4AFZC

Human chymase - fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
VTLFVALYDYNATRWTDLSFHKGEKFQILEFGPGDWWEARSLTTGETGYIPSNYVAPVDSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
total genus 11
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afzC00
4HCKA 3VS0A 5ECAA 1GCPA 3UATA 1M3CA 2PNIA 1K4US 4JZ3A 1S1NA 2HBWA 2YUQA 4F14A 2RQRA 1ZUKA 3VS2A 3PVQA 3A98A 2DMOA 3UA6A 2EVRA 1XOVA 4OMPA 2EKHA 1WYXA 1T0HA 2LJ1A 2BTTA 1KFZA 4QT7A 4IIMA 3H0FA 2YUPA 1H8KA 1UE9A 1BK2A 2ENMA 1PWTA 2FPFA 4Z89A 2LP5A 1NLPC 1ZX6A 1NEBA 1WI7A 1PKSA 1PKTA 2KYBA 2KXDA 4WCIA 1E6GA 1M27C 5FWCA 1I07A 3M0TA 2CH4A 2JS0A 4RTWA 1K0SA 4M4ZA 2AZVA 2OI3A 4GBQA 1UHFA 2J06A 1I0CA 4Z88A 1YWOA 3TSWA 1GFDA 2GGRA 2EPDA 4RTTA 2YDLA 2DYBA 1E6HA 2EQIA 4D8KA 3R6NA 1Z9ZA 2A28A 2J6KA 3I5RA 2D0NA 1U3OA 2W0ZA 2DL3A 1OPLA 3RNJA 3EG0A 4HVWA 3JV3A 2LX7A 1RUWA 3EHQA 1ABQA 3NPFA 1J3TA 1GCQA 2JM9A 1PRMC 3M0RA 1G83A 2LZ6B 3U23A 2RN8A 2DLPA 2DL4A 3NGPA 1JXMA 5IHIA 1M3BA 2OJ2A 4R0KA 2LJ3A 3O5ZA 1M30A 5L23A 1UJYA 4LUEA 1JO8A 2ABLA 2L2PA 4J9BA 4D8DA 1ARKA 1GFCA 2KT1A 5IHKA 1W6XA 2AKKA 2I0NA 1W70A 1GL5A 1AZEA 2FRWA 1MV3A 4Y92A 1B07A 1UG1A 1SPKA 2AZSA 1YP5A 4LUDA 1U06A 2XMFA 3CQTA 1B3QA 3TSZA 1JEGA 2VWFA 3ZL7C 1UJ0A 1QWEA 2CUDA 2W10A 2DM1A 2V1RA 1M3AA 2DA9A 2KGTA 1AWOA 4DEXA 4RTVA 4HVVA 2CDTA 2RQWA 2KRMA 2NUZA 2VKNA 4RTXA 1YWPA 3VRYA 4ZNXA 1AOJA 2GBQA 1ZBJA 1X2QA 1GBRA 1WXUA 2GQIA 1T0JA 1GRIA 1VYVA 4ORZA 1AWWA 4AFQC 1T3SA 3THKA 2O31A 2YUNA 1UTIA 2JT4A 1UFFA 1SRLA 2D8JA 1RLPC 4RTUA 2HCKA 2MOXA 5IXFA 2EBPA 1K9AA 1TG0A 3I9QA 2EGEA 2LQWA 4DEYA 3ULRB 4X1VA 1UDLA 2ECZA 3VS5A 2J6OA 4J9EA 2ED0A 5GJWB 1H92A 3VS1A 1NYGA 1YNZA 3LH5A 3H41A 3IQLA 4EIKA 1WX6A 4F17A 1X69A 2DNUA 1N5ZA 1UGVA 2EYYA 3VS4A 2QDLA 3PE0A 5GJVB 1A0NB 1NYFA 2C0TA 4JJCA 2CREA 3EGUA 3GBQA 4J9FA 5FWBA 3KFVA 3TVTA 2CT3A 2O9SA 1X6BA 2JM8A 2J05A 1WFWA 2KR3A 2EGCA 2K2MA 2RMOA 1X6GA 1KSWA 1ZUUA 2IIMA 2M51A 2DILA 3SEMA 2MIOA 1NEGA 4F16A 1X43A 5IH2A 1UHCA 1HSQA 1KJWA 4K11A 1JXOA 2CT4A 1VA7A 1MV0B 2FPDA 2YSQA 2EYXA 2OAWA 3M0SA 2KBTA 2ESWA 2PTKA 2CSIA 3UA7A 2LCSA 2A37A 4OMLA 1GBQA 1BBZA 1G2BA 3VRZA 3UF4A 3EG2A 1RI9A 1OV3A 1Y57A 4J9IA 3M0QA 3C0CA 4JJDA 2FRYA 1AWJA 2E5KA 2O88A 2P4RA 3RBBB 1AD5A 1QCFA 3I5SA 1KIKA 1W1FA 4JPBW 1OPKA 2HSPA 2RPNA 2JMAA 2SEMA 1YCSB 2L3PA 4HVUA 5EC7A 4LN2A 1WXBA 2SRCA 3QWXX 1JU5C 2A36A 2DBKA 1K0XA 2EYWA 4AG1C 2EGAA 4FSSA 2DF6A 2X3WD 2JMCA 1FYNA 2KXCA 1ZUYA 1U5SA 2K79A 1WXTA 2A08A 2B86A 1HD3A 2BZYA 1WLPB 2GNCA 1QWFA 2BZ8A 4RTYA 2CH4W 1Y0MA 3REBB 2FEIA 2PZ1A 4AFZC 2RF0A 2O9VA 4RTZA 2KRNA 1RLQC 2KYMA 4JZ4A 1V1CA 1WDXA 3H0IA 1NG2A 5IXBA 2KEAA 1TUCA 1OOTA 4AFUC 1CSKA 1MUZA 1T3LA 2J7IA 1GCQC 2J6FA 4CC3A 2VVKA 4GLMA 2LNHB 2KRSA 2HEQA 2DE0X 2JW4A 4RUGA 2JTEA 3EHRA 1TUDA 1E7OA 2O2OA 4Z8AA 2D1XA 1PHTA 1QKWA 2DRKA 3I35A 4CC4B 2DVJA 1SEMA 1JQQA 1ZSGA 2YT6A 5HCKA 2EYZA 2F2VA 4HXJA 3VS3A 1UECA 1X27A 1NLOC 2V1QA 3M0UA 4OMNA 2DJQA 1WA7A 3QWYA 3VS7A 2FG0A 3VS6A 4J9DA 1BU1A 1K1ZA 4E6RA 1FMKA 2K6DA 2K7AA 5I22A 1WIEA 2D8HA 1K76A 1CKAA 1VYUA 2FO0A 3PVLA 1M8MA 4OMOA 2JS2A 2RQVA 1AEYA 2DBMA 5IHNA 1VYTA 1SHFA 2DL8A 2CUBA 2KT8A 4LE9A 1Z9QA 1NM7A 1PNJA 1SRMA 1AZGB 1PRLC 2ROTA 4JJBA 2KROA 2M0YA 2AKLA 1UUEA 2YUOA 3H0HA 4OMQA 1CKBA 2MCNA 1ABOA 2RQTA 4J9HA 1H3HA 2DL7A 4IIOA 5I11A 2DRMA 1ZLMA 4J9GA 3REAB 2KNBB 1I1JA 2RQUA 2LJ0A 4AFSC 4AG2C 2G6FX 4A63B 2H8HA 2CSQA 3NMZC 2DL5A 2KE9A 2X3XD 4CC2A 2K3BA 2F2XA 4KRTA 2HDAA 1IO6A 2AK5A 2GTOA 4LNPA 1AWXA 5FW9A 4CC7A 3SHWA 1YN8A 4ESRA 1BB9A 3EG1A 1QLYA 2GTJA 3M0PA 2L3QA 4J9CA 2F2WA 2L3SA 4OMMA 3FJ5A 1OEBA 2JXBA 2K9GA 2DX1A 1AVZC 3NHNA 2C0IA 1HJDA 1SSHA 3EG3A 2RNAA 2BZXA 1SHGA 2EW3A 2LQNA 2FPEA 2ED1A 1X2KA 2L0AA 1QKXA 2NWMA 1LCKA 2LMJA 2ROLA 1EFNA 2C0OA
chains in the Genus database with same CATH superfamily
4HCKA 3VS0A 2AIRB 4C5GA 2LQ8A 3S3OA 4JZ3A 3E2UA 4KUDK 2QI2A 2E65A 9ATCB 3OYNA 3LLRA 1ZUKA 2M0OA 5D7UA 3OMCA 3VS2A 1G3TA 4M75B 5DM7R 2EVRA 2XIDA 2QQBA 3KUFA 1Q82U 2BTTA 4X34A 1VQNA 3V8KA 2YUPA 1QVFA 1BK2A 4XTXA 1NZ9A 3QKJA 3JB9F 1NEBA 3URGA 3DLMA 5GMKe 1QVGA 4OB3B 4PJOE 3CCUQ 1M8VA 1JB0E 4F7UG 1M27C 4QVDA 5EG2A 1I07A 5FWCA 1VQLA 3OYGA 2CZ1B 4RTWA 1TU0B 4EMKA 2AZVA 4RG2A 3VU3C 1UHFA 2M1HA 3RR6A 4MDWA 2GGRA 3OW2S 1YHQT 2IG0A 2EQUA 2RHIA 1E6HA 5DY9A 4DBHA 3R6NA 1BI2A 1OQKA 2W0ZA 4OMFB 3RNJA 3C95A 1ACMB 3V7RA 3EG0A 4E7HA 3A8OB 4C92A 4LDWA 1D1CA 2D0QB 3MEWA 3NPFA 5GAN5 2GF7A 1GCQA 2QG9B 2JM9A 3CCSA 4F04B 5AT1B 1C0MA 2LZ6B 2DL4A 2CP7A 1VQKQ 3CC7Q 2OJ2A 3CCLA 4PJOG 2LJ3A 1UJYA 5C6SA 4WTOB 4J9BA 1SF9A 2CP0A 1GFCA 2O4XB 1VQ5T 2I0NA 4OF1A 1GL5A 2FRWA 4M77G 5FRMA 1N9SA 1YBYA 3CQTA 5CKFA 1B3QA 5AYFA 2VWFA 1QWEA 2W10A 3L1AA 3BDUA 4MZPA 1M3AA 3CCRA 1UGQB 2BE7D 2KRMA 4M77B 2NUZA 4RTXA 2EQMA 1AOJA 2YXYA 3OSSC 4QVZA 2OTJT 1VQ9A 1M4ZA 2KQWA 2NUPA 1QW1A 4PJOC 1UGRB 4AFQC 4M75C 3JCMg 4X9DA 2WSEE 1UTIA 2JT4A 4QKUA 4C8QB 1RLPC 2LNVA 2HCKA 4M78B 3PIPA 1M2VB 2MOXA 3L2WA 1K9AA 3LYIA 5D6XA 3MPUB 2XDPA 4VUBA 3OYHA 2EFIA 4DEYA 4A53A 3GIBA 2X35A 3OYAA 4ME7A 2O4XA 1M90R 2VASA 3AHUA 5GANj 3VS1A 1U1TA 2YLBA 2E12A 1OX9A 4EIKA 3P8BB 4PFZA 1XQHA 1QVGS 1N5ZA 2YRDA 1YI2Q 1S72Q 2X51A 1M1FA 3VS4A 1VQMA 1VQ5A 2FZKB 1UB4A 5GJVB 3V7CA 2EYQA 1D0YA 4NL2A 3CC4Q 3RIRA 1I4K1 4QQDA 4PL6A 4C0FA 2ATCB 2RI3A 4C0GA 4HT9A 4BI4A 4C8QD 2DILA 2MIOA 3EGXB 1EX4A 3DB3A 4ZN3A 2HZYA 4JS4A 3MEVA 3GPLA 2QA4Q 3PFSA 1RACB 1SG5A 2PUOB 1VA7A 4B6MA 2QEXT 2Y4XA 1MMDA 1X01A 2OAWA 4OP0A 3GNFB 4Z02A 1HXDA 2A37A 2QGFB 3I55Q 1G2BA 1N8RU 1RI9A 3VKIA 5GAMf 3EH2A 3C0CA 3UWNA 3PMIA 2C06A 4JPBW 1KQSA 5J26A 1OPKA 3MEUA 2MMPA 3JB9H 1D0XA 1YCSB 4Q5WA 4HVUA 3CCJT 5EC7A 3VYGA 1JU5C 1WHGA 2DKGA 2V8JA 4C8QC 2A36A 3EGDB 4RCCA 1Y71A 4FW1A 4J6XA 2DZ9A 1FYNA 2G3RA 3M4GA 3QPHA 2JTMA 4NS5A 2B86A 1VQPA 2BZYA 5CKDA 1XTDA 1Q7YU 1QWFA 2BZ8A 2CH4W 2FHDA 4HCBA 1YJWT 1Y0MA 3CXCP 1Q82C 4M75D 2RF0A 2KRNA 3X25B 5KYYB 4EMGA 3RKYA 4C0DC 2DPPB 1TUCA 1RADB 1KK7A 1T3LA 1IRXA 2IPOB 1W2BS 1Q86C 1M5Q1 4BI8B 3G71T 4PJNA 2K2VA 4BY6B 2DE0X 4M7DC 2E6NA 4RUGA 1E7OA 4Z8AA 1YHQQ 1RAIB 2DRKA 4JLGA 2DVJA 2QGGA 5M9OA 2BUDA 4IURA 1MNDA 3C94A 1K73U 5LJ5g 4XU1A 1TS9A 5LJ5j 4C8QG 2RB6A 4HXJA 1UECA 2V1QA 2QA4A 1WQ7A 3S3MA 1WA7A 2VV5A 3VS6A 4J9DA 3RKWA 4LDUA 1LNXA 5I22A 4RMOA 1K76A 1VYUA 2JS2A 8AT1B 1YITT 1AEYA 3JB9D 2DBMA 4BE1A 4ATOA 3CC4A 1NM7A 1AZGB 1VQ5Q 1VQMQ 4C92F 1S72A 1YI2A 2AKLA 4OMQA 2KAFA 1CKBA 2Y90A 3GF5A 3FJPA 2D6FA 4J9HA 1G3WA 2Z0WA 2DL7A 2QASA 5GAN3 4XK8E 3E1SA 3UDCA 1WPYA 2PVGB 2RA2A 3REAB 2KNBB 1RAEB 2LVMA 3OYIA 4AG2C 2ZPEB 1X6OA 2VC8A 3NMZC 4HCCA 1DJ7B 3HL8A 3A8MB 2X3XD 4KGXB 4BD3A 3CPWA 4KRTA 1I5LA 4KBMB 5FW9A 1KD1R 3L2ZA 4OB1B 3MCAB 3L2RA 1R77A 2GTJA 2HL5C 3LGLA 1IGUA 1YFNA 2ZPIB 2L3QA 1VQ6T 1JRIA 4OMMA 1OI1A 2JXBA 2DX1A 3NHNA 1AVZC 1QCOA 2XDDA 2DETA 1FWZA 1JJ2A 1X2KA 2L0AA 2NWMA 1R8OB 5HY6A 1K73R 1VQ6A 3UPUA 2CP2A 5ECAA 3QIIA 2CP3A 1M3CA 2PNIA 5IAYA 1TXQA 2YUQA 1B7TA 2QK0A 2YHTA 3CMAT 1Q81R 3M58A 5KE3A 3A98A 3OY9A 5GAMe 3SDZA 2DMOA 2E1HA 3MKDA 3UA6A 1NPRA 4R56A 1Q81C 2LT4A 1OX8A 1BI3A 3FDRA 4M7AD 4QT7A 3H0FA 1WHLA 5KH6A 1PWTA 1YIJQ 2ZZDA 4Z89A 2LP5A 3CCSQ 1NLPC 2HKNA 2KVQG 1ZX6A 3JCMV 3ZBDA 1WI7A 1PKSA 4A4KA 5GMKj 3OMGA 3VV0A 2KYBA 3QYGB 1E6GA 2MWOA 3CPFA 1IB8A 3SWNB 1K0SA 2CZ7B 4M4ZA 7AT1B 1Y7XA 5CR2A 3X20B 1BI1A 4JRIA 4DBFA 2QXFA 2J6KA 3V8JA 2D0NA 4UC4A 2DL3A 1OPLA 3OYFA 4ZGDB 3JB9I 4HVWA 2O01E 3JV3A 1VQLQ 3CMEA 1ABQA 2DXTA 3PMTA 4NL3A 4M75E 1TWBA 4M78C 3M0RA 2XI9A 3U23A 2DLPA 3HP9A 3NTHA 5IHIA 4KGZB 1M3BA 5CKEA 2CGHA 4AMCA 3QG1A 3A5ZB 4R0KA 1WHMA 1VQNQ 5L23A 5GAOr 5KYXB 1JO8A 2L2PA 4BUGA 2QAZA 2DJZA 2AKKA 2ZCFB 2DIGA 1QCNA 1B07A 1SPKA 4LUDA 1U06A 3JB9G 2DD4A 1Q7YR 1I5OB 5KYNA 2CP6A 2R58A 4C0DB 2P4TA 3BW1A 1UJ0A 3MJXA 2M9UA 3ER0A 3CXCA 2NLUA 5J3BA 1RAGB 1N8RC 4DEXA 4HVVA 3CCVA 1BCOA 5KYUB 3VRYA 4ZNXA 5CCAA 3QDFA 2OTJA 2RM4A 3LWHA 1X2QA 1WXUA 3M5AA 3OS0A 4B9XA 4M7DE 1EZZB 1KC8C 3R6OA 1VQOQ 5GAOq 1SRLA 3GNGA 4L59A 5IXFA 3CD6T 1OYXA 3RMSA 1HK9A 5GAOp 4XU2A 5KCOA 1ZA1B 2DTIA 2LQWA 4X1VA 3KXTA 1LPLA 5GAOl 2H3JA 3VS5A 4ZGJB 2DD5A 4A4EA 3H41A 3IQLA 1M1KC 1UEBA 4J6WA 2LDMA 1C6VX 1PSFA 1X69A 2DNUA 2JUFA 5GANd 2EYYA 2FZGB 1C1AA 2EQJA 2HQXA 2QDLA 4FYYB 2RHZA 1A0NB 4HCZA 5GAOn 3JB9J 4XTZA 1X6BA 2P0QA 4L6V5 4F7UE 2K2MA 3V7SA 1YJNA 2E41A 2IIMA 2QEXQ 2QQAA 3HFNA 1NEGA 2A7YA 4A4HA 4ZTJA 1Q86R 4M7AF 4F16A 5IH2A 1UHCA 1KJWA 3QDRB 1BIBA 1JXOA 2CT4A 1IZ6A 4C92E 2FPDA 3WVDB 1PG5B 1UGSB 3JRZA 1KQSP 4ELZC 3CD6Q 1I81A 2OX7A 3G4SA 3CCMT 2LCSA 4OMLA 1LJOA 3VRZA 1AT1B 3EFSA 1FMWA 1EIFA 3M9QA 4N4IA 5IN1A 4DA4A 3RBBB 1V76A 1AD5A 2DTOA 1QP2A 3HHTB 1R0CB 1TH7A 1W1FA 3FIFA 4C5IA 2OTLA 1IHWA 4MZMA 4M78E 1KHIA 3UT1A 4PJOB 2ZPBB 2L3PA 1I8FA 4LN2A 3CCMA 4RG8A 2DXUA 2DAQA 4AG1C 4V2SA 1TOVA 2BIVA 2E3HA 2HSEB 4FU6A 1PC0A 2KXCA 1M90U 1ZUYA 2K4YA 3H8ZA 1WJSA 3KBGA 3QXEB 3GLXA 5GANh 1YJWQ 4E7ZA 2RJDA 4J83A 1MMAA 4OGCA 1WLPB 3L2VA 2K5IA 2MF2A 3CCJA 5FU7B 2DXBA 4RTZA 2KMTA 2QQSA 1YIJT 1RLQC 2KYMA 1PD1A 4JZ4A 2HL3A 2JVVA 1IREB 2M02A 4II1A 4E2FB 1MUZA 4KT0E 1TSFA 3RDVA 3S3NA 2VVKA 1ZSZC 1VQ7A 5L8RE 1W4SA 3PNWC 1YJNT 2MPXC 2JW4A 1WHKA 1TUDA 5J39A 3J80E 3CBOA 4F7UA 2HQHA 1QKWA 2R5MA 3I35A 2XKOC 1YJ9A 1SEMA 1ZSGA 4PK4A 3N5BB 2EYZA 1K9MC 4DOWA 2VUBA 2HD0A 5DLQE 4PNOA 1Y07A 3H6ZA 1N27A 1FMKA 2K6DA 2K7AA 4YTLA 1WIEA 2D8HA 4FSXA 1CKAA 4OGEA 1W2BP 1MMGA 2EAYA 3QO3A 2JTFA 1VQ9T 2L5QA 4LDVA 1Q82R 5IHNA 1VYTA 1SHFA 2DL8A 3PTAA 2KT8A 3A8GB 3WVEB 3ASKA 4M7DA 3M54A 1UUEA 2YUOA 4BDYA 2XHCA 3OB9A 3TU4K 3G71A 5GAMh 2RQTA 3G6EA 2DRMA 3TREA 4PJOF 4FIBA 3CCQQ 2DZCA 4KH0B 3QUIA 2PU9B 2K57A 4C92C 2ZPFB 2CSQA 2F69A 2E70A 2QTVA 1S72T 1ZSZA 3HRUA 2HDAA 3M55A 4O6JA 1LOJA 4TVRA 4CC7A 1QVGP 3E9FA 4ESRA 1OULA 1BB9A 3CCEQ 4LDYA 3BY7A 5KYWB 1VQOT 1QLYA 4XTWA 3EGDA 3M0PA 1D3BA 3LX7A 2HAXA 3VUBA 3FJ5A 5I21A 4E7KA 2RK1A 1OZ2A 1WQWA 3JCMX 1SHGA 3M57A 2LQNA 5FU6B 5FU6C 3RESA 2ED1A 3A8LB 1GXIE 3CCUT 5LJ3d 2C0OA 4M75A 5CO7A 5GAN2 4DBRA 3SWNC 1K4US 1S1NA 2HBWA 5KYYA 4NOYA 3PVQA 2QA4T 3RKXA 2R57A 3MP8A 3DLLA 1XOVA 2EKHA 2DIQA 1WYXA 1HYOA 2VGMA 3D7SB 4ZTFA 4PJOA 3OQ5A 2DEUA 4BI3A 1VIEA 3S6WA 1H8KA 1UE9A 2K3YA 4JRKA 2ENMA 3META 4EMKB 2FPFA 4A4FA 4PLIA 5GAMg 4WCIA 5GAN6 2ZGWA 3M0TA 3CPWP 1D3BB 2VB6A 2NUTA 2XD0A 3CMAA 2FVUA 2YRCA 4GBQA 5LJ5d 1I0CA 3SB2A 1YWOA 3TSWA 3OYEA 2EPDA 2E4HA 2KI7A 2XICA 2MAMA 3HKSA 4FYVB 4HKEA 2CZ0B 4C92B 2EQIA 2RH2A 1WJQA 3I5RA 1QQJA 1U3OA 2EJGA 2QQRA 2F1LA 3CCQA 2RJEA 1VQ4A 1ZBXA 3EHQA 2CP5A 1G5VA 1J3TA 2COYA 2K5FA 3Q1JA 3G71Q 1FMVA 4M77D 2X4WA 2LQKA 4C0ZA 2DXCA 5GMKi 1M1KR 2K5LA 2RN8A 1M1KU 3ZFJA 3C12A 1JXMA 2L3RA 5LJ5e 1K8AR 2KY9A 5I2MA 3O5ZA 5LJ3g 5CIUA 2HQEA 4J5YA 2HBPA 4LUEA 4N4GA 3CCQT 1R0BG 3GOXA 2R5AA 3JCMh 1W70A 1AZEA 4FT2A 3X26B 4Y92A 2AZSA 1YP5A 2XMFA 3TSZA 3OBWA 4M77E 1KC8U 3E9GA 3X28B 2V1RA 1U1SA 4J8OA 4KULA 2KGTA 4RTVA 2RO0A 5CK9A 3CCET 2CDTA 2RQWA 4PJMA 4M7AG 2VKNA 1YWPA 5GMKh 4M7DB 4ZGEB 1IHVA 2RD1A 3OYLA 2DTHA 5GANe 2JN0A 3I56Q 1ZBJA 1M2VA 1OU9A 1KD1C 1PD0A 3OBYA 1VYVA 4ORZA 1AWWA 4DBQA 1T3SA 1PSEA 3G1JA 1U8RA 1VQ7Q 4CRIA 2O31A 2EJ9A 4M7AB 1UFFA 1NE8A 2D8JA 4M7DG 2XG8D 3BDLA 3ZEHA 3GP8A 2VXEA 1TG0A 3I9QA 2CS7A 4J7IA 1VQ8T 1M1GA 4LD9K 2J6OA 4J9EA 1H3ZA 2ED0A 5GJWB 1BIAA 5KCHA 4DQ2A 1H641 4F17A 3DKMA 4XTVA 3LH0A 1QVPA 4PLLA 4MMLA 3HRSA 1X75C 3CBPA 5LJ3h 2C0TA 2CREA 3M53A 3OYCA 4J9FA 5FWBA 3CCVT 3EGXA 2CT3A 2O9SA 3CC2A 1TUGB 2KR3A 2EGCA 4BY6C 2CYZB 2RMOA 3FEOA 1X6GA 2PVOB 2OTLQ 1ZUUA 2DERA 2MK5A 3EH1A 3SEMA 1Q81U 1VOMA 1QMCA 3H9NA 2V8KA 4B9WA 1X43A 1HSQA 4JDSA 2P0PA 5CVIA 3LGFA 3G4SQ 4QVCA 3M0SA 2ESWA 1RAHB 2OAUA 2PTKA 3P8DA 3G4ST 1MGQA 2CSIA 2YLCA 1VQ8A 3UA7A 3HPWA 1GBQA 3OYJA 2MI6A 2A3LA 4QQGA 2X4XA 3EG2A 2QQ9A 2H3EB 4IUTA 3QZ5B 4JJDA 1K9MR 2FRYA 1WNLA 1AWJA 4O5VA 1K9MU 2QEXA 2O88A 3OS2A 2P4RA 3L2QA 2NUTB 1K8AC 3I5SA 1KIKA 5GAOm 1OZ3A 2JMAA 2SEMA 3CC4T 3J81E 2DEQA 4LDXA 3QWXX 2SRCA 5DLOA 1YITA 2EYWA 2VXFA 4FSSA 2DF6A 2X3WD 4IUQA 4KGVB 1WXTA 1IXDA 1V29B 4M77F 3JCMW 2COWA 1HD3A 4RTYA 5KYUA 3OYDA 4JRPA 5LJ3f 3HSBA 3M59A 2LRQA 2O9VA 4EDUA 4M75G 5LJ5h 1YITQ 2BE9B 1MMNA 3SD4A 1NG2A 4M78F 2KEAA 5KE2A 1OOTA 4AFUC 1CSKA 3JCMd 2J7IA 4BB7A 4Y28E 3JCMb 3MP1A 2D9TA 2P0KA 4CC3A 1VQOA 1VQ7T 2ZPGB 1UGPB 4GLMA 2LNHB 2KRSA 1PM3A 3VUZA 2RHUA 4BACA 4E47A 1O75A 2JTEA 1KQ1A 5A0GA 4BE2A 1SKUB 2D1XA 1BCMA 3L42A 1VQKT 3CC7T 4CC4B 1VQ8Q 3EG9A 1JQQA 4KUIA 2YT6A 4IUPA 3QJ6A 2GFAA 4KH1B 1FXXA 3T9NA 1X27A 1NLOC 3M0UA 4OMNA 1NJIR 2GCXA 2LCLA 3QWYA 1NJIU 3VS7A 2FG0A 3CCRT 3NTIA 4FCYA 3C4SA 1K1ZA 4E6RA 3CC2T 2LT1A 4M77C 3QJYA 3PVLA 4OMOA 4M7AA 8ATCB 4BE0A 2HMAA 2RQVA 3CC2Q 4X9CA 4DOVA 2OTLT 5LJ5f 2LX9A 2CUBA 4LE9A 1Z9QA 1PRLC 2ROTA 1QP3A 2KROA 2M0YA 4ANJA 3H0HA 2MCNA 1ABOA 4IUVA 4JJNK 1YCYA 1H3HA 3CMEQ 4JRQA 3JCMf 4ZN1A 2F5KA 4OVAA 2KDSA 4J9GA 3M4YA 3VJPA 1I1JA 3MP6A 1KC8R 5CKHA 3OYKA 3JSCA 4AFSC 1G3SA 2G6FX 2X4YA 2MYSA 1WHHA 4RCBA 4LD6A 4MZTA 2DL5A 2KE9A 4CC2A 4CI0C 2FYKA 2K3BA 5GAN7 3OW2A 4XU3A 3I56T 1KG1A 5FLXE 1KHCA 1IO6A 3E19A 2GTOA 2DFUA 1YN8A 4PKCC 1OU8A 1VQMT 2YRVA 3EG1A 2FB7A 1YI2T 5FRNA 3I56A 4M77A 1O9SA 2HKQB 2C0IA 1HJDA 3AT1B 1SSHA 2RNAA 2BZXA 1YIJA 4FYXB 3CCST 2NUPB 4IUUA 3LW5E 3M56A 2CZ6B 1LCKA 2ROLA 1EFNA 3OYYA 4FM4B 1WJRA 1GCPA 1NPPA 4M78A 3UATA 1ZHIA 4F14A 3EAEA 5GANg 2RQRA 1WZOA 2E5QA 5A0LA 3JCMc 2RJCA 3O8VA 4OMPA 3MO8A 1WGSA 1T0HA 2RHXA 4A54A 4M78D 2LJ1A 2GQVA 1VQ6Q 1KFZA 4IIMA 4E7IA 2X4JA 4GLKA 2PUKB 3HTRA 3PT9A 3WXMB 4N0AC 1N8RR 1PKTA 2KXDA 2PQWA 2RI2A 4JUVA 5GAN4 2DO3A 1VQ4Q 2CH4A 2JS0A 2RJFA 2OI3A 3ME9A 2J06A 1VQ4T 4Z88A 3TCJA 4FYWB 1GFDA 1W2BA 1JJ2P 1LVKA 4RTTA 2QDYB 3F70A 2YDLA 2DYBA 4P5NA 2JZ2A 1NJIC 2EIFA 4D8KA 4AT1B 1Z9ZA 2A28A 1RABB 1BYMA 2E10A 3CMAQ 2EQKA 4M7DF 2L89A 3MEAA 3JAME 2LX7A 1RUWA 2LCCA 3A1PA 2FZCB 5CKBA 1PRMC 2DK3A 1P92A 2RK2A 1G83A 3EG9B 3JCMQ 2WSCE 1QVFS 4C5HA 4PJJA 4N4HA 3NGPA 4C8QF 5GAMd 2K3XA 2JNGA 1M30A 3A8HB 2ABLA 2EJFA 4XTUA 4D8DA 1ARKA 2KT1A 5IHKA 1W6XA 2VGNA 2E64A 3JCMJ 4OB0B 2WSFE 1MV3A 4FW2A 1UG1A 2FL7A 1ZSZB 2F5TX 5I2SA 2I2LA 1JEGA 5LJ3e 2QTXA 3ZL7C 2CUDA 2DM1A 2DA9A 1TTHB 5KYWA 1AWOA 3MHXA 4J7FA 2RHYA 4XQ3A 5CAIA 3VYHB 3FC3A 2GBQA 3J7AF 1YHQA 3LWIA 4M7AE 1GBRA 2GQIA 3SFMA 1T0JA 3NFCA 3QHSA 3QBYA 5FROA 1Q86U 1GRIA 5IT9E 3CCEA 3PIOA 3THKA 4E7JA 2YUNA 4XTYA 5GAN8 4RTUA 4QW2A 2PVDB 2EBPA 2GFUA 2EGEA 1M90C 3ULRB 4ELYC 1Q95G 1UDLA 1KQSS 2ECZA 1D1BA 1D1AA 5CQXA 3INZA 1B34B 1H92A 1NYGA 1YNZA 3LH5A 1VQPQ 3G6EQ 2P84A 1WX6A 3OW2P 4C5EA 3FLGA 3OS1A 1M9SA 2KSSA 1VQPT 1UGVA 5D6WA 3CPWS 3PE0A 1NYFA 4JJCA 5A0DA 1PCXA 5LJ3j 3EGUA 3GBQA 3RUXA 3TVTA 3KFVA 2XDBA 1K8AU 1M2OA 2KK4A 2LTOA 2JM8A 4IKFA 4L5GA 3EFOA 2J05A 1WFWA 3CBMA 1KSWA 2IVWA 3CCLT 2ZPHB 1KD1U 2M51A 4FL6A 4M75F 4N0AA 3QZ9B 2M16A 5GMKm 2COZA 4EMHA 2X9HA 2XU8A 4K11A 3V8LA 3PGGA 4XU0A 1MV0B 2WACA 3I55A 4FT4A 4PJOD 4WF2A 3NTKA 4J6YA 2YSQA 3EFRA 2XK0A 2EYXA 2LC4A 2KBTA 2EWNA 4GY5A 5HK0A 1YJ9Q 3CXCS 3X24B 1K73C 1BBZA 3L2UA 3UF4A 4HA8A 1BI0A 1OV3A 1Y57A 1B34A 3RMQA 4J9IA 3M0QA 2MWPA 2VYTA 5FU7C 2ZAEA 4M78G 4HT8A 1XNIA 2DVEA 2E5KA 3I55T 1D0ZA 1Y96A 1QCFA 4R55A 1ZA2B 4PFOA 2HSPA 2RPNA 3OA6A 3OYBA 4C92D 3P8HA 5CQYA 4Y91A 1WXBA 2DBKA 1K0XA 3FB9A 4EPCA 4M7DD 2EGAA 3EFOB 2JMCA 4RKUE 1U5SA 2K79A 3CCJQ 4JS5A 2A08A 4QQ6A 5D6YA 3JCMe 2GNCA 2JJ9A 1RAAB 4XAXB 1YJWA 1MNEA 5LL6S 3REBB 2FEIA 2PZ1A 4AFZC 2AHJB 4OB2B 2Y4YA 1V1CA 1G8XA 1WDXA 4MMKA 2V8IA 3CCMQ 3H0IA 3BE3A 5IXBA 4PFPA 6AT1B 1GCQC 2J6FA 1VQLT 1WHJA 3RERA 2HEQA 1SSFA 1JBMA 2RI5A 3TQ7P 3EHRA 1Y96B 2AT1B 2O2OA 2V26A 4EMKC 1VQ9Q 1PHTA 3BFMA 3OYMA 3HFOA 1XJWB 1VQNT 4F7UF 3CD6A 4C8QE 3SWNA 3FRNA 5HCKA 3CCRQ 4MDXA 1RI0A 3TEEA 4F7UB 5GAMj 3G6ET 2F2VA 1ZQ1A 3VS3A 4JLIA 2DJQA 4PJLA 1QVFP 4BDZA 5HKCA 1BU1A 1KQ2A 3DB4A 2B8AA 3G7ZA 1AHJB 3HRTA 1YJNQ 2FO0A 1M8MA 2BKDN 2L8DA 3CCLQ 4LXCA 5C0MA 3CC7A 1VQKA 1F1BB 2HNIA 1PNJA 1IGQA 1SRMA 4D6WA 5GANf 3CMET 2JOYA 1NBEB 1Q7YC 1N9RA 1JJ2S 4JJBA 2CKKA 2DYIA 1RL2A 4A4GA 3JCMP 4E7SA 2A0FB 5I11A 1ZLMA 1VUBA 4C92G 5KYXA 2E6ZA 2RQUA 4C8QA 2E3IA 2LJ0A 1YJ9T 4A63B 2H8HA 1FX7A 3CEYA 2EKOA 2F2XA 1G3YA 2YWWA 3QYHB 5GMKl 2AK5A 4LNPA 1AWXA 3OSVA 3SHWA 1N6AA 4M7AC 1VIFA 5HK3A 1D09B 4J9CA 2F2WA 2L3SA 3CCUA 2OTJQ 1OEBA 1RAFB 2K9GA 1MHNA 2QYZA 3EG3A 5A2QE 3CCVQ 2EW3A 3QSUA 2FPEA 4E7LA 2NYSA 1BKBA 1QKXA 2LMJA 3OS5A 4IIOA
chains in the Genus database with same CATH topology
4HCKA 3VS0A 5ECAA 1GCPA 3UATA 1M3CA 2PNIA 1K4US 4JZ3A 1S1NA 2HBWA 2YUQA 4F14A 2RQRA 1ZUKA 3VS2A 3PVQA 3A98A 2DMOA 3UA6A 2EVRA 1XOVA 4OMPA 2EKHA 1WYXA 1T0HA 2LJ1A 2BTTA 1KFZA 4QT7A 4IIMA 3H0FA 2YUPA 1H8KA 1UE9A 1BK2A 2ENMA 1PWTA 2FPFA 4Z89A 2LP5A 1NLPC 1ZX6A 1NEBA 1WI7A 1PKSA 1PKTA 2KYBA 2KXDA 4WCIA 1E6GA 1M27C 5FWCA 1I07A 3M0TA 2CH4A 2JS0A 4RTWA 1K0SA 4M4ZA 2AZVA 2OI3A 4GBQA 1UHFA 2J06A 1I0CA 4Z88A 1YWOA 3TSWA 1GFDA 2GGRA 2EPDA 4RTTA 2YDLA 2DYBA 1E6HA 2EQIA 4D8KA 3R6NA 1Z9ZA 2A28A 2J6KA 3I5RA 2D0NA 1U3OA 2W0ZA 2DL3A 1OPLA 3RNJA 3EG0A 4HVWA 3JV3A 2LX7A 1RUWA 3EHQA 1ABQA 3NPFA 1J3TA 1GCQA 2JM9A 1PRMC 3M0RA 1G83A 2LZ6B 3U23A 2RN8A 2DLPA 2DL4A 3NGPA 1JXMA 5IHIA 1M3BA 2OJ2A 4R0KA 2LJ3A 3O5ZA 1M30A 5L23A 1UJYA 4LUEA 1JO8A 2ABLA 2L2PA 4J9BA 4D8DA 1ARKA 1GFCA 2KT1A 5IHKA 1W6XA 2AKKA 2I0NA 1W70A 1GL5A 1AZEA 2FRWA 1MV3A 4Y92A 1B07A 1UG1A 1SPKA 2AZSA 1YP5A 4LUDA 1U06A 2XMFA 3CQTA 1B3QA 3TSZA 1JEGA 2VWFA 3ZL7C 1UJ0A 1QWEA 2CUDA 2W10A 2DM1A 2V1RA 1M3AA 2DA9A 2KGTA 1AWOA 4DEXA 4RTVA 4HVVA 2CDTA 2RQWA 2KRMA 2NUZA 2VKNA 4RTXA 1YWPA 3VRYA 4ZNXA 1AOJA 2GBQA 1ZBJA 1X2QA 1GBRA 1WXUA 2GQIA 1T0JA 1GRIA 1VYVA 4ORZA 1AWWA 4AFQC 1T3SA 3THKA 2O31A 2YUNA 1UTIA 2JT4A 1UFFA 1SRLA 2D8JA 1RLPC 4RTUA 2HCKA 2MOXA 5IXFA 2EBPA 1K9AA 1TG0A 3I9QA 2EGEA 2LQWA 4DEYA 3ULRB 4X1VA 1UDLA 2ECZA 3VS5A 2J6OA 4J9EA 2ED0A 5GJWB 1H92A 3VS1A 1NYGA 1YNZA 3LH5A 3H41A 3IQLA 4EIKA 1WX6A 4F17A 1X69A 2DNUA 1N5ZA 1UGVA 2EYYA 3VS4A 2QDLA 3PE0A 5GJVB 1A0NB 1NYFA 2C0TA 4JJCA 2CREA 3EGUA 3GBQA 4J9FA 5FWBA 3KFVA 3TVTA 2CT3A 2O9SA 1X6BA 2JM8A 2J05A 1WFWA 2KR3A 2EGCA 2K2MA 2RMOA 1X6GA 1KSWA 1ZUUA 2IIMA 2M51A 2DILA 3SEMA 2MIOA 1NEGA 4F16A 1X43A 5IH2A 1UHCA 1HSQA 1KJWA 4K11A 1JXOA 2CT4A 1VA7A 1MV0B 2FPDA 2YSQA 2EYXA 2OAWA 3M0SA 2KBTA 2ESWA 2PTKA 2CSIA 3UA7A 2LCSA 2A37A 4OMLA 1GBQA 1BBZA 1G2BA 3VRZA 3UF4A 3EG2A 1RI9A 1OV3A 1Y57A 4J9IA 3M0QA 3C0CA 4JJDA 2FRYA 1AWJA 2E5KA 2O88A 2P4RA 3RBBB 1AD5A 1QCFA 3I5SA 1KIKA 1W1FA 4JPBW 1OPKA 2HSPA 2RPNA 2JMAA 2SEMA 1YCSB 2L3PA 4HVUA 5EC7A 4LN2A 1WXBA 2SRCA 3QWXX 1JU5C 2A36A 2DBKA 1K0XA 2EYWA 4AG1C 2EGAA 4FSSA 2DF6A 2X3WD 2JMCA 1FYNA 2KXCA 1ZUYA 1U5SA 2K79A 1WXTA 2A08A 2B86A 1HD3A 2BZYA 1WLPB 2GNCA 1QWFA 2BZ8A 4RTYA 2CH4W 1Y0MA 3REBB 2FEIA 2PZ1A 4AFZC 2RF0A 2O9VA 4RTZA 2KRNA 1RLQC 2KYMA 4JZ4A 1V1CA 1WDXA 3H0IA 1NG2A 5IXBA 2KEAA 1TUCA 1OOTA 4AFUC 1CSKA 1MUZA 1T3LA 2J7IA 1GCQC 2J6FA 4CC3A 2VVKA 4GLMA 2LNHB 2KRSA 2HEQA 2DE0X 2JW4A 4RUGA 2JTEA 3EHRA 1TUDA 1E7OA 2O2OA 4Z8AA 2D1XA 1PHTA 1QKWA 2DRKA 3I35A 4CC4B 2DVJA 1SEMA 1JQQA 1ZSGA 2YT6A 5HCKA 2EYZA 2F2VA 4HXJA 3VS3A 1UECA 1X27A 1NLOC 2V1QA 3M0UA 4OMNA 2DJQA 1WA7A 3QWYA 3VS7A 2FG0A 3VS6A 4J9DA 1BU1A 1K1ZA 4E6RA 1FMKA 2K6DA 2K7AA 5I22A 1WIEA 2D8HA 1K76A 1CKAA 1VYUA 2FO0A 3PVLA 1M8MA 4OMOA 2JS2A 2RQVA 1AEYA 2DBMA 5IHNA 1VYTA 1SHFA 2DL8A 2CUBA 2KT8A 4LE9A 1Z9QA 1NM7A 1PNJA 1SRMA 1AZGB 1PRLC 2ROTA 4JJBA 2KROA 2M0YA 2AKLA 1UUEA 2YUOA 3H0HA 4OMQA 1CKBA 2MCNA 1ABOA 2RQTA 4J9HA 1H3HA 2DL7A 4IIOA 5I11A 2DRMA 1ZLMA 4J9GA 3REAB 2KNBB 1I1JA 2RQUA 2LJ0A 4AFSC 4AG2C 2G6FX 4A63B 2H8HA 2CSQA 3NMZC 2DL5A 2KE9A 2X3XD 4CC2A 2K3BA 2F2XA 4KRTA 2HDAA 1IO6A 2AK5A 2GTOA 4LNPA 1AWXA 5FW9A 4CC7A 3SHWA 1YN8A 4ESRA 1BB9A 3EG1A 1QLYA 2GTJA 3M0PA 2L3QA 4J9CA 2F2WA 2L3SA 4OMMA 3FJ5A 1OEBA 2JXBA 2K9GA 2DX1A 1AVZC 3NHNA 2C0IA 1HJDA 1SSHA 3EG3A 2RNAA 2BZXA 1SHGA 2EW3A 2LQNA 2FPEA 2ED1A 1X2KA 2L0AA 1QKXA 2NWMA 1LCKA 2LMJA 2ROLA 1EFNA 2C0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HCK A;  3VS0 A;  5ECA A;  1GCP A;  3UAT A;  1M3C A;  2PNI A;  1K4U S;  4JZ3 A;  1S1N A;  2HBW A;  2YUQ A;  4F14 A;  2RQR A;  1ZUK A;  3VS2 A;  3PVQ A;  3A98 A;  2DMO A;  3UA6 A;  2EVR A;  1XOV A;  4OMP A;  2EKH A;  1WYX A;  1T0H A;  2LJ1 A;  2BTT A;  1KFZ A;  4QT7 A;  4IIM A;  3H0F A;  2YUP A;  1H8K A;  1UE9 A;  1BK2 A;  2ENM A;  1PWT A;  2FPF A;  4Z89 A;  2LP5 A;  1NLP C;  1ZX6 A;  1NEB A;  1WI7 A;  1PKS A;  1PKT A;  2KYB A;  2KXD A;  4WCI A;  1E6G A;  1M27 C;  5FWC A;  1I07 A;  3M0T A;  2CH4 A;  2JS0 A;  4RTW A;  1K0S A;  4M4Z A;  2AZV A;  2OI3 A;  4GBQ A;  1UHF A;  2J06 A;  1I0C A;  4Z88 A;  1YWO A;  3TSW A;  1GFD A;  2GGR A;  2EPD A;  4RTT A;  2YDL A;  2DYB A;  1E6H A;  2EQI A;  4D8K A;  3R6N A;  1Z9Z A;  2A28 A;  2J6K A;  3I5R A;  2D0N A;  1U3O A;  2W0Z A;  2DL3 A;  1OPL A;  3RNJ A;  3EG0 A;  4HVW A;  3JV3 A;  2LX7 A;  1RUW A;  3EHQ A;  1ABQ A;  3NPF A;  1J3T A;  1GCQ A;  2JM9 A;  1PRM C;  3M0R A;  1G83 A;  2LZ6 B;  3U23 A;  2RN8 A;  2DLP A;  2DL4 A;  3NGP A;  1JXM A;  5IHI A;  1M3B A;  2OJ2 A;  4R0K A;  2LJ3 A;  3O5Z A;  1M30 A;  5L23 A;  1UJY A;  4LUE A;  1JO8 A;  2ABL A;  2L2P A;  4J9B A;  4D8D A;  1ARK A;  1GFC A;  2KT1 A;  5IHK A;  1W6X A;  2AKK A;  2I0N A;  1W70 A;  1GL5 A;  1AZE A;  2FRW A;  1MV3 A;  4Y92 A;  1B07 A;  1UG1 A;  1SPK A;  2AZS A;  1YP5 A;  4LUD A;  1U06 A;  2XMF A;  3CQT A;  1B3Q A;  3TSZ A;  1JEG A;  2VWF A;  3ZL7 C;  1UJ0 A;  1QWE A;  2CUD A;  2W10 A;  2DM1 A;  2V1R A;  1M3A A;  2DA9 A;  2KGT A;  1AWO A;  4DEX A;  4RTV A;  4HVV A;  2CDT A;  2RQW A;  2KRM A;  2NUZ A;  2VKN A;  4RTX A;  1YWP A;  3VRY A;  4ZNX A;  1AOJ A;  2GBQ A;  1ZBJ A;  1X2Q A;  1GBR A;  1WXU A;  2GQI A;  1T0J A;  1GRI A;  1VYV A;  4ORZ A;  1AWW A;  4AFQ C;  1T3S A;  3THK A;  2O31 A;  2YUN A;  1UTI A;  2JT4 A;  1UFF A;  1SRL A;  2D8J A;  1RLP C;  4RTU A;  2HCK A;  2MOX A;  5IXF A;  2EBP A;  1K9A A;  1TG0 A;  3I9Q A;  2EGE A;  2LQW A;  4DEY A;  3ULR B;  4X1V A;  1UDL A;  2ECZ A;  3VS5 A;  2J6O A;  4J9E A;  2ED0 A;  5GJW B;  1H92 A;  3VS1 A;  1NYG A;  1YNZ A;  3LH5 A;  3H41 A;  3IQL A;  4EIK A;  1WX6 A;  4F17 A;  1X69 A;  2DNU A;  1N5Z A;  1UGV A;  2EYY A;  3VS4 A;  2QDL A;  3PE0 A;  5GJV B;  1A0N B;  1NYF A;  2C0T A;  4JJC A;  2CRE A;  3EGU A;  3GBQ A;  4J9F A;  5FWB A;  3KFV A;  3TVT A;  2CT3 A;  2O9S A;  1X6B A;  2JM8 A;  2J05 A;  1WFW A;  2KR3 A;  2EGC A;  2K2M A;  2RMO A;  1X6G A;  1KSW A;  1ZUU A;  2IIM A;  2M51 A;  2DIL A;  3SEM A;  2MIO A;  1NEG A;  4F16 A;  1X43 A;  5IH2 A;  1UHC A;  1HSQ A;  1KJW A;  4K11 A;  1JXO A;  2CT4 A;  1VA7 A;  1MV0 B;  2FPD A;  2YSQ A;  2EYX A;  2OAW A;  3M0S A;  2KBT A;  2ESW A;  2PTK A;  2CSI A;  3UA7 A;  2LCS A;  2A37 A;  4OML A;  1GBQ A;  1BBZ A;  1G2B A;  3VRZ A;  3UF4 A;  3EG2 A;  1RI9 A;  1OV3 A;  1Y57 A;  4J9I A;  3M0Q A;  3C0C A;  4JJD A;  2FRY A;  1AWJ A;  2E5K A;  2O88 A;  2P4R A;  3RBB B;  1AD5 A;  1QCF A;  3I5S A;  1KIK A;  1W1F A;  4JPB W;  1OPK A;  2HSP A;  2RPN A;  2JMA A;  2SEM A;  1YCS B;  2L3P A;  4HVU A;  5EC7 A;  4LN2 A;  1WXB A;  2SRC A;  3QWX X;  1JU5 C;  2A36 A;  2DBK A;  1K0X A;  2EYW A;  4AG1 C;  2EGA A;  4FSS A;  2DF6 A;  2X3W D;  2JMC A;  1FYN A;  2KXC A;  1ZUY A;  1U5S A;  2K79 A;  1WXT A;  2A08 A;  2B86 A;  1HD3 A;  2BZY A;  1WLP B;  2GNC A;  1QWF A;  2BZ8 A;  4RTY A;  2CH4 W;  1Y0M A;  3REB B;  2FEI A;  2PZ1 A;  4AFZ C;  2RF0 A;  2O9V A;  4RTZ A;  2KRN A;  1RLQ C;  2KYM A;  4JZ4 A;  1V1C A;  1WDX A;  3H0I A;  1NG2 A;  5IXB A;  2KEA A;  1TUC A;  1OOT A;  4AFU C;  1CSK A;  1MUZ A;  1T3L A;  2J7I A;  1GCQ C;  2J6F A;  4CC3 A;  2VVK A;  4GLM A;  2LNH B;  2KRS A;  2HEQ A;  2DE0 X;  2JW4 A;  4RUG A;  2JTE A;  3EHR A;  1TUD A;  1E7O A;  2O2O A;  4Z8A A;  2D1X A;  1PHT A;  1QKW A;  2DRK A;  3I35 A;  4CC4 B;  2DVJ A;  1SEM A;  1JQQ A;  1ZSG A;  2YT6 A;  5HCK A;  2EYZ A;  2F2V A;  4HXJ A;  3VS3 A;  1UEC A;  1X27 A;  1NLO C;  2V1Q A;  3M0U A;  4OMN A;  2DJQ A;  1WA7 A;  3QWY A;  3VS7 A;  2FG0 A;  3VS6 A;  4J9D A;  1BU1 A;  1K1Z A;  4E6R A;  1FMK A;  2K6D A;  2K7A A;  5I22 A;  1WIE A;  2D8H A;  1K76 A;  1CKA A;  1VYU A;  2FO0 A;  3PVL A;  1M8M A;  4OMO A;  2JS2 A;  2RQV A;  1AEY A;  2DBM A;  5IHN A;  1VYT A;  1SHF A;  2DL8 A;  2CUB A;  2KT8 A;  4LE9 A;  1Z9Q A;  1NM7 A;  1PNJ A;  1SRM A;  1AZG B;  1PRL C;  2ROT A;  4JJB A;  2KRO A;  2M0Y A;  2AKL A;  1UUE A;  2YUO A;  3H0H A;  4OMQ A;  1CKB A;  2MCN A;  1ABO A;  2RQT A;  4J9H A;  1H3H A;  2DL7 A;  4IIO A;  5I11 A;  2DRM A;  1ZLM A;  4J9G A;  3REA B;  2KNB B;  1I1J A;  2RQU A;  2LJ0 A;  4AFS C;  4AG2 C;  2G6F X;  4A63 B;  2H8H A;  2CSQ A;  3NMZ C;  2DL5 A;  2KE9 A;  2X3X D;  4CC2 A;  2K3B A;  2F2X A;  4KRT A;  2HDA A;  1IO6 A;  2AK5 A;  2GTO A;  4LNP A;  1AWX A;  5FW9 A;  4CC7 A;  3SHW A;  1YN8 A;  4ESR A;  1BB9 A;  3EG1 A;  1QLY A;  2GTJ A;  3M0P A;  2L3Q A;  4J9C A;  2F2W A;  2L3S A;  4OMM A;  3FJ5 A;  1OEB A;  2JXB A;  2K9G A;  2DX1 A;  1AVZ C;  3NHN A;  2C0I A;  1HJD A;  1SSH A;  3EG3 A;  2RNA A;  2BZX A;  1SHG A;  2EW3 A;  2LQN A;  2FPE A;  2ED1 A;  1X2K A;  2L0A A;  1QKX A;  2NWM A;  1LCK A;  2LMJ A;  2ROL A;  1EFN A;  2C0O A; 
#chains in the Genus database with same CATH topology
 4HCK A;  3VS0 A;  2AIR B;  4C5G A;  2LQ8 A;  3S3O A;  4JZ3 A;  3E2U A;  4KUD K;  2QI2 A;  2E65 A;  9ATC B;  3OYN A;  3LLR A;  1ZUK A;  2M0O A;  5D7U A;  3OMC A;  3VS2 A;  1G3T A;  4M75 B;  5DM7 R;  2EVR A;  2XID A;  2QQB A;  3KUF A;  1Q82 U;  2BTT A;  4X34 A;  1VQN A;  3V8K A;  2YUP A;  1QVF A;  1BK2 A;  4XTX A;  1NZ9 A;  3QKJ A;  3JB9 F;  1NEB A;  3URG A;  3DLM A;  5GMK e;  1QVG A;  4OB3 B;  4PJO E;  3CCU Q;  1M8V A;  1JB0 E;  4F7U G;  1M27 C;  4QVD A;  5EG2 A;  1I07 A;  5FWC A;  1VQL A;  3OYG A;  2CZ1 B;  4RTW A;  1TU0 B;  4EMK A;  2AZV A;  4RG2 A;  3VU3 C;  1UHF A;  2M1H A;  3RR6 A;  4MDW A;  2GGR A;  3OW2 S;  1YHQ T;  2IG0 A;  2EQU A;  2RHI A;  1E6H A;  5DY9 A;  4DBH A;  3R6N A;  1BI2 A;  1OQK A;  2W0Z A;  4OMF B;  3RNJ A;  3C95 A;  1ACM B;  3V7R A;  3EG0 A;  4E7H A;  3A8O B;  4C92 A;  4LDW A;  1D1C A;  2D0Q B;  3MEW A;  3NPF A;  5GAN 5;  2GF7 A;  1GCQ A;  2QG9 B;  2JM9 A;  3CCS A;  4F04 B;  5AT1 B;  1C0M A;  2LZ6 B;  2DL4 A;  2CP7 A;  1VQK Q;  3CC7 Q;  2OJ2 A;  3CCL A;  4PJO G;  2LJ3 A;  1UJY A;  5C6S A;  4WTO B;  4J9B A;  1SF9 A;  2CP0 A;  1GFC A;  2O4X B;  1VQ5 T;  2I0N A;  4OF1 A;  1GL5 A;  2FRW A;  4M77 G;  5FRM A;  1N9S A;  1YBY A;  3CQT A;  5CKF A;  1B3Q A;  5AYF A;  2VWF A;  1QWE A;  2W10 A;  3L1A A;  3BDU A;  4MZP A;  1M3A A;  3CCR A;  1UGQ B;  2BE7 D;  2KRM A;  4M77 B;  2NUZ A;  4RTX A;  2EQM A;  1AOJ A;  2YXY A;  3OSS C;  4QVZ A;  2OTJ T;  1VQ9 A;  1M4Z A;  2KQW A;  2NUP A;  1QW1 A;  4PJO C;  1UGR B;  4AFQ C;  4M75 C;  3JCM g;  4X9D A;  2WSE E;  1UTI A;  2JT4 A;  4QKU A;  4C8Q B;  1RLP C;  2LNV A;  2HCK A;  4M78 B;  3PIP A;  1M2V B;  2MOX A;  3L2W A;  1K9A A;  3LYI A;  5D6X A;  3MPU B;  2XDP A;  4VUB A;  3OYH A;  2EFI A;  4DEY A;  4A53 A;  3GIB A;  2X35 A;  3OYA A;  4ME7 A;  2O4X A;  1M90 R;  2VAS A;  3AHU A;  5GAN j;  3VS1 A;  1U1T A;  2YLB A;  2E12 A;  1OX9 A;  4EIK A;  3P8B B;  4PFZ A;  1XQH A;  1QVG S;  1N5Z A;  2YRD A;  1YI2 Q;  1S72 Q;  2X51 A;  1M1F A;  3VS4 A;  1VQM A;  1VQ5 A;  2FZK B;  1UB4 A;  5GJV B;  3V7C A;  2EYQ A;  1D0Y A;  4NL2 A;  3CC4 Q;  3RIR A;  1I4K 1;  4QQD A;  4PL6 A;  4C0F A;  2ATC B;  2RI3 A;  4C0G A;  4HT9 A;  4BI4 A;  4C8Q D;  2DIL A;  2MIO A;  3EGX B;  1EX4 A;  3DB3 A;  4ZN3 A;  2HZY A;  4JS4 A;  3MEV A;  3GPL A;  2QA4 Q;  3PFS A;  1RAC B;  1SG5 A;  2PUO B;  1VA7 A;  4B6M A;  2QEX T;  2Y4X A;  1MMD A;  1X01 A;  2OAW A;  4OP0 A;  3GNF B;  4Z02 A;  1HXD A;  2A37 A;  2QGF B;  3I55 Q;  1G2B A;  1N8R U;  1RI9 A;  3VKI A;  5GAM f;  3EH2 A;  3C0C A;  3UWN A;  3PMI A;  2C06 A;  4JPB W;  1KQS A;  5J26 A;  1OPK A;  3MEU A;  2MMP A;  3JB9 H;  1D0X A;  1YCS B;  4Q5W A;  4HVU A;  3CCJ T;  5EC7 A;  3VYG A;  1JU5 C;  1WHG A;  2DKG A;  2V8J A;  4C8Q C;  2A36 A;  3EGD B;  4RCC A;  1Y71 A;  4FW1 A;  4J6X A;  2DZ9 A;  1FYN A;  2G3R A;  3M4G A;  3QPH A;  2JTM A;  4NS5 A;  2B86 A;  1VQP A;  2BZY A;  5CKD A;  1XTD A;  1Q7Y U;  1QWF A;  2BZ8 A;  2CH4 W;  2FHD A;  4HCB A;  1YJW T;  1Y0M A;  3CXC P;  1Q82 C;  4M75 D;  2RF0 A;  2KRN A;  3X25 B;  5KYY B;  4EMG A;  3RKY A;  4C0D C;  2DPP B;  1TUC A;  1RAD B;  1KK7 A;  1T3L A;  1IRX A;  2IPO B;  1W2B S;  1Q86 C;  1M5Q 1;  4BI8 B;  3G71 T;  4PJN A;  2K2V A;  4BY6 B;  2DE0 X;  4M7D C;  2E6N A;  4RUG A;  1E7O A;  4Z8A A;  1YHQ Q;  1RAI B;  2DRK A;  4JLG A;  2DVJ A;  2QGG A;  5M9O A;  2BUD A;  4IUR A;  1MND A;  3C94 A;  1K73 U;  5LJ5 g;  4XU1 A;  1TS9 A;  5LJ5 j;  4C8Q G;  2RB6 A;  4HXJ A;  1UEC A;  2V1Q A;  2QA4 A;  1WQ7 A;  3S3M A;  1WA7 A;  2VV5 A;  3VS6 A;  4J9D A;  3RKW A;  4LDU A;  1LNX A;  5I22 A;  4RMO A;  1K76 A;  1VYU A;  2JS2 A;  8AT1 B;  1YIT T;  1AEY A;  3JB9 D;  2DBM A;  4BE1 A;  4ATO A;  3CC4 A;  1NM7 A;  1AZG B;  1VQ5 Q;  1VQM Q;  4C92 F;  1S72 A;  1YI2 A;  2AKL A;  4OMQ A;  2KAF A;  1CKB A;  2Y90 A;  3GF5 A;  3FJP A;  2D6F A;  4J9H A;  1G3W A;  2Z0W A;  2DL7 A;  2QAS A;  5GAN 3;  4XK8 E;  3E1S A;  3UDC A;  1WPY A;  2PVG B;  2RA2 A;  3REA B;  2KNB B;  1RAE B;  2LVM A;  3OYI A;  4AG2 C;  2ZPE B;  1X6O A;  2VC8 A;  3NMZ C;  4HCC A;  1DJ7 B;  3HL8 A;  3A8M B;  2X3X D;  4KGX B;  4BD3 A;  3CPW A;  4KRT A;  1I5L A;  4KBM B;  5FW9 A;  1KD1 R;  3L2Z A;  4OB1 B;  3MCA B;  3L2R A;  1R77 A;  2GTJ A;  2HL5 C;  3LGL A;  1IGU A;  1YFN A;  2ZPI B;  2L3Q A;  1VQ6 T;  1JRI A;  4OMM A;  1OI1 A;  2JXB A;  2DX1 A;  3NHN A;  1AVZ C;  1QCO A;  2XDD A;  2DET A;  1FWZ A;  1JJ2 A;  1X2K A;  2L0A A;  2NWM A;  1R8O B;  5HY6 A;  1K73 R;  1VQ6 A;  3UPU A;  2CP2 A;  5ECA A;  3QII A;  2CP3 A;  1M3C A;  2PNI A;  5IAY A;  1TXQ A;  2YUQ A;  1B7T A;  2QK0 A;  2YHT A;  3CMA T;  1Q81 R;  3M58 A;  5KE3 A;  3A98 A;  3OY9 A;  5GAM e;  3SDZ A;  2DMO A;  2E1H A;  3MKD A;  3UA6 A;  1NPR A;  4R56 A;  1Q81 C;  2LT4 A;  1OX8 A;  1BI3 A;  3FDR A;  4M7A D;  4QT7 A;  3H0F A;  1WHL A;  5KH6 A;  1PWT A;  1YIJ Q;  2ZZD A;  4Z89 A;  2LP5 A;  3CCS Q;  1NLP C;  2HKN A;  2KVQ G;  1ZX6 A;  3JCM V;  3ZBD A;  1WI7 A;  1PKS A;  4A4K A;  5GMK j;  3OMG A;  3VV0 A;  2KYB A;  3QYG B;  1E6G A;  2MWO A;  3CPF A;  1IB8 A;  3SWN B;  1K0S A;  2CZ7 B;  4M4Z A;  7AT1 B;  1Y7X A;  5CR2 A;  3X20 B;  1BI1 A;  4JRI A;  4DBF A;  2QXF A;  2J6K A;  3V8J A;  2D0N A;  4UC4 A;  2DL3 A;  1OPL A;  3OYF A;  4ZGD B;  3JB9 I;  4HVW A;  2O01 E;  3JV3 A;  1VQL Q;  3CME A;  1ABQ A;  2DXT A;  3PMT A;  4NL3 A;  4M75 E;  1TWB A;  4M78 C;  3M0R A;  2XI9 A;  3U23 A;  2DLP A;  3HP9 A;  3NTH A;  5IHI A;  4KGZ B;  1M3B A;  5CKE A;  2CGH A;  4AMC A;  3QG1 A;  3A5Z B;  4R0K A;  1WHM A;  1VQN Q;  5L23 A;  5GAO r;  5KYX B;  1JO8 A;  2L2P A;  4BUG A;  2QAZ A;  2DJZ A;  2AKK A;  2ZCF B;  2DIG A;  1QCN A;  1B07 A;  1SPK A;  4LUD A;  1U06 A;  3JB9 G;  2DD4 A;  1Q7Y R;  1I5O B;  5KYN A;  2CP6 A;  2R58 A;  4C0D B;  2P4T A;  3BW1 A;  1UJ0 A;  3MJX A;  2M9U A;  3ER0 A;  3CXC A;  2NLU A;  5J3B A;  1RAG B;  1N8R C;  4DEX A;  4HVV A;  3CCV A;  1BCO A;  5KYU B;  3VRY A;  4ZNX A;  5CCA A;  3QDF A;  2OTJ A;  2RM4 A;  3LWH A;  1X2Q A;  1WXU A;  3M5A A;  3OS0 A;  4B9X A;  4M7D E;  1EZZ B;  1KC8 C;  3R6O A;  1VQO Q;  5GAO q;  1SRL A;  3GNG A;  4L59 A;  5IXF A;  3CD6 T;  1OYX A;  3RMS A;  1HK9 A;  5GAO p;  4XU2 A;  5KCO A;  1ZA1 B;  2DTI A;  2LQW A;  4X1V A;  3KXT A;  1LPL A;  5GAO l;  2H3J A;  3VS5 A;  4ZGJ B;  2DD5 A;  4A4E A;  3H41 A;  3IQL A;  1M1K C;  1UEB A;  4J6W A;  2LDM A;  1C6V X;  1PSF A;  1X69 A;  2DNU A;  2JUF A;  5GAN d;  2EYY A;  2FZG B;  1C1A A;  2EQJ A;  2HQX A;  2QDL A;  4FYY B;  2RHZ A;  1A0N B;  4HCZ A;  5GAO n;  3JB9 J;  4XTZ A;  1X6B A;  2P0Q A;  4L6V 5;  4F7U E;  2K2M A;  3V7S A;  1YJN A;  2E41 A;  2IIM A;  2QEX Q;  2QQA A;  3HFN A;  1NEG A;  2A7Y A;  4A4H A;  4ZTJ A;  1Q86 R;  4M7A F;  4F16 A;  5IH2 A;  1UHC A;  1KJW A;  3QDR B;  1BIB A;  1JXO A;  2CT4 A;  1IZ6 A;  4C92 E;  2FPD A;  3WVD B;  1PG5 B;  1UGS B;  3JRZ A;  1KQS P;  4ELZ C;  3CD6 Q;  1I81 A;  2OX7 A;  3G4S A;  3CCM T;  2LCS A;  4OML A;  1LJO A;  3VRZ A;  1AT1 B;  3EFS A;  1FMW A;  1EIF A;  3M9Q A;  4N4I A;  5IN1 A;  4DA4 A;  3RBB B;  1V76 A;  1AD5 A;  2DTO A;  1QP2 A;  3HHT B;  1R0C B;  1TH7 A;  1W1F A;  3FIF A;  4C5I A;  2OTL A;  1IHW A;  4MZM A;  4M78 E;  1KHI A;  3UT1 A;  4PJO B;  2ZPB B;  2L3P A;  1I8F A;  4LN2 A;  3CCM A;  4RG8 A;  2DXU A;  2DAQ A;  4AG1 C;  4V2S A;  1TOV A;  2BIV A;  2E3H A;  2HSE B;  4FU6 A;  1PC0 A;  2KXC A;  1M90 U;  1ZUY A;  2K4Y A;  3H8Z A;  1WJS A;  3KBG A;  3QXE B;  3GLX A;  5GAN h;  1YJW Q;  4E7Z A;  2RJD A;  4J83 A;  1MMA A;  4OGC A;  1WLP B;  3L2V A;  2K5I A;  2MF2 A;  3CCJ A;  5FU7 B;  2DXB A;  4RTZ A;  2KMT A;  2QQS A;  1YIJ T;  1RLQ C;  2KYM A;  1PD1 A;  4JZ4 A;  2HL3 A;  2JVV A;  1IRE B;  2M02 A;  4II1 A;  4E2F B;  1MUZ A;  4KT0 E;  1TSF A;  3RDV A;  3S3N A;  2VVK A;  1ZSZ C;  1VQ7 A;  5L8R E;  1W4S A;  3PNW C;  1YJN T;  2MPX C;  2JW4 A;  1WHK A;  1TUD A;  5J39 A;  3J80 E;  3CBO A;  4F7U A;  2HQH A;  1QKW A;  2R5M A;  3I35 A;  2XKO C;  1YJ9 A;  1SEM A;  1ZSG A;  4PK4 A;  3N5B B;  2EYZ A;  1K9M C;  4DOW A;  2VUB A;  2HD0 A;  5DLQ E;  4PNO A;  1Y07 A;  3H6Z A;  1N27 A;  1FMK A;  2K6D A;  2K7A A;  4YTL A;  1WIE A;  2D8H A;  4FSX A;  1CKA A;  4OGE A;  1W2B P;  1MMG A;  2EAY A;  3QO3 A;  2JTF A;  1VQ9 T;  2L5Q A;  4LDV A;  1Q82 R;  5IHN A;  1VYT A;  1SHF A;  2DL8 A;  3PTA A;  2KT8 A;  3A8G B;  3WVE B;  3ASK A;  4M7D A;  3M54 A;  1UUE A;  2YUO A;  4BDY A;  2XHC A;  3OB9 A;  3TU4 K;  3G71 A;  5GAM h;  2RQT A;  3G6E A;  2DRM A;  3TRE A;  4PJO F;  4FIB A;  3CCQ Q;  2DZC A;  4KH0 B;  3QUI A;  2PU9 B;  2K57 A;  4C92 C;  2ZPF B;  2CSQ A;  2F69 A;  2E70 A;  2QTV A;  1S72 T;  1ZSZ A;  3HRU A;  2HDA A;  3M55 A;  4O6J A;  1LOJ A;  4TVR A;  4CC7 A;  1QVG P;  3E9F A;  4ESR A;  1OUL A;  1BB9 A;  3CCE Q;  4LDY A;  3BY7 A;  5KYW B;  1VQO T;  1QLY A;  4XTW A;  3EGD A;  3M0P A;  1D3B A;  3LX7 A;  2HAX A;  3VUB A;  3FJ5 A;  5I21 A;  4E7K A;  2RK1 A;  1OZ2 A;  1WQW A;  3JCM X;  1SHG A;  3M57 A;  2LQN A;  5FU6 B;  5FU6 C;  3RES A;  2ED1 A;  3A8L B;  1GXI E;  3CCU T;  5LJ3 d;  2C0O A;  4M75 A;  5CO7 A;  5GAN 2;  4DBR A;  3SWN C;  1K4U S;  1S1N A;  2HBW A;  5KYY A;  4NOY A;  3PVQ A;  2QA4 T;  3RKX A;  2R57 A;  3MP8 A;  3DLL A;  1XOV A;  2EKH A;  2DIQ A;  1WYX A;  1HYO A;  2VGM A;  3D7S B;  4ZTF A;  4PJO A;  3OQ5 A;  2DEU A;  4BI3 A;  1VIE A;  3S6W A;  1H8K A;  1UE9 A;  2K3Y A;  4JRK A;  2ENM A;  3MET A;  4EMK B;  2FPF A;  4A4F A;  4PLI A;  5GAM g;  4WCI A;  5GAN 6;  2ZGW A;  3M0T A;  3CPW P;  1D3B B;  2VB6 A;  2NUT A;  2XD0 A;  3CMA A;  2FVU A;  2YRC A;  4GBQ A;  5LJ5 d;  1I0C A;  3SB2 A;  1YWO A;  3TSW A;  3OYE A;  2EPD A;  2E4H A;  2KI7 A;  2XIC A;  2MAM A;  3HKS A;  4FYV B;  4HKE A;  2CZ0 B;  4C92 B;  2EQI A;  2RH2 A;  1WJQ A;  3I5R A;  1QQJ A;  1U3O A;  2EJG A;  2QQR A;  2F1L A;  3CCQ A;  2RJE A;  1VQ4 A;  1ZBX A;  3EHQ A;  2CP5 A;  1G5V A;  1J3T A;  2COY A;  2K5F A;  3Q1J A;  3G71 Q;  1FMV A;  4M77 D;  2X4W A;  2LQK A;  4C0Z A;  2DXC A;  5GMK i;  1M1K R;  2K5L A;  2RN8 A;  1M1K U;  3ZFJ A;  3C12 A;  1JXM A;  2L3R A;  5LJ5 e;  1K8A R;  2KY9 A;  5I2M A;  3O5Z A;  5LJ3 g;  5CIU A;  2HQE A;  4J5Y A;  2HBP A;  4LUE A;  4N4G A;  3CCQ T;  1R0B G;  3GOX A;  2R5A A;  3JCM h;  1W70 A;  1AZE A;  4FT2 A;  3X26 B;  4Y92 A;  2AZS A;  1YP5 A;  2XMF A;  3TSZ A;  3OBW A;  4M77 E;  1KC8 U;  3E9G A;  3X28 B;  2V1R A;  1U1S A;  4J8O A;  4KUL A;  2KGT A;  4RTV A;  2RO0 A;  5CK9 A;  3CCE T;  2CDT A;  2RQW A;  4PJM A;  4M7A G;  2VKN A;  1YWP A;  5GMK h;  4M7D B;  4ZGE B;  1IHV A;  2RD1 A;  3OYL A;  2DTH A;  5GAN e;  2JN0 A;  3I56 Q;  1ZBJ A;  1M2V A;  1OU9 A;  1KD1 C;  1PD0 A;  3OBY A;  1VYV A;  4ORZ A;  1AWW A;  4DBQ A;  1T3S A;  1PSE A;  3G1J A;  1U8R A;  1VQ7 Q;  4CRI A;  2O31 A;  2EJ9 A;  4M7A B;  1UFF A;  1NE8 A;  2D8J A;  4M7D G;  2XG8 D;  3BDL A;  3ZEH A;  3GP8 A;  2VXE A;  1TG0 A;  3I9Q A;  2CS7 A;  4J7I A;  1VQ8 T;  1M1G A;  4LD9 K;  2J6O A;  4J9E A;  1H3Z A;  2ED0 A;  5GJW B;  1BIA A;  5KCH A;  4DQ2 A;  1H64 1;  4F17 A;  3DKM A;  4XTV A;  3LH0 A;  1QVP A;  4PLL A;  4MML A;  3HRS A;  1X75 C;  3CBP A;  5LJ3 h;  2C0T A;  2CRE A;  3M53 A;  3OYC A;  4J9F A;  5FWB A;  3CCV T;  3EGX A;  2CT3 A;  2O9S A;  3CC2 A;  1TUG B;  2KR3 A;  2EGC A;  4BY6 C;  2CYZ B;  2RMO A;  3FEO A;  1X6G A;  2PVO B;  2OTL Q;  1ZUU A;  2DER A;  2MK5 A;  3EH1 A;  3SEM A;  1Q81 U;  1VOM A;  1QMC A;  3H9N A;  2V8K A;  4B9W A;  1X43 A;  1HSQ A;  4JDS A;  2P0P A;  5CVI A;  3LGF A;  3G4S Q;  4QVC A;  3M0S A;  2ESW A;  1RAH B;  2OAU A;  2PTK A;  3P8D A;  3G4S T;  1MGQ A;  2CSI A;  2YLC A;  1VQ8 A;  3UA7 A;  3HPW A;  1GBQ A;  3OYJ A;  2MI6 A;  2A3L A;  4QQG A;  2X4X A;  3EG2 A;  2QQ9 A;  2H3E B;  4IUT A;  3QZ5 B;  4JJD A;  1K9M R;  2FRY A;  1WNL A;  1AWJ A;  4O5V A;  1K9M U;  2QEX A;  2O88 A;  3OS2 A;  2P4R A;  3L2Q A;  2NUT B;  1K8A C;  3I5S A;  1KIK A;  5GAO m;  1OZ3 A;  2JMA A;  2SEM A;  3CC4 T;  3J81 E;  2DEQ A;  4LDX A;  3QWX X;  2SRC A;  5DLO A;  1YIT A;  2EYW A;  2VXF A;  4FSS A;  2DF6 A;  2X3W D;  4IUQ A;  4KGV B;  1WXT A;  1IXD A;  1V29 B;  4M77 F;  3JCM W;  2COW A;  1HD3 A;  4RTY A;  5KYU A;  3OYD A;  4JRP A;  5LJ3 f;  3HSB A;  3M59 A;  2LRQ A;  2O9V A;  4EDU A;  4M75 G;  5LJ5 h;  1YIT Q;  2BE9 B;  1MMN A;  3SD4 A;  1NG2 A;  4M78 F;  2KEA A;  5KE2 A;  1OOT A;  4AFU C;  1CSK A;  3JCM d;  2J7I A;  4BB7 A;  4Y28 E;  3JCM b;  3MP1 A;  2D9T A;  2P0K A;  4CC3 A;  1VQO A;  1VQ7 T;  2ZPG B;  1UGP B;  4GLM A;  2LNH B;  2KRS A;  1PM3 A;  3VUZ A;  2RHU A;  4BAC A;  4E47 A;  1O75 A;  2JTE A;  1KQ1 A;  5A0G A;  4BE2 A;  1SKU B;  2D1X A;  1BCM A;  3L42 A;  1VQK T;  3CC7 T;  4CC4 B;  1VQ8 Q;  3EG9 A;  1JQQ A;  4KUI A;  2YT6 A;  4IUP A;  3QJ6 A;  2GFA A;  4KH1 B;  1FXX A;  3T9N A;  1X27 A;  1NLO C;  3M0U A;  4OMN A;  1NJI R;  2GCX A;  2LCL A;  3QWY A;  1NJI U;  3VS7 A;  2FG0 A;  3CCR T;  3NTI A;  4FCY A;  3C4S A;  1K1Z A;  4E6R A;  3CC2 T;  2LT1 A;  4M77 C;  3QJY A;  3PVL A;  4OMO A;  4M7A A;  8ATC B;  4BE0 A;  2HMA A;  2RQV A;  3CC2 Q;  4X9C A;  4DOV A;  2OTL T;  5LJ5 f;  2LX9 A;  2CUB A;  4LE9 A;  1Z9Q A;  1PRL C;  2ROT A;  1QP3 A;  2KRO A;  2M0Y A;  4ANJ A;  3H0H A;  2MCN A;  1ABO A;  4IUV A;  4JJN K;  1YCY A;  1H3H A;  3CME Q;  4JRQ A;  3JCM f;  4ZN1 A;  2F5K A;  4OVA A;  2KDS A;  4J9G A;  3M4Y A;  3VJP A;  1I1J A;  3MP6 A;  1KC8 R;  5CKH A;  3OYK A;  3JSC A;  4AFS C;  1G3S A;  2G6F X;  2X4Y A;  2MYS A;  1WHH A;  4RCB A;  4LD6 A;  4MZT A;  2DL5 A;  2KE9 A;  4CC2 A;  4CI0 C;  2FYK A;  2K3B A;  5GAN 7;  3OW2 A;  4XU3 A;  3I56 T;  1KG1 A;  5FLX E;  1KHC A;  1IO6 A;  3E19 A;  2GTO A;  2DFU A;  1YN8 A;  4PKC C;  1OU8 A;  1VQM T;  2YRV A;  3EG1 A;  2FB7 A;  1YI2 T;  5FRN A;  3I56 A;  4M77 A;  1O9S A;  2HKQ B;  2C0I A;  1HJD A;  3AT1 B;  1SSH A;  2RNA A;  2BZX A;  1YIJ A;  4FYX B;  3CCS T;  2NUP B;  4IUU A;  3LW5 E;  3M56 A;  2CZ6 B;  1LCK A;  2ROL A;  1EFN A;  3OYY A;  4FM4 B;  1WJR A;  1GCP A;  1NPP A;  4M78 A;  3UAT A;  1ZHI A;  4F14 A;  3EAE A;  5GAN g;  2RQR A;  1WZO A;  2E5Q A;  5A0L A;  3JCM c;  2RJC A;  3O8V A;  4OMP A;  3MO8 A;  1WGS A;  1T0H A;  2RHX A;  4A54 A;  4M78 D;  2LJ1 A;  2GQV A;  1VQ6 Q;  1KFZ A;  4IIM A;  4E7I A;  2X4J A;  4GLK A;  2PUK B;  3HTR A;  3PT9 A;  3WXM B;  4N0A C;  1N8R R;  1PKT A;  2KXD A;  2PQW A;  2RI2 A;  4JUV A;  5GAN 4;  2DO3 A;  1VQ4 Q;  2CH4 A;  2JS0 A;  2RJF A;  2OI3 A;  3ME9 A;  2J06 A;  1VQ4 T;  4Z88 A;  3TCJ A;  4FYW B;  1GFD A;  1W2B A;  1JJ2 P;  1LVK A;  4RTT A;  2QDY B;  3F70 A;  2YDL A;  2DYB A;  4P5N A;  2JZ2 A;  1NJI C;  2EIF A;  4D8K A;  4AT1 B;  1Z9Z A;  2A28 A;  1RAB B;  1BYM A;  2E10 A;  3CMA Q;  2EQK A;  4M7D F;  2L89 A;  3MEA A;  3JAM E;  2LX7 A;  1RUW A;  2LCC A;  3A1P A;  2FZC B;  5CKB A;  1PRM C;  2DK3 A;  1P92 A;  2RK2 A;  1G83 A;  3EG9 B;  3JCM Q;  2WSC E;  1QVF S;  4C5H A;  4PJJ A;  4N4H A;  3NGP A;  4C8Q F;  5GAM d;  2K3X A;  2JNG A;  1M30 A;  3A8H B;  2ABL A;  2EJF A;  4XTU A;  4D8D A;  1ARK A;  2KT1 A;  5IHK A;  1W6X A;  2VGN A;  2E64 A;  3JCM J;  4OB0 B;  2WSF E;  1MV3 A;  4FW2 A;  1UG1 A;  2FL7 A;  1ZSZ B;  2F5T X;  5I2S A;  2I2L A;  1JEG A;  5LJ3 e;  2QTX A;  3ZL7 C;  2CUD A;  2DM1 A;  2DA9 A;  1TTH B;  5KYW A;  1AWO A;  3MHX A;  4J7F A;  2RHY A;  4XQ3 A;  5CAI A;  3VYH B;  3FC3 A;  2GBQ A;  3J7A F;  1YHQ A;  3LWI A;  4M7A E;  1GBR A;  2GQI A;  3SFM A;  1T0J A;  3NFC A;  3QHS A;  3QBY A;  5FRO A;  1Q86 U;  1GRI A;  5IT9 E;  3CCE A;  3PIO A;  3THK A;  4E7J A;  2YUN A;  4XTY A;  5GAN 8;  4RTU A;  4QW2 A;  2PVD B;  2EBP A;  2GFU A;  2EGE A;  1M90 C;  3ULR B;  4ELY C;  1Q95 G;  1UDL A;  1KQS S;  2ECZ A;  1D1B A;  1D1A A;  5CQX A;  3INZ A;  1B34 B;  1H92 A;  1NYG A;  1YNZ A;  3LH5 A;  1VQP Q;  3G6E Q;  2P84 A;  1WX6 A;  3OW2 P;  4C5E A;  3FLG A;  3OS1 A;  1M9S A;  2KSS A;  1VQP T;  1UGV A;  5D6W A;  3CPW S;  3PE0 A;  1NYF A;  4JJC A;  5A0D A;  1PCX A;  5LJ3 j;  3EGU A;  3GBQ A;  3RUX A;  3TVT A;  3KFV A;  2XDB A;  1K8A U;  1M2O A;  2KK4 A;  2LTO A;  2JM8 A;  4IKF A;  4L5G A;  3EFO A;  2J05 A;  1WFW A;  3CBM A;  1KSW A;  2IVW A;  3CCL T;  2ZPH B;  1KD1 U;  2M51 A;  4FL6 A;  4M75 F;  4N0A A;  3QZ9 B;  2M16 A;  5GMK m;  2COZ A;  4EMH A;  2X9H A;  2XU8 A;  4K11 A;  3V8L A;  3PGG A;  4XU0 A;  1MV0 B;  2WAC A;  3I55 A;  4FT4 A;  4PJO D;  4WF2 A;  3NTK A;  4J6Y A;  2YSQ A;  3EFR A;  2XK0 A;  2EYX A;  2LC4 A;  2KBT A;  2EWN A;  4GY5 A;  5HK0 A;  1YJ9 Q;  3CXC S;  3X24 B;  1K73 C;  1BBZ A;  3L2U A;  3UF4 A;  4HA8 A;  1BI0 A;  1OV3 A;  1Y57 A;  1B34 A;  3RMQ A;  4J9I A;  3M0Q A;  2MWP A;  2VYT A;  5FU7 C;  2ZAE A;  4M78 G;  4HT8 A;  1XNI A;  2DVE A;  2E5K A;  3I55 T;  1D0Z A;  1Y96 A;  1QCF A;  4R55 A;  1ZA2 B;  4PFO A;  2HSP A;  2RPN A;  3OA6 A;  3OYB A;  4C92 D;  3P8H A;  5CQY A;  4Y91 A;  1WXB A;  2DBK A;  1K0X A;  3FB9 A;  4EPC A;  4M7D D;  2EGA A;  3EFO B;  2JMC A;  4RKU E;  1U5S A;  2K79 A;  3CCJ Q;  4JS5 A;  2A08 A;  4QQ6 A;  5D6Y A;  3JCM e;  2GNC A;  2JJ9 A;  1RAA B;  4XAX B;  1YJW A;  1MNE A;  5LL6 S;  3REB B;  2FEI A;  2PZ1 A;  4AFZ C;  2AHJ B;  4OB2 B;  2Y4Y A;  1V1C A;  1G8X A;  1WDX A;  4MMK A;  2V8I A;  3CCM Q;  3H0I A;  3BE3 A;  5IXB A;  4PFP A;  6AT1 B;  1GCQ C;  2J6F A;  1VQL T;  1WHJ A;  3RER A;  2HEQ A;  1SSF A;  1JBM A;  2RI5 A;  3TQ7 P;  3EHR A;  1Y96 B;  2AT1 B;  2O2O A;  2V26 A;  4EMK C;  1VQ9 Q;  1PHT A;  3BFM A;  3OYM A;  3HFO A;  1XJW B;  1VQN T;  4F7U F;  3CD6 A;  4C8Q E;  3SWN A;  3FRN A;  5HCK A;  3CCR Q;  4MDX A;  1RI0 A;  3TEE A;  4F7U B;  5GAM j;  3G6E T;  2F2V A;  1ZQ1 A;  3VS3 A;  4JLI A;  2DJQ A;  4PJL A;  1QVF P;  4BDZ A;  5HKC A;  1BU1 A;  1KQ2 A;  3DB4 A;  2B8A A;  3G7Z A;  1AHJ B;  3HRT A;  1YJN Q;  2FO0 A;  1M8M A;  2BKD N;  2L8D A;  3CCL Q;  4LXC A;  5C0M A;  3CC7 A;  1VQK A;  1F1B B;  2HNI A;  1PNJ A;  1IGQ A;  1SRM A;  4D6W A;  5GAN f;  3CME T;  2JOY A;  1NBE B;  1Q7Y C;  1N9R A;  1JJ2 S;  4JJB A;  2CKK A;  2DYI A;  1RL2 A;  4A4G A;  3JCM P;  4E7S A;  2A0F B;  5I11 A;  1ZLM A;  1VUB A;  4C92 G;  5KYX A;  2E6Z A;  2RQU A;  4C8Q A;  2E3I A;  2LJ0 A;  1YJ9 T;  4A63 B;  2H8H A;  1FX7 A;  3CEY A;  2EKO A;  2F2X A;  1G3Y A;  2YWW A;  3QYH B;  5GMK l;  2AK5 A;  4LNP A;  1AWX A;  3OSV A;  3SHW A;  1N6A A;  4M7A C;  1VIF A;  5HK3 A;  1D09 B;  4J9C A;  2F2W A;  2L3S A;  3CCU A;  2OTJ Q;  1OEB A;  1RAF B;  2K9G A;  1MHN A;  2QYZ A;  3EG3 A;  5A2Q E;  3CCV Q;  2EW3 A;  3QSU A;  2FPE A;  4E7L A;  2NYS A;  1BKB A;  1QKX A;  2LMJ A;  3OS5 A;  4IIO A; 
#chains in the Genus database with same CATH homology
 4HCK A;  3VS0 A;  5ECA A;  1GCP A;  3UAT A;  1M3C A;  2PNI A;  1K4U S;  4JZ3 A;  1S1N A;  2HBW A;  2YUQ A;  4F14 A;  2RQR A;  1ZUK A;  3VS2 A;  3PVQ A;  3A98 A;  2DMO A;  3UA6 A;  2EVR A;  1XOV A;  4OMP A;  2EKH A;  1WYX A;  1T0H A;  2LJ1 A;  2BTT A;  1KFZ A;  4QT7 A;  4IIM A;  3H0F A;  2YUP A;  1H8K A;  1UE9 A;  1BK2 A;  2ENM A;  1PWT A;  2FPF A;  4Z89 A;  2LP5 A;  1NLP C;  1ZX6 A;  1NEB A;  1WI7 A;  1PKS A;  1PKT A;  2KYB A;  2KXD A;  4WCI A;  1E6G A;  1M27 C;  5FWC A;  1I07 A;  3M0T A;  2CH4 A;  2JS0 A;  4RTW A;  1K0S A;  4M4Z A;  2AZV A;  2OI3 A;  4GBQ A;  1UHF A;  2J06 A;  1I0C A;  4Z88 A;  1YWO A;  3TSW A;  1GFD A;  2GGR A;  2EPD A;  4RTT A;  2YDL A;  2DYB A;  1E6H A;  2EQI A;  4D8K A;  3R6N A;  1Z9Z A;  2A28 A;  2J6K A;  3I5R A;  2D0N A;  1U3O A;  2W0Z A;  2DL3 A;  1OPL A;  3RNJ A;  3EG0 A;  4HVW A;  3JV3 A;  2LX7 A;  1RUW A;  3EHQ A;  1ABQ A;  3NPF A;  1J3T A;  1GCQ A;  2JM9 A;  1PRM C;  3M0R A;  1G83 A;  2LZ6 B;  3U23 A;  2RN8 A;  2DLP A;  2DL4 A;  3NGP A;  1JXM A;  5IHI A;  1M3B A;  2OJ2 A;  4R0K A;  2LJ3 A;  3O5Z A;  1M30 A;  5L23 A;  1UJY A;  4LUE A;  1JO8 A;  2ABL A;  2L2P A;  4J9B A;  4D8D A;  1ARK A;  1GFC A;  2KT1 A;  5IHK A;  1W6X A;  2AKK A;  2I0N A;  1W70 A;  1GL5 A;  1AZE A;  2FRW A;  1MV3 A;  4Y92 A;  1B07 A;  1UG1 A;  1SPK A;  2AZS A;  1YP5 A;  4LUD A;  1U06 A;  2XMF A;  3CQT A;  1B3Q A;  3TSZ A;  1JEG A;  2VWF A;  3ZL7 C;  1UJ0 A;  1QWE A;  2CUD A;  2W10 A;  2DM1 A;  2V1R A;  1M3A A;  2DA9 A;  2KGT A;  1AWO A;  4DEX A;  4RTV A;  4HVV A;  2CDT A;  2RQW A;  2KRM A;  2NUZ A;  2VKN A;  4RTX A;  1YWP A;  3VRY A;  4ZNX A;  1AOJ A;  2GBQ A;  1ZBJ A;  1X2Q A;  1GBR A;  1WXU A;  2GQI A;  1T0J A;  1GRI A;  1VYV A;  4ORZ A;  1AWW A;  4AFQ C;  1T3S A;  3THK A;  2O31 A;  2YUN A;  1UTI A;  2JT4 A;  1UFF A;  1SRL A;  2D8J A;  1RLP C;  4RTU A;  2HCK A;  2MOX A;  5IXF A;  2EBP A;  1K9A A;  1TG0 A;  3I9Q A;  2EGE A;  2LQW A;  4DEY A;  3ULR B;  4X1V A;  1UDL A;  2ECZ A;  3VS5 A;  2J6O A;  4J9E A;  2ED0 A;  5GJW B;  1H92 A;  3VS1 A;  1NYG A;  1YNZ A;  3LH5 A;  3H41 A;  3IQL A;  4EIK A;  1WX6 A;  4F17 A;  1X69 A;  2DNU A;  1N5Z A;  1UGV A;  2EYY A;  3VS4 A;  2QDL A;  3PE0 A;  5GJV B;  1A0N B;  1NYF A;  2C0T A;  4JJC A;  2CRE A;  3EGU A;  3GBQ A;  4J9F A;  5FWB A;  3KFV A;  3TVT A;  2CT3 A;  2O9S A;  1X6B A;  2JM8 A;  2J05 A;  1WFW A;  2KR3 A;  2EGC A;  2K2M A;  2RMO A;  1X6G A;  1KSW A;  1ZUU A;  2IIM A;  2M51 A;  2DIL A;  3SEM A;  2MIO A;  1NEG A;  4F16 A;  1X43 A;  5IH2 A;  1UHC A;  1HSQ A;  1KJW A;  4K11 A;  1JXO A;  2CT4 A;  1VA7 A;  1MV0 B;  2FPD A;  2YSQ A;  2EYX A;  2OAW A;  3M0S A;  2KBT A;  2ESW A;  2PTK A;  2CSI A;  3UA7 A;  2LCS A;  2A37 A;  4OML A;  1GBQ A;  1BBZ A;  1G2B A;  3VRZ A;  3UF4 A;  3EG2 A;  1RI9 A;  1OV3 A;  1Y57 A;  4J9I A;  3M0Q A;  3C0C A;  4JJD A;  2FRY A;  1AWJ A;  2E5K A;  2O88 A;  2P4R A;  3RBB B;  1AD5 A;  1QCF A;  3I5S A;  1KIK A;  1W1F A;  4JPB W;  1OPK A;  2HSP A;  2RPN A;  2JMA A;  2SEM A;  1YCS B;  2L3P A;  4HVU A;  5EC7 A;  4LN2 A;  1WXB A;  2SRC A;  3QWX X;  1JU5 C;  2A36 A;  2DBK A;  1K0X A;  2EYW A;  4AG1 C;  2EGA A;  4FSS A;  2DF6 A;  2X3W D;  2JMC A;  1FYN A;  2KXC A;  1ZUY A;  1U5S A;  2K79 A;  1WXT A;  2A08 A;  2B86 A;  1HD3 A;  2BZY A;  1WLP B;  2GNC A;  1QWF A;  2BZ8 A;  4RTY A;  2CH4 W;  1Y0M A;  3REB B;  2FEI A;  2PZ1 A;  4AFZ C;  2RF0 A;  2O9V A;  4RTZ A;  2KRN A;  1RLQ C;  2KYM A;  4JZ4 A;  1V1C A;  1WDX A;  3H0I A;  1NG2 A;  5IXB A;  2KEA A;  1TUC A;  1OOT A;  4AFU C;  1CSK A;  1MUZ A;  1T3L A;  2J7I A;  1GCQ C;  2J6F A;  4CC3 A;  2VVK A;  4GLM A;  2LNH B;  2KRS A;  2HEQ A;  2DE0 X;  2JW4 A;  4RUG A;  2JTE A;  3EHR A;  1TUD A;  1E7O A;  2O2O A;  4Z8A A;  2D1X A;  1PHT A;  1QKW A;  2DRK A;  3I35 A;  4CC4 B;  2DVJ A;  1SEM A;  1JQQ A;  1ZSG A;  2YT6 A;  5HCK A;  2EYZ A;  2F2V A;  4HXJ A;  3VS3 A;  1UEC A;  1X27 A;  1NLO C;  2V1Q A;  3M0U A;  4OMN A;  2DJQ A;  1WA7 A;  3QWY A;  3VS7 A;  2FG0 A;  3VS6 A;  4J9D A;  1BU1 A;  1K1Z A;  4E6R A;  1FMK A;  2K6D A;  2K7A A;  5I22 A;  1WIE A;  2D8H A;  1K76 A;  1CKA A;  1VYU A;  2FO0 A;  3PVL A;  1M8M A;  4OMO A;  2JS2 A;  2RQV A;  1AEY A;  2DBM A;  5IHN A;  1VYT A;  1SHF A;  2DL8 A;  2CUB A;  2KT8 A;  4LE9 A;  1Z9Q A;  1NM7 A;  1PNJ A;  1SRM A;  1AZG B;  1PRL C;  2ROT A;  4JJB A;  2KRO A;  2M0Y A;  2AKL A;  1UUE A;  2YUO A;  3H0H A;  4OMQ A;  1CKB A;  2MCN A;  1ABO A;  2RQT A;  4J9H A;  1H3H A;  2DL7 A;  4IIO A;  5I11 A;  2DRM A;  1ZLM A;  4J9G A;  3REA B;  2KNB B;  1I1J A;  2RQU A;  2LJ0 A;  4AFS C;  4AG2 C;  2G6F X;  4A63 B;  2H8H A;  2CSQ A;  3NMZ C;  2DL5 A;  2KE9 A;  2X3X D;  4CC2 A;  2K3B A;  2F2X A;  4KRT A;  2HDA A;  1IO6 A;  2AK5 A;  2GTO A;  4LNP A;  1AWX A;  5FW9 A;  4CC7 A;  3SHW A;  1YN8 A;  4ESR A;  1BB9 A;  3EG1 A;  1QLY A;  2GTJ A;  3M0P A;  2L3Q A;  4J9C A;  2F2W A;  2L3S A;  4OMM A;  3FJ5 A;  1OEB A;  2JXB A;  2K9G A;  2DX1 A;  1AVZ C;  3NHN A;  2C0I A;  1HJD A;  1SSH A;  3EG3 A;  2RNA A;  2BZX A;  1SHG A;  2EW3 A;  2LQN A;  2FPE A;  2ED1 A;  1X2K A;  2L0A A;  1QKX A;  2NWM A;  1LCK A;  2LMJ A;  2ROL A;  1EFN A;  2C0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...