3MEAA

Crystal structure of the sgf29 in complex with h3k4me3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
164
structure length
162
Chain Sequence
b'LYFQGTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 162
sequence length 164
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3meaA02
3F70A 3OYDA 3DB4A 2DIQA 4C5IA 3OYKA 4QVZA 5IN1A 3L2RA 2RJCA 2EFIA 2G3RA 4HCZA 2O4XA 3MO8A 3BDLA 3OYHA 3LYIA 2RI5A 3P8HA 3FDRA 5M9OA 5J39A 2RHXA 4II1A 1RI0A 4IUVA 5KE2A 1MHNA 2WACA 3OS2A 4ZTFA 2M16A 2BUDA 3ASKA 3QJ6A 2LTOA 3QBYA 2GFUA 3EAEA 3PNWC 5D6WA 5KCHA 5KE3A 2RHUA 3S6WA 2M0OA 3MEAA 5FROA 2L3RA 4E7HA 2VYTA 3MEWA 5FRMA 2M1HA 2IG0A 2RJFA 3ZEHA 2FHDA 4B9WA 4BE0A 3M9QA 2RO0A 4BE1A 3L2VA 2RI3A 4RG2A 4OVAA 2K3XA 1WGSA 3E9FA 3NTKA 3L2UA 1H3ZA 2X35A 3UT1A 4C5HA 1N27A 2BIVA 3FLGA 3META 4A4HA 3OY9A 3Q1JA 2MWOA 4NS5A 4ZTJA 4FU6A 4X34A 4QQ6A 3QIIA 3OQ5A 2P0KA 5J26A 2XDPA 1OYXA 3LGFA 4C5EA 2BKDN 3QKJA 4BACA 2HQEA 2X4YA 4E7JA 2B8AA 1WJRA 3E9GA 3FEOA 3MP1A 4N4HA 2D9TA 3LX7A 4IUPA 4A4FA 2X4XA 2EQMA 4N4GA 2LRQA 2O4XB 5KCOA 4GY5A 2X4WA 3OB9A 2F5KA 4QQDA 3OYLA 3PFSA 2L89A 2RHYA 3OA6A 2GFAA 3H8ZA 4E7IA 2RI2A 2RJEA 5C6SA 2CKKA 3GOXA 4N4IA 4A4EA 5CIUA 3O8VA 3OYBA 1WJQA 2RHZA 4BE2A 3L42A 1XNIA 3CEYA 2GF7A 1WJSA 3PMIA 2E5QA 3LGLA 3MP6A 4L59A 4QQGA 2DIGA 4FL6A 3OMGA 3H6ZA 4IUUA 4PLLA 3OYJA 4IURA 5D6YA 4IUQA 1G5VA 3DB3A 4B9XA 2K3YA 5C0MA 4QW2A 2LVMA 3LLRA 3P8DA 1SSFA 1KHCA 3ME9A 3MEVA 2L8DA 3OS1A 2MWPA 3OYMA 2R5MA 3L2WA 3MP8A 3OYIA 4BDZA 3NTHA 3OMCA 5IAYA 3S3MA 4C5GA 1OZ3A 2LCCA 4PLIA 2LDMA 3OYAA 2NLUA 2EQJA 4Z02A 4BD3A 2QQSA 3UWNA 4IUTA 4A4GA 5KH6A 3L2QA 4BDYA 3S3NA 5D6XA 4UC4A 3KUFA 3OYGA 4IKFA 3NTIA 1OZ2A 3OS0A 4Q5WA 3SD4A 3S3OA 2R58A 4CRIA 3MEUA 4EDUA 2DAQA 2RHIA 4LD6A 2XK0A 2RJDA 5FRNA 2R57A 2R5AA 3OYEA 3FC3A 2JZ2A 2PQWA 4E7KA 3C4SA 3OYNA 3OYCA 3PMTA 2EQUA 2YRVA 3LH0A 2QQRA 3OYFA 2EKOA 4PL6A 2JTFA 4E7LA 1OI1A 2EQKA 3DLMA 2E6NA 2HQXA
chains in the Genus database with same CATH superfamily
3I55Q 5HY6A 2OTJT 4F14A 1UJ0A 1ZSZB 4HCZA 2O4XA 2PNIA 3JCMe 3OS2A 1NJIU 3IQLA 1GXIE 1PKTA 2CP5A 4A63B 1VQLQ 2LC4A 1H641 2CH4A 5KYUB 3TU4K 1QVFP 4M77F 4RG2A 3E9FA 3NTKA 3QPHA 4C0GA 2GGRA 4XU1A 5IHNA 3M55A 4J9HA 4M7DF 2MPXC 1HK9A 2CDTA 2EBPA 2HQEA 3HHTB 1WQWA 4HKEA 2KRSA 1QWFA 2CP2A 4E47A 1M8MA 4QT7A 2O4XB 3M5AA 2A7YA 4DA4A 3H41A 1X6GA 2PUOB 3CCMT 2O88A 4GBQA 3R6NA 2EYYA 5GAMh 1TUCA 1X43A 2O01E 5LJ3g 2DL7A 2MOXA 1Q86C 1AD5A 2K5IA 4IUUA 5D6YA 1AZGB 4IUQA 3U23A 4DBRA 1VQMQ 1T3LA 3LLRA 5FU6B 4RG8A 4C0FA 3QDRB 1WHGA 3UWNA 1VQ5T 1W4SA 3G4SQ 3PIPA 1WHKA 5D6XA 3CXCS 5GJVB 2RH2A 3D7SB 2COYA 3CCLQ 4ZGDB 4LD6A 4JJNK 1VQ9Q 4XTXA 2DL5A 3BDUA 2JZ2A 5FWBA 3G71T 2EYQA 3OYCA 3PT9A 1CKBA 1AWOA 2EKOA 2RMOA 2E6NA 3F70A 4M7DG 1TWBA 4J7FA 3VS1A 2CUBA 2P0QA 1OV3A 2EFIA 3CXCA 4RTZA 1VQPQ 4V2SA 3FDRA 2JOYA 2I0NA 1IO6A 2QA4A 2RPNA 3EGDA 2RK1A 3EAEA 3M0SA 1F1BB 4PJLA 4AFZC 4Z8AA 4DOVA 5FROA 1VQNQ 1YCSB 2GQVA 3M56A 1HXDA 4DEYA 2JM8A 2DK3A 3M9QA 1XTDA 2QG9B 2XU8A 1ACMB 4J9GA 3C95A 2V8JA 4JUVA 3OY9A 3Q1JA 1ARKA 2L3SA 4X34A 2HCKA 1TSFA 1U5SA 2HEQA 5J26A 1OYXA 1YJNT 1VA7A 3REAB 3L1AA 5GAN3 2GQIA 2HL5C 2IPOB 3VS5A 1PSEA 1VQOA 4N4GA 1Q81C 4GLMA 2MIOA 1K8AC 1JJ2P 1NE8A 3VRYA 3M54A 2MYSA 3EGDB 2HBPA 1QCFA 3QUIA 4F04B 1RACB 3CD6Q 4J8OA 1S72A 4KUIA 3MP6A 2ZPIB 1H8KA 2W0ZA 2O2OA 1YHQT 2RQUA 1TG0A 1UGRB 1Z9ZA 4NOYA 3EHQA 1YI2T 1CSKA 2JVVA 3NHNA 2ROTA 2BZYA 3HRSA 4Z89A 1KC8C 3VS3A 1M30A 4LD9K 2IIMA 2NWMA 1SG5A 1K9MU 4ME7A 1GBQA 1PG5B 2DL8A 2EKHA 3TCJA 3FJ5A 1VQ4Q 2G3RA 2K4YA 1JBMA 2FRWA 1UJYA 1VYUA 3BDLA 3JCMg 1U1SA 3V8JA 2KQWA 4JS4A 3JCMW 4IUVA 1MHNA 2E4HA 2KXDA 4C92C 5CKBA 3A5ZB 2RNAA 3INZA 2DRMA 2M1HA 4M75F 2YRDA 4BE1A 5GAOn 2DERA 2V1QA 4QQ6A 1BI0A 1WXTA 1N8RU 4Y91A 1YP5A 2M0YA 4A53A 2YRCA 1LNXA 4HCCA 2YUNA 2D8JA 3HFNA 3JB9G 3RNJA 2H3EB 1QMCA 2YUOA 2CP0A 1ZLMA 4EPCA 2M51A 1MMGA 3OA6A 4ELZC 2KE9A 4FYVB 5GAN7 8ATCB 3M0RA 2DF6A 1FYNA 1ZBXA 2PVGB 1UGSB 4R0KA 1Q86U 2KAFA 5LJ5h 1VQ6A 1YIJT 2KROA 4FIBA 5ECAA 3S3MA 4EMGA 3V8LA 4Z02A 4BD3A 3FIFA 4BI4A 3V7CA 4A4GA 2H8HA 2RB6A 2HDAA 4ZGJB 2PVOB 1TH7A 3JV3A 2YLCA 1JXMA 4JS5A 1IRXA 1OULA 2CSIA 4FSXA 2FZCB 4OB2B 3M57A 4CI0C 4RUGA 2OTLA 4L6V5 1KQSS 3RKYA 1VQOQ 4F7UE 3SB2A 2LT1A 1W70A 4RKUE 5GANe 3CCMQ 1ZQ1A 5CK9A 3CCQA 3SFMA 2C0TA 1D1AA 2RJFA 3HL8A 1ABQA 2VKNA 4ESRA 3I5SA 4N0AC 1Q86R 1NJIC 2F69A 1UHFA 1NM7A 4XTWA 2B8AA 4M78C 3V7RA 4PK4A 1VQ5Q 4OMMA 3QZ5B 2EW3A 3OB9A 2MF2A 5HKCA 5LJ5j 1RLPC 2ZPEB 4C92A 3UPUA 1YITT 1B3QA 2RJEA 1BIBA 4PNOA 1VOMA 3G71Q 2OAUA 1K8AU 3UF4A 1V1CA 2GTJA 2QGGA 1I5OB 2GBQA 5GAMg 1EIFA 4EMHA 3I55A 2DIGA 1ZUYA 1KIKA 4ATOA 4JZ4A 2HAXA 4CC3A 3MEVA 2ZAEA 5DM7R 3CCJA 4M77C 1I0CA 4JLGA 1WHHA 5LJ3j 2D0NA 2DTHA 4OGCA 5LJ5d 3EH1A 4IUTA 4BDYA 4AG1C 4EMKC 2BTTA 5LJ3e 5FU7C 4C92B 2CT4A 1SHFA 5GAN5 1QVGA 1BI1A 2AT1B 1C6VX 3OW2S 2EQUA 3I35A 3DLMA 5GMKi 2XHCA 2LJ3A 1E6HA 2ECZA 4PFZA 1O9SA 1Y07A 2VB6A 2QK0A 2QEXA 2WACA 1M3BA 2Y90A 1Y96A 2EYZA 1K8AR 2KNBB 3OW2A 4MDWA 2QASA 2EJFA 4XAXB 2FPDA 2KVQG 3RKXA 1PHTA 3H0FA 1OOTA 5CVIA 2X35A 2EGCA 1N27A 4XU3A 1VQMA 3OQ5A 3T9NA 3LWHA 1HJDA 2CYZB 1K76A 1VYVA 1YHQQ 1VQ6Q 3E19A 2KEAA 2EGAA 4HCBA 1YI2Q 2QQBA 2OJ2A 1PKSA 2XIDA 1T0HA 2SEMA 2RD1A 2YLBA 1YJWA 2QGFB 1VQ9A 4F7UG 1Y96B 2WSEE 1KFZA 3KBGA 1OX8A 3ZFJA 4BE2A 1J3TA 2MK5A 3NMZC 3VS7A 3JCMJ 1LOJA 4N0AA 3CMAA 5FLXE 2NUPA 3M58A 4QW2A 2OTLQ 1VQKT 1KHCA 2MWPA 4C8QC 1WX6A 4M78A 1HD3A 4LUDA 1WDXA 4J9EA 2XDDA 1VQNA 2E1HA 1JXOA 3L2QA 1SKUB 4OMNA 2XICA 3OS0A 5AYFA 2QDLA 3SD4A 1YBYA 4FSSA 2QYZA 3V7SA 3CMET 4L5GA 3CPFA 5GAOq 3LH0A 4QKUA 3H0IA 3OSVA 4HCKA 3CCET 1K73U 5CCAA 1SHGA 4OMPA 3A8LB 2NUPB 4KH0B 1K9MC 4RCBA 2RQVA 2RHXA 2LNVA 5KE2A 4BUGA 4M78B 3JCMX 2FPEA 5GAOm 5GAN8 4NL2A 2J05A 4EMKA 3CD6A 2L2PA 2FHDA 4B9WA 4ANJA 3M53A 4X1VA 5CKHA 1O75A 1IXDA 1WGSA 1H3ZA 3MCAB 3H0HA 3GBQA 4A4HA 3CCST 4ZTJA 2A37A 3CXCP 2ZPFB 2VGMA 1FMVA 2P0KA 1KQ1A 1YIJQ 3G6ET 5DY9A 2VASA 3CCJQ 1DJ7B 2VXFA 2DXCA 1QW1A 1AWXA 4QQDA 2CP6A 2L89A 3GLXA 3CCVT 4PJOC 1GRIA 1N8RC 1VIEA 1TXQA 2EIFA 1FMWA 2KT1A 2JXBA 4F17A 3JCMd 4HXJA 2DVJA 2BE7D 2KMTA 3M0TA 4EMKB 4BY6C 5FU7B 3VKIA 1I4K1 1K73R 3VS6A 1D0XA 4B9XA 5C0MA 1VQ4A 2LVMA 4LDXA 2JN0A 2K5LA 4M75C 3VJPA 2DL4A 2QEXQ 1GFDA 4J9IA 3C0CA 1K0SA 2F2VA 1MMNA 4DEXA 3OYGA 1JQQA 2EVRA 4KUDK 1H92A 2R5AA 2Z0WA 3OYEA 3HRUA 3GP8A 3C4SA 4ZGEB 3H9NA 4JRQA 1M4ZA 1SF9A 3M0UA 4D8DA 2HL3A 1NJIR 1WFWA 3OYDA 3OYKA 2LX9A 4M4ZA 4XTVA 5GAOp 3CCUT 3OYHA 2FZKB 3LYIA 4C8QA 2DNUA 3MHXA 2EAYA 1WI7A 2M16A 2ZPBB 2KDSA 1KJWA 1YJWQ 5LJ5f 1K9AA 4MZMA 9ATCB 1G83A 2W10A 2RI3A 2OTJA 2DM1A 5I22A 3FLGA 3CCRT 3CMAQ 5KYWA 3OBYA 2D8HA 2XDPA 2EYXA 3CBOA 1NLPC 3I56T 4E7JA 1HSQA 4HT8A 3EG2A 2QAZA 3DKMA 4M7AC 1BU1A 2D9TA 1QKXA 4C8QB 3GF5A 3KFVA 1VQ8T 4E6RA 2YT6A 1TUDA 2LX7A 3RMSA 2VC8A 1RI9A 3O5ZA 4C92D 3PVQA 4OMOA 4FM4B 2E5QA 4L59A 2YDLA 1C0MA 1AVZC 4XTYA 2K3YA 5KYWB 3M59A 2V8IA 3OS1A 3CCMA 4BDZA 3CC4T 4CC2A 2K2MA 1MUZA 1Y7XA 4OB0B 2DZ9A 4XTUA 3KUFA 4PJOA 3EFRA 1EFNA 4HA8A 2ATCB 1AZEA 2DXUA 5GAMe 1N9SA 1VUBA 4JJCA 1BKBA 3PE0A 5IXBA 3VS2A 3P8BB 4OGEA 3CC7T 4R55A 4XU2A 1RAFB 3JB9F 3RUXA 4HVWA 1GCQC 1TS9A 2AZVA 3CBPA 1VQ5A 2IVWA 4J83A 3PVLA 1V76A 4FT2A 4M75A 5IHKA 4D8KA 1YJ9T 2WSFE 3REBB 5M9OA 5J39A 3TREA 1M5Q1 2P4RA 2LQNA 3S6WA 2HQHA 3G71A 2XI9A 1LJOA 2DL3A 1BI3A 2OI3A 4PJOB 2Y4XA 4LE9A 2V8KA 3JB9J 2KGTA 3SWNC 2A0FB 1VQKQ 1G2BA 4KULA 2BKDN 1M2VA 3QKJA 2HBWA 4A54A 1WJRA 3E9GA 1PNJA 4IUPA 1BYMA 2DX1A 2DETA 1SRMA 4M75B 1R0CB 3VUBA 3CPWS 2ZGWA 4KBMB 5GANh 1EZZB 3CMEQ 2ENMA 4RTUA 2FZGB 3PTAA 1YJNA 2XG8D 4JRIA 1SPKA 4QQGA 2GCXA 2CZ7B 4IURA 3HKSA 4VUBA 3CPWA 1WQ7A 5CO7A 3X24B 1PSFA 1JJ2S 1M2VB 3SHWA 2YXYA 4M7AA 1K9MR 2NLUA 1UB4A 2V26A 3QSUA 4M78D 2P4TA 2O9VA 2OTJQ 2RHIA 2ZZDA 1PD0A 1Y57A 2R57A 3CC2T 1QCNA 2DYBA 1R8OB 5IH2A 3JCMf 3VV0A 1YHQA 2HQXA 1ZSGA 3FRNA 2RJCA 4TVRA 1YI2A 1TTHB 3OSSC 3MO8A 4WCIA 3QZ9B 1UUEA 1CKAA 2EGEA 1IGUA 3DLLA 3QO3A 3QYGB 2COWA 2BUDA 2GTOA 4M7AB 4BI8B 4QVDA 1QVGP 4M77D 5FRMA 1K73C 1N8RR 1FX7A 1RL2A 2IG0A 1PCXA 2RO0A 2FRYA 3OBWA 2AK5A 2K3XA 5GANj 2DEQA 5LJ3h 1RAEB 3L2UA 1B7TA 3GPLA 1G3SA 4RTVA 1VQLT 1AEYA 1FWZA 2O9SA 3ZL7C 2DEUA 1WHLA 1GCQA 3UDCA 2FVUA 1VQ7T 3OW2P 2CREA 5CAIA 5DLQE 3V8KA 1JEGA 2DO3A 5A0GA 1KQSA 2C0IA 1ZHIA 2RHZA 2E70A 5GANd 4C92E 3L42A 3EG0A 2K79A 2VXEA 2F5TX 1Q82U 3OYJA 3SWNA 1YCYA 2J6FA 3A8GB 2M02A 4LNPA 3CCUQ 2CSQA 1SSFA 1Y0MA 1W2BS 4MMKA 3X20B 4AG2C 5FWCA 5IT9E 2KSSA 1LVKA 2R5MA 2JT4A 1X2QA 2NUZA 1GL5A 3CBMA 3A98A 4OP0A 3TSWA 2JS0A 1Z9QA 2KXCA 3NPFA 1KHIA 2YHTA 4IKFA 5GMKe 1I1JA 1SRLA 4EDUA 7AT1B 3CCRQ 1IHVA 1W2BA 1QVPA 3J81E 1BCMA 1WHJA 2YRVA 3G4ST 2K57A 2DILA 2QQRA 1YIJA 2JTFA 4E7LA 3CCLT 1WNLA 2CGHA 5HK0A 4MZPA 2LQ8A 3SWNB 4YTLA 3EG1A 2ABLA 1MV0B 1VQ8Q 2CH4W 4II1A 4M7DC 4F7UF 2DTIA 2XDBA 4C8QD 4CC7A 1KG1A 2VYTA 3BW1A 1YJNQ 1VQPT 1QKWA 5L23A 2JM9A 1FXXA 1JU5C 1X69A 4J7IA 3I9QA 3R6OA 2FYKA 1UHCA 2MWOA 2LZ6B 1AT1B 2CP7A 1M3AA 5LJ3d 2CZ0B 2D6FA 1G3YA 3WVEB 4X9DA 4C92F 3CC4Q 2HSEB 3BE3A 4MMLA 1NLOC 3LX7A 3JRZA 4E7ZA 3QXEB 4J6WA 1WLPB 1YFNA 2E3IA 2HSPA 4DBHA 5CKDA 2E65A 5I21A 2L0AA 1LPLA 1WXBA 5C6SA 2HZYA 1U06A 1IHWA 2CZ6B 4J9DA 2ROLA 2X3XD 5DLOA 3JB9I 5GJWB 2A3LA 2E12A 3JCMV 2F1LA 1TU0B 5KYYA 5IHIA 8AT1B 2L8DA 4DBQA 3OYMA 3L2WA 1YITA 5GAN6 5HK3A 2FO0A 4ZN1A 3JCMh 4PLIA 2JNGA 3PIOA 4PJNA 4M78E 3VYHB 3NTIA 1AWWA 2DJZA 3TSZA 1NZ9A 1X75C 2RJDA 1RAAB 3SEMA 2PQWA 4PJOD 2J6KA 2C06A 4HVUA 3PMTA 4JPBW 1N5ZA 4E7SA 2RN8A 4J5YA 4J6YA 2DIQA 4C5IA 4C92G 5KYYB 1ZUKA 1M1GA 3LWIA 3I5RA 3WVDB 4O6JA 1PM3A 2SRCA 3ASKA 5A0DA 3RMQA 4C0DC 3PNWC 5I2MA 4M75D 4P5NA 1BCOA 1XQHA 3UA6A 1I8FA 3J80E 2H3JA 2DTOA 4XU0A 3M0PA 1OU9A 4C5HA 1VYTA 3FJPA 4KRTA 2LP5A 3QWYA 4MDXA 3FB9A 4M77A 3C12A 2PU9B 2RM4A 1X6OA 4XTZA 3FEOA 2QTVA 2X4XA 2COZA 4LXCA 4GY5A 2F5KA 4M7DA 2A28A 1UE9A 3MKDA 1FMKA 2F2XA 2JUFA 3HRTA 3O8VA 2BZXA 3A1PA 3LW5E 2MCNA 1MGQA 4M78F 1TOVA 2VVKA 1Q7YC 3OMGA 1HYOA 2NYSA 3DB3A 4JLIA 2J7IA 2J6OA 2FPFA 3L2ZA 3A8HB 4HVVA 4M77B 3E2UA 3VS0A 3OMCA 5IAYA 1OZ3A 1QLYA 2CS7A 5KH6A 1JB0E 3S3NA 4UC4A 3JCMQ 4M7AD 2D0QB 1K1ZA 4M7DB 1V29B 2KK4A 2DAQA 3PGGA 2QA4T 1VQKA 4IIMA 2B86A 5I11A 4J9FA 2M9UA 3OYNA 3LH5A 2HKQB 2X3WD 1XJWB 2MMPA 5GANf 1KSWA 4LDYA 4RCCA 4IIOA 2EJ9A 1VQ7Q 1NEGA 2HKNA 5IXFA 1IB8A 4QVZA 3G1JA 2JW4A 3EGUA 2LNHB 5LJ5g 3P8HA 2F2WA 2LMJA 3QDFA 1G8XA 2DZCA 5A0LA 2AZSA 1QCOA 3CMEA 1RAIB 1G3TA 4C8QE 1YWPA 4E7HA 1VQOT 3ZEHA 2FL7A 1NPRA 4RTYA 2EWNA 3CCEA 4JRPA 2BIVA 2K2VA 4M78G 4FYWB 2OAWA 1RAHB 1ZA1B 3HFOA 2XMFA 3X28B 4RTTA 4OMQA 3HP9A 2JMCA 3N5BB 5CQXA 1S72T 1YITQ 1KQ2A 4R56A 4A4FA 4PJJA 1WYXA 1OX9A 2DA9A 1KD1C 4DBFA 4PFPA 1WA7A 3RR6A 3H8ZA 2KBTA 3CCSA 1UTIA 4Y28E 4A4EA 2P0PA 4LDUA 1JRIA 3G6EA 1NEBA 3PMIA 3EG3A 2NUTA 3RIRA 4M77G 4LDVA 2E41A 1A0NB 1VIFA 1T0JA 2K7AA 3P8DA 3HPWA 3ME9A 2HMAA 4KH1B 3CCVA 2E5KA 5LJ3f 1QVFS 1H3HA 3NTHA 2K6DA 2LCCA 2LDMA 2K3BA 3EFSA 1D3BA 2GNCA 4RTWA 1Q82C 4EIKA 3RDVA 2RK2A 2DMOA 1OQKA 3EHRA 4PKCC 2DE0X 1KK7A 4C0DB 4AFUC 2XK0A 1W1FA 2C0OA 5FRNA 3QG1A 1U3OA 3M4YA 1X6BA 2JTMA 4PJOE 2LJ0A 2AKKA 3CPWP 4C8QF 1IREB 1QVFA 3CQTA 3JAME 2DBMA 4A4KA 1NBEB 2NUTB 5GMKl 1YWOA 2KI7A 4FYYB 1IZ6A 5GAMj 2OX7A 3AT1B 3NGPA 3ER0A 1YNZA 1N9RA 2PTKA 1BI2A 2L5QA 2GFUA 4KGXB 5D6WA 5KE3A 4M75E 3MEAA 4XQ3A 1D3BB 1M3CA 3E1SA 3EG9A 2LQKA 2YUQA 3UT1A 1ZUUA 2MAMA 1U8RA 3MPUB 2DVEA 2P84A 5EG2A 3CCUA 1UDLA 4FU6A 2PZ1A 1OPLA 5L8RE 2O31A 2LJ1A 4C5EA 1NPPA 5GAMd 3BFMA 1B34A 2KRMA 2HD0A 1GCPA 4ZN3A 2V1RA 2LRQA 2EPDA 2ED0A 5KCOA 1UECA 3JCMc 3OYLA 3GNGA 4JZ3A 3HTRA 4K11A 5HCKA 5CQYA 1VQ6T 2RI2A 3GIBA 3CCRA 3MJXA 3GOXA 1IGQA 5EC7A 2AKLA 4D6WA 4RTXA 1NYFA 2LQWA 1XNIA 3CEYA 3EFOA 3EG9B 4BY6B 2VWFA 5CR2A 3I56A 3LGLA 3AHUA 1QWEA 4C8QG 3VRZA 1T3SA 1G5VA 2FG0A 1UEBA 2DKGA 2L3PA 4OMFB 3RBBB 1VQ8A 4PJOF 1Q7YU 3TVTA 2VUBA 1B34B 4AFSC 1UFFA 3HSBA 3OYAA 2RF0A 1KQSP 5KYNA 4KGVB 2OTLT 2BZ8A 4ELYC 4M7AE 1M90C 4CRIA 3MEUA 3CCEQ 5D7UA 2LT4A 1WIEA 3CCQT 1RAGB 2E10A 1BIAA 4JDSA 2DXTA 1NG2A 3EFOB 3CC4A 1OI1A 4J9CA 3VU3C 2EJGA 4E2FB 4LN2A 1M1KC 2JJ9A 3L2RA 2G6FX 1PD1A 2E3HA 5I2SA 2RI5A 1OEBA 1UG1A 4NL3A 2RHUA 3EGXA 1I81A 3J7AF 3CCSQ 1W2BP 3CC7A 3G6EQ 5GAOl 1JJ2A 2HNIA 2X9HA 3OS5A 5GMKh 1D0ZA 1WXUA 4ZNXA 3META 1BBZA 1PRMC 1YJ9A 1Q7YR 3QIIA 1S1NA 3CCVQ 2WSCE 3UATA 2X4YA 2FEIA 4PJOG 3I55T 1WZOA 4N4HA 5CKEA 2VGNA 2EQMA 1OU8A 3OYYA 3JCMP 1E6GA 4LDWA 2YSQA 1GFCA 2RHYA 4AMCA 3CCJT 2QA4Q 4OF1A 4PJMA 2CKKA 2RQRA 1KD1U 3EGXB 5CIUA 4FYXB 3OYBA 4M7DD 1WJQA 3QJYA 3RKWA 1SEMA 4OB3B 4O5VA 4M75G 4M7AF 1X27A 4RMOA 3H6ZA 4PLLA 2FB7A 1UGQB 3WXMB 4HT9A 4JRKA 3SDZA 3BY7A 1I07A 1R0BG 3RESA 2EQJA 1SSHA 3A8MB 4F16A 3GNFB 4BI3A 2QEXT 3S3OA 5J3BA 1AHJB 1AOJA 3FC3A 2DD4A 2AIRB 2RA2A 2CP3A 1RADB 2KY9A 1XOVA 1S72Q 2DFUA 1W6XA 1QP3A 4F7UA 4AT1B 5GMKj 4Y92A 3DB4A 2QXFA 1MNEA 4Z88A 5GAN2 4BB7A 1VQMT 3URGA 2XD0A 1I5LA 1RI0A 1QQJA 3NFCA 4JJDA 1KD1R 3CC2A 5A2QE 2M0OA 2DXBA 3X26B 2PVDB 2L3RA 2X51A 5CKFA 2DLPA 3I56Q 3L2VA 4PFOA 3THKA 1RABB 3QHSA 3JB9H 1X2KA 1Q81U 2EYWA 1YJWT 1VQ9T 1WPYA 1ZSZC 4M7AG 1PWTA 2Y4YA 5LJ5e 1RUWA 3LGFA 1OPKA 3M0QA 3VYGA 4BACA 2PUKB 4F7UB 1M8VA 2J06A 3CMAT 1QVGS 1ZX6A 2YWWA 4XK8E 1RLQC 1C1AA 1Y71A 1GBRA 1MNDA 4E7IA 3EH2A 4LUEA 1Q82R 2K5FA 1MMDA 1VQLA 2VV5A 1ABOA 2RQWA 1VQNT 1AWJA 2DYIA 2GF7A 1WJSA 4CC4B 1VQ7A 2D1XA 3JSCA 4AFQC 4FT4A 2QQAA 2EQIA 4C0ZA 1KC8U 2KR3A 1BK2A 4GLKA 5GAOr 2QI2A 5GMKm 3JCMb 3MP8A 3OYIA 1NYGA 5GAMf 4B6MA 1N6AA 2E6ZA 4QVCA 1M27C 3A8OB 1LCKA 1TUGB 4KGZB 3CC7Q 2AHJB 1D0YA 2KYMA 3KXTA 3TQ7P 1Q81R 4OB1B 1PC0A 1JO8A 2A36A 4J9BA 5GAN4 4E7KA 1MV3A 3JB9D 1YJ9Q 5FU6C 4DOWA 1M90U 3CD6T 1D09B 3VUZA 1EX4A 3QYHB 4WTOB 5KYXA 2K9GA 5IN1A 3TEEA 3VS4A 2CT3A 4KT0E 2ED1A 4WF2A 2DRKA 1X01A 1D1CA 1M1KU 3ULRB 4ZTFA 3QJ6A 1ZBJA 2L3QA 2LTOA 3QBYA 5KCHA 2ZPHB 1YN8A 2LCSA 3G4SA 4FCYA 2X4JA 3MEWA 3CCLA 4BE0A 1ZA2B 1K4US 4OMLA 1M2OA 4OVAA 1R77A 1P92A 1B07A 1Q95G 1KC8R 4NS5A 2JS2A 4FW2A 2CZ1B 3G7ZA 4ORZA 1M1FA 5AT1B 3ZBDA 2QQ9A 2JMAA 3MP1A 5KYXB 3QWXX 6AT1B 1MMAA 1VQPA 1UGPB 4M77E 1VQ4T 2X4WA 2CUDA 4X9CA 3PFSA 2GFAA 4J6XA 3UA7A 1U1TA 3CCQQ 1BB9A 4N4IA 2DPPB 2KT8A 4M7DE 1M90R 2E64A 3X25B 2I2LA 2BE9B 2DBKA 2QTXA 1E7OA 1M9SA 2KRNA 4FL6A 1PRLC 1QP2A 1WHMA 1UGVA 1ZSZA 2XKOC 2ZCFB 2YUPA 4DQ2A 4JJBA 1M1KR 2A08A 3C94A 3RERA 4C5GA 2MI6A 5LL6S 2ESWA 3CC2Q 2QQSA 2KYBA 4MZTA 2QDYB 4FW1A 5KYUA 5GANg 1K0XA 2DJQA 1OZ2A 2DD5A 3M4GA 4Q5WA 2R58A 2ZPGB 2RQTA 2LCLA 1D1BA 5FW9A 3OYFA 4PL6A 2EQKA 1G3WA 2JTEA
chains in the Genus database with same CATH topology
5HY6A 5GMKi 2OTJT 2XHCA 3FRNA 5GMKl 2RJCA 4TVRA 5GAMj 1IZ6A 1YI2A 3OSSC 4HCZA 2O4XA 1O9SA 3MO8A 1Y07A 3ER0A 3QZ9B 3JCMe 2QEXA 3OS2A 3DLLA 3QO3A 1N9RA 2WACA 3QYGB 2BUDA 1NJIU 1BI2A 2L5QA 2GFUA 4M7AB 5D6WA 2Y90A 1Y96A 4M75E 4BI8B 4QVDA 5KE3A 3MEAA 3OW2A 1GXIE 4XQ3A 1D3BB 4M77D 4MDWA 5FRMA 2LC4A 1K73C 1FX7A 1H641 2EJFA 1RL2A 2IG0A 3E1SA 4XAXB 3TU4K 2LQKA 4M77F 2KVQG 2RO0A 3RKXA 3OBWA 4RG2A 2K3XA 3E9FA 3NTKA 5GANj 2DEQA 5LJ3h 5CVIA 3L2UA 2X35A 3QPHA 2MAMA 3UT1A 1U8RA 1N27A 2DVEA 4C0GA 4XU3A 1VQMA 5EG2A 3CCUA 4XU1A 4FU6A 1G3SA 3M55A 3GPLA 1VQLT 5L8RE 3OQ5A 3T9NA 3LWHA 4M7DF 2CYZB 4C5EA 1HK9A 1FWZA 1NPPA 5GAMd 3BFMA 2HQEA 1B34A 3HHTB 3UDCA 1WQWA 4HKEA 2FVUA 3E19A 4HCBA 1VQ7T 2HD0A 4ZN3A 4E47A 2QQBA 2LRQA 5CAIA 2O4XB 5DLQE 3M5AA 5KCOA 2A7YA 4DA4A 2XIDA 3JCMc 3V8KA 3OYLA 3GNGA 2PUOB 2RD1A 3CCMT 5CQYA 2YLBA 2RI2A 1VQ6T 3GIBA 1YJWA 3CCRA 3GOXA 1VQ9A 2DO3A 4F7UG 5A0GA 1Y96B 2WSEE 1KQSA 3KBGA 5GAMh 3ZFJA 1ZHIA 2RHZA 2E70A 5GANd 4D6WA 4C92E 4BE2A 2O01E 3L42A 5LJ3g 1XNIA 3CEYA 5CR2A 4BY6B 3I56A 1Q86C 3LGLA 3AHUA 2VXEA 2F5TX 2K5IA 4C8QG 1Q82U 4IUUA 3OYJA 1LOJA 4N0AA 3SWNA 5FLXE 3CMAA 3JCMJ 1YCYA 5D6YA 4IUQA 3M58A 1G5VA 3A8GB 1UEBA 4QW2A 2DKGA 3LLRA 5FU6B 1SSFA 1VQKT 1KHCA 4OMFB 1W2BS 1VQ8A 4PJOF 1Q7YU 4MMKA 3X20B 2MWPA 4C8QC 5IT9E 2KSSA 2R5MA 4M78A 4RG8A 4C0FA 2VUBA 1B34B 3CBMA 3QDRB 4OP0A 3OYAA 3HSBA 2XDDA 3UWNA 2E1HA 1VQ5T 1VQNA 1W4SA 3L2QA 2OTLT 3PIPA 5D6XA 2XICA 1KHIA 4ELYC 2RH2A 3CXCS 2YHTA 4M7AE 4IKFA 5GMKe 4ZGDB 3OS0A 5AYFA 1M90C 3SD4A 4CRIA 3MEUA 4EDUA 1YBYA 4LD6A 4JJNK 4XTXA 2LT4A 3CCQT 3V7SA 3CMET 4L5GA 2E10A 2JZ2A 3BDUA 1BIAA 3CPFA 4JDSA 1QVPA 5GAOq 3J81E 2EYQA 3G71T 2DXTA 3OYCA 3PT9A 3G4ST 2YRVA 3LH0A 2K57A 2QQRA 2EKOA 1YIJA 2JTFA 4E7LA 3CC4A 1OI1A 3CCLT 1WNLA 2E6NA 2CGHA 3OSVA 5HK0A 3VU3C 2EJGA 3F70A 4M7DG 3CCET 4MZPA 1K73U 4J7FA 5CCAA 1M1KC 2LQ8A 3A8LB 3SWNB 3L2RA 4YTLA 2P0QA 2EFIA 3CXCA 1K9MC 5I2SA 2RI5A 4RCBA 4V2SA 3FDRA 2JOYA 2LNVA 2RHXA 4II1A 5KE2A 4M7DC 4BUGA 4F7UF 2DTIA 4M78B 4NL3A 2QA4A 3JCMX 2RK1A 3EAEA 2XDBA 2RHUA 1I81A 3J7AF 4DOVA 4C8QD 5FROA 5GAOm 5GAN8 3CC7A 1KG1A 2GQVA 2VYTA 3M56A 4NL2A 4EMKA 3BW1A 3CD6A 1HXDA 1VQPT 2DK3A 2FHDA 4B9WA 5GAOl 3M9QA 1JJ2A 1XTDA 3M53A 2HNIA 2XU8A 1O75A 5CKHA 3OS5A 5GMKh 1FXXA 1WGSA 1H3ZA 3MCAB 3C95A 4J7IA 2V8JA 3R6OA 4JUVA 3META 2FYKA 4A4HA 3Q1JA 2MWOA 3OY9A 3CCST 4ZTJA 1YJ9A 4X34A 2VGMA 2ZPFB 3QIIA 2P0KA 2CZ0B 5LJ3d 1G3YA 1KQ1A 5J26A 1OYXA 1YJNT 3G6ET 3WVEB 2D6FA 4X9DA 2WSCE 4C92F 5GAN3 3L1AA 5DY9A 2X4YA 1DJ7B 4PJOG 4MMLA 3I55T 4N4HA 5CKEA 2VXFA 3LX7A 3JRZA 2VGNA 1PSEA 1VQOA 2EQMA 4N4GA 2DXCA 1Q81C 1QW1A 3OYYA 3QXEB 3JCMP 4QQDA 1K8AC 4LDWA 4J6WA 5I21A 2L89A 2RHYA 1NE8A 2E65A 3GLXA 5CKDA 3M54A 3CCVT 1N8RC 4PJOC 1VIEA 3CCJT 4OF1A 5C6SA 2CKKA 1KD1U 2HBPA 2EIFA 5CIUA 3QUIA 3OYBA 3JCMd 4M7DD 1WJQA 2KMTA 3QJYA 3RKWA 4J8OA 4EMKB 1S72A 4BY6C 2CZ6B 4OB3B 4KUIA 5FU7B 3MP6A 4M75G 4O5VA 3VKIA 5DLOA 1I4K1 3JB9I 4M7AF 2A3LA 2E12A 3JCMV 3H6ZA 4PLLA 4RMOA 4B9XA 5C0MA 2ZPIB 1VQ4A 2FB7A 2LVMA 4LDXA 1UGQB 2JN0A 3WXMB 2K5LA 2L8DA 4M75C 3VJPA 4HT9A 3OYMA 4JRKA 3SDZA 5GAN6 5HK3A 3BY7A 3L2WA 1YITA 4ZN1A 3JCMh 1YHQT 4PLIA 2JNGA 4NOYA 1UGRB 3RESA 2EQJA 3PIOA 1YI2T 3A8MB 4M78E 2JVVA 3HRSA 1KC8C 3VYHB 3OYGA 3GNFB 3NTIA 4BI3A 2DJZA 2QEXT 3S3OA 4LD9K 1W2BA 1NZ9A 1X75C 5J3BA 1K9MU 1AHJB 2RJDA 4KUDK 2R5AA 3OYEA 3FC3A 2PQWA 2DD4A 2RA2A 4ME7A 3HRUA 3GP8A 3C4SA 4PJOD 2C06A 2KY9A 3PMTA 3TCJA 4ZGEB 1XOVA 4JRQA 1M4ZA 1QP3A 4F7UA 4J5YA 4J6YA 5GMKj 3OYDA 3DB4A 2DIQA 4C5IA 2QXFA 3OYKA 2LX9A 5GAN2 4C92G 4XTVA 4BB7A 5GAOp 2G3RA 2K4YA 1JBMA 1VQMT 3CCUT 1M1GA 3BDLA 3URGA 3LYIA 3JCMg 4C8QA 3OYHA 1U1SA 3V8JA 2KQWA 3MHXA 3LWIA 4JS4A 3JCMW 1RI0A 4IUVA 1I5LA 1MHNA 3WVDB 2EAYA 2ZPBB 2M16A 3ASKA 3NFCA 4O6JA 5A0DA 3RMQA 4C92C 5CKBA 3A5ZB 2KDSA 3PNWC 5I2MA 4C0DC 3CC2A 5A2QE 3INZA 2M0OA 2DXBA 4M75D 4P5NA 3X26B 2PVDB 2L3RA 5CKFA 2M1HA 4M75F 5LJ5f 4MZMA 1XQHA 4BE1A 5GAOn 1I8FA 3L2VA 2OTJA 2RI3A 3J80E 2H3JA 2DTOA 4XU0A 3QHSA 3JB9H 1Q81U 4C5HA 3FLGA 1YJWT 3CCRT 3FJPA 1VQ9T 1WPYA 4M7AG 2Y4YA 4QQ6A 1BI0A 3OBYA 1N8RU 4MDXA 5LJ5e 4Y91A 2XDPA 3LGFA 3VYGA 3FB9A 3CBOA 4M77A 4A53A 3C12A 4A4KA 1LNXA 2PU9B 3I56T 4BACA 2PUKB 4F7UB 4E7JA 4HCCA 2RM4A 4HT8A 1X6OA 4XTZA 3FEOA 3DKMA 3HFNA 3JB9G 1M8VA 4M7AC 2D9TA 3CMAT 1QVGS 2X4XA 4EPCA 4GY5A 4XK8E 1Y71A 4C8QB 2F5KA 3GF5A 4M7DA 1VQ8T 3OA6A 4ELZC 4E7IA 5GAN7 2K5FA 3RMSA 2VC8A 2JUFA 3HRTA 2VV5A 3O8VA 1VQLA 1VQNT 4C92D 3LW5E 1MGQA 2GF7A 1WJSA 4M78F 4FM4B 2E5QA 4L59A 1Q7YC 1VQ7A 3JSCA 3OMGA 4FT4A 1ZBXA 2PVGB 1UGSB 2QQAA 3DB3A 4JLIA 2K3YA 4XTYA 4C0ZA 1KC8U 4GLKA 3M59A 1Q86U 5GAOr 2V8IA 2KAFA 3L2ZA 3OS1A 2QI2A 5GMKm 5LJ5h 3A8HB 3JCMb 3CCMA 3MP8A 1YIJT 4M77B 3OYIA 4BDZA 4FIBA 3CC4T 1VQ6A 3OMCA 5GAMf 5IAYA 3S3MA 1OZ3A 1N6AA 1Y7XA 2E6ZA 4EMGA 4QVCA 3V8LA 3A8OB 4Z02A 4BD3A 3FIFA 4OB0B 2CS7A 2DZ9A 3V7CA 4A4GA 4BI4A 5KH6A 4XTUA 1JB0E 2RB6A 3S3NA 4UC4A 3KUFA 4ZGJB 2AHJB 2PVOB 3EFRA 3JCMQ 2D0QB 4M7AD 4M7DB 4PJOA 1V29B 4HA8A 3KXTA 2KK4A 1TH7A 2DAQA 4OB1B 2DXUA 5GAMe 3PGGA 1N9SA 2QA4T 2YLCA 1VUBA 4JS5A 1VQKA 5GAN4 1BKBA 4FSXA 4E7KA 2M9UA 3OYNA 3JB9D 3P8BB 4OGEA 5FU6C 4DOWA 1M90U 3CC7T 4R55A 4OB2B 4XU2A 2MMPA 3CD6T 5GANf 3JB9F 4LDYA 3M57A 4RCCA 3RUXA 3VUZA 4CI0C 2EJ9A 3QYHB 4QVZA 5IN1A 3TEEA 3CBPA 1VQ5A 2IVWA 4J83A 2OTLA 5LJ5g 4L6V5 1KQSS 4FT2A 4KT0E 3RKYA 4M75A 4F7UE 1YJ9T 2WSFE 4WF2A 3SB2A 2LT1A 3P8HA 4RKUE 1X01A 5M9OA 5J39A 3TREA 5GANe 1M5Q1 1M1KU 4ZTFA 1ZQ1A 3QJ6A 2DZCA 2LTOA 5CK9A 3QBYA 5A0LA 5KCHA 3CMEA 3CCQA 1G3TA 2ZPHB 3S6WA 3G71A 4C8QE 2XI9A 3SFMA 3G4SA 1LJOA 4E7HA 2X4JA 3MEWA 1VQOT 2RJFA 3HL8A 3ZEHA 2FL7A 1BI3A 4BE0A 3CCLA 4PJOB 1NPRA 2Y4XA 2EWNA 3CCEA 4OVAA 4JRPA 1P92A 2V8KA 2BIVA 2K2VA 4M78G 4N0AC 3JB9J 3SWNC 3HFOA 4NS5A 1NJIC 3X28B 2CZ1B 2F69A 3G7ZA 4KULA 1M1FA 3ZBDA 3HP9A 2BKDN 3N5BB 5CQXA 2QQ9A 3QKJA 4XTWA 1S72T 2B8AA 4M78C 1WJRA 4A54A 3E9GA 3MP1A 3V7RA 1KQ2A 4R56A 4IUPA 4A4FA 1BYMA 3QZ5B 1KD1C 1VQPA 1UGPB 4M77E 1VQ4T 4M75B 2X4WA 2MF2A 3OB9A 2XD0A 3VUBA 4X9CA 3CPWS 2ZGWA 5HKCA 4KBMB 3PFSA 5LJ5j 2ZPEB 4C92A 2GFAA 3H8ZA 4J6XA 1U1TA 5GANh 3UPUA 1YITT 2RJEA 1BIBA 3CCSA 4N4IA 4PNOA 4Y28E 2DPPB 4A4EA 2OAUA 2P0PA 3PTAA 1K8AU 4LDUA 4M7DE 1JRIA 1YJNA 2E64A 2XG8D 4JRIA 3X25B 3G6EA 2I2LA 3PMIA 5GAMg 1EIFA 4EMHA 3I55A 4QQGA 2QTXA 2DIGA 3RIRA 1M9SA 2CZ7B 2GCXA 4FL6A 2E41A 4LDVA 4M77G 1QP2A 4IURA 1VIFA 4ATOA 2XKOC 2ZCFB 3HKSA 4VUBA 3CPWA 3P8DA 3HPWA 3ME9A 2HAXA 1WQ7A 3MEVA 4DQ2A 5CO7A 3CCVA 3X24B 1PSFA 5DM7R 5LJ3f 3CCJA 4M77C 1JJ2S 1QVFS 4JLGA 3C94A 3NTHA 5LJ3j 3RERA 4M7AA 2DTHA 4C5GA 2LCCA 2MI6A 5LL6S 2LDMA 2NLUA 1UB4A 3EFSA 4OGCA 1D3BA 2QQSA 4IUTA 4MZTA 5LJ5d 2QDYB 1Q82C 3QSUA 2RK2A 5GANg 4M78D 4BDYA 4EMKC 2P4TA 1OZ2A 2DD5A 3M4GA 4PKCC 4Q5WA 5FU7C 5LJ3e 2R58A 4C92B 4C0DB 2RHIA 2ZZDA 2XK0A 2ZPGB 5GAN5 1QVGA 2R57A 3QG1A 5FRNA 1BI1A 2LCLA 3M4YA 2JTMA 3CC2T 4PJOE 1R8OB 4C8QF 1IREB 3OW2S 2EQUA 1QVFA 3OYFA 3JCMf 4PL6A 3JAME 3VV0A 2EQKA 3DLMA 1YHQA 2HQXA 1G3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F70 A;  3OYD A;  3DB4 A;  2DIQ A;  4C5I A;  3OYK A;  4QVZ A;  5IN1 A;  3L2R A;  2RJC A;  2EFI A;  2G3R A;  4HCZ A;  2O4X A;  3MO8 A;  3BDL A;  3OYH A;  3LYI A;  2RI5 A;  3P8H A;  3FDR A;  5M9O A;  5J39 A;  2RHX A;  4II1 A;  1RI0 A;  4IUV A;  5KE2 A;  1MHN A;  2WAC A;  3OS2 A;  4ZTF A;  2M16 A;  2BUD A;  3ASK A;  3QJ6 A;  2LTO A;  3QBY A;  2GFU A;  3EAE A;  3PNW C;  5D6W A;  5KCH A;  5KE3 A;  2RHU A;  3S6W A;  2M0O A;  3MEA A;  5FRO A;  2L3R A;  4E7H A;  2VYT A;  3MEW A;  5FRM A;  2M1H A;  2IG0 A;  2RJF A;  3ZEH A;  2FHD A;  4B9W A;  4BE0 A;  3M9Q A;  2RO0 A;  4BE1 A;  3L2V A;  2RI3 A;  4RG2 A;  4OVA A;  2K3X A;  1WGS A;  3E9F A;  3NTK A;  3L2U A;  1H3Z A;  2X35 A;  3UT1 A;  4C5H A;  1N27 A;  2BIV A;  3FLG A;  3MET A;  4A4H A;  3OY9 A;  3Q1J A;  2MWO A;  4NS5 A;  4ZTJ A;  4FU6 A;  4X34 A;  4QQ6 A;  3QII A;  3OQ5 A;  2P0K A;  5J26 A;  2XDP A;  1OYX A;  3LGF A;  4C5E A;  2BKD N;  3QKJ A;  4BAC A;  2HQE A;  2X4Y A;  4E7J A;  2B8A A;  1WJR A;  3E9G A;  3FEO A;  3MP1 A;  4N4H A;  2D9T A;  3LX7 A;  4IUP A;  4A4F A;  2X4X A;  2EQM A;  4N4G A;  2LRQ A;  2O4X B;  5KCO A;  4GY5 A;  2X4W A;  3OB9 A;  2F5K A;  4QQD A;  3OYL A;  3PFS A;  2L89 A;  2RHY A;  3OA6 A;  2GFA A;  3H8Z A;  4E7I A;  2RI2 A;  2RJE A;  5C6S A;  2CKK A;  3GOX A;  4N4I A;  4A4E A;  5CIU A;  3O8V A;  3OYB A;  1WJQ A;  2RHZ A;  4BE2 A;  3L42 A;  1XNI A;  3CEY A;  2GF7 A;  1WJS A;  3PMI A;  2E5Q A;  3LGL A;  3MP6 A;  4L59 A;  4QQG A;  2DIG A;  4FL6 A;  3OMG A;  3H6Z A;  4IUU A;  4PLL A;  3OYJ A;  4IUR A;  5D6Y A;  4IUQ A;  1G5V A;  3DB3 A;  4B9X A;  2K3Y A;  5C0M A;  4QW2 A;  2LVM A;  3LLR A;  3P8D A;  1SSF A;  1KHC A;  3ME9 A;  3MEV A;  2L8D A;  3OS1 A;  2MWP A;  3OYM A;  2R5M A;  3L2W A;  3MP8 A;  3OYI A;  4BDZ A;  3NTH A;  3OMC A;  5IAY A;  3S3M A;  4C5G A;  1OZ3 A;  2LCC A;  4PLI A;  2LDM A;  3OYA A;  2NLU A;  2EQJ A;  4Z02 A;  4BD3 A;  2QQS A;  3UWN A;  4IUT A;  4A4G A;  5KH6 A;  3L2Q A;  4BDY A;  3S3N A;  5D6X A;  4UC4 A;  3KUF A;  3OYG A;  4IKF A;  3NTI A;  1OZ2 A;  3OS0 A;  4Q5W A;  3SD4 A;  3S3O A;  2R58 A;  4CRI A;  3MEU A;  4EDU A;  2DAQ A;  2RHI A;  4LD6 A;  2XK0 A;  2RJD A;  5FRN A;  2R57 A;  2R5A A;  3OYE A;  3FC3 A;  2JZ2 A;  2PQW A;  4E7K A;  3C4S A;  3OYN A;  3OYC A;  3PMT A;  2EQU A;  2YRV A;  3LH0 A;  2QQR A;  3OYF A;  2EKO A;  4PL6 A;  2JTF A;  4E7L A;  1OI1 A;  2EQK A;  3DLM A;  2E6N A;  2HQX A; 
#chains in the Genus database with same CATH topology
 3I55 Q;  5HY6 A;  2OTJ T;  4F14 A;  1UJ0 A;  1ZSZ B;  4HCZ A;  2O4X A;  2PNI A;  3JCM e;  3OS2 A;  1NJI U;  3IQL A;  1GXI E;  1PKT A;  2CP5 A;  4A63 B;  1VQL Q;  2LC4 A;  1H64 1;  2CH4 A;  5KYU B;  3TU4 K;  1QVF P;  4M77 F;  4RG2 A;  3E9F A;  3NTK A;  3QPH A;  4C0G A;  2GGR A;  4XU1 A;  5IHN A;  3M55 A;  4J9H A;  4M7D F;  2MPX C;  1HK9 A;  2CDT A;  2EBP A;  2HQE A;  3HHT B;  1WQW A;  4HKE A;  2KRS A;  1QWF A;  2CP2 A;  4E47 A;  1M8M A;  4QT7 A;  2O4X B;  3M5A A;  2A7Y A;  4DA4 A;  3H41 A;  1X6G A;  2PUO B;  3CCM T;  2O88 A;  4GBQ A;  3R6N A;  2EYY A;  5GAM h;  1TUC A;  1X43 A;  2O01 E;  5LJ3 g;  2DL7 A;  2MOX A;  1Q86 C;  1AD5 A;  2K5I A;  4IUU A;  5D6Y A;  1AZG B;  4IUQ A;  3U23 A;  4DBR A;  1VQM Q;  1T3L A;  3LLR A;  5FU6 B;  4RG8 A;  4C0F A;  3QDR B;  1WHG A;  3UWN A;  1VQ5 T;  1W4S A;  3G4S Q;  3PIP A;  1WHK A;  5D6X A;  3CXC S;  5GJV B;  2RH2 A;  3D7S B;  2COY A;  3CCL Q;  4ZGD B;  4LD6 A;  4JJN K;  1VQ9 Q;  4XTX A;  2DL5 A;  3BDU A;  2JZ2 A;  5FWB A;  3G71 T;  2EYQ A;  3OYC A;  3PT9 A;  1CKB A;  1AWO A;  2EKO A;  2RMO A;  2E6N A;  3F70 A;  4M7D G;  1TWB A;  4J7F A;  3VS1 A;  2CUB A;  2P0Q A;  1OV3 A;  2EFI A;  3CXC A;  4RTZ A;  1VQP Q;  4V2S A;  3FDR A;  2JOY A;  2I0N A;  1IO6 A;  2QA4 A;  2RPN A;  3EGD A;  2RK1 A;  3EAE A;  3M0S A;  1F1B B;  4PJL A;  4AFZ C;  4Z8A A;  4DOV A;  5FRO A;  1VQN Q;  1YCS B;  2GQV A;  3M56 A;  1HXD A;  4DEY A;  2JM8 A;  2DK3 A;  3M9Q A;  1XTD A;  2QG9 B;  2XU8 A;  1ACM B;  4J9G A;  3C95 A;  2V8J A;  4JUV A;  3OY9 A;  3Q1J A;  1ARK A;  2L3S A;  4X34 A;  2HCK A;  1TSF A;  1U5S A;  2HEQ A;  5J26 A;  1OYX A;  1YJN T;  1VA7 A;  3REA B;  3L1A A;  5GAN 3;  2GQI A;  2HL5 C;  2IPO B;  3VS5 A;  1PSE A;  1VQO A;  4N4G A;  1Q81 C;  4GLM A;  2MIO A;  1K8A C;  1JJ2 P;  1NE8 A;  3VRY A;  3M54 A;  2MYS A;  3EGD B;  2HBP A;  1QCF A;  3QUI A;  4F04 B;  1RAC B;  3CD6 Q;  4J8O A;  1S72 A;  4KUI A;  3MP6 A;  2ZPI B;  1H8K A;  2W0Z A;  2O2O A;  1YHQ T;  2RQU A;  1TG0 A;  1UGR B;  1Z9Z A;  4NOY A;  3EHQ A;  1YI2 T;  1CSK A;  2JVV A;  3NHN A;  2ROT A;  2BZY A;  3HRS A;  4Z89 A;  1KC8 C;  3VS3 A;  1M30 A;  4LD9 K;  2IIM A;  2NWM A;  1SG5 A;  1K9M U;  4ME7 A;  1GBQ A;  1PG5 B;  2DL8 A;  2EKH A;  3TCJ A;  3FJ5 A;  1VQ4 Q;  2G3R A;  2K4Y A;  1JBM A;  2FRW A;  1UJY A;  1VYU A;  3BDL A;  3JCM g;  1U1S A;  3V8J A;  2KQW A;  4JS4 A;  3JCM W;  4IUV A;  1MHN A;  2E4H A;  2KXD A;  4C92 C;  5CKB A;  3A5Z B;  2RNA A;  3INZ A;  2DRM A;  2M1H A;  4M75 F;  2YRD A;  4BE1 A;  5GAO n;  2DER A;  2V1Q A;  4QQ6 A;  1BI0 A;  1WXT A;  1N8R U;  4Y91 A;  1YP5 A;  2M0Y A;  4A53 A;  2YRC A;  1LNX A;  4HCC A;  2YUN A;  2D8J A;  3HFN A;  3JB9 G;  3RNJ A;  2H3E B;  1QMC A;  2YUO A;  2CP0 A;  1ZLM A;  4EPC A;  2M51 A;  1MMG A;  3OA6 A;  4ELZ C;  2KE9 A;  4FYV B;  5GAN 7;  8ATC B;  3M0R A;  2DF6 A;  1FYN A;  1ZBX A;  2PVG B;  1UGS B;  4R0K A;  1Q86 U;  2KAF A;  5LJ5 h;  1VQ6 A;  1YIJ T;  2KRO A;  4FIB A;  5ECA A;  3S3M A;  4EMG A;  3V8L A;  4Z02 A;  4BD3 A;  3FIF A;  4BI4 A;  3V7C A;  4A4G A;  2H8H A;  2RB6 A;  2HDA A;  4ZGJ B;  2PVO B;  1TH7 A;  3JV3 A;  2YLC A;  1JXM A;  4JS5 A;  1IRX A;  1OUL A;  2CSI A;  4FSX A;  2FZC B;  4OB2 B;  3M57 A;  4CI0 C;  4RUG A;  2OTL A;  4L6V 5;  1KQS S;  3RKY A;  1VQO Q;  4F7U E;  3SB2 A;  2LT1 A;  1W70 A;  4RKU E;  5GAN e;  3CCM Q;  1ZQ1 A;  5CK9 A;  3CCQ A;  3SFM A;  2C0T A;  1D1A A;  2RJF A;  3HL8 A;  1ABQ A;  2VKN A;  4ESR A;  3I5S A;  4N0A C;  1Q86 R;  1NJI C;  2F69 A;  1UHF A;  1NM7 A;  4XTW A;  2B8A A;  4M78 C;  3V7R A;  4PK4 A;  1VQ5 Q;  4OMM A;  3QZ5 B;  2EW3 A;  3OB9 A;  2MF2 A;  5HKC A;  5LJ5 j;  1RLP C;  2ZPE B;  4C92 A;  3UPU A;  1YIT T;  1B3Q A;  2RJE A;  1BIB A;  4PNO A;  1VOM A;  3G71 Q;  2OAU A;  1K8A U;  3UF4 A;  1V1C A;  2GTJ A;  2QGG A;  1I5O B;  2GBQ A;  5GAM g;  1EIF A;  4EMH A;  3I55 A;  2DIG A;  1ZUY A;  1KIK A;  4ATO A;  4JZ4 A;  2HAX A;  4CC3 A;  3MEV A;  2ZAE A;  5DM7 R;  3CCJ A;  4M77 C;  1I0C A;  4JLG A;  1WHH A;  5LJ3 j;  2D0N A;  2DTH A;  4OGC A;  5LJ5 d;  3EH1 A;  4IUT A;  4BDY A;  4AG1 C;  4EMK C;  2BTT A;  5LJ3 e;  5FU7 C;  4C92 B;  2CT4 A;  1SHF A;  5GAN 5;  1QVG A;  1BI1 A;  2AT1 B;  1C6V X;  3OW2 S;  2EQU A;  3I35 A;  3DLM A;  5GMK i;  2XHC A;  2LJ3 A;  1E6H A;  2ECZ A;  4PFZ A;  1O9S A;  1Y07 A;  2VB6 A;  2QK0 A;  2QEX A;  2WAC A;  1M3B A;  2Y90 A;  1Y96 A;  2EYZ A;  1K8A R;  2KNB B;  3OW2 A;  4MDW A;  2QAS A;  2EJF A;  4XAX B;  2FPD A;  2KVQ G;  3RKX A;  1PHT A;  3H0F A;  1OOT A;  5CVI A;  2X35 A;  2EGC A;  1N27 A;  4XU3 A;  1VQM A;  3OQ5 A;  3T9N A;  3LWH A;  1HJD A;  2CYZ B;  1K76 A;  1VYV A;  1YHQ Q;  1VQ6 Q;  3E19 A;  2KEA A;  2EGA A;  4HCB A;  1YI2 Q;  2QQB A;  2OJ2 A;  1PKS A;  2XID A;  1T0H A;  2SEM A;  2RD1 A;  2YLB A;  1YJW A;  2QGF B;  1VQ9 A;  4F7U G;  1Y96 B;  2WSE E;  1KFZ A;  3KBG A;  1OX8 A;  3ZFJ A;  4BE2 A;  1J3T A;  2MK5 A;  3NMZ C;  3VS7 A;  3JCM J;  1LOJ A;  4N0A A;  3CMA A;  5FLX E;  2NUP A;  3M58 A;  4QW2 A;  2OTL Q;  1VQK T;  1KHC A;  2MWP A;  4C8Q C;  1WX6 A;  4M78 A;  1HD3 A;  4LUD A;  1WDX A;  4J9E A;  2XDD A;  1VQN A;  2E1H A;  1JXO A;  3L2Q A;  1SKU B;  4OMN A;  2XIC A;  3OS0 A;  5AYF A;  2QDL A;  3SD4 A;  1YBY A;  4FSS A;  2QYZ A;  3V7S A;  3CME T;  4L5G A;  3CPF A;  5GAO q;  3LH0 A;  4QKU A;  3H0I A;  3OSV A;  4HCK A;  3CCE T;  1K73 U;  5CCA A;  1SHG A;  4OMP A;  3A8L B;  2NUP B;  4KH0 B;  1K9M C;  4RCB A;  2RQV A;  2RHX A;  2LNV A;  5KE2 A;  4BUG A;  4M78 B;  3JCM X;  2FPE A;  5GAO m;  5GAN 8;  4NL2 A;  2J05 A;  4EMK A;  3CD6 A;  2L2P A;  2FHD A;  4B9W A;  4ANJ A;  3M53 A;  4X1V A;  5CKH A;  1O75 A;  1IXD A;  1WGS A;  1H3Z A;  3MCA B;  3H0H A;  3GBQ A;  4A4H A;  3CCS T;  4ZTJ A;  2A37 A;  3CXC P;  2ZPF B;  2VGM A;  1FMV A;  2P0K A;  1KQ1 A;  1YIJ Q;  3G6E T;  5DY9 A;  2VAS A;  3CCJ Q;  1DJ7 B;  2VXF A;  2DXC A;  1QW1 A;  1AWX A;  4QQD A;  2CP6 A;  2L89 A;  3GLX A;  3CCV T;  4PJO C;  1GRI A;  1N8R C;  1VIE A;  1TXQ A;  2EIF A;  1FMW A;  2KT1 A;  2JXB A;  4F17 A;  3JCM d;  4HXJ A;  2DVJ A;  2BE7 D;  2KMT A;  3M0T A;  4EMK B;  4BY6 C;  5FU7 B;  3VKI A;  1I4K 1;  1K73 R;  3VS6 A;  1D0X A;  4B9X A;  5C0M A;  1VQ4 A;  2LVM A;  4LDX A;  2JN0 A;  2K5L A;  4M75 C;  3VJP A;  2DL4 A;  2QEX Q;  1GFD A;  4J9I A;  3C0C A;  1K0S A;  2F2V A;  1MMN A;  4DEX A;  3OYG A;  1JQQ A;  2EVR A;  4KUD K;  1H92 A;  2R5A A;  2Z0W A;  3OYE A;  3HRU A;  3GP8 A;  3C4S A;  4ZGE B;  3H9N A;  4JRQ A;  1M4Z A;  1SF9 A;  3M0U A;  4D8D A;  2HL3 A;  1NJI R;  1WFW A;  3OYD A;  3OYK A;  2LX9 A;  4M4Z A;  4XTV A;  5GAO p;  3CCU T;  3OYH A;  2FZK B;  3LYI A;  4C8Q A;  2DNU A;  3MHX A;  2EAY A;  1WI7 A;  2M16 A;  2ZPB B;  2KDS A;  1KJW A;  1YJW Q;  5LJ5 f;  1K9A A;  4MZM A;  9ATC B;  1G83 A;  2W10 A;  2RI3 A;  2OTJ A;  2DM1 A;  5I22 A;  3FLG A;  3CCR T;  3CMA Q;  5KYW A;  3OBY A;  2D8H A;  2XDP A;  2EYX A;  3CBO A;  1NLP C;  3I56 T;  4E7J A;  1HSQ A;  4HT8 A;  3EG2 A;  2QAZ A;  3DKM A;  4M7A C;  1BU1 A;  2D9T A;  1QKX A;  4C8Q B;  3GF5 A;  3KFV A;  1VQ8 T;  4E6R A;  2YT6 A;  1TUD A;  2LX7 A;  3RMS A;  2VC8 A;  1RI9 A;  3O5Z A;  4C92 D;  3PVQ A;  4OMO A;  4FM4 B;  2E5Q A;  4L59 A;  2YDL A;  1C0M A;  1AVZ C;  4XTY A;  2K3Y A;  5KYW B;  3M59 A;  2V8I A;  3OS1 A;  3CCM A;  4BDZ A;  3CC4 T;  4CC2 A;  2K2M A;  1MUZ A;  1Y7X A;  4OB0 B;  2DZ9 A;  4XTU A;  3KUF A;  4PJO A;  3EFR A;  1EFN A;  4HA8 A;  2ATC B;  1AZE A;  2DXU A;  5GAM e;  1N9S A;  1VUB A;  4JJC A;  1BKB A;  3PE0 A;  5IXB A;  3VS2 A;  3P8B B;  4OGE A;  3CC7 T;  4R55 A;  4XU2 A;  1RAF B;  3JB9 F;  3RUX A;  4HVW A;  1GCQ C;  1TS9 A;  2AZV A;  3CBP A;  1VQ5 A;  2IVW A;  4J83 A;  3PVL A;  1V76 A;  4FT2 A;  4M75 A;  5IHK A;  4D8K A;  1YJ9 T;  2WSF E;  3REB B;  5M9O A;  5J39 A;  3TRE A;  1M5Q 1;  2P4R A;  2LQN A;  3S6W A;  2HQH A;  3G71 A;  2XI9 A;  1LJO A;  2DL3 A;  1BI3 A;  2OI3 A;  4PJO B;  2Y4X A;  4LE9 A;  2V8K A;  3JB9 J;  2KGT A;  3SWN C;  2A0F B;  1VQK Q;  1G2B A;  4KUL A;  2BKD N;  1M2V A;  3QKJ A;  2HBW A;  4A54 A;  1WJR A;  3E9G A;  1PNJ A;  4IUP A;  1BYM A;  2DX1 A;  2DET A;  1SRM A;  4M75 B;  1R0C B;  3VUB A;  3CPW S;  2ZGW A;  4KBM B;  5GAN h;  1EZZ B;  3CME Q;  2ENM A;  4RTU A;  2FZG B;  3PTA A;  1YJN A;  2XG8 D;  4JRI A;  1SPK A;  4QQG A;  2GCX A;  2CZ7 B;  4IUR A;  3HKS A;  4VUB A;  3CPW A;  1WQ7 A;  5CO7 A;  3X24 B;  1PSF A;  1JJ2 S;  1M2V B;  3SHW A;  2YXY A;  4M7A A;  1K9M R;  2NLU A;  1UB4 A;  2V26 A;  3QSU A;  4M78 D;  2P4T A;  2O9V A;  2OTJ Q;  2RHI A;  2ZZD A;  1PD0 A;  1Y57 A;  2R57 A;  3CC2 T;  1QCN A;  2DYB A;  1R8O B;  5IH2 A;  3JCM f;  3VV0 A;  1YHQ A;  2HQX A;  1ZSG A;  3FRN A;  2RJC A;  4TVR A;  1YI2 A;  1TTH B;  3OSS C;  3MO8 A;  4WCI A;  3QZ9 B;  1UUE A;  1CKA A;  2EGE A;  1IGU A;  3DLL A;  3QO3 A;  3QYG B;  2COW A;  2BUD A;  2GTO A;  4M7A B;  4BI8 B;  4QVD A;  1QVG P;  4M77 D;  5FRM A;  1K73 C;  1N8R R;  1FX7 A;  1RL2 A;  2IG0 A;  1PCX A;  2RO0 A;  2FRY A;  3OBW A;  2AK5 A;  2K3X A;  5GAN j;  2DEQ A;  5LJ3 h;  1RAE B;  3L2U A;  1B7T A;  3GPL A;  1G3S A;  4RTV A;  1VQL T;  1AEY A;  1FWZ A;  2O9S A;  3ZL7 C;  2DEU A;  1WHL A;  1GCQ A;  3UDC A;  2FVU A;  1VQ7 T;  3OW2 P;  2CRE A;  5CAI A;  5DLQ E;  3V8K A;  1JEG A;  2DO3 A;  5A0G A;  1KQS A;  2C0I A;  1ZHI A;  2RHZ A;  2E70 A;  5GAN d;  4C92 E;  3L42 A;  3EG0 A;  2K79 A;  2VXE A;  2F5T X;  1Q82 U;  3OYJ A;  3SWN A;  1YCY A;  2J6F A;  3A8G B;  2M02 A;  4LNP A;  3CCU Q;  2CSQ A;  1SSF A;  1Y0M A;  1W2B S;  4MMK A;  3X20 B;  4AG2 C;  5FWC A;  5IT9 E;  2KSS A;  1LVK A;  2R5M A;  2JT4 A;  1X2Q A;  2NUZ A;  1GL5 A;  3CBM A;  3A98 A;  4OP0 A;  3TSW A;  2JS0 A;  1Z9Q A;  2KXC A;  3NPF A;  1KHI A;  2YHT A;  4IKF A;  5GMK e;  1I1J A;  1SRL A;  4EDU A;  7AT1 B;  3CCR Q;  1IHV A;  1W2B A;  1QVP A;  3J81 E;  1BCM A;  1WHJ A;  2YRV A;  3G4S T;  2K57 A;  2DIL A;  2QQR A;  1YIJ A;  2JTF A;  4E7L A;  3CCL T;  1WNL A;  2CGH A;  5HK0 A;  4MZP A;  2LQ8 A;  3SWN B;  4YTL A;  3EG1 A;  2ABL A;  1MV0 B;  1VQ8 Q;  2CH4 W;  4II1 A;  4M7D C;  4F7U F;  2DTI A;  2XDB A;  4C8Q D;  4CC7 A;  1KG1 A;  2VYT A;  3BW1 A;  1YJN Q;  1VQP T;  1QKW A;  5L23 A;  2JM9 A;  1FXX A;  1JU5 C;  1X69 A;  4J7I A;  3I9Q A;  3R6O A;  2FYK A;  1UHC A;  2MWO A;  2LZ6 B;  1AT1 B;  2CP7 A;  1M3A A;  5LJ3 d;  2CZ0 B;  2D6F A;  1G3Y A;  3WVE B;  4X9D A;  4C92 F;  3CC4 Q;  2HSE B;  3BE3 A;  4MML A;  1NLO C;  3LX7 A;  3JRZ A;  4E7Z A;  3QXE B;  4J6W A;  1WLP B;  1YFN A;  2E3I A;  2HSP A;  4DBH A;  5CKD A;  2E65 A;  5I21 A;  2L0A A;  1LPL A;  1WXB A;  5C6S A;  2HZY A;  1U06 A;  1IHW A;  2CZ6 B;  4J9D A;  2ROL A;  2X3X D;  5DLO A;  3JB9 I;  5GJW B;  2A3L A;  2E12 A;  3JCM V;  2F1L A;  1TU0 B;  5KYY A;  5IHI A;  8AT1 B;  2L8D A;  4DBQ A;  3OYM A;  3L2W A;  1YIT A;  5GAN 6;  5HK3 A;  2FO0 A;  4ZN1 A;  3JCM h;  4PLI A;  2JNG A;  3PIO A;  4PJN A;  4M78 E;  3VYH B;  3NTI A;  1AWW A;  2DJZ A;  3TSZ A;  1NZ9 A;  1X75 C;  2RJD A;  1RAA B;  3SEM A;  2PQW A;  4PJO D;  2J6K A;  2C06 A;  4HVU A;  3PMT A;  4JPB W;  1N5Z A;  4E7S A;  2RN8 A;  4J5Y A;  4J6Y A;  2DIQ A;  4C5I A;  4C92 G;  5KYY B;  1ZUK A;  1M1G A;  3LWI A;  3I5R A;  3WVD B;  4O6J A;  1PM3 A;  2SRC A;  3ASK A;  5A0D A;  3RMQ A;  4C0D C;  3PNW C;  5I2M A;  4M75 D;  4P5N A;  1BCO A;  1XQH A;  3UA6 A;  1I8F A;  3J80 E;  2H3J A;  2DTO A;  4XU0 A;  3M0P A;  1OU9 A;  4C5H A;  1VYT A;  3FJP A;  4KRT A;  2LP5 A;  3QWY A;  4MDX A;  3FB9 A;  4M77 A;  3C12 A;  2PU9 B;  2RM4 A;  1X6O A;  4XTZ A;  3FEO A;  2QTV A;  2X4X A;  2COZ A;  4LXC A;  4GY5 A;  2F5K A;  4M7D A;  2A28 A;  1UE9 A;  3MKD A;  1FMK A;  2F2X A;  2JUF A;  3HRT A;  3O8V A;  2BZX A;  3A1P A;  3LW5 E;  2MCN A;  1MGQ A;  4M78 F;  1TOV A;  2VVK A;  1Q7Y C;  3OMG A;  1HYO A;  2NYS A;  3DB3 A;  4JLI A;  2J7I A;  2J6O A;  2FPF A;  3L2Z A;  3A8H B;  4HVV A;  4M77 B;  3E2U A;  3VS0 A;  3OMC A;  5IAY A;  1OZ3 A;  1QLY A;  2CS7 A;  5KH6 A;  1JB0 E;  3S3N A;  4UC4 A;  3JCM Q;  4M7A D;  2D0Q B;  1K1Z A;  4M7D B;  1V29 B;  2KK4 A;  2DAQ A;  3PGG A;  2QA4 T;  1VQK A;  4IIM A;  2B86 A;  5I11 A;  4J9F A;  2M9U A;  3OYN A;  3LH5 A;  2HKQ B;  2X3W D;  1XJW B;  2MMP A;  5GAN f;  1KSW A;  4LDY A;  4RCC A;  4IIO A;  2EJ9 A;  1VQ7 Q;  1NEG A;  2HKN A;  5IXF A;  1IB8 A;  4QVZ A;  3G1J A;  2JW4 A;  3EGU A;  2LNH B;  5LJ5 g;  3P8H A;  2F2W A;  2LMJ A;  3QDF A;  1G8X A;  2DZC A;  5A0L A;  2AZS A;  1QCO A;  3CME A;  1RAI B;  1G3T A;  4C8Q E;  1YWP A;  4E7H A;  1VQO T;  3ZEH A;  2FL7 A;  1NPR A;  4RTY A;  2EWN A;  3CCE A;  4JRP A;  2BIV A;  2K2V A;  4M78 G;  4FYW B;  2OAW A;  1RAH B;  1ZA1 B;  3HFO A;  2XMF A;  3X28 B;  4RTT A;  4OMQ A;  3HP9 A;  2JMC A;  3N5B B;  5CQX A;  1S72 T;  1YIT Q;  1KQ2 A;  4R56 A;  4A4F A;  4PJJ A;  1WYX A;  1OX9 A;  2DA9 A;  1KD1 C;  4DBF A;  4PFP A;  1WA7 A;  3RR6 A;  3H8Z A;  2KBT A;  3CCS A;  1UTI A;  4Y28 E;  4A4E A;  2P0P A;  4LDU A;  1JRI A;  3G6E A;  1NEB A;  3PMI A;  3EG3 A;  2NUT A;  3RIR A;  4M77 G;  4LDV A;  2E41 A;  1A0N B;  1VIF A;  1T0J A;  2K7A A;  3P8D A;  3HPW A;  3ME9 A;  2HMA A;  4KH1 B;  3CCV A;  2E5K A;  5LJ3 f;  1QVF S;  1H3H A;  3NTH A;  2K6D A;  2LCC A;  2LDM A;  2K3B A;  3EFS A;  1D3B A;  2GNC A;  4RTW A;  1Q82 C;  4EIK A;  3RDV A;  2RK2 A;  2DMO A;  1OQK A;  3EHR A;  4PKC C;  2DE0 X;  1KK7 A;  4C0D B;  4AFU C;  2XK0 A;  1W1F A;  2C0O A;  5FRN A;  3QG1 A;  1U3O A;  3M4Y A;  1X6B A;  2JTM A;  4PJO E;  2LJ0 A;  2AKK A;  3CPW P;  4C8Q F;  1IRE B;  1QVF A;  3CQT A;  3JAM E;  2DBM A;  4A4K A;  1NBE B;  2NUT B;  5GMK l;  1YWO A;  2KI7 A;  4FYY B;  1IZ6 A;  5GAM j;  2OX7 A;  3AT1 B;  3NGP A;  3ER0 A;  1YNZ A;  1N9R A;  2PTK A;  1BI2 A;  2L5Q A;  2GFU A;  4KGX B;  5D6W A;  5KE3 A;  4M75 E;  3MEA A;  4XQ3 A;  1D3B B;  1M3C A;  3E1S A;  3EG9 A;  2LQK A;  2YUQ A;  3UT1 A;  1ZUU A;  2MAM A;  1U8R A;  3MPU B;  2DVE A;  2P84 A;  5EG2 A;  3CCU A;  1UDL A;  4FU6 A;  2PZ1 A;  1OPL A;  5L8R E;  2O31 A;  2LJ1 A;  4C5E A;  1NPP A;  5GAM d;  3BFM A;  1B34 A;  2KRM A;  2HD0 A;  1GCP A;  4ZN3 A;  2V1R A;  2LRQ A;  2EPD A;  2ED0 A;  5KCO A;  1UEC A;  3JCM c;  3OYL A;  3GNG A;  4JZ3 A;  3HTR A;  4K11 A;  5HCK A;  5CQY A;  1VQ6 T;  2RI2 A;  3GIB A;  3CCR A;  3MJX A;  3GOX A;  1IGQ A;  5EC7 A;  2AKL A;  4D6W A;  4RTX A;  1NYF A;  2LQW A;  1XNI A;  3CEY A;  3EFO A;  3EG9 B;  4BY6 B;  2VWF A;  5CR2 A;  3I56 A;  3LGL A;  3AHU A;  1QWE A;  4C8Q G;  3VRZ A;  1T3S A;  1G5V A;  2FG0 A;  1UEB A;  2DKG A;  2L3P A;  4OMF B;  3RBB B;  1VQ8 A;  4PJO F;  1Q7Y U;  3TVT A;  2VUB A;  1B34 B;  4AFS C;  1UFF A;  3HSB A;  3OYA A;  2RF0 A;  1KQS P;  5KYN A;  4KGV B;  2OTL T;  2BZ8 A;  4ELY C;  4M7A E;  1M90 C;  4CRI A;  3MEU A;  3CCE Q;  5D7U A;  2LT4 A;  1WIE A;  3CCQ T;  1RAG B;  2E10 A;  1BIA A;  4JDS A;  2DXT A;  1NG2 A;  3EFO B;  3CC4 A;  1OI1 A;  4J9C A;  3VU3 C;  2EJG A;  4E2F B;  4LN2 A;  1M1K C;  2JJ9 A;  3L2R A;  2G6F X;  1PD1 A;  2E3H A;  5I2S A;  2RI5 A;  1OEB A;  1UG1 A;  4NL3 A;  2RHU A;  3EGX A;  1I81 A;  3J7A F;  3CCS Q;  1W2B P;  3CC7 A;  3G6E Q;  5GAO l;  1JJ2 A;  2HNI A;  2X9H A;  3OS5 A;  5GMK h;  1D0Z A;  1WXU A;  4ZNX A;  3MET A;  1BBZ A;  1PRM C;  1YJ9 A;  1Q7Y R;  3QII A;  1S1N A;  3CCV Q;  2WSC E;  3UAT A;  2X4Y A;  2FEI A;  4PJO G;  3I55 T;  1WZO A;  4N4H A;  5CKE A;  2VGN A;  2EQM A;  1OU8 A;  3OYY A;  3JCM P;  1E6G A;  4LDW A;  2YSQ A;  1GFC A;  2RHY A;  4AMC A;  3CCJ T;  2QA4 Q;  4OF1 A;  4PJM A;  2CKK A;  2RQR A;  1KD1 U;  3EGX B;  5CIU A;  4FYX B;  3OYB A;  4M7D D;  1WJQ A;  3QJY A;  3RKW A;  1SEM A;  4OB3 B;  4O5V A;  4M75 G;  4M7A F;  1X27 A;  4RMO A;  3H6Z A;  4PLL A;  2FB7 A;  1UGQ B;  3WXM B;  4HT9 A;  4JRK A;  3SDZ A;  3BY7 A;  1I07 A;  1R0B G;  3RES A;  2EQJ A;  1SSH A;  3A8M B;  4F16 A;  3GNF B;  4BI3 A;  2QEX T;  3S3O A;  5J3B A;  1AHJ B;  1AOJ A;  3FC3 A;  2DD4 A;  2AIR B;  2RA2 A;  2CP3 A;  1RAD B;  2KY9 A;  1XOV A;  1S72 Q;  2DFU A;  1W6X A;  1QP3 A;  4F7U A;  4AT1 B;  5GMK j;  4Y92 A;  3DB4 A;  2QXF A;  1MNE A;  4Z88 A;  5GAN 2;  4BB7 A;  1VQM T;  3URG A;  2XD0 A;  1I5L A;  1RI0 A;  1QQJ A;  3NFC A;  4JJD A;  1KD1 R;  3CC2 A;  5A2Q E;  2M0O A;  2DXB A;  3X26 B;  2PVD B;  2L3R A;  2X51 A;  5CKF A;  2DLP A;  3I56 Q;  3L2V A;  4PFO A;  3THK A;  1RAB B;  3QHS A;  3JB9 H;  1X2K A;  1Q81 U;  2EYW A;  1YJW T;  1VQ9 T;  1WPY A;  1ZSZ C;  4M7A G;  1PWT A;  2Y4Y A;  5LJ5 e;  1RUW A;  3LGF A;  1OPK A;  3M0Q A;  3VYG A;  4BAC A;  2PUK B;  4F7U B;  1M8V A;  2J06 A;  3CMA T;  1QVG S;  1ZX6 A;  2YWW A;  4XK8 E;  1RLQ C;  1C1A A;  1Y71 A;  1GBR A;  1MND A;  4E7I A;  3EH2 A;  4LUE A;  1Q82 R;  2K5F A;  1MMD A;  1VQL A;  2VV5 A;  1ABO A;  2RQW A;  1VQN T;  1AWJ A;  2DYI A;  2GF7 A;  1WJS A;  4CC4 B;  1VQ7 A;  2D1X A;  3JSC A;  4AFQ C;  4FT4 A;  2QQA A;  2EQI A;  4C0Z A;  1KC8 U;  2KR3 A;  1BK2 A;  4GLK A;  5GAO r;  2QI2 A;  5GMK m;  3JCM b;  3MP8 A;  3OYI A;  1NYG A;  5GAM f;  4B6M A;  1N6A A;  2E6Z A;  4QVC A;  1M27 C;  3A8O B;  1LCK A;  1TUG B;  4KGZ B;  3CC7 Q;  2AHJ B;  1D0Y A;  2KYM A;  3KXT A;  3TQ7 P;  1Q81 R;  4OB1 B;  1PC0 A;  1JO8 A;  2A36 A;  4J9B A;  5GAN 4;  4E7K A;  1MV3 A;  3JB9 D;  1YJ9 Q;  5FU6 C;  4DOW A;  1M90 U;  3CD6 T;  1D09 B;  3VUZ A;  1EX4 A;  3QYH B;  4WTO B;  5KYX A;  2K9G A;  5IN1 A;  3TEE A;  3VS4 A;  2CT3 A;  4KT0 E;  2ED1 A;  4WF2 A;  2DRK A;  1X01 A;  1D1C A;  1M1K U;  3ULR B;  4ZTF A;  3QJ6 A;  1ZBJ A;  2L3Q A;  2LTO A;  3QBY A;  5KCH A;  2ZPH B;  1YN8 A;  2LCS A;  3G4S A;  4FCY A;  2X4J A;  3MEW A;  3CCL A;  4BE0 A;  1ZA2 B;  1K4U S;  4OML A;  1M2O A;  4OVA A;  1R77 A;  1P92 A;  1B07 A;  1Q95 G;  1KC8 R;  4NS5 A;  2JS2 A;  4FW2 A;  2CZ1 B;  3G7Z A;  4ORZ A;  1M1F A;  5AT1 B;  3ZBD A;  2QQ9 A;  2JMA A;  3MP1 A;  5KYX B;  3QWX X;  6AT1 B;  1MMA A;  1VQP A;  1UGP B;  4M77 E;  1VQ4 T;  2X4W A;  2CUD A;  4X9C A;  3PFS A;  2GFA A;  4J6X A;  3UA7 A;  1U1T A;  3CCQ Q;  1BB9 A;  4N4I A;  2DPP B;  2KT8 A;  4M7D E;  1M90 R;  2E64 A;  3X25 B;  2I2L A;  2BE9 B;  2DBK A;  2QTX A;  1E7O A;  1M9S A;  2KRN A;  4FL6 A;  1PRL C;  1QP2 A;  1WHM A;  1UGV A;  1ZSZ A;  2XKO C;  2ZCF B;  2YUP A;  4DQ2 A;  4JJB A;  1M1K R;  2A08 A;  3C94 A;  3RER A;  4C5G A;  2MI6 A;  5LL6 S;  2ESW A;  3CC2 Q;  2QQS A;  2KYB A;  4MZT A;  2QDY B;  4FW1 A;  5KYU A;  5GAN g;  1K0X A;  2DJQ A;  1OZ2 A;  2DD5 A;  3M4G A;  4Q5W A;  2R58 A;  2ZPG B;  2RQT A;  2LCL A;  1D1B A;  5FW9 A;  3OYF A;  4PL6 A;  2EQK A;  1G3W A;  2JTE A; 
#chains in the Genus database with same CATH homology
 5HY6 A;  5GMK i;  2OTJ T;  2XHC A;  3FRN A;  5GMK l;  2RJC A;  4TVR A;  5GAM j;  1IZ6 A;  1YI2 A;  3OSS C;  4HCZ A;  2O4X A;  1O9S A;  3MO8 A;  1Y07 A;  3ER0 A;  3QZ9 B;  3JCM e;  2QEX A;  3OS2 A;  3DLL A;  3QO3 A;  1N9R A;  2WAC A;  3QYG B;  2BUD A;  1NJI U;  1BI2 A;  2L5Q A;  2GFU A;  4M7A B;  5D6W A;  2Y90 A;  1Y96 A;  4M75 E;  4BI8 B;  4QVD A;  5KE3 A;  3MEA A;  3OW2 A;  1GXI E;  4XQ3 A;  1D3B B;  4M77 D;  4MDW A;  5FRM A;  2LC4 A;  1K73 C;  1FX7 A;  1H64 1;  2EJF A;  1RL2 A;  2IG0 A;  3E1S A;  4XAX B;  3TU4 K;  2LQK A;  4M77 F;  2KVQ G;  2RO0 A;  3RKX A;  3OBW A;  4RG2 A;  2K3X A;  3E9F A;  3NTK A;  5GAN j;  2DEQ A;  5LJ3 h;  5CVI A;  3L2U A;  2X35 A;  3QPH A;  2MAM A;  3UT1 A;  1U8R A;  1N27 A;  2DVE A;  4C0G A;  4XU3 A;  1VQM A;  5EG2 A;  3CCU A;  4XU1 A;  4FU6 A;  1G3S A;  3M55 A;  3GPL A;  1VQL T;  5L8R E;  3OQ5 A;  3T9N A;  3LWH A;  4M7D F;  2CYZ B;  4C5E A;  1HK9 A;  1FWZ A;  1NPP A;  5GAM d;  3BFM A;  2HQE A;  1B34 A;  3HHT B;  3UDC A;  1WQW A;  4HKE A;  2FVU A;  3E19 A;  4HCB A;  1VQ7 T;  2HD0 A;  4ZN3 A;  4E47 A;  2QQB A;  2LRQ A;  5CAI A;  2O4X B;  5DLQ E;  3M5A A;  5KCO A;  2A7Y A;  4DA4 A;  2XID A;  3JCM c;  3V8K A;  3OYL A;  3GNG A;  2PUO B;  2RD1 A;  3CCM T;  5CQY A;  2YLB A;  2RI2 A;  1VQ6 T;  3GIB A;  1YJW A;  3CCR A;  3GOX A;  1VQ9 A;  2DO3 A;  4F7U G;  5A0G A;  1Y96 B;  2WSE E;  1KQS A;  3KBG A;  5GAM h;  3ZFJ A;  1ZHI A;  2RHZ A;  2E70 A;  5GAN d;  4D6W A;  4C92 E;  4BE2 A;  2O01 E;  3L42 A;  5LJ3 g;  1XNI A;  3CEY A;  5CR2 A;  4BY6 B;  3I56 A;  1Q86 C;  3LGL A;  3AHU A;  2VXE A;  2F5T X;  2K5I A;  4C8Q G;  1Q82 U;  4IUU A;  3OYJ A;  1LOJ A;  4N0A A;  3SWN A;  5FLX E;  3CMA A;  3JCM J;  1YCY A;  5D6Y A;  4IUQ A;  3M58 A;  1G5V A;  3A8G B;  1UEB A;  4QW2 A;  2DKG A;  3LLR A;  5FU6 B;  1SSF A;  1VQK T;  1KHC A;  4OMF B;  1W2B S;  1VQ8 A;  4PJO F;  1Q7Y U;  4MMK A;  3X20 B;  2MWP A;  4C8Q C;  5IT9 E;  2KSS A;  2R5M A;  4M78 A;  4RG8 A;  4C0F A;  2VUB A;  1B34 B;  3CBM A;  3QDR B;  4OP0 A;  3OYA A;  3HSB A;  2XDD A;  3UWN A;  2E1H A;  1VQ5 T;  1VQN A;  1W4S A;  3L2Q A;  2OTL T;  3PIP A;  5D6X A;  2XIC A;  1KHI A;  4ELY C;  2RH2 A;  3CXC S;  2YHT A;  4M7A E;  4IKF A;  5GMK e;  4ZGD B;  3OS0 A;  5AYF A;  1M90 C;  3SD4 A;  4CRI A;  3MEU A;  4EDU A;  1YBY A;  4LD6 A;  4JJN K;  4XTX A;  2LT4 A;  3CCQ T;  3V7S A;  3CME T;  4L5G A;  2E10 A;  2JZ2 A;  3BDU A;  1BIA A;  3CPF A;  4JDS A;  1QVP A;  5GAO q;  3J81 E;  2EYQ A;  3G71 T;  2DXT A;  3OYC A;  3PT9 A;  3G4S T;  2YRV A;  3LH0 A;  2K57 A;  2QQR A;  2EKO A;  1YIJ A;  2JTF A;  4E7L A;  3CC4 A;  1OI1 A;  3CCL T;  1WNL A;  2E6N A;  2CGH A;  3OSV A;  5HK0 A;  3VU3 C;  2EJG A;  3F70 A;  4M7D G;  3CCE T;  4MZP A;  1K73 U;  4J7F A;  5CCA A;  1M1K C;  2LQ8 A;  3A8L B;  3SWN B;  3L2R A;  4YTL A;  2P0Q A;  2EFI A;  3CXC A;  1K9M C;  5I2S A;  2RI5 A;  4RCB A;  4V2S A;  3FDR A;  2JOY A;  2LNV A;  2RHX A;  4II1 A;  5KE2 A;  4M7D C;  4BUG A;  4F7U F;  2DTI A;  4M78 B;  4NL3 A;  2QA4 A;  3JCM X;  2RK1 A;  3EAE A;  2XDB A;  2RHU A;  1I81 A;  3J7A F;  4DOV A;  4C8Q D;  5FRO A;  5GAO m;  5GAN 8;  3CC7 A;  1KG1 A;  2GQV A;  2VYT A;  3M56 A;  4NL2 A;  4EMK A;  3BW1 A;  3CD6 A;  1HXD A;  1VQP T;  2DK3 A;  2FHD A;  4B9W A;  5GAO l;  3M9Q A;  1JJ2 A;  1XTD A;  3M53 A;  2HNI A;  2XU8 A;  1O75 A;  5CKH A;  3OS5 A;  5GMK h;  1FXX A;  1WGS A;  1H3Z A;  3MCA B;  3C95 A;  4J7I A;  2V8J A;  3R6O A;  4JUV A;  3MET A;  2FYK A;  4A4H A;  3Q1J A;  2MWO A;  3OY9 A;  3CCS T;  4ZTJ A;  1YJ9 A;  4X34 A;  2VGM A;  2ZPF B;  3QII A;  2P0K A;  2CZ0 B;  5LJ3 d;  1G3Y A;  1KQ1 A;  5J26 A;  1OYX A;  1YJN T;  3G6E T;  3WVE B;  2D6F A;  4X9D A;  2WSC E;  4C92 F;  5GAN 3;  3L1A A;  5DY9 A;  2X4Y A;  1DJ7 B;  4PJO G;  4MML A;  3I55 T;  4N4H A;  5CKE A;  2VXF A;  3LX7 A;  3JRZ A;  2VGN A;  1PSE A;  1VQO A;  2EQM A;  4N4G A;  2DXC A;  1Q81 C;  1QW1 A;  3OYY A;  3QXE B;  3JCM P;  4QQD A;  1K8A C;  4LDW A;  4J6W A;  5I21 A;  2L89 A;  2RHY A;  1NE8 A;  2E65 A;  3GLX A;  5CKD A;  3M54 A;  3CCV T;  1N8R C;  4PJO C;  1VIE A;  3CCJ T;  4OF1 A;  5C6S A;  2CKK A;  1KD1 U;  2HBP A;  2EIF A;  5CIU A;  3QUI A;  3OYB A;  3JCM d;  4M7D D;  1WJQ A;  2KMT A;  3QJY A;  3RKW A;  4J8O A;  4EMK B;  1S72 A;  4BY6 C;  2CZ6 B;  4OB3 B;  4KUI A;  5FU7 B;  3MP6 A;  4M75 G;  4O5V A;  3VKI A;  5DLO A;  1I4K 1;  3JB9 I;  4M7A F;  2A3L A;  2E12 A;  3JCM V;  3H6Z A;  4PLL A;  4RMO A;  4B9X A;  5C0M A;  2ZPI B;  1VQ4 A;  2FB7 A;  2LVM A;  4LDX A;  1UGQ B;  2JN0 A;  3WXM B;  2K5L A;  2L8D A;  4M75 C;  3VJP A;  4HT9 A;  3OYM A;  4JRK A;  3SDZ A;  5GAN 6;  5HK3 A;  3BY7 A;  3L2W A;  1YIT A;  4ZN1 A;  3JCM h;  1YHQ T;  4PLI A;  2JNG A;  4NOY A;  1UGR B;  3RES A;  2EQJ A;  3PIO A;  1YI2 T;  3A8M B;  4M78 E;  2JVV A;  3HRS A;  1KC8 C;  3VYH B;  3OYG A;  3GNF B;  3NTI A;  4BI3 A;  2DJZ A;  2QEX T;  3S3O A;  4LD9 K;  1W2B A;  1NZ9 A;  1X75 C;  5J3B A;  1K9M U;  1AHJ B;  2RJD A;  4KUD K;  2R5A A;  3OYE A;  3FC3 A;  2PQW A;  2DD4 A;  2RA2 A;  4ME7 A;  3HRU A;  3GP8 A;  3C4S A;  4PJO D;  2C06 A;  2KY9 A;  3PMT A;  3TCJ A;  4ZGE B;  1XOV A;  4JRQ A;  1M4Z A;  1QP3 A;  4F7U A;  4J5Y A;  4J6Y A;  5GMK j;  3OYD A;  3DB4 A;  2DIQ A;  4C5I A;  2QXF A;  3OYK A;  2LX9 A;  5GAN 2;  4C92 G;  4XTV A;  4BB7 A;  5GAO p;  2G3R A;  2K4Y A;  1JBM A;  1VQM T;  3CCU T;  1M1G A;  3BDL A;  3URG A;  3LYI A;  3JCM g;  4C8Q A;  3OYH A;  1U1S A;  3V8J A;  2KQW A;  3MHX A;  3LWI A;  4JS4 A;  3JCM W;  1RI0 A;  4IUV A;  1I5L A;  1MHN A;  3WVD B;  2EAY A;  2ZPB B;  2M16 A;  3ASK A;  3NFC A;  4O6J A;  5A0D A;  3RMQ A;  4C92 C;  5CKB A;  3A5Z B;  2KDS A;  3PNW C;  5I2M A;  4C0D C;  3CC2 A;  5A2Q E;  3INZ A;  2M0O A;  2DXB A;  4M75 D;  4P5N A;  3X26 B;  2PVD B;  2L3R A;  5CKF A;  2M1H A;  4M75 F;  5LJ5 f;  4MZM A;  1XQH A;  4BE1 A;  5GAO n;  1I8F A;  3L2V A;  2OTJ A;  2RI3 A;  3J80 E;  2H3J A;  2DTO A;  4XU0 A;  3QHS A;  3JB9 H;  1Q81 U;  4C5H A;  3FLG A;  1YJW T;  3CCR T;  3FJP A;  1VQ9 T;  1WPY A;  4M7A G;  2Y4Y A;  4QQ6 A;  1BI0 A;  3OBY A;  1N8R U;  4MDX A;  5LJ5 e;  4Y91 A;  2XDP A;  3LGF A;  3VYG A;  3FB9 A;  3CBO A;  4M77 A;  4A53 A;  3C12 A;  4A4K A;  1LNX A;  2PU9 B;  3I56 T;  4BAC A;  2PUK B;  4F7U B;  4E7J A;  4HCC A;  2RM4 A;  4HT8 A;  1X6O A;  4XTZ A;  3FEO A;  3DKM A;  3HFN A;  3JB9 G;  1M8V A;  4M7A C;  2D9T A;  3CMA T;  1QVG S;  2X4X A;  4EPC A;  4GY5 A;  4XK8 E;  1Y71 A;  4C8Q B;  2F5K A;  3GF5 A;  4M7D A;  1VQ8 T;  3OA6 A;  4ELZ C;  4E7I A;  5GAN 7;  2K5F A;  3RMS A;  2VC8 A;  2JUF A;  3HRT A;  2VV5 A;  3O8V A;  1VQL A;  1VQN T;  4C92 D;  3LW5 E;  1MGQ A;  2GF7 A;  1WJS A;  4M78 F;  4FM4 B;  2E5Q A;  4L59 A;  1Q7Y C;  1VQ7 A;  3JSC A;  3OMG A;  4FT4 A;  1ZBX A;  2PVG B;  1UGS B;  2QQA A;  3DB3 A;  4JLI A;  2K3Y A;  4XTY A;  4C0Z A;  1KC8 U;  4GLK A;  3M59 A;  1Q86 U;  5GAO r;  2V8I A;  2KAF A;  3L2Z A;  3OS1 A;  2QI2 A;  5GMK m;  5LJ5 h;  3A8H B;  3JCM b;  3CCM A;  3MP8 A;  1YIJ T;  4M77 B;  3OYI A;  4BDZ A;  4FIB A;  3CC4 T;  1VQ6 A;  3OMC A;  5GAM f;  5IAY A;  3S3M A;  1OZ3 A;  1N6A A;  1Y7X A;  2E6Z A;  4EMG A;  4QVC A;  3V8L A;  3A8O B;  4Z02 A;  4BD3 A;  3FIF A;  4OB0 B;  2CS7 A;  2DZ9 A;  3V7C A;  4A4G A;  4BI4 A;  5KH6 A;  4XTU A;  1JB0 E;  2RB6 A;  3S3N A;  4UC4 A;  3KUF A;  4ZGJ B;  2AHJ B;  2PVO B;  3EFR A;  3JCM Q;  2D0Q B;  4M7A D;  4M7D B;  4PJO A;  1V29 B;  4HA8 A;  3KXT A;  2KK4 A;  1TH7 A;  2DAQ A;  4OB1 B;  2DXU A;  5GAM e;  3PGG A;  1N9S A;  2QA4 T;  2YLC A;  1VUB A;  4JS5 A;  1VQK A;  5GAN 4;  1BKB A;  4FSX A;  4E7K A;  2M9U A;  3OYN A;  3JB9 D;  3P8B B;  4OGE A;  5FU6 C;  4DOW A;  1M90 U;  3CC7 T;  4R55 A;  4OB2 B;  4XU2 A;  2MMP A;  3CD6 T;  5GAN f;  3JB9 F;  4LDY A;  3M57 A;  4RCC A;  3RUX A;  3VUZ A;  4CI0 C;  2EJ9 A;  3QYH B;  4QVZ A;  5IN1 A;  3TEE A;  3CBP A;  1VQ5 A;  2IVW A;  4J83 A;  2OTL A;  5LJ5 g;  4L6V 5;  1KQS S;  4FT2 A;  4KT0 E;  3RKY A;  4M75 A;  4F7U E;  1YJ9 T;  2WSF E;  4WF2 A;  3SB2 A;  2LT1 A;  3P8H A;  4RKU E;  1X01 A;  5M9O A;  5J39 A;  3TRE A;  5GAN e;  1M5Q 1;  1M1K U;  4ZTF A;  1ZQ1 A;  3QJ6 A;  2DZC A;  2LTO A;  5CK9 A;  3QBY A;  5A0L A;  5KCH A;  3CME A;  3CCQ A;  1G3T A;  2ZPH B;  3S6W A;  3G71 A;  4C8Q E;  2XI9 A;  3SFM A;  3G4S A;  1LJO A;  4E7H A;  2X4J A;  3MEW A;  1VQO T;  2RJF A;  3HL8 A;  3ZEH A;  2FL7 A;  1BI3 A;  4BE0 A;  3CCL A;  4PJO B;  1NPR A;  2Y4X A;  2EWN A;  3CCE A;  4OVA A;  4JRP A;  1P92 A;  2V8K A;  2BIV A;  2K2V A;  4M78 G;  4N0A C;  3JB9 J;  3SWN C;  3HFO A;  4NS5 A;  1NJI C;  3X28 B;  2CZ1 B;  2F69 A;  3G7Z A;  4KUL A;  1M1F A;  3ZBD A;  3HP9 A;  2BKD N;  3N5B B;  5CQX A;  2QQ9 A;  3QKJ A;  4XTW A;  1S72 T;  2B8A A;  4M78 C;  1WJR A;  4A54 A;  3E9G A;  3MP1 A;  3V7R A;  1KQ2 A;  4R56 A;  4IUP A;  4A4F A;  1BYM A;  3QZ5 B;  1KD1 C;  1VQP A;  1UGP B;  4M77 E;  1VQ4 T;  4M75 B;  2X4W A;  2MF2 A;  3OB9 A;  2XD0 A;  3VUB A;  4X9C A;  3CPW S;  2ZGW A;  5HKC A;  4KBM B;  3PFS A;  5LJ5 j;  2ZPE B;  4C92 A;  2GFA A;  3H8Z A;  4J6X A;  1U1T A;  5GAN h;  3UPU A;  1YIT T;  2RJE A;  1BIB A;  3CCS A;  4N4I A;  4PNO A;  4Y28 E;  2DPP B;  4A4E A;  2OAU A;  2P0P A;  3PTA A;  1K8A U;  4LDU A;  4M7D E;  1JRI A;  1YJN A;  2E64 A;  2XG8 D;  4JRI A;  3X25 B;  3G6E A;  2I2L A;  3PMI A;  5GAM g;  1EIF A;  4EMH A;  3I55 A;  4QQG A;  2QTX A;  2DIG A;  3RIR A;  1M9S A;  2CZ7 B;  2GCX A;  4FL6 A;  2E41 A;  4LDV A;  4M77 G;  1QP2 A;  4IUR A;  1VIF A;  4ATO A;  2XKO C;  2ZCF B;  3HKS A;  4VUB A;  3CPW A;  3P8D A;  3HPW A;  3ME9 A;  2HAX A;  1WQ7 A;  3MEV A;  4DQ2 A;  5CO7 A;  3CCV A;  3X24 B;  1PSF A;  5DM7 R;  5LJ3 f;  3CCJ A;  4M77 C;  1JJ2 S;  1QVF S;  4JLG A;  3C94 A;  3NTH A;  5LJ3 j;  3RER A;  4M7A A;  2DTH A;  4C5G A;  2LCC A;  2MI6 A;  5LL6 S;  2LDM A;  2NLU A;  1UB4 A;  3EFS A;  4OGC A;  1D3B A;  2QQS A;  4IUT A;  4MZT A;  5LJ5 d;  2QDY B;  1Q82 C;  3QSU A;  2RK2 A;  5GAN g;  4M78 D;  4BDY A;  4EMK C;  2P4T A;  1OZ2 A;  2DD5 A;  3M4G A;  4PKC C;  4Q5W A;  5FU7 C;  5LJ3 e;  2R58 A;  4C92 B;  4C0D B;  2RHI A;  2ZZD A;  2XK0 A;  2ZPG B;  5GAN 5;  1QVG A;  2R57 A;  3QG1 A;  5FRN A;  1BI1 A;  2LCL A;  3M4Y A;  2JTM A;  3CC2 T;  4PJO E;  1R8O B;  4C8Q F;  1IRE B;  3OW2 S;  2EQU A;  1QVF A;  3OYF A;  3JCM f;  4PL6 A;  3JAM E;  3VV0 A;  2EQK A;  3DLM A;  1YHQ A;  2HQX A;  1G3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...