4M75D

Crystal structure of lsm1-7 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
EFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
total genus 13
structure length 72
sequence length 72
chains with identical sequence K
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75D00
2EJ9A 2DTHA 2DVEA 1D3BB 4M77D 1LOJA 3EFRA 5GAOp 4M7DA 4XU3A 4X9CA 2CGHA 3JCMf 5GAMf 5GANe 5LJ3j 2DKGA 4NL2A 4C92G 2Y90A 4C92D 4QVCA 5GAOn 3BDUA 4C8QA 4M78D 1JRIA 4F7UG 2FYKA 3JB9J 3JB9G 4RCCA 5GAN5 3PGGA 3JB9F 4HT9A 4M7AD 4JRKA 4M7DC 1B34B 4M77B 1X01A 3RIRA 3RUXA 2EWNA 5GANg 3JCMX 1N9SA 1WNLA 4M75B 4DQ2A 5LJ5e 4M77F 5LJ3d 4J6YA 4M78E 4MMLA 4M7DD 4F7UE 2DEQA 3FIFA 1I4K1 4QVDA 1KQ1A 5LJ3e 4M75F 3QSUA 5GANf 4C92A 1BIBA 2QTXA 2VXFA 4HA8A 5DY9A 4N0AA 1JBMA 4C8QE 4XTVA 2JN0A 2RM4A 4M75D 4NOYA 4M7DG 4M75C 2YLBA 3JCMJ 4M7AC 2RD1A 2DXTA 5LJ3h 1YCYA 3JCMc 3JCMW 2RB6A 3V8KA 4M7AF 1U1SA 2E65A 4A53A 2EJFA 5I21A 3RERA 1M8VA 3V8JA 4PJOE 1TH7A 4M7AB 5LJ5h 3AHUA 5GAMj 4F7UA 4M7AG 4M77G 4EMKA 5LJ5f 1Y96A 5LJ5j 5GANh 3SWNC 4C92E 5GMKi 3V7SA 3JCMg 5GAMg 3JCMd 5GAMd 3RKYA 4M7DB 1LJOA 4M77C 3RKWA 4M75G 3QO3A 4XU1A 3JCMV 4XU2A 3HFNA 3L2ZA 4M7DF 4JRIA 5GMKm 4RCBA 5LJ5d 4V2SA 4M78G 3SWNB 3BFMA 4Y91A 3FJPA 1M5Q1 5GAOl 3V7CA 3JB9D 2HNIA 4EMGA 3QHSA 2DXUA 1HXDA 1U1TA 2YHTA 2EAYA 4XTWA 4XTXA 5LJ3f 4PJOG 4C92B 5LJ3g 4NL3A 4M7AE 5GMKj 4PJOB 5GAN8 4OP0A 2E10A 3INZA 3GIBA 4C92F 5LJ5g 5GAN2 2DZ9A 4PJOF 3JCMP 4M75A 3L1AA 5GAOq 4PJOC 5GAOm 2VC8A 4XTUA 3RESA 3V8LA 4F7UB 3QUIA 1B34A 4M77A 3JCMh 5GAMh 4WF2A 5GMKe 4PJOA 3HSBA 5GMKl 4A54A 4X9DA 4J6XA 4F7UF 4XU0A 1I81A 4M78C 5GANd 3JB9H 2DZCA 3M4GA 1KQ2A 4M77E 4XTZA 1HK9A 5GAOr 4M78A 3V7RA 4C8QC 2DTIA 4XTYA 2RA2A 4C8QF 4M7AA 5GAMe 3JCMe 2I2LA 5GMKh 4M78F 5GAN4 1D3BA 2E64A 4HT8A 2YLCA 4PNOA 4XQ3A 2FB7A 4MMKA 3BW1A 3BY7A 4M75E 4C8QB 4J5YA 1H641 4J6WA 3SB2A 4C8QG 3RKXA 4M78B 1BIAA 2E41A 5GAN6 2K57A 4EMKC 3JCMb 3JB9I 5GANj 4PJOD 4M7DE 4EMHA 1Y96B 1WQWA 4C92C 1I8FA 1MGQA 5CAIA 3HFOA 1WQ7A 2E1HA 1WPYA 2VXEA 5GAN3 3FB9A 4C8QD 3SWNA 2DJZA 2DTOA 1LNXA 3EFSA 5GAN7 4JUVA 1I5LA 4N0AC 4EMKB 3JCMQ 1N9RA 2EJGA 2ZGWA 4JLIA 3VU3C
chains in the Genus database with same CATH superfamily
1TOVA 2CH4W 1D3BB 3EGXB 1LOJA 1XQHA 1PM3A 2RH2A 1ZSGA 4JJDA 5DLOA 4C92D 4QVCA 4F7UG 1GRIA 3JB9G 3PGGA 2KRSA 3GF5A 3HL8A 2RQVA 1S72T 2FPFA 1VQ7Q 2E12A 2KR3A 1K9MR 4QVDA 3QSUA 4LDWA 2DBMA 4N4GA 4XTVA 2RM4A 1YJNQ 4M75D 4M7DG 3MEAA 3R6OA 1BI2A 5FWCA 4PJNA 3Q1JA 5HKCA 1NPRA 5DM7R 1QLYA 4KULA 5LJ5h 3OW2A 1QP3A 4F7UA 3OS5A 1AOJA 1PWTA 5GANh 1CKBA 3V7SA 5KYNA 3CMAT 4XU1A 1CKAA 3L2ZA 4KUIA 2A08A 2KSSA 4OMQA 2HBWA 3GPLA 1KK7A 1Y7XA 2BTTA 3A8HB 2QEXT 1VQOA 3CMEQ 1EX4A 3V7CA 4J9IA 1Q7YC 4IUTA 1YWOA 2DXUA 1OZ3A 2DD5A 1W2BA 5GMKj 2L5QA 1VQ8Q 5IHNA 2SRCA 3C4SA 2DFUA 5GAOq 3CPWS 3VS0A 1QVGP 4PJOA 1PHTA 2COYA 2CP5A 2WSCE 4F7UF 5CVIA 4E7ZA 1QMCA 1I5OB 4B9WA 4FT4A 3TSZA 2CS7A 3N5BB 5FW9A 1NJIC 2DMOA 1D3BA 2QYZA 5CKHA 2V26A 4MMKA 2MK5A 3SFMA 4C8QB 1QCNA 3SB2A 2KDSA 3MEUA 2GQVA 2DL3A 1ZX6A 4KGZB 3CXCA 2D8JA 4C0DB 2HL5C 4OB2B 3CCQQ 1T0JA 1VA7A 5EC7A 2EW3A 5J3BA 4Y28E 2L3PA 4N4HA 4DBQA 4CI0C 5GAN3 1WHHA 4JJBA 3OYIA 1Q86C 2FZKB 4C0ZA 3CCRQ 1ZBXA 2XMFA 1TTHB 4FM4B 2RPNA 2W10A 4OMFB 4D8DA 1GFDA 2P84A 1OI1A 3JRZA 5GAOn 3OYDA 2DRKA 3QDRB 4A4EA 1N8RR 3PIOA 4D6WA 3CCRA 2J06A 2LT4A 1VQNT 1OV3A 3EG3A 1RI9A 1X43A 4LD9K 2QTVA 2DBKA 2VGNA 4RG2A 1UHCA 2LQ8A 4BDZA 1RAIB 3G6ET 1YBYA 3MP8A 5L23A 2HMAA 5LL6S 1K73C 3E9GA 4PK4A 3VUZA 3EG0A 3JV3A 3URGA 1RAGB 1W6XA 3CCSQ 1IZ6A 2HKNA 4JLGA 1U3OA 2RJFA 4ZNXA 4QVZA 4O5VA 4JJNK 2JNGA 3SHWA 5LJ3f 2YHTA 3M0RA 2CREA 3E19A 5CKBA 1E6HA 1RL2A 3G4SQ 1RI0A 1Y71A 1VQPA 4FSXA 2K3YA 3C94A 3EGDB 4AG1C 4FYYB 3CCRT 4AMCA 2CH4A 3MHXA 4M78C 1OEBA 3UF4A 3G7ZA 3OMGA 2DTIA 1VQ5A 4XQ3A 2KT8A 4IKFA 1QCOA 4PJOD 3QWXX 4MZMA 1WX6A 2E4HA 1F1BB 1W70A 4DBRA 3HTRA 1XOVA 3QWYA 1GCQA 2J6OA 5AYFA 2BE7D 2DF6A 3M54A 2RK1A 3NTHA 2DEUA 3M4YA 3LX7A 5KCHA 3CCEA 1BI3A 2CZ1B 2EJGA 4FW2A 3EAEA 2FPDA 3A8GB 4HCKA 4AFUC 3OYMA 2RHXA 2DLPA 1M1GA 4FT2A 1M27C 1WI7A 2OTJA 4E6RA 5I2SA 1R8OB 5A0LA 2JJ9A 2LQWA 3JCMX 1PCXA 4LUDA 2E5QA 1ZUUA 1X6BA 2QTXA 2VXFA 4KGVB 2CZ6B 1D1CA 1QVFS 2QXFA 2L8DA 3CBPA 3CCSA 1SF9A 1O9SA 1U1SA 1ZA1B 2HD0A 1M8VA 3CCUQ 3V8JA 1VQMQ 4PJOE 4ESRA 2A28A 3CPWP 3CCET 2HKQB 1V76A 2P0QA 5HK0A 2E3HA 4HVUA 4JRQA 1X69A 2DK3A 1BCMA 2CP6A 2JOYA 2OAUA 4OB1B 3GP8A 2YUOA 5GMKm 1M30A 2EBPA 3HHTB 5KH6A 2RMOA 5D7UA 2JMAA 1G8XA 4HCBA 1VQLT 1G5VA 1HD3A 3HRSA 5CQYA 1SSHA 2VKNA 2X3WD 1M2OA 1YNZA 1QVGA 1M90R 3PNWC 1Z9QA 3JCMh 5GAMh 3HRTA 5GMKl 1YP5A 3REBB 2OTLQ 1BK2A 2KGTA 1UFFA 1EZZB 4IUPA 4MDWA 3CQTA 1JXMA 4PNOA 1MV0B 3BY7A 4II1A 4M75E 3I5RA 2DL7A 2B86A 3L2UA 1I1JA 4JRPA 3P8DA 4OVAA 4ZGDB 3CCMA 2MWPA 2MOXA 4DOVA 2PUOB 2NWMA 1VIEA 3I56T 4ZN1A 1T3SA 2DTHA 4JDSA 4QQDA 3OW2S 3X26B 1V29B 5FRNA 1MNDA 3BDUA 2GTJA 2FYKA 6AT1B 3MKDA 4KH0B 1PKSA 1QP2A 5GANg 2RI3A 2Y4XA 2MI6A 2V8IA 4E7SA 3CCVA 1Y0MA 1QVGS 2HBPA 4RTZA 4RMOA 1BKBA 1QVPA 5CKFA 1Y57A 3EGXA 4HA8A 4C8QE 1G3YA 1SKUB 3CC7T 2RI2A 2HQEA 2E6NA 1KHCA 1VQ4A 2DETA 1SRLA 1KQSS 3EG9B 1OQKA 5L8RE 1Y07A 1M90U 3PVQA 3M56A 3ULRB 1OU8A 1RAAB 1KD1C 2E3IA 2PU9B 4KRTA 4M7DF 4JRIA 1VQ6A 1RAFB 2X35A 2MCNA 5GAMj 3TVTA 1U8RA 4IURA 1ZUKA 2CP0A 3QBYA 1RADB 2JT4A 4PJOC 2LNHB 4A54A 4J6XA 4XU0A 5CO7A 1MUZA 4LUEA 1GXIE 2KT1A 1M1FA 1NJIU 3CEYA 4NS5A 1NLOC 2DO3A 4A4KA 2YLCA 1BYMA 5GAN6 3LWIA 2XI9A 4IIMA 4EMKC 3CMAA 4DEXA 2CP3A 4J9FA 1Q81U 4PLLA 1ARKA 1Q81C 1ZBJA 4OF1A 2E1HA 2M1HA 3FB9A 2O31A 1Q82C 5FRMA 2ZPIB 1FX7A 1LNXA 5C6SA 1YJWA 1QVFP 2GFUA 4LDUA 2DE0X 4M7DA 2R57A 2QG9B 3JCMf 2YRDA 5GAMf 3GNFB 2MAMA 4RCCA 5GAN5 3LGFA 4QQGA 2KXDA 4M77B 2L3RA 3QJYA 4HCZA 5LJ3d 1M2VA 4MMLA 3OYJA 4M75F 5GANf 1AVZC 4N0AA 1Q95G 1UE9A 4F16A 2RJCA 2HQHA 2PTKA 2FRYA 1XTDA 1AWWA 2XK0A 4C5EA 3A5ZB 1Y96A 3MPUB 1M1KU 4C5HA 4ELYC 3KBGA 1UB4A 3CD6Q 1OPLA 2CP2A 3O5ZA 4RKUE 1KD1U 1W2BS 2VVKA 1VQMT 2QDYB 2L0AA 3CCJA 1Q7YU 2CUBA 3UPUA 3H9NA 4OP0A 2AKKA 2AZVA 3INZA 2H8HA 2YWWA 3F70A 1WA7A 3RESA 2NUZA 3QUIA 1KD1R 1UG1A 5GMKe 1Q86R 4X9DA 4CC4B 2F5KA 5I22A 1SEMA 4DBFA 3OBWA 2OTJQ 4XTYA 2C06A 2AT1B 5CR2A 1ACMB 3CCUT 3L2RA 1K8AU 2NUTB 3U23A 2BKDN 3CCQT 4C8QG 2XD0A 3ZEHA 1U5SA 4EMHA 4K11A 4M4ZA 1YHQQ 2H3EB 1M9SA 2J7IA 1WJQA 2B8AA 4N0AC 1N9RA 1AZEA 2EYYA 3EFOA 1YITT 3VS1A 1NPPA 2YDLA 4J9EA 1IGUA 1VIFA 2Y90A 1WXUA 2DAQA 1BCOA 4JRKA 5KYWA 2P0PA 4Z89A 4PJLA 4QT7A 1AD5A 1I4K1 1ABQA 1YHQT 1BIBA 2VB6A 3FLGA 2CZ0B 1UGPB 1WGSA 2YLBA 3S3NA 1YI2Q 2DA9A 1YCYA 1RUWA 5D6WA 2H3JA 1BB9A 1TH7A 4O6JA 3OYAA 2ATCB 1OU9A 3VRZA 3ER0A 3TQ7P 5IN1A 3JCMd 5GAMd 3RKYA 2HAXA 4M7DB 3LYIA 2VASA 4PFZA 3RKWA 2YT6A 1PD1A 3A98A 1IXDA 3H6ZA 4RCBA 4X1VA 1JO8A 3OYHA 1AWOA 3PMTA 3VJPA 3BDLA 4RTWA 2K4YA 1EFNA 1YJWQ 4AG2C 1NM7A 2F69A 2ECZA 4WF2A 1K0SA 2FZCB 3OYGA 3FRNA 2HQXA 1C0MA 3CPFA 3S6WA 5GAOr 3CCQA 3M0PA 2KAFA 2P4TA 8AT1B 2DVJA 1K8AC 3LGLA 1BIAA 3M0SA 3L2WA 3OYFA 4JZ3A 1CSKA 5KYXB 1WQWA 1I8FA 3LH0A 1R0CB 1WQ7A 2VXEA 1GCQC 3SWNA 1YJNA 2JW4A 3H0IA 1VQ9T 1GFCA 3TCJA 2QDLA 1IHWA 2ZAEA 1QVFA 3OYBA 1YIJA 5ECAA 4F14A 5IAYA 3I56A 1VQ5T 1SPKA 2JM8A 2DILA 2HCKA 2EQKA 2ROLA 3QZ5B 1WNLA 3CCMT 4M75B 1IO6A 3S3OA 7AT1B 1VQKT 3FIFA 3LWHA 3CMEA 1YITQ 5KYWB 3PE0A 3NHNA 3ZBDA 3OS1A 2V1QA 4M7AC 4E7LA 3IQLA 4B9XA 4GLKA 3OYNA 1UJ0A 2R58A 2EJFA 2QEXQ 4OMLA 1KJWA 5DLQE 1VQ5Q 4LD6A 4PKCC 1M90C 2LZ6B 2KBTA 1FMWA 2LJ0A 4A4GA 1D1AA 4P5NA 1G83A 3JSCA 4L6V5 2COWA 3JCMV 2K5IA 3SWNB 1UTIA 1VQLQ 4Y91A 3FJPA 4FL6A 5FU7B 3QHSA 4JPBW 5LJ3g 4C92B 1NEGA 4EDUA 3GIBA 4C92F 1N8RC 2C0TA 2DZ9A 3OYEA 4XTUA 3CD6T 5FLXE 1B34A 3H0HA 1AZGB 2K2MA 2K79A 2LQNA 1HYOA 1R0BG 2LT1A 4JS4A 2CDTA 3RNJA 2GTOA 3GBQA 3I9QA 4ATOA 2VUBA 1WJRA 4C92C 3VU3C 4C8QD 1X75C 4C5GA 1NJIR 4ZGJB 1JU5C 3M0UA 2RHZA 1WJSA 2JM9A 2LRQA 2GNCA 1UJYA 3OB9A 1YITA 1OX9A 2O9VA 3MP6A 1D0YA 2RF0A 1VYUA 4PJJA 1KC8R 1M2VB 2I0NA 1VUBA 2XG8D 2FL7A 1GCPA 4IIOA 4QQ6A 4C92A 3UWNA 2JS2A 4F17A 1TUDA 3AT1B 3ZL7C 3G1JA 3JCMc 2V1RA 3CMET 1T3LA 4LE9A 3C0CA 2CT4A 1P92A 5FU6B 2AZSA 4EPCA 4LDYA 3QPHA 1WHGA 2A3LA 1HSQA 1VQ8A 3CC2A 1NYFA 2OAWA 4J7IA 4E7HA 1GL5A 5GAOl 2O01E 3MO8A 1WHMA 1R77A 4M7AE 2LC4A 4Q5WA 2RHIA 2GGRA 5A0DA 4MZTA 5LJ5g 1WIEA 4M75A 3V8LA 2NUPA 1O75A 1WZOA 1TU0B 1BI1A 4C5IA 3M4GA 1OZ2A 2KE9A 1FMVA 2A37A 2FZGB 2YUNA 2EYWA 2MWOA 3VV0A 2M0YA 3RKXA 2E41A 1IRXA 4TVRA 2EQMA 3CXCP 5CKEA 3E2UA 2DXCA 5KYXA 1WPYA 1MNEA 1YI2A 3WVDB 2DJZA 5IXFA 1FYNA 1MMGA 5IH2A 2OX7A 5D6YA 3G71Q 4CC7A 2JVVA 4PJMA 4BB7A 1WLPB 3FDRA 2DKGA 2PVDB 3CCLA 1YJWT 4LDXA 2DM1A 2ROTA 4M78D 3VYHB 4C8QA 3JB9J 4M7AD 4M7DC 1TG0A 2EWNA 1ZSZC 3KFVA 3I55Q 4DQ2A 2QK0A 1VQNA 1JJ2A 3VS3A 1EIFA 2X4XA 1RLPC 2DPPB 3FEOA 1H3ZA 1VQLA 3CCST 3JAME 5DY9A 1H8KA 3I35A 1E7OA 3DLMA 2J6FA 4A53A 2ZPGB 2K6DA 1TS9A 3CXCS 3J81E 4HCCA 1D0XA 1M1KC 3VS5A 4BI4A 4ZTFA 2ENMA 5KE3A 5I2MA 3RMSA 1YWPA 1X2KA 2QEXA 2OJ2A 3FC3A 3HRUA 2F1LA 3M9QA 3G4SA 4JS5A 3C12A 2EAYA 5GJVB 1LVKA 1PC0A 3L1AA 2LCSA 1UHFA 5GAOm 1OPKA 2NLUA 5KYUA 4A63B 2G3RA 3QG1A 4OGCA 3V7RA 2XDPA 1RACB 5GAMe 3JCMe 9ATCB 5GAN4 1WXBA 2FB7A 2X51A 1KQSA 3QIIA 1QWEA 4J5YA 2R5AA 1E6GA 2AK5A 1B07A 2LJ1A 2DL4A 4M7DE 3M58A 2K7AA 1XNIA 3MJXA 1X27A 3M0TA 4CRIA 4CC3A 1Q81R 2P4RA 1UGQB 1A0NB 2WACA 4MZPA 1X2QA 1K9MU 1SRMA 2EJ9A 2NUTA 3EFRA 5FU7C 4RG8A 5LJ3j 3NTIA 4NL2A 3J80E 2RHYA 5KYYA 4C92G 3VS4A 3A1PA 3A8LB 2LNVA 2M51A 2EQUA 5EG2A 4BUGA 2DRMA 3G71T 1K4US 2EFIA 2DYIA 1VQPT 1KC8U 2FVUA 4RTUA 2V8KA 1X6OA 2HL3A 2MIOA 2KROA 2CT3A 2QQAA 2EQJA 2EGCA 2HSEB 1JBMA 2E6ZA 2G6FX 1WHKA 1SG5A 2X4JA 2RB6A 5I11A 2DXBA 1AHJB 1PG5B 4XAXB 4FYWB 4CC2A 2A7YA 3E9FA 3HFNA 3LLRA 1VQ8T 3CC2T 1K8AR 4KT0E 1K9AA 2YRCA 1ZUYA 4NL3A 1N8RU 1YFNA 3TU4K 3PFSA 5GAN2 2RI5A 2MMPA 2EYXA 2VC8A 4F7UB 1YJ9T 3RDVA 2QQBA 2CKKA 2M02A 3JB9H 2DZCA 3EHRA 3X25B 1JEGA 1M3BA 3OW2P 2A36A 1Q86U 2KRMA 2W0ZA 3VKIA 1G3SA 1ZLMA 2MF2A 5GMKh 3TSWA 2ZPBB 3HPWA 1VOMA 2RQRA 2V8JA 2K3BA 4M78B 1S1NA 3VRYA 3LH5A 2LDMA 1K73R 2FG0A 1I0CA 2QAZA 4BY6C 2LTOA 2XU8A 1ABOA 1U06A 1I5LA 3JCMQ 2IIMA 3I55A 1VQOT 4M77D 4KGXB 5GAOp 1C1AA 4XU3A 1PRLC 2CGHA 4X9CA 3PMIA 1VQ6T 2LX9A 1W1FA 2L3QA 1JRIA 4RTXA 5J26A 4HT9A 3OYYA 5C0MA 4BE2A 3UA6A 1B34B 2BZ8A 5LJ5e 1QCFA 3CCLQ 3WVEB 3CCJQ 1KC8C 4E7JA 3EGDA 4A4HA 1VQ4T 2XDBA 2QA4Q 3META 5CCAA 4HVVA 2JN0A 5KCOA 1C6VX 3X28B 1D1BA 2RD1A 3GOXA 2DD4A 4M7AF 3A8OB 4PLIA 4DBHA 3I55T 1NZ9A 3C95A 3RERA 3CBMA 4M7AB 3OBYA 4BE1A 3CCVT 5LJ5f 4BY6B 4C92E 5GMKi 2LJ3A 1LJOA 3EG9A 1UGVA 4LNPA 1UGRB 4F04B 4V2SA 3RR6A 3BFMA 2CP7A 2GFAA 1U1TA 1MMAA 2BZXA 4PL6A 4E2FB 2EYQA 2VYTA 1W2BP 2JTFA 3GNGA 1KG1A 1GBQA 3CMAQ 2VV5A 2XICA 1S72A 3T9NA 1VQOQ 1I81A 5GANd 3CC2Q 3DLLA 4M77E 1KQ2A 1NBEB 2F2XA 1KFZA 2VWFA 2QGGA 4M78A 2MYSA 2CSQA 3NTKA 4M7AA 2LX7A 4XK8E 3VS6A 2CUDA 2JS0A 3OYLA 4L59A 2PZ1A 1X6GA 4ELZC 2ESWA 4OMOA 5FWBA 1N6AA 1SHGA 3HKSA 3EH1A 1D0ZA 3BE3A 3P8BB 2D8HA 2DTOA 4J7FA 1M8MA 2ZPFB 2ZGWA 2F5TX 4RTYA 2FPEA 1V1CA 2PUKB 2RO0A 2BZYA 1PSEA 5GANe 3CCVQ 2JMCA 1VQ7A 1D09B 2FEIA 2WSEE 3UA7A 4FYVB 1UGSB 1SHFA 1BI0A 1X01A 2CZ7B 3G71A 4M77F 1JQQA 2OI3A 4J6YA 4M78E 4M7DD 1VQ4Q 2BUDA 1IB8A 3D7SB 1NG2A 4E47A 2RQUA 1VQ9Q 5HY6A 2EKOA 2M16A 2FO0A 4M75C 3ASKA 2MPXC 3MCAB 3SEMA 2GQIA 5J39A 4M7AG 3ME9A 5LJ5j 1OOTA 3SWNC 2PVGB 2C0IA 1PNJA 1B3QA 1OX8A 4M77C 4M75G 1VQKQ 3G4ST 2COZA 1S72Q 2EPDA 4GLMA 2PNIA 1K73U 1ZHIA 3L2QA 5GAN8 2J6KA 2ED1A 2E10A 2QQSA 4OB3B 1ZSZB 3H0FA 2K9GA 4A4FA 1AEYA 3PT9A 1TSFA 1HK9A 3UT1A 1N5ZA 2SEMA 2EKHA 2KEAA 1WYXA 3EFOB 3TREA 1XJWB 4LN2A 3CC4A 3E1SA 3REAB 5GANj 1YJ9Q 1G2BA 2A0FB 5KYUB 2OTLA 1MGQA 3OSSC 2RK2A 2DYBA 1NLPC 3X24B 5GAN7 2JXBA 4FYXB 4GBQA 4EMKB 3CCMQ 2KXCA 5IHIA 4OB0B 2X4WA 3O8VA 4Y92A 3KUFA 2ZCFB 2DNUA 4ME7A 2D9TA 1G3WA 1UEBA 1IHVA 2EVRA 2O9SA 2QI2A 4IUUA 3RIRA 3NPFA 5A2QE 2KMTA 2X4YA 1UDLA 5LJ3e 2D1XA 1WHJA 2O4XB 1MV3A 3G6EA 1ZA2B 4GY5A 2LQKA 4FU6A 4ORZA 5CIUA 1MHNA 4RUGA 3CCEQ 1K76A 1FXXA 3JCMJ 3OYCA 1FMKA 3SD4A 2E65A 5I21A 4AFQC 3EHQA 1SSFA 1Z9ZA 2QA4A 5GJWB 5FU6C 4M77G 1YI2T 1ZQ1A 2PQWA 2YXYA 2JTMA 4BACA 2FRWA 2LVMA 3EG1A 2J05A 1W4SA 4BI3A 2KK4A 2EQIA 2ED0A 3I5SA 2KY9A 1M5Q1 3QYHB 4C0FA 3CC7A 3TEEA 2D0NA 3OMCA 4BDYA 4JJCA 4X34A 2GF7A 4HVWA 4EIKA 1JJ2P 1H3HA 4M77A 1T0HA 2XKOC 4E7IA 1JJ2S 2F2VA 4DA4A 5FROA 2KYBA 1DJ7B 1WDXA 2I2LA 4M78F 1VQMA 2D0QB 3JCMb 2K57A 2AIRB 4J9HA 1VYVA 4Z02A 2RJEA 2FHDA 2ZZDA 5HCKA 5M9OA 1KSWA 3M0QA 4Z8AA 1K9MC 3ZFJA 3R6NA 2XHCA 2BIVA 2Y4YA 4WTOB 2RHUA 2YSQA 1LPLA 1N9SA 8ATCB 1HJDA 2AHJB 4F7UE 1TWBA 3OYKA 3QDFA 3KXTA 1WFWA 1JXOA 3CC4T 2O4XA 4RTVA 3FJ5A 1KQSP 1G3TA 2HEQA 3JCMW 3M57A 3V8KA 1AT1B 1PD0A 1YHQA 2DIGA 2PVOB 1GBRA 3VS2A 3G6EQ 4AT1B 1Q7YR 3CBOA 2ZPHB 3CPWA 2OTLT 5IXBA 1FWZA 3EH2A 2AKLA 4OGEA 2DL5A 4UC4A 1IREB 2F2WA 3L42A 2D6FA 2RJDA 1JB0E 3JB9D 4XTXA 1I07A 1K0XA 3H8ZA 3JCMP 4OMMA 1BBZA 1RABB 4QKUA 5CQXA 2R5MA 5HK3A 3CD6A 1WHLA 3HSBA 5IT9E 3P8HA 3I56Q 4R0KA 4XTZA 3RBBB 2X9HA 3VYGA 5D6XA 1UUEA 2DX1A 4HT8A 4KH1B 4FCYA 4D8KA 4LDVA 4R55A 1NE8A 1WXTA 3JB9I 2GCXA 4RTTA 2EYZA 1RAHB 5CKDA 1Q82R 5IHKA 2LCLA 1LCKA 5AT1B 1BU1A 3EFSA 5KYYB 2KVQG 1TXQA 3MEWA 1VQ7T 4JLIA 4B6MA 2XDDA 5CK9A 2DVEA 3NFCA 5A0GA 4N4IA 4C0GA 1YIJT 1KIKA 4BE0A 2JZ2A 3MP1A 1IGQA 1PKTA 3M59A 1VYTA 2EGAA 4AFSC 4DOWA 3JB9F 1K1ZA 2K5FA 1VQKA 2DIQA 2E5KA 3S3MA 1YN8A 3EGUA 2HZYA 4ANJA 2QA4T 2DEQA 2KRNA 4J8OA 2VGMA 3X20B 2QASA 4VUBA 3VS7A 2LCCA 4L5GA 2RQTA 2IPOB 2RQWA 3QZ9B 2DXTA 3WXMB 1YCSB 2YRVA 4DEYA 1VQ9A 4J9BA 2K3XA 4FIBA 1J3TA 3SDZA 3OY9A 1MMNA 3JCMg 5GAMg 3QJ6A 4WCIA 3CC4Q 3PIPA 2JUFA 3QO3A 2RNAA 2LP5A 5LJ5d 1TUCA 2KI7A 2K5LA 1N27A 2YUQA 3LW5E 4J9DA 2DERA 2HNIA 4EMGA 4PJOG 3OS0A 2JTEA 2O2OA 3J7AF 1QWFA 3OS2A 1VQ6Q 1PSFA 2XIDA 2KYMA 3CC7Q 4E7KA 1QKXA 1KHIA 2CSIA 3MEVA 3DB3A 2K2VA 4MDXA 1MMDA 1NEBA 2E64A 3BW1A 4OMPA 1H641 1RAEB 3HP9A 4J6WA 2YUPA 1Y96B 3RMQA 3PVLA 3GLXA 1QQJA 4FSSA 2OTJT 4BD3A 2BE9B 1M3AA 1VQNQ 2QQ9A 1NYGA 1AWJA 4ZGEB 1M4ZA 3NGPA 2IVWA 2L89A 4PFPA 2EGEA 2RN8A 4OMNA 4QW2A 2KQWA 3RUXA 4AFZC 5KE2A 1B7TA 3L2VA 1UECA 3OA6A 1TUGB 3UDCA 1KQ1A 4Z88A 2DL8A 1YIJQ 3M53A 2EIFA 3CCUA 2HSPA 1QW1A 2C0OA 4J9GA 2O88A 2P0KA 4NOYA 1H92A 5LJ3h 2IG0A 3EG2A 2E70A 2HDAA 3M5AA 1QKWA 2NUPB 3AHUA 2CYZB 4EMKA 3UATA 1YJ9A 4IUVA 4HXJA 3OQ5A 4KBMB 1AWXA 2ZPEB 3QXEB 2Z0WA 4XU2A 1RLQC 3CCJT 4PFOA 2M9UA 4M78G 2QQRA 4J83A 2NYSA 4XTWA 1HXDA 3H41A 4BI8B 4PJOB 2DJQA 1YJNT 4IUQA 4PJOF 2KNBB 1M3CA 3VUBA 3QYGB 2GBQA 4HKEA 4LXCA 1ZSZA 3DKMA 3THKA 2QGFB 4C8QC 4FW1A 2L2PA 2RA2A 3OSVA 4C8QF 3CCLT 4ZTJA 2X3XD 2WSFE 4C0DC 2ABLA 3A8MB 4ZN3A 3QKJA 4J9CA 2M0OA 4YTLA 4R56A 1PRMC 2LMJA 5CAIA 3PTAA 3HFOA 1M1KR 1Q82U 1OYXA 1OULA 3NMZC 4JUVA 1VQPQ 3M55A 4KUDK 3DB4A 2L3SA 4JZ4A
chains in the Genus database with same CATH topology
4BB7A 3KUFA 1D3BB 1LOJA 1XQHA 2GFUA 2ZCFB 3FDRA 4LDUA 4M7DA 2R57A 2RH2A 3JCMf 4ME7A 2D9TA 5GAMf 2DKGA 2PVDB 5DLOA 3CCLA 1YJWT 4C92D 3GNFB 1G3WA 4QVCA 4LDXA 3VYHB 4M78D 4C8QA 4F7UG 3JB9J 3JB9G 2MAMA 4RCCA 1UEBA 3PGGA 5GAN5 4M7AD 3GF5A 3HL8A 3LGFA 4M7DC 4QQGA 4IUUA 2QI2A 4M77B 3RIRA 2EWNA 1S72T 2L3RA 2E12A 4DQ2A 1VQNA 3QJYA 4HCZA 5LJ3d 1JJ2A 1EIFA 2X4XA 5A2QE 2DPPB 4MMLA 3OYJA 2KMTA 2X4YA 1VQOA 4QVDA 3FEOA 5LJ3e 4M75F 3QSUA 1H3ZA 2O4XB 4LDWA 1VQLA 4N4GA 5GANf 3CCST 3JAME 3G6EA 5DY9A 4N0AA 4GY5A 4XTVA 2LQKA 4FU6A 2RM4A 5CIUA 3DLMA 1MHNA 4M75D 4M7DG 1FXXA 3MEAA 3R6OA 3JCMJ 1BI2A 3OYCA 2RJCA 3SD4A 2E65A 3Q1JA 4A53A 5HKCA 1NPRA 5I21A 2ZPGB 1XTDA 5DM7R 4KULA 1SSFA 2XK0A 5LJ5h 2QA4A 3OW2A 4C5EA 1QP3A 5FU6C 3OS5A 4M77G 4F7UA 3J81E 3CXCS 3A5ZB 1Y96A 1YI2T 1M1KU 4HCCA 1ZQ1A 2PQWA 5GANh 3V7SA 4C5HA 1M1KC 2JTMA 4ELYC 4BACA 3KBGA 4BI4A 4ZTFA 2LVMA 1UB4A 4XU1A 1W4SA 4BI3A 5KE3A 3CMAT 2KK4A 5I2MA 3L2ZA 3RMSA 4KUIA 4RKUE 2QEXA 3FC3A 1KD1U 2KSSA 3HRUA 1W2BS 3M9QA 3GPLA 3G4SA 3A8HB 1Y7XA 1VQMT 2QEXT 4JS5A 2KY9A 1M5Q1 2QDYB 3QYHB 3V7CA 4C0FA 4IUTA 3C12A 3CC7A 2DXUA 3CCJA 1OZ3A 3TEEA 2EAYA 1Q7YU 2DD5A 3OMCA 1W2BA 5GMKj 3UPUA 4OP0A 2L5QA 4BDYA 3INZA 3C4SA 4X34A 2GF7A 5GAOq 3L1AA 3F70A 3CPWS 5GAOm 3RESA 3QUIA 2NLUA 4M77A 4PJOA 5GMKe 2XKOC 4X9DA 2WSCE 4F7UF 2G3RA 5CVIA 4E7IA 2F5KA 3QG1A 4DA4A 4OGCA 5FROA 1JJ2S 4B9WA 4FT4A 3OBWA 3V7RA 2XDPA 4XTYA 2CS7A 3N5BB 1DJ7B 5CR2A 2C06A 5GAMe 3JCMe 2I2LA 5GAN4 4M78F 3L2RA 1D3BA 3CCUT 1NJIC 1VQMA 5CKHA 1K8AU 2BKDN 2D0QB 2FB7A 4MMKA 3CCQT 3QIIA 3SFMA 4C8QB 1KQSA 4J5YA 2KDSA 3SB2A 2R5AA 4C8QG 3JCMb 3MEUA 2K57A 2XD0A 2GQVA 3ZEHA 3CXCA 4M7DE 4C0DB 4EMHA 3M58A 4OB2B 1XNIA 4Z02A 5J3BA 4Y28E 4N4HA 4CI0C 5GAN3 4CRIA 2RJEA 1M9SA 2FHDA 1UGQB 2ZZDA 1WJQA 2B8AA 4N0AC 5M9OA 3OYIA 1Q86C 1N9RA 2WACA 4MZPA 4C0ZA 1K9MU 1ZBXA 2EJ9A 3EFRA 1YITT 1K9MC 4FM4B 1NPPA 5FU7C 3ZFJA 4RG8A 4OMFB 5LJ3j 2XHCA 3NTIA 4NL2A 2RHYA 3J80E 4C92G 1VIFA 1OI1A 2Y90A 3JRZA 5GAOn 2BIVA 3OYDA 2Y4YA 3QDRB 4A4EA 2DAQA 2RHUA 4JRKA 3A8LB 3PIOA 2LNVA 4D6WA 2EQUA 5EG2A 4BUGA 3CCRA 2LT4A 1VQNT 1N9SA 2P0PA 3G71T 2EFIA 1VQPT 1KC8U 2FVUA 2AHJB 2V8KA 1X6OA 4F7UE 1I4K1 2QQAA 3OYKA 1YHQT 2EQJA 4LD9K 3KXTA 1BIBA 3CC4T 3FLGA 2CZ0B 2VGNA 2O4XA 1JBMA 4RG2A 1G3TA 2E6ZA 1UGPB 2LQ8A 1WGSA 4BDZA 2YLBA 3S3NA 3G6ET 1YBYA 3JCMW 1YCYA 2X4JA 2RB6A 3M57A 3MP8A 5D6WA 3V8KA 1YHQA 2DIGA 2DXBA 2H3JA 2PVOB 5LL6S 1AHJB 1K73C 1TH7A 4O6JA 3E9GA 3CBOA 3OYAA 4XAXB 3VUZA 2ZPHB 3CPWA 3ER0A 2A7YA 2OTLT 5IN1A 3URGA 3JCMd 1FWZA 3RKYA 5GAMd 2HAXA 4M7DB 3LYIA 1IZ6A 4JLGA 4OGEA 3RKWA 2RJFA 3E9FA 3HFNA 4UC4A 1IREB 3H6ZA 3L42A 4QVZA 4O5VA 4RCBA 3LLRA 4JJNK 2D6FA 2JNGA 1VQ8T 3CC2T 3OYHA 2RJDA 4KT0E 1JB0E 3JB9D 3PMTA 4XTXA 5LJ3f 2YHTA 3VJPA 4NL3A 3BDLA 3H8ZA 3E19A 1N8RU 5CKBA 1RL2A 2K4YA 3TU4K 3PFSA 5GAN2 2RI5A 2MMPA 3JCMP 1RI0A 2VC8A 1Y71A 5CQXA 4F7UB 1VQPA 1YJ9T 2F69A 2R5MA 2QQBA 5HK3A 3CD6A 4FSXA 2CKKA 2K3YA 3C94A 4WF2A 3CCRT 3HSBA 3OYGA 5IT9E 1Q7YC 3P8HA 3MHXA 3FRNA 4M78C 3JB9H 2DZCA 3X25B 2HQXA 4XTZA 3CPFA 3G7ZA 3S6WA 5GAOr 3CCQA 1Q86U 3OMGA 2DTIA 2KAFA 3VYGA 3VKIA 2P4TA 1VQ5A 1G3SA 2MF2A 5GMKh 5D6XA 2ZPBB 3HPWA 4HT8A 4XQ3A 2V8JA 1K8AC 4IKFA 4LDVA 4R55A 3LGLA 4M78B 1BIAA 4MZMA 1NE8A 4PJOD 3L2WA 3JB9I 2GCXA 2LDMA 3OYFA 4BY6C 5CKDA 1XOVA 1WQWA 2LTOA 1I8FA 3LH0A 2XU8A 5AYFA 1WQ7A 2VXEA 2LCLA 3M54A 2RK1A 3NTHA 3M4YA 3LX7A 3CCEA 1BI3A 2CZ1B 3SWNA 1YJNA 3EFSA 1I5LA 2KVQG 3MEWA 1VQ9T 3JCMQ 4JLIA 2EJGA 2XDDA 1VQ7T 3I55A 3TCJA 5CK9A 3EAEA 2DVEA 1VQOT 3A8GB 4M77D 3NFCA 5A0GA 5GAOp 4N4IA 4C0GA 3OYBA 1YIJT 1YIJA 4BE0A 1QVFA 2JZ2A 4X9CA 2CGHA 4XU3A 3PMIA 3MP1A 5IAYA 3OYMA 3M59A 1VQ6T 2LX9A 3I56A 1VQ5T 2RHXA 4DOWA 1M1GA 1JRIA 4FT2A 3JB9F 5J26A 2EQKA 2K5FA 4HT9A 3OYYA 2OTJA 5C0MA 4BE2A 1VQKA 5I2SA 1R8OB 1B34B 2DIQA 5A0LA 3S3MA 3QZ5B 1WNLA 3JCMX 3CCMT 4M75B 5LJ5e 2QA4T 3S3OA 3WVEB 1VQKT 2DEQA 3FIFA 3LWHA 1KC8C 3CMEA 2E5QA 4E7JA 4A4HA 1VQ4T 2XDBA 4J8OA 2VGMA 2QTXA 3X20B 2VXFA 4VUBA 2CZ6B 2LCCA 3META 3ZBDA 5CCAA 4L5GA 3OS1A 1QVFS 2JN0A 2QXFA 5KCOA 2L8DA 3X28B 3CBPA 4M7AC 3GOXA 2RD1A 4E7LA 3QZ9B 2DD4A 2DXTA 4B9XA 3CCSA 4M7AF 4GLKA 3OYNA 1O9SA 1U1SA 3A8OB 4PLIA 3WXMB 3I55T 2R58A 1NZ9A 2EJFA 2YRVA 2HD0A 3C95A 3CBMA 3V8JA 1VQ9A 3RERA 4PJOE 1M8VA 4M7AB 5DLQE 3OBYA 4BE1A 4LD6A 4PKCC 2K3XA 5LJ5f 3CCVT 1M90C 3CCET 4FIBA 2P0QA 3SDZA 4BY6B 4A4GA 4C92E 3OY9A 5HK0A 5GMKi 4P5NA 3JCMg 5GAMg 3QJ6A 4JRQA 3PIPA 2DK3A 2JUFA 1LJOA 3JSCA 4L6V5 2OAUA 2JOYA 4OB1B 3GP8A 3QO3A 3JCMV 1UGRB 5GMKm 5LJ5d 4V2SA 2K5IA 2K5LA 1N27A 3SWNB 3BFMA 3LW5E 3HHTB 3FJPA 2GFAA 4Y91A 5KH6A 4FL6A 5FU7B 2HNIA 4EMGA 3QHSA 4PJOG 5LJ3g 1U1TA 4PL6A 4C92B 3OS0A 2EYQA 2VYTA 4HCBA 1VQLT 3J7AF 2JTFA 4EDUA 1G5VA 3GIBA 3GNGA 4C92F 3OS2A 1N8RC 2DZ9A 3HRSA 3OYEA 5CQYA 1KG1A 1PSFA 2XIDA 4XTUA 3CD6T 1QVGA 5FLXE 1B34A 3PNWC 3JCMh 2VV5A 2XICA 5GAMh 1S72A 3T9NA 3HRTA 5GMKl 4E7KA 1I81A 5GANd 1KHIA 3DLLA 4M77E 1KQ2A 3MEVA 3DB3A 4M78A 3NTKA 2K2VA 4M7AA 2LT1A 4IUPA 4MDXA 4MDWA 2E64A 4PNOA 4XK8E 4JS4A 3BW1A 3BY7A 4II1A 4M75E 1H641 3HP9A 4J6WA 3OYLA 4L59A 4ELZC 3L2UA 4ATOA 1Y96B 2VUBA 1WJRA 4JRPA 3P8DA 4OVAA 4ZGDB 3RMQA 3CCMA 2MWPA 4C92C 4DOVA 1N6AA 3GLXA 3HKSA 3VU3C 4C8QD 2OTJT 1X75C 2PUOB 3P8BB 4C5GA 4ZGJB 2DTOA 4BD3A 4J7FA 2ZPFB 2RHZA 1VIEA 1WJSA 2ZGWA 2LRQA 2F5TX 3I56T 4ZN1A 2QQ9A 2DTHA 3OB9A 2PUKB 1YITA 4JDSA 4QQDA 2RO0A 3OW2S 3X26B 1PSEA 4ZGEB 1M4ZA 1V29B 5GANe 3MP6A 2IVWA 2L89A 5FRNA 1VQ7A 2WSEE 3BDUA 1UGSB 2FYKA 4QW2A 1BI0A 2KQWA 1X01A 3RUXA 1QP2A 5KE2A 5GANg 2CZ7B 2RI3A 3G71A 2Y4XA 2MI6A 2V8IA 1VUBA 2XG8D 3L2VA 3OA6A 4M77F 2FL7A 3CCVA 1QVGS 3UDCA 2HBPA 4J6YA 4M78E 4M7DD 2BUDA 4RMOA 1BKBA 1KQ1A 1QVPA 4QQ6A 4C92A 5CKFA 3UWNA 3M53A 4HA8A 4E47A 2EIFA 4C8QE 1G3YA 3CCUA 3CC7T 5HY6A 2EKOA 1QW1A 2RI2A 2HQEA 2M16A 2E6NA 2P0KA 4NOYA 4M75C 5LJ3h 3ASKA 1KHCA 3JCMc 1VQ4A 2IG0A 3MCAB 1KQSS 3CMET 2E70A 5L8RE 5J39A 3M5AA 3AHUA 1Y07A 2CYZB 4EMKA 1P92A 4M7AG 3ME9A 5LJ5j 1YJ9A 4IUVA 3SWNC 1M90U 3M56A 2PVGB 3OQ5A 5FU6B 4KBMB 2ZPEB 4M77C 3QXEB 4M75G 4EPCA 4XU2A 1KD1C 4LDYA 2PU9B 3QPHA 3CCJT 4M7DF 2A3LA 4JRIA 1VQ6A 3G4ST 3CC2A 1VQ8A 2M9UA 4M78G 4J7IA 4E7HA 2QQRA 4J83A 5GAOl 2X35A 5GAMj 4XTWA 1HXDA 1K73U 1ZHIA 2O01E 3MO8A 4BI8B 3L2QA 2LC4A 1U8RA 5GAN8 4Q5WA 4M7AE 2RHIA 1YJNT 2E10A 4IURA 4IUQA 4MZTA 5A0DA 5LJ5g 4PJOF 2QQSA 3QBYA 4M75A 4PJOC 3V8LA 3VUBA 4OB3B 3QYGB 1O75A 4HKEA 1BI1A 4C5IA 4A54A 4J6XA 4XU0A 4A4FA 5CO7A 3DKMA 3M4GA 1OZ2A 3PT9A 1GXIE 3UT1A 1HK9A 1M1FA 1NJIU 4C8QC 3CEYA 2RA2A 3OSVA 4C8QF 4NS5A 3CCLT 4ZTJA 4A4KA 2DO3A 2MWOA 3TREA 2WSFE 2YLCA 3VV0A 4C0DC 1BYMA 3CC4A 3A8MB 5GAN6 4ZN3A 3E1SA 3QKJA 2XI9A 3RKXA 3LWIA 2E41A 5GANj 2M0OA 4EMKC 4PJOB 4TVRA 3CMAA 2EQMA 5CKEA 4YTLA 1Q81U 4R56A 4PLLA 2DXCA 2OTLA 1MGQA 5CAIA 1Q81C 4OF1A 3HFOA 2E1HA 3PTAA 2M1HA 1WPYA 3OSSC 1Q82U 2RK2A 3FB9A 1YI2A 1OYXA 3WVDB 1Q82C 2DJZA 2ZPIB 1FX7A 1LNXA 3X24B 4JUVA 5GAN7 5FRMA 4EMKB 5C6SA 3M55A 4OB0B 2X4WA 5D6YA 4KUDK 1YJWA 3DB4A 5KCHA 2JVVA 3O8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJ9 A;  2DTH A;  2DVE A;  1D3B B;  4M77 D;  1LOJ A;  3EFR A;  5GAO p;  4M7D A;  4XU3 A;  4X9C A;  2CGH A;  3JCM f;  5GAM f;  5GAN e;  5LJ3 j;  2DKG A;  4NL2 A;  4C92 G;  2Y90 A;  4C92 D;  4QVC A;  5GAO n;  3BDU A;  4C8Q A;  4M78 D;  1JRI A;  4F7U G;  2FYK A;  3JB9 J;  3JB9 G;  4RCC A;  5GAN 5;  3PGG A;  3JB9 F;  4HT9 A;  4M7A D;  4JRK A;  4M7D C;  1B34 B;  4M77 B;  1X01 A;  3RIR A;  3RUX A;  2EWN A;  5GAN g;  3JCM X;  1N9S A;  1WNL A;  4M75 B;  4DQ2 A;  5LJ5 e;  4M77 F;  5LJ3 d;  4J6Y A;  4M78 E;  4MML A;  4M7D D;  4F7U E;  2DEQ A;  3FIF A;  1I4K 1;  4QVD A;  1KQ1 A;  5LJ3 e;  4M75 F;  3QSU A;  5GAN f;  4C92 A;  1BIB A;  2QTX A;  2VXF A;  4HA8 A;  5DY9 A;  4N0A A;  1JBM A;  4C8Q E;  4XTV A;  2JN0 A;  2RM4 A;  4M75 D;  4NOY A;  4M7D G;  4M75 C;  2YLB A;  3JCM J;  4M7A C;  2RD1 A;  2DXT A;  5LJ3 h;  1YCY A;  3JCM c;  3JCM W;  2RB6 A;  3V8K A;  4M7A F;  1U1S A;  2E65 A;  4A53 A;  2EJF A;  5I21 A;  3RER A;  1M8V A;  3V8J A;  4PJO E;  1TH7 A;  4M7A B;  5LJ5 h;  3AHU A;  5GAM j;  4F7U A;  4M7A G;  4M77 G;  4EMK A;  5LJ5 f;  1Y96 A;  5LJ5 j;  5GAN h;  3SWN C;  4C92 E;  5GMK i;  3V7S A;  3JCM g;  5GAM g;  3JCM d;  5GAM d;  3RKY A;  4M7D B;  1LJO A;  4M77 C;  3RKW A;  4M75 G;  3QO3 A;  4XU1 A;  3JCM V;  4XU2 A;  3HFN A;  3L2Z A;  4M7D F;  4JRI A;  5GMK m;  4RCB A;  5LJ5 d;  4V2S A;  4M78 G;  3SWN B;  3BFM A;  4Y91 A;  3FJP A;  1M5Q 1;  5GAO l;  3V7C A;  3JB9 D;  2HNI A;  4EMG A;  3QHS A;  2DXU A;  1HXD A;  1U1T A;  2YHT A;  2EAY A;  4XTW A;  4XTX A;  5LJ3 f;  4PJO G;  4C92 B;  5LJ3 g;  4NL3 A;  4M7A E;  5GMK j;  4PJO B;  5GAN 8;  4OP0 A;  2E10 A;  3INZ A;  3GIB A;  4C92 F;  5LJ5 g;  5GAN 2;  2DZ9 A;  4PJO F;  3JCM P;  4M75 A;  3L1A A;  5GAO q;  4PJO C;  5GAO m;  2VC8 A;  4XTU A;  3RES A;  3V8L A;  4F7U B;  3QUI A;  1B34 A;  4M77 A;  3JCM h;  5GAM h;  4WF2 A;  5GMK e;  4PJO A;  3HSB A;  5GMK l;  4A54 A;  4X9D A;  4J6X A;  4F7U F;  4XU0 A;  1I81 A;  4M78 C;  5GAN d;  3JB9 H;  2DZC A;  3M4G A;  1KQ2 A;  4M77 E;  4XTZ A;  1HK9 A;  5GAO r;  4M78 A;  3V7R A;  4C8Q C;  2DTI A;  4XTY A;  2RA2 A;  4C8Q F;  4M7A A;  5GAM e;  3JCM e;  2I2L A;  5GMK h;  4M78 F;  5GAN 4;  1D3B A;  2E64 A;  4HT8 A;  2YLC A;  4PNO A;  4XQ3 A;  2FB7 A;  4MMK A;  3BW1 A;  3BY7 A;  4M75 E;  4C8Q B;  4J5Y A;  1H64 1;  4J6W A;  3SB2 A;  4C8Q G;  3RKX A;  4M78 B;  1BIA A;  2E41 A;  5GAN 6;  2K57 A;  4EMK C;  3JCM b;  3JB9 I;  5GAN j;  4PJO D;  4M7D E;  4EMH A;  1Y96 B;  1WQW A;  4C92 C;  1I8F A;  1MGQ A;  5CAI A;  3HFO A;  1WQ7 A;  2E1H A;  1WPY A;  2VXE A;  5GAN 3;  3FB9 A;  4C8Q D;  3SWN A;  2DJZ A;  2DTO A;  1LNX A;  3EFS A;  5GAN 7;  4JUV A;  1I5L A;  4N0A C;  4EMK B;  3JCM Q;  1N9R A;  2EJG A;  2ZGW A;  4JLI A;  3VU3 C; 
#chains in the Genus database with same CATH topology
 1TOV A;  2CH4 W;  1D3B B;  3EGX B;  1LOJ A;  1XQH A;  1PM3 A;  2RH2 A;  1ZSG A;  4JJD A;  5DLO A;  4C92 D;  4QVC A;  4F7U G;  1GRI A;  3JB9 G;  3PGG A;  2KRS A;  3GF5 A;  3HL8 A;  2RQV A;  1S72 T;  2FPF A;  1VQ7 Q;  2E12 A;  2KR3 A;  1K9M R;  4QVD A;  3QSU A;  4LDW A;  2DBM A;  4N4G A;  4XTV A;  2RM4 A;  1YJN Q;  4M75 D;  4M7D G;  3MEA A;  3R6O A;  1BI2 A;  5FWC A;  4PJN A;  3Q1J A;  5HKC A;  1NPR A;  5DM7 R;  1QLY A;  4KUL A;  5LJ5 h;  3OW2 A;  1QP3 A;  4F7U A;  3OS5 A;  1AOJ A;  1PWT A;  5GAN h;  1CKB A;  3V7S A;  5KYN A;  3CMA T;  4XU1 A;  1CKA A;  3L2Z A;  4KUI A;  2A08 A;  2KSS A;  4OMQ A;  2HBW A;  3GPL A;  1KK7 A;  1Y7X A;  2BTT A;  3A8H B;  2QEX T;  1VQO A;  3CME Q;  1EX4 A;  3V7C A;  4J9I A;  1Q7Y C;  4IUT A;  1YWO A;  2DXU A;  1OZ3 A;  2DD5 A;  1W2B A;  5GMK j;  2L5Q A;  1VQ8 Q;  5IHN A;  2SRC A;  3C4S A;  2DFU A;  5GAO q;  3CPW S;  3VS0 A;  1QVG P;  4PJO A;  1PHT A;  2COY A;  2CP5 A;  2WSC E;  4F7U F;  5CVI A;  4E7Z A;  1QMC A;  1I5O B;  4B9W A;  4FT4 A;  3TSZ A;  2CS7 A;  3N5B B;  5FW9 A;  1NJI C;  2DMO A;  1D3B A;  2QYZ A;  5CKH A;  2V26 A;  4MMK A;  2MK5 A;  3SFM A;  4C8Q B;  1QCN A;  3SB2 A;  2KDS A;  3MEU A;  2GQV A;  2DL3 A;  1ZX6 A;  4KGZ B;  3CXC A;  2D8J A;  4C0D B;  2HL5 C;  4OB2 B;  3CCQ Q;  1T0J A;  1VA7 A;  5EC7 A;  2EW3 A;  5J3B A;  4Y28 E;  2L3P A;  4N4H A;  4DBQ A;  4CI0 C;  5GAN 3;  1WHH A;  4JJB A;  3OYI A;  1Q86 C;  2FZK B;  4C0Z A;  3CCR Q;  1ZBX A;  2XMF A;  1TTH B;  4FM4 B;  2RPN A;  2W10 A;  4OMF B;  4D8D A;  1GFD A;  2P84 A;  1OI1 A;  3JRZ A;  5GAO n;  3OYD A;  2DRK A;  3QDR B;  4A4E A;  1N8R R;  3PIO A;  4D6W A;  3CCR A;  2J06 A;  2LT4 A;  1VQN T;  1OV3 A;  3EG3 A;  1RI9 A;  1X43 A;  4LD9 K;  2QTV A;  2DBK A;  2VGN A;  4RG2 A;  1UHC A;  2LQ8 A;  4BDZ A;  1RAI B;  3G6E T;  1YBY A;  3MP8 A;  5L23 A;  2HMA A;  5LL6 S;  1K73 C;  3E9G A;  4PK4 A;  3VUZ A;  3EG0 A;  3JV3 A;  3URG A;  1RAG B;  1W6X A;  3CCS Q;  1IZ6 A;  2HKN A;  4JLG A;  1U3O A;  2RJF A;  4ZNX A;  4QVZ A;  4O5V A;  4JJN K;  2JNG A;  3SHW A;  5LJ3 f;  2YHT A;  3M0R A;  2CRE A;  3E19 A;  5CKB A;  1E6H A;  1RL2 A;  3G4S Q;  1RI0 A;  1Y71 A;  1VQP A;  4FSX A;  2K3Y A;  3C94 A;  3EGD B;  4AG1 C;  4FYY B;  3CCR T;  4AMC A;  2CH4 A;  3MHX A;  4M78 C;  1OEB A;  3UF4 A;  3G7Z A;  3OMG A;  2DTI A;  1VQ5 A;  4XQ3 A;  2KT8 A;  4IKF A;  1QCO A;  4PJO D;  3QWX X;  4MZM A;  1WX6 A;  2E4H A;  1F1B B;  1W70 A;  4DBR A;  3HTR A;  1XOV A;  3QWY A;  1GCQ A;  2J6O A;  5AYF A;  2BE7 D;  2DF6 A;  3M54 A;  2RK1 A;  3NTH A;  2DEU A;  3M4Y A;  3LX7 A;  5KCH A;  3CCE A;  1BI3 A;  2CZ1 B;  2EJG A;  4FW2 A;  3EAE A;  2FPD A;  3A8G B;  4HCK A;  4AFU C;  3OYM A;  2RHX A;  2DLP A;  1M1G A;  4FT2 A;  1M27 C;  1WI7 A;  2OTJ A;  4E6R A;  5I2S A;  1R8O B;  5A0L A;  2JJ9 A;  2LQW A;  3JCM X;  1PCX A;  4LUD A;  2E5Q A;  1ZUU A;  1X6B A;  2QTX A;  2VXF A;  4KGV B;  2CZ6 B;  1D1C A;  1QVF S;  2QXF A;  2L8D A;  3CBP A;  3CCS A;  1SF9 A;  1O9S A;  1U1S A;  1ZA1 B;  2HD0 A;  1M8V A;  3CCU Q;  3V8J A;  1VQM Q;  4PJO E;  4ESR A;  2A28 A;  3CPW P;  3CCE T;  2HKQ B;  1V76 A;  2P0Q A;  5HK0 A;  2E3H A;  4HVU A;  4JRQ A;  1X69 A;  2DK3 A;  1BCM A;  2CP6 A;  2JOY A;  2OAU A;  4OB1 B;  3GP8 A;  2YUO A;  5GMK m;  1M30 A;  2EBP A;  3HHT B;  5KH6 A;  2RMO A;  5D7U A;  2JMA A;  1G8X A;  4HCB A;  1VQL T;  1G5V A;  1HD3 A;  3HRS A;  5CQY A;  1SSH A;  2VKN A;  2X3W D;  1M2O A;  1YNZ A;  1QVG A;  1M90 R;  3PNW C;  1Z9Q A;  3JCM h;  5GAM h;  3HRT A;  5GMK l;  1YP5 A;  3REB B;  2OTL Q;  1BK2 A;  2KGT A;  1UFF A;  1EZZ B;  4IUP A;  4MDW A;  3CQT A;  1JXM A;  4PNO A;  1MV0 B;  3BY7 A;  4II1 A;  4M75 E;  3I5R A;  2DL7 A;  2B86 A;  3L2U A;  1I1J A;  4JRP A;  3P8D A;  4OVA A;  4ZGD B;  3CCM A;  2MWP A;  2MOX A;  4DOV A;  2PUO B;  2NWM A;  1VIE A;  3I56 T;  4ZN1 A;  1T3S A;  2DTH A;  4JDS A;  4QQD A;  3OW2 S;  3X26 B;  1V29 B;  5FRN A;  1MND A;  3BDU A;  2GTJ A;  2FYK A;  6AT1 B;  3MKD A;  4KH0 B;  1PKS A;  1QP2 A;  5GAN g;  2RI3 A;  2Y4X A;  2MI6 A;  2V8I A;  4E7S A;  3CCV A;  1Y0M A;  1QVG S;  2HBP A;  4RTZ A;  4RMO A;  1BKB A;  1QVP A;  5CKF A;  1Y57 A;  3EGX A;  4HA8 A;  4C8Q E;  1G3Y A;  1SKU B;  3CC7 T;  2RI2 A;  2HQE A;  2E6N A;  1KHC A;  1VQ4 A;  2DET A;  1SRL A;  1KQS S;  3EG9 B;  1OQK A;  5L8R E;  1Y07 A;  1M90 U;  3PVQ A;  3M56 A;  3ULR B;  1OU8 A;  1RAA B;  1KD1 C;  2E3I A;  2PU9 B;  4KRT A;  4M7D F;  4JRI A;  1VQ6 A;  1RAF B;  2X35 A;  2MCN A;  5GAM j;  3TVT A;  1U8R A;  4IUR A;  1ZUK A;  2CP0 A;  3QBY A;  1RAD B;  2JT4 A;  4PJO C;  2LNH B;  4A54 A;  4J6X A;  4XU0 A;  5CO7 A;  1MUZ A;  4LUE A;  1GXI E;  2KT1 A;  1M1F A;  1NJI U;  3CEY A;  4NS5 A;  1NLO C;  2DO3 A;  4A4K A;  2YLC A;  1BYM A;  5GAN 6;  3LWI A;  2XI9 A;  4IIM A;  4EMK C;  3CMA A;  4DEX A;  2CP3 A;  4J9F A;  1Q81 U;  4PLL A;  1ARK A;  1Q81 C;  1ZBJ A;  4OF1 A;  2E1H A;  2M1H A;  3FB9 A;  2O31 A;  1Q82 C;  5FRM A;  2ZPI B;  1FX7 A;  1LNX A;  5C6S A;  1YJW A;  1QVF P;  2GFU A;  4LDU A;  2DE0 X;  4M7D A;  2R57 A;  2QG9 B;  3JCM f;  2YRD A;  5GAM f;  3GNF B;  2MAM A;  4RCC A;  5GAN 5;  3LGF A;  4QQG A;  2KXD A;  4M77 B;  2L3R A;  3QJY A;  4HCZ A;  5LJ3 d;  1M2V A;  4MML A;  3OYJ A;  4M75 F;  5GAN f;  1AVZ C;  4N0A A;  1Q95 G;  1UE9 A;  4F16 A;  2RJC A;  2HQH A;  2PTK A;  2FRY A;  1XTD A;  1AWW A;  2XK0 A;  4C5E A;  3A5Z B;  1Y96 A;  3MPU B;  1M1K U;  4C5H A;  4ELY C;  3KBG A;  1UB4 A;  3CD6 Q;  1OPL A;  2CP2 A;  3O5Z A;  4RKU E;  1KD1 U;  1W2B S;  2VVK A;  1VQM T;  2QDY B;  2L0A A;  3CCJ A;  1Q7Y U;  2CUB A;  3UPU A;  3H9N A;  4OP0 A;  2AKK A;  2AZV A;  3INZ A;  2H8H A;  2YWW A;  3F70 A;  1WA7 A;  3RES A;  2NUZ A;  3QUI A;  1KD1 R;  1UG1 A;  5GMK e;  1Q86 R;  4X9D A;  4CC4 B;  2F5K A;  5I22 A;  1SEM A;  4DBF A;  3OBW A;  2OTJ Q;  4XTY A;  2C06 A;  2AT1 B;  5CR2 A;  1ACM B;  3CCU T;  3L2R A;  1K8A U;  2NUT B;  3U23 A;  2BKD N;  3CCQ T;  4C8Q G;  2XD0 A;  3ZEH A;  1U5S A;  4EMH A;  4K11 A;  4M4Z A;  1YHQ Q;  2H3E B;  1M9S A;  2J7I A;  1WJQ A;  2B8A A;  4N0A C;  1N9R A;  1AZE A;  2EYY A;  3EFO A;  1YIT T;  3VS1 A;  1NPP A;  2YDL A;  4J9E A;  1IGU A;  1VIF A;  2Y90 A;  1WXU A;  2DAQ A;  1BCO A;  4JRK A;  5KYW A;  2P0P A;  4Z89 A;  4PJL A;  4QT7 A;  1AD5 A;  1I4K 1;  1ABQ A;  1YHQ T;  1BIB A;  2VB6 A;  3FLG A;  2CZ0 B;  1UGP B;  1WGS A;  2YLB A;  3S3N A;  1YI2 Q;  2DA9 A;  1YCY A;  1RUW A;  5D6W A;  2H3J A;  1BB9 A;  1TH7 A;  4O6J A;  3OYA A;  2ATC B;  1OU9 A;  3VRZ A;  3ER0 A;  3TQ7 P;  5IN1 A;  3JCM d;  5GAM d;  3RKY A;  2HAX A;  4M7D B;  3LYI A;  2VAS A;  4PFZ A;  3RKW A;  2YT6 A;  1PD1 A;  3A98 A;  1IXD A;  3H6Z A;  4RCB A;  4X1V A;  1JO8 A;  3OYH A;  1AWO A;  3PMT A;  3VJP A;  3BDL A;  4RTW A;  2K4Y A;  1EFN A;  1YJW Q;  4AG2 C;  1NM7 A;  2F69 A;  2ECZ A;  4WF2 A;  1K0S A;  2FZC B;  3OYG A;  3FRN A;  2HQX A;  1C0M A;  3CPF A;  3S6W A;  5GAO r;  3CCQ A;  3M0P A;  2KAF A;  2P4T A;  8AT1 B;  2DVJ A;  1K8A C;  3LGL A;  1BIA A;  3M0S A;  3L2W A;  3OYF A;  4JZ3 A;  1CSK A;  5KYX B;  1WQW A;  1I8F A;  3LH0 A;  1R0C B;  1WQ7 A;  2VXE A;  1GCQ C;  3SWN A;  1YJN A;  2JW4 A;  3H0I A;  1VQ9 T;  1GFC A;  3TCJ A;  2QDL A;  1IHW A;  2ZAE A;  1QVF A;  3OYB A;  1YIJ A;  5ECA A;  4F14 A;  5IAY A;  3I56 A;  1VQ5 T;  1SPK A;  2JM8 A;  2DIL A;  2HCK A;  2EQK A;  2ROL A;  3QZ5 B;  1WNL A;  3CCM T;  4M75 B;  1IO6 A;  3S3O A;  7AT1 B;  1VQK T;  3FIF A;  3LWH A;  3CME A;  1YIT Q;  5KYW B;  3PE0 A;  3NHN A;  3ZBD A;  3OS1 A;  2V1Q A;  4M7A C;  4E7L A;  3IQL A;  4B9X A;  4GLK A;  3OYN A;  1UJ0 A;  2R58 A;  2EJF A;  2QEX Q;  4OML A;  1KJW A;  5DLQ E;  1VQ5 Q;  4LD6 A;  4PKC C;  1M90 C;  2LZ6 B;  2KBT A;  1FMW A;  2LJ0 A;  4A4G A;  1D1A A;  4P5N A;  1G83 A;  3JSC A;  4L6V 5;  2COW A;  3JCM V;  2K5I A;  3SWN B;  1UTI A;  1VQL Q;  4Y91 A;  3FJP A;  4FL6 A;  5FU7 B;  3QHS A;  4JPB W;  5LJ3 g;  4C92 B;  1NEG A;  4EDU A;  3GIB A;  4C92 F;  1N8R C;  2C0T A;  2DZ9 A;  3OYE A;  4XTU A;  3CD6 T;  5FLX E;  1B34 A;  3H0H A;  1AZG B;  2K2M A;  2K79 A;  2LQN A;  1HYO A;  1R0B G;  2LT1 A;  4JS4 A;  2CDT A;  3RNJ A;  2GTO A;  3GBQ A;  3I9Q A;  4ATO A;  2VUB A;  1WJR A;  4C92 C;  3VU3 C;  4C8Q D;  1X75 C;  4C5G A;  1NJI R;  4ZGJ B;  1JU5 C;  3M0U A;  2RHZ A;  1WJS A;  2JM9 A;  2LRQ A;  2GNC A;  1UJY A;  3OB9 A;  1YIT A;  1OX9 A;  2O9V A;  3MP6 A;  1D0Y A;  2RF0 A;  1VYU A;  4PJJ A;  1KC8 R;  1M2V B;  2I0N A;  1VUB A;  2XG8 D;  2FL7 A;  1GCP A;  4IIO A;  4QQ6 A;  4C92 A;  3UWN A;  2JS2 A;  4F17 A;  1TUD A;  3AT1 B;  3ZL7 C;  3G1J A;  3JCM c;  2V1R A;  3CME T;  1T3L A;  4LE9 A;  3C0C A;  2CT4 A;  1P92 A;  5FU6 B;  2AZS A;  4EPC A;  4LDY A;  3QPH A;  1WHG A;  2A3L A;  1HSQ A;  1VQ8 A;  3CC2 A;  1NYF A;  2OAW A;  4J7I A;  4E7H A;  1GL5 A;  5GAO l;  2O01 E;  3MO8 A;  1WHM A;  1R77 A;  4M7A E;  2LC4 A;  4Q5W A;  2RHI A;  2GGR A;  5A0D A;  4MZT A;  5LJ5 g;  1WIE A;  4M75 A;  3V8L A;  2NUP A;  1O75 A;  1WZO A;  1TU0 B;  1BI1 A;  4C5I A;  3M4G A;  1OZ2 A;  2KE9 A;  1FMV A;  2A37 A;  2FZG B;  2YUN A;  2EYW A;  2MWO A;  3VV0 A;  2M0Y A;  3RKX A;  2E41 A;  1IRX A;  4TVR A;  2EQM A;  3CXC P;  5CKE A;  3E2U A;  2DXC A;  5KYX A;  1WPY A;  1MNE A;  1YI2 A;  3WVD B;  2DJZ A;  5IXF A;  1FYN A;  1MMG A;  5IH2 A;  2OX7 A;  5D6Y A;  3G71 Q;  4CC7 A;  2JVV A;  4PJM A;  4BB7 A;  1WLP B;  3FDR A;  2DKG A;  2PVD B;  3CCL A;  1YJW T;  4LDX A;  2DM1 A;  2ROT A;  4M78 D;  3VYH B;  4C8Q A;  3JB9 J;  4M7A D;  4M7D C;  1TG0 A;  2EWN A;  1ZSZ C;  3KFV A;  3I55 Q;  4DQ2 A;  2QK0 A;  1VQN A;  1JJ2 A;  3VS3 A;  1EIF A;  2X4X A;  1RLP C;  2DPP B;  3FEO A;  1H3Z A;  1VQL A;  3CCS T;  3JAM E;  5DY9 A;  1H8K A;  3I35 A;  1E7O A;  3DLM A;  2J6F A;  4A53 A;  2ZPG B;  2K6D A;  1TS9 A;  3CXC S;  3J81 E;  4HCC A;  1D0X A;  1M1K C;  3VS5 A;  4BI4 A;  4ZTF A;  2ENM A;  5KE3 A;  5I2M A;  3RMS A;  1YWP A;  1X2K A;  2QEX A;  2OJ2 A;  3FC3 A;  3HRU A;  2F1L A;  3M9Q A;  3G4S A;  4JS5 A;  3C12 A;  2EAY A;  5GJV B;  1LVK A;  1PC0 A;  3L1A A;  2LCS A;  1UHF A;  5GAO m;  1OPK A;  2NLU A;  5KYU A;  4A63 B;  2G3R A;  3QG1 A;  4OGC A;  3V7R A;  2XDP A;  1RAC B;  5GAM e;  3JCM e;  9ATC B;  5GAN 4;  1WXB A;  2FB7 A;  2X51 A;  1KQS A;  3QII A;  1QWE A;  4J5Y A;  2R5A A;  1E6G A;  2AK5 A;  1B07 A;  2LJ1 A;  2DL4 A;  4M7D E;  3M58 A;  2K7A A;  1XNI A;  3MJX A;  1X27 A;  3M0T A;  4CRI A;  4CC3 A;  1Q81 R;  2P4R A;  1UGQ B;  1A0N B;  2WAC A;  4MZP A;  1X2Q A;  1K9M U;  1SRM A;  2EJ9 A;  2NUT A;  3EFR A;  5FU7 C;  4RG8 A;  5LJ3 j;  3NTI A;  4NL2 A;  3J80 E;  2RHY A;  5KYY A;  4C92 G;  3VS4 A;  3A1P A;  3A8L B;  2LNV A;  2M51 A;  2EQU A;  5EG2 A;  4BUG A;  2DRM A;  3G71 T;  1K4U S;  2EFI A;  2DYI A;  1VQP T;  1KC8 U;  2FVU A;  4RTU A;  2V8K A;  1X6O A;  2HL3 A;  2MIO A;  2KRO A;  2CT3 A;  2QQA A;  2EQJ A;  2EGC A;  2HSE B;  1JBM A;  2E6Z A;  2G6F X;  1WHK A;  1SG5 A;  2X4J A;  2RB6 A;  5I11 A;  2DXB A;  1AHJ B;  1PG5 B;  4XAX B;  4FYW B;  4CC2 A;  2A7Y A;  3E9F A;  3HFN A;  3LLR A;  1VQ8 T;  3CC2 T;  1K8A R;  4KT0 E;  1K9A A;  2YRC A;  1ZUY A;  4NL3 A;  1N8R U;  1YFN A;  3TU4 K;  3PFS A;  5GAN 2;  2RI5 A;  2MMP A;  2EYX A;  2VC8 A;  4F7U B;  1YJ9 T;  3RDV A;  2QQB A;  2CKK A;  2M02 A;  3JB9 H;  2DZC A;  3EHR A;  3X25 B;  1JEG A;  1M3B A;  3OW2 P;  2A36 A;  1Q86 U;  2KRM A;  2W0Z A;  3VKI A;  1G3S A;  1ZLM A;  2MF2 A;  5GMK h;  3TSW A;  2ZPB B;  3HPW A;  1VOM A;  2RQR A;  2V8J A;  2K3B A;  4M78 B;  1S1N A;  3VRY A;  3LH5 A;  2LDM A;  1K73 R;  2FG0 A;  1I0C A;  2QAZ A;  4BY6 C;  2LTO A;  2XU8 A;  1ABO A;  1U06 A;  1I5L A;  3JCM Q;  2IIM A;  3I55 A;  1VQO T;  4M77 D;  4KGX B;  5GAO p;  1C1A A;  4XU3 A;  1PRL C;  2CGH A;  4X9C A;  3PMI A;  1VQ6 T;  2LX9 A;  1W1F A;  2L3Q A;  1JRI A;  4RTX A;  5J26 A;  4HT9 A;  3OYY A;  5C0M A;  4BE2 A;  3UA6 A;  1B34 B;  2BZ8 A;  5LJ5 e;  1QCF A;  3CCL Q;  3WVE B;  3CCJ Q;  1KC8 C;  4E7J A;  3EGD A;  4A4H A;  1VQ4 T;  2XDB A;  2QA4 Q;  3MET A;  5CCA A;  4HVV A;  2JN0 A;  5KCO A;  1C6V X;  3X28 B;  1D1B A;  2RD1 A;  3GOX A;  2DD4 A;  4M7A F;  3A8O B;  4PLI A;  4DBH A;  3I55 T;  1NZ9 A;  3C95 A;  3RER A;  3CBM A;  4M7A B;  3OBY A;  4BE1 A;  3CCV T;  5LJ5 f;  4BY6 B;  4C92 E;  5GMK i;  2LJ3 A;  1LJO A;  3EG9 A;  1UGV A;  4LNP A;  1UGR B;  4F04 B;  4V2S A;  3RR6 A;  3BFM A;  2CP7 A;  2GFA A;  1U1T A;  1MMA A;  2BZX A;  4PL6 A;  4E2F B;  2EYQ A;  2VYT A;  1W2B P;  2JTF A;  3GNG A;  1KG1 A;  1GBQ A;  3CMA Q;  2VV5 A;  2XIC A;  1S72 A;  3T9N A;  1VQO Q;  1I81 A;  5GAN d;  3CC2 Q;  3DLL A;  4M77 E;  1KQ2 A;  1NBE B;  2F2X A;  1KFZ A;  2VWF A;  2QGG A;  4M78 A;  2MYS A;  2CSQ A;  3NTK A;  4M7A A;  2LX7 A;  4XK8 E;  3VS6 A;  2CUD A;  2JS0 A;  3OYL A;  4L59 A;  2PZ1 A;  1X6G A;  4ELZ C;  2ESW A;  4OMO A;  5FWB A;  1N6A A;  1SHG A;  3HKS A;  3EH1 A;  1D0Z A;  3BE3 A;  3P8B B;  2D8H A;  2DTO A;  4J7F A;  1M8M A;  2ZPF B;  2ZGW A;  2F5T X;  4RTY A;  2FPE A;  1V1C A;  2PUK B;  2RO0 A;  2BZY A;  1PSE A;  5GAN e;  3CCV Q;  2JMC A;  1VQ7 A;  1D09 B;  2FEI A;  2WSE E;  3UA7 A;  4FYV B;  1UGS B;  1SHF A;  1BI0 A;  1X01 A;  2CZ7 B;  3G71 A;  4M77 F;  1JQQ A;  2OI3 A;  4J6Y A;  4M78 E;  4M7D D;  1VQ4 Q;  2BUD A;  1IB8 A;  3D7S B;  1NG2 A;  4E47 A;  2RQU A;  1VQ9 Q;  5HY6 A;  2EKO A;  2M16 A;  2FO0 A;  4M75 C;  3ASK A;  2MPX C;  3MCA B;  3SEM A;  2GQI A;  5J39 A;  4M7A G;  3ME9 A;  5LJ5 j;  1OOT A;  3SWN C;  2PVG B;  2C0I A;  1PNJ A;  1B3Q A;  1OX8 A;  4M77 C;  4M75 G;  1VQK Q;  3G4S T;  2COZ A;  1S72 Q;  2EPD A;  4GLM A;  2PNI A;  1K73 U;  1ZHI A;  3L2Q A;  5GAN 8;  2J6K A;  2ED1 A;  2E10 A;  2QQS A;  4OB3 B;  1ZSZ B;  3H0F A;  2K9G A;  4A4F A;  1AEY A;  3PT9 A;  1TSF A;  1HK9 A;  3UT1 A;  1N5Z A;  2SEM A;  2EKH A;  2KEA A;  1WYX A;  3EFO B;  3TRE A;  1XJW B;  4LN2 A;  3CC4 A;  3E1S A;  3REA B;  5GAN j;  1YJ9 Q;  1G2B A;  2A0F B;  5KYU B;  2OTL A;  1MGQ A;  3OSS C;  2RK2 A;  2DYB A;  1NLP C;  3X24 B;  5GAN 7;  2JXB A;  4FYX B;  4GBQ A;  4EMK B;  3CCM Q;  2KXC A;  5IHI A;  4OB0 B;  2X4W A;  3O8V A;  4Y92 A;  3KUF A;  2ZCF B;  2DNU A;  4ME7 A;  2D9T A;  1G3W A;  1UEB A;  1IHV A;  2EVR A;  2O9S A;  2QI2 A;  4IUU A;  3RIR A;  3NPF A;  5A2Q E;  2KMT A;  2X4Y A;  1UDL A;  5LJ3 e;  2D1X A;  1WHJ A;  2O4X B;  1MV3 A;  3G6E A;  1ZA2 B;  4GY5 A;  2LQK A;  4FU6 A;  4ORZ A;  5CIU A;  1MHN A;  4RUG A;  3CCE Q;  1K76 A;  1FXX A;  3JCM J;  3OYC A;  1FMK A;  3SD4 A;  2E65 A;  5I21 A;  4AFQ C;  3EHQ A;  1SSF A;  1Z9Z A;  2QA4 A;  5GJW B;  5FU6 C;  4M77 G;  1YI2 T;  1ZQ1 A;  2PQW A;  2YXY A;  2JTM A;  4BAC A;  2FRW A;  2LVM A;  3EG1 A;  2J05 A;  1W4S A;  4BI3 A;  2KK4 A;  2EQI A;  2ED0 A;  3I5S A;  2KY9 A;  1M5Q 1;  3QYH B;  4C0F A;  3CC7 A;  3TEE A;  2D0N A;  3OMC A;  4BDY A;  4JJC A;  4X34 A;  2GF7 A;  4HVW A;  4EIK A;  1JJ2 P;  1H3H A;  4M77 A;  1T0H A;  2XKO C;  4E7I A;  1JJ2 S;  2F2V A;  4DA4 A;  5FRO A;  2KYB A;  1DJ7 B;  1WDX A;  2I2L A;  4M78 F;  1VQM A;  2D0Q B;  3JCM b;  2K57 A;  2AIR B;  4J9H A;  1VYV A;  4Z02 A;  2RJE A;  2FHD A;  2ZZD A;  5HCK A;  5M9O A;  1KSW A;  3M0Q A;  4Z8A A;  1K9M C;  3ZFJ A;  3R6N A;  2XHC A;  2BIV A;  2Y4Y A;  4WTO B;  2RHU A;  2YSQ A;  1LPL A;  1N9S A;  8ATC B;  1HJD A;  2AHJ B;  4F7U E;  1TWB A;  3OYK A;  3QDF A;  3KXT A;  1WFW A;  1JXO A;  3CC4 T;  2O4X A;  4RTV A;  3FJ5 A;  1KQS P;  1G3T A;  2HEQ A;  3JCM W;  3M57 A;  3V8K A;  1AT1 B;  1PD0 A;  1YHQ A;  2DIG A;  2PVO B;  1GBR A;  3VS2 A;  3G6E Q;  4AT1 B;  1Q7Y R;  3CBO A;  2ZPH B;  3CPW A;  2OTL T;  5IXB A;  1FWZ A;  3EH2 A;  2AKL A;  4OGE A;  2DL5 A;  4UC4 A;  1IRE B;  2F2W A;  3L42 A;  2D6F A;  2RJD A;  1JB0 E;  3JB9 D;  4XTX A;  1I07 A;  1K0X A;  3H8Z A;  3JCM P;  4OMM A;  1BBZ A;  1RAB B;  4QKU A;  5CQX A;  2R5M A;  5HK3 A;  3CD6 A;  1WHL A;  3HSB A;  5IT9 E;  3P8H A;  3I56 Q;  4R0K A;  4XTZ A;  3RBB B;  2X9H A;  3VYG A;  5D6X A;  1UUE A;  2DX1 A;  4HT8 A;  4KH1 B;  4FCY A;  4D8K A;  4LDV A;  4R55 A;  1NE8 A;  1WXT A;  3JB9 I;  2GCX A;  4RTT A;  2EYZ A;  1RAH B;  5CKD A;  1Q82 R;  5IHK A;  2LCL A;  1LCK A;  5AT1 B;  1BU1 A;  3EFS A;  5KYY B;  2KVQ G;  1TXQ A;  3MEW A;  1VQ7 T;  4JLI A;  4B6M A;  2XDD A;  5CK9 A;  2DVE A;  3NFC A;  5A0G A;  4N4I A;  4C0G A;  1YIJ T;  1KIK A;  4BE0 A;  2JZ2 A;  3MP1 A;  1IGQ A;  1PKT A;  3M59 A;  1VYT A;  2EGA A;  4AFS C;  4DOW A;  3JB9 F;  1K1Z A;  2K5F A;  1VQK A;  2DIQ A;  2E5K A;  3S3M A;  1YN8 A;  3EGU A;  2HZY A;  4ANJ A;  2QA4 T;  2DEQ A;  2KRN A;  4J8O A;  2VGM A;  3X20 B;  2QAS A;  4VUB A;  3VS7 A;  2LCC A;  4L5G A;  2RQT A;  2IPO B;  2RQW A;  3QZ9 B;  2DXT A;  3WXM B;  1YCS B;  2YRV A;  4DEY A;  1VQ9 A;  4J9B A;  2K3X A;  4FIB A;  1J3T A;  3SDZ A;  3OY9 A;  1MMN A;  3JCM g;  5GAM g;  3QJ6 A;  4WCI A;  3CC4 Q;  3PIP A;  2JUF A;  3QO3 A;  2RNA A;  2LP5 A;  5LJ5 d;  1TUC A;  2KI7 A;  2K5L A;  1N27 A;  2YUQ A;  3LW5 E;  4J9D A;  2DER A;  2HNI A;  4EMG A;  4PJO G;  3OS0 A;  2JTE A;  2O2O A;  3J7A F;  1QWF A;  3OS2 A;  1VQ6 Q;  1PSF A;  2XID A;  2KYM A;  3CC7 Q;  4E7K A;  1QKX A;  1KHI A;  2CSI A;  3MEV A;  3DB3 A;  2K2V A;  4MDX A;  1MMD A;  1NEB A;  2E64 A;  3BW1 A;  4OMP A;  1H64 1;  1RAE B;  3HP9 A;  4J6W A;  2YUP A;  1Y96 B;  3RMQ A;  3PVL A;  3GLX A;  1QQJ A;  4FSS A;  2OTJ T;  4BD3 A;  2BE9 B;  1M3A A;  1VQN Q;  2QQ9 A;  1NYG A;  1AWJ A;  4ZGE B;  1M4Z A;  3NGP A;  2IVW A;  2L89 A;  4PFP A;  2EGE A;  2RN8 A;  4OMN A;  4QW2 A;  2KQW A;  3RUX A;  4AFZ C;  5KE2 A;  1B7T A;  3L2V A;  1UEC A;  3OA6 A;  1TUG B;  3UDC A;  1KQ1 A;  4Z88 A;  2DL8 A;  1YIJ Q;  3M53 A;  2EIF A;  3CCU A;  2HSP A;  1QW1 A;  2C0O A;  4J9G A;  2O88 A;  2P0K A;  4NOY A;  1H92 A;  5LJ3 h;  2IG0 A;  3EG2 A;  2E70 A;  2HDA A;  3M5A A;  1QKW A;  2NUP B;  3AHU A;  2CYZ B;  4EMK A;  3UAT A;  1YJ9 A;  4IUV A;  4HXJ A;  3OQ5 A;  4KBM B;  1AWX A;  2ZPE B;  3QXE B;  2Z0W A;  4XU2 A;  1RLQ C;  3CCJ T;  4PFO A;  2M9U A;  4M78 G;  2QQR A;  4J83 A;  2NYS A;  4XTW A;  1HXD A;  3H41 A;  4BI8 B;  4PJO B;  2DJQ A;  1YJN T;  4IUQ A;  4PJO F;  2KNB B;  1M3C A;  3VUB A;  3QYG B;  2GBQ A;  4HKE A;  4LXC A;  1ZSZ A;  3DKM A;  3THK A;  2QGF B;  4C8Q C;  4FW1 A;  2L2P A;  2RA2 A;  3OSV A;  4C8Q F;  3CCL T;  4ZTJ A;  2X3X D;  2WSF E;  4C0D C;  2ABL A;  3A8M B;  4ZN3 A;  3QKJ A;  4J9C A;  2M0O A;  4YTL A;  4R56 A;  1PRM C;  2LMJ A;  5CAI A;  3PTA A;  3HFO A;  1M1K R;  1Q82 U;  1OYX A;  1OUL A;  3NMZ C;  4JUV A;  1VQP Q;  3M55 A;  4KUD K;  3DB4 A;  2L3S A;  4JZ4 A; 
#chains in the Genus database with same CATH homology
 4BB7 A;  3KUF A;  1D3B B;  1LOJ A;  1XQH A;  2GFU A;  2ZCF B;  3FDR A;  4LDU A;  4M7D A;  2R57 A;  2RH2 A;  3JCM f;  4ME7 A;  2D9T A;  5GAM f;  2DKG A;  2PVD B;  5DLO A;  3CCL A;  1YJW T;  4C92 D;  3GNF B;  1G3W A;  4QVC A;  4LDX A;  3VYH B;  4M78 D;  4C8Q A;  4F7U G;  3JB9 J;  3JB9 G;  2MAM A;  4RCC A;  1UEB A;  3PGG A;  5GAN 5;  4M7A D;  3GF5 A;  3HL8 A;  3LGF A;  4M7D C;  4QQG A;  4IUU A;  2QI2 A;  4M77 B;  3RIR A;  2EWN A;  1S72 T;  2L3R A;  2E12 A;  4DQ2 A;  1VQN A;  3QJY A;  4HCZ A;  5LJ3 d;  1JJ2 A;  1EIF A;  2X4X A;  5A2Q E;  2DPP B;  4MML A;  3OYJ A;  2KMT A;  2X4Y A;  1VQO A;  4QVD A;  3FEO A;  5LJ3 e;  4M75 F;  3QSU A;  1H3Z A;  2O4X B;  4LDW A;  1VQL A;  4N4G A;  5GAN f;  3CCS T;  3JAM E;  3G6E A;  5DY9 A;  4N0A A;  4GY5 A;  4XTV A;  2LQK A;  4FU6 A;  2RM4 A;  5CIU A;  3DLM A;  1MHN A;  4M75 D;  4M7D G;  1FXX A;  3MEA A;  3R6O A;  3JCM J;  1BI2 A;  3OYC A;  2RJC A;  3SD4 A;  2E65 A;  3Q1J A;  4A53 A;  5HKC A;  1NPR A;  5I21 A;  2ZPG B;  1XTD A;  5DM7 R;  4KUL A;  1SSF A;  2XK0 A;  5LJ5 h;  2QA4 A;  3OW2 A;  4C5E A;  1QP3 A;  5FU6 C;  3OS5 A;  4M77 G;  4F7U A;  3J81 E;  3CXC S;  3A5Z B;  1Y96 A;  1YI2 T;  1M1K U;  4HCC A;  1ZQ1 A;  2PQW A;  5GAN h;  3V7S A;  4C5H A;  1M1K C;  2JTM A;  4ELY C;  4BAC A;  3KBG A;  4BI4 A;  4ZTF A;  2LVM A;  1UB4 A;  4XU1 A;  1W4S A;  4BI3 A;  5KE3 A;  3CMA T;  2KK4 A;  5I2M A;  3L2Z A;  3RMS A;  4KUI A;  4RKU E;  2QEX A;  3FC3 A;  1KD1 U;  2KSS A;  3HRU A;  1W2B S;  3M9Q A;  3GPL A;  3G4S A;  3A8H B;  1Y7X A;  1VQM T;  2QEX T;  4JS5 A;  2KY9 A;  1M5Q 1;  2QDY B;  3QYH B;  3V7C A;  4C0F A;  4IUT A;  3C12 A;  3CC7 A;  2DXU A;  3CCJ A;  1OZ3 A;  3TEE A;  2EAY A;  1Q7Y U;  2DD5 A;  3OMC A;  1W2B A;  5GMK j;  3UPU A;  4OP0 A;  2L5Q A;  4BDY A;  3INZ A;  3C4S A;  4X34 A;  2GF7 A;  5GAO q;  3L1A A;  3F70 A;  3CPW S;  5GAO m;  3RES A;  3QUI A;  2NLU A;  4M77 A;  4PJO A;  5GMK e;  2XKO C;  4X9D A;  2WSC E;  4F7U F;  2G3R A;  5CVI A;  4E7I A;  2F5K A;  3QG1 A;  4DA4 A;  4OGC A;  5FRO A;  1JJ2 S;  4B9W A;  4FT4 A;  3OBW A;  3V7R A;  2XDP A;  4XTY A;  2CS7 A;  3N5B B;  1DJ7 B;  5CR2 A;  2C06 A;  5GAM e;  3JCM e;  2I2L A;  5GAN 4;  4M78 F;  3L2R A;  1D3B A;  3CCU T;  1NJI C;  1VQM A;  5CKH A;  1K8A U;  2BKD N;  2D0Q B;  2FB7 A;  4MMK A;  3CCQ T;  3QII A;  3SFM A;  4C8Q B;  1KQS A;  4J5Y A;  2KDS A;  3SB2 A;  2R5A A;  4C8Q G;  3JCM b;  3MEU A;  2K57 A;  2XD0 A;  2GQV A;  3ZEH A;  3CXC A;  4M7D E;  4C0D B;  4EMH A;  3M58 A;  4OB2 B;  1XNI A;  4Z02 A;  5J3B A;  4Y28 E;  4N4H A;  4CI0 C;  5GAN 3;  4CRI A;  2RJE A;  1M9S A;  2FHD A;  1UGQ B;  2ZZD A;  1WJQ A;  2B8A A;  4N0A C;  5M9O A;  3OYI A;  1Q86 C;  1N9R A;  2WAC A;  4MZP A;  4C0Z A;  1K9M U;  1ZBX A;  2EJ9 A;  3EFR A;  1YIT T;  1K9M C;  4FM4 B;  1NPP A;  5FU7 C;  3ZFJ A;  4RG8 A;  4OMF B;  5LJ3 j;  2XHC A;  3NTI A;  4NL2 A;  2RHY A;  3J80 E;  4C92 G;  1VIF A;  1OI1 A;  2Y90 A;  3JRZ A;  5GAO n;  2BIV A;  3OYD A;  2Y4Y A;  3QDR B;  4A4E A;  2DAQ A;  2RHU A;  4JRK A;  3A8L B;  3PIO A;  2LNV A;  4D6W A;  2EQU A;  5EG2 A;  4BUG A;  3CCR A;  2LT4 A;  1VQN T;  1N9S A;  2P0P A;  3G71 T;  2EFI A;  1VQP T;  1KC8 U;  2FVU A;  2AHJ B;  2V8K A;  1X6O A;  4F7U E;  1I4K 1;  2QQA A;  3OYK A;  1YHQ T;  2EQJ A;  4LD9 K;  3KXT A;  1BIB A;  3CC4 T;  3FLG A;  2CZ0 B;  2VGN A;  2O4X A;  1JBM A;  4RG2 A;  1G3T A;  2E6Z A;  1UGP B;  2LQ8 A;  1WGS A;  4BDZ A;  2YLB A;  3S3N A;  3G6E T;  1YBY A;  3JCM W;  1YCY A;  2X4J A;  2RB6 A;  3M57 A;  3MP8 A;  5D6W A;  3V8K A;  1YHQ A;  2DIG A;  2DXB A;  2H3J A;  2PVO B;  5LL6 S;  1AHJ B;  1K73 C;  1TH7 A;  4O6J A;  3E9G A;  3CBO A;  3OYA A;  4XAX B;  3VUZ A;  2ZPH B;  3CPW A;  3ER0 A;  2A7Y A;  2OTL T;  5IN1 A;  3URG A;  3JCM d;  1FWZ A;  3RKY A;  5GAM d;  2HAX A;  4M7D B;  3LYI A;  1IZ6 A;  4JLG A;  4OGE A;  3RKW A;  2RJF A;  3E9F A;  3HFN A;  4UC4 A;  1IRE B;  3H6Z A;  3L42 A;  4QVZ A;  4O5V A;  4RCB A;  3LLR A;  4JJN K;  2D6F A;  2JNG A;  1VQ8 T;  3CC2 T;  3OYH A;  2RJD A;  4KT0 E;  1JB0 E;  3JB9 D;  3PMT A;  4XTX A;  5LJ3 f;  2YHT A;  3VJP A;  4NL3 A;  3BDL A;  3H8Z A;  3E19 A;  1N8R U;  5CKB A;  1RL2 A;  2K4Y A;  3TU4 K;  3PFS A;  5GAN 2;  2RI5 A;  2MMP A;  3JCM P;  1RI0 A;  2VC8 A;  1Y71 A;  5CQX A;  4F7U B;  1VQP A;  1YJ9 T;  2F69 A;  2R5M A;  2QQB A;  5HK3 A;  3CD6 A;  4FSX A;  2CKK A;  2K3Y A;  3C94 A;  4WF2 A;  3CCR T;  3HSB A;  3OYG A;  5IT9 E;  1Q7Y C;  3P8H A;  3MHX A;  3FRN A;  4M78 C;  3JB9 H;  2DZC A;  3X25 B;  2HQX A;  4XTZ A;  3CPF A;  3G7Z A;  3S6W A;  5GAO r;  3CCQ A;  1Q86 U;  3OMG A;  2DTI A;  2KAF A;  3VYG A;  3VKI A;  2P4T A;  1VQ5 A;  1G3S A;  2MF2 A;  5GMK h;  5D6X A;  2ZPB B;  3HPW A;  4HT8 A;  4XQ3 A;  2V8J A;  1K8A C;  4IKF A;  4LDV A;  4R55 A;  3LGL A;  4M78 B;  1BIA A;  4MZM A;  1NE8 A;  4PJO D;  3L2W A;  3JB9 I;  2GCX A;  2LDM A;  3OYF A;  4BY6 C;  5CKD A;  1XOV A;  1WQW A;  2LTO A;  1I8F A;  3LH0 A;  2XU8 A;  5AYF A;  1WQ7 A;  2VXE A;  2LCL A;  3M54 A;  2RK1 A;  3NTH A;  3M4Y A;  3LX7 A;  3CCE A;  1BI3 A;  2CZ1 B;  3SWN A;  1YJN A;  3EFS A;  1I5L A;  2KVQ G;  3MEW A;  1VQ9 T;  3JCM Q;  4JLI A;  2EJG A;  2XDD A;  1VQ7 T;  3I55 A;  3TCJ A;  5CK9 A;  3EAE A;  2DVE A;  1VQO T;  3A8G B;  4M77 D;  3NFC A;  5A0G A;  5GAO p;  4N4I A;  4C0G A;  3OYB A;  1YIJ T;  1YIJ A;  4BE0 A;  1QVF A;  2JZ2 A;  4X9C A;  2CGH A;  4XU3 A;  3PMI A;  3MP1 A;  5IAY A;  3OYM A;  3M59 A;  1VQ6 T;  2LX9 A;  3I56 A;  1VQ5 T;  2RHX A;  4DOW A;  1M1G A;  1JRI A;  4FT2 A;  3JB9 F;  5J26 A;  2EQK A;  2K5F A;  4HT9 A;  3OYY A;  2OTJ A;  5C0M A;  4BE2 A;  1VQK A;  5I2S A;  1R8O B;  1B34 B;  2DIQ A;  5A0L A;  3S3M A;  3QZ5 B;  1WNL A;  3JCM X;  3CCM T;  4M75 B;  5LJ5 e;  2QA4 T;  3S3O A;  3WVE B;  1VQK T;  2DEQ A;  3FIF A;  3LWH A;  1KC8 C;  3CME A;  2E5Q A;  4E7J A;  4A4H A;  1VQ4 T;  2XDB A;  4J8O A;  2VGM A;  2QTX A;  3X20 B;  2VXF A;  4VUB A;  2CZ6 B;  2LCC A;  3MET A;  3ZBD A;  5CCA A;  4L5G A;  3OS1 A;  1QVF S;  2JN0 A;  2QXF A;  5KCO A;  2L8D A;  3X28 B;  3CBP A;  4M7A C;  3GOX A;  2RD1 A;  4E7L A;  3QZ9 B;  2DD4 A;  2DXT A;  4B9X A;  3CCS A;  4M7A F;  4GLK A;  3OYN A;  1O9S A;  1U1S A;  3A8O B;  4PLI A;  3WXM B;  3I55 T;  2R58 A;  1NZ9 A;  2EJF A;  2YRV A;  2HD0 A;  3C95 A;  3CBM A;  3V8J A;  1VQ9 A;  3RER A;  4PJO E;  1M8V A;  4M7A B;  5DLQ E;  3OBY A;  4BE1 A;  4LD6 A;  4PKC C;  2K3X A;  5LJ5 f;  3CCV T;  1M90 C;  3CCE T;  4FIB A;  2P0Q A;  3SDZ A;  4BY6 B;  4A4G A;  4C92 E;  3OY9 A;  5HK0 A;  5GMK i;  4P5N A;  3JCM g;  5GAM g;  3QJ6 A;  4JRQ A;  3PIP A;  2DK3 A;  2JUF A;  1LJO A;  3JSC A;  4L6V 5;  2OAU A;  2JOY A;  4OB1 B;  3GP8 A;  3QO3 A;  3JCM V;  1UGR B;  5GMK m;  5LJ5 d;  4V2S A;  2K5I A;  2K5L A;  1N27 A;  3SWN B;  3BFM A;  3LW5 E;  3HHT B;  3FJP A;  2GFA A;  4Y91 A;  5KH6 A;  4FL6 A;  5FU7 B;  2HNI A;  4EMG A;  3QHS A;  4PJO G;  5LJ3 g;  1U1T A;  4PL6 A;  4C92 B;  3OS0 A;  2EYQ A;  2VYT A;  4HCB A;  1VQL T;  3J7A F;  2JTF A;  4EDU A;  1G5V A;  3GIB A;  3GNG A;  4C92 F;  3OS2 A;  1N8R C;  2DZ9 A;  3HRS A;  3OYE A;  5CQY A;  1KG1 A;  1PSF A;  2XID A;  4XTU A;  3CD6 T;  1QVG A;  5FLX E;  1B34 A;  3PNW C;  3JCM h;  2VV5 A;  2XIC A;  5GAM h;  1S72 A;  3T9N A;  3HRT A;  5GMK l;  4E7K A;  1I81 A;  5GAN d;  1KHI A;  3DLL A;  4M77 E;  1KQ2 A;  3MEV A;  3DB3 A;  4M78 A;  3NTK A;  2K2V A;  4M7A A;  2LT1 A;  4IUP A;  4MDX A;  4MDW A;  2E64 A;  4PNO A;  4XK8 E;  4JS4 A;  3BW1 A;  3BY7 A;  4II1 A;  4M75 E;  1H64 1;  3HP9 A;  4J6W A;  3OYL A;  4L59 A;  4ELZ C;  3L2U A;  4ATO A;  1Y96 B;  2VUB A;  1WJR A;  4JRP A;  3P8D A;  4OVA A;  4ZGD B;  3RMQ A;  3CCM A;  2MWP A;  4C92 C;  4DOV A;  1N6A A;  3GLX A;  3HKS A;  3VU3 C;  4C8Q D;  2OTJ T;  1X75 C;  2PUO B;  3P8B B;  4C5G A;  4ZGJ B;  2DTO A;  4BD3 A;  4J7F A;  2ZPF B;  2RHZ A;  1VIE A;  1WJS A;  2ZGW A;  2LRQ A;  2F5T X;  3I56 T;  4ZN1 A;  2QQ9 A;  2DTH A;  3OB9 A;  2PUK B;  1YIT A;  4JDS A;  4QQD A;  2RO0 A;  3OW2 S;  3X26 B;  1PSE A;  4ZGE B;  1M4Z A;  1V29 B;  5GAN e;  3MP6 A;  2IVW A;  2L89 A;  5FRN A;  1VQ7 A;  2WSE E;  3BDU A;  1UGS B;  2FYK A;  4QW2 A;  1BI0 A;  2KQW A;  1X01 A;  3RUX A;  1QP2 A;  5KE2 A;  5GAN g;  2CZ7 B;  2RI3 A;  3G71 A;  2Y4X A;  2MI6 A;  2V8I A;  1VUB A;  2XG8 D;  3L2V A;  3OA6 A;  4M77 F;  2FL7 A;  3CCV A;  1QVG S;  3UDC A;  2HBP A;  4J6Y A;  4M78 E;  4M7D D;  2BUD A;  4RMO A;  1BKB A;  1KQ1 A;  1QVP A;  4QQ6 A;  4C92 A;  5CKF A;  3UWN A;  3M53 A;  4HA8 A;  4E47 A;  2EIF A;  4C8Q E;  1G3Y A;  3CCU A;  3CC7 T;  5HY6 A;  2EKO A;  1QW1 A;  2RI2 A;  2HQE A;  2M16 A;  2E6N A;  2P0K A;  4NOY A;  4M75 C;  5LJ3 h;  3ASK A;  1KHC A;  3JCM c;  1VQ4 A;  2IG0 A;  3MCA B;  1KQS S;  3CME T;  2E70 A;  5L8R E;  5J39 A;  3M5A A;  3AHU A;  1Y07 A;  2CYZ B;  4EMK A;  1P92 A;  4M7A G;  3ME9 A;  5LJ5 j;  1YJ9 A;  4IUV A;  3SWN C;  1M90 U;  3M56 A;  2PVG B;  3OQ5 A;  5FU6 B;  4KBM B;  2ZPE B;  4M77 C;  3QXE B;  4M75 G;  4EPC A;  4XU2 A;  1KD1 C;  4LDY A;  2PU9 B;  3QPH A;  3CCJ T;  4M7D F;  2A3L A;  4JRI A;  1VQ6 A;  3G4S T;  3CC2 A;  1VQ8 A;  2M9U A;  4M78 G;  4J7I A;  4E7H A;  2QQR A;  4J83 A;  5GAO l;  2X35 A;  5GAM j;  4XTW A;  1HXD A;  1K73 U;  1ZHI A;  2O01 E;  3MO8 A;  4BI8 B;  3L2Q A;  2LC4 A;  1U8R A;  5GAN 8;  4Q5W A;  4M7A E;  2RHI A;  1YJN T;  2E10 A;  4IUR A;  4IUQ A;  4MZT A;  5A0D A;  5LJ5 g;  4PJO F;  2QQS A;  3QBY A;  4M75 A;  4PJO C;  3V8L A;  3VUB A;  4OB3 B;  3QYG B;  1O75 A;  4HKE A;  1BI1 A;  4C5I A;  4A54 A;  4J6X A;  4XU0 A;  4A4F A;  5CO7 A;  3DKM A;  3M4G A;  1OZ2 A;  3PT9 A;  1GXI E;  3UT1 A;  1HK9 A;  1M1F A;  1NJI U;  4C8Q C;  3CEY A;  2RA2 A;  3OSV A;  4C8Q F;  4NS5 A;  3CCL T;  4ZTJ A;  4A4K A;  2DO3 A;  2MWO A;  3TRE A;  2WSF E;  2YLC A;  3VV0 A;  4C0D C;  1BYM A;  3CC4 A;  3A8M B;  5GAN 6;  4ZN3 A;  3E1S A;  3QKJ A;  2XI9 A;  3RKX A;  3LWI A;  2E41 A;  5GAN j;  2M0O A;  4EMK C;  4PJO B;  4TVR A;  3CMA A;  2EQM A;  5CKE A;  4YTL A;  1Q81 U;  4R56 A;  4PLL A;  2DXC A;  2OTL A;  1MGQ A;  5CAI A;  1Q81 C;  4OF1 A;  3HFO A;  2E1H A;  3PTA A;  2M1H A;  1WPY A;  3OSS C;  1Q82 U;  2RK2 A;  3FB9 A;  1YI2 A;  1OYX A;  3WVD B;  1Q82 C;  2DJZ A;  2ZPI B;  1FX7 A;  1LNX A;  3X24 B;  4JUV A;  5GAN 7;  5FRM A;  4EMK B;  5C6S A;  3M55 A;  4OB0 B;  2X4W A;  5D6Y A;  4KUD K;  1YJW A;  3DB4 A;  5KCH A;  2JVV A;  3O8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...