4AFZC

Human chymase - fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
VTLFVALYDYNATRWTDLSFHKGEKFQILEFGPGDWWEARSLTTGETGYIPSNYVAPVDSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afzC00
1W6XA 5IHKA 2L3SA 1VA7A 3R6NA 5GJVB 1X27A 3VRZA 2DX1A 2YUPA 4EIKA 2PNIA 2SRCA 2KYMA 1NYFA 2K2MA 1RUWA 3FJ5A 1KFZA 1E7OA 1UJ0A 2H8HA 1T0HA 1PHTA 2JM9A 4OMNA 1GCQC 1RI9A 2AZVA 1PKSA 3M0RA 2DBKA 3SEMA 1QKXA 4RTYA 4AFUC 1GCQA 4X1VA 1X2QA 5EC7A 1NEGA 1ZUKA 2FEIA 2JMCA 2FRWA 5L23A 4RTTA 3REAB 1WYXA 1BU1A 2X3XD 4JZ3A 1WX6A 2ROTA 1SSHA 2AKLA 2F2WA 3M0QA 2EGEA 4AFSC 4F14A 1TUCA 2DRMA 2LQWA 2DL7A 1K0SA 2ED0A 2DL8A 4LUDA 3VS7A 1CSKA 3ZL7C 2EPDA 1WXBA 2B86A 4Z88A 1UFFA 2EKHA 1T3LA 3VS6A 2E5KA 2ECZA 2GTJA 2CT3A 2HDAA 1OOTA 5IXFA 1UG1A 1VYVA 1AZEA 3M0PA 2FPFA 2ESWA 3IQLA 2CT4A 3KFVA 1RLQC 1M30A 2DYBA 1J3TA 2FG0A 2YSQA 1Y57A 2O88A 4F17A 2KE9A 1VYTA 3U23A 2FO0A 1UDLA 4QT7A 2K6DA 4ORZA 1H92A 1I07A 1KJWA 2ABLA 2L3QA 2LCSA 4J9BA 4KRTA 2V1QA 3EG1A 2RMOA 2KRNA 1E6HA 1X2KA 1ABOA 1ARKA 1V1CA 2J06A 1CKBA 1B3QA 2I0NA 2K3BA 1NLOC 3THKA 1SEMA 2DL3A 2FRYA 2JW4A 4OMQA 4JJCA 2AKKA 1K1ZA 4RTWA 2HBWA 1SHFA 2A36A 4OMPA 1RLPC 2D8JA 3UATA 1VYUA 1SRLA 2RQRA 4J9HA 2EVRA 3I35A 1HD3A 2L0AA 2GTOA 2KRSA 3CQTA 1T3SA 2XMFA 1PRMC 2OJ2A 4OMMA 1JXMA 2JM8A 1SRMA 3C0CA 4HVWA 4J9CA 4JZ4A 2FPEA 3PVLA 1X6BA 2DLPA 4RTXA 1UJYA 1WI7A 5I11A 1YWPA 1I0CA 3NMZC 2CREA 4J9DA 1AEYA 1UHCA 1M3AA 2YUNA 1HJDA 2GBQA 1UTIA 2KEAA 2KGTA 2F2VA 1M3CA 4Y92A 3H0IA 5I22A 2K79A 2K7AA 1H8KA 1K9AA 3H0HA 3EG3A 4CC7A 1NG2A 4F16A 1NYGA 4DEYA 1OEBA 3GBQA 1K76A 1FMKA 2KYBA 2AK5A 1WXTA 5FW9A 1AWJA 3A98A 4HXJA 4D8KA 1Z9ZA 2D8HA 2YDLA 1GBQA 1AOJA 2LJ1A 3EG2A 2RPNA 3VS1A 2IIMA 3QWYA 1YCSB 1K4US 2EYXA 2C0OA 2BZXA 2VKNA 2KXCA 1WA7A 3VS0A 2DVJA 2JMAA 2EYZA 4RTZA 2DE0X 2JT4A 2C0IA 5GJWB 4ESRA 2L3PA 2G6FX 2KXDA 2M0YA 1XOVA 1QCFA 1GBRA 2DM1A 1K0XA 2DBMA 4RTUA 1GRIA 2VWFA 3PE0A 2HEQA 2EGAA 1YN8A 2DJQA 1GL5A 2SEMA 3EG0A 1YNZA 3JV3A 3RBBB 2D1XA 1JQQA 1S1NA 1WXUA 1UUEA 4CC3A 2HCKA 1BBZA 1OPLA 5IHIA 1MUZA 2ENMA 1GFCA 1Y0MA 3TVTA 1M8MA 4AFQC 2MOXA 1WLPB 4GBQA 4WCIA 1ZX6A 3SHWA 3I5SA 1YP5A 2ROLA 2PZ1A 2J6KA 1WDXA 1SHGA 4JPBW 2CH4A 1ZLMA 2W10A 1QWFA 1B07A 4K11A 5IXBA 2YT6A 4LN2A 2JS0A 1AWWA 2V1RA 1M27C 2LMJA 3VS3A 1ZUUA 2A37A 2EGCA 1UGVA 1E6GA 2ED1A 1YWOA 1PKTA 2JXBA 4J9EA 1AD5A 1PNJA 3EGUA 4DEXA 4CC2A 1CKAA 3VRYA 2EQIA 2L2PA 1KIKA 2CH4W 2DF6A 2DL5A 2RQVA 2OAWA 2J6OA 2DNUA 5FWCA 2EYWA 1X69A 1BK2A 2DRKA 1QKWA 2EW3A 1QLYA 4OMLA 5IH2A 2A08A 2LJ3A 3NGPA 1N5ZA 3H0FA 2LJ0A 2O2OA 4JJDA 2CUDA 2DMOA 2NUZA 2LZ6B 5FWBA 2YUQA 4M4ZA 4HVVA 4AG1C 2P4RA 1HSQA 3EHRA 2VVKA 4A63B 4LUEA 1SPKA 2RQWA 1QWEA 2DL4A 1JO8A 3ULRB 2PTKA 1JXOA 1KSWA 2CDTA 1NLPC 3NHNA 3VS4A 4J9FA 1GCPA 2KBTA 4J9GA 2RQUA 4CC4B 1UHFA 2LP5A 1ZSGA 2W0ZA 2JS2A 4Z8AA 2J7IA 1A0NB 4E6RA 1M3BA 2CSIA 1G2BA 2CUBA 2D0NA 2OI3A 1PRLC 1AZGB 2J05A 1OPKA 2NWMA 1ZBJA 2O9VA 3VS2A 2KR3A 2RF0A 1X43A 2BTTA 2GNCA 1GFDA 2KNBB 1FYNA 3H41A 3M0UA 4IIOA 1H3HA 2GGRA 2RNAA 2FPDA 3M0TA 1X6GA 2EBPA 1I1JA 2RQTA 3REBB 2LX7A 4LE9A 2BZYA 4LNPA 3QWXX 1TG0A 4RTVA 3VS5A 2KT1A 3UF4A 4IIMA 1W70A 1AWXA 1NM7A 1W1FA 2KRMA 5ECAA 5HCKA 4Z89A 3TSZA 1MV3A 1PWTA 2QDLA 1EFNA 4RUGA 1U3OA 3UA6A 2A28A 2F2XA 1OV3A 1JEGA 1UECA 3I9QA 2KROA 3PVQA 3RNJA 2K9GA 4D8DA 1Z9QA 2RN8A 2C0TA 1G83A 4ZNXA 1AVZC 2CSQA 1WFWA 4HCKA 3UA7A 1ABQA 2KT8A 3O5ZA 2MIOA 1NEBA 1IO6A 2DILA 4J9IA 4OMOA 2O9SA 4HVUA 1WIEA 2BZ8A 2M51A 4AG2C 3TSWA 1MV0B 2AZSA 2LNHB 2JTEA 2X3WD 3EHQA 1AWOA 4GLMA 2EYYA 4R0KA 1U5SA 2LQNA 2YUOA 2GQIA 1T0JA 1U06A 4JJBA 1ZUYA 2J6FA 2O31A 4FSSA 2HSPA 2MCNA 4AFZC 3NPFA 3I5RA 3LH5A 5IHNA 1UE9A 1JU5C 2DA9A 1TUDA 3M0SA 1LCKA 1BB9A
chains in the Genus database with same CATH superfamily
1KK7A 3H6ZA 5GJVB 4EIKA 2KYMA 3BW1A 3CC4T 3DB3A 4KBMB 3MKDA 3OS5A 1I5OB 5CO7A 1E7OA 2I2LA 4C5IA 1K8AC 1M90C 3FEOA 3QXEB 1RI9A 2YLCA 3HPWA 3JCMf 4M7DC 3CEYA 1OX9A 2RA2A 2OTLQ 2R58A 1OU9A 4X1VA 1X2QA 2RI2A 4DBRA 2K2VA 2QAZA 2RB6A 3REAB 1BU1A 2JTMA 2FB7A 1SSHA 1Q7YR 3EFSA 3MEUA 3M0QA 3MCAB 4LD6A 4F14A 2LQWA 5KH6A 1K0SA 4KGXB 2ED0A 3MO8A 3VS7A 1CSKA 2QTVA 3TEEA 1M1FA 1WXBA 5J26A 3UWNA 3LLRA 2EKHA 4F7UF 1VIEA 3VS6A 1MGQA 2HDAA 3Q1JA 4BE1A 2E4HA 3CCVT 1AZEA 2ZPGB 2ESWA 3BDLA 2CT4A 3IQLA 1RLQC 1U1TA 2EWNA 4C8QG 4KUIA 2FG0A 2ATCB 4J8OA 4HKEA 5IAYA 2YSQA 1EIFA 1OZ2A 5LJ3g 4QT7A 3G1JA 2A7YA 3C95A 3HL8A 1B7TA 4BY6B 4A4HA 4R56A 4FIBA 1ABOA 3FB9A 3EGDB 4M77D 3CC4Q 3I55T 1B3QA 2I0NA 5KYYA 2QG9B 1NLOC 1QVPA 1SEMA 2DL3A 2FRYA 4E7KA 8AT1B 3UDCA 2AKKA 2E6NA 4OMPA 4JUVA 3QZ5B 1VYUA 1YHQT 3JCMd 1HD3A 3CMEA 2L0AA 2QXFA 2KRSA 2RHYA 3OS0A 2XMFA 4MZPA 2OJ2A 2RHXA 1JXMA 3ZBDA 5FU6C 1SRMA 1I81A 1M1GA 2FPEA 2DLPA 3L2QA 3JCMh 5KCOA 3V7CA 3NMZC 3O8VA 1VUBA 3A8OB 2HBPA 2VUBA 3QIIA 4LXCA 1G8XA 3G6EA 1HJDA 2CP7A 1UTIA 2X4JA 3OYFA 1VQPQ 2BUDA 1H8KA 1K9AA 4PJLA 2C06A 2JVVA 4CI0C 5DY9A 2KYBA 5GMKh 4IUQA 1YJ9Q 5FW9A 4C92E 3CCVQ 4JJNK 3OYDA 1Z9ZA 3G4ST 2YRVA 4JS4A 1ZSZB 1GBQA 2X4YA 2IIMA 5M9OA 1Q86R 3CCLT 2VV5A 1KG1A 1K4US 2C0OA 1Y71A 2K3XA 3JB9D 3CCMA 2DVJA 2ZAEA 2EYZA 3V7RA 2QK0A 1K9MC 4C92G 3JCMP 5GAMd 4L59A 5GJWB 3OB9A 4ESRA 2L3PA 2G6FX 3OW2A 3I55Q 5I2SA 1XOVA 2Z0WA 1WHJA 4OF1A 1GBRA 2DM1A 2V8IA 2V8JA 3HFOA 2HL3A 3GLXA 1NZ9A 2QA4T 2SEMA 3KBGA 5AT1B 5GAMh 3PIPA 1YHQQ 2LQ8A 3JV3A 3GF5A 2HCKA 1MUZA 1PG5B 1TTHB 1U1SA 3SHWA 3C4SA 2PZ1A 5C0MA 2J6KA 1U8RA 1H641 2EJFA 2XI9A 3CXCA 3PT9A 1JBMA 1Q81U 4BY6C 5GMKi 1R8OB 1QCNA 1WQ7A 3VU3C 1EZZB 1Y07A 3ER0A 4M78C 2A37A 5GAN4 4KUDK 5FRMA 2DAQA 1YI2A 5DLQE 2M9UA 4MZMA 3V7SA 1OZ3A 2X51A 2COWA 4J9EA 3OYLA 2YWWA 2V26A 2DTHA 5GMKj 1N8RU 1KHIA 1UGPB 3SWNC 4PJOB 4KGVB 3LH0A 4RKUE 4M75D 5GANg 2CH4W 2DL5A 4A4KA 3JCMV 2J6OA 3CCSA 5FWCA 3LWHA 1BK2A 5GAN8 4II1A 2PVOB 1VQ4Q 1IB8A 3OMCA 3EAEA 2DZ9A 3NGPA 1N5ZA 2LJ0A 4PFPA 4JJDA 2LZ6B 1YBYA 1YITA 2XIDA 3EHRA 4LUEA 3VYGA 2RQWA 5KYXA 1JO8A 2DTIA 3NHNA 4J9FA 1GCPA 1Q82U 2LP5A 1D1AA 2JS2A 4Z8AA 5GAMj 2J7IA 3CCRT 2KSSA 1M3BA 1G2BA 2CUBA 4PJNA 3L2VA 1MMDA 1QCOA 1WQWA 3NTIA 2CZ0B 2CZ6B 2NUPB 1ZBJA 2DK3A 4BE2A 4M7AE 4FT2A 3RR6A 2VB6A 5GAN2 4JRQA 2ZPBB 1GFDA 3CXCP 2GGRA 2EBPA 1I1JA 3S3OA 2LX7A 1N27A 2IPOB 2KVQG 2F69A 2RI5A 2DD5A 1M4ZA 2QGFB 4RTVA 1MMAA 1BKBA 2EKOA 1VQOT 1QP3A 1VQMT 3P8HA 1NJIC 5CVIA 4M7AG 4J7FA 3CC7A 5KYWA 5D6WA 4N4IA 5C6SA 1PWTA 2RO0A 2QDLA 2ZCFB 3RKXA 1HXDA 4BDYA 2JZ2A 1YFNA 2G3RA 3MP8A 3CC4A 3QDFA 1Y96B 5LJ5f 3HHTB 1UECA 1XTDA 1OX8A 2YXYA 3MEAA 3OYIA 4QVZA 2PUKB 1VQLT 3CCJT 2K5LA 3GPLA 4BACA 4HCKA 1ABQA 1IO6A 2CKKA 1YJWT 4JRIA 2DYIA 3JCMQ 4HVUA 3OYKA 1LOJA 2M51A 2QEXT 4M77C 1AWOA 2E3IA 3CCRQ 4C92D 2JOYA 1K8AU 2YUOA 4FYWB 2JN0A 1M90U 4Z02A 2HSPA 5I21A 5LJ5g 4AFZC 4WTOB 3FJPA 3CMEQ 2CGHA 5IHNA 3JCMX 4UC4A 4M75F 1TUDA 4LUDA 1LCKA 1WNLA 1QVFA 5IHKA 2P0PA 2YUPA 3S6WA 4RG8A 1K73C 1KFZA 2VYTA 1T0HA 3G6EQ 4QW2A 2X35A 1GCQC 5CKBA 4PJJA 4C8QB 1VQ7T 1M1KU 2DBKA 3SEMA 5CKFA 1QKXA 1P92A 3X24B 4RTYA 4DQ2A 3EH2A 3FLGA 1O75A 3GNFB 1WHMA 3GP8A 3QG1A 2FEIA 4HCBA 1VQNA 2P4TA 1WX6A 1TXQA 2AKLA 3DLLA 2F2WA 3CCST 2EGEA 2XD0A 2AHJB 2DL7A 1EX4A 1KC8U 2QQBA 2LNVA 3CCMQ 1N8RR 3VJPA 2EPDA 3E2UA 1UFFA 1T3LA 1WHGA 2QDYB 2PVDB 5D6XA 4OVAA 1KD1C 5FU7C 2MWOA 2FPFA 5DM7R 1S72A 4DBHA 1Y57A 3EFOB 1NPRA 3CD6T 3VUBA 1VYTA 3U23A 3E1SA 3OY9A 3A1PA 1H92A 4A4EA 1W2BA 2JNGA 2L3QA 4J9BA 3M53A 2KMTA 2V1QA 2KAFA 2RMOA 3EG1A 1QVFP 1E6HA 2P0KA 1Q82R 2J06A 4PFOA 5CKHA 3EFRA 3OYJA 4BB7A 5KYNA 3DB4A 3THKA 3G4SA 3RMSA 5KYUA 3CCLA 1DJ7B 1RLPC 3QZ9B 3HRTA 1D3BB 4ATOA 1YI2Q 2EVRA 2GQVA 1RACB 2RK1A 4XU3A 4JLIA 4KH1B 1G5VA 2OTJT 4FYXB 3CQTA 3C94A 4C5GA 1PRMC 2D6FA 3C0CA 4BDZA 4HVWA 4C92B 4RTXA 5I11A 1HK9A 1YWPA 4M75C 1MHNA 1SF9A 1ZA1B 2EFIA 5GAOq 2QA4A 4J9DA 3CCSQ 3KXTA 3PIOA 3PFSA 4RMOA 3QKJA 1Q7YC 3OMGA 1OU8A 2BIVA 4Y92A 4JRKA 2R5AA 3KUFA 2A0FB 4CC7A 1NG2A 4HT8A 1ZHIA 2E12A 5D6YA 1YITQ 3VV0A 2M0OA 4IUVA 1WXTA 4OB3B 4JRPA 3H8ZA 3PNWC 4HXJA 1C1AA 5AYFA 5LJ3f 1ZBXA 3VS1A 3CD6Q 1YCSB 2EYXA 2BZXA 2VKNA 1ACMB 4C8QE 4JLGA 1Q95G 3NFCA 2FZGB 1W2BP 4RTZA 1H3ZA 2PQWA 5HKCA 4XU2A 2M02A 3OYHA 1D0ZA 4J6WA 5GAOp 4PKCC 4VUBA 4QKUA 4M7DE 1GRIA 4LDXA 2PUOB 3GIBA 1I8FA 2DJQA 2XHCA 4EMGA 1WHLA 1KQSA 4PNOA 3SFMA 2H3JA 1JQQA 1X75C 2P84A 4F7UA 3TVTA 1M8MA 3CC7Q 1XJWB 2BE9B 5A2QE 4GBQA 1ZX6A 4M7DG 3QBYA 1JJ2A 1WDXA 4M78F 1SHGA 1B07A 4K11A 5IXBA 4LN2A 1AWWA 3VS3A 4DOVA 1YIJA 2EGCA 1VQ6T 3CCRA 1C0MA 1VQNT 4PJOD 5IT9E 1M1KR 1TWBA 3VUZA 4OP0A 4EMKC 1PKTA 2K5IA 3LWIA 3H9NA 3ME9A 4M78A 4V2SA 1AD5A 3JB9J 1WGSA 3VRYA 2EQIA 2L2PA 1KIKA 3DLMA 3MHXA 2E3HA 4ZTFA 1QW1A 5LJ3d 3X25B 2EYWA 3BE3A 3QO3A 3M59A 2DRKA 2CS7A 3JAME 1S72T 2YHTA 5IH2A 3SWNA 3C12A 1BI1A 1KC8R 1VQOA 5L8RE 1Q86C 1VQMA 1BCMA 3HRUA 2NUZA 5CQYA 2JUFA 2YUQA 4AG1C 5LJ3h 3RERA 4A63B 1QWEA 4M7AB 1KSWA 2CDTA 3VYHB 3CXCS 2F5TX 4XU0A 3CC2T 2CP2A 3PMIA 2RQUA 3JCMc 4CC4B 6AT1B 2E1HA 3J7AF 2EYQA 3M56A 5GMKl 1VQLA 3CCJA 3G7ZA 4E6RA 1NE8A 3M9QA 4KH0B 3CCQT 4ELYC 1NJIU 4EDUA 2CP0A 1FWZA 1PD1A 2OI3A 4HA8A 2H3EB 2LCCA 1YJWA 2F5KA 2EQKA 2O9VA 3OYBA 4OMFB 2KR3A 1JJ2P 2GNCA 2KNBB 2QEXA 3H41A 2CP5A 2A3LA 4LE9A 1VQNQ 3QWXX 2K57A 5EG2A 2KT1A 3UF4A 1W70A 2RHIA 1VIFA 2GFUA 5ECAA 2IG0A 4Z89A 5GANf 1VQ8T 2WSEE 4C0DB 2CZ7B 4GLKA 1M2VA 1UB4A 5LJ5e 3L1AA 2YRDA 3S3NA 3UA6A 2A28A 2F2XA 3QJYA 2DXBA 3QUIA 1G3TA 3X26B 1S72Q 2O4XB 2K9GA 3INZA 3CCUT 4D8DA 1Z9QA 2RN8A 4EMHA 3NTHA 1VQ7A 4ZNXA 3UA7A 4F7UE 4P5NA 2KT8A 3O5ZA 1RL2A 2MIOA 1NEBA 2O9SA 4M77F 4FW2A 4D6WA 2KQWA 3OSSC 4PJOF 2QQSA 2AZSA 2X3WD 2JTEA 4HT9A 3G4SQ 3OS1A 2ZGWA 3PGGA 5HK0A 3CCLQ 1U06A 4QVDA 4F7UG 2J6FA 4A53A 2MCNA 1C6VX 2FVUA 1R0CB 4M77A 4M78E 3LH5A 3R6OA 2QQRA 2CP3A 4PJOA 3S3MA 4MDXA 1ZA2B 4C8QD 2DXTA 2L3SA 1VA7A 3R6NA 2YRCA 4Y28E 1X27A 3OW2P 3VRZA 2PNIA 4F04B 2SRCA 3UT1A 1WJSA 3RKWA 2QASA 1IGUA 2QA4Q 3FJ5A 2H8HA 2HZYA 4AMCA 4OMNA 2JM9A 3CD6A 4KT0E 1YIJT 1RAHB 2AZVA 4M78G 5CIUA 3M0RA 2PU9B 1W4SA 1ZSZC 5GANd 1ZQ1A 3J80E 1MMGA 4AFUC 1TU0B 5LL6S 1GCQA 4E7IA 3SB2A 1ZUKA 2FRWA 5L23A 3CMAA 2LT1A 3EH1A 4Y91A 4GY5A 3WVDB 2X3XD 4JZ3A 1PC0A 5GANh 1LJOA 5GAOm 1YCYA 4AFSC 2HKQB 2E5QA 3JB9F 1TUCA 2AT1B 1I4K1 2MYSA 2NUPA 2OTJA 4FW1A 1IHVA 2XDBA 2RJDA 4Z88A 1QVGA 2DEQA 2E5KA 2ECZA 2GTJA 1OOTA 5IXFA 1QVFS 1VYVA 5GAOl 1SSFA 2MK5A 3QYGB 4FYYB 2RD1A 2DYBA 3P8DA 3N5BB 2YLBA 2O88A 4ZGJB 2FL7A 2VASA 2DERA 2KE9A 3LGLA 3TU4K 4ORZA 2R5MA 1I07A 1KJWA 2ABLA 2LCSA 1IHWA 3OQ5A 4J83A 1PM3A 4E2FB 4XTVA 4J5YA 2KRNA 1X2KA 1Y96A 1IRXA 5FLXE 5HY6A 3T9NA 3OYAA 2K3BA 2OX7A 1PSEA 1SKUB 5GAN5 4JJCA 4R55A 1K1ZA 4RTWA 1SHFA 1Q7YU 1YIJQ 4FM4B 1WHHA 4PJOC 4XU1A 2D8JA 3UATA 1RAEB 4LD9K 2E65A 3CBPA 3I35A 1RI0A 3EGXA 3HRSA 3BY7A 2QTXA 1XNIA 5FROA 2RHZA 3MP6A 2JTFA 2MAMA 4J9CA 1X6BA 1UJYA 1WI7A 3DKMA 3L2ZA 1VQ5T 2DIQA 3M5AA 1XQHA 3QSUA 1AEYA 5GAOn 1UHCA 1M3AA 3EG9A 2GBQA 4L6V5 2KEAA 2KGTA 2RHUA 2F2VA 2Y4XA 1VQOQ 3H0IA 5I22A 1PCXA 4MDWA 3X20B 3H0HA 3EG3A 1VQMQ 2LCLA 4M75A 3L2RA 2FYKA 4DEYA 3CPWA 3HKSA 4PFZA 1FMKA 1K76A 1W2BS 3QPHA 1QVGP 1N8RC 2AK5A 2VXEA 1N6AA 2DIGA 1KQ2A 1AWJA 1GXIE 3M55A 2XDDA 5LJ3e 1Q81R 2LQKA 1D1CA 4PLLA 4M7DB 2D8HA 2CZ1B 1VQ6A 5LJ5d 1AOJA 1RAGB 2K4YA 1BIBA 2RJEA 3I56T 1G3YA 2CP6A 1VQLQ 3CCJQ 2B8AA 2HSEB 2XKOC 2HKNA 2MF2A 2JMAA 3CCET 2RK2A 4N0AA 3V8LA 1VQ9A 4E7SA 4A4GA 2JT4A 4PL6A 1AHJB 1VOMA 2C0IA 1YJWQ 5LJ5h 2QYZA 2KXDA 5CKDA 3GOXA 1QCFA 2L5QA 1K0XA 2DBMA 2QEXQ 2ZPHB 1Q82C 2VWFA 3PE0A 1TUGB 1LVKA 2EGAA 2QI2A 8ATCB 1YN8A 1GL5A 4RG2A 3EG0A 3HSBA 3FC3A 3RBBB 1S1NA 1UUEA 1N9SA 3E9GA 5I2MA 4CC3A 2ENMA 3OYEA 1IXDA 2NYSA 3LX7A 5GAN3 2MOXA 1WLPB 4WCIA 4ANJA 1BYMA 1YP5A 5CQXA 1D1BA 2OTLT 2O01E 1RAIB 2D0QB 2DO3A 4KULA 1M8VA 1ZLMA 1QWFA 3CC2A 1BI2A 2VXFA 2YT6A 3QJ6A 1M27C 2BE7D 3CMAT 3MEWA 2NUTA 5KYUB 2XICA 1UGVA 3CCQA 2ED1A 1YWOA 1VQ7Q 3MPUB 1B34A 4C0FA 1FXXA 2JXBA 1D09B 3HFNA 3PMTA 3TREA 3EGUA 3X28B 3JCMW 3A5ZB 5GAN7 3J81E 2HMAA 4EMKA 4C92F 1WZOA 2WACA 1D3BA 4M7AD 1G3WA 4OMLA 3A8HB 5FU6B 1OULA 1X6OA 2VC8A 2O2OA 3V8KA 5FWBA 1TSFA 2DFUA 1K9MU 1VQ8A 3OYCA 2P4RA 1HSQA 5LJ5j 2GCXA 1BIAA 2RH2A 4C92A 1SPKA 2DL4A 1JRIA 4RCBA 4C8QC 1JJ2S 2PTKA 2E6ZA 3VS4A 4DBFA 5J39A 4HCCA 4CRIA 4LDVA 3RIRA 3M54A 2KBTA 1UHFA 3CCUA 3G71A 1ZSGA 4N0AC 2W0ZA 2KY9A 1A0NB 2HD0A 2CSIA 2K5FA 1JB0E 4IUUA 2E64A 5D7UA 1LPLA 4M75E 2K3YA 2R57A 3MJXA 3PTAA 1AZGB 4A54A 2J05A 1OPKA 4IURA 2LVMA 1RADB 2DKGA 1D0XA 1RAAB 3A8GB 2BTTA 3CPFA 3M0UA 1PSFA 1H3HA 2RNAA 4E7LA 3L42A 3CMAQ 5CCAA 4LNPA 5A0LA 1K8AR 2DXCA 1M90R 1TG0A 3VS5A 4M75G 3URGA 4QVCA 4IIMA 1AWXA 1VQPT 3QDRB 4LDUA 5GANe 1M1KC 3JSCA 1R77A 5HCKA 1TS9A 2OTJQ 4C5HA 4E47A 4F7UB 2XDPA 4O6JA 2VGNA 3JCMg 5CR2A 1YJ9T 2HQXA 4RUGA 1U3OA 2AIRB 4OB1B 3RNJA 2KROA 1FMVA 4XTZA 5KYYB 4J7IA 5CAIA 2LDMA 4XQ3A 1G83A 1KC8C 4RCCA 2DEUA 2DTOA 1TOVA 3FRNA 4ZN3A 5GAMf 4C0ZA 4M78B 4IKFA 1VQ9T 1R0BG 4OGCA 3EGDA 2HNIA 4WF2A 4PK4A 4AG2C 3TSWA 1WJRA 2EJ9A 1MV0B 3OW2S 2P0QA 2DXUA 3TCJA 2BKDN 4GLMA 1U5SA 1TH7A 1IZ6A 2LQNA 4PLIA 2GQIA 1T0JA 2GF7A 4JJBA 1ZUYA 3E9FA 2O31A 3SWNB 4NOYA 1UGRB 4C92C 2GFAA 3NPFA 2DPPB 3I5RA 9ATCB 5GMKm 1UE9A 1JU5C 3M0SA 4L5GA 2JJ9A 2D9TA 5DLOA 3E19A 1W6XA 5GAOr 3A8MB 4M7AF 2DX1A 5GAMg 1NYFA 3CBMA 2K2MA 1UGSB 1RUWA 4FYVB 3ASKA 4N4GA 2COZA 1UJ0A 4HCZA 1PHTA 1VQKA 1YJNA 1KQSP 3CBOA 1PKSA 3LW5E 4FU6A 1IREB 1V76A 4XAXB 4M7AA 4DBQA 2EQUA 3P8BB 5EC7A 1NEGA 4XK8E 2DVEA 3JB9I 2M1HA 2JMCA 3M58A 3LYIA 2HQEA 4RTTA 1WYXA 1ZSZA 1RAFB 2DD4A 2ROTA 1VQ6Q 1VQ4T 1WPYA 2DRMA 3LGFA 4ZTJA 1M9SA 3AHUA 2DL8A 3ZL7C 3MP1A 1VQ9Q 2B86A 2L3RA 1M2OA 2FHDA 2CT3A 1AT1B 2XG8D 2FZKB 2RI3A 1UG1A 2HAXA 1M2VB 1X01A 1VQ5A 3SDZA 1OYXA 3M0PA 4JS5A 3KFVA 2E70A 1M30A 2DZCA 4JDSA 1J3TA 3OYMA 3M57A 3G71T 2MMPA 4F17A 4MMLA 4XTWA 3AT1B 1K9MR 2FO0A 1UDLA 2K6DA 1M5Q1 4ELZC 4LDYA 4KRTA 5LJ3j 1ARKA 1V1CA 1CKBA 2O4XA 5CK9A 1WJQA 4YTLA 3CC2Q 4J6YA 2JW4A 3D7SB 4OMQA 2HBWA 1K73U 2A36A 3I56A 2IVWA 3RMQA 4QQ6A 3META 3CCQQ 1OQKA 2ZPIB 1SRLA 2RQRA 2WSCE 4J9HA 3RDVA 4EPCA 3CCEA 3JRZA 2GTOA 4M77B 5A0DA 5CKEA 2LC4A 2ZZDA 1Y7XA 1T3SA 4OMMA 1V29B 2JM8A 1QVGS 4KGZB 3JB9H 1N9RA 2EJGA 4JZ4A 3PVLA 3OA6A 2QQAA 2KDSA 2MI6A 2L8DA 1I0CA 5KYXB 3OS2A 2CREA 1MNEA 2YUNA 3F70A 1KHCA 2MWPA 4M7AC 1M3CA 4X9CA 4M7DD 2K79A 2K7AA 2LT4A 3OSVA 4F16A 1NYGA 3BFMA 2LTOA 1OEBA 2KI7A 3GBQA 4B6MA 1VQ8Q 2OTLA 2LRQA 3RKYA 1BI0A 3A98A 7AT1B 2X4WA 4X34A 1KD1U 4D8KA 1IGQA 4FSXA 2YDLA 1NBEB 2LJ1A 2Y90A 5GAN6 3EG2A 3G71Q 3CCUQ 2RPNA 3QWYA 3NTKA 2V8KA 3FDRA 2KXCA 3L2WA 1WA7A 4E7ZA 3FIFA 3VS0A 5FRNA 3CMET 5KE3A 2LX9A 2DE0X 5KYWB 3WXMB 2CYZB 2M0YA 2QQ9A 1BCOA 4RTUA 2HEQA 4C0DC 4J6XA 4B9WA 3G6ET 3A8LB 1YNZA 2D1XA 1WXUA 1VQKT 1BBZA 1OPLA 5FU7B 1NPPA 5IHIA 4BUGA 4BE0A 1YJNT 2OAUA 1GFCA 3CPWS 1Y0MA 3RUXA 4AFQC 3I5SA 2ROLA 2DETA 1F1BB 4MZTA 2RJCA 3GNGA 1WHKA 3OBWA 4JPBW 2CH4A 4FT4A 1FX7A 2W10A 2EQJA 2WSFE 2Y4YA 3JCMb 4FL6A 1KQ1A 2JS0A 2V1RA 2LMJA 1ZUUA 4OB2B 3QYHB 1UGQB 3M4GA 1E6GA 4NS5A 1NJIR 1FMWA 4X9DA 1MMNA 3CCMT 3EGXB 1PNJA 2EQMA 2ZPEB 4DEXA 4CC2A 2KK4A 4BD3A 3HTRA 4Q5WA 1CKAA 1D0YA 2DF6A 2RQVA 5KE2A 2OAWA 2FZCB 4B9XA 2DNUA 1Q81C 1QMCA 1X69A 1QKWA 2E10A 2EW3A 4IUPA 3JCMJ 3SD4A 1QLYA 5GANj 2A08A 2LJ3A 3EG9B 3HP9A 1VQPA 4ZN1A 3V8JA 3H0FA 4E7HA 4N4HA 2CUDA 2DMOA 3OBYA 4M75B 4M77E 1G3SA 3QHSA 4M4ZA 3VKIA 4C8QF 4HVVA 2HL5C 2NLUA 2MPXC 2VVKA 2PVGB 4PJOE 1YJ9A 3CCVA 3ULRB 1JXOA 1NLPC 2DJZA 4C5EA 3TQ7P 4J9GA 4NL3A 4M7DF 3JCMe 3OYNA 1OI1A 4ME7A 4C8QA 1VQKQ 4M77G 2ZPFB 4A4FA 1YI2T 4E7JA 1YJNQ 2D0NA 4IUTA 1PRLC 4PJOG 4OB0B 1HYOA 5HK3A 2NWMA 2RJFA 2HQHA 3VS2A 3I55A 2RF0A 4BI3A 1X43A 4XTUA 4M7DA 4ZGDB 5GMKe 1FYNA 2EAYA 4IIOA 3M0TA 3ZEHA 2FPDA 4C0GA 1X6GA 2RQTA 3REBB 4XTYA 1K73R 2BZYA 5J3BA 2M16A 2COYA 4O5VA 1O9SA 1YHQA 1PD0A 4QQDA 2L89A 4QQGA 3MEVA 1SG5A 1NM7A 1W1FA 2KRMA 3OYYA 4NL2A 3TSZA 1MV3A 1YITT 3BDUA 4AT1B 2VGMA 1QP2A 2E41A 1MNDA 1EFNA 4OGEA 3L2UA 1VQ5Q 1OV3A 4M78D 3ZFJA 1QQJA 1JEGA 3I9QA 3PVQA 4XTXA 2EIFA 5IN1A 1I5LA 3EFOA 2F1LA 2C0TA 4LDWA 2NUTB 4BI4A 5GAMe 1Q86U 1AVZC 2CSQA 1WFWA 4TVRA 4PJMA 2QGGA 3RESA 1B34B 2XU8A 5A0GA 1UEBA 2DILA 4J9IA 3CPWP 4DA4A 2X9HA 4OMOA 2XK0A 4DOWA 3UPUA 4MMKA 1KD1R 2RM4A 1WIEA 2BZ8A 3JB9G 1RABB 4EMKB 2LNHB 3EHQA 4R0KA 2EYYA 3WVEB 4ZGEB 1VQ4A 3I56Q 4FSSA 4BI8B 4FCYA 5KCHA 1KQSS 3CCEQ 2X4XA 3OYGA 3CC7T 1BI3A 3M4YA 2DA9A 1BB9A 1LNXA
chains in the Genus database with same CATH topology
1W6XA 5IHKA 2L3SA 1VA7A 3R6NA 5GJVB 1X27A 3VRZA 2DX1A 2YUPA 4EIKA 2PNIA 2SRCA 2KYMA 1NYFA 2K2MA 1RUWA 3FJ5A 1KFZA 1E7OA 1UJ0A 2H8HA 1T0HA 1PHTA 2JM9A 4OMNA 1GCQC 1RI9A 2AZVA 1PKSA 3M0RA 2DBKA 3SEMA 1QKXA 4RTYA 4AFUC 1GCQA 4X1VA 1X2QA 5EC7A 1NEGA 1ZUKA 2FEIA 2JMCA 2FRWA 5L23A 4RTTA 3REAB 1WYXA 1BU1A 2X3XD 4JZ3A 1WX6A 2ROTA 1SSHA 2AKLA 2F2WA 3M0QA 2EGEA 4AFSC 4F14A 1TUCA 2DRMA 2LQWA 2DL7A 1K0SA 2ED0A 2DL8A 4LUDA 3VS7A 1CSKA 3ZL7C 2EPDA 1WXBA 2B86A 4Z88A 1UFFA 2EKHA 1T3LA 3VS6A 2E5KA 2ECZA 2GTJA 2CT3A 2HDAA 1OOTA 5IXFA 1UG1A 1VYVA 1AZEA 3M0PA 2FPFA 2ESWA 3IQLA 2CT4A 3KFVA 1RLQC 1M30A 2DYBA 1J3TA 2FG0A 2YSQA 1Y57A 2O88A 4F17A 2KE9A 1VYTA 3U23A 2FO0A 1UDLA 4QT7A 2K6DA 4ORZA 1H92A 1I07A 1KJWA 2ABLA 2L3QA 2LCSA 4J9BA 4KRTA 2V1QA 3EG1A 2RMOA 2KRNA 1E6HA 1X2KA 1ABOA 1ARKA 1V1CA 2J06A 1CKBA 1B3QA 2I0NA 2K3BA 1NLOC 3THKA 1SEMA 2DL3A 2FRYA 2JW4A 4OMQA 4JJCA 2AKKA 1K1ZA 4RTWA 2HBWA 1SHFA 2A36A 4OMPA 1RLPC 2D8JA 3UATA 1VYUA 1SRLA 2RQRA 4J9HA 2EVRA 3I35A 1HD3A 2L0AA 2GTOA 2KRSA 3CQTA 1T3SA 2XMFA 1PRMC 2OJ2A 4OMMA 1JXMA 2JM8A 1SRMA 3C0CA 4HVWA 4J9CA 4JZ4A 2FPEA 3PVLA 1X6BA 2DLPA 4RTXA 1UJYA 1WI7A 5I11A 1YWPA 1I0CA 3NMZC 2CREA 4J9DA 1AEYA 1UHCA 1M3AA 2YUNA 1HJDA 2GBQA 1UTIA 2KEAA 2KGTA 2F2VA 1M3CA 4Y92A 3H0IA 5I22A 2K79A 2K7AA 1H8KA 1K9AA 3H0HA 3EG3A 4CC7A 1NG2A 4F16A 1NYGA 4DEYA 1OEBA 3GBQA 1K76A 1FMKA 2KYBA 2AK5A 1WXTA 5FW9A 1AWJA 3A98A 4HXJA 4D8KA 1Z9ZA 2D8HA 2YDLA 1GBQA 1AOJA 2LJ1A 3EG2A 2RPNA 3VS1A 2IIMA 3QWYA 1YCSB 1K4US 2EYXA 2C0OA 2BZXA 2VKNA 2KXCA 1WA7A 3VS0A 2DVJA 2JMAA 2EYZA 4RTZA 2DE0X 2JT4A 2C0IA 5GJWB 4ESRA 2L3PA 2G6FX 2KXDA 2M0YA 1XOVA 1QCFA 1GBRA 2DM1A 1K0XA 2DBMA 4RTUA 1GRIA 2VWFA 3PE0A 2HEQA 2EGAA 1YN8A 2DJQA 1GL5A 2SEMA 3EG0A 1YNZA 3JV3A 3RBBB 2D1XA 1JQQA 1S1NA 1WXUA 1UUEA 4CC3A 2HCKA 1BBZA 1OPLA 5IHIA 1MUZA 2ENMA 1GFCA 1Y0MA 3TVTA 1M8MA 4AFQC 2MOXA 1WLPB 4GBQA 4WCIA 1ZX6A 3SHWA 3I5SA 1YP5A 2ROLA 2PZ1A 2J6KA 1WDXA 1SHGA 4JPBW 2CH4A 1ZLMA 2W10A 1QWFA 1B07A 4K11A 5IXBA 2YT6A 4LN2A 2JS0A 1AWWA 2V1RA 1M27C 2LMJA 3VS3A 1ZUUA 2A37A 2EGCA 1UGVA 1E6GA 2ED1A 1YWOA 1PKTA 2JXBA 4J9EA 1AD5A 1PNJA 3EGUA 4DEXA 4CC2A 1CKAA 3VRYA 2EQIA 2L2PA 1KIKA 2CH4W 2DF6A 2DL5A 2RQVA 2OAWA 2J6OA 2DNUA 5FWCA 2EYWA 1X69A 1BK2A 2DRKA 1QKWA 2EW3A 1QLYA 4OMLA 5IH2A 2A08A 2LJ3A 3NGPA 1N5ZA 3H0FA 2LJ0A 2O2OA 4JJDA 2CUDA 2DMOA 2NUZA 2LZ6B 5FWBA 2YUQA 4M4ZA 4HVVA 4AG1C 2P4RA 1HSQA 3EHRA 2VVKA 4A63B 4LUEA 1SPKA 2RQWA 1QWEA 2DL4A 1JO8A 3ULRB 2PTKA 1JXOA 1KSWA 2CDTA 1NLPC 3NHNA 3VS4A 4J9FA 1GCPA 2KBTA 4J9GA 2RQUA 4CC4B 1UHFA 2LP5A 1ZSGA 2W0ZA 2JS2A 4Z8AA 2J7IA 1A0NB 4E6RA 1M3BA 2CSIA 1G2BA 2CUBA 2D0NA 2OI3A 1PRLC 1AZGB 2J05A 1OPKA 2NWMA 1ZBJA 2O9VA 3VS2A 2KR3A 2RF0A 1X43A 2BTTA 2GNCA 1GFDA 2KNBB 1FYNA 3H41A 3M0UA 4IIOA 1H3HA 2GGRA 2RNAA 2FPDA 3M0TA 1X6GA 2EBPA 1I1JA 2RQTA 3REBB 2LX7A 4LE9A 2BZYA 4LNPA 3QWXX 1TG0A 4RTVA 3VS5A 2KT1A 3UF4A 4IIMA 1W70A 1AWXA 1NM7A 1W1FA 2KRMA 5ECAA 5HCKA 4Z89A 3TSZA 1MV3A 1PWTA 2QDLA 1EFNA 4RUGA 1U3OA 3UA6A 2A28A 2F2XA 1OV3A 1JEGA 1UECA 3I9QA 2KROA 3PVQA 3RNJA 2K9GA 4D8DA 1Z9QA 2RN8A 2C0TA 1G83A 4ZNXA 1AVZC 2CSQA 1WFWA 4HCKA 3UA7A 1ABQA 2KT8A 3O5ZA 2MIOA 1NEBA 1IO6A 2DILA 4J9IA 4OMOA 2O9SA 4HVUA 1WIEA 2BZ8A 2M51A 4AG2C 3TSWA 1MV0B 2AZSA 2LNHB 2JTEA 2X3WD 3EHQA 1AWOA 4GLMA 2EYYA 4R0KA 1U5SA 2LQNA 2YUOA 2GQIA 1T0JA 1U06A 4JJBA 1ZUYA 2J6FA 2O31A 4FSSA 2HSPA 2MCNA 4AFZC 3NPFA 3I5RA 3LH5A 5IHNA 1UE9A 1JU5C 2DA9A 1TUDA 3M0SA 1LCKA 1BB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6X A;  5IHK A;  2L3S A;  1VA7 A;  3R6N A;  5GJV B;  1X27 A;  3VRZ A;  2DX1 A;  2YUP A;  4EIK A;  2PNI A;  2SRC A;  2KYM A;  1NYF A;  2K2M A;  1RUW A;  3FJ5 A;  1KFZ A;  1E7O A;  1UJ0 A;  2H8H A;  1T0H A;  1PHT A;  2JM9 A;  4OMN A;  1GCQ C;  1RI9 A;  2AZV A;  1PKS A;  3M0R A;  2DBK A;  3SEM A;  1QKX A;  4RTY A;  4AFU C;  1GCQ A;  4X1V A;  1X2Q A;  5EC7 A;  1NEG A;  1ZUK A;  2FEI A;  2JMC A;  2FRW A;  5L23 A;  4RTT A;  3REA B;  1WYX A;  1BU1 A;  2X3X D;  4JZ3 A;  1WX6 A;  2ROT A;  1SSH A;  2AKL A;  2F2W A;  3M0Q A;  2EGE A;  4AFS C;  4F14 A;  1TUC A;  2DRM A;  2LQW A;  2DL7 A;  1K0S A;  2ED0 A;  2DL8 A;  4LUD A;  3VS7 A;  1CSK A;  3ZL7 C;  2EPD A;  1WXB A;  2B86 A;  4Z88 A;  1UFF A;  2EKH A;  1T3L A;  3VS6 A;  2E5K A;  2ECZ A;  2GTJ A;  2CT3 A;  2HDA A;  1OOT A;  5IXF A;  1UG1 A;  1VYV A;  1AZE A;  3M0P A;  2FPF A;  2ESW A;  3IQL A;  2CT4 A;  3KFV A;  1RLQ C;  1M30 A;  2DYB A;  1J3T A;  2FG0 A;  2YSQ A;  1Y57 A;  2O88 A;  4F17 A;  2KE9 A;  1VYT A;  3U23 A;  2FO0 A;  1UDL A;  4QT7 A;  2K6D A;  4ORZ A;  1H92 A;  1I07 A;  1KJW A;  2ABL A;  2L3Q A;  2LCS A;  4J9B A;  4KRT A;  2V1Q A;  3EG1 A;  2RMO A;  2KRN A;  1E6H A;  1X2K A;  1ABO A;  1ARK A;  1V1C A;  2J06 A;  1CKB A;  1B3Q A;  2I0N A;  2K3B A;  1NLO C;  3THK A;  1SEM A;  2DL3 A;  2FRY A;  2JW4 A;  4OMQ A;  4JJC A;  2AKK A;  1K1Z A;  4RTW A;  2HBW A;  1SHF A;  2A36 A;  4OMP A;  1RLP C;  2D8J A;  3UAT A;  1VYU A;  1SRL A;  2RQR A;  4J9H A;  2EVR A;  3I35 A;  1HD3 A;  2L0A A;  2GTO A;  2KRS A;  3CQT A;  1T3S A;  2XMF A;  1PRM C;  2OJ2 A;  4OMM A;  1JXM A;  2JM8 A;  1SRM A;  3C0C A;  4HVW A;  4J9C A;  4JZ4 A;  2FPE A;  3PVL A;  1X6B A;  2DLP A;  4RTX A;  1UJY A;  1WI7 A;  5I11 A;  1YWP A;  1I0C A;  3NMZ C;  2CRE A;  4J9D A;  1AEY A;  1UHC A;  1M3A A;  2YUN A;  1HJD A;  2GBQ A;  1UTI A;  2KEA A;  2KGT A;  2F2V A;  1M3C A;  4Y92 A;  3H0I A;  5I22 A;  2K79 A;  2K7A A;  1H8K A;  1K9A A;  3H0H A;  3EG3 A;  4CC7 A;  1NG2 A;  4F16 A;  1NYG A;  4DEY A;  1OEB A;  3GBQ A;  1K76 A;  1FMK A;  2KYB A;  2AK5 A;  1WXT A;  5FW9 A;  1AWJ A;  3A98 A;  4HXJ A;  4D8K A;  1Z9Z A;  2D8H A;  2YDL A;  1GBQ A;  1AOJ A;  2LJ1 A;  3EG2 A;  2RPN A;  3VS1 A;  2IIM A;  3QWY A;  1YCS B;  1K4U S;  2EYX A;  2C0O A;  2BZX A;  2VKN A;  2KXC A;  1WA7 A;  3VS0 A;  2DVJ A;  2JMA A;  2EYZ A;  4RTZ A;  2DE0 X;  2JT4 A;  2C0I A;  5GJW B;  4ESR A;  2L3P A;  2G6F X;  2KXD A;  2M0Y A;  1XOV A;  1QCF A;  1GBR A;  2DM1 A;  1K0X A;  2DBM A;  4RTU A;  1GRI A;  2VWF A;  3PE0 A;  2HEQ A;  2EGA A;  1YN8 A;  2DJQ A;  1GL5 A;  2SEM A;  3EG0 A;  1YNZ A;  3JV3 A;  3RBB B;  2D1X A;  1JQQ A;  1S1N A;  1WXU A;  1UUE A;  4CC3 A;  2HCK A;  1BBZ A;  1OPL A;  5IHI A;  1MUZ A;  2ENM A;  1GFC A;  1Y0M A;  3TVT A;  1M8M A;  4AFQ C;  2MOX A;  1WLP B;  4GBQ A;  4WCI A;  1ZX6 A;  3SHW A;  3I5S A;  1YP5 A;  2ROL A;  2PZ1 A;  2J6K A;  1WDX A;  1SHG A;  4JPB W;  2CH4 A;  1ZLM A;  2W10 A;  1QWF A;  1B07 A;  4K11 A;  5IXB A;  2YT6 A;  4LN2 A;  2JS0 A;  1AWW A;  2V1R A;  1M27 C;  2LMJ A;  3VS3 A;  1ZUU A;  2A37 A;  2EGC A;  1UGV A;  1E6G A;  2ED1 A;  1YWO A;  1PKT A;  2JXB A;  4J9E A;  1AD5 A;  1PNJ A;  3EGU A;  4DEX A;  4CC2 A;  1CKA A;  3VRY A;  2EQI A;  2L2P A;  1KIK A;  2CH4 W;  2DF6 A;  2DL5 A;  2RQV A;  2OAW A;  2J6O A;  2DNU A;  5FWC A;  2EYW A;  1X69 A;  1BK2 A;  2DRK A;  1QKW A;  2EW3 A;  1QLY A;  4OML A;  5IH2 A;  2A08 A;  2LJ3 A;  3NGP A;  1N5Z A;  3H0F A;  2LJ0 A;  2O2O A;  4JJD A;  2CUD A;  2DMO A;  2NUZ A;  2LZ6 B;  5FWB A;  2YUQ A;  4M4Z A;  4HVV A;  4AG1 C;  2P4R A;  1HSQ A;  3EHR A;  2VVK A;  4A63 B;  4LUE A;  1SPK A;  2RQW A;  1QWE A;  2DL4 A;  1JO8 A;  3ULR B;  2PTK A;  1JXO A;  1KSW A;  2CDT A;  1NLP C;  3NHN A;  3VS4 A;  4J9F A;  1GCP A;  2KBT A;  4J9G A;  2RQU A;  4CC4 B;  1UHF A;  2LP5 A;  1ZSG A;  2W0Z A;  2JS2 A;  4Z8A A;  2J7I A;  1A0N B;  4E6R A;  1M3B A;  2CSI A;  1G2B A;  2CUB A;  2D0N A;  2OI3 A;  1PRL C;  1AZG B;  2J05 A;  1OPK A;  2NWM A;  1ZBJ A;  2O9V A;  3VS2 A;  2KR3 A;  2RF0 A;  1X43 A;  2BTT A;  2GNC A;  1GFD A;  2KNB B;  1FYN A;  3H41 A;  3M0U A;  4IIO A;  1H3H A;  2GGR A;  2RNA A;  2FPD A;  3M0T A;  1X6G A;  2EBP A;  1I1J A;  2RQT A;  3REB B;  2LX7 A;  4LE9 A;  2BZY A;  4LNP A;  3QWX X;  1TG0 A;  4RTV A;  3VS5 A;  2KT1 A;  3UF4 A;  4IIM A;  1W70 A;  1AWX A;  1NM7 A;  1W1F A;  2KRM A;  5ECA A;  5HCK A;  4Z89 A;  3TSZ A;  1MV3 A;  1PWT A;  2QDL A;  1EFN A;  4RUG A;  1U3O A;  3UA6 A;  2A28 A;  2F2X A;  1OV3 A;  1JEG A;  1UEC A;  3I9Q A;  2KRO A;  3PVQ A;  3RNJ A;  2K9G A;  4D8D A;  1Z9Q A;  2RN8 A;  2C0T A;  1G83 A;  4ZNX A;  1AVZ C;  2CSQ A;  1WFW A;  4HCK A;  3UA7 A;  1ABQ A;  2KT8 A;  3O5Z A;  2MIO A;  1NEB A;  1IO6 A;  2DIL A;  4J9I A;  4OMO A;  2O9S A;  4HVU A;  1WIE A;  2BZ8 A;  2M51 A;  4AG2 C;  3TSW A;  1MV0 B;  2AZS A;  2LNH B;  2JTE A;  2X3W D;  3EHQ A;  1AWO A;  4GLM A;  2EYY A;  4R0K A;  1U5S A;  2LQN A;  2YUO A;  2GQI A;  1T0J A;  1U06 A;  4JJB A;  1ZUY A;  2J6F A;  2O31 A;  4FSS A;  2HSP A;  2MCN A;  4AFZ C;  3NPF A;  3I5R A;  3LH5 A;  5IHN A;  1UE9 A;  1JU5 C;  2DA9 A;  1TUD A;  3M0S A;  1LCK A;  1BB9 A; 
#chains in the Genus database with same CATH topology
 1KK7 A;  3H6Z A;  5GJV B;  4EIK A;  2KYM A;  3BW1 A;  3CC4 T;  3DB3 A;  4KBM B;  3MKD A;  3OS5 A;  1I5O B;  5CO7 A;  1E7O A;  2I2L A;  4C5I A;  1K8A C;  1M90 C;  3FEO A;  3QXE B;  1RI9 A;  2YLC A;  3HPW A;  3JCM f;  4M7D C;  3CEY A;  1OX9 A;  2RA2 A;  2OTL Q;  2R58 A;  1OU9 A;  4X1V A;  1X2Q A;  2RI2 A;  4DBR A;  2K2V A;  2QAZ A;  2RB6 A;  3REA B;  1BU1 A;  2JTM A;  2FB7 A;  1SSH A;  1Q7Y R;  3EFS A;  3MEU A;  3M0Q A;  3MCA B;  4LD6 A;  4F14 A;  2LQW A;  5KH6 A;  1K0S A;  4KGX B;  2ED0 A;  3MO8 A;  3VS7 A;  1CSK A;  2QTV A;  3TEE A;  1M1F A;  1WXB A;  5J26 A;  3UWN A;  3LLR A;  2EKH A;  4F7U F;  1VIE A;  3VS6 A;  1MGQ A;  2HDA A;  3Q1J A;  4BE1 A;  2E4H A;  3CCV T;  1AZE A;  2ZPG B;  2ESW A;  3BDL A;  2CT4 A;  3IQL A;  1RLQ C;  1U1T A;  2EWN A;  4C8Q G;  4KUI A;  2FG0 A;  2ATC B;  4J8O A;  4HKE A;  5IAY A;  2YSQ A;  1EIF A;  1OZ2 A;  5LJ3 g;  4QT7 A;  3G1J A;  2A7Y A;  3C95 A;  3HL8 A;  1B7T A;  4BY6 B;  4A4H A;  4R56 A;  4FIB A;  1ABO A;  3FB9 A;  3EGD B;  4M77 D;  3CC4 Q;  3I55 T;  1B3Q A;  2I0N A;  5KYY A;  2QG9 B;  1NLO C;  1QVP A;  1SEM A;  2DL3 A;  2FRY A;  4E7K A;  8AT1 B;  3UDC A;  2AKK A;  2E6N A;  4OMP A;  4JUV A;  3QZ5 B;  1VYU A;  1YHQ T;  3JCM d;  1HD3 A;  3CME A;  2L0A A;  2QXF A;  2KRS A;  2RHY A;  3OS0 A;  2XMF A;  4MZP A;  2OJ2 A;  2RHX A;  1JXM A;  3ZBD A;  5FU6 C;  1SRM A;  1I81 A;  1M1G A;  2FPE A;  2DLP A;  3L2Q A;  3JCM h;  5KCO A;  3V7C A;  3NMZ C;  3O8V A;  1VUB A;  3A8O B;  2HBP A;  2VUB A;  3QII A;  4LXC A;  1G8X A;  3G6E A;  1HJD A;  2CP7 A;  1UTI A;  2X4J A;  3OYF A;  1VQP Q;  2BUD A;  1H8K A;  1K9A A;  4PJL A;  2C06 A;  2JVV A;  4CI0 C;  5DY9 A;  2KYB A;  5GMK h;  4IUQ A;  1YJ9 Q;  5FW9 A;  4C92 E;  3CCV Q;  4JJN K;  3OYD A;  1Z9Z A;  3G4S T;  2YRV A;  4JS4 A;  1ZSZ B;  1GBQ A;  2X4Y A;  2IIM A;  5M9O A;  1Q86 R;  3CCL T;  2VV5 A;  1KG1 A;  1K4U S;  2C0O A;  1Y71 A;  2K3X A;  3JB9 D;  3CCM A;  2DVJ A;  2ZAE A;  2EYZ A;  3V7R A;  2QK0 A;  1K9M C;  4C92 G;  3JCM P;  5GAM d;  4L59 A;  5GJW B;  3OB9 A;  4ESR A;  2L3P A;  2G6F X;  3OW2 A;  3I55 Q;  5I2S A;  1XOV A;  2Z0W A;  1WHJ A;  4OF1 A;  1GBR A;  2DM1 A;  2V8I A;  2V8J A;  3HFO A;  2HL3 A;  3GLX A;  1NZ9 A;  2QA4 T;  2SEM A;  3KBG A;  5AT1 B;  5GAM h;  3PIP A;  1YHQ Q;  2LQ8 A;  3JV3 A;  3GF5 A;  2HCK A;  1MUZ A;  1PG5 B;  1TTH B;  1U1S A;  3SHW A;  3C4S A;  2PZ1 A;  5C0M A;  2J6K A;  1U8R A;  1H64 1;  2EJF A;  2XI9 A;  3CXC A;  3PT9 A;  1JBM A;  1Q81 U;  4BY6 C;  5GMK i;  1R8O B;  1QCN A;  1WQ7 A;  3VU3 C;  1EZZ B;  1Y07 A;  3ER0 A;  4M78 C;  2A37 A;  5GAN 4;  4KUD K;  5FRM A;  2DAQ A;  1YI2 A;  5DLQ E;  2M9U A;  4MZM A;  3V7S A;  1OZ3 A;  2X51 A;  2COW A;  4J9E A;  3OYL A;  2YWW A;  2V26 A;  2DTH A;  5GMK j;  1N8R U;  1KHI A;  1UGP B;  3SWN C;  4PJO B;  4KGV B;  3LH0 A;  4RKU E;  4M75 D;  5GAN g;  2CH4 W;  2DL5 A;  4A4K A;  3JCM V;  2J6O A;  3CCS A;  5FWC A;  3LWH A;  1BK2 A;  5GAN 8;  4II1 A;  2PVO B;  1VQ4 Q;  1IB8 A;  3OMC A;  3EAE A;  2DZ9 A;  3NGP A;  1N5Z A;  2LJ0 A;  4PFP A;  4JJD A;  2LZ6 B;  1YBY A;  1YIT A;  2XID A;  3EHR A;  4LUE A;  3VYG A;  2RQW A;  5KYX A;  1JO8 A;  2DTI A;  3NHN A;  4J9F A;  1GCP A;  1Q82 U;  2LP5 A;  1D1A A;  2JS2 A;  4Z8A A;  5GAM j;  2J7I A;  3CCR T;  2KSS A;  1M3B A;  1G2B A;  2CUB A;  4PJN A;  3L2V A;  1MMD A;  1QCO A;  1WQW A;  3NTI A;  2CZ0 B;  2CZ6 B;  2NUP B;  1ZBJ A;  2DK3 A;  4BE2 A;  4M7A E;  4FT2 A;  3RR6 A;  2VB6 A;  5GAN 2;  4JRQ A;  2ZPB B;  1GFD A;  3CXC P;  2GGR A;  2EBP A;  1I1J A;  3S3O A;  2LX7 A;  1N27 A;  2IPO B;  2KVQ G;  2F69 A;  2RI5 A;  2DD5 A;  1M4Z A;  2QGF B;  4RTV A;  1MMA A;  1BKB A;  2EKO A;  1VQO T;  1QP3 A;  1VQM T;  3P8H A;  1NJI C;  5CVI A;  4M7A G;  4J7F A;  3CC7 A;  5KYW A;  5D6W A;  4N4I A;  5C6S A;  1PWT A;  2RO0 A;  2QDL A;  2ZCF B;  3RKX A;  1HXD A;  4BDY A;  2JZ2 A;  1YFN A;  2G3R A;  3MP8 A;  3CC4 A;  3QDF A;  1Y96 B;  5LJ5 f;  3HHT B;  1UEC A;  1XTD A;  1OX8 A;  2YXY A;  3MEA A;  3OYI A;  4QVZ A;  2PUK B;  1VQL T;  3CCJ T;  2K5L A;  3GPL A;  4BAC A;  4HCK A;  1ABQ A;  1IO6 A;  2CKK A;  1YJW T;  4JRI A;  2DYI A;  3JCM Q;  4HVU A;  3OYK A;  1LOJ A;  2M51 A;  2QEX T;  4M77 C;  1AWO A;  2E3I A;  3CCR Q;  4C92 D;  2JOY A;  1K8A U;  2YUO A;  4FYW B;  2JN0 A;  1M90 U;  4Z02 A;  2HSP A;  5I21 A;  5LJ5 g;  4AFZ C;  4WTO B;  3FJP A;  3CME Q;  2CGH A;  5IHN A;  3JCM X;  4UC4 A;  4M75 F;  1TUD A;  4LUD A;  1LCK A;  1WNL A;  1QVF A;  5IHK A;  2P0P A;  2YUP A;  3S6W A;  4RG8 A;  1K73 C;  1KFZ A;  2VYT A;  1T0H A;  3G6E Q;  4QW2 A;  2X35 A;  1GCQ C;  5CKB A;  4PJJ A;  4C8Q B;  1VQ7 T;  1M1K U;  2DBK A;  3SEM A;  5CKF A;  1QKX A;  1P92 A;  3X24 B;  4RTY A;  4DQ2 A;  3EH2 A;  3FLG A;  1O75 A;  3GNF B;  1WHM A;  3GP8 A;  3QG1 A;  2FEI A;  4HCB A;  1VQN A;  2P4T A;  1WX6 A;  1TXQ A;  2AKL A;  3DLL A;  2F2W A;  3CCS T;  2EGE A;  2XD0 A;  2AHJ B;  2DL7 A;  1EX4 A;  1KC8 U;  2QQB A;  2LNV A;  3CCM Q;  1N8R R;  3VJP A;  2EPD A;  3E2U A;  1UFF A;  1T3L A;  1WHG A;  2QDY B;  2PVD B;  5D6X A;  4OVA A;  1KD1 C;  5FU7 C;  2MWO A;  2FPF A;  5DM7 R;  1S72 A;  4DBH A;  1Y57 A;  3EFO B;  1NPR A;  3CD6 T;  3VUB A;  1VYT A;  3U23 A;  3E1S A;  3OY9 A;  3A1P A;  1H92 A;  4A4E A;  1W2B A;  2JNG A;  2L3Q A;  4J9B A;  3M53 A;  2KMT A;  2V1Q A;  2KAF A;  2RMO A;  3EG1 A;  1QVF P;  1E6H A;  2P0K A;  1Q82 R;  2J06 A;  4PFO A;  5CKH A;  3EFR A;  3OYJ A;  4BB7 A;  5KYN A;  3DB4 A;  3THK A;  3G4S A;  3RMS A;  5KYU A;  3CCL A;  1DJ7 B;  1RLP C;  3QZ9 B;  3HRT A;  1D3B B;  4ATO A;  1YI2 Q;  2EVR A;  2GQV A;  1RAC B;  2RK1 A;  4XU3 A;  4JLI A;  4KH1 B;  1G5V A;  2OTJ T;  4FYX B;  3CQT A;  3C94 A;  4C5G A;  1PRM C;  2D6F A;  3C0C A;  4BDZ A;  4HVW A;  4C92 B;  4RTX A;  5I11 A;  1HK9 A;  1YWP A;  4M75 C;  1MHN A;  1SF9 A;  1ZA1 B;  2EFI A;  5GAO q;  2QA4 A;  4J9D A;  3CCS Q;  3KXT A;  3PIO A;  3PFS A;  4RMO A;  3QKJ A;  1Q7Y C;  3OMG A;  1OU8 A;  2BIV A;  4Y92 A;  4JRK A;  2R5A A;  3KUF A;  2A0F B;  4CC7 A;  1NG2 A;  4HT8 A;  1ZHI A;  2E12 A;  5D6Y A;  1YIT Q;  3VV0 A;  2M0O A;  4IUV A;  1WXT A;  4OB3 B;  4JRP A;  3H8Z A;  3PNW C;  4HXJ A;  1C1A A;  5AYF A;  5LJ3 f;  1ZBX A;  3VS1 A;  3CD6 Q;  1YCS B;  2EYX A;  2BZX A;  2VKN A;  1ACM B;  4C8Q E;  4JLG A;  1Q95 G;  3NFC A;  2FZG B;  1W2B P;  4RTZ A;  1H3Z A;  2PQW A;  5HKC A;  4XU2 A;  2M02 A;  3OYH A;  1D0Z A;  4J6W A;  5GAO p;  4PKC C;  4VUB A;  4QKU A;  4M7D E;  1GRI A;  4LDX A;  2PUO B;  3GIB A;  1I8F A;  2DJQ A;  2XHC A;  4EMG A;  1WHL A;  1KQS A;  4PNO A;  3SFM A;  2H3J A;  1JQQ A;  1X75 C;  2P84 A;  4F7U A;  3TVT A;  1M8M A;  3CC7 Q;  1XJW B;  2BE9 B;  5A2Q E;  4GBQ A;  1ZX6 A;  4M7D G;  3QBY A;  1JJ2 A;  1WDX A;  4M78 F;  1SHG A;  1B07 A;  4K11 A;  5IXB A;  4LN2 A;  1AWW A;  3VS3 A;  4DOV A;  1YIJ A;  2EGC A;  1VQ6 T;  3CCR A;  1C0M A;  1VQN T;  4PJO D;  5IT9 E;  1M1K R;  1TWB A;  3VUZ A;  4OP0 A;  4EMK C;  1PKT A;  2K5I A;  3LWI A;  3H9N A;  3ME9 A;  4M78 A;  4V2S A;  1AD5 A;  3JB9 J;  1WGS A;  3VRY A;  2EQI A;  2L2P A;  1KIK A;  3DLM A;  3MHX A;  2E3H A;  4ZTF A;  1QW1 A;  5LJ3 d;  3X25 B;  2EYW A;  3BE3 A;  3QO3 A;  3M59 A;  2DRK A;  2CS7 A;  3JAM E;  1S72 T;  2YHT A;  5IH2 A;  3SWN A;  3C12 A;  1BI1 A;  1KC8 R;  1VQO A;  5L8R E;  1Q86 C;  1VQM A;  1BCM A;  3HRU A;  2NUZ A;  5CQY A;  2JUF A;  2YUQ A;  4AG1 C;  5LJ3 h;  3RER A;  4A63 B;  1QWE A;  4M7A B;  1KSW A;  2CDT A;  3VYH B;  3CXC S;  2F5T X;  4XU0 A;  3CC2 T;  2CP2 A;  3PMI A;  2RQU A;  3JCM c;  4CC4 B;  6AT1 B;  2E1H A;  3J7A F;  2EYQ A;  3M56 A;  5GMK l;  1VQL A;  3CCJ A;  3G7Z A;  4E6R A;  1NE8 A;  3M9Q A;  4KH0 B;  3CCQ T;  4ELY C;  1NJI U;  4EDU A;  2CP0 A;  1FWZ A;  1PD1 A;  2OI3 A;  4HA8 A;  2H3E B;  2LCC A;  1YJW A;  2F5K A;  2EQK A;  2O9V A;  3OYB A;  4OMF B;  2KR3 A;  1JJ2 P;  2GNC A;  2KNB B;  2QEX A;  3H41 A;  2CP5 A;  2A3L A;  4LE9 A;  1VQN Q;  3QWX X;  2K57 A;  5EG2 A;  2KT1 A;  3UF4 A;  1W70 A;  2RHI A;  1VIF A;  2GFU A;  5ECA A;  2IG0 A;  4Z89 A;  5GAN f;  1VQ8 T;  2WSE E;  4C0D B;  2CZ7 B;  4GLK A;  1M2V A;  1UB4 A;  5LJ5 e;  3L1A A;  2YRD A;  3S3N A;  3UA6 A;  2A28 A;  2F2X A;  3QJY A;  2DXB A;  3QUI A;  1G3T A;  3X26 B;  1S72 Q;  2O4X B;  2K9G A;  3INZ A;  3CCU T;  4D8D A;  1Z9Q A;  2RN8 A;  4EMH A;  3NTH A;  1VQ7 A;  4ZNX A;  3UA7 A;  4F7U E;  4P5N A;  2KT8 A;  3O5Z A;  1RL2 A;  2MIO A;  1NEB A;  2O9S A;  4M77 F;  4FW2 A;  4D6W A;  2KQW A;  3OSS C;  4PJO F;  2QQS A;  2AZS A;  2X3W D;  2JTE A;  4HT9 A;  3G4S Q;  3OS1 A;  2ZGW A;  3PGG A;  5HK0 A;  3CCL Q;  1U06 A;  4QVD A;  4F7U G;  2J6F A;  4A53 A;  2MCN A;  1C6V X;  2FVU A;  1R0C B;  4M77 A;  4M78 E;  3LH5 A;  3R6O A;  2QQR A;  2CP3 A;  4PJO A;  3S3M A;  4MDX A;  1ZA2 B;  4C8Q D;  2DXT A;  2L3S A;  1VA7 A;  3R6N A;  2YRC A;  4Y28 E;  1X27 A;  3OW2 P;  3VRZ A;  2PNI A;  4F04 B;  2SRC A;  3UT1 A;  1WJS A;  3RKW A;  2QAS A;  1IGU A;  2QA4 Q;  3FJ5 A;  2H8H A;  2HZY A;  4AMC A;  4OMN A;  2JM9 A;  3CD6 A;  4KT0 E;  1YIJ T;  1RAH B;  2AZV A;  4M78 G;  5CIU A;  3M0R A;  2PU9 B;  1W4S A;  1ZSZ C;  5GAN d;  1ZQ1 A;  3J80 E;  1MMG A;  4AFU C;  1TU0 B;  5LL6 S;  1GCQ A;  4E7I A;  3SB2 A;  1ZUK A;  2FRW A;  5L23 A;  3CMA A;  2LT1 A;  3EH1 A;  4Y91 A;  4GY5 A;  3WVD B;  2X3X D;  4JZ3 A;  1PC0 A;  5GAN h;  1LJO A;  5GAO m;  1YCY A;  4AFS C;  2HKQ B;  2E5Q A;  3JB9 F;  1TUC A;  2AT1 B;  1I4K 1;  2MYS A;  2NUP A;  2OTJ A;  4FW1 A;  1IHV A;  2XDB A;  2RJD A;  4Z88 A;  1QVG A;  2DEQ A;  2E5K A;  2ECZ A;  2GTJ A;  1OOT A;  5IXF A;  1QVF S;  1VYV A;  5GAO l;  1SSF A;  2MK5 A;  3QYG B;  4FYY B;  2RD1 A;  2DYB A;  3P8D A;  3N5B B;  2YLB A;  2O88 A;  4ZGJ B;  2FL7 A;  2VAS A;  2DER A;  2KE9 A;  3LGL A;  3TU4 K;  4ORZ A;  2R5M A;  1I07 A;  1KJW A;  2ABL A;  2LCS A;  1IHW A;  3OQ5 A;  4J83 A;  1PM3 A;  4E2F B;  4XTV A;  4J5Y A;  2KRN A;  1X2K A;  1Y96 A;  1IRX A;  5FLX E;  5HY6 A;  3T9N A;  3OYA A;  2K3B A;  2OX7 A;  1PSE A;  1SKU B;  5GAN 5;  4JJC A;  4R55 A;  1K1Z A;  4RTW A;  1SHF A;  1Q7Y U;  1YIJ Q;  4FM4 B;  1WHH A;  4PJO C;  4XU1 A;  2D8J A;  3UAT A;  1RAE B;  4LD9 K;  2E65 A;  3CBP A;  3I35 A;  1RI0 A;  3EGX A;  3HRS A;  3BY7 A;  2QTX A;  1XNI A;  5FRO A;  2RHZ A;  3MP6 A;  2JTF A;  2MAM A;  4J9C A;  1X6B A;  1UJY A;  1WI7 A;  3DKM A;  3L2Z A;  1VQ5 T;  2DIQ A;  3M5A A;  1XQH A;  3QSU A;  1AEY A;  5GAO n;  1UHC A;  1M3A A;  3EG9 A;  2GBQ A;  4L6V 5;  2KEA A;  2KGT A;  2RHU A;  2F2V A;  2Y4X A;  1VQO Q;  3H0I A;  5I22 A;  1PCX A;  4MDW A;  3X20 B;  3H0H A;  3EG3 A;  1VQM Q;  2LCL A;  4M75 A;  3L2R A;  2FYK A;  4DEY A;  3CPW A;  3HKS A;  4PFZ A;  1FMK A;  1K76 A;  1W2B S;  3QPH A;  1QVG P;  1N8R C;  2AK5 A;  2VXE A;  1N6A A;  2DIG A;  1KQ2 A;  1AWJ A;  1GXI E;  3M55 A;  2XDD A;  5LJ3 e;  1Q81 R;  2LQK A;  1D1C A;  4PLL A;  4M7D B;  2D8H A;  2CZ1 B;  1VQ6 A;  5LJ5 d;  1AOJ A;  1RAG B;  2K4Y A;  1BIB A;  2RJE A;  3I56 T;  1G3Y A;  2CP6 A;  1VQL Q;  3CCJ Q;  2B8A A;  2HSE B;  2XKO C;  2HKN A;  2MF2 A;  2JMA A;  3CCE T;  2RK2 A;  4N0A A;  3V8L A;  1VQ9 A;  4E7S A;  4A4G A;  2JT4 A;  4PL6 A;  1AHJ B;  1VOM A;  2C0I A;  1YJW Q;  5LJ5 h;  2QYZ A;  2KXD A;  5CKD A;  3GOX A;  1QCF A;  2L5Q A;  1K0X A;  2DBM A;  2QEX Q;  2ZPH B;  1Q82 C;  2VWF A;  3PE0 A;  1TUG B;  1LVK A;  2EGA A;  2QI2 A;  8ATC B;  1YN8 A;  1GL5 A;  4RG2 A;  3EG0 A;  3HSB A;  3FC3 A;  3RBB B;  1S1N A;  1UUE A;  1N9S A;  3E9G A;  5I2M A;  4CC3 A;  2ENM A;  3OYE A;  1IXD A;  2NYS A;  3LX7 A;  5GAN 3;  2MOX A;  1WLP B;  4WCI A;  4ANJ A;  1BYM A;  1YP5 A;  5CQX A;  1D1B A;  2OTL T;  2O01 E;  1RAI B;  2D0Q B;  2DO3 A;  4KUL A;  1M8V A;  1ZLM A;  1QWF A;  3CC2 A;  1BI2 A;  2VXF A;  2YT6 A;  3QJ6 A;  1M27 C;  2BE7 D;  3CMA T;  3MEW A;  2NUT A;  5KYU B;  2XIC A;  1UGV A;  3CCQ A;  2ED1 A;  1YWO A;  1VQ7 Q;  3MPU B;  1B34 A;  4C0F A;  1FXX A;  2JXB A;  1D09 B;  3HFN A;  3PMT A;  3TRE A;  3EGU A;  3X28 B;  3JCM W;  3A5Z B;  5GAN 7;  3J81 E;  2HMA A;  4EMK A;  4C92 F;  1WZO A;  2WAC A;  1D3B A;  4M7A D;  1G3W A;  4OML A;  3A8H B;  5FU6 B;  1OUL A;  1X6O A;  2VC8 A;  2O2O A;  3V8K A;  5FWB A;  1TSF A;  2DFU A;  1K9M U;  1VQ8 A;  3OYC A;  2P4R A;  1HSQ A;  5LJ5 j;  2GCX A;  1BIA A;  2RH2 A;  4C92 A;  1SPK A;  2DL4 A;  1JRI A;  4RCB A;  4C8Q C;  1JJ2 S;  2PTK A;  2E6Z A;  3VS4 A;  4DBF A;  5J39 A;  4HCC A;  4CRI A;  4LDV A;  3RIR A;  3M54 A;  2KBT A;  1UHF A;  3CCU A;  3G71 A;  1ZSG A;  4N0A C;  2W0Z A;  2KY9 A;  1A0N B;  2HD0 A;  2CSI A;  2K5F A;  1JB0 E;  4IUU A;  2E64 A;  5D7U A;  1LPL A;  4M75 E;  2K3Y A;  2R57 A;  3MJX A;  3PTA A;  1AZG B;  4A54 A;  2J05 A;  1OPK A;  4IUR A;  2LVM A;  1RAD B;  2DKG A;  1D0X A;  1RAA B;  3A8G B;  2BTT A;  3CPF A;  3M0U A;  1PSF A;  1H3H A;  2RNA A;  4E7L A;  3L42 A;  3CMA Q;  5CCA A;  4LNP A;  5A0L A;  1K8A R;  2DXC A;  1M90 R;  1TG0 A;  3VS5 A;  4M75 G;  3URG A;  4QVC A;  4IIM A;  1AWX A;  1VQP T;  3QDR B;  4LDU A;  5GAN e;  1M1K C;  3JSC A;  1R77 A;  5HCK A;  1TS9 A;  2OTJ Q;  4C5H A;  4E47 A;  4F7U B;  2XDP A;  4O6J A;  2VGN A;  3JCM g;  5CR2 A;  1YJ9 T;  2HQX A;  4RUG A;  1U3O A;  2AIR B;  4OB1 B;  3RNJ A;  2KRO A;  1FMV A;  4XTZ A;  5KYY B;  4J7I A;  5CAI A;  2LDM A;  4XQ3 A;  1G83 A;  1KC8 C;  4RCC A;  2DEU A;  2DTO A;  1TOV A;  3FRN A;  4ZN3 A;  5GAM f;  4C0Z A;  4M78 B;  4IKF A;  1VQ9 T;  1R0B G;  4OGC A;  3EGD A;  2HNI A;  4WF2 A;  4PK4 A;  4AG2 C;  3TSW A;  1WJR A;  2EJ9 A;  1MV0 B;  3OW2 S;  2P0Q A;  2DXU A;  3TCJ A;  2BKD N;  4GLM A;  1U5S A;  1TH7 A;  1IZ6 A;  2LQN A;  4PLI A;  2GQI A;  1T0J A;  2GF7 A;  4JJB A;  1ZUY A;  3E9F A;  2O31 A;  3SWN B;  4NOY A;  1UGR B;  4C92 C;  2GFA A;  3NPF A;  2DPP B;  3I5R A;  9ATC B;  5GMK m;  1UE9 A;  1JU5 C;  3M0S A;  4L5G A;  2JJ9 A;  2D9T A;  5DLO A;  3E19 A;  1W6X A;  5GAO r;  3A8M B;  4M7A F;  2DX1 A;  5GAM g;  1NYF A;  3CBM A;  2K2M A;  1UGS B;  1RUW A;  4FYV B;  3ASK A;  4N4G A;  2COZ A;  1UJ0 A;  4HCZ A;  1PHT A;  1VQK A;  1YJN A;  1KQS P;  3CBO A;  1PKS A;  3LW5 E;  4FU6 A;  1IRE B;  1V76 A;  4XAX B;  4M7A A;  4DBQ A;  2EQU A;  3P8B B;  5EC7 A;  1NEG A;  4XK8 E;  2DVE A;  3JB9 I;  2M1H A;  2JMC A;  3M58 A;  3LYI A;  2HQE A;  4RTT A;  1WYX A;  1ZSZ A;  1RAF B;  2DD4 A;  2ROT A;  1VQ6 Q;  1VQ4 T;  1WPY A;  2DRM A;  3LGF A;  4ZTJ A;  1M9S A;  3AHU A;  2DL8 A;  3ZL7 C;  3MP1 A;  1VQ9 Q;  2B86 A;  2L3R A;  1M2O A;  2FHD A;  2CT3 A;  1AT1 B;  2XG8 D;  2FZK B;  2RI3 A;  1UG1 A;  2HAX A;  1M2V B;  1X01 A;  1VQ5 A;  3SDZ A;  1OYX A;  3M0P A;  4JS5 A;  3KFV A;  2E70 A;  1M30 A;  2DZC A;  4JDS A;  1J3T A;  3OYM A;  3M57 A;  3G71 T;  2MMP A;  4F17 A;  4MML A;  4XTW A;  3AT1 B;  1K9M R;  2FO0 A;  1UDL A;  2K6D A;  1M5Q 1;  4ELZ C;  4LDY A;  4KRT A;  5LJ3 j;  1ARK A;  1V1C A;  1CKB A;  2O4X A;  5CK9 A;  1WJQ A;  4YTL A;  3CC2 Q;  4J6Y A;  2JW4 A;  3D7S B;  4OMQ A;  2HBW A;  1K73 U;  2A36 A;  3I56 A;  2IVW A;  3RMQ A;  4QQ6 A;  3MET A;  3CCQ Q;  1OQK A;  2ZPI B;  1SRL A;  2RQR A;  2WSC E;  4J9H A;  3RDV A;  4EPC A;  3CCE A;  3JRZ A;  2GTO A;  4M77 B;  5A0D A;  5CKE A;  2LC4 A;  2ZZD A;  1Y7X A;  1T3S A;  4OMM A;  1V29 B;  2JM8 A;  1QVG S;  4KGZ B;  3JB9 H;  1N9R A;  2EJG A;  4JZ4 A;  3PVL A;  3OA6 A;  2QQA A;  2KDS A;  2MI6 A;  2L8D A;  1I0C A;  5KYX B;  3OS2 A;  2CRE A;  1MNE A;  2YUN A;  3F70 A;  1KHC A;  2MWP A;  4M7A C;  1M3C A;  4X9C A;  4M7D D;  2K79 A;  2K7A A;  2LT4 A;  3OSV A;  4F16 A;  1NYG A;  3BFM A;  2LTO A;  1OEB A;  2KI7 A;  3GBQ A;  4B6M A;  1VQ8 Q;  2OTL A;  2LRQ A;  3RKY A;  1BI0 A;  3A98 A;  7AT1 B;  2X4W A;  4X34 A;  1KD1 U;  4D8K A;  1IGQ A;  4FSX A;  2YDL A;  1NBE B;  2LJ1 A;  2Y90 A;  5GAN 6;  3EG2 A;  3G71 Q;  3CCU Q;  2RPN A;  3QWY A;  3NTK A;  2V8K A;  3FDR A;  2KXC A;  3L2W A;  1WA7 A;  4E7Z A;  3FIF A;  3VS0 A;  5FRN A;  3CME T;  5KE3 A;  2LX9 A;  2DE0 X;  5KYW B;  3WXM B;  2CYZ B;  2M0Y A;  2QQ9 A;  1BCO A;  4RTU A;  2HEQ A;  4C0D C;  4J6X A;  4B9W A;  3G6E T;  3A8L B;  1YNZ A;  2D1X A;  1WXU A;  1VQK T;  1BBZ A;  1OPL A;  5FU7 B;  1NPP A;  5IHI A;  4BUG A;  4BE0 A;  1YJN T;  2OAU A;  1GFC A;  3CPW S;  1Y0M A;  3RUX A;  4AFQ C;  3I5S A;  2ROL A;  2DET A;  1F1B B;  4MZT A;  2RJC A;  3GNG A;  1WHK A;  3OBW A;  4JPB W;  2CH4 A;  4FT4 A;  1FX7 A;  2W10 A;  2EQJ A;  2WSF E;  2Y4Y A;  3JCM b;  4FL6 A;  1KQ1 A;  2JS0 A;  2V1R A;  2LMJ A;  1ZUU A;  4OB2 B;  3QYH B;  1UGQ B;  3M4G A;  1E6G A;  4NS5 A;  1NJI R;  1FMW A;  4X9D A;  1MMN A;  3CCM T;  3EGX B;  1PNJ A;  2EQM A;  2ZPE B;  4DEX A;  4CC2 A;  2KK4 A;  4BD3 A;  3HTR A;  4Q5W A;  1CKA A;  1D0Y A;  2DF6 A;  2RQV A;  5KE2 A;  2OAW A;  2FZC B;  4B9X A;  2DNU A;  1Q81 C;  1QMC A;  1X69 A;  1QKW A;  2E10 A;  2EW3 A;  4IUP A;  3JCM J;  3SD4 A;  1QLY A;  5GAN j;  2A08 A;  2LJ3 A;  3EG9 B;  3HP9 A;  1VQP A;  4ZN1 A;  3V8J A;  3H0F A;  4E7H A;  4N4H A;  2CUD A;  2DMO A;  3OBY A;  4M75 B;  4M77 E;  1G3S A;  3QHS A;  4M4Z A;  3VKI A;  4C8Q F;  4HVV A;  2HL5 C;  2NLU A;  2MPX C;  2VVK A;  2PVG B;  4PJO E;  1YJ9 A;  3CCV A;  3ULR B;  1JXO A;  1NLP C;  2DJZ A;  4C5E A;  3TQ7 P;  4J9G A;  4NL3 A;  4M7D F;  3JCM e;  3OYN A;  1OI1 A;  4ME7 A;  4C8Q A;  1VQK Q;  4M77 G;  2ZPF B;  4A4F A;  1YI2 T;  4E7J A;  1YJN Q;  2D0N A;  4IUT A;  1PRL C;  4PJO G;  4OB0 B;  1HYO A;  5HK3 A;  2NWM A;  2RJF A;  2HQH A;  3VS2 A;  3I55 A;  2RF0 A;  4BI3 A;  1X43 A;  4XTU A;  4M7D A;  4ZGD B;  5GMK e;  1FYN A;  2EAY A;  4IIO A;  3M0T A;  3ZEH A;  2FPD A;  4C0G A;  1X6G A;  2RQT A;  3REB B;  4XTY A;  1K73 R;  2BZY A;  5J3B A;  2M16 A;  2COY A;  4O5V A;  1O9S A;  1YHQ A;  1PD0 A;  4QQD A;  2L89 A;  4QQG A;  3MEV A;  1SG5 A;  1NM7 A;  1W1F A;  2KRM A;  3OYY A;  4NL2 A;  3TSZ A;  1MV3 A;  1YIT T;  3BDU A;  4AT1 B;  2VGM A;  1QP2 A;  2E41 A;  1MND A;  1EFN A;  4OGE A;  3L2U A;  1VQ5 Q;  1OV3 A;  4M78 D;  3ZFJ A;  1QQJ A;  1JEG A;  3I9Q A;  3PVQ A;  4XTX A;  2EIF A;  5IN1 A;  1I5L A;  3EFO A;  2F1L A;  2C0T A;  4LDW A;  2NUT B;  4BI4 A;  5GAM e;  1Q86 U;  1AVZ C;  2CSQ A;  1WFW A;  4TVR A;  4PJM A;  2QGG A;  3RES A;  1B34 B;  2XU8 A;  5A0G A;  1UEB A;  2DIL A;  4J9I A;  3CPW P;  4DA4 A;  2X9H A;  4OMO A;  2XK0 A;  4DOW A;  3UPU A;  4MMK A;  1KD1 R;  2RM4 A;  1WIE A;  2BZ8 A;  3JB9 G;  1RAB B;  4EMK B;  2LNH B;  3EHQ A;  4R0K A;  2EYY A;  3WVE B;  4ZGE B;  1VQ4 A;  3I56 Q;  4FSS A;  4BI8 B;  4FCY A;  5KCH A;  1KQS S;  3CCE Q;  2X4X A;  3OYG A;  3CC7 T;  1BI3 A;  3M4Y A;  2DA9 A;  1BB9 A;  1LNX A; 
#chains in the Genus database with same CATH homology
 1W6X A;  5IHK A;  2L3S A;  1VA7 A;  3R6N A;  5GJV B;  1X27 A;  3VRZ A;  2DX1 A;  2YUP A;  4EIK A;  2PNI A;  2SRC A;  2KYM A;  1NYF A;  2K2M A;  1RUW A;  3FJ5 A;  1KFZ A;  1E7O A;  1UJ0 A;  2H8H A;  1T0H A;  1PHT A;  2JM9 A;  4OMN A;  1GCQ C;  1RI9 A;  2AZV A;  1PKS A;  3M0R A;  2DBK A;  3SEM A;  1QKX A;  4RTY A;  4AFU C;  1GCQ A;  4X1V A;  1X2Q A;  5EC7 A;  1NEG A;  1ZUK A;  2FEI A;  2JMC A;  2FRW A;  5L23 A;  4RTT A;  3REA B;  1WYX A;  1BU1 A;  2X3X D;  4JZ3 A;  1WX6 A;  2ROT A;  1SSH A;  2AKL A;  2F2W A;  3M0Q A;  2EGE A;  4AFS C;  4F14 A;  1TUC A;  2DRM A;  2LQW A;  2DL7 A;  1K0S A;  2ED0 A;  2DL8 A;  4LUD A;  3VS7 A;  1CSK A;  3ZL7 C;  2EPD A;  1WXB A;  2B86 A;  4Z88 A;  1UFF A;  2EKH A;  1T3L A;  3VS6 A;  2E5K A;  2ECZ A;  2GTJ A;  2CT3 A;  2HDA A;  1OOT A;  5IXF A;  1UG1 A;  1VYV A;  1AZE A;  3M0P A;  2FPF A;  2ESW A;  3IQL A;  2CT4 A;  3KFV A;  1RLQ C;  1M30 A;  2DYB A;  1J3T A;  2FG0 A;  2YSQ A;  1Y57 A;  2O88 A;  4F17 A;  2KE9 A;  1VYT A;  3U23 A;  2FO0 A;  1UDL A;  4QT7 A;  2K6D A;  4ORZ A;  1H92 A;  1I07 A;  1KJW A;  2ABL A;  2L3Q A;  2LCS A;  4J9B A;  4KRT A;  2V1Q A;  3EG1 A;  2RMO A;  2KRN A;  1E6H A;  1X2K A;  1ABO A;  1ARK A;  1V1C A;  2J06 A;  1CKB A;  1B3Q A;  2I0N A;  2K3B A;  1NLO C;  3THK A;  1SEM A;  2DL3 A;  2FRY A;  2JW4 A;  4OMQ A;  4JJC A;  2AKK A;  1K1Z A;  4RTW A;  2HBW A;  1SHF A;  2A36 A;  4OMP A;  1RLP C;  2D8J A;  3UAT A;  1VYU A;  1SRL A;  2RQR A;  4J9H A;  2EVR A;  3I35 A;  1HD3 A;  2L0A A;  2GTO A;  2KRS A;  3CQT A;  1T3S A;  2XMF A;  1PRM C;  2OJ2 A;  4OMM A;  1JXM A;  2JM8 A;  1SRM A;  3C0C A;  4HVW A;  4J9C A;  4JZ4 A;  2FPE A;  3PVL A;  1X6B A;  2DLP A;  4RTX A;  1UJY A;  1WI7 A;  5I11 A;  1YWP A;  1I0C A;  3NMZ C;  2CRE A;  4J9D A;  1AEY A;  1UHC A;  1M3A A;  2YUN A;  1HJD A;  2GBQ A;  1UTI A;  2KEA A;  2KGT A;  2F2V A;  1M3C A;  4Y92 A;  3H0I A;  5I22 A;  2K79 A;  2K7A A;  1H8K A;  1K9A A;  3H0H A;  3EG3 A;  4CC7 A;  1NG2 A;  4F16 A;  1NYG A;  4DEY A;  1OEB A;  3GBQ A;  1K76 A;  1FMK A;  2KYB A;  2AK5 A;  1WXT A;  5FW9 A;  1AWJ A;  3A98 A;  4HXJ A;  4D8K A;  1Z9Z A;  2D8H A;  2YDL A;  1GBQ A;  1AOJ A;  2LJ1 A;  3EG2 A;  2RPN A;  3VS1 A;  2IIM A;  3QWY A;  1YCS B;  1K4U S;  2EYX A;  2C0O A;  2BZX A;  2VKN A;  2KXC A;  1WA7 A;  3VS0 A;  2DVJ A;  2JMA A;  2EYZ A;  4RTZ A;  2DE0 X;  2JT4 A;  2C0I A;  5GJW B;  4ESR A;  2L3P A;  2G6F X;  2KXD A;  2M0Y A;  1XOV A;  1QCF A;  1GBR A;  2DM1 A;  1K0X A;  2DBM A;  4RTU A;  1GRI A;  2VWF A;  3PE0 A;  2HEQ A;  2EGA A;  1YN8 A;  2DJQ A;  1GL5 A;  2SEM A;  3EG0 A;  1YNZ A;  3JV3 A;  3RBB B;  2D1X A;  1JQQ A;  1S1N A;  1WXU A;  1UUE A;  4CC3 A;  2HCK A;  1BBZ A;  1OPL A;  5IHI A;  1MUZ A;  2ENM A;  1GFC A;  1Y0M A;  3TVT A;  1M8M A;  4AFQ C;  2MOX A;  1WLP B;  4GBQ A;  4WCI A;  1ZX6 A;  3SHW A;  3I5S A;  1YP5 A;  2ROL A;  2PZ1 A;  2J6K A;  1WDX A;  1SHG A;  4JPB W;  2CH4 A;  1ZLM A;  2W10 A;  1QWF A;  1B07 A;  4K11 A;  5IXB A;  2YT6 A;  4LN2 A;  2JS0 A;  1AWW A;  2V1R A;  1M27 C;  2LMJ A;  3VS3 A;  1ZUU A;  2A37 A;  2EGC A;  1UGV A;  1E6G A;  2ED1 A;  1YWO A;  1PKT A;  2JXB A;  4J9E A;  1AD5 A;  1PNJ A;  3EGU A;  4DEX A;  4CC2 A;  1CKA A;  3VRY A;  2EQI A;  2L2P A;  1KIK A;  2CH4 W;  2DF6 A;  2DL5 A;  2RQV A;  2OAW A;  2J6O A;  2DNU A;  5FWC A;  2EYW A;  1X69 A;  1BK2 A;  2DRK A;  1QKW A;  2EW3 A;  1QLY A;  4OML A;  5IH2 A;  2A08 A;  2LJ3 A;  3NGP A;  1N5Z A;  3H0F A;  2LJ0 A;  2O2O A;  4JJD A;  2CUD A;  2DMO A;  2NUZ A;  2LZ6 B;  5FWB A;  2YUQ A;  4M4Z A;  4HVV A;  4AG1 C;  2P4R A;  1HSQ A;  3EHR A;  2VVK A;  4A63 B;  4LUE A;  1SPK A;  2RQW A;  1QWE A;  2DL4 A;  1JO8 A;  3ULR B;  2PTK A;  1JXO A;  1KSW A;  2CDT A;  1NLP C;  3NHN A;  3VS4 A;  4J9F A;  1GCP A;  2KBT A;  4J9G A;  2RQU A;  4CC4 B;  1UHF A;  2LP5 A;  1ZSG A;  2W0Z A;  2JS2 A;  4Z8A A;  2J7I A;  1A0N B;  4E6R A;  1M3B A;  2CSI A;  1G2B A;  2CUB A;  2D0N A;  2OI3 A;  1PRL C;  1AZG B;  2J05 A;  1OPK A;  2NWM A;  1ZBJ A;  2O9V A;  3VS2 A;  2KR3 A;  2RF0 A;  1X43 A;  2BTT A;  2GNC A;  1GFD A;  2KNB B;  1FYN A;  3H41 A;  3M0U A;  4IIO A;  1H3H A;  2GGR A;  2RNA A;  2FPD A;  3M0T A;  1X6G A;  2EBP A;  1I1J A;  2RQT A;  3REB B;  2LX7 A;  4LE9 A;  2BZY A;  4LNP A;  3QWX X;  1TG0 A;  4RTV A;  3VS5 A;  2KT1 A;  3UF4 A;  4IIM A;  1W70 A;  1AWX A;  1NM7 A;  1W1F A;  2KRM A;  5ECA A;  5HCK A;  4Z89 A;  3TSZ A;  1MV3 A;  1PWT A;  2QDL A;  1EFN A;  4RUG A;  1U3O A;  3UA6 A;  2A28 A;  2F2X A;  1OV3 A;  1JEG A;  1UEC A;  3I9Q A;  2KRO A;  3PVQ A;  3RNJ A;  2K9G A;  4D8D A;  1Z9Q A;  2RN8 A;  2C0T A;  1G83 A;  4ZNX A;  1AVZ C;  2CSQ A;  1WFW A;  4HCK A;  3UA7 A;  1ABQ A;  2KT8 A;  3O5Z A;  2MIO A;  1NEB A;  1IO6 A;  2DIL A;  4J9I A;  4OMO A;  2O9S A;  4HVU A;  1WIE A;  2BZ8 A;  2M51 A;  4AG2 C;  3TSW A;  1MV0 B;  2AZS A;  2LNH B;  2JTE A;  2X3W D;  3EHQ A;  1AWO A;  4GLM A;  2EYY A;  4R0K A;  1U5S A;  2LQN A;  2YUO A;  2GQI A;  1T0J A;  1U06 A;  4JJB A;  1ZUY A;  2J6F A;  2O31 A;  4FSS A;  2HSP A;  2MCN A;  4AFZ C;  3NPF A;  3I5R A;  3LH5 A;  5IHN A;  1UE9 A;  1JU5 C;  2DA9 A;  1TUD A;  3M0S A;  1LCK A;  1BB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...