3JCMf

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
77
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDRNEKVMQHHGRMLLSGNNIAILVPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
total genus 12
structure length 77
sequence length 82
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmf00
4M7AB 1WPYA 4C92E 1X01A 5LJ3d 3FB9A 5GAMf 5GAN6 1M5Q1 2RM4A 2VXFA 5LJ5g 5LJ3g 2VXEA 3M4GA 5LJ5d 3JCMb 2RD1A 2K57A 1KQ2A 1HK9A 4J6WA 5GMKi 4M7DE 4C8QC 1B34A 2E10A 2Y90A 4N0AA 5LJ5h 3JB9G 1HXDA 5GANg 3V7SA 2EAYA 2I2LA 2EJ9A 3VU3C 4XTUA 1WNLA 1BIAA 2ZGWA 2HNIA 5GAOr 4C92A 3JCMe 4V2SA 4PJOD 3SWNC 3GIBA 4M77D 4XTZA 4M75B 4M77A 3V8LA 4EMKA 3V7RA 4M78B 4C8QB 4JLIA 4MMKA 3HFOA 3HSBA 5GMKe 1D3BB 3QHSA 4RCCA 4M7DA 3QO3A 3JCMJ 4X9CA 1JBMA 1LOJA 1U1SA 2QTXA 4M77C 4XTXA 3EFSA 4M75G 4F7UA 2DVEA 1I81A 1Y96A 4C8QF 4A54A 5GAOn 4PJOC 2YHTA 2VC8A 3JCMg 1WQWA 4EMGA 4XTVA 3JCMd 4A53A 4DQ2A 3V8JA 1MGQA 2EJGA 2FYKA 2FB7A 4HT9A 3BY7A 3RIRA 4M7AA 5CAIA 4C8QG 5GANd 2YLBA 4WF2A 5LJ5e 4M75A 4XU1A 4M77B 4F7UG 4M75D 3JCMP 4QVDA 5GANj 5GAN3 4Y91A 1LNXA 3L2ZA 4XQ3A 4J5YA 5GAN8 4M7DG 2DTIA 4C92F 3V8KA 3EFRA 1I5LA 3JCMX 2EJFA 4NOYA 4EMKC 5GMKm 4J6XA 1Y96B 2DJZA 5LJ3h 3HFNA 5GANh 4JUVA 4M7DF 3JCMc 4M7AE 3V7CA 5GAOq 5GAMg 4XTWA 4F7UF 5GAOm 4M75E 4F7UB 2RA2A 2E41A 2RB6A 3RESA 4C92G 5GAMe 1KQ1A 3JCMf 5I21A 3JB9J 3BFMA 1M8VA 3INZA 2DTHA 2CGHA 1WQ7A 3SB2A 3JB9H 4PJOA 2E64A 3QSUA 4PNOA 3JCMW 2E65A 4M7AF 5GMKl 1I8FA 3BDUA 3SWNB 4JRKA 1N9SA 4M7AD 1LJOA 4C8QE 4F7UE 5GAOp 5GAN5 4M78C 4M75F 3BW1A 4X9DA 2DXTA 5LJ5j 5DY9A 5LJ3j 5GANe 4M77G 3RKYA 3JCMQ 5GAN4 4M75C 4M78F 4J6YA 1I4K1 3FIFA 4QVCA 4PJOG 1H641 5GAN7 4HA8A 4XU3A 2EWNA 4N0AC 4M7AC 4NL3A 3RKXA 3JB9I 5LJ3f 3JB9D 4C8QD 5GAN2 4XU0A 3L1AA 4HT8A 3AHUA 4PJOB 1B34B 1YCYA 2JN0A 3FJPA 1N9RA 2DTOA 4C92D 4EMHA 1JRIA 4JRIA 1U1TA 4M78E 5GAMh 2DXUA 3RUXA 4NL2A 4C92B 2DZ9A 1TH7A 4PJOF 5GAMj 5GAMd 3JCMh 3JB9F 4RCBA 5LJ5f 4M7DC 3RKWA 4M78G 5GMKj 4M77F 1D3BA 4MMLA 5GAOl 2DEQA 3SWNA 1BIBA 2E1HA 2YLCA 4C92C 3RERA 4M7DD 2DKGA 5GANf 5GMKh 4M78D 4EMKB 4XTYA 4M78A 4C8QA 4M7DB 4PJOE 4M7AG 4XU2A 3PGGA 5LJ3e 3QUIA 2DZCA 3JCMV 4M77E 4OP0A
chains in the Genus database with same CATH superfamily
2OTJQ 2FZCB 3CQTA 2RM4A 3I9QA 1N8RU 3M0QA 2DX1A 5GANg 3PVQA 2RMOA 4QQGA 2F1LA 1BU1A 1I0CA 2JTMA 2L3PA 4OGEA 4MMKA 3HSBA 4GBQA 2KT1A 2XK0A 1V76A 1ZSZB 3M58A 4DEYA 4XTVA 1QVGA 3OS1A 2KRSA 4Z02A 2X35A 1KQSP 1GBRA 2YLBA 1M3AA 2DFUA 3OYHA 4Y91A 1IB8A 3EGDA 1I5LA 2A37A 2ENMA 1ZA2B 4J9IA 2CYZB 2ZPBB 4LDYA 1I1JA 1OULA 3CCET 3OYCA 4C0GA 1WJRA 3A8LB 3BFMA 3META 3ZL7C 1TUGB 3UATA 2DF6A 2AT1B 1LPLA 1OOTA 2QI2A 3C4SA 2KMTA 3M0UA 3LYIA 2PVDB 2C0TA 2EYYA 3CCUT 5CCAA 4QVCA 2DXBA 4C0FA 2EWNA 4C5IA 2PTKA 1D1CA 3UPUA 2J7IA 3OS2A 3G4SQ 2DL4A 2O2OA 2ZPIB 4M78G 2AKKA 3QPHA 5GAOl 2DMOA 2VWFA 1HYOA 2D1XA 3EG2A 4A4KA 2KDSA 4EMKB 2WSFE 4E7HA 2XU8A 4XU2A 1JU5C 3CD6Q 4BACA 4N4GA 2EQKA 5LJ5g 2QEXA 2RJEA 2RD1A 2RQVA 3ME9A 1X27A 4OB0B 4PLLA 1M1KR 5LJ5h 1M3BA 3NHNA 2ZGWA 4KH1B 1K73C 2MWPA 2MI6A 4IIMA 1QVFP 3EFOB 3G6ET 2OAUA 1YJWQ 1VQKT 1OQKA 4Z88A 4RG2A 1N5ZA 2OTLT 4MZPA 2QTXA 4XTXA 4GLKA 2DK3A 2XD0A 5CR2A 3PIPA 2C06A 1YWOA 1PKTA 1EIFA 3V8JA 3RIRA 3OW2A 3CCUA 2E5KA 2K5LA 3S6WA 1VUBA 2NUZA 1WHKA 3G7ZA 3JCMX 1X6OA 4M7AE 3RMSA 3O5ZA 2FPFA 3H0HA 2X9HA 1WYXA 1WGSA 4C0DC 5KE3A 3OMCA 4HVUA 3CD6T 4QT7A 3JB9J 3JCMf 5I21A 1Q86C 1FWZA 3X24B 2DTHA 1M3CA 2E64A 1ACMB 1LCKA 1D0YA 2F2VA 4FIBA 1I8FA 4CC7A 2K2VA 2QYZA 1YIJQ 1WXTA 4X9DA 3C94A 2D8HA 4O6JA 3CC7A 5GANe 1YFNA 4PJNA 3VS5A 5FRNA 4R55A 2HSPA 1QQJA 3ULRB 1VA7A 5I22A 2DERA 2JN0A 1G83A 5CQYA 1N9RA 2XIDA 2RHZA 2W0ZA 4BI3A 3ASKA 1O9SA 1RAAB 2LMJA 3LGLA 5GAMj 1M1GA 2QA4Q 1YI2T 4MMLA 2GTOA 4D6WA 3WVEB 3KBGA 2EGEA 4C5EA 3CBOA 3MP6A 3JRZA 1VQ8A 2HL3A 3GPLA 5GMKi 1EZZB 2RF0A 2XG8D 1FMVA 3OA6A 2D6FA 1PRMC 4J7IA 1WHHA 2AZSA 4CC3A 4X9CA 2LQ8A 2F2XA 3A1PA 3E19A 1CKBA 4A54A 1NLPC 1K0XA 1MNDA 2DPPB 4EMGA 4B9XA 3VUBA 3X26B 3L42A 1ABQA 3M53A 4BE2A 3C12A 2CZ0B 3MKDA 4E7ZA 1W4SA 1TOVA 4ME7A 2CZ1B 2RH2A 3M59A 5KE2A 1NYGA 4A4HA 3S3MA 2EYXA 5CKFA 1QKXA 1S72T 2GNCA 4R56A 4XTWA 3H0IA 3OYDA 4DA4A 2ESWA 1A0NB 2SRCA 1M90C 2GFUA 4J9GA 5CK9A 1WQ7A 2MK5A 1JJ2P 1RABB 3MEWA 4DBHA 1PC0A 3UWNA 3VS1A 1S72Q 2EW3A 3CCJA 3C0CA 3FJ5A 5M9OA 1W2BS 4PJOG 4M7AC 1VQPT 1M90U 3G1JA 3SHWA 4A63B 2F69A 4LUDA 2SEMA 5D6YA 1XQHA 3I56A 3C95A 4DBRA 4PJOF 2EIFA 2RHYA 4E6RA 4X34A 2K3BA 2CUDA 3CCQA 2K5FA 1XOVA 2DIGA 4HCZA 1KHCA 5KYWA 2R5AA 4XTYA 3QXEB 1HJDA 5D6WA 5FROA 3JCMV 5IHIA 1V1CA 2HKNA 4PKCC 3G6EA 2LCLA 1AZEA 2HAXA 2VXEA 2KGTA 1KQ2A 1QP2A 2E10A 5J39A 3RBBB 1RLPC 3EHRA 2JS0A 1OZ2A 1XNIA 2HNIA 4OB2B 4C92A 2A3LA 1W2BP 1PSEA 1VQ9T 2BIVA 1PSFA 4M78B 2BZ8A 4JJDA 2ZAEA 3SEMA 2YUQA 1FXXA 2M0OA 4EPCA 2K9GA 2HDAA 4C8QF 2QA4T 1M2OA 5FU7C 4A53A 1NEGA 4KUIA 2FZKB 2EJGA 3CCUQ 4M7AA 4J9BA 4ELZC 3ZFJA 1QVPA 5GANd 4BD3A 4LDXA 3WXMB 2J6KA 4J8OA 8AT1B 4D8KA 1Q81U 1NG2A 1OYXA 1YIJT 2L3RA 2V8IA 1ZSZA 2G3RA 1P92A 5GAMe 2HBWA 2OJ2A 4QW2A 1G2BA 4OMLA 4OMFB 4C8QE 1G3YA 2KQWA 3VS2A 1Q82U 1NJIU 1WI7A 2EKOA 2M02A 5DY9A 4RTWA 3EGDB 2HCKA 4FW2A 2CP2A 3MEUA 1K73R 5GAN7 4ZN1A 2FZGB 5I2SA 1M1FA 4PJOB 2DTOA 2L5QA 1G8XA 1PCXA 2L2PA 2L89A 4AT1B 4MZMA 4RCBA 3FDRA 3RKWA 3LWIA 2QA4A 4FSXA 2DEQA 1E6HA 1BIBA 1C0MA 2KSSA 3HL8A 3OBYA 4FW1A 3ZEHA 3TEEA 1UG1A 1YJWT 3CPFA 1C1AA 1SSFA 3CCVA 4KULA 1YI2A 4M77E 3G71T 1WPYA 3GLXA 1AVZC 2X4JA 1GBQA 3CBMA 3JB9G 2DBKA 3M0SA 2I2LA 4HXJA 3VU3C 3ZBDA 2BTTA 1E6GA 3QWYA 2O4XB 2NUPA 2RK2A 4FYWB 1IGUA 2RJCA 5GMKe 5IXBA 1KC8U 3HTRA 5AT1B 2HD0A 1I81A 2DBMA 3E2UA 2E6ZA 4E2FB 3JCMd 2X4XA 2E4HA 3KXTA 4PK4A 5DM7R 1S72A 1R8OB 3NPFA 1K9MR 5CAIA 1VQ6A 4A4GA 3EH1A 3PMIA 4M77B 1W6XA 3A8HB 1PKSA 1TU0B 2DLPA 4LNPA 1WHJA 1WZOA 2BZYA 2MYSA 4C0ZA 4LUEA 3NGPA 3OQ5A 4M7DF 5A0LA 2AZVA 5KYYA 1WXUA 2RJDA 3H0FA 1G3TA 2RQUA 4C92G 5L8RE 2P0PA 2OTLA 2ZPHB 1D09B 3JCMW 4ORZA 2COZA 1VIFA 1AWXA 3EGXB 4MDWA 2COWA 4M78F 2DIQA 4RTXA 1WIEA 3CMET 3CPWP 2RHUA 2K7AA 1MV0B 4DOVA 1YWPA 1RI9A 2DILA 3M5AA 4GLMA 3CC2Q 2DJQA 2E70A 1XJWB 3O8VA 1U3OA 1RUWA 3F70A 4M7DC 1QP3A 1PG5B 1H3HA 2GQVA 3EG9B 1NE8A 1X69A 2ECZA 2O9VA 3L2UA 4IKFA 1ZUYA 2QQBA 3OSSC 3CCJQ 3TVTA 2LNHB 3OYGA 3ER0A 3OB9A 1UE9A 5DLOA 3OYAA 2NUTB 3MPUB 4ELYC 2KAFA 2LT1A 2CKKA 2DD5A 4EIKA 3QJ6A 3CCEA 3LWHA 4UC4A 1C6VX 3QO3A 1WHMA 4M75G 1SG5A 2L8DA 1OX9A 1W70A 2YHTA 2COYA 1RADB 4ATOA 4DQ2A 1MGQA 3GOXA 2KNBB 3HRSA 4F7UG 1OI1A 3NTIA 3LW5E 2JUFA 2B86A 4NOYA 3PE0A 4JUVA 3LH5A 2QQ9A 1RAFB 3OW2S 2XKOC 1I07A 3HRUA 1GCQA 4M75E 1UGRB 4J83A 3OS0A 3A98A 5KCHA 1QKWA 4D8DA 1VQ7A 2CGHA 1MNEA 2BZXA 4ZTJA 1K8AC 3SWNB 2A7YA 6AT1B 3EG1A 1Y71A 2KK4A 2X3WD 4QQDA 3SD4A 4OMNA 3LH0A 2DXCA 3RMQA 1G5VA 4LDUA 1Y7XA 5I11A 2HEQA 5CQXA 2YT6A 2CZ6B 1ARKA 3QYGB 1TG0A 2DYBA 1GFDA 5GMKj 4M77F 5I2MA 2X4YA 2CS7A 2JW4A 2A0FB 3VS4A 2D9TA 3RERA 2O9SA 4M7DB 2LX9A 2LVMA 3PGGA 5J3BA 3L2RA 1H92A 4WCIA 1BI3A 2F5KA 5LJ3d 3OY9A 2MIOA 3NTHA 4DBFA 1D0XA 4C8QC 4N0AA 1QCOA 1HXDA 1WJQA 2KRMA 3G4SA 2LTOA 3V8LA 4LE9A 4RKUE 1F1BB 1VQ7T 2OTLQ 1VQLQ 4IUPA 4N4IA 3DB4A 3UA6A 1WQWA 2ROLA 3OYJA 2P0KA 1NBEB 3JSCA 2FB7A 2F2WA 2WSCE 4L59A 2A36A 3X20B 3CCMT 4M75D 4J7FA 5LL6S 1ZUUA 4C92F 2Z0WA 4C5HA 3REBB 2RQRA 1PD0A 2EQIA 2EGAA 1VQ9A 1T3SA 1YITA 2CP6A 2PUOB 2J06A 2JM8A 1YHQA 3DKMA 2FG0A 1M2VB 3NTKA 1RI0A 4E7KA 4F7UE 5C6SA 3OMGA 1BYMA 3CCRQ 2RPNA 1IREB 1MMAA 5EC7A 3J7AF 3H6ZA 4M75C 2QEXQ 3M9QA 1IHWA 2JM9A 1UEBA 3CCSQ 3VUZA 2M51A 2M1HA 1JRIA 2FPEA 3P8HA 3A8OB 2HQHA 1QWFA 2KEAA 3PVLA 2HL5C 3JB9F 3SFMA 1D3BA 3OBWA 2LNVA 3QG1A 4PFZA 1IO6A 2M16A 2H3EB 1IZ6A 1BCOA 5HY6A 2KBTA 4IURA 2X3XD 3P8BB 4OP0A 2AKLA 1TSFA 4OB3B 5KYNA 5LJ3g 2XICA 1RLQC 4PJOD 2FHDA 4V2SA 4XTZA 2EPDA 4J9DA 3CCRA 1YHQQ 2PVGB 2F5TX 1U8RA 4F7UA 4ESRA 4BE0A 5IAYA 1Y96A 1WXBA 4BY6C 1K9MC 3CC7Q 2O31A 1PNJA 2P84A 2EVRA 5KYUB 3D7SB 5KCOA 3CCJT 2R57A 4M75A 2OI3A 4F14A 4XK8E 2OTJT 1SRMA 1K1ZA 1G3SA 4EMKC 3CC4A 5GMKm 1JXMA 3HFNA 2ZPGB 1E7OA 3EH2A 1K9MU 3V7CA 3CCEQ 2RK1A 1D1AA 2HQXA 1TUCA 2XMFA 1FMWA 2I0NA 4E7LA 3RNJA 1YP5A 1BI0A 5FU7B 2YRDA 1O75A 2YDLA 1UUEA 1PM3A 3BDUA 3NFCA 1WFWA 4DOWA 4M7AD 1HSQA 4BE1A 3E1SA 2ZPFB 2G6FX 4HCBA 1JB0E 2BE7D 3FIFA 4HVVA 5CKDA 1R0CB 4FYXB 2YSQA 3WVDB 3L1AA 5IT9E 1YCYA 1QVFA 2QQAA 4WTOB 3CC2A 1U1TA 5GAMh 1VYUA 2DZ9A 4F17A 3CBPA 5DLQE 2CP0A 3QZ5B 3DLMA 2MPXC 3PT9A 2DKGA 2OX7A 4M78A 3P8DA 4PJOE 4M7AG 5HKCA 3EAEA 1ABOA 2X4WA 1RACB 1SPKA 5D7UA 5GAN6 2KY9A 5LJ5d 2ABLA 1HK9A 3CC4T 5CKBA 2Y90A 1GFCA 5KYXA 2JT4A 3E9FA 2K4YA 4CC2A 2CZ7B 4C8QB 4OVAA 4O5VA 3OYIA 4YTLA 3G4ST 4MZTA 1BKBA 2FL7A 4AFUC 4BB7A 3CCLT 1N27A 1Q81R 2VVKA 4IUUA 5LJ5e 5GAN3 1W2BA 2V8JA 2JZ2A 1QWEA 3V8KA 3QWXX 3H9NA 5IN1A 4F16A 1VOMA 1QVGS 3HP9A 1CSKA 1KIKA 3M0TA 5GAMg 2HMAA 4FYVB 1T0HA 2AK5A 5HCKA 2ATCB 1Q81C 1M1KU 2CP5A 2LJ3A 1AEYA 3JB9H 4PJOA 2RQWA 3DLLA 4HKEA 1SHFA 1QLYA 2DO3A 4M78C 3R6OA 3CCVQ 2BE9B 4GY5A 1VQ4Q 5LJ3j 2BKDN 1EX4A 1T3LA 2K79A 2MAMA 1VQ5T 3GF5A 1OPKA 4HA8A 2P4TA 4VUBA 2EQUA 2JNGA 2K2MA 3CCQT 1RAGB 5GJVB 4F04B 3FJPA 1Q95G 3PMTA 1OU9A 4Z8AA 1TH7A 2MF2A 2EKHA 3M54A 4OGCA 4M7DD 2LP5A 2NUPB 1VQ6T 4M78D 3EFOA 1Z9QA 3THKA 2JMCA 4OMMA 2LDMA 2NYSA 3OS5A 1X01A 4DEXA 1YITQ 3H8ZA 4FU6A 4IUQA 5ECAA 3VS3A 4IIOA 3I5SA 4KUDK 2DL3A 4LDWA 1VQOA 4EDUA 4KRTA 3VV0A 2WACA 4XTUA 1BIAA 1WA7A 4KGZB 3GIBA 2XDBA 4PJLA 5CKEA 4EMKA 3V7RA 1H3ZA 3QHSA 4AG1C 1FYNA 4PJOC 2JMAA 4PJJA 2QK0A 2LQKA 1MMDA 4BDYA 2FYKA 2DE0X 1DJ7B 2HQEA 4CRIA 4AG2C 4C5GA 3TQ7P 3G71Q 2MWOA 2RN8A 5CO7A 2EJFA 2EYWA 2KT8A 2P0QA 3KFVA 1Q86U 1Q7YC 4JZ3A 2KVQG 3DB3A 2LRQA 2P4RA 2YRVA 3PTAA 2E41A 3RESA 1KQ1A 1VQ6Q 1M8VA 3INZA 1N8RR 4LD6A 1OEBA 1GRIA 3QSUA 2K3YA 2KYBA 3PIOA 2LC4A 1KFZA 5FU6B 2V26A 2RNAA 5L23A 2DRKA 4BUGA 3QJYA 2QAZA 3RKXA 2EFIA 2QGFB 2OAWA 3UA7A 1ZBXA 1BB9A 2XDPA 1B34B 1UGPB 2V1QA 4JRIA 4M78E 5IHNA 1RAIB 2NUTA 5A2QE 1YITT 5IH2A 3M0PA 3S3NA 4JZ4A 2D8JA 1WHLA 2E1HA 3QKJA 1WHGA 5D6XA 4CC4B 1UJYA 4ZGJB 2KXDA 1NYFA 3IQLA 2JTEA 1RAEB 4C92E 5GAMf 3FB9A 1KC8R 2K57A 2QDLA 3MP8A 4J9CA 1TS9A 1AWJA 1NZ9A 3SWNC 4M77D 4QQ6A 3J80E 1MV3A 2VGNA 3CCLA 2V8KA 3GP8A 3EFSA 1VQ5Q 4II1A 3M0RA 3S3OA 3L2QA 2RI5A 3HRTA 1MMGA 3KUFA 4L6V5 4XAXB 4X1VA 2C0IA 3L2ZA 2DEUA 1K9AA 4IUVA 3EFRA 3H41A 1K76A 3OYNA 1FMKA 5GANh 3UDCA 2JS2A 1BI1A 1GL5A 5GAOq 2JVVA 4P5NA 4FYYB 2ZCFB 2WSEE 1K73U 2CH4A 2LCCA 2RHXA 3N5BB 4M7AF 1Q82R 1NJIR 1OX8A 3OYYA 2QXFA 5GAN5 4M75F 5FWBA 3X28B 4ZGEB 2KE9A 4ZNXA 1YJ9Q 1X75C 1H641 5KYWB 1QVFS 2OTJA 1JXOA 4FSSA 3R6NA 2PZ1A 5A0GA 2CT4A 2VYTA 2EQJA 2K5IA 3L2WA 2VB6A 3CMEA 2J6OA 3CXCA 3RDVA 1CKAA 2QTVA 2QEXT 2CUBA 3I56Q 4C92C 5FLXE 2PUKB 1VQ4T 3I55Q 1AZGB 1UGSB 1QMCA 1PHTA 4J9FA 1M9SA 3CCMA 1SKUB 2D0QB 3HHTB 4PL6A 3EG0A 4Q5WA 2ZPEB 1VQKA 3GNGA 3JCMb 3E9GA 2JXBA 2O01E 3CMAT 2ED1A 3T9NA 4BI4A 1W1FA 3V7SA 3SDZA 1M8MA 2CSIA 2IPOB 2PU9B 1Q7YU 4K11A 5J26A 1ZUKA 1YJ9A 1LOJA 1U1SA 9ATCB 1VQ7Q 4J9HA 1VQOT 3TREA 4OB1B 4PJMA 1UHCA 2DVEA 3VJPA 4RUGA 4RG8A 3FRNA 2V1RA 4FT2A 2CDTA 1Z9ZA 3JCMg 2CT3A 4LDVA 2IG0A 3QIIA 1NM7A 1Y0MA 2K3XA 1UTIA 1VQNQ 2JTFA 3CPWA 1N8RC 5GANj 1VQPA 1LNXA 4XQ3A 4DBQA 2XDDA 4JRPA 3AT1B 7AT1B 3CCMQ 2DETA 1M90R 4TVRA 3L2VA 1N6AA 3MEVA 1Q82C 2RHIA 1NJIC 4N4HA 1H8KA 2B8AA 5FW9A 3EGUA 2E65A 1OU8A 1KQSS 1VQ8Q 2DXTA 4QKUA 4AFSC 1UGQB 2KROA 3CMAA 4PFOA 4L5GA 2ROTA 1YI2Q 3I5RA 4JDSA 4B6MA 3MO8A 2NLUA 1QCNA 3AHUA 4HT8A 5IHKA 4E7JA 3CC7T 3CCRT 1AWOA 3CEYA 3MP1A 1BCMA 3SWNA 4BI8B 4BDZA 2HZYA 1XTDA 1NPPA 2O4XA 4R0KA 3TU4K 3TCJA 2A28A 5FU6C 5CKHA 2HSEB 1Q7YR 3I55A 2JJ9A 2LT4A 2DL5A 1YJNA 3VRZA 1ZSGA 1VQNT 1FX7A 1WNLA 3NMZC 3REAB 3JCMe 4KT0E 2KRNA 4M75B 4M77A 2H8HA 3JV3A 1VQ8T 2VKNA 1NPRA 1K8AU 1Y57A 1ZQ1A 2VC8A 1KD1U 4HT9A 8ATCB 3QBYA 5HK0A 1VQPQ 2YWWA 2GQIA 4HVWA 1VQMQ 4LD9K 1YHQT 3VS6A 3EGXA 3RR6A 4J6XA 2DJZA 3PFSA 2EQMA 3QDRB 2KI7A 2RA2A 2RB6A 1VQMT 3CXCS 1WDXA 1BBZA 1YJWA 4PNOA 1KK7A 1VQOQ 2LJ0A 1RAHB 1LJOA 2DM1A 2YXYA 2FO0A 1VQKQ 2L0AA 2QDYB 1K4US 2YUOA 2E3IA 4M77G 3I56T 2VUBA 3EG9A 1YJNT 3FC3A 5KYYB 1KG1A 4KGVB 1R77A 3JB9I 5LJ3f 5GAN2 2QQSA 2IIMA 1WX6A 3CCLQ 1X2QA 4BY6B 3VYHB 5CIUA 4FT4A 3FLGA 4RTVA 1VIEA 3VRYA 4AFZC 4AMCA 4C92B 5GAMd 1GCQC 2R58A 3CCST 1WLPB 3A8MB 3CMEQ 3CD6A 2MCNA 3Q1JA 2YLCA 2CP3A 4JJCA 1VYTA 4C8QA 1AOJA 1TXQA 1OZ3A 4M7AB 1BK2A 4IUTA 5A0DA 2KYMA 2QGGA 3OYLA 2DNUA 2JOYA 3A8GB 1B34A 2YUPA 2ED0A 2EJ9A 3VS7A 1ZLMA 4ZGDB 3U23A 2RO0A 1JO8A 2XHCA 3VS0A 2K6DA 3HFOA 2GF7A 1D3BB 4RCCA 1PD1A 4M4ZA 1M1KC 2HBPA 3HPWA 5FWCA 1KJWA 2A08A 4J9EA 3M56A 2M9UA 1YJ9T 1KD1R 2DRMA 2BUDA 1VQ5A 1YIJA 2LCSA 4FM4B 1PRLC 2IVWA 1VYVA 3OYEA 4Z89A 2DD4A 2DTIA 2RJFA 1S1NA 1K8AR 1T0JA 2DL8A 1QW1A 2L3SA 4F7UF 1GCPA 2KXCA 4F7UB 2GGRA 2NWMA 4RTTA 4E7IA 4LXCA 3FEOA 3SB2A 1BI2A 1VQLT 5GMKl 1N9SA 4Y28E 4E47A 3MEAA 4KGXB 4C0DB 2GCXA 2E12A 3CC2T 1UB4A 5GAN4 4B9WA 3RKYA 3MHXA 2LJ1A 4J6YA 1Q86R 1G3WA 2XI9A 3A5ZB 4JJBA 2DVJA 2DL7A 3OW2P 2DXUA 3VKIA 4NL2A 3CMAQ 3CCVT 4NS5A 2E3HA 1KHIA 1B3QA 1ZHIA 3BDLA 1M27C 3UT1A 2EYQA 3G6EQ 2LQNA 4ZTFA 2LQWA 2D0NA 2YRCA 1M5Q1 1IHVA 1GXIE 1SF9A 1X2KA 2CSQA 5C0MA 4A4FA 4J6WA 2O88A 2EAYA 3OYFA 1IRXA 5AYFA 5GAOr 5EG2A 2CREA 1NEBA 3I55T 2CP7A 4JLIA 4M7DA 3M4YA 1JBMA 4LN2A 2C0OA 3GNFB 4M77C 2M0YA 2GBQA 3MJXA 3PNWC 1U06A 2MMPA 3VYGA 1MMNA 1VQ4A 1TUDA 3X25B 1J3TA 3BY7A 1YN8A 4C8QG 4WF2A 1AHJB 2FEIA 4XU1A 3JCMP 1IGQA 4KBMB 1OPLA 1WJSA 3OYBA 5GAN8 1VQMA 4M7DG 5KYXB 4OMQA 2J6FA 1MUZA 3JCMc 4MDXA 1OV3A 2EBPA 1UHFA 4A4EA 4HCCA 2QASA 4JS4A 3QZ9B 1LVKA 3OSVA 2FVUA 4JRKA 1TWBA 1X6GA 4FL6A 5GAOp 2KR3A 3OYKA 1X6BA 2GTJA 5LJ5j 1M30A 4Y92A 1IXDA 2DYIA 1YJNQ 5IXFA 4OMOA 3GBQA 4OMPA 4N0AC 1YNZA 3JB9D 3LLRA 4C8QD 1M2VA 1X43A 4QVZA 2RQTA 3LGFA 2Y4XA 1TTHB 1AT1B 2ZZDA 1YCSB 3RUXA 1EFNA 2VASA 3JCMh 2PQWA 1QVGP 1YBYA 5LJ5f 1JEGA 2PNIA 2FPDA 1PWTA 1D0ZA 1NLOC 2DA9A 3QDFA 1QCFA 2EYZA 2X51A 4JS5A 5LJ3e 3UF4A 1JJ2A 2DZCA 1V29B 2MOXA 1ZBJA 1KSWA 5GANf 2AIRB 3CCSA 2QG9B 4ZN3A 2VXFA 2RI3A 1R0BG 2Y4YA 3TSWA 3M4GA 4KH0B 1SRLA 4M7DE 1ZA1B 1KC8C 2E6NA 3MCAB 2FRYA 5CVIA 2DAQA 5KYUA 5FRMA 3CXCP 2FRWA 3HKSA 1I5OB 1JJ2S 1K0SA 1B7TA 3J81E 3JCMJ 2HKQB 3EG3A 1JQQA 1M4ZA 2EGCA 1D1BA 2YUNA 3I35A 4HCKA 5GAOn 4RTUA 3LX7A 1HD3A 1UJ0A 4CI0C 2CH4W 2LX7A 4JLGA 1VQ9Q 5GJWB 4QVDA 3G71A 4E7SA 4JPBW 1Y07A 4ANJA 2J05A 4J5YA 5HK3A 2H3JA 3JAME 2VGMA 1Y96B 5LJ3h 1VQLA 1VQNA 2E5QA 4JJNK 1RL2A 5GAOm 1ZSZC 1KD1C 3M55A 3CC4Q 1B07A 1AWWA 2PVOB 3M57A 2AHJB 4RMOA 3OYMA 1AD5A 3BW1A 4RTZA 4OF1A 2QQRA 2VV5A 3JCMQ 1MHNA 2LZ6B 2RI2A 1I4K1 4PLIA 4XU3A 4RTYA 1SSHA 2R5MA 4NL3A 3CCQQ 4XU0A 4EMHA 4C92D 2L3QA 1KQSA 3CPWS 1UECA 2GFAA 4PFPA 1UGVA 1ZX6A 3URGA 5KH6A 4JRQA 1U5SA 3TSZA 2W10A 1SEMA 1UDLA 5GMKh 3EHQA 4AFQC 1SHGA 3QUIA 3BE3A 4FCYA 3QYHB 1UFFA
chains in the Genus database with same CATH topology
2X4WA 1M8VA 1WPYA 3I55A 5GAN6 2RM4A 2LT4A 2KY9A 5LJ5d 3GLXA 2X4JA 3CBMA 1YJNA 1HK9A 3CC4T 1N8RU 5CKBA 2Y90A 3JB9G 1VQNT 5GANg 2I2LA 3VU3C 1FX7A 1WNLA 3ZBDA 3E9FA 3JCMe 4KT0E 4QQGA 2JTMA 2K4YA 2O4XB 4M75B 2RK2A 4M77A 4OGEA 2CZ7B 2RJCA 4C8QB 4MMKA 4O5VA 4OVAA 1VQ8T 5GMKe 3HSBA 3OYIA 1KC8U 1NPRA 1K8AU 2XK0A 2HD0A 1I81A 1ZQ1A 2E6ZA 3M58A 4YTLA 3G4ST 2VC8A 4MZTA 4XTVA 1BKBA 2X4XA 3JCMd 3OS1A 1QVGA 2FL7A 4Z02A 2X35A 5DM7R 3KXTA 1S72A 1KD1U 4BB7A 4HT9A 1R8OB 3CCLT 1VQ6A 1N27A 5CAIA 2YLBA 3QBYA 5HK0A 4A4GA 4IUUA 5LJ5e 3PMIA 4M77B 3A8HB 5GAN3 3OYHA 4Y91A 1W2BA 2V8JA 2JZ2A 4LD9K 1YHQT 3V8KA 1I5LA 5IN1A 4C0ZA 4J6XA 3OQ5A 2DJZA 3HP9A 1QVGS 4M7DF 3PFSA 2EQMA 2CYZB 2ZPBB 5A0LA 5GAMg 3QDRB 4LDYA 3CCET 2RJDA 2RA2A 3OYCA 2RB6A 4C0GA 1G3TA 1VQMT 1WJRA 3A8LB 4C92G 1Q81C 1M1KU 3CXCS 5L8RE 2P0PA 3BFMA 3META 1YJWA 2OTLA 2ZPHB 3JB9H 4PJOA 4PNOA 3JCMW 3DLLA 2QI2A 4HKEA 3C4SA 1LJOA 1VIFA 2DO3A 4M78C 3R6OA 2KMTA 2QDYB 4MDWA 4GY5A 3LYIA 2PVDB 5LJ3j 4M77G 2BKDN 2VUBA 3I56T 4M78F 2MAMA 1VQ5T 2DIQA 3CCUT 1YJNT 3FC3A 5CCAA 4QVCA 2DXBA 3GF5A 1KG1A 3CMET 4HA8A 4C0FA 2P4TA 2EWNA 4VUBA 2EQUA 2JNGA 2RHUA 3JB9I 5LJ3f 5GAN2 2QQSA 3CCQT 4C5IA 4DOVA 3FJPA 4BY6B 3UPUA 3M5AA 3PMTA 5CIUA 3VYHB 4FT4A 3FLGA 4C92B 1VIEA 3OS2A 4LDXA 2E70A 1TH7A 3O8VA 5GAMd 2ZPIB 2R58A 3F70A 1QP3A 3A8MB 4M78G 3QPHA 3CCST 1VQOT 2MF2A 5GAOl 3CD6A 2GQVA 3Q1JA 2YLCA 3M54A 4OGCA 1NE8A 4M7DD 3L2UA 4A4KA 2KDSA 1VQ6T 4M78D 4EMKB 4IKFA 2QQBA 2WSFE 4C8QA 2XU8A 3OSSC 4E7HA 4XU2A 1OZ3A 4BACA 2LDMA 4N4GA 2EQKA 4M7AB 3OS5A 1X01A 4IUTA 5LJ5g 5A0DA 3OYGA 3H8ZA 3ER0A 3OB9A 4FU6A 4IUQA 3OYLA 2QEXA 2RJEA 2JOYA 2RD1A 5DLOA 3OYAA 3ME9A 3A8GB 4OB0B 4KUDK 4LDWA 4PLLA 1VQOA 1B34A 5LJ5h 4EDUA 3VV0A 2EJ9A 2WACA 2KAFA 2LT1A 1BIAA 2CKKA 2ZGWA 4XTUA 2DD5A 4ZGDB 1K73C 3QJ6A 2MWPA 3CCEA 3GIBA 2MI6A 2RO0A 2XDBA 5CKEA 2XHCA 4EMKA 3V7RA 2OAUA 3LWHA 4UC4A 3G6ET 1VQKT 3HFOA 4RG2A 2GF7A 1D3BB 3QHSA 4RCCA 1H3ZA 3QO3A 2OTLT 4MZPA 2QTXA 4XTXA 4GLKA 2DK3A 4M75G 2XD0A 5CR2A 2L8DA 3PIPA 4PJOC 2C06A 1M1KC 2YHTA 2HBPA 3HPWA 1EIFA 2LQKA 4ATOA 4DQ2A 3M56A 4BDYA 3V8JA 1MGQA 2FYKA 2M9UA 1YJ9T 1DJ7B 3RIRA 3OW2A 2BUDA 3GOXA 1VQ5A 3CCUA 1YIJA 2HQEA 4CRIA 3HRSA 2K5LA 3S6WA 4F7UG 4FM4B 1OI1A 3NTIA 4C5GA 3LW5E 2IVWA 1VUBA 3OYEA 3G7ZA 2JUFA 2DD4A 2DTIA 2RJFA 2MWOA 5CO7A 3JCMX 1X6OA 2EJFA 4NOYA 2P0QA 1Q86U 1Q7YC 4JUVA 1QW1A 4M7AE 3RMSA 2QQ9A 2KVQG 3DB3A 3OW2S 4F7UF 2XKOC 1WGSA 2LRQA 1UGRB 3HRUA 4J83A 4M75E 4C0DC 4F7UB 3OMCA 2YRVA 5KE3A 2E41A 5KCHA 3OS0A 3PTAA 3CD6T 3RESA 1KQ1A 3JCMf 5I21A 4E7IA 3JB9J 1FWZA 3INZA 2DTHA 4LD6A 3X24B 2CGHA 1Q86C 3FEOA 3SB2A 1VQ7A 2E64A 3QSUA 1BI2A 2K3YA 4FIBA 5GMKl 4ZTJA 1I8FA 1K8AC 3G71T 1VQLT 3SWNB 1N9SA 2K2VA 2A7YA 4Y28E 4E47A 4X9DA 3PIOA 3C94A 2LC4A 3MEAA 1Y71A 4C0DB 2GCXA 4O6JA 2E12A 2KK4A 5FU6B 4QQDA 3CC2T 3CC7A 1UB4A 5GANe 3SD4A 3RKYA 4B9WA 5GAN4 3MHXA 4J6YA 3LH0A 2DXCA 3RMQA 5FRNA 1G5VA 4LDUA 4R55A 2HAXA 4BUGA 1Y7XA 3QJYA 3RKXA 2EFIA 5CQXA 1G3WA 2XI9A 1ZBXA 2XDPA 3A5ZB 1B34B 1UGPB 2JN0A 5CQYA 1N9RA 2CZ6B 2XIDA 4JRIA 2RHZA 5FU6C 4M78E 4BI3A 2DXUA 3ASKA 3VKIA 4NL2A 3QYGB 1O9SA 3LGLA 5GAMj 1M1GA 3CCVT 4NS5A 1KHIA 1YI2T 5GMKj 5A2QE 1YITT 4M77F 5I2MA 4MMLA 2X4YA 2CS7A 3S3NA 1ZHIA 2E1HA 3BDLA 3QKJA 4D6WA 3UT1A 2D9TA 5D6XA 3RERA 2EYQA 3WVEB 3KBGA 4ZGJB 4ZTFA 4C5EA 2LX9A 4M7DB 2LVMA 3PGGA 5J3BA 3L2RA 1BI3A 2F5KA 3CBOA 3MP6A 4C92E 5LJ3d 5GAMf 3FB9A 3OY9A 1M5Q1 3JRZA 3NTHA 1VQ8A 1GXIE 2K57A 5C0MA 4A4FA 3GPLA 3MP8A 4J6WA 5GMKi 4C8QC 2XG8D 4N0AA 1HXDA 3OA6A 1WJQA 2EAYA 2D6FA 3G4SA 3OYFA 5AYFA 5GAOr 4J7IA 5EG2A 1NZ9A 3SWNC 4M77D 4QQ6A 2LTOA 3V8LA 3I55T 3J80E 4JLIA 4M7DA 3M4YA 3CCLA 2VGNA 4RKUE 2V8KA 4X9CA 1JBMA 2LQ8A 3GP8A 1VQ7T 3GNFB 4M77C 3E19A 3EFSA 4II1A 3S3OA 3L2QA 4IUPA 4A54A 3PNWC 4N4IA 3DB4A 2MMPA 2RI5A 1WQWA 2DPPB 4EMGA 3VYGA 4B9XA 3OYJA 1VQ4A 2P0KA 3VUBA 3L42A 3JSCA 3HRTA 3X25B 4L6V5 3KUFA 3M53A 2FB7A 3X26B 3BY7A 4BE2A 2WSCE 3C12A 4L59A 4C8QG 4XAXB 3X20B 3CCMT 4WF2A 1AHJB 2CZ0B 4XU1A 3JCMP 4M75D 4J7FA 4KBMB 5LL6S 1WJSA 3OYBA 1W4SA 3L2ZA 5GAN8 1VQMA 4M7DG 4C92F 4IUVA 3EFRA 4ME7A 2CZ1B 2RH2A 4C5HA 3M59A 5KE2A 4A4HA 3OYNA 3S3MA 5CKFA 1S72T 5GANh 3UDCA 3JCMc 4MDXA 4R56A 1BI1A 5GAOq 2JVVA 4P5NA 4XTWA 3OYDA 4DA4A 1VQ9A 1YITA 2PUOB 2ZCFB 2WSEE 1K73U 1YHQA 3DKMA 1M90C 2RHXA 2GFUA 2LCCA 4A4EA 5CK9A 3N5BB 4JS4A 4HCCA 1WQ7A 3QZ9B 4M7AF 3NTKA 1RI0A 3OSVA 2FVUA 3OYYA 4E7KA 4JRKA 2QXFA 3MEWA 4FL6A 4F7UE 5GAOp 5C6SA 4M75F 3UWNA 5GAN5 3OYKA 4ELYC 3OMGA 3X28B 5LJ5j 1BYMA 4ZGEB 1IREB 3J7AF 3H6ZA 4M75C 3M9QA 3CCJA 5M9OA 1W2BS 1X75C 1H641 4PJOG 1UEBA 3VUZA 4N0AC 1QVFS 4M7AC 1VQPT 2M1HA 1M90U 3JB9D 3LLRA 4C8QD 2OTJA 5A0GA 4QVZA 3LGFA 2Y4XA 2VYTA 2ZZDA 1JRIA 2F69A 3P8HA 3A8OB 3I56A 5D6YA 2EQJA 1XQHA 2K5IA 3C95A 3RUXA 3L2WA 4PJOF 3JCMh 2PQWA 3CMEA 3JB9F 1YBYA 2EIFA 2RHYA 5LJ5f 4X34A 3CXCA 3SFMA 1D3BA 3OBWA 2LNVA 3QG1A 3CCQA 2K5FA 2QEXT 1XOVA 2DIGA 2M16A 4HCZA 2PUKB 4C92C 5FLXE 1VQ4T 1KHCA 1UGSB 1IZ6A 4M7DC 1M9SA 2R5AA 4XTYA 3QXEB 4JS5A 3CCMA 5HY6A 2D0QB 5D6WA 3HHTB 5LJ3e 4IURA 5FROA 4PL6A 1JJ2A 2DZCA 1V29B 3P8BB 4Q5WA 4OP0A 3JCMV 5GANf 4OB3B 4ZN3A 3CCSA 4PKCC 3G6EA 2ZPEB 2LCLA 1VQKA 2VXFA 2RI3A 2Y4YA 3E9GA 3GNGA 2VXEA 3M4GA 5LJ3g 2O01E 3JCMb 2XICA 3CMAT 3T9NA 4BI4A 1KQ2A 4M7DE 1QP2A 2E10A 5J39A 1KC8C 2E6NA 3MCAB 3V7SA 5CVIA 3SDZA 2DAQA 4OB2B 4PJOD 1OZ2A 1XNIA 2FHDA 2HNIA 4C92A 2A3LA 5FRMA 4V2SA 1PSEA 1VQ9T 2PU9B 2BIVA 4XTZA 1Q7YU 5J26A 1PSFA 3HKSA 4M78B 1YJ9A 1JJ2S 3J81E 3CCRA 3JCMJ 1LOJA 1U1SA 2F5TX 2PVGB 1U8RA 1FXXA 2M0OA 4F7UA 3TREA 4EPCA 4OB1B 1M4ZA 4BE0A 2DVEA 3VJPA 5IAYA 1Y96A 4RG8A 3FRNA 4C8QF 4FT2A 5GAOn 2QA4T 3JCMg 4BY6C 3LX7A 4LDVA 2IG0A 3QIIA 1K9MC 5FU7C 4A53A 4KUIA 2K3XA 2EJGA 4M7AA 4ELZC 3ZFJA 1QVPA 4CI0C 5KCOA 5GANd 3CCJT 2JTFA 2R57A 4JLGA 4M75A 4BD3A 3CPWA 3WXMB 1N8RC 4J8OA 4XK8E 4QVDA 3G71A 5GANj 1VQPA 1LNXA 1Y07A 2OTJT 4XQ3A 4J5YA 2XDDA 5HK3A 1G3SA 2H3JA 4EMKC 3JAME 5GMKm 4JRPA 2VGMA 1Y96B 5LJ3h 1Q81U 3HFNA 3CC4A 2ZPGB 1VQLA 1VQNA 2E5QA 1OYXA 1K9MU 3V7CA 4JJNK 1YIJT 1RL2A 5GAOm 2RK1A 2L3RA 4TVRA 2HQXA 3L2VA 3M55A 1KD1C 2V8IA 1N6AA 2G3RA 3MEVA 1P92A 2RHIA 5GAMe 4N4HA 4E7LA 1Q82C 1NJIC 1BI0A 5FU7B 2B8AA 2PVOB 3M57A 2AHJB 1O75A 4QW2A 4RMOA 2E65A 3OYMA 4DOWA 3BDUA 3NFCA 4M7AD 4OMFB 4C8QE 1G3YA 1KQSS 3BW1A 2KQWA 4BE1A 2DXTA 3E1SA 1Q82U 2ZPFB 1NJIU 2EKOA 4OF1A 5DY9A 2QQRA 2VV5A 3JCMQ 4HCBA 1UGQB 1JB0E 3CMAA 1MHNA 2RI2A 4PLIA 1I4K1 3FIFA 3MEUA 4L5GA 5CKDA 5GAN7 4ZN1A 4XU3A 4JDSA 2R5MA 3MO8A 4NL3A 3WVDB 2NLUA 5I2SA 4XU0A 3L1AA 4HT8A 1M1FA 5IT9E 3AHUA 4PJOB 1YCYA 4EMHA 4C92D 2DTOA 1KQSA 2QQAA 1QVFA 2L5QA 3CPWS 4E7JA 3CC2A 1U1TA 5GAMh 3CC7T 2GFAA 3CCRT 2DZ9A 5KH6A 4JRQA 2L89A 3URGA 3CEYA 3MP1A 4MZMA 4RCBA 3CBPA 3FDRA 5DLQE 3RKWA 3LWIA 2QA4A 4FSXA 2DEQA 3QZ5B 3DLMA 3PT9A 3SWNA 1BIBA 2KSSA 3HL8A 3OBYA 4BI8B 3ZEHA 4BDZA 3TEEA 1YJWT 1XTDA 2DKGA 1NPPA 2O4XA 5GMKh 3TU4K 3CPFA 4M78A 3P8DA 3TCJA 4M7AG 4PJOE 5HKCA 3EAEA 3QUIA 3CCVA 1SSFA 4KULA 3QYHB 1YI2A 4M77E 5CKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A B;  1WPY A;  4C92 E;  1X01 A;  5LJ3 d;  3FB9 A;  5GAM f;  5GAN 6;  1M5Q 1;  2RM4 A;  2VXF A;  5LJ5 g;  5LJ3 g;  2VXE A;  3M4G A;  5LJ5 d;  3JCM b;  2RD1 A;  2K57 A;  1KQ2 A;  1HK9 A;  4J6W A;  5GMK i;  4M7D E;  4C8Q C;  1B34 A;  2E10 A;  2Y90 A;  4N0A A;  5LJ5 h;  3JB9 G;  1HXD A;  5GAN g;  3V7S A;  2EAY A;  2I2L A;  2EJ9 A;  3VU3 C;  4XTU A;  1WNL A;  1BIA A;  2ZGW A;  2HNI A;  5GAO r;  4C92 A;  3JCM e;  4V2S A;  4PJO D;  3SWN C;  3GIB A;  4M77 D;  4XTZ A;  4M75 B;  4M77 A;  3V8L A;  4EMK A;  3V7R A;  4M78 B;  4C8Q B;  4JLI A;  4MMK A;  3HFO A;  3HSB A;  5GMK e;  1D3B B;  3QHS A;  4RCC A;  4M7D A;  3QO3 A;  3JCM J;  4X9C A;  1JBM A;  1LOJ A;  1U1S A;  2QTX A;  4M77 C;  4XTX A;  3EFS A;  4M75 G;  4F7U A;  2DVE A;  1I81 A;  1Y96 A;  4C8Q F;  4A54 A;  5GAO n;  4PJO C;  2YHT A;  2VC8 A;  3JCM g;  1WQW A;  4EMG A;  4XTV A;  3JCM d;  4A53 A;  4DQ2 A;  3V8J A;  1MGQ A;  2EJG A;  2FYK A;  2FB7 A;  4HT9 A;  3BY7 A;  3RIR A;  4M7A A;  5CAI A;  4C8Q G;  5GAN d;  2YLB A;  4WF2 A;  5LJ5 e;  4M75 A;  4XU1 A;  4M77 B;  4F7U G;  4M75 D;  3JCM P;  4QVD A;  5GAN j;  5GAN 3;  4Y91 A;  1LNX A;  3L2Z A;  4XQ3 A;  4J5Y A;  5GAN 8;  4M7D G;  2DTI A;  4C92 F;  3V8K A;  3EFR A;  1I5L A;  3JCM X;  2EJF A;  4NOY A;  4EMK C;  5GMK m;  4J6X A;  1Y96 B;  2DJZ A;  5LJ3 h;  3HFN A;  5GAN h;  4JUV A;  4M7D F;  3JCM c;  4M7A E;  3V7C A;  5GAO q;  5GAM g;  4XTW A;  4F7U F;  5GAO m;  4M75 E;  4F7U B;  2RA2 A;  2E41 A;  2RB6 A;  3RES A;  4C92 G;  5GAM e;  1KQ1 A;  3JCM f;  5I21 A;  3JB9 J;  3BFM A;  1M8V A;  3INZ A;  2DTH A;  2CGH A;  1WQ7 A;  3SB2 A;  3JB9 H;  4PJO A;  2E64 A;  3QSU A;  4PNO A;  3JCM W;  2E65 A;  4M7A F;  5GMK l;  1I8F A;  3BDU A;  3SWN B;  4JRK A;  1N9S A;  4M7A D;  1LJO A;  4C8Q E;  4F7U E;  5GAO p;  5GAN 5;  4M78 C;  4M75 F;  3BW1 A;  4X9D A;  2DXT A;  5LJ5 j;  5DY9 A;  5LJ3 j;  5GAN e;  4M77 G;  3RKY A;  3JCM Q;  5GAN 4;  4M75 C;  4M78 F;  4J6Y A;  1I4K 1;  3FIF A;  4QVC A;  4PJO G;  1H64 1;  5GAN 7;  4HA8 A;  4XU3 A;  2EWN A;  4N0A C;  4M7A C;  4NL3 A;  3RKX A;  3JB9 I;  5LJ3 f;  3JB9 D;  4C8Q D;  5GAN 2;  4XU0 A;  3L1A A;  4HT8 A;  3AHU A;  4PJO B;  1B34 B;  1YCY A;  2JN0 A;  3FJP A;  1N9R A;  2DTO A;  4C92 D;  4EMH A;  1JRI A;  4JRI A;  1U1T A;  4M78 E;  5GAM h;  2DXU A;  3RUX A;  4NL2 A;  4C92 B;  2DZ9 A;  1TH7 A;  4PJO F;  5GAM j;  5GAM d;  3JCM h;  3JB9 F;  4RCB A;  5LJ5 f;  4M7D C;  3RKW A;  4M78 G;  5GMK j;  4M77 F;  1D3B A;  4MML A;  5GAO l;  2DEQ A;  3SWN A;  1BIB A;  2E1H A;  2YLC A;  4C92 C;  3RER A;  4M7D D;  2DKG A;  5GAN f;  5GMK h;  4M78 D;  4EMK B;  4XTY A;  4M78 A;  4C8Q A;  4M7D B;  4PJO E;  4M7A G;  4XU2 A;  3PGG A;  5LJ3 e;  3QUI A;  2DZC A;  3JCM V;  4M77 E;  4OP0 A; 
#chains in the Genus database with same CATH topology
 2OTJ Q;  2FZC B;  3CQT A;  2RM4 A;  3I9Q A;  1N8R U;  3M0Q A;  2DX1 A;  5GAN g;  3PVQ A;  2RMO A;  4QQG A;  2F1L A;  1BU1 A;  1I0C A;  2JTM A;  2L3P A;  4OGE A;  4MMK A;  3HSB A;  4GBQ A;  2KT1 A;  2XK0 A;  1V76 A;  1ZSZ B;  3M58 A;  4DEY A;  4XTV A;  1QVG A;  3OS1 A;  2KRS A;  4Z02 A;  2X35 A;  1KQS P;  1GBR A;  2YLB A;  1M3A A;  2DFU A;  3OYH A;  4Y91 A;  1IB8 A;  3EGD A;  1I5L A;  2A37 A;  2ENM A;  1ZA2 B;  4J9I A;  2CYZ B;  2ZPB B;  4LDY A;  1I1J A;  1OUL A;  3CCE T;  3OYC A;  4C0G A;  1WJR A;  3A8L B;  3BFM A;  3MET A;  3ZL7 C;  1TUG B;  3UAT A;  2DF6 A;  2AT1 B;  1LPL A;  1OOT A;  2QI2 A;  3C4S A;  2KMT A;  3M0U A;  3LYI A;  2PVD B;  2C0T A;  2EYY A;  3CCU T;  5CCA A;  4QVC A;  2DXB A;  4C0F A;  2EWN A;  4C5I A;  2PTK A;  1D1C A;  3UPU A;  2J7I A;  3OS2 A;  3G4S Q;  2DL4 A;  2O2O A;  2ZPI B;  4M78 G;  2AKK A;  3QPH A;  5GAO l;  2DMO A;  2VWF A;  1HYO A;  2D1X A;  3EG2 A;  4A4K A;  2KDS A;  4EMK B;  2WSF E;  4E7H A;  2XU8 A;  4XU2 A;  1JU5 C;  3CD6 Q;  4BAC A;  4N4G A;  2EQK A;  5LJ5 g;  2QEX A;  2RJE A;  2RD1 A;  2RQV A;  3ME9 A;  1X27 A;  4OB0 B;  4PLL A;  1M1K R;  5LJ5 h;  1M3B A;  3NHN A;  2ZGW A;  4KH1 B;  1K73 C;  2MWP A;  2MI6 A;  4IIM A;  1QVF P;  3EFO B;  3G6E T;  2OAU A;  1YJW Q;  1VQK T;  1OQK A;  4Z88 A;  4RG2 A;  1N5Z A;  2OTL T;  4MZP A;  2QTX A;  4XTX A;  4GLK A;  2DK3 A;  2XD0 A;  5CR2 A;  3PIP A;  2C06 A;  1YWO A;  1PKT A;  1EIF A;  3V8J A;  3RIR A;  3OW2 A;  3CCU A;  2E5K A;  2K5L A;  3S6W A;  1VUB A;  2NUZ A;  1WHK A;  3G7Z A;  3JCM X;  1X6O A;  4M7A E;  3RMS A;  3O5Z A;  2FPF A;  3H0H A;  2X9H A;  1WYX A;  1WGS A;  4C0D C;  5KE3 A;  3OMC A;  4HVU A;  3CD6 T;  4QT7 A;  3JB9 J;  3JCM f;  5I21 A;  1Q86 C;  1FWZ A;  3X24 B;  2DTH A;  1M3C A;  2E64 A;  1ACM B;  1LCK A;  1D0Y A;  2F2V A;  4FIB A;  1I8F A;  4CC7 A;  2K2V A;  2QYZ A;  1YIJ Q;  1WXT A;  4X9D A;  3C94 A;  2D8H A;  4O6J A;  3CC7 A;  5GAN e;  1YFN A;  4PJN A;  3VS5 A;  5FRN A;  4R55 A;  2HSP A;  1QQJ A;  3ULR B;  1VA7 A;  5I22 A;  2DER A;  2JN0 A;  1G83 A;  5CQY A;  1N9R A;  2XID A;  2RHZ A;  2W0Z A;  4BI3 A;  3ASK A;  1O9S A;  1RAA B;  2LMJ A;  3LGL A;  5GAM j;  1M1G A;  2QA4 Q;  1YI2 T;  4MML A;  2GTO A;  4D6W A;  3WVE B;  3KBG A;  2EGE A;  4C5E A;  3CBO A;  3MP6 A;  3JRZ A;  1VQ8 A;  2HL3 A;  3GPL A;  5GMK i;  1EZZ B;  2RF0 A;  2XG8 D;  1FMV A;  3OA6 A;  2D6F A;  1PRM C;  4J7I A;  1WHH A;  2AZS A;  4CC3 A;  4X9C A;  2LQ8 A;  2F2X A;  3A1P A;  3E19 A;  1CKB A;  4A54 A;  1NLP C;  1K0X A;  1MND A;  2DPP B;  4EMG A;  4B9X A;  3VUB A;  3X26 B;  3L42 A;  1ABQ A;  3M53 A;  4BE2 A;  3C12 A;  2CZ0 B;  3MKD A;  4E7Z A;  1W4S A;  1TOV A;  4ME7 A;  2CZ1 B;  2RH2 A;  3M59 A;  5KE2 A;  1NYG A;  4A4H A;  3S3M A;  2EYX A;  5CKF A;  1QKX A;  1S72 T;  2GNC A;  4R56 A;  4XTW A;  3H0I A;  3OYD A;  4DA4 A;  2ESW A;  1A0N B;  2SRC A;  1M90 C;  2GFU A;  4J9G A;  5CK9 A;  1WQ7 A;  2MK5 A;  1JJ2 P;  1RAB B;  3MEW A;  4DBH A;  1PC0 A;  3UWN A;  3VS1 A;  1S72 Q;  2EW3 A;  3CCJ A;  3C0C A;  3FJ5 A;  5M9O A;  1W2B S;  4PJO G;  4M7A C;  1VQP T;  1M90 U;  3G1J A;  3SHW A;  4A63 B;  2F69 A;  4LUD A;  2SEM A;  5D6Y A;  1XQH A;  3I56 A;  3C95 A;  4DBR A;  4PJO F;  2EIF A;  2RHY A;  4E6R A;  4X34 A;  2K3B A;  2CUD A;  3CCQ A;  2K5F A;  1XOV A;  2DIG A;  4HCZ A;  1KHC A;  5KYW A;  2R5A A;  4XTY A;  3QXE B;  1HJD A;  5D6W A;  5FRO A;  3JCM V;  5IHI A;  1V1C A;  2HKN A;  4PKC C;  3G6E A;  2LCL A;  1AZE A;  2HAX A;  2VXE A;  2KGT A;  1KQ2 A;  1QP2 A;  2E10 A;  5J39 A;  3RBB B;  1RLP C;  3EHR A;  2JS0 A;  1OZ2 A;  1XNI A;  2HNI A;  4OB2 B;  4C92 A;  2A3L A;  1W2B P;  1PSE A;  1VQ9 T;  2BIV A;  1PSF A;  4M78 B;  2BZ8 A;  4JJD A;  2ZAE A;  3SEM A;  2YUQ A;  1FXX A;  2M0O A;  4EPC A;  2K9G A;  2HDA A;  4C8Q F;  2QA4 T;  1M2O A;  5FU7 C;  4A53 A;  1NEG A;  4KUI A;  2FZK B;  2EJG A;  3CCU Q;  4M7A A;  4J9B A;  4ELZ C;  3ZFJ A;  1QVP A;  5GAN d;  4BD3 A;  4LDX A;  3WXM B;  2J6K A;  4J8O A;  8AT1 B;  4D8K A;  1Q81 U;  1NG2 A;  1OYX A;  1YIJ T;  2L3R A;  2V8I A;  1ZSZ A;  2G3R A;  1P92 A;  5GAM e;  2HBW A;  2OJ2 A;  4QW2 A;  1G2B A;  4OML A;  4OMF B;  4C8Q E;  1G3Y A;  2KQW A;  3VS2 A;  1Q82 U;  1NJI U;  1WI7 A;  2EKO A;  2M02 A;  5DY9 A;  4RTW A;  3EGD B;  2HCK A;  4FW2 A;  2CP2 A;  3MEU A;  1K73 R;  5GAN 7;  4ZN1 A;  2FZG B;  5I2S A;  1M1F A;  4PJO B;  2DTO A;  2L5Q A;  1G8X A;  1PCX A;  2L2P A;  2L89 A;  4AT1 B;  4MZM A;  4RCB A;  3FDR A;  3RKW A;  3LWI A;  2QA4 A;  4FSX A;  2DEQ A;  1E6H A;  1BIB A;  1C0M A;  2KSS A;  3HL8 A;  3OBY A;  4FW1 A;  3ZEH A;  3TEE A;  1UG1 A;  1YJW T;  3CPF A;  1C1A A;  1SSF A;  3CCV A;  4KUL A;  1YI2 A;  4M77 E;  3G71 T;  1WPY A;  3GLX A;  1AVZ C;  2X4J A;  1GBQ A;  3CBM A;  3JB9 G;  2DBK A;  3M0S A;  2I2L A;  4HXJ A;  3VU3 C;  3ZBD A;  2BTT A;  1E6G A;  3QWY A;  2O4X B;  2NUP A;  2RK2 A;  4FYW B;  1IGU A;  2RJC A;  5GMK e;  5IXB A;  1KC8 U;  3HTR A;  5AT1 B;  2HD0 A;  1I81 A;  2DBM A;  3E2U A;  2E6Z A;  4E2F B;  3JCM d;  2X4X A;  2E4H A;  3KXT A;  4PK4 A;  5DM7 R;  1S72 A;  1R8O B;  3NPF A;  1K9M R;  5CAI A;  1VQ6 A;  4A4G A;  3EH1 A;  3PMI A;  4M77 B;  1W6X A;  3A8H B;  1PKS A;  1TU0 B;  2DLP A;  4LNP A;  1WHJ A;  1WZO A;  2BZY A;  2MYS A;  4C0Z A;  4LUE A;  3NGP A;  3OQ5 A;  4M7D F;  5A0L A;  2AZV A;  5KYY A;  1WXU A;  2RJD A;  3H0F A;  1G3T A;  2RQU A;  4C92 G;  5L8R E;  2P0P A;  2OTL A;  2ZPH B;  1D09 B;  3JCM W;  4ORZ A;  2COZ A;  1VIF A;  1AWX A;  3EGX B;  4MDW A;  2COW A;  4M78 F;  2DIQ A;  4RTX A;  1WIE A;  3CME T;  3CPW P;  2RHU A;  2K7A A;  1MV0 B;  4DOV A;  1YWP A;  1RI9 A;  2DIL A;  3M5A A;  4GLM A;  3CC2 Q;  2DJQ A;  2E70 A;  1XJW B;  3O8V A;  1U3O A;  1RUW A;  3F70 A;  4M7D C;  1QP3 A;  1PG5 B;  1H3H A;  2GQV A;  3EG9 B;  1NE8 A;  1X69 A;  2ECZ A;  2O9V A;  3L2U A;  4IKF A;  1ZUY A;  2QQB A;  3OSS C;  3CCJ Q;  3TVT A;  2LNH B;  3OYG A;  3ER0 A;  3OB9 A;  1UE9 A;  5DLO A;  3OYA A;  2NUT B;  3MPU B;  4ELY C;  2KAF A;  2LT1 A;  2CKK A;  2DD5 A;  4EIK A;  3QJ6 A;  3CCE A;  3LWH A;  4UC4 A;  1C6V X;  3QO3 A;  1WHM A;  4M75 G;  1SG5 A;  2L8D A;  1OX9 A;  1W70 A;  2YHT A;  2COY A;  1RAD B;  4ATO A;  4DQ2 A;  1MGQ A;  3GOX A;  2KNB B;  3HRS A;  4F7U G;  1OI1 A;  3NTI A;  3LW5 E;  2JUF A;  2B86 A;  4NOY A;  3PE0 A;  4JUV A;  3LH5 A;  2QQ9 A;  1RAF B;  3OW2 S;  2XKO C;  1I07 A;  3HRU A;  1GCQ A;  4M75 E;  1UGR B;  4J83 A;  3OS0 A;  3A98 A;  5KCH A;  1QKW A;  4D8D A;  1VQ7 A;  2CGH A;  1MNE A;  2BZX A;  4ZTJ A;  1K8A C;  3SWN B;  2A7Y A;  6AT1 B;  3EG1 A;  1Y71 A;  2KK4 A;  2X3W D;  4QQD A;  3SD4 A;  4OMN A;  3LH0 A;  2DXC A;  3RMQ A;  1G5V A;  4LDU A;  1Y7X A;  5I11 A;  2HEQ A;  5CQX A;  2YT6 A;  2CZ6 B;  1ARK A;  3QYG B;  1TG0 A;  2DYB A;  1GFD A;  5GMK j;  4M77 F;  5I2M A;  2X4Y A;  2CS7 A;  2JW4 A;  2A0F B;  3VS4 A;  2D9T A;  3RER A;  2O9S A;  4M7D B;  2LX9 A;  2LVM A;  3PGG A;  5J3B A;  3L2R A;  1H92 A;  4WCI A;  1BI3 A;  2F5K A;  5LJ3 d;  3OY9 A;  2MIO A;  3NTH A;  4DBF A;  1D0X A;  4C8Q C;  4N0A A;  1QCO A;  1HXD A;  1WJQ A;  2KRM A;  3G4S A;  2LTO A;  3V8L A;  4LE9 A;  4RKU E;  1F1B B;  1VQ7 T;  2OTL Q;  1VQL Q;  4IUP A;  4N4I A;  3DB4 A;  3UA6 A;  1WQW A;  2ROL A;  3OYJ A;  2P0K A;  1NBE B;  3JSC A;  2FB7 A;  2F2W A;  2WSC E;  4L59 A;  2A36 A;  3X20 B;  3CCM T;  4M75 D;  4J7F A;  5LL6 S;  1ZUU A;  4C92 F;  2Z0W A;  4C5H A;  3REB B;  2RQR A;  1PD0 A;  2EQI A;  2EGA A;  1VQ9 A;  1T3S A;  1YIT A;  2CP6 A;  2PUO B;  2J06 A;  2JM8 A;  1YHQ A;  3DKM A;  2FG0 A;  1M2V B;  3NTK A;  1RI0 A;  4E7K A;  4F7U E;  5C6S A;  3OMG A;  1BYM A;  3CCR Q;  2RPN A;  1IRE B;  1MMA A;  5EC7 A;  3J7A F;  3H6Z A;  4M75 C;  2QEX Q;  3M9Q A;  1IHW A;  2JM9 A;  1UEB A;  3CCS Q;  3VUZ A;  2M51 A;  2M1H A;  1JRI A;  2FPE A;  3P8H A;  3A8O B;  2HQH A;  1QWF A;  2KEA A;  3PVL A;  2HL5 C;  3JB9 F;  3SFM A;  1D3B A;  3OBW A;  2LNV A;  3QG1 A;  4PFZ A;  1IO6 A;  2M16 A;  2H3E B;  1IZ6 A;  1BCO A;  5HY6 A;  2KBT A;  4IUR A;  2X3X D;  3P8B B;  4OP0 A;  2AKL A;  1TSF A;  4OB3 B;  5KYN A;  5LJ3 g;  2XIC A;  1RLQ C;  4PJO D;  2FHD A;  4V2S A;  4XTZ A;  2EPD A;  4J9D A;  3CCR A;  1YHQ Q;  2PVG B;  2F5T X;  1U8R A;  4F7U A;  4ESR A;  4BE0 A;  5IAY A;  1Y96 A;  1WXB A;  4BY6 C;  1K9M C;  3CC7 Q;  2O31 A;  1PNJ A;  2P84 A;  2EVR A;  5KYU B;  3D7S B;  5KCO A;  3CCJ T;  2R57 A;  4M75 A;  2OI3 A;  4F14 A;  4XK8 E;  2OTJ T;  1SRM A;  1K1Z A;  1G3S A;  4EMK C;  3CC4 A;  5GMK m;  1JXM A;  3HFN A;  2ZPG B;  1E7O A;  3EH2 A;  1K9M U;  3V7C A;  3CCE Q;  2RK1 A;  1D1A A;  2HQX A;  1TUC A;  2XMF A;  1FMW A;  2I0N A;  4E7L A;  3RNJ A;  1YP5 A;  1BI0 A;  5FU7 B;  2YRD A;  1O75 A;  2YDL A;  1UUE A;  1PM3 A;  3BDU A;  3NFC A;  1WFW A;  4DOW A;  4M7A D;  1HSQ A;  4BE1 A;  3E1S A;  2ZPF B;  2G6F X;  4HCB A;  1JB0 E;  2BE7 D;  3FIF A;  4HVV A;  5CKD A;  1R0C B;  4FYX B;  2YSQ A;  3WVD B;  3L1A A;  5IT9 E;  1YCY A;  1QVF A;  2QQA A;  4WTO B;  3CC2 A;  1U1T A;  5GAM h;  1VYU A;  2DZ9 A;  4F17 A;  3CBP A;  5DLQ E;  2CP0 A;  3QZ5 B;  3DLM A;  2MPX C;  3PT9 A;  2DKG A;  2OX7 A;  4M78 A;  3P8D A;  4PJO E;  4M7A G;  5HKC A;  3EAE A;  1ABO A;  2X4W A;  1RAC B;  1SPK A;  5D7U A;  5GAN 6;  2KY9 A;  5LJ5 d;  2ABL A;  1HK9 A;  3CC4 T;  5CKB A;  2Y90 A;  1GFC A;  5KYX A;  2JT4 A;  3E9F A;  2K4Y A;  4CC2 A;  2CZ7 B;  4C8Q B;  4OVA A;  4O5V A;  3OYI A;  4YTL A;  3G4S T;  4MZT A;  1BKB A;  2FL7 A;  4AFU C;  4BB7 A;  3CCL T;  1N27 A;  1Q81 R;  2VVK A;  4IUU A;  5LJ5 e;  5GAN 3;  1W2B A;  2V8J A;  2JZ2 A;  1QWE A;  3V8K A;  3QWX X;  3H9N A;  5IN1 A;  4F16 A;  1VOM A;  1QVG S;  3HP9 A;  1CSK A;  1KIK A;  3M0T A;  5GAM g;  2HMA A;  4FYV B;  1T0H A;  2AK5 A;  5HCK A;  2ATC B;  1Q81 C;  1M1K U;  2CP5 A;  2LJ3 A;  1AEY A;  3JB9 H;  4PJO A;  2RQW A;  3DLL A;  4HKE A;  1SHF A;  1QLY A;  2DO3 A;  4M78 C;  3R6O A;  3CCV Q;  2BE9 B;  4GY5 A;  1VQ4 Q;  5LJ3 j;  2BKD N;  1EX4 A;  1T3L A;  2K79 A;  2MAM A;  1VQ5 T;  3GF5 A;  1OPK A;  4HA8 A;  2P4T A;  4VUB A;  2EQU A;  2JNG A;  2K2M A;  3CCQ T;  1RAG B;  5GJV B;  4F04 B;  3FJP A;  1Q95 G;  3PMT A;  1OU9 A;  4Z8A A;  1TH7 A;  2MF2 A;  2EKH A;  3M54 A;  4OGC A;  4M7D D;  2LP5 A;  2NUP B;  1VQ6 T;  4M78 D;  3EFO A;  1Z9Q A;  3THK A;  2JMC A;  4OMM A;  2LDM A;  2NYS A;  3OS5 A;  1X01 A;  4DEX A;  1YIT Q;  3H8Z A;  4FU6 A;  4IUQ A;  5ECA A;  3VS3 A;  4IIO A;  3I5S A;  4KUD K;  2DL3 A;  4LDW A;  1VQO A;  4EDU A;  4KRT A;  3VV0 A;  2WAC A;  4XTU A;  1BIA A;  1WA7 A;  4KGZ B;  3GIB A;  2XDB A;  4PJL A;  5CKE A;  4EMK A;  3V7R A;  1H3Z A;  3QHS A;  4AG1 C;  1FYN A;  4PJO C;  2JMA A;  4PJJ A;  2QK0 A;  2LQK A;  1MMD A;  4BDY A;  2FYK A;  2DE0 X;  1DJ7 B;  2HQE A;  4CRI A;  4AG2 C;  4C5G A;  3TQ7 P;  3G71 Q;  2MWO A;  2RN8 A;  5CO7 A;  2EJF A;  2EYW A;  2KT8 A;  2P0Q A;  3KFV A;  1Q86 U;  1Q7Y C;  4JZ3 A;  2KVQ G;  3DB3 A;  2LRQ A;  2P4R A;  2YRV A;  3PTA A;  2E41 A;  3RES A;  1KQ1 A;  1VQ6 Q;  1M8V A;  3INZ A;  1N8R R;  4LD6 A;  1OEB A;  1GRI A;  3QSU A;  2K3Y A;  2KYB A;  3PIO A;  2LC4 A;  1KFZ A;  5FU6 B;  2V26 A;  2RNA A;  5L23 A;  2DRK A;  4BUG A;  3QJY A;  2QAZ A;  3RKX A;  2EFI A;  2QGF B;  2OAW A;  3UA7 A;  1ZBX A;  1BB9 A;  2XDP A;  1B34 B;  1UGP B;  2V1Q A;  4JRI A;  4M78 E;  5IHN A;  1RAI B;  2NUT A;  5A2Q E;  1YIT T;  5IH2 A;  3M0P A;  3S3N A;  4JZ4 A;  2D8J A;  1WHL A;  2E1H A;  3QKJ A;  1WHG A;  5D6X A;  4CC4 B;  1UJY A;  4ZGJ B;  2KXD A;  1NYF A;  3IQL A;  2JTE A;  1RAE B;  4C92 E;  5GAM f;  3FB9 A;  1KC8 R;  2K57 A;  2QDL A;  3MP8 A;  4J9C A;  1TS9 A;  1AWJ A;  1NZ9 A;  3SWN C;  4M77 D;  4QQ6 A;  3J80 E;  1MV3 A;  2VGN A;  3CCL A;  2V8K A;  3GP8 A;  3EFS A;  1VQ5 Q;  4II1 A;  3M0R A;  3S3O A;  3L2Q A;  2RI5 A;  3HRT A;  1MMG A;  3KUF A;  4L6V 5;  4XAX B;  4X1V A;  2C0I A;  3L2Z A;  2DEU A;  1K9A A;  4IUV A;  3EFR A;  3H41 A;  1K76 A;  3OYN A;  1FMK A;  5GAN h;  3UDC A;  2JS2 A;  1BI1 A;  1GL5 A;  5GAO q;  2JVV A;  4P5N A;  4FYY B;  2ZCF B;  2WSE E;  1K73 U;  2CH4 A;  2LCC A;  2RHX A;  3N5B B;  4M7A F;  1Q82 R;  1NJI R;  1OX8 A;  3OYY A;  2QXF A;  5GAN 5;  4M75 F;  5FWB A;  3X28 B;  4ZGE B;  2KE9 A;  4ZNX A;  1YJ9 Q;  1X75 C;  1H64 1;  5KYW B;  1QVF S;  2OTJ A;  1JXO A;  4FSS A;  3R6N A;  2PZ1 A;  5A0G A;  2CT4 A;  2VYT A;  2EQJ A;  2K5I A;  3L2W A;  2VB6 A;  3CME A;  2J6O A;  3CXC A;  3RDV A;  1CKA A;  2QTV A;  2QEX T;  2CUB A;  3I56 Q;  4C92 C;  5FLX E;  2PUK B;  1VQ4 T;  3I55 Q;  1AZG B;  1UGS B;  1QMC A;  1PHT A;  4J9F A;  1M9S A;  3CCM A;  1SKU B;  2D0Q B;  3HHT B;  4PL6 A;  3EG0 A;  4Q5W A;  2ZPE B;  1VQK A;  3GNG A;  3JCM b;  3E9G A;  2JXB A;  2O01 E;  3CMA T;  2ED1 A;  3T9N A;  4BI4 A;  1W1F A;  3V7S A;  3SDZ A;  1M8M A;  2CSI A;  2IPO B;  2PU9 B;  1Q7Y U;  4K11 A;  5J26 A;  1ZUK A;  1YJ9 A;  1LOJ A;  1U1S A;  9ATC B;  1VQ7 Q;  4J9H A;  1VQO T;  3TRE A;  4OB1 B;  4PJM A;  1UHC A;  2DVE A;  3VJP A;  4RUG A;  4RG8 A;  3FRN A;  2V1R A;  4FT2 A;  2CDT A;  1Z9Z A;  3JCM g;  2CT3 A;  4LDV A;  2IG0 A;  3QII A;  1NM7 A;  1Y0M A;  2K3X A;  1UTI A;  1VQN Q;  2JTF A;  3CPW A;  1N8R C;  5GAN j;  1VQP A;  1LNX A;  4XQ3 A;  4DBQ A;  2XDD A;  4JRP A;  3AT1 B;  7AT1 B;  3CCM Q;  2DET A;  1M90 R;  4TVR A;  3L2V A;  1N6A A;  3MEV A;  1Q82 C;  2RHI A;  1NJI C;  4N4H A;  1H8K A;  2B8A A;  5FW9 A;  3EGU A;  2E65 A;  1OU8 A;  1KQS S;  1VQ8 Q;  2DXT A;  4QKU A;  4AFS C;  1UGQ B;  2KRO A;  3CMA A;  4PFO A;  4L5G A;  2ROT A;  1YI2 Q;  3I5R A;  4JDS A;  4B6M A;  3MO8 A;  2NLU A;  1QCN A;  3AHU A;  4HT8 A;  5IHK A;  4E7J A;  3CC7 T;  3CCR T;  1AWO A;  3CEY A;  3MP1 A;  1BCM A;  3SWN A;  4BI8 B;  4BDZ A;  2HZY A;  1XTD A;  1NPP A;  2O4X A;  4R0K A;  3TU4 K;  3TCJ A;  2A28 A;  5FU6 C;  5CKH A;  2HSE B;  1Q7Y R;  3I55 A;  2JJ9 A;  2LT4 A;  2DL5 A;  1YJN A;  3VRZ A;  1ZSG A;  1VQN T;  1FX7 A;  1WNL A;  3NMZ C;  3REA B;  3JCM e;  4KT0 E;  2KRN A;  4M75 B;  4M77 A;  2H8H A;  3JV3 A;  1VQ8 T;  2VKN A;  1NPR A;  1K8A U;  1Y57 A;  1ZQ1 A;  2VC8 A;  1KD1 U;  4HT9 A;  8ATC B;  3QBY A;  5HK0 A;  1VQP Q;  2YWW A;  2GQI A;  4HVW A;  1VQM Q;  4LD9 K;  1YHQ T;  3VS6 A;  3EGX A;  3RR6 A;  4J6X A;  2DJZ A;  3PFS A;  2EQM A;  3QDR B;  2KI7 A;  2RA2 A;  2RB6 A;  1VQM T;  3CXC S;  1WDX A;  1BBZ A;  1YJW A;  4PNO A;  1KK7 A;  1VQO Q;  2LJ0 A;  1RAH B;  1LJO A;  2DM1 A;  2YXY A;  2FO0 A;  1VQK Q;  2L0A A;  2QDY B;  1K4U S;  2YUO A;  2E3I A;  4M77 G;  3I56 T;  2VUB A;  3EG9 A;  1YJN T;  3FC3 A;  5KYY B;  1KG1 A;  4KGV B;  1R77 A;  3JB9 I;  5LJ3 f;  5GAN 2;  2QQS A;  2IIM A;  1WX6 A;  3CCL Q;  1X2Q A;  4BY6 B;  3VYH B;  5CIU A;  4FT4 A;  3FLG A;  4RTV A;  1VIE A;  3VRY A;  4AFZ C;  4AMC A;  4C92 B;  5GAM d;  1GCQ C;  2R58 A;  3CCS T;  1WLP B;  3A8M B;  3CME Q;  3CD6 A;  2MCN A;  3Q1J A;  2YLC A;  2CP3 A;  4JJC A;  1VYT A;  4C8Q A;  1AOJ A;  1TXQ A;  1OZ3 A;  4M7A B;  1BK2 A;  4IUT A;  5A0D A;  2KYM A;  2QGG A;  3OYL A;  2DNU A;  2JOY A;  3A8G B;  1B34 A;  2YUP A;  2ED0 A;  2EJ9 A;  3VS7 A;  1ZLM A;  4ZGD B;  3U23 A;  2RO0 A;  1JO8 A;  2XHC A;  3VS0 A;  2K6D A;  3HFO A;  2GF7 A;  1D3B B;  4RCC A;  1PD1 A;  4M4Z A;  1M1K C;  2HBP A;  3HPW A;  5FWC A;  1KJW A;  2A08 A;  4J9E A;  3M56 A;  2M9U A;  1YJ9 T;  1KD1 R;  2DRM A;  2BUD A;  1VQ5 A;  1YIJ A;  2LCS A;  4FM4 B;  1PRL C;  2IVW A;  1VYV A;  3OYE A;  4Z89 A;  2DD4 A;  2DTI A;  2RJF A;  1S1N A;  1K8A R;  1T0J A;  2DL8 A;  1QW1 A;  2L3S A;  4F7U F;  1GCP A;  2KXC A;  4F7U B;  2GGR A;  2NWM A;  4RTT A;  4E7I A;  4LXC A;  3FEO A;  3SB2 A;  1BI2 A;  1VQL T;  5GMK l;  1N9S A;  4Y28 E;  4E47 A;  3MEA A;  4KGX B;  4C0D B;  2GCX A;  2E12 A;  3CC2 T;  1UB4 A;  5GAN 4;  4B9W A;  3RKY A;  3MHX A;  2LJ1 A;  4J6Y A;  1Q86 R;  1G3W A;  2XI9 A;  3A5Z B;  4JJB A;  2DVJ A;  2DL7 A;  3OW2 P;  2DXU A;  3VKI A;  4NL2 A;  3CMA Q;  3CCV T;  4NS5 A;  2E3H A;  1KHI A;  1B3Q A;  1ZHI A;  3BDL A;  1M27 C;  3UT1 A;  2EYQ A;  3G6E Q;  2LQN A;  4ZTF A;  2LQW A;  2D0N A;  2YRC A;  1M5Q 1;  1IHV A;  1GXI E;  1SF9 A;  1X2K A;  2CSQ A;  5C0M A;  4A4F A;  4J6W A;  2O88 A;  2EAY A;  3OYF A;  1IRX A;  5AYF A;  5GAO r;  5EG2 A;  2CRE A;  1NEB A;  3I55 T;  2CP7 A;  4JLI A;  4M7D A;  3M4Y A;  1JBM A;  4LN2 A;  2C0O A;  3GNF B;  4M77 C;  2M0Y A;  2GBQ A;  3MJX A;  3PNW C;  1U06 A;  2MMP A;  3VYG A;  1MMN A;  1VQ4 A;  1TUD A;  3X25 B;  1J3T A;  3BY7 A;  1YN8 A;  4C8Q G;  4WF2 A;  1AHJ B;  2FEI A;  4XU1 A;  3JCM P;  1IGQ A;  4KBM B;  1OPL A;  1WJS A;  3OYB A;  5GAN 8;  1VQM A;  4M7D G;  5KYX B;  4OMQ A;  2J6F A;  1MUZ A;  3JCM c;  4MDX A;  1OV3 A;  2EBP A;  1UHF A;  4A4E A;  4HCC A;  2QAS A;  4JS4 A;  3QZ9 B;  1LVK A;  3OSV A;  2FVU A;  4JRK A;  1TWB A;  1X6G A;  4FL6 A;  5GAO p;  2KR3 A;  3OYK A;  1X6B A;  2GTJ A;  5LJ5 j;  1M30 A;  4Y92 A;  1IXD A;  2DYI A;  1YJN Q;  5IXF A;  4OMO A;  3GBQ A;  4OMP A;  4N0A C;  1YNZ A;  3JB9 D;  3LLR A;  4C8Q D;  1M2V A;  1X43 A;  4QVZ A;  2RQT A;  3LGF A;  2Y4X A;  1TTH B;  1AT1 B;  2ZZD A;  1YCS B;  3RUX A;  1EFN A;  2VAS A;  3JCM h;  2PQW A;  1QVG P;  1YBY A;  5LJ5 f;  1JEG A;  2PNI A;  2FPD A;  1PWT A;  1D0Z A;  1NLO C;  2DA9 A;  3QDF A;  1QCF A;  2EYZ A;  2X51 A;  4JS5 A;  5LJ3 e;  3UF4 A;  1JJ2 A;  2DZC A;  1V29 B;  2MOX A;  1ZBJ A;  1KSW A;  5GAN f;  2AIR B;  3CCS A;  2QG9 B;  4ZN3 A;  2VXF A;  2RI3 A;  1R0B G;  2Y4Y A;  3TSW A;  3M4G A;  4KH0 B;  1SRL A;  4M7D E;  1ZA1 B;  1KC8 C;  2E6N A;  3MCA B;  2FRY A;  5CVI A;  2DAQ A;  5KYU A;  5FRM A;  3CXC P;  2FRW A;  3HKS A;  1I5O B;  1JJ2 S;  1K0S A;  1B7T A;  3J81 E;  3JCM J;  2HKQ B;  3EG3 A;  1JQQ A;  1M4Z A;  2EGC A;  1D1B A;  2YUN A;  3I35 A;  4HCK A;  5GAO n;  4RTU A;  3LX7 A;  1HD3 A;  1UJ0 A;  4CI0 C;  2CH4 W;  2LX7 A;  4JLG A;  1VQ9 Q;  5GJW B;  4QVD A;  3G71 A;  4E7S A;  4JPB W;  1Y07 A;  4ANJ A;  2J05 A;  4J5Y A;  5HK3 A;  2H3J A;  3JAM E;  2VGM A;  1Y96 B;  5LJ3 h;  1VQL A;  1VQN A;  2E5Q A;  4JJN K;  1RL2 A;  5GAO m;  1ZSZ C;  1KD1 C;  3M55 A;  3CC4 Q;  1B07 A;  1AWW A;  2PVO B;  3M57 A;  2AHJ B;  4RMO A;  3OYM A;  1AD5 A;  3BW1 A;  4RTZ A;  4OF1 A;  2QQR A;  2VV5 A;  3JCM Q;  1MHN A;  2LZ6 B;  2RI2 A;  1I4K 1;  4PLI A;  4XU3 A;  4RTY A;  1SSH A;  2R5M A;  4NL3 A;  3CCQ Q;  4XU0 A;  4EMH A;  4C92 D;  2L3Q A;  1KQS A;  3CPW S;  1UEC A;  2GFA A;  4PFP A;  1UGV A;  1ZX6 A;  3URG A;  5KH6 A;  4JRQ A;  1U5S A;  3TSZ A;  2W10 A;  1SEM A;  1UDL A;  5GMK h;  3EHQ A;  4AFQ C;  1SHG A;  3QUI A;  3BE3 A;  4FCY A;  3QYH B;  1UFF A; 
#chains in the Genus database with same CATH homology
 2X4W A;  1M8V A;  1WPY A;  3I55 A;  5GAN 6;  2RM4 A;  2LT4 A;  2KY9 A;  5LJ5 d;  3GLX A;  2X4J A;  3CBM A;  1YJN A;  1HK9 A;  3CC4 T;  1N8R U;  5CKB A;  2Y90 A;  3JB9 G;  1VQN T;  5GAN g;  2I2L A;  3VU3 C;  1FX7 A;  1WNL A;  3ZBD A;  3E9F A;  3JCM e;  4KT0 E;  4QQG A;  2JTM A;  2K4Y A;  2O4X B;  4M75 B;  2RK2 A;  4M77 A;  4OGE A;  2CZ7 B;  2RJC A;  4C8Q B;  4MMK A;  4O5V A;  4OVA A;  1VQ8 T;  5GMK e;  3HSB A;  3OYI A;  1KC8 U;  1NPR A;  1K8A U;  2XK0 A;  2HD0 A;  1I81 A;  1ZQ1 A;  2E6Z A;  3M58 A;  4YTL A;  3G4S T;  2VC8 A;  4MZT A;  4XTV A;  1BKB A;  2X4X A;  3JCM d;  3OS1 A;  1QVG A;  2FL7 A;  4Z02 A;  2X35 A;  5DM7 R;  3KXT A;  1S72 A;  1KD1 U;  4BB7 A;  4HT9 A;  1R8O B;  3CCL T;  1VQ6 A;  1N27 A;  5CAI A;  2YLB A;  3QBY A;  5HK0 A;  4A4G A;  4IUU A;  5LJ5 e;  3PMI A;  4M77 B;  3A8H B;  5GAN 3;  3OYH A;  4Y91 A;  1W2B A;  2V8J A;  2JZ2 A;  4LD9 K;  1YHQ T;  3V8K A;  1I5L A;  5IN1 A;  4C0Z A;  4J6X A;  3OQ5 A;  2DJZ A;  3HP9 A;  1QVG S;  4M7D F;  3PFS A;  2EQM A;  2CYZ B;  2ZPB B;  5A0L A;  5GAM g;  3QDR B;  4LDY A;  3CCE T;  2RJD A;  2RA2 A;  3OYC A;  2RB6 A;  4C0G A;  1G3T A;  1VQM T;  1WJR A;  3A8L B;  4C92 G;  1Q81 C;  1M1K U;  3CXC S;  5L8R E;  2P0P A;  3BFM A;  3MET A;  1YJW A;  2OTL A;  2ZPH B;  3JB9 H;  4PJO A;  4PNO A;  3JCM W;  3DLL A;  2QI2 A;  4HKE A;  3C4S A;  1LJO A;  1VIF A;  2DO3 A;  4M78 C;  3R6O A;  2KMT A;  2QDY B;  4MDW A;  4GY5 A;  3LYI A;  2PVD B;  5LJ3 j;  4M77 G;  2BKD N;  2VUB A;  3I56 T;  4M78 F;  2MAM A;  1VQ5 T;  2DIQ A;  3CCU T;  1YJN T;  3FC3 A;  5CCA A;  4QVC A;  2DXB A;  3GF5 A;  1KG1 A;  3CME T;  4HA8 A;  4C0F A;  2P4T A;  2EWN A;  4VUB A;  2EQU A;  2JNG A;  2RHU A;  3JB9 I;  5LJ3 f;  5GAN 2;  2QQS A;  3CCQ T;  4C5I A;  4DOV A;  3FJP A;  4BY6 B;  3UPU A;  3M5A A;  3PMT A;  5CIU A;  3VYH B;  4FT4 A;  3FLG A;  4C92 B;  1VIE A;  3OS2 A;  4LDX A;  2E70 A;  1TH7 A;  3O8V A;  5GAM d;  2ZPI B;  2R58 A;  3F70 A;  1QP3 A;  3A8M B;  4M78 G;  3QPH A;  3CCS T;  1VQO T;  2MF2 A;  5GAO l;  3CD6 A;  2GQV A;  3Q1J A;  2YLC A;  3M54 A;  4OGC A;  1NE8 A;  4M7D D;  3L2U A;  4A4K A;  2KDS A;  1VQ6 T;  4M78 D;  4EMK B;  4IKF A;  2QQB A;  2WSF E;  4C8Q A;  2XU8 A;  3OSS C;  4E7H A;  4XU2 A;  1OZ3 A;  4BAC A;  2LDM A;  4N4G A;  2EQK A;  4M7A B;  3OS5 A;  1X01 A;  4IUT A;  5LJ5 g;  5A0D A;  3OYG A;  3H8Z A;  3ER0 A;  3OB9 A;  4FU6 A;  4IUQ A;  3OYL A;  2QEX A;  2RJE A;  2JOY A;  2RD1 A;  5DLO A;  3OYA A;  3ME9 A;  3A8G B;  4OB0 B;  4KUD K;  4LDW A;  4PLL A;  1VQO A;  1B34 A;  5LJ5 h;  4EDU A;  3VV0 A;  2EJ9 A;  2WAC A;  2KAF A;  2LT1 A;  1BIA A;  2CKK A;  2ZGW A;  4XTU A;  2DD5 A;  4ZGD B;  1K73 C;  3QJ6 A;  2MWP A;  3CCE A;  3GIB A;  2MI6 A;  2RO0 A;  2XDB A;  5CKE A;  2XHC A;  4EMK A;  3V7R A;  2OAU A;  3LWH A;  4UC4 A;  3G6E T;  1VQK T;  3HFO A;  4RG2 A;  2GF7 A;  1D3B B;  3QHS A;  4RCC A;  1H3Z A;  3QO3 A;  2OTL T;  4MZP A;  2QTX A;  4XTX A;  4GLK A;  2DK3 A;  4M75 G;  2XD0 A;  5CR2 A;  2L8D A;  3PIP A;  4PJO C;  2C06 A;  1M1K C;  2YHT A;  2HBP A;  3HPW A;  1EIF A;  2LQK A;  4ATO A;  4DQ2 A;  3M56 A;  4BDY A;  3V8J A;  1MGQ A;  2FYK A;  2M9U A;  1YJ9 T;  1DJ7 B;  3RIR A;  3OW2 A;  2BUD A;  3GOX A;  1VQ5 A;  3CCU A;  1YIJ A;  2HQE A;  4CRI A;  3HRS A;  2K5L A;  3S6W A;  4F7U G;  4FM4 B;  1OI1 A;  3NTI A;  4C5G A;  3LW5 E;  2IVW A;  1VUB A;  3OYE A;  3G7Z A;  2JUF A;  2DD4 A;  2DTI A;  2RJF A;  2MWO A;  5CO7 A;  3JCM X;  1X6O A;  2EJF A;  4NOY A;  2P0Q A;  1Q86 U;  1Q7Y C;  4JUV A;  1QW1 A;  4M7A E;  3RMS A;  2QQ9 A;  2KVQ G;  3DB3 A;  3OW2 S;  4F7U F;  2XKO C;  1WGS A;  2LRQ A;  1UGR B;  3HRU A;  4J83 A;  4M75 E;  4C0D C;  4F7U B;  3OMC A;  2YRV A;  5KE3 A;  2E41 A;  5KCH A;  3OS0 A;  3PTA A;  3CD6 T;  3RES A;  1KQ1 A;  3JCM f;  5I21 A;  4E7I A;  3JB9 J;  1FWZ A;  3INZ A;  2DTH A;  4LD6 A;  3X24 B;  2CGH A;  1Q86 C;  3FEO A;  3SB2 A;  1VQ7 A;  2E64 A;  3QSU A;  1BI2 A;  2K3Y A;  4FIB A;  5GMK l;  4ZTJ A;  1I8F A;  1K8A C;  3G71 T;  1VQL T;  3SWN B;  1N9S A;  2K2V A;  2A7Y A;  4Y28 E;  4E47 A;  4X9D A;  3PIO A;  3C94 A;  2LC4 A;  3MEA A;  1Y71 A;  4C0D B;  2GCX A;  4O6J A;  2E12 A;  2KK4 A;  5FU6 B;  4QQD A;  3CC2 T;  3CC7 A;  1UB4 A;  5GAN e;  3SD4 A;  3RKY A;  4B9W A;  5GAN 4;  3MHX A;  4J6Y A;  3LH0 A;  2DXC A;  3RMQ A;  5FRN A;  1G5V A;  4LDU A;  4R55 A;  2HAX A;  4BUG A;  1Y7X A;  3QJY A;  3RKX A;  2EFI A;  5CQX A;  1G3W A;  2XI9 A;  1ZBX A;  2XDP A;  3A5Z B;  1B34 B;  1UGP B;  2JN0 A;  5CQY A;  1N9R A;  2CZ6 B;  2XID A;  4JRI A;  2RHZ A;  5FU6 C;  4M78 E;  4BI3 A;  2DXU A;  3ASK A;  3VKI A;  4NL2 A;  3QYG B;  1O9S A;  3LGL A;  5GAM j;  1M1G A;  3CCV T;  4NS5 A;  1KHI A;  1YI2 T;  5GMK j;  5A2Q E;  1YIT T;  4M77 F;  5I2M A;  4MML A;  2X4Y A;  2CS7 A;  3S3N A;  1ZHI A;  2E1H A;  3BDL A;  3QKJ A;  4D6W A;  3UT1 A;  2D9T A;  5D6X A;  3RER A;  2EYQ A;  3WVE B;  3KBG A;  4ZGJ B;  4ZTF A;  4C5E A;  2LX9 A;  4M7D B;  2LVM A;  3PGG A;  5J3B A;  3L2R A;  1BI3 A;  2F5K A;  3CBO A;  3MP6 A;  4C92 E;  5LJ3 d;  5GAM f;  3FB9 A;  3OY9 A;  1M5Q 1;  3JRZ A;  3NTH A;  1VQ8 A;  1GXI E;  2K57 A;  5C0M A;  4A4F A;  3GPL A;  3MP8 A;  4J6W A;  5GMK i;  4C8Q C;  2XG8 D;  4N0A A;  1HXD A;  3OA6 A;  1WJQ A;  2EAY A;  2D6F A;  3G4S A;  3OYF A;  5AYF A;  5GAO r;  4J7I A;  5EG2 A;  1NZ9 A;  3SWN C;  4M77 D;  4QQ6 A;  2LTO A;  3V8L A;  3I55 T;  3J80 E;  4JLI A;  4M7D A;  3M4Y A;  3CCL A;  2VGN A;  4RKU E;  2V8K A;  4X9C A;  1JBM A;  2LQ8 A;  3GP8 A;  1VQ7 T;  3GNF B;  4M77 C;  3E19 A;  3EFS A;  4II1 A;  3S3O A;  3L2Q A;  4IUP A;  4A54 A;  3PNW C;  4N4I A;  3DB4 A;  2MMP A;  2RI5 A;  1WQW A;  2DPP B;  4EMG A;  3VYG A;  4B9X A;  3OYJ A;  1VQ4 A;  2P0K A;  3VUB A;  3L42 A;  3JSC A;  3HRT A;  3X25 B;  4L6V 5;  3KUF A;  3M53 A;  2FB7 A;  3X26 B;  3BY7 A;  4BE2 A;  2WSC E;  3C12 A;  4L59 A;  4C8Q G;  4XAX B;  3X20 B;  3CCM T;  4WF2 A;  1AHJ B;  2CZ0 B;  4XU1 A;  3JCM P;  4M75 D;  4J7F A;  4KBM B;  5LL6 S;  1WJS A;  3OYB A;  1W4S A;  3L2Z A;  5GAN 8;  1VQM A;  4M7D G;  4C92 F;  4IUV A;  3EFR A;  4ME7 A;  2CZ1 B;  2RH2 A;  4C5H A;  3M59 A;  5KE2 A;  4A4H A;  3OYN A;  3S3M A;  5CKF A;  1S72 T;  5GAN h;  3UDC A;  3JCM c;  4MDX A;  4R56 A;  1BI1 A;  5GAO q;  2JVV A;  4P5N A;  4XTW A;  3OYD A;  4DA4 A;  1VQ9 A;  1YIT A;  2PUO B;  2ZCF B;  2WSE E;  1K73 U;  1YHQ A;  3DKM A;  1M90 C;  2RHX A;  2GFU A;  2LCC A;  4A4E A;  5CK9 A;  3N5B B;  4JS4 A;  4HCC A;  1WQ7 A;  3QZ9 B;  4M7A F;  3NTK A;  1RI0 A;  3OSV A;  2FVU A;  3OYY A;  4E7K A;  4JRK A;  2QXF A;  3MEW A;  4FL6 A;  4F7U E;  5GAO p;  5C6S A;  4M75 F;  3UWN A;  5GAN 5;  3OYK A;  4ELY C;  3OMG A;  3X28 B;  5LJ5 j;  1BYM A;  4ZGE B;  1IRE B;  3J7A F;  3H6Z A;  4M75 C;  3M9Q A;  3CCJ A;  5M9O A;  1W2B S;  1X75 C;  1H64 1;  4PJO G;  1UEB A;  3VUZ A;  4N0A C;  1QVF S;  4M7A C;  1VQP T;  2M1H A;  1M90 U;  3JB9 D;  3LLR A;  4C8Q D;  2OTJ A;  5A0G A;  4QVZ A;  3LGF A;  2Y4X A;  2VYT A;  2ZZD A;  1JRI A;  2F69 A;  3P8H A;  3A8O B;  3I56 A;  5D6Y A;  2EQJ A;  1XQH A;  2K5I A;  3C95 A;  3RUX A;  3L2W A;  4PJO F;  3JCM h;  2PQW A;  3CME A;  3JB9 F;  1YBY A;  2EIF A;  2RHY A;  5LJ5 f;  4X34 A;  3CXC A;  3SFM A;  1D3B A;  3OBW A;  2LNV A;  3QG1 A;  3CCQ A;  2K5F A;  2QEX T;  1XOV A;  2DIG A;  2M16 A;  4HCZ A;  2PUK B;  4C92 C;  5FLX E;  1VQ4 T;  1KHC A;  1UGS B;  1IZ6 A;  4M7D C;  1M9S A;  2R5A A;  4XTY A;  3QXE B;  4JS5 A;  3CCM A;  5HY6 A;  2D0Q B;  5D6W A;  3HHT B;  5LJ3 e;  4IUR A;  5FRO A;  4PL6 A;  1JJ2 A;  2DZC A;  1V29 B;  3P8B B;  4Q5W A;  4OP0 A;  3JCM V;  5GAN f;  4OB3 B;  4ZN3 A;  3CCS A;  4PKC C;  3G6E A;  2ZPE B;  2LCL A;  1VQK A;  2VXF A;  2RI3 A;  2Y4Y A;  3E9G A;  3GNG A;  2VXE A;  3M4G A;  5LJ3 g;  2O01 E;  3JCM b;  2XIC A;  3CMA T;  3T9N A;  4BI4 A;  1KQ2 A;  4M7D E;  1QP2 A;  2E10 A;  5J39 A;  1KC8 C;  2E6N A;  3MCA B;  3V7S A;  5CVI A;  3SDZ A;  2DAQ A;  4OB2 B;  4PJO D;  1OZ2 A;  1XNI A;  2FHD A;  2HNI A;  4C92 A;  2A3L A;  5FRM A;  4V2S A;  1PSE A;  1VQ9 T;  2PU9 B;  2BIV A;  4XTZ A;  1Q7Y U;  5J26 A;  1PSF A;  3HKS A;  4M78 B;  1YJ9 A;  1JJ2 S;  3J81 E;  3CCR A;  3JCM J;  1LOJ A;  1U1S A;  2F5T X;  2PVG B;  1U8R A;  1FXX A;  2M0O A;  4F7U A;  3TRE A;  4EPC A;  4OB1 B;  1M4Z A;  4BE0 A;  2DVE A;  3VJP A;  5IAY A;  1Y96 A;  4RG8 A;  3FRN A;  4C8Q F;  4FT2 A;  5GAO n;  2QA4 T;  3JCM g;  4BY6 C;  3LX7 A;  4LDV A;  2IG0 A;  3QII A;  1K9M C;  5FU7 C;  4A53 A;  4KUI A;  2K3X A;  2EJG A;  4M7A A;  4ELZ C;  3ZFJ A;  1QVP A;  4CI0 C;  5KCO A;  5GAN d;  3CCJ T;  2JTF A;  2R57 A;  4JLG A;  4M75 A;  4BD3 A;  3CPW A;  3WXM B;  1N8R C;  4J8O A;  4XK8 E;  4QVD A;  3G71 A;  5GAN j;  1VQP A;  1LNX A;  1Y07 A;  2OTJ T;  4XQ3 A;  4J5Y A;  2XDD A;  5HK3 A;  1G3S A;  2H3J A;  4EMK C;  3JAM E;  5GMK m;  4JRP A;  2VGM A;  1Y96 B;  5LJ3 h;  1Q81 U;  3HFN A;  3CC4 A;  2ZPG B;  1VQL A;  1VQN A;  2E5Q A;  1OYX A;  1K9M U;  3V7C A;  4JJN K;  1YIJ T;  1RL2 A;  5GAO m;  2RK1 A;  2L3R A;  4TVR A;  2HQX A;  3L2V A;  3M55 A;  1KD1 C;  2V8I A;  1N6A A;  2G3R A;  3MEV A;  1P92 A;  2RHI A;  5GAM e;  4N4H A;  4E7L A;  1Q82 C;  1NJI C;  1BI0 A;  5FU7 B;  2B8A A;  2PVO B;  3M57 A;  2AHJ B;  1O75 A;  4QW2 A;  4RMO A;  2E65 A;  3OYM A;  4DOW A;  3BDU A;  3NFC A;  4M7A D;  4OMF B;  4C8Q E;  1G3Y A;  1KQS S;  3BW1 A;  2KQW A;  4BE1 A;  2DXT A;  3E1S A;  1Q82 U;  2ZPF B;  1NJI U;  2EKO A;  4OF1 A;  5DY9 A;  2QQR A;  2VV5 A;  3JCM Q;  4HCB A;  1UGQ B;  1JB0 E;  3CMA A;  1MHN A;  2RI2 A;  4PLI A;  1I4K 1;  3FIF A;  3MEU A;  4L5G A;  5CKD A;  5GAN 7;  4ZN1 A;  4XU3 A;  4JDS A;  2R5M A;  3MO8 A;  4NL3 A;  3WVD B;  2NLU A;  5I2S A;  4XU0 A;  3L1A A;  4HT8 A;  1M1F A;  5IT9 E;  3AHU A;  4PJO B;  1YCY A;  4EMH A;  4C92 D;  2DTO A;  1KQS A;  2QQA A;  1QVF A;  2L5Q A;  3CPW S;  4E7J A;  3CC2 A;  1U1T A;  5GAM h;  3CC7 T;  2GFA A;  3CCR T;  2DZ9 A;  5KH6 A;  4JRQ A;  2L89 A;  3URG A;  3CEY A;  3MP1 A;  4MZM A;  4RCB A;  3CBP A;  3FDR A;  5DLQ E;  3RKW A;  3LWI A;  2QA4 A;  4FSX A;  2DEQ A;  3QZ5 B;  3DLM A;  3PT9 A;  3SWN A;  1BIB A;  2KSS A;  3HL8 A;  3OBY A;  4BI8 B;  3ZEH A;  4BDZ A;  3TEE A;  1YJW T;  1XTD A;  2DKG A;  1NPP A;  2O4X A;  5GMK h;  3TU4 K;  3CPF A;  4M78 A;  3P8D A;  3TCJ A;  4M7A G;  4PJO E;  5HKC A;  3EAE A;  3QUI A;  3CCV A;  1SSF A;  4KUL A;  3QYH B;  1YI2 A;  4M77 E;  5CKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...