3MEAA

Crystal structure of the sgf29 in complex with h3k4me3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
164
structure length
162
Chain Sequence
LYFQGTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 162
sequence length 164
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3meaA02
2K3YA 3FDRA 4BACA 3O8VA 2LCCA 4QQDA 4OVAA 3S3OA 3LX7A 3BDLA 3FEOA 2RJDA 5CIUA 4E7JA 3QIIA 1SSFA 5KCHA 2XDPA 3OYMA 2DIGA 2R57A 3DB3A 4PLIA 3FC3A 1OI1A 4N4IA 3L2QA 3QKJA 5D6XA 5KE2A 1RI0A 4BE1A 2G3RA 2HQEA 4IUVA 3S6WA 5J26A 4II1A 1OZ3A 4BDYA 3DB4A 2EKOA 2GFAA 4HCZA 4IUPA 4A4HA 2E5QA 3S3MA 5FROA 3MEAA 4QQ6A 2RHUA 1OYXA 3L2WA 4FU6A 2RHYA 5KH6A 4RG2A 4BDZA 3OYDA 1KHCA 2DIQA 3QBYA 3OYJA 4Q5WA 3PFSA 3E9GA 2PQWA 3OYEA 2L89A 3MEVA 1OZ2A 3EAEA 3LYIA 2M1HA 3MP1A 3OMCA 3PMIA 4GY5A 5IN1A 3DLMA 4A4GA 3OS0A 3OY9A 4QW2A 4PLLA 5FRMA 2MWOA 3MEWA 2LTOA 4E7KA 3PMTA 2O4XB 1WGSA 3KUFA 3H8ZA 3MP8A 3OYKA 3P8HA 5M9OA 2LVMA 3LLRA 2F5KA 4BD3A 4E7IA 3NTIA 2X4YA 3META 2FHDA 4B9XA 3UWNA 5J39A 2R5AA 4LD6A 2L8DA 1H3ZA 3OQ5A 4CRIA 4C5IA 3UT1A 1G5VA 2B8AA 3L2RA 3MP6A 2R5MA 2NLUA 3OYCA 5IAYA 2RI3A 4A4FA 3LH0A 3OYLA 2DAQA 4BE0A 3OYAA 2MWPA 2BKDN 2RHIA 4X34A 4E7HA 1WJRA 2RJEA 2CKKA 3OB9A 4IUUA 4C5EA 4NS5A 3OYBA 3OYFA 2BIVA 5KE3A 4IUTA 3P8DA 4Z02A 4ZTJA 2L3RA 2D9TA 3ZEHA 2LDMA 2GF7A 1MHNA 3L42A 5D6WA 2VYTA 2X35A 4N4HA 2WACA 2EQUA 2YRVA 3MO8A 2O4XA 3CEYA 2RI2A 2IG0A 2EQMA 2HQXA 4E7LA 2X4XA 2RJCA 3FLGA 3LGLA 3L2VA 4IKFA 1WJSA 3C4SA 4N4GA 2JZ2A 5C6SA 2X4WA 3OYHA 4L59A 2E6NA 2QQSA 3OS1A 2EFIA 3F70A 2M0OA 2LRQA 3OYGA 3L2UA 4QVZA 2R58A 2BUDA 4BE2A 2P0KA 3OMGA 4EDUA 3M9QA 3S3NA 2EQJA 4FL6A 5C0MA 3OS2A 4ZTFA 2EQKA 3ME9A 2QQRA 3LGFA 3E9FA 4IURA 4PL6A 2K3XA 3ASKA 5KCOA 3OYNA 3QJ6A 2RO0A 3GOXA 1N27A 2RJFA 3Q1JA 3OA6A 2RHZA 3NTKA 4IUQA 3MEUA 4QQGA 2RHXA 4UC4A 5FRNA 3H6ZA 4B9WA 2JTFA 2RI5A 3SD4A 5D6YA 3PNWC 1XNIA 4C5HA 4C5GA 2XK0A 4A4EA 2GFUA 2M16A 1WJQA 3OYIA 3NTHA
chains in the Genus database with same CATH superfamily
2C0TA 1VQOT 1M90C 2QEXQ 2J6OA 3C94A 4CC4B 2DEUA 1OULA 3CC7T 3I56T 4KUIA 5CCAA 1WQ7A 3JB9J 3G71T 2OAWA 4BDYA 3DB4A 2GFAA 2E5QA 5FROA 2L0AA 2DERA 3FRNA 2WSEE 1JXOA 3CCLA 3CCEA 3SWNC 5LJ3j 3OW2S 5HY6A 5I11A 4LDXA 3E2UA 4OMNA 5I2MA 1G83A 2Y4YA 2NUZA 3RUXA 2O4XB 1QVFS 1VUBA 1C6VX 1ZX6A 1GBQA 2O2OA 4HVVA 3VS5A 4OP0A 2LX9A 3L1AA 1VQ5A 1MUZA 1YITQ 2OX7A 4ZNXA 2KBTA 4AG2C 4WCIA 3VU3C 3QXEB 4CC2A 4JS4A 3GLXA 4EMHA 1RI9A 1T3LA 2LC4A 4PJOB 3RKWA 1WJRA 2DO3A 2QAZA 4M7DB 1UB4A 1RAEB 1SG5A 3FIFA 1NJIC 1VQ4Q 4N4HA 2JS2A 2O4XA 1HJDA 2JZ2A 3CCSQ 4DBQA 2YT6A 3JB9H 2JS0A 2HL3A 4BE2A 2JXBA 1K9MU 1JJ2A 2HQHA 2FRYA 4N0AA 5CKBA 4PJOA 3JCMV 1ZA2B 2LJ3A 3EH2A 3H6ZA 4OMQA 3A8HB 5IXBA 1T0HA 2OI3A 2XI9A 1YFNA 1K8AR 2AZSA 4M75B 3MCAB 2M9UA 3CCVT 4M7DA 1SF9A 1VQKQ 3CPWP 2DL4A 2AK5A 2YLCA 2QQAA 4JPBW 1Q81C 2O31A 4YTLA 3QJYA 2F5TX 2H3JA 3OYMA 3M0PA 1U8RA 4N4IA 2XMFA 1OX9A 5DY9A 4XTZA 2ROLA 4C0GA 4JRQA 2KT1A 4ATOA 3CCJA 3LWHA 3S3MA 1YP5A 4GLMA 2XD0A 1M5Q1 4ZN3A 1N8RC 1VOMA 4F7UF 2FPFA 2YUNA 4CC7A 2ABLA 2KK4A 3THKA 1AEYA 1WXUA 4ZGDB 3CCUA 4M75A 1YJWA 2HBWA 3EG2A 2FG0A 4KUDK 2EBPA 3G1JA 1IO6A 1S1NA 2Y90A 3NGPA 3LLRA 4FT2A 4Y28E 4JJBA 1XJWB 5J39A 2R5AA 1YCSB 1I07A 2W10A 5GAMh 1Q82R 4P5NA 4JRIA 2LNHB 2B86A 1NYFA 1JU5C 2HSPA 5FWCA 4IIMA 3X25B 1LNXA 3FJPA 2FYKA 1VIEA 2BE9B 1WXBA 1PKSA 2D9TA 2CP2A 5IHNA 5D6WA 1W6XA 4M77D 2YUQA 2RQTA 4MZTA 2DNUA 2E12A 3VS2A 4LD9K 1MMAA 5GAOr 1X69A 4OB3B 1H641 5KCOA 2K3XA 4KGXB 3VV0A 3I9QA 4HT9A 1M1KU 2CZ1B 1FWZA 1ARKA 4FIBA 5GMKi 3EHRA 4J9FA 5GANf 1X6OA 1VYVA 2RN8A 3LW5E 5KCHA 1VQ7Q 1H3HA 4OGCA 2XDPA 3BFMA 3G6ET 5D6XA 2KYBA 2G3RA 1FMKA 1WIEA 4O6JA 4DOWA 3PVLA 3G4SQ 2CT3A 4IUPA 1M1KC 1E6HA 4RCBA 4JZ4A 2M51A 1KG1A 1AWJA 1VQ9A 1OZ2A 1K73R 2J06A 2L3SA 2RNAA 7AT1B 1NE8A 1WGSA 3H8ZA 1VQLA 2EYQA 1XQHA 4CC3A 4OMPA 2KE9A 3HKSA 3QG1A 3CC4A 3OSVA 3UT1A 3CCQT 5DM7R 2KYMA 1JEGA 2NUTB 1CKBA 2ZPHB 2KI7A 1KD1C 4LDYA 2RHIA 1OQKA 2LCSA 4NS5A 4PJMA 1QW1A 3P8DA 3RDVA 3LH5A 2CUDA 1VQOQ 4HCCA 1WHKA 1RACB 2YRVA 4M78B 4C8QG 1M2VB 1QVGP 4E7LA 5GAMd 4PJLA 3C4SA 5GAOl 1M9SA 4L59A 3E19A 2Y4XA 1GL5A 2E64A 3I56Q 1YJ9T 2AZVA 4PJOD 3LGFA 3M55A 4X9DA 2NUTA 3CD6A 2AKLA 2DFUA 2RHZA 2X51A 5FU6B 3M5AA 2X3WD 1WJQA 4WF2A 5LJ5g 1MV3A 3M59A 5GAN8 2EW3A 2FRWA 4M78A 1M2VA 1WDXA 1V1CA 2LQKA 2GCXA 1BYMA 4PLIA 2K57A 1NM7A 1ZSGA 4RCCA 4R56A 4IUVA 3S6WA 3EGDB 4FT4A 2DVEA 2YXYA 2DPPB 1GRIA 2EIFA 1KQ2A 5GAN2 2YLBA 1WHLA 4Q5WA 4JJDA 4X1VA 3RKYA 3CCRA 4BI8B 4A4GA 3PVQA 5LL6S 3OY9A 2RM4A 2F2VA 3PMTA 3CCST 2D1XA 1BIAA 2GTOA 3M4YA 3NMZC 3NPFA 4B6MA 4J5YA 3M54A 5LJ5e 5D7UA 4A4KA 2EJGA 3CBOA 3MP6A 3EGDA 2KXCA 2NLUA 1K9MR 2AIRB 4E7HA 1VQKT 2RD1A 2DD4A 2KT8A 3ULRB 1UGRB 2D6FA 3CC2Q 1QWEA 2CS7A 2YDLA 5CVIA 2X35A 3PIOA 2P4RA 5KYXB 1Q7YC 1WA7A 5C6SA 2X4WA 3VS4A 2A36A 2ZGWA 2BUDA 4PFZA 4OB0B 2OTLT 2HNIA 2K6DA 2EQKA 3QJ6A 3NTKA 3GNFB 1GFCA 4B9WA 4J6WA 1UECA 3VS3A 1JRIA 2F2WA 2EYZA 3NTHA 2EJFA 1UGPB 2X3XD 2DMOA 2EYXA 3CXCA 1QVPA 3QIIA 5GAMj 5KYXA 3TQ7P 1N9RA 2JTMA 3A8GB 3PGGA 1W2BP 3HRUA 1M30A 4MDWA 4J9CA 1KC8U 4XU1A 1T3SA 3INZA 2NUPB 2QA4A 3EFSA 2LQ8A 4HCZA 3VUZA 4C8QF 1YIJA 1AT1B 1Q95G 1BI2A 4AFQC 4HVUA 4HXJA 1YI2Q 4BI3A 3PFSA 4L5GA 1TTHB 2L89A 1IXDA 3VS0A 5FRMA 2CZ6B 1WI7A 2MWOA 2V8KA 3I55A 3OYYA 1U1SA 1B7TA 1RAGB 2M0YA 4PKCC 5IHKA 3CMAT 1Y96B 2FEIA 2A28A 3KBGA 1ZHIA 2LCLA 1GCQC 3SWNB 3OQ5A 5LJ5f 3GBQA 4BY6C 1AVZC 1UGQB 2NUPA 2JOYA 5A0LA 2QEXA 3A98A 2KQWA 3OW2A 1M1KR 1ABOA 3OYFA 3BDUA 4LN2A 3RESA 4OB2B 1MHNA 1QVFA 3HFNA 4JZ3A 1T0JA 3A8LB 1M27C 1M8MA 1FXXA 2VWFA 4EMGA 4C8QE 3FLGA 1UE9A 3G4ST 2HBPA 1X27A 2E6NA 2COWA 2QQ9A 1O75A 2K4YA 3M58A 4A54A 3VS1A 3OS2A 4IURA 4JLGA 2GQVA 4KRTA 3OYNA 2KSSA 1QQJA 2RQUA 5A0DA 4ZGEB 3QWYA 5GAOm 3M0TA 2CSIA 3GIBA 4M78D 1M8VA 1M90U 1YITA 3SFMA 2K9GA 2LCCA 4QQDA 2NWMA 4M77A 2CP3A 2RJDA 1GXIE 2FB7A 1QKWA 1UJ0A 3OSSC 3FC3A 2HCKA 4RTUA 3O5ZA 4F16A 2CP7A 2E41A 2ZZDA 4PJOE 2HQEA 4LNPA 1OZ3A 2RQVA 5A2QE 1VQ4A 3L2WA 4M7DE 2K3BA 4FU6A 2D8HA 4KH0B 4OGEA 3R6NA 4IIOA 3JCMb 2A3LA 3OYJA 3UA6A 4E47A 2ZPGB 5IT9E 4LUEA 2JNGA 3NTIA 3M57A 3HPWA 1AWXA 2FPDA 1YJ9Q 1V76A 2HAXA 3A8OB 5KYYB 2OTJT 4XK8E 5A0GA 4C0DC 5GANh 1W1FA 4M75E 2LP5A 4M7AB 2DJQA 2RJEA 2GQIA 2OJ2A 2PNIA 1NJIU 1D0YA 1PHTA 2XU8A 3C95A 1KIKA 3JSCA 3NHNA 3PIPA 1KHIA 1GFDA 1VQPA 2IG0A 1K9AA 2RJCA 5GANg 2KRNA 4EPCA 3HSBA 1G8XA 1VQNA 3RMQA 2ED0A 1UUEA 5C0MA 5KYYA 2JVVA 3ME9A 1JJ2P 3SHWA 4KBMB 1PD0A 4M7AA 2V26A 4IUQA 3VYGA 3ZL7C 3EGUA 5CKHA 2EYWA 2AHJB 1HYOA 1HD3A 2V8JA 1VQMQ 1Q81U 4EMKC 2ECZA 3FEOA 4XU3A 1Q86C 3UATA 1GCPA 2CP0A 2GTJA 2EQIA 2AKKA 2GBQA 4RTXA 5IH2A 3H0FA 4II1A 2VXFA 1N8RU 3URGA 1LOJA 2JN0A 3CC2T 1OU8A 4MDXA 2JMAA 2MK5A 2DBMA 5GANe 3PTAA 3QUIA 1O9SA 2CT4A 1YWOA 2QK0A 4KH1B 2E6ZA 4RTVA 1A0NB 4FSXA 5CQYA 3OYGA 1PCXA 4XU0A 3M4GA 4JJCA 3MEWA 5GJVB 3OBYA 3RERA 2HZYA 5J3BA 3UF4A 3CCLQ 4BI4A 2VGNA 2OTLQ 1IGQA 3TREA 2RI3A 2LT4A 2EKHA 2RQRA 3LH0A 2DBKA 4X34A 2HSEB 3JB9I 3UA7A 1VQ7A 2EGAA 2PVGB 1RABB 4Z02A 1EFNA 2EJ9A 4J9BA 3L42A 5FWBA 4C8QC 3QPHA 2RI2A 2EQMA 4XAXB 3MPUB 4XTVA 4IKFA 1WJSA 2RK2A 2E4HA 5GANd 4LE9A 4C0ZA 3D7SB 4QVZA 4GLKA 2VV5A 1KC8R 5CKEA 4L6V5 4C92E 1V29B 2FZGB 1YI2T 2KNBB 3Q1JA 4UC4A 3V8LA 2JTFA 2KRSA 1NLPC 2YUPA 1VQ8A 1LPLA 2MI6A 2K5FA 2QQBA 5EG2A 3CCMA 1SSFA 4N0AC 3CMAQ 4PJOC 5CKFA 4DEYA 4QVCA 1PD1A 3VYHB 1C0MA 2DZ9A 1YHQT 1M3CA 4A4HA 1U3OA 4M7DC 1KK7A 2LZ6B 1VQOA 2DE0X 3CMET 2CP6A 1KHCA 1SRMA 3MJXA 2VC8A 1WYXA 4M78E 2DYIA 3CC7A 4J9GA 3KXTA 3A5ZB 3JCMg 2QDLA 4JRKA 3I56A 3QWXX 2RA2A 2SEMA 3MHXA 3QO3A 3G71A 2LJ1A 3CCJQ 1X75C 4E7IA 1YBYA 2JW4A 1AHJB 4CRIA 2WSFE 4FCYA 2SRCA 4XTUA 1UJYA 2CSQA 3CCUQ 1YJWQ 4M75C 1KD1U 3M0QA 1PSFA 3LWIA 2V1RA 4C5EA 4E6RA 3JV3A 2XG8D 4HCKA 1MMDA 1M90R 3CPWS 2EQUA 2DYBA 4ME7A 3CEYA 1TU0B 3VS6A 2KVQG 3OS1A 4MMKA 4RMOA 1G3TA 1Z9ZA 4OMOA 4AT1B 3M9QA 3JCMe 4M7AD 3TEEA 1B34B 4FYVB 2QQRA 1RLQC 2IVWA 3WXMB 4F7UB 2PU9B 2E3HA 4ORZA 1SSHA 1UGSB 1E7OA 4JJNK 3JAME 2X9HA 2BZ8A 4RTTA 4BACA 4HA8A 3S3OA 3LX7A 4LDVA 5FU7C 5LJ5h 1NG2A 4LDUA 2P84A 1MGQA 5GANj 3L2QA 3QKJA 1IHVA 1G3YA 5J26A 2RF0A 2DETA 1I1JA 3CCVA 2RQWA 2OTJQ 2EKOA 2EPDA 2L3PA 4F7UA 3RBBB 4BB7A 2J7IA 1LVKA 2PUKB 2RHYA 4RG2A 4ELZC 1VQ6T 2VGMA 1TWBA 2DTHA 1SEMA 3MP1A 3BE3A 1NJIR 3OS0A 1S72T 4E7KA 1ZBXA 4PJOG 1KQSS 3KUFA 2W0ZA 2LVMA 3QDRB 4F04B 5GAN3 4M7DG 1SHFA 2RPNA 1PWTA 3SDZA 1YJNT 3JCMc 2HMAA 2MCNA 1VQ9Q 1R77A 4HCBA 3AHUA 2RMOA 2COZA 2KAFA 4FSSA 1YCYA 5I21A 3OB9A 8ATCB 1VQMT 1ABQA 3H41A 4RTWA 2LDMA 4AG1C 4KULA 4BY6B 3CC4Q 1AWOA 1Q81R 1Q7YU 4XTWA 2DTOA 2AT1B 5GJWB 1WHHA 4N4GA 2GNCA 1BI1A 2Z0WA 2CH4A 2HD0A 4M75G 1IB8A 2IPOB 2EGEA 4EDUA 4C92C 1WXTA 1JQQA 3C0CA 3JCMf 4FL6A 1FMVA 2J05A 1NPRA 3E9FA 1N8RR 2PVDB 1RUWA 2CGHA 3JB9D 2BTTA 2MIOA 4QKUA 4O5VA 3SD4A 1RAHB 2COYA 2HEQA 1TG0A 2QASA 4C5GA 2M16A 3RKXA 1GCQA 1RL2A 2C0OA 3EGXB 3O8VA 4JLIA 4X9CA 4JS5A 1K0XA 3CXCP 3JCMJ 3CCLT 3CCET 4BUGA 4OMFB 4ZN1A 1WHJA 2RK1A 4PJNA 2K2MA 2EGCA 4OMMA 1VQ5T 1WX6A 2QG9B 2DILA 3HTRA 5LJ5d 4M77E 4DA4A 4DQ2A 1XTDA 2J6KA 1N5ZA 3ZFJA 2V8IA 4J9IA 2FL7A 3PMIA 3G6EA 1K8AC 1I5LA 3GP8A 3EGXA 2KEAA 2ZPIB 2O88A 3ZBDA 1QVGS 2E65A 5M9OA 4J83A 4E2FB 2YSQA 2L8DA 4LD6A 3VJPA 2BZYA 1Y71A 2K79A 1H8KA 1BIBA 3L2ZA 9ATCB 3EG3A 4BE0A 2MWPA 1IHWA 1MMNA 2DXUA 1EX4A 3X24B 3OW2P 2DXCA 2BIVA 1E6GA 4ZTJA 3ZEHA 1SRLA 3GPLA 2VYTA 2KRMA 1ZSZC 2DD5A 1QVFP 3CCQA 3MO8A 1XOVA 4C0DB 1YNZA 4J7IA 3HRTA 3LGLA 4PJJA 2A0FB 2RH2A 1X43A 3A1PA 4JUVA 3KFVA 2M0OA 2R58A 3S3NA 1X6BA 2FVUA 1YHQQ 4RUGA 1Q82C 4PJOF 5CK9A 1RAFB 3CMEQ 5FRNA 2MF2A 4PNOA 2RI5A 5FLXE 1Y07A 4A4EA 2GFUA 3EFRA 4M7DF 3CCJT 2K3YA 3EHQA 2BE7D 1YJ9A 1K1ZA 1ZLMA 3BDLA 2VASA 1Y96A 3M0UA 1RAAB 3SWNA 1U06A 5HKCA 4C92G 4LXCA 1AZGB 3CCUT 3J7AF 1Z9QA 5KE2A 1YJWT 4M7AE 2C06A 3JCMP 1K0SA 2CYZB 4EMKB 1WHGA 5GMKh 4KGZB 1KD1R 1G3SA 4EIKA 4XQ3A 1QP3A 3PT9A 4M4ZA 1MNDA 2GGRA 1VYUA 1I0CA 2PQWA 2IIMA 3OYEA 4M75F 2O9SA 1I5OB 1MNEA 3M53A 2ZPBB 4QVDA 1TUCA 2XIDA 2OAUA 1JB0E 4AMCA 1YIJQ 5GAOq 3EH1A 1B07A 2FHDA 4B9XA 2PTKA 4D8DA 1ZBJA 1X2KA 1DJ7B 2JUFA 4M78G 3OYCA 2DRMA 1J3TA 4EMKA 1QP2A 2FZCB 2DAQA 3CCSA 3R6OA 2ENMA 3N5BB 5LJ5j 4XU2A 3QZ5B 2F2XA 2XHCA 2L3RA 4ELYC 1BB9A 5GAN6 2YUOA 3C12A 1OOTA 1K73C 3AT1B 4ZGJB 2WACA 1UG1A 2O9VA 1BCMA 2E1HA 1Y0MA 3TU4K 2H8HA 2DTIA 2LNVA 5CAIA 3QZ9B 4RG8A 4RTYA 1W2BS 1FYNA 2DXTA 2ESWA 1VQKA 2DXBA 2LRQA 4J9HA 3WVEB 1M1FA 3FJ5A 4FM4B 3RR6A 4PL6A 4C8QB 1OX8A 2JTEA 2I2LA 3EG0A 5GMKe 1VQ6Q 1M2OA 4C5HA 3HL8A 4NOYA 3M0SA 1WQWA 3OYIA 1R0CB 4A63B 1BU1A 1S72Q 1Q86U 2O01E 4DBFA 2MYSA 5CIUA 2KMTA 2OTLA 2F1LA 2QTXA 3TSZA 3TSWA 2DIGA 4F14A 1VQ9T 3OBWA 1JXMA 1RI0A 2LX7A 4K11A 2HKQB 1YJNQ 4AFSC 3CPFA 1VQLT 5CO7A 4C8QA 2XDBA 1D1CA 4OF1A 1ZA1B 4M77C 5GMKl 1BKBA 2YRCA 4BDZA 3CC4T 1QCOA 1W70A 1QCFA 5CKDA 2ZCFB 3VKIA 1NZ9A 3MEVA 3LYIA 3EAEA 3JCMQ 1NLOC 4QW2A 5GAN7 4D6WA 2P4TA 3SB2A 1HK9A 1Q7YR 3I5RA 2DX1A 1FX7A 2DJZA 4HKEA 2L2PA 1X6GA 4NL2A 3X20B 2DK3A 1M3AA 2ED1A 2B8AA 1G2BA 2R5MA 2D8JA 2K2VA 5GAOp 1UEBA 1M3BA 4HVWA 1QMCA 4C92F 3V7RA 2I0NA 2ZPEB 3CMAA 4WTOB 3VRZA 1N6AA 8AT1B 3CD6T 1WPYA 4JDSA 1FMWA 1HXDA 4KGVB 3L2VA 3A8MB 3CCEQ 2BZXA 3DKMA 2QQSA 3JCMW 2K5LA 1K4US 1NEBA 1X01A 3EG9B 1QLYA 4MZPA 1NBEB 4R55A 4Z88A 2DA9A 5L8RE 2DL8A 1K9MC 2ZPFB 1N27A 1VQ5Q 1VQPQ 1U1TA 5DLOA 3G4SA 1I4K1 3H0IA 3CPWA 2DKGA 4FYWB 2FO0A 1AWWA 1VQNQ 4F17A 4M78F 5IXFA 4E7JA 2MMPA 2D0QB 2DL7A 3UPUA 3CCRT 1OI1A 1MV0B 1WZOA 4JRPA 4M7AC 3I35A 4OB1B 3HP9A 4BE1A 4D8KA 1PRMC 1VA7A 2YHTA 3RMSA 3EG9A 2M02A 2VVKA 4E7SA 3V7SA 2E10A 5FU7B 5AT1B 4DEXA 1TUGB 1N9SA 4J9DA 1VIFA 5KYUB 3V7CA 5GAN5 3VUBA 1UTIA 2DVJA 3OMCA 3OYLA 3V8KA 1C1AA 3J80E 1ZQ1A 3MP8A 1WNLA 3JCMh 2F5KA 1M4ZA 1KQSP 4Z89A 5GAMg 1KFZA 1U5SA 4DBRA 4F7UE 2KDSA 2KY9A 3VRYA 3GNGA 1UDLA 2DM1A 3I5SA 4M77G 1D0XA 1X2QA 5IAYA 1BI0A 3J81E 4RTZA 1JJ2S 1YN8A 1D09B 1IRXA 4IUUA 1PC0A 5KE3A 5KYUA 2HKNA 2DZCA 1KQSA 2QDYB 1Y57A 2EVRA 1TH7A 2OTJA 2HQXA 2A08A 5GMKj 3OYHA 4J6XA 1H92A 3U23A 1MMGA 3OMGA 4VUBA 2ZAEA 1CSKA 3DLLA 4ZTFA 1NYGA 2EWNA 2LMJA 2P0PA 3GOXA 4Y91A 1AD5A 2FZKB 4QQGA 2MPXC 5CQXA 2VUBA 3H9NA 1XNIA 5GAMe 1QWFA 4A53A 2QA4T 2YWWA 2KR3A 4C92B 1YIJT 1I8FA 4OVAA 3X26B 1UHCA 1SPKA 1VYTA 3QSUA 1SKUB 2R57A 4R0KA 2JM9A 3G7ZA 2H3EB 2MOXA 2K7AA 4C8QD 1VQ8Q 3I55T 2ATCB 2X4JA 1K76A 1KJWA 3CCMQ 1D3BB 1OYXA 5KYWB 2QGFB 2A37A 1UGVA 4XTXA 1ACMB 2JMCA 5KH6A 5DLQE 4FYXB 3QBYA 2PUOB 2V1QA 3BW1A 2M1HA 2D0NA 5IN1A 3DLMA 4C92A 4LUDA 1G3WA 2LTOA 2QEXT 1ZUKA 3NFCA 2WSCE 4PFPA 3VS7A 4M7AG 2LJ0A 3P8HA 2VKNA 2L5QA 2PZ1A 1OPKA 3RIRA 5HCKA 2L3QA 3CC2A 1QCNA 5GMKm 2QGGA 1B34A 1ZUYA 3UWNA 2HL5C 2FPEA 4DBHA 1UFFA 2QXFA 4QT7A 5IHIA 3CC7Q 4AFZC 3TCJA 5ECAA 3OS5A 1WFWA 4A4FA 4J6YA 3ER0A 1D3BA 5KYWA 1OEBA 1LJOA 2CDTA 4CI0C 3OYAA 3G71Q 4E7ZA 4LDWA 4J7FA 3IQLA 4MMLA 3JCMd 1UHFA 3JCMX 4M7DD 1PG5B 2C0IA 2VB6A 1QVGA 2F69A 1F1BB 1EIFA 4DOVA 2LT1A 1Q86R 1M1GA 5GAN4 2A7YA 2CUBA 2X4XA 5LJ3h 1EZZB 2CREA 1YITT 1GBRA 3REAB 2P0KA 2JT4A 1VQLQ 3T9NA 1ZSZB 1TXQA 2RO0A 1NPPA 5HK0A 3OA6A 2RHXA 3PNWC 5LJ3g 1WLPB 5GAMf 2XDDA 1OPLA 4M75D 4V2SA 4Y92A 1VQ4T 4M77F 1HSQA 1KQ1A 3CBMA 1YI2A 1IGUA 2EYYA 4AFUC 2E70A 1ZSZA 4QQ6A 1TS9A 2XKOC 3CBPA 2DL3A 1K8AU 1P92A 1BI3A 5L23A 1AOJA 5EC7A 4RKUE 3QHSA 1ZUUA 4GY5A 2LQWA 3CD6Q 4PLLA 3X28B 2EAYA 2CZ0B 1OU9A 4PK4A 3CCVQ 3OYKA 1YHQA 3E1SA 3JB9G 1PKTA 3META 3CMEA 5LJ3e 3M0RA 1TUDA 1H3ZA 4J8OA 3REBB 4C5IA 3QYHB 1D1AA 1PNJA 3WVDB 1VQPT 4M78C 1NEGA 3L2RA 3V8JA 2CKKA 5I2SA 1VQNT 4IUTA 1PSEA 2KGTA 4XTYA 1TSFA 1OV3A 4FW1A 4TVRA 5HK3A 5FU6C 1IREB 1BK2A 3CCRQ 3HFOA 2EFIA 5I22A 3L2UA 1Q82U 2EQJA 2XICA 1AZEA 4PFOA 3ASKA 4Z8AA 2RJFA 2NYSA 4M7AF 2DF6A 3MEUA 1RAIB 3CQTA 2JJ9A 3FB9A 3BY7A 2XK0A 2RB6A 2DL5A 2QTVA 1WHMA 5LJ3d 1PM3A 1RADB 3FDRA 3QDFA 1Y7XA 5FW9A 4J9EA 4C0FA 2YRDA 1W2BA 3RNJA 3M56A 2KROA 3DB3A 3H0HA 3JRZA 4MZMA 4ANJA 2JM8A 1RLPC 3P8BB 1BCOA 3SEMA 1CKAA 2LQNA 3EFOB 1B3QA 4GBQA 2ROTA 1KC8C 5AYFA 3MEAA 2RHUA 4FYYB 1YWPA 2DRKA 1R0BG 3OYDA 2PVOB 2DIQA 3PE0A 3QYGB 2G6FX 4C92D 3E9GA 1JBMA 2J6FA 2HDAA 2K5IA 1VQ7T 4BD3A 2CH4W 4M77B 2X4YA 4KT0E 5LJ3f 2QI2A 1SHGA 2P0QA 5CR2A 1VQ6A 1D1BA 2E5KA 3EFOA 1G5VA 3G6EQ 1PRLC 2MAMA 1S72A 3HRSA 2BKDN 4ESRA 1LCKA 5KYNA 3GF5A 1IZ6A 3OYBA 2CZ7B 1K73U 2QA4Q 2GF7A 3MKDA 2E3IA 1YJNA 4F7UG 1KSWA 1D0ZA 4FW2A 1TOVA 1I81A 3UDCA 3HHTB 5GAOn 3CXCS 1VQ8T 2VXEA 4NL3A 3F70A 1W4SA 3TVTA 1VQMA 3CCMT 2KXDA 2CP5A 2QYZA 1R8OB 1BBZA 3I55Q 4HT8A 2DLPA 3CCQQ 6AT1B 3EG1A 4OMLA 5D6YA 3JB9F 2DEQA 1JO8A 1QKXA
chains in the Genus database with same CATH topology
1UGPB 4BACA 1VQOT 4HA8A 1M90C 3S3OA 3LX7A 4LDVA 4M78F 3CXCA 4E7JA 5FU7C 1QVPA 5LJ5h 3C94A 3QIIA 2MMPA 5GAMj 4LDUA 2D0QB 1N9RA 2JTMA 3A8GB 3PGGA 5GANj 1MGQA 3UPUA 3HRUA 1OI1A 3CCRT 3L2QA 3QKJA 3CC7T 4JRPA 4M7AC 4MDWA 3HP9A 4OB1B 4BE1A 3I56T 4KUIA 2YHTA 1WQ7A 1G3YA 5J26A 4XU1A 3RMSA 5CCAA 3JB9J 1KC8U 3INZA 3G71T 4BDYA 3DB4A 3CCVA 3EFSA 2QA4A 2EKOA 2GFAA 2LQ8A 4HCZA 2E5QA 5FROA 3VUZA 4C8QF 3V7SA 1YIJA 4F7UA 1BI2A 2E10A 5FU7B 4BB7A 2PUKB 1N9SA 3FRNA 2RHYA 2WSEE 4RG2A 4ELZC 1VQ6T 2VGMA 1VIFA 3CCLA 3CCEA 3SWNC 3V7CA 4BI3A 3PFSA 5LJ3j 5GAN5 3VUBA 3OW2S 4L5GA 5HY6A 2DTHA 4LDXA 2L89A 5I2MA 3OMCA 3OYLA 3MP1A 2Y4YA 3OS0A 5FRMA 3RUXA 2CZ6B 3V8KA 1S72T 2MWOA 2V8KA 3J80E 4E7KA 1ZQ1A 1ZBXA 2O4XB 4PJOG 1I5LA 3I55A 1KQSS 3KUFA 1VUBA 1QVFS 3OYYA 1U1SA 3MP8A 1WNLA 3JCMh 2LVMA 2F5KA 1M4ZA 4OP0A 4PKCC 3QDRB 3CMAT 5GAN3 2LX9A 3L1AA 1Y96B 5GAMg 1VQ5A 3KBGA 1ZHIA 2LCLA 4M7DG 4F7UE 3SWNB 2KDSA 2KY9A 3OQ5A 3VU3C 3QXEB 3SDZA 5LJ5f 1YJNT 4BY6C 3GNGA 4JS4A 3JCMc 3GLXA 4EMHA 1UGQB 4M77G 4HCBA 5IAYA 1BI0A 3J81E 3AHUA 2LC4A 4PJOB 1JJ2S 2JOYA 2KAFA 3RKWA 5A0LA 2QEXA 1YCYA 1WJRA 2KQWA 2DO3A 3OB9A 4IUUA 5I21A 3OW2A 1VQMT 3OYFA 5KE3A 3BDUA 4M7DB 2LDMA 3RESA 4OB2B 1MHNA 1UB4A 2DZCA 4KULA 1KQSA 3FIFA 1NJIC 4BY6B 1QVFA 4N4HA 3HFNA 2QDYB 3A8LB 1TH7A 2O4XA 4XTWA 1FXXA 1Q7YU 2DTOA 2OTJA 4EMGA 2HQXA 4C8QE 3FLGA 4N4GA 1BI1A 3G4ST 2JZ2A 5GMKj 2HBPA 3OYHA 4J6XA 2E6NA 2HD0A 4M75G 3JB9H 4BE2A 2QQ9A 1O75A 2K4YA 3OMGA 4VUBA 4C92C 4EDUA 3M58A 4A54A 3JCMf 4FL6A 1K9MU 1JJ2A 3OS2A 3DLLA 4ZTFA 4IURA 1NPRA 3E9FA 4JLGA 4N0AA 2GQVA 2EWNA 2P0PA 2PVDB 5CKBA 2CGHA 2KSSA 3OYNA 4Y91A 3GOXA 3JB9D 4PJOA 1K8AC 3JCMV 5A0DA 4ZGEB 4O5VA 4QQGA 3H6ZA 3A8HB 5CQXA 3SD4A 2VUBA 5GAOm 5GAMe 1XNIA 2XI9A 4C5GA 3GIBA 2M16A 4M75B 3MCAB 2M9UA 4M78D 3RKXA 4A53A 3CCVT 2QA4T 1M90U 4M7DA 1M8VA 1RL2A 1YITA 3SFMA 4C92B 1YIJT 3O8VA 2LCCA 1I8FA 2YLCA 4QQDA 4OVAA 4JLIA 3X26B 4M77A 2QQAA 4X9CA 4JS5A 2RJDA 1Q81C 4YTLA 1GXIE 2FB7A 3QJYA 3JCMJ 2F5TX 3QSUA 3CCLT 2H3JA 3OSSC 4BUGA 3OYMA 3CCET 2R57A 4OMFB 1U8RA 3FC3A 4ZN1A 4N4IA 2RK1A 3G7ZA 2E41A 2ZZDA 4PJOE 2HQEA 5DY9A 4C8QD 4XTZA 1OZ3A 4C0GA 3I55T 4JRQA 4ATOA 3CCJA 3LWHA 2X4JA 5A2QE 3S3MA 2XD0A 1M5Q1 4ZN3A 1N8RC 1VQ4A 1D3BB 1OYXA 4F7UF 3PIPA 3L2WA 4M7DE 4FU6A 1VQ5T 4XTXA 4OGEA 5KH6A 2KK4A 5DLQE 5LJ5d 4M77E 4DA4A 3QBYA 2A3LA 4ZGDB 3JCMb 4DQ2A 1XTDA 3OYJA 4E47A 2PUOB 3ZFJA 2V8IA 4M75A 2FL7A 3PMIA 3G6EA 3CCUA 1YJWA 3BW1A 2M1HA 5IN1A 3GP8A 3DLMA 3CCQA 2ZPIB 4C92A 4KUDK 1G3WA 2LTOA 2QEXT 2ZPGB 3NFCA 2WSCE 4M7AG 3ZBDA 1QVGS 3P8HA 2E65A 2Y90A 4J83A 5M9OA 2L5QA 5IT9E 3LLRA 4FT2A 4Y28E 3RIRA 2JNGA 3CC2A 3NTIA 5GMKm 3M57A 5J39A 1B34A 3UWNA 3HPWA 2R5AA 4LD6A 2L8DA 3VJPA 2QXFA 2HAXA 1Y71A 3A8OB 5GAMh 2OTJT 4P5NA 4JRIA 4XK8E 3TCJA 3OS5A 5A0GA 4C0DC 1BIBA 4J6YA 3ER0A 4A4FA 5GANh 1D3BA 3L2ZA 4M75E 4M7AB 4BE0A 1LJOA 2MWPA 4CI0C 3OYAA 2DXUA 2RJEA 1LNXA 4LDWA 4J7FA 3X24B 3X25B 4MMLA 3FJPA 2FYKA 1VIEA 2DXCA 3JCMd 2BIVA 4ZTJA 2D9TA 3ZEHA 1NJIU 3JCMX 4M7DD 2XU8A 3C95A 3GPLA 5D6WA 2VYTA 3JSCA 1QVGA 2F69A 2DD5A 1EIFA 4DOVA 1KHIA 3MO8A 1XOVA 2LT1A 4M77D 1M1GA 5GAN4 2A7YA 4C0DB 1VQPA 2IG0A 2X4XA 4J7IA 2RJCA 3HRTA 4MZTA 3LGLA 5GANg 5LJ3h 4EPCA 2E12A 2RH2A 4LD9K 4JUVA 1YITT 2M0OA 3HSBA 5GAOr 2R58A 2P0KA 1VQNA 3RMQA 4OB3B 2FVUA 3S3NA 5C0MA 2JVVA 3ME9A 1H641 3T9NA 1Q82C 5KCOA 2K3XA 3VV0A 4KBMB 2RO0A 4PJOF 1NPPA 5CK9A 5HK0A 4HT9A 4M7AA 3OA6A 1M1KU 2CZ1B 4IUQA 3VYGA 2RHXA 5FRNA 2MF2A 4PNOA 1FWZA 2RI5A 5CKHA 3PNWC 5FLXE 1Y07A 5LJ3g 5GAMf 4FIBA 2AHJB 5GMKi 4A4EA 2GFUA 3EFRA 2XDDA 3CCJT 4M7DF 5GANf 4M75D 4V2SA 2K3YA 1X6OA 2V8JA 1VQ4T 1Q81U 1YJ9A 4EMKC 4M77F 3BDLA 3FEOA 1Y96A 3LW5E 4XU3A 1Q86C 1KQ1A 3CBMA 5KCHA 3SWNA 4OGCA 5HKCA 2XDPA 4C92G 3BFMA 1YI2A 3CCUT 3J7AF 3G6ET 5D6XA 5KE2A 1YJWT 2G3RA 4O6JA 4DOWA 4M7AE 2E70A 2C06A 3JCMP 4II1A 2CYZB 2VXFA 1N8RU 3URGA 1LOJA 4IUPA 1M1KC 4EMKB 4QQ6A 4RCBA 5GMKh 2JN0A 3CC2T 1G3SA 4MDXA 3PTAA 5GANe 4XQ3A 1QP3A 2XKOC 3PT9A 3CBPA 3QUIA 1O9SA 1KG1A 1K8AU 2E6ZA 1P92A 4FSXA 1BI3A 2PQWA 3OYEA 4M75F 5CQYA 1VQ9A 4RKUE 3OYGA 1OZ2A 3QHSA 4GY5A 4XU0A 3M4GA 3M53A 4PLLA 3X28B 2ZPBB 3MEWA 2EAYA 4QVDA 1NE8A 1WGSA 2CZ0B 3H8ZA 1VQLA 3OYKA 1YHQA 3OBYA 2EYQA 2XIDA 3E1SA 3RERA 2OAUA 1JB0E 1XQHA 3JB9G 5GAOq 3HKSA 3META 3CMEA 3QG1A 5LJ3e 2FHDA 4B9XA 5J3BA 1H3ZA 3CC4A 4J8OA 4C5IA 3OSVA 3UT1A 3QYHB 4BI4A 3CCQT 5DM7R 2VGNA 3WVDB 1DJ7B 2JUFA 4M78C 4M78G 3L2RA 3TREA 1VQPT 3OYCA 2RI3A 2LT4A 3LH0A 4EMKA 1QP2A 2DAQA 2ZPHB 3CCSA 1KD1C 3R6OA 4LDYA 2RHIA 3N5BB 4X34A 3V8JA 2CKKA 3JB9I 5LJ5j 4XU2A 3QZ5B 4NS5A 2PVGB 5I2SA 1VQ7A 1VQNT 2XHCA 4IUTA 1QW1A 3P8DA 4Z02A 2L3RA 4ELYC 2EJ9A 5GAN6 1PSEA 3C12A 3L42A 4HCCA 1K73C 4XTYA 4ZGJB 2WACA 4C8QC 2YRVA 4M78B 4C8QG 3QPHA 2RI2A 2EQMA 2E1HA 3TU4K 4E7LA 2DTIA 4XAXB 5GAMd 4TVRA 4XTVA 5HK3A 2LNVA 1WJSA 3C4SA 2RK2A 5FU6C 5CAIA 5GAOl 3QZ9B 4RG8A 1IREB 1M9SA 5GANd 3HFOA 4L59A 1W2BS 2DXTA 2Y4XA 3E19A 2EFIA 4C0ZA 1VQKA 2E64A 2DXBA 2LRQA 3WVEB 3L2UA 1M1FA 4GLKA 2VV5A 4QVZA 4FM4B 1YJ9T 4PJOD 1Q82U 2EQJA 2XICA 5CKEA 4L6V5 4C92E 3LGFA 3M55A 4PL6A 4X9DA 1V29B 3ASKA 4C8QB 3CD6A 1YI2T 2I2LA 2RJFA 4M7AF 3Q1JA 2RHZA 5GMKe 3MEUA 4UC4A 3V8LA 2JTFA 5FU6B 3M5AA 3FB9A 4C5HA 3BY7A 2XK0A 3HL8A 4NOYA 2RB6A 5LJ3d 1VQ8A 1WQWA 2MI6A 1WJQA 4WF2A 2K5FA 5LJ5g 3OYIA 3FDRA 1Y7XA 3M59A 5GAN8 2QQBA 5EG2A 3CCMA 1Q86U 2O01E 4M78A 5CIUA 2OTLA 2KMTA 4C0FA 1SSFA 2LQKA 2QTXA 1W2BA 2GCXA 3M56A 4N0AC 1BYMA 2DIGA 2K57A 3DB3A 4PLIA 4PJOC 3JRZA 4MZMA 3OBWA 5CKFA 1VQ9T 4RCCA 1RI0A 4QVCA 4R56A 3P8BB 4IUVA 3S6WA 3VYHB 2DZ9A 3CPFA 1VQLT 1KC8C 1YHQT 5AYFA 4A4HA 4FT4A 4M7DC 3MEAA 1VQOA 2RHUA 5CO7A 4C8QA 2XDBA 2DVEA 4OF1A 2DPPB 3CMET 4M77C 5GMKl 1BKBA 4BDZA 2EIFA 3OYDA 1KHCA 2PVOB 2YLBA 2DIQA 5GAN2 3CC4T 3QYGB 1KQ2A 4C92D 2VC8A 4M78E 4Q5WA 5CKDA 2ZCFB 3E9GA 1NZ9A 3RKYA 3VKIA 3CCRA 4BI8B 3CC7A 3KXTA 1JBMA 3A5ZB 3EAEA 3LYIA 3MEVA 4A4GA 3JCMg 5LL6S 4JRKA 3OY9A 3JCMQ 4QW2A 3I56A 2RM4A 3PMTA 5GAN7 3CCST 2RA2A 3MHXA 3QO3A 3G71A 4D6WA 2K5IA 2P4TA 1BIAA 3SB2A 1X75C 1HK9A 1VQ7T 4BD3A 1FX7A 4E7IA 2DJZA 3M4YA 4HKEA 1YBYA 4M77B 2X4YA 4KT0E 4NL2A 5LJ3f 4IKFA 2QI2A 4J5YA 2P0QA 3X20B 3M54A 5CR2A 1VQ6A 1AHJB 4CRIA 2WSFE 2DK3A 5LJ5e 4XTUA 1G5VA 2B8AA 2EJGA 4A4KA 3CBOA 3MP6A 2MAMA 2R5MA 2NLUA 4M75C 1KD1U 1S72A 2K2VA 3HRSA 5GAOp 1UEBA 1PSFA 2BKDN 4E7HA 1VQKT 2RD1A 2DD4A 3GF5A 4C92F 3LWIA 4C5EA 1IZ6A 3OYBA 1UGRB 3V7RA 2D6FA 2XG8D 2ZPEB 2CZ7B 3CMAA 2CS7A 1K73U 2GF7A 1N6AA 5CVIA 2X35A 3PIOA 3CD6T 3CPWS 1WPYA 2EQUA 1YJNA 4F7UG 4ME7A 3CEYA 4JDSA 1I81A 3UDCA 3HHTB 5GAOn 1Q7YC 1HXDA 3L2VA 3CXCS 3A8MB 5C6SA 1VQ8T 2X4WA 2VXEA 3DKMA 2KVQG 2QQSA 4NL3A 4MMKA 2K5LA 3F70A 4RMOA 1W4SA 3OS1A 3JCMW 1VQMA 1G3TA 1X01A 2ZGWA 2BUDA 3CCMT 3M9QA 1R8OB 4OB0B 3JCMe 2OTLT 2HNIA 4M7AD 4MZPA 3TEEA 4R55A 1B34B 2EQKA 4HT8A 2QQRA 5L8RE 2IVWA 1K9MC 3QJ6A 3WXMB 4F7UB 2ZPFB 2PU9B 1N27A 3NTKA 3GNFB 4B9WA 4J6WA 1U1TA 5D6YA 5DLOA 3JB9F 1UGSB 4JJNK 2DEQA 3G4SA 1JRIA 1I4K1 3JAME 3CPWA 2DKGA 3NTHA 2EJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3Y A;  3FDR A;  4BAC A;  3O8V A;  2LCC A;  4QQD A;  4OVA A;  3S3O A;  3LX7 A;  3BDL A;  3FEO A;  2RJD A;  5CIU A;  4E7J A;  3QII A;  1SSF A;  5KCH A;  2XDP A;  3OYM A;  2DIG A;  2R57 A;  3DB3 A;  4PLI A;  3FC3 A;  1OI1 A;  4N4I A;  3L2Q A;  3QKJ A;  5D6X A;  5KE2 A;  1RI0 A;  4BE1 A;  2G3R A;  2HQE A;  4IUV A;  3S6W A;  5J26 A;  4II1 A;  1OZ3 A;  4BDY A;  3DB4 A;  2EKO A;  2GFA A;  4HCZ A;  4IUP A;  4A4H A;  2E5Q A;  3S3M A;  5FRO A;  3MEA A;  4QQ6 A;  2RHU A;  1OYX A;  3L2W A;  4FU6 A;  2RHY A;  5KH6 A;  4RG2 A;  4BDZ A;  3OYD A;  1KHC A;  2DIQ A;  3QBY A;  3OYJ A;  4Q5W A;  3PFS A;  3E9G A;  2PQW A;  3OYE A;  2L89 A;  3MEV A;  1OZ2 A;  3EAE A;  3LYI A;  2M1H A;  3MP1 A;  3OMC A;  3PMI A;  4GY5 A;  5IN1 A;  3DLM A;  4A4G A;  3OS0 A;  3OY9 A;  4QW2 A;  4PLL A;  5FRM A;  2MWO A;  3MEW A;  2LTO A;  4E7K A;  3PMT A;  2O4X B;  1WGS A;  3KUF A;  3H8Z A;  3MP8 A;  3OYK A;  3P8H A;  5M9O A;  2LVM A;  3LLR A;  2F5K A;  4BD3 A;  4E7I A;  3NTI A;  2X4Y A;  3MET A;  2FHD A;  4B9X A;  3UWN A;  5J39 A;  2R5A A;  4LD6 A;  2L8D A;  1H3Z A;  3OQ5 A;  4CRI A;  4C5I A;  3UT1 A;  1G5V A;  2B8A A;  3L2R A;  3MP6 A;  2R5M A;  2NLU A;  3OYC A;  5IAY A;  2RI3 A;  4A4F A;  3LH0 A;  3OYL A;  2DAQ A;  4BE0 A;  3OYA A;  2MWP A;  2BKD N;  2RHI A;  4X34 A;  4E7H A;  1WJR A;  2RJE A;  2CKK A;  3OB9 A;  4IUU A;  4C5E A;  4NS5 A;  3OYB A;  3OYF A;  2BIV A;  5KE3 A;  4IUT A;  3P8D A;  4Z02 A;  4ZTJ A;  2L3R A;  2D9T A;  3ZEH A;  2LDM A;  2GF7 A;  1MHN A;  3L42 A;  5D6W A;  2VYT A;  2X35 A;  4N4H A;  2WAC A;  2EQU A;  2YRV A;  3MO8 A;  2O4X A;  3CEY A;  2RI2 A;  2IG0 A;  2EQM A;  2HQX A;  4E7L A;  2X4X A;  2RJC A;  3FLG A;  3LGL A;  3L2V A;  4IKF A;  1WJS A;  3C4S A;  4N4G A;  2JZ2 A;  5C6S A;  2X4W A;  3OYH A;  4L59 A;  2E6N A;  2QQS A;  3OS1 A;  2EFI A;  3F70 A;  2M0O A;  2LRQ A;  3OYG A;  3L2U A;  4QVZ A;  2R58 A;  2BUD A;  4BE2 A;  2P0K A;  3OMG A;  4EDU A;  3M9Q A;  3S3N A;  2EQJ A;  4FL6 A;  5C0M A;  3OS2 A;  4ZTF A;  2EQK A;  3ME9 A;  2QQR A;  3LGF A;  3E9F A;  4IUR A;  4PL6 A;  2K3X A;  3ASK A;  5KCO A;  3OYN A;  3QJ6 A;  2RO0 A;  3GOX A;  1N27 A;  2RJF A;  3Q1J A;  3OA6 A;  2RHZ A;  3NTK A;  4IUQ A;  3MEU A;  4QQG A;  2RHX A;  4UC4 A;  5FRN A;  3H6Z A;  4B9W A;  2JTF A;  2RI5 A;  3SD4 A;  5D6Y A;  3PNW C;  1XNI A;  4C5H A;  4C5G A;  2XK0 A;  4A4E A;  2GFU A;  2M16 A;  1WJQ A;  3OYI A;  3NTH A; 
#chains in the Genus database with same CATH topology
 2C0T A;  1VQO T;  1M90 C;  2QEX Q;  2J6O A;  3C94 A;  4CC4 B;  2DEU A;  1OUL A;  3CC7 T;  3I56 T;  4KUI A;  5CCA A;  1WQ7 A;  3JB9 J;  3G71 T;  2OAW A;  4BDY A;  3DB4 A;  2GFA A;  2E5Q A;  5FRO A;  2L0A A;  2DER A;  3FRN A;  2WSE E;  1JXO A;  3CCL A;  3CCE A;  3SWN C;  5LJ3 j;  3OW2 S;  5HY6 A;  5I11 A;  4LDX A;  3E2U A;  4OMN A;  5I2M A;  1G83 A;  2Y4Y A;  2NUZ A;  3RUX A;  2O4X B;  1QVF S;  1VUB A;  1C6V X;  1ZX6 A;  1GBQ A;  2O2O A;  4HVV A;  3VS5 A;  4OP0 A;  2LX9 A;  3L1A A;  1VQ5 A;  1MUZ A;  1YIT Q;  2OX7 A;  4ZNX A;  2KBT A;  4AG2 C;  4WCI A;  3VU3 C;  3QXE B;  4CC2 A;  4JS4 A;  3GLX A;  4EMH A;  1RI9 A;  1T3L A;  2LC4 A;  4PJO B;  3RKW A;  1WJR A;  2DO3 A;  2QAZ A;  4M7D B;  1UB4 A;  1RAE B;  1SG5 A;  3FIF A;  1NJI C;  1VQ4 Q;  4N4H A;  2JS2 A;  2O4X A;  1HJD A;  2JZ2 A;  3CCS Q;  4DBQ A;  2YT6 A;  3JB9 H;  2JS0 A;  2HL3 A;  4BE2 A;  2JXB A;  1K9M U;  1JJ2 A;  2HQH A;  2FRY A;  4N0A A;  5CKB A;  4PJO A;  3JCM V;  1ZA2 B;  2LJ3 A;  3EH2 A;  3H6Z A;  4OMQ A;  3A8H B;  5IXB A;  1T0H A;  2OI3 A;  2XI9 A;  1YFN A;  1K8A R;  2AZS A;  4M75 B;  3MCA B;  2M9U A;  3CCV T;  4M7D A;  1SF9 A;  1VQK Q;  3CPW P;  2DL4 A;  2AK5 A;  2YLC A;  2QQA A;  4JPB W;  1Q81 C;  2O31 A;  4YTL A;  3QJY A;  2F5T X;  2H3J A;  3OYM A;  3M0P A;  1U8R A;  4N4I A;  2XMF A;  1OX9 A;  5DY9 A;  4XTZ A;  2ROL A;  4C0G A;  4JRQ A;  2KT1 A;  4ATO A;  3CCJ A;  3LWH A;  3S3M A;  1YP5 A;  4GLM A;  2XD0 A;  1M5Q 1;  4ZN3 A;  1N8R C;  1VOM A;  4F7U F;  2FPF A;  2YUN A;  4CC7 A;  2ABL A;  2KK4 A;  3THK A;  1AEY A;  1WXU A;  4ZGD B;  3CCU A;  4M75 A;  1YJW A;  2HBW A;  3EG2 A;  2FG0 A;  4KUD K;  2EBP A;  3G1J A;  1IO6 A;  1S1N A;  2Y90 A;  3NGP A;  3LLR A;  4FT2 A;  4Y28 E;  4JJB A;  1XJW B;  5J39 A;  2R5A A;  1YCS B;  1I07 A;  2W10 A;  5GAM h;  1Q82 R;  4P5N A;  4JRI A;  2LNH B;  2B86 A;  1NYF A;  1JU5 C;  2HSP A;  5FWC A;  4IIM A;  3X25 B;  1LNX A;  3FJP A;  2FYK A;  1VIE A;  2BE9 B;  1WXB A;  1PKS A;  2D9T A;  2CP2 A;  5IHN A;  5D6W A;  1W6X A;  4M77 D;  2YUQ A;  2RQT A;  4MZT A;  2DNU A;  2E12 A;  3VS2 A;  4LD9 K;  1MMA A;  5GAO r;  1X69 A;  4OB3 B;  1H64 1;  5KCO A;  2K3X A;  4KGX B;  3VV0 A;  3I9Q A;  4HT9 A;  1M1K U;  2CZ1 B;  1FWZ A;  1ARK A;  4FIB A;  5GMK i;  3EHR A;  4J9F A;  5GAN f;  1X6O A;  1VYV A;  2RN8 A;  3LW5 E;  5KCH A;  1VQ7 Q;  1H3H A;  4OGC A;  2XDP A;  3BFM A;  3G6E T;  5D6X A;  2KYB A;  2G3R A;  1FMK A;  1WIE A;  4O6J A;  4DOW A;  3PVL A;  3G4S Q;  2CT3 A;  4IUP A;  1M1K C;  1E6H A;  4RCB A;  4JZ4 A;  2M51 A;  1KG1 A;  1AWJ A;  1VQ9 A;  1OZ2 A;  1K73 R;  2J06 A;  2L3S A;  2RNA A;  7AT1 B;  1NE8 A;  1WGS A;  3H8Z A;  1VQL A;  2EYQ A;  1XQH A;  4CC3 A;  4OMP A;  2KE9 A;  3HKS A;  3QG1 A;  3CC4 A;  3OSV A;  3UT1 A;  3CCQ T;  5DM7 R;  2KYM A;  1JEG A;  2NUT B;  1CKB A;  2ZPH B;  2KI7 A;  1KD1 C;  4LDY A;  2RHI A;  1OQK A;  2LCS A;  4NS5 A;  4PJM A;  1QW1 A;  3P8D A;  3RDV A;  3LH5 A;  2CUD A;  1VQO Q;  4HCC A;  1WHK A;  1RAC B;  2YRV A;  4M78 B;  4C8Q G;  1M2V B;  1QVG P;  4E7L A;  5GAM d;  4PJL A;  3C4S A;  5GAO l;  1M9S A;  4L59 A;  3E19 A;  2Y4X A;  1GL5 A;  2E64 A;  3I56 Q;  1YJ9 T;  2AZV A;  4PJO D;  3LGF A;  3M55 A;  4X9D A;  2NUT A;  3CD6 A;  2AKL A;  2DFU A;  2RHZ A;  2X51 A;  5FU6 B;  3M5A A;  2X3W D;  1WJQ A;  4WF2 A;  5LJ5 g;  1MV3 A;  3M59 A;  5GAN 8;  2EW3 A;  2FRW A;  4M78 A;  1M2V A;  1WDX A;  1V1C A;  2LQK A;  2GCX A;  1BYM A;  4PLI A;  2K57 A;  1NM7 A;  1ZSG A;  4RCC A;  4R56 A;  4IUV A;  3S6W A;  3EGD B;  4FT4 A;  2DVE A;  2YXY A;  2DPP B;  1GRI A;  2EIF A;  1KQ2 A;  5GAN 2;  2YLB A;  1WHL A;  4Q5W A;  4JJD A;  4X1V A;  3RKY A;  3CCR A;  4BI8 B;  4A4G A;  3PVQ A;  5LL6 S;  3OY9 A;  2RM4 A;  2F2V A;  3PMT A;  3CCS T;  2D1X A;  1BIA A;  2GTO A;  3M4Y A;  3NMZ C;  3NPF A;  4B6M A;  4J5Y A;  3M54 A;  5LJ5 e;  5D7U A;  4A4K A;  2EJG A;  3CBO A;  3MP6 A;  3EGD A;  2KXC A;  2NLU A;  1K9M R;  2AIR B;  4E7H A;  1VQK T;  2RD1 A;  2DD4 A;  2KT8 A;  3ULR B;  1UGR B;  2D6F A;  3CC2 Q;  1QWE A;  2CS7 A;  2YDL A;  5CVI A;  2X35 A;  3PIO A;  2P4R A;  5KYX B;  1Q7Y C;  1WA7 A;  5C6S A;  2X4W A;  3VS4 A;  2A36 A;  2ZGW A;  2BUD A;  4PFZ A;  4OB0 B;  2OTL T;  2HNI A;  2K6D A;  2EQK A;  3QJ6 A;  3NTK A;  3GNF B;  1GFC A;  4B9W A;  4J6W A;  1UEC A;  3VS3 A;  1JRI A;  2F2W A;  2EYZ A;  3NTH A;  2EJF A;  1UGP B;  2X3X D;  2DMO A;  2EYX A;  3CXC A;  1QVP A;  3QII A;  5GAM j;  5KYX A;  3TQ7 P;  1N9R A;  2JTM A;  3A8G B;  3PGG A;  1W2B P;  3HRU A;  1M30 A;  4MDW A;  4J9C A;  1KC8 U;  4XU1 A;  1T3S A;  3INZ A;  2NUP B;  2QA4 A;  3EFS A;  2LQ8 A;  4HCZ A;  3VUZ A;  4C8Q F;  1YIJ A;  1AT1 B;  1Q95 G;  1BI2 A;  4AFQ C;  4HVU A;  4HXJ A;  1YI2 Q;  4BI3 A;  3PFS A;  4L5G A;  1TTH B;  2L89 A;  1IXD A;  3VS0 A;  5FRM A;  2CZ6 B;  1WI7 A;  2MWO A;  2V8K A;  3I55 A;  3OYY A;  1U1S A;  1B7T A;  1RAG B;  2M0Y A;  4PKC C;  5IHK A;  3CMA T;  1Y96 B;  2FEI A;  2A28 A;  3KBG A;  1ZHI A;  2LCL A;  1GCQ C;  3SWN B;  3OQ5 A;  5LJ5 f;  3GBQ A;  4BY6 C;  1AVZ C;  1UGQ B;  2NUP A;  2JOY A;  5A0L A;  2QEX A;  3A98 A;  2KQW A;  3OW2 A;  1M1K R;  1ABO A;  3OYF A;  3BDU A;  4LN2 A;  3RES A;  4OB2 B;  1MHN A;  1QVF A;  3HFN A;  4JZ3 A;  1T0J A;  3A8L B;  1M27 C;  1M8M A;  1FXX A;  2VWF A;  4EMG A;  4C8Q E;  3FLG A;  1UE9 A;  3G4S T;  2HBP A;  1X27 A;  2E6N A;  2COW A;  2QQ9 A;  1O75 A;  2K4Y A;  3M58 A;  4A54 A;  3VS1 A;  3OS2 A;  4IUR A;  4JLG A;  2GQV A;  4KRT A;  3OYN A;  2KSS A;  1QQJ A;  2RQU A;  5A0D A;  4ZGE B;  3QWY A;  5GAO m;  3M0T A;  2CSI A;  3GIB A;  4M78 D;  1M8V A;  1M90 U;  1YIT A;  3SFM A;  2K9G A;  2LCC A;  4QQD A;  2NWM A;  4M77 A;  2CP3 A;  2RJD A;  1GXI E;  2FB7 A;  1QKW A;  1UJ0 A;  3OSS C;  3FC3 A;  2HCK A;  4RTU A;  3O5Z A;  4F16 A;  2CP7 A;  2E41 A;  2ZZD A;  4PJO E;  2HQE A;  4LNP A;  1OZ3 A;  2RQV A;  5A2Q E;  1VQ4 A;  3L2W A;  4M7D E;  2K3B A;  4FU6 A;  2D8H A;  4KH0 B;  4OGE A;  3R6N A;  4IIO A;  3JCM b;  2A3L A;  3OYJ A;  3UA6 A;  4E47 A;  2ZPG B;  5IT9 E;  4LUE A;  2JNG A;  3NTI A;  3M57 A;  3HPW A;  1AWX A;  2FPD A;  1YJ9 Q;  1V76 A;  2HAX A;  3A8O B;  5KYY B;  2OTJ T;  4XK8 E;  5A0G A;  4C0D C;  5GAN h;  1W1F A;  4M75 E;  2LP5 A;  4M7A B;  2DJQ A;  2RJE A;  2GQI A;  2OJ2 A;  2PNI A;  1NJI U;  1D0Y A;  1PHT A;  2XU8 A;  3C95 A;  1KIK A;  3JSC A;  3NHN A;  3PIP A;  1KHI A;  1GFD A;  1VQP A;  2IG0 A;  1K9A A;  2RJC A;  5GAN g;  2KRN A;  4EPC A;  3HSB A;  1G8X A;  1VQN A;  3RMQ A;  2ED0 A;  1UUE A;  5C0M A;  5KYY A;  2JVV A;  3ME9 A;  1JJ2 P;  3SHW A;  4KBM B;  1PD0 A;  4M7A A;  2V26 A;  4IUQ A;  3VYG A;  3ZL7 C;  3EGU A;  5CKH A;  2EYW A;  2AHJ B;  1HYO A;  1HD3 A;  2V8J A;  1VQM Q;  1Q81 U;  4EMK C;  2ECZ A;  3FEO A;  4XU3 A;  1Q86 C;  3UAT A;  1GCP A;  2CP0 A;  2GTJ A;  2EQI A;  2AKK A;  2GBQ A;  4RTX A;  5IH2 A;  3H0F A;  4II1 A;  2VXF A;  1N8R U;  3URG A;  1LOJ A;  2JN0 A;  3CC2 T;  1OU8 A;  4MDX A;  2JMA A;  2MK5 A;  2DBM A;  5GAN e;  3PTA A;  3QUI A;  1O9S A;  2CT4 A;  1YWO A;  2QK0 A;  4KH1 B;  2E6Z A;  4RTV A;  1A0N B;  4FSX A;  5CQY A;  3OYG A;  1PCX A;  4XU0 A;  3M4G A;  4JJC A;  3MEW A;  5GJV B;  3OBY A;  3RER A;  2HZY A;  5J3B A;  3UF4 A;  3CCL Q;  4BI4 A;  2VGN A;  2OTL Q;  1IGQ A;  3TRE A;  2RI3 A;  2LT4 A;  2EKH A;  2RQR A;  3LH0 A;  2DBK A;  4X34 A;  2HSE B;  3JB9 I;  3UA7 A;  1VQ7 A;  2EGA A;  2PVG B;  1RAB B;  4Z02 A;  1EFN A;  2EJ9 A;  4J9B A;  3L42 A;  5FWB A;  4C8Q C;  3QPH A;  2RI2 A;  2EQM A;  4XAX B;  3MPU B;  4XTV A;  4IKF A;  1WJS A;  2RK2 A;  2E4H A;  5GAN d;  4LE9 A;  4C0Z A;  3D7S B;  4QVZ A;  4GLK A;  2VV5 A;  1KC8 R;  5CKE A;  4L6V 5;  4C92 E;  1V29 B;  2FZG B;  1YI2 T;  2KNB B;  3Q1J A;  4UC4 A;  3V8L A;  2JTF A;  2KRS A;  1NLP C;  2YUP A;  1VQ8 A;  1LPL A;  2MI6 A;  2K5F A;  2QQB A;  5EG2 A;  3CCM A;  1SSF A;  4N0A C;  3CMA Q;  4PJO C;  5CKF A;  4DEY A;  4QVC A;  1PD1 A;  3VYH B;  1C0M A;  2DZ9 A;  1YHQ T;  1M3C A;  4A4H A;  1U3O A;  4M7D C;  1KK7 A;  2LZ6 B;  1VQO A;  2DE0 X;  3CME T;  2CP6 A;  1KHC A;  1SRM A;  3MJX A;  2VC8 A;  1WYX A;  4M78 E;  2DYI A;  3CC7 A;  4J9G A;  3KXT A;  3A5Z B;  3JCM g;  2QDL A;  4JRK A;  3I56 A;  3QWX X;  2RA2 A;  2SEM A;  3MHX A;  3QO3 A;  3G71 A;  2LJ1 A;  3CCJ Q;  1X75 C;  4E7I A;  1YBY A;  2JW4 A;  1AHJ B;  4CRI A;  2WSF E;  4FCY A;  2SRC A;  4XTU A;  1UJY A;  2CSQ A;  3CCU Q;  1YJW Q;  4M75 C;  1KD1 U;  3M0Q A;  1PSF A;  3LWI A;  2V1R A;  4C5E A;  4E6R A;  3JV3 A;  2XG8 D;  4HCK A;  1MMD A;  1M90 R;  3CPW S;  2EQU A;  2DYB A;  4ME7 A;  3CEY A;  1TU0 B;  3VS6 A;  2KVQ G;  3OS1 A;  4MMK A;  4RMO A;  1G3T A;  1Z9Z A;  4OMO A;  4AT1 B;  3M9Q A;  3JCM e;  4M7A D;  3TEE A;  1B34 B;  4FYV B;  2QQR A;  1RLQ C;  2IVW A;  3WXM B;  4F7U B;  2PU9 B;  2E3H A;  4ORZ A;  1SSH A;  1UGS B;  1E7O A;  4JJN K;  3JAM E;  2X9H A;  2BZ8 A;  4RTT A;  4BAC A;  4HA8 A;  3S3O A;  3LX7 A;  4LDV A;  5FU7 C;  5LJ5 h;  1NG2 A;  4LDU A;  2P84 A;  1MGQ A;  5GAN j;  3L2Q A;  3QKJ A;  1IHV A;  1G3Y A;  5J26 A;  2RF0 A;  2DET A;  1I1J A;  3CCV A;  2RQW A;  2OTJ Q;  2EKO A;  2EPD A;  2L3P A;  4F7U A;  3RBB B;  4BB7 A;  2J7I A;  1LVK A;  2PUK B;  2RHY A;  4RG2 A;  4ELZ C;  1VQ6 T;  2VGM A;  1TWB A;  2DTH A;  1SEM A;  3MP1 A;  3BE3 A;  1NJI R;  3OS0 A;  1S72 T;  4E7K A;  1ZBX A;  4PJO G;  1KQS S;  3KUF A;  2W0Z A;  2LVM A;  3QDR B;  4F04 B;  5GAN 3;  4M7D G;  1SHF A;  2RPN A;  1PWT A;  3SDZ A;  1YJN T;  3JCM c;  2HMA A;  2MCN A;  1VQ9 Q;  1R77 A;  4HCB A;  3AHU A;  2RMO A;  2COZ A;  2KAF A;  4FSS A;  1YCY A;  5I21 A;  3OB9 A;  8ATC B;  1VQM T;  1ABQ A;  3H41 A;  4RTW A;  2LDM A;  4AG1 C;  4KUL A;  4BY6 B;  3CC4 Q;  1AWO A;  1Q81 R;  1Q7Y U;  4XTW A;  2DTO A;  2AT1 B;  5GJW B;  1WHH A;  4N4G A;  2GNC A;  1BI1 A;  2Z0W A;  2CH4 A;  2HD0 A;  4M75 G;  1IB8 A;  2IPO B;  2EGE A;  4EDU A;  4C92 C;  1WXT A;  1JQQ A;  3C0C A;  3JCM f;  4FL6 A;  1FMV A;  2J05 A;  1NPR A;  3E9F A;  1N8R R;  2PVD B;  1RUW A;  2CGH A;  3JB9 D;  2BTT A;  2MIO A;  4QKU A;  4O5V A;  3SD4 A;  1RAH B;  2COY A;  2HEQ A;  1TG0 A;  2QAS A;  4C5G A;  2M16 A;  3RKX A;  1GCQ A;  1RL2 A;  2C0O A;  3EGX B;  3O8V A;  4JLI A;  4X9C A;  4JS5 A;  1K0X A;  3CXC P;  3JCM J;  3CCL T;  3CCE T;  4BUG A;  4OMF B;  4ZN1 A;  1WHJ A;  2RK1 A;  4PJN A;  2K2M A;  2EGC A;  4OMM A;  1VQ5 T;  1WX6 A;  2QG9 B;  2DIL A;  3HTR A;  5LJ5 d;  4M77 E;  4DA4 A;  4DQ2 A;  1XTD A;  2J6K A;  1N5Z A;  3ZFJ A;  2V8I A;  4J9I A;  2FL7 A;  3PMI A;  3G6E A;  1K8A C;  1I5L A;  3GP8 A;  3EGX A;  2KEA A;  2ZPI B;  2O88 A;  3ZBD A;  1QVG S;  2E65 A;  5M9O A;  4J83 A;  4E2F B;  2YSQ A;  2L8D A;  4LD6 A;  3VJP A;  2BZY A;  1Y71 A;  2K79 A;  1H8K A;  1BIB A;  3L2Z A;  9ATC B;  3EG3 A;  4BE0 A;  2MWP A;  1IHW A;  1MMN A;  2DXU A;  1EX4 A;  3X24 B;  3OW2 P;  2DXC A;  2BIV A;  1E6G A;  4ZTJ A;  3ZEH A;  1SRL A;  3GPL A;  2VYT A;  2KRM A;  1ZSZ C;  2DD5 A;  1QVF P;  3CCQ A;  3MO8 A;  1XOV A;  4C0D B;  1YNZ A;  4J7I A;  3HRT A;  3LGL A;  4PJJ A;  2A0F B;  2RH2 A;  1X43 A;  3A1P A;  4JUV A;  3KFV A;  2M0O A;  2R58 A;  3S3N A;  1X6B A;  2FVU A;  1YHQ Q;  4RUG A;  1Q82 C;  4PJO F;  5CK9 A;  1RAF B;  3CME Q;  5FRN A;  2MF2 A;  4PNO A;  2RI5 A;  5FLX E;  1Y07 A;  4A4E A;  2GFU A;  3EFR A;  4M7D F;  3CCJ T;  2K3Y A;  3EHQ A;  2BE7 D;  1YJ9 A;  1K1Z A;  1ZLM A;  3BDL A;  2VAS A;  1Y96 A;  3M0U A;  1RAA B;  3SWN A;  1U06 A;  5HKC A;  4C92 G;  4LXC A;  1AZG B;  3CCU T;  3J7A F;  1Z9Q A;  5KE2 A;  1YJW T;  4M7A E;  2C06 A;  3JCM P;  1K0S A;  2CYZ B;  4EMK B;  1WHG A;  5GMK h;  4KGZ B;  1KD1 R;  1G3S A;  4EIK A;  4XQ3 A;  1QP3 A;  3PT9 A;  4M4Z A;  1MND A;  2GGR A;  1VYU A;  1I0C A;  2PQW A;  2IIM A;  3OYE A;  4M75 F;  2O9S A;  1I5O B;  1MNE A;  3M53 A;  2ZPB B;  4QVD A;  1TUC A;  2XID A;  2OAU A;  1JB0 E;  4AMC A;  1YIJ Q;  5GAO q;  3EH1 A;  1B07 A;  2FHD A;  4B9X A;  2PTK A;  4D8D A;  1ZBJ A;  1X2K A;  1DJ7 B;  2JUF A;  4M78 G;  3OYC A;  2DRM A;  1J3T A;  4EMK A;  1QP2 A;  2FZC B;  2DAQ A;  3CCS A;  3R6O A;  2ENM A;  3N5B B;  5LJ5 j;  4XU2 A;  3QZ5 B;  2F2X A;  2XHC A;  2L3R A;  4ELY C;  1BB9 A;  5GAN 6;  2YUO A;  3C12 A;  1OOT A;  1K73 C;  3AT1 B;  4ZGJ B;  2WAC A;  1UG1 A;  2O9V A;  1BCM A;  2E1H A;  1Y0M A;  3TU4 K;  2H8H A;  2DTI A;  2LNV A;  5CAI A;  3QZ9 B;  4RG8 A;  4RTY A;  1W2B S;  1FYN A;  2DXT A;  2ESW A;  1VQK A;  2DXB A;  2LRQ A;  4J9H A;  3WVE B;  1M1F A;  3FJ5 A;  4FM4 B;  3RR6 A;  4PL6 A;  4C8Q B;  1OX8 A;  2JTE A;  2I2L A;  3EG0 A;  5GMK e;  1VQ6 Q;  1M2O A;  4C5H A;  3HL8 A;  4NOY A;  3M0S A;  1WQW A;  3OYI A;  1R0C B;  4A63 B;  1BU1 A;  1S72 Q;  1Q86 U;  2O01 E;  4DBF A;  2MYS A;  5CIU A;  2KMT A;  2OTL A;  2F1L A;  2QTX A;  3TSZ A;  3TSW A;  2DIG A;  4F14 A;  1VQ9 T;  3OBW A;  1JXM A;  1RI0 A;  2LX7 A;  4K11 A;  2HKQ B;  1YJN Q;  4AFS C;  3CPF A;  1VQL T;  5CO7 A;  4C8Q A;  2XDB A;  1D1C A;  4OF1 A;  1ZA1 B;  4M77 C;  5GMK l;  1BKB A;  2YRC A;  4BDZ A;  3CC4 T;  1QCO A;  1W70 A;  1QCF A;  5CKD A;  2ZCF B;  3VKI A;  1NZ9 A;  3MEV A;  3LYI A;  3EAE A;  3JCM Q;  1NLO C;  4QW2 A;  5GAN 7;  4D6W A;  2P4T A;  3SB2 A;  1HK9 A;  1Q7Y R;  3I5R A;  2DX1 A;  1FX7 A;  2DJZ A;  4HKE A;  2L2P A;  1X6G A;  4NL2 A;  3X20 B;  2DK3 A;  1M3A A;  2ED1 A;  2B8A A;  1G2B A;  2R5M A;  2D8J A;  2K2V A;  5GAO p;  1UEB A;  1M3B A;  4HVW A;  1QMC A;  4C92 F;  3V7R A;  2I0N A;  2ZPE B;  3CMA A;  4WTO B;  3VRZ A;  1N6A A;  8AT1 B;  3CD6 T;  1WPY A;  4JDS A;  1FMW A;  1HXD A;  4KGV B;  3L2V A;  3A8M B;  3CCE Q;  2BZX A;  3DKM A;  2QQS A;  3JCM W;  2K5L A;  1K4U S;  1NEB A;  1X01 A;  3EG9 B;  1QLY A;  4MZP A;  1NBE B;  4R55 A;  4Z88 A;  2DA9 A;  5L8R E;  2DL8 A;  1K9M C;  2ZPF B;  1N27 A;  1VQ5 Q;  1VQP Q;  1U1T A;  5DLO A;  3G4S A;  1I4K 1;  3H0I A;  3CPW A;  2DKG A;  4FYW B;  2FO0 A;  1AWW A;  1VQN Q;  4F17 A;  4M78 F;  5IXF A;  4E7J A;  2MMP A;  2D0Q B;  2DL7 A;  3UPU A;  3CCR T;  1OI1 A;  1MV0 B;  1WZO A;  4JRP A;  4M7A C;  3I35 A;  4OB1 B;  3HP9 A;  4BE1 A;  4D8K A;  1PRM C;  1VA7 A;  2YHT A;  3RMS A;  3EG9 A;  2M02 A;  2VVK A;  4E7S A;  3V7S A;  2E10 A;  5FU7 B;  5AT1 B;  4DEX A;  1TUG B;  1N9S A;  4J9D A;  1VIF A;  5KYU B;  3V7C A;  5GAN 5;  3VUB A;  1UTI A;  2DVJ A;  3OMC A;  3OYL A;  3V8K A;  1C1A A;  3J80 E;  1ZQ1 A;  3MP8 A;  1WNL A;  3JCM h;  2F5K A;  1M4Z A;  1KQS P;  4Z89 A;  5GAM g;  1KFZ A;  1U5S A;  4DBR A;  4F7U E;  2KDS A;  2KY9 A;  3VRY A;  3GNG A;  1UDL A;  2DM1 A;  3I5S A;  4M77 G;  1D0X A;  1X2Q A;  5IAY A;  1BI0 A;  3J81 E;  4RTZ A;  1JJ2 S;  1YN8 A;  1D09 B;  1IRX A;  4IUU A;  1PC0 A;  5KE3 A;  5KYU A;  2HKN A;  2DZC A;  1KQS A;  2QDY B;  1Y57 A;  2EVR A;  1TH7 A;  2OTJ A;  2HQX A;  2A08 A;  5GMK j;  3OYH A;  4J6X A;  1H92 A;  3U23 A;  1MMG A;  3OMG A;  4VUB A;  2ZAE A;  1CSK A;  3DLL A;  4ZTF A;  1NYG A;  2EWN A;  2LMJ A;  2P0P A;  3GOX A;  4Y91 A;  1AD5 A;  2FZK B;  4QQG A;  2MPX C;  5CQX A;  2VUB A;  3H9N A;  1XNI A;  5GAM e;  1QWF A;  4A53 A;  2QA4 T;  2YWW A;  2KR3 A;  4C92 B;  1YIJ T;  1I8F A;  4OVA A;  3X26 B;  1UHC A;  1SPK A;  1VYT A;  3QSU A;  1SKU B;  2R57 A;  4R0K A;  2JM9 A;  3G7Z A;  2H3E B;  2MOX A;  2K7A A;  4C8Q D;  1VQ8 Q;  3I55 T;  2ATC B;  2X4J A;  1K76 A;  1KJW A;  3CCM Q;  1D3B B;  1OYX A;  5KYW B;  2QGF B;  2A37 A;  1UGV A;  4XTX A;  1ACM B;  2JMC A;  5KH6 A;  5DLQ E;  4FYX B;  3QBY A;  2PUO B;  2V1Q A;  3BW1 A;  2M1H A;  2D0N A;  5IN1 A;  3DLM A;  4C92 A;  4LUD A;  1G3W A;  2LTO A;  2QEX T;  1ZUK A;  3NFC A;  2WSC E;  4PFP A;  3VS7 A;  4M7A G;  2LJ0 A;  3P8H A;  2VKN A;  2L5Q A;  2PZ1 A;  1OPK A;  3RIR A;  5HCK A;  2L3Q A;  3CC2 A;  1QCN A;  5GMK m;  2QGG A;  1B34 A;  1ZUY A;  3UWN A;  2HL5 C;  2FPE A;  4DBH A;  1UFF A;  2QXF A;  4QT7 A;  5IHI A;  3CC7 Q;  4AFZ C;  3TCJ A;  5ECA A;  3OS5 A;  1WFW A;  4A4F A;  4J6Y A;  3ER0 A;  1D3B A;  5KYW A;  1OEB A;  1LJO A;  2CDT A;  4CI0 C;  3OYA A;  3G71 Q;  4E7Z A;  4LDW A;  4J7F A;  3IQL A;  4MML A;  3JCM d;  1UHF A;  3JCM X;  4M7D D;  1PG5 B;  2C0I A;  2VB6 A;  1QVG A;  2F69 A;  1F1B B;  1EIF A;  4DOV A;  2LT1 A;  1Q86 R;  1M1G A;  5GAN 4;  2A7Y A;  2CUB A;  2X4X A;  5LJ3 h;  1EZZ B;  2CRE A;  1YIT T;  1GBR A;  3REA B;  2P0K A;  2JT4 A;  1VQL Q;  3T9N A;  1ZSZ B;  1TXQ A;  2RO0 A;  1NPP A;  5HK0 A;  3OA6 A;  2RHX A;  3PNW C;  5LJ3 g;  1WLP B;  5GAM f;  2XDD A;  1OPL A;  4M75 D;  4V2S A;  4Y92 A;  1VQ4 T;  4M77 F;  1HSQ A;  1KQ1 A;  3CBM A;  1YI2 A;  1IGU A;  2EYY A;  4AFU C;  2E70 A;  1ZSZ A;  4QQ6 A;  1TS9 A;  2XKO C;  3CBP A;  2DL3 A;  1K8A U;  1P92 A;  1BI3 A;  5L23 A;  1AOJ A;  5EC7 A;  4RKU E;  3QHS A;  1ZUU A;  4GY5 A;  2LQW A;  3CD6 Q;  4PLL A;  3X28 B;  2EAY A;  2CZ0 B;  1OU9 A;  4PK4 A;  3CCV Q;  3OYK A;  1YHQ A;  3E1S A;  3JB9 G;  1PKT A;  3MET A;  3CME A;  5LJ3 e;  3M0R A;  1TUD A;  1H3Z A;  4J8O A;  3REB B;  4C5I A;  3QYH B;  1D1A A;  1PNJ A;  3WVD B;  1VQP T;  4M78 C;  1NEG A;  3L2R A;  3V8J A;  2CKK A;  5I2S A;  1VQN T;  4IUT A;  1PSE A;  2KGT A;  4XTY A;  1TSF A;  1OV3 A;  4FW1 A;  4TVR A;  5HK3 A;  5FU6 C;  1IRE B;  1BK2 A;  3CCR Q;  3HFO A;  2EFI A;  5I22 A;  3L2U A;  1Q82 U;  2EQJ A;  2XIC A;  1AZE A;  4PFO A;  3ASK A;  4Z8A A;  2RJF A;  2NYS A;  4M7A F;  2DF6 A;  3MEU A;  1RAI B;  3CQT A;  2JJ9 A;  3FB9 A;  3BY7 A;  2XK0 A;  2RB6 A;  2DL5 A;  2QTV A;  1WHM A;  5LJ3 d;  1PM3 A;  1RAD B;  3FDR A;  3QDF A;  1Y7X A;  5FW9 A;  4J9E A;  4C0F A;  2YRD A;  1W2B A;  3RNJ A;  3M56 A;  2KRO A;  3DB3 A;  3H0H A;  3JRZ A;  4MZM A;  4ANJ A;  2JM8 A;  1RLP C;  3P8B B;  1BCO A;  3SEM A;  1CKA A;  2LQN A;  3EFO B;  1B3Q A;  4GBQ A;  2ROT A;  1KC8 C;  5AYF A;  3MEA A;  2RHU A;  4FYY B;  1YWP A;  2DRK A;  1R0B G;  3OYD A;  2PVO B;  2DIQ A;  3PE0 A;  3QYG B;  2G6F X;  4C92 D;  3E9G A;  1JBM A;  2J6F A;  2HDA A;  2K5I A;  1VQ7 T;  4BD3 A;  2CH4 W;  4M77 B;  2X4Y A;  4KT0 E;  5LJ3 f;  2QI2 A;  1SHG A;  2P0Q A;  5CR2 A;  1VQ6 A;  1D1B A;  2E5K A;  3EFO A;  1G5V A;  3G6E Q;  1PRL C;  2MAM A;  1S72 A;  3HRS A;  2BKD N;  4ESR A;  1LCK A;  5KYN A;  3GF5 A;  1IZ6 A;  3OYB A;  2CZ7 B;  1K73 U;  2QA4 Q;  2GF7 A;  3MKD A;  2E3I A;  1YJN A;  4F7U G;  1KSW A;  1D0Z A;  4FW2 A;  1TOV A;  1I81 A;  3UDC A;  3HHT B;  5GAO n;  3CXC S;  1VQ8 T;  2VXE A;  4NL3 A;  3F70 A;  1W4S A;  3TVT A;  1VQM A;  3CCM T;  2KXD A;  2CP5 A;  2QYZ A;  1R8O B;  1BBZ A;  3I55 Q;  4HT8 A;  2DLP A;  3CCQ Q;  6AT1 B;  3EG1 A;  4OML A;  5D6Y A;  3JB9 F;  2DEQ A;  1JO8 A;  1QKX A; 
#chains in the Genus database with same CATH homology
 1UGP B;  4BAC A;  1VQO T;  4HA8 A;  1M90 C;  3S3O A;  3LX7 A;  4LDV A;  4M78 F;  3CXC A;  4E7J A;  5FU7 C;  1QVP A;  5LJ5 h;  3C94 A;  3QII A;  2MMP A;  5GAM j;  4LDU A;  2D0Q B;  1N9R A;  2JTM A;  3A8G B;  3PGG A;  5GAN j;  1MGQ A;  3UPU A;  3HRU A;  1OI1 A;  3CCR T;  3L2Q A;  3QKJ A;  3CC7 T;  4JRP A;  4M7A C;  4MDW A;  3HP9 A;  4OB1 B;  4BE1 A;  3I56 T;  4KUI A;  2YHT A;  1WQ7 A;  1G3Y A;  5J26 A;  4XU1 A;  3RMS A;  5CCA A;  3JB9 J;  1KC8 U;  3INZ A;  3G71 T;  4BDY A;  3DB4 A;  3CCV A;  3EFS A;  2QA4 A;  2EKO A;  2GFA A;  2LQ8 A;  4HCZ A;  2E5Q A;  5FRO A;  3VUZ A;  4C8Q F;  3V7S A;  1YIJ A;  4F7U A;  1BI2 A;  2E10 A;  5FU7 B;  4BB7 A;  2PUK B;  1N9S A;  3FRN A;  2RHY A;  2WSE E;  4RG2 A;  4ELZ C;  1VQ6 T;  2VGM A;  1VIF A;  3CCL A;  3CCE A;  3SWN C;  3V7C A;  4BI3 A;  3PFS A;  5LJ3 j;  5GAN 5;  3VUB A;  3OW2 S;  4L5G A;  5HY6 A;  2DTH A;  4LDX A;  2L89 A;  5I2M A;  3OMC A;  3OYL A;  3MP1 A;  2Y4Y A;  3OS0 A;  5FRM A;  3RUX A;  2CZ6 B;  3V8K A;  1S72 T;  2MWO A;  2V8K A;  3J80 E;  4E7K A;  1ZQ1 A;  1ZBX A;  2O4X B;  4PJO G;  1I5L A;  3I55 A;  1KQS S;  3KUF A;  1VUB A;  1QVF S;  3OYY A;  1U1S A;  3MP8 A;  1WNL A;  3JCM h;  2LVM A;  2F5K A;  1M4Z A;  4OP0 A;  4PKC C;  3QDR B;  3CMA T;  5GAN 3;  2LX9 A;  3L1A A;  1Y96 B;  5GAM g;  1VQ5 A;  3KBG A;  1ZHI A;  2LCL A;  4M7D G;  4F7U E;  3SWN B;  2KDS A;  2KY9 A;  3OQ5 A;  3VU3 C;  3QXE B;  3SDZ A;  5LJ5 f;  1YJN T;  4BY6 C;  3GNG A;  4JS4 A;  3JCM c;  3GLX A;  4EMH A;  1UGQ B;  4M77 G;  4HCB A;  5IAY A;  1BI0 A;  3J81 E;  3AHU A;  2LC4 A;  4PJO B;  1JJ2 S;  2JOY A;  2KAF A;  3RKW A;  5A0L A;  2QEX A;  1YCY A;  1WJR A;  2KQW A;  2DO3 A;  3OB9 A;  4IUU A;  5I21 A;  3OW2 A;  1VQM T;  3OYF A;  5KE3 A;  3BDU A;  4M7D B;  2LDM A;  3RES A;  4OB2 B;  1MHN A;  1UB4 A;  2DZC A;  4KUL A;  1KQS A;  3FIF A;  1NJI C;  4BY6 B;  1QVF A;  4N4H A;  3HFN A;  2QDY B;  3A8L B;  1TH7 A;  2O4X A;  4XTW A;  1FXX A;  1Q7Y U;  2DTO A;  2OTJ A;  4EMG A;  2HQX A;  4C8Q E;  3FLG A;  4N4G A;  1BI1 A;  3G4S T;  2JZ2 A;  5GMK j;  2HBP A;  3OYH A;  4J6X A;  2E6N A;  2HD0 A;  4M75 G;  3JB9 H;  4BE2 A;  2QQ9 A;  1O75 A;  2K4Y A;  3OMG A;  4VUB A;  4C92 C;  4EDU A;  3M58 A;  4A54 A;  3JCM f;  4FL6 A;  1K9M U;  1JJ2 A;  3OS2 A;  3DLL A;  4ZTF A;  4IUR A;  1NPR A;  3E9F A;  4JLG A;  4N0A A;  2GQV A;  2EWN A;  2P0P A;  2PVD B;  5CKB A;  2CGH A;  2KSS A;  3OYN A;  4Y91 A;  3GOX A;  3JB9 D;  4PJO A;  1K8A C;  3JCM V;  5A0D A;  4ZGE B;  4O5V A;  4QQG A;  3H6Z A;  3A8H B;  5CQX A;  3SD4 A;  2VUB A;  5GAO m;  5GAM e;  1XNI A;  2XI9 A;  4C5G A;  3GIB A;  2M16 A;  4M75 B;  3MCA B;  2M9U A;  4M78 D;  3RKX A;  4A53 A;  3CCV T;  2QA4 T;  1M90 U;  4M7D A;  1M8V A;  1RL2 A;  1YIT A;  3SFM A;  4C92 B;  1YIJ T;  3O8V A;  2LCC A;  1I8F A;  2YLC A;  4QQD A;  4OVA A;  4JLI A;  3X26 B;  4M77 A;  2QQA A;  4X9C A;  4JS5 A;  2RJD A;  1Q81 C;  4YTL A;  1GXI E;  2FB7 A;  3QJY A;  3JCM J;  2F5T X;  3QSU A;  3CCL T;  2H3J A;  3OSS C;  4BUG A;  3OYM A;  3CCE T;  2R57 A;  4OMF B;  1U8R A;  3FC3 A;  4ZN1 A;  4N4I A;  2RK1 A;  3G7Z A;  2E41 A;  2ZZD A;  4PJO E;  2HQE A;  5DY9 A;  4C8Q D;  4XTZ A;  1OZ3 A;  4C0G A;  3I55 T;  4JRQ A;  4ATO A;  3CCJ A;  3LWH A;  2X4J A;  5A2Q E;  3S3M A;  2XD0 A;  1M5Q 1;  4ZN3 A;  1N8R C;  1VQ4 A;  1D3B B;  1OYX A;  4F7U F;  3PIP A;  3L2W A;  4M7D E;  4FU6 A;  1VQ5 T;  4XTX A;  4OGE A;  5KH6 A;  2KK4 A;  5DLQ E;  5LJ5 d;  4M77 E;  4DA4 A;  3QBY A;  2A3L A;  4ZGD B;  3JCM b;  4DQ2 A;  1XTD A;  3OYJ A;  4E47 A;  2PUO B;  3ZFJ A;  2V8I A;  4M75 A;  2FL7 A;  3PMI A;  3G6E A;  3CCU A;  1YJW A;  3BW1 A;  2M1H A;  5IN1 A;  3GP8 A;  3DLM A;  3CCQ A;  2ZPI B;  4C92 A;  4KUD K;  1G3W A;  2LTO A;  2QEX T;  2ZPG B;  3NFC A;  2WSC E;  4M7A G;  3ZBD A;  1QVG S;  3P8H A;  2E65 A;  2Y90 A;  4J83 A;  5M9O A;  2L5Q A;  5IT9 E;  3LLR A;  4FT2 A;  4Y28 E;  3RIR A;  2JNG A;  3CC2 A;  3NTI A;  5GMK m;  3M57 A;  5J39 A;  1B34 A;  3UWN A;  3HPW A;  2R5A A;  4LD6 A;  2L8D A;  3VJP A;  2QXF A;  2HAX A;  1Y71 A;  3A8O B;  5GAM h;  2OTJ T;  4P5N A;  4JRI A;  4XK8 E;  3TCJ A;  3OS5 A;  5A0G A;  4C0D C;  1BIB A;  4J6Y A;  3ER0 A;  4A4F A;  5GAN h;  1D3B A;  3L2Z A;  4M75 E;  4M7A B;  4BE0 A;  1LJO A;  2MWP A;  4CI0 C;  3OYA A;  2DXU A;  2RJE A;  1LNX A;  4LDW A;  4J7F A;  3X24 B;  3X25 B;  4MML A;  3FJP A;  2FYK A;  1VIE A;  2DXC A;  3JCM d;  2BIV A;  4ZTJ A;  2D9T A;  3ZEH A;  1NJI U;  3JCM X;  4M7D D;  2XU8 A;  3C95 A;  3GPL A;  5D6W A;  2VYT A;  3JSC A;  1QVG A;  2F69 A;  2DD5 A;  1EIF A;  4DOV A;  1KHI A;  3MO8 A;  1XOV A;  2LT1 A;  4M77 D;  1M1G A;  5GAN 4;  2A7Y A;  4C0D B;  1VQP A;  2IG0 A;  2X4X A;  4J7I A;  2RJC A;  3HRT A;  4MZT A;  3LGL A;  5GAN g;  5LJ3 h;  4EPC A;  2E12 A;  2RH2 A;  4LD9 K;  4JUV A;  1YIT T;  2M0O A;  3HSB A;  5GAO r;  2R58 A;  2P0K A;  1VQN A;  3RMQ A;  4OB3 B;  2FVU A;  3S3N A;  5C0M A;  2JVV A;  3ME9 A;  1H64 1;  3T9N A;  1Q82 C;  5KCO A;  2K3X A;  3VV0 A;  4KBM B;  2RO0 A;  4PJO F;  1NPP A;  5CK9 A;  5HK0 A;  4HT9 A;  4M7A A;  3OA6 A;  1M1K U;  2CZ1 B;  4IUQ A;  3VYG A;  2RHX A;  5FRN A;  2MF2 A;  4PNO A;  1FWZ A;  2RI5 A;  5CKH A;  3PNW C;  5FLX E;  1Y07 A;  5LJ3 g;  5GAM f;  4FIB A;  2AHJ B;  5GMK i;  4A4E A;  2GFU A;  3EFR A;  2XDD A;  3CCJ T;  4M7D F;  5GAN f;  4M75 D;  4V2S A;  2K3Y A;  1X6O A;  2V8J A;  1VQ4 T;  1Q81 U;  1YJ9 A;  4EMK C;  4M77 F;  3BDL A;  3FEO A;  1Y96 A;  3LW5 E;  4XU3 A;  1Q86 C;  1KQ1 A;  3CBM A;  5KCH A;  3SWN A;  4OGC A;  5HKC A;  2XDP A;  4C92 G;  3BFM A;  1YI2 A;  3CCU T;  3J7A F;  3G6E T;  5D6X A;  5KE2 A;  1YJW T;  2G3R A;  4O6J A;  4DOW A;  4M7A E;  2E70 A;  2C06 A;  3JCM P;  4II1 A;  2CYZ B;  2VXF A;  1N8R U;  3URG A;  1LOJ A;  4IUP A;  1M1K C;  4EMK B;  4QQ6 A;  4RCB A;  5GMK h;  2JN0 A;  3CC2 T;  1G3S A;  4MDX A;  3PTA A;  5GAN e;  4XQ3 A;  1QP3 A;  2XKO C;  3PT9 A;  3CBP A;  3QUI A;  1O9S A;  1KG1 A;  1K8A U;  2E6Z A;  1P92 A;  4FSX A;  1BI3 A;  2PQW A;  3OYE A;  4M75 F;  5CQY A;  1VQ9 A;  4RKU E;  3OYG A;  1OZ2 A;  3QHS A;  4GY5 A;  4XU0 A;  3M4G A;  3M53 A;  4PLL A;  3X28 B;  2ZPB B;  3MEW A;  2EAY A;  4QVD A;  1NE8 A;  1WGS A;  2CZ0 B;  3H8Z A;  1VQL A;  3OYK A;  1YHQ A;  3OBY A;  2EYQ A;  2XID A;  3E1S A;  3RER A;  2OAU A;  1JB0 E;  1XQH A;  3JB9 G;  5GAO q;  3HKS A;  3MET A;  3CME A;  3QG1 A;  5LJ3 e;  2FHD A;  4B9X A;  5J3B A;  1H3Z A;  3CC4 A;  4J8O A;  4C5I A;  3OSV A;  3UT1 A;  3QYH B;  4BI4 A;  3CCQ T;  5DM7 R;  2VGN A;  3WVD B;  1DJ7 B;  2JUF A;  4M78 C;  4M78 G;  3L2R A;  3TRE A;  1VQP T;  3OYC A;  2RI3 A;  2LT4 A;  3LH0 A;  4EMK A;  1QP2 A;  2DAQ A;  2ZPH B;  3CCS A;  1KD1 C;  3R6O A;  4LDY A;  2RHI A;  3N5B B;  4X34 A;  3V8J A;  2CKK A;  3JB9 I;  5LJ5 j;  4XU2 A;  3QZ5 B;  4NS5 A;  2PVG B;  5I2S A;  1VQ7 A;  1VQN T;  2XHC A;  4IUT A;  1QW1 A;  3P8D A;  4Z02 A;  2L3R A;  4ELY C;  2EJ9 A;  5GAN 6;  1PSE A;  3C12 A;  3L42 A;  4HCC A;  1K73 C;  4XTY A;  4ZGJ B;  2WAC A;  4C8Q C;  2YRV A;  4M78 B;  4C8Q G;  3QPH A;  2RI2 A;  2EQM A;  2E1H A;  3TU4 K;  4E7L A;  2DTI A;  4XAX B;  5GAM d;  4TVR A;  4XTV A;  5HK3 A;  2LNV A;  1WJS A;  3C4S A;  2RK2 A;  5FU6 C;  5CAI A;  5GAO l;  3QZ9 B;  4RG8 A;  1IRE B;  1M9S A;  5GAN d;  3HFO A;  4L59 A;  1W2B S;  2DXT A;  2Y4X A;  3E19 A;  2EFI A;  4C0Z A;  1VQK A;  2E64 A;  2DXB A;  2LRQ A;  3WVE B;  3L2U A;  1M1F A;  4GLK A;  2VV5 A;  4QVZ A;  4FM4 B;  1YJ9 T;  4PJO D;  1Q82 U;  2EQJ A;  2XIC A;  5CKE A;  4L6V 5;  4C92 E;  3LGF A;  3M55 A;  4PL6 A;  4X9D A;  1V29 B;  3ASK A;  4C8Q B;  3CD6 A;  1YI2 T;  2I2L A;  2RJF A;  4M7A F;  3Q1J A;  2RHZ A;  5GMK e;  3MEU A;  4UC4 A;  3V8L A;  2JTF A;  5FU6 B;  3M5A A;  3FB9 A;  4C5H A;  3BY7 A;  2XK0 A;  3HL8 A;  4NOY A;  2RB6 A;  5LJ3 d;  1VQ8 A;  1WQW A;  2MI6 A;  1WJQ A;  4WF2 A;  2K5F A;  5LJ5 g;  3OYI A;  3FDR A;  1Y7X A;  3M59 A;  5GAN 8;  2QQB A;  5EG2 A;  3CCM A;  1Q86 U;  2O01 E;  4M78 A;  5CIU A;  2OTL A;  2KMT A;  4C0F A;  1SSF A;  2LQK A;  2QTX A;  1W2B A;  2GCX A;  3M56 A;  4N0A C;  1BYM A;  2DIG A;  2K57 A;  3DB3 A;  4PLI A;  4PJO C;  3JRZ A;  4MZM A;  3OBW A;  5CKF A;  1VQ9 T;  4RCC A;  1RI0 A;  4QVC A;  4R56 A;  3P8B B;  4IUV A;  3S6W A;  3VYH B;  2DZ9 A;  3CPF A;  1VQL T;  1KC8 C;  1YHQ T;  5AYF A;  4A4H A;  4FT4 A;  4M7D C;  3MEA A;  1VQO A;  2RHU A;  5CO7 A;  4C8Q A;  2XDB A;  2DVE A;  4OF1 A;  2DPP B;  3CME T;  4M77 C;  5GMK l;  1BKB A;  4BDZ A;  2EIF A;  3OYD A;  1KHC A;  2PVO B;  2YLB A;  2DIQ A;  5GAN 2;  3CC4 T;  3QYG B;  1KQ2 A;  4C92 D;  2VC8 A;  4M78 E;  4Q5W A;  5CKD A;  2ZCF B;  3E9G A;  1NZ9 A;  3RKY A;  3VKI A;  3CCR A;  4BI8 B;  3CC7 A;  3KXT A;  1JBM A;  3A5Z B;  3EAE A;  3LYI A;  3MEV A;  4A4G A;  3JCM g;  5LL6 S;  4JRK A;  3OY9 A;  3JCM Q;  4QW2 A;  3I56 A;  2RM4 A;  3PMT A;  5GAN 7;  3CCS T;  2RA2 A;  3MHX A;  3QO3 A;  3G71 A;  4D6W A;  2K5I A;  2P4T A;  1BIA A;  3SB2 A;  1X75 C;  1HK9 A;  1VQ7 T;  4BD3 A;  1FX7 A;  4E7I A;  2DJZ A;  3M4Y A;  4HKE A;  1YBY A;  4M77 B;  2X4Y A;  4KT0 E;  4NL2 A;  5LJ3 f;  4IKF A;  2QI2 A;  4J5Y A;  2P0Q A;  3X20 B;  3M54 A;  5CR2 A;  1VQ6 A;  1AHJ B;  4CRI A;  2WSF E;  2DK3 A;  5LJ5 e;  4XTU A;  1G5V A;  2B8A A;  2EJG A;  4A4K A;  3CBO A;  3MP6 A;  2MAM A;  2R5M A;  2NLU A;  4M75 C;  1KD1 U;  1S72 A;  2K2V A;  3HRS A;  5GAO p;  1UEB A;  1PSF A;  2BKD N;  4E7H A;  1VQK T;  2RD1 A;  2DD4 A;  3GF5 A;  4C92 F;  3LWI A;  4C5E A;  1IZ6 A;  3OYB A;  1UGR B;  3V7R A;  2D6F A;  2XG8 D;  2ZPE B;  2CZ7 B;  3CMA A;  2CS7 A;  1K73 U;  2GF7 A;  1N6A A;  5CVI A;  2X35 A;  3PIO A;  3CD6 T;  3CPW S;  1WPY A;  2EQU A;  1YJN A;  4F7U G;  4ME7 A;  3CEY A;  4JDS A;  1I81 A;  3UDC A;  3HHT B;  5GAO n;  1Q7Y C;  1HXD A;  3L2V A;  3CXC S;  3A8M B;  5C6S A;  1VQ8 T;  2X4W A;  2VXE A;  3DKM A;  2KVQ G;  2QQS A;  4NL3 A;  4MMK A;  2K5L A;  3F70 A;  4RMO A;  1W4S A;  3OS1 A;  3JCM W;  1VQM A;  1G3T A;  1X01 A;  2ZGW A;  2BUD A;  3CCM T;  3M9Q A;  1R8O B;  4OB0 B;  3JCM e;  2OTL T;  2HNI A;  4M7A D;  4MZP A;  3TEE A;  4R55 A;  1B34 B;  2EQK A;  4HT8 A;  2QQR A;  5L8R E;  2IVW A;  1K9M C;  3QJ6 A;  3WXM B;  4F7U B;  2ZPF B;  2PU9 B;  1N27 A;  3NTK A;  3GNF B;  4B9W A;  4J6W A;  1U1T A;  5D6Y A;  5DLO A;  3JB9 F;  1UGS B;  4JJN K;  2DEQ A;  3G4S A;  1JRI A;  1I4K 1;  3JAM E;  3CPW A;  2DKG A;  3NTH A;  2EJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...