4AFZC

Human chymase - fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
VTLFVALYDYNATRWTDLSFHKGEKFQILEFGPGDWWEARSLTTGETGYIPSNYVAPVDSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 11
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afzC00
1G83A 2IIMA 4Z89A 1BBZA 1E6HA 2JXBA 1UE9A 1QLYA 1UJ0A 1M27C 1B3QA 1NYGA 2C0TA 1SSHA 1UDLA 2JTEA 2X3XD 4AFQC 1JO8A 5I22A 2CT3A 1ZBJA 2EKHA 1ABQA 2EBPA 4E6RA 1WDXA 2CUDA 1YP5A 2DJQA 1PKSA 3VS5A 4D8DA 2RQRA 1UFFA 2DYBA 4J9GA 1UUEA 2FRWA 1E6GA 1WYXA 1GFDA 1AWOA 1Y57A 3PE0A 3R6NA 2LQNA 2KRMA 4AFUC 2LCSA 4IIMA 1X2KA 5FW9A 2DRMA 2A36A 2DX1A 2EGEA 2VWFA 4A63B 2RF0A 1KSWA 5IHIA 4RTZA 4CC3A 2G6FX 3LH5A 4Y92A 1ZUUA 1ZUYA 2AKKA 1MV3A 1X27A 2MCNA 1EFNA 3NGPA 1WXBA 2FG0A 2DE0X 2PZ1A 1UJYA 3C0CA 2FO0A 1SHFA 5IXFA 3ULRB 1LCKA 4LUEA 1ARKA 3EG1A 2ECZA 1GBRA 4OMQA 4LE9A 2PTKA 1ABOA 2DILA 3M0UA 4OMMA 4OMLA 2D8HA 2MOXA 2C0OA 1M3AA 2FPFA 1G2BA 2AZSA 3EGUA 1X43A 4KRTA 2OAWA 2DL7A 1HD3A 2KXCA 1E7OA 4OMNA 2FPDA 3TVTA 1GRIA 2DL4A 2J6FA 3FJ5A 3NHNA 2DMOA 1JXMA 4HCKA 2AK5A 3CQTA 2A08A 1VA7A 2O88A 1T0JA 1WFWA 2ROTA 1JEGA 1CKAA 2FRYA 1BU1A 2JMCA 4K11A 1GCPA 1ZX6A 2P4RA 3TSZA 1YNZA 4AG1C 2NUZA 1GFCA 4AG2C 2E5KA 2DM1A 2EYXA 4Z8AA 2DA9A 4OMOA 2K6DA 4Z88A 1AWJA 4RTYA 1WI7A 5FWCA 2KRSA 3I5SA 2JS0A 2K79A 1GBQA 4HVWA 4R0KA 2PNIA 1AWXA 1W6XA 2DVJA 4J9DA 4RTVA 2EPDA 2L3SA 3M0PA 1KIKA 5GJWB 3U23A 1T0HA 1V1CA 2DBMA 3QWXX 1K9AA 1X6BA 1AOJA 1RLQC 2HEQA 2LP5A 1I0CA 3NMZC 3ZL7C 1TUDA 2DF6A 2XMFA 4CC2A 2RNAA 2AKLA 4F14A 2V1QA 3JV3A 4LUDA 3M0RA 1W1FA 2EYZA 3VS2A 2YUQA 1JU5C 2K2MA 2O2OA 2SRCA 4FSSA 2D8JA 1RLPC 3A98A 3SHWA 3TSWA 2JMAA 1ZLMA 2J06A 4ESRA 1PRLC 5GJVB 4JZ4A 1GCQC 1TUCA 1AD5A 2DNUA 2F2WA 2H8HA 2EVRA 1QCFA 3H0HA 4J9CA 1WLPB 2LMJA 1ZSGA 2EQIA 2GBQA 5FWBA 2ENMA 4JJCA 4DEYA 2KT1A 2ABLA 2KEAA 2D1XA 1H92A 1FMKA 1YWPA 2KT8A 2O31A 1GL5A 1JQQA 1YWOA 1NLPC 3I9QA 4ORZA 2EGAA 2KROA 4F17A 3NPFA 1SRMA 4CC4B 2CH4A 5IXBA 2HDAA 2J7IA 2AZVA 4J9EA 1H8KA 1MUZA 2EGCA 2DL3A 4CC7A 1AZEA 4M4ZA 1CKBA 1B07A 2RPNA 4IIOA 1IO6A 1OV3A 1YCSB 2J6KA 4EIKA 2K9GA 1X69A 1W70A 2F2VA 4RTXA 1UTIA 1K4US 5IHNA 1NLOC 2EW3A 2M0YA 1PHTA 2RMOA 1FYNA 2FEIA 2NWMA 1SEMA 3O5ZA 2K7AA 2GTJA 1WX6A 2A28A 2M51A 1QWFA 1VYTA 2K3BA 3EG0A 1BK2A 2ED0A 2RQWA 2YSQA 1X2QA 1SRLA 2KE9A 1K0XA 2QDLA 2EYYA 1H3HA 2C0IA 4HVUA 1I1JA 2I0NA 4GBQA 1KJWA 2GNCA 1PKTA 1U06A 2JM8A 4WCIA 3H0IA 4JZ3A 2OI3A 3VS6A 2DLPA 2JM9A 3M0QA 1NM7A 1AEYA 1WXTA 3VRZA 3UA7A 3M0SA 3VRYA 3EG3A 2J6OA 2W0ZA 1AVZC 5EC7A 1T3SA 2RQUA 2CSQA 1U3OA 1M30A 1Z9ZA 4AFSC 2LNHB 2LJ1A 2L3QA 4J9IA 3REAB 2A37A 2O9SA 2HCKA 1NEGA 1HSQA 2RQVA 1NG2A 2KYMA 2W10A 5ECAA 2YUNA 2JW4A 1CSKA 4RTTA 2VVKA 2GTOA 1K0SA 4J9HA 3I5RA 1TG0A 2BZXA 2F2XA 2L3PA 5IHKA 2DRKA 3REBB 2V1RA 1K76A 1OPKA 3RNJA 2KXDA 3UATA 2DBKA 3VS3A 2KBTA 3IQLA 1WA7A 1M3BA 4J9FA 1KFZA 1NEBA 1GCQA 3I35A 2CSIA 2RN8A 4X1VA 2L0AA 1SHGA 3SEMA 2JT4A 3RBBB 4RTWA 1PWTA 1T3LA 1UG1A 2DL8A 4HVVA 4JJBA 4J9BA 1XOVA 1BB9A 2BZYA 3H41A 3PVQA 3EHRA 4LNPA 2YUPA 2MIOA 3THKA 2KRNA 4DEXA 2JS2A 2ED1A 2KR3A 1WIEA 3GBQA 2LQWA 1Y0MA 2HBWA 1SPKA 2FPEA 2X3WD 1OOTA 2ROLA 1J3TA 1U5SA 4OMPA 3H0FA 5IH2A 1M8MA 2D0NA 3PVLA 4GLMA 2LJ3A 1UHCA 3EG2A 3UF4A 1X6GA 2CDTA 1QKXA 2CH4W 2KYBA 4RTUA 3EHQA 2SEMA 2DL5A 1N5ZA 2OJ2A 1AZGB 1A0NB 4D8KA 2YUOA 2GGRA 2KGTA 1NYFA 5I11A 2HSPA 1K1ZA 2LJ0A 2RQTA 4LN2A 3KFVA 1HJDA 2YT6A 1UHFA 1I07A 1RUWA 2ESWA 4RUGA 1QKWA 5HCKA 1WXUA 4HXJA 2CREA 2O9VA 2LX7A 1VYVA 4F16A 3UA6A 2KNBB 3VS1A 1M3CA 2BZ8A 2L2PA 3VS4A 5L23A 1OEBA 1YN8A 1VYUA 2EYWA 1AWWA 2CT4A 2CUBA 1QWEA 4JPBW 1ZUKA 1UECA 4JJDA 2GQIA 3VS7A 2VKNA 2B86A 1RI9A 1UGVA 1JXOA 1OPLA 1MV0B 4QT7A 4ZNXA 1Z9QA 2YDLA 4AFZC 2LZ6B 2J05A 1PNJA 2BTTA 3M0TA 1PRMC 3VS0A 3QWYA 1S1NA
chains in the Genus database with same CATH superfamily
5GANd 2GQVA 4EDUA 1BBZA 2JXBA 3LGLA 5LJ5j 4A54A 4AMCA 1M27C 2PVDB 4D6WA 4EMKC 1XTDA 1UDLA 4AFQC 4C0FA 3CBPA 3PFSA 1OULA 1ZBJA 4E6RA 2ZPGB 1VQ4A 2IG0A 1YP5A 1K73R 2DJQA 1M1GA 3VS5A 1UFFA 3OBWA 4J9GA 2X4JA 1UUEA 2MF2A 1WYXA 5FRNA 1GFDA 1VQMA 1AWOA 3PE0A 3R6NA 2RK1A 2XG8D 2LCSA 2VYTA 3CCVA 3TQ7P 1X2KA 2DRMA 4DOVA 2EGEA 1KSWA 5IHIA 4A4GA 1VQ8A 3M4GA 1D0ZA 4Q5WA 2G6FX 2MI6A 3LH5A 1ZUUA 1ZUYA 4Y92A 2AKKA 5LL6S 3ZEHA 4QQDA 3RKWA 5LJ3f 2RH2A 1M90R 1Q7YC 1VOMA 1WXBA 2NUPB 2FO0A 4C5EA 4HCZA 2IVWA 4BY6C 4LUEA 4EMGA 2ECZA 4OMQA 2DILA 3RR6A 3CCQA 2O01E 2DTIA 4OMLA 1YJNA 2C0OA 3EGUA 1X43A 3RKXA 2RJFA 1KHIA 2PQWA 2FPDA 3TVTA 5IN1A 1W2BA 3C94A 2DMOA 4M75F 4C0ZA 1OX9A 3RESA 1ZHIA 3CQTA 5FROA 4XU3A 2A08A 1WFWA 5LJ3j 4XK8E 2JMCA 1OZ3A 2K57A 1YNZA 4AG1C 4AG2C 4E7LA 2NYSA 4FYXB 1FMWA 2DA9A 3MCAB 2MK5A 2BE9B 3JB9I 4FCYA 5FWCA 4M75B 1Q82R 2NUTA 3CXCP 4HVWA 1W6XA 2DVJA 3OYDA 4RG8A 4FIBA 1X01A 1KIKA 2K5LA 2HAXA 1C6VX 3CCUQ 4KBMB 3ZL7C 2HEQA 2LP5A 1I0CA 1BIBA 4CC2A 4F04B 2RK2A 3MEWA 3SFMA 2V1QA 3JV3A 2K2MA 2HSEB 4FSSA 2D8JA 1RLPC 3A98A 3FJPA 3SHWA 3CCUT 1QVFS 2J06A 2CGHA 4RMOA 3L2WA 4M75D 6AT1B 3MEAA 2L89A 3F70A 2F2WA 3ME9A 1QCFA 4PJOC 2LMJA 2EQIA 4M7AB 2X51A 1ZQ1A 2QAZA 2DERA 2KEAA 2D1XA 4B9XA 1H92A 1YWPA 2O31A 4JRPA 2F1LA 1GL5A 1MGQA 1JQQA 1YWOA 4KULA 2MAMA 2KROA 2VGMA 4FM4B 2E6ZA 1SRMA 3OYHA 4CC4B 1H3ZA 2YLCA 1TOVA 2HDAA 4M78C 4PJJA 2DD5A 3M53A 1XJWB 4PJOE 4IIOA 1B07A 4M7AD 2VASA 3VV0A 4J7FA 1RL2A 1MMDA 5LJ3h 3FLGA 1IHWA 1X69A 4JS5A 4PJNA 1UTIA 1K4US 3M59A 1TXQA 1PHTA 5DLOA 1SEMA 3O5ZA 1OZ2A 1B7TA 2M51A 3EGXA 4M78E 2ED0A 1M1KR 1X2QA 4C8QC 1VQNQ 2M0OA 2QA4Q 2LQKA 5DLQE 2EYYA 3BFMA 2XDBA 3L2VA 3BDLA 2QGGA 2XKOC 4JRIA 1G3WA 1KQSP 4PFZA 1KD1C 3GNGA 3DKMA 3EGDA 1I1JA 3GLXA 2CKKA 1U06A 1K9MC 1VQNT 4MDWA 2QA4T 1EIFA 5FU6B 3M0QA 2MPXC 1NM7A 3EFOA 4RCCA 3RDVA 2IPOB 2JZ2A 2EFIA 2RD1A 1R0CB 2V8JA 3OA6A 2KAFA 1YJWQ 1VQLA 2O4XA 3OSSC 2G3RA 3LWHA 4C8QE 3OYBA 4II1A 1M30A 3LW5E 1Q81R 2L3QA 3REAB 3GNFB 3V7SA 2O9SA 1YJWT 2ZPIB 2HMAA 2P0KA 3ZBDA 2KYMA 4XTXA 2NLUA 5ECAA 1N6AA 2NUTB 1VQ9A 3SWNA 1K0SA 4J9HA 5GMKj 4FYYB 2RA2A 2F2XA 3DB4A 2L3PA 5CO7A 2WSCE 5I2SA 4LD6A 3GIBA 5AT1B 1PCXA 3UWNA 3VS3A 2K5IA 3VUBA 4BE2A 1QVGP 1M3BA 1K73C 3CMAQ 5J3BA 1O75A 4PJOF 1SHGA 3CC2Q 4M7DG 4LDWA 3C95A 4ELZC 2VC8A 3CPWA 2PVGB 1NJIR 1S72Q 1K8AU 1C1AA 4Z02A 2GFUA 2EQUA 3CMAT 4IUQA 3H41A 2FZGB 2HQHA 2FL7A 3DLMA 2B8AA 3CC2T 5D6WA 4DBFA 3RIRA 2YUPA 1U1TA 2MIOA 2KRNA 2OTLA 5GAN6 3PNWC 4DEXA 2JS2A 2LQWA 5CR2A 1SPKA 4QVCA 4M78F 1M90C 2X4YA 3OSVA 2LX9A 3GP8A 4OMPA 5GAMd 2ZPBB 1Q7YR 3M57A 2D0NA 2CS7A 3EG2A 1PSEA 2XIDA 4PKCC 3EHQA 3C4SA 1M8VA 2DXCA 1A0NB 2EIFA 3JB9G 3CD6Q 3OW2A 5CKHA 2DIQA 3QHSA 3CC7A 4QKUA 2YT6A 3AHUA 4QW2A 1I07A 2PUOB 4M77A 3O8VA 3CMEQ 5HCKA 3CD6T 1WXUA 2EJGA 3E9GA 4C8QF 2CREA 2O9VA 3G71Q 1Q86U 2QQSA 2A7YA 3EGXB 3HSBA 3CXCA 1W2BP 2KNBB 1I8FA 3CMET 1KQ2A 1YITQ 1FMVA 1I4K1 5CQYA 2COZA 5GANg 3G71T 2BZ8A 5D6YA 3VS4A 3C12A 1VYUA 2DAQA 4Y28E 1Q82C 1AWWA 5EG2A 3OBYA 3MP1A 2CUBA 1QWEA 4M78D 2ZGWA 1YITT 1X6OA 4XTZA 2CP5A 2VKNA 2RO0A 3QJ6A 4PJLA 3EFOB 3M5AA 4RKUE 2QTVA 2JOYA 2P84A 3JCMP 4E7IA 3X26B 2J05A 3HHTB 5KYWA 1G83A 5GAOn 2IIMA 1UE9A 1UJ0A 1M1FA 1B3QA 2C0TA 4DBQA 1BYMA 1SSHA 3BDUA 5D6XA 4KGXB 2RI5A 4IUUA 3SWNB 1JO8A 3FDRA 2EKHA 3LX7A 2MWOA 2WSFE 2CUDA 4HT9A 1PKSA 3J80E 3G4SQ 2RQRA 3RERA 3JB9F 4JLIA 3TU4K 4PFOA 1I5LA 1WPYA 2FRWA 4J7IA 4FSXA 1Y57A 3G4ST 1Y07A 2DX1A 3V8JA 2VWFA 1UGRB 1YI2A 2RF0A 3CCSA 2RJDA 3NTHA 4KH1B 4HKEA 3OYFA 1D1BA 1Y71A 2MWPA 2PZ1A 1JRIA 4B6MA 1YIJA 1SG5A 2DIGA 3ULRB 1LCKA 3JCMc 1ARKA 1KQSA 2PTKA 1VQOA 4DQ2A 1M1KC 2AZSA 2OAWA 1E7OA 1MMAA 2AHJB 2XD0A 3FJ5A 4QVZA 5C0MA 2FHDA 1VA7A 1WNLA 2JTFA 4KGVB 2HKQB 2JVVA 4M75A 1NPRA 1CKAA 2DJZA 1KD1R 1BU1A 3I55Q 3X24B 3TEEA 1K9MR 4L5GA 1GFCA 2M9UA 1XNIA 4ATOA 2MYSA 4M77B 4BE1A 1KC8U 4Z8AA 5I21A 4OMOA 3I55T 1FXXA 2D6FA 2K6DA 2OAUA 1AWJA 1AHJB 4RTYA 1YBYA 2DKGA 1WI7A 5GAN7 4F7UE 1JBMA 1GBQA 3JSCA 2PNIA 4J9DA 3L2QA 2EPDA 1TSFA 4RG2A 5GJWB 3FRNA 3FEOA 1VIFA 3KUFA 3NMZC 2OTJA 3KBGA 5FU7C 1QVGA 3JCMh 4PLIA 4F7UG 2EQKA 2KI7A 4M77D 3HPWA 1W1FA 3VS2A 2YUQA 3QYHB 2O2OA 4J6YA 4FYWB 3TSWA 3CC4T 4ESRA 1PRLC 2X35A 2E65A 1BI3A 1BKBA 1R8OB 4JZ4A 1IREB 2DNUA 4XQ3A 1DJ7B 3SDZA 4JRQA 1GXIE 2RHXA 2E5QA 4J9CA 5KYWB 1PSFA 1WLPB 1OYXA 2GBQA 4DEYA 2ABLA 5FRMA 3G6EQ 1NJIC 4J83A 2KT8A 4EMKA 3OYYA 1WHGA 1NZ9A 1M2VA 4PNOA 4ORZA 2E64A 1D09B 1JB0E 4F17A 1FWZA 3G6ET 5GANf 4NOYA 5IXBA 2LDMA 3HFNA 2J7IA 2AZVA 3CPWP 1OQKA 4J9EA 5CAIA 2EGCA 3S6WA 4CC7A 1TWBA 1AZEA 1QQJA 3QYGB 1CKBA 2Y4YA 1VQPA 3LWIA 3JB9J 2L8DA 3QSUA 1D3BA 1UEBA 3VJPA 2EW3A 2QDYB 2RMOA 1VQLQ 2FEIA 5GANj 2I2LA 2K7AA 1WX6A 3VYGA 3V7RA 2BUDA 2PVOB 1VQLT 1XQHA 2KE9A 5GMKi 3CCEQ 5L8RE 2VGNA 3BE3A 3I56Q 3OW2P 2DVEA 3M4YA 3QJYA 2LTOA 4MDXA 3A1PA 5CKFA 3CCET 2JUFA 5AYFA 2DLPA 5LJ5h 3I56T 4ZN3A 4BACA 4L59A 3J7AF 1AEYA 3G7ZA 2RB6A 2FZCB 3MPUB 3VRYA 2DXBA 3FIFA 2PUKB 1LNXA 5EC7A 4IKFA 5GAMe 4BDZA 3RMQA 2EJ9A 4MZMA 3CCRQ 2A37A 3QIIA 1OI1A 1RAFB 2E3HA 1N8RC 1QMCA 2M16A 4L6V5 2QASA 3OY9A 1VIEA 2RI2A 2YUNA 3CCRT 3VYHB 3A8GB 1TG0A 1UGQB 1QCOA 3CBOA 1WHKA 2BZXA 3REBB 3L42A 1OPKA 4X9DA 1UB4A 2DBKA 3SD4A 3E9FA 3MEVA 1NEBA 5KE2A 3I35A 4BI3A 2RN8A 4X1VA 5GAN3 2LC4A 3SEMA 4E2FB 2JT4A 1MMNA 4PJOA 1UG1A 1Q81U 2K3XA 1YJ9A 4HVVA 4JJBA 3CCJA 4J9BA 4O6JA 2JTMA 3EH1A 3RUXA 2BZYA 5HY6A 1YHQQ 4LD9K 3PIPA 1SKUB 2QXFA 2LQ8A 4C92E 4EMKB 1G3TA 3E2UA 1M2VB 1WHHA 2ED1A 2KR3A 3GBQA 3RMSA 5GAOm 3L2UA 1YHQT 2FPEA 2ROLA 1RAHB 1WQ7A 4JRKA 2FVUA 4M78A 2PU9B 2LJ3A 1UHCA 2CH4W 4C92G 2K3YA 2SEMA 2LCLA 3OQ5A 4E7ZA 2CP2A 2KSSA 1KHCA 2KGTA 5I11A 1D3BB 5IAYA 4ZGJB 2HNIA 5CKEA 1IB8A 3PMTA 3KFVA 4X9CA 3H9NA 5GMKm 1RUWA 4YTLA 1QKWA 1JJ2P 4F16A 1I5OB 3UA6A 4C8QA 3CCMQ 4BY6B 2RHIA 4M7DC 1Q7YU 3WVDB 1M3CA 1NE8A 4A4EA 1OEBA 2DTHA 3CCLQ 3CCMT 1VQ5Q 1VQ6Q 2HBPA 2VV5A 1OU8A 1ZBXA 3INZA 1U8RA 3V8LA 2B86A 5CVIA 3M9QA 3CCLT 1VQ5T 3CXCS 1RI0A 2AT1B 1OPLA 3EFRA 4QT7A 1VQ6T 4JLGA 1R0BG 4ZNXA 2LVMA 4IURA 2BTTA 2HQXA 4M7DE 3M0TA 1WJQA 2RI3A 5IT9E 3KXTA 3HRSA 2YRVA 2M1HA 4Z89A 5KH6A 3PTAA 3OYCA 3J81E 1NYGA 4DOWA 3JCMb 2CZ7B 4PLLA 1D0YA 1WJSA 1WHLA 2LRQA 1NBEB 5CKDA 4CI0C 4R56A 1UGSB 5I22A 2LNVA 3JCMX 2EBPA 4EMHA 1ZSZC 1WDXA 3M56A 3X28B 3ASKA 4D8DA 2JJ9A 4FT4A 1QP3A 4J6XA 1W4SA 4X34A 1E6GA 4C0DC 4VUBA 1S72T 3ZFJA 2X9HA 4AFUC 3CCUA 3CPFA 3OYNA 2A36A 4ZTJA 4ELYC 3A8LB 4PJOB 4A63B 3UT1A 2E3IA 1TS9A 1Y96A 3Q1JA 1VQKQ 3N5BB 1IXDA 2GFAA 1X27A 2MCNA 4N0AC 2P0QA 1EFNA 3QZ5B 2DE0X 1UJYA 3UPUA 1SHFA 1VQKT 5IXFA 2DXTA 1QW1A 2MMPA 2LT1A 1N9RA 4KH0B 3QBYA 4LE9A 2K5FA 1M3AA 2FPFA 3UDCA 4E7HA 4M78B 5KYNA 4A4HA 4PJOD 4OMNA 4N0AA 2J6FA 5GAOp 1JXMA 4KT0E 3QPHA 2O88A 1T0JA 2QEXQ 5LJ3e 1TU0B 2FRYA 5GAMf 3EG9A 4RCBA 1D0XA 4K11A 4QQGA 5GMKh 2HL5C 2QEXT 1KQSS 2P0PA 3MO8A 2L5QA 4M7DF 4Z88A 3JCMd 4TVRA 1VQ4Q 1WHMA 3I5SA 4XTWA 3META 4GLKA 1YFNA 4C8QB 1RAGB 2K79A 1IZ6A 2KQWA 4R0KA 1Q95G 1AWXA 4ZGDB 1VQMQ 3JB9H 1VQ4T 3U23A 1T0HA 1N8RR 2HL3A 3CCVQ 1V1CA 2DBMA 3QWXX 1X6BA 1AOJA 5GAOq 2DF6A 2RNAA 2AKLA 4F14A 4LUDA 1VQNA 1VQMT 2QA4A 1KD1U 3LH0A 2EYZA 1OX8A 1JU5C 1VQ8Q 2SRCA 1V76A 5A2QE 1OU9A 1K9MU 3CCVT 2QQBA 5DY9A 3HKSA 5GJVB 3MKDA 3PIOA 1GCQC 4C8QD 1TUCA 1AD5A 3VU3C 4KGZB 2RM4A 2H8HA 1VQ8T 4DBRA 3MJXA 2LCCA 1ZSGA 5FWBA 2ENMA 2ATCB 3CCQQ 4E7SA 2CP7A 4FYVB 1YJNQ 4HCCA 1FMKA 2EAYA 3S3OA 3VUZA 1YJWA 1QVGS 3EH2A 4C5IA 5C6SA 3I9QA 4EPCA 2EGAA 4MMLA 4FL6A 3NPFA 3CCQT 4KUDK 1YJNT 2QG9B 1U1SA 1PD0A 2RJCA 2EQMA 4OB1B 4P5NA 1D1AA 3P8HA 1MUZA 4BE0A 1M5Q1 5CCAA 4J6WA 1Q86R 2J6KA 4HA8A 4OGEA 3HL8A 1RAEB 4EIKA 1W70A 2F2VA 1K73U 3X25B 2EKOA 4RTXA 3DB3A 4LDVA 5IHNA 1NLOC 2P4TA 1JJ2A 1FYNA 1Y96B 5GAN4 3QDFA 2RHUA 3CMAA 4BI8B 2QQAA 1QWFA 3A5ZB 5LJ5d 1BK2A 1B34B 4XU0A 5CK9A 4ANJA 5GAN5 1EX4A 3JB9D 2E12A 2DEQA 2YWWA 3JAME 1K0XA 1Y7XA 2QDLA 1WHJA 1ZA1B 3ER0A 2Y90A 4F7UA 4HVUA 1EZZB 1M90U 3OMCA 4GBQA 1KJWA 4WCIA 3L2RA 3QG1A 3H0IA 4JZ3A 5GAN8 1MHNA 4FT2A 1W2BS 4LDUA 1WXTA 3UA7A 3HRTA 3EG9B 2J6OA 2W0ZA 3MP8A 4C5HA 1PM3A 2RQUA 4M75E 2XDDA 2E10A 2CSQA 4E47A 4AFSC 2LNHB 4BD3A 2LJ1A 4J9IA 4M7AC 3OS0A 2E4HA 2HCKA 3CD6A 2ZZDA 1NEGA 4C0GA 1HSQA 2RQVA 2W10A 4NL2A 4UC4A 1QVFP 2JW4A 2JNGA 1CSKA 4RTTA 2VVKA 4M75G 1TTHB 3CMEA 2R5MA 4A4FA 3I5RA 3G71A 1MNDA 1C0MA 4ZTFA 4PFPA 3OYAA 4IUTA 3RNJA 2KXDA 1G8XA 3MP6A 1YITA 2KBTA 1Q82U 1NPPA 3IQLA 4V2SA 4LXCA 2R57A 4M7AE 1KFZA 2FB7A 2L0AA 5LJ3d 4N4HA 3EFSA 1M4ZA 4RTWA 3RBBB 1PWTA 1T3LA 1PD1A 1BI0A 2X4WA 2QK0A 4N4IA 3PGGA 1XOVA 1BB9A 2H3EB 2JN0A 3OYGA 3PVQA 4LNPA 4M7AG 2FYKA 5J39A 3THKA 3WXMB 2VB6A 1RACB 1TUGB 2DTOA 1WIEA 4NS5A 4OMFB 2VUBA 1J3TA 2CZ0B 3CBMA 4IUPA 2XK0A 3SB2A 3H0FA 5IH2A 1M8MA 4C5GA 4GLMA 9ATCB 4QQ6A 4MMKA 3UF4A 1QKXA 2KYBA 1PG5B 1WGSA 3EAEA 2DL5A 1KC8R 2COYA 1N5ZA 2OJ2A 2WACA 5FU6C 4B9WA 2AIRB 2GGRA 1MNEA 1NYFA 2DD4A 3QXEB 5FLXE 3OYEA 2HSPA 3JCMV 3G4SA 2LJ0A 1TH7A 4F7UF 2RQTA 2DXUA 2QTXA 4LN2A 1IGUA 3LYIA 4HCBA 5KYYA 1BIAA 1G5VA 3QKJA 3QDRB 4RUGA 1VQ9Q 3QUIA 4JDSA 2BKDN 2YXYA 2KY9A 1VYVA 1MMGA 1VQ7A 2E70A 3FC3A 3VS1A 5HKCA 1VQ9T 1D1CA 3V8KA 2VXFA 4A53A 3GF5A 3P8DA 4PK4A 2M02A 5L23A 2XU8A 3URGA 4F7UB 2F5KA 4JPBW 1ZUKA 2CP3A 2GQIA 1M1KU 2R58A 1RI9A 3PMIA 4MZPA 1H641 1K8AC 1MV0B 2QQ9A 3M55A 1Z9QA 2YDLA 4M7AF 2OTLQ 2LZ6B 3QZ9B 3MHXA 1HK9A 2EJFA 2YRDA 1G3SA 2VXEA 3QWYA 1FX7A 1M9SA 4C92C 1E6HA 3I55A 1QLYA 2OTLT 4O5VA 1N9SA 5GAMg 1P92A 2JTEA 2X3XD 2K4YA 1IHVA 2HD0A 8ATCB 2CT3A 3PT9A 1ABQA 2DETA 2EYQA 4C92A 3A8OB 2COWA 2A3LA 5FU7B 1I81A 1N27A 5GANh 2DYBA 2KK4A 4JUVA 3JCMe 4GY5A 4BI4A 3OMGA 3CC7Q 1QCNA 2DK3A 3OYIA 4Y91A 1LOJA 4LDXA 4WF2A 3OS5A 2LT4A 2LQNA 4OVAA 2KRMA 4A4KA 3CC4A 5KYUA 4IIMA 5FW9A 4J5YA 3CC7T 1Q86C 4RTZA 4MZTA 4QVDA 3CPWS 4CC3A 3OYMA 1MV3A 4CRIA 3DLLA 3AT1B 3NGPA 1IRXA 3NTKA 2FG0A 3C0CA 5GAOr 2CP6A 2BIVA 5HK0A 1NJIU 1WZOA 1BCMA 3EG1A 1GBRA 2CP0A 3JCMg 1ABOA 3M0UA 4OMMA 3G6EA 2D8HA 2MOXA 1G2BA 2CZ1B 4KRTA 2CYZB 1LPLA 4PJOG 2DL7A 1HD3A 2KXCA 3H6ZA 1GRIA 2DL4A 4OB2B 3NHNA 4HCKA 5KYXA 2AK5A 3L2ZA 4OF1A 3X20B 1JEGA 2ROTA 2K2VA 2XDPA 1RABB 2XICA 3TREA 1WQWA 4HT8A 1GCPA 1ZX6A 2P4RA 1UGPB 3OW2S 1LJOA 3TSZA 3JRZA 2NUZA 2F5TX 5KCOA 5KYYB 2E5KA 1R77A 2QGFB 1HYOA 2DM1A 4XAXB 5A0DA 2EYXA 4M78G 5D7UA 1QVFA 3E19A 2KRSA 3OYKA 4M7DA 1F1BB 4KUIA 2JS0A 3P8BB 3T9NA 4RTVA 2L3SA 2HZYA 3M0PA 4XU1A 3SWNC 2XHCA 3M54A 1V29B 1BI1A 3BY7A 3OYLA 1K9AA 1RLQC 1SSFA 1TUDA 2XMFA 3D7SB 4JJNK 1YI2Q 3CCEA 3A8MB 5LJ5e 2FZKB 3M0RA 3CCSQ 2CZ6B 2WSEE 3G1JA 4R55A 3I56A 2D9TA 4JS4A 2JMAA 1ZLMA 1VUBA 2F69A 4AT1B 4C8QG 2QQRA 4C92F 1YI2T 2YRCA 3CCST 1YIJQ 2EVRA 3H0HA 3BW1A 4NL3A 4JJCA 2KT1A 1VQOQ 3RKYA 2QI2A 1NLPC 4FW1A 1YIJT 2EQJA 2RHYA 1N8RU 1QVPA 2X4XA 3TCJA 2ZPFB 1ZSZA 1BCOA 1VQOT 3CCRA 2GF7A 3LLRA 5LJ5g 2CH4A 2YLBA 2OX7A 4C92B 1RAAB 3NTIA 1H8KA 2A0FB 4XU2A 5GAOl 2DL3A 2XI9A 5DM7R 4M4ZA 3L1AA 2RPNA 4DBHA 1IO6A 4OB3B 5CQXA 3OYJA 1B34A 1OV3A 1YCSB 4J8OA 5KYUB 2K9GA 1WJRA 2Z0WA 1KC8C 1O9SA 4BB7A 2V8IA 2M0YA 2DPPB 2RHZA 5GANe 2NWMA 2GTJA 2D0QB 2E6NA 4M77C 4C92D 2A28A 2QYZA 5CIUA 5GAN2 1VYTA 2K3BA 3LGFA 2DFUA 3EG0A 3M58A 5GMKl 2RQWA 4PL6A 4E7KA 2OTJQ 2YSQA 1SRLA 2E1HA 1YHQA 4LDYA 1H3HA 4BUGA 2C0IA 2KDSA 2RJEA 2DEUA 2OTJT 1QP2A 2I0NA 2GNCA 1PKTA 2DZCA 3FB9A 2JM8A 4FU6A 1JJ2S 2OI3A 4XTUA 3VS6A 2JM9A 3WVEB 3QO3A 2ZPEB 5KYXB 5KCHA 4M77E 2ZAEA 5CKBA 3VRZA 8AT1B 3M0SA 2H3JA 3EG3A 4N4GA 2HQEA 1AVZC 1T3SA 4IUVA 5GAMj 1U3OA 1Z9ZA 3H8ZA 3EGDB 1K8AR 5LJ3g 4M77G 1BI2A 1NG2A 5I2MA 3JCMJ 2E41A 4M7DB 4DA4A 3S3MA 4ZN1A 4ZGEB 2HKNA 1VQPQ 2GTOA 2O4XB 3GOXA 3JCMf 4OB0B 5IHKA 2DRKA 5A0LA 1AT1B 4FW2A 2V1RA 1K76A 3CCMA 3UATA 4ME7A 4XTVA 2KVQG 3GPLA 1VQPT 5M9OA 3R6OA 2DYIA 1WA7A 5KE3A 4J9FA 1KK7A 1GCQA 3HFOA 2CSIA 3CCLA 2V8KA 1VQ5A 3OS2A 4M7DD 2GCXA 1VQ6A 2DL8A 2DO3A 3OS1A 1YCYA 2R5AA 3EHRA 1LVKA 2NUPA 2ZCFB 4E7JA 7AT1B 1Y0MA 2HBWA 2X3WD 1OOTA 1VQ7Q 3HTRA 3S3NA 4PJMA 1ZSZB 1U5SA 3CEYA 1KQ1A 1ZA2B 3E1SA 3JCMQ 3V7CA 4WTOB 2KMTA 3PVLA 1X6GA 2CDTA 2Y4XA 3HP9A 4RTUA 4C0DB 1VQ7T 1PC0A 3CC2A 4OP0A 1AZGB 4D8KA 2YUOA 3NFCA 1S72A 2C06A 4M75C 2YHTA 1G3YA 1K1ZA 3MEUA 4M77F 2EWNA 3HRUA 1M2OA 5GAMh 1HJDA 1UHFA 2ESWA 2DZ9A 4OGCA 4HXJA 1ACMB 2LX7A 3A8HB 5A0GA 2ZPHB 1RAIB 3OB9A 1HXDA 1VQKA 2L3RA 1SF9A 5HK3A 2L2PA 1YN8A 2EYWA 1KG1A 2CT4A 5LJ5f 2V26A 4JJDA 1UECA 1X75C 1YJ9Q 3CCJQ 3VS7A 4BDYA 2BE7D 1UGVA 1Q81C 1RADB 4XTYA 1JXOA 3VKIA 3JCMW 1IGQA 5J26A 1YJ9T 5GMKe 4AFZC 3CCJT 1PNJA 1PRMC 3CC4Q 3VS0A 4M7AA 2QEXA 1S1NA
chains in the Genus database with same CATH topology
1G83A 2IIMA 4Z89A 1BBZA 1E6HA 2JXBA 1UE9A 1QLYA 1UJ0A 1M27C 1B3QA 1NYGA 2C0TA 1SSHA 1UDLA 2JTEA 2X3XD 4AFQC 1JO8A 5I22A 2CT3A 1ZBJA 2EKHA 1ABQA 2EBPA 4E6RA 1WDXA 2CUDA 1YP5A 2DJQA 1PKSA 3VS5A 4D8DA 2RQRA 1UFFA 2DYBA 4J9GA 1UUEA 2FRWA 1E6GA 1WYXA 1GFDA 1AWOA 1Y57A 3PE0A 3R6NA 2LQNA 2KRMA 4AFUC 2LCSA 4IIMA 1X2KA 5FW9A 2DRMA 2A36A 2DX1A 2EGEA 2VWFA 4A63B 2RF0A 1KSWA 5IHIA 4RTZA 4CC3A 2G6FX 3LH5A 4Y92A 1ZUUA 1ZUYA 2AKKA 1MV3A 1X27A 2MCNA 1EFNA 3NGPA 1WXBA 2FG0A 2DE0X 2PZ1A 1UJYA 3C0CA 2FO0A 1SHFA 5IXFA 3ULRB 1LCKA 4LUEA 1ARKA 3EG1A 2ECZA 1GBRA 4OMQA 4LE9A 2PTKA 1ABOA 2DILA 3M0UA 4OMMA 4OMLA 2D8HA 2MOXA 2C0OA 1M3AA 2FPFA 1G2BA 2AZSA 3EGUA 1X43A 4KRTA 2OAWA 2DL7A 1HD3A 2KXCA 1E7OA 4OMNA 2FPDA 3TVTA 1GRIA 2DL4A 2J6FA 3FJ5A 3NHNA 2DMOA 1JXMA 4HCKA 2AK5A 3CQTA 2A08A 1VA7A 2O88A 1T0JA 1WFWA 2ROTA 1JEGA 1CKAA 2FRYA 1BU1A 2JMCA 4K11A 1GCPA 1ZX6A 2P4RA 3TSZA 1YNZA 4AG1C 2NUZA 1GFCA 4AG2C 2E5KA 2DM1A 2EYXA 4Z8AA 2DA9A 4OMOA 2K6DA 4Z88A 1AWJA 4RTYA 1WI7A 5FWCA 2KRSA 3I5SA 2JS0A 2K79A 1GBQA 4HVWA 4R0KA 2PNIA 1AWXA 1W6XA 2DVJA 4J9DA 4RTVA 2EPDA 2L3SA 3M0PA 1KIKA 5GJWB 3U23A 1T0HA 1V1CA 2DBMA 3QWXX 1K9AA 1X6BA 1AOJA 1RLQC 2HEQA 2LP5A 1I0CA 3NMZC 3ZL7C 1TUDA 2DF6A 2XMFA 4CC2A 2RNAA 2AKLA 4F14A 2V1QA 3JV3A 4LUDA 3M0RA 1W1FA 2EYZA 3VS2A 2YUQA 1JU5C 2K2MA 2O2OA 2SRCA 4FSSA 2D8JA 1RLPC 3A98A 3SHWA 3TSWA 2JMAA 1ZLMA 2J06A 4ESRA 1PRLC 5GJVB 4JZ4A 1GCQC 1TUCA 1AD5A 2DNUA 2F2WA 2H8HA 2EVRA 1QCFA 3H0HA 4J9CA 1WLPB 2LMJA 1ZSGA 2EQIA 2GBQA 5FWBA 2ENMA 4JJCA 4DEYA 2KT1A 2ABLA 2KEAA 2D1XA 1H92A 1FMKA 1YWPA 2KT8A 2O31A 1GL5A 1JQQA 1YWOA 1NLPC 3I9QA 4ORZA 2EGAA 2KROA 4F17A 3NPFA 1SRMA 4CC4B 2CH4A 5IXBA 2HDAA 2J7IA 2AZVA 4J9EA 1H8KA 1MUZA 2EGCA 2DL3A 4CC7A 1AZEA 4M4ZA 1CKBA 1B07A 2RPNA 4IIOA 1IO6A 1OV3A 1YCSB 2J6KA 4EIKA 2K9GA 1X69A 1W70A 2F2VA 4RTXA 1UTIA 1K4US 5IHNA 1NLOC 2EW3A 2M0YA 1PHTA 2RMOA 1FYNA 2FEIA 2NWMA 1SEMA 3O5ZA 2K7AA 2GTJA 1WX6A 2A28A 2M51A 1QWFA 1VYTA 2K3BA 3EG0A 1BK2A 2ED0A 2RQWA 2YSQA 1X2QA 1SRLA 2KE9A 1K0XA 2QDLA 2EYYA 1H3HA 2C0IA 4HVUA 1I1JA 2I0NA 4GBQA 1KJWA 2GNCA 1PKTA 1U06A 2JM8A 4WCIA 3H0IA 4JZ3A 2OI3A 3VS6A 2DLPA 2JM9A 3M0QA 1NM7A 1AEYA 1WXTA 3VRZA 3UA7A 3M0SA 3VRYA 3EG3A 2J6OA 2W0ZA 1AVZC 5EC7A 1T3SA 2RQUA 2CSQA 1U3OA 1M30A 1Z9ZA 4AFSC 2LNHB 2LJ1A 2L3QA 4J9IA 3REAB 2A37A 2O9SA 2HCKA 1NEGA 1HSQA 2RQVA 1NG2A 2KYMA 2W10A 5ECAA 2YUNA 2JW4A 1CSKA 4RTTA 2VVKA 2GTOA 1K0SA 4J9HA 3I5RA 1TG0A 2BZXA 2F2XA 2L3PA 5IHKA 2DRKA 3REBB 2V1RA 1K76A 1OPKA 3RNJA 2KXDA 3UATA 2DBKA 3VS3A 2KBTA 3IQLA 1WA7A 1M3BA 4J9FA 1KFZA 1NEBA 1GCQA 3I35A 2CSIA 2RN8A 4X1VA 2L0AA 1SHGA 3SEMA 2JT4A 3RBBB 4RTWA 1PWTA 1T3LA 1UG1A 2DL8A 4HVVA 4JJBA 4J9BA 1XOVA 1BB9A 2BZYA 3H41A 3PVQA 3EHRA 4LNPA 2YUPA 2MIOA 3THKA 2KRNA 4DEXA 2JS2A 2ED1A 2KR3A 1WIEA 3GBQA 2LQWA 1Y0MA 2HBWA 1SPKA 2FPEA 2X3WD 1OOTA 2ROLA 1J3TA 1U5SA 4OMPA 3H0FA 5IH2A 1M8MA 2D0NA 3PVLA 4GLMA 2LJ3A 1UHCA 3EG2A 3UF4A 1X6GA 2CDTA 1QKXA 2CH4W 2KYBA 4RTUA 3EHQA 2SEMA 2DL5A 1N5ZA 2OJ2A 1AZGB 1A0NB 4D8KA 2YUOA 2GGRA 2KGTA 1NYFA 5I11A 2HSPA 1K1ZA 2LJ0A 2RQTA 4LN2A 3KFVA 1HJDA 2YT6A 1UHFA 1I07A 1RUWA 2ESWA 4RUGA 1QKWA 5HCKA 1WXUA 4HXJA 2CREA 2O9VA 2LX7A 1VYVA 4F16A 3UA6A 2KNBB 3VS1A 1M3CA 2BZ8A 2L2PA 3VS4A 5L23A 1OEBA 1YN8A 1VYUA 2EYWA 1AWWA 2CT4A 2CUBA 1QWEA 4JPBW 1ZUKA 1UECA 4JJDA 2GQIA 3VS7A 2VKNA 2B86A 1RI9A 1UGVA 1JXOA 1OPLA 1MV0B 4QT7A 4ZNXA 1Z9QA 2YDLA 4AFZC 2LZ6B 2J05A 1PNJA 2BTTA 3M0TA 1PRMC 3VS0A 3QWYA 1S1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G83 A;  2IIM A;  4Z89 A;  1BBZ A;  1E6H A;  2JXB A;  1UE9 A;  1QLY A;  1UJ0 A;  1M27 C;  1B3Q A;  1NYG A;  2C0T A;  1SSH A;  1UDL A;  2JTE A;  2X3X D;  4AFQ C;  1JO8 A;  5I22 A;  2CT3 A;  1ZBJ A;  2EKH A;  1ABQ A;  2EBP A;  4E6R A;  1WDX A;  2CUD A;  1YP5 A;  2DJQ A;  1PKS A;  3VS5 A;  4D8D A;  2RQR A;  1UFF A;  2DYB A;  4J9G A;  1UUE A;  2FRW A;  1E6G A;  1WYX A;  1GFD A;  1AWO A;  1Y57 A;  3PE0 A;  3R6N A;  2LQN A;  2KRM A;  4AFU C;  2LCS A;  4IIM A;  1X2K A;  5FW9 A;  2DRM A;  2A36 A;  2DX1 A;  2EGE A;  2VWF A;  4A63 B;  2RF0 A;  1KSW A;  5IHI A;  4RTZ A;  4CC3 A;  2G6F X;  3LH5 A;  4Y92 A;  1ZUU A;  1ZUY A;  2AKK A;  1MV3 A;  1X27 A;  2MCN A;  1EFN A;  3NGP A;  1WXB A;  2FG0 A;  2DE0 X;  2PZ1 A;  1UJY A;  3C0C A;  2FO0 A;  1SHF A;  5IXF A;  3ULR B;  1LCK A;  4LUE A;  1ARK A;  3EG1 A;  2ECZ A;  1GBR A;  4OMQ A;  4LE9 A;  2PTK A;  1ABO A;  2DIL A;  3M0U A;  4OMM A;  4OML A;  2D8H A;  2MOX A;  2C0O A;  1M3A A;  2FPF A;  1G2B A;  2AZS A;  3EGU A;  1X43 A;  4KRT A;  2OAW A;  2DL7 A;  1HD3 A;  2KXC A;  1E7O A;  4OMN A;  2FPD A;  3TVT A;  1GRI A;  2DL4 A;  2J6F A;  3FJ5 A;  3NHN A;  2DMO A;  1JXM A;  4HCK A;  2AK5 A;  3CQT A;  2A08 A;  1VA7 A;  2O88 A;  1T0J A;  1WFW A;  2ROT A;  1JEG A;  1CKA A;  2FRY A;  1BU1 A;  2JMC A;  4K11 A;  1GCP A;  1ZX6 A;  2P4R A;  3TSZ A;  1YNZ A;  4AG1 C;  2NUZ A;  1GFC A;  4AG2 C;  2E5K A;  2DM1 A;  2EYX A;  4Z8A A;  2DA9 A;  4OMO A;  2K6D A;  4Z88 A;  1AWJ A;  4RTY A;  1WI7 A;  5FWC A;  2KRS A;  3I5S A;  2JS0 A;  2K79 A;  1GBQ A;  4HVW A;  4R0K A;  2PNI A;  1AWX A;  1W6X A;  2DVJ A;  4J9D A;  4RTV A;  2EPD A;  2L3S A;  3M0P A;  1KIK A;  5GJW B;  3U23 A;  1T0H A;  1V1C A;  2DBM A;  3QWX X;  1K9A A;  1X6B A;  1AOJ A;  1RLQ C;  2HEQ A;  2LP5 A;  1I0C A;  3NMZ C;  3ZL7 C;  1TUD A;  2DF6 A;  2XMF A;  4CC2 A;  2RNA A;  2AKL A;  4F14 A;  2V1Q A;  3JV3 A;  4LUD A;  3M0R A;  1W1F A;  2EYZ A;  3VS2 A;  2YUQ A;  1JU5 C;  2K2M A;  2O2O A;  2SRC A;  4FSS A;  2D8J A;  1RLP C;  3A98 A;  3SHW A;  3TSW A;  2JMA A;  1ZLM A;  2J06 A;  4ESR A;  1PRL C;  5GJV B;  4JZ4 A;  1GCQ C;  1TUC A;  1AD5 A;  2DNU A;  2F2W A;  2H8H A;  2EVR A;  1QCF A;  3H0H A;  4J9C A;  1WLP B;  2LMJ A;  1ZSG A;  2EQI A;  2GBQ A;  5FWB A;  2ENM A;  4JJC A;  4DEY A;  2KT1 A;  2ABL A;  2KEA A;  2D1X A;  1H92 A;  1FMK A;  1YWP A;  2KT8 A;  2O31 A;  1GL5 A;  1JQQ A;  1YWO A;  1NLP C;  3I9Q A;  4ORZ A;  2EGA A;  2KRO A;  4F17 A;  3NPF A;  1SRM A;  4CC4 B;  2CH4 A;  5IXB A;  2HDA A;  2J7I A;  2AZV A;  4J9E A;  1H8K A;  1MUZ A;  2EGC A;  2DL3 A;  4CC7 A;  1AZE A;  4M4Z A;  1CKB A;  1B07 A;  2RPN A;  4IIO A;  1IO6 A;  1OV3 A;  1YCS B;  2J6K A;  4EIK A;  2K9G A;  1X69 A;  1W70 A;  2F2V A;  4RTX A;  1UTI A;  1K4U S;  5IHN A;  1NLO C;  2EW3 A;  2M0Y A;  1PHT A;  2RMO A;  1FYN A;  2FEI A;  2NWM A;  1SEM A;  3O5Z A;  2K7A A;  2GTJ A;  1WX6 A;  2A28 A;  2M51 A;  1QWF A;  1VYT A;  2K3B A;  3EG0 A;  1BK2 A;  2ED0 A;  2RQW A;  2YSQ A;  1X2Q A;  1SRL A;  2KE9 A;  1K0X A;  2QDL A;  2EYY A;  1H3H A;  2C0I A;  4HVU A;  1I1J A;  2I0N A;  4GBQ A;  1KJW A;  2GNC A;  1PKT A;  1U06 A;  2JM8 A;  4WCI A;  3H0I A;  4JZ3 A;  2OI3 A;  3VS6 A;  2DLP A;  2JM9 A;  3M0Q A;  1NM7 A;  1AEY A;  1WXT A;  3VRZ A;  3UA7 A;  3M0S A;  3VRY A;  3EG3 A;  2J6O A;  2W0Z A;  1AVZ C;  5EC7 A;  1T3S A;  2RQU A;  2CSQ A;  1U3O A;  1M30 A;  1Z9Z A;  4AFS C;  2LNH B;  2LJ1 A;  2L3Q A;  4J9I A;  3REA B;  2A37 A;  2O9S A;  2HCK A;  1NEG A;  1HSQ A;  2RQV A;  1NG2 A;  2KYM A;  2W10 A;  5ECA A;  2YUN A;  2JW4 A;  1CSK A;  4RTT A;  2VVK A;  2GTO A;  1K0S A;  4J9H A;  3I5R A;  1TG0 A;  2BZX A;  2F2X A;  2L3P A;  5IHK A;  2DRK A;  3REB B;  2V1R A;  1K76 A;  1OPK A;  3RNJ A;  2KXD A;  3UAT A;  2DBK A;  3VS3 A;  2KBT A;  3IQL A;  1WA7 A;  1M3B A;  4J9F A;  1KFZ A;  1NEB A;  1GCQ A;  3I35 A;  2CSI A;  2RN8 A;  4X1V A;  2L0A A;  1SHG A;  3SEM A;  2JT4 A;  3RBB B;  4RTW A;  1PWT A;  1T3L A;  1UG1 A;  2DL8 A;  4HVV A;  4JJB A;  4J9B A;  1XOV A;  1BB9 A;  2BZY A;  3H41 A;  3PVQ A;  3EHR A;  4LNP A;  2YUP A;  2MIO A;  3THK A;  2KRN A;  4DEX A;  2JS2 A;  2ED1 A;  2KR3 A;  1WIE A;  3GBQ A;  2LQW A;  1Y0M A;  2HBW A;  1SPK A;  2FPE A;  2X3W D;  1OOT A;  2ROL A;  1J3T A;  1U5S A;  4OMP A;  3H0F A;  5IH2 A;  1M8M A;  2D0N A;  3PVL A;  4GLM A;  2LJ3 A;  1UHC A;  3EG2 A;  3UF4 A;  1X6G A;  2CDT A;  1QKX A;  2CH4 W;  2KYB A;  4RTU A;  3EHQ A;  2SEM A;  2DL5 A;  1N5Z A;  2OJ2 A;  1AZG B;  1A0N B;  4D8K A;  2YUO A;  2GGR A;  2KGT A;  1NYF A;  5I11 A;  2HSP A;  1K1Z A;  2LJ0 A;  2RQT A;  4LN2 A;  3KFV A;  1HJD A;  2YT6 A;  1UHF A;  1I07 A;  1RUW A;  2ESW A;  4RUG A;  1QKW A;  5HCK A;  1WXU A;  4HXJ A;  2CRE A;  2O9V A;  2LX7 A;  1VYV A;  4F16 A;  3UA6 A;  2KNB B;  3VS1 A;  1M3C A;  2BZ8 A;  2L2P A;  3VS4 A;  5L23 A;  1OEB A;  1YN8 A;  1VYU A;  2EYW A;  1AWW A;  2CT4 A;  2CUB A;  1QWE A;  4JPB W;  1ZUK A;  1UEC A;  4JJD A;  2GQI A;  3VS7 A;  2VKN A;  2B86 A;  1RI9 A;  1UGV A;  1JXO A;  1OPL A;  1MV0 B;  4QT7 A;  4ZNX A;  1Z9Q A;  2YDL A;  4AFZ C;  2LZ6 B;  2J05 A;  1PNJ A;  2BTT A;  3M0T A;  1PRM C;  3VS0 A;  3QWY A;  1S1N A; 
#chains in the Genus database with same CATH topology
 5GAN d;  2GQV A;  4EDU A;  1BBZ A;  2JXB A;  3LGL A;  5LJ5 j;  4A54 A;  4AMC A;  1M27 C;  2PVD B;  4D6W A;  4EMK C;  1XTD A;  1UDL A;  4AFQ C;  4C0F A;  3CBP A;  3PFS A;  1OUL A;  1ZBJ A;  4E6R A;  2ZPG B;  1VQ4 A;  2IG0 A;  1YP5 A;  1K73 R;  2DJQ A;  1M1G A;  3VS5 A;  1UFF A;  3OBW A;  4J9G A;  2X4J A;  1UUE A;  2MF2 A;  1WYX A;  5FRN A;  1GFD A;  1VQM A;  1AWO A;  3PE0 A;  3R6N A;  2RK1 A;  2XG8 D;  2LCS A;  2VYT A;  3CCV A;  3TQ7 P;  1X2K A;  2DRM A;  4DOV A;  2EGE A;  1KSW A;  5IHI A;  4A4G A;  1VQ8 A;  3M4G A;  1D0Z A;  4Q5W A;  2G6F X;  2MI6 A;  3LH5 A;  1ZUU A;  1ZUY A;  4Y92 A;  2AKK A;  5LL6 S;  3ZEH A;  4QQD A;  3RKW A;  5LJ3 f;  2RH2 A;  1M90 R;  1Q7Y C;  1VOM A;  1WXB A;  2NUP B;  2FO0 A;  4C5E A;  4HCZ A;  2IVW A;  4BY6 C;  4LUE A;  4EMG A;  2ECZ A;  4OMQ A;  2DIL A;  3RR6 A;  3CCQ A;  2O01 E;  2DTI A;  4OML A;  1YJN A;  2C0O A;  3EGU A;  1X43 A;  3RKX A;  2RJF A;  1KHI A;  2PQW A;  2FPD A;  3TVT A;  5IN1 A;  1W2B A;  3C94 A;  2DMO A;  4M75 F;  4C0Z A;  1OX9 A;  3RES A;  1ZHI A;  3CQT A;  5FRO A;  4XU3 A;  2A08 A;  1WFW A;  5LJ3 j;  4XK8 E;  2JMC A;  1OZ3 A;  2K57 A;  1YNZ A;  4AG1 C;  4AG2 C;  4E7L A;  2NYS A;  4FYX B;  1FMW A;  2DA9 A;  3MCA B;  2MK5 A;  2BE9 B;  3JB9 I;  4FCY A;  5FWC A;  4M75 B;  1Q82 R;  2NUT A;  3CXC P;  4HVW A;  1W6X A;  2DVJ A;  3OYD A;  4RG8 A;  4FIB A;  1X01 A;  1KIK A;  2K5L A;  2HAX A;  1C6V X;  3CCU Q;  4KBM B;  3ZL7 C;  2HEQ A;  2LP5 A;  1I0C A;  1BIB A;  4CC2 A;  4F04 B;  2RK2 A;  3MEW A;  3SFM A;  2V1Q A;  3JV3 A;  2K2M A;  2HSE B;  4FSS A;  2D8J A;  1RLP C;  3A98 A;  3FJP A;  3SHW A;  3CCU T;  1QVF S;  2J06 A;  2CGH A;  4RMO A;  3L2W A;  4M75 D;  6AT1 B;  3MEA A;  2L89 A;  3F70 A;  2F2W A;  3ME9 A;  1QCF A;  4PJO C;  2LMJ A;  2EQI A;  4M7A B;  2X51 A;  1ZQ1 A;  2QAZ A;  2DER A;  2KEA A;  2D1X A;  4B9X A;  1H92 A;  1YWP A;  2O31 A;  4JRP A;  2F1L A;  1GL5 A;  1MGQ A;  1JQQ A;  1YWO A;  4KUL A;  2MAM A;  2KRO A;  2VGM A;  4FM4 B;  2E6Z A;  1SRM A;  3OYH A;  4CC4 B;  1H3Z A;  2YLC A;  1TOV A;  2HDA A;  4M78 C;  4PJJ A;  2DD5 A;  3M53 A;  1XJW B;  4PJO E;  4IIO A;  1B07 A;  4M7A D;  2VAS A;  3VV0 A;  4J7F A;  1RL2 A;  1MMD A;  5LJ3 h;  3FLG A;  1IHW A;  1X69 A;  4JS5 A;  4PJN A;  1UTI A;  1K4U S;  3M59 A;  1TXQ A;  1PHT A;  5DLO A;  1SEM A;  3O5Z A;  1OZ2 A;  1B7T A;  2M51 A;  3EGX A;  4M78 E;  2ED0 A;  1M1K R;  1X2Q A;  4C8Q C;  1VQN Q;  2M0O A;  2QA4 Q;  2LQK A;  5DLQ E;  2EYY A;  3BFM A;  2XDB A;  3L2V A;  3BDL A;  2QGG A;  2XKO C;  4JRI A;  1G3W A;  1KQS P;  4PFZ A;  1KD1 C;  3GNG A;  3DKM A;  3EGD A;  1I1J A;  3GLX A;  2CKK A;  1U06 A;  1K9M C;  1VQN T;  4MDW A;  2QA4 T;  1EIF A;  5FU6 B;  3M0Q A;  2MPX C;  1NM7 A;  3EFO A;  4RCC A;  3RDV A;  2IPO B;  2JZ2 A;  2EFI A;  2RD1 A;  1R0C B;  2V8J A;  3OA6 A;  2KAF A;  1YJW Q;  1VQL A;  2O4X A;  3OSS C;  2G3R A;  3LWH A;  4C8Q E;  3OYB A;  4II1 A;  1M30 A;  3LW5 E;  1Q81 R;  2L3Q A;  3REA B;  3GNF B;  3V7S A;  2O9S A;  1YJW T;  2ZPI B;  2HMA A;  2P0K A;  3ZBD A;  2KYM A;  4XTX A;  2NLU A;  5ECA A;  1N6A A;  2NUT B;  1VQ9 A;  3SWN A;  1K0S A;  4J9H A;  5GMK j;  4FYY B;  2RA2 A;  2F2X A;  3DB4 A;  2L3P A;  5CO7 A;  2WSC E;  5I2S A;  4LD6 A;  3GIB A;  5AT1 B;  1PCX A;  3UWN A;  3VS3 A;  2K5I A;  3VUB A;  4BE2 A;  1QVG P;  1M3B A;  1K73 C;  3CMA Q;  5J3B A;  1O75 A;  4PJO F;  1SHG A;  3CC2 Q;  4M7D G;  4LDW A;  3C95 A;  4ELZ C;  2VC8 A;  3CPW A;  2PVG B;  1NJI R;  1S72 Q;  1K8A U;  1C1A A;  4Z02 A;  2GFU A;  2EQU A;  3CMA T;  4IUQ A;  3H41 A;  2FZG B;  2HQH A;  2FL7 A;  3DLM A;  2B8A A;  3CC2 T;  5D6W A;  4DBF A;  3RIR A;  2YUP A;  1U1T A;  2MIO A;  2KRN A;  2OTL A;  5GAN 6;  3PNW C;  4DEX A;  2JS2 A;  2LQW A;  5CR2 A;  1SPK A;  4QVC A;  4M78 F;  1M90 C;  2X4Y A;  3OSV A;  2LX9 A;  3GP8 A;  4OMP A;  5GAM d;  2ZPB B;  1Q7Y R;  3M57 A;  2D0N A;  2CS7 A;  3EG2 A;  1PSE A;  2XID A;  4PKC C;  3EHQ A;  3C4S A;  1M8V A;  2DXC A;  1A0N B;  2EIF A;  3JB9 G;  3CD6 Q;  3OW2 A;  5CKH A;  2DIQ A;  3QHS A;  3CC7 A;  4QKU A;  2YT6 A;  3AHU A;  4QW2 A;  1I07 A;  2PUO B;  4M77 A;  3O8V A;  3CME Q;  5HCK A;  3CD6 T;  1WXU A;  2EJG A;  3E9G A;  4C8Q F;  2CRE A;  2O9V A;  3G71 Q;  1Q86 U;  2QQS A;  2A7Y A;  3EGX B;  3HSB A;  3CXC A;  1W2B P;  2KNB B;  1I8F A;  3CME T;  1KQ2 A;  1YIT Q;  1FMV A;  1I4K 1;  5CQY A;  2COZ A;  5GAN g;  3G71 T;  2BZ8 A;  5D6Y A;  3VS4 A;  3C12 A;  1VYU A;  2DAQ A;  4Y28 E;  1Q82 C;  1AWW A;  5EG2 A;  3OBY A;  3MP1 A;  2CUB A;  1QWE A;  4M78 D;  2ZGW A;  1YIT T;  1X6O A;  4XTZ A;  2CP5 A;  2VKN A;  2RO0 A;  3QJ6 A;  4PJL A;  3EFO B;  3M5A A;  4RKU E;  2QTV A;  2JOY A;  2P84 A;  3JCM P;  4E7I A;  3X26 B;  2J05 A;  3HHT B;  5KYW A;  1G83 A;  5GAO n;  2IIM A;  1UE9 A;  1UJ0 A;  1M1F A;  1B3Q A;  2C0T A;  4DBQ A;  1BYM A;  1SSH A;  3BDU A;  5D6X A;  4KGX B;  2RI5 A;  4IUU A;  3SWN B;  1JO8 A;  3FDR A;  2EKH A;  3LX7 A;  2MWO A;  2WSF E;  2CUD A;  4HT9 A;  1PKS A;  3J80 E;  3G4S Q;  2RQR A;  3RER A;  3JB9 F;  4JLI A;  3TU4 K;  4PFO A;  1I5L A;  1WPY A;  2FRW A;  4J7I A;  4FSX A;  1Y57 A;  3G4S T;  1Y07 A;  2DX1 A;  3V8J A;  2VWF A;  1UGR B;  1YI2 A;  2RF0 A;  3CCS A;  2RJD A;  3NTH A;  4KH1 B;  4HKE A;  3OYF A;  1D1B A;  1Y71 A;  2MWP A;  2PZ1 A;  1JRI A;  4B6M A;  1YIJ A;  1SG5 A;  2DIG A;  3ULR B;  1LCK A;  3JCM c;  1ARK A;  1KQS A;  2PTK A;  1VQO A;  4DQ2 A;  1M1K C;  2AZS A;  2OAW A;  1E7O A;  1MMA A;  2AHJ B;  2XD0 A;  3FJ5 A;  4QVZ A;  5C0M A;  2FHD A;  1VA7 A;  1WNL A;  2JTF A;  4KGV B;  2HKQ B;  2JVV A;  4M75 A;  1NPR A;  1CKA A;  2DJZ A;  1KD1 R;  1BU1 A;  3I55 Q;  3X24 B;  3TEE A;  1K9M R;  4L5G A;  1GFC A;  2M9U A;  1XNI A;  4ATO A;  2MYS A;  4M77 B;  4BE1 A;  1KC8 U;  4Z8A A;  5I21 A;  4OMO A;  3I55 T;  1FXX A;  2D6F A;  2K6D A;  2OAU A;  1AWJ A;  1AHJ B;  4RTY A;  1YBY A;  2DKG A;  1WI7 A;  5GAN 7;  4F7U E;  1JBM A;  1GBQ A;  3JSC A;  2PNI A;  4J9D A;  3L2Q A;  2EPD A;  1TSF A;  4RG2 A;  5GJW B;  3FRN A;  3FEO A;  1VIF A;  3KUF A;  3NMZ C;  2OTJ A;  3KBG A;  5FU7 C;  1QVG A;  3JCM h;  4PLI A;  4F7U G;  2EQK A;  2KI7 A;  4M77 D;  3HPW A;  1W1F A;  3VS2 A;  2YUQ A;  3QYH B;  2O2O A;  4J6Y A;  4FYW B;  3TSW A;  3CC4 T;  4ESR A;  1PRL C;  2X35 A;  2E65 A;  1BI3 A;  1BKB A;  1R8O B;  4JZ4 A;  1IRE B;  2DNU A;  4XQ3 A;  1DJ7 B;  3SDZ A;  4JRQ A;  1GXI E;  2RHX A;  2E5Q A;  4J9C A;  5KYW B;  1PSF A;  1WLP B;  1OYX A;  2GBQ A;  4DEY A;  2ABL A;  5FRM A;  3G6E Q;  1NJI C;  4J83 A;  2KT8 A;  4EMK A;  3OYY A;  1WHG A;  1NZ9 A;  1M2V A;  4PNO A;  4ORZ A;  2E64 A;  1D09 B;  1JB0 E;  4F17 A;  1FWZ A;  3G6E T;  5GAN f;  4NOY A;  5IXB A;  2LDM A;  3HFN A;  2J7I A;  2AZV A;  3CPW P;  1OQK A;  4J9E A;  5CAI A;  2EGC A;  3S6W A;  4CC7 A;  1TWB A;  1AZE A;  1QQJ A;  3QYG B;  1CKB A;  2Y4Y A;  1VQP A;  3LWI A;  3JB9 J;  2L8D A;  3QSU A;  1D3B A;  1UEB A;  3VJP A;  2EW3 A;  2QDY B;  2RMO A;  1VQL Q;  2FEI A;  5GAN j;  2I2L A;  2K7A A;  1WX6 A;  3VYG A;  3V7R A;  2BUD A;  2PVO B;  1VQL T;  1XQH A;  2KE9 A;  5GMK i;  3CCE Q;  5L8R E;  2VGN A;  3BE3 A;  3I56 Q;  3OW2 P;  2DVE A;  3M4Y A;  3QJY A;  2LTO A;  4MDX A;  3A1P A;  5CKF A;  3CCE T;  2JUF A;  5AYF A;  2DLP A;  5LJ5 h;  3I56 T;  4ZN3 A;  4BAC A;  4L59 A;  3J7A F;  1AEY A;  3G7Z A;  2RB6 A;  2FZC B;  3MPU B;  3VRY A;  2DXB A;  3FIF A;  2PUK B;  1LNX A;  5EC7 A;  4IKF A;  5GAM e;  4BDZ A;  3RMQ A;  2EJ9 A;  4MZM A;  3CCR Q;  2A37 A;  3QII A;  1OI1 A;  1RAF B;  2E3H A;  1N8R C;  1QMC A;  2M16 A;  4L6V 5;  2QAS A;  3OY9 A;  1VIE A;  2RI2 A;  2YUN A;  3CCR T;  3VYH B;  3A8G B;  1TG0 A;  1UGQ B;  1QCO A;  3CBO A;  1WHK A;  2BZX A;  3REB B;  3L42 A;  1OPK A;  4X9D A;  1UB4 A;  2DBK A;  3SD4 A;  3E9F A;  3MEV A;  1NEB A;  5KE2 A;  3I35 A;  4BI3 A;  2RN8 A;  4X1V A;  5GAN 3;  2LC4 A;  3SEM A;  4E2F B;  2JT4 A;  1MMN A;  4PJO A;  1UG1 A;  1Q81 U;  2K3X A;  1YJ9 A;  4HVV A;  4JJB A;  3CCJ A;  4J9B A;  4O6J A;  2JTM A;  3EH1 A;  3RUX A;  2BZY A;  5HY6 A;  1YHQ Q;  4LD9 K;  3PIP A;  1SKU B;  2QXF A;  2LQ8 A;  4C92 E;  4EMK B;  1G3T A;  3E2U A;  1M2V B;  1WHH A;  2ED1 A;  2KR3 A;  3GBQ A;  3RMS A;  5GAO m;  3L2U A;  1YHQ T;  2FPE A;  2ROL A;  1RAH B;  1WQ7 A;  4JRK A;  2FVU A;  4M78 A;  2PU9 B;  2LJ3 A;  1UHC A;  2CH4 W;  4C92 G;  2K3Y A;  2SEM A;  2LCL A;  3OQ5 A;  4E7Z A;  2CP2 A;  2KSS A;  1KHC A;  2KGT A;  5I11 A;  1D3B B;  5IAY A;  4ZGJ B;  2HNI A;  5CKE A;  1IB8 A;  3PMT A;  3KFV A;  4X9C A;  3H9N A;  5GMK m;  1RUW A;  4YTL A;  1QKW A;  1JJ2 P;  4F16 A;  1I5O B;  3UA6 A;  4C8Q A;  3CCM Q;  4BY6 B;  2RHI A;  4M7D C;  1Q7Y U;  3WVD B;  1M3C A;  1NE8 A;  4A4E A;  1OEB A;  2DTH A;  3CCL Q;  3CCM T;  1VQ5 Q;  1VQ6 Q;  2HBP A;  2VV5 A;  1OU8 A;  1ZBX A;  3INZ A;  1U8R A;  3V8L A;  2B86 A;  5CVI A;  3M9Q A;  3CCL T;  1VQ5 T;  3CXC S;  1RI0 A;  2AT1 B;  1OPL A;  3EFR A;  4QT7 A;  1VQ6 T;  4JLG A;  1R0B G;  4ZNX A;  2LVM A;  4IUR A;  2BTT A;  2HQX A;  4M7D E;  3M0T A;  1WJQ A;  2RI3 A;  5IT9 E;  3KXT A;  3HRS A;  2YRV A;  2M1H A;  4Z89 A;  5KH6 A;  3PTA A;  3OYC A;  3J81 E;  1NYG A;  4DOW A;  3JCM b;  2CZ7 B;  4PLL A;  1D0Y A;  1WJS A;  1WHL A;  2LRQ A;  1NBE B;  5CKD A;  4CI0 C;  4R56 A;  1UGS B;  5I22 A;  2LNV A;  3JCM X;  2EBP A;  4EMH A;  1ZSZ C;  1WDX A;  3M56 A;  3X28 B;  3ASK A;  4D8D A;  2JJ9 A;  4FT4 A;  1QP3 A;  4J6X A;  1W4S A;  4X34 A;  1E6G A;  4C0D C;  4VUB A;  1S72 T;  3ZFJ A;  2X9H A;  4AFU C;  3CCU A;  3CPF A;  3OYN A;  2A36 A;  4ZTJ A;  4ELY C;  3A8L B;  4PJO B;  4A63 B;  3UT1 A;  2E3I A;  1TS9 A;  1Y96 A;  3Q1J A;  1VQK Q;  3N5B B;  1IXD A;  2GFA A;  1X27 A;  2MCN A;  4N0A C;  2P0Q A;  1EFN A;  3QZ5 B;  2DE0 X;  1UJY A;  3UPU A;  1SHF A;  1VQK T;  5IXF A;  2DXT A;  1QW1 A;  2MMP A;  2LT1 A;  1N9R A;  4KH0 B;  3QBY A;  4LE9 A;  2K5F A;  1M3A A;  2FPF A;  3UDC A;  4E7H A;  4M78 B;  5KYN A;  4A4H A;  4PJO D;  4OMN A;  4N0A A;  2J6F A;  5GAO p;  1JXM A;  4KT0 E;  3QPH A;  2O88 A;  1T0J A;  2QEX Q;  5LJ3 e;  1TU0 B;  2FRY A;  5GAM f;  3EG9 A;  4RCB A;  1D0X A;  4K11 A;  4QQG A;  5GMK h;  2HL5 C;  2QEX T;  1KQS S;  2P0P A;  3MO8 A;  2L5Q A;  4M7D F;  4Z88 A;  3JCM d;  4TVR A;  1VQ4 Q;  1WHM A;  3I5S A;  4XTW A;  3MET A;  4GLK A;  1YFN A;  4C8Q B;  1RAG B;  2K79 A;  1IZ6 A;  2KQW A;  4R0K A;  1Q95 G;  1AWX A;  4ZGD B;  1VQM Q;  3JB9 H;  1VQ4 T;  3U23 A;  1T0H A;  1N8R R;  2HL3 A;  3CCV Q;  1V1C A;  2DBM A;  3QWX X;  1X6B A;  1AOJ A;  5GAO q;  2DF6 A;  2RNA A;  2AKL A;  4F14 A;  4LUD A;  1VQN A;  1VQM T;  2QA4 A;  1KD1 U;  3LH0 A;  2EYZ A;  1OX8 A;  1JU5 C;  1VQ8 Q;  2SRC A;  1V76 A;  5A2Q E;  1OU9 A;  1K9M U;  3CCV T;  2QQB A;  5DY9 A;  3HKS A;  5GJV B;  3MKD A;  3PIO A;  1GCQ C;  4C8Q D;  1TUC A;  1AD5 A;  3VU3 C;  4KGZ B;  2RM4 A;  2H8H A;  1VQ8 T;  4DBR A;  3MJX A;  2LCC A;  1ZSG A;  5FWB A;  2ENM A;  2ATC B;  3CCQ Q;  4E7S A;  2CP7 A;  4FYV B;  1YJN Q;  4HCC A;  1FMK A;  2EAY A;  3S3O A;  3VUZ A;  1YJW A;  1QVG S;  3EH2 A;  4C5I A;  5C6S A;  3I9Q A;  4EPC A;  2EGA A;  4MML A;  4FL6 A;  3NPF A;  3CCQ T;  4KUD K;  1YJN T;  2QG9 B;  1U1S A;  1PD0 A;  2RJC A;  2EQM A;  4OB1 B;  4P5N A;  1D1A A;  3P8H A;  1MUZ A;  4BE0 A;  1M5Q 1;  5CCA A;  4J6W A;  1Q86 R;  2J6K A;  4HA8 A;  4OGE A;  3HL8 A;  1RAE B;  4EIK A;  1W70 A;  2F2V A;  1K73 U;  3X25 B;  2EKO A;  4RTX A;  3DB3 A;  4LDV A;  5IHN A;  1NLO C;  2P4T A;  1JJ2 A;  1FYN A;  1Y96 B;  5GAN 4;  3QDF A;  2RHU A;  3CMA A;  4BI8 B;  2QQA A;  1QWF A;  3A5Z B;  5LJ5 d;  1BK2 A;  1B34 B;  4XU0 A;  5CK9 A;  4ANJ A;  5GAN 5;  1EX4 A;  3JB9 D;  2E12 A;  2DEQ A;  2YWW A;  3JAM E;  1K0X A;  1Y7X A;  2QDL A;  1WHJ A;  1ZA1 B;  3ER0 A;  2Y90 A;  4F7U A;  4HVU A;  1EZZ B;  1M90 U;  3OMC A;  4GBQ A;  1KJW A;  4WCI A;  3L2R A;  3QG1 A;  3H0I A;  4JZ3 A;  5GAN 8;  1MHN A;  4FT2 A;  1W2B S;  4LDU A;  1WXT A;  3UA7 A;  3HRT A;  3EG9 B;  2J6O A;  2W0Z A;  3MP8 A;  4C5H A;  1PM3 A;  2RQU A;  4M75 E;  2XDD A;  2E10 A;  2CSQ A;  4E47 A;  4AFS C;  2LNH B;  4BD3 A;  2LJ1 A;  4J9I A;  4M7A C;  3OS0 A;  2E4H A;  2HCK A;  3CD6 A;  2ZZD A;  1NEG A;  4C0G A;  1HSQ A;  2RQV A;  2W10 A;  4NL2 A;  4UC4 A;  1QVF P;  2JW4 A;  2JNG A;  1CSK A;  4RTT A;  2VVK A;  4M75 G;  1TTH B;  3CME A;  2R5M A;  4A4F A;  3I5R A;  3G71 A;  1MND A;  1C0M A;  4ZTF A;  4PFP A;  3OYA A;  4IUT A;  3RNJ A;  2KXD A;  1G8X A;  3MP6 A;  1YIT A;  2KBT A;  1Q82 U;  1NPP A;  3IQL A;  4V2S A;  4LXC A;  2R57 A;  4M7A E;  1KFZ A;  2FB7 A;  2L0A A;  5LJ3 d;  4N4H A;  3EFS A;  1M4Z A;  4RTW A;  3RBB B;  1PWT A;  1T3L A;  1PD1 A;  1BI0 A;  2X4W A;  2QK0 A;  4N4I A;  3PGG A;  1XOV A;  1BB9 A;  2H3E B;  2JN0 A;  3OYG A;  3PVQ A;  4LNP A;  4M7A G;  2FYK A;  5J39 A;  3THK A;  3WXM B;  2VB6 A;  1RAC B;  1TUG B;  2DTO A;  1WIE A;  4NS5 A;  4OMF B;  2VUB A;  1J3T A;  2CZ0 B;  3CBM A;  4IUP A;  2XK0 A;  3SB2 A;  3H0F A;  5IH2 A;  1M8M A;  4C5G A;  4GLM A;  9ATC B;  4QQ6 A;  4MMK A;  3UF4 A;  1QKX A;  2KYB A;  1PG5 B;  1WGS A;  3EAE A;  2DL5 A;  1KC8 R;  2COY A;  1N5Z A;  2OJ2 A;  2WAC A;  5FU6 C;  4B9W A;  2AIR B;  2GGR A;  1MNE A;  1NYF A;  2DD4 A;  3QXE B;  5FLX E;  3OYE A;  2HSP A;  3JCM V;  3G4S A;  2LJ0 A;  1TH7 A;  4F7U F;  2RQT A;  2DXU A;  2QTX A;  4LN2 A;  1IGU A;  3LYI A;  4HCB A;  5KYY A;  1BIA A;  1G5V A;  3QKJ A;  3QDR B;  4RUG A;  1VQ9 Q;  3QUI A;  4JDS A;  2BKD N;  2YXY A;  2KY9 A;  1VYV A;  1MMG A;  1VQ7 A;  2E70 A;  3FC3 A;  3VS1 A;  5HKC A;  1VQ9 T;  1D1C A;  3V8K A;  2VXF A;  4A53 A;  3GF5 A;  3P8D A;  4PK4 A;  2M02 A;  5L23 A;  2XU8 A;  3URG A;  4F7U B;  2F5K A;  4JPB W;  1ZUK A;  2CP3 A;  2GQI A;  1M1K U;  2R58 A;  1RI9 A;  3PMI A;  4MZP A;  1H64 1;  1K8A C;  1MV0 B;  2QQ9 A;  3M55 A;  1Z9Q A;  2YDL A;  4M7A F;  2OTL Q;  2LZ6 B;  3QZ9 B;  3MHX A;  1HK9 A;  2EJF A;  2YRD A;  1G3S A;  2VXE A;  3QWY A;  1FX7 A;  1M9S A;  4C92 C;  1E6H A;  3I55 A;  1QLY A;  2OTL T;  4O5V A;  1N9S A;  5GAM g;  1P92 A;  2JTE A;  2X3X D;  2K4Y A;  1IHV A;  2HD0 A;  8ATC B;  2CT3 A;  3PT9 A;  1ABQ A;  2DET A;  2EYQ A;  4C92 A;  3A8O B;  2COW A;  2A3L A;  5FU7 B;  1I81 A;  1N27 A;  5GAN h;  2DYB A;  2KK4 A;  4JUV A;  3JCM e;  4GY5 A;  4BI4 A;  3OMG A;  3CC7 Q;  1QCN A;  2DK3 A;  3OYI A;  4Y91 A;  1LOJ A;  4LDX A;  4WF2 A;  3OS5 A;  2LT4 A;  2LQN A;  4OVA A;  2KRM A;  4A4K A;  3CC4 A;  5KYU A;  4IIM A;  5FW9 A;  4J5Y A;  3CC7 T;  1Q86 C;  4RTZ A;  4MZT A;  4QVD A;  3CPW S;  4CC3 A;  3OYM A;  1MV3 A;  4CRI A;  3DLL A;  3AT1 B;  3NGP A;  1IRX A;  3NTK A;  2FG0 A;  3C0C A;  5GAO r;  2CP6 A;  2BIV A;  5HK0 A;  1NJI U;  1WZO A;  1BCM A;  3EG1 A;  1GBR A;  2CP0 A;  3JCM g;  1ABO A;  3M0U A;  4OMM A;  3G6E A;  2D8H A;  2MOX A;  1G2B A;  2CZ1 B;  4KRT A;  2CYZ B;  1LPL A;  4PJO G;  2DL7 A;  1HD3 A;  2KXC A;  3H6Z A;  1GRI A;  2DL4 A;  4OB2 B;  3NHN A;  4HCK A;  5KYX A;  2AK5 A;  3L2Z A;  4OF1 A;  3X20 B;  1JEG A;  2ROT A;  2K2V A;  2XDP A;  1RAB B;  2XIC A;  3TRE A;  1WQW A;  4HT8 A;  1GCP A;  1ZX6 A;  2P4R A;  1UGP B;  3OW2 S;  1LJO A;  3TSZ A;  3JRZ A;  2NUZ A;  2F5T X;  5KCO A;  5KYY B;  2E5K A;  1R77 A;  2QGF B;  1HYO A;  2DM1 A;  4XAX B;  5A0D A;  2EYX A;  4M78 G;  5D7U A;  1QVF A;  3E19 A;  2KRS A;  3OYK A;  4M7D A;  1F1B B;  4KUI A;  2JS0 A;  3P8B B;  3T9N A;  4RTV A;  2L3S A;  2HZY A;  3M0P A;  4XU1 A;  3SWN C;  2XHC A;  3M54 A;  1V29 B;  1BI1 A;  3BY7 A;  3OYL A;  1K9A A;  1RLQ C;  1SSF A;  1TUD A;  2XMF A;  3D7S B;  4JJN K;  1YI2 Q;  3CCE A;  3A8M B;  5LJ5 e;  2FZK B;  3M0R A;  3CCS Q;  2CZ6 B;  2WSE E;  3G1J A;  4R55 A;  3I56 A;  2D9T A;  4JS4 A;  2JMA A;  1ZLM A;  1VUB A;  2F69 A;  4AT1 B;  4C8Q G;  2QQR A;  4C92 F;  1YI2 T;  2YRC A;  3CCS T;  1YIJ Q;  2EVR A;  3H0H A;  3BW1 A;  4NL3 A;  4JJC A;  2KT1 A;  1VQO Q;  3RKY A;  2QI2 A;  1NLP C;  4FW1 A;  1YIJ T;  2EQJ A;  2RHY A;  1N8R U;  1QVP A;  2X4X A;  3TCJ A;  2ZPF B;  1ZSZ A;  1BCO A;  1VQO T;  3CCR A;  2GF7 A;  3LLR A;  5LJ5 g;  2CH4 A;  2YLB A;  2OX7 A;  4C92 B;  1RAA B;  3NTI A;  1H8K A;  2A0F B;  4XU2 A;  5GAO l;  2DL3 A;  2XI9 A;  5DM7 R;  4M4Z A;  3L1A A;  2RPN A;  4DBH A;  1IO6 A;  4OB3 B;  5CQX A;  3OYJ A;  1B34 A;  1OV3 A;  1YCS B;  4J8O A;  5KYU B;  2K9G A;  1WJR A;  2Z0W A;  1KC8 C;  1O9S A;  4BB7 A;  2V8I A;  2M0Y A;  2DPP B;  2RHZ A;  5GAN e;  2NWM A;  2GTJ A;  2D0Q B;  2E6N A;  4M77 C;  4C92 D;  2A28 A;  2QYZ A;  5CIU A;  5GAN 2;  1VYT A;  2K3B A;  3LGF A;  2DFU A;  3EG0 A;  3M58 A;  5GMK l;  2RQW A;  4PL6 A;  4E7K A;  2OTJ Q;  2YSQ A;  1SRL A;  2E1H A;  1YHQ A;  4LDY A;  1H3H A;  4BUG A;  2C0I A;  2KDS A;  2RJE A;  2DEU A;  2OTJ T;  1QP2 A;  2I0N A;  2GNC A;  1PKT A;  2DZC A;  3FB9 A;  2JM8 A;  4FU6 A;  1JJ2 S;  2OI3 A;  4XTU A;  3VS6 A;  2JM9 A;  3WVE B;  3QO3 A;  2ZPE B;  5KYX B;  5KCH A;  4M77 E;  2ZAE A;  5CKB A;  3VRZ A;  8AT1 B;  3M0S A;  2H3J A;  3EG3 A;  4N4G A;  2HQE A;  1AVZ C;  1T3S A;  4IUV A;  5GAM j;  1U3O A;  1Z9Z A;  3H8Z A;  3EGD B;  1K8A R;  5LJ3 g;  4M77 G;  1BI2 A;  1NG2 A;  5I2M A;  3JCM J;  2E41 A;  4M7D B;  4DA4 A;  3S3M A;  4ZN1 A;  4ZGE B;  2HKN A;  1VQP Q;  2GTO A;  2O4X B;  3GOX A;  3JCM f;  4OB0 B;  5IHK A;  2DRK A;  5A0L A;  1AT1 B;  4FW2 A;  2V1R A;  1K76 A;  3CCM A;  3UAT A;  4ME7 A;  4XTV A;  2KVQ G;  3GPL A;  1VQP T;  5M9O A;  3R6O A;  2DYI A;  1WA7 A;  5KE3 A;  4J9F A;  1KK7 A;  1GCQ A;  3HFO A;  2CSI A;  3CCL A;  2V8K A;  1VQ5 A;  3OS2 A;  4M7D D;  2GCX A;  1VQ6 A;  2DL8 A;  2DO3 A;  3OS1 A;  1YCY A;  2R5A A;  3EHR A;  1LVK A;  2NUP A;  2ZCF B;  4E7J A;  7AT1 B;  1Y0M A;  2HBW A;  2X3W D;  1OOT A;  1VQ7 Q;  3HTR A;  3S3N A;  4PJM A;  1ZSZ B;  1U5S A;  3CEY A;  1KQ1 A;  1ZA2 B;  3E1S A;  3JCM Q;  3V7C A;  4WTO B;  2KMT A;  3PVL A;  1X6G A;  2CDT A;  2Y4X A;  3HP9 A;  4RTU A;  4C0D B;  1VQ7 T;  1PC0 A;  3CC2 A;  4OP0 A;  1AZG B;  4D8K A;  2YUO A;  3NFC A;  1S72 A;  2C06 A;  4M75 C;  2YHT A;  1G3Y A;  1K1Z A;  3MEU A;  4M77 F;  2EWN A;  3HRU A;  1M2O A;  5GAM h;  1HJD A;  1UHF A;  2ESW A;  2DZ9 A;  4OGC A;  4HXJ A;  1ACM B;  2LX7 A;  3A8H B;  5A0G A;  2ZPH B;  1RAI B;  3OB9 A;  1HXD A;  1VQK A;  2L3R A;  1SF9 A;  5HK3 A;  2L2P A;  1YN8 A;  2EYW A;  1KG1 A;  2CT4 A;  5LJ5 f;  2V26 A;  4JJD A;  1UEC A;  1X75 C;  1YJ9 Q;  3CCJ Q;  3VS7 A;  4BDY A;  2BE7 D;  1UGV A;  1Q81 C;  1RAD B;  4XTY A;  1JXO A;  3VKI A;  3JCM W;  1IGQ A;  5J26 A;  1YJ9 T;  5GMK e;  4AFZ C;  3CCJ T;  1PNJ A;  1PRM C;  3CC4 Q;  3VS0 A;  4M7A A;  2QEX A;  1S1N A; 
#chains in the Genus database with same CATH homology
 1G83 A;  2IIM A;  4Z89 A;  1BBZ A;  1E6H A;  2JXB A;  1UE9 A;  1QLY A;  1UJ0 A;  1M27 C;  1B3Q A;  1NYG A;  2C0T A;  1SSH A;  1UDL A;  2JTE A;  2X3X D;  4AFQ C;  1JO8 A;  5I22 A;  2CT3 A;  1ZBJ A;  2EKH A;  1ABQ A;  2EBP A;  4E6R A;  1WDX A;  2CUD A;  1YP5 A;  2DJQ A;  1PKS A;  3VS5 A;  4D8D A;  2RQR A;  1UFF A;  2DYB A;  4J9G A;  1UUE A;  2FRW A;  1E6G A;  1WYX A;  1GFD A;  1AWO A;  1Y57 A;  3PE0 A;  3R6N A;  2LQN A;  2KRM A;  4AFU C;  2LCS A;  4IIM A;  1X2K A;  5FW9 A;  2DRM A;  2A36 A;  2DX1 A;  2EGE A;  2VWF A;  4A63 B;  2RF0 A;  1KSW A;  5IHI A;  4RTZ A;  4CC3 A;  2G6F X;  3LH5 A;  4Y92 A;  1ZUU A;  1ZUY A;  2AKK A;  1MV3 A;  1X27 A;  2MCN A;  1EFN A;  3NGP A;  1WXB A;  2FG0 A;  2DE0 X;  2PZ1 A;  1UJY A;  3C0C A;  2FO0 A;  1SHF A;  5IXF A;  3ULR B;  1LCK A;  4LUE A;  1ARK A;  3EG1 A;  2ECZ A;  1GBR A;  4OMQ A;  4LE9 A;  2PTK A;  1ABO A;  2DIL A;  3M0U A;  4OMM A;  4OML A;  2D8H A;  2MOX A;  2C0O A;  1M3A A;  2FPF A;  1G2B A;  2AZS A;  3EGU A;  1X43 A;  4KRT A;  2OAW A;  2DL7 A;  1HD3 A;  2KXC A;  1E7O A;  4OMN A;  2FPD A;  3TVT A;  1GRI A;  2DL4 A;  2J6F A;  3FJ5 A;  3NHN A;  2DMO A;  1JXM A;  4HCK A;  2AK5 A;  3CQT A;  2A08 A;  1VA7 A;  2O88 A;  1T0J A;  1WFW A;  2ROT A;  1JEG A;  1CKA A;  2FRY A;  1BU1 A;  2JMC A;  4K11 A;  1GCP A;  1ZX6 A;  2P4R A;  3TSZ A;  1YNZ A;  4AG1 C;  2NUZ A;  1GFC A;  4AG2 C;  2E5K A;  2DM1 A;  2EYX A;  4Z8A A;  2DA9 A;  4OMO A;  2K6D A;  4Z88 A;  1AWJ A;  4RTY A;  1WI7 A;  5FWC A;  2KRS A;  3I5S A;  2JS0 A;  2K79 A;  1GBQ A;  4HVW A;  4R0K A;  2PNI A;  1AWX A;  1W6X A;  2DVJ A;  4J9D A;  4RTV A;  2EPD A;  2L3S A;  3M0P A;  1KIK A;  5GJW B;  3U23 A;  1T0H A;  1V1C A;  2DBM A;  3QWX X;  1K9A A;  1X6B A;  1AOJ A;  1RLQ C;  2HEQ A;  2LP5 A;  1I0C A;  3NMZ C;  3ZL7 C;  1TUD A;  2DF6 A;  2XMF A;  4CC2 A;  2RNA A;  2AKL A;  4F14 A;  2V1Q A;  3JV3 A;  4LUD A;  3M0R A;  1W1F A;  2EYZ A;  3VS2 A;  2YUQ A;  1JU5 C;  2K2M A;  2O2O A;  2SRC A;  4FSS A;  2D8J A;  1RLP C;  3A98 A;  3SHW A;  3TSW A;  2JMA A;  1ZLM A;  2J06 A;  4ESR A;  1PRL C;  5GJV B;  4JZ4 A;  1GCQ C;  1TUC A;  1AD5 A;  2DNU A;  2F2W A;  2H8H A;  2EVR A;  1QCF A;  3H0H A;  4J9C A;  1WLP B;  2LMJ A;  1ZSG A;  2EQI A;  2GBQ A;  5FWB A;  2ENM A;  4JJC A;  4DEY A;  2KT1 A;  2ABL A;  2KEA A;  2D1X A;  1H92 A;  1FMK A;  1YWP A;  2KT8 A;  2O31 A;  1GL5 A;  1JQQ A;  1YWO A;  1NLP C;  3I9Q A;  4ORZ A;  2EGA A;  2KRO A;  4F17 A;  3NPF A;  1SRM A;  4CC4 B;  2CH4 A;  5IXB A;  2HDA A;  2J7I A;  2AZV A;  4J9E A;  1H8K A;  1MUZ A;  2EGC A;  2DL3 A;  4CC7 A;  1AZE A;  4M4Z A;  1CKB A;  1B07 A;  2RPN A;  4IIO A;  1IO6 A;  1OV3 A;  1YCS B;  2J6K A;  4EIK A;  2K9G A;  1X69 A;  1W70 A;  2F2V A;  4RTX A;  1UTI A;  1K4U S;  5IHN A;  1NLO C;  2EW3 A;  2M0Y A;  1PHT A;  2RMO A;  1FYN A;  2FEI A;  2NWM A;  1SEM A;  3O5Z A;  2K7A A;  2GTJ A;  1WX6 A;  2A28 A;  2M51 A;  1QWF A;  1VYT A;  2K3B A;  3EG0 A;  1BK2 A;  2ED0 A;  2RQW A;  2YSQ A;  1X2Q A;  1SRL A;  2KE9 A;  1K0X A;  2QDL A;  2EYY A;  1H3H A;  2C0I A;  4HVU A;  1I1J A;  2I0N A;  4GBQ A;  1KJW A;  2GNC A;  1PKT A;  1U06 A;  2JM8 A;  4WCI A;  3H0I A;  4JZ3 A;  2OI3 A;  3VS6 A;  2DLP A;  2JM9 A;  3M0Q A;  1NM7 A;  1AEY A;  1WXT A;  3VRZ A;  3UA7 A;  3M0S A;  3VRY A;  3EG3 A;  2J6O A;  2W0Z A;  1AVZ C;  5EC7 A;  1T3S A;  2RQU A;  2CSQ A;  1U3O A;  1M30 A;  1Z9Z A;  4AFS C;  2LNH B;  2LJ1 A;  2L3Q A;  4J9I A;  3REA B;  2A37 A;  2O9S A;  2HCK A;  1NEG A;  1HSQ A;  2RQV A;  1NG2 A;  2KYM A;  2W10 A;  5ECA A;  2YUN A;  2JW4 A;  1CSK A;  4RTT A;  2VVK A;  2GTO A;  1K0S A;  4J9H A;  3I5R A;  1TG0 A;  2BZX A;  2F2X A;  2L3P A;  5IHK A;  2DRK A;  3REB B;  2V1R A;  1K76 A;  1OPK A;  3RNJ A;  2KXD A;  3UAT A;  2DBK A;  3VS3 A;  2KBT A;  3IQL A;  1WA7 A;  1M3B A;  4J9F A;  1KFZ A;  1NEB A;  1GCQ A;  3I35 A;  2CSI A;  2RN8 A;  4X1V A;  2L0A A;  1SHG A;  3SEM A;  2JT4 A;  3RBB B;  4RTW A;  1PWT A;  1T3L A;  1UG1 A;  2DL8 A;  4HVV A;  4JJB A;  4J9B A;  1XOV A;  1BB9 A;  2BZY A;  3H41 A;  3PVQ A;  3EHR A;  4LNP A;  2YUP A;  2MIO A;  3THK A;  2KRN A;  4DEX A;  2JS2 A;  2ED1 A;  2KR3 A;  1WIE A;  3GBQ A;  2LQW A;  1Y0M A;  2HBW A;  1SPK A;  2FPE A;  2X3W D;  1OOT A;  2ROL A;  1J3T A;  1U5S A;  4OMP A;  3H0F A;  5IH2 A;  1M8M A;  2D0N A;  3PVL A;  4GLM A;  2LJ3 A;  1UHC A;  3EG2 A;  3UF4 A;  1X6G A;  2CDT A;  1QKX A;  2CH4 W;  2KYB A;  4RTU A;  3EHQ A;  2SEM A;  2DL5 A;  1N5Z A;  2OJ2 A;  1AZG B;  1A0N B;  4D8K A;  2YUO A;  2GGR A;  2KGT A;  1NYF A;  5I11 A;  2HSP A;  1K1Z A;  2LJ0 A;  2RQT A;  4LN2 A;  3KFV A;  1HJD A;  2YT6 A;  1UHF A;  1I07 A;  1RUW A;  2ESW A;  4RUG A;  1QKW A;  5HCK A;  1WXU A;  4HXJ A;  2CRE A;  2O9V A;  2LX7 A;  1VYV A;  4F16 A;  3UA6 A;  2KNB B;  3VS1 A;  1M3C A;  2BZ8 A;  2L2P A;  3VS4 A;  5L23 A;  1OEB A;  1YN8 A;  1VYU A;  2EYW A;  1AWW A;  2CT4 A;  2CUB A;  1QWE A;  4JPB W;  1ZUK A;  1UEC A;  4JJD A;  2GQI A;  3VS7 A;  2VKN A;  2B86 A;  1RI9 A;  1UGV A;  1JXO A;  1OPL A;  1MV0 B;  4QT7 A;  4ZNX A;  1Z9Q A;  2YDL A;  4AFZ C;  2LZ6 B;  2J05 A;  1PNJ A;  2BTT A;  3M0T A;  1PRM C;  3VS0 A;  3QWY A;  1S1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...