4M75D

Crystal structure of lsm1-7 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
EFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 13
structure length 72
sequence length 72
chains with identical sequence K
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75D00
5GAN3 2RD1A 5LJ5h 1D3BA 5GMKl 4Y91A 5LJ5j 1LOJA 4PNOA 3L2ZA 2EJGA 4M75B 5GAMd 4XTVA 4C92D 4M78B 4M77B 2EWNA 3JCMh 5LJ3f 5LJ5g 3EFRA 3HSBA 4M77D 1WPYA 2E64A 3JCMc 1BIAA 2FB7A 3RERA 1JBMA 4JRIA 1MGQA 4M7AF 4EMKC 3JCMg 2DTOA 2YHTA 3RKXA 4X9CA 4JLIA 4XTXA 1LJOA 2QTXA 4PJOF 4F7UF 5GANe 3VU3C 3FJPA 3BFMA 3AHUA 3JCMb 4M75G 3JCMX 3BDUA 5LJ3j 2EJ9A 2DTHA 4XQ3A 4M7DG 4M75C 3RIRA 4C92A 4M78G 1HXDA 1TH7A 4PJOG 1H641 4M78C 4M77A 4M77C 4F7UG 5GAOp 4HT9A 3JB9H 3V7RA 4EMKA 4MMLA 5LJ5d 5GANh 1U1TA 2Y90A 1M8VA 2RA2A 2RM4A 4C8QF 1KQ2A 4J6YA 4M7AB 4M7DB 2CGHA 2VXEA 4M75D 3JCMd 4M7DD 5GANg 1X01A 3QHSA 5GAN2 2DKGA 4M78D 3RKYA 1YCYA 4F7UB 5GAOl 4PJOB 4C8QG 4PJOD 3QO3A 5I21A 2K57A 1B34B 4OP0A 5GAN4 5DY9A 4N0AA 4N0AC 2DEQA 4J6XA 5GAN6 5LJ3d 2DZCA 1I8FA 5GAMe 2E10A 2HNIA 5GANf 5GAOm 4M7AG 2JN0A 4M75A 1BIBA 4RCBA 2VXFA 4XTYA 5CAIA 4M7DA 4M7DC 4M7AC 2DXUA 1Y96B 4M78A 4C8QB 4EMHA 3BW1A 4M75E 3JB9F 4PJOA 4C8QD 4JUVA 4C92E 4F7UA 1M5Q1 4QVCA 4PJOC 4NOYA 4M78E 4M77E 3JB9I 5GAOr 1N9SA 2E65A 2FYKA 1WQWA 2E1HA 3HFNA 1B34A 4XU3A 4HA8A 5GAMh 5GANj 2YLCA 3V8KA 1N9RA 3QSUA 4WF2A 4XU2A 3SWNB 4M7AD 1I4K1 2I2LA 3FB9A 4J6WA 4MMKA 1D3BB 4C92F 5GAMg 1U1SA 1HK9A 2E41A 3PGGA 3V8JA 1Y96A 3FIFA 1WNLA 4C8QA 4C8QC 3HFOA 4XU0A 3JCMV 3V8LA 3JCMQ 4EMGA 4JRKA 4HT8A 3EFSA 2EJFA 5GAMf 1I5LA 2EAYA 2DXTA 4M7AA 3SWNA 3SWNC 3JCMJ 3M4GA 3JCMP 2DJZA 2YLBA 2RB6A 3SB2A 4M7AE 1WQ7A 4M7DE 2DVEA 5GANd 4C92B 5LJ3e 4PJOE 4F7UE 4XTUA 5GMKi 2ZGWA 3V7SA 3V7CA 4XTWA 5GAMj 3JB9G 4EMKB 3L1AA 1JRIA 3INZA 3RESA 5GMKe 5GAN7 5GMKm 4M75F 4A54A 5GAN5 3JB9J 4M7DF 2DTIA 4M78F 4M77F 4XU1A 4RCCA 2DZ9A 4X9DA 5LJ5e 5GAOn 3JCMW 4DQ2A 1LNXA 5LJ3h 4A53A 5GAOq 5LJ5f 3QUIA 4C92G 4QVDA 1KQ1A 4J5YA 4NL2A 4C8QE 5GAN8 4V2SA 3BY7A 4M77G 4C92C 4NL3A 3GIBA 3JCMe 1I81A 3JB9D 5GMKh 3RUXA 5LJ3g 5GMKj 3JCMf 4XTZA 3RKWA 2VC8A
chains in the Genus database with same CATH superfamily
1BB9A 2NUTB 5LJ5h 1WIEA 3CBPA 1GCPA 2LCSA 2NUZA 5GJVB 3PT9A 2A7YA 1S72T 3C12A 4JLIA 3EH2A 2P0QA 5FU7C 3HRTA 4C92A 1M2OA 2FZGB 4E7HA 4M78C 5FROA 1VQNA 2DL8A 2DBMA 1ZBXA 5J26A 1VQ7A 4M7AB 9ATCB 1K0XA 1YJNA 1GFCA 3X25B 2PVGB 1UGPB 1NG2A 3UA6A 1XQHA 4E7IA 1QP3A 5CAIA 3S3MA 2JTEA 3EFOA 5FWCA 4M77E 2L2PA 2YLCA 1WHHA 5KCOA 1AOJA 4ORZA 4E6RA 2EW3A 2BZ8A 1KSWA 1Q7YC 1MHNA 1O75A 1UGSB 2QEXQ 4XU0A 2HD0A 3MP8A 4HT8A 4BI4A 4MZPA 2XI9A 2RQWA 1WYXA 4OVAA 2HKQB 5FU6B 2RB6A 3RMQA 4M7DE 1GCQA 2I0NA 2X3XD 2EQIA 2H3JA 2BTTA 1PKSA 2OAUA 1U5SA 1VQ9Q 4A4EA 1JRIA 1YJ9Q 5I2SA 2VYTA 1PSEA 3FC3A 4X9DA 3JCMW 3M56A 1GFDA 4J9FA 3RUXA 4XTZA 2VC8A 3BDLA 2A0FB 2X4JA 3A8OB 4Y91A 3EAEA 2LNHB 4M75B 2EQKA 3CMEQ 3U23A 3L2VA 3RERA 4LE9A 3CC7T 1Q7YR 4CC3A 1JQQA 3H6ZA 3M0PA 3EG2A 2L3SA 2D8HA 3TQ7P 1RUWA 3OY9A 3KXTA 4EMKA 3I5SA 2KRNA 5LJ5d 2YWWA 2OTLT 2ROLA 2P0KA 1Q82U 4RG8A 4KGZB 3CCVQ 4M78D 1HYOA 5CKHA 3CCJQ 3QO3A 1OPKA 2HSPA 1G83A 1VQOQ 1YIJT 1MV0B 1QQJA 2KR3A 1E6GA 3CCUA 5GAMe 5L8RE 4XTYA 2AKLA 3EGXB 4OGCA 1IGUA 1PM3A 4DBRA 3CC4T 3EH1A 2RHXA 3FJ5A 1X75C 1SSHA 1B34A 4QQ6A 5GANj 1K9MC 1G3YA 3OYDA 3MEWA 3CXCS 5FRMA 2SRCA 5D6XA 2PTKA 3G4SQ 1X6OA 3EG1A 3NMZC 4DOVA 1Q82R 5IN1A 3PVLA 2RO0A 2O4XA 2MF2A 3EG0A 3EG9A 2ZPBB 4Z8AA 5IHNA 3I35A 2DXCA 1NLPC 2ESWA 2DX1A 2QDLA 4KRTA 3V7SA 2CH4A 4J9CA 3CD6Q 1AHJB 3P8BB 2JM9A 1PD1A 1ZSGA 2YUOA 2L3PA 4FW2A 1I0CA 4M77G 4PFZA 2MMPA 3PFSA 1NZ9A 3OYLA 1YJWT 3UDCA 1VQ7Q 3EHQA 2DD5A 3FDRA 1I07A 1YJNQ 3M5AA 2RN8A 2Z0WA 1IZ6A 1QVPA 2PQWA 4RTVA 1K9MR 2RJDA 3CCEA 5CR2A 3H0HA 4RTUA 2YHTA 3VS0A 4PLLA 4JDSA 4HCCA 4M7DG 3PVQA 3UATA 1RAAB 3OYYA 1HXDA 2JOYA 3E9GA 1H641 4M77A 1E7OA 1M3BA 1W2BP 2RM4A 1WXTA 2ZCFB 1BCOA 2QAZA 5J3BA 2CUDA 2EFIA 3H9NA 3CCQQ 1YCSB 3MO8A 4N4IA 5KE3A 1B34B 1KHCA 2M16A 5KYXB 1V1CA 2J6OA 1WHMA 3SDZA 3KUFA 1T3LA 3NPFA 1SRMA 4C5GA 4M7DA 1H3HA 3CCRT 1TUDA 1M2VB 1Y0MA 2KT8A 2LTOA 5A0GA 2O4XB 4Y92A 1YBYA 3CCST 3HFNA 2XU8A 1SHGA 4HA8A 2KAFA 3MJXA 3OW2A 1G3SA 1FYNA 8AT1B 1D0YA 2FL7A 5C6SA 4FCYA 1WNLA 1YITQ 1VQ5T 1N8RU 1VQLT 3EFSA 4ZGDB 3JRZA 3JCMP 5CVIA 5IHIA 3L2UA 2F2WA 1AWXA 3I56T 4KT0E 4KGVB 2BIVA 5GMKi 3RESA 2DTIA 4UC4A 3OMCA 2F1LA 4A4HA 4MZMA 5GAOq 4EIKA 4QVDA 2D6FA 2OTJA 1IXDA 3HL8A 1X69A 2M51A 2JUFA 1K0SA 3QZ9B 5GMKl 4JLGA 4PNOA 1K73U 4M77B 5LJ5g 3CCUQ 1ZUUA 1WPYA 2E64A 2KMTA 1WZOA 2YUQA 3SEMA 2FB7A 3C4SA 5KYYA 1Y57A 1UG1A 1ZSZB 4JS5A 3C94A 2MYSA 5GANe 3JCMX 2YRDA 5LJ3j 3CCLQ 1FXXA 4RTZA 4DEYA 2FRWA 5GAOp 1UTIA 2DRKA 4AT1B 1TXQA 1RLPC 1WA7A 4X1VA 2HL3A 1SKUB 1RADB 2M0YA 3M0UA 3QPHA 1VQKA 4M7DB 2CGHA 4P5NA 2GTOA 2QYZA 2FZKB 2GQIA 1WHJA 3F70A 3S3OA 3ZBDA 1SRLA 2RHYA 3LWIA 5GAN6 2D8JA 2JN0A 4RCBA 1K1ZA 5KYUA 3HTRA 4C0ZA 2XIDA 8ATCB 2P0PA 1N9SA 2FYKA 3CPWP 4OB0B 1UEBA 1KHIA 2IG0A 2DIGA 1ZQ1A 2E5KA 2OAWA 3EGDA 2JTMA 2QEXT 2BUDA 2E41A 1K9AA 2AKKA 4JRKA 2ROTA 1Z9ZA 1WGSA 4ATOA 2RK1A 4D8KA 1WHLA 3SWNA 3CBOA 2EGEA 7AT1B 1VQ9T 1N27A 2CS7A 1BU1A 2HZYA 4F7UE 2D1XA 3CCEQ 2ED1A 1YJ9T 2HEQA 4F16A 3JB9J 4R0KA 2QQBA 2CREA 1WJRA 4LDXA 3OYHA 2F69A 2DA9A 2LJ3A 4C8QE 3OYKA 1D1AA 4LDWA 1I81A 4PFPA 2AZSA 4B9WA 2DL7A 3JCMf 2NUPB 3SD4A 3UWNA 3CMET 2K3BA 3H0FA 5FRNA 1QMCA 1A0NB 1MGQA 1PG5B 3M4YA 2E5QA 4F17A 3G7ZA 1BI2A 2HBWA 3PIPA 3MCAB 3TVTA 2X4XA 2E12A 1IREB 3OS2A 1SF9A 3J81E 3CCVT 1H8KA 2K2VA 2LQWA 3G6EQ 5KYUB 3CCJT 1ZA1B 1VQOT 2QTVA 3C95A 4BI3A 4PJOD 4Q5WA 1VQPA 4L59A 2WACA 4N0AC 2DEQA 2NUTA 4Y28E 2KI7A 4M7AG 2RHIA 3EGDB 2FHDA 5A2QE 1SEMA 1AT1B 1M5Q1 2LNVA 1KC8U 4M78E 3O5ZA 1RAFB 3A8HB 4D6WA 3HPWA 3G4ST 3SWNB 3QJ6A 1TUGB 5D6WA 4C92F 1UUEA 1U1SA 5FW9A 3V8JA 3MPUB 2WSFE 2G6FX 1NJIC 5KYNA 4ZGJB 5GAMf 1I1JA 4M7AA 1NE8A 3G71A 3OW2S 1KQSP 4CC7A 3LWHA 3DKMA 2WSEE 3CD6T 3QZ5B 2DVEA 5LJ3e 2QK0A 3JB9G 1NM7A 3INZA 5GMKe 1R0BG 4OMOA 3QYHB 2ENMA 1G3WA 1RI9A 1Y71A 1LNXA 4PK4A 2DNUA 4NL2A 4C92C 2X35A 1VQ7T 2LP5A 1YJNT 4RTWA 5GAN3 3ZFJA 1VQKQ 3X26B 1LVKA 5LJ5j 1Q86U 3M0TA 1WLPB 1ABQA 1NLOC 2ATCB 3A8MB 3OS0A 3X24B 1M90U 3LX7A 2GFAA 1BCMA 3QKJA 1JBMA 2RHUA 3VV0A 4M75G 4JJDA 1VQ6A 2Y4YA 4F7UG 1NJIR 3GBQA 2VV5A 2EYQA 2AHJB 3T9NA 4HXJA 1XNIA 2QI2A 1YWPA 3OBYA 1EZZB 1EIFA 1VQMA 3GPLA 3CCQT 1UECA 2KE9A 2K3XA 4E7ZA 1WHGA 1X01A 3RKYA 4RTYA 4C8QG 1X2QA 1Q86R 3OBWA 2EKHA 4MDWA 1G8XA 4O5VA 4BE0A 1M90R 2CP3A 2DZCA 3VRZA 3QWXX 4FT2A 4J9EA 4M75A 2VXFA 4GY5A 4F7UA 4JUVA 4QVCA 1GCQC 3IQLA 2KT1A 3VS5A 2XDBA 1MUZA 3CPFA 4WTOB 5GAMh 2L5QA 1S1NA 3V8KA 2X4YA 1P92A 1C1AA 1YITT 4DBHA 4JJCA 4KBMB 2O9SA 3LGLA 4FL6A 1Y96A 4C8QA 3JCMV 2VUBA 4EMGA 2DL3A 2XKOC 2KY9A 4HVVA 2G3RA 4ZTFA 1MMNA 2EAYA 1UJYA 5IH2A 2ZPEB 2RJCA 3OSVA 2JTFA 4XTUA 4DOWA 4LNPA 5D7UA 5CK9A 2LZ6B 2FO0A 2RJFA 3EGXA 3CCMQ 1Y07A 3A98A 3KBGA 2O2OA 2O01E 3JCMe 3CEYA 1K76A 3QWYA 4EMKC 2MK5A 3VU3C 4JZ4A 2XD0A 4ELZC 2A37A 3CCUT 4BY6B 3H8ZA 4C92D 2QXFA 3HSBA 1VQPQ 2J6FA 4X34A 3M0QA 4PJNA 1BIAA 3NFCA 3TU4K 1VUBA 1B7TA 1BI0A 1MV3A 3CCLT 3OQ5A 2FRYA 3BDUA 1NYGA 1OOTA 1IGQA 1VOMA 1I5OB 3M57A 1OU8A 2IIMA 2EYYA 4FT4A 1B3QA 2ED0A 1EX4A 1QWEA 1QVFA 2KBTA 5CKFA 1DJ7B 1W4SA 2F2XA 4OB2B 1YFNA 2KQWA 2J05A 4LDUA 4F7UB 2M9UA 3THKA 1Q82C 4C0DB 3VUZA 4RG2A 3G71Q 1SHFA 1I8FA 1NYFA 2FVUA 3OYJA 5GANf 3UA7A 3JAME 4CRIA 1Y96B 3JSCA 1OPLA 1VYVA 4C8QB 3OYNA 3PIOA 3UPUA 1JJ2P 2BE7D 3QSUA 4LUDA 1BI3A 2GBQA 4OMNA 2I2LA 4JPBW 2DF6A 3I55Q 1YHQA 2LT1A 3OYFA 2VASA 3VKIA 3R6OA 2YRCA 3L42A 2E3HA 2A28A 1WI7A 2DXTA 1OV3A 5HCKA 1M3CA 1BBZA 1QVGA 1WQ7A 3CC2A 3CCET 2LJ1A 3PMIA 4O6JA 3N5BB 5KYXA 2HMAA 1FMVA 4M7DF 1CKAA 2C0OA 3GF5A 2C06A 4A53A 1M2VA 2DYIA 3MEVA 3RDVA 5FU7B 3EG3A 2RK2A 3NHNA 2K2MA 4M78B 2QQAA 1JXOA 5HK0A 2DTOA 4HVWA 3BFMA 4FIBA 1VQNQ 1YP5A 5L23A 2YUPA 1MMDA 3G6ET 5GANh 1ZHIA 2OJ2A 1KD1U 1GRIA 4WCIA 2OTLA 3FLGA 3GLXA 3UT1A 2NYSA 2JNGA 2ECZA 1QCNA 2E10A 2XMFA 3RR6A 1MMAA 4IKFA 1YNZA 1M8MA 2LQKA 1ZSZA 2LC4A 2DD4A 4LD9K 2XDDA 4J6WA 1ACMB 1X27A 1QW1A 2DERA 3PGGA 2EPDA 3RNJA 4LDVA 1Z9QA 2DEUA 1XTDA 1NEBA 2QG9B 1N8RC 5A0DA 1D0XA 2EYXA 4FYXB 4LDYA 1M4ZA 2K6DA 1JU5C 2M02A 3HHTB 2LDMA 3CMAA 4GLKA 2CDTA 3H0IA 4FYYB 3PE0A 2MCNA 3G1JA 3OYAA 2JVVA 1YN8A 1LPLA 5GAN8 3I5RA 1QLYA 1VQKT 4AMCA 4ZN1A 1WXBA 1J3TA 1IHWA 1LOJA 2V8JA 1YJWA 5LJ3f 4M77D 3L2RA 2FPDA 1BI1A 4JRIA 1K73C 1RAIB 4PJOF 4Z02A 1PWTA 2QGFB 3CXCP 4A4FA 2DXBA 3MKDA 2DYBA 2K7AA 3VS2A 4MMLA 4EPCA 3L2QA 1N8RR 2E4HA 4RUGA 1ZX6A 2O88A 1YHQQ 4M7DD 5CIUA 5GAN2 1H92A 2EYZA 1HJDA 1LCKA 3AT1B 2K57A 1IB8A 2NUPA 1QVFS 2RMOA 1IO6A 5GAOm 3CC2Q 5J39A 1OU9A 1UJ0A 3CQTA 3MHXA 2VB6A 2ZPIB 4PJOC 1JEGA 2X51A 2E65A 1R77A 4DBQA 1WDXA 1M1KU 1WQWA 4IUUA 3DLLA 1PC0A 3M9QA 4XU2A 3CCRA 5GAMg 1D3BB 1E6HA 1UHCA 3CCSA 4HCKA 1OX9A 3HKSA 3ZL7C 2YT6A 3OS1A 1K73R 3J80E 3NTHA 3JCMJ 1QCFA 4R56A 4QT7A 3SB2A 4E7JA 4IIOA 4ANJA 1SSFA 1KFZA 5LL6S 3S6WA 3URGA 1MNEA 2QQSA 2MAMA 3CCMT 2P84A 4PJLA 4RKUE 2K3YA 1X43A 6AT1B 5LJ3h 1QVGS 4AFQC 1K4US 1KQ1A 4E7KA 2JJ9A 5GMKh 2CUBA 3RKWA 3HP9A 1PCXA 2RD1A 3NTKA 2GF7A 1JXMA 2FZCB 1TUCA 2KXCA 1VQPT 3QDRB 4QKUA 2ZZDA 1VYTA 1BYMA 2L8DA 3JCMc 3GNFB 4N4GA 4M7AF 4VUBA 2EGAA 1LJOA 2DIQA 4XK8E 3OYMA 1JO8A 3AHUA 1MMGA 5CO7A 1IHVA 4E7SA 4AFUC 4FW1A 4AFZC 4ZGEB 2R5MA 4RMOA 4HCZA 2FEIA 4ME7A 4QVZA 2V1QA 4OF1A 3WXMB 5IHKA 2CP5A 4C0GA 2JXBA 4JRQA 3QHSA 4L6V5 3QXEB 2K5FA 4OMQA 3R6NA 4B9XA 5I21A 3G71T 2DLPA 5GAN4 2NWMA 5IT9E 2X9HA 5ECAA 1UDLA 3ZEHA 2KEAA 4E2FB 4E47A 4M7AC 2MOXA 1NPPA 3OYEA 4KUDK 2ZPGB 2DM1A 2PVOB 3BW1A 4KULA 2K4YA 3JB9F 3MEUA 1M27C 4OGEA 3CMAQ 1W2BA 2MWOA 2H8HA 2COZA 2M1HA 2DVJA 4IUPA 1KC8C 2KRSA 3I55T 1H3ZA 1OZ2A 1VQ4A 2RQRA 1X6GA 5KYWA 4BDZA 2BZYA 1QKXA 5FWBA 1RAEB 2QEXA 1KK7A 2EJFA 2J7IA 3OYBA 3M0SA 2KXDA 2DPPB 1OI1A 3TCJA 1GL5A 4ESRA 4CI0C 2AT1B 4RTTA 4PJMA 4GBQA 4JRPA 2EKOA 4M75F 2SEMA 4BB7A 2EGCA 1OQKA 4C0FA 4OMPA 4J9BA 3OMGA 2OTJQ 2M0OA 4MZTA 5FU6C 3QYGB 2KVQG 3QUIA 5LJ5f 2A36A 5DM7R 2KYBA 1IRXA 1D0ZA 2DL5A 2EQJA 2P4RA 1YI2A 4IIMA 4FYWB 3D7SB 4XTVA 3JCMh 2X4WA 3VS3A 1D1CA 1T0JA 2CZ7B 1Q86C 4A63B 1M90C 3MP1A 1KC8R 4X9CA 3X20B 1FX7A 4RTXA 1VQNT 1K8AU 1TOVA 1RACB 2L89A 2D0QB 2RJEA 3OS5A 2KROA 4M75C 4QQGA 4GLMA 3A8LB 1TH7A 2K5LA 2KSSA 1AEYA 2JM8A 4PJJA 2EVRA 5HK3A 5EG2A 2JZ2A 3OYGA 1U1TA 1QP2A 2XHCA 1M8VA 4N4HA 4J6YA 3JV3A 2R57A 1W6XA 2VXEA 4J9HA 4PFOA 5GANg 4JZ3A 2BE9B 3NGPA 5GAOl 2PZ1A 4C5IA 1G2BA 1AD5A 2QASA 2EQUA 4N0AA 1Y7XA 3CCJA 1VQOA 2LCLA 1D09B 3QJYA 2JMAA 4B6MA 2HKNA 5KYWB 2V26A 4NOYA 3JB9I 1U3OA 4XU3A 4A4GA 1N9RA 4F14A 1NEGA 4M7AD 1AZGB 3ME9A 1I4K1 1HK9A 2DO3A 4J7FA 1NPRA 2L0AA 2D0NA 1VQ8A 2E6NA 3G4SA 1JJ2S 1M1GA 3HRUA 2F2VA 1Q81U 2PU9B 2YLBA 2RHZA 3P8HA 3CPWA 1WJSA 2GQVA 3V7CA 2HQXA 2COWA 5CKDA 4IUVA 3CD6A 1CKBA 3M55A 4DQ2A 2ZPHB 1RAGB 3JB9D 3VYHB 5C0MA 4BE1A 3S3NA 4J83A 1PRLC 3BE3A 1RLQC 1ARKA 1Q81R 1QCOA 2C0TA 4PLIA 4XTXA 2QTXA 4XAXB 3META 1U8RA 4L5GA 4J9DA 2A08A 2EJ9A 4R55A 4M78G 3VUBA 2VKNA 2QA4A 5M9OA 2CP6A 4OMMA 1W70A 2XG8D 1YHQT 1M1FA 1KQ2A 2EIFA 1UGQB 2RF0A 3JCMd 2EYWA 4M75D 1VQ4Q 1F1BB 1CSKA 2DKGA 3OW2P 1YCYA 2O9VA 3M54A 3VS6A 1QKWA 3CC2T 3CCQA 4J6XA 2OI3A 1TS9A 1BIBA 2GFUA 1TWBA 4M78A 2R58A 3LH0A 1S72A 4C8QD 2VGNA 1Q7YU 2JS2A 2Y4XA 2E1HA 5GJWB 2VGMA 2BZXA 2DFUA 4DBFA 4LN2A 3M53A 1GXIE 2OX7A 3FB9A 3L2WA 4JJBA 3FIFA 3V8LA 3JCMQ 1VIEA 2K79A 1W2BS 3PMTA 2IPOB 1YITA 1YI2Q 3M4GA 2AK5A 1X6BA 4J9IA 4C92B 2W10A 4D8DA 5I22A 3DB3A 5EC7A 2MPXC 4XTWA 2V8IA 1AVZC 3VS4A 3OYCA 5GMKm 2YSQA 4CC2A 2LQNA 4M77F 4RCCA 4XU1A 4C5EA 5LJ5e 2XICA 2DRMA 5IXBA 1R8OB 5LJ3g 1KQSA 1WHKA 4FSXA 2XDPA 3E2UA 2RQUA 3L2ZA 2LCCA 3A1PA 2P4TA 2HQHA 3MEAA 5GAMd 1U06A 3EFOB 2E6ZA 2HSEB 3PTAA 2CT4A 2IVWA 1KG1A 1VQ6Q 1OX8A 3PNWC 3FJPA 5DLQE 2ZAEA 1TG0A 4M77C 4FYVB 3CCLA 1VQMQ 4NS5A 4J7IA 2QGGA 4C5HA 2Y90A 2GGRA 1ZSZC 3LGFA 1WJQA 2DILA 2LX7A 2X3WD 4ELYC 1VQ8Q 4JJNK 1KD1C 1T0HA 2KGTA 2JMCA 2R5AA 4OP0A 2CYZB 1R0CB 2MIOA 3J7AF 2D9TA 1PKTA 2FPFA 3CMAT 4FU6A 4M7DC 2DXUA 1K9MU 4KH0B 2JW4A 3E9FA 3CC7A 3VS1A 4EDUA 1VYUA 4OB3B 1X2KA 5GAOr 3KFVA 4J9GA 2KNBB 2LX9A 3E1SA 4PKCC 2DE0X 4YTLA 1XJWB 2NLUA 3Q1JA 3HFOA 3C0CA 2B8AA 1XOVA 2MWPA 1I5LA 1SPKA 5HKCA 1YIJA 5CCAA 2ABLA 2B86A 4PJOE 4EMKB 1C6VX 2GTJA 2FPEA 5I2MA 3I9QA 3CC4A 2OTJT 4QQDA 2AIRB 2DZ9A 1KD1R 2QA4Q 3CPWS 4NL3A 2QQ9A 1PHTA 3UF4A 3EHRA 2LQ8A 2W0ZA 1ZUYA 1D3BA 2HAXA 4MDXA 1JB0E 3EFRA 2QDYB 2RPNA 2V8KA 3JCMg 3RKXA 3M0RA 1S72Q 3WVDB 2DTHA 3WVEB 1KIKA 1MNDA 1YWOA 2FG0A 2YRVA 3GNGA 2LRQA 3EG9B 1D1BA 4A4KA 2ZPFB 1PNJA 4CC4B 1WFWA 1N5ZA 3G6EA 3O8VA 1PSFA 1RAHB 1UGRB 2RNAA 3EGUA 2GCXA 5KE2A 1M30A 2E70A 3QDFA 1V76A 1SG5A 4EMHA 2BKDN 2HBPA 4Z88A 4IUQA 2DAQA 1O9SA 1B07A 1M1KC 2J6KA 3VRYA 3TEEA 1UHFA 1ZBJA 3X28B 1M9SA 1OYXA 3QG1A 1ABOA 4J8OA 3SWNC 4JS4A 2JT4A 4M7AE 1AWWA 2RQTA 3SHWA 1JJ2A 5GANd 1UE9A 2L3QA 2CP7A 2CSQA 3A5ZB 1G5VA 3H41A 1ZLMA 3L1AA 2CZ0B 1WXUA 1VA7A 2H3EB 2GNCA 5CQXA 4V2SA 1Q95G 2EQMA 2HL5C 3BY7A 5HY6A 2XK0A 3GIBA 4DA4A 5GMKj 3M59A 4HVUA 2CH4W 1VQ5A 4PL6A 3OA6A 1VQLA 5I11A 2EJGA 5CQYA 2EWNA 4BD3A 1FMKA 4QW2A 1KQSS 4ZNXA 3I56A 1M1KR 3OYIA 1HSQA 3CC7Q 4XQ3A 4FM4B 4PJOG 4DEXA 1RI0A 4HT9A 3JB9H 2WSCE 2QQRA 4KGXB 1EFNA 4BUGA 1VQ4T 2RA2A 3QBYA 3VYGA 5IXFA 2OTLQ 5KCHA 1T3SA 2JS0A 2PVDB 1BKBA 3DB4A 2LMJA 3TREA 2YUNA 3OSSC 3SFMA 5DY9A 1YIJQ 4LD6A 2RQVA 3LH5A 4ZTJA 2E3IA 2HNIA 2KK4A 4FSSA 2V1RA 1PRMC 4BE2A 1BK2A 1GBQA 4M75E 3REAB 1KJWA 4PJOA 5IAYA 4C92E 5A0LA 2PUKB 2CSIA 3CC4Q 4LUEA 2CZ6B 4KUIA 4OB1B 3TSZA 4IUTA 1VIFA 2RI2A 1UFFA 1AWJA 3DLMA 3VJPA 1UB4A 2C0IA 2F5TX 1YI2T 3ER0A 3A8GB 5KYYB 2CP2A 3E19A 2RH2A 2LVMA 1WX6A 1OZ3A 3LYIA 5CKEA 2O31A 2F5KA 2K9GA 4A54A 5GAN5 4KH1B 2VVKA 5GAOn 2L3RA 1M3AA 1UGVA 3GP8A 1OEBA 3CCMA 2A3LA 3LLRA 1V29B 3REBB 2DJQA 1QWFA 4BI8B 1YJWQ 1RABB 2AZVA 2CP0A 1QVFP 4K11A 2VWFA 3OB9A 1TTHB 2EBPA 1VQ6T 3LW5E 2K5IA 4Z89A 1VQ9A 1GBRA 2HDAA 3ULRB 4F7UF 1YJ9A 3JCMb 1OULA 1C0MA 3RIRA 4AG1C 3FEOA 4BY6C 1VQMT 1K8AC 2CZ1B 5AYFA 5FLXE 2HQEA 3V7RA 5CKBA 4AG2C 3TSWA 4E7LA 2DMOA 1NBEB 4C8QF 1VQ8T 2CKKA 5D6YA 4F04B 2COYA 3MP6A 3NTIA 2DETA 2RI5A 4PJOB 2LJ0A 1AZEA 3CMEA 1FWZA 3VS7A 2HCKA 5LJ3d 3CXCA 2DBKA 3CBMA 1HD3A 1RL2A 2KYMA 2PNIA 4ZN3A 1QVGP 4C0DC 3CCRQ 1N6AA 4WF2A 2MI6A 3CCSQ 2KDSA 4OMLA 4MMKA 1FMWA 3QIIA 1NJIU 4IURA 2KRMA 4OMFB 4BACA 4C8QC 2J06A 3CCVA 3M58A 3RBBB 1VQ5Q 1ZUKA 4M4ZA 3I55A 2PUOB 2YXYA 1VQLQ 2DL4A 2YDLA 2DJZA 1W1FA 4LXCA 3GOXA 1K8AR 4II1A 5DLOA 2DK3A 1AWOA 2ZGWA 1Q81C 2LT4A 5GAMj 2CT3A 3I56Q 3FRNA 4TVRA 5GAN7 3RMSA 5AT1B 4AFSC 4BDYA 4HKEA 4M78F 5KH6A 2QA4T 1PD0A 3HRSA 1ZA2B 1G3TA 4C92G 2RI3A 4HCBA 4J5YA 1TSFA 3ASKA 3P8DA 1TU0B
chains in the Genus database with same CATH topology
4FSXA 3SD4A 3UWNA 3CMET 2XDPA 5LJ5h 1LOJA 3L2ZA 2LCCA 2P4TA 3MEAA 5GAMd 2V8JA 3CBPA 1YJWA 5LJ3f 4M77D 2E6ZA 5FRNA 3L2RA 3PTAA 1BI1A 1MGQA 2IVWA 3PT9A 2A7YA 3M4YA 4JRIA 1S72T 1K73C 2E5QA 3C12A 4JLIA 1KG1A 3G7ZA 1BI2A 4PJOF 3PNWC 4Z02A 2P0QA 3FJPA 5FU7C 3PIPA 3MCAB 5DLQE 3HRTA 4A4FA 4C92A 2DXBA 2X4XA 4E7HA 4M78C 2E12A 4M77C 5FROA 1IREB 4MMLA 4EPCA 3OS2A 3L2QA 3CCLA 1VQNA 1ZBXA 4NS5A 4J7IA 3J81E 4C5HA 2Y90A 3CCVT 5J26A 1VQ7A 2K2VA 3LGFA 1WJQA 4M7AB 3CCJT 1VQOT 3C95A 4BI3A 5CIUA 5GAN2 4ELYC 1YJNA 4M7DD 3X25B 2PVGB 4PJOD 4JJNK 1KD1C 1UGPB 2K57A 4Q5WA 2R5AA 1VQPA 4OP0A 4L59A 2WACA 2CYZB 1XQHA 4N0AC 2DEQA 4E7IA 1QVFS 4Y28E 3J7AF 5GAOm 4M7AG 2RHIA 2D9TA 1QP3A 2FHDA 5CAIA 5J39A 5A2QE 4FU6A 3S3MA 2DXUA 3CMAT 4M7DC 1K9MU 3E9FA 2ZPIB 3MHXA 3CC7A 4EDUA 4PJOC 1M5Q1 2LNVA 1KC8U 4M78E 4M77E 4OB3B 5GAOr 2E65A 1M1KU 1WQWA 3A8HB 4D6WA 2YLCA 3HPWA 4IUUA 3DLLA 5KCOA 3M9QA 3G4ST 4XU2A 3SWNB 4LDXA 3CCRA 4HT9A 3QJ6A 1Q7YC 1MHNA 2LX9A 3E1SA 4PKCC 5D6WA 1D3BB 4C92F 5GAMg 4YTLA 1U1SA 3V8JA 1O75A 3CCSA 2NLUA 3Q1JA 1UGSB 3HFOA 2WSFE 4XU0A 3HKSA 2B8AA 3OS1A 2HD0A 3MP8A 3J80E 1XOVA 1NJIC 4ZGJB 4HT8A 4BI4A 4MZPA 2MWPA 5GAMf 2XI9A 3NTHA 1I5LA 4OVAA 4M7AA 1NE8A 5HKCA 3G71A 3OW2S 3JCMJ 1YIJA 5CCAA 4R56A 5FU6B 3LWHA 2RB6A 3DKMA 3RMQA 3SB2A 2WSEE 4E7JA 4M7DE 3CD6T 2H3JA 3QZ5B 2DVEA 2OAUA 1SSFA 5LJ3e 5LL6S 4PJOE 3JB9F 3S6WA 3URGA 3JB9G 4A4EA 4EMKB 1JRIA 3INZA 5I2MA 5GMKe 5I2SA 3CC4A 2QQSA 2MAMA 2OTJT 3QYHB 3CCMT 2VYTA 1G3WA 4QQDA 1PSEA 4RKUE 2DZ9A 2K3YA 4X9DA 3FC3A 3JCMW 1Y71A 3M56A 1LNXA 5LJ3h 1QVGS 1KQ1A 4NL2A 3CPWS 4E7KA 4C92C 2X35A 4NL3A 1VQ7T 2QQ9A 5GMKh 3RUXA 2LQ8A 4XTZA 3RKWA 1YJNT 2VC8A 3HP9A 5GAN3 2RD1A 3ZFJA 3NTKA 3BDLA 2GF7A 2X4JA 1D3BA 3A8OB 3X26B 4Y91A 5LJ5j 1Q86U 3EAEA 2HAXA 1VQPT 4MDXA 1JB0E 3QDRB 2EQKA 4M75B 1M90U 3A8MB 2ZZDA 3OS0A 3X24B 3LX7A 1BYMA 3EFRA 2L8DA 3L2VA 2GFAA 2QDYB 3JCMc 3GNFB 3RERA 3QKJA 1JBMA 4N4GA 4M7AF 4VUBA 2V8KA 3JCMg 3RKXA 3CC7T 1LJOA 2DIQA 4XK8E 3OYMA 2RHUA 3H6ZA 3AHUA 3WVDB 3VV0A 4M75G 2DTHA 1VQ6A 3WVEB 2Y4YA 5CO7A 4F7UG 3OY9A 4ZGEB 3KXTA 2YRVA 2R5MA 4EMKA 4RMOA 2VV5A 2LRQA 2EYQA 2AHJB 3GNGA 4HCZA 4ME7A 3T9NA 5LJ5d 4QVZA 2OTLT 4OF1A 3WXMB 1XNIA 2QI2A 2P0KA 3OBYA 4C0GA 1EIFA 1VQMA 1Q82U 3GPLA 4RG8A 3CCQT 2K3XA 4A4KA 4JRQA 1X01A 3QHSA 4L6V5 2ZPFB 3QXEB 4M78D 3RKYA 2K5FA 5CKHA 4C8QG 3G6EA 3QO3A 4B9XA 5I21A 3G71T 3O8VA 1PSFA 3OBWA 1YIJT 4MDWA 1UGRB 5GAN4 3CCUA 4O5VA 4BE0A 5IT9E 2GCXA 2DZCA 5GAMe 5KE2A 3ZEHA 2E70A 4FT2A 5L8RE 4M75A 4E47A 2VXFA 4XTYA 1NPPA 4GY5A 3OYEA 4OGCA 4KUDK 2ZPGB 4M7AC 4EMHA 2BKDN 2PVOB 3BW1A 2HBPA 2K4YA 4KULA 3MEUA 4JUVA 2RHXA 4OGEA 4F7UA 4QVCA 1W2BA 1X75C 2MWOA 2XDBA 3CPFA 5GAMh 1B34A 4QQ6A 2L5QA 5GANj 1K9MC 4IUQA 3V8KA 2X4YA 1G3YA 2M1HA 2DAQA 4IUPA 1P92A 3OYDA 1KC8C 3MEWA 1O9SA 3CXCS 5FRMA 1YITT 1M1KC 5D6XA 3I55T 3TEEA 4KBMB 3LGLA 4FL6A 1Y96A 1OZ2A 1H3ZA 4C8QA 1X6OA 1VQ4A 4DOVA 3X28B 1M9SA 5IN1A 3JCMV 2VUBA 4EMGA 4BDZA 1OYXA 2RO0A 3QG1A 2O4XA 2MF2A 2XKOC 2KY9A 2QEXA 2G3RA 2EJFA 2ZPBB 4ZTFA 2EAYA 4J8OA 3SWNC 2ZPEB 3OYBA 4JS4A 2DXCA 2DPPB 4M7AE 2RJCA 1OI1A 3TCJA 3OSVA 1JJ2A 2JTFA 5GANd 4CI0C 4XTUA 4DOWA 3V7SA 3A5ZB 1G5VA 1AHJB 3L1AA 2CZ0B 3P8BB 4JRPA 2EKOA 4M75F 4BB7A 4C0FA 3OMGA 5CK9A 2RJFA 2M0OA 4MZTA 5FU6C 1Y07A 3QYGB 2KVQG 3QUIA 5CQXA 5LJ5f 4V2SA 2EQMA 5DM7R 3BY7A 4M77G 2XK0A 3KBGA 5HY6A 2MMPA 2O01E 3PFSA 1NZ9A 3CEYA 3JCMe 3OYLA 3GIBA 4DA4A 2EQJA 5GMKj 1YJWT 3M59A 4EMKC 3UDCA 3VU3C 2XD0A 2DD5A 1VQ5A 3FDRA 1YI2A 4PL6A 3OA6A 3M5AA 4ELZC 1VQLA 3CC4T 2EJGA 3CCUT 5CQYA 4BY6B 4XTVA 3H8ZA 4C92D 2QXFA 3JCMh 1IZ6A 1QVPA 2EWNA 2X4WA 2PQWA 4BD3A 3HSBA 2CZ7B 4X34A 4QW2A 1Q86C 1BIAA 3NFCA 3TU4K 2RJDA 3CCEA 5CR2A 1VUBA 1M90C 3MP1A 1KQSS 2YHTA 4X9CA 3X20B 3I56A 1BI0A 1FX7A 3CCLT 1VQNT 1K8AU 3OYIA 2RJEA 2L89A 2D0QB 3OQ5A 4PLLA 4JDSA 4HCCA 3BDUA 4XQ3A 4M7DG 3OS5A 4M75C 4FM4B 4QQGA 3A8LB 1HXDA 1TH7A 2JOYA 3E9GA 1H641 1RI0A 2K5LA 3M57A 3OYYA 4M77A 4PJOG 3JB9H 4FT4A 2KSSA 2WSCE 5HK3A 2QQRA 5EG2A 2JZ2A 1QVFA 3OYGA 1U1TA 1QP2A 5CKFA 4BUGA 2XHCA 2RA2A 2RM4A 3QBYA 4N4HA 1DJ7B 4J6YA 3VYGA 1VQ4T 1M8VA 1W4SA 2R57A 2ZCFB 2VXEA 2KQWA 4OB2B 5J3BA 5KCHA 5GANg 4LDUA 2PVDB 4F7UB 2M9UA 2EFIA 1BKBA 5GAOl 3DB4A 1Q82C 4C0DB 4C5IA 3TREA 3MO8A 4N4IA 3VUZA 5KE3A 1B34B 2EQUA 3OSSC 1KHCA 2M16A 4N0AA 5DY9A 4RG2A 3SFMA 1Y7XA 3CCJA 1VQOA 2LCLA 1I8FA 4LD6A 2FVUA 2HNIA 3OYJA 5GANf 3SDZA 3KUFA 2QA4T 2KK4A 3JAME 4ZTJA 3QJYA 4C5GA 4CRIA 4BE2A 4M7DA 1Y96B 3JSCA 4C8QB 3OYNA 4M75E 3CCRT 4PJOA 5IAYA 4C92E 5A0LA 4NOYA 2PUKB 3JB9I 3PIOA 2LTOA 5A0GA 3UPUA 2O4XB 2CZ6B 4KUIA 1YBYA 4OB1B 3HFNA 4XU3A 2XU8A 4HA8A 4IUTA 4A4GA 3CCST 3QSUA 1N9RA 1VIFA 2KAFA 1BI3A 2RI2A 3OW2A 4M7AD 3ME9A 1I4K1 2I2LA 1G3SA 3DLMA 2FL7A 1HK9A 5C6SA 2DO3A 1WNLA 3VJPA 1UB4A 4J7FA 1NPRA 1YHQA 1VQ5T 1N8RU 2LT1A 2F5TX 3OYFA 2E6NA 3G4SA 3ER0A 1YI2T 1JJ2S 1M1GA 1VQ8A 1VQLT 3HRUA 3VKIA 3R6OA 3A8GB 3L42A 3EFSA 4ZGDB 2DXTA 3JRZA 3JCMP 1Q81U 2PU9B 2YLBA 3E19A 2RHZA 2RH2A 5CVIA 3P8HA 1WQ7A 1QVGA 3CC2A 3CCET 3L2UA 3PMIA 2LVMA 1OZ3A 3CPWA 4O6JA 3I56T 3LYIA 4KT0E 5CKEA 1WJSA 3N5BB 2BIVA 2GQVA 5GMKi 3V7CA 2HQXA 3RESA 2F5KA 4A54A 5CKDA 5GAN5 4IUVA 3CD6A 2DTIA 4M7DF 4UC4A 3OMCA 3GF5A 2C06A 5GAOn 3M55A 4A4HA 4MZMA 4DQ2A 4A53A 5GAOq 2ZPHB 2L3RA 4QVDA 2D6FA 3GP8A 2OTJA 3HL8A 3CCMA 3JB9D 3MEVA 3VYHB 2A3LA 3LLRA 2JUFA 1V29B 5FU7B 4BI8B 3QZ9B 5GMKl 2RK2A 5C0MA 4JLGA 4PNOA 4BE1A 3S3NA 4J83A 1K73U 4M78B 4M77B 5LJ5g 3OB9A 1WPYA 2E64A 2KMTA 2QQAA 1VQ6T 2FB7A 3C4SA 3LW5E 2K5IA 1VQ9A 4PLIA 5HK0A 2DTOA 4XTXA 4JS5A 3C94A 2QTXA 5GANe 4F7UF 4XAXB 3META 1YJ9A 3BFMA 4FIBA 3JCMb 1U8RA 4L5GA 3JCMX 5LJ3j 2EJ9A 4R55A 1FXXA 3RIRA 3FEOA 4M78G 3VUBA 4BY6C 1VQMT 1K8AC 5GAOp 2CZ1B 5AYFA 5FLXE 2HQEA 2QA4A 3V7RA 5CKBA 5M9OA 3G6ET 5GANh 1ZHIA 4E7LA 2XG8D 1YHQT 1M1FA 4C8QF 1KQ2A 2EIFA 1KD1U 3QPHA 1VQ8T 1VQKA 1UGQB 2CKKA 5D6YA 2CGHA 4M75D 3JCMd 4M7DB 3MP6A 3NTIA 4P5NA 2RI5A 2DKGA 4PJOB 1YCYA 3CMEA 3FLGA 3GLXA 3M54A 3UT1A 2OTLA 1FWZA 3F70A 3S3OA 3ZBDA 2JNGA 2RHYA 3LWIA 3CC2T 3CCQA 4J6XA 5GAN6 5LJ3d 3CXCA 2E10A 3CBMA 2JN0A 1RL2A 1BIBA 4RCBA 2GFUA 4IKFA 4M78A 2R58A 3LH0A 4C0ZA 1S72A 2XIDA 4C8QD 2LQKA 4ZN3A 2P0PA 4C0DC 1N9SA 2VGNA 1Q7YU 2Y4XA 2FYKA 2E1HA 4OB0B 1UEBA 1KHIA 2VGMA 1N6AA 2IG0A 4WF2A 2DIGA 1ZQ1A 2MI6A 2LC4A 2KDSA 2DD4A 3M53A 1GXIE 4LD9K 2XDDA 3FB9A 4J6WA 2JTMA 3QIIA 4MMKA 2BUDA 3L2WA 2QEXT 1QW1A 1NJIU 3PGGA 4IURA 2E41A 4OMFB 3FIFA 4BACA 4C8QC 3CCVA 3V8LA 3JCMQ 3M58A 4LDVA 1XTDA 1VIEA 4JRKA 1W2BS 3PMTA 1YITA 1WGSA 3I55A 4ATOA 2RK1A 2PUOB 1N8RC 5A0DA 3SWNA 3M4GA 2DJZA 3CBOA 4LDYA 1M4ZA 1VQ9T 1N27A 2CS7A 3GOXA 4II1A 3HHTB 5DLOA 4C92B 2DK3A 4F7UE 3DB3A 2ZGWA 1YJ9T 1Q81C 2LT4A 2LDMA 2V8IA 4XTWA 5GAMj 3CMAA 3FRNA 4TVRA 3OYCA 4GLKA 5GAN7 5GMKm 3RMSA 3JB9J 2QQBA 4BDYA 1WJRA 4HKEA 4M77F 4M78F 4RCCA 4XU1A 4C5EA 2JVVA 3HRSA 5KH6A 3OYAA 5LJ5e 3OYHA 1G3TA 2F69A 2XICA 4C92G 2RI3A 4HCBA 4J5YA 4C8QE 5GAN8 3OYKA 4LDWA 1R8OB 1I81A 3ASKA 3P8DA 1VQKT 4B9WA 4ZN1A 5LJ3g 3JCMf 1KQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 3;  2RD1 A;  5LJ5 h;  1D3B A;  5GMK l;  4Y91 A;  5LJ5 j;  1LOJ A;  4PNO A;  3L2Z A;  2EJG A;  4M75 B;  5GAM d;  4XTV A;  4C92 D;  4M78 B;  4M77 B;  2EWN A;  3JCM h;  5LJ3 f;  5LJ5 g;  3EFR A;  3HSB A;  4M77 D;  1WPY A;  2E64 A;  3JCM c;  1BIA A;  2FB7 A;  3RER A;  1JBM A;  4JRI A;  1MGQ A;  4M7A F;  4EMK C;  3JCM g;  2DTO A;  2YHT A;  3RKX A;  4X9C A;  4JLI A;  4XTX A;  1LJO A;  2QTX A;  4PJO F;  4F7U F;  5GAN e;  3VU3 C;  3FJP A;  3BFM A;  3AHU A;  3JCM b;  4M75 G;  3JCM X;  3BDU A;  5LJ3 j;  2EJ9 A;  2DTH A;  4XQ3 A;  4M7D G;  4M75 C;  3RIR A;  4C92 A;  4M78 G;  1HXD A;  1TH7 A;  4PJO G;  1H64 1;  4M78 C;  4M77 A;  4M77 C;  4F7U G;  5GAO p;  4HT9 A;  3JB9 H;  3V7R A;  4EMK A;  4MML A;  5LJ5 d;  5GAN h;  1U1T A;  2Y90 A;  1M8V A;  2RA2 A;  2RM4 A;  4C8Q F;  1KQ2 A;  4J6Y A;  4M7A B;  4M7D B;  2CGH A;  2VXE A;  4M75 D;  3JCM d;  4M7D D;  5GAN g;  1X01 A;  3QHS A;  5GAN 2;  2DKG A;  4M78 D;  3RKY A;  1YCY A;  4F7U B;  5GAO l;  4PJO B;  4C8Q G;  4PJO D;  3QO3 A;  5I21 A;  2K57 A;  1B34 B;  4OP0 A;  5GAN 4;  5DY9 A;  4N0A A;  4N0A C;  2DEQ A;  4J6X A;  5GAN 6;  5LJ3 d;  2DZC A;  1I8F A;  5GAM e;  2E10 A;  2HNI A;  5GAN f;  5GAO m;  4M7A G;  2JN0 A;  4M75 A;  1BIB A;  4RCB A;  2VXF A;  4XTY A;  5CAI A;  4M7D A;  4M7D C;  4M7A C;  2DXU A;  1Y96 B;  4M78 A;  4C8Q B;  4EMH A;  3BW1 A;  4M75 E;  3JB9 F;  4PJO A;  4C8Q D;  4JUV A;  4C92 E;  4F7U A;  1M5Q 1;  4QVC A;  4PJO C;  4NOY A;  4M78 E;  4M77 E;  3JB9 I;  5GAO r;  1N9S A;  2E65 A;  2FYK A;  1WQW A;  2E1H A;  3HFN A;  1B34 A;  4XU3 A;  4HA8 A;  5GAM h;  5GAN j;  2YLC A;  3V8K A;  1N9R A;  3QSU A;  4WF2 A;  4XU2 A;  3SWN B;  4M7A D;  1I4K 1;  2I2L A;  3FB9 A;  4J6W A;  4MMK A;  1D3B B;  4C92 F;  5GAM g;  1U1S A;  1HK9 A;  2E41 A;  3PGG A;  3V8J A;  1Y96 A;  3FIF A;  1WNL A;  4C8Q A;  4C8Q C;  3HFO A;  4XU0 A;  3JCM V;  3V8L A;  3JCM Q;  4EMG A;  4JRK A;  4HT8 A;  3EFS A;  2EJF A;  5GAM f;  1I5L A;  2EAY A;  2DXT A;  4M7A A;  3SWN A;  3SWN C;  3JCM J;  3M4G A;  3JCM P;  2DJZ A;  2YLB A;  2RB6 A;  3SB2 A;  4M7A E;  1WQ7 A;  4M7D E;  2DVE A;  5GAN d;  4C92 B;  5LJ3 e;  4PJO E;  4F7U E;  4XTU A;  5GMK i;  2ZGW A;  3V7S A;  3V7C A;  4XTW A;  5GAM j;  3JB9 G;  4EMK B;  3L1A A;  1JRI A;  3INZ A;  3RES A;  5GMK e;  5GAN 7;  5GMK m;  4M75 F;  4A54 A;  5GAN 5;  3JB9 J;  4M7D F;  2DTI A;  4M78 F;  4M77 F;  4XU1 A;  4RCC A;  2DZ9 A;  4X9D A;  5LJ5 e;  5GAO n;  3JCM W;  4DQ2 A;  1LNX A;  5LJ3 h;  4A53 A;  5GAO q;  5LJ5 f;  3QUI A;  4C92 G;  4QVD A;  1KQ1 A;  4J5Y A;  4NL2 A;  4C8Q E;  5GAN 8;  4V2S A;  3BY7 A;  4M77 G;  4C92 C;  4NL3 A;  3GIB A;  3JCM e;  1I81 A;  3JB9 D;  5GMK h;  3RUX A;  5LJ3 g;  5GMK j;  3JCM f;  4XTZ A;  3RKW A;  2VC8 A; 
#chains in the Genus database with same CATH topology
 1BB9 A;  2NUT B;  5LJ5 h;  1WIE A;  3CBP A;  1GCP A;  2LCS A;  2NUZ A;  5GJV B;  3PT9 A;  2A7Y A;  1S72 T;  3C12 A;  4JLI A;  3EH2 A;  2P0Q A;  5FU7 C;  3HRT A;  4C92 A;  1M2O A;  2FZG B;  4E7H A;  4M78 C;  5FRO A;  1VQN A;  2DL8 A;  2DBM A;  1ZBX A;  5J26 A;  1VQ7 A;  4M7A B;  9ATC B;  1K0X A;  1YJN A;  1GFC A;  3X25 B;  2PVG B;  1UGP B;  1NG2 A;  3UA6 A;  1XQH A;  4E7I A;  1QP3 A;  5CAI A;  3S3M A;  2JTE A;  3EFO A;  5FWC A;  4M77 E;  2L2P A;  2YLC A;  1WHH A;  5KCO A;  1AOJ A;  4ORZ A;  4E6R A;  2EW3 A;  2BZ8 A;  1KSW A;  1Q7Y C;  1MHN A;  1O75 A;  1UGS B;  2QEX Q;  4XU0 A;  2HD0 A;  3MP8 A;  4HT8 A;  4BI4 A;  4MZP A;  2XI9 A;  2RQW A;  1WYX A;  4OVA A;  2HKQ B;  5FU6 B;  2RB6 A;  3RMQ A;  4M7D E;  1GCQ A;  2I0N A;  2X3X D;  2EQI A;  2H3J A;  2BTT A;  1PKS A;  2OAU A;  1U5S A;  1VQ9 Q;  4A4E A;  1JRI A;  1YJ9 Q;  5I2S A;  2VYT A;  1PSE A;  3FC3 A;  4X9D A;  3JCM W;  3M56 A;  1GFD A;  4J9F A;  3RUX A;  4XTZ A;  2VC8 A;  3BDL A;  2A0F B;  2X4J A;  3A8O B;  4Y91 A;  3EAE A;  2LNH B;  4M75 B;  2EQK A;  3CME Q;  3U23 A;  3L2V A;  3RER A;  4LE9 A;  3CC7 T;  1Q7Y R;  4CC3 A;  1JQQ A;  3H6Z A;  3M0P A;  3EG2 A;  2L3S A;  2D8H A;  3TQ7 P;  1RUW A;  3OY9 A;  3KXT A;  4EMK A;  3I5S A;  2KRN A;  5LJ5 d;  2YWW A;  2OTL T;  2ROL A;  2P0K A;  1Q82 U;  4RG8 A;  4KGZ B;  3CCV Q;  4M78 D;  1HYO A;  5CKH A;  3CCJ Q;  3QO3 A;  1OPK A;  2HSP A;  1G83 A;  1VQO Q;  1YIJ T;  1MV0 B;  1QQJ A;  2KR3 A;  1E6G A;  3CCU A;  5GAM e;  5L8R E;  4XTY A;  2AKL A;  3EGX B;  4OGC A;  1IGU A;  1PM3 A;  4DBR A;  3CC4 T;  3EH1 A;  2RHX A;  3FJ5 A;  1X75 C;  1SSH A;  1B34 A;  4QQ6 A;  5GAN j;  1K9M C;  1G3Y A;  3OYD A;  3MEW A;  3CXC S;  5FRM A;  2SRC A;  5D6X A;  2PTK A;  3G4S Q;  1X6O A;  3EG1 A;  3NMZ C;  4DOV A;  1Q82 R;  5IN1 A;  3PVL A;  2RO0 A;  2O4X A;  2MF2 A;  3EG0 A;  3EG9 A;  2ZPB B;  4Z8A A;  5IHN A;  3I35 A;  2DXC A;  1NLP C;  2ESW A;  2DX1 A;  2QDL A;  4KRT A;  3V7S A;  2CH4 A;  4J9C A;  3CD6 Q;  1AHJ B;  3P8B B;  2JM9 A;  1PD1 A;  1ZSG A;  2YUO A;  2L3P A;  4FW2 A;  1I0C A;  4M77 G;  4PFZ A;  2MMP A;  3PFS A;  1NZ9 A;  3OYL A;  1YJW T;  3UDC A;  1VQ7 Q;  3EHQ A;  2DD5 A;  3FDR A;  1I07 A;  1YJN Q;  3M5A A;  2RN8 A;  2Z0W A;  1IZ6 A;  1QVP A;  2PQW A;  4RTV A;  1K9M R;  2RJD A;  3CCE A;  5CR2 A;  3H0H A;  4RTU A;  2YHT A;  3VS0 A;  4PLL A;  4JDS A;  4HCC A;  4M7D G;  3PVQ A;  3UAT A;  1RAA B;  3OYY A;  1HXD A;  2JOY A;  3E9G A;  1H64 1;  4M77 A;  1E7O A;  1M3B A;  1W2B P;  2RM4 A;  1WXT A;  2ZCF B;  1BCO A;  2QAZ A;  5J3B A;  2CUD A;  2EFI A;  3H9N A;  3CCQ Q;  1YCS B;  3MO8 A;  4N4I A;  5KE3 A;  1B34 B;  1KHC A;  2M16 A;  5KYX B;  1V1C A;  2J6O A;  1WHM A;  3SDZ A;  3KUF A;  1T3L A;  3NPF A;  1SRM A;  4C5G A;  4M7D A;  1H3H A;  3CCR T;  1TUD A;  1M2V B;  1Y0M A;  2KT8 A;  2LTO A;  5A0G A;  2O4X B;  4Y92 A;  1YBY A;  3CCS T;  3HFN A;  2XU8 A;  1SHG A;  4HA8 A;  2KAF A;  3MJX A;  3OW2 A;  1G3S A;  1FYN A;  8AT1 B;  1D0Y A;  2FL7 A;  5C6S A;  4FCY A;  1WNL A;  1YIT Q;  1VQ5 T;  1N8R U;  1VQL T;  3EFS A;  4ZGD B;  3JRZ A;  3JCM P;  5CVI A;  5IHI A;  3L2U A;  2F2W A;  1AWX A;  3I56 T;  4KT0 E;  4KGV B;  2BIV A;  5GMK i;  3RES A;  2DTI A;  4UC4 A;  3OMC A;  2F1L A;  4A4H A;  4MZM A;  5GAO q;  4EIK A;  4QVD A;  2D6F A;  2OTJ A;  1IXD A;  3HL8 A;  1X69 A;  2M51 A;  2JUF A;  1K0S A;  3QZ9 B;  5GMK l;  4JLG A;  4PNO A;  1K73 U;  4M77 B;  5LJ5 g;  3CCU Q;  1ZUU A;  1WPY A;  2E64 A;  2KMT A;  1WZO A;  2YUQ A;  3SEM A;  2FB7 A;  3C4S A;  5KYY A;  1Y57 A;  1UG1 A;  1ZSZ B;  4JS5 A;  3C94 A;  2MYS A;  5GAN e;  3JCM X;  2YRD A;  5LJ3 j;  3CCL Q;  1FXX A;  4RTZ A;  4DEY A;  2FRW A;  5GAO p;  1UTI A;  2DRK A;  4AT1 B;  1TXQ A;  1RLP C;  1WA7 A;  4X1V A;  2HL3 A;  1SKU B;  1RAD B;  2M0Y A;  3M0U A;  3QPH A;  1VQK A;  4M7D B;  2CGH A;  4P5N A;  2GTO A;  2QYZ A;  2FZK B;  2GQI A;  1WHJ A;  3F70 A;  3S3O A;  3ZBD A;  1SRL A;  2RHY A;  3LWI A;  5GAN 6;  2D8J A;  2JN0 A;  4RCB A;  1K1Z A;  5KYU A;  3HTR A;  4C0Z A;  2XID A;  8ATC B;  2P0P A;  1N9S A;  2FYK A;  3CPW P;  4OB0 B;  1UEB A;  1KHI A;  2IG0 A;  2DIG A;  1ZQ1 A;  2E5K A;  2OAW A;  3EGD A;  2JTM A;  2QEX T;  2BUD A;  2E41 A;  1K9A A;  2AKK A;  4JRK A;  2ROT A;  1Z9Z A;  1WGS A;  4ATO A;  2RK1 A;  4D8K A;  1WHL A;  3SWN A;  3CBO A;  2EGE A;  7AT1 B;  1VQ9 T;  1N27 A;  2CS7 A;  1BU1 A;  2HZY A;  4F7U E;  2D1X A;  3CCE Q;  2ED1 A;  1YJ9 T;  2HEQ A;  4F16 A;  3JB9 J;  4R0K A;  2QQB A;  2CRE A;  1WJR A;  4LDX A;  3OYH A;  2F69 A;  2DA9 A;  2LJ3 A;  4C8Q E;  3OYK A;  1D1A A;  4LDW A;  1I81 A;  4PFP A;  2AZS A;  4B9W A;  2DL7 A;  3JCM f;  2NUP B;  3SD4 A;  3UWN A;  3CME T;  2K3B A;  3H0F A;  5FRN A;  1QMC A;  1A0N B;  1MGQ A;  1PG5 B;  3M4Y A;  2E5Q A;  4F17 A;  3G7Z A;  1BI2 A;  2HBW A;  3PIP A;  3MCA B;  3TVT A;  2X4X A;  2E12 A;  1IRE B;  3OS2 A;  1SF9 A;  3J81 E;  3CCV T;  1H8K A;  2K2V A;  2LQW A;  3G6E Q;  5KYU B;  3CCJ T;  1ZA1 B;  1VQO T;  2QTV A;  3C95 A;  4BI3 A;  4PJO D;  4Q5W A;  1VQP A;  4L59 A;  2WAC A;  4N0A C;  2DEQ A;  2NUT A;  4Y28 E;  2KI7 A;  4M7A G;  2RHI A;  3EGD B;  2FHD A;  5A2Q E;  1SEM A;  1AT1 B;  1M5Q 1;  2LNV A;  1KC8 U;  4M78 E;  3O5Z A;  1RAF B;  3A8H B;  4D6W A;  3HPW A;  3G4S T;  3SWN B;  3QJ6 A;  1TUG B;  5D6W A;  4C92 F;  1UUE A;  1U1S A;  5FW9 A;  3V8J A;  3MPU B;  2WSF E;  2G6F X;  1NJI C;  5KYN A;  4ZGJ B;  5GAM f;  1I1J A;  4M7A A;  1NE8 A;  3G71 A;  3OW2 S;  1KQS P;  4CC7 A;  3LWH A;  3DKM A;  2WSE E;  3CD6 T;  3QZ5 B;  2DVE A;  5LJ3 e;  2QK0 A;  3JB9 G;  1NM7 A;  3INZ A;  5GMK e;  1R0B G;  4OMO A;  3QYH B;  2ENM A;  1G3W A;  1RI9 A;  1Y71 A;  1LNX A;  4PK4 A;  2DNU A;  4NL2 A;  4C92 C;  2X35 A;  1VQ7 T;  2LP5 A;  1YJN T;  4RTW A;  5GAN 3;  3ZFJ A;  1VQK Q;  3X26 B;  1LVK A;  5LJ5 j;  1Q86 U;  3M0T A;  1WLP B;  1ABQ A;  1NLO C;  2ATC B;  3A8M B;  3OS0 A;  3X24 B;  1M90 U;  3LX7 A;  2GFA A;  1BCM A;  3QKJ A;  1JBM A;  2RHU A;  3VV0 A;  4M75 G;  4JJD A;  1VQ6 A;  2Y4Y A;  4F7U G;  1NJI R;  3GBQ A;  2VV5 A;  2EYQ A;  2AHJ B;  3T9N A;  4HXJ A;  1XNI A;  2QI2 A;  1YWP A;  3OBY A;  1EZZ B;  1EIF A;  1VQM A;  3GPL A;  3CCQ T;  1UEC A;  2KE9 A;  2K3X A;  4E7Z A;  1WHG A;  1X01 A;  3RKY A;  4RTY A;  4C8Q G;  1X2Q A;  1Q86 R;  3OBW A;  2EKH A;  4MDW A;  1G8X A;  4O5V A;  4BE0 A;  1M90 R;  2CP3 A;  2DZC A;  3VRZ A;  3QWX X;  4FT2 A;  4J9E A;  4M75 A;  2VXF A;  4GY5 A;  4F7U A;  4JUV A;  4QVC A;  1GCQ C;  3IQL A;  2KT1 A;  3VS5 A;  2XDB A;  1MUZ A;  3CPF A;  4WTO B;  5GAM h;  2L5Q A;  1S1N A;  3V8K A;  2X4Y A;  1P92 A;  1C1A A;  1YIT T;  4DBH A;  4JJC A;  4KBM B;  2O9S A;  3LGL A;  4FL6 A;  1Y96 A;  4C8Q A;  3JCM V;  2VUB A;  4EMG A;  2DL3 A;  2XKO C;  2KY9 A;  4HVV A;  2G3R A;  4ZTF A;  1MMN A;  2EAY A;  1UJY A;  5IH2 A;  2ZPE B;  2RJC A;  3OSV A;  2JTF A;  4XTU A;  4DOW A;  4LNP A;  5D7U A;  5CK9 A;  2LZ6 B;  2FO0 A;  2RJF A;  3EGX A;  3CCM Q;  1Y07 A;  3A98 A;  3KBG A;  2O2O A;  2O01 E;  3JCM e;  3CEY A;  1K76 A;  3QWY A;  4EMK C;  2MK5 A;  3VU3 C;  4JZ4 A;  2XD0 A;  4ELZ C;  2A37 A;  3CCU T;  4BY6 B;  3H8Z A;  4C92 D;  2QXF A;  3HSB A;  1VQP Q;  2J6F A;  4X34 A;  3M0Q A;  4PJN A;  1BIA A;  3NFC A;  3TU4 K;  1VUB A;  1B7T A;  1BI0 A;  1MV3 A;  3CCL T;  3OQ5 A;  2FRY A;  3BDU A;  1NYG A;  1OOT A;  1IGQ A;  1VOM A;  1I5O B;  3M57 A;  1OU8 A;  2IIM A;  2EYY A;  4FT4 A;  1B3Q A;  2ED0 A;  1EX4 A;  1QWE A;  1QVF A;  2KBT A;  5CKF A;  1DJ7 B;  1W4S A;  2F2X A;  4OB2 B;  1YFN A;  2KQW A;  2J05 A;  4LDU A;  4F7U B;  2M9U A;  3THK A;  1Q82 C;  4C0D B;  3VUZ A;  4RG2 A;  3G71 Q;  1SHF A;  1I8F A;  1NYF A;  2FVU A;  3OYJ A;  5GAN f;  3UA7 A;  3JAM E;  4CRI A;  1Y96 B;  3JSC A;  1OPL A;  1VYV A;  4C8Q B;  3OYN A;  3PIO A;  3UPU A;  1JJ2 P;  2BE7 D;  3QSU A;  4LUD A;  1BI3 A;  2GBQ A;  4OMN A;  2I2L A;  4JPB W;  2DF6 A;  3I55 Q;  1YHQ A;  2LT1 A;  3OYF A;  2VAS A;  3VKI A;  3R6O A;  2YRC A;  3L42 A;  2E3H A;  2A28 A;  1WI7 A;  2DXT A;  1OV3 A;  5HCK A;  1M3C A;  1BBZ A;  1QVG A;  1WQ7 A;  3CC2 A;  3CCE T;  2LJ1 A;  3PMI A;  4O6J A;  3N5B B;  5KYX A;  2HMA A;  1FMV A;  4M7D F;  1CKA A;  2C0O A;  3GF5 A;  2C06 A;  4A53 A;  1M2V A;  2DYI A;  3MEV A;  3RDV A;  5FU7 B;  3EG3 A;  2RK2 A;  3NHN A;  2K2M A;  4M78 B;  2QQA A;  1JXO A;  5HK0 A;  2DTO A;  4HVW A;  3BFM A;  4FIB A;  1VQN Q;  1YP5 A;  5L23 A;  2YUP A;  1MMD A;  3G6E T;  5GAN h;  1ZHI A;  2OJ2 A;  1KD1 U;  1GRI A;  4WCI A;  2OTL A;  3FLG A;  3GLX A;  3UT1 A;  2NYS A;  2JNG A;  2ECZ A;  1QCN A;  2E10 A;  2XMF A;  3RR6 A;  1MMA A;  4IKF A;  1YNZ A;  1M8M A;  2LQK A;  1ZSZ A;  2LC4 A;  2DD4 A;  4LD9 K;  2XDD A;  4J6W A;  1ACM B;  1X27 A;  1QW1 A;  2DER A;  3PGG A;  2EPD A;  3RNJ A;  4LDV A;  1Z9Q A;  2DEU A;  1XTD A;  1NEB A;  2QG9 B;  1N8R C;  5A0D A;  1D0X A;  2EYX A;  4FYX B;  4LDY A;  1M4Z A;  2K6D A;  1JU5 C;  2M02 A;  3HHT B;  2LDM A;  3CMA A;  4GLK A;  2CDT A;  3H0I A;  4FYY B;  3PE0 A;  2MCN A;  3G1J A;  3OYA A;  2JVV A;  1YN8 A;  1LPL A;  5GAN 8;  3I5R A;  1QLY A;  1VQK T;  4AMC A;  4ZN1 A;  1WXB A;  1J3T A;  1IHW A;  1LOJ A;  2V8J A;  1YJW A;  5LJ3 f;  4M77 D;  3L2R A;  2FPD A;  1BI1 A;  4JRI A;  1K73 C;  1RAI B;  4PJO F;  4Z02 A;  1PWT A;  2QGF B;  3CXC P;  4A4F A;  2DXB A;  3MKD A;  2DYB A;  2K7A A;  3VS2 A;  4MML A;  4EPC A;  3L2Q A;  1N8R R;  2E4H A;  4RUG A;  1ZX6 A;  2O88 A;  1YHQ Q;  4M7D D;  5CIU A;  5GAN 2;  1H92 A;  2EYZ A;  1HJD A;  1LCK A;  3AT1 B;  2K57 A;  1IB8 A;  2NUP A;  1QVF S;  2RMO A;  1IO6 A;  5GAO m;  3CC2 Q;  5J39 A;  1OU9 A;  1UJ0 A;  3CQT A;  3MHX A;  2VB6 A;  2ZPI B;  4PJO C;  1JEG A;  2X51 A;  2E65 A;  1R77 A;  4DBQ A;  1WDX A;  1M1K U;  1WQW A;  4IUU A;  3DLL A;  1PC0 A;  3M9Q A;  4XU2 A;  3CCR A;  5GAM g;  1D3B B;  1E6H A;  1UHC A;  3CCS A;  4HCK A;  1OX9 A;  3HKS A;  3ZL7 C;  2YT6 A;  3OS1 A;  1K73 R;  3J80 E;  3NTH A;  3JCM J;  1QCF A;  4R56 A;  4QT7 A;  3SB2 A;  4E7J A;  4IIO A;  4ANJ A;  1SSF A;  1KFZ A;  5LL6 S;  3S6W A;  3URG A;  1MNE A;  2QQS A;  2MAM A;  3CCM T;  2P84 A;  4PJL A;  4RKU E;  2K3Y A;  1X43 A;  6AT1 B;  5LJ3 h;  1QVG S;  4AFQ C;  1K4U S;  1KQ1 A;  4E7K A;  2JJ9 A;  5GMK h;  2CUB A;  3RKW A;  3HP9 A;  1PCX A;  2RD1 A;  3NTK A;  2GF7 A;  1JXM A;  2FZC B;  1TUC A;  2KXC A;  1VQP T;  3QDR B;  4QKU A;  2ZZD A;  1VYT A;  1BYM A;  2L8D A;  3JCM c;  3GNF B;  4N4G A;  4M7A F;  4VUB A;  2EGA A;  1LJO A;  2DIQ A;  4XK8 E;  3OYM A;  1JO8 A;  3AHU A;  1MMG A;  5CO7 A;  1IHV A;  4E7S A;  4AFU C;  4FW1 A;  4AFZ C;  4ZGE B;  2R5M A;  4RMO A;  4HCZ A;  2FEI A;  4ME7 A;  4QVZ A;  2V1Q A;  4OF1 A;  3WXM B;  5IHK A;  2CP5 A;  4C0G A;  2JXB A;  4JRQ A;  3QHS A;  4L6V 5;  3QXE B;  2K5F A;  4OMQ A;  3R6N A;  4B9X A;  5I21 A;  3G71 T;  2DLP A;  5GAN 4;  2NWM A;  5IT9 E;  2X9H A;  5ECA A;  1UDL A;  3ZEH A;  2KEA A;  4E2F B;  4E47 A;  4M7A C;  2MOX A;  1NPP A;  3OYE A;  4KUD K;  2ZPG B;  2DM1 A;  2PVO B;  3BW1 A;  4KUL A;  2K4Y A;  3JB9 F;  3MEU A;  1M27 C;  4OGE A;  3CMA Q;  1W2B A;  2MWO A;  2H8H A;  2COZ A;  2M1H A;  2DVJ A;  4IUP A;  1KC8 C;  2KRS A;  3I55 T;  1H3Z A;  1OZ2 A;  1VQ4 A;  2RQR A;  1X6G A;  5KYW A;  4BDZ A;  2BZY A;  1QKX A;  5FWB A;  1RAE B;  2QEX A;  1KK7 A;  2EJF A;  2J7I A;  3OYB A;  3M0S A;  2KXD A;  2DPP B;  1OI1 A;  3TCJ A;  1GL5 A;  4ESR A;  4CI0 C;  2AT1 B;  4RTT A;  4PJM A;  4GBQ A;  4JRP A;  2EKO A;  4M75 F;  2SEM A;  4BB7 A;  2EGC A;  1OQK A;  4C0F A;  4OMP A;  4J9B A;  3OMG A;  2OTJ Q;  2M0O A;  4MZT A;  5FU6 C;  3QYG B;  2KVQ G;  3QUI A;  5LJ5 f;  2A36 A;  5DM7 R;  2KYB A;  1IRX A;  1D0Z A;  2DL5 A;  2EQJ A;  2P4R A;  1YI2 A;  4IIM A;  4FYW B;  3D7S B;  4XTV A;  3JCM h;  2X4W A;  3VS3 A;  1D1C A;  1T0J A;  2CZ7 B;  1Q86 C;  4A63 B;  1M90 C;  3MP1 A;  1KC8 R;  4X9C A;  3X20 B;  1FX7 A;  4RTX A;  1VQN T;  1K8A U;  1TOV A;  1RAC B;  2L89 A;  2D0Q B;  2RJE A;  3OS5 A;  2KRO A;  4M75 C;  4QQG A;  4GLM A;  3A8L B;  1TH7 A;  2K5L A;  2KSS A;  1AEY A;  2JM8 A;  4PJJ A;  2EVR A;  5HK3 A;  5EG2 A;  2JZ2 A;  3OYG A;  1U1T A;  1QP2 A;  2XHC A;  1M8V A;  4N4H A;  4J6Y A;  3JV3 A;  2R57 A;  1W6X A;  2VXE A;  4J9H A;  4PFO A;  5GAN g;  4JZ3 A;  2BE9 B;  3NGP A;  5GAO l;  2PZ1 A;  4C5I A;  1G2B A;  1AD5 A;  2QAS A;  2EQU A;  4N0A A;  1Y7X A;  3CCJ A;  1VQO A;  2LCL A;  1D09 B;  3QJY A;  2JMA A;  4B6M A;  2HKN A;  5KYW B;  2V26 A;  4NOY A;  3JB9 I;  1U3O A;  4XU3 A;  4A4G A;  1N9R A;  4F14 A;  1NEG A;  4M7A D;  1AZG B;  3ME9 A;  1I4K 1;  1HK9 A;  2DO3 A;  4J7F A;  1NPR A;  2L0A A;  2D0N A;  1VQ8 A;  2E6N A;  3G4S A;  1JJ2 S;  1M1G A;  3HRU A;  2F2V A;  1Q81 U;  2PU9 B;  2YLB A;  2RHZ A;  3P8H A;  3CPW A;  1WJS A;  2GQV A;  3V7C A;  2HQX A;  2COW A;  5CKD A;  4IUV A;  3CD6 A;  1CKB A;  3M55 A;  4DQ2 A;  2ZPH B;  1RAG B;  3JB9 D;  3VYH B;  5C0M A;  4BE1 A;  3S3N A;  4J83 A;  1PRL C;  3BE3 A;  1RLQ C;  1ARK A;  1Q81 R;  1QCO A;  2C0T A;  4PLI A;  4XTX A;  2QTX A;  4XAX B;  3MET A;  1U8R A;  4L5G A;  4J9D A;  2A08 A;  2EJ9 A;  4R55 A;  4M78 G;  3VUB A;  2VKN A;  2QA4 A;  5M9O A;  2CP6 A;  4OMM A;  1W70 A;  2XG8 D;  1YHQ T;  1M1F A;  1KQ2 A;  2EIF A;  1UGQ B;  2RF0 A;  3JCM d;  2EYW A;  4M75 D;  1VQ4 Q;  1F1B B;  1CSK A;  2DKG A;  3OW2 P;  1YCY A;  2O9V A;  3M54 A;  3VS6 A;  1QKW A;  3CC2 T;  3CCQ A;  4J6X A;  2OI3 A;  1TS9 A;  1BIB A;  2GFU A;  1TWB A;  4M78 A;  2R58 A;  3LH0 A;  1S72 A;  4C8Q D;  2VGN A;  1Q7Y U;  2JS2 A;  2Y4X A;  2E1H A;  5GJW B;  2VGM A;  2BZX A;  2DFU A;  4DBF A;  4LN2 A;  3M53 A;  1GXI E;  2OX7 A;  3FB9 A;  3L2W A;  4JJB A;  3FIF A;  3V8L A;  3JCM Q;  1VIE A;  2K79 A;  1W2B S;  3PMT A;  2IPO B;  1YIT A;  1YI2 Q;  3M4G A;  2AK5 A;  1X6B A;  4J9I A;  4C92 B;  2W10 A;  4D8D A;  5I22 A;  3DB3 A;  5EC7 A;  2MPX C;  4XTW A;  2V8I A;  1AVZ C;  3VS4 A;  3OYC A;  5GMK m;  2YSQ A;  4CC2 A;  2LQN A;  4M77 F;  4RCC A;  4XU1 A;  4C5E A;  5LJ5 e;  2XIC A;  2DRM A;  5IXB A;  1R8O B;  5LJ3 g;  1KQS A;  1WHK A;  4FSX A;  2XDP A;  3E2U A;  2RQU A;  3L2Z A;  2LCC A;  3A1P A;  2P4T A;  2HQH A;  3MEA A;  5GAM d;  1U06 A;  3EFO B;  2E6Z A;  2HSE B;  3PTA A;  2CT4 A;  2IVW A;  1KG1 A;  1VQ6 Q;  1OX8 A;  3PNW C;  3FJP A;  5DLQ E;  2ZAE A;  1TG0 A;  4M77 C;  4FYV B;  3CCL A;  1VQM Q;  4NS5 A;  4J7I A;  2QGG A;  4C5H A;  2Y90 A;  2GGR A;  1ZSZ C;  3LGF A;  1WJQ A;  2DIL A;  2LX7 A;  2X3W D;  4ELY C;  1VQ8 Q;  4JJN K;  1KD1 C;  1T0H A;  2KGT A;  2JMC A;  2R5A A;  4OP0 A;  2CYZ B;  1R0C B;  2MIO A;  3J7A F;  2D9T A;  1PKT A;  2FPF A;  3CMA T;  4FU6 A;  4M7D C;  2DXU A;  1K9M U;  4KH0 B;  2JW4 A;  3E9F A;  3CC7 A;  3VS1 A;  4EDU A;  1VYU A;  4OB3 B;  1X2K A;  5GAO r;  3KFV A;  4J9G A;  2KNB B;  2LX9 A;  3E1S A;  4PKC C;  2DE0 X;  4YTL A;  1XJW B;  2NLU A;  3Q1J A;  3HFO A;  3C0C A;  2B8A A;  1XOV A;  2MWP A;  1I5L A;  1SPK A;  5HKC A;  1YIJ A;  5CCA A;  2ABL A;  2B86 A;  4PJO E;  4EMK B;  1C6V X;  2GTJ A;  2FPE A;  5I2M A;  3I9Q A;  3CC4 A;  2OTJ T;  4QQD A;  2AIR B;  2DZ9 A;  1KD1 R;  2QA4 Q;  3CPW S;  4NL3 A;  2QQ9 A;  1PHT A;  3UF4 A;  3EHR A;  2LQ8 A;  2W0Z A;  1ZUY A;  1D3B A;  2HAX A;  4MDX A;  1JB0 E;  3EFR A;  2QDY B;  2RPN A;  2V8K A;  3JCM g;  3RKX A;  3M0R A;  1S72 Q;  3WVD B;  2DTH A;  3WVE B;  1KIK A;  1MND A;  1YWO A;  2FG0 A;  2YRV A;  3GNG A;  2LRQ A;  3EG9 B;  1D1B A;  4A4K A;  2ZPF B;  1PNJ A;  4CC4 B;  1WFW A;  1N5Z A;  3G6E A;  3O8V A;  1PSF A;  1RAH B;  1UGR B;  2RNA A;  3EGU A;  2GCX A;  5KE2 A;  1M30 A;  2E70 A;  3QDF A;  1V76 A;  1SG5 A;  4EMH A;  2BKD N;  2HBP A;  4Z88 A;  4IUQ A;  2DAQ A;  1O9S A;  1B07 A;  1M1K C;  2J6K A;  3VRY A;  3TEE A;  1UHF A;  1ZBJ A;  3X28 B;  1M9S A;  1OYX A;  3QG1 A;  1ABO A;  4J8O A;  3SWN C;  4JS4 A;  2JT4 A;  4M7A E;  1AWW A;  2RQT A;  3SHW A;  1JJ2 A;  5GAN d;  1UE9 A;  2L3Q A;  2CP7 A;  2CSQ A;  3A5Z B;  1G5V A;  3H41 A;  1ZLM A;  3L1A A;  2CZ0 B;  1WXU A;  1VA7 A;  2H3E B;  2GNC A;  5CQX A;  4V2S A;  1Q95 G;  2EQM A;  2HL5 C;  3BY7 A;  5HY6 A;  2XK0 A;  3GIB A;  4DA4 A;  5GMK j;  3M59 A;  4HVU A;  2CH4 W;  1VQ5 A;  4PL6 A;  3OA6 A;  1VQL A;  5I11 A;  2EJG A;  5CQY A;  2EWN A;  4BD3 A;  1FMK A;  4QW2 A;  1KQS S;  4ZNX A;  3I56 A;  1M1K R;  3OYI A;  1HSQ A;  3CC7 Q;  4XQ3 A;  4FM4 B;  4PJO G;  4DEX A;  1RI0 A;  4HT9 A;  3JB9 H;  2WSC E;  2QQR A;  4KGX B;  1EFN A;  4BUG A;  1VQ4 T;  2RA2 A;  3QBY A;  3VYG A;  5IXF A;  2OTL Q;  5KCH A;  1T3S A;  2JS0 A;  2PVD B;  1BKB A;  3DB4 A;  2LMJ A;  3TRE A;  2YUN A;  3OSS C;  3SFM A;  5DY9 A;  1YIJ Q;  4LD6 A;  2RQV A;  3LH5 A;  4ZTJ A;  2E3I A;  2HNI A;  2KK4 A;  4FSS A;  2V1R A;  1PRM C;  4BE2 A;  1BK2 A;  1GBQ A;  4M75 E;  3REA B;  1KJW A;  4PJO A;  5IAY A;  4C92 E;  5A0L A;  2PUK B;  2CSI A;  3CC4 Q;  4LUE A;  2CZ6 B;  4KUI A;  4OB1 B;  3TSZ A;  4IUT A;  1VIF A;  2RI2 A;  1UFF A;  1AWJ A;  3DLM A;  3VJP A;  1UB4 A;  2C0I A;  2F5T X;  1YI2 T;  3ER0 A;  3A8G B;  5KYY B;  2CP2 A;  3E19 A;  2RH2 A;  2LVM A;  1WX6 A;  1OZ3 A;  3LYI A;  5CKE A;  2O31 A;  2F5K A;  2K9G A;  4A54 A;  5GAN 5;  4KH1 B;  2VVK A;  5GAO n;  2L3R A;  1M3A A;  1UGV A;  3GP8 A;  1OEB A;  3CCM A;  2A3L A;  3LLR A;  1V29 B;  3REB B;  2DJQ A;  1QWF A;  4BI8 B;  1YJW Q;  1RAB B;  2AZV A;  2CP0 A;  1QVF P;  4K11 A;  2VWF A;  3OB9 A;  1TTH B;  2EBP A;  1VQ6 T;  3LW5 E;  2K5I A;  4Z89 A;  1VQ9 A;  1GBR A;  2HDA A;  3ULR B;  4F7U F;  1YJ9 A;  3JCM b;  1OUL A;  1C0M A;  3RIR A;  4AG1 C;  3FEO A;  4BY6 C;  1VQM T;  1K8A C;  2CZ1 B;  5AYF A;  5FLX E;  2HQE A;  3V7R A;  5CKB A;  4AG2 C;  3TSW A;  4E7L A;  2DMO A;  1NBE B;  4C8Q F;  1VQ8 T;  2CKK A;  5D6Y A;  4F04 B;  2COY A;  3MP6 A;  3NTI A;  2DET A;  2RI5 A;  4PJO B;  2LJ0 A;  1AZE A;  3CME A;  1FWZ A;  3VS7 A;  2HCK A;  5LJ3 d;  3CXC A;  2DBK A;  3CBM A;  1HD3 A;  1RL2 A;  2KYM A;  2PNI A;  4ZN3 A;  1QVG P;  4C0D C;  3CCR Q;  1N6A A;  4WF2 A;  2MI6 A;  3CCS Q;  2KDS A;  4OML A;  4MMK A;  1FMW A;  3QII A;  1NJI U;  4IUR A;  2KRM A;  4OMF B;  4BAC A;  4C8Q C;  2J06 A;  3CCV A;  3M58 A;  3RBB B;  1VQ5 Q;  1ZUK A;  4M4Z A;  3I55 A;  2PUO B;  2YXY A;  1VQL Q;  2DL4 A;  2YDL A;  2DJZ A;  1W1F A;  4LXC A;  3GOX A;  1K8A R;  4II1 A;  5DLO A;  2DK3 A;  1AWO A;  2ZGW A;  1Q81 C;  2LT4 A;  5GAM j;  2CT3 A;  3I56 Q;  3FRN A;  4TVR A;  5GAN 7;  3RMS A;  5AT1 B;  4AFS C;  4BDY A;  4HKE A;  4M78 F;  5KH6 A;  2QA4 T;  1PD0 A;  3HRS A;  1ZA2 B;  1G3T A;  4C92 G;  2RI3 A;  4HCB A;  4J5Y A;  1TSF A;  3ASK A;  3P8D A;  1TU0 B; 
#chains in the Genus database with same CATH homology
 4FSX A;  3SD4 A;  3UWN A;  3CME T;  2XDP A;  5LJ5 h;  1LOJ A;  3L2Z A;  2LCC A;  2P4T A;  3MEA A;  5GAM d;  2V8J A;  3CBP A;  1YJW A;  5LJ3 f;  4M77 D;  2E6Z A;  5FRN A;  3L2R A;  3PTA A;  1BI1 A;  1MGQ A;  2IVW A;  3PT9 A;  2A7Y A;  3M4Y A;  4JRI A;  1S72 T;  1K73 C;  2E5Q A;  3C12 A;  4JLI A;  1KG1 A;  3G7Z A;  1BI2 A;  4PJO F;  3PNW C;  4Z02 A;  2P0Q A;  3FJP A;  5FU7 C;  3PIP A;  3MCA B;  5DLQ E;  3HRT A;  4A4F A;  4C92 A;  2DXB A;  2X4X A;  4E7H A;  4M78 C;  2E12 A;  4M77 C;  5FRO A;  1IRE B;  4MML A;  4EPC A;  3OS2 A;  3L2Q A;  3CCL A;  1VQN A;  1ZBX A;  4NS5 A;  4J7I A;  3J81 E;  4C5H A;  2Y90 A;  3CCV T;  5J26 A;  1VQ7 A;  2K2V A;  3LGF A;  1WJQ A;  4M7A B;  3CCJ T;  1VQO T;  3C95 A;  4BI3 A;  5CIU A;  5GAN 2;  4ELY C;  1YJN A;  4M7D D;  3X25 B;  2PVG B;  4PJO D;  4JJN K;  1KD1 C;  1UGP B;  2K57 A;  4Q5W A;  2R5A A;  1VQP A;  4OP0 A;  4L59 A;  2WAC A;  2CYZ B;  1XQH A;  4N0A C;  2DEQ A;  4E7I A;  1QVF S;  4Y28 E;  3J7A F;  5GAO m;  4M7A G;  2RHI A;  2D9T A;  1QP3 A;  2FHD A;  5CAI A;  5J39 A;  5A2Q E;  4FU6 A;  3S3M A;  2DXU A;  3CMA T;  4M7D C;  1K9M U;  3E9F A;  2ZPI B;  3MHX A;  3CC7 A;  4EDU A;  4PJO C;  1M5Q 1;  2LNV A;  1KC8 U;  4M78 E;  4M77 E;  4OB3 B;  5GAO r;  2E65 A;  1M1K U;  1WQW A;  3A8H B;  4D6W A;  2YLC A;  3HPW A;  4IUU A;  3DLL A;  5KCO A;  3M9Q A;  3G4S T;  4XU2 A;  3SWN B;  4LDX A;  3CCR A;  4HT9 A;  3QJ6 A;  1Q7Y C;  1MHN A;  2LX9 A;  3E1S A;  4PKC C;  5D6W A;  1D3B B;  4C92 F;  5GAM g;  4YTL A;  1U1S A;  3V8J A;  1O75 A;  3CCS A;  2NLU A;  3Q1J A;  1UGS B;  3HFO A;  2WSF E;  4XU0 A;  3HKS A;  2B8A A;  3OS1 A;  2HD0 A;  3MP8 A;  3J80 E;  1XOV A;  1NJI C;  4ZGJ B;  4HT8 A;  4BI4 A;  4MZP A;  2MWP A;  5GAM f;  2XI9 A;  3NTH A;  1I5L A;  4OVA A;  4M7A A;  1NE8 A;  5HKC A;  3G71 A;  3OW2 S;  3JCM J;  1YIJ A;  5CCA A;  4R56 A;  5FU6 B;  3LWH A;  2RB6 A;  3DKM A;  3RMQ A;  3SB2 A;  2WSE E;  4E7J A;  4M7D E;  3CD6 T;  2H3J A;  3QZ5 B;  2DVE A;  2OAU A;  1SSF A;  5LJ3 e;  5LL6 S;  4PJO E;  3JB9 F;  3S6W A;  3URG A;  3JB9 G;  4A4E A;  4EMK B;  1JRI A;  3INZ A;  5I2M A;  5GMK e;  5I2S A;  3CC4 A;  2QQS A;  2MAM A;  2OTJ T;  3QYH B;  3CCM T;  2VYT A;  1G3W A;  4QQD A;  1PSE A;  4RKU E;  2DZ9 A;  2K3Y A;  4X9D A;  3FC3 A;  3JCM W;  1Y71 A;  3M56 A;  1LNX A;  5LJ3 h;  1QVG S;  1KQ1 A;  4NL2 A;  3CPW S;  4E7K A;  4C92 C;  2X35 A;  4NL3 A;  1VQ7 T;  2QQ9 A;  5GMK h;  3RUX A;  2LQ8 A;  4XTZ A;  3RKW A;  1YJN T;  2VC8 A;  3HP9 A;  5GAN 3;  2RD1 A;  3ZFJ A;  3NTK A;  3BDL A;  2GF7 A;  2X4J A;  1D3B A;  3A8O B;  3X26 B;  4Y91 A;  5LJ5 j;  1Q86 U;  3EAE A;  2HAX A;  1VQP T;  4MDX A;  1JB0 E;  3QDR B;  2EQK A;  4M75 B;  1M90 U;  3A8M B;  2ZZD A;  3OS0 A;  3X24 B;  3LX7 A;  1BYM A;  3EFR A;  2L8D A;  3L2V A;  2GFA A;  2QDY B;  3JCM c;  3GNF B;  3RER A;  3QKJ A;  1JBM A;  4N4G A;  4M7A F;  4VUB A;  2V8K A;  3JCM g;  3RKX A;  3CC7 T;  1LJO A;  2DIQ A;  4XK8 E;  3OYM A;  2RHU A;  3H6Z A;  3AHU A;  3WVD B;  3VV0 A;  4M75 G;  2DTH A;  1VQ6 A;  3WVE B;  2Y4Y A;  5CO7 A;  4F7U G;  3OY9 A;  4ZGE B;  3KXT A;  2YRV A;  2R5M A;  4EMK A;  4RMO A;  2VV5 A;  2LRQ A;  2EYQ A;  2AHJ B;  3GNG A;  4HCZ A;  4ME7 A;  3T9N A;  5LJ5 d;  4QVZ A;  2OTL T;  4OF1 A;  3WXM B;  1XNI A;  2QI2 A;  2P0K A;  3OBY A;  4C0G A;  1EIF A;  1VQM A;  1Q82 U;  3GPL A;  4RG8 A;  3CCQ T;  2K3X A;  4A4K A;  4JRQ A;  1X01 A;  3QHS A;  4L6V 5;  2ZPF B;  3QXE B;  4M78 D;  3RKY A;  2K5F A;  5CKH A;  4C8Q G;  3G6E A;  3QO3 A;  4B9X A;  5I21 A;  3G71 T;  3O8V A;  1PSF A;  3OBW A;  1YIJ T;  4MDW A;  1UGR B;  5GAN 4;  3CCU A;  4O5V A;  4BE0 A;  5IT9 E;  2GCX A;  2DZC A;  5GAM e;  5KE2 A;  3ZEH A;  2E70 A;  4FT2 A;  5L8R E;  4M75 A;  4E47 A;  2VXF A;  4XTY A;  1NPP A;  4GY5 A;  3OYE A;  4OGC A;  4KUD K;  2ZPG B;  4M7A C;  4EMH A;  2BKD N;  2PVO B;  3BW1 A;  2HBP A;  2K4Y A;  4KUL A;  3MEU A;  4JUV A;  2RHX A;  4OGE A;  4F7U A;  4QVC A;  1W2B A;  1X75 C;  2MWO A;  2XDB A;  3CPF A;  5GAM h;  1B34 A;  4QQ6 A;  2L5Q A;  5GAN j;  1K9M C;  4IUQ A;  3V8K A;  2X4Y A;  1G3Y A;  2M1H A;  2DAQ A;  4IUP A;  1P92 A;  3OYD A;  1KC8 C;  3MEW A;  1O9S A;  3CXC S;  5FRM A;  1YIT T;  1M1K C;  5D6X A;  3I55 T;  3TEE A;  4KBM B;  3LGL A;  4FL6 A;  1Y96 A;  1OZ2 A;  1H3Z A;  4C8Q A;  1X6O A;  1VQ4 A;  4DOV A;  3X28 B;  1M9S A;  5IN1 A;  3JCM V;  2VUB A;  4EMG A;  4BDZ A;  1OYX A;  2RO0 A;  3QG1 A;  2O4X A;  2MF2 A;  2XKO C;  2KY9 A;  2QEX A;  2G3R A;  2EJF A;  2ZPB B;  4ZTF A;  2EAY A;  4J8O A;  3SWN C;  2ZPE B;  3OYB A;  4JS4 A;  2DXC A;  2DPP B;  4M7A E;  2RJC A;  1OI1 A;  3TCJ A;  3OSV A;  1JJ2 A;  2JTF A;  5GAN d;  4CI0 C;  4XTU A;  4DOW A;  3V7S A;  3A5Z B;  1G5V A;  1AHJ B;  3L1A A;  2CZ0 B;  3P8B B;  4JRP A;  2EKO A;  4M75 F;  4BB7 A;  4C0F A;  3OMG A;  5CK9 A;  2RJF A;  2M0O A;  4MZT A;  5FU6 C;  1Y07 A;  3QYG B;  2KVQ G;  3QUI A;  5CQX A;  5LJ5 f;  4V2S A;  2EQM A;  5DM7 R;  3BY7 A;  4M77 G;  2XK0 A;  3KBG A;  5HY6 A;  2MMP A;  2O01 E;  3PFS A;  1NZ9 A;  3CEY A;  3JCM e;  3OYL A;  3GIB A;  4DA4 A;  2EQJ A;  5GMK j;  1YJW T;  3M59 A;  4EMK C;  3UDC A;  3VU3 C;  2XD0 A;  2DD5 A;  1VQ5 A;  3FDR A;  1YI2 A;  4PL6 A;  3OA6 A;  3M5A A;  4ELZ C;  1VQL A;  3CC4 T;  2EJG A;  3CCU T;  5CQY A;  4BY6 B;  4XTV A;  3H8Z A;  4C92 D;  2QXF A;  3JCM h;  1IZ6 A;  1QVP A;  2EWN A;  2X4W A;  2PQW A;  4BD3 A;  3HSB A;  2CZ7 B;  4X34 A;  4QW2 A;  1Q86 C;  1BIA A;  3NFC A;  3TU4 K;  2RJD A;  3CCE A;  5CR2 A;  1VUB A;  1M90 C;  3MP1 A;  1KQS S;  2YHT A;  4X9C A;  3X20 B;  3I56 A;  1BI0 A;  1FX7 A;  3CCL T;  1VQN T;  1K8A U;  3OYI A;  2RJE A;  2L89 A;  2D0Q B;  3OQ5 A;  4PLL A;  4JDS A;  4HCC A;  3BDU A;  4XQ3 A;  4M7D G;  3OS5 A;  4M75 C;  4FM4 B;  4QQG A;  3A8L B;  1HXD A;  1TH7 A;  2JOY A;  3E9G A;  1H64 1;  1RI0 A;  2K5L A;  3M57 A;  3OYY A;  4M77 A;  4PJO G;  3JB9 H;  4FT4 A;  2KSS A;  2WSC E;  5HK3 A;  2QQR A;  5EG2 A;  2JZ2 A;  1QVF A;  3OYG A;  1U1T A;  1QP2 A;  5CKF A;  4BUG A;  2XHC A;  2RA2 A;  2RM4 A;  3QBY A;  4N4H A;  1DJ7 B;  4J6Y A;  3VYG A;  1VQ4 T;  1M8V A;  1W4S A;  2R57 A;  2ZCF B;  2VXE A;  2KQW A;  4OB2 B;  5J3B A;  5KCH A;  5GAN g;  4LDU A;  2PVD B;  4F7U B;  2M9U A;  2EFI A;  1BKB A;  5GAO l;  3DB4 A;  1Q82 C;  4C0D B;  4C5I A;  3TRE A;  3MO8 A;  4N4I A;  3VUZ A;  5KE3 A;  1B34 B;  2EQU A;  3OSS C;  1KHC A;  2M16 A;  4N0A A;  5DY9 A;  4RG2 A;  3SFM A;  1Y7X A;  3CCJ A;  1VQO A;  2LCL A;  1I8F A;  4LD6 A;  2FVU A;  2HNI A;  3OYJ A;  5GAN f;  3SDZ A;  3KUF A;  2QA4 T;  2KK4 A;  3JAM E;  4ZTJ A;  3QJY A;  4C5G A;  4CRI A;  4BE2 A;  4M7D A;  1Y96 B;  3JSC A;  4C8Q B;  3OYN A;  4M75 E;  3CCR T;  4PJO A;  5IAY A;  4C92 E;  5A0L A;  4NOY A;  2PUK B;  3JB9 I;  3PIO A;  2LTO A;  5A0G A;  3UPU A;  2O4X B;  2CZ6 B;  4KUI A;  1YBY A;  4OB1 B;  3HFN A;  4XU3 A;  2XU8 A;  4HA8 A;  4IUT A;  4A4G A;  3CCS T;  3QSU A;  1N9R A;  1VIF A;  2KAF A;  1BI3 A;  2RI2 A;  3OW2 A;  4M7A D;  3ME9 A;  1I4K 1;  2I2L A;  1G3S A;  3DLM A;  2FL7 A;  1HK9 A;  5C6S A;  2DO3 A;  1WNL A;  3VJP A;  1UB4 A;  4J7F A;  1NPR A;  1YHQ A;  1VQ5 T;  1N8R U;  2LT1 A;  2F5T X;  3OYF A;  2E6N A;  3G4S A;  3ER0 A;  1YI2 T;  1JJ2 S;  1M1G A;  1VQ8 A;  1VQL T;  3HRU A;  3VKI A;  3R6O A;  3A8G B;  3L42 A;  3EFS A;  4ZGD B;  2DXT A;  3JRZ A;  3JCM P;  1Q81 U;  2PU9 B;  2YLB A;  3E19 A;  2RHZ A;  2RH2 A;  5CVI A;  3P8H A;  1WQ7 A;  1QVG A;  3CC2 A;  3CCE T;  3L2U A;  3PMI A;  2LVM A;  1OZ3 A;  3CPW A;  4O6J A;  3I56 T;  3LYI A;  4KT0 E;  5CKE A;  1WJS A;  3N5B B;  2BIV A;  2GQV A;  5GMK i;  3V7C A;  2HQX A;  3RES A;  2F5K A;  4A54 A;  5CKD A;  5GAN 5;  4IUV A;  3CD6 A;  2DTI A;  4M7D F;  4UC4 A;  3OMC A;  3GF5 A;  2C06 A;  5GAO n;  3M55 A;  4A4H A;  4MZM A;  4DQ2 A;  4A53 A;  5GAO q;  2ZPH B;  2L3R A;  4QVD A;  2D6F A;  3GP8 A;  2OTJ A;  3HL8 A;  3CCM A;  3JB9 D;  3MEV A;  3VYH B;  2A3L A;  3LLR A;  2JUF A;  1V29 B;  5FU7 B;  4BI8 B;  3QZ9 B;  5GMK l;  2RK2 A;  5C0M A;  4JLG A;  4PNO A;  4BE1 A;  3S3N A;  4J83 A;  1K73 U;  4M78 B;  4M77 B;  5LJ5 g;  3OB9 A;  1WPY A;  2E64 A;  2KMT A;  2QQA A;  1VQ6 T;  2FB7 A;  3C4S A;  3LW5 E;  2K5I A;  1VQ9 A;  4PLI A;  5HK0 A;  2DTO A;  4XTX A;  4JS5 A;  3C94 A;  2QTX A;  5GAN e;  4F7U F;  4XAX B;  3MET A;  1YJ9 A;  3BFM A;  4FIB A;  3JCM b;  1U8R A;  4L5G A;  3JCM X;  5LJ3 j;  2EJ9 A;  4R55 A;  1FXX A;  3RIR A;  3FEO A;  4M78 G;  3VUB A;  4BY6 C;  1VQM T;  1K8A C;  5GAO p;  2CZ1 B;  5AYF A;  5FLX E;  2HQE A;  2QA4 A;  3V7R A;  5CKB A;  5M9O A;  3G6E T;  5GAN h;  1ZHI A;  4E7L A;  2XG8 D;  1YHQ T;  1M1F A;  4C8Q F;  1KQ2 A;  2EIF A;  1KD1 U;  3QPH A;  1VQ8 T;  1VQK A;  1UGQ B;  2CKK A;  5D6Y A;  2CGH A;  4M75 D;  3JCM d;  4M7D B;  3MP6 A;  3NTI A;  4P5N A;  2RI5 A;  2DKG A;  4PJO B;  1YCY A;  3CME A;  3FLG A;  3GLX A;  3M54 A;  3UT1 A;  2OTL A;  1FWZ A;  3F70 A;  3S3O A;  3ZBD A;  2JNG A;  2RHY A;  3LWI A;  3CC2 T;  3CCQ A;  4J6X A;  5GAN 6;  5LJ3 d;  3CXC A;  2E10 A;  3CBM A;  2JN0 A;  1RL2 A;  1BIB A;  4RCB A;  2GFU A;  4IKF A;  4M78 A;  2R58 A;  3LH0 A;  4C0Z A;  1S72 A;  2XID A;  4C8Q D;  2LQK A;  4ZN3 A;  2P0P A;  4C0D C;  1N9S A;  2VGN A;  1Q7Y U;  2Y4X A;  2FYK A;  2E1H A;  4OB0 B;  1UEB A;  1KHI A;  2VGM A;  1N6A A;  2IG0 A;  4WF2 A;  2DIG A;  1ZQ1 A;  2MI6 A;  2LC4 A;  2KDS A;  2DD4 A;  3M53 A;  1GXI E;  4LD9 K;  2XDD A;  3FB9 A;  4J6W A;  2JTM A;  3QII A;  4MMK A;  2BUD A;  3L2W A;  2QEX T;  1QW1 A;  1NJI U;  3PGG A;  4IUR A;  2E41 A;  4OMF B;  3FIF A;  4BAC A;  4C8Q C;  3CCV A;  3V8L A;  3JCM Q;  3M58 A;  4LDV A;  1XTD A;  1VIE A;  4JRK A;  1W2B S;  3PMT A;  1YIT A;  1WGS A;  3I55 A;  4ATO A;  2RK1 A;  2PUO B;  1N8R C;  5A0D A;  3SWN A;  3M4G A;  2DJZ A;  3CBO A;  4LDY A;  1M4Z A;  1VQ9 T;  1N27 A;  2CS7 A;  3GOX A;  4II1 A;  3HHT B;  5DLO A;  4C92 B;  2DK3 A;  4F7U E;  3DB3 A;  2ZGW A;  1YJ9 T;  1Q81 C;  2LT4 A;  2LDM A;  2V8I A;  4XTW A;  5GAM j;  3CMA A;  3FRN A;  4TVR A;  3OYC A;  4GLK A;  5GAN 7;  5GMK m;  3RMS A;  3JB9 J;  2QQB A;  4BDY A;  1WJR A;  4HKE A;  4M77 F;  4M78 F;  4RCC A;  4XU1 A;  4C5E A;  2JVV A;  3HRS A;  5KH6 A;  3OYA A;  5LJ5 e;  3OYH A;  1G3T A;  2F69 A;  2XIC A;  4C92 G;  2RI3 A;  4HCB A;  4J5Y A;  4C8Q E;  5GAN 8;  3OYK A;  4LDW A;  1R8O B;  1I81 A;  3ASK A;  3P8D A;  1VQK T;  4B9W A;  4ZN1 A;  5LJ3 g;  3JCM f;  1KQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...