3MEAA

Crystal structure of the sgf29 in complex with h3k4me3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
164
structure length
162
Chain Sequence
LYFQGTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords SAGA-associated factor 29 homolog
total genus 26
structure length 162
sequence length 164
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3meaA02
1MHNA 2E6NA 2RHXA 4N4GA 3EAEA 4QQGA 2O4XA 5IAYA 2EKOA 3OYGA 1G5VA 2RHIA 3OYAA 5KCHA 3L2WA 2RJCA 3C4SA 2LCCA 3ASKA 2RHYA 3P8DA 4RG2A 3FDRA 2BIVA 2X4YA 3QIIA 5FRNA 3Q1JA 3ME9A 5KCOA 3S3OA 3OYEA 4BD3A 4PLIA 3LH0A 4QQ6A 3H6ZA 5D6XA 2RJFA 2JTFA 3OS2A 3CEYA 3OYCA 1XNIA 4BDYA 2LRQA 2R58A 3MP6A 4ZTJA 4PLLA 3MP8A 1N27A 2RHUA 3M9QA 5KE2A 2P0KA 3OYLA 4E7HA 3E9FA 2MWOA 4Q5WA 2IG0A 3OYHA 1WJQA 2NLUA 2B8AA 2VYTA 3DB4A 2K3XA 2XDPA 2EQUA 2M1HA 2YRVA 3DLMA 3LGLA 3LLRA 2CKKA 2L8DA 2RI5A 3MEVA 5KH6A 3OYFA 3L2UA 4E7KA 3E9GA 4EDUA 3BDLA 3MO8A 4N4HA 3LX7A 3GOXA 2HQEA 3S3MA 3ZEHA 2L89A 5D6YA 5J39A 1OZ3A 2MWPA 3S6WA 3OS1A 2GFAA 4IUVA 3UT1A 1KHCA 2QQSA 2WACA 4C5EA 3S3NA 4BE1A 3OYDA 4UC4A 3MEWA 2G3RA 3OB9A 4IURA 3LGFA 3LYIA 5IN1A 4HCZA 1WJRA 2X4WA 4IUQA 4QW2A 3SD4A 5M9OA 4A4HA 3F70A 3META 2LTOA 4FU6A 3OY9A 3OYKA 2M16A 3OYIA 3OYJA 4E7JA 2LDMA 2R57A 4B9WA 2L3RA 4E7LA 4IUPA 3PMTA 3DB3A 3UWNA 2R5AA 4GY5A 2RI2A 2GF7A 3OQ5A 4A4GA 4C5HA 3NTHA 2EQKA 2LVMA 3FLGA 4LD6A 4A4FA 3NTKA 2DIQA 4N4IA 2EQMA 1OI1A 4PL6A 4B9XA 3OMCA 4C5IA 2O4XB 5KE3A 3OA6A 4IKFA 1H3ZA 4A4EA 3PMIA 3L42A 3L2RA 2JZ2A 3QKJA 5FRMA 3L2QA 3QJ6A 2RHZA 3NTIA 4IUTA 3OYNA 3OYBA 5CIUA 5J26A 3KUFA 2X4XA 4C5GA 3OS0A 4Z02A 2RJDA 1RI0A 2RJEA 3P8HA 2BUDA 2PQWA 4II1A 4QQDA 2E5QA 5C0MA 2GFUA 3OMGA 1WGSA 2M0OA 2EFIA 5FROA 2FHDA 1OYXA 2R5MA 3MEUA 4BACA 4X34A 4NS5A 2DAQA 5C6SA 2XK0A 4IUUA 2F5KA 4QVZA 2D9TA 4BE0A 3PFSA 4CRIA 2QQRA 2RO0A 2DIGA 4OVAA 5D6WA 4BE2A 3QBYA 2EQJA 3L2VA 1OZ2A 3OYMA 1SSFA 2RI3A 3FC3A 3H8ZA 4E7IA 4L59A 3MEAA 3O8VA 3PNWC 2BKDN 3FEOA 1WJSA 4BDZA 2HQXA 3MP1A 4ZTFA 4FL6A 2K3YA 2X35A
chains in the Genus database with same CATH superfamily
2E6NA 3NFCA 2SRCA 3A8OB 3C4SA 3ASKA 1GBQA 4JRKA 4MDXA 1I81A 1KQSA 2DF6A 1R77A 2D6FA 2HL3A 2VUBA 5GAN4 3CEYA 2DXUA 1LNXA 4QVDA 1G8XA 2R58A 4ZGDB 4XTWA 2BE9B 1NBEB 2PVDB 5KE2A 1X6OA 2QDLA 2JJ9A 1YBYA 3KFVA 2NUPA 3M58A 2KR3A 2L3PA 4ORZA 2L8DA 4HCCA 3X20B 2ZPGB 4BY6C 1D0XA 3BDLA 2FZGB 3CCSA 1I1JA 1FMWA 4Y92A 2KI7A 2MWPA 4ZN1A 1LCKA 1VQ7T 3M57A 1KHCA 1BKBA 3CCVT 4QW2A 4J8OA 1AZGB 2QAZA 1VQNQ 2DILA 3A8HB 1PRMC 1UGQB 2KQWA 3JCMV 2YSQA 3CBMA 3DB3A 2ATCB 3PMTA 2NWMA 3RKWA 5CKHA 1YP5A 2GCXA 2KK4A 5CK9A 3X26B 4N0AC 5LJ5e 1M90R 3VYGA 3JCMP 5CIUA 2V1RA 3G7ZA 5IHIA 4M7DG 3KBGA 4M7DD 3I35A 5GAMe 3MEUA 5C6SA 5KYXA 4M75F 3OBWA 3L2VA 1RUWA 2CH4A 3RMSA 2GGRA 3CCLT 2K3BA 1K0XA 1PNJA 3T9NA 3OYGA 1Y0MA 3H0FA 5KYUB 2ESWA 2KE9A 1NG2A 1ZBXA 1N9SA 1YNZA 1K0SA 3GNFB 5LL6S 1Y7XA 1X43A 3MP6A 3V8KA 1VQ8T 4PLLA 4KRTA 1S72A 2P0KA 1RAIB 4M75C 1TOVA 5CQXA 1M1KR 3CCMA 1KQ2A 2C0OA 1NLOC 3QJYA 2OTJT 3CCUQ 1BIBA 4OP0A 5DLOA 3MO8A 3HL8A 2W0ZA 1W4SA 2E70A 4HKEA 3ZEHA 4HT8A 3OS1A 1R0CB 3CCJT 2PUKB 4RTYA 3CCLQ 4IURA 4R55A 3LGFA 3JCMb 2YT6A 4A4HA 2HD0A 4JRQA 1D1CA 2JUFA 2VXFA 2GF7A 3FLGA 4J6YA 1FYNA 4F7UF 1U8RA 4C5IA 5KE3A 2KEAA 2EYXA 3A1PA 1KQSS 3BE3A 3JAME 2JN0A 4C8QB 2M51A 1IB8A 2JMCA 3KUFA 1QMCA 1ZA2B 4LE9A 2PQWA 3VV0A 5LJ3j 2OAUA 3VS0A 1RAFB 1E7OA 2JTEA 3SWNC 1C6VX 2E4HA 2EVRA 3MHXA 1VQLQ 2F1LA 3G6ET 2GBQA 4QVZA 4Y28E 1K73C 2CYZB 2HEQA 3M0SA 1WQWA 3CCUT 1VQLT 2LX9A 1NE8A 4OVAA 2JNGA 3MJXA 5GANj 5HK0A 1SEMA 5GAMh 2KROA 4BI4A 3PNWC 1VQ6T 4C8QA 1VA7A 4FSSA 5DLQE 2QDYB 4QQGA 2CUBA 2O4XA 4HVUA 1G5VA 5IHKA 2GQIA 4E7SA 2LCCA 3OYBA 4HCBA 4M77C 2O88A 2MK5A 3CC4Q 3JCMJ 5LJ5h 1YCSB 3G71T 1YJ9A 2EKHA 2JTFA 4QKUA 4M7AE 4PKCC 1H8KA 1BBZA 1M8VA 4ZTJA 2P84A 5GMKm 1QP2A 2ROLA 4FYYB 3OYHA 2RK1A 5GAMg 3E1SA 4KH1B 2CP3A 2HNIA 3VS1A 4GLKA 1WX6A 4OB3B 4LDWA 5GAOq 1BCMA 5D6YA 1KD1C 2JS2A 2BZXA 1MMNA 2KNBB 3H0IA 2GFAA 3J80E 4RTTA 5LJ5g 3S3NA 4JPBW 2VV5A 4KUDK 1M5Q1 2MAMA 3J7AF 2CZ6B 4JS5A 1JRIA 3RESA 2XKOC 3OYKA 3JB9H 4C0ZA 4ANJA 1UHCA 1U1SA 2K79A 2LCSA 5GAN2 1I5LA 2ZZDA 3G6EA 4A4EA 1SHGA 2FYKA 1MMGA 2XIDA 2DL5A 1Q86R 4LN2A 4IUTA 4XU0A 1G3YA 1W6XA 2JXBA 4M78G 1WHJA 4Z02A 2RJDA 3P8HA 1NEGA 3CXCA 1ZUKA 2ECZA 2O2OA 2R5MA 4BACA 1RI9A 2AKLA 2D9TA 1IGUA 4CRIA 3QXEB 2QQRA 2ZAEA 3OS5A 3OSSC 1ZHIA 3EGUA 5D6WA 3PE0A 1WXUA 1VQ6A 1QVFS 2I0NA 4OMNA 4K11A 4M77G 1OU8A 4NL3A 4C92C 4BY6B 4N4GA 1ZA1B 3QSUA 1O75A 4DBQA 3FIFA 1YJ9Q 2QGGA 1YHQT 4HA8A 4A54A 2EGEA 4FW2A 3I55T 4PFZA 3OS2A 1KFZA 4M7AC 2QQBA 4HT9A 3H41A 1YJWA 4AFZC 2NUTA 1I07A 5GAN8 4OMQA 1R0BG 1VQ7Q 2K57A 1UB4A 2JM9A 2CKKA 3L2UA 4E7KA 1NPPA 1VQOA 1WHGA 1WXBA 2KYBA 1AHJB 4FT2A 3JCMW 3JB9I 2LT4A 1QKWA 4M7AF 4FW1A 4OGEA 1IRXA 4RCBA 3QYGB 4JJBA 3EFRA 1M1KC 2DTHA 3JRZA 3MPUB 3ER0A 1W2BA 5HK3A 4M7DC 4M75E 1KSWA 3EHQA 3M59A 3OYIA 1PCXA 1SKUB 3EG1A 3HFOA 4FCYA 1X6GA 2EJ9A 4R0KA 5GANg 2CT3A 5KYUA 5A0LA 2EYZA 2V8KA 4ZNXA 3CQTA 4PJOE 2A7YA 4C8QF 5LJ5d 4C0DC 2HL5C 3MKDA 3GPLA 4KGXB 4RTZA 2EWNA 2FRYA 2O01E 3DKMA 2P4RA 3RBBB 2DAQA 1NYGA 2EYWA 2QA4T 1K9MR 3GF5A 2XG8D 2ZPEB 5GAMd 1UG1A 1WA7A 2CZ0B 1OZ2A 1SSFA 1T3SA 3TEEA 3EH1A 1JBMA 4J6XA 3CCMQ 3O8VA 4M7DE 3G4SA 3FEOA 1WJSA 3QZ5B 5IT9E 1MHNA 2QA4A 1QVFP 3L2WA 2RHYA 3ME9A 1VUBA 2ZPFB 3M0UA 5FWBA 3JCMQ 4J9HA 2YWWA 4J9EA 2DXBA 1KG1A 1WYXA 1UEBA 2YRDA 1G3TA 4OMMA 3CMEQ 1X27A 1Y07A 3OW2S 2DXCA 2QTVA 4BI3A 1WXTA 4X9CA 1UGPB 2QQ9A 2V8IA 2MCNA 2ZCFB 5LJ3d 4A63B 2MMPA 2EQUA 4JDSA 3MEVA 3JCMg 1VQPT 4NOYA 5L8RE 4J9GA 1HXDA 2EYQA 4JLGA 1TUDA 1WDXA 3V7SA 4CC4B 1WNLA 2NUZA 3RUXA 3SWNB 2FO0A 3V8JA 3I9QA 1V1CA 1BB9A 4AFSC 3OYJA 2BZYA 1YHQQ 4LD6A 4C0FA 1CKAA 5CO7A 2CP7A 1OI1A 4L6V5 3EGXB 1W1FA 1Y96B 2LC4A 4DA4A 2MIOA 1VQNA 1W70A 4MMLA 2O9VA 2JZ2A 4AG2C 1NJIU 4M77B 1Q7YC 2J6OA 2LMJA 4D8DA 1RACB 2DEUA 3CMEA 4DBRA 1U3OA 2Y90A 1VYTA 4M77E 4C8QD 4LDVA 2E64A 4DEYA 1A0NB 2F5TX 3QDRB 3CC7Q 2DL7A 4RCCA 4FSXA 2QA4Q 2EJGA 3G1JA 3HRSA 5CKBA 1N8RC 2YUQA 3CBPA 4PJLA 4DBHA 1E6HA 2Y4YA 2RK2A 1PHTA 5FU6B 3JV3A 2RJCA 3GP8A 3FDRA 5LJ3h 3CCRQ 1M27C 1RLQC 1AVZC 1B7TA 3N5BB 2HMAA 4F16A 2COYA 4OMLA 1VQOT 4MZPA 2RN8A 4LUDA 4LDUA 1M4ZA 3UDCA 3H9NA 2DKGA 3RDVA 3EG0A 1UGVA 1M2OA 1WFWA 1JJ2A 4OF1A 1X2KA 5I11A 3LGLA 2RMOA 2DNUA 2ZPBB 1UJ0A 2PVOB 2O31A 3LX7A 2HQHA 5GAOl 4EPCA 1GXIE 4C92G 1YHQA 3A8GB 3DLLA 3UT1A 4P5NA 2XU8A 1YCYA 2K5LA 3R6OA 2WACA 4E7ZA 1TXQA 4J9DA 1U1TA 3TQ7P 3I56T 5IN1A 2RNAA 3LYIA 2KRMA 4IIMA 2XDDA 2H3JA 4RUGA 3JCMe 3CD6Q 1UTIA 1NZ9A 2LVMA 1SHFA 2DIQA 3M53A 4EMKC 1SPKA 3OA6A 1M1KU 4JJNK 4N0AA 4QT7A 1Q82C 1Q86U 3OYNA 1NJIC 3CCEA 1I5OB 4C5GA 2P0QA 1RI0A 1EX4A 2D0QB 3TU4K 3FRNA 1X75C 5GMKi 1M30A 1WQ7A 2FEIA 2DVEA 2H3EB 4X34A 4IUUA 4ESRA 5L23A 5I2SA 4M75D 2JMAA 1X69A 2BE7D 3OYMA 2GTJA 1RAHB 4L59A 3EG2A 1ZX6A 2BKDN 5FU6C 4E2FB 1CKBA 4M78E 2OTJQ 4MMKA 2J06A 1V29B 2XHCA 1YIJQ 1HK9A 4RG2A 2RF0A 2F69A 4JZ4A 4PJOD 5HY6A 2KYMA 1XJWB 2KT1A 1W2BP 1SG5A 4DOWA 2JW4A 2DERA 3VRYA 2VB6A 1N27A 2RHUA 4F17A 1BCOA 4J7FA 2A08A 1WJQA 1VYUA 3OYYA 1G3WA 2YLCA 1GFDA 1YITT 3GBQA 4C92E 4N4HA 4XAXB 3CPWP 3S6WA 3G71A 2X3XD 4CC3A 1YIJA 2QQSA 1ACMB 2EGCA 2F2VA 2FPDA 2MOXA 3F70A 2DMOA 3M55A 2XMFA 1OU9A 4E7JA 4M75B 4B9WA 1QLYA 1GRIA 4M7AB 4A4GA 1PD0A 2JS0A 4N4IA 3JCMX 4LDYA 4CC7A 4JZ3A 1FWZA 2OTLT 1J3TA 3QZ9B 3CCJQ 5CKDA 3I56Q 5FRMA 1UUEA 2GTOA 2RHZA 5A0GA 1Q81R 3CC2Q 5C0MA 2RQWA 3BFMA 2PTKA 6AT1B 5A0DA 3CD6T 1ZUUA 2IPOB 2B86A 4M7DB 4C92A 2I2LA 2YUNA 2K5FA 1IO6A 2M0YA 1GFCA 1BI3A 2QEXT 4ELYC 3INZA 5GAN7 1YITQ 3QYHB 1PWTA 4MDWA 5GANf 2E41A 2L5QA 5KCHA 2PUOB 5FRNA 1AWXA 3Q1JA 4NL2A 4Y91A 1ZQ1A 4XU2A 1YWOA 3LH0A 1Y57A 3EH2A 1FX7A 4O5VA 1VQNT 5GAN6 2DZ9A 3E9FA 4XTYA 3PIPA 4KBMB 2NLUA 4M78A 3BY7A 2JTMA 1YJNT 2YRVA 2PZ1A 3UA6A 2CGHA 4R56A 3G6EQ 4MZMA 3RMQA 1JJ2P 2L89A 3CCRA 1QCOA 3NPFA 1YJ9T 3G4SQ 5FU7C 2VKNA 2DA9A 2G6FX 1Q82R 4BI8B 4AG1C 4DQ2A 2SEMA 3AT1B 1UDLA 4C5HA 1IHVA 3HSBA 2LX7A 1OQKA 2EQMA 2L0AA 3CCUA 1WZOA 2CZ1B 2XI9A 4WCIA 5FU7B 2RQUA 4OGCA 1I4K1 1AT1B 2KT8A 2RQVA 5GJWB 3C0CA 2FVUA 3V7CA 1VQ5T 1EZZB 2BUDA 1K8AC 5GJVB 2L3QA 1RADB 1D0YA 2P4TA 3VU3C 2V8JA 2DIGA 2YXYA 3RKXA 4BE2A 1ZSZA 2EQJA 1PM3A 1RAEB 2D0NA 2RPNA 2HKNA 5GAN3 2WSFE 1OPLA 5KYNA 4E6RA 2D8HA 4BDZA 1TSFA 4PFOA 1IGQA 3CC2T 5FWCA 1BU1A 1KQSP 4RKUE 4D8KA 9ATCB 1LOJA 2H8HA 2FG0A 3TSWA 4BD3A 1VQ7A 3EFOB 1I0CA 1VQ5A 5AYFA 3H6ZA 4EMHA 3URGA 3C94A 4Z8AA 1XNIA 5LJ3e 2LRQA 2DXTA 3VRZA 1LVKA 2FZCB 2ZGWA 3TSZA 3M9QA 3OYLA 5FLXE 1EFNA 1NYFA 2J7IA 1SRMA 2CT4A 2A3LA 4Z88A 3DB4A 4BB7A 2DBMA 1N8RR 1OEBA 1M1GA 3UPUA 5CQYA 4C92B 1VQ8A 2L2PA 4C0DB 3GOXA 4ATOA 4M77D 5I22A 5KYWB 2COWA 4IIOA 1K8AR 2LJ3A 3SB2A 8AT1B 4PJOA 1BIAA 1VQMQ 3CCLA 1TH7A 1G3SA 2ROTA 3CXCS 2RI2A 3X24B 3SEMA 2XDBA 5I2MA 1H3ZA 5IXBA 4M75A 4XU3A 2M02A 3O5ZA 2LQ8A 1RAAB 2AZSA 2CREA 2DYIA 3TVTA 2CP6A 5J26A 3A98A 1M2VA 3VS4A 1S72Q 2M0OA 4M78D 2EIFA 2XK0A 3VS2A 4BE0A 1YI2Q 2J6FA 3E19A 1B34A 2QTXA 1M2VB 4D6WA 1D3BA 3R6NA 2RI3A 4E7IA 1TG0A 3UATA 3BW1A 1QKXA 3MP1A 2LQKA 5CCAA 1PKTA 2K3YA 3ZFJA 4DOVA 4MZTA 2RHXA 2HDAA 1M3AA 3JSCA 2BIVA 2X4YA 4EMKB 1JXOA 5KCOA 3GLXA 3JB9J 1HJDA 1OPKA 2EW3A 1MMDA 3EG9B 1S1NA 1MUZA 2C0TA 3KXTA 3CC7T 4RMOA 4J83A 2MWOA 2X51A 4OB2B 2LP5A 2DM1A 3GIBA 1MNDA 4TVRA 3LLRA 1YJWT 3QHSA 1NEBA 2HSEB 3S3MA 1ZSZC 2ZPIB 1RLPC 3A5ZB 1Y71A 1PRLC 4F14A 3EG3A 4RTUA 1VQKA 2DETA 3FJ5A 3CBOA 1ZUYA 1M3CA 3VYHB 4OB0B 3WVDB 1H641 2R57A 2A0FB 4FYVB 4AFUC 1OV3A 1AWOA 5FW9A 4M7AG 2X4JA 3ULRB 4KUIA 1K73U 3CCQA 5KYYA 2HBWA 4KGVB 3QWYA 1IXDA 4PJOB 1X2QA 2X4XA 2W10A 2AHJB 1TWBA 2FB7A 1YI2A 1P92A 4X9DA 5FROA 4LUEA 2EGAA 1BI1A 4NS5A 4AMCA 2K4YA 5D7UA 3PFSA 2ED1A 1UE9A 2K7AA 1D09B 1N5ZA 2ED0A 1WHHA 1X01A 4PJOG 1YFNA 3REBB 4FL6A 3SDZA 4XTZA 2RHIA 3OYAA 1RAGB 3VS5A 3OYEA 1M8MA 1OULA 1QVFA 2LNHB 4PLIA 4AFQC 1SSHA 1YI2T 3CC4T 2RJFA 2MPXC 1UGSB 2X9HA 2VGNA 5HCKA 4WF2A 2D8JA 1VQ4A 1NPRA 2OTLA 3JCMh 1VIEA 2MF2A 2O9SA 1VQMA 4M7AD 4LDXA 2OJ2A 1B34B 1GCQA 5LJ5j 1ZSGA 1KQ1A 1ZSZB 4J7IA 1I8FA 1M1FA 1QVGA 3M5AA 3CC4A 3JB9G 2PNIA 4OMFB 5LJ3f 4PFPA 4PJNA 2LJ1A 4V2SA 2DJQA 4J9IA 3CCEQ 2AK5A 2AKKA 3M0QA 1HSQA 5GAMj 3MEWA 2D1XA 1Q7YU 2DRMA 5M9OA 1M9SA 3META 2V26A 2M16A 1Y96A 3A8MB 2X3WD 4C0GA 2YDLA 2KVQG 1QWEA 4ZN3A 1VQLA 2XICA 1VQ5Q 1QCNA 2E3IA 1VQMT 1QVPA 1N8RU 3I5RA 3TCJA 4XU1A 1IZ6A 2RQRA 5GANh 2VVKA 1X6BA 4F7UB 3VS3A 2DZCA 2FPFA 4J9FA 3NMZC 4CI0C 1GBRA 2E6ZA 3I5SA 3A8LB 1QW1A 2GFUA 1V76A 1N6AA 2LQWA 2FHDA 2LQNA 1JO8A 1WHKA 3M4YA 2FRWA 1F1BB 1U5SA 1OX8A 2PU9B 7AT1B 1IREB 3X28B 1NJIR 2DK3A 2LJ0A 3EFSA 1RL2A 2KGTA 3FB9A 5LJ3g 4KH0B 4HVVA 1ARKA 2DEQA 4LXCA 1GCPA 3C95A 2OTLQ 2RD1A 4OMPA 3CPFA 2EKOA 2P0PA 3QUIA 4M78F 3CCSQ 3QIIA 1MGQA 3OW2P 3S3OA 4M7AA 1M90U 2RH2A 3CCET 2BZ8A 2YRCA 4WTOB 4O6JA 1UFFA 1NLPC 3RERA 1XQHA 3CCQT 5GAMf 5IH2A 4A53A 2B8AA 2VYTA 1PC0A 2K3XA 2RM4A 1TTHB 3PTAA 2QK0A 1TUCA 1WHMA 2COZA 1TUGB 3CC7A 5KH6A 5KYWA 2MYSA 3E9GA 4EDUA 5GAOn 1KD1U 3HFNA 2EJFA 3X25B 1Z9ZA 5J39A 5LJ5f 1B07A 3WVEB 2L3SA 2DD5A 3H0HA 3P8BB 3THKA 2Y4XA 4PJJA 1FMKA 1VQKT 1VYVA 3LWHA 4F7UA 2QEXQ 2G3RA 1PKSA 1Q7YR 1QCFA 2DBKA 4VUBA 2HZYA 3EG9A 5GANe 3M56A 3CCST 1WI7A 2QI2A 2LDMA 1KD1R 2L3RA 5A2QE 1VQPA 2VXEA 2R5AA 2KXCA 1UJYA 5DM7R 3EFOA 5GANd 3CCMT 1UGRB 3V7RA 2YUPA 3L2RA 1S72T 1MV3A 3C12A 1WLPB 3QJ6A 5I21A 1PSEA 2MI6A 1H92A 3M0TA 5J3BA 3QO3A 1D3BB 2PVGB 2K5IA 3D7SB 4QQDA 4F7UE 1TU0B 3LH5A 1T0JA 5GMKl 1LPLA 4PK4A 2A36A 3JCMc 2GNCA 3JCMd 5GAOp 3CC2A 4YTLA 2KAFA 4A4KA 2FZKB 2OX7A 3QBYA 2IIMA 4EMGA 1JQQA 1OX9A 1ABOA 2FPEA 4LD9K 2DTOA 5CVIA 2LZ6B 3CCVQ 2OAWA 3BDUA 2RQTA 2VC8A 2HQXA 2CSIA 1VQ9Q 1C1AA 1KC8U 2CH4W 4FYWB 3I56A 1KJWA 2EBPA 1AEYA 3NHNA 1H3HA 1K73R 4JRPA 1Z9QA 2DTIA 4FIBA 2KXDA 4L5GA 2C06A 4JLIA 1SRLA 3OYCA 3ZL7C 4XTVA 4C8QE 2CSQA 2E3HA 2C0IA 2DL8A 4E7HA 4Q5WA 5IXFA 2KSSA 4M78C 1YN8A 1FXXA 2WSCE 2BTTA 1Q81U 2AZVA 4EIKA 2ABLA 2CP2A 2KBTA 1T0HA 4PJOC 4Z89A 5AT1B 4C5EA 3M0PA 3FJPA 1B3QA 5KYYB 1WJRA 4IUQA 2LTOA 3OY9A 3UA7A 1C0MA 1T3LA 2JOYA 4E7LA 1D1AA 2QQAA 4J6WA 4GY5A 4PNOA 2EQKA 3NTKA 4B9XA 4OMOA 1XOVA 2LNVA 3VJPA 3QKJA 3NTIA 3CMET 2A28A 3EHRA 3OS0A 5CKFA 4II1A 4RG8A 1YJNQ 2Z0WA 3OMGA 1K9MC 2E65A 4FYXB 1GCQC 1EIFA 3NGPA 1KIKA 2CS7A 3HKSA 1VQ8Q 1W2BS 3RNJA 2YUOA 1QWFA 3HTRA 1KHIA 4F7UG 2DPPB 3GNGA 2X35A 1N9RA 3VUBA 2JT4A 4B6MA 1DJ7B 2DL3A 1K9MU 3CD6A 4M7DF 2ZPHB 2JVVA 3HRTA 4EMKA 3V8LA 1LJOA 5D6XA 3CCRT 2LCLA 4XQ3A 4C8QC 2AIRB 4M75G 3HHTB 1KK7A 1JXMA 1YWPA 2RB6A 4M4ZA 2HAXA 4AT1B 5GMKe 1YJNA 2K2VA 3CPWA 3JCMf 2HCKA 3SHWA 3DLMA 3CMAA 2DRKA 3OYFA 1BK2A 1JB0E 2AT1B 2WSEE 2KDSA 4ELZC 1VQPQ 3I55A 1VOMA 1G83A 2K2MA 2QYZA 1QP3A 2DVJA 4RTVA 2VWFA 4JS4A 2HBPA 3OYDA 1HD3A 3CXCP 4C8QG 4HCZA 3SD4A 2CP0A 2X4WA 1Q86C 4J9BA 4JJDA 2KMTA 2E1HA 5GMKh 2HSPA 4IUPA 3EGXA 3OQ5A 2DYBA 1SF9A 4XTXA 2CZ7B 3PVLA 3OMCA 3AHUA 1R8OB 4LNPA 2EYYA 3L42A 4PJOF 1JU5C 5CAIA 2E5KA 3HRUA 3VUZA 4XK8E 1BI2A 2DJZA 4CC2A 1XTDA 2LT1A 2CP5A 2RJEA 4ZGEB 1QVGS 2E5QA 2QG9B 1QVGP 1WGSA 2J6KA 2EFIA 1TS9A 1ABQA 3QDFA 2ENMA 1Q82U 4XTUA 1PSFA 1FMVA 3TREA 4ZTFA 1M90C 1VQ9A 4C92F 5IAYA 1MMAA 4JUVA 2CDTA 4HCKA 3PT9A 3CMAQ 1JJ2S 1UECA 2E12A 5GAN5 2DD4A 3ZBDA 2DFUA 4F04B 1YITA 5IHNA 1WHLA 5EG2A 2M9UA 2M1HA 4J9CA 2RA2A 3QWXX 4E47A 4KT0E 2QGFB 2HQEA 1GL5A 4HXJA 5KYXB 2QASA 3U23A 2JM8A 4C92D 2NUTB 4M77A 1Q81C 1YIJT 3OB9A 3QPHA 2NYSA 1D0ZA 1VQ9T 4GLMA 2YLBA 3CCJA 1K1ZA 3HP9A 2KRSA 4FU6A 2EQIA 2QEXA 3L1AA 2YHTA 3NTHA 2K9GA 3LW5E 2DX1A 1U06A 3PMIA 1VIFA 4J5YA 3SWNA 3UF4A 1Q95G 3RIRA 5EC7A 4BUGA 5CR2A 1VQ4Q 1QQJA 1AWJA 3WXMB 2FL7A 3RR6A 1ZLMA 3G71Q 1K8AU 3VS6A 3M4GA 1OYXA 3IQLA 5GAOm 1JEGA 2DE0X 2RO0A 3REAB 1K76A 1KC8C 4M78B 4PJMA 3J81E 3FC3A 4OB1B 2NUPB 1OOTA 3OBYA 1E6GA 1RABB 2J05A 2K6DA 4JJCA 4RTXA 1MNEA 4ZGJB 3EAEA 1NM7A 4X1VA 3P8DA 2E10A 3RKYA 1BYMA 1BI0A 1AOJA 5CKEA 3I55Q 4QQ6A 3CPWS 4RTWA 5DY9A 3PVQA 2DO3A 2F2WA 4BDYA 3OW2A 2VASA 3MP8A 3CMAT 2OTJA 5ECAA 4FT4A 1G2BA 4M77F 2IG0A 3E2UA 2VGMA 2XDPA 3CCQQ 3JB9F 2EPDA 4M7DA 2EAYA 2KY9A 4HVWA 1VQOQ 2RI5A 1VQ4T 4KGZB 3EGDA 2DLPA 1AD5A 1UHFA 1OZ3A 3MCAB 1AWWA 3SFMA 4IUVA 2KRNA 1AZEA 3CCVA 5GAOr 4BE1A 4UC4A 4DEXA 1YJWQ 2DL4A 1CSKA 1VQKQ 2OI3A 1D1BA 1WIEA 1PG5B 3LWIA 3UWNA 2IVWA 5GMKj 4GBQA 3M0RA 4A4FA 4FM4B 4PL6A 3OSVA 4IKFA 8ATCB 2O4XB 3M54A 1PD1A 5HKCA 2F2XA 3PGGA 1O9SA 3JB9D 2V1QA 1HYOA 3VS7A 1VQ6Q 3L2QA 2XD0A 4ME7A 1WPYA 1MV0B 1ZBJA 1M3BA 2CUDA 1IHWA 1KC8R 3PIOA 2F5KA 2GQVA 3VKIA 4DBFA 4QVCA 2A37A 3EGDB 4JRIA 1K4US 3G4ST 3H8ZA 2QXFA 3MEAA 2HKQB 1K9AA 3L2ZA 4KULA 3QG1A 3HPWA
chains in the Genus database with same CATH topology
1MHNA 2E6NA 1KC8U 2QA4A 3CC2T 3NFCA 3I56A 4RKUE 3L2WA 1LOJA 3A8OB 3C4SA 3ASKA 2RHYA 4JRKA 3ME9A 4MDXA 1VUBA 2ZPFB 4BD3A 4JRPA 1VQ7A 1I81A 1KQSA 3JCMQ 2DTIA 1VQ5A 5AYFA 3H6ZA 4FIBA 4EMHA 2D6FA 2DXBA 2VUBA 1KG1A 1UEBA 4L5GA 3URGA 2C06A 3C94A 1G3TA 3CEYA 4JLIA 5GAN4 3OYCA 2DXUA 1LNXA 1XNIA 5LJ3e 4XTVA 2LRQA 2DXTA 2R58A 4C8QE 4QVDA 4ZGDB 1Y07A 3OW2S 4XTWA 2PVDB 2DXCA 2ZGWA 5KE2A 3M9QA 1X6OA 4BI3A 3OYLA 4E7HA 5FLXE 4Q5WA 4X9CA 1UGPB 2A3LA 2QQ9A 2KSSA 1YBYA 2V8IA 3DB4A 4BB7A 4M78C 2ZCFB 5LJ3d 2MMPA 3M58A 2EQUA 1FXXA 1M1GA 3UPUA 5CQYA 2L8DA 4JDSA 3MEVA 3X20B 2ZPGB 3JCMg 4NOYA 5L8RE 4BY6C 2WSCE 4C0DB 1HXDA 3BDLA 1VQPT 3CCSA 1Q81U 3GOXA 4ATOA 2EYQA 4JLGA 2MWPA 4ZN1A 4M77D 1VQ7T 4PJOC 3M57A 1KHCA 1BKBA 3SB2A 4C5EA 3V7SA 3CCVT 3FJPA 1WNLA 4PJOA 3RUXA 1BIAA 1WJRA 4IUQA 4QW2A 3SWNB 4J8OA 2LTOA 3OY9A 3V8JA 3A8HB 3CCLA 1UGQB 1TH7A 2JOYA 2KQWA 3JCMV 3OYJA 4E7LA 4HCCA 2QQAA 1G3SA 3CBMA 3DB3A 3PMTA 4J6WA 3CXCS 4GY5A 2RI2A 3X24B 4PNOA 3RKWA 4LD6A 2EQKA 4C0FA 3NTKA 5CO7A 2XDBA 1OI1A 5CKHA 5I2MA 4L6V5 4B9XA 2GCXA 2KK4A 1H3ZA 1Y96B 4M75A 4XU3A 2LC4A 5CK9A 3X26B 4DA4A 1XOVA 2LNVA 4N0AC 5LJ5e 2LQ8A 3VJPA 1VQNA 3VYGA 4MMLA 2JZ2A 3QKJA 1NJIU 4M77B 3NTIA 3JCMP 1Q7YC 3CMET 5CIUA 5J26A 3OS0A 5CKFA 3CMEA 3G7ZA 4M7DG 3KBGA 4II1A 4RG8A 2Y90A 4M7DD 3OMGA 4M77E 4C92B 1K9MC 2M0OA 4M78D 2E65A 5GAMe 1EIFA 3MEUA 2EIFA 5C6SA 2XK0A 4C8QD 4LDVA 2E64A 4BE0A 2F5TX 3QDRB 3E19A 4M75F 2CS7A 3HKSA 1W2BS 4RCCA 1B34A 3OBWA 2QTXA 4D6WA 3L2VA 1D3BA 4FSXA 2EJGA 2RI3A 3HRSA 5CKBA 3RMSA 4E7IA 1N8RC 3CBPA 1KHIA 4F7UG 3CCLT 2DPPB 3BW1A 3GNGA 3MP1A 2LQKA 5CCAA 2K3YA 3ZFJA 2Y4YA 2X35A 2RHXA 1N9RA 2RK2A 4MZTA 5FU6B 3VUBA 3T9NA 4DOVA 3OYGA 3JSCA 2RJCA 3GP8A 1DJ7B 1K9MU 3FDRA 2BIVA 2X4YA 4EMKB 3CD6A 4M7DF 1ZBXA 5LJ3h 1N9SA 5KCOA 2ZPHB 2JVVA 3GLXA 3JB9J 3HRTA 4EMKA 3N5BB 3V8LA 1LJOA 5D6XA 3CCRT 2LCLA 4XQ3A 4C8QC 3GNFB 4M75G 5LL6S 1VQOT 4MZPA 1Y7XA 1VQ8T 3MP6A 3HHTB 3V8KA 4PLLA 4LDUA 3KXTA 4RMOA 3CC7T 1M4ZA 4J83A 2RB6A 1S72A 1VQ8A 2P0KA 2HAXA 5GMKe 1YJNA 4M75C 2MWOA 3UDCA 2DKGA 5CQXA 2K2VA 3CPWA 3JCMf 3CCMA 1KQ2A 1JJ2A 3QJYA 4OB2B 4OF1A 3DLMA 3LGLA 2OTJT 3GIBA 3CMAA 4TVRA 2ZPBB 3LLRA 3OYFA 1BIBA 1JB0E 1YJWT 2PVOB 3QHSA 3MO8A 4OP0A 5DLOA 3HL8A 2WSEE 3LX7A 2KDSA 3S3MA 1W4SA 2E70A 4HKEA 3ZEHA 5GAOl 2ZPIB 4HT8A 3A5ZB 4ELZC 1Y71A 4EPCA 3I55A 1QP3A 3OS1A 3CCJT 1GXIE 4C92G 1YHQA 3A8GB 3DLLA 2PUKB 3UT1A 4P5NA 2XU8A 1YCYA 2K5LA 3R6OA 4JS4A 2WACA 2HBPA 3OYDA 1VQKA 1U1TA 4IURA 4R55A 3LGFA 3I56T 3JCMb 3LYIA 5IN1A 4HCZA 4C8QG 3CBOA 3SD4A 2X4WA 2XDDA 4A4HA 2H3JA 1Q86C 2HD0A 3VYHB 4OB0B 3WVDB 2KMTA 4JRQA 2E1HA 1H641 2R57A 5GMKh 2JUFA 2VXFA 4IUPA 3JCMe 3OQ5A 2GF7A 1NZ9A 2LVMA 3FLGA 4M7AG 2X4JA 4J6YA 4KUIA 2DIQA 4XTXA 4F7UF 2CZ7B 3M53A 1U8RA 3OMCA 4C5IA 4EMKC 5KE3A 3OA6A 1R8OB 1M1KU 3AHUA 1K73U 3L42A 4JJNK 3CCQA 4PJOF 1KQSS 5CAIA 4N0AA 1Q82C 1Q86U 3JAME 3HRUA 3VUZA 4XK8E 2JN0A 1BI2A 2DJZA 3OYNA 4C8QB 1NJIC 4PJOB 1XTDA 3CCEA 3KUFA 2X4XA 4C5GA 2LT1A 2AHJB 2FB7A 2P0QA 1RI0A 2RJEA 4ZGEB 1YI2A 2PQWA 2D0QB 3VV0A 2E5QA 5LJ3j 3TU4K 1P92A 3FRNA 1WGSA 2OAUA 4X9DA 2EFIA 1X75C 5FROA 5GMKi 3SWNC 3MHXA 1BI1A 1WQ7A 4X34A 2DVEA 4NS5A 3G6ET 4IUUA 2K4YA 4QVZA 4Y28E 3PFSA 1K73C 2CYZB 1VQLT 1WQWA 3CCUT 2LX9A 1NE8A 4OVAA 5I2SA 4M75D 2JNGA 5GANj 1Q82U 3OYMA 5HK0A 4XTUA 1PSFA 4L59A 5GAMh 1X01A 4BI4A 3PNWC 4PJOG 2BKDN 1VQ6T 5FU6C 3TREA 4C8QA 5DLQE 4M78E 4ZTFA 4FL6A 4MMKA 1M90C 3SDZA 1VQ9A 1V29B 2QDYB 2XHCA 2O4XA 4QQGA 4C92F 5IAYA 4XTZA 1G5VA 2RHIA 1HK9A 4JUVA 3OYAA 3OYBA 2LCCA 4RG2A 4HCBA 2F69A 4M77C 3PT9A 3JCMJ 3OYEA 4PJOD 5LJ5h 1JJ2S 1QVFA 4PLIA 5HY6A 3G71T 1YI2T 1YJ9A 2E12A 3CC4T 2RJFA 1UGSB 2JTFA 4M7AE 2VGNA 4PKCC 4DOWA 1M8VA 5GAN5 4WF2A 2DD4A 4ZTJA 1VQ4A 1NPRA 1N27A 2RHUA 3ZBDA 1QP2A 3JCMh 5GMKm 1YITA 2OTLA 1VIEA 2MF2A 4J7FA 1VQMA 4M7AD 5EG2A 3OYHA 1WJQA 4LDXA 3OYYA 2M9UA 2RK1A 1B34B 1G3WA 2M1HA 2YLCA 5GAMg 3E1SA 1YITT 2HNIA 2RA2A 4GLKA 1KQ1A 4E47A 5LJ5j 4J7IA 4KT0E 1I8FA 1M1FA 1QVGA 4C92E 4N4HA 4OB3B 2HQEA 4LDWA 4XAXB 3M5AA 5GAOq 5D6YA 1KD1C 3CC4A 3JB9G 4OMFB 3S6WA 3G71A 5LJ3f 2GFAA 3J80E 4V2SA 4C92D 5LJ5g 1YIJA 4M77A 2QQSA 3S3NA 1Q81C 1YIJT 2VV5A 5GAMj 4KUDK 1M5Q1 3MEWA 3OB9A 3QPHA 2MAMA 3J7AF 1Q7YU 1VQ9T 2YLBA 5M9OA 3CCJA 2CZ6B 1M9SA 3F70A 3META 3HP9A 3M55A 4FU6A 1JRIA 4JS5A 3RESA 2XKOC 3OYKA 2QEXA 2M16A 4E7JA 3JB9H 1Y96A 3A8MB 4M75B 4B9WA 4M7AB 4C0GA 4C0ZA 4A4GA 3L1AA 2KVQG 2YHTA 3NTHA 1U1SA 5GAN2 3LW5E 4N4IA 1I5LA 4ZN3A 1VQLA 2XICA 3JCMX 2ZZDA 4LDYA 3G6EA 4A4EA 1VQMT 1QVPA 3PMIA 1FWZA 1VIFA 2FYKA 4J5YA 3SWNA 2XIDA 3TCJA 1N8RU 2OTLT 4XU1A 1IZ6A 3QZ9B 5GANh 4F7UB 3RIRA 5CKDA 2DZCA 5FRMA 4IUTA 2RHZA 1G3YA 4XU0A 5A0GA 4M78G 4BUGA 5CR2A 4CI0C 4Z02A 2E6ZA 2RJDA 3P8HA 1QVGS 5C0MA 3A8LB 1QW1A 2GFUA 2FL7A 3WXMB 1N6AA 3CXCA 3BFMA 2FHDA 1K8AU 3M4GA 1OYXA 3M4YA 2R5MA 5A0DA 5GAOm 4BACA 3CD6T 2D9TA 4CRIA 2PU9B 3QXEB 2QQRA 2RO0A 3OS5A 3OSSC 1ZHIA 5D6WA 1IREB 4M7DB 3X28B 4C92A 2I2LA 1KC8C 1VQ6A 4M78B 2K5FA 3J81E 3FC3A 1QVFS 4OB1B 4M77G 2DK3A 4NL3A 1BI3A 1RL2A 3EFSA 3FB9A 5LJ3g 2QEXT 3OBYA 4ELYC 2DEQA 4C92C 3INZA 4BY6B 5GAN7 3C95A 2RD1A 4ZGJB 4N4GA 3CPFA 3EAEA 3QYHB 2EKOA 5GANf 2P0PA 4MDWA 2E41A 3QUIA 2L5QA 4M78F 5KCHA 2PUOB 3P8DA 5FRNA 3QSUA 1O75A 2E10A 3RKYA 3QIIA 1BYMA 1BI0A 1MGQA 3Q1JA 4NL2A 5CKEA 4Y91A 1ZQ1A 3FIFA 3S3OA 4XU2A 1YHQT 4HA8A 4A54A 3LH0A 2RH2A 4QQ6A 1M90U 4M7AA 3CPWS 5DY9A 3I55T 3CCET 2DO3A 3OS2A 4M7AC 2QQBA 4BDYA 4HT9A 4O6JA 1FX7A 1YJWA 3OW2A 4O5VA 3RERA 1VQNT 1XQHA 3MP8A 3CMAT 5GAN6 2OTJA 2DZ9A 3CCQT 4FT4A 3E9FA 5GAMf 4M77F 2IG0A 4XTYA 3PIPA 4KBMB 2B8AA 2NLUA 4M78A 2VYTA 3BY7A 4A53A 5GAN8 2K3XA 2VGMA 2JTMA 2RM4A 2XDPA 3JB9F 4M7DA 2EAYA 3PTAA 2KY9A 1YJNT 2YRVA 2K57A 1UB4A 2CKKA 2RI5A 5KH6A 3L2UA 1NPPA 2CGHA 3CC7A 4R56A 4E7KA 1VQ4T 3E9GA 4EDUA 5GAOn 1VQOA 4MZMA 1KD1U 3HFNA 2EJFA 3RMQA 3X25B 1AHJB 2L89A 4FT2A 5LJ5f 5J39A 3JB9I 1OZ3A 3CCRA 3JCMW 2LT4A 1YJ9T 3MCAB 4M7AF 3WVEB 4OGEA 3SFMA 4IUVA 2DD5A 3P8BB 4RCBA 2Y4XA 3QYGB 3CCVA 5GAOr 1VQKT 5FU7C 3EFRA 4BE1A 1M1KC 3LWHA 4F7UA 4UC4A 2DTHA 2G3RA 3JRZA 3ER0A 1W2BA 5HK3A 4M7DC 4M75E 4VUBA 4BI8B 4DQ2A 5GANe 3M56A 3CCST 3M59A 3OYIA 2QI2A 2LDMA 2L3RA 3HFOA 5A2QE 3LWIA 1VQPA 2VXEA 3UWNA 2R5AA 2IVWA 4C5HA 2EJ9A 5GMKj 5GANg 3HSBA 4A4FA 4FM4B 5DM7R 4PL6A 2EQMA 5GANd 3CCMT 3CCUA 1UGRB 3OSVA 2CZ1B 2XI9A 4IKFA 2O4XB 5A0LA 3M54A 5FU7B 5HKCA 3V7RA 3PGGA 1O9SA 2V8KA 3L2RA 3JB9D 1S72T 4PJOE 2A7YA 4C8QF 4OGCA 3C12A 1I4K1 3L2QA 3QJ6A 5I21A 2XD0A 5LJ5d 1PSEA 2MI6A 4C0DC 4ME7A 1WPYA 3QO3A 5J3BA 1D3BB 2PVGB 2K5IA 3GPLA 2EWNA 2FVUA 3V7CA 4QQDA 2BUDA 4F7UE 1VQ5T 1K8AC 2O01E 3DKMA 5GMKl 3PIOA 3JCMc 2DAQA 3JCMd 2F5KA 2GQVA 3VKIA 2P4TA 3VU3C 4QVCA 2V8JA 5GAOp 3CC2A 4YTLA 2KAFA 2QA4T 2DIGA 2XG8D 2ZPEB 3GF5A 3RKXA 4A4KA 5GAMd 4BE2A 3QBYA 2CZ0B 4JRIA 2EQJA 1OZ2A 3G4ST 4EMGA 1SSFA 3H8ZA 3TEEA 4LD9K 4J6XA 1JBMA 2DTOA 2QXFA 5CVIA 3MEAA 5GAN3 3L2ZA 3O8VA 3BDUA 3QG1A 4KULA 2WSFE 4M7DE 3G4SA 3FEOA 1WJSA 2VC8A 2HQXA 3QZ5B 4BDZA 3HPWA 5IT9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHN A;  2E6N A;  2RHX A;  4N4G A;  3EAE A;  4QQG A;  2O4X A;  5IAY A;  2EKO A;  3OYG A;  1G5V A;  2RHI A;  3OYA A;  5KCH A;  3L2W A;  2RJC A;  3C4S A;  2LCC A;  3ASK A;  2RHY A;  3P8D A;  4RG2 A;  3FDR A;  2BIV A;  2X4Y A;  3QII A;  5FRN A;  3Q1J A;  3ME9 A;  5KCO A;  3S3O A;  3OYE A;  4BD3 A;  4PLI A;  3LH0 A;  4QQ6 A;  3H6Z A;  5D6X A;  2RJF A;  2JTF A;  3OS2 A;  3CEY A;  3OYC A;  1XNI A;  4BDY A;  2LRQ A;  2R58 A;  3MP6 A;  4ZTJ A;  4PLL A;  3MP8 A;  1N27 A;  2RHU A;  3M9Q A;  5KE2 A;  2P0K A;  3OYL A;  4E7H A;  3E9F A;  2MWO A;  4Q5W A;  2IG0 A;  3OYH A;  1WJQ A;  2NLU A;  2B8A A;  2VYT A;  3DB4 A;  2K3X A;  2XDP A;  2EQU A;  2M1H A;  2YRV A;  3DLM A;  3LGL A;  3LLR A;  2CKK A;  2L8D A;  2RI5 A;  3MEV A;  5KH6 A;  3OYF A;  3L2U A;  4E7K A;  3E9G A;  4EDU A;  3BDL A;  3MO8 A;  4N4H A;  3LX7 A;  3GOX A;  2HQE A;  3S3M A;  3ZEH A;  2L89 A;  5D6Y A;  5J39 A;  1OZ3 A;  2MWP A;  3S6W A;  3OS1 A;  2GFA A;  4IUV A;  3UT1 A;  1KHC A;  2QQS A;  2WAC A;  4C5E A;  3S3N A;  4BE1 A;  3OYD A;  4UC4 A;  3MEW A;  2G3R A;  3OB9 A;  4IUR A;  3LGF A;  3LYI A;  5IN1 A;  4HCZ A;  1WJR A;  2X4W A;  4IUQ A;  4QW2 A;  3SD4 A;  5M9O A;  4A4H A;  3F70 A;  3MET A;  2LTO A;  4FU6 A;  3OY9 A;  3OYK A;  2M16 A;  3OYI A;  3OYJ A;  4E7J A;  2LDM A;  2R57 A;  4B9W A;  2L3R A;  4E7L A;  4IUP A;  3PMT A;  3DB3 A;  3UWN A;  2R5A A;  4GY5 A;  2RI2 A;  2GF7 A;  3OQ5 A;  4A4G A;  4C5H A;  3NTH A;  2EQK A;  2LVM A;  3FLG A;  4LD6 A;  4A4F A;  3NTK A;  2DIQ A;  4N4I A;  2EQM A;  1OI1 A;  4PL6 A;  4B9X A;  3OMC A;  4C5I A;  2O4X B;  5KE3 A;  3OA6 A;  4IKF A;  1H3Z A;  4A4E A;  3PMI A;  3L42 A;  3L2R A;  2JZ2 A;  3QKJ A;  5FRM A;  3L2Q A;  3QJ6 A;  2RHZ A;  3NTI A;  4IUT A;  3OYN A;  3OYB A;  5CIU A;  5J26 A;  3KUF A;  2X4X A;  4C5G A;  3OS0 A;  4Z02 A;  2RJD A;  1RI0 A;  2RJE A;  3P8H A;  2BUD A;  2PQW A;  4II1 A;  4QQD A;  2E5Q A;  5C0M A;  2GFU A;  3OMG A;  1WGS A;  2M0O A;  2EFI A;  5FRO A;  2FHD A;  1OYX A;  2R5M A;  3MEU A;  4BAC A;  4X34 A;  4NS5 A;  2DAQ A;  5C6S A;  2XK0 A;  4IUU A;  2F5K A;  4QVZ A;  2D9T A;  4BE0 A;  3PFS A;  4CRI A;  2QQR A;  2RO0 A;  2DIG A;  4OVA A;  5D6W A;  4BE2 A;  3QBY A;  2EQJ A;  3L2V A;  1OZ2 A;  3OYM A;  1SSF A;  2RI3 A;  3FC3 A;  3H8Z A;  4E7I A;  4L59 A;  3MEA A;  3O8V A;  3PNW C;  2BKD N;  3FEO A;  1WJS A;  4BDZ A;  2HQX A;  3MP1 A;  4ZTF A;  4FL6 A;  2K3Y A;  2X35 A; 
#chains in the Genus database with same CATH topology
 2E6N A;  3NFC A;  2SRC A;  3A8O B;  3C4S A;  3ASK A;  1GBQ A;  4JRK A;  4MDX A;  1I81 A;  1KQS A;  2DF6 A;  1R77 A;  2D6F A;  2HL3 A;  2VUB A;  5GAN 4;  3CEY A;  2DXU A;  1LNX A;  4QVD A;  1G8X A;  2R58 A;  4ZGD B;  4XTW A;  2BE9 B;  1NBE B;  2PVD B;  5KE2 A;  1X6O A;  2QDL A;  2JJ9 A;  1YBY A;  3KFV A;  2NUP A;  3M58 A;  2KR3 A;  2L3P A;  4ORZ A;  2L8D A;  4HCC A;  3X20 B;  2ZPG B;  4BY6 C;  1D0X A;  3BDL A;  2FZG B;  3CCS A;  1I1J A;  1FMW A;  4Y92 A;  2KI7 A;  2MWP A;  4ZN1 A;  1LCK A;  1VQ7 T;  3M57 A;  1KHC A;  1BKB A;  3CCV T;  4QW2 A;  4J8O A;  1AZG B;  2QAZ A;  1VQN Q;  2DIL A;  3A8H B;  1PRM C;  1UGQ B;  2KQW A;  3JCM V;  2YSQ A;  3CBM A;  3DB3 A;  2ATC B;  3PMT A;  2NWM A;  3RKW A;  5CKH A;  1YP5 A;  2GCX A;  2KK4 A;  5CK9 A;  3X26 B;  4N0A C;  5LJ5 e;  1M90 R;  3VYG A;  3JCM P;  5CIU A;  2V1R A;  3G7Z A;  5IHI A;  4M7D G;  3KBG A;  4M7D D;  3I35 A;  5GAM e;  3MEU A;  5C6S A;  5KYX A;  4M75 F;  3OBW A;  3L2V A;  1RUW A;  2CH4 A;  3RMS A;  2GGR A;  3CCL T;  2K3B A;  1K0X A;  1PNJ A;  3T9N A;  3OYG A;  1Y0M A;  3H0F A;  5KYU B;  2ESW A;  2KE9 A;  1NG2 A;  1ZBX A;  1N9S A;  1YNZ A;  1K0S A;  3GNF B;  5LL6 S;  1Y7X A;  1X43 A;  3MP6 A;  3V8K A;  1VQ8 T;  4PLL A;  4KRT A;  1S72 A;  2P0K A;  1RAI B;  4M75 C;  1TOV A;  5CQX A;  1M1K R;  3CCM A;  1KQ2 A;  2C0O A;  1NLO C;  3QJY A;  2OTJ T;  3CCU Q;  1BIB A;  4OP0 A;  5DLO A;  3MO8 A;  3HL8 A;  2W0Z A;  1W4S A;  2E70 A;  4HKE A;  3ZEH A;  4HT8 A;  3OS1 A;  1R0C B;  3CCJ T;  2PUK B;  4RTY A;  3CCL Q;  4IUR A;  4R55 A;  3LGF A;  3JCM b;  2YT6 A;  4A4H A;  2HD0 A;  4JRQ A;  1D1C A;  2JUF A;  2VXF A;  2GF7 A;  3FLG A;  4J6Y A;  1FYN A;  4F7U F;  1U8R A;  4C5I A;  5KE3 A;  2KEA A;  2EYX A;  3A1P A;  1KQS S;  3BE3 A;  3JAM E;  2JN0 A;  4C8Q B;  2M51 A;  1IB8 A;  2JMC A;  3KUF A;  1QMC A;  1ZA2 B;  4LE9 A;  2PQW A;  3VV0 A;  5LJ3 j;  2OAU A;  3VS0 A;  1RAF B;  1E7O A;  2JTE A;  3SWN C;  1C6V X;  2E4H A;  2EVR A;  3MHX A;  1VQL Q;  2F1L A;  3G6E T;  2GBQ A;  4QVZ A;  4Y28 E;  1K73 C;  2CYZ B;  2HEQ A;  3M0S A;  1WQW A;  3CCU T;  1VQL T;  2LX9 A;  1NE8 A;  4OVA A;  2JNG A;  3MJX A;  5GAN j;  5HK0 A;  1SEM A;  5GAM h;  2KRO A;  4BI4 A;  3PNW C;  1VQ6 T;  4C8Q A;  1VA7 A;  4FSS A;  5DLQ E;  2QDY B;  4QQG A;  2CUB A;  2O4X A;  4HVU A;  1G5V A;  5IHK A;  2GQI A;  4E7S A;  2LCC A;  3OYB A;  4HCB A;  4M77 C;  2O88 A;  2MK5 A;  3CC4 Q;  3JCM J;  5LJ5 h;  1YCS B;  3G71 T;  1YJ9 A;  2EKH A;  2JTF A;  4QKU A;  4M7A E;  4PKC C;  1H8K A;  1BBZ A;  1M8V A;  4ZTJ A;  2P84 A;  5GMK m;  1QP2 A;  2ROL A;  4FYY B;  3OYH A;  2RK1 A;  5GAM g;  3E1S A;  4KH1 B;  2CP3 A;  2HNI A;  3VS1 A;  4GLK A;  1WX6 A;  4OB3 B;  4LDW A;  5GAO q;  1BCM A;  5D6Y A;  1KD1 C;  2JS2 A;  2BZX A;  1MMN A;  2KNB B;  3H0I A;  2GFA A;  3J80 E;  4RTT A;  5LJ5 g;  3S3N A;  4JPB W;  2VV5 A;  4KUD K;  1M5Q 1;  2MAM A;  3J7A F;  2CZ6 B;  4JS5 A;  1JRI A;  3RES A;  2XKO C;  3OYK A;  3JB9 H;  4C0Z A;  4ANJ A;  1UHC A;  1U1S A;  2K79 A;  2LCS A;  5GAN 2;  1I5L A;  2ZZD A;  3G6E A;  4A4E A;  1SHG A;  2FYK A;  1MMG A;  2XID A;  2DL5 A;  1Q86 R;  4LN2 A;  4IUT A;  4XU0 A;  1G3Y A;  1W6X A;  2JXB A;  4M78 G;  1WHJ A;  4Z02 A;  2RJD A;  3P8H A;  1NEG A;  3CXC A;  1ZUK A;  2ECZ A;  2O2O A;  2R5M A;  4BAC A;  1RI9 A;  2AKL A;  2D9T A;  1IGU A;  4CRI A;  3QXE B;  2QQR A;  2ZAE A;  3OS5 A;  3OSS C;  1ZHI A;  3EGU A;  5D6W A;  3PE0 A;  1WXU A;  1VQ6 A;  1QVF S;  2I0N A;  4OMN A;  4K11 A;  4M77 G;  1OU8 A;  4NL3 A;  4C92 C;  4BY6 B;  4N4G A;  1ZA1 B;  3QSU A;  1O75 A;  4DBQ A;  3FIF A;  1YJ9 Q;  2QGG A;  1YHQ T;  4HA8 A;  4A54 A;  2EGE A;  4FW2 A;  3I55 T;  4PFZ A;  3OS2 A;  1KFZ A;  4M7A C;  2QQB A;  4HT9 A;  3H41 A;  1YJW A;  4AFZ C;  2NUT A;  1I07 A;  5GAN 8;  4OMQ A;  1R0B G;  1VQ7 Q;  2K57 A;  1UB4 A;  2JM9 A;  2CKK A;  3L2U A;  4E7K A;  1NPP A;  1VQO A;  1WHG A;  1WXB A;  2KYB A;  1AHJ B;  4FT2 A;  3JCM W;  3JB9 I;  2LT4 A;  1QKW A;  4M7A F;  4FW1 A;  4OGE A;  1IRX A;  4RCB A;  3QYG B;  4JJB A;  3EFR A;  1M1K C;  2DTH A;  3JRZ A;  3MPU B;  3ER0 A;  1W2B A;  5HK3 A;  4M7D C;  4M75 E;  1KSW A;  3EHQ A;  3M59 A;  3OYI A;  1PCX A;  1SKU B;  3EG1 A;  3HFO A;  4FCY A;  1X6G A;  2EJ9 A;  4R0K A;  5GAN g;  2CT3 A;  5KYU A;  5A0L A;  2EYZ A;  2V8K A;  4ZNX A;  3CQT A;  4PJO E;  2A7Y A;  4C8Q F;  5LJ5 d;  4C0D C;  2HL5 C;  3MKD A;  3GPL A;  4KGX B;  4RTZ A;  2EWN A;  2FRY A;  2O01 E;  3DKM A;  2P4R A;  3RBB B;  2DAQ A;  1NYG A;  2EYW A;  2QA4 T;  1K9M R;  3GF5 A;  2XG8 D;  2ZPE B;  5GAM d;  1UG1 A;  1WA7 A;  2CZ0 B;  1OZ2 A;  1SSF A;  1T3S A;  3TEE A;  3EH1 A;  1JBM A;  4J6X A;  3CCM Q;  3O8V A;  4M7D E;  3G4S A;  3FEO A;  1WJS A;  3QZ5 B;  5IT9 E;  1MHN A;  2QA4 A;  1QVF P;  3L2W A;  2RHY A;  3ME9 A;  1VUB A;  2ZPF B;  3M0U A;  5FWB A;  3JCM Q;  4J9H A;  2YWW A;  4J9E A;  2DXB A;  1KG1 A;  1WYX A;  1UEB A;  2YRD A;  1G3T A;  4OMM A;  3CME Q;  1X27 A;  1Y07 A;  3OW2 S;  2DXC A;  2QTV A;  4BI3 A;  1WXT A;  4X9C A;  1UGP B;  2QQ9 A;  2V8I A;  2MCN A;  2ZCF B;  5LJ3 d;  4A63 B;  2MMP A;  2EQU A;  4JDS A;  3MEV A;  3JCM g;  1VQP T;  4NOY A;  5L8R E;  4J9G A;  1HXD A;  2EYQ A;  4JLG A;  1TUD A;  1WDX A;  3V7S A;  4CC4 B;  1WNL A;  2NUZ A;  3RUX A;  3SWN B;  2FO0 A;  3V8J A;  3I9Q A;  1V1C A;  1BB9 A;  4AFS C;  3OYJ A;  2BZY A;  1YHQ Q;  4LD6 A;  4C0F A;  1CKA A;  5CO7 A;  2CP7 A;  1OI1 A;  4L6V 5;  3EGX B;  1W1F A;  1Y96 B;  2LC4 A;  4DA4 A;  2MIO A;  1VQN A;  1W70 A;  4MML A;  2O9V A;  2JZ2 A;  4AG2 C;  1NJI U;  4M77 B;  1Q7Y C;  2J6O A;  2LMJ A;  4D8D A;  1RAC B;  2DEU A;  3CME A;  4DBR A;  1U3O A;  2Y90 A;  1VYT A;  4M77 E;  4C8Q D;  4LDV A;  2E64 A;  4DEY A;  1A0N B;  2F5T X;  3QDR B;  3CC7 Q;  2DL7 A;  4RCC A;  4FSX A;  2QA4 Q;  2EJG A;  3G1J A;  3HRS A;  5CKB A;  1N8R C;  2YUQ A;  3CBP A;  4PJL A;  4DBH A;  1E6H A;  2Y4Y A;  2RK2 A;  1PHT A;  5FU6 B;  3JV3 A;  2RJC A;  3GP8 A;  3FDR A;  5LJ3 h;  3CCR Q;  1M27 C;  1RLQ C;  1AVZ C;  1B7T A;  3N5B B;  2HMA A;  4F16 A;  2COY A;  4OML A;  1VQO T;  4MZP A;  2RN8 A;  4LUD A;  4LDU A;  1M4Z A;  3UDC A;  3H9N A;  2DKG A;  3RDV A;  3EG0 A;  1UGV A;  1M2O A;  1WFW A;  1JJ2 A;  4OF1 A;  1X2K A;  5I11 A;  3LGL A;  2RMO A;  2DNU A;  2ZPB B;  1UJ0 A;  2PVO B;  2O31 A;  3LX7 A;  2HQH A;  5GAO l;  4EPC A;  1GXI E;  4C92 G;  1YHQ A;  3A8G B;  3DLL A;  3UT1 A;  4P5N A;  2XU8 A;  1YCY A;  2K5L A;  3R6O A;  2WAC A;  4E7Z A;  1TXQ A;  4J9D A;  1U1T A;  3TQ7 P;  3I56 T;  5IN1 A;  2RNA A;  3LYI A;  2KRM A;  4IIM A;  2XDD A;  2H3J A;  4RUG A;  3JCM e;  3CD6 Q;  1UTI A;  1NZ9 A;  2LVM A;  1SHF A;  2DIQ A;  3M53 A;  4EMK C;  1SPK A;  3OA6 A;  1M1K U;  4JJN K;  4N0A A;  4QT7 A;  1Q82 C;  1Q86 U;  3OYN A;  1NJI C;  3CCE A;  1I5O B;  4C5G A;  2P0Q A;  1RI0 A;  1EX4 A;  2D0Q B;  3TU4 K;  3FRN A;  1X75 C;  5GMK i;  1M30 A;  1WQ7 A;  2FEI A;  2DVE A;  2H3E B;  4X34 A;  4IUU A;  4ESR A;  5L23 A;  5I2S A;  4M75 D;  2JMA A;  1X69 A;  2BE7 D;  3OYM A;  2GTJ A;  1RAH B;  4L59 A;  3EG2 A;  1ZX6 A;  2BKD N;  5FU6 C;  4E2F B;  1CKB A;  4M78 E;  2OTJ Q;  4MMK A;  2J06 A;  1V29 B;  2XHC A;  1YIJ Q;  1HK9 A;  4RG2 A;  2RF0 A;  2F69 A;  4JZ4 A;  4PJO D;  5HY6 A;  2KYM A;  1XJW B;  2KT1 A;  1W2B P;  1SG5 A;  4DOW A;  2JW4 A;  2DER A;  3VRY A;  2VB6 A;  1N27 A;  2RHU A;  4F17 A;  1BCO A;  4J7F A;  2A08 A;  1WJQ A;  1VYU A;  3OYY A;  1G3W A;  2YLC A;  1GFD A;  1YIT T;  3GBQ A;  4C92 E;  4N4H A;  4XAX B;  3CPW P;  3S6W A;  3G71 A;  2X3X D;  4CC3 A;  1YIJ A;  2QQS A;  1ACM B;  2EGC A;  2F2V A;  2FPD A;  2MOX A;  3F70 A;  2DMO A;  3M55 A;  2XMF A;  1OU9 A;  4E7J A;  4M75 B;  4B9W A;  1QLY A;  1GRI A;  4M7A B;  4A4G A;  1PD0 A;  2JS0 A;  4N4I A;  3JCM X;  4LDY A;  4CC7 A;  4JZ3 A;  1FWZ A;  2OTL T;  1J3T A;  3QZ9 B;  3CCJ Q;  5CKD A;  3I56 Q;  5FRM A;  1UUE A;  2GTO A;  2RHZ A;  5A0G A;  1Q81 R;  3CC2 Q;  5C0M A;  2RQW A;  3BFM A;  2PTK A;  6AT1 B;  5A0D A;  3CD6 T;  1ZUU A;  2IPO B;  2B86 A;  4M7D B;  4C92 A;  2I2L A;  2YUN A;  2K5F A;  1IO6 A;  2M0Y A;  1GFC A;  1BI3 A;  2QEX T;  4ELY C;  3INZ A;  5GAN 7;  1YIT Q;  3QYH B;  1PWT A;  4MDW A;  5GAN f;  2E41 A;  2L5Q A;  5KCH A;  2PUO B;  5FRN A;  1AWX A;  3Q1J A;  4NL2 A;  4Y91 A;  1ZQ1 A;  4XU2 A;  1YWO A;  3LH0 A;  1Y57 A;  3EH2 A;  1FX7 A;  4O5V A;  1VQN T;  5GAN 6;  2DZ9 A;  3E9F A;  4XTY A;  3PIP A;  4KBM B;  2NLU A;  4M78 A;  3BY7 A;  2JTM A;  1YJN T;  2YRV A;  2PZ1 A;  3UA6 A;  2CGH A;  4R56 A;  3G6E Q;  4MZM A;  3RMQ A;  1JJ2 P;  2L89 A;  3CCR A;  1QCO A;  3NPF A;  1YJ9 T;  3G4S Q;  5FU7 C;  2VKN A;  2DA9 A;  2G6F X;  1Q82 R;  4BI8 B;  4AG1 C;  4DQ2 A;  2SEM A;  3AT1 B;  1UDL A;  4C5H A;  1IHV A;  3HSB A;  2LX7 A;  1OQK A;  2EQM A;  2L0A A;  3CCU A;  1WZO A;  2CZ1 B;  2XI9 A;  4WCI A;  5FU7 B;  2RQU A;  4OGC A;  1I4K 1;  1AT1 B;  2KT8 A;  2RQV A;  5GJW B;  3C0C A;  2FVU A;  3V7C A;  1VQ5 T;  1EZZ B;  2BUD A;  1K8A C;  5GJV B;  2L3Q A;  1RAD B;  1D0Y A;  2P4T A;  3VU3 C;  2V8J A;  2DIG A;  2YXY A;  3RKX A;  4BE2 A;  1ZSZ A;  2EQJ A;  1PM3 A;  1RAE B;  2D0N A;  2RPN A;  2HKN A;  5GAN 3;  2WSF E;  1OPL A;  5KYN A;  4E6R A;  2D8H A;  4BDZ A;  1TSF A;  4PFO A;  1IGQ A;  3CC2 T;  5FWC A;  1BU1 A;  1KQS P;  4RKU E;  4D8K A;  9ATC B;  1LOJ A;  2H8H A;  2FG0 A;  3TSW A;  4BD3 A;  1VQ7 A;  3EFO B;  1I0C A;  1VQ5 A;  5AYF A;  3H6Z A;  4EMH A;  3URG A;  3C94 A;  4Z8A A;  1XNI A;  5LJ3 e;  2LRQ A;  2DXT A;  3VRZ A;  1LVK A;  2FZC B;  2ZGW A;  3TSZ A;  3M9Q A;  3OYL A;  5FLX E;  1EFN A;  1NYF A;  2J7I A;  1SRM A;  2CT4 A;  2A3L A;  4Z88 A;  3DB4 A;  4BB7 A;  2DBM A;  1N8R R;  1OEB A;  1M1G A;  3UPU A;  5CQY A;  4C92 B;  1VQ8 A;  2L2P A;  4C0D B;  3GOX A;  4ATO A;  4M77 D;  5I22 A;  5KYW B;  2COW A;  4IIO A;  1K8A R;  2LJ3 A;  3SB2 A;  8AT1 B;  4PJO A;  1BIA A;  1VQM Q;  3CCL A;  1TH7 A;  1G3S A;  2ROT A;  3CXC S;  2RI2 A;  3X24 B;  3SEM A;  2XDB A;  5I2M A;  1H3Z A;  5IXB A;  4M75 A;  4XU3 A;  2M02 A;  3O5Z A;  2LQ8 A;  1RAA B;  2AZS A;  2CRE A;  2DYI A;  3TVT A;  2CP6 A;  5J26 A;  3A98 A;  1M2V A;  3VS4 A;  1S72 Q;  2M0O A;  4M78 D;  2EIF A;  2XK0 A;  3VS2 A;  4BE0 A;  1YI2 Q;  2J6F A;  3E19 A;  1B34 A;  2QTX A;  1M2V B;  4D6W A;  1D3B A;  3R6N A;  2RI3 A;  4E7I A;  1TG0 A;  3UAT A;  3BW1 A;  1QKX A;  3MP1 A;  2LQK A;  5CCA A;  1PKT A;  2K3Y A;  3ZFJ A;  4DOV A;  4MZT A;  2RHX A;  2HDA A;  1M3A A;  3JSC A;  2BIV A;  2X4Y A;  4EMK B;  1JXO A;  5KCO A;  3GLX A;  3JB9 J;  1HJD A;  1OPK A;  2EW3 A;  1MMD A;  3EG9 B;  1S1N A;  1MUZ A;  2C0T A;  3KXT A;  3CC7 T;  4RMO A;  4J83 A;  2MWO A;  2X51 A;  4OB2 B;  2LP5 A;  2DM1 A;  3GIB A;  1MND A;  4TVR A;  3LLR A;  1YJW T;  3QHS A;  1NEB A;  2HSE B;  3S3M A;  1ZSZ C;  2ZPI B;  1RLP C;  3A5Z B;  1Y71 A;  1PRL C;  4F14 A;  3EG3 A;  4RTU A;  1VQK A;  2DET A;  3FJ5 A;  3CBO A;  1ZUY A;  1M3C A;  3VYH B;  4OB0 B;  3WVD B;  1H64 1;  2R57 A;  2A0F B;  4FYV B;  4AFU C;  1OV3 A;  1AWO A;  5FW9 A;  4M7A G;  2X4J A;  3ULR B;  4KUI A;  1K73 U;  3CCQ A;  5KYY A;  2HBW A;  4KGV B;  3QWY A;  1IXD A;  4PJO B;  1X2Q A;  2X4X A;  2W10 A;  2AHJ B;  1TWB A;  2FB7 A;  1YI2 A;  1P92 A;  4X9D A;  5FRO A;  4LUE A;  2EGA A;  1BI1 A;  4NS5 A;  4AMC A;  2K4Y A;  5D7U A;  3PFS A;  2ED1 A;  1UE9 A;  2K7A A;  1D09 B;  1N5Z A;  2ED0 A;  1WHH A;  1X01 A;  4PJO G;  1YFN A;  3REB B;  4FL6 A;  3SDZ A;  4XTZ A;  2RHI A;  3OYA A;  1RAG B;  3VS5 A;  3OYE A;  1M8M A;  1OUL A;  1QVF A;  2LNH B;  4PLI A;  4AFQ C;  1SSH A;  1YI2 T;  3CC4 T;  2RJF A;  2MPX C;  1UGS B;  2X9H A;  2VGN A;  5HCK A;  4WF2 A;  2D8J A;  1VQ4 A;  1NPR A;  2OTL A;  3JCM h;  1VIE A;  2MF2 A;  2O9S A;  1VQM A;  4M7A D;  4LDX A;  2OJ2 A;  1B34 B;  1GCQ A;  5LJ5 j;  1ZSG A;  1KQ1 A;  1ZSZ B;  4J7I A;  1I8F A;  1M1F A;  1QVG A;  3M5A A;  3CC4 A;  3JB9 G;  2PNI A;  4OMF B;  5LJ3 f;  4PFP A;  4PJN A;  2LJ1 A;  4V2S A;  2DJQ A;  4J9I A;  3CCE Q;  2AK5 A;  2AKK A;  3M0Q A;  1HSQ A;  5GAM j;  3MEW A;  2D1X A;  1Q7Y U;  2DRM A;  5M9O A;  1M9S A;  3MET A;  2V26 A;  2M16 A;  1Y96 A;  3A8M B;  2X3W D;  4C0G A;  2YDL A;  2KVQ G;  1QWE A;  4ZN3 A;  1VQL A;  2XIC A;  1VQ5 Q;  1QCN A;  2E3I A;  1VQM T;  1QVP A;  1N8R U;  3I5R A;  3TCJ A;  4XU1 A;  1IZ6 A;  2RQR A;  5GAN h;  2VVK A;  1X6B A;  4F7U B;  3VS3 A;  2DZC A;  2FPF A;  4J9F A;  3NMZ C;  4CI0 C;  1GBR A;  2E6Z A;  3I5S A;  3A8L B;  1QW1 A;  2GFU A;  1V76 A;  1N6A A;  2LQW A;  2FHD A;  2LQN A;  1JO8 A;  1WHK A;  3M4Y A;  2FRW A;  1F1B B;  1U5S A;  1OX8 A;  2PU9 B;  7AT1 B;  1IRE B;  3X28 B;  1NJI R;  2DK3 A;  2LJ0 A;  3EFS A;  1RL2 A;  2KGT A;  3FB9 A;  5LJ3 g;  4KH0 B;  4HVV A;  1ARK A;  2DEQ A;  4LXC A;  1GCP A;  3C95 A;  2OTL Q;  2RD1 A;  4OMP A;  3CPF A;  2EKO A;  2P0P A;  3QUI A;  4M78 F;  3CCS Q;  3QII A;  1MGQ A;  3OW2 P;  3S3O A;  4M7A A;  1M90 U;  2RH2 A;  3CCE T;  2BZ8 A;  2YRC A;  4WTO B;  4O6J A;  1UFF A;  1NLP C;  3RER A;  1XQH A;  3CCQ T;  5GAM f;  5IH2 A;  4A53 A;  2B8A A;  2VYT A;  1PC0 A;  2K3X A;  2RM4 A;  1TTH B;  3PTA A;  2QK0 A;  1TUC A;  1WHM A;  2COZ A;  1TUG B;  3CC7 A;  5KH6 A;  5KYW A;  2MYS A;  3E9G A;  4EDU A;  5GAO n;  1KD1 U;  3HFN A;  2EJF A;  3X25 B;  1Z9Z A;  5J39 A;  5LJ5 f;  1B07 A;  3WVE B;  2L3S A;  2DD5 A;  3H0H A;  3P8B B;  3THK A;  2Y4X A;  4PJJ A;  1FMK A;  1VQK T;  1VYV A;  3LWH A;  4F7U A;  2QEX Q;  2G3R A;  1PKS A;  1Q7Y R;  1QCF A;  2DBK A;  4VUB A;  2HZY A;  3EG9 A;  5GAN e;  3M56 A;  3CCS T;  1WI7 A;  2QI2 A;  2LDM A;  1KD1 R;  2L3R A;  5A2Q E;  1VQP A;  2VXE A;  2R5A A;  2KXC A;  1UJY A;  5DM7 R;  3EFO A;  5GAN d;  3CCM T;  1UGR B;  3V7R A;  2YUP A;  3L2R A;  1S72 T;  1MV3 A;  3C12 A;  1WLP B;  3QJ6 A;  5I21 A;  1PSE A;  2MI6 A;  1H92 A;  3M0T A;  5J3B A;  3QO3 A;  1D3B B;  2PVG B;  2K5I A;  3D7S B;  4QQD A;  4F7U E;  1TU0 B;  3LH5 A;  1T0J A;  5GMK l;  1LPL A;  4PK4 A;  2A36 A;  3JCM c;  2GNC A;  3JCM d;  5GAO p;  3CC2 A;  4YTL A;  2KAF A;  4A4K A;  2FZK B;  2OX7 A;  3QBY A;  2IIM A;  4EMG A;  1JQQ A;  1OX9 A;  1ABO A;  2FPE A;  4LD9 K;  2DTO A;  5CVI A;  2LZ6 B;  3CCV Q;  2OAW A;  3BDU A;  2RQT A;  2VC8 A;  2HQX A;  2CSI A;  1VQ9 Q;  1C1A A;  1KC8 U;  2CH4 W;  4FYW B;  3I56 A;  1KJW A;  2EBP A;  1AEY A;  3NHN A;  1H3H A;  1K73 R;  4JRP A;  1Z9Q A;  2DTI A;  4FIB A;  2KXD A;  4L5G A;  2C06 A;  4JLI A;  1SRL A;  3OYC A;  3ZL7 C;  4XTV A;  4C8Q E;  2CSQ A;  2E3H A;  2C0I A;  2DL8 A;  4E7H A;  4Q5W A;  5IXF A;  2KSS A;  4M78 C;  1YN8 A;  1FXX A;  2WSC E;  2BTT A;  1Q81 U;  2AZV A;  4EIK A;  2ABL A;  2CP2 A;  2KBT A;  1T0H A;  4PJO C;  4Z89 A;  5AT1 B;  4C5E A;  3M0P A;  3FJP A;  1B3Q A;  5KYY B;  1WJR A;  4IUQ A;  2LTO A;  3OY9 A;  3UA7 A;  1C0M A;  1T3L A;  2JOY A;  4E7L A;  1D1A A;  2QQA A;  4J6W A;  4GY5 A;  4PNO A;  2EQK A;  3NTK A;  4B9X A;  4OMO A;  1XOV A;  2LNV A;  3VJP A;  3QKJ A;  3NTI A;  3CME T;  2A28 A;  3EHR A;  3OS0 A;  5CKF A;  4II1 A;  4RG8 A;  1YJN Q;  2Z0W A;  3OMG A;  1K9M C;  2E65 A;  4FYX B;  1GCQ C;  1EIF A;  3NGP A;  1KIK A;  2CS7 A;  3HKS A;  1VQ8 Q;  1W2B S;  3RNJ A;  2YUO A;  1QWF A;  3HTR A;  1KHI A;  4F7U G;  2DPP B;  3GNG A;  2X35 A;  1N9R A;  3VUB A;  2JT4 A;  4B6M A;  1DJ7 B;  2DL3 A;  1K9M U;  3CD6 A;  4M7D F;  2ZPH B;  2JVV A;  3HRT A;  4EMK A;  3V8L A;  1LJO A;  5D6X A;  3CCR T;  2LCL A;  4XQ3 A;  4C8Q C;  2AIR B;  4M75 G;  3HHT B;  1KK7 A;  1JXM A;  1YWP A;  2RB6 A;  4M4Z A;  2HAX A;  4AT1 B;  5GMK e;  1YJN A;  2K2V A;  3CPW A;  3JCM f;  2HCK A;  3SHW A;  3DLM A;  3CMA A;  2DRK A;  3OYF A;  1BK2 A;  1JB0 E;  2AT1 B;  2WSE E;  2KDS A;  4ELZ C;  1VQP Q;  3I55 A;  1VOM A;  1G83 A;  2K2M A;  2QYZ A;  1QP3 A;  2DVJ A;  4RTV A;  2VWF A;  4JS4 A;  2HBP A;  3OYD A;  1HD3 A;  3CXC P;  4C8Q G;  4HCZ A;  3SD4 A;  2CP0 A;  2X4W A;  1Q86 C;  4J9B A;  4JJD A;  2KMT A;  2E1H A;  5GMK h;  2HSP A;  4IUP A;  3EGX A;  3OQ5 A;  2DYB A;  1SF9 A;  4XTX A;  2CZ7 B;  3PVL A;  3OMC A;  3AHU A;  1R8O B;  4LNP A;  2EYY A;  3L42 A;  4PJO F;  1JU5 C;  5CAI A;  2E5K A;  3HRU A;  3VUZ A;  4XK8 E;  1BI2 A;  2DJZ A;  4CC2 A;  1XTD A;  2LT1 A;  2CP5 A;  2RJE A;  4ZGE B;  1QVG S;  2E5Q A;  2QG9 B;  1QVG P;  1WGS A;  2J6K A;  2EFI A;  1TS9 A;  1ABQ A;  3QDF A;  2ENM A;  1Q82 U;  4XTU A;  1PSF A;  1FMV A;  3TRE A;  4ZTF A;  1M90 C;  1VQ9 A;  4C92 F;  5IAY A;  1MMA A;  4JUV A;  2CDT A;  4HCK A;  3PT9 A;  3CMA Q;  1JJ2 S;  1UEC A;  2E12 A;  5GAN 5;  2DD4 A;  3ZBD A;  2DFU A;  4F04 B;  1YIT A;  5IHN A;  1WHL A;  5EG2 A;  2M9U A;  2M1H A;  4J9C A;  2RA2 A;  3QWX X;  4E47 A;  4KT0 E;  2QGF B;  2HQE A;  1GL5 A;  4HXJ A;  5KYX B;  2QAS A;  3U23 A;  2JM8 A;  4C92 D;  2NUT B;  4M77 A;  1Q81 C;  1YIJ T;  3OB9 A;  3QPH A;  2NYS A;  1D0Z A;  1VQ9 T;  4GLM A;  2YLB A;  3CCJ A;  1K1Z A;  3HP9 A;  2KRS A;  4FU6 A;  2EQI A;  2QEX A;  3L1A A;  2YHT A;  3NTH A;  2K9G A;  3LW5 E;  2DX1 A;  1U06 A;  3PMI A;  1VIF A;  4J5Y A;  3SWN A;  3UF4 A;  1Q95 G;  3RIR A;  5EC7 A;  4BUG A;  5CR2 A;  1VQ4 Q;  1QQJ A;  1AWJ A;  3WXM B;  2FL7 A;  3RR6 A;  1ZLM A;  3G71 Q;  1K8A U;  3VS6 A;  3M4G A;  1OYX A;  3IQL A;  5GAO m;  1JEG A;  2DE0 X;  2RO0 A;  3REA B;  1K76 A;  1KC8 C;  4M78 B;  4PJM A;  3J81 E;  3FC3 A;  4OB1 B;  2NUP B;  1OOT A;  3OBY A;  1E6G A;  1RAB B;  2J05 A;  2K6D A;  4JJC A;  4RTX A;  1MNE A;  4ZGJ B;  3EAE A;  1NM7 A;  4X1V A;  3P8D A;  2E10 A;  3RKY A;  1BYM A;  1BI0 A;  1AOJ A;  5CKE A;  3I55 Q;  4QQ6 A;  3CPW S;  4RTW A;  5DY9 A;  3PVQ A;  2DO3 A;  2F2W A;  4BDY A;  3OW2 A;  2VAS A;  3MP8 A;  3CMA T;  2OTJ A;  5ECA A;  4FT4 A;  1G2B A;  4M77 F;  2IG0 A;  3E2U A;  2VGM A;  2XDP A;  3CCQ Q;  3JB9 F;  2EPD A;  4M7D A;  2EAY A;  2KY9 A;  4HVW A;  1VQO Q;  2RI5 A;  1VQ4 T;  4KGZ B;  3EGD A;  2DLP A;  1AD5 A;  1UHF A;  1OZ3 A;  3MCA B;  1AWW A;  3SFM A;  4IUV A;  2KRN A;  1AZE A;  3CCV A;  5GAO r;  4BE1 A;  4UC4 A;  4DEX A;  1YJW Q;  2DL4 A;  1CSK A;  1VQK Q;  2OI3 A;  1D1B A;  1WIE A;  1PG5 B;  3LWI A;  3UWN A;  2IVW A;  5GMK j;  4GBQ A;  3M0R A;  4A4F A;  4FM4 B;  4PL6 A;  3OSV A;  4IKF A;  8ATC B;  2O4X B;  3M54 A;  1PD1 A;  5HKC A;  2F2X A;  3PGG A;  1O9S A;  3JB9 D;  2V1Q A;  1HYO A;  3VS7 A;  1VQ6 Q;  3L2Q A;  2XD0 A;  4ME7 A;  1WPY A;  1MV0 B;  1ZBJ A;  1M3B A;  2CUD A;  1IHW A;  1KC8 R;  3PIO A;  2F5K A;  2GQV A;  3VKI A;  4DBF A;  4QVC A;  2A37 A;  3EGD B;  4JRI A;  1K4U S;  3G4S T;  3H8Z A;  2QXF A;  3MEA A;  2HKQ B;  1K9A A;  3L2Z A;  4KUL A;  3QG1 A;  3HPW A; 
#chains in the Genus database with same CATH homology
 1MHN A;  2E6N A;  1KC8 U;  2QA4 A;  3CC2 T;  3NFC A;  3I56 A;  4RKU E;  3L2W A;  1LOJ A;  3A8O B;  3C4S A;  3ASK A;  2RHY A;  4JRK A;  3ME9 A;  4MDX A;  1VUB A;  2ZPF B;  4BD3 A;  4JRP A;  1VQ7 A;  1I81 A;  1KQS A;  3JCM Q;  2DTI A;  1VQ5 A;  5AYF A;  3H6Z A;  4FIB A;  4EMH A;  2D6F A;  2DXB A;  2VUB A;  1KG1 A;  1UEB A;  4L5G A;  3URG A;  2C06 A;  3C94 A;  1G3T A;  3CEY A;  4JLI A;  5GAN 4;  3OYC A;  2DXU A;  1LNX A;  1XNI A;  5LJ3 e;  4XTV A;  2LRQ A;  2DXT A;  2R58 A;  4C8Q E;  4QVD A;  4ZGD B;  1Y07 A;  3OW2 S;  4XTW A;  2PVD B;  2DXC A;  2ZGW A;  5KE2 A;  3M9Q A;  1X6O A;  4BI3 A;  3OYL A;  4E7H A;  5FLX E;  4Q5W A;  4X9C A;  1UGP B;  2A3L A;  2QQ9 A;  2KSS A;  1YBY A;  2V8I A;  3DB4 A;  4BB7 A;  4M78 C;  2ZCF B;  5LJ3 d;  2MMP A;  3M58 A;  2EQU A;  1FXX A;  1M1G A;  3UPU A;  5CQY A;  2L8D A;  4JDS A;  3MEV A;  3X20 B;  2ZPG B;  3JCM g;  4NOY A;  5L8R E;  4BY6 C;  2WSC E;  4C0D B;  1HXD A;  3BDL A;  1VQP T;  3CCS A;  1Q81 U;  3GOX A;  4ATO A;  2EYQ A;  4JLG A;  2MWP A;  4ZN1 A;  4M77 D;  1VQ7 T;  4PJO C;  3M57 A;  1KHC A;  1BKB A;  3SB2 A;  4C5E A;  3V7S A;  3CCV T;  3FJP A;  1WNL A;  4PJO A;  3RUX A;  1BIA A;  1WJR A;  4IUQ A;  4QW2 A;  3SWN B;  4J8O A;  2LTO A;  3OY9 A;  3V8J A;  3A8H B;  3CCL A;  1UGQ B;  1TH7 A;  2JOY A;  2KQW A;  3JCM V;  3OYJ A;  4E7L A;  4HCC A;  2QQA A;  1G3S A;  3CBM A;  3DB3 A;  3PMT A;  4J6W A;  3CXC S;  4GY5 A;  2RI2 A;  3X24 B;  4PNO A;  3RKW A;  4LD6 A;  2EQK A;  4C0F A;  3NTK A;  5CO7 A;  2XDB A;  1OI1 A;  5CKH A;  5I2M A;  4L6V 5;  4B9X A;  2GCX A;  2KK4 A;  1H3Z A;  1Y96 B;  4M75 A;  4XU3 A;  2LC4 A;  5CK9 A;  3X26 B;  4DA4 A;  1XOV A;  2LNV A;  4N0A C;  5LJ5 e;  2LQ8 A;  3VJP A;  1VQN A;  3VYG A;  4MML A;  2JZ2 A;  3QKJ A;  1NJI U;  4M77 B;  3NTI A;  3JCM P;  1Q7Y C;  3CME T;  5CIU A;  5J26 A;  3OS0 A;  5CKF A;  3CME A;  3G7Z A;  4M7D G;  3KBG A;  4II1 A;  4RG8 A;  2Y90 A;  4M7D D;  3OMG A;  4M77 E;  4C92 B;  1K9M C;  2M0O A;  4M78 D;  2E65 A;  5GAM e;  1EIF A;  3MEU A;  2EIF A;  5C6S A;  2XK0 A;  4C8Q D;  4LDV A;  2E64 A;  4BE0 A;  2F5T X;  3QDR B;  3E19 A;  4M75 F;  2CS7 A;  3HKS A;  1W2B S;  4RCC A;  1B34 A;  3OBW A;  2QTX A;  4D6W A;  3L2V A;  1D3B A;  4FSX A;  2EJG A;  2RI3 A;  3HRS A;  5CKB A;  3RMS A;  4E7I A;  1N8R C;  3CBP A;  1KHI A;  4F7U G;  3CCL T;  2DPP B;  3BW1 A;  3GNG A;  3MP1 A;  2LQK A;  5CCA A;  2K3Y A;  3ZFJ A;  2Y4Y A;  2X35 A;  2RHX A;  1N9R A;  2RK2 A;  4MZT A;  5FU6 B;  3VUB A;  3T9N A;  4DOV A;  3OYG A;  3JSC A;  2RJC A;  3GP8 A;  1DJ7 B;  1K9M U;  3FDR A;  2BIV A;  2X4Y A;  4EMK B;  3CD6 A;  4M7D F;  1ZBX A;  5LJ3 h;  1N9S A;  5KCO A;  2ZPH B;  2JVV A;  3GLX A;  3JB9 J;  3HRT A;  4EMK A;  3N5B B;  3V8L A;  1LJO A;  5D6X A;  3CCR T;  2LCL A;  4XQ3 A;  4C8Q C;  3GNF B;  4M75 G;  5LL6 S;  1VQO T;  4MZP A;  1Y7X A;  1VQ8 T;  3MP6 A;  3HHT B;  3V8K A;  4PLL A;  4LDU A;  3KXT A;  4RMO A;  3CC7 T;  1M4Z A;  4J83 A;  2RB6 A;  1S72 A;  1VQ8 A;  2P0K A;  2HAX A;  5GMK e;  1YJN A;  4M75 C;  2MWO A;  3UDC A;  2DKG A;  5CQX A;  2K2V A;  3CPW A;  3JCM f;  3CCM A;  1KQ2 A;  1JJ2 A;  3QJY A;  4OB2 B;  4OF1 A;  3DLM A;  3LGL A;  2OTJ T;  3GIB A;  3CMA A;  4TVR A;  2ZPB B;  3LLR A;  3OYF A;  1BIB A;  1JB0 E;  1YJW T;  2PVO B;  3QHS A;  3MO8 A;  4OP0 A;  5DLO A;  3HL8 A;  2WSE E;  3LX7 A;  2KDS A;  3S3M A;  1W4S A;  2E70 A;  4HKE A;  3ZEH A;  5GAO l;  2ZPI B;  4HT8 A;  3A5Z B;  4ELZ C;  1Y71 A;  4EPC A;  3I55 A;  1QP3 A;  3OS1 A;  3CCJ T;  1GXI E;  4C92 G;  1YHQ A;  3A8G B;  3DLL A;  2PUK B;  3UT1 A;  4P5N A;  2XU8 A;  1YCY A;  2K5L A;  3R6O A;  4JS4 A;  2WAC A;  2HBP A;  3OYD A;  1VQK A;  1U1T A;  4IUR A;  4R55 A;  3LGF A;  3I56 T;  3JCM b;  3LYI A;  5IN1 A;  4HCZ A;  4C8Q G;  3CBO A;  3SD4 A;  2X4W A;  2XDD A;  4A4H A;  2H3J A;  1Q86 C;  2HD0 A;  3VYH B;  4OB0 B;  3WVD B;  2KMT A;  4JRQ A;  2E1H A;  1H64 1;  2R57 A;  5GMK h;  2JUF A;  2VXF A;  4IUP A;  3JCM e;  3OQ5 A;  2GF7 A;  1NZ9 A;  2LVM A;  3FLG A;  4M7A G;  2X4J A;  4J6Y A;  4KUI A;  2DIQ A;  4XTX A;  4F7U F;  2CZ7 B;  3M53 A;  1U8R A;  3OMC A;  4C5I A;  4EMK C;  5KE3 A;  3OA6 A;  1R8O B;  1M1K U;  3AHU A;  1K73 U;  3L42 A;  4JJN K;  3CCQ A;  4PJO F;  1KQS S;  5CAI A;  4N0A A;  1Q82 C;  1Q86 U;  3JAM E;  3HRU A;  3VUZ A;  4XK8 E;  2JN0 A;  1BI2 A;  2DJZ A;  3OYN A;  4C8Q B;  1NJI C;  4PJO B;  1XTD A;  3CCE A;  3KUF A;  2X4X A;  4C5G A;  2LT1 A;  2AHJ B;  2FB7 A;  2P0Q A;  1RI0 A;  2RJE A;  4ZGE B;  1YI2 A;  2PQW A;  2D0Q B;  3VV0 A;  2E5Q A;  5LJ3 j;  3TU4 K;  1P92 A;  3FRN A;  1WGS A;  2OAU A;  4X9D A;  2EFI A;  1X75 C;  5FRO A;  5GMK i;  3SWN C;  3MHX A;  1BI1 A;  1WQ7 A;  4X34 A;  2DVE A;  4NS5 A;  3G6E T;  4IUU A;  2K4Y A;  4QVZ A;  4Y28 E;  3PFS A;  1K73 C;  2CYZ B;  1VQL T;  1WQW A;  3CCU T;  2LX9 A;  1NE8 A;  4OVA A;  5I2S A;  4M75 D;  2JNG A;  5GAN j;  1Q82 U;  3OYM A;  5HK0 A;  4XTU A;  1PSF A;  4L59 A;  5GAM h;  1X01 A;  4BI4 A;  3PNW C;  4PJO G;  2BKD N;  1VQ6 T;  5FU6 C;  3TRE A;  4C8Q A;  5DLQ E;  4M78 E;  4ZTF A;  4FL6 A;  4MMK A;  1M90 C;  3SDZ A;  1VQ9 A;  1V29 B;  2QDY B;  2XHC A;  2O4X A;  4QQG A;  4C92 F;  5IAY A;  4XTZ A;  1G5V A;  2RHI A;  1HK9 A;  4JUV A;  3OYA A;  3OYB A;  2LCC A;  4RG2 A;  4HCB A;  2F69 A;  4M77 C;  3PT9 A;  3JCM J;  3OYE A;  4PJO D;  5LJ5 h;  1JJ2 S;  1QVF A;  4PLI A;  5HY6 A;  3G71 T;  1YI2 T;  1YJ9 A;  2E12 A;  3CC4 T;  2RJF A;  1UGS B;  2JTF A;  4M7A E;  2VGN A;  4PKC C;  4DOW A;  1M8V A;  5GAN 5;  4WF2 A;  2DD4 A;  4ZTJ A;  1VQ4 A;  1NPR A;  1N27 A;  2RHU A;  3ZBD A;  1QP2 A;  3JCM h;  5GMK m;  1YIT A;  2OTL A;  1VIE A;  2MF2 A;  4J7F A;  1VQM A;  4M7A D;  5EG2 A;  3OYH A;  1WJQ A;  4LDX A;  3OYY A;  2M9U A;  2RK1 A;  1B34 B;  1G3W A;  2M1H A;  2YLC A;  5GAM g;  3E1S A;  1YIT T;  2HNI A;  2RA2 A;  4GLK A;  1KQ1 A;  4E47 A;  5LJ5 j;  4J7I A;  4KT0 E;  1I8F A;  1M1F A;  1QVG A;  4C92 E;  4N4H A;  4OB3 B;  2HQE A;  4LDW A;  4XAX B;  3M5A A;  5GAO q;  5D6Y A;  1KD1 C;  3CC4 A;  3JB9 G;  4OMF B;  3S6W A;  3G71 A;  5LJ3 f;  2GFA A;  3J80 E;  4V2S A;  4C92 D;  5LJ5 g;  1YIJ A;  4M77 A;  2QQS A;  3S3N A;  1Q81 C;  1YIJ T;  2VV5 A;  5GAM j;  4KUD K;  1M5Q 1;  3MEW A;  3OB9 A;  3QPH A;  2MAM A;  3J7A F;  1Q7Y U;  1VQ9 T;  2YLB A;  5M9O A;  3CCJ A;  2CZ6 B;  1M9S A;  3F70 A;  3MET A;  3HP9 A;  3M55 A;  4FU6 A;  1JRI A;  4JS5 A;  3RES A;  2XKO C;  3OYK A;  2QEX A;  2M16 A;  4E7J A;  3JB9 H;  1Y96 A;  3A8M B;  4M75 B;  4B9W A;  4M7A B;  4C0G A;  4C0Z A;  4A4G A;  3L1A A;  2KVQ G;  2YHT A;  3NTH A;  1U1S A;  5GAN 2;  3LW5 E;  4N4I A;  1I5L A;  4ZN3 A;  1VQL A;  2XIC A;  3JCM X;  2ZZD A;  4LDY A;  3G6E A;  4A4E A;  1VQM T;  1QVP A;  3PMI A;  1FWZ A;  1VIF A;  2FYK A;  4J5Y A;  3SWN A;  2XID A;  3TCJ A;  1N8R U;  2OTL T;  4XU1 A;  1IZ6 A;  3QZ9 B;  5GAN h;  4F7U B;  3RIR A;  5CKD A;  2DZC A;  5FRM A;  4IUT A;  2RHZ A;  1G3Y A;  4XU0 A;  5A0G A;  4M78 G;  4BUG A;  5CR2 A;  4CI0 C;  4Z02 A;  2E6Z A;  2RJD A;  3P8H A;  1QVG S;  5C0M A;  3A8L B;  1QW1 A;  2GFU A;  2FL7 A;  3WXM B;  1N6A A;  3CXC A;  3BFM A;  2FHD A;  1K8A U;  3M4G A;  1OYX A;  3M4Y A;  2R5M A;  5A0D A;  5GAO m;  4BAC A;  3CD6 T;  2D9T A;  4CRI A;  2PU9 B;  3QXE B;  2QQR A;  2RO0 A;  3OS5 A;  3OSS C;  1ZHI A;  5D6W A;  1IRE B;  4M7D B;  3X28 B;  4C92 A;  2I2L A;  1KC8 C;  1VQ6 A;  4M78 B;  2K5F A;  3J81 E;  3FC3 A;  1QVF S;  4OB1 B;  4M77 G;  2DK3 A;  4NL3 A;  1BI3 A;  1RL2 A;  3EFS A;  3FB9 A;  5LJ3 g;  2QEX T;  3OBY A;  4ELY C;  2DEQ A;  4C92 C;  3INZ A;  4BY6 B;  5GAN 7;  3C95 A;  2RD1 A;  4ZGJ B;  4N4G A;  3CPF A;  3EAE A;  3QYH B;  2EKO A;  5GAN f;  2P0P A;  4MDW A;  2E41 A;  3QUI A;  2L5Q A;  4M78 F;  5KCH A;  2PUO B;  3P8D A;  5FRN A;  3QSU A;  1O75 A;  2E10 A;  3RKY A;  3QII A;  1BYM A;  1BI0 A;  1MGQ A;  3Q1J A;  4NL2 A;  5CKE A;  4Y91 A;  1ZQ1 A;  3FIF A;  3S3O A;  4XU2 A;  1YHQ T;  4HA8 A;  4A54 A;  3LH0 A;  2RH2 A;  4QQ6 A;  1M90 U;  4M7A A;  3CPW S;  5DY9 A;  3I55 T;  3CCE T;  2DO3 A;  3OS2 A;  4M7A C;  2QQB A;  4BDY A;  4HT9 A;  4O6J A;  1FX7 A;  1YJW A;  3OW2 A;  4O5V A;  3RER A;  1VQN T;  1XQH A;  3MP8 A;  3CMA T;  5GAN 6;  2OTJ A;  2DZ9 A;  3CCQ T;  4FT4 A;  3E9F A;  5GAM f;  4M77 F;  2IG0 A;  4XTY A;  3PIP A;  4KBM B;  2B8A A;  2NLU A;  4M78 A;  2VYT A;  3BY7 A;  4A53 A;  5GAN 8;  2K3X A;  2VGM A;  2JTM A;  2RM4 A;  2XDP A;  3JB9 F;  4M7D A;  2EAY A;  3PTA A;  2KY9 A;  1YJN T;  2YRV A;  2K57 A;  1UB4 A;  2CKK A;  2RI5 A;  5KH6 A;  3L2U A;  1NPP A;  2CGH A;  3CC7 A;  4R56 A;  4E7K A;  1VQ4 T;  3E9G A;  4EDU A;  5GAO n;  1VQO A;  4MZM A;  1KD1 U;  3HFN A;  2EJF A;  3RMQ A;  3X25 B;  1AHJ B;  2L89 A;  4FT2 A;  5LJ5 f;  5J39 A;  3JB9 I;  1OZ3 A;  3CCR A;  3JCM W;  2LT4 A;  1YJ9 T;  3MCA B;  4M7A F;  3WVE B;  4OGE A;  3SFM A;  4IUV A;  2DD5 A;  3P8B B;  4RCB A;  2Y4X A;  3QYG B;  3CCV A;  5GAO r;  1VQK T;  5FU7 C;  3EFR A;  4BE1 A;  1M1K C;  3LWH A;  4F7U A;  4UC4 A;  2DTH A;  2G3R A;  3JRZ A;  3ER0 A;  1W2B A;  5HK3 A;  4M7D C;  4M75 E;  4VUB A;  4BI8 B;  4DQ2 A;  5GAN e;  3M56 A;  3CCS T;  3M59 A;  3OYI A;  2QI2 A;  2LDM A;  2L3R A;  3HFO A;  5A2Q E;  3LWI A;  1VQP A;  2VXE A;  3UWN A;  2R5A A;  2IVW A;  4C5H A;  2EJ9 A;  5GMK j;  5GAN g;  3HSB A;  4A4F A;  4FM4 B;  5DM7 R;  4PL6 A;  2EQM A;  5GAN d;  3CCM T;  3CCU A;  1UGR B;  3OSV A;  2CZ1 B;  2XI9 A;  4IKF A;  2O4X B;  5A0L A;  3M54 A;  5FU7 B;  5HKC A;  3V7R A;  3PGG A;  1O9S A;  2V8K A;  3L2R A;  3JB9 D;  1S72 T;  4PJO E;  2A7Y A;  4C8Q F;  4OGC A;  3C12 A;  1I4K 1;  3L2Q A;  3QJ6 A;  5I21 A;  2XD0 A;  5LJ5 d;  1PSE A;  2MI6 A;  4C0D C;  4ME7 A;  1WPY A;  3QO3 A;  5J3B A;  1D3B B;  2PVG B;  2K5I A;  3GPL A;  2EWN A;  2FVU A;  3V7C A;  4QQD A;  2BUD A;  4F7U E;  1VQ5 T;  1K8A C;  2O01 E;  3DKM A;  5GMK l;  3PIO A;  3JCM c;  2DAQ A;  3JCM d;  2F5K A;  2GQV A;  3VKI A;  2P4T A;  3VU3 C;  4QVC A;  2V8J A;  5GAO p;  3CC2 A;  4YTL A;  2KAF A;  2QA4 T;  2DIG A;  2XG8 D;  2ZPE B;  3GF5 A;  3RKX A;  4A4K A;  5GAM d;  4BE2 A;  3QBY A;  2CZ0 B;  4JRI A;  2EQJ A;  1OZ2 A;  3G4S T;  4EMG A;  1SSF A;  3H8Z A;  3TEE A;  4LD9 K;  4J6X A;  1JBM A;  2DTO A;  2QXF A;  5CVI A;  3MEA A;  5GAN 3;  3L2Z A;  3O8V A;  3BDU A;  3QG1 A;  4KUL A;  2WSF E;  4M7D E;  3G4S A;  3FEO A;  1WJS A;  2VC8 A;  2HQX A;  3QZ5 B;  4BDZ A;  3HPW A;  5IT9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...