3JCMf

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
77
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDRNEKVMQHHGRMLLSGNNIAILVPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
total genus 12
structure length 77
sequence length 82
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmf00
4M78D 5GANj 2Y90A 5GAMe 1I4K1 4J6WA 4M7AD 4PJOA 1JRIA 3JCMf 2DVEA 5LJ5h 3HFOA 5GAN7 1I5LA 4M77A 4J6XA 4M7AC 2YLBA 5GANf 1JBMA 2VXEA 1BIAA 4M78G 4PJOG 4A53A 3JCMg 4C92G 2RA2A 5GAMj 4M77G 5GANd 5LJ3f 2DTOA 4M7AF 4M7DB 3QHSA 5GANg 2DZ9A 2I2LA 2RM4A 5LJ3d 4RCCA 5GMKe 4PJOE 4F7UF 5LJ3g 4C92E 4M7DA 3M4GA 4M77E 3JCMX 1MGQA 2E64A 5GAMg 4XTUA 5GMKj 3L2ZA 4M75A 4C8QA 1B34B 2DXUA 1WQ7A 1YCYA 1WQWA 3SB2A 3V8JA 3VU3C 2YHTA 4WF2A 2VXFA 4M75G 3RKWA 3QO3A 4C8QG 4QVCA 3QUIA 2DJZA 5DY9A 4F7UB 2CGHA 3BW1A 4X9DA 4XTYA 5GMKi 5GANh 5GAOp 5GAOr 3GIBA 1D3BA 4M75E 4C8QE 4PJOD 5GAN2 5LJ3h 4C92D 1I81A 4XU2A 4M77D 3AHUA 1KQ1A 2EJFA 4JLIA 4XU3A 4PJOC 4M78C 4C92C 3SWNA 4M77C 3JCMd 3JCMQ 3JB9I 4PJOF 4M78F 1Y96B 2E41A 4C92F 4EMKC 4MMKA 4M77F 4XTZA 3JB9G 2EAYA 3V8LA 3RESA 4XU0A 2DEQA 1HXDA 4HT8A 2DZCA 5GAMf 3EFSA 5GAMd 4XTWA 1X01A 4OP0A 2HNIA 4M75D 4N0AA 4C8QD 3RERA 3JB9H 2JN0A 4NL2A 2QTXA 3L1AA 4M7DG 4M75C 4C8QC 4M78B 1WPYA 1LNXA 3EFRA 2DTHA 4M7AB 3RKXA 5GAN6 5GAN4 2RD1A 1TH7A 1WNLA 2ZGWA 3V8KA 4C8QF 4EMKB 5LJ5e 3JCMh 4M7DE 3RIRA 1B34A 4JUVA 2DXTA 3BFMA 2EJGA 5LJ5j 3RKYA 5GMKm 2EWNA 3JB9D 4F7UA 5GAOq 2E1HA 3FIFA 5GAMh 2E10A 5LJ5f 3JCMP 3HSBA 3HFNA 4F7UG 3JCMc 4HA8A 1H641 5GAOm 1HK9A 4XU1A 3JB9F 5CAIA 5I21A 2FB7A 5LJ5g 5GAN5 4JRKA 2K57A 4M7DD 2YLCA 3RUXA 4F7UE 1Y96A 3JB9J 5GMKh 4M7DC 3BDUA 5GAN8 4N0AC 1N9SA 5GANe 4A54A 4M7DF 4XTVA 4PJOB 4C92B 1BIBA 4QVDA 4M77B 5LJ3e 1M8VA 4JRIA 4M75F 4XTXA 4DQ2A 5GAN3 1KQ2A 2E65A 4M78A 4RCBA 2EJ9A 4C92A 5LJ3j 3JCMb 4M7AA 1LOJA 1N9RA 4EMKA 2VC8A 4M7AG 2DTIA 3FJPA 1I8FA 1U1SA 3SWNC 4Y91A 1LJOA 2DKGA 4M75B 4C8QB 5GAOn 4HT9A 4M78E 5LJ5d 4EMHA 4NOYA 4M7AE 3PGGA 4J5YA 4J6YA 4PNOA 3V7SA 3JCMV 3V7RA 1M5Q1 3INZA 4X9CA 4EMGA 5GMKl 2RB6A 4MMLA 2FYKA 3JCMe 1D3BB 3V7CA 3BY7A 4XQ3A 3JCMW 4NL3A 3JCMJ 5GAOl 3QSUA 3SWNB 1U1TA 3FB9A 4V2SA
chains in the Genus database with same CATH superfamily
1WHGA 4CRIA 2O31A 2RA2A 2EW3A 1IHWA 2X35A 4DA4A 4M77E 2AIRB 4M75A 1D09B 3ASKA 3D7SB 1PC0A 1RAFB 4M75G 5KE2A 3OYAA 1VUBA 3M5AA 2J6OA 1N8RC 2FPDA 3VS1A 3CCQQ 1AZGB 2AK5A 4PJOF 1Y96B 1HXDA 5D6XA 2RJDA 1KFZA 2XU8A 1X01A 2QEXT 5KCOA 3S3MA 4R55A 2QTXA 3OBWA 1D1AA 1M1KU 3OBYA 3EG9B 3QPHA 3OYGA 3VUZA 2QQBA 2RD1A 1T3SA 2MI6A 4RTTA 2BUDA 3LWHA 3VJPA 1WIEA 2QXFA 1ZUKA 2O9VA 4D8DA 1N5ZA 1GL5A 2QDYB 4YTLA 4ZN3A 4LXCA 7AT1B 2FB7A 4AFUC 3O8VA 1QVFS 5DLOA 4M7DC 2MAMA 4IUVA 2KGTA 3Q1JA 3VYGA 2LJ0A 3CMAA 2HKQB 3C12A 1UECA 1EX4A 2FO0A 2WSCE 3ZFJA 2E65A 3PIOA 2ZPBB 5FLXE 2IG0A 1VQNQ 3PMIA 1PSEA 1ZSGA 1QVGS 3G4SA 3CC7Q 3CMAT 4PNOA 5CQXA 2FYKA 3UDCA 1WHLA 4CC4B 2CSQA 3A8MB 2CP7A 2IIMA 3FB9A 3R6OA 4V2SA 3G4ST 5GAMe 1I4K1 4FYWB 5D6WA 3S3OA 1V1CA 2RM4A 2HBWA 2HQHA 2DM1A 2KI7A 1UGQB 4DOVA 3KXTA 3GF5A 2KYBA 1VQ6Q 4FYVB 5LL6S 3AT1B 2FPFA 1Q7YU 2GF7A 5A0DA 3MKDA 3EGDA 3OS1A 3CCLQ 2ROLA 5DY9A 2OX7A 1IHVA 2COYA 1JQQA 2V8JA 4C0GA 1ARKA 2E3HA 1I1JA 2YSQA 3CQTA 2EYZA 4JDSA 3I5SA 2EAYA 5IN1A 2J05A 3RESA 4ME7A 4EIKA 5GAMf 5HKCA 2M16A 1OOTA 2MPXC 5M9OA 2DFUA 3EFOA 4B9WA 4M7AB 1WNLA 1M3BA 2CH4A 1XTDA 2YUNA 2DX1A 3CBPA 1G3TA 4FU6A 1VQ9A 3CBOA 2A0FB 3A8HB 1Q86C 3T9NA 1VQ5Q 1IB8A 2D8JA 4BDYA 2PZ1A 4OF1A 4AT1B 3CMEQ 4C92B 4JRIA 2QYZA 1JXMA 1VQ9T 3R6NA 4OB2B 1S72A 1OU9A 2VC8A 1YHQQ 1YI2A 3CCVQ 3L2WA 1Y57A 4OB0B 2QGGA 2YUOA 4M7AE 2LCLA 4J5YA 4J6YA 2DXCA 1E6GA 3QIIA 1G5VA 2AHJB 4E6RA 1X2QA 1S72T 3V7CA 4PL6A 2YT6A 1OX8A 1YI2T 1YJ9A 3QSUA 1U1TA 3E1SA 1VYVA 1M90C 1W1FA 2OJ2A 5LJ5h 2DVEA 4VUBA 4M77A 2CUDA 4MDWA 4M77G 1BI0A 2DO3A 3M0TA 4C92E 4M7DA 2C0OA 1YJ9T 4BUGA 1NEBA 3L2ZA 1QCOA 1YCYA 3CEYA 1K8AR 4F7UB 2FRWA 4XTYA 4DEXA 2VV5A 3P8HA 1VQOT 3H0FA 3GIBA 1WX6A 4D8KA 2CP2A 4PJOD 1YNZA 3LH5A 2NLUA 3CBMA 3OSSC 2MF2A 1BK2A 2HMAA 1PNJA 3LLRA 1O75A 3PFSA 4CC2A 2M0OA 2RJEA 2OTJT 3G6EQ 4FSXA 5HY6A 4N0AA 4LDYA 4FT4A 1SPKA 2GTJA 2DL8A 2O4XB 1WHJA 3JCMh 4HXJA 4FW1A 5LJ5j 2LJ1A 1C1AA 3HRTA 1TOVA 1NBEB 1FYNA 2JS2A 2LNVA 3PIPA 3JCMc 3G1JA 2LX7A 3I56A 4PFZA 2V26A 4F7UE 1Y96A 3JB9J 2KVQG 2QGFB 3LYIA 4GY5A 1NM7A 4A4KA 2BKDN 1UTIA 1M8VA 3ZL7C 4LE9A 4PKCC 3EG9A 3I56T 1AWOA 3G71A 4F17A 4ZGJB 4R56A 2JS0A 1EZZB 4QT7A 1KHCA 4ZNXA 3X28B 3GP8A 1KIKA 3UPUA 3M58A 2LQ8A 3G71T 1ZX6A 4KGZB 2L0AA 4FT2A 1VQPQ 4A4EA 2F2WA 5IHKA 1JRIA 2K3XA 2E6NA 1SEMA 3QYHB 2PQWA 4M78G 2CH4W 4C5IA 2C0TA 3L2RA 1KQSA 2HCKA 5FU6B 2NUZA 2HKNA 2YUQA 2YRVA 1B34B 4IUUA 1WQWA 2M02A 3VS2A 4JJDA 3M53A 1WXBA 2H8HA 1G2BA 1QLYA 3UATA 1MMDA 2GTOA 4L59A 3CCSQ 2LTOA 4HVUA 4BI8B 1QMCA 1UGSB 3VUBA 3NMZC 1BYMA 5KYWB 4JJBA 1B3QA 2AKLA 4RUGA 2JN0A 2AZSA 2FG0A 1FX7A 3ER0A 2GQIA 1WJQA 3M0PA 1IZ6A 1UG1A 1OEBA 3QWXX 2A28A 5AT1B 1N8RR 4PJJA 3OYEA 3FRNA 1M4ZA 5GAMh 2FRYA 1SHGA 1YFNA 4L6V5 3CCUQ 4ZGDB 3HFNA 1I5OB 3NTIA 3CCRA 3MJXA 1T3LA 3C4SA 2EQMA 3OYYA 3N5BB 2VWFA 2HL3A 3U23A 5KH6A 2CZ7B 1OV3A 3H0IA 4C0ZA 2X4WA 3LWIA 3CCET 1JO8A 1XQHA 4ZN1A 5CKHA 4M7AA 1YIJA 2EQIA 1VA7A 4M7AG 1OPLA 2JNGA 4JZ3A 4C8QB 2YRDA 5IXBA 3CPWA 1IGQA 1M1KC 2MMPA 2CP5A 1NLOC 3BY7A 2EGCA 3H9NA 2FZGB 1G3YA 4M78D 5GANj 1NPRA 5FWBA 5GAN7 2X3WD 1LPLA 3VS6A 1WFWA 4C92G 5GAMj 3CPWP 5LJ3d 1YP5A 1WJSA 2MWOA 2M1HA 2ZCFB 3TREA 1MGQA 2SEMA 2HSEB 3SHWA 2DXUA 3QDFA 4FYXB 4J9DA 3KBGA 1V76A 2R58A 4C8QE 2P0PA 4HCBA 4K11A 4FSSA 1H3ZA 3JCMQ 2A08A 4B6MA 3OYDA 3I55T 2PVOB 2D8HA 4E7SA 1F1BB 1HD3A 5CK9A 2KY9A 2R57A 5IXFA 3JV3A 4OP0A 2HNIA 1AVZC 2QDLA 1TG0A 2C0IA 4NS5A 1M1GA 3ZEHA 3VS4A 2DLPA 1PRMC 1QP3A 3MP8A 2HZYA 1VQLA 4F7UA 5CR2A 4LNPA 3M0UA 2L3PA 4F7UG 2P0KA 4O6JA 1Q7YC 4KRTA 1JJ2A 3VYHB 2CZ1B 4Z02A 1YITQ 1JXOA 2YLCA 1Y71A 3OMCA 1XOVA 4RTVA 1VQMA 2K79A 2E12A 3QBYA 2HBPA 3QXEB 3M0RA 3TQ7P 1VQLT 4ELZC 4RTWA 2XI9A 3CD6Q 3JCMb 6AT1B 1WI7A 1TS9A 2O4XA 1NLPC 3FJPA 2ZPEB 1KSWA 3OYIA 1JJ2P 1FXXA 2QI2A 2RPNA 1RLQC 2RQUA 1Y0MA 2HD0A 2IPOB 1M5Q1 3OA6A 2DE0X 1VQ7A 3JRZA 3CCMQ 1UFFA 3OS5A 4IIMA 1MUZA 4M7DB 2X4YA 2DVJA 1AZEA 3A8OB 3A8LB 3QHSA 4TVRA 5IH2A 2HEQA 3UA6A 1R0BG 4C5EA 1H92A 4LN2A 4J9FA 3NPFA 2A3LA 1VQ4Q 4HVWA 1QCNA 4RTYA 2V8IA 2OTLQ 3QO3A 4Q5WA 1QWFA 2AKKA 1AWWA 1GXIE 1Z9ZA 2ATCB 2BZYA 2QASA 1D1CA 4PJOC 3NGPA 3OSVA 4GBQA 2DF6A 1X75C 2K9GA 3RDVA 1SRLA 5KYXB 1FMVA 1BI2A 1OX9A 3S6WA 4IUQA 1SHFA 1GRIA 1VQ8Q 2DPPB 1WPYA 1EFNA 4KUDK 4M7DE 1PHTA 1B34A 1AHJB 2K3BA 2QEXA 3CCQT 4BD3A 3FJ5A 2ZPHB 3NFCA 2ZAEA 4MZTA 2MOXA 3FEOA 2GCXA 2OI3A 4IURA 4XU1A 1OYXA 1X6OA 3EGXA 4J9IA 5KYWA 2GBQA 3MEWA 4FCYA 3OY9A 4RCBA 3M54A 1TTHB 4E7KA 1UUEA 2QG9B 1ZQ1A 4BE2A 8ATCB 1M3AA 1VQNA 3V7SA 3E19A 2DBKA 2RB6A 3PNWC 4BY6B 2YWWA 3CC7A 2EYYA 1H3HA 5L23A 2XKOC 3H0HA 4LDUA 1U8RA 1JB0E 2H3EB 3M9QA 1VQNT 1BIAA 4A53A 3EH2A 5GANd 1J3TA 1BBZA 2I2LA 2NYSA 4ATOA 3CC7T 2KYMA 1M30A 3TU4K 5HK0A 2EFIA 4XTUA 4C8QA 3VU3C 4QVZA 1WQ7A 2XDBA 1K8AU 3HP9A 4C8QG 4QVCA 3O5ZA 1KK7A 2HSPA 3E2UA 1KQSS 2E70A 2K7AA 4F14A 3UF4A 2OAUA 5I2MA 3CCLA 4JLIA 2ESWA 2F5TX 5I22A 3CC4A 1ZSZB 2F2XA 4M77F 3TEEA 3MEAA 3EFSA 2RI5A 4BI4A 3RNJA 2KRMA 2BZ8A 2BZXA 4M75D 5CIUA 3DB4A 4NL2A 2K5IA 3HRUA 2JVVA 3CCLT 2ECZA 2DTHA 4MDXA 1IO6A 1X2KA 3CC4T 1NE8A 2RQVA 2RI3A 1FMWA 4BB7A 4AMCA 4C5HA 2BE7D 1WLPB 1Z9QA 3FIFA 3FLGA 2KK4A 2RH2A 4HKEA 1V29B 1YJNQ 2VGMA 2FEIA 4EPCA 4JS4A 1K0XA 1ABQA 3ULRB 2L3QA 4E7ZA 8AT1B 1MMGA 1KC8U 1N9SA 2R5AA 4KH1B 3RMQA 2KNBB 2J7IA 1WJRA 4A4FA 4DBFA 3CMEA 4BY6C 1TUCA 1ZBXA 3OYBA 2ABLA 1Q82U 1VQ5T 1YHQA 1VIEA 2CREA 3CCVA 3DB3A 1KHIA 5A2QE 3TSWA 2FHDA 3CMET 5DM7R 4LUDA 2KEAA 3TCJA 1PM3A 3CPWS 1K76A 1UGVA 2Y90A 4IIOA 1M8MA 2C06A 3HFOA 3VKIA 1YHQT 5IT9E 3CCVT 1NJIR 1E7OA 5C0MA 4RG2A 4BDZA 4IUTA 1IGUA 3H6ZA 2RMOA 3OYMA 2YUPA 4J83A 2K2VA 3IQLA 1ZSZC 1M1KR 2VUBA 2QK0A 4LD6A 3URGA 3QUIA 2DJZA 5KE3A 5GAOp 2K4YA 1CKBA 5CO7A 2KAFA 3EG2A 1RLPC 2OAWA 1BU1A 4M78F 2E41A 5CKDA 4XTZA 5I11A 4RTZA 3ZBDA 1VQOA 3V8LA 4HT8A 2GGRA 1OULA 4M4ZA 4J9BA 1K9MU 4M7DG 3EHQA 3MCAB 3V8KA 1LCKA 2CYZB 2OTJA 3MO8A 1M2OA 2VVKA 4J7FA 4RG8A 3UT1A 5CKBA 1UJ0A 4PLIA 2QA4Q 2F1LA 4IUPA 1BCOA 3G6ET 2COZA 5FWCA 3MEUA 5KYXA 4A54A 5AYFA 5HCKA 3OS0A 5GAN3 1JJ2S 4IKFA 1KQ2A 1T0HA 3META 2L2PA 1N6AA 2LZ6B 1W4SA 2A7YA 2CP0A 1IREB 4FW2A 4E7IA 2LX9A 3PGGA 4DBHA 3INZA 2HDAA 2ROTA 1S1NA 1Q7YR 3LX7A 3CC2Q 3EG3A 1YJWQ 3L2QA 2DERA 1I5LA 1RI0A 1VQPA 3GNGA 1K73R 1KD1U 4M7AF 2DIQA 1M9SA 1OZ2A 1UDLA 2BE9B 3VRYA 2L5QA 1JU5C 5D6YA 2VXFA 4OGEA 1VQKQ 4OMMA 1PG5B 1VQPT 1MV0B 2CGHA 5I2SA 5GAOr 4ZTFA 2COWA 1TXQA 4WTOB 1I81A 1M3CA 4M77D 2EKHA 1C6VX 2E5QA 3OW2S 1G83A 1M1FA 4C92F 2CSIA 1GBQA 4QQDA 5CCAA 3JB9G 3DLLA 3EAEA 1NYFA 3REBB 3CCSA 1QWEA 4LUEA 4P5NA 1UHFA 2DA9A 3NTKA 3RERA 3JB9H 1Q81R 3CCJQ 2RHZA 5CVIA 1PD0A 5GAN4 4J9EA 2RO0A 2DAQA 3SDZA 1X27A 5KYNA 3CCST 4PJMA 1GCQC 2E10A 1KQSP 1ZUYA 1HK9A 5D7UA 1MMNA 3EGXB 2XICA 3CCUA 1AWXA 4N4IA 1ZSZA 5GAN8 2O2OA 4II1A 2J06A 4AFQC 4XTXA 4OMPA 1SG5A 2NUPB 1SSHA 2RQTA 4HVVA 2FZKB 2RHXA 3CCUT 2X4XA 4J9CA 3CCEA 2D6FA 3V7RA 2JTEA 5IHIA 1RUWA 1ABOA 3EG1A 1ZA1B 1I07A 2K3YA 2F5KA 3JCMJ 3H41A 3SWNB 2PVGB 2PTKA 2YDLA 1RAIB 5L8RE 1P92A 2ED0A 2JM8A 2KR3A 4OVAA 3PMTA 2LVMA 2MCNA 2XG8D 4RKUE 4ESRA 3JCMX 1NG2A 1FWZA 2LP5A 1TUGB 2JT4A 1YBYA 2RHUA 4JPBW 3EHRA 4F04B 1PWTA 2FZCB 3OYKA 4J9GA 1CKAA 1G3SA 4OGCA 4X9DA 3VRZA 1SKUB 4XAXB 1TU0B 4L5GA 3CCRQ 2RHYA 2KT8A 3JB9I 3TVTA 4E7JA 2LT1A 5HK3A 4XU0A 2DEQA 4E2FB 3GPLA 4JRPA 2CP6A 3FDRA 2KRSA 3L1AA 3I55A 4M75C 2DK3A 4J9HA 1AT1B 1YIJQ 2MYSA 1UHCA 2DXTA 2A37A 2DL7A 3RR6A 3THKA 2KXCA 1HYOA 4UC4A 2DJQA 2VKNA 3JCMP 1M2VB 4BI3A 2E6ZA 3CXCA 4FIBA 1K8AC 3BDUA 1YITA 2EQJA 4PJOB 1BIBA 1IRXA 1MNEA 5LJ3e 4EDUA 1QQJA 4M75F 2DD4A 2KT1A 2EJ9A 1LOJA 4QW2A 3RMSA 4O5VA 4KT0E 3J80E 4XK8E 1QKXA 3SWNC 3CXCP 3PTAA 5LJ5d 1YITT 3GLXA 3P8BB 2KBTA 3MPUB 3JCMV 3QYGB 2JMAA 1OZ3A 2DIGA 2EGAA 2LCSA 5GAOl 2CUBA 2XDPA 4M7AD 1WXTA 4C0DB 5GAN5 5LJ3f 2XHCA 1AOJA 4PJOE 2D0QB 2M51A 1KC8C 5CKFA 3J81E 3V8JA 1U06A 2PNIA 1Q86R 4WF2A 3CCMT 3QJ6A 5FU7C 1VYTA 2ZPIB 2LQKA 1SRMA 1VQ4A 4JLGA 4CC3A 4C92D 4BE1A 3AHUA 2EPDA 3JCMd 4JRQA 1VQMQ 1Y7XA 1Q82C 1ZHIA 3TSZA 4OMNA 2ZPFB 4C0FA 3HHTB 2LQWA 4ORZA 3X26B 2GFAA 3OYNA 1VQ4T 1K4US 3MEVA 3EH1A 2OTLT 1ACMB 3SD4A 1LNXA 2QQRA 3EFRA 3OW2A 4C8QF 2LJ3A 9ATCB 2BTTA 1K1ZA 2JTMA 2EJGA 2XD0A 3E9FA 4ZTJA 5LJ5f 1M90R 3KUFA 2RK1A 4KUIA 3CCQA 1RADB 1VQ7Q 2CDTA 1VQ8T 1B07A 5DLQE 3OW2P 1WYXA 2DL5A 1QP2A 1G8XA 3VS5A 4XTVA 2ENMA 4DQ2A 1WXUA 3OYJA 1K9AA 1MMAA 2L3SA 3WVDB 1AD5A 4HCKA 2J6FA 4Y91A 3OYCA 2KE9A 1PSFA 4E47A 2W0ZA 2ED1A 1X69A 1K9MC 4MZPA 4C0DC 2QQAA 5GMKl 4C5GA 3WXMB 2HQXA 1D3BB 1TUDA 4XQ3A 2DXBA 3JCMW 4XU2A 4QQ6A 1NPPA 2P4RA 4CC7A 1R8OB 1VYUA 3JCMf 1NJIU 4E7HA 2VXEA 2YRCA 1CSKA 2NUPA 2DTOA 2DZ9A 3BDLA 4RCCA 5GMKe 4AFSC 4J8OA 2PUKB 4N4GA 2QEXQ 2JW4A 3BE3A 1RACB 5GJVB 2E3IA 2DL3A 5GMKi 2F2VA 4GLKA 2QQSA 3QDRB 4M77C 3SWNA 1D1BA 1WZOA 1O9SA 1UEBA 5GAMd 4XTWA 2CT3A 4Z88A 2DNUA 1RABB 2RHIA 4PFOA 1VQ6A 1X6BA 4M78B 2VB6A 1W70A 3QKJA 4KGVB 2QTVA 2CKKA 4JUVA 3C0CA 1QKWA 3BFMA 2AT1B 1KD1C 2J6KA 3JSCA 2V1RA 4PLLA 2K5LA 1VQ6T 5GAOm 2NWMA 5CAIA 4X34A 4JRKA 1BCMA 3CMAQ 1YJNA 4OMQA 1W2BS 1MV3A 4N0AC 1PD1A 2DL4A 2XMFA 5GANe 2Y4YA 3QZ5B 4M7DF 3MP6A 3DLMA 4F16A 2JOYA 4J7IA 4FYYB 3G4SQ 2ZZDA 5C6SA 2EVRA 2B8AA 4QQGA 2MK5A 1YJNT 4HT9A 1PRLC 1BB9A 4M78E 2LRQA 4BE0A 3I9QA 1KJWA 1M2VA 2X4JA 3VS3A 4KGXB 1ZUUA 1VQ5A 2PU9B 3L42A 2V1QA 3CC4Q 4PJOA 1K73U 1QW1A 5GANf 1JBMA 1YWPA 1H8KA 2EQUA 2IVWA 3MHXA 4PJOG 1RAAB 3VV0A 2CZ0B 2WSFE 3M4YA 1R0CB 2E64A 2X51A 1IXDA 3RKWA 4LD9K 4DBRA 1GBRA 2DYIA 4KBMB 1WA7A 3BW1A 1GFCA 4PJLA 1MNDA 1WDXA 1RL2A 5LJ3h 2EQKA 2EJFA 3J7AF 4M78C 1N27A 2QQ9A 2RQRA 2KQWA 2CZ6B 1Q81U 4C8QD 2RF0A 3X20B 4DOWA 1VOMA 4PFPA 2FL7A 3F70A 3RKXA 2EGEA 4PJNA 2ZGWA 4FM4B 5IHNA 4EMKB 5A0LA 3RIRA 3GBQA 1GCPA 2DEUA 4AG2C 4FL6A 1VQ9Q 5GMKm 5GAOq 2E1HA 2RQWA 3M0QA 3HSBA 4X1VA 4B9XA 2VYTA 3JB9F 5I21A 2JMCA 2M9UA 2QA4A 1SF9A 1D0YA 2DRKA 2RN8A 1NEGA 4RTXA 2DMOA 3OYFA 1SSFA 4HCZA 3G7ZA 2HL5C 1S72Q 3G6EA 2DYBA 1U3OA 3LH0A 3CXCS 1YI2Q 3NTHA 4OMOA 5LJ3j 1N8RU 1AWJA 4Y92A 2LT4A 3SEMA 1BKBA 1G3WA 2K5FA 2DTIA 2QA4T 1DJ7B 1U1SA 2JM9A 2DKGA 3PVLA 3I5RA 5CKEA 4EMHA 2L89A 2Y4XA 2CT4A 1YJ9Q 2E4HA 1XNIA 1HSQA 4NL3A 4RMOA 4Y28E 1XJWB 4DBQA 2R5MA 3CC2A 4J6WA 4MZMA 1YJWA 1VQOQ 3M55A 1UE9A 1OI1A 4J6XA 4M7AC 2NUTB 1RI9A 3HL8A 2YXYA 1EIFA 2WSEE 5KYUB 4JJCA 5LJ3g 3M4GA 1QCFA 2OTJQ 3HPWA 3CC2T 2G3RA 3OB9A 3SB2A 1QVPA 2DBMA 2YHTA 1YJWT 1M27C 3ME9A 1D3BA 2GQVA 1VQKA 3M56A 1KQ1A 1YN8A 4XU3A 2Z0WA 4C92C 1NYGA 3OS2A 1UB4A 3GOXA 4EMKC 1MHNA 5J26A 4ELYC 2M0YA 5KYYB 1T0JA 1JEGA 1YCSB 2LDMA 1Y07A 2XK0A 2LMJA 2F69A 3OMGA 1VQKT 1KC8R 2RK2A 2X3XD 1R77A 3CCJA 1AEYA 3PE0A 4R0KA 1QVFA 2L3RA 3RKYA 3I56Q 2EYQA 5EG2A 3A1PA 4HA8A 4OB1B 2XIDA 1E6HA 5LJ5g 1Q82R 1ZLMA 4M7DD 1PKTA 1OQKA 4ZGEB 2FVUA 2PUOB 5GMKh 3CCJT 2X9HA 1QVGA 3G71Q 1QVFP 3FC3A 4Z8AA 3EGUA 4M78A 3NHNA 1K0SA 1VIFA 2EKOA 4WCIA 2DILA 3PVQA 1W2BA 2O9SA 5GAOn 2EYWA 4M75B 2JZ2A 1BI3A 3L2VA 2MIOA 3LGLA 2A36A 4X9CA 2PVDB 1W6XA 2DRMA 1QVGP 2D9TA 5CQYA 4BACA 3PT9A 1UGPB 2KSSA 3I35A 2RJFA 4JS5A 2HQEA 2G6FX 2FPEA 3QZ9B 1W2BP 3A5ZB 2LC4A 4ANJA 2KRNA 4HCCA 3JCMg 1RAHB 5ECAA 5IAYA 4F7UF 3L2UA 2RNAA 3GNFB 1UGRB 3M57A 1Q86U 5GMKj 5GJWB 1HJDA 1K9MR 4CI0C 4LDXA 2K6DA 3X25B 2VASA 5GANh 3HRSA 4M75E 5GAN2 2AZVA 3HTRA 1PKSA 1WHMA 1A0NB 1WGSA 4N4HA 2JJ9A 2EYXA 4MMKA 2I0NA 2HAXA 5FROA 2DZCA 3OYHA 1OPKA 4RTUA 1TSFA 2KMTA 5EC7A 5GAN6 3M59A 1TH7A 4D6WA 2ZPGB 2D1XA 1NJIC 2BIVA 3CCRT 4LDVA 3X24B 4AFZC 3CCEQ 1RAEB 2O01E 1M90U 5KCHA 3JB9D 4JJNK 3WVEB 3S3NA 1H641 2VGNA 3HKSA 5FRMA 1KG1A 3M0SA 5FU7B 2B86A 3VS0A 1BI1A 2JXBA 1WHKA 1NZ9A 1FMKA 5FRNA 2P0QA 1YIJT 5J3BA 4QVDA 5FU6C 3UWNA 3QJYA 5FW9A 3RBBB 2O88A 2MWPA 4C92A 2P84A 2CS7A 1D0ZA 1N9RA 4EMKA 4KULA 1KD1R 1OU8A 3EGDB 5J39A 3H8ZA 2GNCA 4QKUA 4OMFB 2KROA 3CPFA 1GFDA 2XDDA 2P4TA 2JTFA 2YLBA 3DKMA 4OMLA 3CD6A 3REAB 5GANg 3I55Q 2D0NA 4PK4A 1PCXA 3EFOB 5GAMg 3C94A 1X43A 1D0XA 1I0CA 3UA7A 3CD6T 3LGFA 3MP1A 4AG1C 1GCQA 1Q95G 3CCMA 1TWBA 3QWYA 2RI2A 4LDWA 2NUTA 2LNHB 5KYUA 5A0GA 2RJCA 1YWOA 1ZBJA 4C8QC 4DEYA 1ZA2B 2QAZA 1C0MA 5LJ5e 4JZ4A 3OQ5A 1VQLQ 1K73C 2K2MA 1RAGB 2H3JA 2W10A 3A98A 3KFVA 4A63B 2OTLA 3OYLA 1B7TA 4E7LA 1VQMT 2EWNA 2GFUA 2LCCA 3LW5E 2E5KA 2KDSA 2V8KA 2K57A 2L8DA 3RUXA 4Z89A 2CP3A 2SRCA 2EIFA 3C95A 2JUFA 3P8DA 2EBPA 5KYYA 2DD5A 3A8GB 4M77B 1VQ8A 2DETA 3SFMA 2WACA 1X6GA 1WHHA 2LQNA 4OB3B 1LVKA 3E9GA 1I8FA 3JAME 1LJOA 1Q81C 1U5SA 1VQ7T 4NOYA 3VS7A 4KH0B 3QG1A 2KXDA 4A4HA 3EG0A 4EMGA 4A4GA 4MMLA 3JCMe 1UJYA 4GLMA
chains in the Genus database with same CATH topology
4M78D 4CRIA 5GANj 1NPRA 4PJOA 5GAN7 1I5LA 1K73U 1QW1A 5GANf 1JBMA 2IVWA 1RI0A 2EQUA 4PJOG 3MHXA 1VQPA 3GNGA 4C92G 3VV0A 2RA2A 5GAMj 1KD1U 4M7AF 2CZ0B 2WSFE 5LJ3d 3M4YA 1WJSA 2DIQA 2X35A 2MWOA 1M9SA 1OZ2A 4DA4A 2M1HA 4M77E 2ZCFB 3TREA 1MGQA 2E64A 2L5QA 4M75A 2DXUA 3ASKA 5D6YA 2VXFA 4M75G 4OGEA 3RKWA 5KE2A 4LD9K 1QVFS 1VQPT 3OYAA 1VUBA 4KBMB 2CGHA 3BW1A 3KBGA 3M5AA 1N8RC 5I2SA 5GAOr 4ZTFA 2R58A 4C8QE 2P0PA 1RL2A 4HCBA 5LJ3h 1I81A 2EQKA 4M77D 2EJFA 3J7AF 4M78C 2E5QA 1N27A 3OW2S 1H3ZA 3JCMQ 3OYDA 4PJOF 2QQ9A 1Y96B 3I55T 1M1FA 4C92F 2PVOB 2KQWA 2CZ6B 4QQDA 5CCAA 3JB9G 3DLLA 3EAEA 5CK9A 1HXDA 2KY9A 2R57A 3CCSA 1Q81U 5D6XA 2RJDA 2XU8A 1X01A 4OP0A 2HNIA 3NTKA 4P5NA 4C8QD 5KCOA 4R55A 2QEXT 3S3MA 3JB9H 3RERA 2QTXA 3OBWA 3X20B 1M1KU 3OBYA 4DOWA 3QPHA 2RHZA 5CVIA 2FL7A 3F70A 3RKXA 5GAN4 3VUZA 2QQBA 2RD1A 4NS5A 2ZGWA 4FM4B 4EMKB 1M1GA 5A0LA 2RO0A 3RIRA 3ZEHA 2DAQA 2MI6A 2BUDA 4FL6A 3LWHA 3VJPA 1QP3A 3SDZA 5GMKm 2QXFA 3MP8A 3CCST 1VQLA 4F7UA 5GAOq 2E1HA 5CR2A 2E10A 3HSBA 4F7UG 2P0KA 2QDYB 4O6JA 4YTLA 4ZN3A 1HK9A 2VYTA 4B9XA 3JB9F 5I21A 2FB7A 1Q7YC 1JJ2A 3VYHB 2CZ1B 4Z02A 3O8VA 3OMCA 2YLCA 1Y71A 2XICA 1XOVA 3CCUA 1VQMA 2M9UA 4N4IA 5DLOA 2QA4A 4M7DC 2MAMA 5GAN8 2E12A 4IUVA 3QBYA 2HBPA 3QXEB 4II1A 3Q1JA 3OYFA 3VYGA 1SSFA 4HCZA 1VQLT 3G7ZA 3CMAA 3G6EA 3C12A 4XTXA 3LH0A 4ELZC 2WSCE 3ZFJA 3CXCS 3NTHA 2XI9A 2E65A 3JCMb 3PIOA 2ZPBB 5LJ3j 5FLXE 2IG0A 1N8RU 2LT4A 3PMIA 2O4XA 1PSEA 1BKBA 1G3WA 2RHXA 2X4XA 2K5FA 3CCUT 2DTIA 2ZPEB 3FJPA 1DJ7B 3OYIA 2QA4T 1U1SA 1QVGS 2DKGA 3CCEA 2D6FA 3G4SA 1FXXA 2QI2A 5CKEA 4EMHA 2L89A 3CMAT 4PNOA 2Y4XA 5CQXA 3V7RA 2HD0A 3OA6A 1M5Q1 2FYKA 1XNIA 3UDCA 2K3YA 1VQ7A 4NL3A 3JRZA 2F5KA 3JCMJ 3A8MB 4RMOA 4Y28E 3SWNB 3FB9A 3R6OA 4V2SA 2R5MA 2PVGB 3CC2A 3G4ST 5GAMe 1I4K1 4J6WA 3OS5A 4MZMA 1YJWA 3M55A 1OI1A 4J6XA 4M7AC 5L8RE 4M7DB 2X4YA 3HL8A 1EIFA 1P92A 2WSEE 5D6WA 3A8OB 3A8LB 3QHSA 4TVRA 3S3OA 2RM4A 4OVAA 3PMTA 1UGQB 2LVMA 2XG8D 3GF5A 4RKUE 4DOVA 5LJ3g 3KXTA 3M4GA 3JCMX 4C5EA 5LL6S 1FWZA 1Q7YU 2GF7A 3HPWA 3CC2T 2G3RA 3OB9A 3SB2A 1YBYA 2RHUA 1QVPA 2A3LA 2YHTA 5A0DA 3OYKA 2V8IA 1YJWT 3QO3A 1G3SA 4Q5WA 3OS1A 4OGCA 5DY9A 3ME9A 4X9DA 1D3BA 4XAXB 1GXIE 2GQVA 1VQKA 4L5GA 2V8JA 3M56A 2RHYA 1KQ1A 4XU3A 4C0GA 4PJOC 4C92C 3JB9I 3OS2A 1UB4A 3GOXA 4E7JA 4JDSA 3OSVA 4EMKC 1MHNA 5J26A 2LT1A 4ELYC 1X75C 2EAYA 5IN1A 5HK3A 3RESA 4ME7A 4XU0A 2DEQA 1BI2A 5GAMf 3S6WA 5HKCA 4IUQA 2M16A 2LDMA 1Y07A 2XK0A 3GPLA 4JRPA 5M9OA 2F69A 3FDRA 2DPPB 3L1AA 3OMGA 3I55A 4M75C 1VQKT 4B9WA 1WPYA 2DK3A 4M7AB 2RK2A 1WNLA 4KUDK 4M7DE 3CCJA 1B34A 1AHJB 1XTDA 2QEXA 2DXTA 3CCQT 4BD3A 1QVFA 2L3RA 3RKYA 2ZPHB 3NFCA 2EYQA 4MZTA 5EG2A 4UC4A 3CBPA 3FEOA 3JCMP 1G3TA 4FU6A 2GCXA 1VQ9A 3CBOA 4IURA 4HA8A 4OB1B 2XIDA 4XU1A 3A8HB 5LJ5g 1Q86C 3T9NA 4BI3A 2E6ZA 4M7DD 4ZGEB 3CXCA 2FVUA 4FIBA 1K8AC 2PUOB 5GMKh 3CCJT 4BDYA 3BDUA 1OYXA 4OF1A 1X6OA 1YITA 2EQJA 4PJOB 4C92B 1BIBA 5LJ3e 4EDUA 1QVGA 4JRIA 4M75F 3FC3A 2DD4A 3MEWA 4OB2B 1VQ9T 4M78A 3OY9A 4RCBA 2EJ9A 3M54A 1S72A 1LOJA 1VIFA 2EKOA 4QW2A 2VC8A 3RMSA 4E7KA 1YI2A 4O5VA 4KT0E 3J80E 3L2WA 1W2BA 4XK8E 1ZQ1A 3SWNC 5GAOn 4M75B 4BE2A 2JZ2A 4OB0B 5LJ5d 3PTAA 1YITT 2C06A 1VQNA 4M7AE 1BI3A 2LCLA 3GLXA 3LGLA 3P8BB 4J5YA 4J6YA 3V7SA 3JCMV 3L2VA 2DXCA 3E19A 3QYGB 4X9CA 3QIIA 2PVDB 2RB6A 3PNWC 4BY6B 1G5VA 2AHJB 1OZ3A 2DIGA 3CC7A 1S72T 2D9TA 4PL6A 3V7CA 5CQYA 4BACA 3PT9A 1UGPB 2KSSA 2XKOC 5GAOl 1YI2T 1YJ9A 2RJFA 1U1TA 4JS5A 2HQEA 3E1SA 4LDUA 3QSUA 2XDPA 1U8RA 1M90C 1JB0E 4M7AD 3M9QA 1VQNT 5LJ5h 2DVEA 3QZ9B 4VUBA 3A5ZB 4M77A 2LC4A 4C0DB 4HCCA 1BIAA 5GAN5 4A53A 3JCMg 5GANd 4MDWA 4M77G 5LJ3f 1BI0A 2I2LA 4ATOA 2XHCA 3CC7T 5IAYA 2DO3A 4PJOE 4F7UF 4C92E 2D0QB 3L2UA 3GNFB 5HK0A 3TU4K 4M7DA 1UGRB 1KC8C 1YJ9T 3M57A 5CKFA 4BUGA 2EFIA 4XTUA 1Q86U 5GMKj 3L2ZA 4C8QA 3J81E 3VU3C 4QVZA 1WQ7A 1YCYA 3V8JA 2XDBA 4WF2A 1K8AU 3HP9A 4CI0C 3CEYA 3CCMT 4C8QG 4QVCA 4LDXA 3QJ6A 5FU7C 1KQSS 4F7UB 2E70A 2ZPIB 4XTYA 2VV5A 2LQKA 3X25B 5GANh 3P8HA 4JLGA 2OAUA 3HRSA 3OYGA 1VQ4A 4M75E 1VQOT 3GIBA 5GAN2 5I2MA 4PJOD 4C92D 3CCLA 4BE1A 3AHUA 4JLIA 2NLUA 3CBMA 2F5TX 3OSSC 2MF2A 1WGSA 3JCMd 4JRQA 1Y7XA 1Q82C 1ZHIA 4N4HA 3CC4A 4MMKA 4M77F 2ZPFB 3TEEA 4C0FA 2HAXA 3LLRA 3HHTB 5FROA 1O75A 3MEAA 3PFSA 2DZCA 2M0OA 2RJEA 3EFSA 2RI5A 3X26B 4BI4A 3OYHA 2GFAA 3OYNA 2OTJT 4FSXA 5HY6A 4M75D 4N0AA 5CIUA 1VQ4T 3DB4A 3MEVA 2K5IA 2KMTA 3HRUA 2JVVA 4NL2A 2OTLT 3CCLT 4LDYA 3SD4A 1LNXA 2QQRA 2DTHA 3EFRA 5GAN6 3OW2A 3M59A 4FT4A 1TH7A 4C8QF 4D6WA 2O4XB 2ZPGB 3JCMh 4MDXA 1NJIC 2BIVA 3CC4T 1NE8A 3CCRT 4LDVA 3X24B 2RI3A 2JTMA 2EJGA 5LJ5j 4BB7A 2O01E 4C5HA 3HRTA 1M90U 5KCHA 3JB9D 2XD0A 3E9FA 4ZTJA 3FIFA 3FLGA 5LJ5f 4JJNK 3KUFA 3WVEB 2KK4A 2RK1A 2RH2A 2LNVA 4HKEA 4KUIA 3JCMc 1H641 1V29B 2VGNA 3HKSA 2VGMA 3PIPA 3I56A 3CCQA 5FRMA 1KG1A 5FU7B 4EPCA 4JS4A 4F7UE 1Y96A 1BI1A 3JB9J 5DLQE 1VQ8T 1NZ9A 2KVQG 5FRNA 1KC8U 3LYIA 1N9SA 1QP2A 2P0QA 4GY5A 1YIJT 4A4KA 2R5AA 4XTVA 5J3BA 3RMQA 4QVDA 2BKDN 1M8VA 5FU6C 3UWNA 3QJYA 4DQ2A 1WJRA 4PKCC 3OYJA 2MWPA 4A4FA 4C92A 3CMEA 4BY6C 3I56T 2CS7A 3WVDB 3G71A 1N9RA 4EMKA 1ZBXA 3OYBA 4ZGJB 4KULA 4R56A 4Y91A 1Q82U 1VQ5T 3OYCA 1YHQA 1PSFA 1VIEA 4E47A 3CCVA 1KHCA 3X28B 5J39A 3DB3A 3H8ZA 3GP8A 4MZPA 1K9MC 4C0DC 2QQAA 5GMKl 1KHIA 4C5GA 3WXMB 5A2QE 2HQXA 2FHDA 3M58A 1D3BB 3CMET 3UPUA 5DM7R 4OMFB 2LQ8A 3G71T 4XQ3A 2DXBA 3JCMW 3CPFA 3TCJA 4XU2A 3CPWS 4FT2A 4QQ6A 1NPPA 4A4EA 2XDDA 2Y90A 1R8OB 2P4TA 1JRIA 3JCMf 1NJIU 2K3XA 3HFOA 3VKIA 2E6NA 2JTFA 4E7HA 3CCVT 5IT9E 2YLBA 3QYHB 1YHQT 2PQWA 2VXEA 4M78G 3DKMA 2DTOA 4C5IA 3CD6A 5GANg 2DZ9A 5C0MA 4RG2A 4BDZA 3BDLA 4IUTA 4RCCA 5GMKe 3L2RA 4J8OA 1KQSA 2PUKB 3H6ZA 5FU6B 3OYMA 4N4GA 5GAMg 3C94A 4J83A 2K2VA 2YRVA 1B34B 4IUUA 1WQWA 2VUBA 3M53A 4LD6A 3URGA 3QUIA 2DJZA 5KE3A 5GMKi 5GAOp 2K4YA 3CD6T 3LGFA 5CO7A 3MP1A 2KAFA 4GLKA 4L59A 3CCMA 2QQSA 3QDRB 4M77C 3SWNA 2RI2A 2LTOA 4M78F 2E41A 4BI8B 5CKDA 4XTZA 1UGSB 1O9SA 3ZBDA 1VQOA 4LDWA 3V8LA 3VUBA 4HT8A 1UEBA 1BYMA 5GAMd 4XTWA 2JN0A 5A0GA 2RJCA 2RHIA 1K9MU 4M7DG 1VQ6A 4C8QC 4M78B 1FX7A 3ER0A 3QKJA 1WJQA 3MCAB 3V8KA 1IZ6A 5LJ5e 3OQ5A 2CYZB 2OTJA 2CKKA 1K73C 3MO8A 2H3JA 4JUVA 3BFMA 2OTLA 3OYLA 1KD1C 4J7FA 4RG8A 4E7LA 1VQMT 3UT1A 2EWNA 2GFUA 3OYEA 3FRNA 1M4ZA 5CKBA 5GAMh 4L6V5 2LCCA 3HFNA 3JSCA 4ZGDB 3LW5E 2K5LA 3NTIA 4PLIA 4PLLA 5GAOm 3CCRA 2KDSA 2V8KA 4IUPA 5CAIA 4X34A 3C4SA 4JRKA 3G6ET 2K57A 2EQMA 2L8DA 3OYYA 3RUXA 1YJNA 1W2BS 3N5BB 3MEUA 4N0AC 2EIFA 3C95A 2JUFA 2Y4YA 3P8DA 3QZ5B 4A54A 3MP6A 5GANe 4M7DF 5AYFA 5KH6A 3DLMA 2DD5A 2CZ7B 3A8GB 4M77B 3OS0A 5GAN3 2JOYA 4C0ZA 2X4WA 3LWIA 1JJ2S 4J7IA 3CCET 1VQ8A 4IKFA 1KQ2A 1XQHA 3META 3SFMA 4ZN1A 2WACA 5CKHA 4M7AA 1N6AA 1YIJA 2ZZDA 1W4SA 2A7YA 5C6SA 1IREB 4OB3B 2B8AA 4M7AG 4E7IA 4QQGA 2JNGA 1YJNT 3E9GA 1I8FA 3JAME 3S3NA 1LJOA 4C8QB 1Q81C 1VQ6T 4HT9A 1VQ7T 4M78E 2LRQA 4BE0A 4NOYA 3CPWA 2LX9A 3PGGA 3QG1A 1M1KC 4A4HA 3INZA 4EMGA 2X4JA 2MMPA 4A4GA 4MMLA 3JCMe 3LX7A 3BY7A 1VQ5A 2PU9B 3L2QA 3L42A 1G3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M78 D;  5GAN j;  2Y90 A;  5GAM e;  1I4K 1;  4J6W A;  4M7A D;  4PJO A;  1JRI A;  3JCM f;  2DVE A;  5LJ5 h;  3HFO A;  5GAN 7;  1I5L A;  4M77 A;  4J6X A;  4M7A C;  2YLB A;  5GAN f;  1JBM A;  2VXE A;  1BIA A;  4M78 G;  4PJO G;  4A53 A;  3JCM g;  4C92 G;  2RA2 A;  5GAM j;  4M77 G;  5GAN d;  5LJ3 f;  2DTO A;  4M7A F;  4M7D B;  3QHS A;  5GAN g;  2DZ9 A;  2I2L A;  2RM4 A;  5LJ3 d;  4RCC A;  5GMK e;  4PJO E;  4F7U F;  5LJ3 g;  4C92 E;  4M7D A;  3M4G A;  4M77 E;  3JCM X;  1MGQ A;  2E64 A;  5GAM g;  4XTU A;  5GMK j;  3L2Z A;  4M75 A;  4C8Q A;  1B34 B;  2DXU A;  1WQ7 A;  1YCY A;  1WQW A;  3SB2 A;  3V8J A;  3VU3 C;  2YHT A;  4WF2 A;  2VXF A;  4M75 G;  3RKW A;  3QO3 A;  4C8Q G;  4QVC A;  3QUI A;  2DJZ A;  5DY9 A;  4F7U B;  2CGH A;  3BW1 A;  4X9D A;  4XTY A;  5GMK i;  5GAN h;  5GAO p;  5GAO r;  3GIB A;  1D3B A;  4M75 E;  4C8Q E;  4PJO D;  5GAN 2;  5LJ3 h;  4C92 D;  1I81 A;  4XU2 A;  4M77 D;  3AHU A;  1KQ1 A;  2EJF A;  4JLI A;  4XU3 A;  4PJO C;  4M78 C;  4C92 C;  3SWN A;  4M77 C;  3JCM d;  3JCM Q;  3JB9 I;  4PJO F;  4M78 F;  1Y96 B;  2E41 A;  4C92 F;  4EMK C;  4MMK A;  4M77 F;  4XTZ A;  3JB9 G;  2EAY A;  3V8L A;  3RES A;  4XU0 A;  2DEQ A;  1HXD A;  4HT8 A;  2DZC A;  5GAM f;  3EFS A;  5GAM d;  4XTW A;  1X01 A;  4OP0 A;  2HNI A;  4M75 D;  4N0A A;  4C8Q D;  3RER A;  3JB9 H;  2JN0 A;  4NL2 A;  2QTX A;  3L1A A;  4M7D G;  4M75 C;  4C8Q C;  4M78 B;  1WPY A;  1LNX A;  3EFR A;  2DTH A;  4M7A B;  3RKX A;  5GAN 6;  5GAN 4;  2RD1 A;  1TH7 A;  1WNL A;  2ZGW A;  3V8K A;  4C8Q F;  4EMK B;  5LJ5 e;  3JCM h;  4M7D E;  3RIR A;  1B34 A;  4JUV A;  2DXT A;  3BFM A;  2EJG A;  5LJ5 j;  3RKY A;  5GMK m;  2EWN A;  3JB9 D;  4F7U A;  5GAO q;  2E1H A;  3FIF A;  5GAM h;  2E10 A;  5LJ5 f;  3JCM P;  3HSB A;  3HFN A;  4F7U G;  3JCM c;  4HA8 A;  1H64 1;  5GAO m;  1HK9 A;  4XU1 A;  3JB9 F;  5CAI A;  5I21 A;  2FB7 A;  5LJ5 g;  5GAN 5;  4JRK A;  2K57 A;  4M7D D;  2YLC A;  3RUX A;  4F7U E;  1Y96 A;  3JB9 J;  5GMK h;  4M7D C;  3BDU A;  5GAN 8;  4N0A C;  1N9S A;  5GAN e;  4A54 A;  4M7D F;  4XTV A;  4PJO B;  4C92 B;  1BIB A;  4QVD A;  4M77 B;  5LJ3 e;  1M8V A;  4JRI A;  4M75 F;  4XTX A;  4DQ2 A;  5GAN 3;  1KQ2 A;  2E65 A;  4M78 A;  4RCB A;  2EJ9 A;  4C92 A;  5LJ3 j;  3JCM b;  4M7A A;  1LOJ A;  1N9R A;  4EMK A;  2VC8 A;  4M7A G;  2DTI A;  3FJP A;  1I8F A;  1U1S A;  3SWN C;  4Y91 A;  1LJO A;  2DKG A;  4M75 B;  4C8Q B;  5GAO n;  4HT9 A;  4M78 E;  5LJ5 d;  4EMH A;  4NOY A;  4M7A E;  3PGG A;  4J5Y A;  4J6Y A;  4PNO A;  3V7S A;  3JCM V;  3V7R A;  1M5Q 1;  3INZ A;  4X9C A;  4EMG A;  5GMK l;  2RB6 A;  4MML A;  2FYK A;  3JCM e;  1D3B B;  3V7C A;  3BY7 A;  4XQ3 A;  3JCM W;  4NL3 A;  3JCM J;  5GAO l;  3QSU A;  3SWN B;  1U1T A;  3FB9 A;  4V2S A; 
#chains in the Genus database with same CATH topology
 1WHG A;  4CRI A;  2O31 A;  2RA2 A;  2EW3 A;  1IHW A;  2X35 A;  4DA4 A;  4M77 E;  2AIR B;  4M75 A;  1D09 B;  3ASK A;  3D7S B;  1PC0 A;  1RAF B;  4M75 G;  5KE2 A;  3OYA A;  1VUB A;  3M5A A;  2J6O A;  1N8R C;  2FPD A;  3VS1 A;  3CCQ Q;  1AZG B;  2AK5 A;  4PJO F;  1Y96 B;  1HXD A;  5D6X A;  2RJD A;  1KFZ A;  2XU8 A;  1X01 A;  2QEX T;  5KCO A;  3S3M A;  4R55 A;  2QTX A;  3OBW A;  1D1A A;  1M1K U;  3OBY A;  3EG9 B;  3QPH A;  3OYG A;  3VUZ A;  2QQB A;  2RD1 A;  1T3S A;  2MI6 A;  4RTT A;  2BUD A;  3LWH A;  3VJP A;  1WIE A;  2QXF A;  1ZUK A;  2O9V A;  4D8D A;  1N5Z A;  1GL5 A;  2QDY B;  4YTL A;  4ZN3 A;  4LXC A;  7AT1 B;  2FB7 A;  4AFU C;  3O8V A;  1QVF S;  5DLO A;  4M7D C;  2MAM A;  4IUV A;  2KGT A;  3Q1J A;  3VYG A;  2LJ0 A;  3CMA A;  2HKQ B;  3C12 A;  1UEC A;  1EX4 A;  2FO0 A;  2WSC E;  3ZFJ A;  2E65 A;  3PIO A;  2ZPB B;  5FLX E;  2IG0 A;  1VQN Q;  3PMI A;  1PSE A;  1ZSG A;  1QVG S;  3G4S A;  3CC7 Q;  3CMA T;  4PNO A;  5CQX A;  2FYK A;  3UDC A;  1WHL A;  4CC4 B;  2CSQ A;  3A8M B;  2CP7 A;  2IIM A;  3FB9 A;  3R6O A;  4V2S A;  3G4S T;  5GAM e;  1I4K 1;  4FYW B;  5D6W A;  3S3O A;  1V1C A;  2RM4 A;  2HBW A;  2HQH A;  2DM1 A;  2KI7 A;  1UGQ B;  4DOV A;  3KXT A;  3GF5 A;  2KYB A;  1VQ6 Q;  4FYV B;  5LL6 S;  3AT1 B;  2FPF A;  1Q7Y U;  2GF7 A;  5A0D A;  3MKD A;  3EGD A;  3OS1 A;  3CCL Q;  2ROL A;  5DY9 A;  2OX7 A;  1IHV A;  2COY A;  1JQQ A;  2V8J A;  4C0G A;  1ARK A;  2E3H A;  1I1J A;  2YSQ A;  3CQT A;  2EYZ A;  4JDS A;  3I5S A;  2EAY A;  5IN1 A;  2J05 A;  3RES A;  4ME7 A;  4EIK A;  5GAM f;  5HKC A;  2M16 A;  1OOT A;  2MPX C;  5M9O A;  2DFU A;  3EFO A;  4B9W A;  4M7A B;  1WNL A;  1M3B A;  2CH4 A;  1XTD A;  2YUN A;  2DX1 A;  3CBP A;  1G3T A;  4FU6 A;  1VQ9 A;  3CBO A;  2A0F B;  3A8H B;  1Q86 C;  3T9N A;  1VQ5 Q;  1IB8 A;  2D8J A;  4BDY A;  2PZ1 A;  4OF1 A;  4AT1 B;  3CME Q;  4C92 B;  4JRI A;  2QYZ A;  1JXM A;  1VQ9 T;  3R6N A;  4OB2 B;  1S72 A;  1OU9 A;  2VC8 A;  1YHQ Q;  1YI2 A;  3CCV Q;  3L2W A;  1Y57 A;  4OB0 B;  2QGG A;  2YUO A;  4M7A E;  2LCL A;  4J5Y A;  4J6Y A;  2DXC A;  1E6G A;  3QII A;  1G5V A;  2AHJ B;  4E6R A;  1X2Q A;  1S72 T;  3V7C A;  4PL6 A;  2YT6 A;  1OX8 A;  1YI2 T;  1YJ9 A;  3QSU A;  1U1T A;  3E1S A;  1VYV A;  1M90 C;  1W1F A;  2OJ2 A;  5LJ5 h;  2DVE A;  4VUB A;  4M77 A;  2CUD A;  4MDW A;  4M77 G;  1BI0 A;  2DO3 A;  3M0T A;  4C92 E;  4M7D A;  2C0O A;  1YJ9 T;  4BUG A;  1NEB A;  3L2Z A;  1QCO A;  1YCY A;  3CEY A;  1K8A R;  4F7U B;  2FRW A;  4XTY A;  4DEX A;  2VV5 A;  3P8H A;  1VQO T;  3H0F A;  3GIB A;  1WX6 A;  4D8K A;  2CP2 A;  4PJO D;  1YNZ A;  3LH5 A;  2NLU A;  3CBM A;  3OSS C;  2MF2 A;  1BK2 A;  2HMA A;  1PNJ A;  3LLR A;  1O75 A;  3PFS A;  4CC2 A;  2M0O A;  2RJE A;  2OTJ T;  3G6E Q;  4FSX A;  5HY6 A;  4N0A A;  4LDY A;  4FT4 A;  1SPK A;  2GTJ A;  2DL8 A;  2O4X B;  1WHJ A;  3JCM h;  4HXJ A;  4FW1 A;  5LJ5 j;  2LJ1 A;  1C1A A;  3HRT A;  1TOV A;  1NBE B;  1FYN A;  2JS2 A;  2LNV A;  3PIP A;  3JCM c;  3G1J A;  2LX7 A;  3I56 A;  4PFZ A;  2V26 A;  4F7U E;  1Y96 A;  3JB9 J;  2KVQ G;  2QGF B;  3LYI A;  4GY5 A;  1NM7 A;  4A4K A;  2BKD N;  1UTI A;  1M8V A;  3ZL7 C;  4LE9 A;  4PKC C;  3EG9 A;  3I56 T;  1AWO A;  3G71 A;  4F17 A;  4ZGJ B;  4R56 A;  2JS0 A;  1EZZ B;  4QT7 A;  1KHC A;  4ZNX A;  3X28 B;  3GP8 A;  1KIK A;  3UPU A;  3M58 A;  2LQ8 A;  3G71 T;  1ZX6 A;  4KGZ B;  2L0A A;  4FT2 A;  1VQP Q;  4A4E A;  2F2W A;  5IHK A;  1JRI A;  2K3X A;  2E6N A;  1SEM A;  3QYH B;  2PQW A;  4M78 G;  2CH4 W;  4C5I A;  2C0T A;  3L2R A;  1KQS A;  2HCK A;  5FU6 B;  2NUZ A;  2HKN A;  2YUQ A;  2YRV A;  1B34 B;  4IUU A;  1WQW A;  2M02 A;  3VS2 A;  4JJD A;  3M53 A;  1WXB A;  2H8H A;  1G2B A;  1QLY A;  3UAT A;  1MMD A;  2GTO A;  4L59 A;  3CCS Q;  2LTO A;  4HVU A;  4BI8 B;  1QMC A;  1UGS B;  3VUB A;  3NMZ C;  1BYM A;  5KYW B;  4JJB A;  1B3Q A;  2AKL A;  4RUG A;  2JN0 A;  2AZS A;  2FG0 A;  1FX7 A;  3ER0 A;  2GQI A;  1WJQ A;  3M0P A;  1IZ6 A;  1UG1 A;  1OEB A;  3QWX X;  2A28 A;  5AT1 B;  1N8R R;  4PJJ A;  3OYE A;  3FRN A;  1M4Z A;  5GAM h;  2FRY A;  1SHG A;  1YFN A;  4L6V 5;  3CCU Q;  4ZGD B;  3HFN A;  1I5O B;  3NTI A;  3CCR A;  3MJX A;  1T3L A;  3C4S A;  2EQM A;  3OYY A;  3N5B B;  2VWF A;  2HL3 A;  3U23 A;  5KH6 A;  2CZ7 B;  1OV3 A;  3H0I A;  4C0Z A;  2X4W A;  3LWI A;  3CCE T;  1JO8 A;  1XQH A;  4ZN1 A;  5CKH A;  4M7A A;  1YIJ A;  2EQI A;  1VA7 A;  4M7A G;  1OPL A;  2JNG A;  4JZ3 A;  4C8Q B;  2YRD A;  5IXB A;  3CPW A;  1IGQ A;  1M1K C;  2MMP A;  2CP5 A;  1NLO C;  3BY7 A;  2EGC A;  3H9N A;  2FZG B;  1G3Y A;  4M78 D;  5GAN j;  1NPR A;  5FWB A;  5GAN 7;  2X3W D;  1LPL A;  3VS6 A;  1WFW A;  4C92 G;  5GAM j;  3CPW P;  5LJ3 d;  1YP5 A;  1WJS A;  2MWO A;  2M1H A;  2ZCF B;  3TRE A;  1MGQ A;  2SEM A;  2HSE B;  3SHW A;  2DXU A;  3QDF A;  4FYX B;  4J9D A;  3KBG A;  1V76 A;  2R58 A;  4C8Q E;  2P0P A;  4HCB A;  4K11 A;  4FSS A;  1H3Z A;  3JCM Q;  2A08 A;  4B6M A;  3OYD A;  3I55 T;  2PVO B;  2D8H A;  4E7S A;  1F1B B;  1HD3 A;  5CK9 A;  2KY9 A;  2R57 A;  5IXF A;  3JV3 A;  4OP0 A;  2HNI A;  1AVZ C;  2QDL A;  1TG0 A;  2C0I A;  4NS5 A;  1M1G A;  3ZEH A;  3VS4 A;  2DLP A;  1PRM C;  1QP3 A;  3MP8 A;  2HZY A;  1VQL A;  4F7U A;  5CR2 A;  4LNP A;  3M0U A;  2L3P A;  4F7U G;  2P0K A;  4O6J A;  1Q7Y C;  4KRT A;  1JJ2 A;  3VYH B;  2CZ1 B;  4Z02 A;  1YIT Q;  1JXO A;  2YLC A;  1Y71 A;  3OMC A;  1XOV A;  4RTV A;  1VQM A;  2K79 A;  2E12 A;  3QBY A;  2HBP A;  3QXE B;  3M0R A;  3TQ7 P;  1VQL T;  4ELZ C;  4RTW A;  2XI9 A;  3CD6 Q;  3JCM b;  6AT1 B;  1WI7 A;  1TS9 A;  2O4X A;  1NLP C;  3FJP A;  2ZPE B;  1KSW A;  3OYI A;  1JJ2 P;  1FXX A;  2QI2 A;  2RPN A;  1RLQ C;  2RQU A;  1Y0M A;  2HD0 A;  2IPO B;  1M5Q 1;  3OA6 A;  2DE0 X;  1VQ7 A;  3JRZ A;  3CCM Q;  1UFF A;  3OS5 A;  4IIM A;  1MUZ A;  4M7D B;  2X4Y A;  2DVJ A;  1AZE A;  3A8O B;  3A8L B;  3QHS A;  4TVR A;  5IH2 A;  2HEQ A;  3UA6 A;  1R0B G;  4C5E A;  1H92 A;  4LN2 A;  4J9F A;  3NPF A;  2A3L A;  1VQ4 Q;  4HVW A;  1QCN A;  4RTY A;  2V8I A;  2OTL Q;  3QO3 A;  4Q5W A;  1QWF A;  2AKK A;  1AWW A;  1GXI E;  1Z9Z A;  2ATC B;  2BZY A;  2QAS A;  1D1C A;  4PJO C;  3NGP A;  3OSV A;  4GBQ A;  2DF6 A;  1X75 C;  2K9G A;  3RDV A;  1SRL A;  5KYX B;  1FMV A;  1BI2 A;  1OX9 A;  3S6W A;  4IUQ A;  1SHF A;  1GRI A;  1VQ8 Q;  2DPP B;  1WPY A;  1EFN A;  4KUD K;  4M7D E;  1PHT A;  1B34 A;  1AHJ B;  2K3B A;  2QEX A;  3CCQ T;  4BD3 A;  3FJ5 A;  2ZPH B;  3NFC A;  2ZAE A;  4MZT A;  2MOX A;  3FEO A;  2GCX A;  2OI3 A;  4IUR A;  4XU1 A;  1OYX A;  1X6O A;  3EGX A;  4J9I A;  5KYW A;  2GBQ A;  3MEW A;  4FCY A;  3OY9 A;  4RCB A;  3M54 A;  1TTH B;  4E7K A;  1UUE A;  2QG9 B;  1ZQ1 A;  4BE2 A;  8ATC B;  1M3A A;  1VQN A;  3V7S A;  3E19 A;  2DBK A;  2RB6 A;  3PNW C;  4BY6 B;  2YWW A;  3CC7 A;  2EYY A;  1H3H A;  5L23 A;  2XKO C;  3H0H A;  4LDU A;  1U8R A;  1JB0 E;  2H3E B;  3M9Q A;  1VQN T;  1BIA A;  4A53 A;  3EH2 A;  5GAN d;  1J3T A;  1BBZ A;  2I2L A;  2NYS A;  4ATO A;  3CC7 T;  2KYM A;  1M30 A;  3TU4 K;  5HK0 A;  2EFI A;  4XTU A;  4C8Q A;  3VU3 C;  4QVZ A;  1WQ7 A;  2XDB A;  1K8A U;  3HP9 A;  4C8Q G;  4QVC A;  3O5Z A;  1KK7 A;  2HSP A;  3E2U A;  1KQS S;  2E70 A;  2K7A A;  4F14 A;  3UF4 A;  2OAU A;  5I2M A;  3CCL A;  4JLI A;  2ESW A;  2F5T X;  5I22 A;  3CC4 A;  1ZSZ B;  2F2X A;  4M77 F;  3TEE A;  3MEA A;  3EFS A;  2RI5 A;  4BI4 A;  3RNJ A;  2KRM A;  2BZ8 A;  2BZX A;  4M75 D;  5CIU A;  3DB4 A;  4NL2 A;  2K5I A;  3HRU A;  2JVV A;  3CCL T;  2ECZ A;  2DTH A;  4MDX A;  1IO6 A;  1X2K A;  3CC4 T;  1NE8 A;  2RQV A;  2RI3 A;  1FMW A;  4BB7 A;  4AMC A;  4C5H A;  2BE7 D;  1WLP B;  1Z9Q A;  3FIF A;  3FLG A;  2KK4 A;  2RH2 A;  4HKE A;  1V29 B;  1YJN Q;  2VGM A;  2FEI A;  4EPC A;  4JS4 A;  1K0X A;  1ABQ A;  3ULR B;  2L3Q A;  4E7Z A;  8AT1 B;  1MMG A;  1KC8 U;  1N9S A;  2R5A A;  4KH1 B;  3RMQ A;  2KNB B;  2J7I A;  1WJR A;  4A4F A;  4DBF A;  3CME A;  4BY6 C;  1TUC A;  1ZBX A;  3OYB A;  2ABL A;  1Q82 U;  1VQ5 T;  1YHQ A;  1VIE A;  2CRE A;  3CCV A;  3DB3 A;  1KHI A;  5A2Q E;  3TSW A;  2FHD A;  3CME T;  5DM7 R;  4LUD A;  2KEA A;  3TCJ A;  1PM3 A;  3CPW S;  1K76 A;  1UGV A;  2Y90 A;  4IIO A;  1M8M A;  2C06 A;  3HFO A;  3VKI A;  1YHQ T;  5IT9 E;  3CCV T;  1NJI R;  1E7O A;  5C0M A;  4RG2 A;  4BDZ A;  4IUT A;  1IGU A;  3H6Z A;  2RMO A;  3OYM A;  2YUP A;  4J83 A;  2K2V A;  3IQL A;  1ZSZ C;  1M1K R;  2VUB A;  2QK0 A;  4LD6 A;  3URG A;  3QUI A;  2DJZ A;  5KE3 A;  5GAO p;  2K4Y A;  1CKB A;  5CO7 A;  2KAF A;  3EG2 A;  1RLP C;  2OAW A;  1BU1 A;  4M78 F;  2E41 A;  5CKD A;  4XTZ A;  5I11 A;  4RTZ A;  3ZBD A;  1VQO A;  3V8L A;  4HT8 A;  2GGR A;  1OUL A;  4M4Z A;  4J9B A;  1K9M U;  4M7D G;  3EHQ A;  3MCA B;  3V8K A;  1LCK A;  2CYZ B;  2OTJ A;  3MO8 A;  1M2O A;  2VVK A;  4J7F A;  4RG8 A;  3UT1 A;  5CKB A;  1UJ0 A;  4PLI A;  2QA4 Q;  2F1L A;  4IUP A;  1BCO A;  3G6E T;  2COZ A;  5FWC A;  3MEU A;  5KYX A;  4A54 A;  5AYF A;  5HCK A;  3OS0 A;  5GAN 3;  1JJ2 S;  4IKF A;  1KQ2 A;  1T0H A;  3MET A;  2L2P A;  1N6A A;  2LZ6 B;  1W4S A;  2A7Y A;  2CP0 A;  1IRE B;  4FW2 A;  4E7I A;  2LX9 A;  3PGG A;  4DBH A;  3INZ A;  2HDA A;  2ROT A;  1S1N A;  1Q7Y R;  3LX7 A;  3CC2 Q;  3EG3 A;  1YJW Q;  3L2Q A;  2DER A;  1I5L A;  1RI0 A;  1VQP A;  3GNG A;  1K73 R;  1KD1 U;  4M7A F;  2DIQ A;  1M9S A;  1OZ2 A;  1UDL A;  2BE9 B;  3VRY A;  2L5Q A;  1JU5 C;  5D6Y A;  2VXF A;  4OGE A;  1VQK Q;  4OMM A;  1PG5 B;  1VQP T;  1MV0 B;  2CGH A;  5I2S A;  5GAO r;  4ZTF A;  2COW A;  1TXQ A;  4WTO B;  1I81 A;  1M3C A;  4M77 D;  2EKH A;  1C6V X;  2E5Q A;  3OW2 S;  1G83 A;  1M1F A;  4C92 F;  2CSI A;  1GBQ A;  4QQD A;  5CCA A;  3JB9 G;  3DLL A;  3EAE A;  1NYF A;  3REB B;  3CCS A;  1QWE A;  4LUE A;  4P5N A;  1UHF A;  2DA9 A;  3NTK A;  3RER A;  3JB9 H;  1Q81 R;  3CCJ Q;  2RHZ A;  5CVI A;  1PD0 A;  5GAN 4;  4J9E A;  2RO0 A;  2DAQ A;  3SDZ A;  1X27 A;  5KYN A;  3CCS T;  4PJM A;  1GCQ C;  2E10 A;  1KQS P;  1ZUY A;  1HK9 A;  5D7U A;  1MMN A;  3EGX B;  2XIC A;  3CCU A;  1AWX A;  4N4I A;  1ZSZ A;  5GAN 8;  2O2O A;  4II1 A;  2J06 A;  4AFQ C;  4XTX A;  4OMP A;  1SG5 A;  2NUP B;  1SSH A;  2RQT A;  4HVV A;  2FZK B;  2RHX A;  3CCU T;  2X4X A;  4J9C A;  3CCE A;  2D6F A;  3V7R A;  2JTE A;  5IHI A;  1RUW A;  1ABO A;  3EG1 A;  1ZA1 B;  1I07 A;  2K3Y A;  2F5K A;  3JCM J;  3H41 A;  3SWN B;  2PVG B;  2PTK A;  2YDL A;  1RAI B;  5L8R E;  1P92 A;  2ED0 A;  2JM8 A;  2KR3 A;  4OVA A;  3PMT A;  2LVM A;  2MCN A;  2XG8 D;  4RKU E;  4ESR A;  3JCM X;  1NG2 A;  1FWZ A;  2LP5 A;  1TUG B;  2JT4 A;  1YBY A;  2RHU A;  4JPB W;  3EHR A;  4F04 B;  1PWT A;  2FZC B;  3OYK A;  4J9G A;  1CKA A;  1G3S A;  4OGC A;  4X9D A;  3VRZ A;  1SKU B;  4XAX B;  1TU0 B;  4L5G A;  3CCR Q;  2RHY A;  2KT8 A;  3JB9 I;  3TVT A;  4E7J A;  2LT1 A;  5HK3 A;  4XU0 A;  2DEQ A;  4E2F B;  3GPL A;  4JRP A;  2CP6 A;  3FDR A;  2KRS A;  3L1A A;  3I55 A;  4M75 C;  2DK3 A;  4J9H A;  1AT1 B;  1YIJ Q;  2MYS A;  1UHC A;  2DXT A;  2A37 A;  2DL7 A;  3RR6 A;  3THK A;  2KXC A;  1HYO A;  4UC4 A;  2DJQ A;  2VKN A;  3JCM P;  1M2V B;  4BI3 A;  2E6Z A;  3CXC A;  4FIB A;  1K8A C;  3BDU A;  1YIT A;  2EQJ A;  4PJO B;  1BIB A;  1IRX A;  1MNE A;  5LJ3 e;  4EDU A;  1QQJ A;  4M75 F;  2DD4 A;  2KT1 A;  2EJ9 A;  1LOJ A;  4QW2 A;  3RMS A;  4O5V A;  4KT0 E;  3J80 E;  4XK8 E;  1QKX A;  3SWN C;  3CXC P;  3PTA A;  5LJ5 d;  1YIT T;  3GLX A;  3P8B B;  2KBT A;  3MPU B;  3JCM V;  3QYG B;  2JMA A;  1OZ3 A;  2DIG A;  2EGA A;  2LCS A;  5GAO l;  2CUB A;  2XDP A;  4M7A D;  1WXT A;  4C0D B;  5GAN 5;  5LJ3 f;  2XHC A;  1AOJ A;  4PJO E;  2D0Q B;  2M51 A;  1KC8 C;  5CKF A;  3J81 E;  3V8J A;  1U06 A;  2PNI A;  1Q86 R;  4WF2 A;  3CCM T;  3QJ6 A;  5FU7 C;  1VYT A;  2ZPI B;  2LQK A;  1SRM A;  1VQ4 A;  4JLG A;  4CC3 A;  4C92 D;  4BE1 A;  3AHU A;  2EPD A;  3JCM d;  4JRQ A;  1VQM Q;  1Y7X A;  1Q82 C;  1ZHI A;  3TSZ A;  4OMN A;  2ZPF B;  4C0F A;  3HHT B;  2LQW A;  4ORZ A;  3X26 B;  2GFA A;  3OYN A;  1VQ4 T;  1K4U S;  3MEV A;  3EH1 A;  2OTL T;  1ACM B;  3SD4 A;  1LNX A;  2QQR A;  3EFR A;  3OW2 A;  4C8Q F;  2LJ3 A;  9ATC B;  2BTT A;  1K1Z A;  2JTM A;  2EJG A;  2XD0 A;  3E9F A;  4ZTJ A;  5LJ5 f;  1M90 R;  3KUF A;  2RK1 A;  4KUI A;  3CCQ A;  1RAD B;  1VQ7 Q;  2CDT A;  1VQ8 T;  1B07 A;  5DLQ E;  3OW2 P;  1WYX A;  2DL5 A;  1QP2 A;  1G8X A;  3VS5 A;  4XTV A;  2ENM A;  4DQ2 A;  1WXU A;  3OYJ A;  1K9A A;  1MMA A;  2L3S A;  3WVD B;  1AD5 A;  4HCK A;  2J6F A;  4Y91 A;  3OYC A;  2KE9 A;  1PSF A;  4E47 A;  2W0Z A;  2ED1 A;  1X69 A;  1K9M C;  4MZP A;  4C0D C;  2QQA A;  5GMK l;  4C5G A;  3WXM B;  2HQX A;  1D3B B;  1TUD A;  4XQ3 A;  2DXB A;  3JCM W;  4XU2 A;  4QQ6 A;  1NPP A;  2P4R A;  4CC7 A;  1R8O B;  1VYU A;  3JCM f;  1NJI U;  4E7H A;  2VXE A;  2YRC A;  1CSK A;  2NUP A;  2DTO A;  2DZ9 A;  3BDL A;  4RCC A;  5GMK e;  4AFS C;  4J8O A;  2PUK B;  4N4G A;  2QEX Q;  2JW4 A;  3BE3 A;  1RAC B;  5GJV B;  2E3I A;  2DL3 A;  5GMK i;  2F2V A;  4GLK A;  2QQS A;  3QDR B;  4M77 C;  3SWN A;  1D1B A;  1WZO A;  1O9S A;  1UEB A;  5GAM d;  4XTW A;  2CT3 A;  4Z88 A;  2DNU A;  1RAB B;  2RHI A;  4PFO A;  1VQ6 A;  1X6B A;  4M78 B;  2VB6 A;  1W70 A;  3QKJ A;  4KGV B;  2QTV A;  2CKK A;  4JUV A;  3C0C A;  1QKW A;  3BFM A;  2AT1 B;  1KD1 C;  2J6K A;  3JSC A;  2V1R A;  4PLL A;  2K5L A;  1VQ6 T;  5GAO m;  2NWM A;  5CAI A;  4X34 A;  4JRK A;  1BCM A;  3CMA Q;  1YJN A;  4OMQ A;  1W2B S;  1MV3 A;  4N0A C;  1PD1 A;  2DL4 A;  2XMF A;  5GAN e;  2Y4Y A;  3QZ5 B;  4M7D F;  3MP6 A;  3DLM A;  4F16 A;  2JOY A;  4J7I A;  4FYY B;  3G4S Q;  2ZZD A;  5C6S A;  2EVR A;  2B8A A;  4QQG A;  2MK5 A;  1YJN T;  4HT9 A;  1PRL C;  1BB9 A;  4M78 E;  2LRQ A;  4BE0 A;  3I9Q A;  1KJW A;  1M2V A;  2X4J A;  3VS3 A;  4KGX B;  1ZUU A;  1VQ5 A;  2PU9 B;  3L42 A;  2V1Q A;  3CC4 Q;  4PJO A;  1K73 U;  1QW1 A;  5GAN f;  1JBM A;  1YWP A;  1H8K A;  2EQU A;  2IVW A;  3MHX A;  4PJO G;  1RAA B;  3VV0 A;  2CZ0 B;  2WSF E;  3M4Y A;  1R0C B;  2E64 A;  2X51 A;  1IXD A;  3RKW A;  4LD9 K;  4DBR A;  1GBR A;  2DYI A;  4KBM B;  1WA7 A;  3BW1 A;  1GFC A;  4PJL A;  1MND A;  1WDX A;  1RL2 A;  5LJ3 h;  2EQK A;  2EJF A;  3J7A F;  4M78 C;  1N27 A;  2QQ9 A;  2RQR A;  2KQW A;  2CZ6 B;  1Q81 U;  4C8Q D;  2RF0 A;  3X20 B;  4DOW A;  1VOM A;  4PFP A;  2FL7 A;  3F70 A;  3RKX A;  2EGE A;  4PJN A;  2ZGW A;  4FM4 B;  5IHN A;  4EMK B;  5A0L A;  3RIR A;  3GBQ A;  1GCP A;  2DEU A;  4AG2 C;  4FL6 A;  1VQ9 Q;  5GMK m;  5GAO q;  2E1H A;  2RQW A;  3M0Q A;  3HSB A;  4X1V A;  4B9X A;  2VYT A;  3JB9 F;  5I21 A;  2JMC A;  2M9U A;  2QA4 A;  1SF9 A;  1D0Y A;  2DRK A;  2RN8 A;  1NEG A;  4RTX A;  2DMO A;  3OYF A;  1SSF A;  4HCZ A;  3G7Z A;  2HL5 C;  1S72 Q;  3G6E A;  2DYB A;  1U3O A;  3LH0 A;  3CXC S;  1YI2 Q;  3NTH A;  4OMO A;  5LJ3 j;  1N8R U;  1AWJ A;  4Y92 A;  2LT4 A;  3SEM A;  1BKB A;  1G3W A;  2K5F A;  2DTI A;  2QA4 T;  1DJ7 B;  1U1S A;  2JM9 A;  2DKG A;  3PVL A;  3I5R A;  5CKE A;  4EMH A;  2L89 A;  2Y4X A;  2CT4 A;  1YJ9 Q;  2E4H A;  1XNI A;  1HSQ A;  4NL3 A;  4RMO A;  4Y28 E;  1XJW B;  4DBQ A;  2R5M A;  3CC2 A;  4J6W A;  4MZM A;  1YJW A;  1VQO Q;  3M55 A;  1UE9 A;  1OI1 A;  4J6X A;  4M7A C;  2NUT B;  1RI9 A;  3HL8 A;  2YXY A;  1EIF A;  2WSE E;  5KYU B;  4JJC A;  5LJ3 g;  3M4G A;  1QCF A;  2OTJ Q;  3HPW A;  3CC2 T;  2G3R A;  3OB9 A;  3SB2 A;  1QVP A;  2DBM A;  2YHT A;  1YJW T;  1M27 C;  3ME9 A;  1D3B A;  2GQV A;  1VQK A;  3M56 A;  1KQ1 A;  1YN8 A;  4XU3 A;  2Z0W A;  4C92 C;  1NYG A;  3OS2 A;  1UB4 A;  3GOX A;  4EMK C;  1MHN A;  5J26 A;  4ELY C;  2M0Y A;  5KYY B;  1T0J A;  1JEG A;  1YCS B;  2LDM A;  1Y07 A;  2XK0 A;  2LMJ A;  2F69 A;  3OMG A;  1VQK T;  1KC8 R;  2RK2 A;  2X3X D;  1R77 A;  3CCJ A;  1AEY A;  3PE0 A;  4R0K A;  1QVF A;  2L3R A;  3RKY A;  3I56 Q;  2EYQ A;  5EG2 A;  3A1P A;  4HA8 A;  4OB1 B;  2XID A;  1E6H A;  5LJ5 g;  1Q82 R;  1ZLM A;  4M7D D;  1PKT A;  1OQK A;  4ZGE B;  2FVU A;  2PUO B;  5GMK h;  3CCJ T;  2X9H A;  1QVG A;  3G71 Q;  1QVF P;  3FC3 A;  4Z8A A;  3EGU A;  4M78 A;  3NHN A;  1K0S A;  1VIF A;  2EKO A;  4WCI A;  2DIL A;  3PVQ A;  1W2B A;  2O9S A;  5GAO n;  2EYW A;  4M75 B;  2JZ2 A;  1BI3 A;  3L2V A;  2MIO A;  3LGL A;  2A36 A;  4X9C A;  2PVD B;  1W6X A;  2DRM A;  1QVG P;  2D9T A;  5CQY A;  4BAC A;  3PT9 A;  1UGP B;  2KSS A;  3I35 A;  2RJF A;  4JS5 A;  2HQE A;  2G6F X;  2FPE A;  3QZ9 B;  1W2B P;  3A5Z B;  2LC4 A;  4ANJ A;  2KRN A;  4HCC A;  3JCM g;  1RAH B;  5ECA A;  5IAY A;  4F7U F;  3L2U A;  2RNA A;  3GNF B;  1UGR B;  3M57 A;  1Q86 U;  5GMK j;  5GJW B;  1HJD A;  1K9M R;  4CI0 C;  4LDX A;  2K6D A;  3X25 B;  2VAS A;  5GAN h;  3HRS A;  4M75 E;  5GAN 2;  2AZV A;  3HTR A;  1PKS A;  1WHM A;  1A0N B;  1WGS A;  4N4H A;  2JJ9 A;  2EYX A;  4MMK A;  2I0N A;  2HAX A;  5FRO A;  2DZC A;  3OYH A;  1OPK A;  4RTU A;  1TSF A;  2KMT A;  5EC7 A;  5GAN 6;  3M59 A;  1TH7 A;  4D6W A;  2ZPG B;  2D1X A;  1NJI C;  2BIV A;  3CCR T;  4LDV A;  3X24 B;  4AFZ C;  3CCE Q;  1RAE B;  2O01 E;  1M90 U;  5KCH A;  3JB9 D;  4JJN K;  3WVE B;  3S3N A;  1H64 1;  2VGN A;  3HKS A;  5FRM A;  1KG1 A;  3M0S A;  5FU7 B;  2B86 A;  3VS0 A;  1BI1 A;  2JXB A;  1WHK A;  1NZ9 A;  1FMK A;  5FRN A;  2P0Q A;  1YIJ T;  5J3B A;  4QVD A;  5FU6 C;  3UWN A;  3QJY A;  5FW9 A;  3RBB B;  2O88 A;  2MWP A;  4C92 A;  2P84 A;  2CS7 A;  1D0Z A;  1N9R A;  4EMK A;  4KUL A;  1KD1 R;  1OU8 A;  3EGD B;  5J39 A;  3H8Z A;  2GNC A;  4QKU A;  4OMF B;  2KRO A;  3CPF A;  1GFD A;  2XDD A;  2P4T A;  2JTF A;  2YLB A;  3DKM A;  4OML A;  3CD6 A;  3REA B;  5GAN g;  3I55 Q;  2D0N A;  4PK4 A;  1PCX A;  3EFO B;  5GAM g;  3C94 A;  1X43 A;  1D0X A;  1I0C A;  3UA7 A;  3CD6 T;  3LGF A;  3MP1 A;  4AG1 C;  1GCQ A;  1Q95 G;  3CCM A;  1TWB A;  3QWY A;  2RI2 A;  4LDW A;  2NUT A;  2LNH B;  5KYU A;  5A0G A;  2RJC A;  1YWO A;  1ZBJ A;  4C8Q C;  4DEY A;  1ZA2 B;  2QAZ A;  1C0M A;  5LJ5 e;  4JZ4 A;  3OQ5 A;  1VQL Q;  1K73 C;  2K2M A;  1RAG B;  2H3J A;  2W10 A;  3A98 A;  3KFV A;  4A63 B;  2OTL A;  3OYL A;  1B7T A;  4E7L A;  1VQM T;  2EWN A;  2GFU A;  2LCC A;  3LW5 E;  2E5K A;  2KDS A;  2V8K A;  2K57 A;  2L8D A;  3RUX A;  4Z89 A;  2CP3 A;  2SRC A;  2EIF A;  3C95 A;  2JUF A;  3P8D A;  2EBP A;  5KYY A;  2DD5 A;  3A8G B;  4M77 B;  1VQ8 A;  2DET A;  3SFM A;  2WAC A;  1X6G A;  1WHH A;  2LQN A;  4OB3 B;  1LVK A;  3E9G A;  1I8F A;  3JAM E;  1LJO A;  1Q81 C;  1U5S A;  1VQ7 T;  4NOY A;  3VS7 A;  4KH0 B;  3QG1 A;  2KXD A;  4A4H A;  3EG0 A;  4EMG A;  4A4G A;  4MML A;  3JCM e;  1UJY A;  4GLM A; 
#chains in the Genus database with same CATH homology
 4M78 D;  4CRI A;  5GAN j;  1NPR A;  4PJO A;  5GAN 7;  1I5L A;  1K73 U;  1QW1 A;  5GAN f;  1JBM A;  2IVW A;  1RI0 A;  2EQU A;  4PJO G;  3MHX A;  1VQP A;  3GNG A;  4C92 G;  3VV0 A;  2RA2 A;  5GAM j;  1KD1 U;  4M7A F;  2CZ0 B;  2WSF E;  5LJ3 d;  3M4Y A;  1WJS A;  2DIQ A;  2X35 A;  2MWO A;  1M9S A;  1OZ2 A;  4DA4 A;  2M1H A;  4M77 E;  2ZCF B;  3TRE A;  1MGQ A;  2E64 A;  2L5Q A;  4M75 A;  2DXU A;  3ASK A;  5D6Y A;  2VXF A;  4M75 G;  4OGE A;  3RKW A;  5KE2 A;  4LD9 K;  1QVF S;  1VQP T;  3OYA A;  1VUB A;  4KBM B;  2CGH A;  3BW1 A;  3KBG A;  3M5A A;  1N8R C;  5I2S A;  5GAO r;  4ZTF A;  2R58 A;  4C8Q E;  2P0P A;  1RL2 A;  4HCB A;  5LJ3 h;  1I81 A;  2EQK A;  4M77 D;  2EJF A;  3J7A F;  4M78 C;  2E5Q A;  1N27 A;  3OW2 S;  1H3Z A;  3JCM Q;  3OYD A;  4PJO F;  2QQ9 A;  1Y96 B;  3I55 T;  1M1F A;  4C92 F;  2PVO B;  2KQW A;  2CZ6 B;  4QQD A;  5CCA A;  3JB9 G;  3DLL A;  3EAE A;  5CK9 A;  1HXD A;  2KY9 A;  2R57 A;  3CCS A;  1Q81 U;  5D6X A;  2RJD A;  2XU8 A;  1X01 A;  4OP0 A;  2HNI A;  3NTK A;  4P5N A;  4C8Q D;  5KCO A;  4R55 A;  2QEX T;  3S3M A;  3JB9 H;  3RER A;  2QTX A;  3OBW A;  3X20 B;  1M1K U;  3OBY A;  4DOW A;  3QPH A;  2RHZ A;  5CVI A;  2FL7 A;  3F70 A;  3RKX A;  5GAN 4;  3VUZ A;  2QQB A;  2RD1 A;  4NS5 A;  2ZGW A;  4FM4 B;  4EMK B;  1M1G A;  5A0L A;  2RO0 A;  3RIR A;  3ZEH A;  2DAQ A;  2MI6 A;  2BUD A;  4FL6 A;  3LWH A;  3VJP A;  1QP3 A;  3SDZ A;  5GMK m;  2QXF A;  3MP8 A;  3CCS T;  1VQL A;  4F7U A;  5GAO q;  2E1H A;  5CR2 A;  2E10 A;  3HSB A;  4F7U G;  2P0K A;  2QDY B;  4O6J A;  4YTL A;  4ZN3 A;  1HK9 A;  2VYT A;  4B9X A;  3JB9 F;  5I21 A;  2FB7 A;  1Q7Y C;  1JJ2 A;  3VYH B;  2CZ1 B;  4Z02 A;  3O8V A;  3OMC A;  2YLC A;  1Y71 A;  2XIC A;  1XOV A;  3CCU A;  1VQM A;  2M9U A;  4N4I A;  5DLO A;  2QA4 A;  4M7D C;  2MAM A;  5GAN 8;  2E12 A;  4IUV A;  3QBY A;  2HBP A;  3QXE B;  4II1 A;  3Q1J A;  3OYF A;  3VYG A;  1SSF A;  4HCZ A;  1VQL T;  3G7Z A;  3CMA A;  3G6E A;  3C12 A;  4XTX A;  3LH0 A;  4ELZ C;  2WSC E;  3ZFJ A;  3CXC S;  3NTH A;  2XI9 A;  2E65 A;  3JCM b;  3PIO A;  2ZPB B;  5LJ3 j;  5FLX E;  2IG0 A;  1N8R U;  2LT4 A;  3PMI A;  2O4X A;  1PSE A;  1BKB A;  1G3W A;  2RHX A;  2X4X A;  2K5F A;  3CCU T;  2DTI A;  2ZPE B;  3FJP A;  1DJ7 B;  3OYI A;  2QA4 T;  1U1S A;  1QVG S;  2DKG A;  3CCE A;  2D6F A;  3G4S A;  1FXX A;  2QI2 A;  5CKE A;  4EMH A;  2L89 A;  3CMA T;  4PNO A;  2Y4X A;  5CQX A;  3V7R A;  2HD0 A;  3OA6 A;  1M5Q 1;  2FYK A;  1XNI A;  3UDC A;  2K3Y A;  1VQ7 A;  4NL3 A;  3JRZ A;  2F5K A;  3JCM J;  3A8M B;  4RMO A;  4Y28 E;  3SWN B;  3FB9 A;  3R6O A;  4V2S A;  2R5M A;  2PVG B;  3CC2 A;  3G4S T;  5GAM e;  1I4K 1;  4J6W A;  3OS5 A;  4MZM A;  1YJW A;  3M55 A;  1OI1 A;  4J6X A;  4M7A C;  5L8R E;  4M7D B;  2X4Y A;  3HL8 A;  1EIF A;  1P92 A;  2WSE E;  5D6W A;  3A8O B;  3A8L B;  3QHS A;  4TVR A;  3S3O A;  2RM4 A;  4OVA A;  3PMT A;  1UGQ B;  2LVM A;  2XG8 D;  3GF5 A;  4RKU E;  4DOV A;  5LJ3 g;  3KXT A;  3M4G A;  3JCM X;  4C5E A;  5LL6 S;  1FWZ A;  1Q7Y U;  2GF7 A;  3HPW A;  3CC2 T;  2G3R A;  3OB9 A;  3SB2 A;  1YBY A;  2RHU A;  1QVP A;  2A3L A;  2YHT A;  5A0D A;  3OYK A;  2V8I A;  1YJW T;  3QO3 A;  1G3S A;  4Q5W A;  3OS1 A;  4OGC A;  5DY9 A;  3ME9 A;  4X9D A;  1D3B A;  4XAX B;  1GXI E;  2GQV A;  1VQK A;  4L5G A;  2V8J A;  3M56 A;  2RHY A;  1KQ1 A;  4XU3 A;  4C0G A;  4PJO C;  4C92 C;  3JB9 I;  3OS2 A;  1UB4 A;  3GOX A;  4E7J A;  4JDS A;  3OSV A;  4EMK C;  1MHN A;  5J26 A;  2LT1 A;  4ELY C;  1X75 C;  2EAY A;  5IN1 A;  5HK3 A;  3RES A;  4ME7 A;  4XU0 A;  2DEQ A;  1BI2 A;  5GAM f;  3S6W A;  5HKC A;  4IUQ A;  2M16 A;  2LDM A;  1Y07 A;  2XK0 A;  3GPL A;  4JRP A;  5M9O A;  2F69 A;  3FDR A;  2DPP B;  3L1A A;  3OMG A;  3I55 A;  4M75 C;  1VQK T;  4B9W A;  1WPY A;  2DK3 A;  4M7A B;  2RK2 A;  1WNL A;  4KUD K;  4M7D E;  3CCJ A;  1B34 A;  1AHJ B;  1XTD A;  2QEX A;  2DXT A;  3CCQ T;  4BD3 A;  1QVF A;  2L3R A;  3RKY A;  2ZPH B;  3NFC A;  2EYQ A;  4MZT A;  5EG2 A;  4UC4 A;  3CBP A;  3FEO A;  3JCM P;  1G3T A;  4FU6 A;  2GCX A;  1VQ9 A;  3CBO A;  4IUR A;  4HA8 A;  4OB1 B;  2XID A;  4XU1 A;  3A8H B;  5LJ5 g;  1Q86 C;  3T9N A;  4BI3 A;  2E6Z A;  4M7D D;  4ZGE B;  3CXC A;  2FVU A;  4FIB A;  1K8A C;  2PUO B;  5GMK h;  3CCJ T;  4BDY A;  3BDU A;  1OYX A;  4OF1 A;  1X6O A;  1YIT A;  2EQJ A;  4PJO B;  4C92 B;  1BIB A;  5LJ3 e;  4EDU A;  1QVG A;  4JRI A;  4M75 F;  3FC3 A;  2DD4 A;  3MEW A;  4OB2 B;  1VQ9 T;  4M78 A;  3OY9 A;  4RCB A;  2EJ9 A;  3M54 A;  1S72 A;  1LOJ A;  1VIF A;  2EKO A;  4QW2 A;  2VC8 A;  3RMS A;  4E7K A;  1YI2 A;  4O5V A;  4KT0 E;  3J80 E;  3L2W A;  1W2B A;  4XK8 E;  1ZQ1 A;  3SWN C;  5GAO n;  4M75 B;  4BE2 A;  2JZ2 A;  4OB0 B;  5LJ5 d;  3PTA A;  1YIT T;  2C06 A;  1VQN A;  4M7A E;  1BI3 A;  2LCL A;  3GLX A;  3LGL A;  3P8B B;  4J5Y A;  4J6Y A;  3V7S A;  3JCM V;  3L2V A;  2DXC A;  3E19 A;  3QYG B;  4X9C A;  3QII A;  2PVD B;  2RB6 A;  3PNW C;  4BY6 B;  1G5V A;  2AHJ B;  1OZ3 A;  2DIG A;  3CC7 A;  1S72 T;  2D9T A;  4PL6 A;  3V7C A;  5CQY A;  4BAC A;  3PT9 A;  1UGP B;  2KSS A;  2XKO C;  5GAO l;  1YI2 T;  1YJ9 A;  2RJF A;  1U1T A;  4JS5 A;  2HQE A;  3E1S A;  4LDU A;  3QSU A;  2XDP A;  1U8R A;  1M90 C;  1JB0 E;  4M7A D;  3M9Q A;  1VQN T;  5LJ5 h;  2DVE A;  3QZ9 B;  4VUB A;  3A5Z B;  4M77 A;  2LC4 A;  4C0D B;  4HCC A;  1BIA A;  5GAN 5;  4A53 A;  3JCM g;  5GAN d;  4MDW A;  4M77 G;  5LJ3 f;  1BI0 A;  2I2L A;  4ATO A;  2XHC A;  3CC7 T;  5IAY A;  2DO3 A;  4PJO E;  4F7U F;  4C92 E;  2D0Q B;  3L2U A;  3GNF B;  5HK0 A;  3TU4 K;  4M7D A;  1UGR B;  1KC8 C;  1YJ9 T;  3M57 A;  5CKF A;  4BUG A;  2EFI A;  4XTU A;  1Q86 U;  5GMK j;  3L2Z A;  4C8Q A;  3J81 E;  3VU3 C;  4QVZ A;  1WQ7 A;  1YCY A;  3V8J A;  2XDB A;  4WF2 A;  1K8A U;  3HP9 A;  4CI0 C;  3CEY A;  3CCM T;  4C8Q G;  4QVC A;  4LDX A;  3QJ6 A;  5FU7 C;  1KQS S;  4F7U B;  2E70 A;  2ZPI B;  4XTY A;  2VV5 A;  2LQK A;  3X25 B;  5GAN h;  3P8H A;  4JLG A;  2OAU A;  3HRS A;  3OYG A;  1VQ4 A;  4M75 E;  1VQO T;  3GIB A;  5GAN 2;  5I2M A;  4PJO D;  4C92 D;  3CCL A;  4BE1 A;  3AHU A;  4JLI A;  2NLU A;  3CBM A;  2F5T X;  3OSS C;  2MF2 A;  1WGS A;  3JCM d;  4JRQ A;  1Y7X A;  1Q82 C;  1ZHI A;  4N4H A;  3CC4 A;  4MMK A;  4M77 F;  2ZPF B;  3TEE A;  4C0F A;  2HAX A;  3LLR A;  3HHT B;  5FRO A;  1O75 A;  3MEA A;  3PFS A;  2DZC A;  2M0O A;  2RJE A;  3EFS A;  2RI5 A;  3X26 B;  4BI4 A;  3OYH A;  2GFA A;  3OYN A;  2OTJ T;  4FSX A;  5HY6 A;  4M75 D;  4N0A A;  5CIU A;  1VQ4 T;  3DB4 A;  3MEV A;  2K5I A;  2KMT A;  3HRU A;  2JVV A;  4NL2 A;  2OTL T;  3CCL T;  4LDY A;  3SD4 A;  1LNX A;  2QQR A;  2DTH A;  3EFR A;  5GAN 6;  3OW2 A;  3M59 A;  4FT4 A;  1TH7 A;  4C8Q F;  4D6W A;  2O4X B;  2ZPG B;  3JCM h;  4MDX A;  1NJI C;  2BIV A;  3CC4 T;  1NE8 A;  3CCR T;  4LDV A;  3X24 B;  2RI3 A;  2JTM A;  2EJG A;  5LJ5 j;  4BB7 A;  2O01 E;  4C5H A;  3HRT A;  1M90 U;  5KCH A;  3JB9 D;  2XD0 A;  3E9F A;  4ZTJ A;  3FIF A;  3FLG A;  5LJ5 f;  4JJN K;  3KUF A;  3WVE B;  2KK4 A;  2RK1 A;  2RH2 A;  2LNV A;  4HKE A;  4KUI A;  3JCM c;  1H64 1;  1V29 B;  2VGN A;  3HKS A;  2VGM A;  3PIP A;  3I56 A;  3CCQ A;  5FRM A;  1KG1 A;  5FU7 B;  4EPC A;  4JS4 A;  4F7U E;  1Y96 A;  1BI1 A;  3JB9 J;  5DLQ E;  1VQ8 T;  1NZ9 A;  2KVQ G;  5FRN A;  1KC8 U;  3LYI A;  1N9S A;  1QP2 A;  2P0Q A;  4GY5 A;  1YIJ T;  4A4K A;  2R5A A;  4XTV A;  5J3B A;  3RMQ A;  4QVD A;  2BKD N;  1M8V A;  5FU6 C;  3UWN A;  3QJY A;  4DQ2 A;  1WJR A;  4PKC C;  3OYJ A;  2MWP A;  4A4F A;  4C92 A;  3CME A;  4BY6 C;  3I56 T;  2CS7 A;  3WVD B;  3G71 A;  1N9R A;  4EMK A;  1ZBX A;  3OYB A;  4ZGJ B;  4KUL A;  4R56 A;  4Y91 A;  1Q82 U;  1VQ5 T;  3OYC A;  1YHQ A;  1PSF A;  1VIE A;  4E47 A;  3CCV A;  1KHC A;  3X28 B;  5J39 A;  3DB3 A;  3H8Z A;  3GP8 A;  4MZP A;  1K9M C;  4C0D C;  2QQA A;  5GMK l;  1KHI A;  4C5G A;  3WXM B;  5A2Q E;  2HQX A;  2FHD A;  3M58 A;  1D3B B;  3CME T;  3UPU A;  5DM7 R;  4OMF B;  2LQ8 A;  3G71 T;  4XQ3 A;  2DXB A;  3JCM W;  3CPF A;  3TCJ A;  4XU2 A;  3CPW S;  4FT2 A;  4QQ6 A;  1NPP A;  4A4E A;  2XDD A;  2Y90 A;  1R8O B;  2P4T A;  1JRI A;  3JCM f;  1NJI U;  2K3X A;  3HFO A;  3VKI A;  2E6N A;  2JTF A;  4E7H A;  3CCV T;  5IT9 E;  2YLB A;  3QYH B;  1YHQ T;  2PQW A;  2VXE A;  4M78 G;  3DKM A;  2DTO A;  4C5I A;  3CD6 A;  5GAN g;  2DZ9 A;  5C0M A;  4RG2 A;  4BDZ A;  3BDL A;  4IUT A;  4RCC A;  5GMK e;  3L2R A;  4J8O A;  1KQS A;  2PUK B;  3H6Z A;  5FU6 B;  3OYM A;  4N4G A;  5GAM g;  3C94 A;  4J83 A;  2K2V A;  2YRV A;  1B34 B;  4IUU A;  1WQW A;  2VUB A;  3M53 A;  4LD6 A;  3URG A;  3QUI A;  2DJZ A;  5KE3 A;  5GMK i;  5GAO p;  2K4Y A;  3CD6 T;  3LGF A;  5CO7 A;  3MP1 A;  2KAF A;  4GLK A;  4L59 A;  3CCM A;  2QQS A;  3QDR B;  4M77 C;  3SWN A;  2RI2 A;  2LTO A;  4M78 F;  2E41 A;  4BI8 B;  5CKD A;  4XTZ A;  1UGS B;  1O9S A;  3ZBD A;  1VQO A;  4LDW A;  3V8L A;  3VUB A;  4HT8 A;  1UEB A;  1BYM A;  5GAM d;  4XTW A;  2JN0 A;  5A0G A;  2RJC A;  2RHI A;  1K9M U;  4M7D G;  1VQ6 A;  4C8Q C;  4M78 B;  1FX7 A;  3ER0 A;  3QKJ A;  1WJQ A;  3MCA B;  3V8K A;  1IZ6 A;  5LJ5 e;  3OQ5 A;  2CYZ B;  2OTJ A;  2CKK A;  1K73 C;  3MO8 A;  2H3J A;  4JUV A;  3BFM A;  2OTL A;  3OYL A;  1KD1 C;  4J7F A;  4RG8 A;  4E7L A;  1VQM T;  3UT1 A;  2EWN A;  2GFU A;  3OYE A;  3FRN A;  1M4Z A;  5CKB A;  5GAM h;  4L6V 5;  2LCC A;  3HFN A;  3JSC A;  4ZGD B;  3LW5 E;  2K5L A;  3NTI A;  4PLI A;  4PLL A;  5GAO m;  3CCR A;  2KDS A;  2V8K A;  4IUP A;  5CAI A;  4X34 A;  3C4S A;  4JRK A;  3G6E T;  2K57 A;  2EQM A;  2L8D A;  3OYY A;  3RUX A;  1YJN A;  1W2B S;  3N5B B;  3MEU A;  4N0A C;  2EIF A;  3C95 A;  2JUF A;  2Y4Y A;  3P8D A;  3QZ5 B;  4A54 A;  3MP6 A;  5GAN e;  4M7D F;  5AYF A;  5KH6 A;  3DLM A;  2DD5 A;  2CZ7 B;  3A8G B;  4M77 B;  3OS0 A;  5GAN 3;  2JOY A;  4C0Z A;  2X4W A;  3LWI A;  1JJ2 S;  4J7I A;  3CCE T;  1VQ8 A;  4IKF A;  1KQ2 A;  1XQH A;  3MET A;  3SFM A;  4ZN1 A;  2WAC A;  5CKH A;  4M7A A;  1N6A A;  1YIJ A;  2ZZD A;  1W4S A;  2A7Y A;  5C6S A;  1IRE B;  4OB3 B;  2B8A A;  4M7A G;  4E7I A;  4QQG A;  2JNG A;  1YJN T;  3E9G A;  1I8F A;  3JAM E;  3S3N A;  1LJO A;  4C8Q B;  1Q81 C;  1VQ6 T;  4HT9 A;  1VQ7 T;  4M78 E;  2LRQ A;  4BE0 A;  4NOY A;  3CPW A;  2LX9 A;  3PGG A;  3QG1 A;  1M1K C;  4A4H A;  3INZ A;  4EMG A;  2X4J A;  2MMP A;  4A4G A;  4MML A;  3JCM e;  3LX7 A;  3BY7 A;  1VQ5 A;  2PU9 B;  3L2Q A;  3L42 A;  1G3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...