JB9 I;  4BE1 A;  4M7A E;  4M7D G;  2JOY A;  3JCM W;  4F7U F;  2IVW A;  5GAN f;  4M75 B;  2K2V A;  4E47 A;  3CCM T;  5KCO A;  4HT8 A;  5LJ5 d;  2A3L A;  4M7D A;  2CZ6 B;  3VYG A;  3T9N A;  4QVC A;  1VQ7 A;  2EJ9 A;  4XU1 A;  4M7A A;  2YLB A;  2LTO A;  2M16 A;  1KC8 U;  1VQN A;  2P0Q A;  1QVG A;  2XKO C;  4IKF A;  1N9R A;  4C8Q D;  1QP3 A;  2AHJ B;  3OQ5 A;  5LJ5 j;  3CCS A;  4LDY A;  4FIB A;  1VQO A;  1Q7Y C;  4HCC A;  1BYM A;  4JS4 A;  4KT0 E;  1P92 A;  2DAQ A;  3FRN A;  4VUB A;  3RUX A;  3OYH A;  3QSU A;  4M7D C;  3QII A;  3BFM A;  3MO8 A;  1WQ7 A;  3JB9 H;  5GMK h;  4RG2 A;  3UPU A;  2HQX A;  2WSE E;  3M9Q A;  4M75 G;  4C92 C;  4LDW A;  5LJ3 e;  2NLU A;  2M0O A;  2DVE A;  4OB2 B;  3JB9 D;  2QA4 A;  2MMP A;  3HP9 A;  2XIC A;  3CCV T;  3VYH B;  1VQ5 A;  4C5H A;  2LC4 A;  2BIV A;  1N8R C;  4RCB A;  3RKY A;  2VGN A;  3M59 A;  4ELZ C;  5GAM d;  1VQ8 A;  3CCJ A;  2E6Z A;  3OYD A;  3PGG A;  5C0M A;  4FSX A;  3JCM X;  2QXF A;  3QZ9 B;  1M1G A;  1YJ9 A;  1VQM A;  3QBY A;  4L59 A;  4JRI A;  3LYI A;  2QA4 T;  1M5Q 1;  1UGR B;  3C4S A;  3L42 A;  3JB9 J;  1Q82 U;  1VQL A;  2LVM A;  3PTA A;  3S3O A;  1KD1 U;  1QVP A;  4F7U E;  3QXE B;  4HKE A;  2EIF A;  3OYM A;  5LL6 S;  2DTI A;  2ZPG B;  2K5F A;  2XID A;  2LCL A;  1VQP T;  1M1F A;  2EFI A;  2R57 A;  4X9D A;  4R55 A;  4IUR A;  4ATO A;  5GAN j;  5DLQ E;  4EPC A;  2X35 A;  1NPP A;  3VU3 C;  3JCM P;  2EQM A;  2VXE A;  3GNG A;  3M57 A;  5LJ5 g;  1K9M U;  3OBW A;  5CKD A;  5IAY A;  2P0K A;  2RO0 A;  4GLK A;  2DD5 A;  4N4G A;  4XTY A;  3GOX A;  4M78 D;  4C5I A;  3X28 B;  4LD6 A;  1ZBX A;  2Y4Y A;  4MDX A;  3WVD B;  3G7Z A;  5A0L A;  3E9G A;  4PJO F;  3BDU A;  4Y91 A;  1VQ6 T;  4A4G A;  3MEA A;  3SFM A;  1S72 A;  5GAM f;  4EMG A;  1NE8 A;  1OZ2 A;  5LJ5 e;  3I55 T;  3OMG A;  2QQS A;  4PJO D;  1MGQ A;  4BAC A;  2RHX A;  3M4Y A;  2R5M A;  3O8V A;  3CBO A;  1VQ8 T;  4ELY C;  3CCR A;  2CYZ B;  5GMK m;  3CCR T;  2E1H A;  5IT9 E;  3C12 A;  3RKW A;  3GP8 A;  1YCY A;  4A54 A;  5M9O A;  1NJI C;  3P8D A;  4FM4 B;  2GFA A;  3LLR A;  4C8Q B;  3KXT A;  3QG1 A;  3MP6 A;  1D3B B;  4OB3 B;  1B34 B;  2XDP A;  2HBP A;  3MEU A;  2KVQ G;  1OI1 A;  1JB0 E;  4ZTF A;  4PLI A;  3VJP A;  3FJP A;  3N5B B;  1BI2 A;  4L6V 5;  1YJW T;  4CI0 C;  2KQW A;  3CEY A;  3HFO A;  4QVD A;  4JRQ A;  5D6Y A;  5FU6 B;  4F7U B;  4M75 F;  4C8Q E;  1XQH A;  4RCC A;  4E7K A;  2FL7 A;  4LDU A;  3M53 A;  5GAO n;  3KUF A;  2EJF A;  4C0F A;  1IZ6 A;  2F5K A;  5GAO q;  2DK3 A;  2LRQ A;  4OVA A;  2EQU A;  3A8O B;  3ZEH A;  3LWH A;  3RMQ A;  1YI2 T;  3CC4 T;  2IG0 A;  5GAO p;  3LGF A;  1QVG S;  3CC4 A;  3QHS A;  2ZPB B;  4XQ3 A;  3MCA B;  3FC3 A;  5HK3 A;  1VQO T;  3OS0 A;  1W2B S;  5FRN A;  5GAN 2;  3C94 A;  2E12 A;  3RKX A;  5GAM e;  2QQ9 A;  3OYK A;  2EWN A;  1Q86 C;  3OYJ A;  3I55 A;  1HK9 A;  4M77 G;  5HY6 A;  1U1T A;  2YRV A;  3JAM E;  4ZN1 A;  3BY7 A;  1YJN A;  4CRI A;  3M5A A;  1Q7Y U;  3NTK A;  5LJ3 d;  3NTI A;  3CCS T;  4L5G A;  2A7Y A;  4O6J A;  3JCM Q;  4C0D B;  3QYH B;  5CQX A;  5D6W A;  4DOW A;  2O4X B;  1WJR A;  4C8Q G;  3OYI A;  5CAI A;  3CCU A;  1U1S A;  2GCX A;  2BUD A;  2LT4 A;  4KUL A;  4C5G A;  4B9X A;  4PJO G;  4M77 C;  2E6N A;  3RMS A;  4JLG A;  2ZPF B;  3G71 T;  1RL2 A;  3SWN B;  4M7A B;  2E41 A;  3OS5 A;  3L2R A;  1VQ4 T;  2DIQ A;  3DLM A;  5KCH A;  3UDC A;  2CGH A;  3CME T;  4PNO A;  4B9W A;  4IUP A;  3OYB A;  3CCU T;  4LD9 K;  2BKD N;  3QZ5 B;  4MZT A;  4C0G A;  3QDR B;  3S3M A;  2EAY A;  3E19 A;  1Y7X A;  4FL6 A;  1YI2 A;  2HAX A;  2D6F A;  2FHD A;  2HNI A;  1BI1 A;  2VGM A;  1N6A A;  4M78 F;  5HK0 A;  1Y71 A;  3CME A;  4Y28 E;  2QDY B;  2XI9 A;  4KBM B;  3OW2 S;  2WSC E;  1G5V A;  4PJO B;  1UB4 A;  5FRM A;  4P5N A;  3CC7 A;  2DXC A;  3R6O A;  3CC7 T;  2VXF A;  2E64 A;  1M90 C;  3HSB A;  4JJN K;  4EMK C;  2DKG A;  3OSS C;  4OF1 A;  1WPY A;  3JB9 F;  3TRE A;  2LCC A;  1Q86 U;  2LX9 A;  4BD3 A;  4HCB A;  4PKC C;  1NJI U;  3FB9 A;  3OBY A;  4A53 A;  2MF2 A;  3PT9 A;  1WJS A;  3SWN C;  4ZGJ B;  2K57 A;  2RJC A;  3L2U A;  2VYT A;  2PVO B;  4MML A;  1M90 U;  2O4X A;  4ZTJ A;  5J3B A;  4EMK A;  2WSF E;  4OGC A;  3A8L B;  5DY9 A;  2CZ1 B;  5I21 A;  4E7H A;  1WQW A;  4J83 A;  4ME7 A;  4OMF B;  5CKH A;  3CPF A;  4M75 E;  3OY9 A;  1X6O A;  3CBM A;  3V7C A;  2M1H A;  1IRE B;  4J6W A;  1UGQ B;  3QPH A;  4XAX B;  3JCM b;  2JVV A;  1XNI A;  3HHT B;  4M7D D;  1KHI A;  1JJ2 A;  1N27 A;  4BI8 B;  3X26 B;  1K8A C;  4XU0 A;  4IUQ A;  4BE0 A;  3M54 A;  3RER A;  2ZCF B;  3PIP A;  4C8Q C;  3LGL A;  3DLL A;  3H6Z A;  1PSE A;  2RHU A;  5EG2 A;  4N4I A;  4NOY A;  2OTJ A;  4M77 D;  3PFS A;  5DM7 R;  3GF5 A;  1K9M C;  1VQM T;  1YJ9 T;  3TEE A;  5CKB A;  3V7S A;  1Y96 B;  2RD1 A;  2V8I A;  5CK9 A;  2LQK A;  5CKF A;  3G4S T;  3E9F A;  4F7U G;  1SSF A;  2I2L A;  5L8R E;  3SD4 A;  3HRU A;  1AHJ B;  3VUZ A;  2PVD B;  4QQ6 A;  2L8D A;  3MEW A;  1LNX A;  2E65 A;  3DB3 A;  5CR2 A;  5KE2 A;  1VQP A;  2B8A A;  2CZ7 B;  1VQ7 T;  2GQV A;  2RA2 A;  2EQK A;  3GLX A;  2RJD A;  5J26 A;  2L89 A;  4C0Z A;  5GAO m;  1YBY A;  4DA4 A;  2QEX A;  3X24 B;  4D6W A;  3P8H A;  5HKC A;  2KSS A;  2QEX T;  3WVE B;  4XTX A;  1QW1 A;  2HQE A;  4IUU A;  4ZN3 A;  1UGS B;  2PUK B;  4XU2 A;  3OA6 A;  3HFN A;  3G6E T;  3CBP A;  3NFC A;  2LQ8 A;  2K4Y A;  3L2W A;  3EFR A;  3CCL T;  4X9C A;  1Q81 C;  3CMA T;  3INZ A;  1BI3 A;  4A4F A;  3OS2 A;  3OYF A;  3JCM d;  4A4H A;  1N9S A;  1BIB A;  3JRZ A;  5KH6 A;  1V29 B;  3MHX A;  4BI3 A;  1YIT A;  4XTU A;  4E7L A;  3OYG A;  1VQ5 T;  3LW5 E;  4NL2 A;  2X4Y A;  1WNL A;  4Q5W A;  4JLI A;  3OS1 A;  5GAO l;  4FT4 A;  1G3Y A;  4II1 A;  4MZP A;  3EAE A;  4X34 A;  4XTV A;  1VQ6 A;  3Q1J A;  4M7A F;  1NZ9 A;  1M8V A;  4E7J A;  1M4Z A;  3M4G A;  2XHC A;  2QTX A;  2RB6 A;  5FU7 B;  4BY6 B;  5CIU A;  3CXC A;  4MDW A;  2XU8 A;  3C95 A;  2JN0 A;  2L3R A;  1I5L A;  2ZPI B;  4M77 A;  4BDZ A;  3A5Z B;  2M9U A;  2HD0 A;  3QYG B;  4XTW A;  5GMK l;  2DIG A;  5CCA A;  4M78 B;  3RIR A;  4DQ2 A;  5J39 A;  5I2S A;  4LDX A;  1KHC A;  2JZ2 A;  4M7D B;  1QVF A;  2FVU A;  2KY9 A;  3OB9 A;  3CC2 A;  2YHT A;  3F70 A;  1FWZ A;  4C92 B;  2XDB A;  2DD4 A;  3GNF B;  2D9T A;  3L1A A;  3M55 A;  4PL6 A;  4FU6 A;  4QW2 A;  3ME9 A;  1XTD A;  4A4E A;  3I56 T;  3I56 A;  5GAN h;  1KD1 C;  2XG8 D;  3HKS A;  3VV0 A;  1BKB A;  4J7F A;  3DKM A;  5GAN e;  1BIA A;  2QI2 A;  3E1S A;  2RI3 A;  2QQB A;  4C92 G;  5GAN g;  3FEO A;  2R58 A;  2ZGW A;  4QVZ A;  2E10 A;  1K8A U;  4GY5 A;  2X4J A;  3VUB A;  5LJ3 j;  2K3X A;  3S6W A;  4N4H A;  1Q81 U;  1DJ7 B;  2K3Y A;  5FLX E;  2VUB A;  2F5T X;  1WGS A;  3M58 A;  1N8R U;  2XD0 A;  1FXX A;  3CD6 T;  3SWN A;  4ZGE B;  1UGP B;  4J6X A;  1G3T A;  5CO7 A;  4M77 E;  2PVG B;  2DTO A;  3MP8 A;  1VQ9 T;  2DJZ A;  3NTH A;  1JBM A;  4V2S A;  1YJN T;  2P4T A;  3L2Z A;  4PLL A;  3VKI A;  5GAN 5;  3CPW S;  1YHQ A;  3JCM c;  3J81 E;  5LJ3 f;  4QQD A;  4FT2 A;  5KE3 A;  2VC8 A;  4MMK A;  5GAM g;  3OYA A;  2C06 A;  3A8H B;  4MZM A;  3G4S A;  4JRP A;  1OZ3 A;  1KQ1 A;  3UWN A;  3J80 E;  1X01 A;  3V8J A;  3JCM f;  3FDR A;  3HPW A;  2PQW A;  4OGE A;  4XTZ A;  4C8Q A;  5DLO A;  2OTJ T;  1HXD A;  4JRK A;  4QQG A;  3P8B B;  2EKO A;  4LDV A;  4C92 A;  3M56 A;  3A8M B;  3JCM V;  2E5Q A;  3PIO A;  1VQ4 A;  3X25 B;  1VQL T;  3CCV A;  3HL8 A;  4KUI A;  2Y90 A;  3GIB A;  5FRO A;  2ZPE B;  4M7A G;  2RJE A;  2X4X A;  3OSV A;  4J7I A;  5A2Q E;  4HA8 A;  1LJO A;  4M7D E;  2KDS A;  1I81 A;  2RJF A;  1K73 U;  1H3Z A;  2DEQ A;  4NS5 A;  1Q82 C;  1GXI E;  2KAF A;  4M78 E;  4R56 A;  2DZ9 A;  3CD6 A;  3CCQ A;  1O75 A;  2RI5 A;  4BI4 A;  5GAN 8;  2VV5 A;  3CCM A;  2F69 A;  3JCM J;  5GAN 6;  3CPW A;  2RM4 A;  4TVR A;  5A0D A;  4HCZ A;  1KQS S;  1YIT T;  1KC8 C;  2JNG A;  3MP1 A;  4M77 B;  2RK1 A;  2LDM A;  4UC4 A;  3CCE A;  4OB0 B;  2YLC A;  1BI0 A;  5GAM j;  2OAU A;  3HRS A;  5GAM h;  2OTL T;  1I8F A;  2ZPH B;  2RHY A;  5LJ5 h;  1TH7 A;  2EQJ A;  1OYX A;  3PMI A;  3FIF A;  4PJO A;  5LJ5 f;  3KBG A;  3L2Q A;  2FYK A;  3PNW C;  4IUT A;  3AHU A;  4HT9 A;  3V7R A;  5GMK i;  1NPR A;  2LNV A;  3HRT A;  5GAN 7;  1G3W A;  3CMA A;  1JRI A;  2DPP B;  5D6X A;  3CXC S;  2JTF A;  2JTM A;  3A8G B;  1X75 C;  4C92 E;  1KQ2 A;  2WAC A;  4J5Y A;  3MET A;  5CKE A;  4A4K A;  4PJO C;  1KG1 A;  4M75 A;  1M9S A;  5GAN 4;  5FU7 C;  4BY6 C;  1PSF A;  4EMK B;  3JCM e;  4M7D F;  2KK4 A;  3RES A;  3CCJ T;  1U8R A;  2KMT A;  5GAO r;  3G71 A;  3OW2 A;  1B34 A;  1I4K 1;  3GPL A;  1YIJ A;  2D0Q B;  4N0A A;  3ZFJ A;  4JDS A;  1Y96 A;  2G3R A;  4RG8 A;  3JCM g;  4C92 F;  1LOJ A;  4J8O A;  4M78 C;  2JUF A;  2QQR A;  1XOV A;  1Y07 A;  2EYQ A;  3MEV A;  4M75 D;  2CZ0 B;  3URG A;  2V8K A;  1KQS A;  4C5E A;  3CCQ T;  3TCJ A;  2DXU A;  3V8L A;  3TU4 K;  4J6Y A;  3OMC A;  1VUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...