3MEAA

Crystal structure of the sgf29 in complex with h3k4me3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
164
structure length
162
Chain Sequence
LYFQGTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords SAGA-associated factor 29 homolog
total genus 26
structure length 162
sequence length 164
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3meaA02
5FRNA 3KUFA 4QQ6A 5KCOA 4L59A 4RG2A 3OYGA 4BE0A 1WJQA 3ASKA 3FLGA 2CKKA 4E7LA 2XDPA 2R5AA 2RI5A 3QJ6A 3O8VA 5KE2A 2GFUA 1WJRA 3ZEHA 3OYHA 3L2WA 1OZ3A 4E7HA 3NTKA 2BKDN 2HQEA 2RHUA 5C6SA 5IN1A 3OYFA 2K3XA 3L2RA 4FU6A 1KHCA 4C5EA 4N4GA 4E7IA 3DB4A 3MP6A 2R57A 3PFSA 5KH6A 3OYLA 5D6WA 4C5GA 2X4WA 3L2UA 2X4XA 2RHYA 2MWOA 3P8HA 2X4YA 3MEUA 3LX7A 4ZTFA 4LD6A 3SD4A 4B9WA 5KE3A 2RHIA 2M1HA 4BACA 5D6XA 3M9QA 2RJEA 3PMTA 4BD3A 4IUPA 2QQRA 3OMCA 4PL6A 4BDZA 4UC4A 5J39A 4IUQA 3OYIA 3S3MA 2X35A 3GOXA 2QQSA 2M0OA 3ME9A 4GY5A 4A4HA 4IUUA 2HQXA 3L42A 1WGSA 3E9GA 3NTIA 4Q5WA 3OYCA 5M9OA 4QQGA 4N4IA 2RHXA 3OS1A 1OI1A 2O4XA 4IKFA 4IUTA 5IAYA 2EQJA 3LLRA 2D9TA 4X34A 4IUVA 3MO8A 2VYTA 3F70A 2PQWA 4QVZA 4C5HA 2EQUA 4QW2A 2RJFA 1OZ2A 2DAQA 4OVAA 2WACA 4EDUA 5FROA 2R58A 2GFAA 3FEOA 3UWNA 3EAEA 2LTOA 2YRVA 2G3RA 3OA6A 5FRMA 3OYBA 3OYAA 5C0MA 3OYJA 3OS0A 2RI3A 4NS5A 3OYNA 4A4FA 3MP1A 1MHNA 2RO0A 3BDLA 3OYKA 3S6WA 3FC3A 1SSFA 3UT1A 2E5QA 2L89A 4Z02A 2IG0A 3OYDA 2K3YA 2O4XB 3LGLA 4E7JA 5CIUA 1OYXA 2FHDA 2RI2A 3S3OA 2E6NA 2EFIA 4A4EA 2JZ2A 3OS2A 4BE2A 3NTHA 3QIIA 2EQMA 3MEWA 3DLMA 4B9XA 4CRIA 4II1A 2BUDA 3LH0A 5J26A 2MWPA 3E9FA 2DIGA 3H8ZA 3DB3A 3META 2DIQA 2LCCA 4QQDA 1G5VA 3OY9A 4IURA 3LYIA 4A4GA 3C4SA 3S3NA 1RI0A 1H3ZA 3MP8A 2EQKA 1WJSA 4PLLA 2F5KA 4ZTJA 3H6ZA 3L2QA 2LDMA 2BIVA 3QKJA 3P8DA 2LVMA 5KCHA 2L8DA 3OYEA 4N4HA 3OQ5A 2B8AA 2NLUA 2GF7A 3PNWC 4HCZA 2L3RA 2P0KA 4C5IA 2LRQA 2EKOA 2RJCA 5D6YA 2M16A 4E7KA 3Q1JA 3CEYA 3LGFA 3PMIA 2R5MA 2XK0A 3MEVA 3OB9A 2RHZA 3L2VA 4BE1A 3MEAA 3FDRA 3OYMA 2RJDA 4BDYA 4FL6A 1XNIA 2JTFA 4PLIA 3QBYA 3OMGA 1N27A
chains in the Genus database with same CATH superfamily
4F16A 4GLKA 4L59A 2CUDA 4M77C 2W0ZA 4R55A 4ZGJB 1G3TA 1V76A 5GAN2 4E7HA 4JUVA 2ESWA 4PKCC 2PUOB 2FO0A 4EIKA 3EG9A 3MPUB 1TS9A 3ULRB 4C0GA 3RUXA 3CC2Q 5KYUA 3OYLA 3I55Q 1M8MA 3L2UA 2JNGA 3JSCA 1V1CA 2CP0A 2ZAEA 4HKEA 1KQ1A 3M9QA 3SB2A 2QEXQ 2HSEB 2DD5A 5CK9A 1VQLQ 1RAHB 1D3BA 1E6GA 1X01A 1Y7XA 5HY6A 2QQSA 3ME9A 1WX6A 1JQQA 1QQJA 1WHGA 3HTRA 2OI3A 3SFMA 2DXUA 1NG2A 3KFVA 2NUPA 3CCJA 4LDVA 1WDXA 2DYIA 3M0TA 2DVJA 5LJ5e 1G8XA 3CC7A 3BY7A 3GNGA 3V8KA 2LNHB 2OX7A 5EG2A 1UHFA 1OX9A 1GCQC 1AZEA 3OS2A 2L3SA 3CC4A 4DBFA 3OY9A 4J7FA 1YI2Q 1I81A 2D1XA 4M78F 2KY9A 2MOXA 3E1SA 2K3BA 1VQ8T 5KYWB 3CQTA 5FW9A 2OTLT 3VS0A 3A1PA 1YP5A 2KT8A 3HFOA 5GAMj 4N4HA 1ZHIA 1VQ4T 1WXUA 2CZ1B 3LH5A 1N8RC 1NJIR 4BE1A 3L2VA 1YIJA 4BI8B 2VXFA 4EMGA 1M2VA 1M3CA 2V8JA 3CCLA 3OYGA 1WJQA 3G6EA 2AZSA 2RI5A 4QT7A 3TCJA 4B6MA 2XDBA 1RI9A 1OPLA 2A08A 2Y4YA 4F7UG 2ABLA 4KUIA 3PIPA 2J06A 4KGXB 3CBOA 2C0TA 2DLPA 3CBPA 1B07A 4F04B 4M7AE 4LDWA 3MKDA 2JVVA 2GCXA 3OSSC 4P5NA 4L6V5 2RQUA 3OYYA 5LJ3h 2QA4A 1BB9A 2COWA 1MMAA 5FLXE 1QVGA 4XU3A 1M1GA 3E2UA 4J9BA 1ZSZB 1M1KU 5LJ5j 1NBEB 2CT3A 4HXJA 4N4IA 4OGEA 4IIOA 1QWFA 5LJ5g 2DRMA 2E64A 4M77E 3L1AA 2KSSA 2LQNA 3CCSQ 1FMKA 1G3YA 4QW2A 1S72Q 3ER0A 1IO6A 2DAQA 2QYZA 3CCRA 3C0CA 2X3XD 2YRVA 1JJ2S 1C1AA 1RUWA 1Q86R 2K2VA 1HYOA 1AWJA 1BIBA 4M75G 3G6ET 2BE9B 4M7AC 4F7UF 3NTHA 1WQ7A 3WVDB 1Y07A 2CP7A 1X6GA 3MEWA 4B9XA 2A36A 2MYSA 2L5QA 5A2QE 4NL3A 2HEQA 1VQ7Q 2V8IA 4OMMA 1VQ9A 1VQ4A 4A53A 1WQWA 3CPFA 1KIKA 1I1JA 1S1NA 2L8DA 2B8AA 3SEMA 5IHNA 1TTHB 1YIJQ 1UJYA 3JCMb 4YTLA 2DZ9A 1QVPA 4FL6A 2DRKA 5ECAA 5GJVB 3G4SQ 5GAMg 2A7YA 2KBTA 2EGAA 4E7LA 5GJWB 2ZPGB 3O8VA 1KQSA 1NEGA 2EYXA 2FL7A 1M30A 2CSIA 2K3XA 3A5ZB 4Y91A 2VVKA 3QYHB 4OMFB 1VQNQ 3GLXA 3LX7A 1Q82U 3CCET 3M59A 1EFNA 1VQ5A 2HMAA 2YRCA 2VC8A 3EFOA 3VS6A 4BD3A 2JTMA 4PL6A 4EMHA 4XTVA 3QPHA 5J39A 5GAOn 3THKA 4EMKA 3OYIA 2GTOA 4A4HA 1D09B 4IUUA 3LWHA 4WF2A 1LJOA 5DLOA 1W1FA 4FIBA 4E7ZA 2O4XA 2RN8A 1I5OB 2DX1A 3HPWA 2IVWA 3M54A 1X6OA 2JM8A 1D0ZA 1Q7YR 4PJOG 5I22A 4C92A 1FMWA 4OB1B 2GFAA 2Y4XA 1MNDA 3URGA 2P4RA 3RIRA 1RADB 4KUDK 4X1VA 2RO0A 2YSQA 5GANf 1WZOA 2BTTA 4JRPA 1LCKA 3A8HB 5A0GA 3L2ZA 3TREA 3SWNB 3PVQA 1HXDA 5FWCA 2CP5A 1ZUYA 2ED0A 2YUNA 3EGDA 1YIJT 1WJSA 3EFOB 1FXXA 4JLGA 1AWOA 5IHKA 3P8DA 1B7TA 2NLUA 2RF0A 2QTVA 4C5IA 1M90C 3JCMc 3PMIA 1FYNA 2LCLA 5LJ3d 1YI2A 1NLPC 4BDYA 1XNIA 1I07A 1X43A 3CMET 3JCMX 5GANj 3JB9G 3EFSA 5IXBA 2XG8D 2L2PA 2DEUA 3EH1A 1OEBA 3I5SA 4XTYA 2FB7A 2ECZA 4JRIA 2EQIA 1AWXA 3PFSA 2CH4W 2JN0A 4C5GA 4FT2A 4OB3B 3RKWA 1M1KC 3CMEA 2E6ZA 2OTLA 3KBGA 1S72T 2RJEA 2LT1A 4OF1A 2HNIA 2DTHA 3N5BB 3GOXA 1OQKA 1IXDA 1MNEA 2DTIA 4J6XA 4M77D 1UECA 4ZN3A 1QVGP 2EYQA 2RJFA 1ZSGA 2M9UA 4KBMB 1X2QA 3EG2A 3R6OA 1VYTA 2JUFA 2AIRB 2KR3A 4C8QA 4C0FA 1YJWT 1ABOA 1KFZA 1MHNA 4M75D 3BDLA 5CO7A 1Y57A 1N8RU 1MV3A 4Z02A 3LGLA 1NJIC 1AWWA 1IZ6A 1WHHA 5KYNA 1UFFA 1MMNA 2EQMA 2ZPHB 1PSFA 4M7AD 3QWXX 1ZSZA 2E41A 4FT4A 3CPWA 4A4GA 1M3AA 2WSCE 2JT4A 3REAB 3A98A 2I2LA 4ME7A 2W10A 3OSVA 4E6RA 1ARKA 1I4K1 3CCUT 3PNWC 2XI9A 3I5RA 2ROLA 3EGUA 4HCBA 2EYWA 4MMLA 2YDLA 1SG5A 4OP0A 3M5AA 4RG2A 2CSQA 4AG2C 4C92G 1ZQ1A 1O9SA 3QJ6A 1M5Q1 3VS2A 1ZLMA 5C6SA 1RACB 1XOVA 4M7DC 1YWOA 5HKCA 4RTZA 2D8JA 1JBMA 4MDXA 2H3JA 5GAOq 1S72A 1VQKT 4M7DD 2FEIA 1UDLA 3OMCA 5CKHA 1PRLC 4QVDA 1YNZA 2RQRA 2DK3A 3OYCA 2PNIA 5GAOr 1Q81U 2ZPFB 4O6JA 2EJFA 2EQUA 3HP9A 1Y71A 1TH7A 5J3BA 2ZPBB 1U1TA 3EFRA 1BBZA 5C0MA 3EHQA 1BCMA 4EMKC 4KT0E 5LJ5h 2E1HA 2AZVA 2NUPB 4PFOA 2RK2A 3QIIA 1RLPC 1OULA 4ZGDB 4DBHA 2CGHA 3HRTA 2FRWA 4JJNK 1T0JA 2KRSA 1RABB 3VRZA 1WFWA 5GMKm 3I56Q 4J6YA 1PNJA 5GAMf 2V8KA 3FB9A 3H6ZA 4J5YA 2LDMA 5IH2A 4XTWA 5FU7C 4RTYA 1LPLA 4FSXA 2RJCA 2PVGB 1WHLA 4CC4B 1NYFA 2XK0A 3EG9B 1WI7A 2RJDA 3VS5A 3G1JA 3G6EQ 1K9MU 3RESA 3OMGA 1N27A 6AT1B 4QQ6A 2KMTA 1KJWA 3BW1A 3JCMV 1WYXA 4PJOE 1SPKA 1H3HA 3OYHA 2O88A 2KVQG 4DOVA 4QVCA 2KI7A 2QQBA 1B3QA 4ATOA 2JMAA 2RA2A 1OU8A 2JXBA 2LJ3A 4LD9K 2LT4A 4OMNA 4E2FB 1YJWQ 5HCKA 2E3HA 5L23A 2HL5C 2DJQA 3E19A 2RHYA 2M51A 3VV0A 3QSUA 2EPDA 1MUZA 1IGUA 1TWBA 3SD4A 4DEYA 3CCQQ 4BACA 1K1ZA 3CD6T 3PMTA 2EVRA 2P4TA 2K5FA 2FPEA 1MV0B 3S3MA 1BK2A 1N9SA 1V29B 4XU2A 2A28A 4Q5WA 5GANd 4K11A 5KYYB 1VQPA 2DO3A 2DPPB 2YXYA 1OI1A 4F7UA 4LDXA 2O31A 4C92E 1W6XA 3LLRA 9ATCB 1O75A 2DJZA 2JJ9A 1CSKA 3V7SA 1BKBA 4C5HA 3EGDB 3CMAQ 4AFQC 3JB9F 3I55T 2E70A 2XIDA 4CC7A 3MP1A 3VYGA 2LJ1A 1ZSZC 1TSFA 5GAOl 4ELYC 2AKLA 1M90U 4DBQA 5CIUA 5GANh 2EGEA 4BB7A 2EBPA 2EKHA 4MZPA 4KH1B 4RTTA 3TU4K 2KGTA 3CCJT 1HK9A 1YITA 1WA7A 5LJ3f 4D6WA 2LX7A 4C0DC 3BDUA 1KC8C 2VKNA 4O5VA 4F14A 1X27A 3JCMe 8AT1B 1YITT 1KQSS 4KGZB 2DTOA 1UEBA 2MPXC 1QKXA 1VQ5Q 1IGQA 2KXCA 3GP8A 2EWNA 2RHZA 2X9HA 1CKBA 2D8HA 1VQ7T 1UHCA 2XICA 3QZ9B 2X51A 4JJDA 1PD0A 3CBMA 1YJ9T 2J6FA 2HZYA 2LNVA 4BE0A 2E10A 5DY9A 5CKFA 2ZZDA 4BI3A 3NHNA 1WJRA 1I8FA 1FX7A 5GMKj 3L2WA 1M2VB 4BY6C 2QASA 2XU8A 5A0DA 5GAOp 2QI2A 3M4GA 4XTXA 1M1FA 2J05A 5GAN3 2X4XA 1YHQT 2KEAA 1M4ZA 1ZA2B 2VUBA 4LD6A 3I9QA 5GAN6 1JJ2A 2RQVA 1UGQB 4KULA 2Z0WA 3GPLA 1RAAB 4FW1A 1YJNQ 4XU1A 3UDCA 2LX9A 2RQTA 3E9GA 3H0FA 3FIFA 4PJOB 1R77A 3GIBA 2GQVA 1AEYA 3SWNC 1D1CA 1YHQQ 4RTVA 2K9GA 1K73R 3CD6Q 2PVOB 1Z9ZA 2OAWA 5FROA 4PNOA 4A4FA 3PE0A 3S6WA 3OYKA 1SSFA 3UA6A 2K3YA 5DLQE 1JJ2P 3CC7Q 2K4YA 4C0ZA 4J7IA 4II1A 3LH0A 5GAN8 2MWPA 4WCIA 5IHIA 1QP2A 1BCOA 5KYXB 4M78B 2JMCA 3JCMg 1K4US 5EC7A 3JCMd 4AMCA 1OPKA 3CCUQ 2PVDB 2RM4A 5KCHA 2LVMA 3CCJQ 2LRQA 4M78E 1VQ8Q 3H9NA 3CC7T 4FW2A 3M0RA 1X6BA 2QG9B 1YN8A 3QBYA 4M78G 1MGQA 4HVUA 4PJOC 4A4KA 3ASKA 4LDYA 2XDPA 5LJ5d 2GFUA 4LN2A 4FYXB 1I0CA 2HQEA 1Q7YU 2HQHA 2DKGA 3PIOA 1UTIA 1G3SA 1WPYA 3QYGB 1QVFS 1HSQA 1GRIA 3MP6A 5GAN5 2HKNA 5I2SA 2RD1A 2X4WA 2PUKB 1EZZB 2VB6A 3RR6A 1RAFB 5GMKl 1KC8R 3CCST 7AT1B 4AFZC 4M75E 1U06A 3PT9A 3X28B 4KGVB 4UC4A 2KYBA 3X25B 3VJPA 1TXQA 3HRUA 2QXFA 4M78C 1RAGB 4QQGA 4DQ2A 2HBPA 2K5LA 4GLMA 1VQLT 2KAFA 1TU0B 4QVZA 1YCYA 1QP3A 1QVGS 2A3LA 1JU5C 1U8RA 3EAEA 2LQKA 3OA6A 4NS5A 3OYNA 2C06A 1SHFA 2P0QA 1IRXA 3MHXA 3FC3A 1XTDA 2EW3A 2EAYA 3PVLA 3VKIA 3MJXA 3OYDA 2AKKA 5KYYA 4BE2A 2JZ2A 2NUZA 1YHQA 1PCXA 2BUDA 1PHTA 4Z8AA 4XU0A 3J81E 1K9AA 4XQ3A 1PG5B 1Z9QA 2XMFA 1GBQA 1BYMA 1Y96B 3LWIA 1VQ4Q 4J8OA 2BIVA 3M4YA 1QWEA 4PJOD 4FYYB 3CCSA 4HCZA 1BI1A 3SHWA 1TOVA 5CKDA 3X20B 3OBYA 1UUEA 3M0QA 3HKSA 4PFZA 3RNJA 3U23A 3UATA 3RMQA 1GCPA 1XQHA 2EGCA 1WHMA 1ZA1B 1NE8A 2WSEE 5GMKi 2R5AA 2RHUA 4A63B 1E6HA 3L2RA 1KHCA 4MDWA 4Y92A 1JEGA 4R56A 2IIMA 2GQIA 2MI6A 3CMAA 1VQKA 3WXMB 2A37A 3J80E 1KK7A 1QW1A 1JO8A 2VWFA 1VYVA 2X4JA 2YRDA 1BU1A 1PRMC 1ZUKA 2ROTA 1B34A 2KK4A 4M7DG 2JM9A 1NYGA 3I35A 4LE9A 3CCEQ 4M75F 3JCMP 3HSBA 4JLIA 1E7OA 3UF4A 3TVTA 2DERA 3CCRT 4M7AF 4M7AG 4HT9A 1HJDA 1KC8U 1SEMA 2G3RA 3CPWP 4PJMA 3OYBA 2GNCA 5LJ3g 3OYAA 1VQLA 1K9MR 4C8QD 2QEXA 1QCOA 5L8RE 2Y90A 1J3TA 1UB4A 2KDSA 2L89A 3CCVT 4E7JA 3EG0A 2FHDA 1Q95G 2QA4T 4C92F 2RI2A 4KH0B 2E6NA 4A4EA 1JB0E 2LP5A 3VS4A 4IIMA 2DMOA 4A54A 3VYHB 1M2OA 2BZYA 1KSWA 3ZL7C 3S3NA 3JRZA 1RI0A 2DYBA 1QKWA 3V8JA 3VS1A 1LNXA 1NPRA 3M56A 2MK5A 3UA7A 3CCMQ 2XD0A 4X9CA 2ENMA 1VA7A 4TVRA 1R0BG 1UGSB 2CS7A 2P0KA 2CREA 3G71T 2EKOA 4ANJA 1X75C 5D6YA 5AYFA 1QVFA 3MEVA 4M75B 3QO3A 4J9HA 3RDVA 2E65A 4PLIA 2LQWA 1AVZC 2VASA 3G7ZA 3KUFA 4IURA 3C95A 3H0HA 2XKOC 4DBRA 4L5GA 4FSSA 4M7AB 4R0KA 4M7DF 2RK1A 4XTZA 3NTKA 4WTOB 1F1BB 2HL3A 5LL6S 2I0NA 4ZNXA 3C94A 3DKMA 4E7IA 1Q81R 3QHSA 5CKBA 4M77G 2DA9A 5KH6A 3JB9J 1SF9A 2YWWA 3T9NA 1X69A 4OMLA 4B9WA 1OOTA 3JCMh 1IB8A 2NYSA 2LZ6B 1VOMA 1D1BA 2HSPA 1YJNA 1YJNT 4JZ3A 2HQXA 1WXBA 1NM7A 1VQKQ 2CZ6B 2J6KA 3HRSA 3OS1A 1KG1A 2FG0A 2NUTB 5A0LA 4IKFA 1ACMB 5GANe 2KROA 2OTJQ 2F2VA 4PJJA 2D9TA 2CP3A 3M0UA 1N6AA 1VQOA 2DD4A 4OVAA 2WACA 5KYXA 2RNAA 3FEOA 1BIAA 1VQMA 1NPPA 1Q82R 4RTUA 3GF5A 2H3EB 3PTAA 2CZ0B 3UT1A 1YJ9Q 3QUIA 1PC0A 2EYYA 3OBWA 1PKSA 1QVFP 1WXTA 4CRIA 1ZX6A 5LJ5f 1YFNA 3BE3A 3X24B 2B86A 2OJ2A 2HBWA 2DIQA 3P8BB 4RCBA 3C4SA 2YHTA 4JRQA 1KD1R 2DXCA 2V26A 3JCMQ 1AHJB 1EIFA 4Z89A 2PTKA 4C8QE 4X9DA 3OYEA 4Z88A 4PJOA 2FVUA 1D0YA 3OB9A 3I56T 2DEQA 3OYMA 1VQ7A 1TUCA 1ZUUA 5KCOA 3CCUA 2RQWA 3FLGA 2ATCB 3QWYA 1M8VA 1K73U 4M4ZA 1Q7YC 3DB4A 2YUPA 2LCSA 2FPFA 1AZGB 2XDDA 4DEXA 4RTXA 5KE3A 2M1HA 4DOWA 5CVIA 3JB9D 2QQ9A 1VYUA 4IUQA 2PU9B 3BFMA 2O2OA 4N0AA 1K9MC 4KRTA 3L42A 5GANg 3VS3A 3NTIA 2L0AA 3ZBDA 2A0FB 2E12A 4JS5A 1K8AC 4HVWA 4IUTA 4CI0C 2BE7D 2LC4A 3CCEA 2P0PA 3MO8A 2CZ7B 3CXCA 3AT1B 1W2BA 1LVKA 1Q86C 1GBRA 2OTJA 4C92B 5GAOm 3QJYA 1BI3A 3A8OB 2JOYA 5CAIA 3WVEB 2L3PA 1RAIB 2E5KA 1NJIU 2QGGA 3M0PA 4OGCA 1K8AR 3I55A 1KQ2A 3EGXB 2K6DA 3CXCS 1W2BS 5J26A 4EMKB 1SRLA 4M75C 2DL4A 1H3ZA 2HD0A 3GBQA 5CQXA 3REBB 3JB9H 4PLLA 3VUZA 3L2QA 4J9FA 3OQ5A 2OTLQ 5GMKh 1CKAA 3CEYA 3QXEB 1YI2T 1T3SA 2LQ8A 3MEAA 4MZMA 2SEMA 2VGMA 5HK3A 1H641 2CUBA 2QDLA 4XK8E 4FYWB 4HVVA 2FZKB 1T0HA 3ZEHA 1YWPA 4ESRA 1JRIA 3OW2P 2JS0A 1FMVA 2AHJB 2MMPA 4C5EA 1WLPB 3HFNA 1DJ7B 1FWZA 1UGPB 2EJ9A 3P8HA 2H8HA 3MEUA 1PKTA 2QQAA 4C8QG 1W4SA 2DFUA 1BI0A 1D0XA 5CCAA 3MCAB 1GCQA 1VIEA 1SKUB 2K79A 2E4HA 1A0NB 2SRCA 3A8GB 1ABQA 3IQLA 3CCQT 2RHXA 3CCVA 2C0OA 2D0QB 3ZFJA 1NLOC 2QEXT 3OS5A 4C8QB 3CCLT 1WHKA 4J9CA 3SWNA 3EGXA 2YLBA 5D7UA 5GAMe 3JV3A 2E5QA 8ATCB 1QCNA 2KYMA 2DE0X 2YT6A 1OYXA 2CP2A 2E3IA 3HL8A 2KXDA 4V2SA 3E9FA 2DIGA 4D8KA 3DB3A 3LW5E 4J9GA 4JPBW 1Y0MA 3TSZA 1H8KA 4J83A 4ELZC 1I5LA 1VQ5T 2HKQB 3CC2A 4ZN1A 1T3LA 1U5SA 1YITQ 4ZTFA 2DILA 1RL2A 1TG0A 2DL8A 3TQ7P 2EJGA 2QDYB 4OB2B 5I21A 4M77A 3CPWS 2QK0A 4M78D 4AT1B 2CDTA 2DNUA 2DZCA 1Q81C 3RMSA 4HCKA 2F2WA 4BI4A 3EG1A 3M0SA 4FCYA 5IN1A 2EYZA 4FU6A 2DBMA 4M75A 3OW2A 2O9SA 1N8RR 2QGFB 2FRYA 4XAXB 3CCRQ 1TUGB 1GFDA 4LUDA 5D6XA 1K0SA 4IUPA 2P84A 1C0MA 1N9RA 3R6NA 4M77B 2DL5A 2X35A 2QTXA 1MMGA 1WGSA 3V7RA 4OMOA 1IHWA 2LJ0A 2MF2A 1SRMA 4MMKA 2MCNA 1SSHA 2VYTA 3A8LB 2PQWA 4RG8A 1R0CB 1YJ9A 4HCCA 2ED1A 2O01E 2RB6A 4OB0B 4EDUA 4RUGA 2LTOA 5FRMA 1VQNT 2VXEA 2RI3A 2NWMA 1QCFA 4N0AC 3KXTA 4JS4A 2J6OA 2RMOA 2O4XB 1EX4A 1VQMT 2EFIA 2OAUA 4HT8A 4F17A 5GAN4 2CYZB 4QQDA 2KE9A 1PM3A 2DXTA 1D3BB 1OU9A 2K2MA 3FJ5A 3NMZC 2L3QA 4JJBA 2RPNA 1U1SA 3CCMT 1YBYA 2GF7A 2L3RA 4Y28E 2M16A 2MIOA 4QKUA 4JJCA 3FDRA 3J7AF 1VQ6Q 2GGRA 3C12A 4ZTJA 4NL2A 1OX8A 5FRNA 3QZ5B 4ORZA 3A8MB 5GAMd 3DLLA 1BI2A 5KE2A 4VUBA 1SHGA 2K5IA 1AOJA 5FWBA 3H41A 2KT1A 1UGVA 1VQPT 1NEBA 3CC4T 1K8AU 2R57A 2KRMA 2GTJA 4GBQA 3NPFA 4M77F 3CCMA 5FU6C 1VQNA 1UGRB 4RKUE 1M27C 4OMPA 2JW4A 2RHIA 3CD6A 2JS2A 1WHJA 3HHTB 4BDZA 3CCQA 2DVEA 2F5TX 3JCMW 5GAMh 1PSEA 4AFSC 2FZGB 5M9OA 4C8QF 3AHUA 1UJ0A 5IAYA 3OW2S 2EQJA 2DBKA 4J9IA 4C92D 3F70A 5FU7B 3CXCP 1W2BP 1M9SA 1ZBJA 2PZ1A 3GNFB 4J9DA 1QMCA 1VQ6A 2KQWA 1HD3A 2CH4A 1VQ9Q 2ZPEB 2COYA 4BUGA 2COZA 3QDFA 4PFPA 3V7CA 3CMEQ 2YUOA 2IG0A 2NUTA 3PGGA 4JDSA 4E47A 3JB9I 4CC3A 1AT1B 1YJWA 3DLMA 5CR2A 3H8ZA 4E7SA 1YCSB 3RKYA 1G5VA 1VQ6T 3LYIA 5FU6B 2EQKA 2LMJA 2FZCB 1UE9A 3RKXA 1XJWB 3QDRB 4HA8A 3M58A 1QLYA 3QKJA 4LDUA 4PJLA 4MZTA 1LOJA 2F1LA 4E7KA 1PWTA 1ZBXA 3LGFA 2R5MA 2HCKA 4LNPA 4J9EA 2QA4Q 2DL3A 5CQYA 2M02A 5GMKe 4F7UE 2BZ8A 3NFCA 1KHIA 1VQMQ 1OV3A 2BKDN 3JAME 3VRYA 1C6VX 4N4GA 1VQ9T 1M90R 1AD5A 4PJOF 2J7IA 3VUBA 3UPUA 4M7DE 2MWOA 2EIFA 4EPCA 3M55A 4XTUA 5KYWA 4CC2A 3M53A 2CT4A 2OTJT 1PD1A 1WNLA 1IREB 1WIEA 3G71A 5I2MA 2D6FA 4C0DB 2MAMA 4RTWA 2BZXA 1M1KR 1W70A 3EG3A 4PK4A 5IXFA 1NZ9A 2HDAA 3UWNA 3V8LA 4LUEA 2X3WD 3OS0A 2DETA 3CC4Q 1GL5A 2AK5A 1VQPQ 2VGNA 4FYVB 2G6FX 2VV5A 1B34B 2KNBB 1K73C 4RCCA 3META 3QG1A 3D7SB 4OMQA 1H92A 2O9VA 3JCMJ 3INZA 4AFUC 2F2XA 2F5KA 3G71Q 2ZPIB 2C0IA 4JRKA 4PJNA 3FJPA 1MMDA 3EH2A 5KYUB 2FYKA 2QAZA 2AT1B 3Q1JA 3I56A 4J6WA 2D0NA 1U3OA 1G2BA 1KD1C 5GAN7 2FPDA 5LJ3e 1KD1U 1D1AA 2K57A 1JXOA 2CKKA 1R8OB 1K0XA 5I11A 1OZ3A 2KRNA 3JCMf 3CCVQ 3RBBB 3EHRA 3OYFA 3CCLQ 1GXIE 3TEEA 2ZGWA 3VS7A 1JXMA 3VU3C 4FM4B 5D6WA 1Q86U 5HK0A 3O5ZA 2IPOB 2X4YA 1VQ8A 1K76A 4M7DA 1Y96A 3CMAT 4M7AA 5DM7R 2QQRA 4JZ4A 1RAEB 4NOYA 4D8DA 2M0OA 4GY5A 1VQOQ 3SDZA 1VQOT 1VUBA 3G4SA 2ZCFB 1G3WA 2YLCA 3TSWA 2DF6A 2JTEA 1N5ZA 4RMOA 3RERA 4X34A 4IUVA 3CC2T 2DL7A 1Q82C 4ZGEB 1OZ2A 4C92C 2CP6A 4M78A 2R58A 2F69A 4LXCA 1IHVA 3OYJA 1GFCA 2GBQA 1UG1A 1G83A 4F7UB 4AG1C 3H0IA 5CKEA 3S3OA 2HAXA 2XHCA 4DA4A 2WSFE 2V1RA 3G4ST 2K7AA 3FRNA 2LCCA 4C8QC 2YUQA 3MP8A 4M7DB 1RLQC 2RH2A 2V1QA 3M57A 1X2KA 5IT9E 5LJ3j 5AT1B 1TUDA 1KQSP 2DXBA 3X26B 4BY6B 1P92A 2DM1A 2M0YA 3NGPA 2JTFA 1VIFA 1M3BA
chains in the Genus database with same CATH topology
4M78D 4GLKA 1NE8A 3M5AA 4L59A 2WSEE 4OP0A 4RG2A 5GMKi 4M77C 4C92G 1ZQ1A 1O9SA 2R5AA 3QJ6A 1M5Q1 4R55A 2DZCA 4ZGJB 1G3TA 4E7HA 3RMSA 5GAN2 1Q81C 5C6SA 2RHUA 1XOVA 4JUVA 4BI4A 4PKCC 5IN1A 2PUOB 3L2RA 4FU6A 1KHCA 4M7DC 4MDWA 4M75A 3OW2A 5HKCA 4C0GA 3RUXA 1JBMA 4R56A 3OYLA 3L2UA 2MI6A 4XAXB 2JNGA 3JSCA 4MDXA 2H3JA 5GAOq 3CMAA 4HKEA 1S72A 1VQKA 1KQ1A 5D6XA 3M9QA 3SB2A 3WXMB 3J80E 1VQKT 2DD5A 5CK9A 4IUPA 4M7DD 1QW1A 3OMCA 1D3BA 1X01A 5CKHA 1Y7XA 1N9RA 2X4JA 4QVDA 5HY6A 4M77B 2X35A 2QQSA 3ME9A 2DK3A 2QTXA 1B34A 2KK4A 3V7RA 1WGSA 3OYCA 4M7DG 3SFMA 4M75F 2DXUA 5GAOr 1Q81U 2MF2A 2ZPFB 4O6JA 4MMKA 3JCMP 3HSBA 4JLIA 2VYTA 2EJFA 2PQWA 3A8LB 4LDVA 2EQUA 4RG8A 3CCJA 5LJ5e 1YJ9A 4HCCA 4OB0B 2O01E 2RB6A 3HP9A 4EDUA 3CCRT 4M7AG 4M7AF 4HT9A 1Y71A 1TH7A 5J3BA 3CC7A 1KC8U 2ZPBB 2LTOA 1U1TA 2G3RA 3EFRA 5FRMA 3BY7A 1VQNT 2VXEA 3OYBA 3GNGA 5LJ3g 5C0MA 3OYAA 2RI3A 3V8KA 1VQLA 4N0AC 4EMKC 3KXTA 4C8QD 4KT0E 5LJ5h 2QEXA 4JS4A 2E1HA 5L8RE 2Y90A 5EG2A 1UB4A 2KDSA 2L89A 3CCVT 4E7JA 2O4XB 2RK2A 1VQMT 2FHDA 2QA4T 4C92F 2RI2A 2E6NA 2EFIA 1JB0E 2OAUA 4A4EA 3OS2A 4HT8A 3QIIA 4ZGDB 4A54A 5GAN4 3VYHB 2CGHA 3HRTA 3CC4A 2CYZB 4QQDA 3OY9A 4JJNK 2DXTA 1D3BB 4J7FA 3S3NA 3JRZA 1RI0A 5GMKm 1I81A 3V8JA 4M78F 2KY9A 4J6YA 3E1SA 1LNXA 1NPRA 5GAMf 1VQ8T 3M56A 2V8KA 2OTLT 3FB9A 1U1SA 3H6ZA 2XD0A 4J5YA 2LDMA 4XTWA 4X9CA 3HFOA 5FU7C 5GAMj 4TVRA 4N4HA 3CCMT 1UGSB 1YBYA 1ZHIA 2CS7A 2GF7A 2L3RA 2P0KA 4FSXA 3G71T 2RJCA 2CZ1B 1X75C 2EKOA 2M16A 2PVGB 4Y28E 5D6YA 5AYFA 1N8RC 5FRNA 1QVFA 2XK0A 3MEVA 4M75B 3L2VA 4BE1A 1YIJA 4BI8B 3QO3A 2VXFA 3FDRA 3J7AF 4EMGA 2RJDA 3C12A 2E65A 1K9MU 4PLIA 2V8JA 3OMGA 4NL2A 3RESA 4ZTJA 3G7ZA 1N27A 4IURA 3KUFA 4QQ6A 3OYGA 3CCLA 2KMTA 3C95A 3QZ5B 3BW1A 3JCMV 1WJQA 3A8MB 5GAMd 2XKOC 3G6EA 4L5GA 3DLLA 4PJOE 1BI2A 2RI5A 4M7AB 5KE2A 4VUBA 3TCJA 2XDBA 4M7DF 2RK1A 3OYHA 4XTZA 2KVQG 2K5IA 3NTKA 4DOVA 4QVCA 2QQBA 4ATOA 5LL6S 5GAOn 4F7UG 2RA2A 2Y4YA 1VQPT 4KUIA 3C94A 3PIPA 3DKMA 3CC4T 4LD9K 4E7IA 1K8AU 2LT4A 2R57A 3QHSA 3CBOA 4M77G 4M77F 5CKBA 5KH6A 3CCMA 3JB9J 5FU6C 3CBPA 3E19A 4M7AE 1VQNA 1UGRB 2RHYA 4LDWA 2JVVA 2GCXA 3OSSC 4RKUE 3T9NA 3VV0A 3QSUA 4P5NA 4L6V5 3SD4A 4B9WA 3OYYA 2RHIA 3JCMh 4BACA 3CD6A 3CD6T 5LJ3h 3PMTA 2QA4A 3HHTB 4BDZA 2P4TA 3CCQA 2DVEA 2K5FA 2F5TX 5FLXE 3JCMW 1QVGA 4XU3A 1M1GA 5GAMh 3S3MA 1M1KU 1YJNA 5LJ5j 1YJNT 1N9SA 1PSEA 1V29B 2HQXA 4XU2A 4Q5WA 5GANd 5M9OA 1VQPA 2CZ6B 4C8QF 3AHUA 2DO3A 2DPPB 4N4IA 3HRSA 4OGEA 3OS1A 1KG1A 4LDXA 1OI1A 4F7UA 5A0LA 4IKFA 5LJ5g 5GANe 5IAYA 3OW2S 4C92E 2EQJA 3LLRA 2D9TA 1O75A 2E64A 4M77E 2DJZA 3L1AA 2KSSA 4C92D 3F70A 1BKBA 1N6AA 5FU7B 3V7SA 4C5HA 1G3YA 4QW2A 3ER0A 1M9SA 1VQOA 2DD4A 2DAQA 3JB9F 4OVAA 2WACA 3CCRA 3FEOA 3GNFB 1VQ6A 3I55T 1BIAA 2KQWA 2YRVA 2E70A 1JJ2S 1VQMA 1NPPA 2ZPEB 3GF5A 2XIDA 3MP1A 4BUGA 3VYGA 3PTAA 2K2VA 2CZ0B 3UT1A 3V7CA 4ELYC 5GAOl 1BIBA 3QUIA 4M75G 1M90U 2IG0A 3OBWA 3G6ET 3PGGA 5CIUA 5GANh 4M7AC 4JDSA 4BB7A 4E47A 4F7UF 3JB9I 3NTHA 1WQ7A 3WVDB 4MZPA 1Y07A 3TU4K 1YJWA 3MEWA 3DLMA 4B9XA 4CRIA 5LJ5f 3X24B 2L5QA 5CR2A 3H8ZA 1HK9A 5A2QE 3CCJT 1YITA 2DIQA 4NL3A 3RKYA 2V8IA 3P8BB 1VQ6T 1G5VA 3LYIA 5LJ3f 1VQ9A 4RCBA 3C4SA 2YHTA 5FU6B 4D6WA 4JRQA 2DXCA 4A53A 1VQ4A 1WQWA 2EQKA 3BDUA 4C0DC 3CPFA 3JCMQ 3RKXA 1KC8C 1AHJB 4O5VA 3QDRB 1EIFA 4HA8A 3M58A 3JB9D 3JCMe 4C8QE 1YITT 1KQSS 3QKJA 2DTOA 4LDUA 1UEBA 2L8DA 4X9DA 3OYEA 2B8AA 4PJOA 4MZTA 1LOJA 4E7KA 2FVUA 1ZBXA 3LGFA 3JCMb 2R5MA 3OB9A 3I56T 3GP8A 2EWNA 2RHZA 4YTLA 2DEQA 2DZ9A 3OYMA 1VQ7T 1VQ7A 2XICA 1QVPA 3QZ9B 4FL6A 5CQYA 3CBMA 1YJ9T 5KCOA 5GMKe 3CCUA 2LNVA 4F7UE 2A7YA 5GAMg 4BE0A 2E10A 5DY9A 3FLGA 4E7LA 3NFCA 2ZPGB 3O8VA 2ZZDA 5CKFA 1KHIA 4BI3A 1KQSA 1I8FA 1FX7A 1WJRA 5GMKj 3L2WA 1M8VA 2BKDN 3JAME 4BY6C 1K73U 1Q7YC 2FL7A 2K3XA 3A5ZB 2XU8A 5A0DA 5GAOp 3QYHB 4N4GA 3DB4A 2QI2A 3M4GA 4OMFB 4XTXA 4Y91A 1VQ9T 1M1FA 4PJOF 5GAN3 3VUBA 2XDDA 2X4XA 3GLXA 1YHQT 3UPUA 4M7DE 2MWOA 1M4ZA 2EIFA 4EPCA 3LX7A 1Q82U 3CCET 3M59A 2VUBA 4LD6A 3M55A 4XTUA 5KE3A 1VQ5A 2M1HA 5GAN6 2VC8A 1JJ2A 1UGQB 4KULA 4BD3A 4DOWA 2JTMA 5CVIA 3M53A 4PL6A 3GPLA 4EMHA 2OTJT 4XTVA 4XU1A 3UDCA 2LX9A 2QQ9A 3QPHA 5J39A 4IUQA 2PU9B 3BFMA 1WNLA 4N0AA 4EMKA 3OYIA 4A4HA 1K9MC 4IUUA 3L42A 3LWHA 5GANg 3E9GA 3NTIA 4WF2A 1IREB 1LJOA 5DLOA 3ZBDA 3FIFA 4FIBA 4PJOB 3G71A 3GIBA 2E12A 5I2MA 4JS5A 1K8AC 2D6FA 2GQVA 2O4XA 4C0DB 2MAMA 4IUTA 4CI0C 3SWNC 2LC4A 3HPWA 2IVWA 3M54A 2P0PA 3CCEA 1X6OA 3MO8A 4C5GA 2CZ7B 4PJOG 2PVOB 4C92A 3CXCA 1W2BA 1NZ9A 5FROA 4OB1B 2GFAA 4PNOA 2Y4XA 3UWNA 1Q86C 3V8LA 3URGA 2OTJA 4C92B 5GAOm 3QJYA 3OS0A 1BI3A 3A8OB 3RIRA 4A4FA 2JOYA 4KUDK 2RO0A 5CAIA 3OYKA 3S6WA 1SSFA 3WVEB 2VGNA 1NJIU 2K3YA 5DLQE 4OGCA 5GANf 3I55A 4JRPA 2VV5A 2K4YA 3A8HB 4C0ZA 4J7IA 1B34B 5A0GA 1KQ2A 3L2ZA 3TREA 1K73C 4II1A 3SWNB 5J26A 3LH0A 4RCCA 1HXDA 2MWPA 5GAN8 3CXCS 1W2BS 1QP2A 4EMKB 3META 4M78B 3QG1A 4M75C 3JCMg 3JCMd 1H3ZA 2HD0A 1YIJT 3JCMJ 1WJSA 5CQXA 3JB9H 3INZA 1FXXA 2F5KA 4PLLA 4JLGA 2ZPIB 3VUZA 4JRKA 3L2QA 2PVDB 1Q86U 2RM4A 3P8DA 2LVMA 5KCHA 3OQ5A 2NLUA 3FJPA 4C5IA 5GMKh 2LRQA 4M78E 2FYKA 1M90C 3Q1JA 3JCMc 3CEYA 3PMIA 3QXEB 3I56A 2LCLA 4J6WA 5LJ3d 2LQ8A 1YI2T 1YI2A 3MEAA 3CC7T 1VQ4T 4BDYA 1XNIA 4MZMA 1KD1C 2VGMA 5HK3A 3QBYA 1H641 4M78G 1MGQA 5GAN7 3CMET 5LJ3e 1KD1U 4PJOC 4A4KA 4XK8E 3JCMX 2K57A 3ASKA 4LDYA 5GANj 2CKKA 2XDPA 1R8OB 5LJ5d 3EFSA 3JB9G 2GFUA 3ZEHA 2XG8D 1OZ3A 1JRIA 3JCMf 2HQEA 1Q7YU 2DKGA 3PIOA 3OYFA 4XTYA 2FB7A 1G3SA 1WPYA 2AHJB 3QYGB 4JRIA 2MMPA 4C5EA 1QVFS 1GXIE 3MP6A 5GAN5 3TEEA 3PFSA 2ZGWA 3VU3C 5I2SA 4FM4B 2JN0A 2RD1A 1DJ7B 2X4WA 1FWZA 3HFNA 4FT2A 4OB3B 5D6WA 1UGPB 3RKWA 5HK0A 2PUKB 2EJ9A 3P8HA 2X4YA 1M1KC 3MEUA 1VQ8A 3CMEA 4M7DA 2E6ZA 2OTLA 1Y96A 3KBGA 1S72T 3CMAT 5GMKl 4M7AA 3CCST 2QQAA 2RJEA 5DM7R 2LT1A 4OF1A 4C8QG 1W4SA 2QQRA 1BI0A 4M75E 2HNIA 3PT9A 3X28B 2DTHA 4UC4A 5CCAA 3MCAB 3N5BB 4NOYA 1VIEA 3X25B 3GOXA 2M0OA 4GY5A 3VJPA 3A8GB 3SDZA 1VQOT 1VUBA 3HRUA 4M78C 2QXFA 3G4SA 2ZCFB 1G3WA 2YLCA 4QQGA 4DQ2A 2HBPA 3CCQT 2RHXA 2DTIA 3CCVA 2K5LA 4RMOA 2D0QB 4J6XA 3ZFJA 3RERA 4M77D 4X34A 1VQLT 4ZN3A 2KAFA 4IUVA 2QEXT 3CC2T 2EYQA 4QVZA 3OS5A 4C8QB 2RJFA 1YCYA 4ZGEB 3CCLT 1OZ2A 4C92C 1Q82C 1QP3A 1QVGS 2M9UA 4KBMB 2A3LA 2R58A 4M78A 3R6OA 1U8RA 3EAEA 2LQKA 2F69A 2JUFA 3OA6A 3SWNA 4C8QA 3OYJA 2YLBA 4C0FA 1YJWT 5GAMe 4NS5A 3OYNA 2C06A 2P0QA 1MHNA 4M75D 3BDLA 3MHXA 5CO7A 1XTDA 3FC3A 2E5QA 2EAYA 3VKIA 1N8RU 4Z02A 3OYDA 4F7UB 3LGLA 1OYXA 1NJIC 5CKEA 3S3OA 1IZ6A 4BE2A 2JZ2A 1YHQA 2HAXA 2EQMA 2ZPHB 3HL8A 1PSFA 4M7AD 2BUDA 2XHCA 4V2SA 4DA4A 3E9FA 2WSFE 2DIGA 3G4ST 3DB3A 4XU0A 2E41A 3FRNA 4FT4A 2LCCA 3LW5E 4XQ3A 3J81E 3CPWA 4A4GA 4C8QC 3MP8A 2WSCE 4ELZC 4J83A 1BYMA 1I5LA 1Y96B 3LWIA 1VQ5T 4M7DB 2I2LA 4ME7A 4ZN1A 3CC2A 4J8OA 2BIVA 3M4YA 3OSVA 1I4K1 2RH2A 3M57A 3CCUT 4ZTFA 3CCSA 4PJOD 3PNWC 4HCZA 2XI9A 1BI1A 5CKDA 3X20B 1RL2A 5IT9E 3OBYA 5LJ3j 2DXBA 3X26B 3HKSA 4BY6B 1P92A 4HCBA 2EJGA 2QDYB 4MMLA 4OB2B 3RMQA 5I21A 1XQHA 4M77A 3CPWS 2JTFA 1VIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FRN A;  3KUF A;  4QQ6 A;  5KCO A;  4L59 A;  4RG2 A;  3OYG A;  4BE0 A;  1WJQ A;  3ASK A;  3FLG A;  2CKK A;  4E7L A;  2XDP A;  2R5A A;  2RI5 A;  3QJ6 A;  3O8V A;  5KE2 A;  2GFU A;  1WJR A;  3ZEH A;  3OYH A;  3L2W A;  1OZ3 A;  4E7H A;  3NTK A;  2BKD N;  2HQE A;  2RHU A;  5C6S A;  5IN1 A;  3OYF A;  2K3X A;  3L2R A;  4FU6 A;  1KHC A;  4C5E A;  4N4G A;  4E7I A;  3DB4 A;  3MP6 A;  2R57 A;  3PFS A;  5KH6 A;  3OYL A;  5D6W A;  4C5G A;  2X4W A;  3L2U A;  2X4X A;  2RHY A;  2MWO A;  3P8H A;  2X4Y A;  3MEU A;  3LX7 A;  4ZTF A;  4LD6 A;  3SD4 A;  4B9W A;  5KE3 A;  2RHI A;  2M1H A;  4BAC A;  5D6X A;  3M9Q A;  2RJE A;  3PMT A;  4BD3 A;  4IUP A;  2QQR A;  3OMC A;  4PL6 A;  4BDZ A;  4UC4 A;  5J39 A;  4IUQ A;  3OYI A;  3S3M A;  2X35 A;  3GOX A;  2QQS A;  2M0O A;  3ME9 A;  4GY5 A;  4A4H A;  4IUU A;  2HQX A;  3L42 A;  1WGS A;  3E9G A;  3NTI A;  4Q5W A;  3OYC A;  5M9O A;  4QQG A;  4N4I A;  2RHX A;  3OS1 A;  1OI1 A;  2O4X A;  4IKF A;  4IUT A;  5IAY A;  2EQJ A;  3LLR A;  2D9T A;  4X34 A;  4IUV A;  3MO8 A;  2VYT A;  3F70 A;  2PQW A;  4QVZ A;  4C5H A;  2EQU A;  4QW2 A;  2RJF A;  1OZ2 A;  2DAQ A;  4OVA A;  2WAC A;  4EDU A;  5FRO A;  2R58 A;  2GFA A;  3FEO A;  3UWN A;  3EAE A;  2LTO A;  2YRV A;  2G3R A;  3OA6 A;  5FRM A;  3OYB A;  3OYA A;  5C0M A;  3OYJ A;  3OS0 A;  2RI3 A;  4NS5 A;  3OYN A;  4A4F A;  3MP1 A;  1MHN A;  2RO0 A;  3BDL A;  3OYK A;  3S6W A;  3FC3 A;  1SSF A;  3UT1 A;  2E5Q A;  2L89 A;  4Z02 A;  2IG0 A;  3OYD A;  2K3Y A;  2O4X B;  3LGL A;  4E7J A;  5CIU A;  1OYX A;  2FHD A;  2RI2 A;  3S3O A;  2E6N A;  2EFI A;  4A4E A;  2JZ2 A;  3OS2 A;  4BE2 A;  3NTH A;  3QII A;  2EQM A;  3MEW A;  3DLM A;  4B9X A;  4CRI A;  4II1 A;  2BUD A;  3LH0 A;  5J26 A;  2MWP A;  3E9F A;  2DIG A;  3H8Z A;  3DB3 A;  3MET A;  2DIQ A;  2LCC A;  4QQD A;  1G5V A;  3OY9 A;  4IUR A;  3LYI A;  4A4G A;  3C4S A;  3S3N A;  1RI0 A;  1H3Z A;  3MP8 A;  2EQK A;  1WJS A;  4PLL A;  2F5K A;  4ZTJ A;  3H6Z A;  3L2Q A;  2LDM A;  2BIV A;  3QKJ A;  3P8D A;  2LVM A;  5KCH A;  2L8D A;  3OYE A;  4N4H A;  3OQ5 A;  2B8A A;  2NLU A;  2GF7 A;  3PNW C;  4HCZ A;  2L3R A;  2P0K A;  4C5I A;  2LRQ A;  2EKO A;  2RJC A;  5D6Y A;  2M16 A;  4E7K A;  3Q1J A;  3CEY A;  3LGF A;  3PMI A;  2R5M A;  2XK0 A;  3MEV A;  3OB9 A;  2RHZ A;  3L2V A;  4BE1 A;  3MEA A;  3FDR A;  3OYM A;  2RJD A;  4BDY A;  4FL6 A;  1XNI A;  2JTF A;  4PLI A;  3QBY A;  3OMG A;  1N27 A; 
#chains in the Genus database with same CATH topology
 4F16 A;  4GLK A;  4L59 A;  2CUD A;  4M77 C;  2W0Z A;  4R55 A;  4ZGJ B;  1G3T A;  1V76 A;  5GAN 2;  4E7H A;  4JUV A;  2ESW A;  4PKC C;  2PUO B;  2FO0 A;  4EIK A;  3EG9 A;  3MPU B;  1TS9 A;  3ULR B;  4C0G A;  3RUX A;  3CC2 Q;  5KYU A;  3OYL A;  3I55 Q;  1M8M A;  3L2U A;  2JNG A;  3JSC A;  1V1C A;  2CP0 A;  2ZAE A;  4HKE A;  1KQ1 A;  3M9Q A;  3SB2 A;  2QEX Q;  2HSE B;  2DD5 A;  5CK9 A;  1VQL Q;  1RAH B;  1D3B A;  1E6G A;  1X01 A;  1Y7X A;  5HY6 A;  2QQS A;  3ME9 A;  1WX6 A;  1JQQ A;  1QQJ A;  1WHG A;  3HTR A;  2OI3 A;  3SFM A;  2DXU A;  1NG2 A;  3KFV A;  2NUP A;  3CCJ A;  4LDV A;  1WDX A;  2DYI A;  3M0T A;  2DVJ A;  5LJ5 e;  1G8X A;  3CC7 A;  3BY7 A;  3GNG A;  3V8K A;  2LNH B;  2OX7 A;  5EG2 A;  1UHF A;  1OX9 A;  1GCQ C;  1AZE A;  3OS2 A;  2L3S A;  3CC4 A;  4DBF A;  3OY9 A;  4J7F A;  1YI2 Q;  1I81 A;  2D1X A;  4M78 F;  2KY9 A;  2MOX A;  3E1S A;  2K3B A;  1VQ8 T;  5KYW B;  3CQT A;  5FW9 A;  2OTL T;  3VS0 A;  3A1P A;  1YP5 A;  2KT8 A;  3HFO A;  5GAM j;  4N4H A;  1ZHI A;  1VQ4 T;  1WXU A;  2CZ1 B;  3LH5 A;  1N8R C;  1NJI R;  4BE1 A;  3L2V A;  1YIJ A;  4BI8 B;  2VXF A;  4EMG A;  1M2V A;  1M3C A;  2V8J A;  3CCL A;  3OYG A;  1WJQ A;  3G6E A;  2AZS A;  2RI5 A;  4QT7 A;  3TCJ A;  4B6M A;  2XDB A;  1RI9 A;  1OPL A;  2A08 A;  2Y4Y A;  4F7U G;  2ABL A;  4KUI A;  3PIP A;  2J06 A;  4KGX B;  3CBO A;  2C0T A;  2DLP A;  3CBP A;  1B07 A;  4F04 B;  4M7A E;  4LDW A;  3MKD A;  2JVV A;  2GCX A;  3OSS C;  4P5N A;  4L6V 5;  2RQU A;  3OYY A;  5LJ3 h;  2QA4 A;  1BB9 A;  2COW A;  1MMA A;  5FLX E;  1QVG A;  4XU3 A;  1M1G A;  3E2U A;  4J9B A;  1ZSZ B;  1M1K U;  5LJ5 j;  1NBE B;  2CT3 A;  4HXJ A;  4N4I A;  4OGE A;  4IIO A;  1QWF A;  5LJ5 g;  2DRM A;  2E64 A;  4M77 E;  3L1A A;  2KSS A;  2LQN A;  3CCS Q;  1FMK A;  1G3Y A;  4QW2 A;  1S72 Q;  3ER0 A;  1IO6 A;  2DAQ A;  2QYZ A;  3CCR A;  3C0C A;  2X3X D;  2YRV A;  1JJ2 S;  1C1A A;  1RUW A;  1Q86 R;  2K2V A;  1HYO A;  1AWJ A;  1BIB A;  4M75 G;  3G6E T;  2BE9 B;  4M7A C;  4F7U F;  3NTH A;  1WQ7 A;  3WVD B;  1Y07 A;  2CP7 A;  1X6G A;  3MEW A;  4B9X A;  2A36 A;  2MYS A;  2L5Q A;  5A2Q E;  4NL3 A;  2HEQ A;  1VQ7 Q;  2V8I A;  4OMM A;  1VQ9 A;  1VQ4 A;  4A53 A;  1WQW A;  3CPF A;  1KIK A;  1I1J A;  1S1N A;  2L8D A;  2B8A A;  3SEM A;  5IHN A;  1TTH B;  1YIJ Q;  1UJY A;  3JCM b;  4YTL A;  2DZ9 A;  1QVP A;  4FL6 A;  2DRK A;  5ECA A;  5GJV B;  3G4S Q;  5GAM g;  2A7Y A;  2KBT A;  2EGA A;  4E7L A;  5GJW B;  2ZPG B;  3O8V A;  1KQS A;  1NEG A;  2EYX A;  2FL7 A;  1M30 A;  2CSI A;  2K3X A;  3A5Z B;  4Y91 A;  2VVK A;  3QYH B;  4OMF B;  1VQN Q;  3GLX A;  3LX7 A;  1Q82 U;  3CCE T;  3M59 A;  1EFN A;  1VQ5 A;  2HMA A;  2YRC A;  2VC8 A;  3EFO A;  3VS6 A;  4BD3 A;  2JTM A;  4PL6 A;  4EMH A;  4XTV A;  3QPH A;  5J39 A;  5GAO n;  3THK A;  4EMK A;  3OYI A;  2GTO A;  4A4H A;  1D09 B;  4IUU A;  3LWH A;  4WF2 A;  1LJO A;  5DLO A;  1W1F A;  4FIB A;  4E7Z A;  2O4X A;  2RN8 A;  1I5O B;  2DX1 A;  3HPW A;  2IVW A;  3M54 A;  1X6O A;  2JM8 A;  1D0Z A;  1Q7Y R;  4PJO G;  5I22 A;  4C92 A;  1FMW A;  4OB1 B;  2GFA A;  2Y4X A;  1MND A;  3URG A;  2P4R A;  3RIR A;  1RAD B;  4KUD K;  4X1V A;  2RO0 A;  2YSQ A;  5GAN f;  1WZO A;  2BTT A;  4JRP A;  1LCK A;  3A8H B;  5A0G A;  3L2Z A;  3TRE A;  3SWN B;  3PVQ A;  1HXD A;  5FWC A;  2CP5 A;  1ZUY A;  2ED0 A;  2YUN A;  3EGD A;  1YIJ T;  1WJS A;  3EFO B;  1FXX A;  4JLG A;  1AWO A;  5IHK A;  3P8D A;  1B7T A;  2NLU A;  2RF0 A;  2QTV A;  4C5I A;  1M90 C;  3JCM c;  3PMI A;  1FYN A;  2LCL A;  5LJ3 d;  1YI2 A;  1NLP C;  4BDY A;  1XNI A;  1I07 A;  1X43 A;  3CME T;  3JCM X;  5GAN j;  3JB9 G;  3EFS A;  5IXB A;  2XG8 D;  2L2P A;  2DEU A;  3EH1 A;  1OEB A;  3I5S A;  4XTY A;  2FB7 A;  2ECZ A;  4JRI A;  2EQI A;  1AWX A;  3PFS A;  2CH4 W;  2JN0 A;  4C5G A;  4FT2 A;  4OB3 B;  3RKW A;  1M1K C;  3CME A;  2E6Z A;  2OTL A;  3KBG A;  1S72 T;  2RJE A;  2LT1 A;  4OF1 A;  2HNI A;  2DTH A;  3N5B B;  3GOX A;  1OQK A;  1IXD A;  1MNE A;  2DTI A;  4J6X A;  4M77 D;  1UEC A;  4ZN3 A;  1QVG P;  2EYQ A;  2RJF A;  1ZSG A;  2M9U A;  4KBM B;  1X2Q A;  3EG2 A;  3R6O A;  1VYT A;  2JUF A;  2AIR B;  2KR3 A;  4C8Q A;  4C0F A;  1YJW T;  1ABO A;  1KFZ A;  1MHN A;  4M75 D;  3BDL A;  5CO7 A;  1Y57 A;  1N8R U;  1MV3 A;  4Z02 A;  3LGL A;  1NJI C;  1AWW A;  1IZ6 A;  1WHH A;  5KYN A;  1UFF A;  1MMN A;  2EQM A;  2ZPH B;  1PSF A;  4M7A D;  3QWX X;  1ZSZ A;  2E41 A;  4FT4 A;  3CPW A;  4A4G A;  1M3A A;  2WSC E;  2JT4 A;  3REA B;  3A98 A;  2I2L A;  4ME7 A;  2W10 A;  3OSV A;  4E6R A;  1ARK A;  1I4K 1;  3CCU T;  3PNW C;  2XI9 A;  3I5R A;  2ROL A;  3EGU A;  4HCB A;  2EYW A;  4MML A;  2YDL A;  1SG5 A;  4OP0 A;  3M5A A;  4RG2 A;  2CSQ A;  4AG2 C;  4C92 G;  1ZQ1 A;  1O9S A;  3QJ6 A;  1M5Q 1;  3VS2 A;  1ZLM A;  5C6S A;  1RAC B;  1XOV A;  4M7D C;  1YWO A;  5HKC A;  4RTZ A;  2D8J A;  1JBM A;  4MDX A;  2H3J A;  5GAO q;  1S72 A;  1VQK T;  4M7D D;  2FEI A;  1UDL A;  3OMC A;  5CKH A;  1PRL C;  4QVD A;  1YNZ A;  2RQR A;  2DK3 A;  3OYC A;  2PNI A;  5GAO r;  1Q81 U;  2ZPF B;  4O6J A;  2EJF A;  2EQU A;  3HP9 A;  1Y71 A;  1TH7 A;  5J3B A;  2ZPB B;  1U1T A;  3EFR A;  1BBZ A;  5C0M A;  3EHQ A;  1BCM A;  4EMK C;  4KT0 E;  5LJ5 h;  2E1H A;  2AZV A;  2NUP B;  4PFO A;  2RK2 A;  3QII A;  1RLP C;  1OUL A;  4ZGD B;  4DBH A;  2CGH A;  3HRT A;  2FRW A;  4JJN K;  1T0J A;  2KRS A;  1RAB B;  3VRZ A;  1WFW A;  5GMK m;  3I56 Q;  4J6Y A;  1PNJ A;  5GAM f;  2V8K A;  3FB9 A;  3H6Z A;  4J5Y A;  2LDM A;  5IH2 A;  4XTW A;  5FU7 C;  4RTY A;  1LPL A;  4FSX A;  2RJC A;  2PVG B;  1WHL A;  4CC4 B;  1NYF A;  2XK0 A;  3EG9 B;  1WI7 A;  2RJD A;  3VS5 A;  3G1J A;  3G6E Q;  1K9M U;  3RES A;  3OMG A;  1N27 A;  6AT1 B;  4QQ6 A;  2KMT A;  1KJW A;  3BW1 A;  3JCM V;  1WYX A;  4PJO E;  1SPK A;  1H3H A;  3OYH A;  2O88 A;  2KVQ G;  4DOV A;  4QVC A;  2KI7 A;  2QQB A;  1B3Q A;  4ATO A;  2JMA A;  2RA2 A;  1OU8 A;  2JXB A;  2LJ3 A;  4LD9 K;  2LT4 A;  4OMN A;  4E2F B;  1YJW Q;  5HCK A;  2E3H A;  5L23 A;  2HL5 C;  2DJQ A;  3E19 A;  2RHY A;  2M51 A;  3VV0 A;  3QSU A;  2EPD A;  1MUZ A;  1IGU A;  1TWB A;  3SD4 A;  4DEY A;  3CCQ Q;  4BAC A;  1K1Z A;  3CD6 T;  3PMT A;  2EVR A;  2P4T A;  2K5F A;  2FPE A;  1MV0 B;  3S3M A;  1BK2 A;  1N9S A;  1V29 B;  4XU2 A;  2A28 A;  4Q5W A;  5GAN d;  4K11 A;  5KYY B;  1VQP A;  2DO3 A;  2DPP B;  2YXY A;  1OI1 A;  4F7U A;  4LDX A;  2O31 A;  4C92 E;  1W6X A;  3LLR A;  9ATC B;  1O75 A;  2DJZ A;  2JJ9 A;  1CSK A;  3V7S A;  1BKB A;  4C5H A;  3EGD B;  3CMA Q;  4AFQ C;  3JB9 F;  3I55 T;  2E70 A;  2XID A;  4CC7 A;  3MP1 A;  3VYG A;  2LJ1 A;  1ZSZ C;  1TSF A;  5GAO l;  4ELY C;  2AKL A;  1M90 U;  4DBQ A;  5CIU A;  5GAN h;  2EGE A;  4BB7 A;  2EBP A;  2EKH A;  4MZP A;  4KH1 B;  4RTT A;  3TU4 K;  2KGT A;  3CCJ T;  1HK9 A;  1YIT A;  1WA7 A;  5LJ3 f;  4D6W A;  2LX7 A;  4C0D C;  3BDU A;  1KC8 C;  2VKN A;  4O5V A;  4F14 A;  1X27 A;  3JCM e;  8AT1 B;  1YIT T;  1KQS S;  4KGZ B;  2DTO A;  1UEB A;  2MPX C;  1QKX A;  1VQ5 Q;  1IGQ A;  2KXC A;  3GP8 A;  2EWN A;  2RHZ A;  2X9H A;  1CKB A;  2D8H A;  1VQ7 T;  1UHC A;  2XIC A;  3QZ9 B;  2X51 A;  4JJD A;  1PD0 A;  3CBM A;  1YJ9 T;  2J6F A;  2HZY A;  2LNV A;  4BE0 A;  2E10 A;  5DY9 A;  5CKF A;  2ZZD A;  4BI3 A;  3NHN A;  1WJR A;  1I8F A;  1FX7 A;  5GMK j;  3L2W A;  1M2V B;  4BY6 C;  2QAS A;  2XU8 A;  5A0D A;  5GAO p;  2QI2 A;  3M4G A;  4XTX A;  1M1F A;  2J05 A;  5GAN 3;  2X4X A;  1YHQ T;  2KEA A;  1M4Z A;  1ZA2 B;  2VUB A;  4LD6 A;  3I9Q A;  5GAN 6;  1JJ2 A;  2RQV A;  1UGQ B;  4KUL A;  2Z0W A;  3GPL A;  1RAA B;  4FW1 A;  1YJN Q;  4XU1 A;  3UDC A;  2LX9 A;  2RQT A;  3E9G A;  3H0F A;  3FIF A;  4PJO B;  1R77 A;  3GIB A;  2GQV A;  1AEY A;  3SWN C;  1D1C A;  1YHQ Q;  4RTV A;  2K9G A;  1K73 R;  3CD6 Q;  2PVO B;  1Z9Z A;  2OAW A;  5FRO A;  4PNO A;  4A4F A;  3PE0 A;  3S6W A;  3OYK A;  1SSF A;  3UA6 A;  2K3Y A;  5DLQ E;  1JJ2 P;  3CC7 Q;  2K4Y A;  4C0Z A;  4J7I A;  4II1 A;  3LH0 A;  5GAN 8;  2MWP A;  4WCI A;  5IHI A;  1QP2 A;  1BCO A;  5KYX B;  4M78 B;  2JMC A;  3JCM g;  1K4U S;  5EC7 A;  3JCM d;  4AMC A;  1OPK A;  3CCU Q;  2PVD B;  2RM4 A;  5KCH A;  2LVM A;  3CCJ Q;  2LRQ A;  4M78 E;  1VQ8 Q;  3H9N A;  3CC7 T;  4FW2 A;  3M0R A;  1X6B A;  2QG9 B;  1YN8 A;  3QBY A;  4M78 G;  1MGQ A;  4HVU A;  4PJO C;  4A4K A;  3ASK A;  4LDY A;  2XDP A;  5LJ5 d;  2GFU A;  4LN2 A;  4FYX B;  1I0C A;  2HQE A;  1Q7Y U;  2HQH A;  2DKG A;  3PIO A;  1UTI A;  1G3S A;  1WPY A;  3QYG B;  1QVF S;  1HSQ A;  1GRI A;  3MP6 A;  5GAN 5;  2HKN A;  5I2S A;  2RD1 A;  2X4W A;  2PUK B;  1EZZ B;  2VB6 A;  3RR6 A;  1RAF B;  5GMK l;  1KC8 R;  3CCS T;  7AT1 B;  4AFZ C;  4M75 E;  1U06 A;  3PT9 A;  3X28 B;  4KGV B;  4UC4 A;  2KYB A;  3X25 B;  3VJP A;  1TXQ A;  3HRU A;  2QXF A;  4M78 C;  1RAG B;  4QQG A;  4DQ2 A;  2HBP A;  2K5L A;  4GLM A;  1VQL T;  2KAF A;  1TU0 B;  4QVZ A;  1YCY A;  1QP3 A;  1QVG S;  2A3L A;  1JU5 C;  1U8R A;  3EAE A;  2LQK A;  3OA6 A;  4NS5 A;  3OYN A;  2C06 A;  1SHF A;  2P0Q A;  1IRX A;  3MHX A;  3FC3 A;  1XTD A;  2EW3 A;  2EAY A;  3PVL A;  3VKI A;  3MJX A;  3OYD A;  2AKK A;  5KYY A;  4BE2 A;  2JZ2 A;  2NUZ A;  1YHQ A;  1PCX A;  2BUD A;  1PHT A;  4Z8A A;  4XU0 A;  3J81 E;  1K9A A;  4XQ3 A;  1PG5 B;  1Z9Q A;  2XMF A;  1GBQ A;  1BYM A;  1Y96 B;  3LWI A;  1VQ4 Q;  4J8O A;  2BIV A;  3M4Y A;  1QWE A;  4PJO D;  4FYY B;  3CCS A;  4HCZ A;  1BI1 A;  3SHW A;  1TOV A;  5CKD A;  3X20 B;  3OBY A;  1UUE A;  3M0Q A;  3HKS A;  4PFZ A;  3RNJ A;  3U23 A;  3UAT A;  3RMQ A;  1GCP A;  1XQH A;  2EGC A;  1WHM A;  1ZA1 B;  1NE8 A;  2WSE E;  5GMK i;  2R5A A;  2RHU A;  4A63 B;  1E6H A;  3L2R A;  1KHC A;  4MDW A;  4Y92 A;  1JEG A;  4R56 A;  2IIM A;  2GQI A;  2MI6 A;  3CMA A;  1VQK A;  3WXM B;  2A37 A;  3J80 E;  1KK7 A;  1QW1 A;  1JO8 A;  2VWF A;  1VYV A;  2X4J A;  2YRD A;  1BU1 A;  1PRM C;  1ZUK A;  2ROT A;  1B34 A;  2KK4 A;  4M7D G;  2JM9 A;  1NYG A;  3I35 A;  4LE9 A;  3CCE Q;  4M75 F;  3JCM P;  3HSB A;  4JLI A;  1E7O A;  3UF4 A;  3TVT A;  2DER A;  3CCR T;  4M7A F;  4M7A G;  4HT9 A;  1HJD A;  1KC8 U;  1SEM A;  2G3R A;  3CPW P;  4PJM A;  3OYB A;  2GNC A;  5LJ3 g;  3OYA A;  1VQL A;  1K9M R;  4C8Q D;  2QEX A;  1QCO A;  5L8R E;  2Y90 A;  1J3T A;  1UB4 A;  2KDS A;  2L89 A;  3CCV T;  4E7J A;  3EG0 A;  2FHD A;  1Q95 G;  2QA4 T;  4C92 F;  2RI2 A;  4KH0 B;  2E6N A;  4A4E A;  1JB0 E;  2LP5 A;  3VS4 A;  4IIM A;  2DMO A;  4A54 A;  3VYH B;  1M2O A;  2BZY A;  1KSW A;  3ZL7 C;  3S3N A;  3JRZ A;  1RI0 A;  2DYB A;  1QKW A;  3V8J A;  3VS1 A;  1LNX A;  1NPR A;  3M56 A;  2MK5 A;  3UA7 A;  3CCM Q;  2XD0 A;  4X9C A;  2ENM A;  1VA7 A;  4TVR A;  1R0B G;  1UGS B;  2CS7 A;  2P0K A;  2CRE A;  3G71 T;  2EKO A;  4ANJ A;  1X75 C;  5D6Y A;  5AYF A;  1QVF A;  3MEV A;  4M75 B;  3QO3 A;  4J9H A;  3RDV A;  2E65 A;  4PLI A;  2LQW A;  1AVZ C;  2VAS A;  3G7Z A;  3KUF A;  4IUR A;  3C95 A;  3H0H A;  2XKO C;  4DBR A;  4L5G A;  4FSS A;  4M7A B;  4R0K A;  4M7D F;  2RK1 A;  4XTZ A;  3NTK A;  4WTO B;  1F1B B;  2HL3 A;  5LL6 S;  2I0N A;  4ZNX A;  3C94 A;  3DKM A;  4E7I A;  1Q81 R;  3QHS A;  5CKB A;  4M77 G;  2DA9 A;  5KH6 A;  3JB9 J;  1SF9 A;  2YWW A;  3T9N A;  1X69 A;  4OML A;  4B9W A;  1OOT A;  3JCM h;  1IB8 A;  2NYS A;  2LZ6 B;  1VOM A;  1D1B A;  2HSP A;  1YJN A;  1YJN T;  4JZ3 A;  2HQX A;  1WXB A;  1NM7 A;  1VQK Q;  2CZ6 B;  2J6K A;  3HRS A;  3OS1 A;  1KG1 A;  2FG0 A;  2NUT B;  5A0L A;  4IKF A;  1ACM B;  5GAN e;  2KRO A;  2OTJ Q;  2F2V A;  4PJJ A;  2D9T A;  2CP3 A;  3M0U A;  1N6A A;  1VQO A;  2DD4 A;  4OVA A;  2WAC A;  5KYX A;  2RNA A;  3FEO A;  1BIA A;  1VQM A;  1NPP A;  1Q82 R;  4RTU A;  3GF5 A;  2H3E B;  3PTA A;  2CZ0 B;  3UT1 A;  1YJ9 Q;  3QUI A;  1PC0 A;  2EYY A;  3OBW A;  1PKS A;  1QVF P;  1WXT A;  4CRI A;  1ZX6 A;  5LJ5 f;  1YFN A;  3BE3 A;  3X24 B;  2B86 A;  2OJ2 A;  2HBW A;  2DIQ A;  3P8B B;  4RCB A;  3C4S A;  2YHT A;  4JRQ A;  1KD1 R;  2DXC A;  2V26 A;  3JCM Q;  1AHJ B;  1EIF A;  4Z89 A;  2PTK A;  4C8Q E;  4X9D A;  3OYE A;  4Z88 A;  4PJO A;  2FVU A;  1D0Y A;  3OB9 A;  3I56 T;  2DEQ A;  3OYM A;  1VQ7 A;  1TUC A;  1ZUU A;  5KCO A;  3CCU A;  2RQW A;  3FLG A;  2ATC B;  3QWY A;  1M8V A;  1K73 U;  4M4Z A;  1Q7Y C;  3DB4 A;  2YUP A;  2LCS A;  2FPF A;  1AZG B;  2XDD A;  4DEX A;  4RTX A;  5KE3 A;  2M1H A;  4DOW A;  5CVI A;  3JB9 D;  2QQ9 A;  1VYU A;  4IUQ A;  2PU9 B;  3BFM A;  2O2O A;  4N0A A;  1K9M C;  4KRT A;  3L42 A;  5GAN g;  3VS3 A;  3NTI A;  2L0A A;  3ZBD A;  2A0F B;  2E12 A;  4JS5 A;  1K8A C;  4HVW A;  4IUT A;  4CI0 C;  2BE7 D;  2LC4 A;  3CCE A;  2P0P A;  3MO8 A;  2CZ7 B;  3CXC A;  3AT1 B;  1W2B A;  1LVK A;  1Q86 C;  1GBR A;  2OTJ A;  4C92 B;  5GAO m;  3QJY A;  1BI3 A;  3A8O B;  2JOY A;  5CAI A;  3WVE B;  2L3P A;  1RAI B;  2E5K A;  1NJI U;  2QGG A;  3M0P A;  4OGC A;  1K8A R;  3I55 A;  1KQ2 A;  3EGX B;  2K6D A;  3CXC S;  1W2B S;  5J26 A;  4EMK B;  1SRL A;  4M75 C;  2DL4 A;  1H3Z A;  2HD0 A;  3GBQ A;  5CQX A;  3REB B;  3JB9 H;  4PLL A;  3VUZ A;  3L2Q A;  4J9F A;  3OQ5 A;  2OTL Q;  5GMK h;  1CKA A;  3CEY A;  3QXE B;  1YI2 T;  1T3S A;  2LQ8 A;  3MEA A;  4MZM A;  2SEM A;  2VGM A;  5HK3 A;  1H64 1;  2CUB A;  2QDL A;  4XK8 E;  4FYW B;  4HVV A;  2FZK B;  1T0H A;  3ZEH A;  1YWP A;  4ESR A;  1JRI A;  3OW2 P;  2JS0 A;  1FMV A;  2AHJ B;  2MMP A;  4C5E A;  1WLP B;  3HFN A;  1DJ7 B;  1FWZ A;  1UGP B;  2EJ9 A;  3P8H A;  2H8H A;  3MEU A;  1PKT A;  2QQA A;  4C8Q G;  1W4S A;  2DFU A;  1BI0 A;  1D0X A;  5CCA A;  3MCA B;  1GCQ A;  1VIE A;  1SKU B;  2K79 A;  2E4H A;  1A0N B;  2SRC A;  3A8G B;  1ABQ A;  3IQL A;  3CCQ T;  2RHX A;  3CCV A;  2C0O A;  2D0Q B;  3ZFJ A;  1NLO C;  2QEX T;  3OS5 A;  4C8Q B;  3CCL T;  1WHK A;  4J9C A;  3SWN A;  3EGX A;  2YLB A;  5D7U A;  5GAM e;  3JV3 A;  2E5Q A;  8ATC B;  1QCN A;  2KYM A;  2DE0 X;  2YT6 A;  1OYX A;  2CP2 A;  2E3I A;  3HL8 A;  2KXD A;  4V2S A;  3E9F A;  2DIG A;  4D8K A;  3DB3 A;  3LW5 E;  4J9G A;  4JPB W;  1Y0M A;  3TSZ A;  1H8K A;  4J83 A;  4ELZ C;  1I5L A;  1VQ5 T;  2HKQ B;  3CC2 A;  4ZN1 A;  1T3L A;  1U5S A;  1YIT Q;  4ZTF A;  2DIL A;  1RL2 A;  1TG0 A;  2DL8 A;  3TQ7 P;  2EJG A;  2QDY B;  4OB2 B;  5I21 A;  4M77 A;  3CPW S;  2QK0 A;  4M78 D;  4AT1 B;  2CDT A;  2DNU A;  2DZC A;  1Q81 C;  3RMS A;  4HCK A;  2F2W A;  4BI4 A;  3EG1 A;  3M0S A;  4FCY A;  5IN1 A;  2EYZ A;  4FU6 A;  2DBM A;  4M75 A;  3OW2 A;  2O9S A;  1N8R R;  2QGF B;  2FRY A;  4XAX B;  3CCR Q;  1TUG B;  1GFD A;  4LUD A;  5D6X A;  1K0S A;  4IUP A;  2P84 A;  1C0M A;  1N9R A;  3R6N A;  4M77 B;  2DL5 A;  2X35 A;  2QTX A;  1MMG A;  1WGS A;  3V7R A;  4OMO A;  1IHW A;  2LJ0 A;  2MF2 A;  1SRM A;  4MMK A;  2MCN A;  1SSH A;  2VYT A;  3A8L B;  2PQW A;  4RG8 A;  1R0C B;  1YJ9 A;  4HCC A;  2ED1 A;  2O01 E;  2RB6 A;  4OB0 B;  4EDU A;  4RUG A;  2LTO A;  5FRM A;  1VQN T;  2VXE A;  2RI3 A;  2NWM A;  1QCF A;  4N0A C;  3KXT A;  4JS4 A;  2J6O A;  2RMO A;  2O4X B;  1EX4 A;  1VQM T;  2EFI A;  2OAU A;  4HT8 A;  4F17 A;  5GAN 4;  2CYZ B;  4QQD A;  2KE9 A;  1PM3 A;  2DXT A;  1D3B B;  1OU9 A;  2K2M A;  3FJ5 A;  3NMZ C;  2L3Q A;  4JJB A;  2RPN A;  1U1S A;  3CCM T;  1YBY A;  2GF7 A;  2L3R A;  4Y28 E;  2M16 A;  2MIO A;  4QKU A;  4JJC A;  3FDR A;  3J7A F;  1VQ6 Q;  2GGR A;  3C12 A;  4ZTJ A;  4NL2 A;  1OX8 A;  5FRN A;  3QZ5 B;  4ORZ A;  3A8M B;  5GAM d;  3DLL A;  1BI2 A;  5KE2 A;  4VUB A;  1SHG A;  2K5I A;  1AOJ A;  5FWB A;  3H41 A;  2KT1 A;  1UGV A;  1VQP T;  1NEB A;  3CC4 T;  1K8A U;  2R57 A;  2KRM A;  2GTJ A;  4GBQ A;  3NPF A;  4M77 F;  3CCM A;  5FU6 C;  1VQN A;  1UGR B;  4RKU E;  1M27 C;  4OMP A;  2JW4 A;  2RHI A;  3CD6 A;  2JS2 A;  1WHJ A;  3HHT B;  4BDZ A;  3CCQ A;  2DVE A;  2F5T X;  3JCM W;  5GAM h;  1PSE A;  4AFS C;  2FZG B;  5M9O A;  4C8Q F;  3AHU A;  1UJ0 A;  5IAY A;  3OW2 S;  2EQJ A;  2DBK A;  4J9I A;  4C92 D;  3F70 A;  5FU7 B;  3CXC P;  1W2B P;  1M9S A;  1ZBJ A;  2PZ1 A;  3GNF B;  4J9D A;  1QMC A;  1VQ6 A;  2KQW A;  1HD3 A;  2CH4 A;  1VQ9 Q;  2ZPE B;  2COY A;  4BUG A;  2COZ A;  3QDF A;  4PFP A;  3V7C A;  3CME Q;  2YUO A;  2IG0 A;  2NUT A;  3PGG A;  4JDS A;  4E47 A;  3JB9 I;  4CC3 A;  1AT1 B;  1YJW A;  3DLM A;  5CR2 A;  3H8Z A;  4E7S A;  1YCS B;  3RKY A;  1G5V A;  1VQ6 T;  3LYI A;  5FU6 B;  2EQK A;  2LMJ A;  2FZC B;  1UE9 A;  3RKX A;  1XJW B;  3QDR B;  4HA8 A;  3M58 A;  1QLY A;  3QKJ A;  4LDU A;  4PJL A;  4MZT A;  1LOJ A;  2F1L A;  4E7K A;  1PWT A;  1ZBX A;  3LGF A;  2R5M A;  2HCK A;  4LNP A;  4J9E A;  2QA4 Q;  2DL3 A;  5CQY A;  2M02 A;  5GMK e;  4F7U E;  2BZ8 A;  3NFC A;  1KHI A;  1VQM Q;  1OV3 A;  2BKD N;  3JAM E;  3VRY A;  1C6V X;  4N4G A;  1VQ9 T;  1M90 R;  1AD5 A;  4PJO F;  2J7I A;  3VUB A;  3UPU A;  4M7D E;  2MWO A;  2EIF A;  4EPC A;  3M55 A;  4XTU A;  5KYW A;  4CC2 A;  3M53 A;  2CT4 A;  2OTJ T;  1PD1 A;  1WNL A;  1IRE B;  1WIE A;  3G71 A;  5I2M A;  2D6F A;  4C0D B;  2MAM A;  4RTW A;  2BZX A;  1M1K R;  1W70 A;  3EG3 A;  4PK4 A;  5IXF A;  1NZ9 A;  2HDA A;  3UWN A;  3V8L A;  4LUE A;  2X3W D;  3OS0 A;  2DET A;  3CC4 Q;  1GL5 A;  2AK5 A;  1VQP Q;  2VGN A;  4FYV B;  2G6F X;  2VV5 A;  1B34 B;  2KNB B;  1K73 C;  4RCC A;  3MET A;  3QG1 A;  3D7S B;  4OMQ A;  1H92 A;  2O9V A;  3JCM J;  3INZ A;  4AFU C;  2F2X A;  2F5K A;  3G71 Q;  2ZPI B;  2C0I A;  4JRK A;  4PJN A;  3FJP A;  1MMD A;  3EH2 A;  5KYU B;  2FYK A;  2QAZ A;  2AT1 B;  3Q1J A;  3I56 A;  4J6W A;  2D0N A;  1U3O A;  1G2B A;  1KD1 C;  5GAN 7;  2FPD A;  5LJ3 e;  1KD1 U;  1D1A A;  2K57 A;  1JXO A;  2CKK A;  1R8O B;  1K0X A;  5I11 A;  1OZ3 A;  2KRN A;  3JCM f;  3CCV Q;  3RBB B;  3EHR A;  3OYF A;  3CCL Q;  1GXI E;  3TEE A;  2ZGW A;  3VS7 A;  1JXM A;  3VU3 C;  4FM4 B;  5D6W A;  1Q86 U;  5HK0 A;  3O5Z A;  2IPO B;  2X4Y A;  1VQ8 A;  1K76 A;  4M7D A;  1Y96 A;  3CMA T;  4M7A A;  5DM7 R;  2QQR A;  4JZ4 A;  1RAE B;  4NOY A;  4D8D A;  2M0O A;  4GY5 A;  1VQO Q;  3SDZ A;  1VQO T;  1VUB A;  3G4S A;  2ZCF B;  1G3W A;  2YLC A;  3TSW A;  2DF6 A;  2JTE A;  1N5Z A;  4RMO A;  3RER A;  4X34 A;  4IUV A;  3CC2 T;  2DL7 A;  1Q82 C;  4ZGE B;  1OZ2 A;  4C92 C;  2CP6 A;  4M78 A;  2R58 A;  2F69 A;  4LXC A;  1IHV A;  3OYJ A;  1GFC A;  2GBQ A;  1UG1 A;  1G83 A;  4F7U B;  4AG1 C;  3H0I A;  5CKE A;  3S3O A;  2HAX A;  2XHC A;  4DA4 A;  2WSF E;  2V1R A;  3G4S T;  2K7A A;  3FRN A;  2LCC A;  4C8Q C;  2YUQ A;  3MP8 A;  4M7D B;  1RLQ C;  2RH2 A;  2V1Q A;  3M57 A;  1X2K A;  5IT9 E;  5LJ3 j;  5AT1 B;  1TUD A;  1KQS P;  2DXB A;  3X26 B;  4BY6 B;  1P92 A;  2DM1 A;  2M0Y A;  3NGP A;  2JTF A;  1VIF A;  1M3B A; 
#chains in the Genus database with same CATH homology
 4M78 D;  4GLK A;  1NE8 A;  3M5A A;  4L59 A;  2WSE E;  4OP0 A;  4RG2 A;  5GMK i;  4M77 C;  4C92 G;  1ZQ1 A;  1O9S A;  2R5A A;  3QJ6 A;  1M5Q 1;  4R55 A;  2DZC A;  4ZGJ B;  1G3T A;  4E7H A;  3RMS A;  5GAN 2;  1Q81 C;  5C6S A;  2RHU A;  1XOV A;  4JUV A;  4BI4 A;  4PKC C;  5IN1 A;  2PUO B;  3L2R A;  4FU6 A;  1KHC A;  4M7D C;  4MDW A;  4M75 A;  3OW2 A;  5HKC A;  4C0G A;  3RUX A;  1JBM A;  4R56 A;  3OYL A;  3L2U A;  2MI6 A;  4XAX B;  2JNG A;  3JSC A;  4MDX A;  2H3J A;  5GAO q;  3CMA A;  4HKE A;  1S72 A;  1VQK A;  1KQ1 A;  5D6X A;  3M9Q A;  3SB2 A;  3WXM B;  3J80 E;  1VQK T;  2DD5 A;  5CK9 A;  4IUP A;  4M7D D;  1QW1 A;  3OMC A;  1D3B A;  1X01 A;  5CKH A;  1Y7X A;  1N9R A;  2X4J A;  4QVD A;  5HY6 A;  4M77 B;  2X35 A;  2QQS A;  3ME9 A;  2DK3 A;  2QTX A;  1B34 A;  2KK4 A;  3V7R A;  1WGS A;  3OYC A;  4M7D G;  3SFM A;  4M75 F;  2DXU A;  5GAO r;  1Q81 U;  2MF2 A;  2ZPF B;  4O6J A;  4MMK A;  3JCM P;  3HSB A;  4JLI A;  2VYT A;  2EJF A;  2PQW A;  3A8L B;  4LDV A;  2EQU A;  4RG8 A;  3CCJ A;  5LJ5 e;  1YJ9 A;  4HCC A;  4OB0 B;  2O01 E;  2RB6 A;  3HP9 A;  4EDU A;  3CCR T;  4M7A G;  4M7A F;  4HT9 A;  1Y71 A;  1TH7 A;  5J3B A;  3CC7 A;  1KC8 U;  2ZPB B;  2LTO A;  1U1T A;  2G3R A;  3EFR A;  5FRM A;  3BY7 A;  1VQN T;  2VXE A;  3OYB A;  3GNG A;  5LJ3 g;  5C0M A;  3OYA A;  2RI3 A;  3V8K A;  1VQL A;  4N0A C;  4EMK C;  3KXT A;  4C8Q D;  4KT0 E;  5LJ5 h;  2QEX A;  4JS4 A;  2E1H A;  5L8R E;  2Y90 A;  5EG2 A;  1UB4 A;  2KDS A;  2L89 A;  3CCV T;  4E7J A;  2O4X B;  2RK2 A;  1VQM T;  2FHD A;  2QA4 T;  4C92 F;  2RI2 A;  2E6N A;  2EFI A;  1JB0 E;  2OAU A;  4A4E A;  3OS2 A;  4HT8 A;  3QII A;  4ZGD B;  4A54 A;  5GAN 4;  3VYH B;  2CGH A;  3HRT A;  3CC4 A;  2CYZ B;  4QQD A;  3OY9 A;  4JJN K;  2DXT A;  1D3B B;  4J7F A;  3S3N A;  3JRZ A;  1RI0 A;  5GMK m;  1I81 A;  3V8J A;  4M78 F;  2KY9 A;  4J6Y A;  3E1S A;  1LNX A;  1NPR A;  5GAM f;  1VQ8 T;  3M56 A;  2V8K A;  2OTL T;  3FB9 A;  1U1S A;  3H6Z A;  2XD0 A;  4J5Y A;  2LDM A;  4XTW A;  4X9C A;  3HFO A;  5FU7 C;  5GAM j;  4TVR A;  4N4H A;  3CCM T;  1UGS B;  1YBY A;  1ZHI A;  2CS7 A;  2GF7 A;  2L3R A;  2P0K A;  4FSX A;  3G71 T;  2RJC A;  2CZ1 B;  1X75 C;  2EKO A;  2M16 A;  2PVG B;  4Y28 E;  5D6Y A;  5AYF A;  1N8R C;  5FRN A;  1QVF A;  2XK0 A;  3MEV A;  4M75 B;  3L2V A;  4BE1 A;  1YIJ A;  4BI8 B;  3QO3 A;  2VXF A;  3FDR A;  3J7A F;  4EMG A;  2RJD A;  3C12 A;  2E65 A;  1K9M U;  4PLI A;  2V8J A;  3OMG A;  4NL2 A;  3RES A;  4ZTJ A;  3G7Z A;  1N27 A;  4IUR A;  3KUF A;  4QQ6 A;  3OYG A;  3CCL A;  2KMT A;  3C95 A;  3QZ5 B;  3BW1 A;  3JCM V;  1WJQ A;  3A8M B;  5GAM d;  2XKO C;  3G6E A;  4L5G A;  3DLL A;  4PJO E;  1BI2 A;  2RI5 A;  4M7A B;  5KE2 A;  4VUB A;  3TCJ A;  2XDB A;  4M7D F;  2RK1 A;  3OYH A;  4XTZ A;  2KVQ G;  2K5I A;  3NTK A;  4DOV A;  4QVC A;  2QQB A;  4ATO A;  5LL6 S;  5GAO n;  4F7U G;  2RA2 A;  2Y4Y A;  1VQP T;  4KUI A;  3C94 A;  3PIP A;  3DKM A;  3CC4 T;  4LD9 K;  4E7I A;  1K8A U;  2LT4 A;  2R57 A;  3QHS A;  3CBO A;  4M77 G;  4M77 F;  5CKB A;  5KH6 A;  3CCM A;  3JB9 J;  5FU6 C;  3CBP A;  3E19 A;  4M7A E;  1VQN A;  1UGR B;  2RHY A;  4LDW A;  2JVV A;  2GCX A;  3OSS C;  4RKU E;  3T9N A;  3VV0 A;  3QSU A;  4P5N A;  4L6V 5;  3SD4 A;  4B9W A;  3OYY A;  2RHI A;  3JCM h;  4BAC A;  3CD6 A;  3CD6 T;  5LJ3 h;  3PMT A;  2QA4 A;  3HHT B;  4BDZ A;  2P4T A;  3CCQ A;  2DVE A;  2K5F A;  2F5T X;  5FLX E;  3JCM W;  1QVG A;  4XU3 A;  1M1G A;  5GAM h;  3S3M A;  1M1K U;  1YJN A;  5LJ5 j;  1YJN T;  1N9S A;  1PSE A;  1V29 B;  2HQX A;  4XU2 A;  4Q5W A;  5GAN d;  5M9O A;  1VQP A;  2CZ6 B;  4C8Q F;  3AHU A;  2DO3 A;  2DPP B;  4N4I A;  3HRS A;  4OGE A;  3OS1 A;  1KG1 A;  4LDX A;  1OI1 A;  4F7U A;  5A0L A;  4IKF A;  5LJ5 g;  5GAN e;  5IAY A;  3OW2 S;  4C92 E;  2EQJ A;  3LLR A;  2D9T A;  1O75 A;  2E64 A;  4M77 E;  2DJZ A;  3L1A A;  2KSS A;  4C92 D;  3F70 A;  1BKB A;  1N6A A;  5FU7 B;  3V7S A;  4C5H A;  1G3Y A;  4QW2 A;  3ER0 A;  1M9S A;  1VQO A;  2DD4 A;  2DAQ A;  3JB9 F;  4OVA A;  2WAC A;  3CCR A;  3FEO A;  3GNF B;  1VQ6 A;  3I55 T;  1BIA A;  2KQW A;  2YRV A;  2E70 A;  1JJ2 S;  1VQM A;  1NPP A;  2ZPE B;  3GF5 A;  2XID A;  3MP1 A;  4BUG A;  3VYG A;  3PTA A;  2K2V A;  2CZ0 B;  3UT1 A;  3V7C A;  4ELY C;  5GAO l;  1BIB A;  3QUI A;  4M75 G;  1M90 U;  2IG0 A;  3OBW A;  3G6E T;  3PGG A;  5CIU A;  5GAN h;  4M7A C;  4JDS A;  4BB7 A;  4E47 A;  4F7U F;  3JB9 I;  3NTH A;  1WQ7 A;  3WVD B;  4MZP A;  1Y07 A;  3TU4 K;  1YJW A;  3MEW A;  3DLM A;  4B9X A;  4CRI A;  5LJ5 f;  3X24 B;  2L5Q A;  5CR2 A;  3H8Z A;  1HK9 A;  5A2Q E;  3CCJ T;  1YIT A;  2DIQ A;  4NL3 A;  3RKY A;  2V8I A;  3P8B B;  1VQ6 T;  1G5V A;  3LYI A;  5LJ3 f;  1VQ9 A;  4RCB A;  3C4S A;  2YHT A;  5FU6 B;  4D6W A;  4JRQ A;  2DXC A;  4A53 A;  1VQ4 A;  1WQW A;  2EQK A;  3BDU A;  4C0D C;  3CPF A;  3JCM Q;  3RKX A;  1KC8 C;  1AHJ B;  4O5V A;  3QDR B;  1EIF A;  4HA8 A;  3M58 A;  3JB9 D;  3JCM e;  4C8Q E;  1YIT T;  1KQS S;  3QKJ A;  2DTO A;  4LDU A;  1UEB A;  2L8D A;  4X9D A;  3OYE A;  2B8A A;  4PJO A;  4MZT A;  1LOJ A;  4E7K A;  2FVU A;  1ZBX A;  3LGF A;  3JCM b;  2R5M A;  3OB9 A;  3I56 T;  3GP8 A;  2EWN A;  2RHZ A;  4YTL A;  2DEQ A;  2DZ9 A;  3OYM A;  1VQ7 T;  1VQ7 A;  2XIC A;  1QVP A;  3QZ9 B;  4FL6 A;  5CQY A;  3CBM A;  1YJ9 T;  5KCO A;  5GMK e;  3CCU A;  2LNV A;  4F7U E;  2A7Y A;  5GAM g;  4BE0 A;  2E10 A;  5DY9 A;  3FLG A;  4E7L A;  3NFC A;  2ZPG B;  3O8V A;  2ZZD A;  5CKF A;  1KHI A;  4BI3 A;  1KQS A;  1I8F A;  1FX7 A;  1WJR A;  5GMK j;  3L2W A;  1M8V A;  2BKD N;  3JAM E;  4BY6 C;  1K73 U;  1Q7Y C;  2FL7 A;  2K3X A;  3A5Z B;  2XU8 A;  5A0D A;  5GAO p;  3QYH B;  4N4G A;  3DB4 A;  2QI2 A;  3M4G A;  4OMF B;  4XTX A;  4Y91 A;  1VQ9 T;  1M1F A;  4PJO F;  5GAN 3;  3VUB A;  2XDD A;  2X4X A;  3GLX A;  1YHQ T;  3UPU A;  4M7D E;  2MWO A;  1M4Z A;  2EIF A;  4EPC A;  3LX7 A;  1Q82 U;  3CCE T;  3M59 A;  2VUB A;  4LD6 A;  3M55 A;  4XTU A;  5KE3 A;  1VQ5 A;  2M1H A;  5GAN 6;  2VC8 A;  1JJ2 A;  1UGQ B;  4KUL A;  4BD3 A;  4DOW A;  2JTM A;  5CVI A;  3M53 A;  4PL6 A;  3GPL A;  4EMH A;  2OTJ T;  4XTV A;  4XU1 A;  3UDC A;  2LX9 A;  2QQ9 A;  3QPH A;  5J39 A;  4IUQ A;  2PU9 B;  3BFM A;  1WNL A;  4N0A A;  4EMK A;  3OYI A;  4A4H A;  1K9M C;  4IUU A;  3L42 A;  3LWH A;  5GAN g;  3E9G A;  3NTI A;  4WF2 A;  1IRE B;  1LJO A;  5DLO A;  3ZBD A;  3FIF A;  4FIB A;  4PJO B;  3G71 A;  3GIB A;  2E12 A;  5I2M A;  4JS5 A;  1K8A C;  2D6F A;  2GQV A;  2O4X A;  4C0D B;  2MAM A;  4IUT A;  4CI0 C;  3SWN C;  2LC4 A;  3HPW A;  2IVW A;  3M54 A;  2P0P A;  3CCE A;  1X6O A;  3MO8 A;  4C5G A;  2CZ7 B;  4PJO G;  2PVO B;  4C92 A;  3CXC A;  1W2B A;  1NZ9 A;  5FRO A;  4OB1 B;  2GFA A;  4PNO A;  2Y4X A;  3UWN A;  1Q86 C;  3V8L A;  3URG A;  2OTJ A;  4C92 B;  5GAO m;  3QJY A;  3OS0 A;  1BI3 A;  3A8O B;  3RIR A;  4A4F A;  2JOY A;  4KUD K;  2RO0 A;  5CAI A;  3OYK A;  3S6W A;  1SSF A;  3WVE B;  2VGN A;  1NJI U;  2K3Y A;  5DLQ E;  4OGC A;  5GAN f;  3I55 A;  4JRP A;  2VV5 A;  2K4Y A;  3A8H B;  4C0Z A;  4J7I A;  1B34 B;  5A0G A;  1KQ2 A;  3L2Z A;  3TRE A;  1K73 C;  4II1 A;  3SWN B;  5J26 A;  3LH0 A;  4RCC A;  1HXD A;  2MWP A;  5GAN 8;  3CXC S;  1W2B S;  1QP2 A;  4EMK B;  3MET A;  4M78 B;  3QG1 A;  4M75 C;  3JCM g;  3JCM d;  1H3Z A;  2HD0 A;  1YIJ T;  3JCM J;  1WJS A;  5CQX A;  3JB9 H;  3INZ A;  1FXX A;  2F5K A;  4PLL A;  4JLG A;  2ZPI B;  3VUZ A;  4JRK A;  3L2Q A;  2PVD B;  1Q86 U;  2RM4 A;  3P8D A;  2LVM A;  5KCH A;  3OQ5 A;  2NLU A;  3FJP A;  4C5I A;  5GMK h;  2LRQ A;  4M78 E;  2FYK A;  1M90 C;  3Q1J A;  3JCM c;  3CEY A;  3PMI A;  3QXE B;  3I56 A;  2LCL A;  4J6W A;  5LJ3 d;  2LQ8 A;  1YI2 T;  1YI2 A;  3MEA A;  3CC7 T;  1VQ4 T;  4BDY A;  1XNI A;  4MZM A;  1KD1 C;  2VGM A;  5HK3 A;  3QBY A;  1H64 1;  4M78 G;  1MGQ A;  5GAN 7;  3CME T;  5LJ3 e;  1KD1 U;  4PJO C;  4A4K A;  4XK8 E;  3JCM X;  2K57 A;  3ASK A;  4LDY A;  5GAN j;  2CKK A;  2XDP A;  1R8O B;  5LJ5 d;  3EFS A;  3JB9 G;  2GFU A;  3ZEH A;  2XG8 D;  1OZ3 A;  1JRI A;  3JCM f;  2HQE A;  1Q7Y U;  2DKG A;  3PIO A;  3OYF A;  4XTY A;  2FB7 A;  1G3S A;  1WPY A;  2AHJ B;  3QYG B;  4JRI A;  2MMP A;  4C5E A;  1QVF S;  1GXI E;  3MP6 A;  5GAN 5;  3TEE A;  3PFS A;  2ZGW A;  3VU3 C;  5I2S A;  4FM4 B;  2JN0 A;  2RD1 A;  1DJ7 B;  2X4W A;  1FWZ A;  3HFN A;  4FT2 A;  4OB3 B;  5D6W A;  1UGP B;  3RKW A;  5HK0 A;  2PUK B;  2EJ9 A;  3P8H A;  2X4Y A;  1M1K C;  3MEU A;  1VQ8 A;  3CME A;  4M7D A;  2E6Z A;  2OTL A;  1Y96 A;  3KBG A;  1S72 T;  3CMA T;  5GMK l;  4M7A A;  3CCS T;  2QQA A;  2RJE A;  5DM7 R;  2LT1 A;  4OF1 A;  4C8Q G;  1W4S A;  2QQR A;  1BI0 A;  4M75 E;  2HNI A;  3PT9 A;  3X28 B;  2DTH A;  4UC4 A;  5CCA A;  3MCA B;  3N5B B;  4NOY A;  1VIE A;  3X25 B;  3GOX A;  2M0O A;  4GY5 A;  3VJP A;  3A8G B;  3SDZ A;  1VQO T;  1VUB A;  3HRU A;  4M78 C;  2QXF A;  3G4S A;  2ZCF B;  1G3W A;  2YLC A;  4QQG A;  4DQ2 A;  2HBP A;  3CCQ T;  2RHX A;  2DTI A;  3CCV A;  2K5L A;  4RMO A;  2D0Q B;  4J6X A;  3ZFJ A;  3RER A;  4M77 D;  4X34 A;  1VQL T;  4ZN3 A;  2KAF A;  4IUV A;  2QEX T;  3CC2 T;  2EYQ A;  4QVZ A;  3OS5 A;  4C8Q B;  2RJF A;  1YCY A;  4ZGE B;  3CCL T;  1OZ2 A;  4C92 C;  1Q82 C;  1QP3 A;  1QVG S;  2M9U A;  4KBM B;  2A3L A;  2R58 A;  4M78 A;  3R6O A;  1U8R A;  3EAE A;  2LQK A;  2F69 A;  2JUF A;  3OA6 A;  3SWN A;  4C8Q A;  3OYJ A;  2YLB A;  4C0F A;  1YJW T;  5GAM e;  4NS5 A;  3OYN A;  2C06 A;  2P0Q A;  1MHN A;  4M75 D;  3BDL A;  3MHX A;  5CO7 A;  1XTD A;  3FC3 A;  2E5Q A;  2EAY A;  3VKI A;  1N8R U;  4Z02 A;  3OYD A;  4F7U B;  3LGL A;  1OYX A;  1NJI C;  5CKE A;  3S3O A;  1IZ6 A;  4BE2 A;  2JZ2 A;  1YHQ A;  2HAX A;  2EQM A;  2ZPH B;  3HL8 A;  1PSF A;  4M7A D;  2BUD A;  2XHC A;  4V2S A;  4DA4 A;  3E9F A;  2WSF E;  2DIG A;  3G4S T;  3DB3 A;  4XU0 A;  2E41 A;  3FRN A;  4FT4 A;  2LCC A;  3LW5 E;  4XQ3 A;  3J81 E;  3CPW A;  4A4G A;  4C8Q C;  3MP8 A;  2WSC E;  4ELZ C;  4J83 A;  1BYM A;  1I5L A;  1Y96 B;  3LWI A;  1VQ5 T;  4M7D B;  2I2L A;  4ME7 A;  4ZN1 A;  3CC2 A;  4J8O A;  2BIV A;  3M4Y A;  3OSV A;  1I4K 1;  2RH2 A;  3M57 A;  3CCU T;  4ZTF A;  3CCS A;  4PJO D;  3PNW C;  4HCZ A;  2XI9 A;  1BI1 A;  5CKD A;  3X20 B;  1RL2 A;  5IT9 E;  3OBY A;  5LJ3 j;  2DXB A;  3X26 B;  3HKS A;  4BY6 B;  1P92 A;  4HCB A;  2EJG A;  2QDY B;  4MML A;  4OB2 B;  3RMQ A;  5I21 A;  1XQH A;  4M77 A;  3CPW S;  2JTF A;  1VIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...