2FRYA

Solution structure of the third sh3 domain of human nck2 adaptor protein
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
61
structure length
61
Chain Sequence
GSHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Cytoplasmic protein NCK2
publication title Structural Insight into the Binding Diversity between the Human Nck2 SH3 Domains and Proline-Rich Proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 3
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fryA00
2AKKA 2CUBA 2RF0A 2EVRA 2E5KA 4KRTA 2OAWA 2O2OA 1WXBA 5IXBA 3NPFA 4X1VA 2LJ3A 2JS2A 4J9FA 1Z9ZA 1B07A 1QWFA 1YWOA 2YT6A 2J7IA 1RLQC 2C0OA 1X43A 2AZSA 3FJ5A 2CH4A 4EIKA 2EW3A 3H41A 1T3SA 2F2WA 5IHKA 1JU5C 2EGAA 3C0CA 3QWXX 1CKBA 1M3BA 4RTUA 1GBQA 4RTTA 1UECA 1YWPA 3M0SA 2GTJA 1UJYA 1ABQA 2FPDA 2KEAA 4OMPA 4D8KA 3RNJA 2JW4A 1M8MA 1H3HA 1UG1A 2DYBA 2L2PA 2RN8A 1Z9QA 1BB9A 2DL3A 4K11A 1OV3A 1OEBA 2YSQA 1ZSGA 1KSWA 2AKLA 1SHGA 1T0HA 1WFWA 2D1XA 3R6NA 3VRZA 1WA7A 1K9AA 1NYGA 2HSPA 4DEYA 2QDLA 1TG0A 1PNJA 1YP5A 2D0NA 4J9GA 5EC7A 3QWYA 4RTYA 2L3SA 2L0AA 1GFCA 1AZGB 2K2MA 1AEYA 4OMQA 4HCKA 4JPBW 2OI3A 4LN2A 1SEMA 2C0TA 4F16A 1WI7A 3TSWA 1BBZA 2J6FA 1KJWA 1YN8A 4OMLA 2KE9A 3EHQA 4Z88A 4ZNXA 4AFSC 2LNHB 4WCIA 2SRCA 3KFVA 4R0KA 4CC2A 1W1FA 1PRLC 2EGCA 4JZ3A 1N5ZA 1QKWA 1UUEA 1WLPB 2EYZA 3REAB 4HXJA 1CSKA 2V1RA 3NHNA 1H8KA 1NEBA 2LQWA 2C0IA 4GLMA 2CDTA 1AD5A 4ORZA 2K6DA 2ECZA 1V1CA 2L3QA 2HDAA 2DBKA 2RMOA 2LZ6B 1YNZA 2YUPA 1GFDA 5L23A 1NLPC 2GBQA 1X2KA 2CT3A 2DE0X 2ESWA 3ZL7C 2VVKA 1AWOA 3O5ZA 1K0XA 3H0FA 1X27A 2LX7A 1WDXA 4HVVA 4JZ4A 4J9EA 2K79A 2F2XA 3M0QA 1UHCA 2I0NA 1GCQC 1ARKA 2MCNA 3LH5A 4AFQC 2DX1A 3I9QA 2ENMA 3PVQA 2PTKA 1W6XA 2KNBB 3UA6A 1AWXA 2LMJA 2YUQA 1BK2A 1KIKA 2O9VA 1CKAA 1I0CA 2EPDA 1X69A 1NYFA 1UE9A 2DF6A 1X6BA 2V1QA 4OMNA 4OMOA 3M0RA 2RQVA 3EG3A 4RTZA 1E6GA 2JM9A 2NUZA 3TVTA 1OPLA 4IIOA 4AG1C 2O31A 2A08A 2CUDA 1HSQA 2PZ1A 2SEMA 1Y0MA 2MOXA 1RLPC 1QWEA 1JEGA 2B86A 2FPEA 1AWJA 2KRSA 2VKNA 2RQUA 2D8HA 1GRIA 2RQRA 3PE0A 2JM8A 4M4ZA 2F2VA 4CC4B 1QKXA 2J06A 3VS4A 3VS1A 3M0TA 2A28A 3I5SA 5ECAA 2HEQA 3GBQA 3THKA 2FG0A 1M30A 1NM7A 1NEGA 1QCFA 1LCKA 2O88A 4LUDA 1BU1A 2BTTA 2XMFA 1MUZA 4LUEA 2JT4A 1K1ZA 1FMKA 2J6KA 4A63B 2EYWA 1JXMA 2EYXA 2VWFA 1WX6A 1G2BA 3UATA 3ULRB 1ZUKA 3I5RA 2M0YA 4RTWA 2DA9A 1SRMA 2K7AA 2LJ0A 3EG1A 3VS6A 1E6HA 1VYUA 3VS0A 1MV0B 2BZXA 1TUCA 5FWBA 4LNPA 5I11A 5I22A 4Z8AA 2G6FX 2CH4W 1PKTA 2GTOA 4FSSA 4J9IA 2EQIA 3TSZA 3UF4A 1UDLA 1WIEA 1YCSB 1AWWA 1FYNA 1B3QA 2JMCA 2MIOA 4CC7A 1S1NA 5GJWB 1ZBJA 1I1JA 1ZUUA 2DL7A 1WYXA 1W70A 3NMZC 2RNAA 2LQNA 2RQWA 4D8DA 2IIMA 2JXBA 2O9SA 4J9BA 4Y92A 4F17A 1K0SA 1SSHA 1SHFA 3VS7A 3H0IA 4AG2C 1VA7A 1PWTA 1GL5A 1ZUYA 2EKHA 1OPKA 2D8JA 2JMAA 2KBTA 1PHTA 5IHIA 1HD3A 4E6RA 2AZVA 2FRWA 2L3PA 1GCQA 1JQQA 2KYMA 2LCSA 1U3OA 2FPFA 2JS0A 3A98A 4JJBA 4HVUA 2HCKA 2EYYA 3CQTA 1OOTA 2H8HA 4ESRA 2ROTA 2EBPA 2CT4A 3VS2A 1JXOA 1MV3A 2EGEA 2KT1A 3VS3A 1A0NB 2DILA 3PVLA 3UA7A 2LP5A 3VS5A 1VYTA 2CSQA 1SRLA 1WXUA 1AVZC 1M27C 5FW9A 2M51A 2ABLA 4F14A 3I35A 3IQLA 1PRMC 1E7OA 1UGVA 4J9DA 2X3XD 3NGPA 1NLOC 1EFNA 2A36A 3EG2A 5GJVB 2FO0A 1U06A 2DRMA 1SPKA 3VRYA 3M0PA 2J05A 3RBBB 1IO6A 3REBB 3EHRA 4J9HA 2OJ2A 1T0JA 1K76A 5HCKA 2KROA 1PKSA 4DEXA 2AK5A 1GCPA 1I07A 4RUGA 4OMMA 2K9GA 1Y57A 1UFFA 2YDLA 2P4RA 1RUWA 1RI9A 2RQTA 1TUDA 1VYVA 1GBRA 4IIMA 2YUOA 2KRMA 1X2QA 4CC3A 2KYBA 2W0ZA 2GNCA 4JJDA 2JTEA 2FRYA 2DL8A 1K4US 2LJ1A 1JO8A 2KGTA 2DL5A 4J9CA 4AFZC 2KT8A 1AOJA 1QLYA 1UTIA 2DJQA 2PNIA 2BZYA 2ED1A 4Z89A 2HBWA 5FWCA 2GQIA 1H92A 2ED0A 2ROLA 3JV3A 4HVWA 4RTVA 1NG2A 1UJ0A 1UHFA 2CREA 2X3WD 3H0HA 4GBQA 3SHWA 3EGUA 2KR3A 2KRNA 4RTXA 2A37A 1XOVA 2DVJA 3EG0A 1ABOA 2DL4A 2DNUA 5IXFA 1G83A 1J3TA 2DM1A 2YUNA 2GGRA 5IHNA 4LE9A 2DLPA 1WXTA 1U5SA 1X6GA 1HJDA 1M3AA 2DBMA 3M0UA 2FEIA 2CSIA 2W10A 4JJCA 4QT7A 1ZX6A 2DRKA 1T3LA 2NWMA 2J6OA 2K3BA 3U23A 1KFZA 2KXCA 3SEMA 5IH2A 2KXDA 2DMOA 4AFUC 2BZ8A 1ZLMA 1M3CA 2RPNA 1AZEA
chains in the Genus database with same CATH superfamily
4OGCA 2AKKA 2OTLQ 5LJ3j 3PGGA 5IXBA 4E7KA 4X1VA 2LJ3A 3RERA 3I55T 2GCXA 3DLMA 4II1A 3G71A 1IHVA 2DIGA 1QWFA 1YWOA 2E3HA 3FLGA 3ZFJA 3EGXA 4MZPA 1X43A 2E64A 2AIRB 5J26A 2YHTA 3CCMQ 2CP0A 4EMHA 3E19A 3H41A 1QVFS 4BB7A 1JU5C 1UGRB 2NUPB 3C0CA 4PJOC 3QWXX 2MMPA 1M3BA 2RI3A 2PVOB 2QDYB 2E10A 2XK0A 3GF5A 4RTTA 1UECA 3M0SA 3X28B 2BE7D 1N27A 3RNJA 2XHCA 4QVDA 1H3HA 1UG1A 2RH2A 2D6FA 4M7AE 5GANe 1M1FA 4PJOB 1XTDA 1SHGA 1PD0A 2DTHA 5M9OA 1Q7YU 3RIRA 1MNDA 2X4WA 2R57A 2WSCE 3QZ9B 2V26A 5KYUA 2QDLA 1TG0A 3L2ZA 3QWYA 2EQJA 3A8MB 1AZGB 2CGHA 2K2MA 3JCMe 4PFOA 4OMQA 2OI3A 5GAOq 3CCLT 2QXFA 1BBZA 5GANh 1KJWA 1YN8A 4HT9A 2E41A 2KE9A 1QP2A 4Z88A 4ZNXA 4AFSC 3MKDA 1FMVA 1I81A 3KFVA 3CMEQ 1BCOA 2QI2A 2A7YA 4JDSA 5DLOA 5CKDA 3CC2T 1IRXA 2JN0A 2X4YA 4C8QC 2COWA 3NHNA 2RB6A 4J6XA 1PG5B 2EJGA 2OTJQ 2VC8A 4GLMA 2L3RA 4R56A 2CDTA 4KGZB 1VQ6Q 3JCMh 1QVGA 2BUDA 2DBKA 3RKWA 4PJOF 4XTUA 4C8QB 1D3BA 5L23A 2X4JA 4JRQA 1X2KA 5CQXA 4IURA 2VGMA 2AT1B 4J6YA 5CKFA 3FEOA 3ZL7C 4TVRA 1YHQA 3H0FA 4RMOA 1VQMA 3NTHA 1WDXA 4GLKA 2QA4Q 2F2XA 5AYFA 1UHCA 2H3JA 3CCST 1YI2T 4OVAA 3BDLA 4KGVB 3WVDB 4QQGA 4LD6A 2DZCA 4KUIA 2QG9B 1KC8C 4KBMB 4ZTJA 4IKFA 1I5OB 3PFSA 2DF6A 1BI3A 4PJOD 3QZ5B 3M0RA 2LCCA 3CCRQ 5GAOm 3PIPA 3EFOA 3CBMA 2DETA 4PJOA 3TVTA 1N9RA 3QKJA 4C0GA 1M2VB 2CUDA 3E1SA 4FYYB 2FVUA 3OYCA 4BD3A 3PT9A 3EGDB 2DXBA 5EG2A 3A5ZB 4C8QF 3V8KA 2DIQA 1Q86U 2VKNA 4J8OA 1DJ7B 4C92G 3CXCA 1LOJA 5GAOp 4CC4B 3KXTA 3G6ET 5GMKm 4BI4A 3VS1A 3EG9B 4QVCA 3M0TA 5KYXA 2PUOB 4PKCC 1RAHB 3I5SA 4KH1B 3GBQA 2IPOB 2FG0A 1NEGA 3JB9H 1BU1A 2JT4A 3OW2A 2J6KA 1VQ7A 4A63B 2RJCA 2EYXA 3CCQA 2ZPEB 2FZKB 3I5RA 4WF2A 2LJ0A 2HQHA 3VS6A 4C8QD 3DB4A 2BZXA 4FL6A 3DLLA 1TUCA 1N9SA 4LNPA 2WACA 4C8QA 3I55A 1YJ9T 4J9IA 1TUGB 2EQIA 1UDLA 4LDWA 1WIEA 3SFMA 3JCMW 1OU8A 5LJ3d 4M7AA 4Q5WA 1S1NA 2VUBA 2RHUA 5A0LA 3MEUA 2IVWA 1KD1U 3RESA 1ZBJA 1UEBA 2DL7A 1WYXA 2HMAA 3NMZC 2RNAA 2LQNA 4BI3A 2XDDA 2RQWA 2IIMA 4J7IA 4XTWA 5GAN5 1YIJQ 1G3TA 2RHIA 1SSHA 1K0SA 3FDRA 1SHFA 2YWWA 1VA7A 3LWHA 1GL5A 4B9WA 1PHTA 2O01E 1SG5A 4M78G 3X26B 1W4SA 5FROA 2AZVA 2DXTA 2L3PA 2E70A 5KYWA 4L6V5 2QK0A 2JS0A 4PJNA 1SSFA 4E7JA 2EYYA 1M2VA 2H8HA 4ESRA 3FRNA 1Q82U 2X35A 3P8DA 1ZHIA 3S3MA 4M7DD 1JXOA 1P92A 3PVLA 1VQNQ 3UA7A 2RK2A 4M7DA 3CCLA 1IGUA 1D09B 2HQEA 2XI9A 1QVPA 3CCVQ 1WXUA 2M51A 1M4ZA 5D7UA 4ATOA 3META 2X3XD 1U1TA 4FYVB 2A36A 1VQ8T 5CAIA 1JB0E 2GQVA 3CC2A 3CCUT 1SPKA 2L5QA 3VRYA 3M0PA 3J7AF 5C6SA 3EHRA 4J9HA 1T0JA 4PJOG 1PKSA 2AK5A 1GCPA 2A3LA 2K9GA 1UFFA 1EZZB 2GFUA 2P4RA 5CQYA 3V7RA 5GAN8 2RQTA 2QQSA 1B7TA 1X2QA 2QQRA 2W0ZA 4E7HA 1RAGB 2LRQA 1YFNA 5GAMg 1PSFA 2QTVA 1KC8R 2FRYA 2DL8A 3C12A 2LJ1A 1QCNA 3JSCA 4AFZC 4J9CA 3OBWA 4V2SA 1AOJA 1QLYA 2ZPFB 3CCSA 2DJQA 5GAN6 4NL2A 1YI2A 2PNIA 5KH6A 1MMGA 4DBQA 1FXXA 2M16A 2CS7A 2ROLA 1NJIC 2FB7A 1S72T 2QEXT 4RG2A 1YJNT 4ME7A 1Y7XA 1UJ0A 1Q81U 5GAOn 2X3WD 3H0HA 2WSEE 3EGUA 3OSVA 2HQXA 1KG1A 1O75A 5HK0A 5IXFA 1G83A 3M53A 2DM1A 2YUNA 2RHXA 1TTHB 4C5EA 4RCBA 1X6GA 1IREB 4C8QG 3OYIA 2DBMA 5I2SA 4CI0C 2CSIA 2X9HA 4HCCA 1ZX6A 2NWMA 2K3BA 2E6ZA 2KXCA 5IH2A 3QJYA 2KXDA 4KH0B 3G4SQ 3HP9A 3M55A 2MI6A 5D6XA 3TREA 3G6EA 3JCMJ 2E5KA 1RAFB 2O2OA 1WXBA 3NPFA 2JS2A 4EPCA 4J9FA 2MPXC 3QBYA 1NBEB 3QUIA 4XAXB 4C92C 2YT6A 5GAN7 1M1KC 4XTXA 2XKOC 1OQKA 2AZSA 4FU6A 3FJ5A 3CD6Q 2EW3A 2PVGB 2LQ8A 2F2WA 1WJQA 2VB6A 1X01A 4J7FA 1CKBA 1VIEA 3PMIA 4C92B 1MNEA 1OZ3A 1TXQA 2GTJA 1UJYA 5LJ5g 2FPDA 4PK4A 2VV5A 2B8AA 1ACMB 5I2MA 4ZN3A 3C95A 1ZBXA 1TU0B 1YJ9A 3OYLA 2ATCB 4RCCA 4IUPA 2YSQA 1ZSGA 3CCJQ 1N8RC 1KSWA 1K8AC 1YJWQ 2MYSA 4OGEA 2LDMA 1WFWA 2D1XA 2P0KA 1OU9A 3VRZA 5GMKl 2KVQG 1MGQA 4XK8E 4X9DA 4J9GA 4N4HA 5A0GA 2F69A 2L3SA 5GMKe 2YRVA 3CMAT 2YLCA 4RKUE 1AEYA 3I56T 4IUTA 1R0CB 1VQ9Q 2QGFB 2P0QA 5DLQE 2EWNA 4F16A 2EYQA 4J6WA 2LVMA 3EHQA 3CPFA 4R0KA 3VUZA 1W1FA 1PRLC 2MAMA 1N5ZA 1QKWA 1UUEA 1WLPB 2EYZA 3REAB 2V1RA 1M8VA 4C92F 3JB9G 4PJOE 1QVGS 2HL3A 1H8KA 1NEBA 3MP8A 2VXFA 4DBHA 5GMKh 1ZA2B 3OYEA 2K6DA 2L3QA 1VQ5Q 1VQPT 2DEQA 3QHSA 2RMOA 2LZ6B 5GAMf 4XU1A 4BE1A 2YUPA 2R58A 1NLPC 2NLUA 4N0AA 1VQOQ 2ESWA 1BCMA 2IG0A 3O5ZA 1VQ8A 2E65A 3JCMP 3CCUA 3CXCP 1VQ4T 3GNGA 3OYHA 3M0QA 2OTLT 2I0NA 2K3YA 4L59A 3OBYA 3CC7Q 2MCNA 2DX1A 4C92D 1I8FA 1W6XA 1G5VA 4AT1B 2LMJA 2YUQA 1BK2A 2YRDA 4C92A 2XICA 1B34B 1CKAA 1I0CA 2EPDA 3MHXA 3QO3A 3RDVA 3CCMT 1X69A 1UE9A 1X6BA 5GANd 1BIBA 2NYSA 2K4YA 3OW2P 5A2QE 2V8KA 3ZBDA 3GNFB 4E7ZA 2JM9A 4C8QE 1BI0A 2JJ9A 4AG1C 2LTOA 5CCAA 2A08A 3QDRB 4OB0B 3JB9J 2MOXA 3A8OB 2XDBA 1QWEA 3MEAA 2FPEA 4F7UB 3X24B 1R0BG 1VQLQ 1X75C 1K73U 2JM8A 1S72A 2QEXA 2F2VA 1YJNA 3JCMd 4M78F 4A53A 3OMCA 1VQKQ 4A54A 5DY9A 3QPHA 3MO8A 5FLXE 3OW2S 5ECAA 3THKA 5KCOA 1QCFA 2RHYA 4A4GA 2E4HA 2RJFA 1MUZA 1M1KR 1FMKA 5LJ5f 3F70A 3HPWA 4GY5A 3SB2A 1JXMA 2VWFA 3UATA 1ZUKA 2DA9A 3EG1A 2KY9A 2NUTB 5KYYB 1E6HA 1VYUA 3VS0A 3EAEA 3CMET 2KQWA 3GPLA 4JJNK 2DXCA 5I22A 4Z8AA 2G6FX 1OULA 3CC4Q 4LXCA 2DERA 2GTOA 4FSSA 4M7DE 4BUGA 4M78D 3TSZA 2O4XA 2ZZDA 3UF4A 3TEEA 2DTOA 1YCSB 1AWWA 4L5GA 1B3QA 1QQJA 2JMCA 2OTJT 4M78A 4CC7A 2EIFA 1RACB 1N8RR 3X20B 1VQ6T 2HD0A 4E7IA 4EMKA 4AMCA 1ZUUA 4O5VA 1W70A 3GLXA 1WHKA 4JRKA 1H641 4D8DA 4J9BA 2Z0WA 4F17A 2BKDN 3MEWA 1RAAB 4AG2C 2YRCA 3R6OA 1WNLA 4IUVA 3QIIA 2KBTA 1TWBA 2CYZB 1HD3A 4FIBA 4JRPA 1YITQ 1B34A 2QA4T 1RADB 4FM4B 2LCSA 2KYMA 1U3OA 2NUPA 4KT0E 5A0DA 2FPFA 5GAMh 1G8XA 1R8OB 4N4IA 3CQTA 1RAIB 2CT4A 2DTIA 3CMAA 1C1AA 1MV3A 2EGEA 2JOYA 3VS3A 3I56A 3C4SA 3PNWC 3CCRT 1VYTA 1Y96B 3V7CA 1Q86C 5HKCA 2PUKB 3M57A 3D7SB 2CSQA 2CZ6B 3BE3A 4B9XA 2ZPIB 4FW2A 1M27C 2ABLA 3OA6A 3FIFA 3NGPA 1M90R 3HHTB 2JTFA 3V8LA 5GJVB 3UDCA 2DRMA 1KC8U 3RBBB 3REBB 4A4EA 5HCKA 1K76A 2ZCFB 1EX4A 5HY6A 4RUGA 4OMMA 3TQ7P 3BDUA 2YDLA 2GFAA 1VQPA 2DFUA 1LJOA 4IUQA 5LL6S 2C06A 1TUDA 2CKKA 4IIMA 4PJJA 5GAN3 4CC3A 1VIFA 1H3ZA 4QW2A 4JJDA 1OX8A 3A1PA 3OS5A 9ATCB 2VGNA 4DQ2A 2LX9A 1JO8A 2KGTA 2LC4A 2HSEB 3L42A 1VQ4A 2CP5A 8ATCB 5GAN4 2ZPGB 4KULA 1UTIA 2OTLA 6AT1B 3J80E 2BIVA 2BZYA 1JBMA 1KD1C 1WQWA 1PCXA 2ED1A 2QTXA 2GQIA 2ED0A 3AHUA 2CP2A 4HVWA 4RTVA 4A4FA 3CEYA 4RTXA 1D0YA 3CCMA 5LJ5h 1XOVA 2V8JA 3EG0A 2DNUA 5CR2A 3OQ5A 2K3XA 4C5IA 3RMQA 2RI5A 1YIJT 1WQ7A 1KQ2A 2KDSA 5L8RE 3M0UA 1U8RA 4DBRA 4PL6A 1KQSP 2CP3A 1T3LA 3SEMA 1Q82C 4C0ZA 3V7SA 2RF0A 4KRTA 2PVDB 5FRNA 3M5AA 3QJ6A 1B07A 2YXYA 3EGDA 4ELYC 3JB9F 1WHHA 2J7IA 1RLQC 2C0OA 3CPWA 2CH4A 1KK7A 1VQNT 2KI7A 3HKSA 1MMAA 3EFRA 5IHKA 3CCVT 2DJZA 1UGPB 3EFSA 1LPLA 2EGAA 3UWNA 3EG9A 4ZN1A 3M54A 5LJ3h 1V76A 1GBQA 3MP1A 1YWPA 2K2VA 1ABQA 2KMTA 2KEAA 2F1LA 4D8KA 3CMEA 2JW4A 1M8MA 2QQBA 2E12A 2DYBA 2HKQB 4PFZA 1Z9QA 3CCEQ 4MDWA 3TU4K 1OV3A 4F7UG 3MPUB 2DKGA 2AKLA 2OTJA 5GANj 4XTZA 3S3OA 1NYGA 2HSPA 4DEYA 3MEVA 3G71Q 4JLGA 3JB9D 1PNJA 1YP5A 1YBYA 3Q1JA 3M59A 3FB9A 2JVVA 2QASA 4VUBA 1GFCA 3OS1A 3H9NA 3L2RA 1W2BP 4HCKA 3FC3A 1K9MC 3NTIA 4LN2A 3L2WA 3AT1B 3TSWA 1Q86R 4OMLA 4BE0A 1WHJA 2QA4A 4C92E 1XNIA 2LNHB 4WCIA 4OP0A 4NL3A 1D0XA 7AT1B 2E1HA 3OYFA 2ZGWA 4MZTA 2EGCA 4PLIA 2QYZA 2LQWA 1I4K1 5CVIA 2EJFA 3BY7A 1AD5A 1JJ2P 1HXDA 2Y90A 3CCRA 4X9CA 2LT4A 3JCMX 1XQHA 3VYHB 1RAEB 1GFDA 2GBQA 3EH2A 2CT3A 1NZ9A 5IT9E 1NE8A 4XU0A 2VVKA 4HKEA 1K0XA 1VOMA 4M77C 2F5KA 4KUDK 3G4ST 2QQAA 4HVVA 2L89A 4JZ4A 4YTLA 2K79A 4D6WA 1QMCA 4HA8A 4ZTFA 2QGGA 2EQKA 3LH5A 3H8ZA 5HK3A 2RD1A 2COZA 3PVQA 1LVKA 4M77B 3UA6A 2FYKA 2KNBB 1AWXA 3C94A 3OYGA 1KIKA 1WZOA 1LNXA 2ZPHB 3CD6T 5GAOl 1NYFA 4OMNA 1VUBA 4OMOA 2RQVA 3ER0A 4UC4A 3EG3A 1E6GA 1WPYA 3OYDA 5CKEA 2NUZA 3L1AA 1KQSA 3OYBA 1OPLA 4IIOA 2D9TA 2Y4XA 1HSQA 2PZ1A 2SEMA 3VUBA 4M78E 4DA4A 4PFPA 2FZCB 1YHQQ 1JEGA 2B86A 3EGXB 3V8JA 2CZ1B 2QAZA 1VQMQ 2KRSA 3LW5E 2D8HA 1GRIA 4PLLA 2RQRA 1OI1A 3CCJT 3MCAB 4NOYA 1C6VX 1YJWT 3PMTA 3QYGB 4XTVA 4Y28E 4BDYA 3VS4A 1ZSZC 3QYHB 3E9GA 4JUVA 2A28A 5D6YA 4HCBA 2EJ9A 3BW1A 1YIJA 2HEQA 4JS4A 1LCKA 4LUDA 3JRZA 2XMFA 4LUEA 1ZSZB 1VQ9T 4M77F 2CP7A 2AHJB 1WX6A 5KCHA 1G2BA 4X34A 3ULRB 2M0YA 2G3RA 3UT1A 3LYIA 3GP8A 4C5GA 1MV0B 2OAUA 1M2OA 5LJ3g 3OYJA 5FWBA 5I11A 5C0MA 3HRSA 2XU8A 3HTRA 4J83A 2LQKA 2MWPA 3KUFA 2RM4A 4ZGDB 3EH1A 3VJPA 5GJWB 1VQ5T 1VQNA 4ZGJB 5I21A 4MMKA 1MMDA 3CCVA 1BI2A 1O9SA 2O9SA 1W2BA 4M75C 1VQOT 3VS7A 3H0IA 4M77D 2RK1A 2D0QB 2EKHA 1OPKA 2D8JA 2A0FB 4M77A 1VQ7Q 1QVFP 2DPPB 1K9MR 4XQ3A 3CCQQ 1BKBA 4M75B 2DZ9A 1JQQA 4FYWB 3CC7T 4HT8A 1D3BB 2LNVA 4B6MA 1M90U 4J5YA 1NJIR 3A98A 4JJBA 5CK9A 4HVUA 3I55Q 1JJ2A 2HCKA 1OOTA 1FWZA 2ROTA 1YCYA 2EBPA 4PJMA 3TCJA 4BI8B 3M58A 1SKUB 2DILA 3VS5A 5IN1A 4EMGA 2MWOA 4JRIA 1Q7YC 3CXCS 1SRLA 1K73C 4A4KA 5FW9A 1OZ2A 4F14A 3I35A 1PRMC 1NLOC 1EFNA 2RJDA 1U06A 5CKHA 4BACA 1VQLT 2J05A 1IO6A 2X51A 2OJ2A 1VQKT 3EFOB 2KROA 4DEXA 5D6WA 1ZSZA 1I07A 3WXMB 1Y57A 4XU2A 1IXDA 1MHNA 1TSFA 4ANJA 1RUWA 4M75F 5FU6C 1VYVA 2VXEA 3QXEB 1NPRA 3LGFA 2YUOA 1BYMA 2FZGB 2JTMA 2JTEA 2I2LA 3H6ZA 3CCLQ 1K4US 3G4SA 2K5FA 5FU6B 1WHMA 1EIFA 2BE9B 3OB9A 5KYXB 5GAMd 2CP6A 2HNIA 4Z89A 5FWCA 4C0DC 3CC4T 3CC2Q 4FW1A 2HAXA 3BFMA 1NG2A 3S3NA 2X4XA 1K8AR 5GAMe 2V8IA 2M02A 4F7UF 1NPPA 4GBQA 2XG8D 3SHWA 2KRNA 3RKXA 3CPWP 3CD6A 2A37A 2DVJA 1C0MA 4M75D 4C0DB 4M7AC 1J3TA 1FX7A 5GMKi 2XIDA 2DLPA 4M75A 2E6NA 2ZAEA 5KE2A 1D1CA 1HJDA 4NS5A 1M3AA 3OY9A 2XDPA 2W10A 4QT7A 2MK5A 3ME9A 4M7AB 3NTKA 5LJ3f 2DMOA 1M5Q1 2DD4A 4AFUC 1YITT 2RPNA 1KHIA 1M3CA 1ZLMA 2RA2A 1AZEA 1RABB 4E47A 3CCJA 1FMWA 3NFCA 2CUBA 3CCSQ 1YI2Q 2FHDA 1IGQA 1YJWA 2EVRA 1PM3A 3OS0A 2OAWA 3OYNA 1BIAA 1D1AA 4CRIA 3LLRA 3CPWS 2YLBA 2RHZA 1Z9ZA 4C5HA 4M77G 2XD0A 3OS2A 3A8HB 1GXIE 2DD5A 4F7UA 2K57A 1PC0A 4HCZA 4EIKA 1VQ9A 1T3SA 2EQUA 4E7LA 5KYWB 2LT1A 4RTUA 3LWIA 2KSSA 4M7DC 1QVFA 4OB1B 2HL5C 2EKOA 4OMPA 1AT1B 3PIOA 2L2PA 4FT4A 5FU7C 2RN8A 1IHWA 1UB4A 1BB9A 2DL3A 4K11A 5LJ5d 2COYA 1OEBA 3VU3C 4R55A 4M7DB 1U1SA 3P8BB 1T0HA 3G6EQ 1PSEA 3R6NA 1VQ5A 4M7AF 3GOXA 3SDZA 1WA7A 1K9AA 5FRMA 2NUTA 5KYYA 5FU7B 5LJ5e 2HKNA 3HFOA 2D0NA 5EC7A 4RTYA 3VKIA 2DAQA 5IAYA 2L0AA 1Y71A 5J3BA 2PQWA 1VQOA 4Y91A 3O8VA 1D0ZA 4LD9K 4JPBW 4P5NA 5GMKj 2EQMA 3OYMA 1SEMA 2C0TA 4FSXA 3WVEB 3FJPA 1WI7A 2J6FA 1Q7YR 3M4GA 1K73R 4LDUA 2SRCA 3CC7A 4CC2A 3URGA 2L8DA 4MMLA 2P4TA 4JZ3A 3MJXA 3S6WA 4HXJA 1CSKA 1YJ9Q 1OYXA 3SD4A 4LDXA 1R77A 1G3YA 1RI0A 2DEUA 2C0IA 3OYKA 3DKMA 4M7AD 2VYTA 1D1BA 2K5IA 4ORZA 2ECZA 1V1CA 2HDAA 1HYOA 2DVEA 2ZPBB 1YNZA 2P84A 3HL8A 4M7DF 3SWNC 3DB3A 3JCMV 2DE0X 3PTAA 5LJ3e 1WJRA 3INZA 1AWOA 2QQ9A 1X27A 2LX7A 1WHLA 1Q95G 1VQLA 2E5QA 4J9EA 1Y96A 3SWNB 4QQ6A 4FCYA 4XTYA 1VQKA 1GCQC 1ARKA 4M75G 2EFIA 4AFQC 1SF9A 3I9QA 3GIBA 1KHCA 3T9NA 4LDYA 2ENMA 2PTKA 5J39A 5GANg 5CKBA 2OX7A 4C0FA 2O9VA 1KQSS 2V1QA 3E2UA 1OX9A 4DOWA 1IZ6A 4RTZA 4JS5A 2LCLA 4A4HA 3J81E 4E7SA 2O31A 3JCMb 4OMFB 3E9FA 1Y0MA 2RO0A 3JCMg 2E3IA 1RLPC 3OMGA 1VQ8Q 3CC4A 1AWJA 1X6OA 2RQUA 3LH0A 3CCUQ 3CCET 2DXUA 3PE0A 4M4ZA 1G3WA 1VQ6A 4PJLA 3A8GB 4QVZA 1QKXA 2J06A 1QCOA 3HRTA 4N4GA 2EAYA 3G71T 4M77E 2GF7A 3A8LB 3M9QA 1M30A 1NM7A 2PU9B 2JNGA 2O88A 2BTTA 1F1BB 1WGSA 1K1ZA 1Q81C 1XJWB 2HBPA 2EYWA 3ASKA 2HZYA 1YITA 3JCMc 1MMNA 4RTWA 1SRMA 2K7AA 4OB3B 3VV0A 2CZ7B 1UGQB 2FL7A 3LX7A 3X25B 2CH4W 1QP3A 1PKTA 2K5LA 3L2QA 3JB9I 1S72Q 1K9MU 2QEXQ 1YJNQ 4ZGEB 1FYNA 1ZQ1A 4PNOA 2MIOA 2Y4YA 2F5TX 1W2BS 1I1JA 3QDFA 3N5BB 1KQ1A 3MP6A 1NJIU 2JXBA 1BI1A 5GAMj 1TS9A 4Y92A 3SWNA 2RJEA 3JAME 3HRUA 5CIUA 4EDUA 4FT2A 1PWTA 3G1JA 3P8HA 1ZUYA 2JMAA 4N0AC 5IHIA 4M7AG 2DK3A 1V29B 3CBOA 4E6RA 2FRWA 2JZ2A 1GCQA 1KD1R 1JJ2S 3M4YA 2R5MA 4DOVA 3G7ZA 2M0OA 4BE2A 4MDXA 4IUUA 2P0PA 1WHGA 3VS2A 2M1HA 8AT1B 2KT1A 3RKYA 1A0NB 1WJSA 5AT1B 2LP5A 4E2FB 2JUFA 5GAOr 4Z02A 4OB2B 1TH7A 1AVZC 1JRIA 3IQLA 1M1KU 1E7OA 1UGVA 4J9DA 3RUXA 1Y07A 2WSFE 5KYNA 3KBGA 1UGSB 1YHQT 3EG2A 2FO0A 1M1GA 3UPUA 1VQMT 3QG1A 3OYAA 2DYIA 4XU3A 1Q82R 4M75E 5GANf 1N6AA 3CBPA 4M7DG 2MF2A 4O6JA 5CO7A 1RI9A 1ZA1B 1G3SA 1GBRA 1QVGP 3RR6A 1K8AU 1N8RU 2R5AA 3CMAQ 2KRMA 2H3EB 3HFNA 2KYBA 2GNCA 3I56Q 3L2VA 3JCMf 5LJ5j 5KYUB 2RI2A 3L2UA 2DL5A 4OF1A 2KT8A 3QSUA 2KK4A 2KAFA 3JCMQ 4ELZC 3M56A 4F7UE 3OYYA 4RG8A 3RMSA 5DM7R 5KE3A 2DO3A 4F04B 2HBWA 1H92A 4QKUA 1I5LA 3JV3A 3OSSC 2VASA 1UHFA 2CREA 4BDZA 1HK9A 2KR3A 1PD1A 1M9SA 3HSBA 1ABOA 2DL4A 3LGLA 1VQPQ 4M78C 2GGRA 5IHNA 1QW1A 4LE9A 5GAN2 4KGXB 1IB8A 1WXTA 1U5SA 4MZMA 4EMKC 4QQDA 4BY6C 4DBFA 1TOVA 2FEIA 2O4XB 4JJCA 2M9UA 3VYGA 1M90C 2DRKA 4JLIA 2CZ0B 1AHJB 2J6OA 3U23A 4WTOB 1VQ7T 1KFZA 4M78B 4FYXB 3CCQT 1Q81R 3CCEA 1RL2A 2BZ8A 4EMKB 1VQ4Q 4LDVA 3ZEHA 4BY6B
chains in the Genus database with same CATH topology
2AKKA 2CUBA 2RF0A 2EVRA 2E5KA 4KRTA 2OAWA 2O2OA 1WXBA 5IXBA 3NPFA 4X1VA 2LJ3A 2JS2A 4J9FA 1Z9ZA 1B07A 1QWFA 1YWOA 2YT6A 2J7IA 1RLQC 2C0OA 1X43A 2AZSA 3FJ5A 2CH4A 4EIKA 2EW3A 3H41A 1T3SA 2F2WA 5IHKA 1JU5C 2EGAA 3C0CA 3QWXX 1CKBA 1M3BA 4RTUA 1GBQA 4RTTA 1UECA 1YWPA 3M0SA 2GTJA 1UJYA 1ABQA 2FPDA 2KEAA 4OMPA 4D8KA 3RNJA 2JW4A 1M8MA 1H3HA 1UG1A 2DYBA 2L2PA 2RN8A 1Z9QA 1BB9A 2DL3A 4K11A 1OV3A 1OEBA 2YSQA 1ZSGA 1KSWA 2AKLA 1SHGA 1T0HA 1WFWA 2D1XA 3R6NA 3VRZA 1WA7A 1K9AA 1NYGA 2HSPA 4DEYA 2QDLA 1TG0A 1PNJA 1YP5A 2D0NA 4J9GA 5EC7A 3QWYA 4RTYA 2L3SA 2L0AA 1GFCA 1AZGB 2K2MA 1AEYA 4OMQA 4HCKA 4JPBW 2OI3A 4LN2A 1SEMA 2C0TA 4F16A 1WI7A 3TSWA 1BBZA 2J6FA 1KJWA 1YN8A 4OMLA 2KE9A 3EHQA 4Z88A 4ZNXA 4AFSC 2LNHB 4WCIA 2SRCA 3KFVA 4R0KA 4CC2A 1W1FA 1PRLC 2EGCA 4JZ3A 1N5ZA 1QKWA 1UUEA 1WLPB 2EYZA 3REAB 4HXJA 1CSKA 2V1RA 3NHNA 1H8KA 1NEBA 2LQWA 2C0IA 4GLMA 2CDTA 1AD5A 4ORZA 2K6DA 2ECZA 1V1CA 2L3QA 2HDAA 2DBKA 2RMOA 2LZ6B 1YNZA 2YUPA 1GFDA 5L23A 1NLPC 2GBQA 1X2KA 2CT3A 2DE0X 2ESWA 3ZL7C 2VVKA 1AWOA 3O5ZA 1K0XA 3H0FA 1X27A 2LX7A 1WDXA 4HVVA 4JZ4A 4J9EA 2K79A 2F2XA 3M0QA 1UHCA 2I0NA 1GCQC 1ARKA 2MCNA 3LH5A 4AFQC 2DX1A 3I9QA 2ENMA 3PVQA 2PTKA 1W6XA 2KNBB 3UA6A 1AWXA 2LMJA 2YUQA 1BK2A 1KIKA 2O9VA 1CKAA 1I0CA 2EPDA 1X69A 1NYFA 1UE9A 2DF6A 1X6BA 2V1QA 4OMNA 4OMOA 3M0RA 2RQVA 3EG3A 4RTZA 1E6GA 2JM9A 2NUZA 3TVTA 1OPLA 4IIOA 4AG1C 2O31A 2A08A 2CUDA 1HSQA 2PZ1A 2SEMA 1Y0MA 2MOXA 1RLPC 1QWEA 1JEGA 2B86A 2FPEA 1AWJA 2KRSA 2VKNA 2RQUA 2D8HA 1GRIA 2RQRA 3PE0A 2JM8A 4M4ZA 2F2VA 4CC4B 1QKXA 2J06A 3VS4A 3VS1A 3M0TA 2A28A 3I5SA 5ECAA 2HEQA 3GBQA 3THKA 2FG0A 1M30A 1NM7A 1NEGA 1QCFA 1LCKA 2O88A 4LUDA 1BU1A 2BTTA 2XMFA 1MUZA 4LUEA 2JT4A 1K1ZA 1FMKA 2J6KA 4A63B 2EYWA 1JXMA 2EYXA 2VWFA 1WX6A 1G2BA 3UATA 3ULRB 1ZUKA 3I5RA 2M0YA 4RTWA 2DA9A 1SRMA 2K7AA 2LJ0A 3EG1A 3VS6A 1E6HA 1VYUA 3VS0A 1MV0B 2BZXA 1TUCA 5FWBA 4LNPA 5I11A 5I22A 4Z8AA 2G6FX 2CH4W 1PKTA 2GTOA 4FSSA 4J9IA 2EQIA 3TSZA 3UF4A 1UDLA 1WIEA 1YCSB 1AWWA 1FYNA 1B3QA 2JMCA 2MIOA 4CC7A 1S1NA 5GJWB 1ZBJA 1I1JA 1ZUUA 2DL7A 1WYXA 1W70A 3NMZC 2RNAA 2LQNA 2RQWA 4D8DA 2IIMA 2JXBA 2O9SA 4J9BA 4Y92A 4F17A 1K0SA 1SSHA 1SHFA 3VS7A 3H0IA 4AG2C 1VA7A 1PWTA 1GL5A 1ZUYA 2EKHA 1OPKA 2D8JA 2JMAA 2KBTA 1PHTA 5IHIA 1HD3A 4E6RA 2AZVA 2FRWA 2L3PA 1GCQA 1JQQA 2KYMA 2LCSA 1U3OA 2FPFA 2JS0A 3A98A 4JJBA 4HVUA 2HCKA 2EYYA 3CQTA 1OOTA 2H8HA 4ESRA 2ROTA 2EBPA 2CT4A 3VS2A 1JXOA 1MV3A 2EGEA 2KT1A 3VS3A 1A0NB 2DILA 3PVLA 3UA7A 2LP5A 3VS5A 1VYTA 2CSQA 1SRLA 1WXUA 1AVZC 1M27C 5FW9A 2M51A 2ABLA 4F14A 3I35A 3IQLA 1PRMC 1E7OA 1UGVA 4J9DA 2X3XD 3NGPA 1NLOC 1EFNA 2A36A 3EG2A 5GJVB 2FO0A 1U06A 2DRMA 1SPKA 3VRYA 3M0PA 2J05A 3RBBB 1IO6A 3REBB 3EHRA 4J9HA 2OJ2A 1T0JA 1K76A 5HCKA 2KROA 1PKSA 4DEXA 2AK5A 1GCPA 1I07A 4RUGA 4OMMA 2K9GA 1Y57A 1UFFA 2YDLA 2P4RA 1RUWA 1RI9A 2RQTA 1TUDA 1VYVA 1GBRA 4IIMA 2YUOA 2KRMA 1X2QA 4CC3A 2KYBA 2W0ZA 2GNCA 4JJDA 2JTEA 2FRYA 2DL8A 1K4US 2LJ1A 1JO8A 2KGTA 2DL5A 4J9CA 4AFZC 2KT8A 1AOJA 1QLYA 1UTIA 2DJQA 2PNIA 2BZYA 2ED1A 4Z89A 2HBWA 5FWCA 2GQIA 1H92A 2ED0A 2ROLA 3JV3A 4HVWA 4RTVA 1NG2A 1UJ0A 1UHFA 2CREA 2X3WD 3H0HA 4GBQA 3SHWA 3EGUA 2KR3A 2KRNA 4RTXA 2A37A 1XOVA 2DVJA 3EG0A 1ABOA 2DL4A 2DNUA 5IXFA 1G83A 1J3TA 2DM1A 2YUNA 2GGRA 5IHNA 4LE9A 2DLPA 1WXTA 1U5SA 1X6GA 1HJDA 1M3AA 2DBMA 3M0UA 2FEIA 2CSIA 2W10A 4JJCA 4QT7A 1ZX6A 2DRKA 1T3LA 2NWMA 2J6OA 2K3BA 3U23A 1KFZA 2KXCA 3SEMA 5IH2A 2KXDA 2DMOA 4AFUC 2BZ8A 1ZLMA 1M3CA 2RPNA 1AZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AKK A;  2CUB A;  2RF0 A;  2EVR A;  2E5K A;  4KRT A;  2OAW A;  2O2O A;  1WXB A;  5IXB A;  3NPF A;  4X1V A;  2LJ3 A;  2JS2 A;  4J9F A;  1Z9Z A;  1B07 A;  1QWF A;  1YWO A;  2YT6 A;  2J7I A;  1RLQ C;  2C0O A;  1X43 A;  2AZS A;  3FJ5 A;  2CH4 A;  4EIK A;  2EW3 A;  3H41 A;  1T3S A;  2F2W A;  5IHK A;  1JU5 C;  2EGA A;  3C0C A;  3QWX X;  1CKB A;  1M3B A;  4RTU A;  1GBQ A;  4RTT A;  1UEC A;  1YWP A;  3M0S A;  2GTJ A;  1UJY A;  1ABQ A;  2FPD A;  2KEA A;  4OMP A;  4D8K A;  3RNJ A;  2JW4 A;  1M8M A;  1H3H A;  1UG1 A;  2DYB A;  2L2P A;  2RN8 A;  1Z9Q A;  1BB9 A;  2DL3 A;  4K11 A;  1OV3 A;  1OEB A;  2YSQ A;  1ZSG A;  1KSW A;  2AKL A;  1SHG A;  1T0H A;  1WFW A;  2D1X A;  3R6N A;  3VRZ A;  1WA7 A;  1K9A A;  1NYG A;  2HSP A;  4DEY A;  2QDL A;  1TG0 A;  1PNJ A;  1YP5 A;  2D0N A;  4J9G A;  5EC7 A;  3QWY A;  4RTY A;  2L3S A;  2L0A A;  1GFC A;  1AZG B;  2K2M A;  1AEY A;  4OMQ A;  4HCK A;  4JPB W;  2OI3 A;  4LN2 A;  1SEM A;  2C0T A;  4F16 A;  1WI7 A;  3TSW A;  1BBZ A;  2J6F A;  1KJW A;  1YN8 A;  4OML A;  2KE9 A;  3EHQ A;  4Z88 A;  4ZNX A;  4AFS C;  2LNH B;  4WCI A;  2SRC A;  3KFV A;  4R0K A;  4CC2 A;  1W1F A;  1PRL C;  2EGC A;  4JZ3 A;  1N5Z A;  1QKW A;  1UUE A;  1WLP B;  2EYZ A;  3REA B;  4HXJ A;  1CSK A;  2V1R A;  3NHN A;  1H8K A;  1NEB A;  2LQW A;  2C0I A;  4GLM A;  2CDT A;  1AD5 A;  4ORZ A;  2K6D A;  2ECZ A;  1V1C A;  2L3Q A;  2HDA A;  2DBK A;  2RMO A;  2LZ6 B;  1YNZ A;  2YUP A;  1GFD A;  5L23 A;  1NLP C;  2GBQ A;  1X2K A;  2CT3 A;  2DE0 X;  2ESW A;  3ZL7 C;  2VVK A;  1AWO A;  3O5Z A;  1K0X A;  3H0F A;  1X27 A;  2LX7 A;  1WDX A;  4HVV A;  4JZ4 A;  4J9E A;  2K79 A;  2F2X A;  3M0Q A;  1UHC A;  2I0N A;  1GCQ C;  1ARK A;  2MCN A;  3LH5 A;  4AFQ C;  2DX1 A;  3I9Q A;  2ENM A;  3PVQ A;  2PTK A;  1W6X A;  2KNB B;  3UA6 A;  1AWX A;  2LMJ A;  2YUQ A;  1BK2 A;  1KIK A;  2O9V A;  1CKA A;  1I0C A;  2EPD A;  1X69 A;  1NYF A;  1UE9 A;  2DF6 A;  1X6B A;  2V1Q A;  4OMN A;  4OMO A;  3M0R A;  2RQV A;  3EG3 A;  4RTZ A;  1E6G A;  2JM9 A;  2NUZ A;  3TVT A;  1OPL A;  4IIO A;  4AG1 C;  2O31 A;  2A08 A;  2CUD A;  1HSQ A;  2PZ1 A;  2SEM A;  1Y0M A;  2MOX A;  1RLP C;  1QWE A;  1JEG A;  2B86 A;  2FPE A;  1AWJ A;  2KRS A;  2VKN A;  2RQU A;  2D8H A;  1GRI A;  2RQR A;  3PE0 A;  2JM8 A;  4M4Z A;  2F2V A;  4CC4 B;  1QKX A;  2J06 A;  3VS4 A;  3VS1 A;  3M0T A;  2A28 A;  3I5S A;  5ECA A;  2HEQ A;  3GBQ A;  3THK A;  2FG0 A;  1M30 A;  1NM7 A;  1NEG A;  1QCF A;  1LCK A;  2O88 A;  4LUD A;  1BU1 A;  2BTT A;  2XMF A;  1MUZ A;  4LUE A;  2JT4 A;  1K1Z A;  1FMK A;  2J6K A;  4A63 B;  2EYW A;  1JXM A;  2EYX A;  2VWF A;  1WX6 A;  1G2B A;  3UAT A;  3ULR B;  1ZUK A;  3I5R A;  2M0Y A;  4RTW A;  2DA9 A;  1SRM A;  2K7A A;  2LJ0 A;  3EG1 A;  3VS6 A;  1E6H A;  1VYU A;  3VS0 A;  1MV0 B;  2BZX A;  1TUC A;  5FWB A;  4LNP A;  5I11 A;  5I22 A;  4Z8A A;  2G6F X;  2CH4 W;  1PKT A;  2GTO A;  4FSS A;  4J9I A;  2EQI A;  3TSZ A;  3UF4 A;  1UDL A;  1WIE A;  1YCS B;  1AWW A;  1FYN A;  1B3Q A;  2JMC A;  2MIO A;  4CC7 A;  1S1N A;  5GJW B;  1ZBJ A;  1I1J A;  1ZUU A;  2DL7 A;  1WYX A;  1W70 A;  3NMZ C;  2RNA A;  2LQN A;  2RQW A;  4D8D A;  2IIM A;  2JXB A;  2O9S A;  4J9B A;  4Y92 A;  4F17 A;  1K0S A;  1SSH A;  1SHF A;  3VS7 A;  3H0I A;  4AG2 C;  1VA7 A;  1PWT A;  1GL5 A;  1ZUY A;  2EKH A;  1OPK A;  2D8J A;  2JMA A;  2KBT A;  1PHT A;  5IHI A;  1HD3 A;  4E6R A;  2AZV A;  2FRW A;  2L3P A;  1GCQ A;  1JQQ A;  2KYM A;  2LCS A;  1U3O A;  2FPF A;  2JS0 A;  3A98 A;  4JJB A;  4HVU A;  2HCK A;  2EYY A;  3CQT A;  1OOT A;  2H8H A;  4ESR A;  2ROT A;  2EBP A;  2CT4 A;  3VS2 A;  1JXO A;  1MV3 A;  2EGE A;  2KT1 A;  3VS3 A;  1A0N B;  2DIL A;  3PVL A;  3UA7 A;  2LP5 A;  3VS5 A;  1VYT A;  2CSQ A;  1SRL A;  1WXU A;  1AVZ C;  1M27 C;  5FW9 A;  2M51 A;  2ABL A;  4F14 A;  3I35 A;  3IQL A;  1PRM C;  1E7O A;  1UGV A;  4J9D A;  2X3X D;  3NGP A;  1NLO C;  1EFN A;  2A36 A;  3EG2 A;  5GJV B;  2FO0 A;  1U06 A;  2DRM A;  1SPK A;  3VRY A;  3M0P A;  2J05 A;  3RBB B;  1IO6 A;  3REB B;  3EHR A;  4J9H A;  2OJ2 A;  1T0J A;  1K76 A;  5HCK A;  2KRO A;  1PKS A;  4DEX A;  2AK5 A;  1GCP A;  1I07 A;  4RUG A;  4OMM A;  2K9G A;  1Y57 A;  1UFF A;  2YDL A;  2P4R A;  1RUW A;  1RI9 A;  2RQT A;  1TUD A;  1VYV A;  1GBR A;  4IIM A;  2YUO A;  2KRM A;  1X2Q A;  4CC3 A;  2KYB A;  2W0Z A;  2GNC A;  4JJD A;  2JTE A;  2FRY A;  2DL8 A;  1K4U S;  2LJ1 A;  1JO8 A;  2KGT A;  2DL5 A;  4J9C A;  4AFZ C;  2KT8 A;  1AOJ A;  1QLY A;  1UTI A;  2DJQ A;  2PNI A;  2BZY A;  2ED1 A;  4Z89 A;  2HBW A;  5FWC A;  2GQI A;  1H92 A;  2ED0 A;  2ROL A;  3JV3 A;  4HVW A;  4RTV A;  1NG2 A;  1UJ0 A;  1UHF A;  2CRE A;  2X3W D;  3H0H A;  4GBQ A;  3SHW A;  3EGU A;  2KR3 A;  2KRN A;  4RTX A;  2A37 A;  1XOV A;  2DVJ A;  3EG0 A;  1ABO A;  2DL4 A;  2DNU A;  5IXF A;  1G83 A;  1J3T A;  2DM1 A;  2YUN A;  2GGR A;  5IHN A;  4LE9 A;  2DLP A;  1WXT A;  1U5S A;  1X6G A;  1HJD A;  1M3A A;  2DBM A;  3M0U A;  2FEI A;  2CSI A;  2W10 A;  4JJC A;  4QT7 A;  1ZX6 A;  2DRK A;  1T3L A;  2NWM A;  2J6O A;  2K3B A;  3U23 A;  1KFZ A;  2KXC A;  3SEM A;  5IH2 A;  2KXD A;  2DMO A;  4AFU C;  2BZ8 A;  1ZLM A;  1M3C A;  2RPN A;  1AZE A; 
#chains in the Genus database with same CATH topology
 4OGC A;  2AKK A;  2OTL Q;  5LJ3 j;  3PGG A;  5IXB A;  4E7K A;  4X1V A;  2LJ3 A;  3RER A;  3I55 T;  2GCX A;  3DLM A;  4II1 A;  3G71 A;  1IHV A;  2DIG A;  1QWF A;  1YWO A;  2E3H A;  3FLG A;  3ZFJ A;  3EGX A;  4MZP A;  1X43 A;  2E64 A;  2AIR B;  5J26 A;  2YHT A;  3CCM Q;  2CP0 A;  4EMH A;  3E19 A;  3H41 A;  1QVF S;  4BB7 A;  1JU5 C;  1UGR B;  2NUP B;  3C0C A;  4PJO C;  3QWX X;  2MMP A;  1M3B A;  2RI3 A;  2PVO B;  2QDY B;  2E10 A;  2XK0 A;  3GF5 A;  4RTT A;  1UEC A;  3M0S A;  3X28 B;  2BE7 D;  1N27 A;  3RNJ A;  2XHC A;  4QVD A;  1H3H A;  1UG1 A;  2RH2 A;  2D6F A;  4M7A E;  5GAN e;  1M1F A;  4PJO B;  1XTD A;  1SHG A;  1PD0 A;  2DTH A;  5M9O A;  1Q7Y U;  3RIR A;  1MND A;  2X4W A;  2R57 A;  2WSC E;  3QZ9 B;  2V26 A;  5KYU A;  2QDL A;  1TG0 A;  3L2Z A;  3QWY A;  2EQJ A;  3A8M B;  1AZG B;  2CGH A;  2K2M A;  3JCM e;  4PFO A;  4OMQ A;  2OI3 A;  5GAO q;  3CCL T;  2QXF A;  1BBZ A;  5GAN h;  1KJW A;  1YN8 A;  4HT9 A;  2E41 A;  2KE9 A;  1QP2 A;  4Z88 A;  4ZNX A;  4AFS C;  3MKD A;  1FMV A;  1I81 A;  3KFV A;  3CME Q;  1BCO A;  2QI2 A;  2A7Y A;  4JDS A;  5DLO A;  5CKD A;  3CC2 T;  1IRX A;  2JN0 A;  2X4Y A;  4C8Q C;  2COW A;  3NHN A;  2RB6 A;  4J6X A;  1PG5 B;  2EJG A;  2OTJ Q;  2VC8 A;  4GLM A;  2L3R A;  4R56 A;  2CDT A;  4KGZ B;  1VQ6 Q;  3JCM h;  1QVG A;  2BUD A;  2DBK A;  3RKW A;  4PJO F;  4XTU A;  4C8Q B;  1D3B A;  5L23 A;  2X4J A;  4JRQ A;  1X2K A;  5CQX A;  4IUR A;  2VGM A;  2AT1 B;  4J6Y A;  5CKF A;  3FEO A;  3ZL7 C;  4TVR A;  1YHQ A;  3H0F A;  4RMO A;  1VQM A;  3NTH A;  1WDX A;  4GLK A;  2QA4 Q;  2F2X A;  5AYF A;  1UHC A;  2H3J A;  3CCS T;  1YI2 T;  4OVA A;  3BDL A;  4KGV B;  3WVD B;  4QQG A;  4LD6 A;  2DZC A;  4KUI A;  2QG9 B;  1KC8 C;  4KBM B;  4ZTJ A;  4IKF A;  1I5O B;  3PFS A;  2DF6 A;  1BI3 A;  4PJO D;  3QZ5 B;  3M0R A;  2LCC A;  3CCR Q;  5GAO m;  3PIP A;  3EFO A;  3CBM A;  2DET A;  4PJO A;  3TVT A;  1N9R A;  3QKJ A;  4C0G A;  1M2V B;  2CUD A;  3E1S A;  4FYY B;  2FVU A;  3OYC A;  4BD3 A;  3PT9 A;  3EGD B;  2DXB A;  5EG2 A;  3A5Z B;  4C8Q F;  3V8K A;  2DIQ A;  1Q86 U;  2VKN A;  4J8O A;  1DJ7 B;  4C92 G;  3CXC A;  1LOJ A;  5GAO p;  4CC4 B;  3KXT A;  3G6E T;  5GMK m;  4BI4 A;  3VS1 A;  3EG9 B;  4QVC A;  3M0T A;  5KYX A;  2PUO B;  4PKC C;  1RAH B;  3I5S A;  4KH1 B;  3GBQ A;  2IPO B;  2FG0 A;  1NEG A;  3JB9 H;  1BU1 A;  2JT4 A;  3OW2 A;  2J6K A;  1VQ7 A;  4A63 B;  2RJC A;  2EYX A;  3CCQ A;  2ZPE B;  2FZK B;  3I5R A;  4WF2 A;  2LJ0 A;  2HQH A;  3VS6 A;  4C8Q D;  3DB4 A;  2BZX A;  4FL6 A;  3DLL A;  1TUC A;  1N9S A;  4LNP A;  2WAC A;  4C8Q A;  3I55 A;  1YJ9 T;  4J9I A;  1TUG B;  2EQI A;  1UDL A;  4LDW A;  1WIE A;  3SFM A;  3JCM W;  1OU8 A;  5LJ3 d;  4M7A A;  4Q5W A;  1S1N A;  2VUB A;  2RHU A;  5A0L A;  3MEU A;  2IVW A;  1KD1 U;  3RES A;  1ZBJ A;  1UEB A;  2DL7 A;  1WYX A;  2HMA A;  3NMZ C;  2RNA A;  2LQN A;  4BI3 A;  2XDD A;  2RQW A;  2IIM A;  4J7I A;  4XTW A;  5GAN 5;  1YIJ Q;  1G3T A;  2RHI A;  1SSH A;  1K0S A;  3FDR A;  1SHF A;  2YWW A;  1VA7 A;  3LWH A;  1GL5 A;  4B9W A;  1PHT A;  2O01 E;  1SG5 A;  4M78 G;  3X26 B;  1W4S A;  5FRO A;  2AZV A;  2DXT A;  2L3P A;  2E70 A;  5KYW A;  4L6V 5;  2QK0 A;  2JS0 A;  4PJN A;  1SSF A;  4E7J A;  2EYY A;  1M2V A;  2H8H A;  4ESR A;  3FRN A;  1Q82 U;  2X35 A;  3P8D A;  1ZHI A;  3S3M A;  4M7D D;  1JXO A;  1P92 A;  3PVL A;  1VQN Q;  3UA7 A;  2RK2 A;  4M7D A;  3CCL A;  1IGU A;  1D09 B;  2HQE A;  2XI9 A;  1QVP A;  3CCV Q;  1WXU A;  2M51 A;  1M4Z A;  5D7U A;  4ATO A;  3MET A;  2X3X D;  1U1T A;  4FYV B;  2A36 A;  1VQ8 T;  5CAI A;  1JB0 E;  2GQV A;  3CC2 A;  3CCU T;  1SPK A;  2L5Q A;  3VRY A;  3M0P A;  3J7A F;  5C6S A;  3EHR A;  4J9H A;  1T0J A;  4PJO G;  1PKS A;  2AK5 A;  1GCP A;  2A3L A;  2K9G A;  1UFF A;  1EZZ B;  2GFU A;  2P4R A;  5CQY A;  3V7R A;  5GAN 8;  2RQT A;  2QQS A;  1B7T A;  1X2Q A;  2QQR A;  2W0Z A;  4E7H A;  1RAG B;  2LRQ A;  1YFN A;  5GAM g;  1PSF A;  2QTV A;  1KC8 R;  2FRY A;  2DL8 A;  3C12 A;  2LJ1 A;  1QCN A;  3JSC A;  4AFZ C;  4J9C A;  3OBW A;  4V2S A;  1AOJ A;  1QLY A;  2ZPF B;  3CCS A;  2DJQ A;  5GAN 6;  4NL2 A;  1YI2 A;  2PNI A;  5KH6 A;  1MMG A;  4DBQ A;  1FXX A;  2M16 A;  2CS7 A;  2ROL A;  1NJI C;  2FB7 A;  1S72 T;  2QEX T;  4RG2 A;  1YJN T;  4ME7 A;  1Y7X A;  1UJ0 A;  1Q81 U;  5GAO n;  2X3W D;  3H0H A;  2WSE E;  3EGU A;  3OSV A;  2HQX A;  1KG1 A;  1O75 A;  5HK0 A;  5IXF A;  1G83 A;  3M53 A;  2DM1 A;  2YUN A;  2RHX A;  1TTH B;  4C5E A;  4RCB A;  1X6G A;  1IRE B;  4C8Q G;  3OYI A;  2DBM A;  5I2S A;  4CI0 C;  2CSI A;  2X9H A;  4HCC A;  1ZX6 A;  2NWM A;  2K3B A;  2E6Z A;  2KXC A;  5IH2 A;  3QJY A;  2KXD A;  4KH0 B;  3G4S Q;  3HP9 A;  3M55 A;  2MI6 A;  5D6X A;  3TRE A;  3G6E A;  3JCM J;  2E5K A;  1RAF B;  2O2O A;  1WXB A;  3NPF A;  2JS2 A;  4EPC A;  4J9F A;  2MPX C;  3QBY A;  1NBE B;  3QUI A;  4XAX B;  4C92 C;  2YT6 A;  5GAN 7;  1M1K C;  4XTX A;  2XKO C;  1OQK A;  2AZS A;  4FU6 A;  3FJ5 A;  3CD6 Q;  2EW3 A;  2PVG B;  2LQ8 A;  2F2W A;  1WJQ A;  2VB6 A;  1X01 A;  4J7F A;  1CKB A;  1VIE A;  3PMI A;  4C92 B;  1MNE A;  1OZ3 A;  1TXQ A;  2GTJ A;  1UJY A;  5LJ5 g;  2FPD A;  4PK4 A;  2VV5 A;  2B8A A;  1ACM B;  5I2M A;  4ZN3 A;  3C95 A;  1ZBX A;  1TU0 B;  1YJ9 A;  3OYL A;  2ATC B;  4RCC A;  4IUP A;  2YSQ A;  1ZSG A;  3CCJ Q;  1N8R C;  1KSW A;  1K8A C;  1YJW Q;  2MYS A;  4OGE A;  2LDM A;  1WFW A;  2D1X A;  2P0K A;  1OU9 A;  3VRZ A;  5GMK l;  2KVQ G;  1MGQ A;  4XK8 E;  4X9D A;  4J9G A;  4N4H A;  5A0G A;  2F69 A;  2L3S A;  5GMK e;  2YRV A;  3CMA T;  2YLC A;  4RKU E;  1AEY A;  3I56 T;  4IUT A;  1R0C B;  1VQ9 Q;  2QGF B;  2P0Q A;  5DLQ E;  2EWN A;  4F16 A;  2EYQ A;  4J6W A;  2LVM A;  3EHQ A;  3CPF A;  4R0K A;  3VUZ A;  1W1F A;  1PRL C;  2MAM A;  1N5Z A;  1QKW A;  1UUE A;  1WLP B;  2EYZ A;  3REA B;  2V1R A;  1M8V A;  4C92 F;  3JB9 G;  4PJO E;  1QVG S;  2HL3 A;  1H8K A;  1NEB A;  3MP8 A;  2VXF A;  4DBH A;  5GMK h;  1ZA2 B;  3OYE A;  2K6D A;  2L3Q A;  1VQ5 Q;  1VQP T;  2DEQ A;  3QHS A;  2RMO A;  2LZ6 B;  5GAM f;  4XU1 A;  4BE1 A;  2YUP A;  2R58 A;  1NLP C;  2NLU A;  4N0A A;  1VQO Q;  2ESW A;  1BCM A;  2IG0 A;  3O5Z A;  1VQ8 A;  2E65 A;  3JCM P;  3CCU A;  3CXC P;  1VQ4 T;  3GNG A;  3OYH A;  3M0Q A;  2OTL T;  2I0N A;  2K3Y A;  4L59 A;  3OBY A;  3CC7 Q;  2MCN A;  2DX1 A;  4C92 D;  1I8F A;  1W6X A;  1G5V A;  4AT1 B;  2LMJ A;  2YUQ A;  1BK2 A;  2YRD A;  4C92 A;  2XIC A;  1B34 B;  1CKA A;  1I0C A;  2EPD A;  3MHX A;  3QO3 A;  3RDV A;  3CCM T;  1X69 A;  1UE9 A;  1X6B A;  5GAN d;  1BIB A;  2NYS A;  2K4Y A;  3OW2 P;  5A2Q E;  2V8K A;  3ZBD A;  3GNF B;  4E7Z A;  2JM9 A;  4C8Q E;  1BI0 A;  2JJ9 A;  4AG1 C;  2LTO A;  5CCA A;  2A08 A;  3QDR B;  4OB0 B;  3JB9 J;  2MOX A;  3A8O B;  2XDB A;  1QWE A;  3MEA A;  2FPE A;  4F7U B;  3X24 B;  1R0B G;  1VQL Q;  1X75 C;  1K73 U;  2JM8 A;  1S72 A;  2QEX A;  2F2V A;  1YJN A;  3JCM d;  4M78 F;  4A53 A;  3OMC A;  1VQK Q;  4A54 A;  5DY9 A;  3QPH A;  3MO8 A;  5FLX E;  3OW2 S;  5ECA A;  3THK A;  5KCO A;  1QCF A;  2RHY A;  4A4G A;  2E4H A;  2RJF A;  1MUZ A;  1M1K R;  1FMK A;  5LJ5 f;  3F70 A;  3HPW A;  4GY5 A;  3SB2 A;  1JXM A;  2VWF A;  3UAT A;  1ZUK A;  2DA9 A;  3EG1 A;  2KY9 A;  2NUT B;  5KYY B;  1E6H A;  1VYU A;  3VS0 A;  3EAE A;  3CME T;  2KQW A;  3GPL A;  4JJN K;  2DXC A;  5I22 A;  4Z8A A;  2G6F X;  1OUL A;  3CC4 Q;  4LXC A;  2DER A;  2GTO A;  4FSS A;  4M7D E;  4BUG A;  4M78 D;  3TSZ A;  2O4X A;  2ZZD A;  3UF4 A;  3TEE A;  2DTO A;  1YCS B;  1AWW A;  4L5G A;  1B3Q A;  1QQJ A;  2JMC A;  2OTJ T;  4M78 A;  4CC7 A;  2EIF A;  1RAC B;  1N8R R;  3X20 B;  1VQ6 T;  2HD0 A;  4E7I A;  4EMK A;  4AMC A;  1ZUU A;  4O5V A;  1W70 A;  3GLX A;  1WHK A;  4JRK A;  1H64 1;  4D8D A;  4J9B A;  2Z0W A;  4F17 A;  2BKD N;  3MEW A;  1RAA B;  4AG2 C;  2YRC A;  3R6O A;  1WNL A;  4IUV A;  3QII A;  2KBT A;  1TWB A;  2CYZ B;  1HD3 A;  4FIB A;  4JRP A;  1YIT Q;  1B34 A;  2QA4 T;  1RAD B;  4FM4 B;  2LCS A;  2KYM A;  1U3O A;  2NUP A;  4KT0 E;  5A0D A;  2FPF A;  5GAM h;  1G8X A;  1R8O B;  4N4I A;  3CQT A;  1RAI B;  2CT4 A;  2DTI A;  3CMA A;  1C1A A;  1MV3 A;  2EGE A;  2JOY A;  3VS3 A;  3I56 A;  3C4S A;  3PNW C;  3CCR T;  1VYT A;  1Y96 B;  3V7C A;  1Q86 C;  5HKC A;  2PUK B;  3M57 A;  3D7S B;  2CSQ A;  2CZ6 B;  3BE3 A;  4B9X A;  2ZPI B;  4FW2 A;  1M27 C;  2ABL A;  3OA6 A;  3FIF A;  3NGP A;  1M90 R;  3HHT B;  2JTF A;  3V8L A;  5GJV B;  3UDC A;  2DRM A;  1KC8 U;  3RBB B;  3REB B;  4A4E A;  5HCK A;  1K76 A;  2ZCF B;  1EX4 A;  5HY6 A;  4RUG A;  4OMM A;  3TQ7 P;  3BDU A;  2YDL A;  2GFA A;  1VQP A;  2DFU A;  1LJO A;  4IUQ A;  5LL6 S;  2C06 A;  1TUD A;  2CKK A;  4IIM A;  4PJJ A;  5GAN 3;  4CC3 A;  1VIF A;  1H3Z A;  4QW2 A;  4JJD A;  1OX8 A;  3A1P A;  3OS5 A;  9ATC B;  2VGN A;  4DQ2 A;  2LX9 A;  1JO8 A;  2KGT A;  2LC4 A;  2HSE B;  3L42 A;  1VQ4 A;  2CP5 A;  8ATC B;  5GAN 4;  2ZPG B;  4KUL A;  1UTI A;  2OTL A;  6AT1 B;  3J80 E;  2BIV A;  2BZY A;  1JBM A;  1KD1 C;  1WQW A;  1PCX A;  2ED1 A;  2QTX A;  2GQI A;  2ED0 A;  3AHU A;  2CP2 A;  4HVW A;  4RTV A;  4A4F A;  3CEY A;  4RTX A;  1D0Y A;  3CCM A;  5LJ5 h;  1XOV A;  2V8J A;  3EG0 A;  2DNU A;  5CR2 A;  3OQ5 A;  2K3X A;  4C5I A;  3RMQ A;  2RI5 A;  1YIJ T;  1WQ7 A;  1KQ2 A;  2KDS A;  5L8R E;  3M0U A;  1U8R A;  4DBR A;  4PL6 A;  1KQS P;  2CP3 A;  1T3L A;  3SEM A;  1Q82 C;  4C0Z A;  3V7S A;  2RF0 A;  4KRT A;  2PVD B;  5FRN A;  3M5A A;  3QJ6 A;  1B07 A;  2YXY A;  3EGD A;  4ELY C;  3JB9 F;  1WHH A;  2J7I A;  1RLQ C;  2C0O A;  3CPW A;  2CH4 A;  1KK7 A;  1VQN T;  2KI7 A;  3HKS A;  1MMA A;  3EFR A;  5IHK A;  3CCV T;  2DJZ A;  1UGP B;  3EFS A;  1LPL A;  2EGA A;  3UWN A;  3EG9 A;  4ZN1 A;  3M54 A;  5LJ3 h;  1V76 A;  1GBQ A;  3MP1 A;  1YWP A;  2K2V A;  1ABQ A;  2KMT A;  2KEA A;  2F1L A;  4D8K A;  3CME A;  2JW4 A;  1M8M A;  2QQB A;  2E12 A;  2DYB A;  2HKQ B;  4PFZ A;  1Z9Q A;  3CCE Q;  4MDW A;  3TU4 K;  1OV3 A;  4F7U G;  3MPU B;  2DKG A;  2AKL A;  2OTJ A;  5GAN j;  4XTZ A;  3S3O A;  1NYG A;  2HSP A;  4DEY A;  3MEV A;  3G71 Q;  4JLG A;  3JB9 D;  1PNJ A;  1YP5 A;  1YBY A;  3Q1J A;  3M59 A;  3FB9 A;  2JVV A;  2QAS A;  4VUB A;  1GFC A;  3OS1 A;  3H9N A;  3L2R A;  1W2B P;  4HCK A;  3FC3 A;  1K9M C;  3NTI A;  4LN2 A;  3L2W A;  3AT1 B;  3TSW A;  1Q86 R;  4OML A;  4BE0 A;  1WHJ A;  2QA4 A;  4C92 E;  1XNI A;  2LNH B;  4WCI A;  4OP0 A;  4NL3 A;  1D0X A;  7AT1 B;  2E1H A;  3OYF A;  2ZGW A;  4MZT A;  2EGC A;  4PLI A;  2QYZ A;  2LQW A;  1I4K 1;  5CVI A;  2EJF A;  3BY7 A;  1AD5 A;  1JJ2 P;  1HXD A;  2Y90 A;  3CCR A;  4X9C A;  2LT4 A;  3JCM X;  1XQH A;  3VYH B;  1RAE B;  1GFD A;  2GBQ A;  3EH2 A;  2CT3 A;  1NZ9 A;  5IT9 E;  1NE8 A;  4XU0 A;  2VVK A;  4HKE A;  1K0X A;  1VOM A;  4M77 C;  2F5K A;  4KUD K;  3G4S T;  2QQA A;  4HVV A;  2L89 A;  4JZ4 A;  4YTL A;  2K79 A;  4D6W A;  1QMC A;  4HA8 A;  4ZTF A;  2QGG A;  2EQK A;  3LH5 A;  3H8Z A;  5HK3 A;  2RD1 A;  2COZ A;  3PVQ A;  1LVK A;  4M77 B;  3UA6 A;  2FYK A;  2KNB B;  1AWX A;  3C94 A;  3OYG A;  1KIK A;  1WZO A;  1LNX A;  2ZPH B;  3CD6 T;  5GAO l;  1NYF A;  4OMN A;  1VUB A;  4OMO A;  2RQV A;  3ER0 A;  4UC4 A;  3EG3 A;  1E6G A;  1WPY A;  3OYD A;  5CKE A;  2NUZ A;  3L1A A;  1KQS A;  3OYB A;  1OPL A;  4IIO A;  2D9T A;  2Y4X A;  1HSQ A;  2PZ1 A;  2SEM A;  3VUB A;  4M78 E;  4DA4 A;  4PFP A;  2FZC B;  1YHQ Q;  1JEG A;  2B86 A;  3EGX B;  3V8J A;  2CZ1 B;  2QAZ A;  1VQM Q;  2KRS A;  3LW5 E;  2D8H A;  1GRI A;  4PLL A;  2RQR A;  1OI1 A;  3CCJ T;  3MCA B;  4NOY A;  1C6V X;  1YJW T;  3PMT A;  3QYG B;  4XTV A;  4Y28 E;  4BDY A;  3VS4 A;  1ZSZ C;  3QYH B;  3E9G A;  4JUV A;  2A28 A;  5D6Y A;  4HCB A;  2EJ9 A;  3BW1 A;  1YIJ A;  2HEQ A;  4JS4 A;  1LCK A;  4LUD A;  3JRZ A;  2XMF A;  4LUE A;  1ZSZ B;  1VQ9 T;  4M77 F;  2CP7 A;  2AHJ B;  1WX6 A;  5KCH A;  1G2B A;  4X34 A;  3ULR B;  2M0Y A;  2G3R A;  3UT1 A;  3LYI A;  3GP8 A;  4C5G A;  1MV0 B;  2OAU A;  1M2O A;  5LJ3 g;  3OYJ A;  5FWB A;  5I11 A;  5C0M A;  3HRS A;  2XU8 A;  3HTR A;  4J83 A;  2LQK A;  2MWP A;  3KUF A;  2RM4 A;  4ZGD B;  3EH1 A;  3VJP A;  5GJW B;  1VQ5 T;  1VQN A;  4ZGJ B;  5I21 A;  4MMK A;  1MMD A;  3CCV A;  1BI2 A;  1O9S A;  2O9S A;  1W2B A;  4M75 C;  1VQO T;  3VS7 A;  3H0I A;  4M77 D;  2RK1 A;  2D0Q B;  2EKH A;  1OPK A;  2D8J A;  2A0F B;  4M77 A;  1VQ7 Q;  1QVF P;  2DPP B;  1K9M R;  4XQ3 A;  3CCQ Q;  1BKB A;  4M75 B;  2DZ9 A;  1JQQ A;  4FYW B;  3CC7 T;  4HT8 A;  1D3B B;  2LNV A;  4B6M A;  1M90 U;  4J5Y A;  1NJI R;  3A98 A;  4JJB A;  5CK9 A;  4HVU A;  3I55 Q;  1JJ2 A;  2HCK A;  1OOT A;  1FWZ A;  2ROT A;  1YCY A;  2EBP A;  4PJM A;  3TCJ A;  4BI8 B;  3M58 A;  1SKU B;  2DIL A;  3VS5 A;  5IN1 A;  4EMG A;  2MWO A;  4JRI A;  1Q7Y C;  3CXC S;  1SRL A;  1K73 C;  4A4K A;  5FW9 A;  1OZ2 A;  4F14 A;  3I35 A;  1PRM C;  1NLO C;  1EFN A;  2RJD A;  1U06 A;  5CKH A;  4BAC A;  1VQL T;  2J05 A;  1IO6 A;  2X51 A;  2OJ2 A;  1VQK T;  3EFO B;  2KRO A;  4DEX A;  5D6W A;  1ZSZ A;  1I07 A;  3WXM B;  1Y57 A;  4XU2 A;  1IXD A;  1MHN A;  1TSF A;  4ANJ A;  1RUW A;  4M75 F;  5FU6 C;  1VYV A;  2VXE A;  3QXE B;  1NPR A;  3LGF A;  2YUO A;  1BYM A;  2FZG B;  2JTM A;  2JTE A;  2I2L A;  3H6Z A;  3CCL Q;  1K4U S;  3G4S A;  2K5F A;  5FU6 B;  1WHM A;  1EIF A;  2BE9 B;  3OB9 A;  5KYX B;  5GAM d;  2CP6 A;  2HNI A;  4Z89 A;  5FWC A;  4C0D C;  3CC4 T;  3CC2 Q;  4FW1 A;  2HAX A;  3BFM A;  1NG2 A;  3S3N A;  2X4X A;  1K8A R;  5GAM e;  2V8I A;  2M02 A;  4F7U F;  1NPP A;  4GBQ A;  2XG8 D;  3SHW A;  2KRN A;  3RKX A;  3CPW P;  3CD6 A;  2A37 A;  2DVJ A;  1C0M A;  4M75 D;  4C0D B;  4M7A C;  1J3T A;  1FX7 A;  5GMK i;  2XID A;  2DLP A;  4M75 A;  2E6N A;  2ZAE A;  5KE2 A;  1D1C A;  1HJD A;  4NS5 A;  1M3A A;  3OY9 A;  2XDP A;  2W10 A;  4QT7 A;  2MK5 A;  3ME9 A;  4M7A B;  3NTK A;  5LJ3 f;  2DMO A;  1M5Q 1;  2DD4 A;  4AFU C;  1YIT T;  2RPN A;  1KHI A;  1M3C A;  1ZLM A;  2RA2 A;  1AZE A;  1RAB B;  4E47 A;  3CCJ A;  1FMW A;  3NFC A;  2CUB A;  3CCS Q;  1YI2 Q;  2FHD A;  1IGQ A;  1YJW A;  2EVR A;  1PM3 A;  3OS0 A;  2OAW A;  3OYN A;  1BIA A;  1D1A A;  4CRI A;  3LLR A;  3CPW S;  2YLB A;  2RHZ A;  1Z9Z A;  4C5H A;  4M77 G;  2XD0 A;  3OS2 A;  3A8H B;  1GXI E;  2DD5 A;  4F7U A;  2K57 A;  1PC0 A;  4HCZ A;  4EIK A;  1VQ9 A;  1T3S A;  2EQU A;  4E7L A;  5KYW B;  2LT1 A;  4RTU A;  3LWI A;  2KSS A;  4M7D C;  1QVF A;  4OB1 B;  2HL5 C;  2EKO A;  4OMP A;  1AT1 B;  3PIO A;  2L2P A;  4FT4 A;  5FU7 C;  2RN8 A;  1IHW A;  1UB4 A;  1BB9 A;  2DL3 A;  4K11 A;  5LJ5 d;  2COY A;  1OEB A;  3VU3 C;  4R55 A;  4M7D B;  1U1S A;  3P8B B;  1T0H A;  3G6E Q;  1PSE A;  3R6N A;  1VQ5 A;  4M7A F;  3GOX A;  3SDZ A;  1WA7 A;  1K9A A;  5FRM A;  2NUT A;  5KYY A;  5FU7 B;  5LJ5 e;  2HKN A;  3HFO A;  2D0N A;  5EC7 A;  4RTY A;  3VKI A;  2DAQ A;  5IAY A;  2L0A A;  1Y71 A;  5J3B A;  2PQW A;  1VQO A;  4Y91 A;  3O8V A;  1D0Z A;  4LD9 K;  4JPB W;  4P5N A;  5GMK j;  2EQM A;  3OYM A;  1SEM A;  2C0T A;  4FSX A;  3WVE B;  3FJP A;  1WI7 A;  2J6F A;  1Q7Y R;  3M4G A;  1K73 R;  4LDU A;  2SRC A;  3CC7 A;  4CC2 A;  3URG A;  2L8D A;  4MML A;  2P4T A;  4JZ3 A;  3MJX A;  3S6W A;  4HXJ A;  1CSK A;  1YJ9 Q;  1OYX A;  3SD4 A;  4LDX A;  1R77 A;  1G3Y A;  1RI0 A;  2DEU A;  2C0I A;  3OYK A;  3DKM A;  4M7A D;  2VYT A;  1D1B A;  2K5I A;  4ORZ A;  2ECZ A;  1V1C A;  2HDA A;  1HYO A;  2DVE A;  2ZPB B;  1YNZ A;  2P84 A;  3HL8 A;  4M7D F;  3SWN C;  3DB3 A;  3JCM V;  2DE0 X;  3PTA A;  5LJ3 e;  1WJR A;  3INZ A;  1AWO A;  2QQ9 A;  1X27 A;  2LX7 A;  1WHL A;  1Q95 G;  1VQL A;  2E5Q A;  4J9E A;  1Y96 A;  3SWN B;  4QQ6 A;  4FCY A;  4XTY A;  1VQK A;  1GCQ C;  1ARK A;  4M75 G;  2EFI A;  4AFQ C;  1SF9 A;  3I9Q A;  3GIB A;  1KHC A;  3T9N A;  4LDY A;  2ENM A;  2PTK A;  5J39 A;  5GAN g;  5CKB A;  2OX7 A;  4C0F A;  2O9V A;  1KQS S;  2V1Q A;  3E2U A;  1OX9 A;  4DOW A;  1IZ6 A;  4RTZ A;  4JS5 A;  2LCL A;  4A4H A;  3J81 E;  4E7S A;  2O31 A;  3JCM b;  4OMF B;  3E9F A;  1Y0M A;  2RO0 A;  3JCM g;  2E3I A;  1RLP C;  3OMG A;  1VQ8 Q;  3CC4 A;  1AWJ A;  1X6O A;  2RQU A;  3LH0 A;  3CCU Q;  3CCE T;  2DXU A;  3PE0 A;  4M4Z A;  1G3W A;  1VQ6 A;  4PJL A;  3A8G B;  4QVZ A;  1QKX A;  2J06 A;  1QCO A;  3HRT A;  4N4G A;  2EAY A;  3G71 T;  4M77 E;  2GF7 A;  3A8L B;  3M9Q A;  1M30 A;  1NM7 A;  2PU9 B;  2JNG A;  2O88 A;  2BTT A;  1F1B B;  1WGS A;  1K1Z A;  1Q81 C;  1XJW B;  2HBP A;  2EYW A;  3ASK A;  2HZY A;  1YIT A;  3JCM c;  1MMN A;  4RTW A;  1SRM A;  2K7A A;  4OB3 B;  3VV0 A;  2CZ7 B;  1UGQ B;  2FL7 A;  3LX7 A;  3X25 B;  2CH4 W;  1QP3 A;  1PKT A;  2K5L A;  3L2Q A;  3JB9 I;  1S72 Q;  1K9M U;  2QEX Q;  1YJN Q;  4ZGE B;  1FYN A;  1ZQ1 A;  4PNO A;  2MIO A;  2Y4Y A;  2F5T X;  1W2B S;  1I1J A;  3QDF A;  3N5B B;  1KQ1 A;  3MP6 A;  1NJI U;  2JXB A;  1BI1 A;  5GAM j;  1TS9 A;  4Y92 A;  3SWN A;  2RJE A;  3JAM E;  3HRU A;  5CIU A;  4EDU A;  4FT2 A;  1PWT A;  3G1J A;  3P8H A;  1ZUY A;  2JMA A;  4N0A C;  5IHI A;  4M7A G;  2DK3 A;  1V29 B;  3CBO A;  4E6R A;  2FRW A;  2JZ2 A;  1GCQ A;  1KD1 R;  1JJ2 S;  3M4Y A;  2R5M A;  4DOV A;  3G7Z A;  2M0O A;  4BE2 A;  4MDX A;  4IUU A;  2P0P A;  1WHG A;  3VS2 A;  2M1H A;  8AT1 B;  2KT1 A;  3RKY A;  1A0N B;  1WJS A;  5AT1 B;  2LP5 A;  4E2F B;  2JUF A;  5GAO r;  4Z02 A;  4OB2 B;  1TH7 A;  1AVZ C;  1JRI A;  3IQL A;  1M1K U;  1E7O A;  1UGV A;  4J9D A;  3RUX A;  1Y07 A;  2WSF E;  5KYN A;  3KBG A;  1UGS B;  1YHQ T;  3EG2 A;  2FO0 A;  1M1G A;  3UPU A;  1VQM T;  3QG1 A;  3OYA A;  2DYI A;  4XU3 A;  1Q82 R;  4M75 E;  5GAN f;  1N6A A;  3CBP A;  4M7D G;  2MF2 A;  4O6J A;  5CO7 A;  1RI9 A;  1ZA1 B;  1G3S A;  1GBR A;  1QVG P;  3RR6 A;  1K8A U;  1N8R U;  2R5A A;  3CMA Q;  2KRM A;  2H3E B;  3HFN A;  2KYB A;  2GNC A;  3I56 Q;  3L2V A;  3JCM f;  5LJ5 j;  5KYU B;  2RI2 A;  3L2U A;  2DL5 A;  4OF1 A;  2KT8 A;  3QSU A;  2KK4 A;  2KAF A;  3JCM Q;  4ELZ C;  3M56 A;  4F7U E;  3OYY A;  4RG8 A;  3RMS A;  5DM7 R;  5KE3 A;  2DO3 A;  4F04 B;  2HBW A;  1H92 A;  4QKU A;  1I5L A;  3JV3 A;  3OSS C;  2VAS A;  1UHF A;  2CRE A;  4BDZ A;  1HK9 A;  2KR3 A;  1PD1 A;  1M9S A;  3HSB A;  1ABO A;  2DL4 A;  3LGL A;  1VQP Q;  4M78 C;  2GGR A;  5IHN A;  1QW1 A;  4LE9 A;  5GAN 2;  4KGX B;  1IB8 A;  1WXT A;  1U5S A;  4MZM A;  4EMK C;  4QQD A;  4BY6 C;  4DBF A;  1TOV A;  2FEI A;  2O4X B;  4JJC A;  2M9U A;  3VYG A;  1M90 C;  2DRK A;  4JLI A;  2CZ0 B;  1AHJ B;  2J6O A;  3U23 A;  4WTO B;  1VQ7 T;  1KFZ A;  4M78 B;  4FYX B;  3CCQ T;  1Q81 R;  3CCE A;  1RL2 A;  2BZ8 A;  4EMK B;  1VQ4 Q;  4LDV A;  3ZEH A;  4BY6 B; 
#chains in the Genus database with same CATH homology
 2AKK A;  2CUB A;  2RF0 A;  2EVR A;  2E5K A;  4KRT A;  2OAW A;  2O2O A;  1WXB A;  5IXB A;  3NPF A;  4X1V A;  2LJ3 A;  2JS2 A;  4J9F A;  1Z9Z A;  1B07 A;  1QWF A;  1YWO A;  2YT6 A;  2J7I A;  1RLQ C;  2C0O A;  1X43 A;  2AZS A;  3FJ5 A;  2CH4 A;  4EIK A;  2EW3 A;  3H41 A;  1T3S A;  2F2W A;  5IHK A;  1JU5 C;  2EGA A;  3C0C A;  3QWX X;  1CKB A;  1M3B A;  4RTU A;  1GBQ A;  4RTT A;  1UEC A;  1YWP A;  3M0S A;  2GTJ A;  1UJY A;  1ABQ A;  2FPD A;  2KEA A;  4OMP A;  4D8K A;  3RNJ A;  2JW4 A;  1M8M A;  1H3H A;  1UG1 A;  2DYB A;  2L2P A;  2RN8 A;  1Z9Q A;  1BB9 A;  2DL3 A;  4K11 A;  1OV3 A;  1OEB A;  2YSQ A;  1ZSG A;  1KSW A;  2AKL A;  1SHG A;  1T0H A;  1WFW A;  2D1X A;  3R6N A;  3VRZ A;  1WA7 A;  1K9A A;  1NYG A;  2HSP A;  4DEY A;  2QDL A;  1TG0 A;  1PNJ A;  1YP5 A;  2D0N A;  4J9G A;  5EC7 A;  3QWY A;  4RTY A;  2L3S A;  2L0A A;  1GFC A;  1AZG B;  2K2M A;  1AEY A;  4OMQ A;  4HCK A;  4JPB W;  2OI3 A;  4LN2 A;  1SEM A;  2C0T A;  4F16 A;  1WI7 A;  3TSW A;  1BBZ A;  2J6F A;  1KJW A;  1YN8 A;  4OML A;  2KE9 A;  3EHQ A;  4Z88 A;  4ZNX A;  4AFS C;  2LNH B;  4WCI A;  2SRC A;  3KFV A;  4R0K A;  4CC2 A;  1W1F A;  1PRL C;  2EGC A;  4JZ3 A;  1N5Z A;  1QKW A;  1UUE A;  1WLP B;  2EYZ A;  3REA B;  4HXJ A;  1CSK A;  2V1R A;  3NHN A;  1H8K A;  1NEB A;  2LQW A;  2C0I A;  4GLM A;  2CDT A;  1AD5 A;  4ORZ A;  2K6D A;  2ECZ A;  1V1C A;  2L3Q A;  2HDA A;  2DBK A;  2RMO A;  2LZ6 B;  1YNZ A;  2YUP A;  1GFD A;  5L23 A;  1NLP C;  2GBQ A;  1X2K A;  2CT3 A;  2DE0 X;  2ESW A;  3ZL7 C;  2VVK A;  1AWO A;  3O5Z A;  1K0X A;  3H0F A;  1X27 A;  2LX7 A;  1WDX A;  4HVV A;  4JZ4 A;  4J9E A;  2K79 A;  2F2X A;  3M0Q A;  1UHC A;  2I0N A;  1GCQ C;  1ARK A;  2MCN A;  3LH5 A;  4AFQ C;  2DX1 A;  3I9Q A;  2ENM A;  3PVQ A;  2PTK A;  1W6X A;  2KNB B;  3UA6 A;  1AWX A;  2LMJ A;  2YUQ A;  1BK2 A;  1KIK A;  2O9V A;  1CKA A;  1I0C A;  2EPD A;  1X69 A;  1NYF A;  1UE9 A;  2DF6 A;  1X6B A;  2V1Q A;  4OMN A;  4OMO A;  3M0R A;  2RQV A;  3EG3 A;  4RTZ A;  1E6G A;  2JM9 A;  2NUZ A;  3TVT A;  1OPL A;  4IIO A;  4AG1 C;  2O31 A;  2A08 A;  2CUD A;  1HSQ A;  2PZ1 A;  2SEM A;  1Y0M A;  2MOX A;  1RLP C;  1QWE A;  1JEG A;  2B86 A;  2FPE A;  1AWJ A;  2KRS A;  2VKN A;  2RQU A;  2D8H A;  1GRI A;  2RQR A;  3PE0 A;  2JM8 A;  4M4Z A;  2F2V A;  4CC4 B;  1QKX A;  2J06 A;  3VS4 A;  3VS1 A;  3M0T A;  2A28 A;  3I5S A;  5ECA A;  2HEQ A;  3GBQ A;  3THK A;  2FG0 A;  1M30 A;  1NM7 A;  1NEG A;  1QCF A;  1LCK A;  2O88 A;  4LUD A;  1BU1 A;  2BTT A;  2XMF A;  1MUZ A;  4LUE A;  2JT4 A;  1K1Z A;  1FMK A;  2J6K A;  4A63 B;  2EYW A;  1JXM A;  2EYX A;  2VWF A;  1WX6 A;  1G2B A;  3UAT A;  3ULR B;  1ZUK A;  3I5R A;  2M0Y A;  4RTW A;  2DA9 A;  1SRM A;  2K7A A;  2LJ0 A;  3EG1 A;  3VS6 A;  1E6H A;  1VYU A;  3VS0 A;  1MV0 B;  2BZX A;  1TUC A;  5FWB A;  4LNP A;  5I11 A;  5I22 A;  4Z8A A;  2G6F X;  2CH4 W;  1PKT A;  2GTO A;  4FSS A;  4J9I A;  2EQI A;  3TSZ A;  3UF4 A;  1UDL A;  1WIE A;  1YCS B;  1AWW A;  1FYN A;  1B3Q A;  2JMC A;  2MIO A;  4CC7 A;  1S1N A;  5GJW B;  1ZBJ A;  1I1J A;  1ZUU A;  2DL7 A;  1WYX A;  1W70 A;  3NMZ C;  2RNA A;  2LQN A;  2RQW A;  4D8D A;  2IIM A;  2JXB A;  2O9S A;  4J9B A;  4Y92 A;  4F17 A;  1K0S A;  1SSH A;  1SHF A;  3VS7 A;  3H0I A;  4AG2 C;  1VA7 A;  1PWT A;  1GL5 A;  1ZUY A;  2EKH A;  1OPK A;  2D8J A;  2JMA A;  2KBT A;  1PHT A;  5IHI A;  1HD3 A;  4E6R A;  2AZV A;  2FRW A;  2L3P A;  1GCQ A;  1JQQ A;  2KYM A;  2LCS A;  1U3O A;  2FPF A;  2JS0 A;  3A98 A;  4JJB A;  4HVU A;  2HCK A;  2EYY A;  3CQT A;  1OOT A;  2H8H A;  4ESR A;  2ROT A;  2EBP A;  2CT4 A;  3VS2 A;  1JXO A;  1MV3 A;  2EGE A;  2KT1 A;  3VS3 A;  1A0N B;  2DIL A;  3PVL A;  3UA7 A;  2LP5 A;  3VS5 A;  1VYT A;  2CSQ A;  1SRL A;  1WXU A;  1AVZ C;  1M27 C;  5FW9 A;  2M51 A;  2ABL A;  4F14 A;  3I35 A;  3IQL A;  1PRM C;  1E7O A;  1UGV A;  4J9D A;  2X3X D;  3NGP A;  1NLO C;  1EFN A;  2A36 A;  3EG2 A;  5GJV B;  2FO0 A;  1U06 A;  2DRM A;  1SPK A;  3VRY A;  3M0P A;  2J05 A;  3RBB B;  1IO6 A;  3REB B;  3EHR A;  4J9H A;  2OJ2 A;  1T0J A;  1K76 A;  5HCK A;  2KRO A;  1PKS A;  4DEX A;  2AK5 A;  1GCP A;  1I07 A;  4RUG A;  4OMM A;  2K9G A;  1Y57 A;  1UFF A;  2YDL A;  2P4R A;  1RUW A;  1RI9 A;  2RQT A;  1TUD A;  1VYV A;  1GBR A;  4IIM A;  2YUO A;  2KRM A;  1X2Q A;  4CC3 A;  2KYB A;  2W0Z A;  2GNC A;  4JJD A;  2JTE A;  2FRY A;  2DL8 A;  1K4U S;  2LJ1 A;  1JO8 A;  2KGT A;  2DL5 A;  4J9C A;  4AFZ C;  2KT8 A;  1AOJ A;  1QLY A;  1UTI A;  2DJQ A;  2PNI A;  2BZY A;  2ED1 A;  4Z89 A;  2HBW A;  5FWC A;  2GQI A;  1H92 A;  2ED0 A;  2ROL A;  3JV3 A;  4HVW A;  4RTV A;  1NG2 A;  1UJ0 A;  1UHF A;  2CRE A;  2X3W D;  3H0H A;  4GBQ A;  3SHW A;  3EGU A;  2KR3 A;  2KRN A;  4RTX A;  2A37 A;  1XOV A;  2DVJ A;  3EG0 A;  1ABO A;  2DL4 A;  2DNU A;  5IXF A;  1G83 A;  1J3T A;  2DM1 A;  2YUN A;  2GGR A;  5IHN A;  4LE9 A;  2DLP A;  1WXT A;  1U5S A;  1X6G A;  1HJD A;  1M3A A;  2DBM A;  3M0U A;  2FEI A;  2CSI A;  2W10 A;  4JJC A;  4QT7 A;  1ZX6 A;  2DRK A;  1T3L A;  2NWM A;  2J6O A;  2K3B A;  3U23 A;  1KFZ A;  2KXC A;  3SEM A;  5IH2 A;  2KXD A;  2DMO A;  4AFU C;  2BZ8 A;  1ZLM A;  1M3C A;  2RPN A;  1AZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...