3JCMf

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
77
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDRNEKVMQHHGRMLLSGNNIAILVPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 77
sequence length 82
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmf00
4NL3A 4NOYA 3JCMg 5GAN6 1M5Q1 5LJ5j 5GAOn 1MGQA 2DVEA 4C8QB 5GAN3 5GAOr 5GANg 4F7UE 4JUVA 4M75E 4PJOC 4M78D 2YHTA 3JCMf 3AHUA 3V8LA 2DXUA 2E65A 2EJFA 3BDUA 4A54A 4C8QD 2DTHA 2RA2A 3JB9F 4EMKC 3L2ZA 1D3BB 2E10A 4M77G 3JCMP 4DQ2A 4M75D 5LJ3e 4JLIA 4M7AB 5LJ3d 5GMKl 3JB9G 2CGHA 4M78C 3RERA 1BIBA 4C92B 5GMKe 5GAN8 4M7AA 4M7DG 2E1HA 1JBMA 2VXFA 3EFSA 4XU3A 3JCMQ 3JB9H 4OP0A 1U1TA 1WNLA 3L1AA 2E64A 2FYKA 4M75C 4C92D 4RCBA 5LJ3g 5LJ5e 2K57A 4PJOG 1TH7A 5GAOq 5GAOl 3QSUA 3RKYA 5GAN7 4C8QE 3V8KA 1HK9A 5CAIA 3QO3A 4M78F 3RKWA 4Y91A 3M4GA 3RUXA 3V7RA 4HA8A 4J5YA 3BFMA 4X9DA 3SWNA 4XTVA 1X01A 4M77F 2QTXA 4XTXA 5DY9A 4C92C 5GAMe 4M78G 2RD1A 5GAMd 2DZCA 4M75F 1N9RA 1U1SA 2Y90A 4N0AC 5GAN2 5GAMh 1Y96B 5GANf 4V2SA 2DJZA 4M7DF 3V7CA 3SB2A 5GAN5 5GAN4 5GAOp 4F7UG 3HFNA 4M75G 1LOJA 1Y96A 4C92E 5LJ3h 5GAMg 4C8QC 4PJOF 3JCMb 5GANj 1H641 4M7AD 5GMKh 1KQ1A 2EJ9A 3QUIA 4HT8A 4RCCA 4XU1A 1I81A 4M77B 2DTOA 5LJ5d 4C92G 3HSBA 3JCMW 2EWNA 4XTUA 2VXEA 5LJ5h 2YLBA 3GIBA 4JRIA 4MMLA 4M77A 3SWNB 4EMHA 5LJ3f 1BIAA 3V7SA 5I21A 4M7AC 4M7DB 4WF2A 1WQ7A 3RKXA 4JRKA 4C8QF 5LJ5g 4QVDA 2YLCA 1B34A 4XTWA 4XTZA 4M7DA 3JB9I 2DEQA 3VU3C 4F7UF 2EJGA 2HNIA 4NL2A 2DXTA 1WQWA 4J6XA 3JCMX 2DZ9A 2VC8A 1HXDA 4XQ3A 4C8QG 5GMKi 5LJ3j 3JCMe 4M7DC 4PJOB 3RIRA 4XU0A 3JB9J 4M7AE 5LJ5f 4PJOA 4EMKB 4XTYA 4HT9A 4EMGA 3JCMc 2I2LA 4XU2A 4A53A 3SWNC 3RESA 4EMKA 3JCMJ 1I5LA 4C92F 1LJOA 3BW1A 5GMKm 1I8FA 4M78B 3INZA 4M7AG 1WPYA 3FB9A 4J6WA 4M77E 5GAMf 4M78A 3V8JA 1JRIA 2EAYA 2FB7A 4F7UB 4C8QA 4M75B 1LNXA 2E41A 1B34B 4M7DE 4F7UA 2ZGWA 1YCYA 3FJPA 4M77D 4M75A 3JCMV 5GAMj 5GAOm 4J6YA 2DKGA 4QVCA 3QHSA 3JB9D 4PNOA 1D3BA 4PJOE 2RB6A 4M7DD 3EFRA 3PGGA 4X9CA 1N9SA 3JCMd 1M8VA 4M77C 4MMKA 4C92A 5GMKj 3JCMh 5GANe 2DTIA 2JN0A 4M7AF 4PJOD 3HFOA 5GANd 3BY7A 1I4K1 3FIFA 4N0AA 1KQ2A 5GANh 2RM4A 4M78E
chains in the Genus database with same CATH superfamily
1TS9A 4NOYA 1F1BB 4J9BA 4BI4A 1U06A 4C8QB 1NM7A 2KYMA 1WZOA 3M55A 5FW9A 1HYOA 1M3BA 4LDXA 4M75D 3R6NA 3DB3A 2QDYB 1X43A 1AD5A 1H92A 1ARKA 2KT1A 2FVUA 4X1VA 4DA4A 2D6FA 3EHRA 1JBMA 2QI2A 2RJDA 5LJ5e 4FIBA 2EQJA 4QQDA 3RKWA 1S72A 3I35A 3JAME 1X01A 1WHMA 1ZQ1A 4PFZA 2PUKB 2LTOA 3HL8A 2QA4Q 2J6FA 2DJQA 3V7CA 2G3RA 4F7UG 1WGSA 4C0ZA 2DFUA 4BY6B 4BDZA 4JPBW 1AVZC 4HT8A 4BI3A 4A4EA 3HSBA 3OYGA 2DIGA 5KYUB 2XU8A 3RKXA 1Z9ZA 3PT9A 1FXXA 5AYFA 2KBTA 1M2VB 3C4SA 3SHWA 2M1HA 1FMKA 4OMMA 5IHIA 1K0XA 3ZEHA 3THKA 2YDLA 1M30A 1R0BG 1PSEA 1X75C 1YBYA 3OS0A 1WPYA 4B6MA 2XDPA 5KCOA 4AFSC 2FB7A 3LWHA 4NS5A 1N8RR 5GAOm 4M75A 2ED0A 2X51A 3NGPA 2CP2A 1AWOA 1D3BA 3SDZA 2XK0A 3PGGA 2YT6A 4OGCA 3CCVA 3EGDA 1TXQA 1HJDA 2QDLA 2DE0X 2V8JA 4LUDA 1FWZA 2QA4A 1ABQA 4J83A 1K8AC 3AHUA 1TUGB 3A8MB 4A63B 2K4YA 1VQMA 1H8KA 4J7IA 1RLPC 1JO8A 3CCQQ 1RI9A 3CCMQ 1QP3A 2OJ2A 4C0DC 4RUGA 1MHNA 2IPOB 1AEYA 2PVDB 1K0SA 2ZZDA 2HKNA 1OZ2A 5IAYA 4RMOA 3M4GA 5D6YA 1D1AA 1WXUA 1VQ5A 3X26B 3ZBDA 2P84A 3O8VA 1GCPA 2NUPB 1OI1A 3CCET 1TSFA 3P8BB 1K9AA 2JVVA 2ZCFB 4B9WA 1CSKA 3UATA 2GFUA 1VQKA 3G4ST 3M59A 3MPUB 5DLOA 2EJ9A 3EAEA 5CKEA 3PTAA 1Q7YR 1WIEA 1UGRB 4XTUA 2VXEA 1MMNA 2LT1A 4FSSA 3M0TA 1ZSZA 2HNIA 3GBQA 3META 2P0PA 1QKWA 2DZ9A 3UWNA 1O9SA 3QIIA 2L3SA 4CC4B 2VVKA 3ZFJA 2RPNA 3CCJA 2E3HA 4DEYA 2X35A 1VQPT 3CCSA 2L2PA 2ZAEA 1YJWQ 2LZ6B 2K2MA 4DBRA 4C0DB 1QVPA 4A4KA 2F2WA 4F7UA 2GF7A 2MWOA 3VV0A 4ZGDB 1YITT 1YIJQ 2CUDA 2KSSA 1YJNA 1PSFA 2LRQA 2RJEA 1W1FA 1RABB 3N5BB 3CD6A 3HFOA 1J3TA 2AT1B 2J05A 1VYTA 4ORZA 2OTLT 3CMEA 3CCRQ 1G2BA 3OS5A 5GAOr 1BI0A 1KQSP 4Z02A 2M0YA 1M1KR 1JU5C 2M16A 2E65A 4C8QD 1VYUA 2QQAA 2QQRA 3L2ZA 3QJYA 4C92B 2KGTA 3JCMQ 2RQUA 1NG2A 2A28A 2CREA 3EG9A 2YRCA 3G6EA 4FSXA 1K4US 3VYHB 2LT4A 4E7SA 2ESWA 2DK3A 3TEEA 5CAIA 5D6XA 1S72T 2L5QA 2DZCA 3FC3A 1WHJA 2MMPA 3EG2A 2L3QA 3L2RA 2RO0A 3J7AF 5D7UA 2GBQA 1RAFB 4FW1A 2L3PA 3JCMb 4Z88A 5HK3A 1KQ1A 2QEXQ 4RCCA 4XU1A 3HHTB 2ZPHB 2NUZA 2DBMA 1QVFS 3QYHB 2DM1A 4PK4A 2H3EB 1QKXA 1RAGB 4RKUE 2RF0A 3CBOA 1QMCA 2LJ3A 1YI2A 4F7UF 2E70A 3A98A 9ATCB 5KE3A 3OW2P 1JJ2A 3H0IA 2BE7D 1UE9A 3RIRA 1SHGA 1VUBA 4E47A 4HKEA 2DPPB 2D1XA 1OZ3A 4EMKA 1W2BA 4PFPA 3TSZA 1MV3A 3PFSA 4C8QA 5KCHA 2CZ1B 3FDRA 5GAMj 3HP9A 2EQKA 2RB6A 1VQ4A 1XQHA 2AZVA 2KROA 2MF2A 2XG8D 3LLRA 1Q86R 3PIOA 2XHCA 1D1CA 2RM4A 3HRUA 3SD4A 4E7KA 5CKHA 5HCKA 3EH2A 2CP7A 4HCBA 2LQKA 2GTOA 2QA4T 3H0FA 4M77G 1K9MR 1KD1U 1PWTA 5GMKl 2CGHA 3EGXB 3RERA 2DMOA 1VQMT 5A0GA 3H0HA 2CH4W 3VJPA 2LDMA 4QT7A 4OP0A 4ZTFA 5CO7A 4CC3A 2K57A 3CPWA 4C8QE 2EVRA 4HA8A 5KYUA 2CH4A 1XTDA 4F16A 1VQ5T 5GANf 5GAOp 1KSWA 1Y96A 3CC2A 3TVTA 1OPLA 1LVKA 2QG9B 4FYWB 1TTHB 1SEMA 1VQKT 2EW3A 4C92G 5ECAA 2A0FB 2RI2A 2MPXC 2L0AA 2B8AA 5CQXA 4C8QF 3S3OA 5LJ5g 2DEQA 4NL2A 3JCMX 4XQ3A 3E9FA 1M1FA 1ABOA 5KYWA 1VQNQ 1IGUA 1NYGA 4Y28E 2K3YA 2EYZA 4IUVA 3X20B 1M3CA 1JJ2S 3X28B 2DXBA 3CCJT 1QW1A 3WVEB 4M7AG 5HKCA 2KNBB 1PKTA 3DLMA 3KUFA 3VS7A 2X3WD 3I5SA 4JJDA 1SHFA 2JJ9A 2DRMA 1KG1A 4M77D 2QYZA 4AFQC 1UB4A 2W0ZA 4O6JA 2RJCA 1GBRA 3OW2A 3U23A 3CCEQ 3MJXA 4MMKA 1YJNT 3JCMh 3CCMT 2O4XB 4GY5A 3VS5A 2JNGA 4N0AA 3G4SQ 1OX8A 3ME9A 1LPLA 3CD6T 4RTYA 2CT3A 1BYMA 2JUFA 4AFZC 2C0OA 1D0ZA 4AG1C 5GANg 2MWPA 1VQ8A 1VQ7A 5HK0A 1HSQA 2CZ0B 4A4HA 1TU0B 2ENMA 1Q81U 4VUBA 4OMFB 1IHWA 1VQLA 2JZ2A 4C92D 1QQJA 1QVGS 2K5FA 1VQPQ 2XIDA 2X4XA 4QQGA 3UA6A 3EGUA 3M53A 2XI9A 2HQEA 1M4ZA 3DLLA 4XTVA 5IHKA 2F2XA 2NLUA 4JLGA 1NBEB 1KD1C 1MNEA 3C0CA 1YITQ 2VKNA 2VV5A 3HFNA 5LJ3h 1JB0E 2ECZA 2LJ0A 2CZ6B 4KUDK 4M7AD 2K5LA 5CR2A 4C5IA 3GF5A 1YJWT 2EYQA 2MYSA 2FZKB 2X4YA 3HPWA 3GIBA 1M9SA 2EQIA 4M77A 3SWNB 4E7ZA 2R57A 3OQ5A 3CXCS 2YLCA 4XTZA 2DNUA 3M58A 3OMGA 3MEAA 4RTUA 4KBMB 1KFZA 1YI2T 5I22A 1X2QA 2LC4A 4HCZA 3CMAQ 2BE9B 1T0HA 2K79A 1WLPB 1GRIA 1MMAA 3H41A 2I2LA 2CT4A 1C0MA 4XU2A 3EFOB 1IB8A 4DBHA 3G71A 2LJ1A 4MDXA 1LNXA 2BZYA 1OX9A 3EG1A 1B3QA 1S72Q 4PNOA 1KHIA 3PE0A 2WACA 4X9CA 2E5KA 4BI8B 3WVDB 1M8VA 1VQ4T 4C92A 2CSQA 3VS6A 1Q82R 1I4K1 4HVWA 4HCCA 2RHXA 5CVIA 1QP2A 2O01E 4JUVA 2DVJA 4PLIA 1UHCA 2QQ9A 3H6ZA 4PJOC 1UJYA 3V8LA 2KK4A 2RA2A 2RNAA 4KH1B 1W4SA 2HZYA 1D09B 1WHGA 1WHLA 2PU9B 3SEMA 4M78C 1DJ7B 2L8DA 4M7AA 5CQYA 4FT2A 1K73U 1GXIE 1AHJB 2FYKA 1UGPB 3CPFA 1X6BA 1YJ9A 2QK0A 3GOXA 3QWXX 2HAXA 3UF4A 4M77F 1KHCA 5KE2A 1N6AA 2P0QA 3CMAA 3L2UA 5GAMh 2OAWA 1Q81C 4C92E 4FYVB 4L59A 5KYXA 1Q7YC 1QWFA 3FJ5A 3TREA 3CC2T 3G1JA 1B7TA 1WX6A 5LJ5d 3CCUA 3CCVQ 2L3RA 3V7SA 5I21A 3LX7A 2ZPBB 1WQWA 2E12A 4JZ4A 4PJOB 5GMKi 2A3LA 4M7AE 2R5MA 1QVFP 1BCMA 1VQMQ 1TUDA 4C92F 1V76A 2F5KA 4M78B 4AMCA 2HSPA 6AT1B 1OV3A 2BZ8A 3NTKA 1SPKA 1UECA 2PNIA 4BDYA 2EGEA 2W10A 2M9UA 1RADB 1TOVA 4KGXB 2E4HA 4ELYC 4WCIA 4QVCA 4BUGA 1AWXA 3QHSA 3OYKA 3HTRA 2XKOC 2KMTA 1VQ5Q 3S3MA 1N9SA 2JXBA 1U5SA 4MZTA 2J7IA 3EGXA 5GANe 3OYNA 4M7AF 5GANd 4E7JA 3FIFA 4M7DC 1VQKQ 4GLMA 5FRNA 4Y92A 3JCMf 4EDUA 4XK8E 1VQ7T 1VQ8T 2B86A 2EYYA 2BKDN 3JB9H 4E7LA 2RHYA 1WA7A 1VQLT 3CCJQ 2X4JA 3QJ6A 4FT4A 1AWWA 2YRVA 3CCSQ 2KI7A 2WSFE 1WDXA 2EBPA 3BFMA 4X9DA 1NJIR 2KEAA 3OBWA 4N4IA 4II1A 5M9OA 3SB2A 5GAN5 2JM9A 1VQNT 2VWFA 3OYDA 2LQWA 3M54A 4KT0E 2I0NA 2GQVA 1K73C 1YJNQ 1WJSA 1BB9A 1K1ZA 4J9DA 3JV3A 3CD6Q 1B07A 4J9GA 1M90R 2G6FX 3LH0A 5LJ3f 3CBMA 4M7DB 1ACMB 2COZA 3CMEQ 4RG8A 1VQ6A 1HXDA 4C8QG 5DLQE 1OU9A 4A53A 4DOWA 1ZUYA 1LJOA 2K3BA 1U8RA 3PVLA 2EQUA 2IIMA 2LCSA 4ZTJA 4JJBA 1IZ6A 1Y57A 2ED1A 2LQNA 3EHQA 3OB9A 3G6EQ 4KRTA 4LNPA 3JCMV 3G71T 4J6YA 4OF1A 5CK9A 3I5RA 3VS1A 1T3SA 1VOMA 2JN0A 2K7AA 3TCJA 2KY9A 3BY7A 4K11A 5GJWB 1RACB 3VUZA 5GAOn 5GAN6 2EGCA 2FG0A 2P4TA 2E6ZA 1X2KA 2M02A 2RHIA 1GCQC 2WSCE 2FRYA 4A4GA 3PMTA 5FWBA 1S1NA 2JW4A 3M0QA 3M0SA 3JCMP 4JZ3A 2DO3A 2HMAA 3LH5A 1IGQA 1YI2Q 1NLOC 3OYJA 4LD9K 4FL6A 2EFIA 5HY6A 1V1CA 1KJWA 2Y4XA 5LJ3g 2JM8A 3O5ZA 1YFNA 3SWNA 1YJ9T 4D6WA 2FPEA 2CUBA 2E5QA 1U1SA 1QVGP 3BDLA 3CMAT 1LOJA 3ZL7C 3OS1A 3UA7A 1VQ4Q 1BCOA 3EFOA 3DB4A 1G5VA 3F70A 1ZLMA 1WXTA 1MMDA 3VKIA 1YWOA 3CCUT 3E2UA 1OEBA 1GL5A 2QASA 4DBFA 4XTWA 2X3XD 2QXFA 5KYYB 3J80E 4PJMA 2K9GA 2EGAA 2DYBA 1UEBA 3QZ5B 5IXBA 4CRIA 2Z0WA 1IO6A 4O5VA 1FMWA 3BW1A 5GMKm 1Z9QA 2OI3A 5I11A 4FU6A 3V8JA 2CS7A 4RTTA 2LQ8A 1VIFA 1KC8R 4MDWA 1K8AR 2PVOB 1BK2A 4AT1B 3CC4Q 3EFRA 4D8DA 2OAUA 1H3HA 3E1SA 2K3XA 3KFVA 2DLPA 2C0TA 5GMKj 3LYIA 3REAB 4J7FA 5GJVB 3CC2Q 2A7YA 4UC4A 2XICA 4C5EA 2JTFA 4L5GA 2RQWA 2DXUA 2AHJB 2DBKA 4ZN3A 3JB9F 3VS4A 3QG1A 4DQ2A 5A0LA 3GLXA 2DYIA 3OS2A 2JS0A 2LCCA 4XU3A 1U1TA 4M75C 2CP5A 3OSVA 3CCVT 1IREB 5I2SA 1TWBA 4Y91A 4F04B 1YHQA 1A0NB 4M4ZA 2H3JA 3PVQA 2FZCB 2DJZA 4R55A 1NEGA 5IN1A 1W70A 3CQTA 3PMIA 1BU1A 1QCNA 5I2MA 7AT1B 2HCKA 3ER0A 4MMLA 3H8ZA 3EG0A 4WF2A 1KQSA 4JRKA 3CC4A 3JB9I 2ZPFB 1VQ7Q 1VQ8Q 1G3TA 4JS5A 3JCMe 5IH2A 3RBBB 1M2VA 3JB9J 1D1BA 3I56A 4HT9A 4XTYA 4ME7A 2LMJA 2DD5A 1QCOA 1E7OA 1OU8A 4PJJA 1N8RU 3MP6A 1VQLQ 3MO8A 4IUQA 4RTVA 4M75B 4RTZA 2E41A 3QDRB 3FJPA 3CCLA 4OGEA 2R58A 5CKDA 1Q82C 1BI1A 3OMCA 2JOYA 4PJOE 3MEWA 4ZGJB 3X24B 2M0OA 1OQKA 4IUUA 1VQOA 4M78E 4IUTA 2LNVA 5D6WA 5LJ5j 1NJIU 2HL5C 3QBYA 4CC7A 3CCST 3H9NA 4OMOA 1R8OB 2X9HA 3MCAB 1W2BS 2KT8A 2JMCA 3BDUA 1YWPA 2C0IA 4J9CA 5J26A 2VUBA 3M57A 5LJ3e 5LJ3d 4QKUA 3TQ7P 1WI7A 1G83A 4J8OA 4HXJA 1QLYA 4RTWA 3VS2A 5GAN7 1HK9A 4M78F 1WJQA 3V7RA 3CMET 1KIKA 2COWA 3DKMA 5C6SA 2P4RA 3G71Q 2EIFA 4HVUA 1W6XA 2NUPA 2EYXA 2LCLA 2MCNA 1Q7YU 5GANj 1H641 3OA6A 1SRMA 5LL6S 4PKCC 1WJRA 1NEBA 3OYLA 1ZUKA 2KDSA 2WSEE 4JDSA 3A8GB 3HRTA 3OY9A 1M3AA 4RTXA 1MNDA 3G6ET 1BIAA 4ANJA 8AT1B 4N4GA 4A4FA 3CPWS 1X6OA 2EJGA 2QQBA 1I5OB 3GNFB 5FLXE 4XU0A 4OVAA 5CIUA 1SF9A 3HRSA 4OB0B 4EMGA 4QW2A 3EG3A 4OB3B 3RESA 3JCMJ 1I5LA 2SEMA 2VASA 1G8XA 4OB2B 1PHTA 2HD0A 2EAYA 4F7UB 3RR6A 5CCAA 3NPFA 4M7DE 1PCXA 1XOVA 2NUTB 2RK1A 1YJ9Q 3I55A 2OTJA 1RAHB 4B9XA 4OMLA 4EPCA 5IT9E 3OYHA 4EIKA 3R6OA 4BE0A 4OMNA 1ZBJA 5IXFA 4MZMA 2DL5A 1PM3A 3JRZA 2O9VA 3LWIA 4F14A 2E6NA 1M1KU 4F17A 1N8RC 2DVEA 2VGNA 4C0FA 2V8KA 3LGLA 3CCUQ 2ZPIB 2OX7A 2NYSA 4EMKC 1UJ0A 2E10A 2JS2A 1NE8A 2VXFA 1R0CB 1VA7A 1WNLA 3OW2S 2KR3A 4BD3A 2DX1A 4IKFA 1QWEA 3OSSC 1NJIC 3QSUA 1Y0MA 2DXCA 2RI3A 4J5YA 1FX7A 1OOTA 2QTXA 2SRCA 4XTXA 1YHQT 4Q5WA 2HEQA 5KYYA 3NFCA 1D0XA 2D8HA 1RL2A 5FU6C 3OYAA 5GMKh 1M90C 2E3IA 3QUIA 2R5AA 1I81A 4PLLA 3QPHA 1KC8U 1KK7A 4EMHA 3L2VA 2KXDA 3M5AA 4QVDA 4BY6C 3CC4T 4JJCA 5A2QE 4EMKB 2K2VA 2RJFA 4RG2A 3MP1A 2OTLA 2ATCB 3I56T 1PRLC 2LX9A 3G7ZA 2D8JA 4LXCA 3FB9A 4HCKA 4GBQA 2V8IA 2F69A 4LN2A 1CKBA 1G3WA 2O9SA 1R77A 2CYZB 3LW5E 4J9IA 4KGVB 5IHNA 3CCLT 1Q86U 3OBYA 2YRDA 1EX4A 2RK2A 1KQ2A 3GPLA 3OYEA 1M5Q1 1Y71A 5CKFA 1MGQA 1VQOT 1BI2A 5FU6B 1K9MU 1ZA2B 4QQ6A 1X27A 3PIPA 4R56A 3A8LB 2HKQB 3JB9G 2YUPA 2D9TA 1KD1R 1OPKA 4GLKA 4QVZA 1VQ6Q 2DEUA 2KRNA 4ATOA 4L6V5 1VQ9A 1TH7A 1D0YA 4DBQA 1M1KC 2DERA 1RI0A 1ZHIA 2XD0A 4PFOA 3RUXA 2JMAA 1UUEA 3C95A 4N0AC 1Y96B 3CC7A 4D8KA 2DL4A 5GAN4 4XAXB 2V1QA 3OYFA 1EIFA 4HVVA 4PL6A 2HQXA 2CP3A 3RDVA 3QDFA 8ATCB 1BKBA 1FMVA 4IIOA 4BACA 1QCFA 1SSFA 2QTVA 5LJ5h 4JRIA 1HD3A 2FO0A 3AT1B 4LUEA 3Q1JA 5KYWB 3FLGA 3MEVA 2MAMA 1OYXA 2L89A 2M51A 1YN8A 1MMGA 3URGA 1FYNA 1IHVA 4J9HA 4N4HA 1PD1A 2AK5A 1AWJA 2KQWA 1JRIA 3FRNA 1KC8C 2RQTA 4R0KA 1B34B 2FPFA 2EYWA 5EG2A 4DOVA 5L23A 3D7SB 4FYYB 3JB9D 2YUQA 3OYIA 3I55T 2OTJT 1IXDA 3KBGA 2V1RA 4M77C 3RMSA 4FYXB 2AIRB 3L42A 5GANh 3BE3A 5DM7R 2O4XA 2DILA 3JCMg 4IIMA 3NMZC 2RQVA 1NLPC 2O31A 4KH0B 4M75E 3KXTA 2RQRA 2RN8A 1SRLA 1I07A 2EJFA 2ZPEB 1JJ2P 2ZPGB 1E6GA 4JLIA 2MI6A 1Q86C 1N27A 1ZX6A 1QVFA 2PZ1A 3L1AA 2E64A 1W2BP 1Q81R 2Y4YA 4LDYA 4PJOG 5GAOl 2DAQA 1WXBA 2K6DA 1JQQA 4CI0C 3I9QA 4JRQA 1K9MC 2COYA 4C92C 5EC7A 4M78G 4ESRA 1P92A 4M75F 1N9RA 4ZGEB 2H8HA 2LNHB 4JJNK 4V2SA 4PJLA 2LVMA 2DD4A 5FRMA 3M56A 2QGGA 3UPUA 2MIOA 2DL3A 3C94A 4FCYA 4M77B 1PD0A 2CZ7B 2EWNA 2YLBA 4M7AC 4ZN1A 1UGQB 3VU3C 2NUTA 2HBPA 3CCQA 2GTJA 5LJ3j 3CCMA 2EPDA 5KH6A 2F1LA 2RMOA 2GQIA 1WYXA 1O75A 4E7HA 3CPWP 3INZA 5GAMf 1T3LA 2VGMA 2EQMA 2HQHA 3MHXA 3E19A 2PVGB 3NTIA 1BBZA 2V26A 2YSQA 1BI3A 3C12A 1YHQQ 3VRYA 4ZNXA 1Q82U 2YWWA 4AFUC 1RAIB 3LGFA 2AKKA 2KAFA 4KULA 4OB1B 4PJOD 2BUDA 2DETA 2PQWA 4NL3A 3CXCP 1EFNA 2MK5A 1EZZB 1UGSB 4F7UE 1WHHA 4M78D 4BE2A 3VUBA 2NWMA 3S3NA 4A54A 3M9QA 4Z8AA 2FL7A 1V29B 5J39A 4M7AB 4DEXA 1YCSB 3M0UA 1YJWA 4M7DG 3QYGB 2KRSA 4KGZB 3I56Q 5GAOq 1K73R 1G3YA 1JEGA 1MUZA 2D0NA 1VQ9T 2QQSA 1YIJA 2K5IA 2CP0A 3NHNA 2FRWA 2GCXA 2QGFB 4E2FB 1JXMA 1NZ9A 1E6HA 3GNGA 2DA9A 2HBWA 5KYXB 3CCLQ 2XMFA 4E6RA 3CC7T 3UT1A 5GAMg 1SG5A 3UDCA 3TU4K 3CCRA 1XNIA 4IUPA 1OULA 1VYVA 3PNWC 1XJWB 4Z89A 5A0DA 3QXEB 2DTOA 2O2OA 3JCMW 1ZA1B 2YUOA 2GNCA 1G3SA 1VQOQ 1WQ7A 1NYFA 1X6GA 1UG1A 2KYBA 3VS3A 1CKAA 2DXTA 4LDWA 4J6XA 2VC8A 1VIEA 2DF6A 1AT1B 5LJ5f 5FU7C 3OYMA 4PJOA 3JCMc 2D0QB 1C1AA 3A8HB 2CKKA 1I8FA 1PG5B 2JTMA 4J6WA 4M78A 1GBQA 2YUNA 2CDTA 2EKOA 1AZGB 1MV0B 3QKJA 3L2QA 2AZSA 5J3BA 1M2OA 5FWCA 2JTEA 3L2WA 4M7DD 1QVGA 2QEXA 3A5ZB 3JCMd 1VQ6T 4LE9A 2HDAA 2DL8A 2RHUA 5CKBA 1IRXA 2BIVA 1SSHA 4X34A 2KVQG 4JRPA 5GAN3 3OYYA 1UGVA 3VYGA 1Y07A 3X25B 1AZEA 1D3BB 3FEOA 4PJNA 2BTTA 1I0CA 1BIBA 5GAN8 2FHDA 3VS0A 3J81E 2PUOB 3EGDB 2FEIA 4C5HA 3QWYA 1ZSZC 4IURA 5FU7B 2FPDA 3CXCA 1GFDA 3RKYA 3JSCA 2XDDA 1WHKA 2IG0A 3OYBA 3V8KA 4TVRA 3NTHA 1PRMC 2J6OA 2ROTA 4CC2A 1I1JA 2HSEB 4LD6A 1RAEB 2MOXA 1RLQC 3M4YA 3REBB 3I55Q 2KRMA 2OTJQ 1PNJA 4C5GA 2XDBA 4PJOF 1X69A 3M0RA 1M90U 3ASKA 4P5NA 2ABLA 2C06A 4LDVA 1B34A 2RH2A 4M7DA 1T0JA 2PTKA 2EKHA 4J9FA 2O88A 1Q95G 2IVWA 3CCQT 1ZUUA 4E7IA 3ULRB 2J6KA 1M27C 3SWNC 2DL7A 3SFMA 1YNZA 1PKSA 3QZ9B 1K76A 1ZSZB 2X4WA 2QAZA 2ZGWA 1YCYA 3MEUA 2HL3A 1Y7XA 3RNJA 2VYTA 1KQSS 2GGRA 1RAAB 4AG2C 4JS4A 1U3OA 2DTIA 1RUWA 3MP8A 1H3ZA 1NPPA 1LCKA 1SKUB 2FZGB 3P8DA 3EH1A 4OMQA 2JT4A 1PC0A 4BB7A 2GFAA 2VB6A 2YHTA 3T9NA 1TG0A 1M1GA 3S6WA 2DRKA 1VQNA 2DTHA 4KUIA 1M8MA 5GMKe 2E1HA 1NPRA 5KYNA 1ZBXA 2J06A 3EFSA 4MZPA 4RCBA 4ELZC 2KE9A 2AKLA 1GFCA 2F5TX 3P8HA 2OTLQ 2LX7A 3QO3A 5FROA 3HKSA 3M0PA 1ZSGA 5DY9A 3E9GA 4LDUA 5GAMe 2A37A 1YIJT 1YP5A 2RD1A 3CEYA 5GAMd 3CCEA 5GAN2 2Y90A 3IQLA 4M7DF 3A1PA 5L8RE 4M75G 3G4SA 2RI5A 2A08A 1TUCA 3OYCA 4C8QC 1AOJA 2KXCA 3EG9B 1N5ZA 5C0MA 3CCRT 1C6VX 2LP5A 4BE1A 5AT1B 3TSWA 3WXMB 4J9EA 3RMQA 2BZXA 1UTIA 2RHZA 3GP8A 2P0KA 1UFFA 1GCQA 3CBPA 1VQPA 2F2VA 2CP6A 1JXOA 2A36A 4FW2A 2ROLA 1UDLA 2DIQA 4M77E 4WTOB 4FM4B 2YXYA 1VQ9Q 1YITA 1K8AU 3A8OB 4YTLA 2DKGA 4C0GA 1UHFA 1WFWA 2CSIA 3MKDA 3VRZA 4OMPA 2QEXT 3CC7Q
chains in the Genus database with same CATH topology
4NOYA 3JCMg 2A7YA 4UC4A 3CD6T 4BI4A 4C8QB 1BYMA 2XICA 2JUFA 4C5EA 2JTFA 4L5GA 2MWPA 3M55A 5GANg 1VQ8A 4M75E 3KXTA 1VQ7A 5HK0A 2DXUA 2AHJB 2EJFA 2ZPEB 4ZN3A 3JB9F 2CZ0B 4LDXA 3QG1A 2ZPGB 4DQ2A 4M75D 4JLIA 4A4HA 2MI6A 5A0LA 3DB3A 3GLXA 1Q86C 2QDYB 1Q81U 1N27A 4VUBA 2FVUA 4OMFB 3OS2A 2LCCA 4DA4A 2D6FA 1QVFA 1JBMA 4XU3A 1VQLA 1U1TA 2QI2A 2RJDA 3L1AA 2E64A 2JZ2A 4M75C 4C92D 5LJ5e 1QVGS 2Y4YA 2K5FA 4LDYA 4PJOG 2XIDA 2X4XA 3OSVA 4FIBA 2DAQA 4QQGA 5GAOl 2EQJA 4QQDA 3CCVT 1IREB 5I2SA 4CI0C 3M53A 2XI9A 4JRQA 4Y91A 3RKWA 1YHQA 1S72A 3JAME 2HQEA 1K9MC 1M4ZA 3DLLA 4XTVA 1X01A 4C92C 2H3JA 2NLUA 1ZQ1A 4M78G 2PUKB 2LTOA 3HL8A 1P92A 4JLGA 1N9RA 4M75F 4ZGEB 4JJNK 1KD1C 4V2SA 2DJZA 2LVMA 3V7CA 2G3RA 2DD4A 4F7UG 2VV5A 5FRMA 1WGSA 3HFNA 4R55A 4C0ZA 5LJ3h 4BY6B 3M56A 1JB0E 3UPUA 5IN1A 4BDZA 2CZ6B 4KUDK 4M7AD 2K5LA 3PMIA 3C94A 3GF5A 4C5IA 5CR2A 1YJWT 4HT8A 2EYQA 4BI3A 4A4EA 2X4YA 4M77B 3HSBA 3HPWA 5I2MA 2CZ7B 3OYGA 2EWNA 2DIGA 3ER0A 2YLBA 3GIBA 4MMLA 1M9SA 4M77A 3SWNB 3H8ZA 2XU8A 4M7AC 2R57A 3OQ5A 4WF2A 3RKXA 1KQSA 4JRKA 3CC4A 3CXCS 2YLCA 1FXXA 3PT9A 4XTZA 5AYFA 1UGQB 4ZN1A 3JB9I 3VU3C 2HBPA 2ZPFB 3C4SA 3M58A 3MEAA 1G3TA 3OMGA 3CCQA 4JS5A 2M1HA 4KBMB 5LJ3j 3ZEHA 3JCMe 3CCMA 1YI2T 2LC4A 4HCZA 3JB9J 3I56A 5KH6A 4HT9A 4XTYA 4J7FA 4ME7A 1PSEA 1X75C 2I2LA 1YBYA 4XU2A 2DD5A 1O75A 3OS0A 4E7HA 3INZA 1WPYA 1N8RU 2XDPA 5GAMf 5KCOA 3MP6A 2VGMA 2FB7A 3MO8A 4IUQA 3LWHA 2EQMA 4M75B 4NS5A 3MHXA 3G71A 3E19A 4MDXA 1LNXA 2E41A 2PVGB 3NTIA 3QDRB 5GAOm 3FJPA 4M75A 3CCLA 1BI3A 3C12A 4OGEA 2R58A 5CKDA 1Q82C 1BI1A 3OMCA 1D3BA 4PNOA 1KHIA 2JOYA 2XK0A 3SDZA 1Q82U 4PJOE 2WACA 3PGGA 3MEWA 4X9CA 4BI8B 3X24B 4ZGJB 3WVDB 3LGFA 1M8VA 2KAFA 1VQ4T 2M0OA 4C92A 4KULA 4OB1B 4OGCA 3CCVA 4IUUA 4PJOD 1I4K1 2BUDA 1VQOA 4M78E 2PQWA 4IUTA 2LNVA 5D6WA 4NL3A 5LJ5j 1NJIU 4HCCA 3QBYA 2RHXA 1UGSB 2V8JA 5CVIA 3CCST 1FWZA 1QP2A 1R8OB 4F7UE 2O01E 2QA4A 4JUVA 3H6ZA 4M78D 2QQ9A 4PLIA 3VUBA 4BE2A 4PJOC 3MCAB 4J83A 1W2BS 3V8LA 3S3NA 1K8AC 2KK4A 3AHUA 3BDUA 3M9QA 4A54A 2FL7A 2RA2A 1V29B 3A8MB 5J26A 1W4SA 2VUBA 5J39A 2K4YA 2PU9B 3M57A 5LJ3e 3QSUA 1VQMA 4M7AB 5LJ3d 4M78C 1DJ7B 2L8DA 4J7IA 4M7AA 1YJWA 4M7DG 5CQYA 3QYGB 4FT2A 1K73U 1GXIE 1AHJB 1QP3A 4C0DC 4J8OA 2FYKA 1MHNA 1UGPB 5GAOq 2PVDB 3CPFA 1G3YA 5GAN7 2ZZDA 1HK9A 1VQ9T 1YJ9A 1OZ2A 4M78F 5IAYA 2QQSA 4RMOA 3M4GA 3GOXA 1WJQA 2K5IA 3V7RA 5D6YA 1YIJA 2HAXA 3CMET 1VQ5A 4M77F 1KHCA 3DKMA 4PJOB 5C6SA 3X26B 5KE2A 3ZBDA 1N6AA 2GCXA 2P0QA 3O8VA 3CMAA 3L2UA 5GAMh 1NZ9A 1OI1A 3GNGA 3CCET 2EIFA 3P8BB 2JVVA 2ZCFB 1Q81C 4C92E 3CC7T 2LCLA 3UT1A 4B9WA 4L59A 3UDCA 5GAMg 2GFUA 1Q7YC 3TREA 3G4ST 3CCRA 3M59A 1XNIA 1H641 5DLOA 3OA6A 4IUPA 3TU4K 5GANj 1Q7YU 3CC2T 5LL6S 2EJ9A 3EAEA 1WJRA 3PNWC 4PKCC 5CKEA 5A0DA 3PTAA 3QXEB 2WSEE 2DTOA 2KDSA 4JDSA 5LJ5d 3OYLA 3JCMW 3A8GB 3HRTA 1UGRB 4XTUA 2VXEA 3OY9A 3CCUA 1G3SA 2L3RA 3G6ET 3V7SA 1BIAA 5I21A 2LT1A 1WQ7A 3LX7A 4N4GA 4A4FA 3CPWS 1X6OA 2ZPBB 2EJGA 2HNIA 2QQBA 2DXTA 1WQWA 3META 2E12A 2DZ9A 2P0PA 1VIEA 2VC8A 3GNFB 1O9SA 4J6XA 3UWNA 5FLXE 2A3LA 5GMKi 4XU0A 4OVAA 5CIUA 2R5MA 3QIIA 5LJ5f 5FU7C 3OYMA 4M7AE 4PJOA 3HRSA 4OB0B 3ZFJA 3CCJA 4EMGA 3JCMc 4QW2A 2D0QB 3A8HB 2X35A 4OB3B 3RESA 3JCMJ 1VQPT 1I5LA 4C92F 2CKKA 3CCSA 1I8FA 2F5KA 4M78B 4OB2B 2JTMA 4J6WA 2HD0A 3NTKA 4M78A 2EAYA 4F7UB 2EKOA 4C0DB 4BDYA 3QKJA 5CCAA 3L2QA 1QVPA 2M9UA 4M7DE 4A4KA 4F7UA 1XOVA 2RK1A 2GF7A 2MWOA 4ELYC 3VV0A 4ZGDB 4QVCA 3I55A 1YITT 4BUGA 2OTJA 3QHSA 5J3BA 3OYKA 2XKOC 2KMTA 2KSSA 4B9XA 3L2WA 4M7DD 1YJNA 1QVGA 1PSFA 2LRQA 1N9SA 4EPCA 2RJEA 2QEXA 5IT9E 3OYHA 3A5ZB 3S3MA 3JCMd 4MZTA 3R6OA 4BE0A 1VQ6T 2RHUA 3N5BB 5CKBA 5GANe 3OYNA 4MZMA 3CD6A 3HFOA 4M7AF 5GANd 3JRZA 4E7JA 3FIFA 3LWIA 2E6NA 4M7DC 2BIVA 1M1KU 4X34A 2OTLT 2KVQG 3CMEA 1N8RC 2DVEA 4JRPA 5GAN3 3OS5A 2VGNA 1BI0A 3OYYA 5GAOr 4Z02A 5FRNA 4C0FA 3VYGA 2V8KA 3JCMf 4EDUA 2M16A 2E65A 4XK8E 3LGLA 4C8QD 1Y07A 2QQAA 2QQRA 2ZPIB 3X25B 4EMKC 3L2ZA 1VQ7T 1D3BB 3FEOA 2E10A 3QJYA 1NE8A 1BIBA 4C92B 5GAN8 2FHDA 3J81E 2BKDN 2PUOB 2VXFA 3JCMQ 3JB9H 4E7LA 4C5HA 1WNLA 2RHYA 3OW2S 5FU7B 4IURA 4BD3A 4IKFA 3G6EA 4FSXA 3CXCA 3OSSC 3VYHB 1NJIC 2LT4A 2X4JA 3RKYA 1VQLT 2DXCA 3QJ6A 3JSCA 2XDDA 2IG0A 4FT4A 3OYBA 3V8KA 2YRVA 2DK3A 3TEEA 4TVRA 5CAIA 2RI3A 2WSFE 3BFMA 3NTHA 1FX7A 4J5YA 4X9DA 5D6XA 4XTXA 2QTXA 1YHQT 1S72T 2L5QA 4Q5WA 3OBWA 2DZCA 4N4IA 4II1A 3FC3A 2MMPA 5M9OA 4LD6A 3SB2A 5GAN5 3L2RA 1VQNT 3NFCA 2RO0A 3M4YA 3J7AF 3OYDA 4C5GA 2XDBA 3M54A 4KT0E 4PJOF 3JCMb 2GQVA 1K73C 1RL2A 5FU6C 5HK3A 5GMKh 3OYAA 1M90C 1KQ1A 3QUIA 2R5AA 1M90U 4RCCA 1WJSA 4XU1A 3ASKA 1I81A 2ZPHB 3HHTB 4P5NA 3QPHA 4PLLA 1KC8U 1QVFS 3QYHB 4EMHA 3LH0A 5LJ3f 4M7DB 3CBMA 3L2VA 2C06A 4RKUE 4LDVA 3CBOA 3M5AA 4QVDA 4BY6C 1B34A 2RH2A 4RG8A 4M7DA 1YI2A 4F7UF 2E70A 3CC4T 5KE3A 1VQ6A 1JJ2A 5A2QE 1HXDA 4C8QG 3RIRA 5DLQE 2IVWA 3CCQT 1VUBA 4E7IA 4EMKB 2K2VA 2RJFA 4RG2A 3MP1A 4E47A 4HKEA 2DPPB 2OTLA 3I56T 4A53A 3SWNC 1OZ3A 4DOWA 4EMKA 3SFMA 1LJOA 2LX9A 1U8RA 1W2BA 2EQUA 3G7ZA 3FB9A 3QZ9B 2V8IA 3PFSA 4ZTJA 2F69A 4C8QA 1VQKA 5KCHA 2CZ1B 1IZ6A 3OB9A 2X4WA 1G3WA 2ZGWA 1YCYA 3JCMV 2CYZB 3FDRA 5GAMj 3MEUA 4J6YA 3G71T 3LW5E 3HP9A 4OF1A 2EQKA 5CK9A 3CCLT 2RB6A 1VQ4A 1Y7XA 1Q86U 1XQHA 3OBYA 2VYTA 1KQSS 4JS4A 2MF2A 2XG8D 3LLRA 2DTIA 2JN0A 3PIOA 3TCJA 2RK2A 2XHCA 2KY9A 3BY7A 1KQ2A 3MP8A 3GPLA 1H3ZA 1NPPA 2RM4A 3VUZA 3P8DA 5GAOn 5GAN6 1M5Q1 1Y71A 3HRUA 3SD4A 3OYEA 5CKFA 4E7KA 1MGQA 1VQOT 2P4TA 1BI2A 5CKHA 4BB7A 2E6ZA 5FU6B 2GFAA 2RHIA 2WSCE 2YHTA 4LDWA 3T9NA 4A4GA 1K9MU 3PMTA 2LQKA 4HCBA 1M1GA 3S6WA 4QQ6A 1VQNA 2QA4T 2DTHA 4KUIA 3PIPA 4R56A 4M77G 3JCMP 1KD1U 3A8LB 2DO3A 5GMKl 3JB9G 2CGHA 3RERA 5GMKe 1VQMT 5A0GA 3OYJA 2E1HA 1NPRA 2D9TA 4LD9K 4FL6A 2EFIA 5HY6A 4GLKA 4QVZA 1ZBXA 3EFSA 4MZPA 2LDMA 3VJPA 4OP0A 2Y4XA 5LJ3g 4ATOA 4RCBA 4L6V5 5CO7A 4ELZC 2K57A 4ZTFA 1VQ9A 1TH7A 3CPWA 1M1KC 1RI0A 1ZHIA 2F5TX 3P8HA 4C8QE 2XD0A 3QO3A 5FROA 3HKSA 3RUXA 4HA8A 3SWNA 1XTDA 5DY9A 1YJ9T 3E9GA 4LDUA 5GAMe 1YIJT 3CEYA 2RD1A 3C95A 4D6WA 5GAMd 2E5QA 3CCEA 5GAN2 1U1SA 2Y90A 4N0AC 1VQ5T 1Y96B 5GANf 3CC7A 4M7DF 3BDLA 5GAOp 5GAN4 4XAXB 5L8RE 3OYFA 1EIFA 3CMAT 4M75G 3G4SA 1LOJA 1Y96A 2RI5A 3OS1A 3OYCA 3CC2A 4PL6A 2HQXA 4C8QC 1BKBA 5C0MA 3DB4A 1VQKT 3CCRT 4BACA 1G5VA 4C92G 4BE1A 1SSFA 5LJ5h 3F70A 2RI2A 4JRIA 3VKIA 2B8AA 3WXMB 3CCUT 5CQXA 3RMQA 4C8QF 3S3OA 2RHZA 3GP8A 5LJ5g 2P0KA 4XTWA 2DEQA 3Q1JA 2QXFA 4NL2A 3JCMX 3FLGA 3MEVA 3J80E 4XQ3A 3E9FA 2MAMA 1M1FA 1OYXA 1UEBA 3QZ5B 3CBPA 4CRIA 1VQPA 4Y28E 2L89A 2K3YA 4IUVA 3X20B 1JJ2S 4O5VA 3URGA 3X28B 3BW1A 2DXBA 5GMKm 3CCJT 2DIQA 1QW1A 3WVEB 4FU6A 4N4HA 4M7AG 5HKCA 4M77E 2KQWA 3V8JA 4FM4B 1JRIA 3DLMA 3FRNA 3KUFA 1KC8C 2CS7A 1KG1A 2LQ8A 1YITA 1B34B 1K8AU 1VIFA 3A8OB 4M77D 4YTLA 1UB4A 4O6JA 2DKGA 5EG2A 2RJCA 4DOVA 3JB9D 4C0GA 4MDWA 3OW2A 3OYIA 2PVOB 3EFRA 2OAUA 3I55T 2OTJT 3E1SA 2K3XA 3KBGA 4M77C 4MMKA 1YJNT 5GMKj 3JCMh 3LYIA 2QEXT 3CCMT 2O4XB 3RMSA 4GY5A 2JNGA 4N0AA 1VQ8T 3L42A 5GANh 5DM7R 3ME9A 2O4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL3 A;  4NOY A;  3JCM g;  5GAN 6;  1M5Q 1;  5LJ5 j;  5GAO n;  1MGQ A;  2DVE A;  4C8Q B;  5GAN 3;  5GAO r;  5GAN g;  4F7U E;  4JUV A;  4M75 E;  4PJO C;  4M78 D;  2YHT A;  3JCM f;  3AHU A;  3V8L A;  2DXU A;  2E65 A;  2EJF A;  3BDU A;  4A54 A;  4C8Q D;  2DTH A;  2RA2 A;  3JB9 F;  4EMK C;  3L2Z A;  1D3B B;  2E10 A;  4M77 G;  3JCM P;  4DQ2 A;  4M75 D;  5LJ3 e;  4JLI A;  4M7A B;  5LJ3 d;  5GMK l;  3JB9 G;  2CGH A;  4M78 C;  3RER A;  1BIB A;  4C92 B;  5GMK e;  5GAN 8;  4M7A A;  4M7D G;  2E1H A;  1JBM A;  2VXF A;  3EFS A;  4XU3 A;  3JCM Q;  3JB9 H;  4OP0 A;  1U1T A;  1WNL A;  3L1A A;  2E64 A;  2FYK A;  4M75 C;  4C92 D;  4RCB A;  5LJ3 g;  5LJ5 e;  2K57 A;  4PJO G;  1TH7 A;  5GAO q;  5GAO l;  3QSU A;  3RKY A;  5GAN 7;  4C8Q E;  3V8K A;  1HK9 A;  5CAI A;  3QO3 A;  4M78 F;  3RKW A;  4Y91 A;  3M4G A;  3RUX A;  3V7R A;  4HA8 A;  4J5Y A;  3BFM A;  4X9D A;  3SWN A;  4XTV A;  1X01 A;  4M77 F;  2QTX A;  4XTX A;  5DY9 A;  4C92 C;  5GAM e;  4M78 G;  2RD1 A;  5GAM d;  2DZC A;  4M75 F;  1N9R A;  1U1S A;  2Y90 A;  4N0A C;  5GAN 2;  5GAM h;  1Y96 B;  5GAN f;  4V2S A;  2DJZ A;  4M7D F;  3V7C A;  3SB2 A;  5GAN 5;  5GAN 4;  5GAO p;  4F7U G;  3HFN A;  4M75 G;  1LOJ A;  1Y96 A;  4C92 E;  5LJ3 h;  5GAM g;  4C8Q C;  4PJO F;  3JCM b;  5GAN j;  1H64 1;  4M7A D;  5GMK h;  1KQ1 A;  2EJ9 A;  3QUI A;  4HT8 A;  4RCC A;  4XU1 A;  1I81 A;  4M77 B;  2DTO A;  5LJ5 d;  4C92 G;  3HSB A;  3JCM W;  2EWN A;  4XTU A;  2VXE A;  5LJ5 h;  2YLB A;  3GIB A;  4JRI A;  4MML A;  4M77 A;  3SWN B;  4EMH A;  5LJ3 f;  1BIA A;  3V7S A;  5I21 A;  4M7A C;  4M7D B;  4WF2 A;  1WQ7 A;  3RKX A;  4JRK A;  4C8Q F;  5LJ5 g;  4QVD A;  2YLC A;  1B34 A;  4XTW A;  4XTZ A;  4M7D A;  3JB9 I;  2DEQ A;  3VU3 C;  4F7U F;  2EJG A;  2HNI A;  4NL2 A;  2DXT A;  1WQW A;  4J6X A;  3JCM X;  2DZ9 A;  2VC8 A;  1HXD A;  4XQ3 A;  4C8Q G;  5GMK i;  5LJ3 j;  3JCM e;  4M7D C;  4PJO B;  3RIR A;  4XU0 A;  3JB9 J;  4M7A E;  5LJ5 f;  4PJO A;  4EMK B;  4XTY A;  4HT9 A;  4EMG A;  3JCM c;  2I2L A;  4XU2 A;  4A53 A;  3SWN C;  3RES A;  4EMK A;  3JCM J;  1I5L A;  4C92 F;  1LJO A;  3BW1 A;  5GMK m;  1I8F A;  4M78 B;  3INZ A;  4M7A G;  1WPY A;  3FB9 A;  4J6W A;  4M77 E;  5GAM f;  4M78 A;  3V8J A;  1JRI A;  2EAY A;  2FB7 A;  4F7U B;  4C8Q A;  4M75 B;  1LNX A;  2E41 A;  1B34 B;  4M7D E;  4F7U A;  2ZGW A;  1YCY A;  3FJP A;  4M77 D;  4M75 A;  3JCM V;  5GAM j;  5GAO m;  4J6Y A;  2DKG A;  4QVC A;  3QHS A;  3JB9 D;  4PNO A;  1D3B A;  4PJO E;  2RB6 A;  4M7D D;  3EFR A;  3PGG A;  4X9C A;  1N9S A;  3JCM d;  1M8V A;  4M77 C;  4MMK A;  4C92 A;  5GMK j;  3JCM h;  5GAN e;  2DTI A;  2JN0 A;  4M7A F;  4PJO D;  3HFO A;  5GAN d;  3BY7 A;  1I4K 1;  3FIF A;  4N0A A;  1KQ2 A;  5GAN h;  2RM4 A;  4M78 E; 
#chains in the Genus database with same CATH topology
 1TS9 A;  4NOY A;  1F1B B;  4J9B A;  4BI4 A;  1U06 A;  4C8Q B;  1NM7 A;  2KYM A;  1WZO A;  3M55 A;  5FW9 A;  1HYO A;  1M3B A;  4LDX A;  4M75 D;  3R6N A;  3DB3 A;  2QDY B;  1X43 A;  1AD5 A;  1H92 A;  1ARK A;  2KT1 A;  2FVU A;  4X1V A;  4DA4 A;  2D6F A;  3EHR A;  1JBM A;  2QI2 A;  2RJD A;  5LJ5 e;  4FIB A;  2EQJ A;  4QQD A;  3RKW A;  1S72 A;  3I35 A;  3JAM E;  1X01 A;  1WHM A;  1ZQ1 A;  4PFZ A;  2PUK B;  2LTO A;  3HL8 A;  2QA4 Q;  2J6F A;  2DJQ A;  3V7C A;  2G3R A;  4F7U G;  1WGS A;  4C0Z A;  2DFU A;  4BY6 B;  4BDZ A;  4JPB W;  1AVZ C;  4HT8 A;  4BI3 A;  4A4E A;  3HSB A;  3OYG A;  2DIG A;  5KYU B;  2XU8 A;  3RKX A;  1Z9Z A;  3PT9 A;  1FXX A;  5AYF A;  2KBT A;  1M2V B;  3C4S A;  3SHW A;  2M1H A;  1FMK A;  4OMM A;  5IHI A;  1K0X A;  3ZEH A;  3THK A;  2YDL A;  1M30 A;  1R0B G;  1PSE A;  1X75 C;  1YBY A;  3OS0 A;  1WPY A;  4B6M A;  2XDP A;  5KCO A;  4AFS C;  2FB7 A;  3LWH A;  4NS5 A;  1N8R R;  5GAO m;  4M75 A;  2ED0 A;  2X51 A;  3NGP A;  2CP2 A;  1AWO A;  1D3B A;  3SDZ A;  2XK0 A;  3PGG A;  2YT6 A;  4OGC A;  3CCV A;  3EGD A;  1TXQ A;  1HJD A;  2QDL A;  2DE0 X;  2V8J A;  4LUD A;  1FWZ A;  2QA4 A;  1ABQ A;  4J83 A;  1K8A C;  3AHU A;  1TUG B;  3A8M B;  4A63 B;  2K4Y A;  1VQM A;  1H8K A;  4J7I A;  1RLP C;  1JO8 A;  3CCQ Q;  1RI9 A;  3CCM Q;  1QP3 A;  2OJ2 A;  4C0D C;  4RUG A;  1MHN A;  2IPO B;  1AEY A;  2PVD B;  1K0S A;  2ZZD A;  2HKN A;  1OZ2 A;  5IAY A;  4RMO A;  3M4G A;  5D6Y A;  1D1A A;  1WXU A;  1VQ5 A;  3X26 B;  3ZBD A;  2P84 A;  3O8V A;  1GCP A;  2NUP B;  1OI1 A;  3CCE T;  1TSF A;  3P8B B;  1K9A A;  2JVV A;  2ZCF B;  4B9W A;  1CSK A;  3UAT A;  2GFU A;  1VQK A;  3G4S T;  3M59 A;  3MPU B;  5DLO A;  2EJ9 A;  3EAE A;  5CKE A;  3PTA A;  1Q7Y R;  1WIE A;  1UGR B;  4XTU A;  2VXE A;  1MMN A;  2LT1 A;  4FSS A;  3M0T A;  1ZSZ A;  2HNI A;  3GBQ A;  3MET A;  2P0P A;  1QKW A;  2DZ9 A;  3UWN A;  1O9S A;  3QII A;  2L3S A;  4CC4 B;  2VVK A;  3ZFJ A;  2RPN A;  3CCJ A;  2E3H A;  4DEY A;  2X35 A;  1VQP T;  3CCS A;  2L2P A;  2ZAE A;  1YJW Q;  2LZ6 B;  2K2M A;  4DBR A;  4C0D B;  1QVP A;  4A4K A;  2F2W A;  4F7U A;  2GF7 A;  2MWO A;  3VV0 A;  4ZGD B;  1YIT T;  1YIJ Q;  2CUD A;  2KSS A;  1YJN A;  1PSF A;  2LRQ A;  2RJE A;  1W1F A;  1RAB B;  3N5B B;  3CD6 A;  3HFO A;  1J3T A;  2AT1 B;  2J05 A;  1VYT A;  4ORZ A;  2OTL T;  3CME A;  3CCR Q;  1G2B A;  3OS5 A;  5GAO r;  1BI0 A;  1KQS P;  4Z02 A;  2M0Y A;  1M1K R;  1JU5 C;  2M16 A;  2E65 A;  4C8Q D;  1VYU A;  2QQA A;  2QQR A;  3L2Z A;  3QJY A;  4C92 B;  2KGT A;  3JCM Q;  2RQU A;  1NG2 A;  2A28 A;  2CRE A;  3EG9 A;  2YRC A;  3G6E A;  4FSX A;  1K4U S;  3VYH B;  2LT4 A;  4E7S A;  2ESW A;  2DK3 A;  3TEE A;  5CAI A;  5D6X A;  1S72 T;  2L5Q A;  2DZC A;  3FC3 A;  1WHJ A;  2MMP A;  3EG2 A;  2L3Q A;  3L2R A;  2RO0 A;  3J7A F;  5D7U A;  2GBQ A;  1RAF B;  4FW1 A;  2L3P A;  3JCM b;  4Z88 A;  5HK3 A;  1KQ1 A;  2QEX Q;  4RCC A;  4XU1 A;  3HHT B;  2ZPH B;  2NUZ A;  2DBM A;  1QVF S;  3QYH B;  2DM1 A;  4PK4 A;  2H3E B;  1QKX A;  1RAG B;  4RKU E;  2RF0 A;  3CBO A;  1QMC A;  2LJ3 A;  1YI2 A;  4F7U F;  2E70 A;  3A98 A;  9ATC B;  5KE3 A;  3OW2 P;  1JJ2 A;  3H0I A;  2BE7 D;  1UE9 A;  3RIR A;  1SHG A;  1VUB A;  4E47 A;  4HKE A;  2DPP B;  2D1X A;  1OZ3 A;  4EMK A;  1W2B A;  4PFP A;  3TSZ A;  1MV3 A;  3PFS A;  4C8Q A;  5KCH A;  2CZ1 B;  3FDR A;  5GAM j;  3HP9 A;  2EQK A;  2RB6 A;  1VQ4 A;  1XQH A;  2AZV A;  2KRO A;  2MF2 A;  2XG8 D;  3LLR A;  1Q86 R;  3PIO A;  2XHC A;  1D1C A;  2RM4 A;  3HRU A;  3SD4 A;  4E7K A;  5CKH A;  5HCK A;  3EH2 A;  2CP7 A;  4HCB A;  2LQK A;  2GTO A;  2QA4 T;  3H0F A;  4M77 G;  1K9M R;  1KD1 U;  1PWT A;  5GMK l;  2CGH A;  3EGX B;  3RER A;  2DMO A;  1VQM T;  5A0G A;  3H0H A;  2CH4 W;  3VJP A;  2LDM A;  4QT7 A;  4OP0 A;  4ZTF A;  5CO7 A;  4CC3 A;  2K57 A;  3CPW A;  4C8Q E;  2EVR A;  4HA8 A;  5KYU A;  2CH4 A;  1XTD A;  4F16 A;  1VQ5 T;  5GAN f;  5GAO p;  1KSW A;  1Y96 A;  3CC2 A;  3TVT A;  1OPL A;  1LVK A;  2QG9 B;  4FYW B;  1TTH B;  1SEM A;  1VQK T;  2EW3 A;  4C92 G;  5ECA A;  2A0F B;  2RI2 A;  2MPX C;  2L0A A;  2B8A A;  5CQX A;  4C8Q F;  3S3O A;  5LJ5 g;  2DEQ A;  4NL2 A;  3JCM X;  4XQ3 A;  3E9F A;  1M1F A;  1ABO A;  5KYW A;  1VQN Q;  1IGU A;  1NYG A;  4Y28 E;  2K3Y A;  2EYZ A;  4IUV A;  3X20 B;  1M3C A;  1JJ2 S;  3X28 B;  2DXB A;  3CCJ T;  1QW1 A;  3WVE B;  4M7A G;  5HKC A;  2KNB B;  1PKT A;  3DLM A;  3KUF A;  3VS7 A;  2X3W D;  3I5S A;  4JJD A;  1SHF A;  2JJ9 A;  2DRM A;  1KG1 A;  4M77 D;  2QYZ A;  4AFQ C;  1UB4 A;  2W0Z A;  4O6J A;  2RJC A;  1GBR A;  3OW2 A;  3U23 A;  3CCE Q;  3MJX A;  4MMK A;  1YJN T;  3JCM h;  3CCM T;  2O4X B;  4GY5 A;  3VS5 A;  2JNG A;  4N0A A;  3G4S Q;  1OX8 A;  3ME9 A;  1LPL A;  3CD6 T;  4RTY A;  2CT3 A;  1BYM A;  2JUF A;  4AFZ C;  2C0O A;  1D0Z A;  4AG1 C;  5GAN g;  2MWP A;  1VQ8 A;  1VQ7 A;  5HK0 A;  1HSQ A;  2CZ0 B;  4A4H A;  1TU0 B;  2ENM A;  1Q81 U;  4VUB A;  4OMF B;  1IHW A;  1VQL A;  2JZ2 A;  4C92 D;  1QQJ A;  1QVG S;  2K5F A;  1VQP Q;  2XID A;  2X4X A;  4QQG A;  3UA6 A;  3EGU A;  3M53 A;  2XI9 A;  2HQE A;  1M4Z A;  3DLL A;  4XTV A;  5IHK A;  2F2X A;  2NLU A;  4JLG A;  1NBE B;  1KD1 C;  1MNE A;  3C0C A;  1YIT Q;  2VKN A;  2VV5 A;  3HFN A;  5LJ3 h;  1JB0 E;  2ECZ A;  2LJ0 A;  2CZ6 B;  4KUD K;  4M7A D;  2K5L A;  5CR2 A;  4C5I A;  3GF5 A;  1YJW T;  2EYQ A;  2MYS A;  2FZK B;  2X4Y A;  3HPW A;  3GIB A;  1M9S A;  2EQI A;  4M77 A;  3SWN B;  4E7Z A;  2R57 A;  3OQ5 A;  3CXC S;  2YLC A;  4XTZ A;  2DNU A;  3M58 A;  3OMG A;  3MEA A;  4RTU A;  4KBM B;  1KFZ A;  1YI2 T;  5I22 A;  1X2Q A;  2LC4 A;  4HCZ A;  3CMA Q;  2BE9 B;  1T0H A;  2K79 A;  1WLP B;  1GRI A;  1MMA A;  3H41 A;  2I2L A;  2CT4 A;  1C0M A;  4XU2 A;  3EFO B;  1IB8 A;  4DBH A;  3G71 A;  2LJ1 A;  4MDX A;  1LNX A;  2BZY A;  1OX9 A;  3EG1 A;  1B3Q A;  1S72 Q;  4PNO A;  1KHI A;  3PE0 A;  2WAC A;  4X9C A;  2E5K A;  4BI8 B;  3WVD B;  1M8V A;  1VQ4 T;  4C92 A;  2CSQ A;  3VS6 A;  1Q82 R;  1I4K 1;  4HVW A;  4HCC A;  2RHX A;  5CVI A;  1QP2 A;  2O01 E;  4JUV A;  2DVJ A;  4PLI A;  1UHC A;  2QQ9 A;  3H6Z A;  4PJO C;  1UJY A;  3V8L A;  2KK4 A;  2RA2 A;  2RNA A;  4KH1 B;  1W4S A;  2HZY A;  1D09 B;  1WHG A;  1WHL A;  2PU9 B;  3SEM A;  4M78 C;  1DJ7 B;  2L8D A;  4M7A A;  5CQY A;  4FT2 A;  1K73 U;  1GXI E;  1AHJ B;  2FYK A;  1UGP B;  3CPF A;  1X6B A;  1YJ9 A;  2QK0 A;  3GOX A;  3QWX X;  2HAX A;  3UF4 A;  4M77 F;  1KHC A;  5KE2 A;  1N6A A;  2P0Q A;  3CMA A;  3L2U A;  5GAM h;  2OAW A;  1Q81 C;  4C92 E;  4FYV B;  4L59 A;  5KYX A;  1Q7Y C;  1QWF A;  3FJ5 A;  3TRE A;  3CC2 T;  3G1J A;  1B7T A;  1WX6 A;  5LJ5 d;  3CCU A;  3CCV Q;  2L3R A;  3V7S A;  5I21 A;  3LX7 A;  2ZPB B;  1WQW A;  2E12 A;  4JZ4 A;  4PJO B;  5GMK i;  2A3L A;  4M7A E;  2R5M A;  1QVF P;  1BCM A;  1VQM Q;  1TUD A;  4C92 F;  1V76 A;  2F5K A;  4M78 B;  4AMC A;  2HSP A;  6AT1 B;  1OV3 A;  2BZ8 A;  3NTK A;  1SPK A;  1UEC A;  2PNI A;  4BDY A;  2EGE A;  2W10 A;  2M9U A;  1RAD B;  1TOV A;  4KGX B;  2E4H A;  4ELY C;  4WCI A;  4QVC A;  4BUG A;  1AWX A;  3QHS A;  3OYK A;  3HTR A;  2XKO C;  2KMT A;  1VQ5 Q;  3S3M A;  1N9S A;  2JXB A;  1U5S A;  4MZT A;  2J7I A;  3EGX A;  5GAN e;  3OYN A;  4M7A F;  5GAN d;  4E7J A;  3FIF A;  4M7D C;  1VQK Q;  4GLM A;  5FRN A;  4Y92 A;  3JCM f;  4EDU A;  4XK8 E;  1VQ7 T;  1VQ8 T;  2B86 A;  2EYY A;  2BKD N;  3JB9 H;  4E7L A;  2RHY A;  1WA7 A;  1VQL T;  3CCJ Q;  2X4J A;  3QJ6 A;  4FT4 A;  1AWW A;  2YRV A;  3CCS Q;  2KI7 A;  2WSF E;  1WDX A;  2EBP A;  3BFM A;  4X9D A;  1NJI R;  2KEA A;  3OBW A;  4N4I A;  4II1 A;  5M9O A;  3SB2 A;  5GAN 5;  2JM9 A;  1VQN T;  2VWF A;  3OYD A;  2LQW A;  3M54 A;  4KT0 E;  2I0N A;  2GQV A;  1K73 C;  1YJN Q;  1WJS A;  1BB9 A;  1K1Z A;  4J9D A;  3JV3 A;  3CD6 Q;  1B07 A;  4J9G A;  1M90 R;  2G6F X;  3LH0 A;  5LJ3 f;  3CBM A;  4M7D B;  1ACM B;  2COZ A;  3CME Q;  4RG8 A;  1VQ6 A;  1HXD A;  4C8Q G;  5DLQ E;  1OU9 A;  4A53 A;  4DOW A;  1ZUY A;  1LJO A;  2K3B A;  1U8R A;  3PVL A;  2EQU A;  2IIM A;  2LCS A;  4ZTJ A;  4JJB A;  1IZ6 A;  1Y57 A;  2ED1 A;  2LQN A;  3EHQ A;  3OB9 A;  3G6E Q;  4KRT A;  4LNP A;  3JCM V;  3G71 T;  4J6Y A;  4OF1 A;  5CK9 A;  3I5R A;  3VS1 A;  1T3S A;  1VOM A;  2JN0 A;  2K7A A;  3TCJ A;  2KY9 A;  3BY7 A;  4K11 A;  5GJW B;  1RAC B;  3VUZ A;  5GAO n;  5GAN 6;  2EGC A;  2FG0 A;  2P4T A;  2E6Z A;  1X2K A;  2M02 A;  2RHI A;  1GCQ C;  2WSC E;  2FRY A;  4A4G A;  3PMT A;  5FWB A;  1S1N A;  2JW4 A;  3M0Q A;  3M0S A;  3JCM P;  4JZ3 A;  2DO3 A;  2HMA A;  3LH5 A;  1IGQ A;  1YI2 Q;  1NLO C;  3OYJ A;  4LD9 K;  4FL6 A;  2EFI A;  5HY6 A;  1V1C A;  1KJW A;  2Y4X A;  5LJ3 g;  2JM8 A;  3O5Z A;  1YFN A;  3SWN A;  1YJ9 T;  4D6W A;  2FPE A;  2CUB A;  2E5Q A;  1U1S A;  1QVG P;  3BDL A;  3CMA T;  1LOJ A;  3ZL7 C;  3OS1 A;  3UA7 A;  1VQ4 Q;  1BCO A;  3EFO A;  3DB4 A;  1G5V A;  3F70 A;  1ZLM A;  1WXT A;  1MMD A;  3VKI A;  1YWO A;  3CCU T;  3E2U A;  1OEB A;  1GL5 A;  2QAS A;  4DBF A;  4XTW A;  2X3X D;  2QXF A;  5KYY B;  3J80 E;  4PJM A;  2K9G A;  2EGA A;  2DYB A;  1UEB A;  3QZ5 B;  5IXB A;  4CRI A;  2Z0W A;  1IO6 A;  4O5V A;  1FMW A;  3BW1 A;  5GMK m;  1Z9Q A;  2OI3 A;  5I11 A;  4FU6 A;  3V8J A;  2CS7 A;  4RTT A;  2LQ8 A;  1VIF A;  1KC8 R;  4MDW A;  1K8A R;  2PVO B;  1BK2 A;  4AT1 B;  3CC4 Q;  3EFR A;  4D8D A;  2OAU A;  1H3H A;  3E1S A;  2K3X A;  3KFV A;  2DLP A;  2C0T A;  5GMK j;  3LYI A;  3REA B;  4J7F A;  5GJV B;  3CC2 Q;  2A7Y A;  4UC4 A;  2XIC A;  4C5E A;  2JTF A;  4L5G A;  2RQW A;  2DXU A;  2AHJ B;  2DBK A;  4ZN3 A;  3JB9 F;  3VS4 A;  3QG1 A;  4DQ2 A;  5A0L A;  3GLX A;  2DYI A;  3OS2 A;  2JS0 A;  2LCC A;  4XU3 A;  1U1T A;  4M75 C;  2CP5 A;  3OSV A;  3CCV T;  1IRE B;  5I2S A;  1TWB A;  4Y91 A;  4F04 B;  1YHQ A;  1A0N B;  4M4Z A;  2H3J A;  3PVQ A;  2FZC B;  2DJZ A;  4R55 A;  1NEG A;  5IN1 A;  1W70 A;  3CQT A;  3PMI A;  1BU1 A;  1QCN A;  5I2M A;  7AT1 B;  2HCK A;  3ER0 A;  4MML A;  3H8Z A;  3EG0 A;  4WF2 A;  1KQS A;  4JRK A;  3CC4 A;  3JB9 I;  2ZPF B;  1VQ7 Q;  1VQ8 Q;  1G3T A;  4JS5 A;  3JCM e;  5IH2 A;  3RBB B;  1M2V A;  3JB9 J;  1D1B A;  3I56 A;  4HT9 A;  4XTY A;  4ME7 A;  2LMJ A;  2DD5 A;  1QCO A;  1E7O A;  1OU8 A;  4PJJ A;  1N8R U;  3MP6 A;  1VQL Q;  3MO8 A;  4IUQ A;  4RTV A;  4M75 B;  4RTZ A;  2E41 A;  3QDR B;  3FJP A;  3CCL A;  4OGE A;  2R58 A;  5CKD A;  1Q82 C;  1BI1 A;  3OMC A;  2JOY A;  4PJO E;  3MEW A;  4ZGJ B;  3X24 B;  2M0O A;  1OQK A;  4IUU A;  1VQO A;  4M78 E;  4IUT A;  2LNV A;  5D6W A;  5LJ5 j;  1NJI U;  2HL5 C;  3QBY A;  4CC7 A;  3CCS T;  3H9N A;  4OMO A;  1R8O B;  2X9H A;  3MCA B;  1W2B S;  2KT8 A;  2JMC A;  3BDU A;  1YWP A;  2C0I A;  4J9C A;  5J26 A;  2VUB A;  3M57 A;  5LJ3 e;  5LJ3 d;  4QKU A;  3TQ7 P;  1WI7 A;  1G83 A;  4J8O A;  4HXJ A;  1QLY A;  4RTW A;  3VS2 A;  5GAN 7;  1HK9 A;  4M78 F;  1WJQ A;  3V7R A;  3CME T;  1KIK A;  2COW A;  3DKM A;  5C6S A;  2P4R A;  3G71 Q;  2EIF A;  4HVU A;  1W6X A;  2NUP A;  2EYX A;  2LCL A;  2MCN A;  1Q7Y U;  5GAN j;  1H64 1;  3OA6 A;  1SRM A;  5LL6 S;  4PKC C;  1WJR A;  1NEB A;  3OYL A;  1ZUK A;  2KDS A;  2WSE E;  4JDS A;  3A8G B;  3HRT A;  3OY9 A;  1M3A A;  4RTX A;  1MND A;  3G6E T;  1BIA A;  4ANJ A;  8AT1 B;  4N4G A;  4A4F A;  3CPW S;  1X6O A;  2EJG A;  2QQB A;  1I5O B;  3GNF B;  5FLX E;  4XU0 A;  4OVA A;  5CIU A;  1SF9 A;  3HRS A;  4OB0 B;  4EMG A;  4QW2 A;  3EG3 A;  4OB3 B;  3RES A;  3JCM J;  1I5L A;  2SEM A;  2VAS A;  1G8X A;  4OB2 B;  1PHT A;  2HD0 A;  2EAY A;  4F7U B;  3RR6 A;  5CCA A;  3NPF A;  4M7D E;  1PCX A;  1XOV A;  2NUT B;  2RK1 A;  1YJ9 Q;  3I55 A;  2OTJ A;  1RAH B;  4B9X A;  4OML A;  4EPC A;  5IT9 E;  3OYH A;  4EIK A;  3R6O A;  4BE0 A;  4OMN A;  1ZBJ A;  5IXF A;  4MZM A;  2DL5 A;  1PM3 A;  3JRZ A;  2O9V A;  3LWI A;  4F14 A;  2E6N A;  1M1K U;  4F17 A;  1N8R C;  2DVE A;  2VGN A;  4C0F A;  2V8K A;  3LGL A;  3CCU Q;  2ZPI B;  2OX7 A;  2NYS A;  4EMK C;  1UJ0 A;  2E10 A;  2JS2 A;  1NE8 A;  2VXF A;  1R0C B;  1VA7 A;  1WNL A;  3OW2 S;  2KR3 A;  4BD3 A;  2DX1 A;  4IKF A;  1QWE A;  3OSS C;  1NJI C;  3QSU A;  1Y0M A;  2DXC A;  2RI3 A;  4J5Y A;  1FX7 A;  1OOT A;  2QTX A;  2SRC A;  4XTX A;  1YHQ T;  4Q5W A;  2HEQ A;  5KYY A;  3NFC A;  1D0X A;  2D8H A;  1RL2 A;  5FU6 C;  3OYA A;  5GMK h;  1M90 C;  2E3I A;  3QUI A;  2R5A A;  1I81 A;  4PLL A;  3QPH A;  1KC8 U;  1KK7 A;  4EMH A;  3L2V A;  2KXD A;  3M5A A;  4QVD A;  4BY6 C;  3CC4 T;  4JJC A;  5A2Q E;  4EMK B;  2K2V A;  2RJF A;  4RG2 A;  3MP1 A;  2OTL A;  2ATC B;  3I56 T;  1PRL C;  2LX9 A;  3G7Z A;  2D8J A;  4LXC A;  3FB9 A;  4HCK A;  4GBQ A;  2V8I A;  2F69 A;  4LN2 A;  1CKB A;  1G3W A;  2O9S A;  1R77 A;  2CYZ B;  3LW5 E;  4J9I A;  4KGV B;  5IHN A;  3CCL T;  1Q86 U;  3OBY A;  2YRD A;  1EX4 A;  2RK2 A;  1KQ2 A;  3GPL A;  3OYE A;  1M5Q 1;  1Y71 A;  5CKF A;  1MGQ A;  1VQO T;  1BI2 A;  5FU6 B;  1K9M U;  1ZA2 B;  4QQ6 A;  1X27 A;  3PIP A;  4R56 A;  3A8L B;  2HKQ B;  3JB9 G;  2YUP A;  2D9T A;  1KD1 R;  1OPK A;  4GLK A;  4QVZ A;  1VQ6 Q;  2DEU A;  2KRN A;  4ATO A;  4L6V 5;  1VQ9 A;  1TH7 A;  1D0Y A;  4DBQ A;  1M1K C;  2DER A;  1RI0 A;  1ZHI A;  2XD0 A;  4PFO A;  3RUX A;  2JMA A;  1UUE A;  3C95 A;  4N0A C;  1Y96 B;  3CC7 A;  4D8K A;  2DL4 A;  5GAN 4;  4XAX B;  2V1Q A;  3OYF A;  1EIF A;  4HVV A;  4PL6 A;  2HQX A;  2CP3 A;  3RDV A;  3QDF A;  8ATC B;  1BKB A;  1FMV A;  4IIO A;  4BAC A;  1QCF A;  1SSF A;  2QTV A;  5LJ5 h;  4JRI A;  1HD3 A;  2FO0 A;  3AT1 B;  4LUE A;  3Q1J A;  5KYW B;  3FLG A;  3MEV A;  2MAM A;  1OYX A;  2L89 A;  2M51 A;  1YN8 A;  1MMG A;  3URG A;  1FYN A;  1IHV A;  4J9H A;  4N4H A;  1PD1 A;  2AK5 A;  1AWJ A;  2KQW A;  1JRI A;  3FRN A;  1KC8 C;  2RQT A;  4R0K A;  1B34 B;  2FPF A;  2EYW A;  5EG2 A;  4DOV A;  5L23 A;  3D7S B;  4FYY B;  3JB9 D;  2YUQ A;  3OYI A;  3I55 T;  2OTJ T;  1IXD A;  3KBG A;  2V1R A;  4M77 C;  3RMS A;  4FYX B;  2AIR B;  3L42 A;  5GAN h;  3BE3 A;  5DM7 R;  2O4X A;  2DIL A;  3JCM g;  4IIM A;  3NMZ C;  2RQV A;  1NLP C;  2O31 A;  4KH0 B;  4M75 E;  3KXT A;  2RQR A;  2RN8 A;  1SRL A;  1I07 A;  2EJF A;  2ZPE B;  1JJ2 P;  2ZPG B;  1E6G A;  4JLI A;  2MI6 A;  1Q86 C;  1N27 A;  1ZX6 A;  1QVF A;  2PZ1 A;  3L1A A;  2E64 A;  1W2B P;  1Q81 R;  2Y4Y A;  4LDY A;  4PJO G;  5GAO l;  2DAQ A;  1WXB A;  2K6D A;  1JQQ A;  4CI0 C;  3I9Q A;  4JRQ A;  1K9M C;  2COY A;  4C92 C;  5EC7 A;  4M78 G;  4ESR A;  1P92 A;  4M75 F;  1N9R A;  4ZGE B;  2H8H A;  2LNH B;  4JJN K;  4V2S A;  4PJL A;  2LVM A;  2DD4 A;  5FRM A;  3M56 A;  2QGG A;  3UPU A;  2MIO A;  2DL3 A;  3C94 A;  4FCY A;  4M77 B;  1PD0 A;  2CZ7 B;  2EWN A;  2YLB A;  4M7A C;  4ZN1 A;  1UGQ B;  3VU3 C;  2NUT A;  2HBP A;  3CCQ A;  2GTJ A;  5LJ3 j;  3CCM A;  2EPD A;  5KH6 A;  2F1L A;  2RMO A;  2GQI A;  1WYX A;  1O75 A;  4E7H A;  3CPW P;  3INZ A;  5GAM f;  1T3L A;  2VGM A;  2EQM A;  2HQH A;  3MHX A;  3E19 A;  2PVG B;  3NTI A;  1BBZ A;  2V26 A;  2YSQ A;  1BI3 A;  3C12 A;  1YHQ Q;  3VRY A;  4ZNX A;  1Q82 U;  2YWW A;  4AFU C;  1RAI B;  3LGF A;  2AKK A;  2KAF A;  4KUL A;  4OB1 B;  4PJO D;  2BUD A;  2DET A;  2PQW A;  4NL3 A;  3CXC P;  1EFN A;  2MK5 A;  1EZZ B;  1UGS B;  4F7U E;  1WHH A;  4M78 D;  4BE2 A;  3VUB A;  2NWM A;  3S3N A;  4A54 A;  3M9Q A;  4Z8A A;  2FL7 A;  1V29 B;  5J39 A;  4M7A B;  4DEX A;  1YCS B;  3M0U A;  1YJW A;  4M7D G;  3QYG B;  2KRS A;  4KGZ B;  3I56 Q;  5GAO q;  1K73 R;  1G3Y A;  1JEG A;  1MUZ A;  2D0N A;  1VQ9 T;  2QQS A;  1YIJ A;  2K5I A;  2CP0 A;  3NHN A;  2FRW A;  2GCX A;  2QGF B;  4E2F B;  1JXM A;  1NZ9 A;  1E6H A;  3GNG A;  2DA9 A;  2HBW A;  5KYX B;  3CCL Q;  2XMF A;  4E6R A;  3CC7 T;  3UT1 A;  5GAM g;  1SG5 A;  3UDC A;  3TU4 K;  3CCR A;  1XNI A;  4IUP A;  1OUL A;  1VYV A;  3PNW C;  1XJW B;  4Z89 A;  5A0D A;  3QXE B;  2DTO A;  2O2O A;  3JCM W;  1ZA1 B;  2YUO A;  2GNC A;  1G3S A;  1VQO Q;  1WQ7 A;  1NYF A;  1X6G A;  1UG1 A;  2KYB A;  3VS3 A;  1CKA A;  2DXT A;  4LDW A;  4J6X A;  2VC8 A;  1VIE A;  2DF6 A;  1AT1 B;  5LJ5 f;  5FU7 C;  3OYM A;  4PJO A;  3JCM c;  2D0Q B;  1C1A A;  3A8H B;  2CKK A;  1I8F A;  1PG5 B;  2JTM A;  4J6W A;  4M78 A;  1GBQ A;  2YUN A;  2CDT A;  2EKO A;  1AZG B;  1MV0 B;  3QKJ A;  3L2Q A;  2AZS A;  5J3B A;  1M2O A;  5FWC A;  2JTE A;  3L2W A;  4M7D D;  1QVG A;  2QEX A;  3A5Z B;  3JCM d;  1VQ6 T;  4LE9 A;  2HDA A;  2DL8 A;  2RHU A;  5CKB A;  1IRX A;  2BIV A;  1SSH A;  4X34 A;  2KVQ G;  4JRP A;  5GAN 3;  3OYY A;  1UGV A;  3VYG A;  1Y07 A;  3X25 B;  1AZE A;  1D3B B;  3FEO A;  4PJN A;  2BTT A;  1I0C A;  1BIB A;  5GAN 8;  2FHD A;  3VS0 A;  3J81 E;  2PUO B;  3EGD B;  2FEI A;  4C5H A;  3QWY A;  1ZSZ C;  4IUR A;  5FU7 B;  2FPD A;  3CXC A;  1GFD A;  3RKY A;  3JSC A;  2XDD A;  1WHK A;  2IG0 A;  3OYB A;  3V8K A;  4TVR A;  3NTH A;  1PRM C;  2J6O A;  2ROT A;  4CC2 A;  1I1J A;  2HSE B;  4LD6 A;  1RAE B;  2MOX A;  1RLQ C;  3M4Y A;  3REB B;  3I55 Q;  2KRM A;  2OTJ Q;  1PNJ A;  4C5G A;  2XDB A;  4PJO F;  1X69 A;  3M0R A;  1M90 U;  3ASK A;  4P5N A;  2ABL A;  2C06 A;  4LDV A;  1B34 A;  2RH2 A;  4M7D A;  1T0J A;  2PTK A;  2EKH A;  4J9F A;  2O88 A;  1Q95 G;  2IVW A;  3CCQ T;  1ZUU A;  4E7I A;  3ULR B;  2J6K A;  1M27 C;  3SWN C;  2DL7 A;  3SFM A;  1YNZ A;  1PKS A;  3QZ9 B;  1K76 A;  1ZSZ B;  2X4W A;  2QAZ A;  2ZGW A;  1YCY A;  3MEU A;  2HL3 A;  1Y7X A;  3RNJ A;  2VYT A;  1KQS S;  2GGR A;  1RAA B;  4AG2 C;  4JS4 A;  1U3O A;  2DTI A;  1RUW A;  3MP8 A;  1H3Z A;  1NPP A;  1LCK A;  1SKU B;  2FZG B;  3P8D A;  3EH1 A;  4OMQ A;  2JT4 A;  1PC0 A;  4BB7 A;  2GFA A;  2VB6 A;  2YHT A;  3T9N A;  1TG0 A;  1M1G A;  3S6W A;  2DRK A;  1VQN A;  2DTH A;  4KUI A;  1M8M A;  5GMK e;  2E1H A;  1NPR A;  5KYN A;  1ZBX A;  2J06 A;  3EFS A;  4MZP A;  4RCB A;  4ELZ C;  2KE9 A;  2AKL A;  1GFC A;  2F5T X;  3P8H A;  2OTL Q;  2LX7 A;  3QO3 A;  5FRO A;  3HKS A;  3M0P A;  1ZSG A;  5DY9 A;  3E9G A;  4LDU A;  5GAM e;  2A37 A;  1YIJ T;  1YP5 A;  2RD1 A;  3CEY A;  5GAM d;  3CCE A;  5GAN 2;  2Y90 A;  3IQL A;  4M7D F;  3A1P A;  5L8R E;  4M75 G;  3G4S A;  2RI5 A;  2A08 A;  1TUC A;  3OYC A;  4C8Q C;  1AOJ A;  2KXC A;  3EG9 B;  1N5Z A;  5C0M A;  3CCR T;  1C6V X;  2LP5 A;  4BE1 A;  5AT1 B;  3TSW A;  3WXM B;  4J9E A;  3RMQ A;  2BZX A;  1UTI A;  2RHZ A;  3GP8 A;  2P0K A;  1UFF A;  1GCQ A;  3CBP A;  1VQP A;  2F2V A;  2CP6 A;  1JXO A;  2A36 A;  4FW2 A;  2ROL A;  1UDL A;  2DIQ A;  4M77 E;  4WTO B;  4FM4 B;  2YXY A;  1VQ9 Q;  1YIT A;  1K8A U;  3A8O B;  4YTL A;  2DKG A;  4C0G A;  1UHF A;  1WFW A;  2CSI A;  3MKD A;  3VRZ A;  4OMP A;  2QEX T;  3CC7 Q; 
#chains in the Genus database with same CATH homology
 4NOY A;  3JCM g;  2A7Y A;  4UC4 A;  3CD6 T;  4BI4 A;  4C8Q B;  1BYM A;  2XIC A;  2JUF A;  4C5E A;  2JTF A;  4L5G A;  2MWP A;  3M55 A;  5GAN g;  1VQ8 A;  4M75 E;  3KXT A;  1VQ7 A;  5HK0 A;  2DXU A;  2AHJ B;  2EJF A;  2ZPE B;  4ZN3 A;  3JB9 F;  2CZ0 B;  4LDX A;  3QG1 A;  2ZPG B;  4DQ2 A;  4M75 D;  4JLI A;  4A4H A;  2MI6 A;  5A0L A;  3DB3 A;  3GLX A;  1Q86 C;  2QDY B;  1Q81 U;  1N27 A;  4VUB A;  2FVU A;  4OMF B;  3OS2 A;  2LCC A;  4DA4 A;  2D6F A;  1QVF A;  1JBM A;  4XU3 A;  1VQL A;  1U1T A;  2QI2 A;  2RJD A;  3L1A A;  2E64 A;  2JZ2 A;  4M75 C;  4C92 D;  5LJ5 e;  1QVG S;  2Y4Y A;  2K5F A;  4LDY A;  4PJO G;  2XID A;  2X4X A;  3OSV A;  4FIB A;  2DAQ A;  4QQG A;  5GAO l;  2EQJ A;  4QQD A;  3CCV T;  1IRE B;  5I2S A;  4CI0 C;  3M53 A;  2XI9 A;  4JRQ A;  4Y91 A;  3RKW A;  1YHQ A;  1S72 A;  3JAM E;  2HQE A;  1K9M C;  1M4Z A;  3DLL A;  4XTV A;  1X01 A;  4C92 C;  2H3J A;  2NLU A;  1ZQ1 A;  4M78 G;  2PUK B;  2LTO A;  3HL8 A;  1P92 A;  4JLG A;  1N9R A;  4M75 F;  4ZGE B;  4JJN K;  1KD1 C;  4V2S A;  2DJZ A;  2LVM A;  3V7C A;  2G3R A;  2DD4 A;  4F7U G;  2VV5 A;  5FRM A;  1WGS A;  3HFN A;  4R55 A;  4C0Z A;  5LJ3 h;  4BY6 B;  3M56 A;  1JB0 E;  3UPU A;  5IN1 A;  4BDZ A;  2CZ6 B;  4KUD K;  4M7A D;  2K5L A;  3PMI A;  3C94 A;  3GF5 A;  4C5I A;  5CR2 A;  1YJW T;  4HT8 A;  2EYQ A;  4BI3 A;  4A4E A;  2X4Y A;  4M77 B;  3HSB A;  3HPW A;  5I2M A;  2CZ7 B;  3OYG A;  2EWN A;  2DIG A;  3ER0 A;  2YLB A;  3GIB A;  4MML A;  1M9S A;  4M77 A;  3SWN B;  3H8Z A;  2XU8 A;  4M7A C;  2R57 A;  3OQ5 A;  4WF2 A;  3RKX A;  1KQS A;  4JRK A;  3CC4 A;  3CXC S;  2YLC A;  1FXX A;  3PT9 A;  4XTZ A;  5AYF A;  1UGQ B;  4ZN1 A;  3JB9 I;  3VU3 C;  2HBP A;  2ZPF B;  3C4S A;  3M58 A;  3MEA A;  1G3T A;  3OMG A;  3CCQ A;  4JS5 A;  2M1H A;  4KBM B;  5LJ3 j;  3ZEH A;  3JCM e;  3CCM A;  1YI2 T;  2LC4 A;  4HCZ A;  3JB9 J;  3I56 A;  5KH6 A;  4HT9 A;  4XTY A;  4J7F A;  4ME7 A;  1PSE A;  1X75 C;  2I2L A;  1YBY A;  4XU2 A;  2DD5 A;  1O75 A;  3OS0 A;  4E7H A;  3INZ A;  1WPY A;  1N8R U;  2XDP A;  5GAM f;  5KCO A;  3MP6 A;  2VGM A;  2FB7 A;  3MO8 A;  4IUQ A;  3LWH A;  2EQM A;  4M75 B;  4NS5 A;  3MHX A;  3G71 A;  3E19 A;  4MDX A;  1LNX A;  2E41 A;  2PVG B;  3NTI A;  3QDR B;  5GAO m;  3FJP A;  4M75 A;  3CCL A;  1BI3 A;  3C12 A;  4OGE A;  2R58 A;  5CKD A;  1Q82 C;  1BI1 A;  3OMC A;  1D3B A;  4PNO A;  1KHI A;  2JOY A;  2XK0 A;  3SDZ A;  1Q82 U;  4PJO E;  2WAC A;  3PGG A;  3MEW A;  4X9C A;  4BI8 B;  3X24 B;  4ZGJ B;  3WVD B;  3LGF A;  1M8V A;  2KAF A;  1VQ4 T;  2M0O A;  4C92 A;  4KUL A;  4OB1 B;  4OGC A;  3CCV A;  4IUU A;  4PJO D;  1I4K 1;  2BUD A;  1VQO A;  4M78 E;  2PQW A;  4IUT A;  2LNV A;  5D6W A;  4NL3 A;  5LJ5 j;  1NJI U;  4HCC A;  3QBY A;  2RHX A;  1UGS B;  2V8J A;  5CVI A;  3CCS T;  1FWZ A;  1QP2 A;  1R8O B;  4F7U E;  2O01 E;  2QA4 A;  4JUV A;  3H6Z A;  4M78 D;  2QQ9 A;  4PLI A;  3VUB A;  4BE2 A;  4PJO C;  3MCA B;  4J83 A;  1W2B S;  3V8L A;  3S3N A;  1K8A C;  2KK4 A;  3AHU A;  3BDU A;  3M9Q A;  4A54 A;  2FL7 A;  2RA2 A;  1V29 B;  3A8M B;  5J26 A;  1W4S A;  2VUB A;  5J39 A;  2K4Y A;  2PU9 B;  3M57 A;  5LJ3 e;  3QSU A;  1VQM A;  4M7A B;  5LJ3 d;  4M78 C;  1DJ7 B;  2L8D A;  4J7I A;  4M7A A;  1YJW A;  4M7D G;  5CQY A;  3QYG B;  4FT2 A;  1K73 U;  1GXI E;  1AHJ B;  1QP3 A;  4C0D C;  4J8O A;  2FYK A;  1MHN A;  1UGP B;  5GAO q;  2PVD B;  3CPF A;  1G3Y A;  5GAN 7;  2ZZD A;  1HK9 A;  1VQ9 T;  1YJ9 A;  1OZ2 A;  4M78 F;  5IAY A;  2QQS A;  4RMO A;  3M4G A;  3GOX A;  1WJQ A;  2K5I A;  3V7R A;  5D6Y A;  1YIJ A;  2HAX A;  3CME T;  1VQ5 A;  4M77 F;  1KHC A;  3DKM A;  4PJO B;  5C6S A;  3X26 B;  5KE2 A;  3ZBD A;  1N6A A;  2GCX A;  2P0Q A;  3O8V A;  3CMA A;  3L2U A;  5GAM h;  1NZ9 A;  1OI1 A;  3GNG A;  3CCE T;  2EIF A;  3P8B B;  2JVV A;  2ZCF B;  1Q81 C;  4C92 E;  3CC7 T;  2LCL A;  3UT1 A;  4B9W A;  4L59 A;  3UDC A;  5GAM g;  2GFU A;  1Q7Y C;  3TRE A;  3G4S T;  3CCR A;  3M59 A;  1XNI A;  1H64 1;  5DLO A;  3OA6 A;  4IUP A;  3TU4 K;  5GAN j;  1Q7Y U;  3CC2 T;  5LL6 S;  2EJ9 A;  3EAE A;  1WJR A;  3PNW C;  4PKC C;  5CKE A;  5A0D A;  3PTA A;  3QXE B;  2WSE E;  2DTO A;  2KDS A;  4JDS A;  5LJ5 d;  3OYL A;  3JCM W;  3A8G B;  3HRT A;  1UGR B;  4XTU A;  2VXE A;  3OY9 A;  3CCU A;  1G3S A;  2L3R A;  3G6E T;  3V7S A;  1BIA A;  5I21 A;  2LT1 A;  1WQ7 A;  3LX7 A;  4N4G A;  4A4F A;  3CPW S;  1X6O A;  2ZPB B;  2EJG A;  2HNI A;  2QQB A;  2DXT A;  1WQW A;  3MET A;  2E12 A;  2DZ9 A;  2P0P A;  1VIE A;  2VC8 A;  3GNF B;  1O9S A;  4J6X A;  3UWN A;  5FLX E;  2A3L A;  5GMK i;  4XU0 A;  4OVA A;  5CIU A;  2R5M A;  3QII A;  5LJ5 f;  5FU7 C;  3OYM A;  4M7A E;  4PJO A;  3HRS A;  4OB0 B;  3ZFJ A;  3CCJ A;  4EMG A;  3JCM c;  4QW2 A;  2D0Q B;  3A8H B;  2X35 A;  4OB3 B;  3RES A;  3JCM J;  1VQP T;  1I5L A;  4C92 F;  2CKK A;  3CCS A;  1I8F A;  2F5K A;  4M78 B;  4OB2 B;  2JTM A;  4J6W A;  2HD0 A;  3NTK A;  4M78 A;  2EAY A;  4F7U B;  2EKO A;  4C0D B;  4BDY A;  3QKJ A;  5CCA A;  3L2Q A;  1QVP A;  2M9U A;  4M7D E;  4A4K A;  4F7U A;  1XOV A;  2RK1 A;  2GF7 A;  2MWO A;  4ELY C;  3VV0 A;  4ZGD B;  4QVC A;  3I55 A;  1YIT T;  4BUG A;  2OTJ A;  3QHS A;  5J3B A;  3OYK A;  2XKO C;  2KMT A;  2KSS A;  4B9X A;  3L2W A;  4M7D D;  1YJN A;  1QVG A;  1PSF A;  2LRQ A;  1N9S A;  4EPC A;  2RJE A;  2QEX A;  5IT9 E;  3OYH A;  3A5Z B;  3S3M A;  3JCM d;  4MZT A;  3R6O A;  4BE0 A;  1VQ6 T;  2RHU A;  3N5B B;  5CKB A;  5GAN e;  3OYN A;  4MZM A;  3CD6 A;  3HFO A;  4M7A F;  5GAN d;  3JRZ A;  4E7J A;  3FIF A;  3LWI A;  2E6N A;  4M7D C;  2BIV A;  1M1K U;  4X34 A;  2OTL T;  2KVQ G;  3CME A;  1N8R C;  2DVE A;  4JRP A;  5GAN 3;  3OS5 A;  2VGN A;  1BI0 A;  3OYY A;  5GAO r;  4Z02 A;  5FRN A;  4C0F A;  3VYG A;  2V8K A;  3JCM f;  4EDU A;  2M16 A;  2E65 A;  4XK8 E;  3LGL A;  4C8Q D;  1Y07 A;  2QQA A;  2QQR A;  2ZPI B;  3X25 B;  4EMK C;  3L2Z A;  1VQ7 T;  1D3B B;  3FEO A;  2E10 A;  3QJY A;  1NE8 A;  1BIB A;  4C92 B;  5GAN 8;  2FHD A;  3J81 E;  2BKD N;  2PUO B;  2VXF A;  3JCM Q;  3JB9 H;  4E7L A;  4C5H A;  1WNL A;  2RHY A;  3OW2 S;  5FU7 B;  4IUR A;  4BD3 A;  4IKF A;  3G6E A;  4FSX A;  3CXC A;  3OSS C;  3VYH B;  1NJI C;  2LT4 A;  2X4J A;  3RKY A;  1VQL T;  2DXC A;  3QJ6 A;  3JSC A;  2XDD A;  2IG0 A;  4FT4 A;  3OYB A;  3V8K A;  2YRV A;  2DK3 A;  3TEE A;  4TVR A;  5CAI A;  2RI3 A;  2WSF E;  3BFM A;  3NTH A;  1FX7 A;  4J5Y A;  4X9D A;  5D6X A;  4XTX A;  2QTX A;  1YHQ T;  1S72 T;  2L5Q A;  4Q5W A;  3OBW A;  2DZC A;  4N4I A;  4II1 A;  3FC3 A;  2MMP A;  5M9O A;  4LD6 A;  3SB2 A;  5GAN 5;  3L2R A;  1VQN T;  3NFC A;  2RO0 A;  3M4Y A;  3J7A F;  3OYD A;  4C5G A;  2XDB A;  3M54 A;  4KT0 E;  4PJO F;  3JCM b;  2GQV A;  1K73 C;  1RL2 A;  5FU6 C;  5HK3 A;  5GMK h;  3OYA A;  1M90 C;  1KQ1 A;  3QUI A;  2R5A A;  1M90 U;  4RCC A;  1WJS A;  4XU1 A;  3ASK A;  1I81 A;  2ZPH B;  3HHT B;  4P5N A;  3QPH A;  4PLL A;  1KC8 U;  1QVF S;  3QYH B;  4EMH A;  3LH0 A;  5LJ3 f;  4M7D B;  3CBM A;  3L2V A;  2C06 A;  4RKU E;  4LDV A;  3CBO A;  3M5A A;  4QVD A;  4BY6 C;  1B34 A;  2RH2 A;  4RG8 A;  4M7D A;  1YI2 A;  4F7U F;  2E70 A;  3CC4 T;  5KE3 A;  1VQ6 A;  1JJ2 A;  5A2Q E;  1HXD A;  4C8Q G;  3RIR A;  5DLQ E;  2IVW A;  3CCQ T;  1VUB A;  4E7I A;  4EMK B;  2K2V A;  2RJF A;  4RG2 A;  3MP1 A;  4E47 A;  4HKE A;  2DPP B;  2OTL A;  3I56 T;  4A53 A;  3SWN C;  1OZ3 A;  4DOW A;  4EMK A;  3SFM A;  1LJO A;  2LX9 A;  1U8R A;  1W2B A;  2EQU A;  3G7Z A;  3FB9 A;  3QZ9 B;  2V8I A;  3PFS A;  4ZTJ A;  2F69 A;  4C8Q A;  1VQK A;  5KCH A;  2CZ1 B;  1IZ6 A;  3OB9 A;  2X4W A;  1G3W A;  2ZGW A;  1YCY A;  3JCM V;  2CYZ B;  3FDR A;  5GAM j;  3MEU A;  4J6Y A;  3G71 T;  3LW5 E;  3HP9 A;  4OF1 A;  2EQK A;  5CK9 A;  3CCL T;  2RB6 A;  1VQ4 A;  1Y7X A;  1Q86 U;  1XQH A;  3OBY A;  2VYT A;  1KQS S;  4JS4 A;  2MF2 A;  2XG8 D;  3LLR A;  2DTI A;  2JN0 A;  3PIO A;  3TCJ A;  2RK2 A;  2XHC A;  2KY9 A;  3BY7 A;  1KQ2 A;  3MP8 A;  3GPL A;  1H3Z A;  1NPP A;  2RM4 A;  3VUZ A;  3P8D A;  5GAO n;  5GAN 6;  1M5Q 1;  1Y71 A;  3HRU A;  3SD4 A;  3OYE A;  5CKF A;  4E7K A;  1MGQ A;  1VQO T;  2P4T A;  1BI2 A;  5CKH A;  4BB7 A;  2E6Z A;  5FU6 B;  2GFA A;  2RHI A;  2WSC E;  2YHT A;  4LDW A;  3T9N A;  4A4G A;  1K9M U;  3PMT A;  2LQK A;  4HCB A;  1M1G A;  3S6W A;  4QQ6 A;  1VQN A;  2QA4 T;  2DTH A;  4KUI A;  3PIP A;  4R56 A;  4M77 G;  3JCM P;  1KD1 U;  3A8L B;  2DO3 A;  5GMK l;  3JB9 G;  2CGH A;  3RER A;  5GMK e;  1VQM T;  5A0G A;  3OYJ A;  2E1H A;  1NPR A;  2D9T A;  4LD9 K;  4FL6 A;  2EFI A;  5HY6 A;  4GLK A;  4QVZ A;  1ZBX A;  3EFS A;  4MZP A;  2LDM A;  3VJP A;  4OP0 A;  2Y4X A;  5LJ3 g;  4ATO A;  4RCB A;  4L6V 5;  5CO7 A;  4ELZ C;  2K57 A;  4ZTF A;  1VQ9 A;  1TH7 A;  3CPW A;  1M1K C;  1RI0 A;  1ZHI A;  2F5T X;  3P8H A;  4C8Q E;  2XD0 A;  3QO3 A;  5FRO A;  3HKS A;  3RUX A;  4HA8 A;  3SWN A;  1XTD A;  5DY9 A;  1YJ9 T;  3E9G A;  4LDU A;  5GAM e;  1YIJ T;  3CEY A;  2RD1 A;  3C95 A;  4D6W A;  5GAM d;  2E5Q A;  3CCE A;  5GAN 2;  1U1S A;  2Y90 A;  4N0A C;  1VQ5 T;  1Y96 B;  5GAN f;  3CC7 A;  4M7D F;  3BDL A;  5GAO p;  5GAN 4;  4XAX B;  5L8R E;  3OYF A;  1EIF A;  3CMA T;  4M75 G;  3G4S A;  1LOJ A;  1Y96 A;  2RI5 A;  3OS1 A;  3OYC A;  3CC2 A;  4PL6 A;  2HQX A;  4C8Q C;  1BKB A;  5C0M A;  3DB4 A;  1VQK T;  3CCR T;  4BAC A;  1G5V A;  4C92 G;  4BE1 A;  1SSF A;  5LJ5 h;  3F70 A;  2RI2 A;  4JRI A;  3VKI A;  2B8A A;  3WXM B;  3CCU T;  5CQX A;  3RMQ A;  4C8Q F;  3S3O A;  2RHZ A;  3GP8 A;  5LJ5 g;  2P0K A;  4XTW A;  2DEQ A;  3Q1J A;  2QXF A;  4NL2 A;  3JCM X;  3FLG A;  3MEV A;  3J80 E;  4XQ3 A;  3E9F A;  2MAM A;  1M1F A;  1OYX A;  1UEB A;  3QZ5 B;  3CBP A;  4CRI A;  1VQP A;  4Y28 E;  2L89 A;  2K3Y A;  4IUV A;  3X20 B;  1JJ2 S;  4O5V A;  3URG A;  3X28 B;  3BW1 A;  2DXB A;  5GMK m;  3CCJ T;  2DIQ A;  1QW1 A;  3WVE B;  4FU6 A;  4N4H A;  4M7A G;  5HKC A;  4M77 E;  2KQW A;  3V8J A;  4FM4 B;  1JRI A;  3DLM A;  3FRN A;  3KUF A;  1KC8 C;  2CS7 A;  1KG1 A;  2LQ8 A;  1YIT A;  1B34 B;  1K8A U;  1VIF A;  3A8O B;  4M77 D;  4YTL A;  1UB4 A;  4O6J A;  2DKG A;  5EG2 A;  2RJC A;  4DOV A;  3JB9 D;  4C0G A;  4MDW A;  3OW2 A;  3OYI A;  2PVO B;  3EFR A;  2OAU A;  3I55 T;  2OTJ T;  3E1S A;  2K3X A;  3KBG A;  4M77 C;  4MMK A;  1YJN T;  5GMK j;  3JCM h;  3LYI A;  2QEX T;  3CCM T;  2O4X B;  3RMS A;  4GY5 A;  2JNG A;  4N0A A;  1VQ8 T;  3L42 A;  5GAN h;  5DM7 R;  3ME9 A;  2O4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...