3JCMf

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
77
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDRNEKVMQHHGRMLLSGNNIAILVPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
total genus 12
structure length 77
sequence length 82
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmf00
2EWNA 2K57A 4C92E 1LJOA 4XU3A 4M7DC 1D3BA 1JBMA 4XTVA 5GAOq 2RB6A 3RUXA 4N0AC 3JCMd 2RD1A 2FB7A 3L1AA 4M77G 3RKWA 3JCMX 3QO3A 5GAMj 4PJOF 4M75B 4M78G 1KQ1A 1Y96B 2YLCA 3BDUA 5GMKl 5LJ5h 5LJ5e 3L2ZA 5GANe 3BW1A 3RKXA 4A53A 4PJOE 4C92D 1HXDA 1WPYA 2VXEA 3SWNC 2EAYA 3SB2A 4RCCA 4M78A 4M7DB 4A54A 4M7AG 5GANh 3V7SA 5GMKj 4J6YA 3V8JA 2VC8A 5LJ3h 5GAMg 3EFRA 3JB9I 5GAN2 4QVDA 5GAMe 4M75C 4M7AE 4XTYA 4PNOA 5GAOl 4C8QB 4F7UE 4OP0A 4JLIA 5GANf 3V7RA 4XTZA 4C92B 1LOJA 5GANg 4M7AF 4EMHA 2RA2A 5GAMh 3QSUA 3SWNB 5GAOr 1BIAA 4C8QF 4F7UG 4EMKC 3HFNA 4J6WA 2E1HA 3BFMA 4M77C 4C92F 2DVEA 5GAN6 3FIFA 4M77D 2DKGA 4M75E 5I21A 4M7AC 4M78D 5LJ5f 4M7AD 4MMLA 4N0AA 4M78C 3QUIA 5GAOn 4NL3A 3SWNA 2QTXA 4X9CA 1H641 4M77F 3PGGA 4M78E 4XQ3A 3JCMb 2DXUA 3FJPA 3JCMP 5GANj 3GIBA 3RKYA 4DQ2A 3JCMJ 2FYKA 3V7CA 3JCMe 4M75A 4M7DE 3JCMW 2RM4A 5LJ3f 1N9RA 4XU0A 2YHTA 4M7AA 1WNLA 4XTWA 3VU3C 4HA8A 2Y90A 4JRIA 4M75D 3JCMQ 4PJOB 1D3BB 1TH7A 4M77B 4XTUA 3JCMh 3V8KA 5LJ3g 2DTOA 5GAN3 3AHUA 4NL2A 4M7AB 4QVCA 4M7DG 2E65A 2EJGA 5LJ3d 3JCMc 5GMKm 5GAN8 2EJ9A 5GMKi 3JB9F 1I4K1 4NOYA 4M77A 4F7UF 4M7DF 4EMKA 4C8QG 2I2LA 1I8FA 1M5Q1 5CAIA 1WQWA 4JRKA 1LNXA 5GAMf 2DZ9A 1X01A 2VXFA 3HSBA 2E64A 5LJ3j 4J5YA 1I81A 1KQ2A 4PJOD 3INZA 2DTHA 5GAMd 1WQ7A 4WF2A 4XTXA 5GAN4 3EFSA 4Y91A 4PJOC 4M75G 3M4GA 3FB9A 3RIRA 4C8QA 1B34B 4C92A 3JB9G 1HK9A 4RCBA 3JB9H 2DZCA 1Y96A 4MMKA 4J6XA 5GAN7 3V8LA 3HFOA 4M78B 4M77E 5LJ5d 5GANd 4M7DA 3JCMV 4V2SA 2DXTA 1JRIA 2E41A 4M7DD 2E10A 2ZGWA 4M75F 4JUVA 4M78F 4X9DA 4PJOG 4XU2A 5LJ5g 2DTIA 4HT9A 1M8VA 4HT8A 5DY9A 1B34A 2CGHA 1U1TA 3BY7A 5GMKh 2JN0A 4C8QD 1YCYA 4C8QC 1U1SA 4C92C 5GAOm 4C8QE 4F7UB 4PJOA 2DJZA 3QHSA 3JB9J 2HNIA 1MGQA 1I5LA 1BIBA 1N9SA 2YLBA 4EMKB 4F7UA 5LJ5j 5LJ3e 3RESA 4C92G 5GAOp 2EJFA 3JCMf 3RERA 3JCMg 4EMGA 5GMKe 2DEQA 3JB9D 4XU1A 5GAN5
chains in the Genus database with same CATH superfamily
2ECZA 2OAWA 1NZ9A 4C0ZA 1YIJA 1BI3A 2VGMA 2X4JA 1VQMT 3EGDB 2ZCFB 2XU8A 2CP6A 4M75B 3BDUA 2EGEA 4J9EA 2BTTA 3DB3A 2H3JA 2I0NA 1VQ5A 1ZUUA 3OYLA 3G71T 2RHYA 1KHIA 4F17A 1H92A 3E1SA 5FRNA 1LOJA 2QI2A 3GLXA 3RDVA 3HFNA 3VS2A 3CCRA 5GAN6 1YIJT 1G5VA 3HKSA 1ZQ1A 1IREB 1ZSGA 1YHQA 3X28B 2FYKA 3V7CA 3OS0A 3LGLA 2RJFA 4OMNA 5DLQE 2D6FA 5D7UA 4Y28E 1MMDA 4JRIA 3GF5A 3A8LB 4L59A 1H3HA 2DIQA 2MWPA 5GMKm 5D6YA 3J81E 4AFSC 2LVMA 1ZBJA 3H0IA 3J80E 5LJ3j 2COYA 3WVDB 1I5OB 3PMIA 1BKBA 3VKIA 3L2QA 3CCMQ 3CCJQ 4JS5A 3OA6A 4M7DA 1VQ4A 3CCMT 2ZGWA 2KK4A 2K3YA 3CMEA 1SRLA 2A08A 2CGHA 2QGGA 5DLOA 1U1SA 1Z9QA 2DE0X 2R57A 3QHSA 4J9FA 1YJNT 3QG1A 1BIBA 2OTLT 2O9VA 4ZTJA 2QQBA 3FRNA 4J9CA 2O4XA 1SPKA 2GQIA 3MKDA 2MOXA 1Q7YR 5I22A 2O4XB 1KJWA 4F14A 2RB6A 5GAOq 2HL3A 2RHIA 2JUFA 1VQ8T 4HCCA 3M9QA 1YJ9Q 1D0ZA 1YI2A 4M7DB 3L42A 3CPWA 1UECA 1UB4A 1KG1A 1JEGA 2JOYA 1WHMA 4QVDA 3UF4A 2KRMA 1D1BA 4KULA 1FYNA 5GANf 3V7RA 4XTZA 4M7AF 3A8HB 2XICA 3M0PA 2RQRA 2FZGB 3QWXX 3LH0A 1KD1R 4OMMA 3CCQA 2KE9A 4CRIA 5KCHA 1ZSZA 2F5TX 1C6VX 4RTWA 1WNLA 1TG0A 4PJOB 3X26B 1D3BB 1AT1B 4NL2A 5CO7A 2COWA 2I2LA 4J9BA 2VXFA 3CCUT 1Z9ZA 1WQ7A 2HZYA 3M4GA 2P4TA 2QQAA 4BI3A 2VUBA 1VQ8A 1AHJB 2HBWA 5LL6S 1M27C 2RJDA 1QP2A 5EC7A 1LCKA 4KH1B 1VQNA 2HKNA 4BD3A 3JAME 3CCEQ 5IXFA 1QVGP 3NTKA 1JXMA 2CUBA 2ABLA 2Y4YA 3JRZA 3VRYA 1PRLC 4VUBA 1QW1A 2OTLA 3NHNA 1D09B 1XNIA 2EBPA 4N4IA 4Z02A 1N9SA 5IH2A 1NYFA 2JTFA 2EJFA 3M58A 1C0MA 2V8JA 3EFOB 1RUWA 1O75A 2V1QA 2YRCA 2K4YA 3I5RA 4FYWB 4IKFA 1E6GA 2L3RA 3JCMX 1D1AA 4BE1A 1G2BA 5I2SA 2Y4XA 2VXEA 4RCCA 2MIOA 1WXUA 3RMSA 2KYBA 3NMZC 4CC7A 2RJEA 3JB9I 1BI0A 4DBRA 1KQSA 4FW1A 1QVPA 2SRCA 4C0DC 2DK3A 2F2WA 2RHXA 4DOWA 1M1KR 4ZGEB 2FRYA 2EGCA 2DXBA 1JB0E 1QKXA 5GANj 3EHRA 3EG3A 2KR3A 3M55A 1S1NA 4M7AA 5LJ3g 1UUEA 5HY6A 2IG0A 2CSQA 1RAAB 4BB7A 3N5BB 1I8FA 4L5GA 3CD6Q 4J7IA 4PFZA 2DL4A 4IURA 2COZA 1YJ9A 2OX7A 4DBHA 4FM4B 2DILA 4X34A 1VQ5T 3VV0A 1YHQT 3OS2A 2XD0A 1WX6A 4PLLA 2DBKA 1BBZA 2E41A 1JRIA 2A28A 1M2OA 1SSFA 2L2PA 3PFSA 4N4HA 2PVDB 4OB3B 1OULA 1VQ7T 1G3TA 1D1CA 2GGRA 2AK5A 3X25B 1N8RU 2GTOA 4EMKB 2DYIA 4BDYA 1ZSZB 1OOTA 2A37A 1Y71A 4Q5WA 2LJ1A 3FLGA 2KNBB 3PE0A 1N8RC 2DJQA 2LNVA 4JPBW 2QEXT 7AT1B 1KQ1A 1Y96B 3M53A 2YRDA 2J6KA 3PIPA 3REAB 3A8GB 3PVQA 3WVEB 3CC4T 1PWTA 1R0CB 3CCVQ 3OYKA 5A0GA 4FSSA 4QT7A 4IUTA 2RMOA 3L2RA 2LC4A 4EMHA 3PMTA 1B07A 4ELZC 2XDDA 2FG0A 2O2OA 2Z0WA 3OBYA 1M1KC 2CH4W 1UG1A 2LCSA 4HCBA 1V76A 4E7ZA 1VQKQ 1M3AA 2F5KA 3TVTA 2KI7A 1HSQA 1PCXA 2RM4A 2EQIA 2QQRA 1TXQA 2YHTA 2EYZA 4XTWA 2Y90A 4M75D 2L3QA 2YSQA 1UJ0A 1I0CA 2E65A 3HP9A 3CCET 1QVFP 4X1VA 5D6XA 3JCMc 3GP8A 4PLIA 4ZNXA 2XHCA 3OYAA 1ZX6A 3A8MB 1CSKA 5GAMd 3RR6A 4WF2A 1J3TA 2BZXA 2RQUA 1FWZA 4AG1C 3AT1B 2WSEE 1VUBA 1Q81R 2DIGA 1OZ3A 3MP6A 1Y96A 1M8MA 3A8OB 4ORZA 4E6RA 2X4YA 1VQ4Q 4LUEA 1FMKA 3UA6A 3I55Q 1PHTA 1VQMQ 1WHLA 2V8KA 3C95A 2PU9B 2ROLA 2DERA 1XJWB 2DL5A 3VS3A 2KDSA 1TUDA 1E7OA 2EGAA 3ZEHA 2IVWA 1V1CA 1VQ9Q 5GMKe 2KXDA 3VS1A 2EWNA 3CMAA 3CCLQ 2E70A 1G3SA 4IUPA 5GAMj 4A4GA 4M78G 1KK7A 4WTOB 4ME7A 2P4RA 5GMKl 4GLKA 2E6NA 2ZAEA 5CKBA 2NUTB 2GF7A 2KXCA 1NPRA 2A0FB 1R8OB 2E5QA 3CCST 1KHCA 3QJYA 2AZVA 4ZGJB 2XDBA 2DA9A 1VQ8Q 2FZCB 5A0DA 1MNEA 4MZTA 4E7SA 1KIKA 2G6FX 5M9OA 2RQVA 3SWNB 4RG8A 1OI1A 3EGUA 4M77D 4HCZA 4M7AC 2R58A 4R0KA 4M7AD 2GNCA 2AKLA 1VQPT 5L23A 1RI0A 2CZ7B 4O6JA 4LDYA 3OYIA 2VASA 2RN8A 4J7FA 4BE0A 3ER0A 5KCOA 2GTJA 1WJQA 1TUCA 2PNIA 2LQWA 2DF6A 2EJ9A 2RQWA 2DAQA 1X43A 1RAHB 1KQ2A 1OEBA 1TS9A 3BE3A 4NS5A 3FB9A 3MCAB 2BIVA 2R5AA 1NJIU 3G6EA 4FU6A 1EX4A 4CC2A 1PKTA 1UHCA 1SSHA 4QQ6A 1GBRA 4MMKA 2J6FA 1Q95G 3MJXA 4ATOA 1OYXA 1K8AU 4LD6A 3CBMA 2DTIA 2AHJB 2KT8A 2V8IA 2DM1A 5FW9A 1KD1U 3PNWC 1IRXA 4HVUA 2L5QA 2H3EB 2LJ3A 5KE2A 2PQWA 3OS5A 3RERA 2DL7A 3JB9D 3MEVA 1T3LA 4BY6B 3I56Q 3CCQQ 3ZL7C 2EQJA 2M16A 4M77G 1SRMA 3SEMA 3HPWA 1ABOA 4A53A 1M4ZA 1WPYA 3PT9A 2K7AA 4KUIA 3EAEA 4M78A 3VS7A 1QMCA 1G83A 4LNPA 3NFCA 1H3ZA 1X27A 2AIRB 1YITT 2GBQA 3GBQA 2A36A 2FO0A 4LN2A 2DETA 1VQOQ 3M0UA 1JXOA 2QTVA 1GRIA 4OMOA 3CQTA 3M54A 5I21A 2ZPBB 4EDUA 4Z89A 4XQ3A 3GIBA 1HYOA 3GNFB 4LD9K 1T3SA 4YTLA 3G7ZA 3GOXA 1TOVA 2A7YA 4J9GA 3CC7Q 1M3BA 4GBQA 1WI7A 1JJ2P 3V8KA 3AHUA 5KYNA 1V29B 4QVCA 4IUVA 1ZUYA 2DX1A 1K1ZA 3X20B 1U5SA 3M0TA 3JB9F 4M77A 5IHIA 1VQ9A 4C8QG 5HK0A 1IHVA 1WQWA 5IT9E 3CC4Q 4LDXA 5KYYA 1Y0MA 4PJOD 2DTHA 1UGPB 4XTXA 5GAN4 4JJBA 2KRSA 4OGEA 5A2QE 1X2QA 4E7IA 1WZOA 2XMFA 4FL6A 1SF9A 4JS4A 3S3OA 3QJ6A 1BB9A 2E3IA 1GCQC 1TWBA 2JTEA 2JS0A 3H9NA 4D8KA 2J6OA 4PJMA 1G8XA 2HQHA 4HVWA 2QK0A 4HT8A 1OX8A 1WLPB 3MO8A 2P0QA 1YCYA 4EIKA 4KT0E 3TSZA 1XOVA 1QLYA 2J05A 5LJ3e 1S72Q 3VYGA 4EMGA 1WHJA 2PVOB 1QVGS 1LJOA 2BKDN 2HQEA 6AT1B 1YHQQ 2EQUA 2OJ2A 2PTKA 3GNGA 4BDZA 2EKOA 5C6SA 3MEWA 1M2VB 2XKOC 5GANh 3EG0A 2PUKB 1HD3A 1K9MU 3LH5A 1OV3A 4XTYA 4JRQA 3QZ9B 1QVGA 5HK3A 5IHNA 2LQNA 2G3RA 4UC4A 1K9MC 4DBFA 4EMKC 2KQWA 5AT1B 3REBB 2VVKA 1W4SA 2K3XA 1ZSZC 1TU0B 3QIIA 4M75E 5LJ5f 1K8AR 1ZUKA 1QQJA 4OB1B 4NL3A 3SWNA 3H41A 2DL8A 3FJPA 4BI4A 1VQ7A 1QCNA 4HVVA 2ENMA 1Q81C 2J06A 2H8HA 1SHFA 1PKSA 2JXBA 5GAN3 4M77B 3JCMh 2MF2A 4HCKA 4F16A 2L89A 2DO3A 3R6NA 1PSFA 4NOYA 2IPOB 4DBQA 1X01A 1VQLT 4J5YA 4F04B 4O5VA 1D0XA 1S72T 3G4SQ 4C8QA 1QWEA 4CC4B 1NLPC 1YWPA 3OYNA 1RL2A 1BU1A 1PC0A 2DZCA 1YI2Q 2D9TA 2KMTA 1AWOA 2AKKA 4B9WA 2DD5A 3VS6A 1G3YA 5LJ5g 2FPFA 3QPHA 3M4YA 5GMKh 4R55A 1P92A 2W10A 3OMCA 2MPXC 2VYTA 2K5LA 3TQ7P 3JB9J 2EQKA 2HNIA 2FVUA 3PVLA 4A4KA 3RESA 1ZA2B 4C92G 2KY9A 2K6DA 2QQ9A 3OYFA 2DEQA 2K57A 4M7DC 5AYFA 1D3BA 1UGVA 3O8VA 2FL7A 4PJOF 2HDAA 2X4WA 3CCUQ 2OTJA 1HXDA 1FMWA 2AT1B 2SEMA 4MDWA 1KC8R 4FYYB 4BI8B 1AD5A 3EHQA 4M7AG 3RBBB 5GMKj 2VV5A 3V8JA 1UFFA 2C0TA 2DYBA 3G6EQ 1AZGB 1U06A 1QVFS 2GQVA 5FU6B 2E5KA 2EVRA 1VYTA 3CPFA 1NEBA 2LQKA 2RNAA 4MZMA 3D7SB 3OYEA 3CD6A 1K73C 4C8QF 5C0MA 2F1LA 2ROTA 3FIFA 3A98A 4L6V5 3M0QA 1QCOA 1VQ7Q 1N6AA 3CCRT 1NLOC 1K73U 1IXDA 5KYUA 2P84A 1N9RA 2CS7A 4MDXA 1W2BA 4M7DG 2D8HA 2MMPA 5FWCA 4BE2A 4M7DF 4RTZA 3OW2A 4JRKA 3PTAA 1ZHIA 3A1PA 5FU7B 1MUZA 2MI6A 1RAIB 2QQSA 3INZA 1PD1A 4JZ4A 3MEUA 3M5AA 3QWYA 1VQPA 2EW3A 4FSXA 3UPUA 4RCBA 2EYWA 4II1A 1WFWA 1BI2A 2OAUA 3P8HA 2M51A 1Y07A 3OYMA 4PJOG 4HT9A 2D0NA 1VYVA 5KYXB 2JN0A 4C8QD 4C8QC 2ESWA 2O9SA 2HQXA 3META 1WHKA 4C5EA 1F1BB 1UHFA 1PNJA 2L3PA 3HTRA 3JCMg 2KAFA 5D6WA 1M90U 1AWXA 3CCJT 4PJJA 4DEYA 4BUGA 5J3BA 3RUXA 1EFNA 2RI2A 2WSFE 4QQDA 2JVVA 3LWIA 1YP5A 1N8RR 3V7SA 3MP1A 4JJNK 1WA7A 3MPUB 1VQPQ 2LRQA 1BYMA 4PNOA 2LX9A 1MNDA 2RQTA 1M1GA 1M2VA 3OYGA 2FZKB 4MMLA 1M9SA 2QEXA 5HKCA 2KEAA 3PGGA 1VQ5Q 4ESRA 1YIJQ 2NWMA 4KUDK 3DLLA 3CCSQ 3JCMW 4QVZA 2ZPGB 4ANJA 1W6XA 3OMGA 4OB0B 3CD6T 4J83A 2DTOA 4RTXA 3O5ZA 4FYXB 1WHGA 2BZYA 3G71Q 1TTHB 4F7UF 2DEUA 2ZPEB 5CAIA 3M57A 1N27A 2DPPB 1VIFA 4BACA 2MK5A 1VQ9T 4OF1A 4A4FA 2O01E 4J8OA 1YITA 2CDTA 3IQLA 2M02A 4C0GA 2NUTA 1FMVA 1HK9A 3R6OA 1MMGA 4M77E 2CP0A 4XK8E 2DXTA 2E6ZA 4M78F 4XU2A 2K5IA 5DY9A 1VQ4T 2HAXA 1M1KU 2HCKA 5IHKA 3VUZA 2FPEA 2X9HA 1RACB 4LUDA 1OPKA 1K9MR 4E7KA 2LCCA 4CC3A 1VQ6A 4PJOA 3CPWS 2EYYA 2B8AA 4Z88A 1GFDA 2DBMA 2DLPA 2NYSA 4E7LA 4DOVA 2HBPA 4MZPA 1VQKA 4LE9A 2LJ0A 2MYSA 3EG9A 2RO0A 1YJ9T 1MMNA 3BW1A 4C92D 1JO8A 4B6MA 1YJWA 5KE3A 4A54A 2CZ1B 1IZ6A 5CKFA 2RK2A 1WHHA 5LJ3h 3CC4A 1QCFA 2QGFB 1KQSP 2R5MA 2HSEB 3EH1A 2JZ2A 2EPDA 3S3NA 4OP0A 4JLIA 1K8AC 2K5FA 3QSUA 5GAOr 3QYGB 4KRTA 3HRUA 4J6WA 4C92F 1QP3A 2CT3A 3G4ST 3MHXA 1OQKA 4M78D 1T0JA 2OI3A 1T0HA 4M78C 4M4ZA 5J39A 4DEXA 2XI9A 4KGXB 2K9GA 1RABB 1M1FA 3LLRA 3OYJA 1FXXA 3CCSA 4HA8A 3OYHA 3H0HA 1JQQA 2M0YA 1TH7A 4XTUA 2RJCA 2QEXQ 5LJ3d 2LP5A 1W2BP 5GMKi 5L8RE 4J9DA 2KROA 4E2FB 2FHDA 1OPLA 2EQMA 3FDRA 1GFCA 1GCPA 3UDCA 1FX7A 1IHWA 5KYYB 2CP5A 3OQ5A 1QKWA 2CYZB 3L2VA 1WJRA 1NPPA 4JZ3A 3OB9A 5GANd 2E12A 2HD0A 1R77A 1M3CA 2E10A 3G4SA 2CKKA 3TEEA 5CVIA 4JUVA 2DD4A 1B34A 5IXBA 3MP8A 5CKHA 4JRPA 4E47A 2X35A 4FT4A 3E19A 1WYXA 1CKAA 3CEYA 3QYHB 4C92C 1RAGB 4C8QE 2KT1A 1VQ6Q 4AG2C 1RADB 2YLBA 3M0RA 5GAOp 2JT4A 3GPLA 4XU1A 2KBTA 2FRWA 2D0QB 2DXCA 4RG2A 1E6HA 3URGA 4XTVA 1BCOA 3EG9B 2DVJA 1U8RA 2JM9A 4FW2A 3P8BB 2YRVA 3SHWA 5LJ5h 2LNHB 3CCRQ 3L2ZA 1IO6A 2VB6A 3SWNC 1PSEA 4Y92A 3L2WA 1JU5C 1NJIC 4KGZB 1RLPC 1NG2A 1YJNQ 1Q81U 1WGSA 1M90R 4GY5A 4AFUC 4M75C 3ME9A 4TVRA 2ZZDA 1H8KA 3QDRB 1B3QA 4J9IA 2OTJQ 3M0SA 2X3WD 2KSSA 5A0LA 4EPCA 4N4GA 1ABQA 1H641 2GFAA 3VS5A 3KXTA 1GBQA 4IUUA 3RKYA 1VOMA 4PK4A 4DQ2A 2HEQA 1OZ2A 2K2VA 2B86A 4WCIA 1LVKA 3CMAT 1OX9A 3TU4K 3CPWP 5KYUB 1ZBXA 4AFZC 4QQGA 3NTIA 3I35A 2JMCA 2CUDA 2ED1A 1EZZB 1QVFA 1SHGA 3OS1A 4GLMA 2RI5A 2VKNA 4ZN3A 4JDSA 3NPFA 2IIMA 2F69A 1YITQ 2L0AA 3H6ZA 1KD1C 2LT1A 1EIFA 4M75F 2LZ6B 2QA4A 3EFOA 2FEIA 4RTVA 4BY6C 1VQLQ 1Q86R 5FRMA 2O31A 3DKMA 4OVAA 3CCQT 1Y7XA 3I56T 2P0KA 2GFUA 5FU7C 1KC8C 4XU3A 2ATCB 5I11A 3QBYA 2FB7A 4XAXB 5CK9A 2QAZA 3CCJA 1WDXA 1IGUA 3TREA 5ECAA 5GANe 1SEMA 1YN8A 3T9NA 2EAYA 3SB2A 1TSFA 3EG1A 3J7AF 4J6YA 3CBOA 1GXIE 3EFRA 1RLQC 4PJLA 5GAMe 5GAOl 4C8QB 5EG2A 2JTMA 2JM8A 2K2MA 4IUQA 2DKGA 1C1AA 2P0PA 2QTXA 3JCMb 4M78E 3JCMP 3E2UA 3JCMJ 3KUFA 4IIOA 5CR2A 3H8ZA 1MV3A 3DB4A 1UDLA 4AT1B 2LQ8A 4PKCC 4D8DA 4OMPA 1VYUA 2L3SA 4FT2A 5KYXA 2RHZA 4EMKA 1S72A 5HCKA 3X24B 5GAMf 3RMQA 1NEGA 2XIDA 1Q82C 4PJOC 4Y91A 4A4EA 2OTLQ 2KVQG 1K9AA 1SG5A 2ZPFB 3QXEB 3ZBDA 1YJWQ 2W0ZA 1QWFA 1BI1A 2EFIA 4OB2B 4HXJA 1UEBA 2QXFA 1M8VA 2K3BA 2EIFA 2F2VA 1ARKA 2M1HA 4ZGDB 1WJSA 2XDPA 3SD4A 1K4US 4PL6A 1I07A 4A4HA 2JMAA 2LX7A 1VQLA 1PG5B 3HRSA 1X6OA 1PD0A 2NLUA 3LX7A 3CCLT 1NE8A 4JJDA 2GCXA 4AFQC 3S6WA 2DMOA 5CKEA 2QA4T 1VQNQ 1UGSB 4OMQA 3OYYA 3S3MA 4K11A 4OMFB 2C06A 5LJ5e 2YUQA 2M9UA 4PJOE 2YUPA 3VUBA 5CQXA 5FWBA 3QDFA 3I55T 2YXYA 4M7AE 1B7TA 5GANg 1O9SA 2CZ6B 3VS0A 3H0FA 3F70A 4M77C 2LT4A 4N0AA 1UJYA 1X2KA 3QZ5B 4D6WA 1WXTA 1ZA1B 4C0DB 1Q86U 3UA7A 1IB8A 1JJ2A 1VA7A 2XG8D 3HSBA 4PFOA 3C4SA 9ATCB 1I81A 2X3XD 2YWWA 3EFSA 5KYWA 4OGCA 1HJDA 2O88A 3ZFJA 1W70A 1AZEA 2BUDA 2YUNA 2K79A 5GJWB 2J7IA 1YJNA 1VQNT 2CP3A 2DRMA 3JB9H 3CMEQ 2ZPHB 4LDWA 1AWJA 5GAN7 4M78B 3EGXA 3JCMV 3I56A 1BK2A 4ZTFA 1JJ2S 1UTIA 2ED0A 4FIBA 3EG2A 4KBMB 3OYCA 3FC3A 3CC2T 3WXMB 5GAOm 3QKJA 4F7UB 1MGQA 2V26A 2E4HA 2A3LA 3JCMf 2RF0A 3LWHA 1XQHA 2BE9B 1GL5A 2KRNA 2DNUA 3VJPA 2RD1A 3L1AA 3RKWA 5FU6C 3CC7A 2QDYB 2JJ9A 3VRZA 5FROA 4C5GA 2QYZA 1AOJA 5IN1A 5GAMg 4FCYA 1XTDA 2VC8A 1BCMA 1NBEB 5GAN2 1YNZA 4C92B 2RA2A 2HL5C 4AMCA 2NUPB 1UE9A 4RUGA 2NUPA 3L2UA 1RAEB 2HMAA 1YFNA 2RI3A 1YCSB 3JCMQ 3VU3C 1M90C 3LW5E 3SDZA 3DLMA 3KFVA 1MMAA 1LPLA 2CREA 1Q82R 1UGRB 2JW4A 1A0NB 3EGXB 1M30A 2HSPA 4C5HA 2QASA 4M75G 3I55A 3OYDA 4P5NA 3RIRA 3VYHB 8AT1B 4C92A 3CCMA 1ZLMA 4J6XA 3HHTB 3V8LA 1K0XA 4M7DD 3BDLA 4ELYC 3E9FA 8ATCB 4X9DA 2BZ8A 2X51A 2CZ0B 1U1TA 4CI0C 2LCLA 1K73R 1Q82U 1NM7A 4RKUE 4DA4A 2EYXA 5GJVB 2D8JA 2DFUA 2VWFA 2JS2A 2PZ1A 3KBGA 3CBPA 1NYGA 1JBMA 4E7HA 3JCMd 3M56A 5FLXE 5CIUA 2YLCA 1VQKT 3RKXA 1MV0B 3G6ET 3OBWA 3HRTA 3NGPA 3Q1JA 3NTHA 4LDVA 3HL8A 1R0BG 2V1RA 2ZPIB 2NUZA 1G3WA 3EH2A 4RTYA 4LXCA 4KH0B 3CC2Q 1IGQA 4F7UE 3OW2P 2RHUA 1Y57A 1BIAA 3CCVT 3CC2A 3FEOA 4F7UG 2E1HA 3BFMA 4ZN1A 2LMJA 1X6GA 5CQYA 3UATA 2X4XA 2AZSA 2QG9B 3QUIA 3U23A 1DJ7B 5GAOn 3E9GA 3CC7T 4X9CA 1WXBA 2MCNA 1PM3A 1X75C 4M75A 2OTJT 3A5ZB 5LJ3f 2KYMA 5J26A 1ACMB 2F2XA 1RI9A 2JNGA 3LGFA 4M7AB 1X6BA 2EJGA 5GAN8 3CXCS 1KFZA 1I4K1 1VQOT 1OU8A 3SFMA 1YJWT 5CCAA 1M5Q1 3C12A 1LNXA 1K76A 1YI2T 2D1XA 1MHNA 3OSSC 2CT4A 3M59A 4HKEA 2RH2A 1Q7YC 1B34B 1KSWA 2QDLA 3CCEA 3JB9G 3C0CA 3JV3A 1KC8U 3LYIA 1K0SA 1Q86C 4KGVB 4RTTA 1Q7YU 2PUOB 3I5SA 3CXCA 1AVZC 1VQ6T 1UGQB 2E3HA 2MWOA 1KQSS 2RK1A 2L8DA 3C94A 1U3OA 2LDMA 4OMLA 3JSCA 1X69A 4C92E 1NJIR 4IIMA 1AEYA 3TSWA 1PRMC 2BE7D 3TCJA 4N0AC 4RMOA 1AWWA 3QO3A 2QA4Q 3ULRB 1D0YA 3CXCP 4PFPA 1N5ZA 3THKA 2KGTA 3OSVA 1WIEA 2YUOA 1W2BS 3I9QA 3G1JA 2VGNA 2XK0A 3FJ5A 5GAMh 3CCUA 2DVEA 2PVGB 2YDLA 2CH4A 3ASKA 1TUGB 4M77F 2DXUA 1I1JA 2YT6A 2C0IA 5KYWB 2EKHA 3JCMe 4B9XA 4M7DE 3UT1A 1VIEA 3P8DA 5CKDA 4XU0A 5KH6A 1SKUB 2CP2A 2RPNA 4RTUA 2CP7A 3EGDA 4R56A 3UWNA 4C0FA 5IAYA 4JJCA 4FYVB 4PJNA 2DZ9A 3OY9A 2E64A 3CCVA 1YBYA 1VQOA 3OYBA 2WACA 1GCQA 5I2MA 4E7JA 3RNJA 1OU9A 2CSIA 2DL3A 2FPDA 2MAMA 4QW2A 1VQMA 4A63B 2EYQA 3HFOA 3PIOA 5LJ5d 4V2SA 4QKUA 3CMAQ 3CCLA 3VS4A 1W1FA 4C5IA 2C0OA 5DM7R 3BY7A 3OW2S 3CMET 4J9HA 2DRKA 3G71A 2WSCE 2DJZA 3MEAA 4Z8AA 1I5LA 1CKBA 4F7UA 5LJ5j 2LTOA 1RAFB 2HKQB 1YWOA 4LDUA 4JLGA 2M0OA 5GAN5
chains in the Genus database with same CATH topology
2EWNA 1NZ9A 3S6WA 5CKEA 2QA4T 4C0ZA 3CCJT 1YIJA 1BI3A 3CMAA 1UGSB 1G3SA 2E70A 2VGMA 2X4JA 3OYYA 1VQMT 4IUPA 4BUGA 5J3BA 3RUXA 3S3MA 4OMFB 2ZCFB 5GAMj 2RI2A 2WSFE 4A4GA 2XU8A 4M75B 4M78G 4QQDA 4ME7A 3BDUA 5GMKl 2C06A 4GLKA 5LJ5e 2JVVA 2M9UA 2E6NA 5CKBA 3DB3A 2H3JA 4PJOE 1VQ5A 2GF7A 3LWIA 1NPRA 2E5QA 1R8OB 3CCST 3VUBA 1KHCA 3QJYA 5CQXA 3OYLA 3V7SA 3G71T 4ZGJB 2RHYA 2XDBA 3MP1A 4JJNK 1KHIA 3I55T 2LRQA 3E1SA 4M7AE 5A0DA 1BYMA 4PNOA 5FRNA 2LX9A 4MZTA 5GANg 1LOJA 1O9SA 2CZ6B 2QI2A 3GLXA 5M9OA 3SWNB 1M1GA 4RG8A 3HFNA 3F70A 4M77C 1OI1A 5GAN6 3CCRA 1YIJT 4M77D 2LT4A 4HCZA 4M7AC 1G5VA 3HKSA 2R58A 3OYGA 4M7AD 4MMLA 4N0AA 1ZQ1A 1VQPT 1IREB 1RI0A 2CZ7B 1M9SA 2QEXA 5HKCA 3PGGA 4O6JA 1YHQA 4LDYA 3OYIA 3QZ5B 3X28B 2FYKA 3V7CA 4D6WA 3OS0A 3LGLA 3DLLA 2RJFA 4KUDK 3JCMW 4QVZA 5DLQE 2D6FA 4Y28E 4C0DB 2ZPGB 4J7FA 4BE0A 3ER0A 4JRIA 3OMGA 4OB0B 1Q86U 3CD6T 3GF5A 3A8LB 5KCOA 4J83A 2DTOA 4L59A 1WJQA 2DIQA 2MWPA 5GMKm 5D6YA 2EJ9A 1JJ2A 2XG8D 4F7UF 3J81E 2DAQA 2LVMA 2ZPEB 5CAIA 3J80E 3HSBA 3M57A 1N27A 3C4SA 5LJ3j 2DPPB 1VIFA 1I81A 4BACA 3WVDB 1KQ2A 1VQ9T 4NS5A 3EFSA 4OF1A 4OGCA 3PMIA 2O01E 4A4FA 3FB9A 3MCAB 4J8OA 3ZFJA 2BIVA 2R5AA 1BKBA 3VKIA 2BUDA 1YITA 4C0GA 3G6EA 4FU6A 1NJIU 4QQ6A 1YJNA 1HK9A 3L2QA 1VQNT 3R6OA 4JS5A 3OA6A 3JB9H 2ZPHB 4LDWA 4MMKA 5GAN7 4M78B 4M77E 4M7DA 4ATOA 1OYXA 4XK8E 3JCMV 3I56A 1VQ4A 2DXTA 3CCMT 2ZGWA 1K8AU 4ZTFA 2E6ZA 2K3YA 2KK4A 4M78F 4LD6A 3CMEA 3CBMA 4XU2A 2K5IA 2DTIA 1JJ2S 5DY9A 1VQ4T 2CGHA 2HAXA 1M1KU 2AHJB 2V8IA 4FIBA 4KBMB 3VUZA 5DLOA 3OYCA 3FC3A 3CC2T 1U1SA 3WXMB 1KD1U 5GAOm 3PNWC 3QKJA 2LCCA 2L5QA 2R57A 3QHSA 4F7UB 4E7KA 1YJNT 1VQ6A 3CPWS 3QG1A 4PJOA 1MGQA 1BIBA 2B8AA 2PQWA 5KE2A 2OTLT 2A3LA 3OS5A 4ZTJA 3JCMf 3RERA 2QQBA 3FRNA 4E7LA 3JB9D 3LWHA 2O4XA 4DOVA 3MEVA 2HBPA 1XQHA 4MZPA 4BY6B 2O4XB 1VQKA 3VJPA 2RB6A 5GAOq 2EQJA 2RD1A 2M16A 3L1AA 4M77G 3RKWA 5FU6C 3CC7A 3HPWA 2RHIA 2RO0A 1YJ9T 2JUFA 3BW1A 4A53A 2QDYB 1M4ZA 4C92D 1WPYA 1VQ8T 5FROA 3PT9A 4HCCA 3M9QA 1YJWA 4KUIA 4C5GA 5KE3A 3EAEA 4M78A 5IN1A 3L42A 2CZ1B 4A54A 3CPWA 1YI2A 4M7DB 1IZ6A 5CKFA 2RK2A 1UB4A 5GAMg 1XTDA 2VC8A 5LJ3h 3CC4A 1KG1A 3NFCA 1H3ZA 2JOYA 2R5MA 5GAN2 4QVDA 1YITT 2JZ2A 4KULA 3S3NA 4OP0A 4JLIA 5GANf 3V7RA 4XTZA 4C92B 4M7AF 3A8HB 2RA2A 2K5FA 1K8AC 3QSUA 5GAOr 2XICA 3QYGB 3HRUA 4J6WA 4C92F 1QP3A 3G4ST 3MHXA 3M54A 5I21A 4M78D 2ZPBB 3L2UA 3LH0A 4M78C 5J39A 4EDUA 2RI3A 3CCQA 2XI9A 4XQ3A 3GIBA 4CRIA 3GNFB 4LD9K 5KCHA 2F5TX 3LLRA 1M1FA 4YTLA 3G7ZA 3GOXA 2A7YA 3OYJA 1FXXA 1WNLA 3JCMQ 3VU3C 4HA8A 3CCSA 3OYHA 1M90C 3LW5E 3X26B 1D3BB 1TH7A 4PJOB 4XTUA 3V8KA 2RJCA 3AHUA 4NL2A 1V29B 4QVCA 4IUVA 5CO7A 3SDZA 3X20B 3DLMA 5LJ3d 5GMKi 3JB9F 5L8RE 4M77A 1VQ9A 1UGRB 2I2LA 4C8QG 5HK0A 1WQWA 5IT9E 2FHDA 2EQMA 2VXFA 3FDRA 4LDXA 3UDCA 4PJOD 2DTHA 1UGPB 4C5HA 1WQ7A 1FX7A 4XTXA 5GAN4 3CCUT 4OGEA 5A2QE 4M75G 3M4GA 3I55A 3OYDA 2P4TA 2QQAA 4E7IA 4P5NA 3RIRA 4BI3A 2VUBA 3OQ5A 3VYHB 1M90U 4FL6A 1VQ8A 1AHJB 4C92A 5LL6S 4JS4A 2CYZB 3CCMA 3S3OA 3L2VA 2RJDA 3QJ6A 1WJRA 3HHTB 1NPPA 4J6XA 3OB9A 3V8LA 5GANd 2E12A 1QP2A 4M7DD 2HD0A 3BDLA 3G4SA 2E10A 1VQNA 2CKKA 4ELYC 3E9FA 3TEEA 4JUVA 4X9DA 5CVIA 4BD3A 3JAME 2DD4A 4HT8A 1B34A 3MO8A 2CZ0B 1U1TA 3NTKA 3MP8A 5CKHA 2P0QA 2Y4YA 1YCYA 3JRZA 4CI0C 4JRPA 4VUBA 1QW1A 2X35A 3E19A 3QYHB 3CEYA 4FT4A 4E47A 4C92C 2OTLA 2LCLA 4C8QE 4KT0E 1Q82U 4RKUE 1XNIA 4DA4A 4Z02A 1XOVA 4N4IA 1N9SA 2YLBA 5LJ3e 5GAOp 2JTFA 2EJFA 3GPLA 3M58A 3VYGA 4EMGA 2V8JA 4XU1A 2PVOB 2D0QB 1O75A 3KBGA 2DXCA 3CBPA 4RG2A 1LJOA 1QVGS 3URGA 2BKDN 2HQEA 1JBMA 4XTVA 1U8RA 2K4YA 2EQUA 4E7HA 3JCMd 4IKFA 2L3RA 3M56A 5FLXE 3JCMX 3P8BB 2YRVA 5CIUA 2YLCA 5LJ5h 1VQKT 4BE1A 3GNGA 4BDZA 3L2ZA 3RKXA 5I2SA 2Y4XA 3G6ET 2VXEA 2EKOA 3OBWA 3SWNC 1PSEA 3HRTA 3L2WA 4RCCA 3Q1JA 3NTHA 4LDVA 5C6SA 3MEWA 3HL8A 5D6WA 3RMSA 1NJIC 2XKOC 2ZPIB 5GANh 1G3WA 1Q81U 2PUKB 1K9MU 1WGSA 2RJEA 3JB9I 4GY5A 1BI0A 4M75C 4XTYA 4JRQA 4F7UE 1KQSA 3QZ9B 3ME9A 1QVGA 5HK3A 4TVRA 2ZZDA 1QVPA 2RHUA 4C0DC 1BIAA 3CCVT 3CC2A 2DK3A 3FEOA 3QDRB 2RHXA 2G3RA 4UC4A 4DOWA 4EMKC 4F7UG 1K9MC 2E1HA 2KQWA 2KSSA 3BFMA 4ZN1A 5A0LA 1W4SA 2K3XA 3QIIA 4M75E 4EPCA 5LJ5f 4N4GA 5CQYA 4ZGEB 2X4XA 3QUIA 5GAOn 4OB1B 4NL3A 1DJ7B 3SWNA 3E9GA 3CC7T 2DXBA 1H641 1JB0E 2GFAA 4X9CA 3KXTA 5GANj 3FJPA 4IUUA 3RKYA 4DQ2A 4BI4A 1OZ2A 2K2VA 1VQ7A 3M55A 1X75C 4M75A 2OTJT 3A5ZB 5LJ3f 4M7AA 5J26A 1Q81C 3CMAT 3TU4K 5LJ3g 2JNGA 3LGFA 4M77B 3JCMh 5GAN3 2MF2A 4M7AB 2L89A 2DO3A 1ZBXA 4QQGA 2EJGA 3NTIA 5GAN8 5HY6A 2IG0A 3CXCS 1PSFA 1I4K1 4NOYA 4BB7A 1VQOT 3N5BB 3SFMA 1YJWT 5CCAA 1I8FA 1M5Q1 3C12A 4L5GA 1QVFA 1LNXA 1X01A 1VQLT 1YI2T 4J7IA 4J5YA 3OS1A 4IURA 1MHNA 3OSSC 4O5VA 3M59A 2RI5A 4HKEA 1S72T 1YJ9A 4ZN3A 2RH2A 4JDSA 4C8QA 1Q7YC 4FM4B 1B34B 4X34A 1VQ5T 3VV0A 3CCEA 3JB9G 1YHQT 3OYNA 1RL2A 2DZCA 1KC8U 3OS2A 3LYIA 2F69A 2D9TA 4PLLA 2XD0A 2KMTA 1Q86C 4B9WA 2DD5A 3H6ZA 2E41A 1G3YA 1JRIA 1KD1C 2LT1A 1Q7YU 1EIFA 1SSFA 2PUOB 3PFSA 4M75F 4N4HA 2PVDB 4OB3B 5LJ5g 3CXCA 3QPHA 2QA4A 1VQ6T 3M4YA 5GMKh 1UGQB 4R55A 1P92A 3OMCA 1VQ7T 4BY6C 1G3TA 2MWOA 2VYTA 1KQSS 2K5LA 3JB9J 2RK1A 2EQKA 2HNIA 2FVUA 2L8DA 3C94A 2LDMA 3X25B 1N8RU 5FRMA 4EMKB 4A4KA 3DKMA 4OVAA 3RESA 4C92G 1Y7XA 3JSCA 3I56T 3CCQT 2KY9A 4BDYA 2P0KA 2QQ9A 3OYFA 2DEQA 2GFUA 5FU7C 1KC8C 1Y71A 2K57A 4Q5WA 4XU3A 4C92E 4M7DC 5AYFA 3FLGA 1D3BA 1N8RC 3TCJA 4N0AC 3QBYA 2LNVA 2FB7A 4XAXB 5CK9A 3O8VA 2FL7A 3QO3A 4RMOA 4PJOF 2QEXT 3CCJA 1KQ1A 1Y96B 3M53A 3TREA 2X4WA 5GANe 3PIPA 3WVEB 3A8GB 2OTJA 1HXDA 3CC4T 3T9NA 2EAYA 4MDWA 3SB2A 4BI8B 4M7AG 3J7AF 5GMKj 2VV5A 4J6YA 3V8JA 3OYKA 5A0GA 3CBOA 3OSVA 1GXIE 3EFRA 4IUTA 1QVFS 1W2BS 2GQVA 5FU6B 5GAMe 5GAOl 4C8QB 3CPFA 2VGNA 5EG2A 2XK0A 2LQKA 2JTMA 4MZMA 3L2RA 2LC4A 4EMHA 3OYEA 3PMTA 4ELZC 5GAMh 2XDDA 3CD6A 1K73C 4C8QF 5C0MA 3CCUA 2DVEA 2PVGB 3OBYA 3FIFA 4IUQA 2DKGA 1M1KC 3ASKA 4L6V5 2P0PA 2QTXA 1N6AA 3JCMb 4HCBA 4M77F 4M78E 3CCRT 2DXUA 3JCMP 1K73U 3JCMJ 2F5KA 3JCMe 3KUFA 4B9XA 4M7DE 5CR2A 3UT1A 1VIEA 2RM4A 1N9RA 2QQRA 3H8ZA 3P8DA 4XU0A 5CKDA 5KH6A 2YHTA 2CS7A 4XTWA 2Y90A 4M75D 3DB4A 4MDXA 1W2BA 2LQ8A 4M7DG 4PKCC 2E65A 3HP9A 3CCET 2MMPA 4R56A 5D6XA 3JCMc 3UWNA 4C0FA 3GP8A 4PLIA 5IAYA 2XHCA 4BE2A 4FT2A 4M7DF 3OYAA 2RHZA 4EMKA 3OW2A 3A8MB 1S72A 4JRKA 3X24B 5GAMf 2DZ9A 3OY9A 1ZHIA 5FU7B 2E64A 3RMQA 3PTAA 3CCVA 2XIDA 2MI6A 1YBYA 2QQSA 1Q82C 3INZA 5GAMd 1VQOA 4WF2A 4PJOC 4Y91A 2WACA 4A4EA 1FWZA 2KVQG 3OYBA 2ZPFB 3QXEB 3MEUA 5I2MA 3M5AA 3ZBDA 2WSEE 4E7JA 1VUBA 1VQPA 2DIGA 1BI1A 1OZ3A 2EFIA 2MAMA 4FSXA 4OB2B 3MP6A 4QW2A 4II1A 4RCBA 3UPUA 1VQMA 1Y96A 3A8OB 1BI2A 2EYQA 2OAUA 3P8HA 3HFOA 3PIOA 2X4YA 5LJ5d 1UEBA 1Y07A 4V2SA 3CCLA 2QXFA 3OYMA 1M8VA 4C5IA 2EIFA 4PJOG 4HT9A 2V8KA 3C95A 2PU9B 5DM7R 2M1HA 3BY7A 3OW2S 2JN0A 1WJSA 2XDPA 3SD4A 4C8QD 4ZGDB 4C8QC 3CMET 4PL6A 3G71A 2WSCE 4A4HA 2DJZA 3MEAA 2HQXA 2KDSA 3META 4C5EA 1I5LA 1VQLA 3HRSA 4F7UA 5LJ5j 1X6OA 2LTOA 3ZEHA 2IVWA 2NLUA 3LX7A 4LDUA 3JCMg 3CCLT 4JLGA 5GMKe 1NE8A 2KAFA 2M0OA 5GAN5 2GCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWN A;  2K57 A;  4C92 E;  1LJO A;  4XU3 A;  4M7D C;  1D3B A;  1JBM A;  4XTV A;  5GAO q;  2RB6 A;  3RUX A;  4N0A C;  3JCM d;  2RD1 A;  2FB7 A;  3L1A A;  4M77 G;  3RKW A;  3JCM X;  3QO3 A;  5GAM j;  4PJO F;  4M75 B;  4M78 G;  1KQ1 A;  1Y96 B;  2YLC A;  3BDU A;  5GMK l;  5LJ5 h;  5LJ5 e;  3L2Z A;  5GAN e;  3BW1 A;  3RKX A;  4A53 A;  4PJO E;  4C92 D;  1HXD A;  1WPY A;  2VXE A;  3SWN C;  2EAY A;  3SB2 A;  4RCC A;  4M78 A;  4M7D B;  4A54 A;  4M7A G;  5GAN h;  3V7S A;  5GMK j;  4J6Y A;  3V8J A;  2VC8 A;  5LJ3 h;  5GAM g;  3EFR A;  3JB9 I;  5GAN 2;  4QVD A;  5GAM e;  4M75 C;  4M7A E;  4XTY A;  4PNO A;  5GAO l;  4C8Q B;  4F7U E;  4OP0 A;  4JLI A;  5GAN f;  3V7R A;  4XTZ A;  4C92 B;  1LOJ A;  5GAN g;  4M7A F;  4EMH A;  2RA2 A;  5GAM h;  3QSU A;  3SWN B;  5GAO r;  1BIA A;  4C8Q F;  4F7U G;  4EMK C;  3HFN A;  4J6W A;  2E1H A;  3BFM A;  4M77 C;  4C92 F;  2DVE A;  5GAN 6;  3FIF A;  4M77 D;  2DKG A;  4M75 E;  5I21 A;  4M7A C;  4M78 D;  5LJ5 f;  4M7A D;  4MML A;  4N0A A;  4M78 C;  3QUI A;  5GAO n;  4NL3 A;  3SWN A;  2QTX A;  4X9C A;  1H64 1;  4M77 F;  3PGG A;  4M78 E;  4XQ3 A;  3JCM b;  2DXU A;  3FJP A;  3JCM P;  5GAN j;  3GIB A;  3RKY A;  4DQ2 A;  3JCM J;  2FYK A;  3V7C A;  3JCM e;  4M75 A;  4M7D E;  3JCM W;  2RM4 A;  5LJ3 f;  1N9R A;  4XU0 A;  2YHT A;  4M7A A;  1WNL A;  4XTW A;  3VU3 C;  4HA8 A;  2Y90 A;  4JRI A;  4M75 D;  3JCM Q;  4PJO B;  1D3B B;  1TH7 A;  4M77 B;  4XTU A;  3JCM h;  3V8K A;  5LJ3 g;  2DTO A;  5GAN 3;  3AHU A;  4NL2 A;  4M7A B;  4QVC A;  4M7D G;  2E65 A;  2EJG A;  5LJ3 d;  3JCM c;  5GMK m;  5GAN 8;  2EJ9 A;  5GMK i;  3JB9 F;  1I4K 1;  4NOY A;  4M77 A;  4F7U F;  4M7D F;  4EMK A;  4C8Q G;  2I2L A;  1I8F A;  1M5Q 1;  5CAI A;  1WQW A;  4JRK A;  1LNX A;  5GAM f;  2DZ9 A;  1X01 A;  2VXF A;  3HSB A;  2E64 A;  5LJ3 j;  4J5Y A;  1I81 A;  1KQ2 A;  4PJO D;  3INZ A;  2DTH A;  5GAM d;  1WQ7 A;  4WF2 A;  4XTX A;  5GAN 4;  3EFS A;  4Y91 A;  4PJO C;  4M75 G;  3M4G A;  3FB9 A;  3RIR A;  4C8Q A;  1B34 B;  4C92 A;  3JB9 G;  1HK9 A;  4RCB A;  3JB9 H;  2DZC A;  1Y96 A;  4MMK A;  4J6X A;  5GAN 7;  3V8L A;  3HFO A;  4M78 B;  4M77 E;  5LJ5 d;  5GAN d;  4M7D A;  3JCM V;  4V2S A;  2DXT A;  1JRI A;  2E41 A;  4M7D D;  2E10 A;  2ZGW A;  4M75 F;  4JUV A;  4M78 F;  4X9D A;  4PJO G;  4XU2 A;  5LJ5 g;  2DTI A;  4HT9 A;  1M8V A;  4HT8 A;  5DY9 A;  1B34 A;  2CGH A;  1U1T A;  3BY7 A;  5GMK h;  2JN0 A;  4C8Q D;  1YCY A;  4C8Q C;  1U1S A;  4C92 C;  5GAO m;  4C8Q E;  4F7U B;  4PJO A;  2DJZ A;  3QHS A;  3JB9 J;  2HNI A;  1MGQ A;  1I5L A;  1BIB A;  1N9S A;  2YLB A;  4EMK B;  4F7U A;  5LJ5 j;  5LJ3 e;  3RES A;  4C92 G;  5GAO p;  2EJF A;  3JCM f;  3RER A;  3JCM g;  4EMG A;  5GMK e;  2DEQ A;  3JB9 D;  4XU1 A;  5GAN 5; 
#chains in the Genus database with same CATH topology
 2ECZ A;  2OAW A;  1NZ9 A;  4C0Z A;  1YIJ A;  1BI3 A;  2VGM A;  2X4J A;  1VQM T;  3EGD B;  2ZCF B;  2XU8 A;  2CP6 A;  4M75 B;  3BDU A;  2EGE A;  4J9E A;  2BTT A;  3DB3 A;  2H3J A;  2I0N A;  1VQ5 A;  1ZUU A;  3OYL A;  3G71 T;  2RHY A;  1KHI A;  4F17 A;  1H92 A;  3E1S A;  5FRN A;  1LOJ A;  2QI2 A;  3GLX A;  3RDV A;  3HFN A;  3VS2 A;  3CCR A;  5GAN 6;  1YIJ T;  1G5V A;  3HKS A;  1ZQ1 A;  1IRE B;  1ZSG A;  1YHQ A;  3X28 B;  2FYK A;  3V7C A;  3OS0 A;  3LGL A;  2RJF A;  4OMN A;  5DLQ E;  2D6F A;  5D7U A;  4Y28 E;  1MMD A;  4JRI A;  3GF5 A;  3A8L B;  4L59 A;  1H3H A;  2DIQ A;  2MWP A;  5GMK m;  5D6Y A;  3J81 E;  4AFS C;  2LVM A;  1ZBJ A;  3H0I A;  3J80 E;  5LJ3 j;  2COY A;  3WVD B;  1I5O B;  3PMI A;  1BKB A;  3VKI A;  3L2Q A;  3CCM Q;  3CCJ Q;  4JS5 A;  3OA6 A;  4M7D A;  1VQ4 A;  3CCM T;  2ZGW A;  2KK4 A;  2K3Y A;  3CME A;  1SRL A;  2A08 A;  2CGH A;  2QGG A;  5DLO A;  1U1S A;  1Z9Q A;  2DE0 X;  2R57 A;  3QHS A;  4J9F A;  1YJN T;  3QG1 A;  1BIB A;  2OTL T;  2O9V A;  4ZTJ A;  2QQB A;  3FRN A;  4J9C A;  2O4X A;  1SPK A;  2GQI A;  3MKD A;  2MOX A;  1Q7Y R;  5I22 A;  2O4X B;  1KJW A;  4F14 A;  2RB6 A;  5GAO q;  2HL3 A;  2RHI A;  2JUF A;  1VQ8 T;  4HCC A;  3M9Q A;  1YJ9 Q;  1D0Z A;  1YI2 A;  4M7D B;  3L42 A;  3CPW A;  1UEC A;  1UB4 A;  1KG1 A;  1JEG A;  2JOY A;  1WHM A;  4QVD A;  3UF4 A;  2KRM A;  1D1B A;  4KUL A;  1FYN A;  5GAN f;  3V7R A;  4XTZ A;  4M7A F;  3A8H B;  2XIC A;  3M0P A;  2RQR A;  2FZG B;  3QWX X;  3LH0 A;  1KD1 R;  4OMM A;  3CCQ A;  2KE9 A;  4CRI A;  5KCH A;  1ZSZ A;  2F5T X;  1C6V X;  4RTW A;  1WNL A;  1TG0 A;  4PJO B;  3X26 B;  1D3B B;  1AT1 B;  4NL2 A;  5CO7 A;  2COW A;  2I2L A;  4J9B A;  2VXF A;  3CCU T;  1Z9Z A;  1WQ7 A;  2HZY A;  3M4G A;  2P4T A;  2QQA A;  4BI3 A;  2VUB A;  1VQ8 A;  1AHJ B;  2HBW A;  5LL6 S;  1M27 C;  2RJD A;  1QP2 A;  5EC7 A;  1LCK A;  4KH1 B;  1VQN A;  2HKN A;  4BD3 A;  3JAM E;  3CCE Q;  5IXF A;  1QVG P;  3NTK A;  1JXM A;  2CUB A;  2ABL A;  2Y4Y A;  3JRZ A;  3VRY A;  1PRL C;  4VUB A;  1QW1 A;  2OTL A;  3NHN A;  1D09 B;  1XNI A;  2EBP A;  4N4I A;  4Z02 A;  1N9S A;  5IH2 A;  1NYF A;  2JTF A;  2EJF A;  3M58 A;  1C0M A;  2V8J A;  3EFO B;  1RUW A;  1O75 A;  2V1Q A;  2YRC A;  2K4Y A;  3I5R A;  4FYW B;  4IKF A;  1E6G A;  2L3R A;  3JCM X;  1D1A A;  4BE1 A;  1G2B A;  5I2S A;  2Y4X A;  2VXE A;  4RCC A;  2MIO A;  1WXU A;  3RMS A;  2KYB A;  3NMZ C;  4CC7 A;  2RJE A;  3JB9 I;  1BI0 A;  4DBR A;  1KQS A;  4FW1 A;  1QVP A;  2SRC A;  4C0D C;  2DK3 A;  2F2W A;  2RHX A;  4DOW A;  1M1K R;  4ZGE B;  2FRY A;  2EGC A;  2DXB A;  1JB0 E;  1QKX A;  5GAN j;  3EHR A;  3EG3 A;  2KR3 A;  3M55 A;  1S1N A;  4M7A A;  5LJ3 g;  1UUE A;  5HY6 A;  2IG0 A;  2CSQ A;  1RAA B;  4BB7 A;  3N5B B;  1I8F A;  4L5G A;  3CD6 Q;  4J7I A;  4PFZ A;  2DL4 A;  4IUR A;  2COZ A;  1YJ9 A;  2OX7 A;  4DBH A;  4FM4 B;  2DIL A;  4X34 A;  1VQ5 T;  3VV0 A;  1YHQ T;  3OS2 A;  2XD0 A;  1WX6 A;  4PLL A;  2DBK A;  1BBZ A;  2E41 A;  1JRI A;  2A28 A;  1M2O A;  1SSF A;  2L2P A;  3PFS A;  4N4H A;  2PVD B;  4OB3 B;  1OUL A;  1VQ7 T;  1G3T A;  1D1C A;  2GGR A;  2AK5 A;  3X25 B;  1N8R U;  2GTO A;  4EMK B;  2DYI A;  4BDY A;  1ZSZ B;  1OOT A;  2A37 A;  1Y71 A;  4Q5W A;  2LJ1 A;  3FLG A;  2KNB B;  3PE0 A;  1N8R C;  2DJQ A;  2LNV A;  4JPB W;  2QEX T;  7AT1 B;  1KQ1 A;  1Y96 B;  3M53 A;  2YRD A;  2J6K A;  3PIP A;  3REA B;  3A8G B;  3PVQ A;  3WVE B;  3CC4 T;  1PWT A;  1R0C B;  3CCV Q;  3OYK A;  5A0G A;  4FSS A;  4QT7 A;  4IUT A;  2RMO A;  3L2R A;  2LC4 A;  4EMH A;  3PMT A;  1B07 A;  4ELZ C;  2XDD A;  2FG0 A;  2O2O A;  2Z0W A;  3OBY A;  1M1K C;  2CH4 W;  1UG1 A;  2LCS A;  4HCB A;  1V76 A;  4E7Z A;  1VQK Q;  1M3A A;  2F5K A;  3TVT A;  2KI7 A;  1HSQ A;  1PCX A;  2RM4 A;  2EQI A;  2QQR A;  1TXQ A;  2YHT A;  2EYZ A;  4XTW A;  2Y90 A;  4M75 D;  2L3Q A;  2YSQ A;  1UJ0 A;  1I0C A;  2E65 A;  3HP9 A;  3CCE T;  1QVF P;  4X1V A;  5D6X A;  3JCM c;  3GP8 A;  4PLI A;  4ZNX A;  2XHC A;  3OYA A;  1ZX6 A;  3A8M B;  1CSK A;  5GAM d;  3RR6 A;  4WF2 A;  1J3T A;  2BZX A;  2RQU A;  1FWZ A;  4AG1 C;  3AT1 B;  2WSE E;  1VUB A;  1Q81 R;  2DIG A;  1OZ3 A;  3MP6 A;  1Y96 A;  1M8M A;  3A8O B;  4ORZ A;  4E6R A;  2X4Y A;  1VQ4 Q;  4LUE A;  1FMK A;  3UA6 A;  3I55 Q;  1PHT A;  1VQM Q;  1WHL A;  2V8K A;  3C95 A;  2PU9 B;  2ROL A;  2DER A;  1XJW B;  2DL5 A;  3VS3 A;  2KDS A;  1TUD A;  1E7O A;  2EGA A;  3ZEH A;  2IVW A;  1V1C A;  1VQ9 Q;  5GMK e;  2KXD A;  3VS1 A;  2EWN A;  3CMA A;  3CCL Q;  2E70 A;  1G3S A;  4IUP A;  5GAM j;  4A4G A;  4M78 G;  1KK7 A;  4WTO B;  4ME7 A;  2P4R A;  5GMK l;  4GLK A;  2E6N A;  2ZAE A;  5CKB A;  2NUT B;  2GF7 A;  2KXC A;  1NPR A;  2A0F B;  1R8O B;  2E5Q A;  3CCS T;  1KHC A;  3QJY A;  2AZV A;  4ZGJ B;  2XDB A;  2DA9 A;  1VQ8 Q;  2FZC B;  5A0D A;  1MNE A;  4MZT A;  4E7S A;  1KIK A;  2G6F X;  5M9O A;  2RQV A;  3SWN B;  4RG8 A;  1OI1 A;  3EGU A;  4M77 D;  4HCZ A;  4M7A C;  2R58 A;  4R0K A;  4M7A D;  2GNC A;  2AKL A;  1VQP T;  5L23 A;  1RI0 A;  2CZ7 B;  4O6J A;  4LDY A;  3OYI A;  2VAS A;  2RN8 A;  4J7F A;  4BE0 A;  3ER0 A;  5KCO A;  2GTJ A;  1WJQ A;  1TUC A;  2PNI A;  2LQW A;  2DF6 A;  2EJ9 A;  2RQW A;  2DAQ A;  1X43 A;  1RAH B;  1KQ2 A;  1OEB A;  1TS9 A;  3BE3 A;  4NS5 A;  3FB9 A;  3MCA B;  2BIV A;  2R5A A;  1NJI U;  3G6E A;  4FU6 A;  1EX4 A;  4CC2 A;  1PKT A;  1UHC A;  1SSH A;  4QQ6 A;  1GBR A;  4MMK A;  2J6F A;  1Q95 G;  3MJX A;  4ATO A;  1OYX A;  1K8A U;  4LD6 A;  3CBM A;  2DTI A;  2AHJ B;  2KT8 A;  2V8I A;  2DM1 A;  5FW9 A;  1KD1 U;  3PNW C;  1IRX A;  4HVU A;  2L5Q A;  2H3E B;  2LJ3 A;  5KE2 A;  2PQW A;  3OS5 A;  3RER A;  2DL7 A;  3JB9 D;  3MEV A;  1T3L A;  4BY6 B;  3I56 Q;  3CCQ Q;  3ZL7 C;  2EQJ A;  2M16 A;  4M77 G;  1SRM A;  3SEM A;  3HPW A;  1ABO A;  4A53 A;  1M4Z A;  1WPY A;  3PT9 A;  2K7A A;  4KUI A;  3EAE A;  4M78 A;  3VS7 A;  1QMC A;  1G83 A;  4LNP A;  3NFC A;  1H3Z A;  1X27 A;  2AIR B;  1YIT T;  2GBQ A;  3GBQ A;  2A36 A;  2FO0 A;  4LN2 A;  2DET A;  1VQO Q;  3M0U A;  1JXO A;  2QTV A;  1GRI A;  4OMO A;  3CQT A;  3M54 A;  5I21 A;  2ZPB B;  4EDU A;  4Z89 A;  4XQ3 A;  3GIB A;  1HYO A;  3GNF B;  4LD9 K;  1T3S A;  4YTL A;  3G7Z A;  3GOX A;  1TOV A;  2A7Y A;  4J9G A;  3CC7 Q;  1M3B A;  4GBQ A;  1WI7 A;  1JJ2 P;  3V8K A;  3AHU A;  5KYN A;  1V29 B;  4QVC A;  4IUV A;  1ZUY A;  2DX1 A;  1K1Z A;  3X20 B;  1U5S A;  3M0T A;  3JB9 F;  4M77 A;  5IHI A;  1VQ9 A;  4C8Q G;  5HK0 A;  1IHV A;  1WQW A;  5IT9 E;  3CC4 Q;  4LDX A;  5KYY A;  1Y0M A;  4PJO D;  2DTH A;  1UGP B;  4XTX A;  5GAN 4;  4JJB A;  2KRS A;  4OGE A;  5A2Q E;  1X2Q A;  4E7I A;  1WZO A;  2XMF A;  4FL6 A;  1SF9 A;  4JS4 A;  3S3O A;  3QJ6 A;  1BB9 A;  2E3I A;  1GCQ C;  1TWB A;  2JTE A;  2JS0 A;  3H9N A;  4D8K A;  2J6O A;  4PJM A;  1G8X A;  2HQH A;  4HVW A;  2QK0 A;  4HT8 A;  1OX8 A;  1WLP B;  3MO8 A;  2P0Q A;  1YCY A;  4EIK A;  4KT0 E;  3TSZ A;  1XOV A;  1QLY A;  2J05 A;  5LJ3 e;  1S72 Q;  3VYG A;  4EMG A;  1WHJ A;  2PVO B;  1QVG S;  1LJO A;  2BKD N;  2HQE A;  6AT1 B;  1YHQ Q;  2EQU A;  2OJ2 A;  2PTK A;  3GNG A;  4BDZ A;  2EKO A;  5C6S A;  3MEW A;  1M2V B;  2XKO C;  5GAN h;  3EG0 A;  2PUK B;  1HD3 A;  1K9M U;  3LH5 A;  1OV3 A;  4XTY A;  4JRQ A;  3QZ9 B;  1QVG A;  5HK3 A;  5IHN A;  2LQN A;  2G3R A;  4UC4 A;  1K9M C;  4DBF A;  4EMK C;  2KQW A;  5AT1 B;  3REB B;  2VVK A;  1W4S A;  2K3X A;  1ZSZ C;  1TU0 B;  3QII A;  4M75 E;  5LJ5 f;  1K8A R;  1ZUK A;  1QQJ A;  4OB1 B;  4NL3 A;  3SWN A;  3H41 A;  2DL8 A;  3FJP A;  4BI4 A;  1VQ7 A;  1QCN A;  4HVV A;  2ENM A;  1Q81 C;  2J06 A;  2H8H A;  1SHF A;  1PKS A;  2JXB A;  5GAN 3;  4M77 B;  3JCM h;  2MF2 A;  4HCK A;  4F16 A;  2L89 A;  2DO3 A;  3R6N A;  1PSF A;  4NOY A;  2IPO B;  4DBQ A;  1X01 A;  1VQL T;  4J5Y A;  4F04 B;  4O5V A;  1D0X A;  1S72 T;  3G4S Q;  4C8Q A;  1QWE A;  4CC4 B;  1NLP C;  1YWP A;  3OYN A;  1RL2 A;  1BU1 A;  1PC0 A;  2DZC A;  1YI2 Q;  2D9T A;  2KMT A;  1AWO A;  2AKK A;  4B9W A;  2DD5 A;  3VS6 A;  1G3Y A;  5LJ5 g;  2FPF A;  3QPH A;  3M4Y A;  5GMK h;  4R55 A;  1P92 A;  2W10 A;  3OMC A;  2MPX C;  2VYT A;  2K5L A;  3TQ7 P;  3JB9 J;  2EQK A;  2HNI A;  2FVU A;  3PVL A;  4A4K A;  3RES A;  1ZA2 B;  4C92 G;  2KY9 A;  2K6D A;  2QQ9 A;  3OYF A;  2DEQ A;  2K57 A;  4M7D C;  5AYF A;  1D3B A;  1UGV A;  3O8V A;  2FL7 A;  4PJO F;  2HDA A;  2X4W A;  3CCU Q;  2OTJ A;  1HXD A;  1FMW A;  2AT1 B;  2SEM A;  4MDW A;  1KC8 R;  4FYY B;  4BI8 B;  1AD5 A;  3EHQ A;  4M7A G;  3RBB B;  5GMK j;  2VV5 A;  3V8J A;  1UFF A;  2C0T A;  2DYB A;  3G6E Q;  1AZG B;  1U06 A;  1QVF S;  2GQV A;  5FU6 B;  2E5K A;  2EVR A;  1VYT A;  3CPF A;  1NEB A;  2LQK A;  2RNA A;  4MZM A;  3D7S B;  3OYE A;  3CD6 A;  1K73 C;  4C8Q F;  5C0M A;  2F1L A;  2ROT A;  3FIF A;  3A98 A;  4L6V 5;  3M0Q A;  1QCO A;  1VQ7 Q;  1N6A A;  3CCR T;  1NLO C;  1K73 U;  1IXD A;  5KYU A;  2P84 A;  1N9R A;  2CS7 A;  4MDX A;  1W2B A;  4M7D G;  2D8H A;  2MMP A;  5FWC A;  4BE2 A;  4M7D F;  4RTZ A;  3OW2 A;  4JRK A;  3PTA A;  1ZHI A;  3A1P A;  5FU7 B;  1MUZ A;  2MI6 A;  1RAI B;  2QQS A;  3INZ A;  1PD1 A;  4JZ4 A;  3MEU A;  3M5A A;  3QWY A;  1VQP A;  2EW3 A;  4FSX A;  3UPU A;  4RCB A;  2EYW A;  4II1 A;  1WFW A;  1BI2 A;  2OAU A;  3P8H A;  2M51 A;  1Y07 A;  3OYM A;  4PJO G;  4HT9 A;  2D0N A;  1VYV A;  5KYX B;  2JN0 A;  4C8Q D;  4C8Q C;  2ESW A;  2O9S A;  2HQX A;  3MET A;  1WHK A;  4C5E A;  1F1B B;  1UHF A;  1PNJ A;  2L3P A;  3HTR A;  3JCM g;  2KAF A;  5D6W A;  1M90 U;  1AWX A;  3CCJ T;  4PJJ A;  4DEY A;  4BUG A;  5J3B A;  3RUX A;  1EFN A;  2RI2 A;  2WSF E;  4QQD A;  2JVV A;  3LWI A;  1YP5 A;  1N8R R;  3V7S A;  3MP1 A;  4JJN K;  1WA7 A;  3MPU B;  1VQP Q;  2LRQ A;  1BYM A;  4PNO A;  2LX9 A;  1MND A;  2RQT A;  1M1G A;  1M2V A;  3OYG A;  2FZK B;  4MML A;  1M9S A;  2QEX A;  5HKC A;  2KEA A;  3PGG A;  1VQ5 Q;  4ESR A;  1YIJ Q;  2NWM A;  4KUD K;  3DLL A;  3CCS Q;  3JCM W;  4QVZ A;  2ZPG B;  4ANJ A;  1W6X A;  3OMG A;  4OB0 B;  3CD6 T;  4J83 A;  2DTO A;  4RTX A;  3O5Z A;  4FYX B;  1WHG A;  2BZY A;  3G71 Q;  1TTH B;  4F7U F;  2DEU A;  2ZPE B;  5CAI A;  3M57 A;  1N27 A;  2DPP B;  1VIF A;  4BAC A;  2MK5 A;  1VQ9 T;  4OF1 A;  4A4F A;  2O01 E;  4J8O A;  1YIT A;  2CDT A;  3IQL A;  2M02 A;  4C0G A;  2NUT A;  1FMV A;  1HK9 A;  3R6O A;  1MMG A;  4M77 E;  2CP0 A;  4XK8 E;  2DXT A;  2E6Z A;  4M78 F;  4XU2 A;  2K5I A;  5DY9 A;  1VQ4 T;  2HAX A;  1M1K U;  2HCK A;  5IHK A;  3VUZ A;  2FPE A;  2X9H A;  1RAC B;  4LUD A;  1OPK A;  1K9M R;  4E7K A;  2LCC A;  4CC3 A;  1VQ6 A;  4PJO A;  3CPW S;  2EYY A;  2B8A A;  4Z88 A;  1GFD A;  2DBM A;  2DLP A;  2NYS A;  4E7L A;  4DOV A;  2HBP A;  4MZP A;  1VQK A;  4LE9 A;  2LJ0 A;  2MYS A;  3EG9 A;  2RO0 A;  1YJ9 T;  1MMN A;  3BW1 A;  4C92 D;  1JO8 A;  4B6M A;  1YJW A;  5KE3 A;  4A54 A;  2CZ1 B;  1IZ6 A;  5CKF A;  2RK2 A;  1WHH A;  5LJ3 h;  3CC4 A;  1QCF A;  2QGF B;  1KQS P;  2R5M A;  2HSE B;  3EH1 A;  2JZ2 A;  2EPD A;  3S3N A;  4OP0 A;  4JLI A;  1K8A C;  2K5F A;  3QSU A;  5GAO r;  3QYG B;  4KRT A;  3HRU A;  4J6W A;  4C92 F;  1QP3 A;  2CT3 A;  3G4S T;  3MHX A;  1OQK A;  4M78 D;  1T0J A;  2OI3 A;  1T0H A;  4M78 C;  4M4Z A;  5J39 A;  4DEX A;  2XI9 A;  4KGX B;  2K9G A;  1RAB B;  1M1F A;  3LLR A;  3OYJ A;  1FXX A;  3CCS A;  4HA8 A;  3OYH A;  3H0H A;  1JQQ A;  2M0Y A;  1TH7 A;  4XTU A;  2RJC A;  2QEX Q;  5LJ3 d;  2LP5 A;  1W2B P;  5GMK i;  5L8R E;  4J9D A;  2KRO A;  4E2F B;  2FHD A;  1OPL A;  2EQM A;  3FDR A;  1GFC A;  1GCP A;  3UDC A;  1FX7 A;  1IHW A;  5KYY B;  2CP5 A;  3OQ5 A;  1QKW A;  2CYZ B;  3L2V A;  1WJR A;  1NPP A;  4JZ3 A;  3OB9 A;  5GAN d;  2E12 A;  2HD0 A;  1R77 A;  1M3C A;  2E10 A;  3G4S A;  2CKK A;  3TEE A;  5CVI A;  4JUV A;  2DD4 A;  1B34 A;  5IXB A;  3MP8 A;  5CKH A;  4JRP A;  4E47 A;  2X35 A;  4FT4 A;  3E19 A;  1WYX A;  1CKA A;  3CEY A;  3QYH B;  4C92 C;  1RAG B;  4C8Q E;  2KT1 A;  1VQ6 Q;  4AG2 C;  1RAD B;  2YLB A;  3M0R A;  5GAO p;  2JT4 A;  3GPL A;  4XU1 A;  2KBT A;  2FRW A;  2D0Q B;  2DXC A;  4RG2 A;  1E6H A;  3URG A;  4XTV A;  1BCO A;  3EG9 B;  2DVJ A;  1U8R A;  2JM9 A;  4FW2 A;  3P8B B;  2YRV A;  3SHW A;  5LJ5 h;  2LNH B;  3CCR Q;  3L2Z A;  1IO6 A;  2VB6 A;  3SWN C;  1PSE A;  4Y92 A;  3L2W A;  1JU5 C;  1NJI C;  4KGZ B;  1RLP C;  1NG2 A;  1YJN Q;  1Q81 U;  1WGS A;  1M90 R;  4GY5 A;  4AFU C;  4M75 C;  3ME9 A;  4TVR A;  2ZZD A;  1H8K A;  3QDR B;  1B3Q A;  4J9I A;  2OTJ Q;  3M0S A;  2X3W D;  2KSS A;  5A0L A;  4EPC A;  4N4G A;  1ABQ A;  1H64 1;  2GFA A;  3VS5 A;  3KXT A;  1GBQ A;  4IUU A;  3RKY A;  1VOM A;  4PK4 A;  4DQ2 A;  2HEQ A;  1OZ2 A;  2K2V A;  2B86 A;  4WCI A;  1LVK A;  3CMA T;  1OX9 A;  3TU4 K;  3CPW P;  5KYU B;  1ZBX A;  4AFZ C;  4QQG A;  3NTI A;  3I35 A;  2JMC A;  2CUD A;  2ED1 A;  1EZZ B;  1QVF A;  1SHG A;  3OS1 A;  4GLM A;  2RI5 A;  2VKN A;  4ZN3 A;  4JDS A;  3NPF A;  2IIM A;  2F69 A;  1YIT Q;  2L0A A;  3H6Z A;  1KD1 C;  2LT1 A;  1EIF A;  4M75 F;  2LZ6 B;  2QA4 A;  3EFO A;  2FEI A;  4RTV A;  4BY6 C;  1VQL Q;  1Q86 R;  5FRM A;  2O31 A;  3DKM A;  4OVA A;  3CCQ T;  1Y7X A;  3I56 T;  2P0K A;  2GFU A;  5FU7 C;  1KC8 C;  4XU3 A;  2ATC B;  5I11 A;  3QBY A;  2FB7 A;  4XAX B;  5CK9 A;  2QAZ A;  3CCJ A;  1WDX A;  1IGU A;  3TRE A;  5ECA A;  5GAN e;  1SEM A;  1YN8 A;  3T9N A;  2EAY A;  3SB2 A;  1TSF A;  3EG1 A;  3J7A F;  4J6Y A;  3CBO A;  1GXI E;  3EFR A;  1RLQ C;  4PJL A;  5GAM e;  5GAO l;  4C8Q B;  5EG2 A;  2JTM A;  2JM8 A;  2K2M A;  4IUQ A;  2DKG A;  1C1A A;  2P0P A;  2QTX A;  3JCM b;  4M78 E;  3JCM P;  3E2U A;  3JCM J;  3KUF A;  4IIO A;  5CR2 A;  3H8Z A;  1MV3 A;  3DB4 A;  1UDL A;  4AT1 B;  2LQ8 A;  4PKC C;  4D8D A;  4OMP A;  1VYU A;  2L3S A;  4FT2 A;  5KYX A;  2RHZ A;  4EMK A;  1S72 A;  5HCK A;  3X24 B;  5GAM f;  3RMQ A;  1NEG A;  2XID A;  1Q82 C;  4PJO C;  4Y91 A;  4A4E A;  2OTL Q;  2KVQ G;  1K9A A;  1SG5 A;  2ZPF B;  3QXE B;  3ZBD A;  1YJW Q;  2W0Z A;  1QWF A;  1BI1 A;  2EFI A;  4OB2 B;  4HXJ A;  1UEB A;  2QXF A;  1M8V A;  2K3B A;  2EIF A;  2F2V A;  1ARK A;  2M1H A;  4ZGD B;  1WJS A;  2XDP A;  3SD4 A;  1K4U S;  4PL6 A;  1I07 A;  4A4H A;  2JMA A;  2LX7 A;  1VQL A;  1PG5 B;  3HRS A;  1X6O A;  1PD0 A;  2NLU A;  3LX7 A;  3CCL T;  1NE8 A;  4JJD A;  2GCX A;  4AFQ C;  3S6W A;  2DMO A;  5CKE A;  2QA4 T;  1VQN Q;  1UGS B;  4OMQ A;  3OYY A;  3S3M A;  4K11 A;  4OMF B;  2C06 A;  5LJ5 e;  2YUQ A;  2M9U A;  4PJO E;  2YUP A;  3VUB A;  5CQX A;  5FWB A;  3QDF A;  3I55 T;  2YXY A;  4M7A E;  1B7T A;  5GAN g;  1O9S A;  2CZ6 B;  3VS0 A;  3H0F A;  3F70 A;  4M77 C;  2LT4 A;  4N0A A;  1UJY A;  1X2K A;  3QZ5 B;  4D6W A;  1WXT A;  1ZA1 B;  4C0D B;  1Q86 U;  3UA7 A;  1IB8 A;  1JJ2 A;  1VA7 A;  2XG8 D;  3HSB A;  4PFO A;  3C4S A;  9ATC B;  1I81 A;  2X3X D;  2YWW A;  3EFS A;  5KYW A;  4OGC A;  1HJD A;  2O88 A;  3ZFJ A;  1W70 A;  1AZE A;  2BUD A;  2YUN A;  2K79 A;  5GJW B;  2J7I A;  1YJN A;  1VQN T;  2CP3 A;  2DRM A;  3JB9 H;  3CME Q;  2ZPH B;  4LDW A;  1AWJ A;  5GAN 7;  4M78 B;  3EGX A;  3JCM V;  3I56 A;  1BK2 A;  4ZTF A;  1JJ2 S;  1UTI A;  2ED0 A;  4FIB A;  3EG2 A;  4KBM B;  3OYC A;  3FC3 A;  3CC2 T;  3WXM B;  5GAO m;  3QKJ A;  4F7U B;  1MGQ A;  2V26 A;  2E4H A;  2A3L A;  3JCM f;  2RF0 A;  3LWH A;  1XQH A;  2BE9 B;  1GL5 A;  2KRN A;  2DNU A;  3VJP A;  2RD1 A;  3L1A A;  3RKW A;  5FU6 C;  3CC7 A;  2QDY B;  2JJ9 A;  3VRZ A;  5FRO A;  4C5G A;  2QYZ A;  1AOJ A;  5IN1 A;  5GAM g;  4FCY A;  1XTD A;  2VC8 A;  1BCM A;  1NBE B;  5GAN 2;  1YNZ A;  4C92 B;  2RA2 A;  2HL5 C;  4AMC A;  2NUP B;  1UE9 A;  4RUG A;  2NUP A;  3L2U A;  1RAE B;  2HMA A;  1YFN A;  2RI3 A;  1YCS B;  3JCM Q;  3VU3 C;  1M90 C;  3LW5 E;  3SDZ A;  3DLM A;  3KFV A;  1MMA A;  1LPL A;  2CRE A;  1Q82 R;  1UGR B;  2JW4 A;  1A0N B;  3EGX B;  1M30 A;  2HSP A;  4C5H A;  2QAS A;  4M75 G;  3I55 A;  3OYD A;  4P5N A;  3RIR A;  3VYH B;  8AT1 B;  4C92 A;  3CCM A;  1ZLM A;  4J6X A;  3HHT B;  3V8L A;  1K0X A;  4M7D D;  3BDL A;  4ELY C;  3E9F A;  8ATC B;  4X9D A;  2BZ8 A;  2X51 A;  2CZ0 B;  1U1T A;  4CI0 C;  2LCL A;  1K73 R;  1Q82 U;  1NM7 A;  4RKU E;  4DA4 A;  2EYX A;  5GJV B;  2D8J A;  2DFU A;  2VWF A;  2JS2 A;  2PZ1 A;  3KBG A;  3CBP A;  1NYG A;  1JBM A;  4E7H A;  3JCM d;  3M56 A;  5FLX E;  5CIU A;  2YLC A;  1VQK T;  3RKX A;  1MV0 B;  3G6E T;  3OBW A;  3HRT A;  3NGP A;  3Q1J A;  3NTH A;  4LDV A;  3HL8 A;  1R0B G;  2V1R A;  2ZPI B;  2NUZ A;  1G3W A;  3EH2 A;  4RTY A;  4LXC A;  4KH0 B;  3CC2 Q;  1IGQ A;  4F7U E;  3OW2 P;  2RHU A;  1Y57 A;  1BIA A;  3CCV T;  3CC2 A;  3FEO A;  4F7U G;  2E1H A;  3BFM A;  4ZN1 A;  2LMJ A;  1X6G A;  5CQY A;  3UAT A;  2X4X A;  2AZS A;  2QG9 B;  3QUI A;  3U23 A;  1DJ7 B;  5GAO n;  3E9G A;  3CC7 T;  4X9C A;  1WXB A;  2MCN A;  1PM3 A;  1X75 C;  4M75 A;  2OTJ T;  3A5Z B;  5LJ3 f;  2KYM A;  5J26 A;  1ACM B;  2F2X A;  1RI9 A;  2JNG A;  3LGF A;  4M7A B;  1X6B A;  2EJG A;  5GAN 8;  3CXC S;  1KFZ A;  1I4K 1;  1VQO T;  1OU8 A;  3SFM A;  1YJW T;  5CCA A;  1M5Q 1;  3C12 A;  1LNX A;  1K76 A;  1YI2 T;  2D1X A;  1MHN A;  3OSS C;  2CT4 A;  3M59 A;  4HKE A;  2RH2 A;  1Q7Y C;  1B34 B;  1KSW A;  2QDL A;  3CCE A;  3JB9 G;  3C0C A;  3JV3 A;  1KC8 U;  3LYI A;  1K0S A;  1Q86 C;  4KGV B;  4RTT A;  1Q7Y U;  2PUO B;  3I5S A;  3CXC A;  1AVZ C;  1VQ6 T;  1UGQ B;  2E3H A;  2MWO A;  1KQS S;  2RK1 A;  2L8D A;  3C94 A;  1U3O A;  2LDM A;  4OML A;  3JSC A;  1X69 A;  4C92 E;  1NJI R;  4IIM A;  1AEY A;  3TSW A;  1PRM C;  2BE7 D;  3TCJ A;  4N0A C;  4RMO A;  1AWW A;  3QO3 A;  2QA4 Q;  3ULR B;  1D0Y A;  3CXC P;  4PFP A;  1N5Z A;  3THK A;  2KGT A;  3OSV A;  1WIE A;  2YUO A;  1W2B S;  3I9Q A;  3G1J A;  2VGN A;  2XK0 A;  3FJ5 A;  5GAM h;  3CCU A;  2DVE A;  2PVG B;  2YDL A;  2CH4 A;  3ASK A;  1TUG B;  4M77 F;  2DXU A;  1I1J A;  2YT6 A;  2C0I A;  5KYW B;  2EKH A;  3JCM e;  4B9X A;  4M7D E;  3UT1 A;  1VIE A;  3P8D A;  5CKD A;  4XU0 A;  5KH6 A;  1SKU B;  2CP2 A;  2RPN A;  4RTU A;  2CP7 A;  3EGD A;  4R56 A;  3UWN A;  4C0F A;  5IAY A;  4JJC A;  4FYV B;  4PJN A;  2DZ9 A;  3OY9 A;  2E64 A;  3CCV A;  1YBY A;  1VQO A;  3OYB A;  2WAC A;  1GCQ A;  5I2M A;  4E7J A;  3RNJ A;  1OU9 A;  2CSI A;  2DL3 A;  2FPD A;  2MAM A;  4QW2 A;  1VQM A;  4A63 B;  2EYQ A;  3HFO A;  3PIO A;  5LJ5 d;  4V2S A;  4QKU A;  3CMA Q;  3CCL A;  3VS4 A;  1W1F A;  4C5I A;  2C0O A;  5DM7 R;  3BY7 A;  3OW2 S;  3CME T;  4J9H A;  2DRK A;  3G71 A;  2WSC E;  2DJZ A;  3MEA A;  4Z8A A;  1I5L A;  1CKB A;  4F7U A;  5LJ5 j;  2LTO A;  1RAF B;  2HKQ B;  1YWO A;  4LDU A;  4JLG A;  2M0O A;  5GAN 5; 
#chains in the Genus database with same CATH homology
 2EWN A;  1NZ9 A;  3S6W A;  5CKE A;  2QA4 T;  4C0Z A;  3CCJ T;  1YIJ A;  1BI3 A;  3CMA A;  1UGS B;  1G3S A;  2E70 A;  2VGM A;  2X4J A;  3OYY A;  1VQM T;  4IUP A;  4BUG A;  5J3B A;  3RUX A;  3S3M A;  4OMF B;  2ZCF B;  5GAM j;  2RI2 A;  2WSF E;  4A4G A;  2XU8 A;  4M75 B;  4M78 G;  4QQD A;  4ME7 A;  3BDU A;  5GMK l;  2C06 A;  4GLK A;  5LJ5 e;  2JVV A;  2M9U A;  2E6N A;  5CKB A;  3DB3 A;  2H3J A;  4PJO E;  1VQ5 A;  2GF7 A;  3LWI A;  1NPR A;  2E5Q A;  1R8O B;  3CCS T;  3VUB A;  1KHC A;  3QJY A;  5CQX A;  3OYL A;  3V7S A;  3G71 T;  4ZGJ B;  2RHY A;  2XDB A;  3MP1 A;  4JJN K;  1KHI A;  3I55 T;  2LRQ A;  3E1S A;  4M7A E;  5A0D A;  1BYM A;  4PNO A;  5FRN A;  2LX9 A;  4MZT A;  5GAN g;  1LOJ A;  1O9S A;  2CZ6 B;  2QI2 A;  3GLX A;  5M9O A;  3SWN B;  1M1G A;  4RG8 A;  3HFN A;  3F70 A;  4M77 C;  1OI1 A;  5GAN 6;  3CCR A;  1YIJ T;  4M77 D;  2LT4 A;  4HCZ A;  4M7A C;  1G5V A;  3HKS A;  2R58 A;  3OYG A;  4M7A D;  4MML A;  4N0A A;  1ZQ1 A;  1VQP T;  1IRE B;  1RI0 A;  2CZ7 B;  1M9S A;  2QEX A;  5HKC A;  3PGG A;  4O6J A;  1YHQ A;  4LDY A;  3OYI A;  3QZ5 B;  3X28 B;  2FYK A;  3V7C A;  4D6W A;  3OS0 A;  3LGL A;  3DLL A;  2RJF A;  4KUD K;  3JCM W;  4QVZ A;  5DLQ E;  2D6F A;  4Y28 E;  4C0D B;  2ZPG B;  4J7F A;  4BE0 A;  3ER0 A;  4JRI A;  3OMG A;  4OB0 B;  1Q86 U;  3CD6 T;  3GF5 A;  3A8L B;  5KCO A;  4J83 A;  2DTO A;  4L59 A;  1WJQ A;  2DIQ A;  2MWP A;  5GMK m;  5D6Y A;  2EJ9 A;  1JJ2 A;  2XG8 D;  4F7U F;  3J81 E;  2DAQ A;  2LVM A;  2ZPE B;  5CAI A;  3J80 E;  3HSB A;  3M57 A;  1N27 A;  3C4S A;  5LJ3 j;  2DPP B;  1VIF A;  1I81 A;  4BAC A;  3WVD B;  1KQ2 A;  1VQ9 T;  4NS5 A;  3EFS A;  4OF1 A;  4OGC A;  3PMI A;  2O01 E;  4A4F A;  3FB9 A;  3MCA B;  4J8O A;  3ZFJ A;  2BIV A;  2R5A A;  1BKB A;  3VKI A;  2BUD A;  1YIT A;  4C0G A;  3G6E A;  4FU6 A;  1NJI U;  4QQ6 A;  1YJN A;  1HK9 A;  3L2Q A;  1VQN T;  3R6O A;  4JS5 A;  3OA6 A;  3JB9 H;  2ZPH B;  4LDW A;  4MMK A;  5GAN 7;  4M78 B;  4M77 E;  4M7D A;  4ATO A;  1OYX A;  4XK8 E;  3JCM V;  3I56 A;  1VQ4 A;  2DXT A;  3CCM T;  2ZGW A;  1K8A U;  4ZTF A;  2E6Z A;  2K3Y A;  2KK4 A;  4M78 F;  4LD6 A;  3CME A;  3CBM A;  4XU2 A;  2K5I A;  2DTI A;  1JJ2 S;  5DY9 A;  1VQ4 T;  2CGH A;  2HAX A;  1M1K U;  2AHJ B;  2V8I A;  4FIB A;  4KBM B;  3VUZ A;  5DLO A;  3OYC A;  3FC3 A;  3CC2 T;  1U1S A;  3WXM B;  1KD1 U;  5GAO m;  3PNW C;  3QKJ A;  2LCC A;  2L5Q A;  2R57 A;  3QHS A;  4F7U B;  4E7K A;  1YJN T;  1VQ6 A;  3CPW S;  3QG1 A;  4PJO A;  1MGQ A;  1BIB A;  2B8A A;  2PQW A;  5KE2 A;  2OTL T;  2A3L A;  3OS5 A;  4ZTJ A;  3JCM f;  3RER A;  2QQB A;  3FRN A;  4E7L A;  3JB9 D;  3LWH A;  2O4X A;  4DOV A;  3MEV A;  2HBP A;  1XQH A;  4MZP A;  4BY6 B;  2O4X B;  1VQK A;  3VJP A;  2RB6 A;  5GAO q;  2EQJ A;  2RD1 A;  2M16 A;  3L1A A;  4M77 G;  3RKW A;  5FU6 C;  3CC7 A;  3HPW A;  2RHI A;  2RO0 A;  1YJ9 T;  2JUF A;  3BW1 A;  4A53 A;  2QDY B;  1M4Z A;  4C92 D;  1WPY A;  1VQ8 T;  5FRO A;  3PT9 A;  4HCC A;  3M9Q A;  1YJW A;  4KUI A;  4C5G A;  5KE3 A;  3EAE A;  4M78 A;  5IN1 A;  3L42 A;  2CZ1 B;  4A54 A;  3CPW A;  1YI2 A;  4M7D B;  1IZ6 A;  5CKF A;  2RK2 A;  1UB4 A;  5GAM g;  1XTD A;  2VC8 A;  5LJ3 h;  3CC4 A;  1KG1 A;  3NFC A;  1H3Z A;  2JOY A;  2R5M A;  5GAN 2;  4QVD A;  1YIT T;  2JZ2 A;  4KUL A;  3S3N A;  4OP0 A;  4JLI A;  5GAN f;  3V7R A;  4XTZ A;  4C92 B;  4M7A F;  3A8H B;  2RA2 A;  2K5F A;  1K8A C;  3QSU A;  5GAO r;  2XIC A;  3QYG B;  3HRU A;  4J6W A;  4C92 F;  1QP3 A;  3G4S T;  3MHX A;  3M54 A;  5I21 A;  4M78 D;  2ZPB B;  3L2U A;  3LH0 A;  4M78 C;  5J39 A;  4EDU A;  2RI3 A;  3CCQ A;  2XI9 A;  4XQ3 A;  3GIB A;  4CRI A;  3GNF B;  4LD9 K;  5KCH A;  2F5T X;  3LLR A;  1M1F A;  4YTL A;  3G7Z A;  3GOX A;  2A7Y A;  3OYJ A;  1FXX A;  1WNL A;  3JCM Q;  3VU3 C;  4HA8 A;  3CCS A;  3OYH A;  1M90 C;  3LW5 E;  3X26 B;  1D3B B;  1TH7 A;  4PJO B;  4XTU A;  3V8K A;  2RJC A;  3AHU A;  4NL2 A;  1V29 B;  4QVC A;  4IUV A;  5CO7 A;  3SDZ A;  3X20 B;  3DLM A;  5LJ3 d;  5GMK i;  3JB9 F;  5L8R E;  4M77 A;  1VQ9 A;  1UGR B;  2I2L A;  4C8Q G;  5HK0 A;  1WQW A;  5IT9 E;  2FHD A;  2EQM A;  2VXF A;  3FDR A;  4LDX A;  3UDC A;  4PJO D;  2DTH A;  1UGP B;  4C5H A;  1WQ7 A;  1FX7 A;  4XTX A;  5GAN 4;  3CCU T;  4OGE A;  5A2Q E;  4M75 G;  3M4G A;  3I55 A;  3OYD A;  2P4T A;  2QQA A;  4E7I A;  4P5N A;  3RIR A;  4BI3 A;  2VUB A;  3OQ5 A;  3VYH B;  1M90 U;  4FL6 A;  1VQ8 A;  1AHJ B;  4C92 A;  5LL6 S;  4JS4 A;  2CYZ B;  3CCM A;  3S3O A;  3L2V A;  2RJD A;  3QJ6 A;  1WJR A;  3HHT B;  1NPP A;  4J6X A;  3OB9 A;  3V8L A;  5GAN d;  2E12 A;  1QP2 A;  4M7D D;  2HD0 A;  3BDL A;  3G4S A;  2E10 A;  1VQN A;  2CKK A;  4ELY C;  3E9F A;  3TEE A;  4JUV A;  4X9D A;  5CVI A;  4BD3 A;  3JAM E;  2DD4 A;  4HT8 A;  1B34 A;  3MO8 A;  2CZ0 B;  1U1T A;  3NTK A;  3MP8 A;  5CKH A;  2P0Q A;  2Y4Y A;  1YCY A;  3JRZ A;  4CI0 C;  4JRP A;  4VUB A;  1QW1 A;  2X35 A;  3E19 A;  3QYH B;  3CEY A;  4FT4 A;  4E47 A;  4C92 C;  2OTL A;  2LCL A;  4C8Q E;  4KT0 E;  1Q82 U;  4RKU E;  1XNI A;  4DA4 A;  4Z02 A;  1XOV A;  4N4I A;  1N9S A;  2YLB A;  5LJ3 e;  5GAO p;  2JTF A;  2EJF A;  3GPL A;  3M58 A;  3VYG A;  4EMG A;  2V8J A;  4XU1 A;  2PVO B;  2D0Q B;  1O75 A;  3KBG A;  2DXC A;  3CBP A;  4RG2 A;  1LJO A;  1QVG S;  3URG A;  2BKD N;  2HQE A;  1JBM A;  4XTV A;  1U8R A;  2K4Y A;  2EQU A;  4E7H A;  3JCM d;  4IKF A;  2L3R A;  3M56 A;  5FLX E;  3JCM X;  3P8B B;  2YRV A;  5CIU A;  2YLC A;  5LJ5 h;  1VQK T;  4BE1 A;  3GNG A;  4BDZ A;  3L2Z A;  3RKX A;  5I2S A;  2Y4X A;  3G6E T;  2VXE A;  2EKO A;  3OBW A;  3SWN C;  1PSE A;  3HRT A;  3L2W A;  4RCC A;  3Q1J A;  3NTH A;  4LDV A;  5C6S A;  3MEW A;  3HL8 A;  5D6W A;  3RMS A;  1NJI C;  2XKO C;  2ZPI B;  5GAN h;  1G3W A;  1Q81 U;  2PUK B;  1K9M U;  1WGS A;  2RJE A;  3JB9 I;  4GY5 A;  1BI0 A;  4M75 C;  4XTY A;  4JRQ A;  4F7U E;  1KQS A;  3QZ9 B;  3ME9 A;  1QVG A;  5HK3 A;  4TVR A;  2ZZD A;  1QVP A;  2RHU A;  4C0D C;  1BIA A;  3CCV T;  3CC2 A;  2DK3 A;  3FEO A;  3QDR B;  2RHX A;  2G3R A;  4UC4 A;  4DOW A;  4EMK C;  4F7U G;  1K9M C;  2E1H A;  2KQW A;  2KSS A;  3BFM A;  4ZN1 A;  5A0L A;  1W4S A;  2K3X A;  3QII A;  4M75 E;  4EPC A;  5LJ5 f;  4N4G A;  5CQY A;  4ZGE B;  2X4X A;  3QUI A;  5GAO n;  4OB1 B;  4NL3 A;  1DJ7 B;  3SWN A;  3E9G A;  3CC7 T;  2DXB A;  1H64 1;  1JB0 E;  2GFA A;  4X9C A;  3KXT A;  5GAN j;  3FJP A;  4IUU A;  3RKY A;  4DQ2 A;  4BI4 A;  1OZ2 A;  2K2V A;  1VQ7 A;  3M55 A;  1X75 C;  4M75 A;  2OTJ T;  3A5Z B;  5LJ3 f;  4M7A A;  5J26 A;  1Q81 C;  3CMA T;  3TU4 K;  5LJ3 g;  2JNG A;  3LGF A;  4M77 B;  3JCM h;  5GAN 3;  2MF2 A;  4M7A B;  2L89 A;  2DO3 A;  1ZBX A;  4QQG A;  2EJG A;  3NTI A;  5GAN 8;  5HY6 A;  2IG0 A;  3CXC S;  1PSF A;  1I4K 1;  4NOY A;  4BB7 A;  1VQO T;  3N5B B;  3SFM A;  1YJW T;  5CCA A;  1I8F A;  1M5Q 1;  3C12 A;  4L5G A;  1QVF A;  1LNX A;  1X01 A;  1VQL T;  1YI2 T;  4J7I A;  4J5Y A;  3OS1 A;  4IUR A;  1MHN A;  3OSS C;  4O5V A;  3M59 A;  2RI5 A;  4HKE A;  1S72 T;  1YJ9 A;  4ZN3 A;  2RH2 A;  4JDS A;  4C8Q A;  1Q7Y C;  4FM4 B;  1B34 B;  4X34 A;  1VQ5 T;  3VV0 A;  3CCE A;  3JB9 G;  1YHQ T;  3OYN A;  1RL2 A;  2DZC A;  1KC8 U;  3OS2 A;  3LYI A;  2F69 A;  2D9T A;  4PLL A;  2XD0 A;  2KMT A;  1Q86 C;  4B9W A;  2DD5 A;  3H6Z A;  2E41 A;  1G3Y A;  1JRI A;  1KD1 C;  2LT1 A;  1Q7Y U;  1EIF A;  1SSF A;  2PUO B;  3PFS A;  4M75 F;  4N4H A;  2PVD B;  4OB3 B;  5LJ5 g;  3CXC A;  3QPH A;  2QA4 A;  1VQ6 T;  3M4Y A;  5GMK h;  1UGQ B;  4R55 A;  1P92 A;  3OMC A;  1VQ7 T;  4BY6 C;  1G3T A;  2MWO A;  2VYT A;  1KQS S;  2K5L A;  3JB9 J;  2RK1 A;  2EQK A;  2HNI A;  2FVU A;  2L8D A;  3C94 A;  2LDM A;  3X25 B;  1N8R U;  5FRM A;  4EMK B;  4A4K A;  3DKM A;  4OVA A;  3RES A;  4C92 G;  1Y7X A;  3JSC A;  3I56 T;  3CCQ T;  2KY9 A;  4BDY A;  2P0K A;  2QQ9 A;  3OYF A;  2DEQ A;  2GFU A;  5FU7 C;  1KC8 C;  1Y71 A;  2K57 A;  4Q5W A;  4XU3 A;  4C92 E;  4M7D C;  5AYF A;  3FLG A;  1D3B A;  1N8R C;  3TCJ A;  4N0A C;  3QBY A;  2LNV A;  2FB7 A;  4XAX B;  5CK9 A;  3O8V A;  2FL7 A;  3QO3 A;  4RMO A;  4PJO F;  2QEX T;  3CCJ A;  1KQ1 A;  1Y96 B;  3M53 A;  3TRE A;  2X4W A;  5GAN e;  3PIP A;  3WVE B;  3A8G B;  2OTJ A;  1HXD A;  3CC4 T;  3T9N A;  2EAY A;  4MDW A;  3SB2 A;  4BI8 B;  4M7A G;  3J7A F;  5GMK j;  2VV5 A;  4J6Y A;  3V8J A;  3OYK A;  5A0G A;  3CBO A;  3OSV A;  1GXI E;  3EFR A;  4IUT A;  1QVF S;  1W2B S;  2GQV A;  5FU6 B;  5GAM e;  5GAO l;  4C8Q B;  3CPF A;  2VGN A;  5EG2 A;  2XK0 A;  2LQK A;  2JTM A;  4MZM A;  3L2R A;  2LC4 A;  4EMH A;  3OYE A;  3PMT A;  4ELZ C;  5GAM h;  2XDD A;  3CD6 A;  1K73 C;  4C8Q F;  5C0M A;  3CCU A;  2DVE A;  2PVG B;  3OBY A;  3FIF A;  4IUQ A;  2DKG A;  1M1K C;  3ASK A;  4L6V 5;  2P0P A;  2QTX A;  1N6A A;  3JCM b;  4HCB A;  4M77 F;  4M78 E;  3CCR T;  2DXU A;  3JCM P;  1K73 U;  3JCM J;  2F5K A;  3JCM e;  3KUF A;  4B9X A;  4M7D E;  5CR2 A;  3UT1 A;  1VIE A;  2RM4 A;  1N9R A;  2QQR A;  3H8Z A;  3P8D A;  4XU0 A;  5CKD A;  5KH6 A;  2YHT A;  2CS7 A;  4XTW A;  2Y90 A;  4M75 D;  3DB4 A;  4MDX A;  1W2B A;  2LQ8 A;  4M7D G;  4PKC C;  2E65 A;  3HP9 A;  3CCE T;  2MMP A;  4R56 A;  5D6X A;  3JCM c;  3UWN A;  4C0F A;  3GP8 A;  4PLI A;  5IAY A;  2XHC A;  4BE2 A;  4FT2 A;  4M7D F;  3OYA A;  2RHZ A;  4EMK A;  3OW2 A;  3A8M B;  1S72 A;  4JRK A;  3X24 B;  5GAM f;  2DZ9 A;  3OY9 A;  1ZHI A;  5FU7 B;  2E64 A;  3RMQ A;  3PTA A;  3CCV A;  2XID A;  2MI6 A;  1YBY A;  2QQS A;  1Q82 C;  3INZ A;  5GAM d;  1VQO A;  4WF2 A;  4PJO C;  4Y91 A;  2WAC A;  4A4E A;  1FWZ A;  2KVQ G;  3OYB A;  2ZPF B;  3QXE B;  3MEU A;  5I2M A;  3M5A A;  3ZBD A;  2WSE E;  4E7J A;  1VUB A;  1VQP A;  2DIG A;  1BI1 A;  1OZ3 A;  2EFI A;  2MAM A;  4FSX A;  4OB2 B;  3MP6 A;  4QW2 A;  4II1 A;  4RCB A;  3UPU A;  1VQM A;  1Y96 A;  3A8O B;  1BI2 A;  2EYQ A;  2OAU A;  3P8H A;  3HFO A;  3PIO A;  2X4Y A;  5LJ5 d;  1UEB A;  1Y07 A;  4V2S A;  3CCL A;  2QXF A;  3OYM A;  1M8V A;  4C5I A;  2EIF A;  4PJO G;  4HT9 A;  2V8K A;  3C95 A;  2PU9 B;  5DM7 R;  2M1H A;  3BY7 A;  3OW2 S;  2JN0 A;  1WJS A;  2XDP A;  3SD4 A;  4C8Q D;  4ZGD B;  4C8Q C;  3CME T;  4PL6 A;  3G71 A;  2WSC E;  4A4H A;  2DJZ A;  3MEA A;  2HQX A;  2KDS A;  3MET A;  4C5E A;  1I5L A;  1VQL A;  3HRS A;  4F7U A;  5LJ5 j;  1X6O A;  2LTO A;  3ZEH A;  2IVW A;  2NLU A;  3LX7 A;  4LDU A;  3JCM g;  3CCL T;  4JLG A;  5GMK e;  1NE8 A;  2KAF A;  2M0O A;  5GAN 5;  2GCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...