4AFZC

Human chymase - fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
b'VTLFVALYDYNATRWTDLSFHKGEKFQILEFGPGDWWEARSLTTGETGYIPSNYVAPVDSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
molecule tags Hydrolase/de novo protein
source organism Homo sapiens
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
total genus 11
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afzC00
1KIKA 2KRSA 2RQUA 2JT4A 1E6HA 2LQNA 2D8JA 1X43A 2RQWA 4ZNXA 1UFFA 2CREA 1K1ZA 2GNCA 2E5KA 4CC3A 2EYWA 2YDLA 2FPFA 2RPNA 2DE0X 3PVQA 2J05A 2F2WA 1W6XA 2FEIA 2FO0A 4X1VA 4HCKA 2C0TA 2MIOA 1X69A 2LJ0A 2P4RA 1UG1A 1AWJA 4OMPA 2A37A 2DX1A 2DL8A 1CSKA 2ED0A 1AVZC 3EG3A 4M4ZA 2I0NA 1SRMA 4HVUA 1BK2A 4LE9A 2ROLA 2JM8A 4IIOA 2JW4A 3M0PA 1JEGA 4J9DA 1GRIA 1NEBA 1NYGA 1WX6A 4AG1C 5ECAA 2L3QA 3EG1A 2HDAA 4JJDA 4HVWA 3PE0A 3VS7A 2EBPA 2VWFA 4OMMA 3H41A 1TUCA 1CKBA 4AFUC 1WXBA 4CC4B 4RTUA 2OJ2A 1UGVA 2NWMA 3O5ZA 2KEAA 3VS1A 1AOJA 2JS2A 1OPLA 2EQIA 3I9QA 2CH4A 1T3LA 2G6FX 1ZUYA 4RTXA 1GBRA 2O88A 4K11A 2YSQA 5FWCA 2PZ1A 4JJCA 3M0QA 5I11A 4CC7A 1AD5A 2L0AA 2O9VA 4J9BA 1GCPA 5IXFA 2DF6A 2HSPA 2PNIA 4J9GA 3VS0A 4LNPA 1LCKA 2SEMA 1AWXA 3CQTA 2KNBB 2LZ6B 1ZBJA 1J3TA 4ESRA 3THKA 1BU1A 1WYXA 1W1FA 2ABLA 2J6OA 3I35A 2K3BA 1AWOA 1NEGA 2DBMA 3VRZA 2JS0A 2QDLA 1VYVA 2B86A 1E7OA 3UA6A 1NYFA 1KFZA 1VYTA 5IHKA 1ZLMA 3KFVA 1K0XA 4OMNA 4OMLA 2FRYA 2FRWA 2KYMA 1WDXA 2DVJA 2V1QA 4WCIA 2LNHB 2A28A 2K79A 1VA7A 2CSQA 3UATA 1G83A 2BZYA 1WFWA 2JMAA 2J7IA 1YNZA 4LUEA 2C0OA 1UJYA 2A08A 2EGCA 2XMFA 4RTWA 3EGUA 2KBTA 2SRCA 2KR3A 1QWFA 4Z8AA 4J9CA 1HJDA 1M8MA 1N5ZA 3NPFA 3R6NA 1H8KA 4Z88A 3NHNA 1QKXA 2KE9A 2K2MA 5FW9A 2KYBA 3U23A 1E6GA 3QWXX 5L23A 1RLPC 2ECZA 1WA7A 1TG0A 1AZGB 1G2BA 3REAB 2DL7A 1I07A 2W10A 5HCKA 1MV3A 3H0IA 4HXJA 1B3QA 1SHGA 2MCNA 1V1CA 3ULRB 4F14A 4AG2C 1PRLC 1NLOC 1X2QA 3M0RA 1PWTA 2MOXA 2FG0A 4JPBW 2EYYA 2HBWA 5IHNA 2HEQA 1ZUUA 2YUQA 1OOTA 1ZUKA 1H3HA 1AWWA 3VS5A 2EYZA 4LUDA 1B07A 4AFQC 1W70A 1AZEA 3TSZA 5GJVB 2DL3A 1RUWA 3LH5A 2AK5A 1Y0MA 2CT3A 1WLPB 1HSQA 1U3OA 1QCFA 2LQWA 1H92A 4JJBA 1X6BA 3RNJA 1GFCA 2L2PA 1ZSGA 3H0FA 2VVKA 2AKLA 2KXCA 4Y92A 2AZSA 4OMOA 2L3SA 2DRKA 1M27C 2CUDA 2KGTA 3RBBB 3EHQA 1UECA 2A36A 2JMCA 1YWPA 1M3BA 1A0NB 1NLPC 2HCKA 1T3SA 4J9EA 2GBQA 3IQLA 2RQRA 1MUZA 1UTIA 1QWEA 2DRMA 3M0TA 1K0SA 1T0HA 2PTKA 4QT7A 2M0YA 4AFSC 2BZXA 3GBQA 3SEMA 4LN2A 3EG0A 2D8HA 2D1XA 1JXOA 1Z9QA 2IIMA 2GTJA 1RI9A 2KT1A 1EFNA 2KXDA 3TVTA 2NUZA 2DM1A 1JXMA 4GLMA 1VYUA 3EHRA 1QKWA 2X3WD 4FSSA 2RNAA 2CUBA 2RF0A 1K4US 4DEXA 4GBQA 1OEBA 1X2KA 2JM9A 1WIEA 2FPEA 2M51A 1Z9ZA 1OPKA 3QWYA 2LMJA 2V1RA 2RN8A 2BZ8A 2H8HA 4A63B 4ORZA 2J6FA 1K9AA 1PRMC 3ZL7C 3H0HA 5IH2A 1MV0B 4EIKA 4AFZC 1KJWA 1JU5C 4KRTA 2EGEA 1AEYA 2LCSA 4JZ4A 2CDTA 1GCQC 2KRNA 2JTEA 2GQIA 4JZ3A 3VS4A 2ESWA 2AKKA 2K6DA 2CH4W 5IXBA 3VS3A 1OV3A 1TUDA 1M30A 2CT4A 1KSWA 1GCQA 3TSWA 1SSHA 2DA9A 1PKSA 2GGRA 1I1JA 3M0UA 1ABQA 4RTZA 1UDLA 2YUPA 1S1NA 2ENMA 1GFDA 1HD3A 2JXBA 2BTTA 3A98A 1BBZA 1FYNA 1UHFA 2K7AA 2OAWA 1U06A 4RTTA 4Z89A 2RMOA 3I5SA 1ZX6A 4OMQA 2EPDA 3VS6A 1ARKA 2DYBA 2LX7A 1ABOA 1UHCA 2X3XD 2DNUA 3VS2A 3EG2A 4F16A 1SEMA 2O31A 2EGAA 1CKAA 2F2XA 2O2OA 2DL5A 2DJQA 2ROTA 3JV3A 4RUGA 2CSIA 1YP5A 1JQQA 3REBB 2KROA 1WI7A 5IHIA 1M3CA 1PHTA 2RQVA 2C0IA 2FPDA 1PNJA 3NMZC 1IO6A 4DEYA 1SRLA 1M3AA 4D8KA 1UE9A 2EVRA 1GL5A 2K9GA 4RTVA 2F2VA 1I0CA 1T0JA 3UF4A 2D0NA 2DLPA 2ED1A 2GTOA 1X27A 2YUNA 3PVLA 2OI3A 2YT6A 1PKTA 1YWOA 2EKHA 4R0KA 2W0ZA 1FMKA 1RLQC 5EC7A 1UUEA 4D8DA 3C0CA 2RQTA 1NG2A 1QLYA 2LJ1A 2LP5A 2KT8A 1GBQA 2DILA 2J06A 4IIMA 4HVVA 5FWBA 1WXUA 2YUOA 3I5RA 2J6KA 4CC2A 2O9SA 2AZVA 1YCSB 1Y57A 2EYXA 3SHWA 3M0SA 1NM7A 1XOVA 1JO8A 2DMOA 2DBKA 1BB9A 3UA7A 1UJ0A 1K76A 4RTYA 2VKNA 2KRMA 1U5SA 2EW3A 4J9HA 5GJWB 3NGPA 1X6GA 1SPKA 4J9IA 2L3PA 2LJ3A 4J9FA 4F17A 3FJ5A 3VRYA 2DL4A 1YN8A 5I22A 1SHFA 1WXTA 4E6RA
chains in the Genus database with same CATH superfamily
1KIKA 1XJWB 3CD6A 2RQUA 1NE8A 4OGEA 5FU7B 1OZ3A 4M7DC 4LDVA 2D8JA 5J3BA 5HK3A 4L6V5 1JJ2A 3A8GB 1WQWA 2QEXT 5GAMj 4CC3A 2DFUA 2FPFA 2D6FA 1QVGP 2IG0A 1Q7YU 1N9SA 2RPNA 3JRZA 2DE0X 3JCMb 2J05A 4XTZA 3BFMA 1D09B 3CBMA 1W6XA 5LJ3h 3HRTA 2MIOA 4C8QG 3OW2P 5KYNA 4ZGDB 1X6OA 3OB9A 3EG3A 1KG1A 4BI4A 4E7LA 2JM8A 4IIOA 2JW4A 3JCMP 4J9DA 1NJIU 2ATCB 3JCMW 2QAZA 2BIVA 1WX6A 4AG1C 2EJGA 3TREA 3MEVA 2L3QA 3EG1A 1B34B 2K5IA 3M59A 3ZBDA 3EGXB 4GLKA 2HZYA 3VS7A 3H41A 1TUCA 1CKBA 2RB6A 1WXBA 2OJ2A 1UGVA 2KEAA 5I21A 4F7UB 1ZBXA 3LLRA 1OPLA 4HCZA 3OW2A 2EQIA 5FROA 4KUDK 5FU7C 4LDXA 2G6FX 1VQ5Q 2QQBA 3QJ6A 3CCJT 1U1SA 3CCLA 1GBRA 3ER0A 2O88A 2LQ8A 1FMVA 3CCRA 1KQSP 2RJFA 3OS0A 2PQWA 1AD5A 2OX7A 2XDPA 2O9VA 1VQMQ 1LJOA 2PNIA 4IUPA 4M77F 1LCKA 4N0AA 2MMPA 3CQTA 2LZ6B 4UC4A 1D1BA 4Q5WA 3S6WA 1UGQB 3L42A 4ESRA 4XU1A 1ACMB 1BU1A 1VQ4A 2J6OA 1VQPQ 2K3BA 3QIIA 1NJIC 2V8JA 4M7DD 4C0FA 1VIFA 1VYVA 1D0YA 2Y4YA 1ZLMA 1K0XA 1W2BS 1BIAA 1B34A 3OYFA 3HRUA 4C92D 2FRWA 1WDXA 2DVJA 5DLOA 5GAMh 2V1QA 1UGPB 2LNHB 3G4SQ 1Q81R 2CSQA 4M77E 1Q7YC 3JB9H 2JMAA 2J7IA 4O5VA 1NBEB 2F1LA 3JSCA 3FDRA 3CC4Q 4RTWA 1WHLA 3M54A 3EGUA 4M75C 4F7UA 2KBTA 1QWFA 2EWNA 1WHHA 3VKIA 4DBHA 2ZPEB 2EJ9A 4ATOA 3Q1JA 2ZGWA 2ZPHB 3VV0A 1VQOA 3L2VA 1I5OB 1K8AR 3QZ5B 5KYWA 4M7DB 2QQRA 3LYIA 1M1KC 1K8AC 3CMAA 2ECZA 4C92G 4MZPA 3QJYA 1G2BA 4M7AA 2Y4XA 2MCNA 3ULRB 2DTHA 3CCEQ 3NFCA 1V76A 1PCXA 4YTLA 1PWTA 1FWZA 2RHIA 3X20B 5HK0A 2HEQA 4XK8E 1YJNQ 4BE2A 1N9RA 1RAEB 1H3HA 5LJ5j 3JCMc 3OY9A 2O4XB 1Q95G 3JCMQ 4JJNK 1HSQA 1G3YA 3JB9D 4PNOA 1F1BB 1X6BA 3RDVA 2CP6A 3H0FA 3NTHA 3M53A 3CCMA 5IAYA 4FSXA 2XKOC 5GANj 3VYHB 1M27C 2CUDA 2KGTA 3CCEA 4XQ3A 3CPWS 2AIRB 3G1JA 2JMCA 1C0MA 3RR6A 1VQ6Q 1A0NB 1NLPC 2ZPGB 1T3SA 2RK1A 1Y07A 4J9EA 1K73U 2LNVA 2EQUA 2CZ1B 2GBQA 3P8BB 2L3RA 3SDZA 3FC3A 1LOJA 5KYYB 4QT7A 1MMDA 4PLLA 4AFSC 2BZXA 2EAYA 2YRVA 3EG0A 4J6YA 3QPHA 1HYOA 4OB0B 1Z9QA 1XNIA 3CCLT 2CS7A 2RHZA 1EFNA 5L8RE 1RACB 3UDCA 4MMLA 3M57A 4GLMA 4DOWA 3HFNA 2XIDA 4JRPA 1YITT 2ZPBB 1S72T 2VV5A 2QA4T 2QDYB 4D6WA 5LJ5d 1YJWT 2JM9A 5CIUA 3QZ9B 1Q86R 1VQNT 3J7AF 2QGGA 1OPKA 2EQMA 5GAN3 1N6AA 4ANJA 4A63B 2YHTA 1KQ2A 1IZ6A 4M78B 3L1AA 3RESA 1G5VA 3OYBA 2EFIA 2HMAA 3EGDB 4KRTA 4Z02A 4FYWB 5GANd 3G7ZA 2CDTA 1GCQC 2JTEA 4JZ3A 3VS4A 1WJRA 4XTVA 3CCQQ 1BI0A 3RKYA 3I55A 3VS3A 4ZN3A 1OV3A 4C92A 3G4ST 2LCCA 4M75F 3JAME 2DTOA 5D6XA 2CT4A 4J5YA 4LD9K 2FZKB 2GGRA 4F04B 4F7UF 3OYIA 5KE2A 3GNFB 3FJPA 4A4GA 4PK4A 4RTZA 4FCYA 1YITA 1S1NA 2ENMA 1TWBA 1HD3A 1IB8A 1C1AA 5C6SA 2E10A 3JCMJ 4RTTA 4OMQA 1XQHA 3CMEQ 4FYVB 2K3YA 1ARKA 5I2MA 3TU4K 3OYKA 1VQKT 3GNGA 4J7FA 2YLBA 3CCRT 2XI9A 1SEMA 2D0QB 2DJQA 1QCOA 1UEBA 2L89A 4M7AF 4PJOG 1VQOQ 2E64A 3X28B 4C8QF 3PIOA 4KT0E 3EGXA 2P0PA 2RQVA 4PJOE 2C0IA 5GAN8 3QUIA 3BDLA 3CCVA 2E70A 2EVRA 5KYXA 1QQJA 4M7AD 4A54A 1JJ2S 2ED1A 4OB1B 2XDDA 1MNDA 3CCMT 1UGRB 4R0KA 1FMKA 2EJFA 1UUEA 1SF9A 1MMAA 2CGHA 3L2WA 4C92B 3V8KA 2DILA 1WXUA 4BY6B 4R56A 3MEWA 2O9SA 3CCUQ 1YCSB 2EYXA 1OI1A 3M0SA 3CC2Q 1NM7A 1PSFA 1JO8A 4PJOD 2DMOA 2DBKA 1UJ0A 2RK2A 2KRMA 4B6MA 1OU9A 2BE7D 1KC8R 3CMAT 4B9XA 3RIRA 1SPKA 4N4GA 1RAIB 2LJ3A 4F17A 4KGXB 2OTJT 1SHFA 1YIJA 3EH1A 2RHYA 2KRSA 4OGCA 1E6HA 2LQNA 3L2ZA 4N4HA 1Q86C 1UFFA 2CREA 2P4TA 4M75E 1IREB 2YDLA 1X01A 3INZA 2VXFA 2F2WA 1EZZB 3OMGA 3QXEB 4X1VA 4HCKA 2C0TA 3N5BB 2P4RA 4Y28E 1AWJA 2XD0A 3LGFA 1AVZC 3CC4A 3QDFA 4XU2A 4HVUA 4FM4B 3OYNA 1GRIA 4PLIA 1NYGA 5ECAA 3CCQT 2QASA 3CD6T 3EFSA 4XTUA 1DJ7B 2JTMA 2DTIA 1UGSB 3PE0A 5CKBA 3QYHB 4AFUC 3S3NA 4E7HA 4RCBA 1YIJT 1ZQ1A 3CCVT 3O5ZA 3VS1A 1M1KU 3M4YA 3CCSA 1ZUYA 3R6OA 1U1TA 4V2SA 2JVVA 3V7CA 5FWCA 2PZ1A 2VGMA 4KBMB 2QEXA 2MWPA 1KQSS 3M0QA 3SWNB 4CC7A 1C6VX 4KULA 3M55A 4J9BA 1GCPA 4P5NA 2VB6A 2RO0A 5GMKh 1VQMA 2CP7A 4OVAA 1AWXA 2ZPFB 2K4YA 2EIFA 4M7DA 2O4XA 1WYXA 1W1FA 4J83A 3VRZA 2DXTA 4L59A 2JS0A 3JCMf 1LVKA 3G6ET 3KFVA 2K2VA 3CMET 4LDYA 3BDUA 3DLMA 3CPWP 3P8DA 2KMTA 1D1CA 5AT1B 2KYMA 1Q82U 2RHXA 4A4EA 2LVMA 3S3OA 2WACA 4CI0C 2K79A 1I81A 5KH6A 2NUTA 1WHKA 1D3BA 1WFWA 3EFRA 2YRCA 5HKCA 1B7TA 3O8VA 3SB2A 2SRCA 2ZAEA 5CKHA 1YJNT 5GAMf 4BUGA 2HSEB 5GAN7 1N5ZA 5CAIA 2COZA 3NHNA 2R58A 3GOXA 3QG1A 2KE9A 2K2MA 4PFPA 3A1PA 2DAQA 3QYGB 3RKWA 6AT1B 1VQ8Q 1IHVA 3JCMX 2DKGA 2CP0A 4DBFA 2KAFA 3QWXX 3V8LA 2HD0A 1WA7A 3FLGA 1AZGB 1YJNA 3EAEA 2WSEE 1MV3A 3OSVA 1K8AU 3JB9G 4HA8A 3CCUT 4PJOA 1V1CA 4HKEA 4AG2C 1WNLA 1N8RU 2XK0A 4N0AC 4RG2A 1X2QA 2GFUA 2DD4A 3M0RA 4JPBW 1KQSA 4M7AC 3VS5A 3OW2S 1B07A 4M7AB 3ASKA 1M2VB 3TSZA 2DL3A 1D1AA 2X4XA 3HP9A 1Y0MA 4ZTFA 1TH7A 2CT3A 2CYZB 1U3OA 1QCFA 1YBYA 3CMEA 4M77D 2LQWA 3MJXA 4JJBA 3FIFA 3HSBA 1ZSGA 2K57A 2PUOB 3OYDA 4Y92A 3CCQA 2EQKA 1TU0B 4A4HA 3JB9I 1OX9A 4ZGJB 1KD1R 2A36A 4FW2A 5LJ3e 3RUXA 1YWPA 5LL6S 4BDZA 3MO8A 4QVZA 2X4JA 2RQRA 2PU9B 4E7SA 2O01E 3EFOA 3QBYA 1K0SA 2DZCA 3CBOA 2E3IA 2PTKA 4C8QE 1VQ6T 1K9MR 5DLQE 3GBQA 4XTXA 4C5GA 1KHCA 4J7IA 1JBMA 4LN2A 1YI2Q 2D8HA 2WSFE 1RAFB 2HQXA 1VQ8A 1YCYA 2QGFB 4AMCA 2RH2A 3QO3A 2DYIA 2JZ2A 1BCMA 2KT1A 3EG9B 4RG8A 4IUUA 3CCJQ 3BE3A 1VQLQ 1JXMA 4J6WA 4XU3A 2E5QA 2JN0A 3OA6A 4QKUA 2RNAA 2CUBA 1K4US 4NL2A 3I56A 3CCET 2RHUA 3VUBA 1WIEA 2M51A 3OS5A 2E4HA 2DETA 1Z9ZA 3OYGA 5FU6C 2V1RA 5FLXE 4IUVA 2VUBA 2BZ8A 4EDUA 4ORZA 2J6FA 2FZCB 1PRMC 5FRMA 3ZL7C 5GAOl 3CPFA 4BI8B 5IH2A 1ZSZA 5GAOq 1MV0B 2QI2A 1K9MU 1PC0A 1KJWA 1JU5C 5GAOp 4CRIA 1VQ6A 4C92C 5CKDA 4JZ4A 3FB9A 4OP0A 2KRNA 2E6NA 2CH4W 3M56A 5GMKl 1TUDA 1BI2A 1LNXA 3MHXA 5J26A 2COYA 3MCAB 1GCQA 3FEOA 3TSWA 2DXBA 3OYMA 9ATCB 1SSHA 2QYZA 1PKSA 1I1JA 2VYTA 5KE3A 1QVFP 3I56T 1QP3A 1UDLA 2X35A 1JRIA 1YJ9Q 3A98A 2RJCA 1BBZA 2RA2A 3G6EQ 4DBRA 4XAXB 2X51A 3I5SA 1MMNA 1AT1B 1G8XA 2MPXC 3AT1B 1ABOA 2DNUA 3VS2A 2QK0A 4M78C 2EGAA 4M78F 1CKAA 1WQ7A 3MP6A 3QDRB 3M5AA 2F2XA 2O2OA 2DL5A 2ROTA 3JV3A 3RKXA 1VQLA 1ZSZB 4RUGA 4E7ZA 2CSIA 5LJ5f 2LT4A 1YP5A 3JCMV 1PHTA 3NMZC 5A2QE 1IO6A 4OF1A 4DBQA 4C5HA 1M3AA 2EQJA 5LJ3j 1BIBA 2GQVA 2K9GA 4RTVA 3A8OB 1Y96A 4QVDA 3UF4A 2RM4A 4PFZA 3H6ZA 1MGQA 3PVLA 1YWOA 1VQNQ 3C0CA 2LJ1A 1OQKA 4QQ6A 5D6WA 4IIMA 3CCMQ 4F7UE 1M90R 1Y57A 3SHWA 1XOVA 1TTHB 4IKFA 3NTKA 3CCSQ 1EX4A 1WZOA 3MPUB 1YI2A 3GF5A 2CP3A 1TOVA 3GIBA 3VUZA 4J9HA 2EW3A 5GJWB 3PT9A 3NGPA 1X6GA 1UB4A 4J9IA 4FU6A 1D0ZA 4M77G 1KC8U 3OYYA 3CCLQ 2EYQA 5LJ5e 2KY9A 4FYYB 4QQDA 1JJ2P 3F70A 2NUPA 1VQPA 1M8VA 2JTFA 3PFSA 2JT4A 1X43A 2A0FB 4ZNXA 3L2QA 1K1ZA 2E5KA 2NLUA 4M75A 5GANe 1YI2T 2AHJB 2GF7A 3DLLA 1W4SA 1VQ5T 1X69A 2LJ0A 3M9QA 4M77B 1QCNA 2A37A 2DX1A 2DL8A 1CSKA 1VQ7A 4M78A 4BACA 1HXDA 4M4ZA 4DA4A 1V29B 2ROLA 3M0PA 1JEGA 3C94A 5EG2A 1KD1C 4JLIA 3H8ZA 1BCOA 1KK7A 2QQSA 1ZHIA 4PJLA 2HDAA 2V8KA 4HVWA 4WF2A 4X9CA 2EBPA 5CKEA 1Y71A 2VWFA 4A4FA 1VQ4T 4CC4B 4RTUA 1NPRA 1K9MC 2KK4A 4M7AE 2NWMA 2GCXA 2JS2A 1IGUA 2CH4A 1T3LA 1FXXA 5CQYA 5GAOn 1SKUB 4OB3B 2E65A 1R0BG 1WHJA 4FT2A 1YJ9A 5I11A 2XU8A 1N27A 2HKNA 1WHMA 2L0AA 4C5IA 5IXFA 2DF6A 2HSPA 1QMCA 3CXCP 2KNBB 1ZBJA 1J3TA 1NPPA 2ZPIB 3LWIA 2QEXQ 4E7IA 3VU3C 4C0DB 2AT1B 4KUIA 1RAAB 3THKA 4C8QB 2ABLA 3I35A 1AWOA 1NEGA 2DBMA 2B86A 2FL7A 3UA6A 4EMGA 1KFZA 5IHKA 5LJ3d 1MHNA 2VGNA 3JCMe 4OMNA 4OMLA 2FRYA 5A0LA 2YLCA 2P0KA 2A28A 4C0GA 2HL5C 1VA7A 3UATA 1G83A 2BZYA 1Q82R 2X9HA 2M1HA 2JUFA 1FMWA 3CC2A 4IURA 1UJYA 2FHDA 2A08A 2XMFA 3M4GA 2FYKA 2MK5A 2KR3A 2KQWA 3CCVQ 1I8FA 4J9CA 1I5LA 1HJDA 2IPOB 1M8MA 3HPWA 2KSSA 1PSEA 3NPFA 3R6NA 1H8KA 5J39A 1QKXA 4A53A 2DJZA 2KYBA 4KGZB 4C92E 3OYCA 1E6GA 2CZ0B 4DOVA 1RLPC 2E41A 1TG0A 2KDSA 4EPCA 3D7SB 3REAB 1YITQ 4DQ2A 2DL7A 1TSFA 1I07A 3C4SA 2W10A 4M7DE 5HCKA 4HXJA 1B3QA 1M1KR 1RADB 1S72Q 4II1A 2E6ZA 4O6JA 1NLOC 2FG0A 3OYLA 2HBWA 2LC4A 5GAMg 1ZA1B 4QW2A 3X26B 1ZUKA 1ZSZC 1OZ2A 1AWWA 4LUDA 2A7YA 3CPWA 4PJOC 4MZTA 1W70A 2QTVA 5GJVB 4E47A 1NJIR 1WHGA 3DB3A 4MMKA 1R77A 1M2OA 3KUFA 3PMTA 1VQOT 4R55A 3OYJA 5M9OA 3RNJA 2VC8A 3SWNC 1GFCA 1QVGA 3TCJA 1RAHB 2KXCA 2M16A 3JCMg 1M2VA 2AZSA 4OMOA 4M7DF 2DRKA 2HKQB 2MAMA 1QP2A 3RBBB 3EHQA 1UECA 3E19A 4L5GA 1Y96B 1Q7YR 5LJ3g 1M3BA 5GMKe 3OSSC 3IQLA 3CC7T 4EMKA 1QWEA 2DRMA 5IT9E 1T0HA 3JB9J 3BW1A 3SEMA 4PJJA 2D1XA 2Z0WA 1JXOA 1O75A 2IIMA 2GTJA 2LX9A 4M77A 1RI9A 4MZMA 3CCUA 1LPLA 1X75C 2KXDA 2FZGB 2NUZA 2DM1A 1M9SA 3P8HA 3CCST 2BUDA 3EHRA 1QKWA 4FSSA 4N4IA 2RF0A 4DEXA 1OEBA 2YWWA 4E7JA 3EH2A 1X2KA 2MWOA 4C5EA 1NZ9A 4JS5A 2DK3A 2K5FA 1PM3A 4RKUE 3HHTB 2C06A 2H8HA 4RCCA 1WJSA 3G4SA 1QW1A 2NYSA 1D3BB 4PL6A 2I2LA 2NUTB 3H0HA 3CC2T 4EIKA 2XHCA 4PFOA 4AFZC 1KQ1A 3SD4A 3UT1A 2EGEA 2DIQA 3PTAA 1VQ5A 2B8AA 1M1FA 3I55T 4JDSA 2GQIA 5GAMd 2ESWA 3J81E 2AKKA 2JNGA 3A8LB 4TVRA 1Q81C 1RABB 1M90U 1YFNA 4BE1A 4JLGA 2FVUA 2DA9A 3OS1A 3G6EA 3MP8A 1VQ9T 2YXYA 1EIFA 4M7DG 4F7UG 1ABQA 3JCMd 4KGVB 1GFDA 3DB4A 2BTTA 3OYHA 3OYAA 4AT1B 4J6XA 2K7AA 3V7SA 4Z89A 3SWNA 2RMOA 1VQ7Q 3G71Q 1PG5B 1G3TA 2DYBA 1IGQA 1VQMT 2LX7A 1UHCA 1W2BP 1YJ9T 2OTJQ 3X25B 5GAOm 3EG2A 2DPPB 4KH0B 1Q81U 4F16A 3I55Q 1WPYA 2EKOA 3NTIA 1BKBA 2OAUA 5CVIA 5GMKm 3E1SA 4HCBA 2F5TX 3GLXA 4IUQA 1JQQA 2KROA 1WI7A 1AHJB 5IHIA 3V8JA 3SFMA 2FPDA 4DEYA 3RMQA 1RL2A 5A0GA 3ME9A 4EMKB 4NS5A 3LH0A 4D8KA 2RJDA 1VIEA 1KD1U 4JRKA 2E1HA 5LJ3f 2JOYA 2R5AA 2COWA 1T0JA 3META 5KYXB 3WXMB 2D0NA 4ELYC 2DLPA 4E7KA 1X27A 2YUNA 1QVFA 2OI3A 1PKTA 2EKHA 2W0ZA 2WSCE 4D8DA 3M58A 2RQTA 1NG2A 1QLYA 2LP5A 2KT8A 2E3HA 4LD6A 2LCLA 2RI3A 2K3XA 3OBYA 3CXCA 3I5RA 2J6KA 1N8RC 4FYXB 2RD1A 3HTRA 3CD6Q 4M78D 2HBPA 3FRNA 1VQ8T 1BB9A 3MEAA 1K76A 4RTYA 1IHWA 1M5Q1 1ZA2B 5CK9A 1GXIE 1VQKQ 2BE9B 4J9FA 3FJ5A 1KC8C 4XTWA 2QA4A 4B9WA 5I22A 1WXTA 5GAN4 4PKCC 3GP8A 4EMKC 2DVEA 1TUGB 4LXCA 1OU8A 2RQWA 5C0MA 1KHIA 4LDWA 3LW5E 2GNCA 2CP2A 3PIPA 2EYWA 8AT1B 3PVQA 1YHQQ 2FEIA 2FO0A 3QKJA 5GAN2 2QXFA 1UG1A 4OMPA 3J80E 1IXDA 2ED0A 1RAGB 2I0NA 1SRMA 1BK2A 4LE9A 5KYYA 1NEBA 3X24B 5KYWB 2F69A 4RMOA 2XG8D 3CXCS 4JJDA 3C12A 4OMMA 4M75D 4OB2B 1VOMA 2DIGA 4C0DC 2LTOA 1R8OB 3LWHA 4JUVA 2OTJA 2HQHA 1AOJA 3PNWC 3I9QA 2KI7A 1VQ4Q 2IVWA 4RTXA 3E9FA 1I4K1 2QA4Q 3PMIA 3DKMA 4K11A 3VYGA 2YSQA 3JB9F 4JJCA 1IRXA 4HCCA 1YHQA 1TS9A 2XICA 4OMFB 3RMSA 3HKSA 5GAN6 2DD5A 4J9GA 1U8RA 2Y90A 3VS0A 4LNPA 2SEMA 1HK9A 4ZN1A 1SG5A 2LDMA 1G3WA 4PJOB 2G3RA 3LX7A 2PVDB 2DO3A 3KXTA 3CEYA 4NOYA 4HT9A 2H3EB 4QVCA 2QDLA 1E7OA 1NYFA 3OS2A 1VYTA 2QG9B 3G71T 4HT8A 3C95A 1BYMA 1QVFS 1VQ7T 5CQXA 3H9NA 3UPUA 3EG9A 5I2SA 3CC4T 5GMKi 5GAOr 3OMCA 4WCIA 3GPLA 3JCMh 4FW1A 1Y7XA 1YHQT 1YNZA 2FB7A 5FU6B 1N8RR 2OTLA 4LUEA 2C0OA 4BD3A 2EGCA 1O9SA 4Z8AA 1VQPT 1WJQA 2BKDN 2E12A 1OYXA 1WGSA 4Z88A 2GFAA 3OYEA 5LJ5g 1G3SA 5FW9A 2LQKA 3U23A 1BI1A 2YRDA 5CCAA 1FX7A 4XU0A 5DM7R 2DEQA 5L23A 8ATCB 3HL8A 1VQLT 2LRQA 4M78E 1SSFA 2RJEA 1K73R 3H0IA 1XTDA 3E9GA 4XTYA 3KBGA 1SHGA 4F14A 4M78G 1PRLC 5GANg 1W2BA 1YJWQ 2MOXA 2EYYA 3V7RA 5IHNA 1VQKA 1ZUUA 2DEUA 2YUQA 1OOTA 5GAMe 2JJ9A 2EYZA 5CO7A 4AFQC 4FL6A 1AZEA 3WVEB 4E2FB 1RUWA 3LH5A 2AK5A 5GAN5 1JB0E 3S3MA 3A8MB 1WLPB 4C8QA 3G71A 1M4ZA 1H92A 3A8HB 2L2PA 2VVKA 2A3LA 1VQ9A 3CBPA 2AKLA 4ZTJA 5CKFA 2ZCFB 3LGLA 2L3SA 1YJWA 4X34A 1QVGS 4C8QD 2XDBA 2OTLT 2HCKA 5D7UA 5AYFA 2VASA 1PD0A 1MMGA 1MUZA 2X4YA 1UTIA 4PJNA 4BI3A 3M0TA 4ELZC 3I56Q 4NL3A 3CMAQ 1BI3A 1D0XA 2M0YA 2R57A 3TQ7P 3UWNA 4M75G 4C92F 2MI6A 1OX8A 5KCHA 4M75B 3WVDB 2HAXA 4VUBA 2D9TA 2KVQG 2MF2A 5GANf 4EMHA 5DY9A 3TVTA 3BY7A 3MP1A 4X9DA 2CZ7B 1VYUA 2CKKA 4KH1B 2X3WD 3QHSA 1VQNA 4M77C 1VQ9Q 4BE0A 4GBQA 4FT4A 1QVPA 5IN1A 1M1GA 2FPEA 1K73C 2QQAA 3MKDA 3L2RA 3QWYA 2LMJA 5CR2A 2RN8A 2QQ9A 4BDYA 1K9AA 2CZ6B 1H641 3URGA 4JS4A 4PJOF 3TEEA 2P84A 7AT1B 1AEYA 2LCSA 4C0ZA 2DERA 3CC7A 2K6DA 1OULA 5IXBA 2V26A 1P92A 2K5LA 2NUPB 3MEUA 2PVOB 3PGGA 1M30A 3QSUA 2V8IA 1KSWA 3EGDA 4IUTA 5GMKj 4J8OA 1RI0A 3M0UA 3ZEHA 2M9UA 2YUPA 3A5ZB 3ZFJA 2JXBA 3CCRQ 1FYNA 1UHFA 2CP5A 2OAWA 1S72A 1U06A 3E2UA 4GY5A 5LJ5h 1ZX6A 2EPDA 1R0CB 3VS6A 2OTLQ 4FIBA 2X3XD 3L2UA 1TXQA 3RERA 2O31A 2H3JA 3CC7Q 4MDXA 2M0OA 2HNIA 2RI2A 5KYUA 4M7AG 3CCJA 4ZGEB 4BB7A 2P0QA 5GANh 3REBB 2L8DA 5FRNA 4MDWA 1H3ZA 1M3CA 2PVGB 3OQ5A 1PNJA 1SRLA 2PUKB 2MYSA 2VXEA 3EFOB 1MNEA 5HY6A 1UE9A 1GL5A 2F2VA 1I0CA 4PJMA 2DXCA 2HL3A 1VUBA 2L5QA 2QTXA 3T9NA 2GTOA 2YT6A 5KCOA 2DZ9A 4QQGA 4Y91A 4A4KA 1RLQC 5EC7A 5D6YA 2RI5A 2F5KA 1Q82C 1GBQA 2J06A 4HVVA 5FWBA 5A0DA 2YUOA 2DXUA 4CC2A 5KYUB 4LDUA 2ZZDA 2AZVA 4JRIA 3OBWA 2M02A 4ME7A 3HFOA 4C8QC 2HQEA 1M90C 3UA7A 1YIJQ 2VKNA 2LT1A 4JRQA 1U5SA 3VJPA 4WTOB 1Q86U 2R5MA 2L3PA 4BY6C 3VRYA 2DL4A 1YN8A 3AHUA 3HRSA 2X4WA 1PD1A 4E6RA
chains in the Genus database with same CATH topology
1KIKA 2KRSA 2RQUA 2JT4A 1E6HA 2LQNA 2D8JA 1X43A 2RQWA 4ZNXA 1UFFA 2CREA 1K1ZA 2GNCA 2E5KA 4CC3A 2EYWA 2YDLA 2FPFA 2RPNA 2DE0X 3PVQA 2J05A 2F2WA 1W6XA 2FEIA 2FO0A 4X1VA 4HCKA 2C0TA 2MIOA 1X69A 2LJ0A 2P4RA 1UG1A 1AWJA 4OMPA 2A37A 2DX1A 2DL8A 1CSKA 2ED0A 1AVZC 3EG3A 4M4ZA 2I0NA 1SRMA 4HVUA 1BK2A 4LE9A 2ROLA 2JM8A 4IIOA 2JW4A 3M0PA 1JEGA 4J9DA 1GRIA 1NEBA 1NYGA 1WX6A 4AG1C 5ECAA 2L3QA 3EG1A 2HDAA 4JJDA 4HVWA 3PE0A 3VS7A 2EBPA 2VWFA 4OMMA 3H41A 1TUCA 1CKBA 4AFUC 1WXBA 4CC4B 4RTUA 2OJ2A 1UGVA 2NWMA 3O5ZA 2KEAA 3VS1A 1AOJA 2JS2A 1OPLA 2EQIA 3I9QA 2CH4A 1T3LA 2G6FX 1ZUYA 4RTXA 1GBRA 2O88A 4K11A 2YSQA 5FWCA 2PZ1A 4JJCA 3M0QA 5I11A 4CC7A 1AD5A 2L0AA 2O9VA 4J9BA 1GCPA 5IXFA 2DF6A 2HSPA 2PNIA 4J9GA 3VS0A 4LNPA 1LCKA 2SEMA 1AWXA 3CQTA 2KNBB 2LZ6B 1ZBJA 1J3TA 4ESRA 3THKA 1BU1A 1WYXA 1W1FA 2ABLA 2J6OA 3I35A 2K3BA 1AWOA 1NEGA 2DBMA 3VRZA 2JS0A 2QDLA 1VYVA 2B86A 1E7OA 3UA6A 1NYFA 1KFZA 1VYTA 5IHKA 1ZLMA 3KFVA 1K0XA 4OMNA 4OMLA 2FRYA 2FRWA 2KYMA 1WDXA 2DVJA 2V1QA 4WCIA 2LNHB 2A28A 2K79A 1VA7A 2CSQA 3UATA 1G83A 2BZYA 1WFWA 2JMAA 2J7IA 1YNZA 4LUEA 2C0OA 1UJYA 2A08A 2EGCA 2XMFA 4RTWA 3EGUA 2KBTA 2SRCA 2KR3A 1QWFA 4Z8AA 4J9CA 1HJDA 1M8MA 1N5ZA 3NPFA 3R6NA 1H8KA 4Z88A 3NHNA 1QKXA 2KE9A 2K2MA 5FW9A 2KYBA 3U23A 1E6GA 3QWXX 5L23A 1RLPC 2ECZA 1WA7A 1TG0A 1AZGB 1G2BA 3REAB 2DL7A 1I07A 2W10A 5HCKA 1MV3A 3H0IA 4HXJA 1B3QA 1SHGA 2MCNA 1V1CA 3ULRB 4F14A 4AG2C 1PRLC 1NLOC 1X2QA 3M0RA 1PWTA 2MOXA 2FG0A 4JPBW 2EYYA 2HBWA 5IHNA 2HEQA 1ZUUA 2YUQA 1OOTA 1ZUKA 1H3HA 1AWWA 3VS5A 2EYZA 4LUDA 1B07A 4AFQC 1W70A 1AZEA 3TSZA 5GJVB 2DL3A 1RUWA 3LH5A 2AK5A 1Y0MA 2CT3A 1WLPB 1HSQA 1U3OA 1QCFA 2LQWA 1H92A 4JJBA 1X6BA 3RNJA 1GFCA 2L2PA 1ZSGA 3H0FA 2VVKA 2AKLA 2KXCA 4Y92A 2AZSA 4OMOA 2L3SA 2DRKA 1M27C 2CUDA 2KGTA 3RBBB 3EHQA 1UECA 2A36A 2JMCA 1YWPA 1M3BA 1A0NB 1NLPC 2HCKA 1T3SA 4J9EA 2GBQA 3IQLA 2RQRA 1MUZA 1UTIA 1QWEA 2DRMA 3M0TA 1K0SA 1T0HA 2PTKA 4QT7A 2M0YA 4AFSC 2BZXA 3GBQA 3SEMA 4LN2A 3EG0A 2D8HA 2D1XA 1JXOA 1Z9QA 2IIMA 2GTJA 1RI9A 2KT1A 1EFNA 2KXDA 3TVTA 2NUZA 2DM1A 1JXMA 4GLMA 1VYUA 3EHRA 1QKWA 2X3WD 4FSSA 2RNAA 2CUBA 2RF0A 1K4US 4DEXA 4GBQA 1OEBA 1X2KA 2JM9A 1WIEA 2FPEA 2M51A 1Z9ZA 1OPKA 3QWYA 2LMJA 2V1RA 2RN8A 2BZ8A 2H8HA 4A63B 4ORZA 2J6FA 1K9AA 1PRMC 3ZL7C 3H0HA 5IH2A 1MV0B 4EIKA 4AFZC 1KJWA 1JU5C 4KRTA 2EGEA 1AEYA 2LCSA 4JZ4A 2CDTA 1GCQC 2KRNA 2JTEA 2GQIA 4JZ3A 3VS4A 2ESWA 2AKKA 2K6DA 2CH4W 5IXBA 3VS3A 1OV3A 1TUDA 1M30A 2CT4A 1KSWA 1GCQA 3TSWA 1SSHA 2DA9A 1PKSA 2GGRA 1I1JA 3M0UA 1ABQA 4RTZA 1UDLA 2YUPA 1S1NA 2ENMA 1GFDA 1HD3A 2JXBA 2BTTA 3A98A 1BBZA 1FYNA 1UHFA 2K7AA 2OAWA 1U06A 4RTTA 4Z89A 2RMOA 3I5SA 1ZX6A 4OMQA 2EPDA 3VS6A 1ARKA 2DYBA 2LX7A 1ABOA 1UHCA 2X3XD 2DNUA 3VS2A 3EG2A 4F16A 1SEMA 2O31A 2EGAA 1CKAA 2F2XA 2O2OA 2DL5A 2DJQA 2ROTA 3JV3A 4RUGA 2CSIA 1YP5A 1JQQA 3REBB 2KROA 1WI7A 5IHIA 1M3CA 1PHTA 2RQVA 2C0IA 2FPDA 1PNJA 3NMZC 1IO6A 4DEYA 1SRLA 1M3AA 4D8KA 1UE9A 2EVRA 1GL5A 2K9GA 4RTVA 2F2VA 1I0CA 1T0JA 3UF4A 2D0NA 2DLPA 2ED1A 2GTOA 1X27A 2YUNA 3PVLA 2OI3A 2YT6A 1PKTA 1YWOA 2EKHA 4R0KA 2W0ZA 1FMKA 1RLQC 5EC7A 1UUEA 4D8DA 3C0CA 2RQTA 1NG2A 1QLYA 2LJ1A 2LP5A 2KT8A 1GBQA 2DILA 2J06A 4IIMA 4HVVA 5FWBA 1WXUA 2YUOA 3I5RA 2J6KA 4CC2A 2O9SA 2AZVA 1YCSB 1Y57A 2EYXA 3SHWA 3M0SA 1NM7A 1XOVA 1JO8A 2DMOA 2DBKA 1BB9A 3UA7A 1UJ0A 1K76A 4RTYA 2VKNA 2KRMA 1U5SA 2EW3A 4J9HA 5GJWB 3NGPA 1X6GA 1SPKA 4J9IA 2L3PA 2LJ3A 4J9FA 4F17A 3FJ5A 3VRYA 2DL4A 1YN8A 5I22A 1SHFA 1WXTA 4E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIK A;  2KRS A;  2RQU A;  2JT4 A;  1E6H A;  2LQN A;  2D8J A;  1X43 A;  2RQW A;  4ZNX A;  1UFF A;  2CRE A;  1K1Z A;  2GNC A;  2E5K A;  4CC3 A;  2EYW A;  2YDL A;  2FPF A;  2RPN A;  2DE0 X;  3PVQ A;  2J05 A;  2F2W A;  1W6X A;  2FEI A;  2FO0 A;  4X1V A;  4HCK A;  2C0T A;  2MIO A;  1X69 A;  2LJ0 A;  2P4R A;  1UG1 A;  1AWJ A;  4OMP A;  2A37 A;  2DX1 A;  2DL8 A;  1CSK A;  2ED0 A;  1AVZ C;  3EG3 A;  4M4Z A;  2I0N A;  1SRM A;  4HVU A;  1BK2 A;  4LE9 A;  2ROL A;  2JM8 A;  4IIO A;  2JW4 A;  3M0P A;  1JEG A;  4J9D A;  1GRI A;  1NEB A;  1NYG A;  1WX6 A;  4AG1 C;  5ECA A;  2L3Q A;  3EG1 A;  2HDA A;  4JJD A;  4HVW A;  3PE0 A;  3VS7 A;  2EBP A;  2VWF A;  4OMM A;  3H41 A;  1TUC A;  1CKB A;  4AFU C;  1WXB A;  4CC4 B;  4RTU A;  2OJ2 A;  1UGV A;  2NWM A;  3O5Z A;  2KEA A;  3VS1 A;  1AOJ A;  2JS2 A;  1OPL A;  2EQI A;  3I9Q A;  2CH4 A;  1T3L A;  2G6F X;  1ZUY A;  4RTX A;  1GBR A;  2O88 A;  4K11 A;  2YSQ A;  5FWC A;  2PZ1 A;  4JJC A;  3M0Q A;  5I11 A;  4CC7 A;  1AD5 A;  2L0A A;  2O9V A;  4J9B A;  1GCP A;  5IXF A;  2DF6 A;  2HSP A;  2PNI A;  4J9G A;  3VS0 A;  4LNP A;  1LCK A;  2SEM A;  1AWX A;  3CQT A;  2KNB B;  2LZ6 B;  1ZBJ A;  1J3T A;  4ESR A;  3THK A;  1BU1 A;  1WYX A;  1W1F A;  2ABL A;  2J6O A;  3I35 A;  2K3B A;  1AWO A;  1NEG A;  2DBM A;  3VRZ A;  2JS0 A;  2QDL A;  1VYV A;  2B86 A;  1E7O A;  3UA6 A;  1NYF A;  1KFZ A;  1VYT A;  5IHK A;  1ZLM A;  3KFV A;  1K0X A;  4OMN A;  4OML A;  2FRY A;  2FRW A;  2KYM A;  1WDX A;  2DVJ A;  2V1Q A;  4WCI A;  2LNH B;  2A28 A;  2K79 A;  1VA7 A;  2CSQ A;  3UAT A;  1G83 A;  2BZY A;  1WFW A;  2JMA A;  2J7I A;  1YNZ A;  4LUE A;  2C0O A;  1UJY A;  2A08 A;  2EGC A;  2XMF A;  4RTW A;  3EGU A;  2KBT A;  2SRC A;  2KR3 A;  1QWF A;  4Z8A A;  4J9C A;  1HJD A;  1M8M A;  1N5Z A;  3NPF A;  3R6N A;  1H8K A;  4Z88 A;  3NHN A;  1QKX A;  2KE9 A;  2K2M A;  5FW9 A;  2KYB A;  3U23 A;  1E6G A;  3QWX X;  5L23 A;  1RLP C;  2ECZ A;  1WA7 A;  1TG0 A;  1AZG B;  1G2B A;  3REA B;  2DL7 A;  1I07 A;  2W10 A;  5HCK A;  1MV3 A;  3H0I A;  4HXJ A;  1B3Q A;  1SHG A;  2MCN A;  1V1C A;  3ULR B;  4F14 A;  4AG2 C;  1PRL C;  1NLO C;  1X2Q A;  3M0R A;  1PWT A;  2MOX A;  2FG0 A;  4JPB W;  2EYY A;  2HBW A;  5IHN A;  2HEQ A;  1ZUU A;  2YUQ A;  1OOT A;  1ZUK A;  1H3H A;  1AWW A;  3VS5 A;  2EYZ A;  4LUD A;  1B07 A;  4AFQ C;  1W70 A;  1AZE A;  3TSZ A;  5GJV B;  2DL3 A;  1RUW A;  3LH5 A;  2AK5 A;  1Y0M A;  2CT3 A;  1WLP B;  1HSQ A;  1U3O A;  1QCF A;  2LQW A;  1H92 A;  4JJB A;  1X6B A;  3RNJ A;  1GFC A;  2L2P A;  1ZSG A;  3H0F A;  2VVK A;  2AKL A;  2KXC A;  4Y92 A;  2AZS A;  4OMO A;  2L3S A;  2DRK A;  1M27 C;  2CUD A;  2KGT A;  3RBB B;  3EHQ A;  1UEC A;  2A36 A;  2JMC A;  1YWP A;  1M3B A;  1A0N B;  1NLP C;  2HCK A;  1T3S A;  4J9E A;  2GBQ A;  3IQL A;  2RQR A;  1MUZ A;  1UTI A;  1QWE A;  2DRM A;  3M0T A;  1K0S A;  1T0H A;  2PTK A;  4QT7 A;  2M0Y A;  4AFS C;  2BZX A;  3GBQ A;  3SEM A;  4LN2 A;  3EG0 A;  2D8H A;  2D1X A;  1JXO A;  1Z9Q A;  2IIM A;  2GTJ A;  1RI9 A;  2KT1 A;  1EFN A;  2KXD A;  3TVT A;  2NUZ A;  2DM1 A;  1JXM A;  4GLM A;  1VYU A;  3EHR A;  1QKW A;  2X3W D;  4FSS A;  2RNA A;  2CUB A;  2RF0 A;  1K4U S;  4DEX A;  4GBQ A;  1OEB A;  1X2K A;  2JM9 A;  1WIE A;  2FPE A;  2M51 A;  1Z9Z A;  1OPK A;  3QWY A;  2LMJ A;  2V1R A;  2RN8 A;  2BZ8 A;  2H8H A;  4A63 B;  4ORZ A;  2J6F A;  1K9A A;  1PRM C;  3ZL7 C;  3H0H A;  5IH2 A;  1MV0 B;  4EIK A;  4AFZ C;  1KJW A;  1JU5 C;  4KRT A;  2EGE A;  1AEY A;  2LCS A;  4JZ4 A;  2CDT A;  1GCQ C;  2KRN A;  2JTE A;  2GQI A;  4JZ3 A;  3VS4 A;  2ESW A;  2AKK A;  2K6D A;  2CH4 W;  5IXB A;  3VS3 A;  1OV3 A;  1TUD A;  1M30 A;  2CT4 A;  1KSW A;  1GCQ A;  3TSW A;  1SSH A;  2DA9 A;  1PKS A;  2GGR A;  1I1J A;  3M0U A;  1ABQ A;  4RTZ A;  1UDL A;  2YUP A;  1S1N A;  2ENM A;  1GFD A;  1HD3 A;  2JXB A;  2BTT A;  3A98 A;  1BBZ A;  1FYN A;  1UHF A;  2K7A A;  2OAW A;  1U06 A;  4RTT A;  4Z89 A;  2RMO A;  3I5S A;  1ZX6 A;  4OMQ A;  2EPD A;  3VS6 A;  1ARK A;  2DYB A;  2LX7 A;  1ABO A;  1UHC A;  2X3X D;  2DNU A;  3VS2 A;  3EG2 A;  4F16 A;  1SEM A;  2O31 A;  2EGA A;  1CKA A;  2F2X A;  2O2O A;  2DL5 A;  2DJQ A;  2ROT A;  3JV3 A;  4RUG A;  2CSI A;  1YP5 A;  1JQQ A;  3REB B;  2KRO A;  1WI7 A;  5IHI A;  1M3C A;  1PHT A;  2RQV A;  2C0I A;  2FPD A;  1PNJ A;  3NMZ C;  1IO6 A;  4DEY A;  1SRL A;  1M3A A;  4D8K A;  1UE9 A;  2EVR A;  1GL5 A;  2K9G A;  4RTV A;  2F2V A;  1I0C A;  1T0J A;  3UF4 A;  2D0N A;  2DLP A;  2ED1 A;  2GTO A;  1X27 A;  2YUN A;  3PVL A;  2OI3 A;  2YT6 A;  1PKT A;  1YWO A;  2EKH A;  4R0K A;  2W0Z A;  1FMK A;  1RLQ C;  5EC7 A;  1UUE A;  4D8D A;  3C0C A;  2RQT A;  1NG2 A;  1QLY A;  2LJ1 A;  2LP5 A;  2KT8 A;  1GBQ A;  2DIL A;  2J06 A;  4IIM A;  4HVV A;  5FWB A;  1WXU A;  2YUO A;  3I5R A;  2J6K A;  4CC2 A;  2O9S A;  2AZV A;  1YCS B;  1Y57 A;  2EYX A;  3SHW A;  3M0S A;  1NM7 A;  1XOV A;  1JO8 A;  2DMO A;  2DBK A;  1BB9 A;  3UA7 A;  1UJ0 A;  1K76 A;  4RTY A;  2VKN A;  2KRM A;  1U5S A;  2EW3 A;  4J9H A;  5GJW B;  3NGP A;  1X6G A;  1SPK A;  4J9I A;  2L3P A;  2LJ3 A;  4J9F A;  4F17 A;  3FJ5 A;  3VRY A;  2DL4 A;  1YN8 A;  5I22 A;  1SHF A;  1WXT A;  4E6R A; 
#chains in the Genus database with same CATH topology
 1KIK A;  1XJW B;  3CD6 A;  2RQU A;  1NE8 A;  4OGE A;  5FU7 B;  1OZ3 A;  4M7D C;  4LDV A;  2D8J A;  5J3B A;  5HK3 A;  4L6V 5;  1JJ2 A;  3A8G B;  1WQW A;  2QEX T;  5GAM j;  4CC3 A;  2DFU A;  2FPF A;  2D6F A;  1QVG P;  2IG0 A;  1Q7Y U;  1N9S A;  2RPN A;  3JRZ A;  2DE0 X;  3JCM b;  2J05 A;  4XTZ A;  3BFM A;  1D09 B;  3CBM A;  1W6X A;  5LJ3 h;  3HRT A;  2MIO A;  4C8Q G;  3OW2 P;  5KYN A;  4ZGD B;  1X6O A;  3OB9 A;  3EG3 A;  1KG1 A;  4BI4 A;  4E7L A;  2JM8 A;  4IIO A;  2JW4 A;  3JCM P;  4J9D A;  1NJI U;  2ATC B;  3JCM W;  2QAZ A;  2BIV A;  1WX6 A;  4AG1 C;  2EJG A;  3TRE A;  3MEV A;  2L3Q A;  3EG1 A;  1B34 B;  2K5I A;  3M59 A;  3ZBD A;  3EGX B;  4GLK A;  2HZY A;  3VS7 A;  3H41 A;  1TUC A;  1CKB A;  2RB6 A;  1WXB A;  2OJ2 A;  1UGV A;  2KEA A;  5I21 A;  4F7U B;  1ZBX A;  3LLR A;  1OPL A;  4HCZ A;  3OW2 A;  2EQI A;  5FRO A;  4KUD K;  5FU7 C;  4LDX A;  2G6F X;  1VQ5 Q;  2QQB A;  3QJ6 A;  3CCJ T;  1U1S A;  3CCL A;  1GBR A;  3ER0 A;  2O88 A;  2LQ8 A;  1FMV A;  3CCR A;  1KQS P;  2RJF A;  3OS0 A;  2PQW A;  1AD5 A;  2OX7 A;  2XDP A;  2O9V A;  1VQM Q;  1LJO A;  2PNI A;  4IUP A;  4M77 F;  1LCK A;  4N0A A;  2MMP A;  3CQT A;  2LZ6 B;  4UC4 A;  1D1B A;  4Q5W A;  3S6W A;  1UGQ B;  3L42 A;  4ESR A;  4XU1 A;  1ACM B;  1BU1 A;  1VQ4 A;  2J6O A;  1VQP Q;  2K3B A;  3QII A;  1NJI C;  2V8J A;  4M7D D;  4C0F A;  1VIF A;  1VYV A;  1D0Y A;  2Y4Y A;  1ZLM A;  1K0X A;  1W2B S;  1BIA A;  1B34 A;  3OYF A;  3HRU A;  4C92 D;  2FRW A;  1WDX A;  2DVJ A;  5DLO A;  5GAM h;  2V1Q A;  1UGP B;  2LNH B;  3G4S Q;  1Q81 R;  2CSQ A;  4M77 E;  1Q7Y C;  3JB9 H;  2JMA A;  2J7I A;  4O5V A;  1NBE B;  2F1L A;  3JSC A;  3FDR A;  3CC4 Q;  4RTW A;  1WHL A;  3M54 A;  3EGU A;  4M75 C;  4F7U A;  2KBT A;  1QWF A;  2EWN A;  1WHH A;  3VKI A;  4DBH A;  2ZPE B;  2EJ9 A;  4ATO A;  3Q1J A;  2ZGW A;  2ZPH B;  3VV0 A;  1VQO A;  3L2V A;  1I5O B;  1K8A R;  3QZ5 B;  5KYW A;  4M7D B;  2QQR A;  3LYI A;  1M1K C;  1K8A C;  3CMA A;  2ECZ A;  4C92 G;  4MZP A;  3QJY A;  1G2B A;  4M7A A;  2Y4X A;  2MCN A;  3ULR B;  2DTH A;  3CCE Q;  3NFC A;  1V76 A;  1PCX A;  4YTL A;  1PWT A;  1FWZ A;  2RHI A;  3X20 B;  5HK0 A;  2HEQ A;  4XK8 E;  1YJN Q;  4BE2 A;  1N9R A;  1RAE B;  1H3H A;  5LJ5 j;  3JCM c;  3OY9 A;  2O4X B;  1Q95 G;  3JCM Q;  4JJN K;  1HSQ A;  1G3Y A;  3JB9 D;  4PNO A;  1F1B B;  1X6B A;  3RDV A;  2CP6 A;  3H0F A;  3NTH A;  3M53 A;  3CCM A;  5IAY A;  4FSX A;  2XKO C;  5GAN j;  3VYH B;  1M27 C;  2CUD A;  2KGT A;  3CCE A;  4XQ3 A;  3CPW S;  2AIR B;  3G1J A;  2JMC A;  1C0M A;  3RR6 A;  1VQ6 Q;  1A0N B;  1NLP C;  2ZPG B;  1T3S A;  2RK1 A;  1Y07 A;  4J9E A;  1K73 U;  2LNV A;  2EQU A;  2CZ1 B;  2GBQ A;  3P8B B;  2L3R A;  3SDZ A;  3FC3 A;  1LOJ A;  5KYY B;  4QT7 A;  1MMD A;  4PLL A;  4AFS C;  2BZX A;  2EAY A;  2YRV A;  3EG0 A;  4J6Y A;  3QPH A;  1HYO A;  4OB0 B;  1Z9Q A;  1XNI A;  3CCL T;  2CS7 A;  2RHZ A;  1EFN A;  5L8R E;  1RAC B;  3UDC A;  4MML A;  3M57 A;  4GLM A;  4DOW A;  3HFN A;  2XID A;  4JRP A;  1YIT T;  2ZPB B;  1S72 T;  2VV5 A;  2QA4 T;  2QDY B;  4D6W A;  5LJ5 d;  1YJW T;  2JM9 A;  5CIU A;  3QZ9 B;  1Q86 R;  1VQN T;  3J7A F;  2QGG A;  1OPK A;  2EQM A;  5GAN 3;  1N6A A;  4ANJ A;  4A63 B;  2YHT A;  1KQ2 A;  1IZ6 A;  4M78 B;  3L1A A;  3RES A;  1G5V A;  3OYB A;  2EFI A;  2HMA A;  3EGD B;  4KRT A;  4Z02 A;  4FYW B;  5GAN d;  3G7Z A;  2CDT A;  1GCQ C;  2JTE A;  4JZ3 A;  3VS4 A;  1WJR A;  4XTV A;  3CCQ Q;  1BI0 A;  3RKY A;  3I55 A;  3VS3 A;  4ZN3 A;  1OV3 A;  4C92 A;  3G4S T;  2LCC A;  4M75 F;  3JAM E;  2DTO A;  5D6X A;  2CT4 A;  4J5Y A;  4LD9 K;  2FZK B;  2GGR A;  4F04 B;  4F7U F;  3OYI A;  5KE2 A;  3GNF B;  3FJP A;  4A4G A;  4PK4 A;  4RTZ A;  4FCY A;  1YIT A;  1S1N A;  2ENM A;  1TWB A;  1HD3 A;  1IB8 A;  1C1A A;  5C6S A;  2E10 A;  3JCM J;  4RTT A;  4OMQ A;  1XQH A;  3CME Q;  4FYV B;  2K3Y A;  1ARK A;  5I2M A;  3TU4 K;  3OYK A;  1VQK T;  3GNG A;  4J7F A;  2YLB A;  3CCR T;  2XI9 A;  1SEM A;  2D0Q B;  2DJQ A;  1QCO A;  1UEB A;  2L89 A;  4M7A F;  4PJO G;  1VQO Q;  2E64 A;  3X28 B;  4C8Q F;  3PIO A;  4KT0 E;  3EGX A;  2P0P A;  2RQV A;  4PJO E;  2C0I A;  5GAN 8;  3QUI A;  3BDL A;  3CCV A;  2E70 A;  2EVR A;  5KYX A;  1QQJ A;  4M7A D;  4A54 A;  1JJ2 S;  2ED1 A;  4OB1 B;  2XDD A;  1MND A;  3CCM T;  1UGR B;  4R0K A;  1FMK A;  2EJF A;  1UUE A;  1SF9 A;  1MMA A;  2CGH A;  3L2W A;  4C92 B;  3V8K A;  2DIL A;  1WXU A;  4BY6 B;  4R56 A;  3MEW A;  2O9S A;  3CCU Q;  1YCS B;  2EYX A;  1OI1 A;  3M0S A;  3CC2 Q;  1NM7 A;  1PSF A;  1JO8 A;  4PJO D;  2DMO A;  2DBK A;  1UJ0 A;  2RK2 A;  2KRM A;  4B6M A;  1OU9 A;  2BE7 D;  1KC8 R;  3CMA T;  4B9X A;  3RIR A;  1SPK A;  4N4G A;  1RAI B;  2LJ3 A;  4F17 A;  4KGX B;  2OTJ T;  1SHF A;  1YIJ A;  3EH1 A;  2RHY A;  2KRS A;  4OGC A;  1E6H A;  2LQN A;  3L2Z A;  4N4H A;  1Q86 C;  1UFF A;  2CRE A;  2P4T A;  4M75 E;  1IRE B;  2YDL A;  1X01 A;  3INZ A;  2VXF A;  2F2W A;  1EZZ B;  3OMG A;  3QXE B;  4X1V A;  4HCK A;  2C0T A;  3N5B B;  2P4R A;  4Y28 E;  1AWJ A;  2XD0 A;  3LGF A;  1AVZ C;  3CC4 A;  3QDF A;  4XU2 A;  4HVU A;  4FM4 B;  3OYN A;  1GRI A;  4PLI A;  1NYG A;  5ECA A;  3CCQ T;  2QAS A;  3CD6 T;  3EFS A;  4XTU A;  1DJ7 B;  2JTM A;  2DTI A;  1UGS B;  3PE0 A;  5CKB A;  3QYH B;  4AFU C;  3S3N A;  4E7H A;  4RCB A;  1YIJ T;  1ZQ1 A;  3CCV T;  3O5Z A;  3VS1 A;  1M1K U;  3M4Y A;  3CCS A;  1ZUY A;  3R6O A;  1U1T A;  4V2S A;  2JVV A;  3V7C A;  5FWC A;  2PZ1 A;  2VGM A;  4KBM B;  2QEX A;  2MWP A;  1KQS S;  3M0Q A;  3SWN B;  4CC7 A;  1C6V X;  4KUL A;  3M55 A;  4J9B A;  1GCP A;  4P5N A;  2VB6 A;  2RO0 A;  5GMK h;  1VQM A;  2CP7 A;  4OVA A;  1AWX A;  2ZPF B;  2K4Y A;  2EIF A;  4M7D A;  2O4X A;  1WYX A;  1W1F A;  4J83 A;  3VRZ A;  2DXT A;  4L59 A;  2JS0 A;  3JCM f;  1LVK A;  3G6E T;  3KFV A;  2K2V A;  3CME T;  4LDY A;  3BDU A;  3DLM A;  3CPW P;  3P8D A;  2KMT A;  1D1C A;  5AT1 B;  2KYM A;  1Q82 U;  2RHX A;  4A4E A;  2LVM A;  3S3O A;  2WAC A;  4CI0 C;  2K79 A;  1I81 A;  5KH6 A;  2NUT A;  1WHK A;  1D3B A;  1WFW A;  3EFR A;  2YRC A;  5HKC A;  1B7T A;  3O8V A;  3SB2 A;  2SRC A;  2ZAE A;  5CKH A;  1YJN T;  5GAM f;  4BUG A;  2HSE B;  5GAN 7;  1N5Z A;  5CAI A;  2COZ A;  3NHN A;  2R58 A;  3GOX A;  3QG1 A;  2KE9 A;  2K2M A;  4PFP A;  3A1P A;  2DAQ A;  3QYG B;  3RKW A;  6AT1 B;  1VQ8 Q;  1IHV A;  3JCM X;  2DKG A;  2CP0 A;  4DBF A;  2KAF A;  3QWX X;  3V8L A;  2HD0 A;  1WA7 A;  3FLG A;  1AZG B;  1YJN A;  3EAE A;  2WSE E;  1MV3 A;  3OSV A;  1K8A U;  3JB9 G;  4HA8 A;  3CCU T;  4PJO A;  1V1C A;  4HKE A;  4AG2 C;  1WNL A;  1N8R U;  2XK0 A;  4N0A C;  4RG2 A;  1X2Q A;  2GFU A;  2DD4 A;  3M0R A;  4JPB W;  1KQS A;  4M7A C;  3VS5 A;  3OW2 S;  1B07 A;  4M7A B;  3ASK A;  1M2V B;  3TSZ A;  2DL3 A;  1D1A A;  2X4X A;  3HP9 A;  1Y0M A;  4ZTF A;  1TH7 A;  2CT3 A;  2CYZ B;  1U3O A;  1QCF A;  1YBY A;  3CME A;  4M77 D;  2LQW A;  3MJX A;  4JJB A;  3FIF A;  3HSB A;  1ZSG A;  2K57 A;  2PUO B;  3OYD A;  4Y92 A;  3CCQ A;  2EQK A;  1TU0 B;  4A4H A;  3JB9 I;  1OX9 A;  4ZGJ B;  1KD1 R;  2A36 A;  4FW2 A;  5LJ3 e;  3RUX A;  1YWP A;  5LL6 S;  4BDZ A;  3MO8 A;  4QVZ A;  2X4J A;  2RQR A;  2PU9 B;  4E7S A;  2O01 E;  3EFO A;  3QBY A;  1K0S A;  2DZC A;  3CBO A;  2E3I A;  2PTK A;  4C8Q E;  1VQ6 T;  1K9M R;  5DLQ E;  3GBQ A;  4XTX A;  4C5G A;  1KHC A;  4J7I A;  1JBM A;  4LN2 A;  1YI2 Q;  2D8H A;  2WSF E;  1RAF B;  2HQX A;  1VQ8 A;  1YCY A;  2QGF B;  4AMC A;  2RH2 A;  3QO3 A;  2DYI A;  2JZ2 A;  1BCM A;  2KT1 A;  3EG9 B;  4RG8 A;  4IUU A;  3CCJ Q;  3BE3 A;  1VQL Q;  1JXM A;  4J6W A;  4XU3 A;  2E5Q A;  2JN0 A;  3OA6 A;  4QKU A;  2RNA A;  2CUB A;  1K4U S;  4NL2 A;  3I56 A;  3CCE T;  2RHU A;  3VUB A;  1WIE A;  2M51 A;  3OS5 A;  2E4H A;  2DET A;  1Z9Z A;  3OYG A;  5FU6 C;  2V1R A;  5FLX E;  4IUV A;  2VUB A;  2BZ8 A;  4EDU A;  4ORZ A;  2J6F A;  2FZC B;  1PRM C;  5FRM A;  3ZL7 C;  5GAO l;  3CPF A;  4BI8 B;  5IH2 A;  1ZSZ A;  5GAO q;  1MV0 B;  2QI2 A;  1K9M U;  1PC0 A;  1KJW A;  1JU5 C;  5GAO p;  4CRI A;  1VQ6 A;  4C92 C;  5CKD A;  4JZ4 A;  3FB9 A;  4OP0 A;  2KRN A;  2E6N A;  2CH4 W;  3M56 A;  5GMK l;  1TUD A;  1BI2 A;  1LNX A;  3MHX A;  5J26 A;  2COY A;  3MCA B;  1GCQ A;  3FEO A;  3TSW A;  2DXB A;  3OYM A;  9ATC B;  1SSH A;  2QYZ A;  1PKS A;  1I1J A;  2VYT A;  5KE3 A;  1QVF P;  3I56 T;  1QP3 A;  1UDL A;  2X35 A;  1JRI A;  1YJ9 Q;  3A98 A;  2RJC A;  1BBZ A;  2RA2 A;  3G6E Q;  4DBR A;  4XAX B;  2X51 A;  3I5S A;  1MMN A;  1AT1 B;  1G8X A;  2MPX C;  3AT1 B;  1ABO A;  2DNU A;  3VS2 A;  2QK0 A;  4M78 C;  2EGA A;  4M78 F;  1CKA A;  1WQ7 A;  3MP6 A;  3QDR B;  3M5A A;  2F2X A;  2O2O A;  2DL5 A;  2ROT A;  3JV3 A;  3RKX A;  1VQL A;  1ZSZ B;  4RUG A;  4E7Z A;  2CSI A;  5LJ5 f;  2LT4 A;  1YP5 A;  3JCM V;  1PHT A;  3NMZ C;  5A2Q E;  1IO6 A;  4OF1 A;  4DBQ A;  4C5H A;  1M3A A;  2EQJ A;  5LJ3 j;  1BIB A;  2GQV A;  2K9G A;  4RTV A;  3A8O B;  1Y96 A;  4QVD A;  3UF4 A;  2RM4 A;  4PFZ A;  3H6Z A;  1MGQ A;  3PVL A;  1YWO A;  1VQN Q;  3C0C A;  2LJ1 A;  1OQK A;  4QQ6 A;  5D6W A;  4IIM A;  3CCM Q;  4F7U E;  1M90 R;  1Y57 A;  3SHW A;  1XOV A;  1TTH B;  4IKF A;  3NTK A;  3CCS Q;  1EX4 A;  1WZO A;  3MPU B;  1YI2 A;  3GF5 A;  2CP3 A;  1TOV A;  3GIB A;  3VUZ A;  4J9H A;  2EW3 A;  5GJW B;  3PT9 A;  3NGP A;  1X6G A;  1UB4 A;  4J9I A;  4FU6 A;  1D0Z A;  4M77 G;  1KC8 U;  3OYY A;  3CCL Q;  2EYQ A;  5LJ5 e;  2KY9 A;  4FYY B;  4QQD A;  1JJ2 P;  3F70 A;  2NUP A;  1VQP A;  1M8V A;  2JTF A;  3PFS A;  2JT4 A;  1X43 A;  2A0F B;  4ZNX A;  3L2Q A;  1K1Z A;  2E5K A;  2NLU A;  4M75 A;  5GAN e;  1YI2 T;  2AHJ B;  2GF7 A;  3DLL A;  1W4S A;  1VQ5 T;  1X69 A;  2LJ0 A;  3M9Q A;  4M77 B;  1QCN A;  2A37 A;  2DX1 A;  2DL8 A;  1CSK A;  1VQ7 A;  4M78 A;  4BAC A;  1HXD A;  4M4Z A;  4DA4 A;  1V29 B;  2ROL A;  3M0P A;  1JEG A;  3C94 A;  5EG2 A;  1KD1 C;  4JLI A;  3H8Z A;  1BCO A;  1KK7 A;  2QQS A;  1ZHI A;  4PJL A;  2HDA A;  2V8K A;  4HVW A;  4WF2 A;  4X9C A;  2EBP A;  5CKE A;  1Y71 A;  2VWF A;  4A4F A;  1VQ4 T;  4CC4 B;  4RTU A;  1NPR A;  1K9M C;  2KK4 A;  4M7A E;  2NWM A;  2GCX A;  2JS2 A;  1IGU A;  2CH4 A;  1T3L A;  1FXX A;  5CQY A;  5GAO n;  1SKU B;  4OB3 B;  2E65 A;  1R0B G;  1WHJ A;  4FT2 A;  1YJ9 A;  5I11 A;  2XU8 A;  1N27 A;  2HKN A;  1WHM A;  2L0A A;  4C5I A;  5IXF A;  2DF6 A;  2HSP A;  1QMC A;  3CXC P;  2KNB B;  1ZBJ A;  1J3T A;  1NPP A;  2ZPI B;  3LWI A;  2QEX Q;  4E7I A;  3VU3 C;  4C0D B;  2AT1 B;  4KUI A;  1RAA B;  3THK A;  4C8Q B;  2ABL A;  3I35 A;  1AWO A;  1NEG A;  2DBM A;  2B86 A;  2FL7 A;  3UA6 A;  4EMG A;  1KFZ A;  5IHK A;  5LJ3 d;  1MHN A;  2VGN A;  3JCM e;  4OMN A;  4OML A;  2FRY A;  5A0L A;  2YLC A;  2P0K A;  2A28 A;  4C0G A;  2HL5 C;  1VA7 A;  3UAT A;  1G83 A;  2BZY A;  1Q82 R;  2X9H A;  2M1H A;  2JUF A;  1FMW A;  3CC2 A;  4IUR A;  1UJY A;  2FHD A;  2A08 A;  2XMF A;  3M4G A;  2FYK A;  2MK5 A;  2KR3 A;  2KQW A;  3CCV Q;  1I8F A;  4J9C A;  1I5L A;  1HJD A;  2IPO B;  1M8M A;  3HPW A;  2KSS A;  1PSE A;  3NPF A;  3R6N A;  1H8K A;  5J39 A;  1QKX A;  4A53 A;  2DJZ A;  2KYB A;  4KGZ B;  4C92 E;  3OYC A;  1E6G A;  2CZ0 B;  4DOV A;  1RLP C;  2E41 A;  1TG0 A;  2KDS A;  4EPC A;  3D7S B;  3REA B;  1YIT Q;  4DQ2 A;  2DL7 A;  1TSF A;  1I07 A;  3C4S A;  2W10 A;  4M7D E;  5HCK A;  4HXJ A;  1B3Q A;  1M1K R;  1RAD B;  1S72 Q;  4II1 A;  2E6Z A;  4O6J A;  1NLO C;  2FG0 A;  3OYL A;  2HBW A;  2LC4 A;  5GAM g;  1ZA1 B;  4QW2 A;  3X26 B;  1ZUK A;  1ZSZ C;  1OZ2 A;  1AWW A;  4LUD A;  2A7Y A;  3CPW A;  4PJO C;  4MZT A;  1W70 A;  2QTV A;  5GJV B;  4E47 A;  1NJI R;  1WHG A;  3DB3 A;  4MMK A;  1R77 A;  1M2O A;  3KUF A;  3PMT A;  1VQO T;  4R55 A;  3OYJ A;  5M9O A;  3RNJ A;  2VC8 A;  3SWN C;  1GFC A;  1QVG A;  3TCJ A;  1RAH B;  2KXC A;  2M16 A;  3JCM g;  1M2V A;  2AZS A;  4OMO A;  4M7D F;  2DRK A;  2HKQ B;  2MAM A;  1QP2 A;  3RBB B;  3EHQ A;  1UEC A;  3E19 A;  4L5G A;  1Y96 B;  1Q7Y R;  5LJ3 g;  1M3B A;  5GMK e;  3OSS C;  3IQL A;  3CC7 T;  4EMK A;  1QWE A;  2DRM A;  5IT9 E;  1T0H A;  3JB9 J;  3BW1 A;  3SEM A;  4PJJ A;  2D1X A;  2Z0W A;  1JXO A;  1O75 A;  2IIM A;  2GTJ A;  2LX9 A;  4M77 A;  1RI9 A;  4MZM A;  3CCU A;  1LPL A;  1X75 C;  2KXD A;  2FZG B;  2NUZ A;  2DM1 A;  1M9S A;  3P8H A;  3CCS T;  2BUD A;  3EHR A;  1QKW A;  4FSS A;  4N4I A;  2RF0 A;  4DEX A;  1OEB A;  2YWW A;  4E7J A;  3EH2 A;  1X2K A;  2MWO A;  4C5E A;  1NZ9 A;  4JS5 A;  2DK3 A;  2K5F A;  1PM3 A;  4RKU E;  3HHT B;  2C06 A;  2H8H A;  4RCC A;  1WJS A;  3G4S A;  1QW1 A;  2NYS A;  1D3B B;  4PL6 A;  2I2L A;  2NUT B;  3H0H A;  3CC2 T;  4EIK A;  2XHC A;  4PFO A;  4AFZ C;  1KQ1 A;  3SD4 A;  3UT1 A;  2EGE A;  2DIQ A;  3PTA A;  1VQ5 A;  2B8A A;  1M1F A;  3I55 T;  4JDS A;  2GQI A;  5GAM d;  2ESW A;  3J81 E;  2AKK A;  2JNG A;  3A8L B;  4TVR A;  1Q81 C;  1RAB B;  1M90 U;  1YFN A;  4BE1 A;  4JLG A;  2FVU A;  2DA9 A;  3OS1 A;  3G6E A;  3MP8 A;  1VQ9 T;  2YXY A;  1EIF A;  4M7D G;  4F7U G;  1ABQ A;  3JCM d;  4KGV B;  1GFD A;  3DB4 A;  2BTT A;  3OYH A;  3OYA A;  4AT1 B;  4J6X A;  2K7A A;  3V7S A;  4Z89 A;  3SWN A;  2RMO A;  1VQ7 Q;  3G71 Q;  1PG5 B;  1G3T A;  2DYB A;  1IGQ A;  1VQM T;  2LX7 A;  1UHC A;  1W2B P;  1YJ9 T;  2OTJ Q;  3X25 B;  5GAO m;  3EG2 A;  2DPP B;  4KH0 B;  1Q81 U;  4F16 A;  3I55 Q;  1WPY A;  2EKO A;  3NTI A;  1BKB A;  2OAU A;  5CVI A;  5GMK m;  3E1S A;  4HCB A;  2F5T X;  3GLX A;  4IUQ A;  1JQQ A;  2KRO A;  1WI7 A;  1AHJ B;  5IHI A;  3V8J A;  3SFM A;  2FPD A;  4DEY A;  3RMQ A;  1RL2 A;  5A0G A;  3ME9 A;  4EMK B;  4NS5 A;  3LH0 A;  4D8K A;  2RJD A;  1VIE A;  1KD1 U;  4JRK A;  2E1H A;  5LJ3 f;  2JOY A;  2R5A A;  2COW A;  1T0J A;  3MET A;  5KYX B;  3WXM B;  2D0N A;  4ELY C;  2DLP A;  4E7K A;  1X27 A;  2YUN A;  1QVF A;  2OI3 A;  1PKT A;  2EKH A;  2W0Z A;  2WSC E;  4D8D A;  3M58 A;  2RQT A;  1NG2 A;  1QLY A;  2LP5 A;  2KT8 A;  2E3H A;  4LD6 A;  2LCL A;  2RI3 A;  2K3X A;  3OBY A;  3CXC A;  3I5R A;  2J6K A;  1N8R C;  4FYX B;  2RD1 A;  3HTR A;  3CD6 Q;  4M78 D;  2HBP A;  3FRN A;  1VQ8 T;  1BB9 A;  3MEA A;  1K76 A;  4RTY A;  1IHW A;  1M5Q 1;  1ZA2 B;  5CK9 A;  1GXI E;  1VQK Q;  2BE9 B;  4J9F A;  3FJ5 A;  1KC8 C;  4XTW A;  2QA4 A;  4B9W A;  5I22 A;  1WXT A;  5GAN 4;  4PKC C;  3GP8 A;  4EMK C;  2DVE A;  1TUG B;  4LXC A;  1OU8 A;  2RQW A;  5C0M A;  1KHI A;  4LDW A;  3LW5 E;  2GNC A;  2CP2 A;  3PIP A;  2EYW A;  8AT1 B;  3PVQ A;  1YHQ Q;  2FEI A;  2FO0 A;  3QKJ A;  5GAN 2;  2QXF A;  1UG1 A;  4OMP A;  3J80 E;  1IXD A;  2ED0 A;  1RAG B;  2I0N A;  1SRM A;  1BK2 A;  4LE9 A;  5KYY A;  1NEB A;  3X24 B;  5KYW B;  2F69 A;  4RMO A;  2XG8 D;  3CXC S;  4JJD A;  3C12 A;  4OMM A;  4M75 D;  4OB2 B;  1VOM A;  2DIG A;  4C0D C;  2LTO A;  1R8O B;  3LWH A;  4JUV A;  2OTJ A;  2HQH A;  1AOJ A;  3PNW C;  3I9Q A;  2KI7 A;  1VQ4 Q;  2IVW A;  4RTX A;  3E9F A;  1I4K 1;  2QA4 Q;  3PMI A;  3DKM A;  4K11 A;  3VYG A;  2YSQ A;  3JB9 F;  4JJC A;  1IRX A;  4HCC A;  1YHQ A;  1TS9 A;  2XIC A;  4OMF B;  3RMS A;  3HKS A;  5GAN 6;  2DD5 A;  4J9G A;  1U8R A;  2Y90 A;  3VS0 A;  4LNP A;  2SEM A;  1HK9 A;  4ZN1 A;  1SG5 A;  2LDM A;  1G3W A;  4PJO B;  2G3R A;  3LX7 A;  2PVD B;  2DO3 A;  3KXT A;  3CEY A;  4NOY A;  4HT9 A;  2H3E B;  4QVC A;  2QDL A;  1E7O A;  1NYF A;  3OS2 A;  1VYT A;  2QG9 B;  3G71 T;  4HT8 A;  3C95 A;  1BYM A;  1QVF S;  1VQ7 T;  5CQX A;  3H9N A;  3UPU A;  3EG9 A;  5I2S A;  3CC4 T;  5GMK i;  5GAO r;  3OMC A;  4WCI A;  3GPL A;  3JCM h;  4FW1 A;  1Y7X A;  1YHQ T;  1YNZ A;  2FB7 A;  5FU6 B;  1N8R R;  2OTL A;  4LUE A;  2C0O A;  4BD3 A;  2EGC A;  1O9S A;  4Z8A A;  1VQP T;  1WJQ A;  2BKD N;  2E12 A;  1OYX A;  1WGS A;  4Z88 A;  2GFA A;  3OYE A;  5LJ5 g;  1G3S A;  5FW9 A;  2LQK A;  3U23 A;  1BI1 A;  2YRD A;  5CCA A;  1FX7 A;  4XU0 A;  5DM7 R;  2DEQ A;  5L23 A;  8ATC B;  3HL8 A;  1VQL T;  2LRQ A;  4M78 E;  1SSF A;  2RJE A;  1K73 R;  3H0I A;  1XTD A;  3E9G A;  4XTY A;  3KBG A;  1SHG A;  4F14 A;  4M78 G;  1PRL C;  5GAN g;  1W2B A;  1YJW Q;  2MOX A;  2EYY A;  3V7R A;  5IHN A;  1VQK A;  1ZUU A;  2DEU A;  2YUQ A;  1OOT A;  5GAM e;  2JJ9 A;  2EYZ A;  5CO7 A;  4AFQ C;  4FL6 A;  1AZE A;  3WVE B;  4E2F B;  1RUW A;  3LH5 A;  2AK5 A;  5GAN 5;  1JB0 E;  3S3M A;  3A8M B;  1WLP B;  4C8Q A;  3G71 A;  1M4Z A;  1H92 A;  3A8H B;  2L2P A;  2VVK A;  2A3L A;  1VQ9 A;  3CBP A;  2AKL A;  4ZTJ A;  5CKF A;  2ZCF B;  3LGL A;  2L3S A;  1YJW A;  4X34 A;  1QVG S;  4C8Q D;  2XDB A;  2OTL T;  2HCK A;  5D7U A;  5AYF A;  2VAS A;  1PD0 A;  1MMG A;  1MUZ A;  2X4Y A;  1UTI A;  4PJN A;  4BI3 A;  3M0T A;  4ELZ C;  3I56 Q;  4NL3 A;  3CMA Q;  1BI3 A;  1D0X A;  2M0Y A;  2R57 A;  3TQ7 P;  3UWN A;  4M75 G;  4C92 F;  2MI6 A;  1OX8 A;  5KCH A;  4M75 B;  3WVD B;  2HAX A;  4VUB A;  2D9T A;  2KVQ G;  2MF2 A;  5GAN f;  4EMH A;  5DY9 A;  3TVT A;  3BY7 A;  3MP1 A;  4X9D A;  2CZ7 B;  1VYU A;  2CKK A;  4KH1 B;  2X3W D;  3QHS A;  1VQN A;  4M77 C;  1VQ9 Q;  4BE0 A;  4GBQ A;  4FT4 A;  1QVP A;  5IN1 A;  1M1G A;  2FPE A;  1K73 C;  2QQA A;  3MKD A;  3L2R A;  3QWY A;  2LMJ A;  5CR2 A;  2RN8 A;  2QQ9 A;  4BDY A;  1K9A A;  2CZ6 B;  1H64 1;  3URG A;  4JS4 A;  4PJO F;  3TEE A;  2P84 A;  7AT1 B;  1AEY A;  2LCS A;  4C0Z A;  2DER A;  3CC7 A;  2K6D A;  1OUL A;  5IXB A;  2V26 A;  1P92 A;  2K5L A;  2NUP B;  3MEU A;  2PVO B;  3PGG A;  1M30 A;  3QSU A;  2V8I A;  1KSW A;  3EGD A;  4IUT A;  5GMK j;  4J8O A;  1RI0 A;  3M0U A;  3ZEH A;  2M9U A;  2YUP A;  3A5Z B;  3ZFJ A;  2JXB A;  3CCR Q;  1FYN A;  1UHF A;  2CP5 A;  2OAW A;  1S72 A;  1U06 A;  3E2U A;  4GY5 A;  5LJ5 h;  1ZX6 A;  2EPD A;  1R0C B;  3VS6 A;  2OTL Q;  4FIB A;  2X3X D;  3L2U A;  1TXQ A;  3RER A;  2O31 A;  2H3J A;  3CC7 Q;  4MDX A;  2M0O A;  2HNI A;  2RI2 A;  5KYU A;  4M7A G;  3CCJ A;  4ZGE B;  4BB7 A;  2P0Q A;  5GAN h;  3REB B;  2L8D A;  5FRN A;  4MDW A;  1H3Z A;  1M3C A;  2PVG B;  3OQ5 A;  1PNJ A;  1SRL A;  2PUK B;  2MYS A;  2VXE A;  3EFO B;  1MNE A;  5HY6 A;  1UE9 A;  1GL5 A;  2F2V A;  1I0C A;  4PJM A;  2DXC A;  2HL3 A;  1VUB A;  2L5Q A;  2QTX A;  3T9N A;  2GTO A;  2YT6 A;  5KCO A;  2DZ9 A;  4QQG A;  4Y91 A;  4A4K A;  1RLQ C;  5EC7 A;  5D6Y A;  2RI5 A;  2F5K A;  1Q82 C;  1GBQ A;  2J06 A;  4HVV A;  5FWB A;  5A0D A;  2YUO A;  2DXU A;  4CC2 A;  5KYU B;  4LDU A;  2ZZD A;  2AZV A;  4JRI A;  3OBW A;  2M02 A;  4ME7 A;  3HFO A;  4C8Q C;  2HQE A;  1M90 C;  3UA7 A;  1YIJ Q;  2VKN A;  2LT1 A;  4JRQ A;  1U5S A;  3VJP A;  4WTO B;  1Q86 U;  2R5M A;  2L3P A;  4BY6 C;  3VRY A;  2DL4 A;  1YN8 A;  3AHU A;  3HRS A;  2X4W A;  1PD1 A;  4E6R A; 
#chains in the Genus database with same CATH homology
 1KIK A;  2KRS A;  2RQU A;  2JT4 A;  1E6H A;  2LQN A;  2D8J A;  1X43 A;  2RQW A;  4ZNX A;  1UFF A;  2CRE A;  1K1Z A;  2GNC A;  2E5K A;  4CC3 A;  2EYW A;  2YDL A;  2FPF A;  2RPN A;  2DE0 X;  3PVQ A;  2J05 A;  2F2W A;  1W6X A;  2FEI A;  2FO0 A;  4X1V A;  4HCK A;  2C0T A;  2MIO A;  1X69 A;  2LJ0 A;  2P4R A;  1UG1 A;  1AWJ A;  4OMP A;  2A37 A;  2DX1 A;  2DL8 A;  1CSK A;  2ED0 A;  1AVZ C;  3EG3 A;  4M4Z A;  2I0N A;  1SRM A;  4HVU A;  1BK2 A;  4LE9 A;  2ROL A;  2JM8 A;  4IIO A;  2JW4 A;  3M0P A;  1JEG A;  4J9D A;  1GRI A;  1NEB A;  1NYG A;  1WX6 A;  4AG1 C;  5ECA A;  2L3Q A;  3EG1 A;  2HDA A;  4JJD A;  4HVW A;  3PE0 A;  3VS7 A;  2EBP A;  2VWF A;  4OMM A;  3H41 A;  1TUC A;  1CKB A;  4AFU C;  1WXB A;  4CC4 B;  4RTU A;  2OJ2 A;  1UGV A;  2NWM A;  3O5Z A;  2KEA A;  3VS1 A;  1AOJ A;  2JS2 A;  1OPL A;  2EQI A;  3I9Q A;  2CH4 A;  1T3L A;  2G6F X;  1ZUY A;  4RTX A;  1GBR A;  2O88 A;  4K11 A;  2YSQ A;  5FWC A;  2PZ1 A;  4JJC A;  3M0Q A;  5I11 A;  4CC7 A;  1AD5 A;  2L0A A;  2O9V A;  4J9B A;  1GCP A;  5IXF A;  2DF6 A;  2HSP A;  2PNI A;  4J9G A;  3VS0 A;  4LNP A;  1LCK A;  2SEM A;  1AWX A;  3CQT A;  2KNB B;  2LZ6 B;  1ZBJ A;  1J3T A;  4ESR A;  3THK A;  1BU1 A;  1WYX A;  1W1F A;  2ABL A;  2J6O A;  3I35 A;  2K3B A;  1AWO A;  1NEG A;  2DBM A;  3VRZ A;  2JS0 A;  2QDL A;  1VYV A;  2B86 A;  1E7O A;  3UA6 A;  1NYF A;  1KFZ A;  1VYT A;  5IHK A;  1ZLM A;  3KFV A;  1K0X A;  4OMN A;  4OML A;  2FRY A;  2FRW A;  2KYM A;  1WDX A;  2DVJ A;  2V1Q A;  4WCI A;  2LNH B;  2A28 A;  2K79 A;  1VA7 A;  2CSQ A;  3UAT A;  1G83 A;  2BZY A;  1WFW A;  2JMA A;  2J7I A;  1YNZ A;  4LUE A;  2C0O A;  1UJY A;  2A08 A;  2EGC A;  2XMF A;  4RTW A;  3EGU A;  2KBT A;  2SRC A;  2KR3 A;  1QWF A;  4Z8A A;  4J9C A;  1HJD A;  1M8M A;  1N5Z A;  3NPF A;  3R6N A;  1H8K A;  4Z88 A;  3NHN A;  1QKX A;  2KE9 A;  2K2M A;  5FW9 A;  2KYB A;  3U23 A;  1E6G A;  3QWX X;  5L23 A;  1RLP C;  2ECZ A;  1WA7 A;  1TG0 A;  1AZG B;  1G2B A;  3REA B;  2DL7 A;  1I07 A;  2W10 A;  5HCK A;  1MV3 A;  3H0I A;  4HXJ A;  1B3Q A;  1SHG A;  2MCN A;  1V1C A;  3ULR B;  4F14 A;  4AG2 C;  1PRL C;  1NLO C;  1X2Q A;  3M0R A;  1PWT A;  2MOX A;  2FG0 A;  4JPB W;  2EYY A;  2HBW A;  5IHN A;  2HEQ A;  1ZUU A;  2YUQ A;  1OOT A;  1ZUK A;  1H3H A;  1AWW A;  3VS5 A;  2EYZ A;  4LUD A;  1B07 A;  4AFQ C;  1W70 A;  1AZE A;  3TSZ A;  5GJV B;  2DL3 A;  1RUW A;  3LH5 A;  2AK5 A;  1Y0M A;  2CT3 A;  1WLP B;  1HSQ A;  1U3O A;  1QCF A;  2LQW A;  1H92 A;  4JJB A;  1X6B A;  3RNJ A;  1GFC A;  2L2P A;  1ZSG A;  3H0F A;  2VVK A;  2AKL A;  2KXC A;  4Y92 A;  2AZS A;  4OMO A;  2L3S A;  2DRK A;  1M27 C;  2CUD A;  2KGT A;  3RBB B;  3EHQ A;  1UEC A;  2A36 A;  2JMC A;  1YWP A;  1M3B A;  1A0N B;  1NLP C;  2HCK A;  1T3S A;  4J9E A;  2GBQ A;  3IQL A;  2RQR A;  1MUZ A;  1UTI A;  1QWE A;  2DRM A;  3M0T A;  1K0S A;  1T0H A;  2PTK A;  4QT7 A;  2M0Y A;  4AFS C;  2BZX A;  3GBQ A;  3SEM A;  4LN2 A;  3EG0 A;  2D8H A;  2D1X A;  1JXO A;  1Z9Q A;  2IIM A;  2GTJ A;  1RI9 A;  2KT1 A;  1EFN A;  2KXD A;  3TVT A;  2NUZ A;  2DM1 A;  1JXM A;  4GLM A;  1VYU A;  3EHR A;  1QKW A;  2X3W D;  4FSS A;  2RNA A;  2CUB A;  2RF0 A;  1K4U S;  4DEX A;  4GBQ A;  1OEB A;  1X2K A;  2JM9 A;  1WIE A;  2FPE A;  2M51 A;  1Z9Z A;  1OPK A;  3QWY A;  2LMJ A;  2V1R A;  2RN8 A;  2BZ8 A;  2H8H A;  4A63 B;  4ORZ A;  2J6F A;  1K9A A;  1PRM C;  3ZL7 C;  3H0H A;  5IH2 A;  1MV0 B;  4EIK A;  4AFZ C;  1KJW A;  1JU5 C;  4KRT A;  2EGE A;  1AEY A;  2LCS A;  4JZ4 A;  2CDT A;  1GCQ C;  2KRN A;  2JTE A;  2GQI A;  4JZ3 A;  3VS4 A;  2ESW A;  2AKK A;  2K6D A;  2CH4 W;  5IXB A;  3VS3 A;  1OV3 A;  1TUD A;  1M30 A;  2CT4 A;  1KSW A;  1GCQ A;  3TSW A;  1SSH A;  2DA9 A;  1PKS A;  2GGR A;  1I1J A;  3M0U A;  1ABQ A;  4RTZ A;  1UDL A;  2YUP A;  1S1N A;  2ENM A;  1GFD A;  1HD3 A;  2JXB A;  2BTT A;  3A98 A;  1BBZ A;  1FYN A;  1UHF A;  2K7A A;  2OAW A;  1U06 A;  4RTT A;  4Z89 A;  2RMO A;  3I5S A;  1ZX6 A;  4OMQ A;  2EPD A;  3VS6 A;  1ARK A;  2DYB A;  2LX7 A;  1ABO A;  1UHC A;  2X3X D;  2DNU A;  3VS2 A;  3EG2 A;  4F16 A;  1SEM A;  2O31 A;  2EGA A;  1CKA A;  2F2X A;  2O2O A;  2DL5 A;  2DJQ A;  2ROT A;  3JV3 A;  4RUG A;  2CSI A;  1YP5 A;  1JQQ A;  3REB B;  2KRO A;  1WI7 A;  5IHI A;  1M3C A;  1PHT A;  2RQV A;  2C0I A;  2FPD A;  1PNJ A;  3NMZ C;  1IO6 A;  4DEY A;  1SRL A;  1M3A A;  4D8K A;  1UE9 A;  2EVR A;  1GL5 A;  2K9G A;  4RTV A;  2F2V A;  1I0C A;  1T0J A;  3UF4 A;  2D0N A;  2DLP A;  2ED1 A;  2GTO A;  1X27 A;  2YUN A;  3PVL A;  2OI3 A;  2YT6 A;  1PKT A;  1YWO A;  2EKH A;  4R0K A;  2W0Z A;  1FMK A;  1RLQ C;  5EC7 A;  1UUE A;  4D8D A;  3C0C A;  2RQT A;  1NG2 A;  1QLY A;  2LJ1 A;  2LP5 A;  2KT8 A;  1GBQ A;  2DIL A;  2J06 A;  4IIM A;  4HVV A;  5FWB A;  1WXU A;  2YUO A;  3I5R A;  2J6K A;  4CC2 A;  2O9S A;  2AZV A;  1YCS B;  1Y57 A;  2EYX A;  3SHW A;  3M0S A;  1NM7 A;  1XOV A;  1JO8 A;  2DMO A;  2DBK A;  1BB9 A;  3UA7 A;  1UJ0 A;  1K76 A;  4RTY A;  2VKN A;  2KRM A;  1U5S A;  2EW3 A;  4J9H A;  5GJW B;  3NGP A;  1X6G A;  1SPK A;  4J9I A;  2L3P A;  2LJ3 A;  4J9F A;  4F17 A;  3FJ5 A;  3VRY A;  2DL4 A;  1YN8 A;  5I22 A;  1SHF A;  1WXT A;  4E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...