4AFZC

Human chymase - fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
VTLFVALYDYNATRWTDLSFHKGEKFQILEFGPGDWWEARSLTTGETGYIPSNYVAPVDSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 11
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afzC00
1RUWA 3EGUA 1BK2A 1E6GA 2DE0X 1PKSA 3EG0A 2A28A 4D8KA 2DL8A 1T0HA 2LZ6B 1YNZA 5FWBA 2C0TA 1I0CA 1FYNA 1W70A 3VS5A 4LUEA 1YP5A 1RLQC 1VYTA 4AFZC 2C0IA 3R6NA 2M51A 4R0KA 1ZBJA 3TVTA 1NEBA 2ABLA 4IIOA 3EG1A 1PWTA 2EPDA 2KE9A 3VS2A 1M3CA 1SRMA 1WA7A 4RTYA 2JXBA 1X27A 2EGEA 2G6FX 2YT6A 2EYWA 1GFDA 4JJBA 2JW4A 3RBBB 2FRYA 4J9BA 2CT3A 2LCSA 2W0ZA 2LJ3A 1UJ0A 2GBQA 3VS4A 1H3HA 5EC7A 4CC7A 3UATA 1J3TA 1UUEA 2LQWA 2PZ1A 1AD5A 2F2XA 2J6OA 1WXTA 1G2BA 1KJWA 2KR3A 2FG0A 1AWOA 1M8MA 2JM8A 1E6HA 2W10A 2PNIA 4LE9A 4J9HA 3I35A 2A37A 2OJ2A 3M0QA 2YUQA 2JM9A 1E7OA 3RNJA 2KYMA 2MOXA 1UTIA 1VYUA 1JO8A 5I11A 1T0JA 1UDLA 2DYBA 2H8HA 3U23A 4F14A 4WCIA 2QDLA 4ZNXA 1UFFA 1CKBA 2FPEA 2DLPA 4ESRA 1K1ZA 2GTOA 2JS2A 3EG2A 4AFSC 1KIKA 1UECA 1AZGB 1PHTA 1ZLMA 2PTKA 2YUPA 1X6BA 1GCQA 2LNHB 2SEMA 1QWFA 3UA7A 1T3SA 1X2QA 3PVQA 2A36A 3NHNA 1I1JA 2EW3A 2L2PA 1TUDA 5GJVB 5FW9A 2K79A 1WXUA 2IIMA 1MV0B 1NLOC 4CC2A 1KSWA 3FJ5A 4CC3A 2JS0A 2P4RA 1NM7A 1NEGA 4Z89A 2ROLA 1NLPC 2L3SA 2J6KA 1K0SA 1I07A 1PKTA 2KXDA 2FRWA 4F17A 1OPLA 1W1FA 3VS7A 1QKWA 4RTZA 2K7AA 5HCKA 1NYGA 2ECZA 2EYYA 2KNBB 1UGVA 1GRIA 2VVKA 3THKA 4J9GA 2DL3A 2CSIA 2AZSA 3PVLA 2VKNA 1M3AA 1PNJA 2RF0A 4Z8AA 1KFZA 3TSZA 4E6RA 2HCKA 2DILA 4J9CA 3VRYA 4RTUA 2CDTA 2F2VA 3IQLA 1RI9A 2O9VA 2VWFA 4HVVA 1K76A 2M0YA 2LMJA 1UE9A 1BB9A 3I9QA 2D8JA 2DX1A 1AEYA 1OPKA 4LUDA 2DMOA 1B07A 1UG1A 1Z9QA 1S1NA 2O2OA 3JV3A 1AWXA 1QWEA 5ECAA 4ORZA 1U5SA 2EQIA 2L3PA 3PE0A 1MV3A 2OI3A 1WX6A 2KRNA 2BTTA 2DL5A 2LJ0A 5IH2A 4JJDA 1VYVA 1AOJA 3NPFA 4KRTA 4J9FA 2CH4W 2RN8A 4GLMA 4RTVA 2AKLA 1BBZA 1HSQA 2DVJA 2HDAA 3EG3A 2RQUA 4QT7A 4M4ZA 2O88A 2D0NA 1M27C 2K3BA 1OOTA 3M0UA 2CUDA 2EYZA 4AFUC 1SHGA 4J9EA 1JEGA 5IHIA 1OV3A 1WDXA 1NG2A 3QWYA 2ED0A 1U06A 2OAWA 1X2KA 2LJ1A 4RTXA 2EYXA 3GBQA 2CH4A 2J06A 1Y0MA 2KEAA 1W6XA 3H41A 1TG0A 1FMKA 4Y92A 4D8DA 1HD3A 2GQIA 1WFWA 2CREA 2I0NA 2LX7A 1AZEA 2RQWA 3O5ZA 5I22A 4J9DA 2ESWA 2V1RA 2CT4A 2DJQA 3KFVA 2JMAA 5IXBA 1TUCA 1GL5A 2NWMA 4AFQC 2EGCA 3H0HA 4HVUA 5L23A 3VS1A 2KT1A 2KGTA 5IHNA 2J7IA 2MIOA 1SSHA 2L0AA 1A0NB 4GBQA 3CQTA 4RTTA 2D1XA 1QLYA 2HSPA 3M0SA 2DBMA 2YSQA 1VA7A 2C0OA 2CUBA 2FO0A 2JMCA 1MUZA 1ZUUA 2K2MA 4EIKA 4LNPA 1RLPC 1JXOA 1UJYA 4OMOA 1V1CA 3M0PA 4JZ3A 4OMLA 1HJDA 2DNUA 2EKHA 2KRMA 4DEXA 2O9SA 3H0IA 2EBPA 2BZYA 3EHQA 2NUZA 2V1QA 2AK5A 1CSKA 1SHFA 2HEQA 2YUOA 1XOVA 4LN2A 1H92A 1IO6A 2KROA 4F16A 2FPFA 2D8HA 1G83A 3I5SA 1YWPA 1X69A 2X3WD 2E5KA 1B3QA 3EHRA 1GFCA 3NGPA 1GBRA 2AKKA 4Z88A 1WXBA 1OEBA 1NYFA 1GBQA 2K6DA 2DRMA 1Z9ZA 2F2WA 1GCPA 2DL4A 2J6FA 2DRKA 2GTJA 3TSWA 4A63B 4HCKA 2EGAA 2BZXA 3I5RA 2YDLA 1SRLA 1ZX6A 5IXFA 3ULRB 2RMOA 1ZUYA 2FPDA 1YCSB 2LP5A 1CKAA 2MCNA 3SEMA 4OMMA 4JPBW 3UA6A 1UHFA 1U3OA 1WYXA 1SEMA 1YWOA 2ENMA 2KXCA 5GJWB 1T3LA 4OMQA 1PRLC 2RPNA 4RTWA 5FWCA 1EFNA 2KRSA 3ZL7C 3NMZC 1K9AA 4JJCA 3QWXX 2RQVA 3SHWA 2HBWA 4AG2C 1K0XA 2ED1A 2GGRA 2KYBA 2AZVA 1JXMA 2KBTA 5IHKA 2RQTA 2LQNA 1SPKA 3H0FA 1X43A 2YUNA 2DL7A 1WI7A 2CSQA 3VS0A 2J05A 2DM1A 1LCKA 4AG1C 4CC4B 1JQQA 3UF4A 3VS3A 1WIEA 1ABOA 2EVRA 1M3BA 2FEIA 1UHCA 4IIMA 1ZSGA 1WLPB 1AVZC 1ZUKA 4X1VA 2KT8A 1PRMC 3C0CA 2K9GA 2B86A 2RQRA 2O31A 4DEYA 3M0RA 2L3QA 4HVWA 2SRCA 1AWWA 2JT4A 1AWJA 1YN8A 1M30A 1H8KA 3REAB 4OMPA 2DA9A 4HXJA 1GCQC 2X3XD 3VS6A 3VRZA 3REBB 4K11A 3M0TA 2DF6A 2RNAA 4RUGA 4J9IA 1ARKA 3LH5A 2DBKA 1BU1A 1Y57A 1K4US 2JTEA 1QKXA 3A98A 2GNCA 1N5ZA 4FSSA 2XMFA 2ROTA 1JU5C 2BZ8A 1QCFA 1X6GA 4JZ4A 1ABQA 2A08A 4OMNA
chains in the Genus database with same CATH superfamily
3EGUA 1BK2A 2DE0X 3EG0A 3OS0A 4N0AA 2A28A 5KYXA 5KCHA 1N27A 2DL8A 1AT1B 5FWBA 1VQ5T 1VQ5A 1I0CA 1FYNA 1TWBA 1W70A 2YRCA 5HY6A 2HKQB 3CCRQ 4M78G 1QVPA 3V8JA 3INZA 4NL2A 4A54A 1VQ7T 2LQKA 1SSFA 1OZ2A 1KD1U 1HXDA 5GAN2 3BW1A 4OF1A 4WF2A 1PWTA 1M3CA 2JXBA 4M75A 1IGUA 1GFDA 4JJBA 3A8MB 3CC2A 1VQOA 3RBBB 1QVGA 1IHWA 3MEAA 1GXIE 4J9BA 3EGXA 3BFMA 2YHTA 4M77A 4E7ZA 4QKUA 3L2RA 5GANd 4PJOC 1J3TA 3EG9A 1WJSA 2J6OA 2LT1A 1WXTA 3LLRA 4LD9K 4HCCA 3GOXA 3EFOA 2FZKB 4M7AA 2PNIA 1YJWT 4EMKC 3VJPA 1YJWA 1WHHA 2A37A 3JAME 1JJ2S 4PJOE 2AT1B 1IRXA 2DAQA 3MO8A 5FU7B 1D1BA 3U23A 4WCIA 4PJJA 3RDVA 4J83A 3I55Q 2QDLA 3GPLA 4FM4B 5LJ5j 4F7UF 1VQMA 4L6V5 2HQHA 2FPEA 5A0DA 2DLPA 4ESRA 1IZ6A 4M7DF 4BE1A 2GTOA 2DXCA 4AFSC 3AT1B 5D6WA 2BE9B 4ANJA 2CP6A 1ZLMA 2HMAA 2PTKA 4C0DB 2SEMA 1X2QA 2A36A 3NHNA 3RMQA 1N9SA 4XTVA 1M2VA 5FW9A 2QEXA 3CD6T 1KD1R 1KSWA 3L2QA 5GANg 2Y4YA 1U1TA 4KGXB 4RMOA 2EIFA 5GAMd 5HKCA 3E2UA 2DPPB 2RJEA 4JJNK 2CP5A 3N5BB 2FZGB 3VS7A 4OVAA 5DLQE 5HCKA 2OTJQ 2EYYA 1UGVA 4FT4A 2BIVA 3THKA 2E64A 4XTXA 3DB4A 3F70A 2AZSA 1WJRA 1B7TA 2KI7A 3CEYA 2VKNA 1H3ZA 1TU0B 4HCZA 3CXCS 2JOYA 1JRIA 2HCKA 2DILA 4J9CA 3VRYA 2O4XA 4RTUA 5CIUA 2CDTA 4DA4A 4DBQA 2YLBA 2FYKA 1OI1A 1K76A 2M0YA 3SFMA 5LJ3d 2EJFA 2D8JA 3OS2A 1AEYA 1VQLQ 1M1FA 2DETA 1UG1A 4ELZC 3ZEHA 4OB0B 2O2OA 3VUBA 3O8VA 5GAN8 4LD6A 4B9WA 5KE3A 3FJPA 5GAMg 4JJDA 2YRDA 4QQGA 3I56Q 1NBEB 4KRTA 2CH4W 1VUBA 4F7UG 1TSFA 1BBZA 2HD0A 2DVJA 3S3MA 1M27C 3CCVA 3QYHB 1YHQQ 4M7DG 2X9HA 2DXBA 2CUDA 2EYZA 4XU1A 2DYIA 5J3BA 3S6WA 2PUOB 3OA6A 2ED0A 3GLXA 2CH4A 4QQDA 2KEAA 4NOYA 3CCEQ 4GLKA 4E47A 4PJOB 2COYA 2CREA 1YJNT 1YJNA 2E3IA 4EMKB 2KMTA 4IUTA 2NWMA 1KQ2A 3GNGA 4FYYB 3FIFA 2DXUA 2KT1A 4OB2B 4PNOA 1VQ9T 4BE2A 1VQ9A 1MMNA 2AHJB 4EDUA 4XQ3A 2M9UA 2HKNA 1MMGA 4C0GA 4GY5A 3P8BB 2ZPBB 4Y91A 3OMCA 1BI1A 3CCRT 3CCRA 4PJLA 2CP3A 1V1CA 3M0PA 4OMOA 1R0CB 2KRMA 4PLIA 1S72Q 4KH1B 1QMCA 3QJYA 5CQXA 2V1QA 1XOVA 1IO6A 2KROA 4F16A 2D8HA 1G83A 3OYKA 1M1KU 5GAN4 2DD5A 2H3JA 2QGGA 4IKFA 4LDVA 4Y28E 2HQEA 1NYFA 1GBQA 1X75C 3VYHB 3CBPA 2DL4A 2J6FA 2DRKA 2GTJA 2DTOA 2EGAA 2F1LA 2XG8D 2YDLA 3H9NA 3OS5A 1M5Q1 5GMKm 1ZUYA 3CPWP 3OYIA 1I4K1 2H3EB 1CKAA 2MCNA 3SEMA 3ER0A 2VGMA 2CZ1B 4JPBW 3UA6A 1U3OA 1WYXA 2ENMA 2KXCA 2X51A 1WNLA 1T3LA 2JVVA 2LC4A 2RI3A 5L8RE 3A1PA 3CC7Q 3MP1A 2XK0A 1WHLA 1EFNA 2KRSA 3ZL7C 3HFNA 3CCUQ 1K9AA 1RL2A 2QK0A 4JJCA 3I55T 2RQVA 1RAGB 1SF9A 3MEWA 3I55A 2M16A 3SHWA 1D1AA 2HBWA 2ZAEA 4AG2C 4PLLA 4BE0A 4N4IA 2IPOB 2LQNA 4MZMA 2PVGB 3LH0A 1X01A 4IUPA 3OYEA 2CSQA 1Q82U 4E2FB 4OB1B 1JQQA 2NYSA 1ABOA 2EVRA 4F7UE 2M0OA 3PGGA 4O6JA 2FEIA 4V2SA 4IIMA 4FYWB 3RIRA 1WLPB 1HK9A 4FW1A 3META 5KE2A 3JB9H 1JB0E 2K9GA 4DEYA 4OP0A 1M1KR 4HVWA 1KD1C 1YJ9A 4XTZA 5FRNA 4M75D 2JT4A 1WZOA 1M30A 1YI2Q 1G3SA 2E4HA 3EFSA 2OTJT 4PJOD 3CPWA 4MDXA 4M77D 3P8DA 4QVCA 5GAN6 3RKXA 5FLXE 2A0FB 1MNDA 2RNAA 4RUGA 3D7SB 4J9IA 2NUPA 1N5ZA 4HT8A 5GMKe 3G71Q 4ZTJA 1N6AA 1X6GA 1M90U 1RAEB 4OMNA 3CCMA 1E6GA 3E1SA 3JCMV 2CZ6B 1T0HA 2LZ6B 1VQLT 1YNZA 3OYAA 2MAMA 2C0TA 2D9TA 1RLQC 3EFRA 2P0PA 3LX7A 1IXDA 4R0KA 1ZBJA 5GMKl 3M53A 2FZCB 5LJ3f 2ABLA 2F5KA 4IUQA 2VXFA 1Q82R 1YFNA 1PM3A 4IIOA 2NUTB 3JCMQ 4RG2A 2KE9A 1WHJA 2EPDA 2EQKA 3I56T 3C95A 2RI5A 1R0BG 2E1HA 2LQ8A 4RTYA 2XU8A 1ZA1B 3HPWA 5KYWB 3A8GB 4DBHA 4XTYA 3GIBA 1YHQT 2JW4A 2LNVA 3PT9A 3CCLQ 2W0ZA 4XU3A 2MWOA 3VS4A 2E5QA 3RERA 1QCNA 1TTHB 3OQ5A 3UATA 3L2WA 1UUEA 2LQWA 1AD5A 2F2XA 1G2BA 2OX7A 2P0QA 4C8QC 5DLOA 1BI3A 2DZ9A 4MDWA 3CCET 3A5ZB 3X20B 4FL6A 2DERA 2JM8A 1E6HA 4A4EA 4LE9A 3V8LA 2LDMA 1I81A 2OJ2A 4BDYA 2YUQA 5A2QE 2JM9A 1R77A 4O5VA 3JCMb 2MOXA 1VYUA 1JO8A 4C8QE 1UDLA 2H8HA 3X26B 2VASA 4MZPA 4M78D 1UFFA 6AT1B 5I2SA 4KT0E 1M90R 2COWA 5GAOn 2K5IA 3NTKA 3HP9A 4RKUE 2EFIA 4DOWA 1SG5A 2OTLA 1QVGS 1KIKA 2GF7A 2QGFB 4E7HA 1PD1A 1UECA 4F7UB 2JTMA 1ZQ1A 1X6BA 1GCQA 2LNHB 3PVQA 1I1JA 3CCQA 1ACMB 2HBPA 5GJVB 1YITA 4JS4A 3R6OA 1WXUA 3T9NA 5GANe 1NLOC 5KYYB 1N9RA 3FJ5A 2L3RA 1S72T 1S72A 1NM7A 1NEGA 4Z89A 2ROLA 1NLPC 2C06A 2DIQA 4IUVA 1EZZB 1PKTA 2EYQA 1QVFP 4ZTFA 1QKWA 3CCSQ 2RB6A 2ECZA 1SKUB 2VVKA 2GCXA 3HRUA 4J9GA 5FU6C 1NJIU 4XK8E 2DL3A 2WSEE 3CCJQ 5GMKh 1M3AA 3J80E 1PNJA 1XQHA 1Q95G 1NE8A 4Z8AA 1KFZA 4E6RA 2Z0WA 3QIIA 3C94A 1X6OA 1VQ7A 3RMSA 2F2VA 2GFUA 1N8RU 2O9VA 2X4JA 3PMTA 1RI0A 3BY7A 2L89A 2A7YA 3I9QA 3OBWA 1OPKA 1PG5B 1ZSZC 3CC7T 1B07A 3UT1A 3HL8A 1S1NA 1AWXA 4XTWA 1QWEA 2CZ7B 1KG1A 4ORZA 3CCUT 2MYSA 5CKFA 1U5SA 4ELYC 4PJOA 2WSCE 2LRQA 5GAMe 1YIJQ 2VC8A 2LJ0A 3PIOA 2DEUA 3G6EQ 1VYVA 3RR6A 1VQPQ 5CKBA 1AHJB 4EMKA 4RTVA 1WQ7A 1QVFA 1C1AA 2RQUA 1WHMA 4M4ZA 2RHUA 4HKEA 2O88A 1TXQA 2NLUA 2EAYA 2K3BA 4XTUA 4C5HA 4C92F 1Q7YU 1K8AR 1OV3A 2CKKA 1EIFA 2RJDA 2VGNA 3KBGA 3QSUA 2WACA 5DY9A 4X34A 1QW1A 2LJ1A 3E9FA 2E6NA 5LJ3e 1Y0MA 1W6XA 4ZN1A 1YI2T 1M1KC 1NJIR 4LDYA 1AZEA 4C8QB 3OBYA 2ESWA 2V1RA 1BCMA 2XDBA 5IT9E 1OU8A 4J7FA 3JRZA 1D0XA 1Q86U 2X35A 5C0MA 4M7AE 4N4HA 4J5YA 1PSEA 3CD6A 4L59A 1VIEA 2QQRA 4HVUA 1N8RR 3VS1A 1PSFA 1G8XA 5GMKj 2E10A 5IHNA 3G71T 3WXMB 5CQYA 1VQKQ 2J7IA 3DB3A 2L0AA 3G1JA 4GBQA 1G3YA 3JCMd 2LX9A 3M0SA 1UEBA 3ZBDA 5GANh 2CUBA 2LCCA 4F04B 1ZUUA 2K2MA 4LNPA 2E70A 1JXOA 4M7DD 2CS7A 4OMLA 2WSFE 4DEXA 2O9SA 2PUKB 5LL6S 3EHQA 5DM7R 3JCMJ 2K3XA 2XI9A 2HEQA 1SHFA 2YUOA 3EH2A 1YWPA 2X3WD 4M78A 1GFCA 1GBRA 2AKKA 1Q82C 4Z88A 1Q7YR 2CP2A 2RHXA 3M4YA 2DRMA 1GCPA 4JS5A 4BB7A 3CCLT 5FU6B 3TSWA 4A63B 4FIBA 1RACB 5HK0A 3QUIA 2KQWA 1KQSP 4LXCA 1SRLA 1ZX6A 3ULRB 4FYXB 5IXFA 2RMOA 1YCSB 5AYFA 4C92G 3HSBA 2Y4XA 3A8LB 3PIPA 4OMMA 3M55A 2LT4A 1UHFA 4E7LA 2HQXA 1SEMA 4QW2A 4TVRA 1LOJA 4OMQA 1VQ8Q 1M9SA 3CMEQ 2FL7A 4JRIA 5GAMh 1Q86R 5LJ5f 3LGLA 3NMZC 1ZSZB 3KXTA 3QWXX 2XDPA 3VV0A 1K0XA 1H641 4C8QF 2ED1A 3L2UA 1B34B 2AZVA 2RQTA 3CMAQ 5GAN7 2YUNA 1M90C 3QO3A 2EWNA 5CKHA 2DM1A 1LCKA 1IB8A 1OX8A 5LJ3g 4AG1C 5GAN3 3VS3A 2CP7A 3JB9F 3L2ZA 4RCBA 1ZSGA 1OQKA 4PKCC 1MHNA 2V26A 5GANj 2V8JA 2JUFA 2P84A 4X1VA 4KH0B 1PRMC 3QZ9B 2RQRA 2B86A 1OU9A 2KSSA 3EGXB 1FXXA 2Y90A 4UC4A 2DFUA 4C5EA 3BDLA 2FVUA 3CCST 1KQSA 1H8KA 3BE3A 1YBYA 2ZPFB 4A4KA 2QA4Q 3OSSC 5IN1A 2ZCFB 4HXJA 1V76A 4YTLA 3VRZA 2PVOB 4M7AB 3SWNC 3LGFA 3CCJT 2DF6A 2MK5A 2NUTA 3H8ZA 1K4US 1Y57A 2JTEA 2GNCA 4FSSA 3RUXA 4PFZA 2DK3A 3KUFA 1VQ6Q 5KYWA 2BZ8A 1MGQA 4QVZA 1QCFA 1U1SA 2XIDA 1ABQA 4Y92A 3LW5E 1RUWA 2E12A 1PKSA 1D0YA 4PJNA 3NTHA 3HTRA 4A4GA 2QQ9A 1YP5A 4HA8A 4AFZC 2C0IA 5GAOm 3R6NA 2M51A 5GAMj 2ZPIB 1Y96A 1YIJT 2QQSA 1YIJA 2XD0A 5D6YA 2M1HA 3CPWS 2D6FA 3G6ET 2X4YA 2XICA 1M2OA 3M58A 1OULA 4CI0C 1BCOA 3EG1A 5C6SA 1VQPT 1BI0A 2VYTA 1SRMA 3CC4Q 2EGEA 4QQ6A 2G6FX 4LDWA 3FB9A 4C8QG 2JJ9A 1ZA2B 2YT6A 3TCJA 2EYWA 2RJFA 2QYZA 2FRYA 2CT3A 2LCSA 4A4HA 1UJ0A 2GBQA 4C92C 1WHGA 4F7UA 5J26A 3JB9G 5EG2A 2PZ1A 4DBRA 3HHTB 2DTIA 3OYDA 1KC8U 1M8VA 4M7DA 2FB7A 2KR3A 4HCBA 1G5VA 2FG0A 4C92E 2RO0A 5KYYA 3M0QA 1XJWB 4M75F 1HYOA 3L2VA 1VQOQ 3FDRA 3CC2Q 3RNJA 1BIAA 1ZHIA 2ZZDA 1NJIC 1UTIA 2L5QA 1T0JA 5KYUB 1TS9A 4VUBA 3CBOA 4ZNXA 3BDUA 1TUGB 2MI6A 1CKBA 2K5FA 8ATCB 4JRKA 3GP8A 1VOMA 1UB4A 3URGA 3MHXA 3S3NA 2QASA 2JS2A 1VQKT 1N8RC 1VQKA 3WVDB 4M7AF 4J6YA 1LPLA 4A4FA 2OTJA 1QWFA 2QTXA 2L2PA 1TUDA 4C5GA 1VQMQ 2K79A 2IIMA 2EQMA 2GFAA 3NTIA 4CC2A 2COZA 1D1CA 3ME9A 4CC3A 1Y7XA 2P4RA 1XNIA 1WHKA 3RKWA 5I21A 3HRSA 2L3SA 4KGZB 4C5IA 1K0SA 1I07A 2FRWA 3JCMf 4DOVA 2IG0A 1W1FA 3JB9I 4ME7A 4RTZA 2KNBB 1PCXA 2DZCA 2QEXQ 3OYMA 1VQLA 3PVLA 5FROA 2RF0A 1Q7YC 4JRPA 3OYCA 3TSZA 1VQ4Q 3SWNB 1D3BB 1KC8R 4E7SA 1LJOA 2G3RA 2YLCA 3GF5A 3IQLA 1WQWA 1UGPB 1RI9A 4ZGDB 4HVVA 1QCOA 3OY9A 1ZBXA 2LMJA 1UE9A 2QTVA 3I56A 4R55A 8AT1B 3J81E 4LUDA 1VQ8T 3CMET 3CMEA 4BI4A 4ZN3A 3QJ6A 1YHQA 4ZGJB 5ECAA 5CVIA 2HSEB 3UPUA 1W2BP 1Q86C 2L3PA 2YWWA 4B6MA 4M75G 2OI3A 2KRNA 5GMKi 2BTTA 2DL5A 1BIBA 5LJ5d 2F5TX 5IH2A 3G7ZA 1MMDA 2VUBA 1AOJA 3CMAT 3OB9A 3S3OA 2RHZA 3JB9J 2RN8A 2AKLA 3CCEA 2HDAA 1VQNQ 2D0NA 2K2VA 4JLIA 3M0UA 4M7AG 3ASKA 1SHGA 3VU3C 4J9EA 3JCMc 1JEGA 5IHIA 3SDZA 3VYGA 2OAWA 1X2KA 4BACA 4PFOA 4RTXA 2EYXA 3TEEA 2M02A 4C92B 1TG0A 1HD3A 2GQIA 3CBMA 4X9CA 3CCVQ 4JDSA 2ATCB 2RQWA 5I22A 2QA4T 2XDDA 2RH2A 1EX4A 2CT4A 1C0MA 2JMAA 3QBYA 1TUCA 4A53A 3SB2A 4AFQC 1K73U 1VIFA 2MMPA 4KUIA 3H0HA 5L23A 5I2MA 2JTFA 4FU6A 5GAOp 2KGTA 5KYNA 5LJ5g 2V8KA 2QXFA 1QVFS 1K8AU 1VQ6T 1R8OB 2MPXC 2MIOA 1SSHA 1W2BA 1KHIA 4XU2A 1A0NB 1QLYA 3RESA 2HSPA 4KGVB 1RABB 2FO0A 3QKJA 5CCAA 3QDFA 1D0ZA 1K9MU 1HJDA 2DNUA 1IGQA 2EQJA 2EBPA 3V8KA 4P5NA 2NUZA 4LN2A 1H92A 1RAHB 2FPFA 3X25B 4KBMB 3I5SA 1BKBA 1X69A 1IREB 2PQWA 2P4TA 5GAOr 3EHRA 1ZSZA 3OW2A 4OGCA 3CC4T 3CC4A 1WXBA 4N0AC 3M59A 2K6DA 3CC7A 1B34A 1IHVA 4KULA 4CRIA 3PTAA 2R57A 3LYIA 4HCKA 1XTDA 2GQVA 3CCUA 4EPCA 2QQAA 2D0QB 2NUPB 3OYBA 2RM4A 3JCMe 2ZGWA 1YWOA 5GJWB 2IVWA 3OYYA 3CC2T 1VQOT 5IAYA 4EMGA 2RPNA 4AT1B 3G4SQ 1K73R 4M75C 3JSCA 3QZ5B 2EJ9A 2RI2A 4M77C 3Q1JA 3EH1A 4PJMA 2GGRA 2KYBA 3JCMP 5IHKA 1SPKA 3H0FA 4M75E 1I8FA 4J6XA 1WI7A 2J05A 4J6WA 4J7IA 7AT1B 1YI2A 4M77E 4M7AC 3M9QA 3QDRB 4CC4B 3UF4A 1K9MR 1JJ2P 1M3BA 2BKDN 1UHCA 2XHCA 3M4GA 1VQMT 3MP6A 3V7SA 3C0CA 4BUGA 3FRNA 2ZPGB 2O31A 1M4ZA 1Y07A 4FCYA 3M0RA 2L3QA 4DQ2A 2OAUA 3UWNA 3G71A 1AWJA 4C92D 3OYJA 1OZ3A 3REAB 3OYLA 5CK9A 2DIGA 4OMPA 2DA9A 3JCMW 3VS6A 2QEXT 3REBB 4K11A 1DJ7B 3M0TA 2K3YA 1ARKA 1OX9A 3LH5A 3ZFJA 3LWIA 1RAFB 2HAXA 1BU1A 1QKXA 4PL6A 3A98A 1VQ4T 1VQ4A 1YJ9Q 4QVDA 1JU5C 3TU4K 2DEQA 4JZ4A 1QP2A 2A08A 3X28B 1KC8C 4JUVA 1FX7A 4D8KA 1I5OB 2CYZB 3OYFA 5CAIA 3V7RA 3VS5A 3J7AF 2HL5C 4LUEA 4HT9A 1BYMA 3PMIA 1VYTA 2EJGA 1JJ2A 3CXCP 3QG1A 3TVTA 1PC0A 1NEBA 1KQSS 2QAZA 1Q81U 3CCLA 2VV5A 4DBFA 3CCMQ 3X24B 3EGDB 3SD4A 3FEOA 3VS2A 3WVEB 1Y71A 5KYUA 1WA7A 4M78C 4RG8A 1X27A 2RD1A 3JCMg 1VQNT 1VQNA 3MP8A 5KYXB 5CR2A 4E7KA 2LJ3A 2RK1A 1H3HA 4MZTA 5EC7A 4M78E 3P8HA 4CC7A 3JCMh 3MKDA 2HZYA 1V29B 5KCOA 3CPFA 4E7IA 1OYXA 3L1AA 4KUDK 4BY6C 4FSXA 1KJWA 1AWOA 1M8MA 2X4XA 4BI8B 2W10A 3MEUA 4J9HA 3I35A 3CCVT 1YCYA 3A8OB 1E7OA 2KYMA 5I11A 2DYBA 3E19A 4BI3A 4F14A 2PU9B 5CO7A 1KHCA 5LJ3h 4M75B 2CGHA 1K1ZA 3M54A 3CXCA 3EG2A 4M77B 5GAN5 2JNGA 3GNFB 1TOVA 1AZGB 1PHTA 2YUPA 3LWHA 3EG9B 3CCSA 4II1A 1P92A 3UA7A 1T3SA 3SWNA 5J39A 3C12A 4PK4A 1D3BA 1NZ9A 2EW3A 4C8QD 3EFOB 4FW2A 4XAXB 1Q81R 3C4SA 4OGEA 2RK2A 1MV0B 1JBMA 3CCJA 2JS0A 2RA2A 3OSVA 4JRQA 2J6KA 2AIRB 2KXDA 4F17A 2OTLQ 1OPLA 3HFOA 3JB9D 2KVQG 2DJZA 4C0ZA 2LCLA 2K7AA 1NYGA 1GRIA 5A0GA 3CCQQ 1YITQ 3FLGA 2CSIA 2HNIA 4XU0A 4L5GA 2E65A 2DTHA 1W4SA 4BD3A 4OMFB 1MNEA 1BI2A 1M2VB 3QYGB 2VWFA 3G6EA 2QI2A 2DKGA 1VQPA 1BB9A 1FMVA 2DX1A 4AMCA 1LNXA 3RKYA 1VQ5Q 4WTOB 2DMOA 3TREA 1Z9QA 1WPYA 3G4ST 3JV3A 3G4SA 3EAEA 1U8RA 4IURA 2QDYB 4C92A 1KK7A 1QP3A 1MMAA 2VXEA 2EQIA 1VQ7Q 1K73C 3PE0A 1MV3A 5CKDA 1WX6A 3H6ZA 3UDCA 2O01E 1K8AC 4LDXA 3PFSA 3NPFA 5LJ3j 2FHDA 2I2LA 2LTOA 4J9FA 2K57A 3NFCA 4GLMA 2O4XB 1HSQA 2EKOA 3EG3A 4QT7A 5GANf 1OOTA 4AFUC 4M78B 3FC3A 4PJOF 1K9MC 4M77F 1WDXA 1NG2A 3DKMA 3QWYA 1U06A 2BUDA 4ATOA 3GBQA 2BE7D 2J06A 2KK4A 4X9DA 4M7DC 4E7JA 3H41A 1M1GA 4D8DA 1FMKA 2KDSA 1UGSB 1YJWQ 1WFWA 2I0NA 2LX7A 4BY6B 3O5ZA 4J9DA 1LVKA 3VUZA 1WGSA 2DJQA 3KFVA 4FT2A 4M7DE 2R5MA 5IXBA 1GL5A 3OS1A 4B9XA 1NPPA 1RAIB 3L42A 4R56A 2EGCA 5LJ5e 4C0FA 4MMLA 2EQUA 3MCAB 1YJ9T 2R58A 3M56A 5AT1B 1KQ1A 2MF2A 1RAAB 2E41A 1PD0A 3CQTA 4RTTA 2D1XA 2DBMA 2YSQA 1VA7A 2C0OA 2B8AA 2JMCA 1MUZA 2DO3A 4EIKA 5GAMf 5KH6A 3DLLA 1RLPC 1UJYA 3CD6Q 4JZ3A 5GAOl 1I5LA 4ZGEB 1FMWA 4M7AD 2EKHA 3MEVA 2DXTA 2CZ0B 3H0IA 2BZYA 2RJCA 2V8IA 3JCMX 2AK5A 1CSKA 3CCMT 2MWPA 4JLGA 2RHIA 1O9SA 2P0KA 1NPRA 1D09B 2JN0A 2E5KA 1B3QA 2E6ZA 3NGPA 3OYHA 3QHSA 1OEBA 4EMHA 4MMKA 3HKSA 3MPUB 3OYNA 1VQ8A 1F1BB 2XKOC 1Z9ZA 2F2WA 1W2BS 9ATCB 2BZXA 3I5RA 4LDUA 2FPDA 2LP5A 4C8QA 1G3WA 2A3LA 3TQ7P 2ZPEB 4PJOG 4M78F 4M77G 3CMAA 5FU7C 4Q5WA 4IUUA 2ZPHB 1WJQA 5CKEA 1PRLC 3AHUA 3OMGA 2DVEA 2LVMA 4RTWA 5FWCA 1RADB 5FRMA 3M5AA 2E3HA 1UGQB 4OB3B 2PVDB 3DLMA 2K5LA 2KAFA 3OW2S 1QQJA 1C6VX 5D7UA 1JXMA 2KBTA 3A8HB 2YXYA 3OW2P 4C0DC 2CP0A 1X43A 1Y96B 2DL7A 3VKIA 5D6XA 3VS0A 3QXEB 1G3TA 4NS5A 5GAOq 1WIEA 2QA4A 3E9GA 4BDZA 1UGRB 5HK3A 2QQBA 1AVZC 2DD4A 2HL3A 1ZUKA 4FYVB 3OYGA 2K4YA 2KT8A 2L8DA 3HRTA 1Q81C 2VB6A 2SRCA 2OTLT 4RCCA 1VQ6A 1AWWA 1YN8A 3V7CA 2R5AA 3PNWC 2YRVA 1QVGP 5M9OA 2KY9A 1YJNQ 2X4WA 3CCQT 2JZ2A 4M7DB 4D6WA 1GCQC 1YITT 5LJ5h 2X3XD 4Z02A 5A0LA 4N4GA 3EGDA 3QPHA 2DBKA 1O75A 4J8OA 1FWZA 1TH7A 2XMFA 2F69A 4PFPA 2ROTA 1VQ9Q 4NL3A 3MJXA 3M57A 2QG9B 2RHYA
chains in the Genus database with same CATH topology
1RUWA 3EGUA 1BK2A 1E6GA 2DE0X 1PKSA 3EG0A 2A28A 4D8KA 2DL8A 1T0HA 2LZ6B 1YNZA 5FWBA 2C0TA 1I0CA 1FYNA 1W70A 3VS5A 4LUEA 1YP5A 1RLQC 1VYTA 4AFZC 2C0IA 3R6NA 2M51A 4R0KA 1ZBJA 3TVTA 1NEBA 2ABLA 4IIOA 3EG1A 1PWTA 2EPDA 2KE9A 3VS2A 1M3CA 1SRMA 1WA7A 4RTYA 2JXBA 1X27A 2EGEA 2G6FX 2YT6A 2EYWA 1GFDA 4JJBA 2JW4A 3RBBB 2FRYA 4J9BA 2CT3A 2LCSA 2W0ZA 2LJ3A 1UJ0A 2GBQA 3VS4A 1H3HA 5EC7A 4CC7A 3UATA 1J3TA 1UUEA 2LQWA 2PZ1A 1AD5A 2F2XA 2J6OA 1WXTA 1G2BA 1KJWA 2KR3A 2FG0A 1AWOA 1M8MA 2JM8A 1E6HA 2W10A 2PNIA 4LE9A 4J9HA 3I35A 2A37A 2OJ2A 3M0QA 2YUQA 2JM9A 1E7OA 3RNJA 2KYMA 2MOXA 1UTIA 1VYUA 1JO8A 5I11A 1T0JA 1UDLA 2DYBA 2H8HA 3U23A 4F14A 4WCIA 2QDLA 4ZNXA 1UFFA 1CKBA 2FPEA 2DLPA 4ESRA 1K1ZA 2GTOA 2JS2A 3EG2A 4AFSC 1KIKA 1UECA 1AZGB 1PHTA 1ZLMA 2PTKA 2YUPA 1X6BA 1GCQA 2LNHB 2SEMA 1QWFA 3UA7A 1T3SA 1X2QA 3PVQA 2A36A 3NHNA 1I1JA 2EW3A 2L2PA 1TUDA 5GJVB 5FW9A 2K79A 1WXUA 2IIMA 1MV0B 1NLOC 4CC2A 1KSWA 3FJ5A 4CC3A 2JS0A 2P4RA 1NM7A 1NEGA 4Z89A 2ROLA 1NLPC 2L3SA 2J6KA 1K0SA 1I07A 1PKTA 2KXDA 2FRWA 4F17A 1OPLA 1W1FA 3VS7A 1QKWA 4RTZA 2K7AA 5HCKA 1NYGA 2ECZA 2EYYA 2KNBB 1UGVA 1GRIA 2VVKA 3THKA 4J9GA 2DL3A 2CSIA 2AZSA 3PVLA 2VKNA 1M3AA 1PNJA 2RF0A 4Z8AA 1KFZA 3TSZA 4E6RA 2HCKA 2DILA 4J9CA 3VRYA 4RTUA 2CDTA 2F2VA 3IQLA 1RI9A 2O9VA 2VWFA 4HVVA 1K76A 2M0YA 2LMJA 1UE9A 1BB9A 3I9QA 2D8JA 2DX1A 1AEYA 1OPKA 4LUDA 2DMOA 1B07A 1UG1A 1Z9QA 1S1NA 2O2OA 3JV3A 1AWXA 1QWEA 5ECAA 4ORZA 1U5SA 2EQIA 2L3PA 3PE0A 1MV3A 2OI3A 1WX6A 2KRNA 2BTTA 2DL5A 2LJ0A 5IH2A 4JJDA 1VYVA 1AOJA 3NPFA 4KRTA 4J9FA 2CH4W 2RN8A 4GLMA 4RTVA 2AKLA 1BBZA 1HSQA 2DVJA 2HDAA 3EG3A 2RQUA 4QT7A 4M4ZA 2O88A 2D0NA 1M27C 2K3BA 1OOTA 3M0UA 2CUDA 2EYZA 4AFUC 1SHGA 4J9EA 1JEGA 5IHIA 1OV3A 1WDXA 1NG2A 3QWYA 2ED0A 1U06A 2OAWA 1X2KA 2LJ1A 4RTXA 2EYXA 3GBQA 2CH4A 2J06A 1Y0MA 2KEAA 1W6XA 3H41A 1TG0A 1FMKA 4Y92A 4D8DA 1HD3A 2GQIA 1WFWA 2CREA 2I0NA 2LX7A 1AZEA 2RQWA 3O5ZA 5I22A 4J9DA 2ESWA 2V1RA 2CT4A 2DJQA 3KFVA 2JMAA 5IXBA 1TUCA 1GL5A 2NWMA 4AFQC 2EGCA 3H0HA 4HVUA 5L23A 3VS1A 2KT1A 2KGTA 5IHNA 2J7IA 2MIOA 1SSHA 2L0AA 1A0NB 4GBQA 3CQTA 4RTTA 2D1XA 1QLYA 2HSPA 3M0SA 2DBMA 2YSQA 1VA7A 2C0OA 2CUBA 2FO0A 2JMCA 1MUZA 1ZUUA 2K2MA 4EIKA 4LNPA 1RLPC 1JXOA 1UJYA 4OMOA 1V1CA 3M0PA 4JZ3A 4OMLA 1HJDA 2DNUA 2EKHA 2KRMA 4DEXA 2O9SA 3H0IA 2EBPA 2BZYA 3EHQA 2NUZA 2V1QA 2AK5A 1CSKA 1SHFA 2HEQA 2YUOA 1XOVA 4LN2A 1H92A 1IO6A 2KROA 4F16A 2FPFA 2D8HA 1G83A 3I5SA 1YWPA 1X69A 2X3WD 2E5KA 1B3QA 3EHRA 1GFCA 3NGPA 1GBRA 2AKKA 4Z88A 1WXBA 1OEBA 1NYFA 1GBQA 2K6DA 2DRMA 1Z9ZA 2F2WA 1GCPA 2DL4A 2J6FA 2DRKA 2GTJA 3TSWA 4A63B 4HCKA 2EGAA 2BZXA 3I5RA 2YDLA 1SRLA 1ZX6A 5IXFA 3ULRB 2RMOA 1ZUYA 2FPDA 1YCSB 2LP5A 1CKAA 2MCNA 3SEMA 4OMMA 4JPBW 3UA6A 1UHFA 1U3OA 1WYXA 1SEMA 1YWOA 2ENMA 2KXCA 5GJWB 1T3LA 4OMQA 1PRLC 2RPNA 4RTWA 5FWCA 1EFNA 2KRSA 3ZL7C 3NMZC 1K9AA 4JJCA 3QWXX 2RQVA 3SHWA 2HBWA 4AG2C 1K0XA 2ED1A 2GGRA 2KYBA 2AZVA 1JXMA 2KBTA 5IHKA 2RQTA 2LQNA 1SPKA 3H0FA 1X43A 2YUNA 2DL7A 1WI7A 2CSQA 3VS0A 2J05A 2DM1A 1LCKA 4AG1C 4CC4B 1JQQA 3UF4A 3VS3A 1WIEA 1ABOA 2EVRA 1M3BA 2FEIA 1UHCA 4IIMA 1ZSGA 1WLPB 1AVZC 1ZUKA 4X1VA 2KT8A 1PRMC 3C0CA 2K9GA 2B86A 2RQRA 2O31A 4DEYA 3M0RA 2L3QA 4HVWA 2SRCA 1AWWA 2JT4A 1AWJA 1YN8A 1M30A 1H8KA 3REAB 4OMPA 2DA9A 4HXJA 1GCQC 2X3XD 3VS6A 3VRZA 3REBB 4K11A 3M0TA 2DF6A 2RNAA 4RUGA 4J9IA 1ARKA 3LH5A 2DBKA 1BU1A 1Y57A 1K4US 2JTEA 1QKXA 3A98A 2GNCA 1N5ZA 4FSSA 2XMFA 2ROTA 1JU5C 2BZ8A 1QCFA 1X6GA 4JZ4A 1ABQA 2A08A 4OMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RUW A;  3EGU A;  1BK2 A;  1E6G A;  2DE0 X;  1PKS A;  3EG0 A;  2A28 A;  4D8K A;  2DL8 A;  1T0H A;  2LZ6 B;  1YNZ A;  5FWB A;  2C0T A;  1I0C A;  1FYN A;  1W70 A;  3VS5 A;  4LUE A;  1YP5 A;  1RLQ C;  1VYT A;  4AFZ C;  2C0I A;  3R6N A;  2M51 A;  4R0K A;  1ZBJ A;  3TVT A;  1NEB A;  2ABL A;  4IIO A;  3EG1 A;  1PWT A;  2EPD A;  2KE9 A;  3VS2 A;  1M3C A;  1SRM A;  1WA7 A;  4RTY A;  2JXB A;  1X27 A;  2EGE A;  2G6F X;  2YT6 A;  2EYW A;  1GFD A;  4JJB A;  2JW4 A;  3RBB B;  2FRY A;  4J9B A;  2CT3 A;  2LCS A;  2W0Z A;  2LJ3 A;  1UJ0 A;  2GBQ A;  3VS4 A;  1H3H A;  5EC7 A;  4CC7 A;  3UAT A;  1J3T A;  1UUE A;  2LQW A;  2PZ1 A;  1AD5 A;  2F2X A;  2J6O A;  1WXT A;  1G2B A;  1KJW A;  2KR3 A;  2FG0 A;  1AWO A;  1M8M A;  2JM8 A;  1E6H A;  2W10 A;  2PNI A;  4LE9 A;  4J9H A;  3I35 A;  2A37 A;  2OJ2 A;  3M0Q A;  2YUQ A;  2JM9 A;  1E7O A;  3RNJ A;  2KYM A;  2MOX A;  1UTI A;  1VYU A;  1JO8 A;  5I11 A;  1T0J A;  1UDL A;  2DYB A;  2H8H A;  3U23 A;  4F14 A;  4WCI A;  2QDL A;  4ZNX A;  1UFF A;  1CKB A;  2FPE A;  2DLP A;  4ESR A;  1K1Z A;  2GTO A;  2JS2 A;  3EG2 A;  4AFS C;  1KIK A;  1UEC A;  1AZG B;  1PHT A;  1ZLM A;  2PTK A;  2YUP A;  1X6B A;  1GCQ A;  2LNH B;  2SEM A;  1QWF A;  3UA7 A;  1T3S A;  1X2Q A;  3PVQ A;  2A36 A;  3NHN A;  1I1J A;  2EW3 A;  2L2P A;  1TUD A;  5GJV B;  5FW9 A;  2K79 A;  1WXU A;  2IIM A;  1MV0 B;  1NLO C;  4CC2 A;  1KSW A;  3FJ5 A;  4CC3 A;  2JS0 A;  2P4R A;  1NM7 A;  1NEG A;  4Z89 A;  2ROL A;  1NLP C;  2L3S A;  2J6K A;  1K0S A;  1I07 A;  1PKT A;  2KXD A;  2FRW A;  4F17 A;  1OPL A;  1W1F A;  3VS7 A;  1QKW A;  4RTZ A;  2K7A A;  5HCK A;  1NYG A;  2ECZ A;  2EYY A;  2KNB B;  1UGV A;  1GRI A;  2VVK A;  3THK A;  4J9G A;  2DL3 A;  2CSI A;  2AZS A;  3PVL A;  2VKN A;  1M3A A;  1PNJ A;  2RF0 A;  4Z8A A;  1KFZ A;  3TSZ A;  4E6R A;  2HCK A;  2DIL A;  4J9C A;  3VRY A;  4RTU A;  2CDT A;  2F2V A;  3IQL A;  1RI9 A;  2O9V A;  2VWF A;  4HVV A;  1K76 A;  2M0Y A;  2LMJ A;  1UE9 A;  1BB9 A;  3I9Q A;  2D8J A;  2DX1 A;  1AEY A;  1OPK A;  4LUD A;  2DMO A;  1B07 A;  1UG1 A;  1Z9Q A;  1S1N A;  2O2O A;  3JV3 A;  1AWX A;  1QWE A;  5ECA A;  4ORZ A;  1U5S A;  2EQI A;  2L3P A;  3PE0 A;  1MV3 A;  2OI3 A;  1WX6 A;  2KRN A;  2BTT A;  2DL5 A;  2LJ0 A;  5IH2 A;  4JJD A;  1VYV A;  1AOJ A;  3NPF A;  4KRT A;  4J9F A;  2CH4 W;  2RN8 A;  4GLM A;  4RTV A;  2AKL A;  1BBZ A;  1HSQ A;  2DVJ A;  2HDA A;  3EG3 A;  2RQU A;  4QT7 A;  4M4Z A;  2O88 A;  2D0N A;  1M27 C;  2K3B A;  1OOT A;  3M0U A;  2CUD A;  2EYZ A;  4AFU C;  1SHG A;  4J9E A;  1JEG A;  5IHI A;  1OV3 A;  1WDX A;  1NG2 A;  3QWY A;  2ED0 A;  1U06 A;  2OAW A;  1X2K A;  2LJ1 A;  4RTX A;  2EYX A;  3GBQ A;  2CH4 A;  2J06 A;  1Y0M A;  2KEA A;  1W6X A;  3H41 A;  1TG0 A;  1FMK A;  4Y92 A;  4D8D A;  1HD3 A;  2GQI A;  1WFW A;  2CRE A;  2I0N A;  2LX7 A;  1AZE A;  2RQW A;  3O5Z A;  5I22 A;  4J9D A;  2ESW A;  2V1R A;  2CT4 A;  2DJQ A;  3KFV A;  2JMA A;  5IXB A;  1TUC A;  1GL5 A;  2NWM A;  4AFQ C;  2EGC A;  3H0H A;  4HVU A;  5L23 A;  3VS1 A;  2KT1 A;  2KGT A;  5IHN A;  2J7I A;  2MIO A;  1SSH A;  2L0A A;  1A0N B;  4GBQ A;  3CQT A;  4RTT A;  2D1X A;  1QLY A;  2HSP A;  3M0S A;  2DBM A;  2YSQ A;  1VA7 A;  2C0O A;  2CUB A;  2FO0 A;  2JMC A;  1MUZ A;  1ZUU A;  2K2M A;  4EIK A;  4LNP A;  1RLP C;  1JXO A;  1UJY A;  4OMO A;  1V1C A;  3M0P A;  4JZ3 A;  4OML A;  1HJD A;  2DNU A;  2EKH A;  2KRM A;  4DEX A;  2O9S A;  3H0I A;  2EBP A;  2BZY A;  3EHQ A;  2NUZ A;  2V1Q A;  2AK5 A;  1CSK A;  1SHF A;  2HEQ A;  2YUO A;  1XOV A;  4LN2 A;  1H92 A;  1IO6 A;  2KRO A;  4F16 A;  2FPF A;  2D8H A;  1G83 A;  3I5S A;  1YWP A;  1X69 A;  2X3W D;  2E5K A;  1B3Q A;  3EHR A;  1GFC A;  3NGP A;  1GBR A;  2AKK A;  4Z88 A;  1WXB A;  1OEB A;  1NYF A;  1GBQ A;  2K6D A;  2DRM A;  1Z9Z A;  2F2W A;  1GCP A;  2DL4 A;  2J6F A;  2DRK A;  2GTJ A;  3TSW A;  4A63 B;  4HCK A;  2EGA A;  2BZX A;  3I5R A;  2YDL A;  1SRL A;  1ZX6 A;  5IXF A;  3ULR B;  2RMO A;  1ZUY A;  2FPD A;  1YCS B;  2LP5 A;  1CKA A;  2MCN A;  3SEM A;  4OMM A;  4JPB W;  3UA6 A;  1UHF A;  1U3O A;  1WYX A;  1SEM A;  1YWO A;  2ENM A;  2KXC A;  5GJW B;  1T3L A;  4OMQ A;  1PRL C;  2RPN A;  4RTW A;  5FWC A;  1EFN A;  2KRS A;  3ZL7 C;  3NMZ C;  1K9A A;  4JJC A;  3QWX X;  2RQV A;  3SHW A;  2HBW A;  4AG2 C;  1K0X A;  2ED1 A;  2GGR A;  2KYB A;  2AZV A;  1JXM A;  2KBT A;  5IHK A;  2RQT A;  2LQN A;  1SPK A;  3H0F A;  1X43 A;  2YUN A;  2DL7 A;  1WI7 A;  2CSQ A;  3VS0 A;  2J05 A;  2DM1 A;  1LCK A;  4AG1 C;  4CC4 B;  1JQQ A;  3UF4 A;  3VS3 A;  1WIE A;  1ABO A;  2EVR A;  1M3B A;  2FEI A;  1UHC A;  4IIM A;  1ZSG A;  1WLP B;  1AVZ C;  1ZUK A;  4X1V A;  2KT8 A;  1PRM C;  3C0C A;  2K9G A;  2B86 A;  2RQR A;  2O31 A;  4DEY A;  3M0R A;  2L3Q A;  4HVW A;  2SRC A;  1AWW A;  2JT4 A;  1AWJ A;  1YN8 A;  1M30 A;  1H8K A;  3REA B;  4OMP A;  2DA9 A;  4HXJ A;  1GCQ C;  2X3X D;  3VS6 A;  3VRZ A;  3REB B;  4K11 A;  3M0T A;  2DF6 A;  2RNA A;  4RUG A;  4J9I A;  1ARK A;  3LH5 A;  2DBK A;  1BU1 A;  1Y57 A;  1K4U S;  2JTE A;  1QKX A;  3A98 A;  2GNC A;  1N5Z A;  4FSS A;  2XMF A;  2ROT A;  1JU5 C;  2BZ8 A;  1QCF A;  1X6G A;  4JZ4 A;  1ABQ A;  2A08 A;  4OMN A; 
#chains in the Genus database with same CATH topology
 3EGU A;  1BK2 A;  2DE0 X;  3EG0 A;  3OS0 A;  4N0A A;  2A28 A;  5KYX A;  5KCH A;  1N27 A;  2DL8 A;  1AT1 B;  5FWB A;  1VQ5 T;  1VQ5 A;  1I0C A;  1FYN A;  1TWB A;  1W70 A;  2YRC A;  5HY6 A;  2HKQ B;  3CCR Q;  4M78 G;  1QVP A;  3V8J A;  3INZ A;  4NL2 A;  4A54 A;  1VQ7 T;  2LQK A;  1SSF A;  1OZ2 A;  1KD1 U;  1HXD A;  5GAN 2;  3BW1 A;  4OF1 A;  4WF2 A;  1PWT A;  1M3C A;  2JXB A;  4M75 A;  1IGU A;  1GFD A;  4JJB A;  3A8M B;  3CC2 A;  1VQO A;  3RBB B;  1QVG A;  1IHW A;  3MEA A;  1GXI E;  4J9B A;  3EGX A;  3BFM A;  2YHT A;  4M77 A;  4E7Z A;  4QKU A;  3L2R A;  5GAN d;  4PJO C;  1J3T A;  3EG9 A;  1WJS A;  2J6O A;  2LT1 A;  1WXT A;  3LLR A;  4LD9 K;  4HCC A;  3GOX A;  3EFO A;  2FZK B;  4M7A A;  2PNI A;  1YJW T;  4EMK C;  3VJP A;  1YJW A;  1WHH A;  2A37 A;  3JAM E;  1JJ2 S;  4PJO E;  2AT1 B;  1IRX A;  2DAQ A;  3MO8 A;  5FU7 B;  1D1B A;  3U23 A;  4WCI A;  4PJJ A;  3RDV A;  4J83 A;  3I55 Q;  2QDL A;  3GPL A;  4FM4 B;  5LJ5 j;  4F7U F;  1VQM A;  4L6V 5;  2HQH A;  2FPE A;  5A0D A;  2DLP A;  4ESR A;  1IZ6 A;  4M7D F;  4BE1 A;  2GTO A;  2DXC A;  4AFS C;  3AT1 B;  5D6W A;  2BE9 B;  4ANJ A;  2CP6 A;  1ZLM A;  2HMA A;  2PTK A;  4C0D B;  2SEM A;  1X2Q A;  2A36 A;  3NHN A;  3RMQ A;  1N9S A;  4XTV A;  1M2V A;  5FW9 A;  2QEX A;  3CD6 T;  1KD1 R;  1KSW A;  3L2Q A;  5GAN g;  2Y4Y A;  1U1T A;  4KGX B;  4RMO A;  2EIF A;  5GAM d;  5HKC A;  3E2U A;  2DPP B;  2RJE A;  4JJN K;  2CP5 A;  3N5B B;  2FZG B;  3VS7 A;  4OVA A;  5DLQ E;  5HCK A;  2OTJ Q;  2EYY A;  1UGV A;  4FT4 A;  2BIV A;  3THK A;  2E64 A;  4XTX A;  3DB4 A;  3F70 A;  2AZS A;  1WJR A;  1B7T A;  2KI7 A;  3CEY A;  2VKN A;  1H3Z A;  1TU0 B;  4HCZ A;  3CXC S;  2JOY A;  1JRI A;  2HCK A;  2DIL A;  4J9C A;  3VRY A;  2O4X A;  4RTU A;  5CIU A;  2CDT A;  4DA4 A;  4DBQ A;  2YLB A;  2FYK A;  1OI1 A;  1K76 A;  2M0Y A;  3SFM A;  5LJ3 d;  2EJF A;  2D8J A;  3OS2 A;  1AEY A;  1VQL Q;  1M1F A;  2DET A;  1UG1 A;  4ELZ C;  3ZEH A;  4OB0 B;  2O2O A;  3VUB A;  3O8V A;  5GAN 8;  4LD6 A;  4B9W A;  5KE3 A;  3FJP A;  5GAM g;  4JJD A;  2YRD A;  4QQG A;  3I56 Q;  1NBE B;  4KRT A;  2CH4 W;  1VUB A;  4F7U G;  1TSF A;  1BBZ A;  2HD0 A;  2DVJ A;  3S3M A;  1M27 C;  3CCV A;  3QYH B;  1YHQ Q;  4M7D G;  2X9H A;  2DXB A;  2CUD A;  2EYZ A;  4XU1 A;  2DYI A;  5J3B A;  3S6W A;  2PUO B;  3OA6 A;  2ED0 A;  3GLX A;  2CH4 A;  4QQD A;  2KEA A;  4NOY A;  3CCE Q;  4GLK A;  4E47 A;  4PJO B;  2COY A;  2CRE A;  1YJN T;  1YJN A;  2E3I A;  4EMK B;  2KMT A;  4IUT A;  2NWM A;  1KQ2 A;  3GNG A;  4FYY B;  3FIF A;  2DXU A;  2KT1 A;  4OB2 B;  4PNO A;  1VQ9 T;  4BE2 A;  1VQ9 A;  1MMN A;  2AHJ B;  4EDU A;  4XQ3 A;  2M9U A;  2HKN A;  1MMG A;  4C0G A;  4GY5 A;  3P8B B;  2ZPB B;  4Y91 A;  3OMC A;  1BI1 A;  3CCR T;  3CCR A;  4PJL A;  2CP3 A;  1V1C A;  3M0P A;  4OMO A;  1R0C B;  2KRM A;  4PLI A;  1S72 Q;  4KH1 B;  1QMC A;  3QJY A;  5CQX A;  2V1Q A;  1XOV A;  1IO6 A;  2KRO A;  4F16 A;  2D8H A;  1G83 A;  3OYK A;  1M1K U;  5GAN 4;  2DD5 A;  2H3J A;  2QGG A;  4IKF A;  4LDV A;  4Y28 E;  2HQE A;  1NYF A;  1GBQ A;  1X75 C;  3VYH B;  3CBP A;  2DL4 A;  2J6F A;  2DRK A;  2GTJ A;  2DTO A;  2EGA A;  2F1L A;  2XG8 D;  2YDL A;  3H9N A;  3OS5 A;  1M5Q 1;  5GMK m;  1ZUY A;  3CPW P;  3OYI A;  1I4K 1;  2H3E B;  1CKA A;  2MCN A;  3SEM A;  3ER0 A;  2VGM A;  2CZ1 B;  4JPB W;  3UA6 A;  1U3O A;  1WYX A;  2ENM A;  2KXC A;  2X51 A;  1WNL A;  1T3L A;  2JVV A;  2LC4 A;  2RI3 A;  5L8R E;  3A1P A;  3CC7 Q;  3MP1 A;  2XK0 A;  1WHL A;  1EFN A;  2KRS A;  3ZL7 C;  3HFN A;  3CCU Q;  1K9A A;  1RL2 A;  2QK0 A;  4JJC A;  3I55 T;  2RQV A;  1RAG B;  1SF9 A;  3MEW A;  3I55 A;  2M16 A;  3SHW A;  1D1A A;  2HBW A;  2ZAE A;  4AG2 C;  4PLL A;  4BE0 A;  4N4I A;  2IPO B;  2LQN A;  4MZM A;  2PVG B;  3LH0 A;  1X01 A;  4IUP A;  3OYE A;  2CSQ A;  1Q82 U;  4E2F B;  4OB1 B;  1JQQ A;  2NYS A;  1ABO A;  2EVR A;  4F7U E;  2M0O A;  3PGG A;  4O6J A;  2FEI A;  4V2S A;  4IIM A;  4FYW B;  3RIR A;  1WLP B;  1HK9 A;  4FW1 A;  3MET A;  5KE2 A;  3JB9 H;  1JB0 E;  2K9G A;  4DEY A;  4OP0 A;  1M1K R;  4HVW A;  1KD1 C;  1YJ9 A;  4XTZ A;  5FRN A;  4M75 D;  2JT4 A;  1WZO A;  1M30 A;  1YI2 Q;  1G3S A;  2E4H A;  3EFS A;  2OTJ T;  4PJO D;  3CPW A;  4MDX A;  4M77 D;  3P8D A;  4QVC A;  5GAN 6;  3RKX A;  5FLX E;  2A0F B;  1MND A;  2RNA A;  4RUG A;  3D7S B;  4J9I A;  2NUP A;  1N5Z A;  4HT8 A;  5GMK e;  3G71 Q;  4ZTJ A;  1N6A A;  1X6G A;  1M90 U;  1RAE B;  4OMN A;  3CCM A;  1E6G A;  3E1S A;  3JCM V;  2CZ6 B;  1T0H A;  2LZ6 B;  1VQL T;  1YNZ A;  3OYA A;  2MAM A;  2C0T A;  2D9T A;  1RLQ C;  3EFR A;  2P0P A;  3LX7 A;  1IXD A;  4R0K A;  1ZBJ A;  5GMK l;  3M53 A;  2FZC B;  5LJ3 f;  2ABL A;  2F5K A;  4IUQ A;  2VXF A;  1Q82 R;  1YFN A;  1PM3 A;  4IIO A;  2NUT B;  3JCM Q;  4RG2 A;  2KE9 A;  1WHJ A;  2EPD A;  2EQK A;  3I56 T;  3C95 A;  2RI5 A;  1R0B G;  2E1H A;  2LQ8 A;  4RTY A;  2XU8 A;  1ZA1 B;  3HPW A;  5KYW B;  3A8G B;  4DBH A;  4XTY A;  3GIB A;  1YHQ T;  2JW4 A;  2LNV A;  3PT9 A;  3CCL Q;  2W0Z A;  4XU3 A;  2MWO A;  3VS4 A;  2E5Q A;  3RER A;  1QCN A;  1TTH B;  3OQ5 A;  3UAT A;  3L2W A;  1UUE A;  2LQW A;  1AD5 A;  2F2X A;  1G2B A;  2OX7 A;  2P0Q A;  4C8Q C;  5DLO A;  1BI3 A;  2DZ9 A;  4MDW A;  3CCE T;  3A5Z B;  3X20 B;  4FL6 A;  2DER A;  2JM8 A;  1E6H A;  4A4E A;  4LE9 A;  3V8L A;  2LDM A;  1I81 A;  2OJ2 A;  4BDY A;  2YUQ A;  5A2Q E;  2JM9 A;  1R77 A;  4O5V A;  3JCM b;  2MOX A;  1VYU A;  1JO8 A;  4C8Q E;  1UDL A;  2H8H A;  3X26 B;  2VAS A;  4MZP A;  4M78 D;  1UFF A;  6AT1 B;  5I2S A;  4KT0 E;  1M90 R;  2COW A;  5GAO n;  2K5I A;  3NTK A;  3HP9 A;  4RKU E;  2EFI A;  4DOW A;  1SG5 A;  2OTL A;  1QVG S;  1KIK A;  2GF7 A;  2QGF B;  4E7H A;  1PD1 A;  1UEC A;  4F7U B;  2JTM A;  1ZQ1 A;  1X6B A;  1GCQ A;  2LNH B;  3PVQ A;  1I1J A;  3CCQ A;  1ACM B;  2HBP A;  5GJV B;  1YIT A;  4JS4 A;  3R6O A;  1WXU A;  3T9N A;  5GAN e;  1NLO C;  5KYY B;  1N9R A;  3FJ5 A;  2L3R A;  1S72 T;  1S72 A;  1NM7 A;  1NEG A;  4Z89 A;  2ROL A;  1NLP C;  2C06 A;  2DIQ A;  4IUV A;  1EZZ B;  1PKT A;  2EYQ A;  1QVF P;  4ZTF A;  1QKW A;  3CCS Q;  2RB6 A;  2ECZ A;  1SKU B;  2VVK A;  2GCX A;  3HRU A;  4J9G A;  5FU6 C;  1NJI U;  4XK8 E;  2DL3 A;  2WSE E;  3CCJ Q;  5GMK h;  1M3A A;  3J80 E;  1PNJ A;  1XQH A;  1Q95 G;  1NE8 A;  4Z8A A;  1KFZ A;  4E6R A;  2Z0W A;  3QII A;  3C94 A;  1X6O A;  1VQ7 A;  3RMS A;  2F2V A;  2GFU A;  1N8R U;  2O9V A;  2X4J A;  3PMT A;  1RI0 A;  3BY7 A;  2L89 A;  2A7Y A;  3I9Q A;  3OBW A;  1OPK A;  1PG5 B;  1ZSZ C;  3CC7 T;  1B07 A;  3UT1 A;  3HL8 A;  1S1N A;  1AWX A;  4XTW A;  1QWE A;  2CZ7 B;  1KG1 A;  4ORZ A;  3CCU T;  2MYS A;  5CKF A;  1U5S A;  4ELY C;  4PJO A;  2WSC E;  2LRQ A;  5GAM e;  1YIJ Q;  2VC8 A;  2LJ0 A;  3PIO A;  2DEU A;  3G6E Q;  1VYV A;  3RR6 A;  1VQP Q;  5CKB A;  1AHJ B;  4EMK A;  4RTV A;  1WQ7 A;  1QVF A;  1C1A A;  2RQU A;  1WHM A;  4M4Z A;  2RHU A;  4HKE A;  2O88 A;  1TXQ A;  2NLU A;  2EAY A;  2K3B A;  4XTU A;  4C5H A;  4C92 F;  1Q7Y U;  1K8A R;  1OV3 A;  2CKK A;  1EIF A;  2RJD A;  2VGN A;  3KBG A;  3QSU A;  2WAC A;  5DY9 A;  4X34 A;  1QW1 A;  2LJ1 A;  3E9F A;  2E6N A;  5LJ3 e;  1Y0M A;  1W6X A;  4ZN1 A;  1YI2 T;  1M1K C;  1NJI R;  4LDY A;  1AZE A;  4C8Q B;  3OBY A;  2ESW A;  2V1R A;  1BCM A;  2XDB A;  5IT9 E;  1OU8 A;  4J7F A;  3JRZ A;  1D0X A;  1Q86 U;  2X35 A;  5C0M A;  4M7A E;  4N4H A;  4J5Y A;  1PSE A;  3CD6 A;  4L59 A;  1VIE A;  2QQR A;  4HVU A;  1N8R R;  3VS1 A;  1PSF A;  1G8X A;  5GMK j;  2E10 A;  5IHN A;  3G71 T;  3WXM B;  5CQY A;  1VQK Q;  2J7I A;  3DB3 A;  2L0A A;  3G1J A;  4GBQ A;  1G3Y A;  3JCM d;  2LX9 A;  3M0S A;  1UEB A;  3ZBD A;  5GAN h;  2CUB A;  2LCC A;  4F04 B;  1ZUU A;  2K2M A;  4LNP A;  2E70 A;  1JXO A;  4M7D D;  2CS7 A;  4OML A;  2WSF E;  4DEX A;  2O9S A;  2PUK B;  5LL6 S;  3EHQ A;  5DM7 R;  3JCM J;  2K3X A;  2XI9 A;  2HEQ A;  1SHF A;  2YUO A;  3EH2 A;  1YWP A;  2X3W D;  4M78 A;  1GFC A;  1GBR A;  2AKK A;  1Q82 C;  4Z88 A;  1Q7Y R;  2CP2 A;  2RHX A;  3M4Y A;  2DRM A;  1GCP A;  4JS5 A;  4BB7 A;  3CCL T;  5FU6 B;  3TSW A;  4A63 B;  4FIB A;  1RAC B;  5HK0 A;  3QUI A;  2KQW A;  1KQS P;  4LXC A;  1SRL A;  1ZX6 A;  3ULR B;  4FYX B;  5IXF A;  2RMO A;  1YCS B;  5AYF A;  4C92 G;  3HSB A;  2Y4X A;  3A8L B;  3PIP A;  4OMM A;  3M55 A;  2LT4 A;  1UHF A;  4E7L A;  2HQX A;  1SEM A;  4QW2 A;  4TVR A;  1LOJ A;  4OMQ A;  1VQ8 Q;  1M9S A;  3CME Q;  2FL7 A;  4JRI A;  5GAM h;  1Q86 R;  5LJ5 f;  3LGL A;  3NMZ C;  1ZSZ B;  3KXT A;  3QWX X;  2XDP A;  3VV0 A;  1K0X A;  1H64 1;  4C8Q F;  2ED1 A;  3L2U A;  1B34 B;  2AZV A;  2RQT A;  3CMA Q;  5GAN 7;  2YUN A;  1M90 C;  3QO3 A;  2EWN A;  5CKH A;  2DM1 A;  1LCK A;  1IB8 A;  1OX8 A;  5LJ3 g;  4AG1 C;  5GAN 3;  3VS3 A;  2CP7 A;  3JB9 F;  3L2Z A;  4RCB A;  1ZSG A;  1OQK A;  4PKC C;  1MHN A;  2V26 A;  5GAN j;  2V8J A;  2JUF A;  2P84 A;  4X1V A;  4KH0 B;  1PRM C;  3QZ9 B;  2RQR A;  2B86 A;  1OU9 A;  2KSS A;  3EGX B;  1FXX A;  2Y90 A;  4UC4 A;  2DFU A;  4C5E A;  3BDL A;  2FVU A;  3CCS T;  1KQS A;  1H8K A;  3BE3 A;  1YBY A;  2ZPF B;  4A4K A;  2QA4 Q;  3OSS C;  5IN1 A;  2ZCF B;  4HXJ A;  1V76 A;  4YTL A;  3VRZ A;  2PVO B;  4M7A B;  3SWN C;  3LGF A;  3CCJ T;  2DF6 A;  2MK5 A;  2NUT A;  3H8Z A;  1K4U S;  1Y57 A;  2JTE A;  2GNC A;  4FSS A;  3RUX A;  4PFZ A;  2DK3 A;  3KUF A;  1VQ6 Q;  5KYW A;  2BZ8 A;  1MGQ A;  4QVZ A;  1QCF A;  1U1S A;  2XID A;  1ABQ A;  4Y92 A;  3LW5 E;  1RUW A;  2E12 A;  1PKS A;  1D0Y A;  4PJN A;  3NTH A;  3HTR A;  4A4G A;  2QQ9 A;  1YP5 A;  4HA8 A;  4AFZ C;  2C0I A;  5GAO m;  3R6N A;  2M51 A;  5GAM j;  2ZPI B;  1Y96 A;  1YIJ T;  2QQS A;  1YIJ A;  2XD0 A;  5D6Y A;  2M1H A;  3CPW S;  2D6F A;  3G6E T;  2X4Y A;  2XIC A;  1M2O A;  3M58 A;  1OUL A;  4CI0 C;  1BCO A;  3EG1 A;  5C6S A;  1VQP T;  1BI0 A;  2VYT A;  1SRM A;  3CC4 Q;  2EGE A;  4QQ6 A;  2G6F X;  4LDW A;  3FB9 A;  4C8Q G;  2JJ9 A;  1ZA2 B;  2YT6 A;  3TCJ A;  2EYW A;  2RJF A;  2QYZ A;  2FRY A;  2CT3 A;  2LCS A;  4A4H A;  1UJ0 A;  2GBQ A;  4C92 C;  1WHG A;  4F7U A;  5J26 A;  3JB9 G;  5EG2 A;  2PZ1 A;  4DBR A;  3HHT B;  2DTI A;  3OYD A;  1KC8 U;  1M8V A;  4M7D A;  2FB7 A;  2KR3 A;  4HCB A;  1G5V A;  2FG0 A;  4C92 E;  2RO0 A;  5KYY A;  3M0Q A;  1XJW B;  4M75 F;  1HYO A;  3L2V A;  1VQO Q;  3FDR A;  3CC2 Q;  3RNJ A;  1BIA A;  1ZHI A;  2ZZD A;  1NJI C;  1UTI A;  2L5Q A;  1T0J A;  5KYU B;  1TS9 A;  4VUB A;  3CBO A;  4ZNX A;  3BDU A;  1TUG B;  2MI6 A;  1CKB A;  2K5F A;  8ATC B;  4JRK A;  3GP8 A;  1VOM A;  1UB4 A;  3URG A;  3MHX A;  3S3N A;  2QAS A;  2JS2 A;  1VQK T;  1N8R C;  1VQK A;  3WVD B;  4M7A F;  4J6Y A;  1LPL A;  4A4F A;  2OTJ A;  1QWF A;  2QTX A;  2L2P A;  1TUD A;  4C5G A;  1VQM Q;  2K79 A;  2IIM A;  2EQM A;  2GFA A;  3NTI A;  4CC2 A;  2COZ A;  1D1C A;  3ME9 A;  4CC3 A;  1Y7X A;  2P4R A;  1XNI A;  1WHK A;  3RKW A;  5I21 A;  3HRS A;  2L3S A;  4KGZ B;  4C5I A;  1K0S A;  1I07 A;  2FRW A;  3JCM f;  4DOV A;  2IG0 A;  1W1F A;  3JB9 I;  4ME7 A;  4RTZ A;  2KNB B;  1PCX A;  2DZC A;  2QEX Q;  3OYM A;  1VQL A;  3PVL A;  5FRO A;  2RF0 A;  1Q7Y C;  4JRP A;  3OYC A;  3TSZ A;  1VQ4 Q;  3SWN B;  1D3B B;  1KC8 R;  4E7S A;  1LJO A;  2G3R A;  2YLC A;  3GF5 A;  3IQL A;  1WQW A;  1UGP B;  1RI9 A;  4ZGD B;  4HVV A;  1QCO A;  3OY9 A;  1ZBX A;  2LMJ A;  1UE9 A;  2QTV A;  3I56 A;  4R55 A;  8AT1 B;  3J81 E;  4LUD A;  1VQ8 T;  3CME T;  3CME A;  4BI4 A;  4ZN3 A;  3QJ6 A;  1YHQ A;  4ZGJ B;  5ECA A;  5CVI A;  2HSE B;  3UPU A;  1W2B P;  1Q86 C;  2L3P A;  2YWW A;  4B6M A;  4M75 G;  2OI3 A;  2KRN A;  5GMK i;  2BTT A;  2DL5 A;  1BIB A;  5LJ5 d;  2F5T X;  5IH2 A;  3G7Z A;  1MMD A;  2VUB A;  1AOJ A;  3CMA T;  3OB9 A;  3S3O A;  2RHZ A;  3JB9 J;  2RN8 A;  2AKL A;  3CCE A;  2HDA A;  1VQN Q;  2D0N A;  2K2V A;  4JLI A;  3M0U A;  4M7A G;  3ASK A;  1SHG A;  3VU3 C;  4J9E A;  3JCM c;  1JEG A;  5IHI A;  3SDZ A;  3VYG A;  2OAW A;  1X2K A;  4BAC A;  4PFO A;  4RTX A;  2EYX A;  3TEE A;  2M02 A;  4C92 B;  1TG0 A;  1HD3 A;  2GQI A;  3CBM A;  4X9C A;  3CCV Q;  4JDS A;  2ATC B;  2RQW A;  5I22 A;  2QA4 T;  2XDD A;  2RH2 A;  1EX4 A;  2CT4 A;  1C0M A;  2JMA A;  3QBY A;  1TUC A;  4A53 A;  3SB2 A;  4AFQ C;  1K73 U;  1VIF A;  2MMP A;  4KUI A;  3H0H A;  5L23 A;  5I2M A;  2JTF A;  4FU6 A;  5GAO p;  2KGT A;  5KYN A;  5LJ5 g;  2V8K A;  2QXF A;  1QVF S;  1K8A U;  1VQ6 T;  1R8O B;  2MPX C;  2MIO A;  1SSH A;  1W2B A;  1KHI A;  4XU2 A;  1A0N B;  1QLY A;  3RES A;  2HSP A;  4KGV B;  1RAB B;  2FO0 A;  3QKJ A;  5CCA A;  3QDF A;  1D0Z A;  1K9M U;  1HJD A;  2DNU A;  1IGQ A;  2EQJ A;  2EBP A;  3V8K A;  4P5N A;  2NUZ A;  4LN2 A;  1H92 A;  1RAH B;  2FPF A;  3X25 B;  4KBM B;  3I5S A;  1BKB A;  1X69 A;  1IRE B;  2PQW A;  2P4T A;  5GAO r;  3EHR A;  1ZSZ A;  3OW2 A;  4OGC A;  3CC4 T;  3CC4 A;  1WXB A;  4N0A C;  3M59 A;  2K6D A;  3CC7 A;  1B34 A;  1IHV A;  4KUL A;  4CRI A;  3PTA A;  2R57 A;  3LYI A;  4HCK A;  1XTD A;  2GQV A;  3CCU A;  4EPC A;  2QQA A;  2D0Q B;  2NUP B;  3OYB A;  2RM4 A;  3JCM e;  2ZGW A;  1YWO A;  5GJW B;  2IVW A;  3OYY A;  3CC2 T;  1VQO T;  5IAY A;  4EMG A;  2RPN A;  4AT1 B;  3G4S Q;  1K73 R;  4M75 C;  3JSC A;  3QZ5 B;  2EJ9 A;  2RI2 A;  4M77 C;  3Q1J A;  3EH1 A;  4PJM A;  2GGR A;  2KYB A;  3JCM P;  5IHK A;  1SPK A;  3H0F A;  4M75 E;  1I8F A;  4J6X A;  1WI7 A;  2J05 A;  4J6W A;  4J7I A;  7AT1 B;  1YI2 A;  4M77 E;  4M7A C;  3M9Q A;  3QDR B;  4CC4 B;  3UF4 A;  1K9M R;  1JJ2 P;  1M3B A;  2BKD N;  1UHC A;  2XHC A;  3M4G A;  1VQM T;  3MP6 A;  3V7S A;  3C0C A;  4BUG A;  3FRN A;  2ZPG B;  2O31 A;  1M4Z A;  1Y07 A;  4FCY A;  3M0R A;  2L3Q A;  4DQ2 A;  2OAU A;  3UWN A;  3G71 A;  1AWJ A;  4C92 D;  3OYJ A;  1OZ3 A;  3REA B;  3OYL A;  5CK9 A;  2DIG A;  4OMP A;  2DA9 A;  3JCM W;  3VS6 A;  2QEX T;  3REB B;  4K11 A;  1DJ7 B;  3M0T A;  2K3Y A;  1ARK A;  1OX9 A;  3LH5 A;  3ZFJ A;  3LWI A;  1RAF B;  2HAX A;  1BU1 A;  1QKX A;  4PL6 A;  3A98 A;  1VQ4 T;  1VQ4 A;  1YJ9 Q;  4QVD A;  1JU5 C;  3TU4 K;  2DEQ A;  4JZ4 A;  1QP2 A;  2A08 A;  3X28 B;  1KC8 C;  4JUV A;  1FX7 A;  4D8K A;  1I5O B;  2CYZ B;  3OYF A;  5CAI A;  3V7R A;  3VS5 A;  3J7A F;  2HL5 C;  4LUE A;  4HT9 A;  1BYM A;  3PMI A;  1VYT A;  2EJG A;  1JJ2 A;  3CXC P;  3QG1 A;  3TVT A;  1PC0 A;  1NEB A;  1KQS S;  2QAZ A;  1Q81 U;  3CCL A;  2VV5 A;  4DBF A;  3CCM Q;  3X24 B;  3EGD B;  3SD4 A;  3FEO A;  3VS2 A;  3WVE B;  1Y71 A;  5KYU A;  1WA7 A;  4M78 C;  4RG8 A;  1X27 A;  2RD1 A;  3JCM g;  1VQN T;  1VQN A;  3MP8 A;  5KYX B;  5CR2 A;  4E7K A;  2LJ3 A;  2RK1 A;  1H3H A;  4MZT A;  5EC7 A;  4M78 E;  3P8H A;  4CC7 A;  3JCM h;  3MKD A;  2HZY A;  1V29 B;  5KCO A;  3CPF A;  4E7I A;  1OYX A;  3L1A A;  4KUD K;  4BY6 C;  4FSX A;  1KJW A;  1AWO A;  1M8M A;  2X4X A;  4BI8 B;  2W10 A;  3MEU A;  4J9H A;  3I35 A;  3CCV T;  1YCY A;  3A8O B;  1E7O A;  2KYM A;  5I11 A;  2DYB A;  3E19 A;  4BI3 A;  4F14 A;  2PU9 B;  5CO7 A;  1KHC A;  5LJ3 h;  4M75 B;  2CGH A;  1K1Z A;  3M54 A;  3CXC A;  3EG2 A;  4M77 B;  5GAN 5;  2JNG A;  3GNF B;  1TOV A;  1AZG B;  1PHT A;  2YUP A;  3LWH A;  3EG9 B;  3CCS A;  4II1 A;  1P92 A;  3UA7 A;  1T3S A;  3SWN A;  5J39 A;  3C12 A;  4PK4 A;  1D3B A;  1NZ9 A;  2EW3 A;  4C8Q D;  3EFO B;  4FW2 A;  4XAX B;  1Q81 R;  3C4S A;  4OGE A;  2RK2 A;  1MV0 B;  1JBM A;  3CCJ A;  2JS0 A;  2RA2 A;  3OSV A;  4JRQ A;  2J6K A;  2AIR B;  2KXD A;  4F17 A;  2OTL Q;  1OPL A;  3HFO A;  3JB9 D;  2KVQ G;  2DJZ A;  4C0Z A;  2LCL A;  2K7A A;  1NYG A;  1GRI A;  5A0G A;  3CCQ Q;  1YIT Q;  3FLG A;  2CSI A;  2HNI A;  4XU0 A;  4L5G A;  2E65 A;  2DTH A;  1W4S A;  4BD3 A;  4OMF B;  1MNE A;  1BI2 A;  1M2V B;  3QYG B;  2VWF A;  3G6E A;  2QI2 A;  2DKG A;  1VQP A;  1BB9 A;  1FMV A;  2DX1 A;  4AMC A;  1LNX A;  3RKY A;  1VQ5 Q;  4WTO B;  2DMO A;  3TRE A;  1Z9Q A;  1WPY A;  3G4S T;  3JV3 A;  3G4S A;  3EAE A;  1U8R A;  4IUR A;  2QDY B;  4C92 A;  1KK7 A;  1QP3 A;  1MMA A;  2VXE A;  2EQI A;  1VQ7 Q;  1K73 C;  3PE0 A;  1MV3 A;  5CKD A;  1WX6 A;  3H6Z A;  3UDC A;  2O01 E;  1K8A C;  4LDX A;  3PFS A;  3NPF A;  5LJ3 j;  2FHD A;  2I2L A;  2LTO A;  4J9F A;  2K57 A;  3NFC A;  4GLM A;  2O4X B;  1HSQ A;  2EKO A;  3EG3 A;  4QT7 A;  5GAN f;  1OOT A;  4AFU C;  4M78 B;  3FC3 A;  4PJO F;  1K9M C;  4M77 F;  1WDX A;  1NG2 A;  3DKM A;  3QWY A;  1U06 A;  2BUD A;  4ATO A;  3GBQ A;  2BE7 D;  2J06 A;  2KK4 A;  4X9D A;  4M7D C;  4E7J A;  3H41 A;  1M1G A;  4D8D A;  1FMK A;  2KDS A;  1UGS B;  1YJW Q;  1WFW A;  2I0N A;  2LX7 A;  4BY6 B;  3O5Z A;  4J9D A;  1LVK A;  3VUZ A;  1WGS A;  2DJQ A;  3KFV A;  4FT2 A;  4M7D E;  2R5M A;  5IXB A;  1GL5 A;  3OS1 A;  4B9X A;  1NPP A;  1RAI B;  3L42 A;  4R56 A;  2EGC A;  5LJ5 e;  4C0F A;  4MML A;  2EQU A;  3MCA B;  1YJ9 T;  2R58 A;  3M56 A;  5AT1 B;  1KQ1 A;  2MF2 A;  1RAA B;  2E41 A;  1PD0 A;  3CQT A;  4RTT A;  2D1X A;  2DBM A;  2YSQ A;  1VA7 A;  2C0O A;  2B8A A;  2JMC A;  1MUZ A;  2DO3 A;  4EIK A;  5GAM f;  5KH6 A;  3DLL A;  1RLP C;  1UJY A;  3CD6 Q;  4JZ3 A;  5GAO l;  1I5L A;  4ZGE B;  1FMW A;  4M7A D;  2EKH A;  3MEV A;  2DXT A;  2CZ0 B;  3H0I A;  2BZY A;  2RJC A;  2V8I A;  3JCM X;  2AK5 A;  1CSK A;  3CCM T;  2MWP A;  4JLG A;  2RHI A;  1O9S A;  2P0K A;  1NPR A;  1D09 B;  2JN0 A;  2E5K A;  1B3Q A;  2E6Z A;  3NGP A;  3OYH A;  3QHS A;  1OEB A;  4EMH A;  4MMK A;  3HKS A;  3MPU B;  3OYN A;  1VQ8 A;  1F1B B;  2XKO C;  1Z9Z A;  2F2W A;  1W2B S;  9ATC B;  2BZX A;  3I5R A;  4LDU A;  2FPD A;  2LP5 A;  4C8Q A;  1G3W A;  2A3L A;  3TQ7 P;  2ZPE B;  4PJO G;  4M78 F;  4M77 G;  3CMA A;  5FU7 C;  4Q5W A;  4IUU A;  2ZPH B;  1WJQ A;  5CKE A;  1PRL C;  3AHU A;  3OMG A;  2DVE A;  2LVM A;  4RTW A;  5FWC A;  1RAD B;  5FRM A;  3M5A A;  2E3H A;  1UGQ B;  4OB3 B;  2PVD B;  3DLM A;  2K5L A;  2KAF A;  3OW2 S;  1QQJ A;  1C6V X;  5D7U A;  1JXM A;  2KBT A;  3A8H B;  2YXY A;  3OW2 P;  4C0D C;  2CP0 A;  1X43 A;  1Y96 B;  2DL7 A;  3VKI A;  5D6X A;  3VS0 A;  3QXE B;  1G3T A;  4NS5 A;  5GAO q;  1WIE A;  2QA4 A;  3E9G A;  4BDZ A;  1UGR B;  5HK3 A;  2QQB A;  1AVZ C;  2DD4 A;  2HL3 A;  1ZUK A;  4FYV B;  3OYG A;  2K4Y A;  2KT8 A;  2L8D A;  3HRT A;  1Q81 C;  2VB6 A;  2SRC A;  2OTL T;  4RCC A;  1VQ6 A;  1AWW A;  1YN8 A;  3V7C A;  2R5A A;  3PNW C;  2YRV A;  1QVG P;  5M9O A;  2KY9 A;  1YJN Q;  2X4W A;  3CCQ T;  2JZ2 A;  4M7D B;  4D6W A;  1GCQ C;  1YIT T;  5LJ5 h;  2X3X D;  4Z02 A;  5A0L A;  4N4G A;  3EGD A;  3QPH A;  2DBK A;  1O75 A;  4J8O A;  1FWZ A;  1TH7 A;  2XMF A;  2F69 A;  4PFP A;  2ROT A;  1VQ9 Q;  4NL3 A;  3MJX A;  3M57 A;  2QG9 B;  2RHY A; 
#chains in the Genus database with same CATH homology
 1RUW A;  3EGU A;  1BK2 A;  1E6G A;  2DE0 X;  1PKS A;  3EG0 A;  2A28 A;  4D8K A;  2DL8 A;  1T0H A;  2LZ6 B;  1YNZ A;  5FWB A;  2C0T A;  1I0C A;  1FYN A;  1W70 A;  3VS5 A;  4LUE A;  1YP5 A;  1RLQ C;  1VYT A;  4AFZ C;  2C0I A;  3R6N A;  2M51 A;  4R0K A;  1ZBJ A;  3TVT A;  1NEB A;  2ABL A;  4IIO A;  3EG1 A;  1PWT A;  2EPD A;  2KE9 A;  3VS2 A;  1M3C A;  1SRM A;  1WA7 A;  4RTY A;  2JXB A;  1X27 A;  2EGE A;  2G6F X;  2YT6 A;  2EYW A;  1GFD A;  4JJB A;  2JW4 A;  3RBB B;  2FRY A;  4J9B A;  2CT3 A;  2LCS A;  2W0Z A;  2LJ3 A;  1UJ0 A;  2GBQ A;  3VS4 A;  1H3H A;  5EC7 A;  4CC7 A;  3UAT A;  1J3T A;  1UUE A;  2LQW A;  2PZ1 A;  1AD5 A;  2F2X A;  2J6O A;  1WXT A;  1G2B A;  1KJW A;  2KR3 A;  2FG0 A;  1AWO A;  1M8M A;  2JM8 A;  1E6H A;  2W10 A;  2PNI A;  4LE9 A;  4J9H A;  3I35 A;  2A37 A;  2OJ2 A;  3M0Q A;  2YUQ A;  2JM9 A;  1E7O A;  3RNJ A;  2KYM A;  2MOX A;  1UTI A;  1VYU A;  1JO8 A;  5I11 A;  1T0J A;  1UDL A;  2DYB A;  2H8H A;  3U23 A;  4F14 A;  4WCI A;  2QDL A;  4ZNX A;  1UFF A;  1CKB A;  2FPE A;  2DLP A;  4ESR A;  1K1Z A;  2GTO A;  2JS2 A;  3EG2 A;  4AFS C;  1KIK A;  1UEC A;  1AZG B;  1PHT A;  1ZLM A;  2PTK A;  2YUP A;  1X6B A;  1GCQ A;  2LNH B;  2SEM A;  1QWF A;  3UA7 A;  1T3S A;  1X2Q A;  3PVQ A;  2A36 A;  3NHN A;  1I1J A;  2EW3 A;  2L2P A;  1TUD A;  5GJV B;  5FW9 A;  2K79 A;  1WXU A;  2IIM A;  1MV0 B;  1NLO C;  4CC2 A;  1KSW A;  3FJ5 A;  4CC3 A;  2JS0 A;  2P4R A;  1NM7 A;  1NEG A;  4Z89 A;  2ROL A;  1NLP C;  2L3S A;  2J6K A;  1K0S A;  1I07 A;  1PKT A;  2KXD A;  2FRW A;  4F17 A;  1OPL A;  1W1F A;  3VS7 A;  1QKW A;  4RTZ A;  2K7A A;  5HCK A;  1NYG A;  2ECZ A;  2EYY A;  2KNB B;  1UGV A;  1GRI A;  2VVK A;  3THK A;  4J9G A;  2DL3 A;  2CSI A;  2AZS A;  3PVL A;  2VKN A;  1M3A A;  1PNJ A;  2RF0 A;  4Z8A A;  1KFZ A;  3TSZ A;  4E6R A;  2HCK A;  2DIL A;  4J9C A;  3VRY A;  4RTU A;  2CDT A;  2F2V A;  3IQL A;  1RI9 A;  2O9V A;  2VWF A;  4HVV A;  1K76 A;  2M0Y A;  2LMJ A;  1UE9 A;  1BB9 A;  3I9Q A;  2D8J A;  2DX1 A;  1AEY A;  1OPK A;  4LUD A;  2DMO A;  1B07 A;  1UG1 A;  1Z9Q A;  1S1N A;  2O2O A;  3JV3 A;  1AWX A;  1QWE A;  5ECA A;  4ORZ A;  1U5S A;  2EQI A;  2L3P A;  3PE0 A;  1MV3 A;  2OI3 A;  1WX6 A;  2KRN A;  2BTT A;  2DL5 A;  2LJ0 A;  5IH2 A;  4JJD A;  1VYV A;  1AOJ A;  3NPF A;  4KRT A;  4J9F A;  2CH4 W;  2RN8 A;  4GLM A;  4RTV A;  2AKL A;  1BBZ A;  1HSQ A;  2DVJ A;  2HDA A;  3EG3 A;  2RQU A;  4QT7 A;  4M4Z A;  2O88 A;  2D0N A;  1M27 C;  2K3B A;  1OOT A;  3M0U A;  2CUD A;  2EYZ A;  4AFU C;  1SHG A;  4J9E A;  1JEG A;  5IHI A;  1OV3 A;  1WDX A;  1NG2 A;  3QWY A;  2ED0 A;  1U06 A;  2OAW A;  1X2K A;  2LJ1 A;  4RTX A;  2EYX A;  3GBQ A;  2CH4 A;  2J06 A;  1Y0M A;  2KEA A;  1W6X A;  3H41 A;  1TG0 A;  1FMK A;  4Y92 A;  4D8D A;  1HD3 A;  2GQI A;  1WFW A;  2CRE A;  2I0N A;  2LX7 A;  1AZE A;  2RQW A;  3O5Z A;  5I22 A;  4J9D A;  2ESW A;  2V1R A;  2CT4 A;  2DJQ A;  3KFV A;  2JMA A;  5IXB A;  1TUC A;  1GL5 A;  2NWM A;  4AFQ C;  2EGC A;  3H0H A;  4HVU A;  5L23 A;  3VS1 A;  2KT1 A;  2KGT A;  5IHN A;  2J7I A;  2MIO A;  1SSH A;  2L0A A;  1A0N B;  4GBQ A;  3CQT A;  4RTT A;  2D1X A;  1QLY A;  2HSP A;  3M0S A;  2DBM A;  2YSQ A;  1VA7 A;  2C0O A;  2CUB A;  2FO0 A;  2JMC A;  1MUZ A;  1ZUU A;  2K2M A;  4EIK A;  4LNP A;  1RLP C;  1JXO A;  1UJY A;  4OMO A;  1V1C A;  3M0P A;  4JZ3 A;  4OML A;  1HJD A;  2DNU A;  2EKH A;  2KRM A;  4DEX A;  2O9S A;  3H0I A;  2EBP A;  2BZY A;  3EHQ A;  2NUZ A;  2V1Q A;  2AK5 A;  1CSK A;  1SHF A;  2HEQ A;  2YUO A;  1XOV A;  4LN2 A;  1H92 A;  1IO6 A;  2KRO A;  4F16 A;  2FPF A;  2D8H A;  1G83 A;  3I5S A;  1YWP A;  1X69 A;  2X3W D;  2E5K A;  1B3Q A;  3EHR A;  1GFC A;  3NGP A;  1GBR A;  2AKK A;  4Z88 A;  1WXB A;  1OEB A;  1NYF A;  1GBQ A;  2K6D A;  2DRM A;  1Z9Z A;  2F2W A;  1GCP A;  2DL4 A;  2J6F A;  2DRK A;  2GTJ A;  3TSW A;  4A63 B;  4HCK A;  2EGA A;  2BZX A;  3I5R A;  2YDL A;  1SRL A;  1ZX6 A;  5IXF A;  3ULR B;  2RMO A;  1ZUY A;  2FPD A;  1YCS B;  2LP5 A;  1CKA A;  2MCN A;  3SEM A;  4OMM A;  4JPB W;  3UA6 A;  1UHF A;  1U3O A;  1WYX A;  1SEM A;  1YWO A;  2ENM A;  2KXC A;  5GJW B;  1T3L A;  4OMQ A;  1PRL C;  2RPN A;  4RTW A;  5FWC A;  1EFN A;  2KRS A;  3ZL7 C;  3NMZ C;  1K9A A;  4JJC A;  3QWX X;  2RQV A;  3SHW A;  2HBW A;  4AG2 C;  1K0X A;  2ED1 A;  2GGR A;  2KYB A;  2AZV A;  1JXM A;  2KBT A;  5IHK A;  2RQT A;  2LQN A;  1SPK A;  3H0F A;  1X43 A;  2YUN A;  2DL7 A;  1WI7 A;  2CSQ A;  3VS0 A;  2J05 A;  2DM1 A;  1LCK A;  4AG1 C;  4CC4 B;  1JQQ A;  3UF4 A;  3VS3 A;  1WIE A;  1ABO A;  2EVR A;  1M3B A;  2FEI A;  1UHC A;  4IIM A;  1ZSG A;  1WLP B;  1AVZ C;  1ZUK A;  4X1V A;  2KT8 A;  1PRM C;  3C0C A;  2K9G A;  2B86 A;  2RQR A;  2O31 A;  4DEY A;  3M0R A;  2L3Q A;  4HVW A;  2SRC A;  1AWW A;  2JT4 A;  1AWJ A;  1YN8 A;  1M30 A;  1H8K A;  3REA B;  4OMP A;  2DA9 A;  4HXJ A;  1GCQ C;  2X3X D;  3VS6 A;  3VRZ A;  3REB B;  4K11 A;  3M0T A;  2DF6 A;  2RNA A;  4RUG A;  4J9I A;  1ARK A;  3LH5 A;  2DBK A;  1BU1 A;  1Y57 A;  1K4U S;  2JTE A;  1QKX A;  3A98 A;  2GNC A;  1N5Z A;  4FSS A;  2XMF A;  2ROT A;  1JU5 C;  2BZ8 A;  1QCF A;  1X6G A;  4JZ4 A;  1ABQ A;  2A08 A;  4OMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...