3MEAA

Crystal structure of the sgf29 in complex with h3k4me3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
164
structure length
162
Chain Sequence
LYFQGTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 162
sequence length 164
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3meaA02
2HQXA 2RHYA 4BDZA 3OMGA 4BDYA 1H3ZA 2IG0A 2R5AA 3EAEA 3FDRA 4PL6A 4QQGA 4E7LA 3OQ5A 2EQJA 3ME9A 2EQUA 2LCCA 2R57A 4A4GA 2QQSA 4GY5A 3OS0A 4C5GA 3QJ6A 5C0MA 4IKFA 4IUQA 3L2WA 2E6NA 1N27A 2FHDA 2L3RA 1MHNA 4PLLA 4BE2A 1G5VA 2GF7A 3QBYA 4IUPA 3OYMA 4A4EA 4ZTFA 3OMCA 2EQMA 4IUTA 2L89A 3M9QA 4II1A 4X34A 3L2VA 1WJRA 4A4HA 3MEUA 5M9OA 2X4XA 2F5KA 3Q1JA 2LTOA 2RHUA 3OS1A 4FU6A 2K3XA 3LX7A 3OYAA 2NLUA 3OYHA 3LH0A 3GOXA 3OY9A 2R58A 3P8DA 3PMTA 4A4FA 2E5QA 2M0OA 2LVMA 3DB3A 3MP8A 3NTIA 4QW2A 2XDPA 2RO0A 3OYJA 3OYGA 2HQEA 2CKKA 2YRVA 3BDLA 3F70A 4B9XA 3OYIA 4NS5A 4EDUA 5KE2A 3PMIA 2EQKA 3OYFA 2RI3A 4QQDA 2M16A 3L2UA 1OI1A 4OVAA 2GFUA 3FEOA 2GFAA 3MP1A 3E9FA 1OZ2A 3UT1A 2PQWA 4Q5WA 4E7JA 5D6YA 5KCHA 3OYKA 2XK0A 4BACA 4UC4A 4IUVA 3META 2RHXA 3P8HA 4RG2A 3E9GA 4CRIA 1SSFA 3H6ZA 1WGSA 3H8ZA 2M1HA 3MP6A 3PFSA 2EKOA 3O8VA 4C5HA 3QKJA 3OYEA 2RJEA 3OB9A 2BKDN 4IUUA 4QQ6A 4N4IA 2LRQA 4N4HA 2O4XA 5J26A 3S6WA 3OYBA 3S3OA 4PLIA 3MEVA 3SD4A 2B8AA 2DIGA 4L59A 3NTKA 4E7IA 2RJDA 3DB4A 2X4YA 5KH6A 3LLRA 4IURA 3CEYA 2MWPA 3L42A 4E7HA 2EFIA 5C6SA 3S3MA 2RJFA 2MWOA 5CIUA 4Z02A 3OYDA 3KUFA 4QVZA 5KE3A 1WJQA 3ZEHA 1OZ3A 5IN1A 3ASKA 2R5MA 4HCZA 3OYLA 5FRNA 2RJCA 3L2RA 2L8DA 3LYIA 3L2QA 3UWNA 1OYXA 2DIQA 3C4SA 2BIVA 5D6XA 2RHZA 2X4WA 1XNIA 2DAQA 3LGLA 3OYNA 3MEAA 4LD6A 3DLMA 2BUDA 2QQRA 2RI2A 4N4GA 3QIIA 3LGFA 5FRMA 2X35A 2K3YA 4B9WA 2WACA 5D6WA 5FROA 3FC3A 3NTHA 2G3RA 3MO8A 3S3NA 2LDMA 1RI0A 2P0KA 2RI5A 4C5IA 2O4XB 5IAYA 3OYCA 4E7KA 4ZTJA 2VYTA 4C5EA 2RHIA 4FL6A 5J39A 3FLGA 3OA6A 4BE1A 1WJSA 3MEWA 2JZ2A 2D9TA 4BE0A 3OS2A 2JTFA 4BD3A 5KCOA 1KHCA 3PNWC
chains in the Genus database with same CATH superfamily
2ZGWA 1VQ7Q 1VQ6T 3UF4A 3CCMA 1QVGS 3VS3A 3A1PA 2QQSA 1JXMA 5DY9A 1SEMA 2EQIA 1HK9A 2FHDA 4EPCA 5DLQE 2KROA 3JCMJ 4IUTA 2LC4A 2QASA 4N0AA 2DERA 1QCFA 4LDWA 3QWXX 2J06A 1K73U 3QDFA 2EVRA 2K9GA 3HRUA 1K76A 1QVPA 2FYKA 4JZ3A 3P8DA 2DPPB 2OTJT 5KYUB 1RUWA 2VC8A 2DLPA 3AHUA 2V26A 2O88A 1V76A 1PC0A 4CC7A 2DILA 4F7UG 2K79A 1K8AC 1VQLT 5GJVB 1HJDA 2GFAA 1I5OB 3HKSA 3UT1A 1NEGA 1VQ4T 1M1KR 1SSFA 3OYEA 4C92E 1Q81U 2RJEA 2KE9A 2PVGB 3S6WA 3MEVA 4LDUA 5IT9E 2F69A 2EFIA 3WVEB 2E64A 1PSFA 3NMZC 2QGFB 3L2QA 4JPBW 5IHKA 1NBEB 1M2VA 2BIVA 2DBKA 3OYNA 4N4GA 5GMKl 2RD1A 1FMVA 1R0CB 1WQ7A 4XU0A 4C5IA 3JCMW 5GANe 4KUDK 4C5EA 3OA6A 2DTHA 4GLKA 2J7IA 3OS2A 2DX1A 1NLOC 2JW4A 1ZUUA 1U5SA 3M0UA 2DXTA 3JCMd 1MGQA 4KH1B 2ROTA 1YHQQ 4L5GA 2VXFA 2IPOB 1N27A 4C92B 3SHWA 2YLBA 4A4EA 3OYMA 1F1BB 1QVGA 4PJOA 3EH2A 1ZX6A 5LJ3f 2QA4A 5HY6A 1YJWA 4NL3A 2CP0A 1D3BA 2RHUA 1D0XA 4C92G 1UGRB 4E47A 3OY9A 1Q7YC 2ZPBB 4WCIA 2CZ6B 1GFDA 1K8AR 4M77F 1VQ5T 5GMKe 1VQNT 2CUBA 1PKTA 2B86A 2GCXA 2M0YA 1QVFP 3EH1A 3M4YA 1PRLC 2GFUA 3OBWA 1Y57A 1K9MU 2JM9A 2VGMA 4Q5WA 3CCJT 1SKUB 3EGDB 4JRQA 2GQVA 2AIRB 4HCKA 2LJ1A 3JCMX 2FZCB 2Y4XA 3ER0A 3QZ5B 1M3BA 4HXJA 1TH7A 4QVDA 2JN0A 4N4HA 2O4XA 1WFWA 2ZPHB 1CSKA 2X4YA 3QYGB 4EMHA 3L42A 2EYXA 2RJFA 2GTJA 3CCET 5CIUA 5KYXA 1M90R 1M8MA 3M58A 2JNGA 3M56A 3CCQQ 1S72A 1B3QA 3CCSA 2ZPEB 3CCRT 4D6WA 2JOYA 3OW2A 5GMKm 3EFSA 3CMAA 4B9WA 2OAWA 1NE8A 2YHTA 4ZN1A 1JJ2S 1RAFB 2FVUA 4FYXB 1D1BA 1GXIE 2VVKA 9ATCB 3CCMT 5EC7A 1OULA 3CC4A 1QP2A 2COWA 1RAAB 4PL6A 4QQGA 2V8IA 2J6KA 2EW3A 5GAMf 2Y4YA 5FU7C 4GY5A 2AHJB 2NUZA 3LH5A 1YJ9T 4IUQA 1XTDA 2E6NA 2FPFA 4M77D 3HPWA 1M3CA 1BKBA 2DE0X 4II1A 1WJRA 1BI3A 1MMGA 1VUBA 2F5KA 2KR3A 1Q7YR 3OS1A 4C0GA 1YITA 2P4TA 2PU9B 3L2ZA 3T9NA 2JUFA 1BI0A 8ATCB 2KQWA 2CKKA 2EQKA 3JCMc 2RMOA 4AFSC 2L3QA 3WVDB 4HKEA 1OEBA 3I56Q 3PVQA 5KYYA 3TEEA 1SF9A 1VYVA 2BE9B 3CC2A 4Z89A 3X20B 2EJ9A 2OI3A 4EMKA 3OB9A 4PLIA 1JB0E 3SFMA 2HKNA 4WF2A 1VQ8Q 2DIGA 5LJ5d 3FB9A 5GJWB 4E7HA 2L2PA 2LQNA 2MK5A 4ELYC 1JU5C 3E1SA 5CKBA 3KUFA 2WSFE 3FIFA 3ZEHA 1OZ3A 4RTXA 1VQKA 2RJCA 1O75A 2KXCA 1K9AA 1T0HA 2ZAEA 3EG0A 2CZ7B 2OJ2A 2K3YA 5FROA 3TREA 1QQJA 1RI0A 1EZZB 1UDLA 1W2BP 4E7KA 1BU1A 1UGVA 2CYZB 2XHCA 1TUGB 3VS0A 4KGZB 2D9TA 4F14A 3CCVT 1I8FA 2RK2A 3PNWC 2HQXA 3G6EQ 1VQ6Q 1JJ2A 2IG0A 3ME9A 4JRIA 4E7ZA 1YI2A 2VGNA 2E3HA 2K7AA 3M54A 1H3HA 2QA4T 5LJ3h 5IXBA 2VUBA 1YJWT 2CS7A 1JQQA 2K6DA 1ZSZA 4JJBA 1FMKA 4PLLA 4Y91A 2PZ1A 1QMCA 4ZTFA 5FW9A 1Q86U 4C8QC 3G4ST 8AT1B 3REAB 4M7AE 1KC8U 2OTJQ 1WPYA 4LUEA 4JS4A 2F2VA 1W70A 3PMIA 1YJNT 1VOMA 2FG0A 1QVFS 4XTUA 1UG1A 4M78E 1UGQB 1VQLQ 5CKEA 2DTIA 1D1CA 1WHGA 1GBRA 4RTUA 2L0AA 1VQ4Q 2EIFA 5L8RE 1KFZA 4A4KA 2RQRA 5EG2A 4AT1B 4C5HA 2DL8A 1EIFA 2OTLQ 2KRMA 5GAOl 4M7DF 1IB8A 4XTVA 1S72T 1M90U 5GANd 4IURA 4BB7A 5LJ3g 3RIRA 2P0PA 2V1QA 1HYOA 3EG9B 2CT3A 1UHCA 4JDSA 3CMAT 1KD1C 4XK8E 2NUPA 1K0SA 3VS1A 2K3BA 3X26B 3QIIA 4RMOA 5I2SA 1WXUA 3PIPA 1PKSA 2EYQA 3ZL7C 2CDTA 4OMQA 3CC4T 3A98A 4XQ3A 2HKQB 1T0JA 1QCOA 1TTHB 3OW2P 1Q82C 4M7AB 3JB9I 5GAMh 1AHJB 4J9IA 1XJWB 5IXFA 4BE0A 4RKUE 1LVKA 4RTWA 4OMLA 4M7AG 2EJFA 3A5ZB 4M78B 4PJJA 2QQ9A 4XU3A 5I21A 4M75F 3M0TA 1E6HA 3VU3C 3M5AA 5GAOq 3CMET 1Q7YU 1X43A 2IIMA 2GF7A 1VQ9A 2CH4W 4J9BA 1MMNA 2MAMA 1WX6A 2EQMA 3INZA 2AK5A 1N8RC 3WXMB 1WNLA 4FIBA 3U23A 3NGPA 3QZ9B 2EJGA 2K5IA 3RKYA 2OX7A 5HK3A 1VQ5Q 1VQNQ 4JJDA 5KE2A 5LL6S 3VRZA 3HTRA 2RI3A 1Y71A 4M7DD 2DK3A 2CH4A 1WA7A 3CCLT 2JXBA 1YWOA 3MP1A 4M77A 2EWNA 4HA8A 3CCJQ 2PUKB 5J3BA 5GAMg 1AD5A 1QVFA 5GMKi 3HSBA 3HHTB 2DL5A 1TG0A 2DF6A 4QQ6A 5GAOm 2VWFA 3M0SA 1VQKT 1GL5A 1VA7A 1YCYA 4P5NA 2D8HA 1KD1R 4FM4B 3S3MA 1B07A 5DM7R 1WJQA 2R5MA 4E2FB 4BI8B 1X01A 2LQKA 1NPPA 1RADB 2QAZA 3V7SA 3TCJA 2DIQA 2D0NA 1AT1B 3CCRQ 2YUQA 2RI2A 3PIOA 4E7SA 2VASA 1X2QA 3CBPA 5D6WA 4AFQC 1Q82R 3JB9J 4TVRA 4C8QF 2QDLA 3GBQA 2LDMA 2DD5A 3EGXA 2P0KA 3MCAB 2KYBA 1UTIA 1W2BS 1NPRA 2XMFA 4M75D 3CCMQ 2RHIA 4KGXB 5J39A 2DEUA 1YI2T 1N5ZA 1YCSB 5CQXA 4F7UE 1KQSP 1TU0B 1Y96A 1UGSB 4PFPA 2CP3A 4E7LA 2YSQA 3CCEA 2I2LA 2P0QA 4IKFA 1TSFA 1ZUKA 4C92C 4J9GA 4OB3B 1PG5B 5IHIA 2L3RA 1N8RR 4LDVA 3GIBA 2CP6A 1VIFA 4QKUA 1PNJA 2X4XA 4FYVB 2JMAA 1UGPB 2RA2A 2HCKA 3PMTA 3J7AF 2QK0A 2E5QA 3A8LB 1YN8A 1I81A 1M1GA 3L2UA 3M4GA 3RUXA 1I0CA 1YJ9A 4DBRA 2KY9A 5LJ5j 3PTAA 1WGSA 2KK4A 2RQUA 3PFSA 3M59A 4F7UB 2HEQA 3S3OA 1FWZA 3LLRA 5IHNA 5FWBA 5C6SA 2MWOA 4C8QD 4FW1A 1G8XA 3I9QA 2DXBA 1X69A 3RESA 1OOTA 2RHZA 4ZGJB 3CBOA 2DAQA 4DBFA 3UDCA 1FMWA 3DKMA 1M9SA 1BI2A 3E19A 1YFNA 2ZPGB 2JT4A 1UEBA 4MZTA 2DJQA 3OYCA 2VYTA 3OW2S 1OU8A 3PE0A 2SEMA 1UB4A 1K4US 2JS0A 3GNGA 1WJSA 3M53A 3LWHA 3SWNA 2GQIA 3JCMQ 3EAEA 1W2BA 4J7IA 1VQ9T 1H8KA 2EQJA 4CC2A 2RF0A 2X3XD 3QXEB 2QA4Q 1T3LA 2PTKA 1PWTA 4ATOA 2HL3A 1BI1A 2KBTA 2YRCA 5FLXE 2DRMA 5LJ3e 4QT7A 1BK2A 2VXEA 1WHKA 2JVVA 5A0DA 2FPEA 2JMCA 2YT6A 3I5SA 2QEXA 1QWFA 3BE3A 4FT4A 4L6V5 3UPUA 3GLXA 1ZHIA 3CCVA 3I55T 3BDLA 3OYFA 1VQOT 1PRMC 4M4ZA 3QWYA 1BCMA 2A08A 2L5QA 1GFCA 1N6AA 2XK0A 4BACA 4UC4A 3H41A 3QO3A 2DA9A 3E9GA 5GANj 1G3WA 2HSPA 2D1XA 1SHGA 1S72Q 2MCNA 2FRWA 3CCSQ 4M77G 4J9EA 3G4SA 3CEYA 4DBHA 1WZOA 3VS6A 3CMAQ 2D6FA 4M7DA 1BCOA 1UE9A 5IN1A 3SEMA 5FRNA 4CI0C 2BE7D 4C92F 3UWNA 1OYXA 2EPDA 2KSSA 1CKBA 1YJNA 2CZ0B 2RN8A 2MYSA 1C1AA 3CC4Q 4Y28E 1NJIU 2G3RA 3S3NA 4B6MA 2YXYA 3HRSA 3I35A 1B34B 3CBMA 1ARKA 2E4HA 1KQSS 1NLPC 5GMKj 1KK7A 4E6RA 3UA6A 5CO7A 4AFUC 4DEYA 4MDXA 2LCCA 5GAMe 4DEXA 2PNIA 2DETA 3H0HA 4C5GA 2E10A 3THKA 1D09B 2DFUA 1YITQ 4DQ2A 2EAYA 3RMQA 2JTEA 4M75A 3M9QA 3V7CA 2O9SA 1HXDA 4AMCA 2NUTB 4J9DA 2QQAA 5GAOp 2KGTA 2XDPA 3A8HB 2RNAA 1LPLA 2MIOA 1RLQC 1BBZA 2YDLA 3CC2Q 1WHLA 3C0CA 3CCUA 1A0NB 1OZ2A 3I5RA 1U3OA 2DBMA 4VUBA 4IUVA 1W6XA 1Z9ZA 3H6ZA 2M1HA 3CMEA 3O8VA 3H0FA 3G71A 1LNXA 2AT1B 4C92D 3L1AA 5I2MA 3OYBA 1VQKQ 1QW1A 3MKDA 3CD6A 3C95A 5KH6A 4HVWA 3SDZA 2MWPA 4HCCA 3QG1A 1PM3A 1K1ZA 4PNOA 1M1KU 2F2XA 1AWJA 2BZ8A 1VQ7T 1XNIA 2DJZA 3JV3A 2H3JA 2ATCB 3V7RA 2X35A 3CCLA 1EFNA 1GCQA 1BIBA 1OX8A 4M7AC 2O01E 4NOYA 4PJOE 3X24B 3JB9G 1YI2Q 1UUEA 1UECA 4C8QA 3RNJA 4M78C 4ELZC 1XOVA 4BDZA 5KYNA 1ZA1B 2D0QB 1H3ZA 3FDRA 5I11A 1ZBJA 3HP9A 4HT8A 3SWNB 4PJNA 2OAUA 2CSQA 4C0DB 1M2VB 2RM4A 4KBMB 5C0MA 2V8JA 5HCKA 3EFOA 1PHTA 2QEXT 3HFOA 3H9NA 1KQSA 1K73C 2YUOA 5KYWA 1MNEA 2EYYA 1U1SA 1E7OA 4A54A 3MEUA 1W4SA 2XKOC 3EFRA 1AOJA 3OBYA 3VRYA 1TS9A 5GAOr 3GP8A 2DYIA 2AKLA 2KI7A 2M0OA 4IIOA 4JJCA 2FEIA 1GRIA 3MHXA 1GBQA 2FZGB 1D0ZA 3VS5A 1VQMA 1Q81C 3E9FA 3PGGA 5GAN4 5D6YA 2ZZDA 4F16A 1M8VA 1OU9A 4J9FA 1RI9A 4PJOB 4RG2A 3QHSA 2O2OA 1K8AU 1ZSGA 1D3BB 4EMKC 4BI4A 2COYA 2CZ1B 1IRXA 4PJOG 1NG2A 2V1RA 2DTOA 2E5KA 2CP2A 3M55A 1ABOA 3CXCP 2EGAA 1YNZA 1SG5A 2QTVA 3BFMA 3QJYA 3IQLA 2GTOA 2DNUA 1TOVA 2L8DA 4LE9A 2LT1A 1OPKA 5AYFA 1MV3A 3LGFA 2MOXA 2QQBA 2H8HA 4MZPA 2ROLA 4M7DG 4JJNK 3QSUA 1OQKA 3ULRB 1Y7XA 1YHQT 3J81E 1TUCA 4RCBA 5HK0A 2O4XB 2CUDA 4J83A 1VYTA 3NFCA 3JAME 5LJ3d 2O9VA 1Z9QA 2QDYB 3HFNA 4RG8A 2RHYA 3OMGA 5KYXB 1TUDA 1VQPA 1IXDA 5KYUA 4C0FA 1VQ9Q 5GAN5 2A37A 2J6FA 2KDSA 1FXXA 3G1JA 1K73R 1UHFA 2AZVA 1KJWA 3CPWP 4BY6B 1ZSZC 1G5VA 1MHNA 1RACB 3OMCA 3TU4K 4X34A 3L2VA 4R55A 3PT9A 5GAN7 3VYGA 1VYUA 3C12A 1ZQ1A 4PFZA 4A4FA 4J9CA 3M0PA 3CCUT 3DB3A 1K9MC 4QW2A 4M75G 3JCMf 1KSWA 1I5LA 2KT8A 3OYIA 4EMGA 2L3PA 4QQDA 4GBQA 5GAN6 2AZSA 2E12A 3G71T 3EG1A 2OTLA 4LDXA 2X3WD 3CCQT 5KCHA 2KMTA 1N9SA 2A0FB 3CD6T 4M7AF 2RPNA 1QKWA 5A2QE 3X28B 4C0ZA 4CRIA 1WHMA 1KIKA 2XU8A 2X51A 1X2KA 4M78F 3NTKA 2DXUA 4OP0A 2E70A 3VUZA 4JRKA 2YUPA 4OB0B 1UJ0A 1U8RA 1IO6A 2LX7A 3VS7A 1JRIA 3LYIA 3I55A 2FPDA 5A0GA 3LGLA 1VQOA 2DL7A 4FSSA 5GAMd 5KYYB 3CC7A 2LQWA 2Y90A 5FWCA 1X6GA 2DEQA 4C92A 1VIEA 2JM8A 4EMKB 5AT1B 2RI5A 2MPXC 1I4K1 2QXFA 2M51A 2DO3A 3TVTA 3CCEQ 2CREA 2LMJA 1EX4A 1DJ7B 5KCOA 4BD3A 4X9CA 1LOJA 1KHCA 2EYWA 1MMDA 4K11A 4KT0E 1AWWA 1AWXA 3X25B 1ACMB 1G83A 3QDRB 4FYWB 4A4GA 4RCCA 3QJ6A 2HBWA 3DLLA 4C8QG 5GAN3 3TQ7P 2GGRA 3RDVA 4IUPA 1D0YA 3JCMV 3VS4A 4JS5A 2NYSA 3EGDA 3I56T 3QYHB 4CC4B 5ECAA 1K9MR 3OYAA 3LH0A 1R0BG 2ESWA 1VQMT 3VYHB 3NTIA 4O6JA 4R0KA 1YJ9Q 3OYGA 1IHVA 4RUGA 2HDAA 1X6BA 1SPKA 4PKCC 2QG9B 4ESRA 2CGHA 1OI1A 3NHNA 4OVAA 4M78D 4J9HA 2KEAA 2DD4A 1ZSZB 3O5ZA 2PQWA 3OSVA 1JO8A 2LJ0A 2WSEE 2LCSA 1SSHA 2WSCE 5FU6C 2BKDN 2MF2A 1YIJA 3P8BB 2F1LA 2VKNA 4J6YA 5CKDA 4V2SA 1Y07A 3CXCS 1C6VX 4QVZA 5KE3A 1BYMA 4YTLA 1QCNA 1PSEA 3OYLA 2LP5A 3G6ET 3N5BB 5D6XA 3C4SA 3JSCA 3C94A 5HKCA 2C0OA 1RAEB 2BUDA 4OMFB 4OB1B 5IH2A 1M3AA 2XDDA 4XAXB 2WACA 3FC3A 2KYMA 4FYYB 1VQPT 1WHHA 1YWPA 5LJ5f 5D7UA 4FL6A 2JZ2A 2COZA 3M57A 1S1NA 5DLOA 1K0XA 2MMPA 4AG1C 1SRLA 1E6GA 2NUPB 4FSXA 1U1TA 5GAN8 1JEGA 2V8KA 1G2BA 3GF5A 2NWMA 2QEXQ 1Q86C 3L2WA 1AZEA 1VQ7A 2DMOA 3CPWS 4XTZA 3MJXA 4F7UF 4M77E 2LNHB 2O31A 1WDXA 1KC8C 3CCVQ 3JCMh 2XI9A 4XTYA 4AG2C 4RTTA 1QKXA 4RTYA 4MDWA 4LXCA 2OTLT 2RO0A 1YJWQ 2YRVA 2ED0A 2CSIA 2ZCFB 2J6OA 3M0RA 2M16A 1B7TA 2CT4A 2W0ZA 4N0AC 3OYKA 1M90C 3G4SQ 3RERA 1J3TA 3VKIA 1NYGA 2KT1A 4IUUA 4J7FA 2HMAA 2ABLA 2B8AA 3DB4A 2FZKB 2HAXA 1YJNQ 3OYDA 1ZUYA 1SRMA 3CC7T 1I1JA 3V8LA 2DKGA 3EG2A 1Y0MA 5CQYA 4XU1A 2F2WA 1BB9A 4OB2B 4KRTA 2X4WA 4EIKA 4M77B 4LD6A 3CXCA 3JCMg 1G3TA 3KXTA 2P4RA 4R56A 1KD1U 5LJ3j 2H3EB 1X27A 2EYZA 2PVOB 2YUNA 4D8DA 5FU6B 2VV5A 5IAYA 3FJPA 5GANf 2EGCA 4BUGA 4NL2A 2PVDB 2RQWA 4XU2A 1M4ZA 2KNBB 4BDYA 3SWNC 2VB6A 1RAHB 4QVCA 4BI3A 4C0DC 5CK9A 1Q82U 1KHIA 2DVEA 1Q86R 4HVVA 1CKAA 4LN2A 1NYFA 1LCKA 2JTMA 4J6WA 3LWIA 2HNIA 2GBQA 1KC8R 1TWBA 2LNVA 2CP5A 3QBYA 2DZCA 3EGXB 2F5TX 2LZ6B 3TSZA 3VJPA 5CAIA 2K57A 3JCMb 3H0IA 4LNPA 1YHQA 3CPWA 1RLPC 3HL8A 1D1AA 2K5LA 2NLUA 1HSQA 3OYHA 1WHJA 4KUIA 1Y96B 3J80E 3CCUQ 1MUZA 3MPUB 4XTXA 3GPLA 1N8RU 3EG9A 4KH0B 3BDUA 4ZGEB 2MI6A 3CMEQ 3A8OB 3G71Q 2DVJA 3V8KA 4PJOC 4LUDA 3CD6Q 4JLGA 1YIJT 1QLYA 3GNFB 1AVZC 3H8ZA 3JB9H 2E41A 4ZN3A 2LRQA 2ED1A 2Z0WA 1WLPB 1PD1A 4IIMA 4M7AA 1UFFA 3CCLQ 4Z02A 4M7DC 5GAMj 4M78A 1JBMA 2QGGA 4PJMA 3RBBB 2C0TA 2XDBA 5LJ5h 2QQRA 1N9RA 1PD0A 2LJ3A 3V8JA 1H641 4MMKA 2DM1A 3CCQA 3NTHA 3R6OA 1WXTA 1HD3A 3VS2A 2A28A 4LDYA 2DXCA 4RTZA 1I07A 3FLGA 4OF1A 4KGVB 1IGUA 2GNCA 3OYYA 4X9DA 4Y92A 1H92A 4ANJA 4BY6C 4AFZC 3OS0A 2LCLA 3TSWA 1TXQA 2QI2A 2HZYA 4M75C 2L89A 2LX9A 4A4HA 2BZYA 2HSEB 4FW2A 4DOVA 1IZ6A 2ECZA 1ZBXA 3GOXA 1NEBA 1R77A 7AT1B 1VQMQ 5LJ5g 1X6OA 1OPLA 5CKHA 4EDUA 4M7DE 3JB9F 1M1FA 4X1VA 2X4JA 2XD0A 4J5YA 2FRYA 4Z88A 2I0NA 3E2UA 2DYBA 2RHXA 1T3SA 2HBPA 3NPFA 2E3IA 3BY7A 1IGQA 2EKOA 3SB2A 3QKJA 1AZGB 3REBB 1WIEA 2QYZA 5J26A 1M5Q1 1NM7A 3RKWA 3SD4A 3I56A 1W1FA 4E7IA 1GCPA 1MNDA 2JJ9A 1V29B 1AEYA 2XG8D 4OGCA 5CCAA 1RAGB 3EHQA 5I22A 1VQ8A 3RMSA 3MEAA 4PFOA 1FX7A 4O5VA 5GANh 5FRMA 2RQVA 1YP5A 2G6FX 1GCQC 2SRCA 5A0LA 3MO8A 1VQPQ 4M75E 4ZTJA 6AT1B 4Z8AA 1X75C 4GLMA 2DL4A 3KFVA 3JCMP 4M7DB 2R5AA 4ME7A 4D8KA 3OQ5A 2FO0A 1G3SA 3EHRA 1QP3A 1KQ1A 3LW5E 1QVGP 4DBQA 1IHWA 1UJYA 1RAIB 2D8JA 1R8OB 4PJOF 4WTOB 2DRKA 5GAN2 5FU7B 3ZFJA 3G6EA 2FB7A 3AT1B 5CVIA 1VQ6A 2K2MA 2QTXA 4KULA 4BE2A 2K4YA 3FJ5A 3RR6A 2M02A 2K5FA 4RTVA 2A3LA 3M0QA 4LD9K 1G3YA 3QPHA 5M9OA 3JB9D 2P84A 2C06A 4FU6A 3G7ZA 3LX7A 4F7UA 2E6ZA 2FL7A 5GMKh 3KBGA 2RB6A 3EGUA 2R58A 3JRZA 1P92A 1MMAA 4ZGDB 2ZPIB 2LVMA 3CPFA 4JZ4A 5L23A 3JCMe 3OYJA 3CCST 1XQHA 5GANg 2AKKA 4NS5A 4A63B 1OX9A 1KG1A 2RQTA 2XIDA 2OTJA 5GAOn 4E7JA 1PCXA 4JUVA 3UATA 3META 4M75B 2LT4A 4JLIA 4JRPA 2DL3A 1VQLA 4OMMA 2YRDA 4F04B 4F17A 3A8MB 4OMNA 4L59A 3I55Q 2RJDA 2RK1A 1Q81R 1VQ4A 1VQOQ 4ORZA 4MZMA 4C8QE 2K2VA 4OMPA 3CC7Q 3QUIA 1WXBA 2A36A 3ASKA 4HCZA 1OV3A 1WI7A 1ABQA 1M27C 1NJIC 4DOWA 3D7SB 2KRSA 1QWEA 2CP7A 2PUOB 4CC3A 1RABB 4M78G 2XICA 1IREB 1RL2A 1YITT 1JXOA 2EKHA 4PJOD 4HVUA 4BE1A 3MEWA 2RH2A 2E65A 2JTFA 1O9SA 3RKXA 1WYXA 2X9HA 1V1CA 3VUBA 4OMOA 1ZLMA 2E1HA 1U06A 1LJOA 1C0MA 2EQUA 2A7YA 2R57A 2LQ8A 2JS2A 4DA4A 2M9UA 3UA7A 4FCYA 3CC2T 2YWWA 3ZBDA 1FYNA 3Q1JA 2IVWA 2LTOA 3URGA 2K3XA 4C8QB 2ENMA 3MP8A 1NZ9A 2HQEA 4B9XA 3F70A 4PJLA 1KQ2A 2L3SA 3EFOB 1AWOA 3BW1A 2ZPFB 3FEOA 2DZ9A 3A8GB 4J6XA 1BIAA 5KYWB 5CR2A 4PK4A 1YIJQ 1VQ5A 4MMLA 1VQNA 3P8HA 3MP6A 1YBYA 3R6NA 2HL5C 3VV0A 3EG3A 5CKFA 1M2OA 4N4IA 3FRNA 4M7AD 1M1KC 3OSSC 2J05A 3CCJA 4HT9A 1VQ8T 1B34A 4FT2A 1M30A 4HCBA 1NJIR 2KRNA 1MV0B 4M77C 3CQTA 3L2RA 4ZNXA 1SHFA 2HQHA 3PVLA 2EGEA 3DLMA 2YLCA 2BTTA 1Q95G 3HRTA 2W10A 2BZXA 1WQWA 1JJ2P 2HD0A 5LJ5e 2KXDA 4A53A 3CCRA 2KAFA 4J8OA 2KVQG 2C0IA 1ZA2B 3OS5A 4XTWA 2NUTA 4OGEA 2EBPA
chains in the Genus database with same CATH topology
4BDZA 2ZGWA 4BDYA 3SWNC 2D0QB 1H3ZA 1VQ6T 4QVCA 4M7AG 4BI3A 2EJFA 3A5ZB 4C0DC 3FDRA 5CK9A 4M78B 1Q82U 3HP9A 1KHIA 2DVEA 4HT8A 3SWNB 3CCMA 1QVGS 2OAUA 4C0DB 2QQSA 2QQ9A 2RM4A 2JTMA 4KBMB 4XU3A 2V8JA 5DY9A 4J6WA 4M75F 5C0MA 5I21A 3LWIA 2QEXT 2HNIA 1HK9A 3HFOA 3VU3C 1KQSA 1K73C 3M5AA 2FHDA 5GAOq 2LNVA 3CMET 1Q7YU 1VQ9A 2GF7A 3QBYA 4EPCA 1U1SA 2DZCA 5DLQE 2MAMA 2F5TX 2EQMA 3VJPA 3INZA 4A54A 4IUTA 2LC4A 5CAIA 3JCMJ 4N0AA 2K57A 4LDWA 3MEUA 3JCMb 3WXMB 1N8RC 1W4SA 2XKOC 1K73U 1YHQA 3EFRA 3OBYA 1WNLA 3CPWA 3HL8A 3HRUA 4FIBA 2K5LA 1QVPA 2NLUA 2FYKA 3OYHA 5GAOr 3GP8A 3P8DA 2DPPB 3QZ9B 1Y96B 4KUIA 2M0OA 3J80E 2EJGA 2OTJT 2K5IA 4XTXA 2VC8A 3RKYA 3GPLA 3AHUA 1N8RU 5HK3A 3MHXA 5KE2A 5LL6S 2RI3A 3BDUA 1Y71A 4F7UG 4ZGEB 2MI6A 2DK3A 4M7DD 3A8OB 3CCLT 1K8AC 1VQLT 1VQMA 3V8KA 2GFAA 1Q81C 3MP1A 4PJOC 3E9FA 3HKSA 4M77A 3UT1A 2EWNA 3PGGA 4HA8A 5D6YA 2ZZDA 5GAN4 1M8VA 2PUKB 4JLGA 1YIJT 4PJOB 4RG2A 5J3BA 5GAMg 3GNFB 1VQ4T 1SSFA 3QHSA 3H8ZA 1QVFA 3JB9H 2E41A 5GMKi 4ZN3A 1K8AU 3HSBA 3HHTB 3OYEA 1D3BB 4C92E 2RJEA 4EMKC 1Q81U 4QQ6A 4BI4A 2LRQA 5GAOm 2CZ1B 2PVGB 3S6WA 3MEVA 1VQKT 4PJOG 4M7AA 2DTOA 1YCYA 4LDUA 4P5NA 3M55A 5IT9E 2F69A 4FM4B 2EFIA 3S3MA 4Z02A 3WVEB 5DM7R 5GAMj 4M7DC 1WJQA 2E64A 3BFMA 1PSFA 3QJYA 4M78A 1JBMA 2R5MA 4BI8B 1X01A 2LQKA 1NPPA 4JRQA 2L8DA 3L2QA 4M7DA 3V7SA 2LT1A 2DIQA 3TCJA 2BIVA 5AYFA 2XDBA 5LJ5h 3OYNA 2QQRA 4N4GA 2RI2A 3LGFA 3PIOA 1N9RA 5GMKl 2QQBA 3V8JA 4MZPA 1H641 2RD1A 4M7DG 3CBPA 4MMKA 5D6WA 4JJNK 1WQ7A 3CCQA 3JB9J 4TVRA 3QSUA 3NTHA 3R6OA 4C8QF 1Y7XA 1YHQT 3J81E 2LDMA 2DD5A 3MCAB 2P0KA 4RCBA 4XU0A 4C5IA 5HK0A 2O4XB 4J83A 5GANe 3JCMW 1W2BS 4LDYA 4KUDK 1NPRA 4M75D 4C5EA 2RHIA 3NFCA 2DXCA 5LJ3d 3JAME 5J39A 3FLGA 3OA6A 1YI2T 2DTHA 2QDYB 4GLKA 4OF1A 5CQXA 3OS2A 3HFNA 4F7UE 4RG8A 2RHYA 3OMGA 3OYYA 1Y96A 4X9DA 1VQPA 1UGSB 4C0FA 4E7LA 5GAN5 3CCEA 2I2LA 2KDSA 1FXXA 2DXTA 2P0QA 3JCMd 1MGQA 4BY6C 3OS0A 4IKFA 2LCLA 4C92C 4L5GA 4OB3B 2VXFA 4BY6B 1N27A 2L3RA 1G5VA 1MHNA 2QI2A 4C92B 2YLBA 4A4EA 3OYMA 3OMCA 4LDVA 1QVGA 3TU4K 3GIBA 4PJOA 4M75C 2L89A 4X34A 5LJ3f 2QA4A 5HY6A 1VIFA 1YJWA 3L2VA 2LX9A 4A4HA 4NL3A 2X4XA 4R55A 3PT9A 4DOVA 1D3BA 2RHUA 5GAN7 3VYGA 1IZ6A 4C92G 1UGRB 1ZQ1A 1ZBXA 3C12A 1UGPB 4E47A 3GOXA 2RA2A 3OY9A 3PMTA 4A4FA 3J7AF 1Q7YC 2E5QA 2ZPBB 3A8LB 3CCUT 3DB3A 1K9MC 2CZ6B 4QW2A 4M75G 3JCMf 5LJ5g 1X6OA 5CKHA 1I5LA 1I81A 4M77F 3OYIA 5GMKe 1VQ5T 1VQNT 4EDUA 4EMGA 2GCXA 4M7DE 4QQDA 1M1GA 5GAN6 3M4YA 3L2UA 3JB9F 1M1FA 2E12A 3G71T 2X4JA 2GFUA 3OBWA 2OTLA 4LDXA 3M4GA 1K9MU 2XD0A 3CCQT 4J5YA 2VGMA 4Q5WA 3RUXA 5KCHA 2KMTA 1N9SA 3CCJT 1YJ9A 4M7AD 3CD6T 2KY9A 4M7AF 2RHXA 5LJ5j 2GQVA 3X28B 4C0ZA 4CRIA 2HBPA 1WGSA 5A2QE 2KK4A 3PTAA 3BY7A 3PFSA 2Y4XA 2EKOA 3ER0A 3SB2A 3QKJA 3JCMX 3M59A 3QZ5B 1TH7A 5J26A 2JN0A 4N4HA 4F7UB 1M5Q1 2O4XA 4QVDA 3RKWA 3S3OA 2XU8A 3SD4A 3I56A 4M78F 2ZPHB 3NTKA 4E7IA 2DXUA 1FWZA 2X4YA 3LLRA 3QYGB 4OP0A 4EMHA 1V29B 3L42A 2XG8D 2E70A 4OGCA 5C6SA 2RJFA 3VUZA 5CCAA 3CCET 4JRKA 2MWOA 5CIUA 4C8QD 4OB0B 3M58A 2JNGA 1U8RA 3M56A 1S72A 2DXBA 1VQ8A 3CCSA 1JRIA 3LYIA 3I55A 5A0GA 2ZPEB 3RESA 2RHZA 3RMSA 4ZGJB 3CBOA 3CCRT 2DAQA 2JOYA 3LGLA 4D6WA 3MEAA 5GAMd 3OW2A 1FX7A 4O5VA 5GANh 1VQOA 5FRMA 5GMKm 3EFSA 3CC7A 3UDCA 4B9WA 3DKMA 3CMAA 1M9SA 1BI2A 2Y90A 3E19A 1NE8A 2DEQA 4C92A 5A0LA 1VIEA 3MO8A 2YHTA 2ZPGB 4ZN1A 4EMKB 1JJ2S 1UEBA 2RI5A 4MZTA 3OYCA 1I4K1 2QXFA 2FVUA 2VYTA 2DO3A 4M75E 3OW2S 4ZTJA 1GXIE 1UB4A 3CCMT 1DJ7B 3GNGA 1WJSA 3M53A 4BD3A 5KCOA 4X9CA 1LOJA 1KHCA 3CC4A 1X75C 1QP2A 3LWHA 3SWNA 3JCMP 3JCMQ 4M7DB 4KT0E 2R5AA 3EAEA 4ME7A 4PL6A 4QQGA 3X25B 2V8IA 3OQ5A 3QDRB 4J7IA 1VQ9T 1G3SA 2EQJA 1W2BA 1QP3A 1KQ1A 3LW5E 5GAMf 2Y4YA 5FU7C 3QXEB 4A4GA 4RCCA 4GY5A 2AHJB 1R8OB 3QJ6A 4PJOF 1YJ9T 4ATOA 3DLLA 4C8QG 5GAN2 4IUQA 5GAN3 5FU7B 1XTDA 3ZFJA 2FB7A 5CVIA 3G6EA 2E6NA 1VQ6A 1BI1A 2QTXA 4KULA 4BE2A 4IUPA 5FLXE 2K4YA 3JCMV 4M77D 3HPWA 4JS5A 2K5FA 5LJ3e 2A3LA 1BKBA 4M78C 2VXEA 4II1A 2JVVA 3I56T 4LD9K 3QYHB 1G3YA 1WJRA 1BI3A 3QPHA 5A0DA 5M9OA 1VUBA 2F5KA 2QEXA 3JB9D 2C06A 3OS1A 4FU6A 4C0GA 3G7ZA 3LX7A 4F7UA 2E6ZA 2FL7A 5GMKh 3OYAA 4FT4A 3KBGA 4L6V5 3LH0A 1YITA 2RB6A 3UPUA 2P4TA 2R58A 3GLXA 2PU9B 1ZHIA 3JRZA 1P92A 1VQMT 3L2ZA 4ZGDB 2ZPIB 2LVMA 3CPFA 3T9NA 3VYHB 2JUFA 3NTIA 3JCMe 1BI0A 4O6JA 3OYJA 3CCST 3CCVA 3OYGA 1XQHA 2KQWA 2CKKA 3BDLA 5GANg 3I55T 4NS5A 2EQKA 3JCMc 3OYFA 1VQOT 4PKCC 1KG1A 2XIDA 2CGHA 1OI1A 3WVDB 4OVAA 4M78D 2DD4A 4HKEA 2OTJA 5GAOn 4E7JA 2L5QA 2PQWA 1N6AA 2XK0A 3OSVA 4BACA 4UC4A 4JUVA 3TEEA 3QO3A 2WSEE 3META 4M75B 2LT4A 4JLIA 3E9GA 2WSCE 5GANj 3CC2A 1G3WA 4JRPA 3X20B 5FU6C 1VQLA 2EJ9A 4EMKA 3OB9A 2BKDN 2MF2A 4PLIA 1JB0E 3SFMA 4WF2A 3A8MB 4L59A 2DIGA 4M77G 1YIJA 3P8BB 2RJDA 2RK1A 3FB9A 5LJ5d 3G4SA 3CEYA 4J6YA 1VQ4A 4E7HA 5CKDA 4V2SA 1Y07A 4MZMA 4ELYC 3CXCS 4C8QE 2K2VA 5CKBA 3E1SA 3KUFA 2WSFE 4QVZA 3FIFA 4YTLA 3ZEHA 5KE3A 3QUIA 2D6FA 1OZ3A 4ELZC 5IN1A 1BYMA 3ASKA 4HCZA 1VQKA 1PSEA 3OYLA 2RJCA 4CI0C 3G6ET 5FRNA 1O75A 1NJIC 3N5BB 4C92F 3UWNA 1OYXA 4DOWA 5D6XA 3C4SA 3JSCA 3C94A 5HKCA 2KSSA 1YJNA 4OMFB 2BUDA 4OB1B 2PUOB 2CZ7B 2CZ0B 2K3YA 2XDDA 4XAXB 2WACA 5FROA 3FC3A 4Y28E 3TREA 4M78G 2XICA 1IREB 2G3RA 1NJIU 3S3NA 1VQPT 1RI0A 1RL2A 1YITT 5LJ5f 4E7KA 3HRSA 4PJOD 2CYZB 2XHCA 1B34B 4FL6A 4BE1A 3CBMA 3MEWA 2JZ2A 2D9TA 2RH2A 2E65A 2JTFA 3M57A 3CCVT 1O9SA 5DLOA 1I8FA 2RK2A 2MMPA 2HQXA 3PNWC 3RKXA 1KQSS 1JJ2A 5GMKj 2IG0A 3VUBA 5CO7A 2E1HA 4MDXA 1LJOA 3ME9A 2EQUA 2LCCA 4FSXA 2A7YA 2R57A 4JRIA 1U1TA 5GAMe 1YI2A 2VGNA 5GAN8 2V8KA 3M54A 2LQ8A 3GF5A 2QA4T 5LJ3h 4C5GA 2VUBA 1YJWT 2CS7A 2E10A 1Q86C 3L2WA 1VQ7A 4DA4A 3CPWS 4XTZA 2M9UA 4PLLA 3CC2T 4F7UF 4Y91A 2EAYA 3RMQA 4DQ2A 4M77E 4ZTFA 3ZBDA 1KC8C 4M75A 3M9QA 3V7CA 1Q86U 4C8QC 3JCMh 1HXDA 3Q1JA 2IVWA 2LTOA 3URGA 2XI9A 4XTYA 3G4ST 2K3XA 4C8QB 4MDWA 4M7AE 2QQAA 1KC8U 5GAOp 2OTLT 1WPYA 3MP8A 1NZ9A 2XDPA 4JS4A 3A8HB 2RO0A 2HQEA 2YRVA 4B9XA 3F70A 3PMIA 2ZCFB 1YJNT 1QVFS 4XTUA 1KQ2A 2M16A 4M78E 1UGQB 3BW1A 2ZPFB 5CKEA 3FEOA 3CCUA 2DZ9A 3A8GB 2DTIA 1BIAA 1OZ2A 4J6XA 5CR2A 4N0AC 3OYKA 1VQ5A 1M90C 4MMLA 1VQNA 4VUBA 3RERA 4IUVA 3P8HA 2EIFA 5L8RE 3H6ZA 3MP6A 3VKIA 2M1HA 1YBYA 3VV0A 4A4KA 3O8VA 5EG2A 4C5HA 3G71A 3CMEA 5CKFA 1LNXA 4C92D 4IUUA 1EIFA 3L1AA 4N4IA 3FRNA 4J7FA 1M1KC 3OSSC 5I2MA 5GAOl 3OYBA 4XTVA 1S72T 4M7DF 1QW1A 3CCJA 4HT9A 1VQ8T 2B8AA 1M90U 1B34A 3CD6A 3DB4A 3C95A 5KH6A 5GANd 4FT2A 4IURA 3SDZA 2HAXA 2MWPA 4BB7A 4HCCA 3QG1A 4HCBA 5LJ3g 3RIRA 2P0PA 3OYDA 4PNOA 3CC7T 3CMAT 4JDSA 3V8LA 1M1KU 2DKGA 1KD1C 4XK8E 5CQYA 4M77C 4XU1A 1VQ7T 4OB2B 3L2RA 2X4WA 1XNIA 4M77B 4LD6A 3DLMA 2DJZA 3X26B 3CXCA 3QIIA 3JCMg 1G3TA 2H3JA 2YLCA 2X35A 3V7RA 4RMOA 3CCLA 5I2SA 3KXTA 4R56A 3PIPA 2EYQA 3HRTA 1KD1U 5LJ3j 2PVOB 1BIBA 1WQWA 3CC4T 4XQ3A 4M7AC 5FU6B 2O01E 4NOYA 2HD0A 2VV5A 5LJ5e 5IAYA 4A53A 3CCRA 4PJOE 3FJPA 2KAFA 4J8OA 2KVQG 3X24B 5GANf 4M7AB 1Q82C 4BUGA 4NL2A 3JB9G 2PVDB 3OS5A 4XTWA 3JB9I 5GAMh 1AHJB 4OGEA 4BE0A 4XU2A 4C8QA 1M4ZA 4RKUE 1XOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQX A;  2RHY A;  4BDZ A;  3OMG A;  4BDY A;  1H3Z A;  2IG0 A;  2R5A A;  3EAE A;  3FDR A;  4PL6 A;  4QQG A;  4E7L A;  3OQ5 A;  2EQJ A;  3ME9 A;  2EQU A;  2LCC A;  2R57 A;  4A4G A;  2QQS A;  4GY5 A;  3OS0 A;  4C5G A;  3QJ6 A;  5C0M A;  4IKF A;  4IUQ A;  3L2W A;  2E6N A;  1N27 A;  2FHD A;  2L3R A;  1MHN A;  4PLL A;  4BE2 A;  1G5V A;  2GF7 A;  3QBY A;  4IUP A;  3OYM A;  4A4E A;  4ZTF A;  3OMC A;  2EQM A;  4IUT A;  2L89 A;  3M9Q A;  4II1 A;  4X34 A;  3L2V A;  1WJR A;  4A4H A;  3MEU A;  5M9O A;  2X4X A;  2F5K A;  3Q1J A;  2LTO A;  2RHU A;  3OS1 A;  4FU6 A;  2K3X A;  3LX7 A;  3OYA A;  2NLU A;  3OYH A;  3LH0 A;  3GOX A;  3OY9 A;  2R58 A;  3P8D A;  3PMT A;  4A4F A;  2E5Q A;  2M0O A;  2LVM A;  3DB3 A;  3MP8 A;  3NTI A;  4QW2 A;  2XDP A;  2RO0 A;  3OYJ A;  3OYG A;  2HQE A;  2CKK A;  2YRV A;  3BDL A;  3F70 A;  4B9X A;  3OYI A;  4NS5 A;  4EDU A;  5KE2 A;  3PMI A;  2EQK A;  3OYF A;  2RI3 A;  4QQD A;  2M16 A;  3L2U A;  1OI1 A;  4OVA A;  2GFU A;  3FEO A;  2GFA A;  3MP1 A;  3E9F A;  1OZ2 A;  3UT1 A;  2PQW A;  4Q5W A;  4E7J A;  5D6Y A;  5KCH A;  3OYK A;  2XK0 A;  4BAC A;  4UC4 A;  4IUV A;  3MET A;  2RHX A;  3P8H A;  4RG2 A;  3E9G A;  4CRI A;  1SSF A;  3H6Z A;  1WGS A;  3H8Z A;  2M1H A;  3MP6 A;  3PFS A;  2EKO A;  3O8V A;  4C5H A;  3QKJ A;  3OYE A;  2RJE A;  3OB9 A;  2BKD N;  4IUU A;  4QQ6 A;  4N4I A;  2LRQ A;  4N4H A;  2O4X A;  5J26 A;  3S6W A;  3OYB A;  3S3O A;  4PLI A;  3MEV A;  3SD4 A;  2B8A A;  2DIG A;  4L59 A;  3NTK A;  4E7I A;  2RJD A;  3DB4 A;  2X4Y A;  5KH6 A;  3LLR A;  4IUR A;  3CEY A;  2MWP A;  3L42 A;  4E7H A;  2EFI A;  5C6S A;  3S3M A;  2RJF A;  2MWO A;  5CIU A;  4Z02 A;  3OYD A;  3KUF A;  4QVZ A;  5KE3 A;  1WJQ A;  3ZEH A;  1OZ3 A;  5IN1 A;  3ASK A;  2R5M A;  4HCZ A;  3OYL A;  5FRN A;  2RJC A;  3L2R A;  2L8D A;  3LYI A;  3L2Q A;  3UWN A;  1OYX A;  2DIQ A;  3C4S A;  2BIV A;  5D6X A;  2RHZ A;  2X4W A;  1XNI A;  2DAQ A;  3LGL A;  3OYN A;  3MEA A;  4LD6 A;  3DLM A;  2BUD A;  2QQR A;  2RI2 A;  4N4G A;  3QII A;  3LGF A;  5FRM A;  2X35 A;  2K3Y A;  4B9W A;  2WAC A;  5D6W A;  5FRO A;  3FC3 A;  3NTH A;  2G3R A;  3MO8 A;  3S3N A;  2LDM A;  1RI0 A;  2P0K A;  2RI5 A;  4C5I A;  2O4X B;  5IAY A;  3OYC A;  4E7K A;  4ZTJ A;  2VYT A;  4C5E A;  2RHI A;  4FL6 A;  5J39 A;  3FLG A;  3OA6 A;  4BE1 A;  1WJS A;  3MEW A;  2JZ2 A;  2D9T A;  4BE0 A;  3OS2 A;  2JTF A;  4BD3 A;  5KCO A;  1KHC A;  3PNW C; 
#chains in the Genus database with same CATH topology
 2ZGW A;  1VQ7 Q;  1VQ6 T;  3UF4 A;  3CCM A;  1QVG S;  3VS3 A;  3A1P A;  2QQS A;  1JXM A;  5DY9 A;  1SEM A;  2EQI A;  1HK9 A;  2FHD A;  4EPC A;  5DLQ E;  2KRO A;  3JCM J;  4IUT A;  2LC4 A;  2QAS A;  4N0A A;  2DER A;  1QCF A;  4LDW A;  3QWX X;  2J06 A;  1K73 U;  3QDF A;  2EVR A;  2K9G A;  3HRU A;  1K76 A;  1QVP A;  2FYK A;  4JZ3 A;  3P8D A;  2DPP B;  2OTJ T;  5KYU B;  1RUW A;  2VC8 A;  2DLP A;  3AHU A;  2V26 A;  2O88 A;  1V76 A;  1PC0 A;  4CC7 A;  2DIL A;  4F7U G;  2K79 A;  1K8A C;  1VQL T;  5GJV B;  1HJD A;  2GFA A;  1I5O B;  3HKS A;  3UT1 A;  1NEG A;  1VQ4 T;  1M1K R;  1SSF A;  3OYE A;  4C92 E;  1Q81 U;  2RJE A;  2KE9 A;  2PVG B;  3S6W A;  3MEV A;  4LDU A;  5IT9 E;  2F69 A;  2EFI A;  3WVE B;  2E64 A;  1PSF A;  3NMZ C;  2QGF B;  3L2Q A;  4JPB W;  5IHK A;  1NBE B;  1M2V A;  2BIV A;  2DBK A;  3OYN A;  4N4G A;  5GMK l;  2RD1 A;  1FMV A;  1R0C B;  1WQ7 A;  4XU0 A;  4C5I A;  3JCM W;  5GAN e;  4KUD K;  4C5E A;  3OA6 A;  2DTH A;  4GLK A;  2J7I A;  3OS2 A;  2DX1 A;  1NLO C;  2JW4 A;  1ZUU A;  1U5S A;  3M0U A;  2DXT A;  3JCM d;  1MGQ A;  4KH1 B;  2ROT A;  1YHQ Q;  4L5G A;  2VXF A;  2IPO B;  1N27 A;  4C92 B;  3SHW A;  2YLB A;  4A4E A;  3OYM A;  1F1B B;  1QVG A;  4PJO A;  3EH2 A;  1ZX6 A;  5LJ3 f;  2QA4 A;  5HY6 A;  1YJW A;  4NL3 A;  2CP0 A;  1D3B A;  2RHU A;  1D0X A;  4C92 G;  1UGR B;  4E47 A;  3OY9 A;  1Q7Y C;  2ZPB B;  4WCI A;  2CZ6 B;  1GFD A;  1K8A R;  4M77 F;  1VQ5 T;  5GMK e;  1VQN T;  2CUB A;  1PKT A;  2B86 A;  2GCX A;  2M0Y A;  1QVF P;  3EH1 A;  3M4Y A;  1PRL C;  2GFU A;  3OBW A;  1Y57 A;  1K9M U;  2JM9 A;  2VGM A;  4Q5W A;  3CCJ T;  1SKU B;  3EGD B;  4JRQ A;  2GQV A;  2AIR B;  4HCK A;  2LJ1 A;  3JCM X;  2FZC B;  2Y4X A;  3ER0 A;  3QZ5 B;  1M3B A;  4HXJ A;  1TH7 A;  4QVD A;  2JN0 A;  4N4H A;  2O4X A;  1WFW A;  2ZPH B;  1CSK A;  2X4Y A;  3QYG B;  4EMH A;  3L42 A;  2EYX A;  2RJF A;  2GTJ A;  3CCE T;  5CIU A;  5KYX A;  1M90 R;  1M8M A;  3M58 A;  2JNG A;  3M56 A;  3CCQ Q;  1S72 A;  1B3Q A;  3CCS A;  2ZPE B;  3CCR T;  4D6W A;  2JOY A;  3OW2 A;  5GMK m;  3EFS A;  3CMA A;  4B9W A;  2OAW A;  1NE8 A;  2YHT A;  4ZN1 A;  1JJ2 S;  1RAF B;  2FVU A;  4FYX B;  1D1B A;  1GXI E;  2VVK A;  9ATC B;  3CCM T;  5EC7 A;  1OUL A;  3CC4 A;  1QP2 A;  2COW A;  1RAA B;  4PL6 A;  4QQG A;  2V8I A;  2J6K A;  2EW3 A;  5GAM f;  2Y4Y A;  5FU7 C;  4GY5 A;  2AHJ B;  2NUZ A;  3LH5 A;  1YJ9 T;  4IUQ A;  1XTD A;  2E6N A;  2FPF A;  4M77 D;  3HPW A;  1M3C A;  1BKB A;  2DE0 X;  4II1 A;  1WJR A;  1BI3 A;  1MMG A;  1VUB A;  2F5K A;  2KR3 A;  1Q7Y R;  3OS1 A;  4C0G A;  1YIT A;  2P4T A;  2PU9 B;  3L2Z A;  3T9N A;  2JUF A;  1BI0 A;  8ATC B;  2KQW A;  2CKK A;  2EQK A;  3JCM c;  2RMO A;  4AFS C;  2L3Q A;  3WVD B;  4HKE A;  1OEB A;  3I56 Q;  3PVQ A;  5KYY A;  3TEE A;  1SF9 A;  1VYV A;  2BE9 B;  3CC2 A;  4Z89 A;  3X20 B;  2EJ9 A;  2OI3 A;  4EMK A;  3OB9 A;  4PLI A;  1JB0 E;  3SFM A;  2HKN A;  4WF2 A;  1VQ8 Q;  2DIG A;  5LJ5 d;  3FB9 A;  5GJW B;  4E7H A;  2L2P A;  2LQN A;  2MK5 A;  4ELY C;  1JU5 C;  3E1S A;  5CKB A;  3KUF A;  2WSF E;  3FIF A;  3ZEH A;  1OZ3 A;  4RTX A;  1VQK A;  2RJC A;  1O75 A;  2KXC A;  1K9A A;  1T0H A;  2ZAE A;  3EG0 A;  2CZ7 B;  2OJ2 A;  2K3Y A;  5FRO A;  3TRE A;  1QQJ A;  1RI0 A;  1EZZ B;  1UDL A;  1W2B P;  4E7K A;  1BU1 A;  1UGV A;  2CYZ B;  2XHC A;  1TUG B;  3VS0 A;  4KGZ B;  2D9T A;  4F14 A;  3CCV T;  1I8F A;  2RK2 A;  3PNW C;  2HQX A;  3G6E Q;  1VQ6 Q;  1JJ2 A;  2IG0 A;  3ME9 A;  4JRI A;  4E7Z A;  1YI2 A;  2VGN A;  2E3H A;  2K7A A;  3M54 A;  1H3H A;  2QA4 T;  5LJ3 h;  5IXB A;  2VUB A;  1YJW T;  2CS7 A;  1JQQ A;  2K6D A;  1ZSZ A;  4JJB A;  1FMK A;  4PLL A;  4Y91 A;  2PZ1 A;  1QMC A;  4ZTF A;  5FW9 A;  1Q86 U;  4C8Q C;  3G4S T;  8AT1 B;  3REA B;  4M7A E;  1KC8 U;  2OTJ Q;  1WPY A;  4LUE A;  4JS4 A;  2F2V A;  1W70 A;  3PMI A;  1YJN T;  1VOM A;  2FG0 A;  1QVF S;  4XTU A;  1UG1 A;  4M78 E;  1UGQ B;  1VQL Q;  5CKE A;  2DTI A;  1D1C A;  1WHG A;  1GBR A;  4RTU A;  2L0A A;  1VQ4 Q;  2EIF A;  5L8R E;  1KFZ A;  4A4K A;  2RQR A;  5EG2 A;  4AT1 B;  4C5H A;  2DL8 A;  1EIF A;  2OTL Q;  2KRM A;  5GAO l;  4M7D F;  1IB8 A;  4XTV A;  1S72 T;  1M90 U;  5GAN d;  4IUR A;  4BB7 A;  5LJ3 g;  3RIR A;  2P0P A;  2V1Q A;  1HYO A;  3EG9 B;  2CT3 A;  1UHC A;  4JDS A;  3CMA T;  1KD1 C;  4XK8 E;  2NUP A;  1K0S A;  3VS1 A;  2K3B A;  3X26 B;  3QII A;  4RMO A;  5I2S A;  1WXU A;  3PIP A;  1PKS A;  2EYQ A;  3ZL7 C;  2CDT A;  4OMQ A;  3CC4 T;  3A98 A;  4XQ3 A;  2HKQ B;  1T0J A;  1QCO A;  1TTH B;  3OW2 P;  1Q82 C;  4M7A B;  3JB9 I;  5GAM h;  1AHJ B;  4J9I A;  1XJW B;  5IXF A;  4BE0 A;  4RKU E;  1LVK A;  4RTW A;  4OML A;  4M7A G;  2EJF A;  3A5Z B;  4M78 B;  4PJJ A;  2QQ9 A;  4XU3 A;  5I21 A;  4M75 F;  3M0T A;  1E6H A;  3VU3 C;  3M5A A;  5GAO q;  3CME T;  1Q7Y U;  1X43 A;  2IIM A;  2GF7 A;  1VQ9 A;  2CH4 W;  4J9B A;  1MMN A;  2MAM A;  1WX6 A;  2EQM A;  3INZ A;  2AK5 A;  1N8R C;  3WXM B;  1WNL A;  4FIB A;  3U23 A;  3NGP A;  3QZ9 B;  2EJG A;  2K5I A;  3RKY A;  2OX7 A;  5HK3 A;  1VQ5 Q;  1VQN Q;  4JJD A;  5KE2 A;  5LL6 S;  3VRZ A;  3HTR A;  2RI3 A;  1Y71 A;  4M7D D;  2DK3 A;  2CH4 A;  1WA7 A;  3CCL T;  2JXB A;  1YWO A;  3MP1 A;  4M77 A;  2EWN A;  4HA8 A;  3CCJ Q;  2PUK B;  5J3B A;  5GAM g;  1AD5 A;  1QVF A;  5GMK i;  3HSB A;  3HHT B;  2DL5 A;  1TG0 A;  2DF6 A;  4QQ6 A;  5GAO m;  2VWF A;  3M0S A;  1VQK T;  1GL5 A;  1VA7 A;  1YCY A;  4P5N A;  2D8H A;  1KD1 R;  4FM4 B;  3S3M A;  1B07 A;  5DM7 R;  1WJQ A;  2R5M A;  4E2F B;  4BI8 B;  1X01 A;  2LQK A;  1NPP A;  1RAD B;  2QAZ A;  3V7S A;  3TCJ A;  2DIQ A;  2D0N A;  1AT1 B;  3CCR Q;  2YUQ A;  2RI2 A;  3PIO A;  4E7S A;  2VAS A;  1X2Q A;  3CBP A;  5D6W A;  4AFQ C;  1Q82 R;  3JB9 J;  4TVR A;  4C8Q F;  2QDL A;  3GBQ A;  2LDM A;  2DD5 A;  3EGX A;  2P0K A;  3MCA B;  2KYB A;  1UTI A;  1W2B S;  1NPR A;  2XMF A;  4M75 D;  3CCM Q;  2RHI A;  4KGX B;  5J39 A;  2DEU A;  1YI2 T;  1N5Z A;  1YCS B;  5CQX A;  4F7U E;  1KQS P;  1TU0 B;  1Y96 A;  1UGS B;  4PFP A;  2CP3 A;  4E7L A;  2YSQ A;  3CCE A;  2I2L A;  2P0Q A;  4IKF A;  1TSF A;  1ZUK A;  4C92 C;  4J9G A;  4OB3 B;  1PG5 B;  5IHI A;  2L3R A;  1N8R R;  4LDV A;  3GIB A;  2CP6 A;  1VIF A;  4QKU A;  1PNJ A;  2X4X A;  4FYV B;  2JMA A;  1UGP B;  2RA2 A;  2HCK A;  3PMT A;  3J7A F;  2QK0 A;  2E5Q A;  3A8L B;  1YN8 A;  1I81 A;  1M1G A;  3L2U A;  3M4G A;  3RUX A;  1I0C A;  1YJ9 A;  4DBR A;  2KY9 A;  5LJ5 j;  3PTA A;  1WGS A;  2KK4 A;  2RQU A;  3PFS A;  3M59 A;  4F7U B;  2HEQ A;  3S3O A;  1FWZ A;  3LLR A;  5IHN A;  5FWB A;  5C6S A;  2MWO A;  4C8Q D;  4FW1 A;  1G8X A;  3I9Q A;  2DXB A;  1X69 A;  3RES A;  1OOT A;  2RHZ A;  4ZGJ B;  3CBO A;  2DAQ A;  4DBF A;  3UDC A;  1FMW A;  3DKM A;  1M9S A;  1BI2 A;  3E19 A;  1YFN A;  2ZPG B;  2JT4 A;  1UEB A;  4MZT A;  2DJQ A;  3OYC A;  2VYT A;  3OW2 S;  1OU8 A;  3PE0 A;  2SEM A;  1UB4 A;  1K4U S;  2JS0 A;  3GNG A;  1WJS A;  3M53 A;  3LWH A;  3SWN A;  2GQI A;  3JCM Q;  3EAE A;  1W2B A;  4J7I A;  1VQ9 T;  1H8K A;  2EQJ A;  4CC2 A;  2RF0 A;  2X3X D;  3QXE B;  2QA4 Q;  1T3L A;  2PTK A;  1PWT A;  4ATO A;  2HL3 A;  1BI1 A;  2KBT A;  2YRC A;  5FLX E;  2DRM A;  5LJ3 e;  4QT7 A;  1BK2 A;  2VXE A;  1WHK A;  2JVV A;  5A0D A;  2FPE A;  2JMC A;  2YT6 A;  3I5S A;  2QEX A;  1QWF A;  3BE3 A;  4FT4 A;  4L6V 5;  3UPU A;  3GLX A;  1ZHI A;  3CCV A;  3I55 T;  3BDL A;  3OYF A;  1VQO T;  1PRM C;  4M4Z A;  3QWY A;  1BCM A;  2A08 A;  2L5Q A;  1GFC A;  1N6A A;  2XK0 A;  4BAC A;  4UC4 A;  3H41 A;  3QO3 A;  2DA9 A;  3E9G A;  5GAN j;  1G3W A;  2HSP A;  2D1X A;  1SHG A;  1S72 Q;  2MCN A;  2FRW A;  3CCS Q;  4M77 G;  4J9E A;  3G4S A;  3CEY A;  4DBH A;  1WZO A;  3VS6 A;  3CMA Q;  2D6F A;  4M7D A;  1BCO A;  1UE9 A;  5IN1 A;  3SEM A;  5FRN A;  4CI0 C;  2BE7 D;  4C92 F;  3UWN A;  1OYX A;  2EPD A;  2KSS A;  1CKB A;  1YJN A;  2CZ0 B;  2RN8 A;  2MYS A;  1C1A A;  3CC4 Q;  4Y28 E;  1NJI U;  2G3R A;  3S3N A;  4B6M A;  2YXY A;  3HRS A;  3I35 A;  1B34 B;  3CBM A;  1ARK A;  2E4H A;  1KQS S;  1NLP C;  5GMK j;  1KK7 A;  4E6R A;  3UA6 A;  5CO7 A;  4AFU C;  4DEY A;  4MDX A;  2LCC A;  5GAM e;  4DEX A;  2PNI A;  2DET A;  3H0H A;  4C5G A;  2E10 A;  3THK A;  1D09 B;  2DFU A;  1YIT Q;  4DQ2 A;  2EAY A;  3RMQ A;  2JTE A;  4M75 A;  3M9Q A;  3V7C A;  2O9S A;  1HXD A;  4AMC A;  2NUT B;  4J9D A;  2QQA A;  5GAO p;  2KGT A;  2XDP A;  3A8H B;  2RNA A;  1LPL A;  2MIO A;  1RLQ C;  1BBZ A;  2YDL A;  3CC2 Q;  1WHL A;  3C0C A;  3CCU A;  1A0N B;  1OZ2 A;  3I5R A;  1U3O A;  2DBM A;  4VUB A;  4IUV A;  1W6X A;  1Z9Z A;  3H6Z A;  2M1H A;  3CME A;  3O8V A;  3H0F A;  3G71 A;  1LNX A;  2AT1 B;  4C92 D;  3L1A A;  5I2M A;  3OYB A;  1VQK Q;  1QW1 A;  3MKD A;  3CD6 A;  3C95 A;  5KH6 A;  4HVW A;  3SDZ A;  2MWP A;  4HCC A;  3QG1 A;  1PM3 A;  1K1Z A;  4PNO A;  1M1K U;  2F2X A;  1AWJ A;  2BZ8 A;  1VQ7 T;  1XNI A;  2DJZ A;  3JV3 A;  2H3J A;  2ATC B;  3V7R A;  2X35 A;  3CCL A;  1EFN A;  1GCQ A;  1BIB A;  1OX8 A;  4M7A C;  2O01 E;  4NOY A;  4PJO E;  3X24 B;  3JB9 G;  1YI2 Q;  1UUE A;  1UEC A;  4C8Q A;  3RNJ A;  4M78 C;  4ELZ C;  1XOV A;  4BDZ A;  5KYN A;  1ZA1 B;  2D0Q B;  1H3Z A;  3FDR A;  5I11 A;  1ZBJ A;  3HP9 A;  4HT8 A;  3SWN B;  4PJN A;  2OAU A;  2CSQ A;  4C0D B;  1M2V B;  2RM4 A;  4KBM B;  5C0M A;  2V8J A;  5HCK A;  3EFO A;  1PHT A;  2QEX T;  3HFO A;  3H9N A;  1KQS A;  1K73 C;  2YUO A;  5KYW A;  1MNE A;  2EYY A;  1U1S A;  1E7O A;  4A54 A;  3MEU A;  1W4S A;  2XKO C;  3EFR A;  1AOJ A;  3OBY A;  3VRY A;  1TS9 A;  5GAO r;  3GP8 A;  2DYI A;  2AKL A;  2KI7 A;  2M0O A;  4IIO A;  4JJC A;  2FEI A;  1GRI A;  3MHX A;  1GBQ A;  2FZG B;  1D0Z A;  3VS5 A;  1VQM A;  1Q81 C;  3E9F A;  3PGG A;  5GAN 4;  5D6Y A;  2ZZD A;  4F16 A;  1M8V A;  1OU9 A;  4J9F A;  1RI9 A;  4PJO B;  4RG2 A;  3QHS A;  2O2O A;  1K8A U;  1ZSG A;  1D3B B;  4EMK C;  4BI4 A;  2COY A;  2CZ1 B;  1IRX A;  4PJO G;  1NG2 A;  2V1R A;  2DTO A;  2E5K A;  2CP2 A;  3M55 A;  1ABO A;  3CXC P;  2EGA A;  1YNZ A;  1SG5 A;  2QTV A;  3BFM A;  3QJY A;  3IQL A;  2GTO A;  2DNU A;  1TOV A;  2L8D A;  4LE9 A;  2LT1 A;  1OPK A;  5AYF A;  1MV3 A;  3LGF A;  2MOX A;  2QQB A;  2H8H A;  4MZP A;  2ROL A;  4M7D G;  4JJN K;  3QSU A;  1OQK A;  3ULR B;  1Y7X A;  1YHQ T;  3J81 E;  1TUC A;  4RCB A;  5HK0 A;  2O4X B;  2CUD A;  4J83 A;  1VYT A;  3NFC A;  3JAM E;  5LJ3 d;  2O9V A;  1Z9Q A;  2QDY B;  3HFN A;  4RG8 A;  2RHY A;  3OMG A;  5KYX B;  1TUD A;  1VQP A;  1IXD A;  5KYU A;  4C0F A;  1VQ9 Q;  5GAN 5;  2A37 A;  2J6F A;  2KDS A;  1FXX A;  3G1J A;  1K73 R;  1UHF A;  2AZV A;  1KJW A;  3CPW P;  4BY6 B;  1ZSZ C;  1G5V A;  1MHN A;  1RAC B;  3OMC A;  3TU4 K;  4X34 A;  3L2V A;  4R55 A;  3PT9 A;  5GAN 7;  3VYG A;  1VYU A;  3C12 A;  1ZQ1 A;  4PFZ A;  4A4F A;  4J9C A;  3M0P A;  3CCU T;  3DB3 A;  1K9M C;  4QW2 A;  4M75 G;  3JCM f;  1KSW A;  1I5L A;  2KT8 A;  3OYI A;  4EMG A;  2L3P A;  4QQD A;  4GBQ A;  5GAN 6;  2AZS A;  2E12 A;  3G71 T;  3EG1 A;  2OTL A;  4LDX A;  2X3W D;  3CCQ T;  5KCH A;  2KMT A;  1N9S A;  2A0F B;  3CD6 T;  4M7A F;  2RPN A;  1QKW A;  5A2Q E;  3X28 B;  4C0Z A;  4CRI A;  1WHM A;  1KIK A;  2XU8 A;  2X51 A;  1X2K A;  4M78 F;  3NTK A;  2DXU A;  4OP0 A;  2E70 A;  3VUZ A;  4JRK A;  2YUP A;  4OB0 B;  1UJ0 A;  1U8R A;  1IO6 A;  2LX7 A;  3VS7 A;  1JRI A;  3LYI A;  3I55 A;  2FPD A;  5A0G A;  3LGL A;  1VQO A;  2DL7 A;  4FSS A;  5GAM d;  5KYY B;  3CC7 A;  2LQW A;  2Y90 A;  5FWC A;  1X6G A;  2DEQ A;  4C92 A;  1VIE A;  2JM8 A;  4EMK B;  5AT1 B;  2RI5 A;  2MPX C;  1I4K 1;  2QXF A;  2M51 A;  2DO3 A;  3TVT A;  3CCE Q;  2CRE A;  2LMJ A;  1EX4 A;  1DJ7 B;  5KCO A;  4BD3 A;  4X9C A;  1LOJ A;  1KHC A;  2EYW A;  1MMD A;  4K11 A;  4KT0 E;  1AWW A;  1AWX A;  3X25 B;  1ACM B;  1G83 A;  3QDR B;  4FYW B;  4A4G A;  4RCC A;  3QJ6 A;  2HBW A;  3DLL A;  4C8Q G;  5GAN 3;  3TQ7 P;  2GGR A;  3RDV A;  4IUP A;  1D0Y A;  3JCM V;  3VS4 A;  4JS5 A;  2NYS A;  3EGD A;  3I56 T;  3QYH B;  4CC4 B;  5ECA A;  1K9M R;  3OYA A;  3LH0 A;  1R0B G;  2ESW A;  1VQM T;  3VYH B;  3NTI A;  4O6J A;  4R0K A;  1YJ9 Q;  3OYG A;  1IHV A;  4RUG A;  2HDA A;  1X6B A;  1SPK A;  4PKC C;  2QG9 B;  4ESR A;  2CGH A;  1OI1 A;  3NHN A;  4OVA A;  4M78 D;  4J9H A;  2KEA A;  2DD4 A;  1ZSZ B;  3O5Z A;  2PQW A;  3OSV A;  1JO8 A;  2LJ0 A;  2WSE E;  2LCS A;  1SSH A;  2WSC E;  5FU6 C;  2BKD N;  2MF2 A;  1YIJ A;  3P8B B;  2F1L A;  2VKN A;  4J6Y A;  5CKD A;  4V2S A;  1Y07 A;  3CXC S;  1C6V X;  4QVZ A;  5KE3 A;  1BYM A;  4YTL A;  1QCN A;  1PSE A;  3OYL A;  2LP5 A;  3G6E T;  3N5B B;  5D6X A;  3C4S A;  3JSC A;  3C94 A;  5HKC A;  2C0O A;  1RAE B;  2BUD A;  4OMF B;  4OB1 B;  5IH2 A;  1M3A A;  2XDD A;  4XAX B;  2WAC A;  3FC3 A;  2KYM A;  4FYY B;  1VQP T;  1WHH A;  1YWP A;  5LJ5 f;  5D7U A;  4FL6 A;  2JZ2 A;  2COZ A;  3M57 A;  1S1N A;  5DLO A;  1K0X A;  2MMP A;  4AG1 C;  1SRL A;  1E6G A;  2NUP B;  4FSX A;  1U1T A;  5GAN 8;  1JEG A;  2V8K A;  1G2B A;  3GF5 A;  2NWM A;  2QEX Q;  1Q86 C;  3L2W A;  1AZE A;  1VQ7 A;  2DMO A;  3CPW S;  4XTZ A;  3MJX A;  4F7U F;  4M77 E;  2LNH B;  2O31 A;  1WDX A;  1KC8 C;  3CCV Q;  3JCM h;  2XI9 A;  4XTY A;  4AG2 C;  4RTT A;  1QKX A;  4RTY A;  4MDW A;  4LXC A;  2OTL T;  2RO0 A;  1YJW Q;  2YRV A;  2ED0 A;  2CSI A;  2ZCF B;  2J6O A;  3M0R A;  2M16 A;  1B7T A;  2CT4 A;  2W0Z A;  4N0A C;  3OYK A;  1M90 C;  3G4S Q;  3RER A;  1J3T A;  3VKI A;  1NYG A;  2KT1 A;  4IUU A;  4J7F A;  2HMA A;  2ABL A;  2B8A A;  3DB4 A;  2FZK B;  2HAX A;  1YJN Q;  3OYD A;  1ZUY A;  1SRM A;  3CC7 T;  1I1J A;  3V8L A;  2DKG A;  3EG2 A;  1Y0M A;  5CQY A;  4XU1 A;  2F2W A;  1BB9 A;  4OB2 B;  4KRT A;  2X4W A;  4EIK A;  4M77 B;  4LD6 A;  3CXC A;  3JCM g;  1G3T A;  3KXT A;  2P4R A;  4R56 A;  1KD1 U;  5LJ3 j;  2H3E B;  1X27 A;  2EYZ A;  2PVO B;  2YUN A;  4D8D A;  5FU6 B;  2VV5 A;  5IAY A;  3FJP A;  5GAN f;  2EGC A;  4BUG A;  4NL2 A;  2PVD B;  2RQW A;  4XU2 A;  1M4Z A;  2KNB B;  4BDY A;  3SWN C;  2VB6 A;  1RAH B;  4QVC A;  4BI3 A;  4C0D C;  5CK9 A;  1Q82 U;  1KHI A;  2DVE A;  1Q86 R;  4HVV A;  1CKA A;  4LN2 A;  1NYF A;  1LCK A;  2JTM A;  4J6W A;  3LWI A;  2HNI A;  2GBQ A;  1KC8 R;  1TWB A;  2LNV A;  2CP5 A;  3QBY A;  2DZC A;  3EGX B;  2F5T X;  2LZ6 B;  3TSZ A;  3VJP A;  5CAI A;  2K57 A;  3JCM b;  3H0I A;  4LNP A;  1YHQ A;  3CPW A;  1RLP C;  3HL8 A;  1D1A A;  2K5L A;  2NLU A;  1HSQ A;  3OYH A;  1WHJ A;  4KUI A;  1Y96 B;  3J80 E;  3CCU Q;  1MUZ A;  3MPU B;  4XTX A;  3GPL A;  1N8R U;  3EG9 A;  4KH0 B;  3BDU A;  4ZGE B;  2MI6 A;  3CME Q;  3A8O B;  3G71 Q;  2DVJ A;  3V8K A;  4PJO C;  4LUD A;  3CD6 Q;  4JLG A;  1YIJ T;  1QLY A;  3GNF B;  1AVZ C;  3H8Z A;  3JB9 H;  2E41 A;  4ZN3 A;  2LRQ A;  2ED1 A;  2Z0W A;  1WLP B;  1PD1 A;  4IIM A;  4M7A A;  1UFF A;  3CCL Q;  4Z02 A;  4M7D C;  5GAM j;  4M78 A;  1JBM A;  2QGG A;  4PJM A;  3RBB B;  2C0T A;  2XDB A;  5LJ5 h;  2QQR A;  1N9R A;  1PD0 A;  2LJ3 A;  3V8J A;  1H64 1;  4MMK A;  2DM1 A;  3CCQ A;  3NTH A;  3R6O A;  1WXT A;  1HD3 A;  3VS2 A;  2A28 A;  4LDY A;  2DXC A;  4RTZ A;  1I07 A;  3FLG A;  4OF1 A;  4KGV B;  1IGU A;  2GNC A;  3OYY A;  4X9D A;  4Y92 A;  1H92 A;  4ANJ A;  4BY6 C;  4AFZ C;  3OS0 A;  2LCL A;  3TSW A;  1TXQ A;  2QI2 A;  2HZY A;  4M75 C;  2L89 A;  2LX9 A;  4A4H A;  2BZY A;  2HSE B;  4FW2 A;  4DOV A;  1IZ6 A;  2ECZ A;  1ZBX A;  3GOX A;  1NEB A;  1R77 A;  7AT1 B;  1VQM Q;  5LJ5 g;  1X6O A;  1OPL A;  5CKH A;  4EDU A;  4M7D E;  3JB9 F;  1M1F A;  4X1V A;  2X4J A;  2XD0 A;  4J5Y A;  2FRY A;  4Z88 A;  2I0N A;  3E2U A;  2DYB A;  2RHX A;  1T3S A;  2HBP A;  3NPF A;  2E3I A;  3BY7 A;  1IGQ A;  2EKO A;  3SB2 A;  3QKJ A;  1AZG B;  3REB B;  1WIE A;  2QYZ A;  5J26 A;  1M5Q 1;  1NM7 A;  3RKW A;  3SD4 A;  3I56 A;  1W1F A;  4E7I A;  1GCP A;  1MND A;  2JJ9 A;  1V29 B;  1AEY A;  2XG8 D;  4OGC A;  5CCA A;  1RAG B;  3EHQ A;  5I22 A;  1VQ8 A;  3RMS A;  3MEA A;  4PFO A;  1FX7 A;  4O5V A;  5GAN h;  5FRM A;  2RQV A;  1YP5 A;  2G6F X;  1GCQ C;  2SRC A;  5A0L A;  3MO8 A;  1VQP Q;  4M75 E;  4ZTJ A;  6AT1 B;  4Z8A A;  1X75 C;  4GLM A;  2DL4 A;  3KFV A;  3JCM P;  4M7D B;  2R5A A;  4ME7 A;  4D8K A;  3OQ5 A;  2FO0 A;  1G3S A;  3EHR A;  1QP3 A;  1KQ1 A;  3LW5 E;  1QVG P;  4DBQ A;  1IHW A;  1UJY A;  1RAI B;  2D8J A;  1R8O B;  4PJO F;  4WTO B;  2DRK A;  5GAN 2;  5FU7 B;  3ZFJ A;  3G6E A;  2FB7 A;  3AT1 B;  5CVI A;  1VQ6 A;  2K2M A;  2QTX A;  4KUL A;  4BE2 A;  2K4Y A;  3FJ5 A;  3RR6 A;  2M02 A;  2K5F A;  4RTV A;  2A3L A;  3M0Q A;  4LD9 K;  1G3Y A;  3QPH A;  5M9O A;  3JB9 D;  2P84 A;  2C06 A;  4FU6 A;  3G7Z A;  3LX7 A;  4F7U A;  2E6Z A;  2FL7 A;  5GMK h;  3KBG A;  2RB6 A;  3EGU A;  2R58 A;  3JRZ A;  1P92 A;  1MMA A;  4ZGD B;  2ZPI B;  2LVM A;  3CPF A;  4JZ4 A;  5L23 A;  3JCM e;  3OYJ A;  3CCS T;  1XQH A;  5GAN g;  2AKK A;  4NS5 A;  4A63 B;  1OX9 A;  1KG1 A;  2RQT A;  2XID A;  2OTJ A;  5GAO n;  4E7J A;  1PCX A;  4JUV A;  3UAT A;  3MET A;  4M75 B;  2LT4 A;  4JLI A;  4JRP A;  2DL3 A;  1VQL A;  4OMM A;  2YRD A;  4F04 B;  4F17 A;  3A8M B;  4OMN A;  4L59 A;  3I55 Q;  2RJD A;  2RK1 A;  1Q81 R;  1VQ4 A;  1VQO Q;  4ORZ A;  4MZM A;  4C8Q E;  2K2V A;  4OMP A;  3CC7 Q;  3QUI A;  1WXB A;  2A36 A;  3ASK A;  4HCZ A;  1OV3 A;  1WI7 A;  1ABQ A;  1M27 C;  1NJI C;  4DOW A;  3D7S B;  2KRS A;  1QWE A;  2CP7 A;  2PUO B;  4CC3 A;  1RAB B;  4M78 G;  2XIC A;  1IRE B;  1RL2 A;  1YIT T;  1JXO A;  2EKH A;  4PJO D;  4HVU A;  4BE1 A;  3MEW A;  2RH2 A;  2E65 A;  2JTF A;  1O9S A;  3RKX A;  1WYX A;  2X9H A;  1V1C A;  3VUB A;  4OMO A;  1ZLM A;  2E1H A;  1U06 A;  1LJO A;  1C0M A;  2EQU A;  2A7Y A;  2R57 A;  2LQ8 A;  2JS2 A;  4DA4 A;  2M9U A;  3UA7 A;  4FCY A;  3CC2 T;  2YWW A;  3ZBD A;  1FYN A;  3Q1J A;  2IVW A;  2LTO A;  3URG A;  2K3X A;  4C8Q B;  2ENM A;  3MP8 A;  1NZ9 A;  2HQE A;  4B9X A;  3F70 A;  4PJL A;  1KQ2 A;  2L3S A;  3EFO B;  1AWO A;  3BW1 A;  2ZPF B;  3FEO A;  2DZ9 A;  3A8G B;  4J6X A;  1BIA A;  5KYW B;  5CR2 A;  4PK4 A;  1YIJ Q;  1VQ5 A;  4MML A;  1VQN A;  3P8H A;  3MP6 A;  1YBY A;  3R6N A;  2HL5 C;  3VV0 A;  3EG3 A;  5CKF A;  1M2O A;  4N4I A;  3FRN A;  4M7A D;  1M1K C;  3OSS C;  2J05 A;  3CCJ A;  4HT9 A;  1VQ8 T;  1B34 A;  4FT2 A;  1M30 A;  4HCB A;  1NJI R;  2KRN A;  1MV0 B;  4M77 C;  3CQT A;  3L2R A;  4ZNX A;  1SHF A;  2HQH A;  3PVL A;  2EGE A;  3DLM A;  2YLC A;  2BTT A;  1Q95 G;  3HRT A;  2W10 A;  2BZX A;  1WQW A;  1JJ2 P;  2HD0 A;  5LJ5 e;  2KXD A;  4A53 A;  3CCR A;  2KAF A;  4J8O A;  2KVQ G;  2C0I A;  1ZA2 B;  3OS5 A;  4XTW A;  2NUT A;  4OGE A;  2EBP A; 
#chains in the Genus database with same CATH homology
 4BDZ A;  2ZGW A;  4BDY A;  3SWN C;  2D0Q B;  1H3Z A;  1VQ6 T;  4QVC A;  4M7A G;  4BI3 A;  2EJF A;  3A5Z B;  4C0D C;  3FDR A;  5CK9 A;  4M78 B;  1Q82 U;  3HP9 A;  1KHI A;  2DVE A;  4HT8 A;  3SWN B;  3CCM A;  1QVG S;  2OAU A;  4C0D B;  2QQS A;  2QQ9 A;  2RM4 A;  2JTM A;  4KBM B;  4XU3 A;  2V8J A;  5DY9 A;  4J6W A;  4M75 F;  5C0M A;  5I21 A;  3LWI A;  2QEX T;  2HNI A;  1HK9 A;  3HFO A;  3VU3 C;  1KQS A;  1K73 C;  3M5A A;  2FHD A;  5GAO q;  2LNV A;  3CME T;  1Q7Y U;  1VQ9 A;  2GF7 A;  3QBY A;  4EPC A;  1U1S A;  2DZC A;  5DLQ E;  2MAM A;  2F5T X;  2EQM A;  3VJP A;  3INZ A;  4A54 A;  4IUT A;  2LC4 A;  5CAI A;  3JCM J;  4N0A A;  2K57 A;  4LDW A;  3MEU A;  3JCM b;  3WXM B;  1N8R C;  1W4S A;  2XKO C;  1K73 U;  1YHQ A;  3EFR A;  3OBY A;  1WNL A;  3CPW A;  3HL8 A;  3HRU A;  4FIB A;  2K5L A;  1QVP A;  2NLU A;  2FYK A;  3OYH A;  5GAO r;  3GP8 A;  3P8D A;  2DPP B;  3QZ9 B;  1Y96 B;  4KUI A;  2M0O A;  3J80 E;  2EJG A;  2OTJ T;  2K5I A;  4XTX A;  2VC8 A;  3RKY A;  3GPL A;  3AHU A;  1N8R U;  5HK3 A;  3MHX A;  5KE2 A;  5LL6 S;  2RI3 A;  3BDU A;  1Y71 A;  4F7U G;  4ZGE B;  2MI6 A;  2DK3 A;  4M7D D;  3A8O B;  3CCL T;  1K8A C;  1VQL T;  1VQM A;  3V8K A;  2GFA A;  1Q81 C;  3MP1 A;  4PJO C;  3E9F A;  3HKS A;  4M77 A;  3UT1 A;  2EWN A;  3PGG A;  4HA8 A;  5D6Y A;  2ZZD A;  5GAN 4;  1M8V A;  2PUK B;  4JLG A;  1YIJ T;  4PJO B;  4RG2 A;  5J3B A;  5GAM g;  3GNF B;  1VQ4 T;  1SSF A;  3QHS A;  3H8Z A;  1QVF A;  3JB9 H;  2E41 A;  5GMK i;  4ZN3 A;  1K8A U;  3HSB A;  3HHT B;  3OYE A;  1D3B B;  4C92 E;  2RJE A;  4EMK C;  1Q81 U;  4QQ6 A;  4BI4 A;  2LRQ A;  5GAO m;  2CZ1 B;  2PVG B;  3S6W A;  3MEV A;  1VQK T;  4PJO G;  4M7A A;  2DTO A;  1YCY A;  4LDU A;  4P5N A;  3M55 A;  5IT9 E;  2F69 A;  4FM4 B;  2EFI A;  3S3M A;  4Z02 A;  3WVE B;  5DM7 R;  5GAM j;  4M7D C;  1WJQ A;  2E64 A;  3BFM A;  1PSF A;  3QJY A;  4M78 A;  1JBM A;  2R5M A;  4BI8 B;  1X01 A;  2LQK A;  1NPP A;  4JRQ A;  2L8D A;  3L2Q A;  4M7D A;  3V7S A;  2LT1 A;  2DIQ A;  3TCJ A;  2BIV A;  5AYF A;  2XDB A;  5LJ5 h;  3OYN A;  2QQR A;  4N4G A;  2RI2 A;  3LGF A;  3PIO A;  1N9R A;  5GMK l;  2QQB A;  3V8J A;  4MZP A;  1H64 1;  2RD1 A;  4M7D G;  3CBP A;  4MMK A;  5D6W A;  4JJN K;  1WQ7 A;  3CCQ A;  3JB9 J;  4TVR A;  3QSU A;  3NTH A;  3R6O A;  4C8Q F;  1Y7X A;  1YHQ T;  3J81 E;  2LDM A;  2DD5 A;  3MCA B;  2P0K A;  4RCB A;  4XU0 A;  4C5I A;  5HK0 A;  2O4X B;  4J83 A;  5GAN e;  3JCM W;  1W2B S;  4LDY A;  4KUD K;  1NPR A;  4M75 D;  4C5E A;  2RHI A;  3NFC A;  2DXC A;  5LJ3 d;  3JAM E;  5J39 A;  3FLG A;  3OA6 A;  1YI2 T;  2DTH A;  2QDY B;  4GLK A;  4OF1 A;  5CQX A;  3OS2 A;  3HFN A;  4F7U E;  4RG8 A;  2RHY A;  3OMG A;  3OYY A;  1Y96 A;  4X9D A;  1VQP A;  1UGS B;  4C0F A;  4E7L A;  5GAN 5;  3CCE A;  2I2L A;  2KDS A;  1FXX A;  2DXT A;  2P0Q A;  3JCM d;  1MGQ A;  4BY6 C;  3OS0 A;  4IKF A;  2LCL A;  4C92 C;  4L5G A;  4OB3 B;  2VXF A;  4BY6 B;  1N27 A;  2L3R A;  1G5V A;  1MHN A;  2QI2 A;  4C92 B;  2YLB A;  4A4E A;  3OYM A;  3OMC A;  4LDV A;  1QVG A;  3TU4 K;  3GIB A;  4PJO A;  4M75 C;  2L89 A;  4X34 A;  5LJ3 f;  2QA4 A;  5HY6 A;  1VIF A;  1YJW A;  3L2V A;  2LX9 A;  4A4H A;  4NL3 A;  2X4X A;  4R55 A;  3PT9 A;  4DOV A;  1D3B A;  2RHU A;  5GAN 7;  3VYG A;  1IZ6 A;  4C92 G;  1UGR B;  1ZQ1 A;  1ZBX A;  3C12 A;  1UGP B;  4E47 A;  3GOX A;  2RA2 A;  3OY9 A;  3PMT A;  4A4F A;  3J7A F;  1Q7Y C;  2E5Q A;  2ZPB B;  3A8L B;  3CCU T;  3DB3 A;  1K9M C;  2CZ6 B;  4QW2 A;  4M75 G;  3JCM f;  5LJ5 g;  1X6O A;  5CKH A;  1I5L A;  1I81 A;  4M77 F;  3OYI A;  5GMK e;  1VQ5 T;  1VQN T;  4EDU A;  4EMG A;  2GCX A;  4M7D E;  4QQD A;  1M1G A;  5GAN 6;  3M4Y A;  3L2U A;  3JB9 F;  1M1F A;  2E12 A;  3G71 T;  2X4J A;  2GFU A;  3OBW A;  2OTL A;  4LDX A;  3M4G A;  1K9M U;  2XD0 A;  3CCQ T;  4J5Y A;  2VGM A;  4Q5W A;  3RUX A;  5KCH A;  2KMT A;  1N9S A;  3CCJ T;  1YJ9 A;  4M7A D;  3CD6 T;  2KY9 A;  4M7A F;  2RHX A;  5LJ5 j;  2GQV A;  3X28 B;  4C0Z A;  4CRI A;  2HBP A;  1WGS A;  5A2Q E;  2KK4 A;  3PTA A;  3BY7 A;  3PFS A;  2Y4X A;  2EKO A;  3ER0 A;  3SB2 A;  3QKJ A;  3JCM X;  3M59 A;  3QZ5 B;  1TH7 A;  5J26 A;  2JN0 A;  4N4H A;  4F7U B;  1M5Q 1;  2O4X A;  4QVD A;  3RKW A;  3S3O A;  2XU8 A;  3SD4 A;  3I56 A;  4M78 F;  2ZPH B;  3NTK A;  4E7I A;  2DXU A;  1FWZ A;  2X4Y A;  3LLR A;  3QYG B;  4OP0 A;  4EMH A;  1V29 B;  3L42 A;  2XG8 D;  2E70 A;  4OGC A;  5C6S A;  2RJF A;  3VUZ A;  5CCA A;  3CCE T;  4JRK A;  2MWO A;  5CIU A;  4C8Q D;  4OB0 B;  3M58 A;  2JNG A;  1U8R A;  3M56 A;  1S72 A;  2DXB A;  1VQ8 A;  3CCS A;  1JRI A;  3LYI A;  3I55 A;  5A0G A;  2ZPE B;  3RES A;  2RHZ A;  3RMS A;  4ZGJ B;  3CBO A;  3CCR T;  2DAQ A;  2JOY A;  3LGL A;  4D6W A;  3MEA A;  5GAM d;  3OW2 A;  1FX7 A;  4O5V A;  5GAN h;  1VQO A;  5FRM A;  5GMK m;  3EFS A;  3CC7 A;  3UDC A;  4B9W A;  3DKM A;  3CMA A;  1M9S A;  1BI2 A;  2Y90 A;  3E19 A;  1NE8 A;  2DEQ A;  4C92 A;  5A0L A;  1VIE A;  3MO8 A;  2YHT A;  2ZPG B;  4ZN1 A;  4EMK B;  1JJ2 S;  1UEB A;  2RI5 A;  4MZT A;  3OYC A;  1I4K 1;  2QXF A;  2FVU A;  2VYT A;  2DO3 A;  4M75 E;  3OW2 S;  4ZTJ A;  1GXI E;  1UB4 A;  3CCM T;  1DJ7 B;  3GNG A;  1WJS A;  3M53 A;  4BD3 A;  5KCO A;  4X9C A;  1LOJ A;  1KHC A;  3CC4 A;  1X75 C;  1QP2 A;  3LWH A;  3SWN A;  3JCM P;  3JCM Q;  4M7D B;  4KT0 E;  2R5A A;  3EAE A;  4ME7 A;  4PL6 A;  4QQG A;  3X25 B;  2V8I A;  3OQ5 A;  3QDR B;  4J7I A;  1VQ9 T;  1G3S A;  2EQJ A;  1W2B A;  1QP3 A;  1KQ1 A;  3LW5 E;  5GAM f;  2Y4Y A;  5FU7 C;  3QXE B;  4A4G A;  4RCC A;  4GY5 A;  2AHJ B;  1R8O B;  3QJ6 A;  4PJO F;  1YJ9 T;  4ATO A;  3DLL A;  4C8Q G;  5GAN 2;  4IUQ A;  5GAN 3;  5FU7 B;  1XTD A;  3ZFJ A;  2FB7 A;  5CVI A;  3G6E A;  2E6N A;  1VQ6 A;  1BI1 A;  2QTX A;  4KUL A;  4BE2 A;  4IUP A;  5FLX E;  2K4Y A;  3JCM V;  4M77 D;  3HPW A;  4JS5 A;  2K5F A;  5LJ3 e;  2A3L A;  1BKB A;  4M78 C;  2VXE A;  4II1 A;  2JVV A;  3I56 T;  4LD9 K;  3QYH B;  1G3Y A;  1WJR A;  1BI3 A;  3QPH A;  5A0D A;  5M9O A;  1VUB A;  2F5K A;  2QEX A;  3JB9 D;  2C06 A;  3OS1 A;  4FU6 A;  4C0G A;  3G7Z A;  3LX7 A;  4F7U A;  2E6Z A;  2FL7 A;  5GMK h;  3OYA A;  4FT4 A;  3KBG A;  4L6V 5;  3LH0 A;  1YIT A;  2RB6 A;  3UPU A;  2P4T A;  2R58 A;  3GLX A;  2PU9 B;  1ZHI A;  3JRZ A;  1P92 A;  1VQM T;  3L2Z A;  4ZGD B;  2ZPI B;  2LVM A;  3CPF A;  3T9N A;  3VYH B;  2JUF A;  3NTI A;  3JCM e;  1BI0 A;  4O6J A;  3OYJ A;  3CCS T;  3CCV A;  3OYG A;  1XQH A;  2KQW A;  2CKK A;  3BDL A;  5GAN g;  3I55 T;  4NS5 A;  2EQK A;  3JCM c;  3OYF A;  1VQO T;  4PKC C;  1KG1 A;  2XID A;  2CGH A;  1OI1 A;  3WVD B;  4OVA A;  4M78 D;  2DD4 A;  4HKE A;  2OTJ A;  5GAO n;  4E7J A;  2L5Q A;  2PQW A;  1N6A A;  2XK0 A;  3OSV A;  4BAC A;  4UC4 A;  4JUV A;  3TEE A;  3QO3 A;  2WSE E;  3MET A;  4M75 B;  2LT4 A;  4JLI A;  3E9G A;  2WSC E;  5GAN j;  3CC2 A;  1G3W A;  4JRP A;  3X20 B;  5FU6 C;  1VQL A;  2EJ9 A;  4EMK A;  3OB9 A;  2BKD N;  2MF2 A;  4PLI A;  1JB0 E;  3SFM A;  4WF2 A;  3A8M B;  4L59 A;  2DIG A;  4M77 G;  1YIJ A;  3P8B B;  2RJD A;  2RK1 A;  3FB9 A;  5LJ5 d;  3G4S A;  3CEY A;  4J6Y A;  1VQ4 A;  4E7H A;  5CKD A;  4V2S A;  1Y07 A;  4MZM A;  4ELY C;  3CXC S;  4C8Q E;  2K2V A;  5CKB A;  3E1S A;  3KUF A;  2WSF E;  4QVZ A;  3FIF A;  4YTL A;  3ZEH A;  5KE3 A;  3QUI A;  2D6F A;  1OZ3 A;  4ELZ C;  5IN1 A;  1BYM A;  3ASK A;  4HCZ A;  1VQK A;  1PSE A;  3OYL A;  2RJC A;  4CI0 C;  3G6E T;  5FRN A;  1O75 A;  1NJI C;  3N5B B;  4C92 F;  3UWN A;  1OYX A;  4DOW A;  5D6X A;  3C4S A;  3JSC A;  3C94 A;  5HKC A;  2KSS A;  1YJN A;  4OMF B;  2BUD A;  4OB1 B;  2PUO B;  2CZ7 B;  2CZ0 B;  2K3Y A;  2XDD A;  4XAX B;  2WAC A;  5FRO A;  3FC3 A;  4Y28 E;  3TRE A;  4M78 G;  2XIC A;  1IRE B;  2G3R A;  1NJI U;  3S3N A;  1VQP T;  1RI0 A;  1RL2 A;  1YIT T;  5LJ5 f;  4E7K A;  3HRS A;  4PJO D;  2CYZ B;  2XHC A;  1B34 B;  4FL6 A;  4BE1 A;  3CBM A;  3MEW A;  2JZ2 A;  2D9T A;  2RH2 A;  2E65 A;  2JTF A;  3M57 A;  3CCV T;  1O9S A;  5DLO A;  1I8F A;  2RK2 A;  2MMP A;  2HQX A;  3PNW C;  3RKX A;  1KQS S;  1JJ2 A;  5GMK j;  2IG0 A;  3VUB A;  5CO7 A;  2E1H A;  4MDX A;  1LJO A;  3ME9 A;  2EQU A;  2LCC A;  4FSX A;  2A7Y A;  2R57 A;  4JRI A;  1U1T A;  5GAM e;  1YI2 A;  2VGN A;  5GAN 8;  2V8K A;  3M54 A;  2LQ8 A;  3GF5 A;  2QA4 T;  5LJ3 h;  4C5G A;  2VUB A;  1YJW T;  2CS7 A;  2E10 A;  1Q86 C;  3L2W A;  1VQ7 A;  4DA4 A;  3CPW S;  4XTZ A;  2M9U A;  4PLL A;  3CC2 T;  4F7U F;  4Y91 A;  2EAY A;  3RMQ A;  4DQ2 A;  4M77 E;  4ZTF A;  3ZBD A;  1KC8 C;  4M75 A;  3M9Q A;  3V7C A;  1Q86 U;  4C8Q C;  3JCM h;  1HXD A;  3Q1J A;  2IVW A;  2LTO A;  3URG A;  2XI9 A;  4XTY A;  3G4S T;  2K3X A;  4C8Q B;  4MDW A;  4M7A E;  2QQA A;  1KC8 U;  5GAO p;  2OTL T;  1WPY A;  3MP8 A;  1NZ9 A;  2XDP A;  4JS4 A;  3A8H B;  2RO0 A;  2HQE A;  2YRV A;  4B9X A;  3F70 A;  3PMI A;  2ZCF B;  1YJN T;  1QVF S;  4XTU A;  1KQ2 A;  2M16 A;  4M78 E;  1UGQ B;  3BW1 A;  2ZPF B;  5CKE A;  3FEO A;  3CCU A;  2DZ9 A;  3A8G B;  2DTI A;  1BIA A;  1OZ2 A;  4J6X A;  5CR2 A;  4N0A C;  3OYK A;  1VQ5 A;  1M90 C;  4MML A;  1VQN A;  4VUB A;  3RER A;  4IUV A;  3P8H A;  2EIF A;  5L8R E;  3H6Z A;  3MP6 A;  3VKI A;  2M1H A;  1YBY A;  3VV0 A;  4A4K A;  3O8V A;  5EG2 A;  4C5H A;  3G71 A;  3CME A;  5CKF A;  1LNX A;  4C92 D;  4IUU A;  1EIF A;  3L1A A;  4N4I A;  3FRN A;  4J7F A;  1M1K C;  3OSS C;  5I2M A;  5GAO l;  3OYB A;  4XTV A;  1S72 T;  4M7D F;  1QW1 A;  3CCJ A;  4HT9 A;  1VQ8 T;  2B8A A;  1M90 U;  1B34 A;  3CD6 A;  3DB4 A;  3C95 A;  5KH6 A;  5GAN d;  4FT2 A;  4IUR A;  3SDZ A;  2HAX A;  2MWP A;  4BB7 A;  4HCC A;  3QG1 A;  4HCB A;  5LJ3 g;  3RIR A;  2P0P A;  3OYD A;  4PNO A;  3CC7 T;  3CMA T;  4JDS A;  3V8L A;  1M1K U;  2DKG A;  1KD1 C;  4XK8 E;  5CQY A;  4M77 C;  4XU1 A;  1VQ7 T;  4OB2 B;  3L2R A;  2X4W A;  1XNI A;  4M77 B;  4LD6 A;  3DLM A;  2DJZ A;  3X26 B;  3CXC A;  3QII A;  3JCM g;  1G3T A;  2H3J A;  2YLC A;  2X35 A;  3V7R A;  4RMO A;  3CCL A;  5I2S A;  3KXT A;  4R56 A;  3PIP A;  2EYQ A;  3HRT A;  1KD1 U;  5LJ3 j;  2PVO B;  1BIB A;  1WQW A;  3CC4 T;  4XQ3 A;  4M7A C;  5FU6 B;  2O01 E;  4NOY A;  2HD0 A;  2VV5 A;  5LJ5 e;  5IAY A;  4A53 A;  3CCR A;  4PJO E;  3FJP A;  2KAF A;  4J8O A;  2KVQ G;  3X24 B;  5GAN f;  4M7A B;  1Q82 C;  4BUG A;  4NL2 A;  3JB9 G;  2PVD B;  3OS5 A;  4XTW A;  3JB9 I;  5GAM h;  1AHJ B;  4OGE A;  4BE0 A;  4XU2 A;  4C8Q A;  1M4Z A;  4RKU E;  1XOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...