2FRYA

Solution structure of the third sh3 domain of human nck2 adaptor protein
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
61
structure length
61
Chain Sequence
GSHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight into the Binding Diversity between the Human Nck2 SH3 Domains and Proline-Rich Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Cytoplasmic protein NCK2
total genus 3
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fryA00
1WLPB 2J05A 1X2QA 1K76A 2DYBA 1YN8A 4FSSA 2I0NA 3LH5A 3O5ZA 3VS1A 4RTYA 2O31A 2D8HA 1PRLC 2F2VA 1OPLA 1NEBA 2K3BA 2EYWA 2CH4A 1K0XA 3CQTA 1SSHA 2D8JA 1PNJA 2DVJA 1WFWA 1ZSGA 5GJWB 3EG3A 3ULRB 1K1ZA 2DL3A 3M0RA 3UA7A 1QKWA 2V1QA 1NYFA 1UHFA 1NLOC 5IXFA 3M0QA 2KGTA 1BBZA 4Z88A 2FPFA 2GTJA 1T3SA 3VS7A 4J9BA 3I5SA 2EKHA 1SRLA 2RNAA 1SHGA 5IHIA 3VRYA 3A98A 3SHWA 2JXBA 3EHRA 2L3QA 1AD5A 5IHKA 2ROLA 1X6BA 1UFFA 2KYMA 1LCKA 2KXCA 1IO6A 1GBQA 4RTTA 4RTWA 4J9EA 2GNCA 2LCSA 2A37A 3NPFA 3H0FA 2PNIA 1K9AA 2M51A 2KRNA 1YCSB 3VS0A 4AG2C 3PVLA 4QT7A 1UUEA 1OPKA 1KJWA 1HD3A 1QLYA 2FRYA 2DE0X 2VKNA 4IIMA 3U23A 2LMJA 2SEMA 2VWFA 4CC2A 2HEQA 5FWCA 2RQTA 2DX1A 2JM9A 2PTKA 4DEXA 4JJBA 1WIEA 1X43A 1WYXA 1GRIA 1XOVA 1AVZC 2LQWA 2JTEA 1X6GA 2JMCA 1ZUUA 4Y92A 2OAWA 4JZ4A 1I0CA 1SEMA 2EW3A 1PKSA 3RBBB 2DL8A 2L2PA 2FO0A 1QCFA 3R6NA 4RTXA 1EFNA 5ECAA 1B3QA 1W70A 2HCKA 1WDXA 2C0OA 4LE9A 1TG0A 4JPBW 2NWMA 1K4US 1OOTA 2KNBB 3GBQA 1U3OA 1MV0B 3ZL7C 4K11A 4RTZA 1UHCA 2GGRA 3VS2A 1NLPC 4J9FA 2CT4A 2J6FA 2K6DA 1UG1A 2KEAA 1WA7A 2KXDA 1JXMA 3M0TA 1ABQA 3TSWA 2CSQA 1K0SA 2LNHB 4JJCA 2EGEA 2FPEA 2SRCA 4J9GA 5FW9A 1YWPA 3TSZA 2KRMA 2EGCA 2FEIA 1HSQA 1T0HA 4HXJA 2MIOA 2EYYA 1JEGA 4CC3A 1Y0MA 4AFSC 1X69A 2RQWA 4OMOA 2RF0A 3M0PA 1OEBA 1JQQA 2DL4A 2DF6A 1YP5A 2H8HA 1NG2A 1GBRA 4A63B 3VS3A 2KT8A 2HDAA 1RUWA 1AWOA 1M8MA 2O9VA 2YUPA 4RUGA 3H0HA 2FG0A 2AKKA 1UJ0A 2OJ2A 3KFVA 1U06A 3M0SA 3PE0A 2K9GA 2DJQA 1WXBA 2DM1A 3VS4A 2P4RA 1VYTA 1T0JA 2GQIA 4J9CA 1PKTA 1E6GA 1M3CA 1UDLA 2LP5A 1S1NA 3I5RA 2RQUA 2C0TA 5FWBA 1Z9ZA 1T3LA 2BZ8A 1RLPC 2O88A 2YSQA 4LUDA 2LX7A 1VYUA 1I1JA 2DL5A 2MCNA 1Y57A 2K2MA 1WXTA 1SHFA 2LJ3A 2KYBA 3UA6A 4GLMA 3VS6A 2YUOA 1E7OA 2EPDA 2IIMA 3TVTA 1RLQC 2DL7A 1AZGB 2J06A 2JM8A 4EIKA 1AZEA 2BZYA 1HJDA 4GBQA 1A0NB 3THKA 2KROA 1AWJA 2HSPA 4D8KA 2FRWA 4M4ZA 2O9SA 4RTUA 4CC7A 2K7AA 1ZUYA 2F2WA 3QWXX 2GBQA 2A28A 1UECA 1FYNA 1ZX6A 4AFUC 2CUDA 2NUZA 1SRMA 4D8DA 2LJ1A 4WCIA 2X3WD 4LUEA 3EHQA 3EG1A 1Z9QA 2KRSA 1CKAA 1AEYA 1X2KA 2DRKA 4F14A 5EC7A 2J7IA 4AFZC 3NMZC 1MV3A 2DNUA 2EQIA 2DBKA 4J9HA 1AWXA 4CC4B 1ARKA 1G2BA 4HVUA 2BTTA 2DA9A 3VRZA 4J9DA 2XMFA 4ZNXA 1GFCA 2W0ZA 2F2XA 2JW4A 5IHNA 4J9IA 2M0YA 5L23A 2CH4W 2ABLA 3NHNA 1GL5A 1PRMC 1W6XA 5GJVB 2CUBA 2RPNA 1KSWA 2A08A 1I07A 4LN2A 3H41A 2BZXA 2O2OA 1QKXA 3RNJA 1SPKA 1VA7A 1QWEA 2L3SA 1TUCA 2OI3A 3SEMA 4HVWA 4Z8AA 1N5ZA 2CSIA 2DBMA 2K79A 5I22A 1V1CA 2ROTA 3M0UA 2KBTA 2DMOA 4JZ3A 3NGPA 4IIOA 3EG0A 1UJYA 2EVRA 2A36A 1NEGA 3UF4A 2G6FX 2W10A 3REAB 1NYGA 4KRTA 2KR3A 2KT1A 2ECZA 2KE9A 1W1FA 3JV3A 2C0IA 5HCKA 1NM7A 2CDTA 1PHTA 2J6KA 2EBPA 1UE9A 2L3PA 4F17A 1H92A 2YDLA 2L0AA 1AOJA 1JXOA 1KIKA 4DEYA 2AZSA 2YUQA 2EGAA 2JMAA 4F16A 4OMPA 2D0NA 3EGUA 2PZ1A 2RN8A 2DRMA 3FJ5A 1X27A 1M3BA 2AZVA 1ZBJA 2MOXA 1RI9A 1ABOA 1KFZA 1B07A 4E6RA 1H3HA 2FPDA 1CSKA 2ESWA 3I35A 1H8KA 3C0CA 2AKLA 2EYXA 1GCQA 2B86A 2RMOA 4X1VA 1M27C 1ZUKA 4OMLA 4OMNA 1TUDA 2JT4A 1M30A 4OMQA 2ENMA 3H0IA 3PVQA 4R0KA 2YUNA 2J6OA 1FMKA 1U5SA 4AFQC 3EG2A 4AG1C 2ED1A 2GTOA 3QWYA 1G83A 1UTIA 2RQVA 4HVVA 4OMMA 1GFDA 4ESRA 2AK5A 2QDLA 1CKBA 1BK2A 2LJ0A 2JS0A 1PWTA 1MUZA 2VVKA 1GCQC 1YNZA 2JS2A 1UGVA 2D1XA 3REBB 1VYVA 1JO8A 3VS5A 1BU1A 5IXBA 2DILA 2RQRA 1OV3A 5IH2A 4JJDA 2E5KA 1AWWA 1WI7A 1M3AA 3UATA 2LQNA 3I9QA 2HBWA 4Z89A 1YWOA 1ZLMA 4RTVA 1E6HA 1QWFA 2EYZA 2YT6A 4LNPA 1BB9A 4HCKA 5I11A 2CT3A 1WX6A 2DLPA 4ORZA 2CREA 2V1RA 1WXUA 1GCPA 1JU5C 1J3TA 2LZ6B 2ED0A 3IQLA 2X3XD
chains in the Genus database with same CATH superfamily
1B34A 2BIVA 1I8FA 2J05A 3QKJA 3SFMA 3CCQT 2DFUA 5KCOA 1M9SA 2I0NA 4N4HA 4C0DC 3LH5A 3VS1A 3I55A 2I2LA 3PFSA 2QTXA 2CH4A 3BDUA 2RHIA 1ZSGA 1VIFA 3EG3A 3ULRB 4LDVA 2DL3A 1VQNA 4XU3A 2V1QA 3AHUA 1VQMA 1M1GA 2AHJB 1QVPA 2QQAA 3M0QA 3RKYA 4Z88A 1T3SA 3A8LB 3QPHA 1Q7YU 3VRYA 3CBOA 2XDPA 3SHWA 2JXBA 3C4SA 1C0MA 2VC8A 3EHRA 5LJ3h 4MZMA 3X24B 3DLMA 1TTHB 4JRPA 4EMKA 1X6BA 2X35A 1RAFB 1IO6A 2QYZA 1N27A 4J9EA 2GNCA 2QXFA 5CR2A 1Q82R 1YHQT 3HRTA 3NPFA 3H0FA 2PNIA 1K9AA 2E64A 3CPWP 1K9MR 4BI4A 5FU7C 3PVLA 4OF1A 2COYA 5D7UA 1VQ8A 1QLYA 5KE2A 3MCAB 2H3JA 5FWCA 4FYXB 5GANd 4LD9K 4DEXA 1V76A 4M75E 1YJNA 4MDXA 1AVZC 1KHCA 4QQGA 4C92D 2JTEA 2RD1A 3LX7A 4EMHA 4JZ4A 1SEMA 3OA6A 1BIAA 4A4FA 2EW3A 1K8AC 3LWIA 3PMIA 3JCMV 1VQ8Q 3R6NA 1D3BB 4RTXA 2DD4A 1K9MU 1B3QA 1WHGA 2DXBA 5GAOn 2HCKA 3QO3A 1WDXA 2C0OA 4RCBA 3V7CA 2VB6A 1TOVA 1OOTA 4JRQA 3ZL7C 3CC2A 2K57A 5GANh 1QVFS 1N8RR 2KXDA 3JCMd 3TSWA 4PJOA 2LNHB 2GQVA 4JJCA 2RHZA 1LJOA 2FPEA 4C0GA 2EGCA 1HSQA 1T0HA 5A0GA 3A8HB 5GANf 3CCSQ 4HXJA 5LL6S 2EYYA 2QQ9A 1PM3A 3JSCA 5FU6C 4CC3A 4IUVA 4LDWA 3G6EA 4M75B 2FVUA 3UDCA 3M0PA 2HBPA 1OEBA 2DL4A 2H8HA 1GBRA 4BE0A 3QZ5B 2HDAA 1RUWA 1IGUA 2V26A 1S72T 1KQ1A 3WVDB 2E12A 3KFVA 1U06A 5GAMg 3T9NA 2DJQA 1WXBA 4C5EA 5GAMd 2DM1A 2QGFB 5DLQE 1VQ7A 3G6EQ 4A53A 2FHDA 5CVIA 3M54A 3TU4K 4BB7A 1YJWT 2LP5A 3QIIA 4Z02A 2PVGB 3MP1A 2E4HA 3LGFA 5GAMf 5CCAA 4C8QB 2O88A 3SDZA 2NYSA 1VQ5A 2KAFA 4LUDA 2LX7A 3BW1A 3CD6A 3JCMf 2RJEA 2V8KA 2EPDA 1RLQC 1VQPT 1AZGB 1Q86R 3L1AA 3OYHA 2ZGWA 1AWJA 4D8KA 2FRWA 1VQKQ 5GMKl 4J83A 1B7TA 4RTUA 1YITQ 2F2WA 3MJXA 5HK0A 2A28A 3GOXA 1WJQA 2RHUA 3CCMA 1G3YA 4NL2A 1VQ5T 4AFUC 1N9RA 1N6AA 2LJ1A 2LDMA 3CCVQ 4WCIA 4LUEA 1NJIR 3I55Q 2OAUA 2R5AA 3EGDA 1VQ9T 1VQKT 2KRSA 4C8QC 5EC7A 4FW1A 4KGVB 2P4TA 4MMKA 4MZPA 3RKWA 2OTJA 4XTVA 3M53A 2DNUA 3FRNA 2EQIA 1WQWA 4J9HA 1AWXA 2M1HA 4C8QA 3TEEA 3KXTA 2VXEA 1GFCA 3MEWA 4LDYA 5HK3A 1M8VA 2CP0A 4JRKA 3M56A 2QEXA 2XHCA 3L2WA 2F5TX 2CH4W 5CO7A 3NHNA 1PRMC 5GJVB 2CUBA 3NTHA 4HCZA 2A08A 2CP3A 2VGMA 2Y4YA 4ZN1A 2DKGA 5CQYA 4FCYA 1QWEA 1UGSB 1I5LA 4JS4A 3EAEA 3JCMW 4X9DA 1N5ZA 2KY9A 3RMSA 2QQRA 2CSIA 3OW2S 2DBMA 2K79A 2BKDN 2E41A 2BE9B 4PL6A 2KBTA 2DO3A 2G3RA 3OYCA 2E10A 3EG0A 2E6NA 1K73R 2OTLA 1LOJA 1QVGS 3REAB 3EFRA 1NYGA 1NPRA 2KR3A 1W1FA 3JV3A 3E9GA 3CBMA 1JJ2P 1AOJA 4DEYA 2YUQA 3CCRT 4OGCA 2VASA 2CYZB 4C5HA 2RN8A 3PIOA 3M58A 4RG8A 1RI0A 4N0AA 4M78C 4OMFB 2MOXA 1D3BA 2EKOA 1KFZA 3DLLA 4BE2A 4E6RA 3QDFA 3QBYA 2V8JA 2D0QB 3S3MA 2CZ1B 1H3HA 1WHKA 3CPWS 1CSKA 2ESWA 3I35A 5GANe 2WSEE 2EYXA 2HQEA 2X4YA 2IPOB 1M27C 3PT9A 4HKEA 3VJPA 2YUNA 5FRNA 5J26A 2EQKA 3CCQQ 1KD1C 3M4YA 1G5VA 4AFQC 4AG1C 2RQVA 2MMPA 1O9SA 3OS2A 1X6OA 2DVEA 3JB9D 1D09B 3CC4A 2JS0A 2VXFA 4E7JA 5D6XA 2QAZA 2D1XA 2YLCA 3RMQA 1VYVA 5L8RE 3R6OA 2RQRA 1Q82U 5HY6A 5I2MA 4C5IA 2BE7D 1D1CA 2HBWA 2HD0A 4A4HA 1E6HA 4M77C 3MP8A 2FZCB 3V8JA 1PC0A 1NJIC 4M75C 4LDXA 4OB2B 1C1AA 2PQWA 2V1RA 1GCPA 1JU5C 3AT1B 5GMKi 2LZ6B 2ED0A 1W2BA 3RUXA 4RCCA 4KUDK 3LWHA 3M59A 1Y96A 1Y96B 1WLPB 2D9TA 4FSSA 1QP3A 4B6MA 3SWNB 4RTYA 4J6WA 5A0DA 2M0OA 2WSCE 3PGGA 1K0XA 3CQTA 1TH7A 1N8RU 1PNJA 1WFWA 3CXCA 1RL2A 1X75C 1PG5B 4FM4B 4OB3B 1MMNA 3M0RA 5CQXA 3CCVA 2DAQA 1QKWA 1EZZB 2DXCA 1UHFA 2RJFA 4FYWB 2Y4XA 5KYYB 2RH2A 4F7UF 2X4WA 5CKDA 5KYUB 1SRLA 1WHMA 5IHIA 1ZA2B 3A98A 3BDLA 3F70A 1MHNA 2LX9A 2DTIA 3BE3A 4M77D 4F7UG 2DTOA 2QDYB 1LCKA 3INZA 2KXCA 1GBQA 4QVCA 4RTWA 4E47A 2QK0A 2ZPGB 3OB9A 1YCSB 1VQPQ 3ME9A 2CP7A 1W2BP 4QT7A 1UUEA 4BDZA 1OPKA 1HD3A 2FRYA 1WHJA 2DE0X 4DBFA 2LMJA 2OX7A 4CC2A 4M75F 2HEQA 2RQTA 2FZKB 2JM9A 4M75A 4DA4A 3CC7A 3OMGA 5IN1A 4WTOB 1UGPB 1KC8R 1KQSP 2DIGA 1WYXA 2LQKA 2PVDB 3JCMh 1X6GA 2JMCA 4M78A 1NE8A 3VYGA 5GMKe 5KYXB 1I0CA 3EG9A 1PKSA 2DL8A 2OTLQ 1D1AA 2XDDA 1HYOA 3S6WA 3NFCA 2K5FA 1FX7A 3V8LA 1TG0A 5LJ3d 3ER0A 3LGLA 2EJ9A 2NLUA 4PLIA 1Q82C 3GBQA 1U3OA 2QASA 4K11A 2GGRA 2JNGA 1NPPA 2CS7A 1NLPC 1BCOA 4J9FA 2J6FA 1UG1A 1WA7A 1M1KR 1JXMA 1ABQA 1BYMA 2EGEA 2OTJT 1YWPA 3TSZA 1MMGA 2KRMA 3OYIA 4OP0A 5FLXE 3OY9A 5CKBA 4C92C 4KBMB 1M2OA 1Y0MA 1VQ6A 4AFSC 4D6WA 4J7FA 4M7DA 1MNDA 1YIJA 4OMOA 4DBQA 4M7AE 1Q81C 4EDUA 2DF6A 1YHQQ 4M7AB 4GY5A 2EQMA 1TWBA 2KT8A 1AWOA 2O9VA 3P8HA 3G4SA 5KYNA 1MNEA 2L8DA 5GAMh 3P8BB 2DERA 2K9GA 4BY6B 2ZZDA 1KQSS 1VQ6Q 3EH1A 3A8GB 3X25B 2GQIA 4J9CA 2YHTA 1E6GA 4ANJA 3JCMQ 1M3CA 1QVGP 3CMEA 3NTKA 3I55T 2XDBA 2RJCA 3FC3A 1VIEA 5LJ5e 2CZ0B 3CCQA 4R56A 5FWBA 1H641 2BZ8A 1VQOA 2QA4A 3G4ST 3OW2P 1VYUA 2XICA 3G71Q 1I1JA 1LPLA 2MCNA 1Y57A 1M90R 1WXTA 1QP2A 3TCJA 4C8QF 3L2RA 3UA6A 1IHVA 2YUOA 1E7OA 1VQ5Q 1VQ7T 3TREA 4EIKA 3THKA 2XU8A 4M4ZA 2O9SA 3Q1JA 2K7AA 1ZUYA 2FZGB 2GBQA 1OU8A 2GF7A 1FYNA 3EH2A 1B34B 1IB8A 2NUZA 2XD0A 3OS1A 3L42A 1M2VA 2CP6A 4AT1B 2X3WD 3EG1A 1Z9QA 4DQ2A 1CKAA 2GFAA 5GAN4 2KI7A 5LJ5f 2J7IA 5I2SA 2Z0WA 3NMZC 1PCXA 4HT9A 3MKDA 4J6XA 4PJMA 2BTTA 3VRZA 4M77B 4J9DA 2XMFA 3JB9G 2W0ZA 4JDSA 3OYKA 4FW2A 1LNXA 2K3YA 2JW4A 4PNOA 3FEOA 3CC7T 4PJOE 1BI0A 2ABLA 1W6XA 4FSXA 2QEXQ 4LN2A 2DTHA 2KQWA 3M5AA 4RMOA 5GAN8 2ZPEB 1SPKA 1VA7A 3SWNC 4BI8B 4ELYC 5GAOr 4Z8AA 4QVZA 1M2VB 5I22A 1G3TA 2ROTA 4FYVB 3MO8A 4AMCA 5CK9A 4JZ3A 4IIOA 4MMLA 1U1SA 2EIFA 1QCOA 3HL8A 2LC4A 2O01E 4J5YA 1VQ8T 5GAOm 1NEGA 2G6FX 1KC8C 4L5GA 4M77E 2KT1A 3CEYA 1RAHB 5HCKA 4C92G 1BCMA 2CDTA 2KMTA 2Y90A 2J6KA 2EBPA 1UE9A 2L0AA 2ZAEA 1AT1B 2A3LA 2K3XA 1KIKA 3P8DA 2AZSA 1SF9A 4PJOF 1IRXA 4E7IA 2VV5A 3CCJT 4OMPA 2D0NA 3EGUA 2PZ1A 3OYFA 2HSEB 5KH6A 3CC4T 4JS5A 1M3BA 4PJOG 2AZVA 3CCSA 1YJ9Q 4HCBA 1ZBJA 1RI9A 4JLIA 4L6V5 1B07A 1D1BA 2DPPB 3CCJA 4PJLA 4PFZA 1OZ3A 2FPDA 4PJNA 4C0DB 2R5MA 2C06A 2AKLA 2CZ7B 2RMOA 3PIPA 5CKFA 1G3WA 4OMNA 2CZ6B 2JT4A 1YJ9T 2ENMA 3H0IA 3PVQA 3FDRA 4JLGA 4R0KA 4FT4A 3A8OB 3OYAA 3L2UA 3EG2A 2DXTA 1QW1A 3M57A 4OMMA 3CMET 7AT1B 1YCYA 3G6ET 4ESRA 3CD6T 1QQJA 1UEBA 3LLRA 1GXIE 5IT9E 2LJ0A 4FT2A 3HSBA 4M7DC 2VVKA 1GCQC 2JS2A 4C92E 3MEUA 3REBB 2CKKA 1BU1A 5IXBA 1WGSA 1OV3A 1XQHA 5IH2A 2YRVA 3L2ZA 2E5KA 1TU0B 3UATA 3DKMA 4NL3A 2E65A 1K9MC 4Z89A 3QDRB 1ZLMA 9ATCB 2EYZA 2HQXA 4M7DF 2YT6A 3JAME 4HCKA 2CP2A 3RKXA 2CT3A 1WX6A 2DZ9A 4ORZA 3CXCS 1U8RA 2A0FB 2DZCA 1I5OB 1WXUA 1ZQ1A 4EMKB 2QQSA 3EG9B 1JJ2S 2KK4A 3JB9J 3OYGA 3DB4A 2QTVA 1X2QA 2EAYA 1K76A 2DYBA 1K8AR 1YN8A 3EFOB 1PSEA 1Q95G 2O31A 3OBWA 4BACA 2F2VA 1OPLA 3GP8A 1NEBA 4M78G 4V2SA 5M9OA 1HXDA 2D8JA 5FRMA 5GJWB 1Q86C 2M16A 4NS5A 1OZ2A 2QEXT 3OYMA 4M78F 3EGXB 3RIRA 5IXFA 2RJDA 5GMKj 2KGTA 4ELZC 1Q7YC 4OVAA 3VS7A 4J9BA 3I5SA 4XTYA 5C0MA 1N8RC 2OTLT 2HMAA 4ZTJA 5DLOA 3KBGA 1JRIA 3CPWA 6AT1B 2L3QA 4IUUA 2HNIA 4IURA 1AD5A 5IHKA 2ROLA 1UFFA 2KYMA 1VQNQ 2MAMA 3UPUA 4RTTA 5FU6B 3BFMA 1VUBA 5GAOl 2NUPB 2A37A 3S3NA 2M51A 2KRNA 1TXQA 2ATCB 3JB9I 3CXCP 3VS0A 2MF2A 4AG2C 3OYLA 2VKNA 4IIMA 3U23A 4EMGA 1WNLA 3SB2A 2DX1A 1KQ2A 1KG1A 2PTKA 4F7UA 4JJBA 1WHLA 1WIEA 1X43A 4M78E 4A4GA 1XOVA 4M77A 4Y92A 3CC7Q 2OAWA 4J6YA 2CP5A 4HCCA 2FO0A 4O5VA 2O4XB 4X9CA 1EFNA 5DY9A 1VQ6T 2ZPBB 3H6ZA 3CCLT 5KYYA 2L5QA 1RAGB 4JPBW 4OGEA 1JBMA 2NWMA 3QXEB 1K4US 3CCRQ 2DJZA 2MWOA 1YJNQ 2EJFA 4RTZA 1UHCA 5CKEA 4Q5WA 2FYKA 2CT4A 1G3SA 2K6DA 1AHJB 2KEAA 1M1KU 4XQ3A 2R58A 2CSQA 2EFIA 2GFUA 4PFOA 5FW9A 4J9GA 3CCLQ 1KQSA 3V8KA 2GCXA 2RHYA 2FEIA 1YIJQ 2M02A 2F5KA 2COWA 1JEGA 2KVQG 1Q7YR 3JCMX 4B9WA 2LRQA 1D0YA 3OYJA 1YP5A 3RERA 1YITT 4A63B 3VS3A 4M7DD 3CC4Q 3JCMb 5CIUA 3HP9A 1M8MA 2YUPA 4N4IA 4QQ6A 3E2UA 4M75G 5GAN5 3MEVA 1YHQA 2OJ2A 2ZCFB 4C0FA 3M0SA 3PE0A 2DXUA 3VS4A 3HRUA 2P4RA 4B9XA 4PLLA 1OYXA 1PKTA 3MP6A 3JCMc 2CGHA 2JVVA 2JJ9A 5IAYA 1EX4A 2RI5A 2XIDA 2RO0A 3I5RA 2C0TA 1T3LA 1YITA 3CMEQ 1RLPC 4QW2A 3GNGA 4DOVA 1QCNA 1S72A 4M7AA 1C6VX 2LJ3A 2P0PA 4GLMA 3VYHB 3VS6A 4M78D 4WF2A 2YLBA 1I4K1 1ZA1B 2DL7A 4C8QE 2JM8A 4TVRA 1AZEA 1RAEB 2BZYA 1HJDA 4C92A 1IGQA 1A0NB 1M90C 2KROA 4E7ZA 2HSPA 1BI1A 2PVOB 2PUKB 4CC7A 3LYIA 1UECA 1S72Q 1ZX6A 4KUIA 4PFPA 1VQ4Q 3CCEQ 1SRMA 1O75A 1RAIB 1X01A 5HKCA 3CC2T 3G7ZA 3EHQA 2L89A 3HPWA 8AT1B 3OS5A 4C0ZA 1X2KA 2DEQA 2DRKA 3LH0A 4F14A 2EWNA 2ZPIB 4OB0B 4IUQA 2DBKA 3VV0A 1IZ6A 4VUBA 4HVUA 2DA9A 4M78B 2X4XA 3TQ7P 3OSVA 1VQLQ 5GAOp 1P92A 2HKNA 4J9IA 4IKFA 2M0YA 5L23A 2DIQA 1R8OB 3ASKA 3JB9H 3OSSC 2KSSA 2QQBA 1Q86U 2RPNA 1KSWA 1I07A 3C94A 1TUGB 2OTJQ 4KT0E 4M77G 3WVEB 3A5ZB 3S3OA 2K2VA 4RG2A 1VQMQ 1QKXA 3RNJA 4C8QG 2L3SA 4DOWA 2COZA 3EGDB 2IG0A 4XTWA 4HVWA 3CCVT 1OI1A 5CKHA 3A1PA 4QVDA 1WZOA 4LXCA 1R0CB 3M0UA 3JRZA 2DMOA 2EYQA 2RA2A 3NGPA 1BIBA 5D6WA 3OYYA 3RESA 3E9FA 2A36A 3CCST 3UF4A 4BDYA 2LCCA 1HK9A 2ECZA 4XTXA 4YTLA 4CI0C 1NM7A 2JTFA 2XG8D 2B8AA 1PHTA 2F1LA 2L3PA 3MPUB 3I56A 1H92A 5DM7R 1YJNT 2DK3A 1OQKA 3MHXA 2JMAA 1IREB 1M1FA 4F16A 4O6JA 2K4YA 1N9SA 1KK7A 2HKQB 2LVMA 1WJSA 3JB9F 3M4GA 1R77A 3D7SB 4XU0A 3EFSA 1YI2Q 2P0QA 4F04B 3I56Q 3JCMP 2DYIA 1SSFA 2AIRB 1ZHIA 1DJ7B 1H8KA 2QGGA 3CMAA 3C0CA 1WQ7A 3J7AF 2B86A 3X28B 2JTMA 3CCRA 4OMLA 1ZUKA 1TUDA 3PTAA 3CC2Q 1M30A 1D0ZA 4OMQA 2QG9B 2ZPHB 1H3ZA 3JCMg 1SG5A 1FMKA 2VUBA 2GTOA 1BI2A 1G83A 4HVVA 1GFDA 1D0XA 2QA4Q 2AK5A 3L2VA 1YIJT 1CKBA 2E3IA 1WPYA 1EIFA 5LJ5d 5LJ3j 1BI3A 2DEUA 1MMDA 1PWTA 5KE3A 1MUZA 3CMAQ 4HA8A 3VUZA 2QI2A 1JO8A 4A4KA 2HL3A 1K8AU 4C92F 4OB1B 4PJOB 4JJDA 1AWWA 3RR6A 1WI7A 1M3AA 4GLKA 2LCLA 4JRIA 2LQNA 3V7SA 4KULA 1XJWB 5GAN6 4QQDA 4RTVA 4LNPA 2RI2A 2MI6A 2X9HA 3VUBA 4KH0B 3M9QA 3QUIA 1VQ7Q 2LQ8A 3CCUA 2CREA 1XNIA 5GAN2 1KC8U 3ZBDA 2L3RA 2YWWA 2K5LA 1J3TA 4E2FB 3VKIA 4ZN3A 2X3XD 2A7YA 5AYFA 1VQ9A 2E5QA 2JZ2A 2WACA 2E3HA 3O5ZA 5A2QE 2RB6A 2D8HA 1PRLC 4MZTA 4E7LA 2E1HA 3E1SA 2K3BA 3GPLA 2EYWA 4PJOC 1SSHA 4EMKC 4PJOD 1W4SA 2DVJA 2JOYA 1VQ4A 5D6YA 1K1ZA 2FL7A 3UA7A 4BE1A 1NYFA 2MWPA 1NLOC 5KYXA 1VQ9Q 1Y7XA 1VQPA 1BBZA 2M9UA 2FPFA 2GTJA 5AT1B 2EKHA 2RNAA 1PD1A 1SHGA 4QKUA 3H8ZA 3QG1A 3PMTA 3OW2A 1NZ9A 1VQLA 3I56T 1TS9A 2LCSA 4M7DG 4CRIA 3UT1A 1YJWA 3URGA 4R55A 1RAAB 1FXXA 5GMKm 4XTZA 2E70A 1KJWA 5LJ5g 4IUPA 1FMVA 2LNVA 1KD1R 2EQJA 2SEMA 2VWFA 2V8IA 3N5BB 4RKUE 1G8XA 3ZEHA 4ZGJB 3QJ6A 3META 2DETA 4ATOA 2ZPFB 1GRIA 4KH1B 5KYUA 1VQOT 2LQWA 1ZUUA 2JN0A 1UGQB 3RBBB 2L2PA 1QCFA 3CCUT 1Y71A 2EQUA 1YBYA 5ECAA 4KGZB 1W70A 4LE9A 4EPCA 3FB9A 4PKCC 1YJ9A 2KNBB 1MV0B 4XAXB 3VS2A 4ZGEB 3SWNA 4M75D 2O4XA 3OBYA 5LJ5j 1U1TA 3M0TA 4II1A 1Q81U 1K0SA 4F7UE 3OYEA 2XKOC 4XU2A 2SRCA 4FL6A 2MIOA 4M7DE 2RK1A 4NOYA 1MGQA 1IXDA 3OS0A 5KYWA 2E6ZA 4JJNK 3LW5E 3M55A 3CCLA 4BUGA 4F7UB 1X69A 2RQWA 2RF0A 2FB7A 2HQHA 2RM4A 1JQQA 3HFNA 2LTOA 3A8MB 1NG2A 5J39A 2YRCA 1RADB 4C8QD 4RUGA 4BI3A 3C95A 1YI2A 3H0HA 2FG0A 3CMAT 2AKKA 1M5Q1 4ZGDB 1UJ0A 4MDWA 4ME7A 2P84A 3CBPA 5GAN7 2R57A 2RK2A 3OQ5A 3DB3A 2HZYA 4E7KA 1VYTA 1T0JA 3ZFJA 1V29B 1OX8A 1UDLA 4ZTFA 1QVFA 5GAOq 3X20B 1RACB 1S1NA 2YXYA 4N4GA 2RQUA 4X34A 5J3BA 1Z9ZA 2YSQA 1OX9A 2EJGA 2DL5A 2K2MA 1SHFA 2BUDA 5GANg 2KYBA 1F1BB 1LVKA 3E19A 2X51A 3JCMJ 3OYBA 2IIMA 1VQ4T 3TVTA 1VQKA 4Y28E 4XTUA 2J06A 3FIFA 3CD6Q 4GBQA 2F69A 1VQMT 3G1JA 5KCHA 2NUTB 4C92B 5I21A 1NBEB 3QWXX 3CCEA 4HT8A 1VQOQ 4M7AG 4A4EA 4KGXB 8ATCB 3G71A 1ZSZA 2CUDA 4D8DA 3HTRA 1Q81R 3CCUQ 1VQLT 3QHSA 3CCMQ 4BD3A 2MPXC 2VYTA 3QZ9B 4M7AF 1SKUB 1AEYA 1K73U 1VOMA 1JB0E 3JCMe 4AFZC 1MV3A 3OYDA 2H3EB 3O8VA 4BY6C 3H9NA 4CC4B 1K73C 1ARKA 1G2BA 3C12A 4DBHA 4ZNXA 1ZBXA 2F2XA 3G71T 2LT1A 4FYYB 5CAIA 5IHNA 1RABB 1UB4A 4E7SA 1ACMB 3CPFA 1FWZA 1GL5A 4LD6A 3V7RA 2KDSA 2P0KA 3MEAA 2WSFE 1JJ2A 3HFOA 3GLXA 3H41A 2BZXA 2O2OA 4DBRA 1IHWA 3HHTB 2X4JA 3BY7A 1TUCA 2OI3A 3HRSA 3NTIA 3X26B 1YFNA 2VGNA 5FU7B 4L59A 3SEMA 4LDUA 4JUVA 2XK0A 1V1CA 1UGRB 1BKBA 2JUFA 3PNWC 1ZSZC 1KHIA 1M90U 4XU1A 3QSUA 4M7DB 3FLGA 1MMAA 1PD0A 1UJYA 2EVRA 4PK4A 3FJPA 2RI3A 2W10A 1XTDA 1OU9A 2NUTA 1YJWQ 1NJIU 3GF5A 5GAMj 4KRTA 3QYHB 1Y07A 2KE9A 2C0IA 2IVWA 4F17A 5GAN3 2YDLA 1OULA 4FIBA 1JXOA 4J7IA 4UC4A 2EGAA 2XI9A 5LJ3e 3HKSA 1YI2T 2D6FA 2HL5C 5GMKh 2DRMA 3GNFB 3CCET 3FJ5A 1KD1U 1TSFA 3GIBA 5LJ5h 1X27A 3QYGB 3OYNA 1ABOA 4P5NA 2HAXA 4IUTA 1W2BS 3J81E 1ZSZB 2RHXA 4A54A 1FMWA 3J80E 3QJYA 1WJRA 1GCQA 4M77F 4X1VA 1QVFP 2QA4T 2NUPA 5A0LA 4Y91A 2J6OA 3RDVA 1U5SA 3L2QA 2ED1A 5LJ3f 2MYSA 1R0BG 3QWYA 1UTIA 3KUFA 1I81A 3CCJQ 4C5GA 2QDLA 5C6SA 1BK2A 5KYWB 1M1KC 1YNZA 1UGVA 4XK8E 1PSFA 2YRDA 3VS5A 2DILA 4PJJA 5LJ3g 5FROA 4M7AC 5EG2A 3EGXA 3SD4A 5GAMe 2MK5A 4E7HA 1QMCA 3OMCA 4FU6A 4J8OA 3WXMB 3I9QA 3G4SQ 2K5IA 2PUOB 1YWOA 5GANj 1QWFA 2AT1B 4M7AD 1BB9A 5I11A 1M4ZA 2DLPA 1WHHA 2LT4A 2DD5A 3CCMT 3VU3C 3EFOA 1VQNT 3UWNA 2PU9B 1QVGA 3IQLA 4N0AC
chains in the Genus database with same CATH topology
1WLPB 2J05A 1X2QA 1K76A 2DYBA 1YN8A 4FSSA 2I0NA 3LH5A 3O5ZA 3VS1A 4RTYA 2O31A 2D8HA 1PRLC 2F2VA 1OPLA 1NEBA 2K3BA 2EYWA 2CH4A 1K0XA 3CQTA 1SSHA 2D8JA 1PNJA 2DVJA 1WFWA 1ZSGA 5GJWB 3EG3A 3ULRB 1K1ZA 2DL3A 3M0RA 3UA7A 1QKWA 2V1QA 1NYFA 1UHFA 1NLOC 5IXFA 3M0QA 2KGTA 1BBZA 4Z88A 2FPFA 2GTJA 1T3SA 3VS7A 4J9BA 3I5SA 2EKHA 1SRLA 2RNAA 1SHGA 5IHIA 3VRYA 3A98A 3SHWA 2JXBA 3EHRA 2L3QA 1AD5A 5IHKA 2ROLA 1X6BA 1UFFA 2KYMA 1LCKA 2KXCA 1IO6A 1GBQA 4RTTA 4RTWA 4J9EA 2GNCA 2LCSA 2A37A 3NPFA 3H0FA 2PNIA 1K9AA 2M51A 2KRNA 1YCSB 3VS0A 4AG2C 3PVLA 4QT7A 1UUEA 1OPKA 1KJWA 1HD3A 1QLYA 2FRYA 2DE0X 2VKNA 4IIMA 3U23A 2LMJA 2SEMA 2VWFA 4CC2A 2HEQA 5FWCA 2RQTA 2DX1A 2JM9A 2PTKA 4DEXA 4JJBA 1WIEA 1X43A 1WYXA 1GRIA 1XOVA 1AVZC 2LQWA 2JTEA 1X6GA 2JMCA 1ZUUA 4Y92A 2OAWA 4JZ4A 1I0CA 1SEMA 2EW3A 1PKSA 3RBBB 2DL8A 2L2PA 2FO0A 1QCFA 3R6NA 4RTXA 1EFNA 5ECAA 1B3QA 1W70A 2HCKA 1WDXA 2C0OA 4LE9A 1TG0A 4JPBW 2NWMA 1K4US 1OOTA 2KNBB 3GBQA 1U3OA 1MV0B 3ZL7C 4K11A 4RTZA 1UHCA 2GGRA 3VS2A 1NLPC 4J9FA 2CT4A 2J6FA 2K6DA 1UG1A 2KEAA 1WA7A 2KXDA 1JXMA 3M0TA 1ABQA 3TSWA 2CSQA 1K0SA 2LNHB 4JJCA 2EGEA 2FPEA 2SRCA 4J9GA 5FW9A 1YWPA 3TSZA 2KRMA 2EGCA 2FEIA 1HSQA 1T0HA 4HXJA 2MIOA 2EYYA 1JEGA 4CC3A 1Y0MA 4AFSC 1X69A 2RQWA 4OMOA 2RF0A 3M0PA 1OEBA 1JQQA 2DL4A 2DF6A 1YP5A 2H8HA 1NG2A 1GBRA 4A63B 3VS3A 2KT8A 2HDAA 1RUWA 1AWOA 1M8MA 2O9VA 2YUPA 4RUGA 3H0HA 2FG0A 2AKKA 1UJ0A 2OJ2A 3KFVA 1U06A 3M0SA 3PE0A 2K9GA 2DJQA 1WXBA 2DM1A 3VS4A 2P4RA 1VYTA 1T0JA 2GQIA 4J9CA 1PKTA 1E6GA 1M3CA 1UDLA 2LP5A 1S1NA 3I5RA 2RQUA 2C0TA 5FWBA 1Z9ZA 1T3LA 2BZ8A 1RLPC 2O88A 2YSQA 4LUDA 2LX7A 1VYUA 1I1JA 2DL5A 2MCNA 1Y57A 2K2MA 1WXTA 1SHFA 2LJ3A 2KYBA 3UA6A 4GLMA 3VS6A 2YUOA 1E7OA 2EPDA 2IIMA 3TVTA 1RLQC 2DL7A 1AZGB 2J06A 2JM8A 4EIKA 1AZEA 2BZYA 1HJDA 4GBQA 1A0NB 3THKA 2KROA 1AWJA 2HSPA 4D8KA 2FRWA 4M4ZA 2O9SA 4RTUA 4CC7A 2K7AA 1ZUYA 2F2WA 3QWXX 2GBQA 2A28A 1UECA 1FYNA 1ZX6A 4AFUC 2CUDA 2NUZA 1SRMA 4D8DA 2LJ1A 4WCIA 2X3WD 4LUEA 3EHQA 3EG1A 1Z9QA 2KRSA 1CKAA 1AEYA 1X2KA 2DRKA 4F14A 5EC7A 2J7IA 4AFZC 3NMZC 1MV3A 2DNUA 2EQIA 2DBKA 4J9HA 1AWXA 4CC4B 1ARKA 1G2BA 4HVUA 2BTTA 2DA9A 3VRZA 4J9DA 2XMFA 4ZNXA 1GFCA 2W0ZA 2F2XA 2JW4A 5IHNA 4J9IA 2M0YA 5L23A 2CH4W 2ABLA 3NHNA 1GL5A 1PRMC 1W6XA 5GJVB 2CUBA 2RPNA 1KSWA 2A08A 1I07A 4LN2A 3H41A 2BZXA 2O2OA 1QKXA 3RNJA 1SPKA 1VA7A 1QWEA 2L3SA 1TUCA 2OI3A 3SEMA 4HVWA 4Z8AA 1N5ZA 2CSIA 2DBMA 2K79A 5I22A 1V1CA 2ROTA 3M0UA 2KBTA 2DMOA 4JZ3A 3NGPA 4IIOA 3EG0A 1UJYA 2EVRA 2A36A 1NEGA 3UF4A 2G6FX 2W10A 3REAB 1NYGA 4KRTA 2KR3A 2KT1A 2ECZA 2KE9A 1W1FA 3JV3A 2C0IA 5HCKA 1NM7A 2CDTA 1PHTA 2J6KA 2EBPA 1UE9A 2L3PA 4F17A 1H92A 2YDLA 2L0AA 1AOJA 1JXOA 1KIKA 4DEYA 2AZSA 2YUQA 2EGAA 2JMAA 4F16A 4OMPA 2D0NA 3EGUA 2PZ1A 2RN8A 2DRMA 3FJ5A 1X27A 1M3BA 2AZVA 1ZBJA 2MOXA 1RI9A 1ABOA 1KFZA 1B07A 4E6RA 1H3HA 2FPDA 1CSKA 2ESWA 3I35A 1H8KA 3C0CA 2AKLA 2EYXA 1GCQA 2B86A 2RMOA 4X1VA 1M27C 1ZUKA 4OMLA 4OMNA 1TUDA 2JT4A 1M30A 4OMQA 2ENMA 3H0IA 3PVQA 4R0KA 2YUNA 2J6OA 1FMKA 1U5SA 4AFQC 3EG2A 4AG1C 2ED1A 2GTOA 3QWYA 1G83A 1UTIA 2RQVA 4HVVA 4OMMA 1GFDA 4ESRA 2AK5A 2QDLA 1CKBA 1BK2A 2LJ0A 2JS0A 1PWTA 1MUZA 2VVKA 1GCQC 1YNZA 2JS2A 1UGVA 2D1XA 3REBB 1VYVA 1JO8A 3VS5A 1BU1A 5IXBA 2DILA 2RQRA 1OV3A 5IH2A 4JJDA 2E5KA 1AWWA 1WI7A 1M3AA 3UATA 2LQNA 3I9QA 2HBWA 4Z89A 1YWOA 1ZLMA 4RTVA 1E6HA 1QWFA 2EYZA 2YT6A 4LNPA 1BB9A 4HCKA 5I11A 2CT3A 1WX6A 2DLPA 4ORZA 2CREA 2V1RA 1WXUA 1GCPA 1JU5C 1J3TA 2LZ6B 2ED0A 3IQLA 2X3XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLP B;  2J05 A;  1X2Q A;  1K76 A;  2DYB A;  1YN8 A;  4FSS A;  2I0N A;  3LH5 A;  3O5Z A;  3VS1 A;  4RTY A;  2O31 A;  2D8H A;  1PRL C;  2F2V A;  1OPL A;  1NEB A;  2K3B A;  2EYW A;  2CH4 A;  1K0X A;  3CQT A;  1SSH A;  2D8J A;  1PNJ A;  2DVJ A;  1WFW A;  1ZSG A;  5GJW B;  3EG3 A;  3ULR B;  1K1Z A;  2DL3 A;  3M0R A;  3UA7 A;  1QKW A;  2V1Q A;  1NYF A;  1UHF A;  1NLO C;  5IXF A;  3M0Q A;  2KGT A;  1BBZ A;  4Z88 A;  2FPF A;  2GTJ A;  1T3S A;  3VS7 A;  4J9B A;  3I5S A;  2EKH A;  1SRL A;  2RNA A;  1SHG A;  5IHI A;  3VRY A;  3A98 A;  3SHW A;  2JXB A;  3EHR A;  2L3Q A;  1AD5 A;  5IHK A;  2ROL A;  1X6B A;  1UFF A;  2KYM A;  1LCK A;  2KXC A;  1IO6 A;  1GBQ A;  4RTT A;  4RTW A;  4J9E A;  2GNC A;  2LCS A;  2A37 A;  3NPF A;  3H0F A;  2PNI A;  1K9A A;  2M51 A;  2KRN A;  1YCS B;  3VS0 A;  4AG2 C;  3PVL A;  4QT7 A;  1UUE A;  1OPK A;  1KJW A;  1HD3 A;  1QLY A;  2FRY A;  2DE0 X;  2VKN A;  4IIM A;  3U23 A;  2LMJ A;  2SEM A;  2VWF A;  4CC2 A;  2HEQ A;  5FWC A;  2RQT A;  2DX1 A;  2JM9 A;  2PTK A;  4DEX A;  4JJB A;  1WIE A;  1X43 A;  1WYX A;  1GRI A;  1XOV A;  1AVZ C;  2LQW A;  2JTE A;  1X6G A;  2JMC A;  1ZUU A;  4Y92 A;  2OAW A;  4JZ4 A;  1I0C A;  1SEM A;  2EW3 A;  1PKS A;  3RBB B;  2DL8 A;  2L2P A;  2FO0 A;  1QCF A;  3R6N A;  4RTX A;  1EFN A;  5ECA A;  1B3Q A;  1W70 A;  2HCK A;  1WDX A;  2C0O A;  4LE9 A;  1TG0 A;  4JPB W;  2NWM A;  1K4U S;  1OOT A;  2KNB B;  3GBQ A;  1U3O A;  1MV0 B;  3ZL7 C;  4K11 A;  4RTZ A;  1UHC A;  2GGR A;  3VS2 A;  1NLP C;  4J9F A;  2CT4 A;  2J6F A;  2K6D A;  1UG1 A;  2KEA A;  1WA7 A;  2KXD A;  1JXM A;  3M0T A;  1ABQ A;  3TSW A;  2CSQ A;  1K0S A;  2LNH B;  4JJC A;  2EGE A;  2FPE A;  2SRC A;  4J9G A;  5FW9 A;  1YWP A;  3TSZ A;  2KRM A;  2EGC A;  2FEI A;  1HSQ A;  1T0H A;  4HXJ A;  2MIO A;  2EYY A;  1JEG A;  4CC3 A;  1Y0M A;  4AFS C;  1X69 A;  2RQW A;  4OMO A;  2RF0 A;  3M0P A;  1OEB A;  1JQQ A;  2DL4 A;  2DF6 A;  1YP5 A;  2H8H A;  1NG2 A;  1GBR A;  4A63 B;  3VS3 A;  2KT8 A;  2HDA A;  1RUW A;  1AWO A;  1M8M A;  2O9V A;  2YUP A;  4RUG A;  3H0H A;  2FG0 A;  2AKK A;  1UJ0 A;  2OJ2 A;  3KFV A;  1U06 A;  3M0S A;  3PE0 A;  2K9G A;  2DJQ A;  1WXB A;  2DM1 A;  3VS4 A;  2P4R A;  1VYT A;  1T0J A;  2GQI A;  4J9C A;  1PKT A;  1E6G A;  1M3C A;  1UDL A;  2LP5 A;  1S1N A;  3I5R A;  2RQU A;  2C0T A;  5FWB A;  1Z9Z A;  1T3L A;  2BZ8 A;  1RLP C;  2O88 A;  2YSQ A;  4LUD A;  2LX7 A;  1VYU A;  1I1J A;  2DL5 A;  2MCN A;  1Y57 A;  2K2M A;  1WXT A;  1SHF A;  2LJ3 A;  2KYB A;  3UA6 A;  4GLM A;  3VS6 A;  2YUO A;  1E7O A;  2EPD A;  2IIM A;  3TVT A;  1RLQ C;  2DL7 A;  1AZG B;  2J06 A;  2JM8 A;  4EIK A;  1AZE A;  2BZY A;  1HJD A;  4GBQ A;  1A0N B;  3THK A;  2KRO A;  1AWJ A;  2HSP A;  4D8K A;  2FRW A;  4M4Z A;  2O9S A;  4RTU A;  4CC7 A;  2K7A A;  1ZUY A;  2F2W A;  3QWX X;  2GBQ A;  2A28 A;  1UEC A;  1FYN A;  1ZX6 A;  4AFU C;  2CUD A;  2NUZ A;  1SRM A;  4D8D A;  2LJ1 A;  4WCI A;  2X3W D;  4LUE A;  3EHQ A;  3EG1 A;  1Z9Q A;  2KRS A;  1CKA A;  1AEY A;  1X2K A;  2DRK A;  4F14 A;  5EC7 A;  2J7I A;  4AFZ C;  3NMZ C;  1MV3 A;  2DNU A;  2EQI A;  2DBK A;  4J9H A;  1AWX A;  4CC4 B;  1ARK A;  1G2B A;  4HVU A;  2BTT A;  2DA9 A;  3VRZ A;  4J9D A;  2XMF A;  4ZNX A;  1GFC A;  2W0Z A;  2F2X A;  2JW4 A;  5IHN A;  4J9I A;  2M0Y A;  5L23 A;  2CH4 W;  2ABL A;  3NHN A;  1GL5 A;  1PRM C;  1W6X A;  5GJV B;  2CUB A;  2RPN A;  1KSW A;  2A08 A;  1I07 A;  4LN2 A;  3H41 A;  2BZX A;  2O2O A;  1QKX A;  3RNJ A;  1SPK A;  1VA7 A;  1QWE A;  2L3S A;  1TUC A;  2OI3 A;  3SEM A;  4HVW A;  4Z8A A;  1N5Z A;  2CSI A;  2DBM A;  2K79 A;  5I22 A;  1V1C A;  2ROT A;  3M0U A;  2KBT A;  2DMO A;  4JZ3 A;  3NGP A;  4IIO A;  3EG0 A;  1UJY A;  2EVR A;  2A36 A;  1NEG A;  3UF4 A;  2G6F X;  2W10 A;  3REA B;  1NYG A;  4KRT A;  2KR3 A;  2KT1 A;  2ECZ A;  2KE9 A;  1W1F A;  3JV3 A;  2C0I A;  5HCK A;  1NM7 A;  2CDT A;  1PHT A;  2J6K A;  2EBP A;  1UE9 A;  2L3P A;  4F17 A;  1H92 A;  2YDL A;  2L0A A;  1AOJ A;  1JXO A;  1KIK A;  4DEY A;  2AZS A;  2YUQ A;  2EGA A;  2JMA A;  4F16 A;  4OMP A;  2D0N A;  3EGU A;  2PZ1 A;  2RN8 A;  2DRM A;  3FJ5 A;  1X27 A;  1M3B A;  2AZV A;  1ZBJ A;  2MOX A;  1RI9 A;  1ABO A;  1KFZ A;  1B07 A;  4E6R A;  1H3H A;  2FPD A;  1CSK A;  2ESW A;  3I35 A;  1H8K A;  3C0C A;  2AKL A;  2EYX A;  1GCQ A;  2B86 A;  2RMO A;  4X1V A;  1M27 C;  1ZUK A;  4OML A;  4OMN A;  1TUD A;  2JT4 A;  1M30 A;  4OMQ A;  2ENM A;  3H0I A;  3PVQ A;  4R0K A;  2YUN A;  2J6O A;  1FMK A;  1U5S A;  4AFQ C;  3EG2 A;  4AG1 C;  2ED1 A;  2GTO A;  3QWY A;  1G83 A;  1UTI A;  2RQV A;  4HVV A;  4OMM A;  1GFD A;  4ESR A;  2AK5 A;  2QDL A;  1CKB A;  1BK2 A;  2LJ0 A;  2JS0 A;  1PWT A;  1MUZ A;  2VVK A;  1GCQ C;  1YNZ A;  2JS2 A;  1UGV A;  2D1X A;  3REB B;  1VYV A;  1JO8 A;  3VS5 A;  1BU1 A;  5IXB A;  2DIL A;  2RQR A;  1OV3 A;  5IH2 A;  4JJD A;  2E5K A;  1AWW A;  1WI7 A;  1M3A A;  3UAT A;  2LQN A;  3I9Q A;  2HBW A;  4Z89 A;  1YWO A;  1ZLM A;  4RTV A;  1E6H A;  1QWF A;  2EYZ A;  2YT6 A;  4LNP A;  1BB9 A;  4HCK A;  5I11 A;  2CT3 A;  1WX6 A;  2DLP A;  4ORZ A;  2CRE A;  2V1R A;  1WXU A;  1GCP A;  1JU5 C;  1J3T A;  2LZ6 B;  2ED0 A;  3IQL A;  2X3X D; 
#chains in the Genus database with same CATH topology
 1B34 A;  2BIV A;  1I8F A;  2J05 A;  3QKJ A;  3SFM A;  3CCQ T;  2DFU A;  5KCO A;  1M9S A;  2I0N A;  4N4H A;  4C0D C;  3LH5 A;  3VS1 A;  3I55 A;  2I2L A;  3PFS A;  2QTX A;  2CH4 A;  3BDU A;  2RHI A;  1ZSG A;  1VIF A;  3EG3 A;  3ULR B;  4LDV A;  2DL3 A;  1VQN A;  4XU3 A;  2V1Q A;  3AHU A;  1VQM A;  1M1G A;  2AHJ B;  1QVP A;  2QQA A;  3M0Q A;  3RKY A;  4Z88 A;  1T3S A;  3A8L B;  3QPH A;  1Q7Y U;  3VRY A;  3CBO A;  2XDP A;  3SHW A;  2JXB A;  3C4S A;  1C0M A;  2VC8 A;  3EHR A;  5LJ3 h;  4MZM A;  3X24 B;  3DLM A;  1TTH B;  4JRP A;  4EMK A;  1X6B A;  2X35 A;  1RAF B;  1IO6 A;  2QYZ A;  1N27 A;  4J9E A;  2GNC A;  2QXF A;  5CR2 A;  1Q82 R;  1YHQ T;  3HRT A;  3NPF A;  3H0F A;  2PNI A;  1K9A A;  2E64 A;  3CPW P;  1K9M R;  4BI4 A;  5FU7 C;  3PVL A;  4OF1 A;  2COY A;  5D7U A;  1VQ8 A;  1QLY A;  5KE2 A;  3MCA B;  2H3J A;  5FWC A;  4FYX B;  5GAN d;  4LD9 K;  4DEX A;  1V76 A;  4M75 E;  1YJN A;  4MDX A;  1AVZ C;  1KHC A;  4QQG A;  4C92 D;  2JTE A;  2RD1 A;  3LX7 A;  4EMH A;  4JZ4 A;  1SEM A;  3OA6 A;  1BIA A;  4A4F A;  2EW3 A;  1K8A C;  3LWI A;  3PMI A;  3JCM V;  1VQ8 Q;  3R6N A;  1D3B B;  4RTX A;  2DD4 A;  1K9M U;  1B3Q A;  1WHG A;  2DXB A;  5GAO n;  2HCK A;  3QO3 A;  1WDX A;  2C0O A;  4RCB A;  3V7C A;  2VB6 A;  1TOV A;  1OOT A;  4JRQ A;  3ZL7 C;  3CC2 A;  2K57 A;  5GAN h;  1QVF S;  1N8R R;  2KXD A;  3JCM d;  3TSW A;  4PJO A;  2LNH B;  2GQV A;  4JJC A;  2RHZ A;  1LJO A;  2FPE A;  4C0G A;  2EGC A;  1HSQ A;  1T0H A;  5A0G A;  3A8H B;  5GAN f;  3CCS Q;  4HXJ A;  5LL6 S;  2EYY A;  2QQ9 A;  1PM3 A;  3JSC A;  5FU6 C;  4CC3 A;  4IUV A;  4LDW A;  3G6E A;  4M75 B;  2FVU A;  3UDC A;  3M0P A;  2HBP A;  1OEB A;  2DL4 A;  2H8H A;  1GBR A;  4BE0 A;  3QZ5 B;  2HDA A;  1RUW A;  1IGU A;  2V26 A;  1S72 T;  1KQ1 A;  3WVD B;  2E12 A;  3KFV A;  1U06 A;  5GAM g;  3T9N A;  2DJQ A;  1WXB A;  4C5E A;  5GAM d;  2DM1 A;  2QGF B;  5DLQ E;  1VQ7 A;  3G6E Q;  4A53 A;  2FHD A;  5CVI A;  3M54 A;  3TU4 K;  4BB7 A;  1YJW T;  2LP5 A;  3QII A;  4Z02 A;  2PVG B;  3MP1 A;  2E4H A;  3LGF A;  5GAM f;  5CCA A;  4C8Q B;  2O88 A;  3SDZ A;  2NYS A;  1VQ5 A;  2KAF A;  4LUD A;  2LX7 A;  3BW1 A;  3CD6 A;  3JCM f;  2RJE A;  2V8K A;  2EPD A;  1RLQ C;  1VQP T;  1AZG B;  1Q86 R;  3L1A A;  3OYH A;  2ZGW A;  1AWJ A;  4D8K A;  2FRW A;  1VQK Q;  5GMK l;  4J83 A;  1B7T A;  4RTU A;  1YIT Q;  2F2W A;  3MJX A;  5HK0 A;  2A28 A;  3GOX A;  1WJQ A;  2RHU A;  3CCM A;  1G3Y A;  4NL2 A;  1VQ5 T;  4AFU C;  1N9R A;  1N6A A;  2LJ1 A;  2LDM A;  3CCV Q;  4WCI A;  4LUE A;  1NJI R;  3I55 Q;  2OAU A;  2R5A A;  3EGD A;  1VQ9 T;  1VQK T;  2KRS A;  4C8Q C;  5EC7 A;  4FW1 A;  4KGV B;  2P4T A;  4MMK A;  4MZP A;  3RKW A;  2OTJ A;  4XTV A;  3M53 A;  2DNU A;  3FRN A;  2EQI A;  1WQW A;  4J9H A;  1AWX A;  2M1H A;  4C8Q A;  3TEE A;  3KXT A;  2VXE A;  1GFC A;  3MEW A;  4LDY A;  5HK3 A;  1M8V A;  2CP0 A;  4JRK A;  3M56 A;  2QEX A;  2XHC A;  3L2W A;  2F5T X;  2CH4 W;  5CO7 A;  3NHN A;  1PRM C;  5GJV B;  2CUB A;  3NTH A;  4HCZ A;  2A08 A;  2CP3 A;  2VGM A;  2Y4Y A;  4ZN1 A;  2DKG A;  5CQY A;  4FCY A;  1QWE A;  1UGS B;  1I5L A;  4JS4 A;  3EAE A;  3JCM W;  4X9D A;  1N5Z A;  2KY9 A;  3RMS A;  2QQR A;  2CSI A;  3OW2 S;  2DBM A;  2K79 A;  2BKD N;  2E41 A;  2BE9 B;  4PL6 A;  2KBT A;  2DO3 A;  2G3R A;  3OYC A;  2E10 A;  3EG0 A;  2E6N A;  1K73 R;  2OTL A;  1LOJ A;  1QVG S;  3REA B;  3EFR A;  1NYG A;  1NPR A;  2KR3 A;  1W1F A;  3JV3 A;  3E9G A;  3CBM A;  1JJ2 P;  1AOJ A;  4DEY A;  2YUQ A;  3CCR T;  4OGC A;  2VAS A;  2CYZ B;  4C5H A;  2RN8 A;  3PIO A;  3M58 A;  4RG8 A;  1RI0 A;  4N0A A;  4M78 C;  4OMF B;  2MOX A;  1D3B A;  2EKO A;  1KFZ A;  3DLL A;  4BE2 A;  4E6R A;  3QDF A;  3QBY A;  2V8J A;  2D0Q B;  3S3M A;  2CZ1 B;  1H3H A;  1WHK A;  3CPW S;  1CSK A;  2ESW A;  3I35 A;  5GAN e;  2WSE E;  2EYX A;  2HQE A;  2X4Y A;  2IPO B;  1M27 C;  3PT9 A;  4HKE A;  3VJP A;  2YUN A;  5FRN A;  5J26 A;  2EQK A;  3CCQ Q;  1KD1 C;  3M4Y A;  1G5V A;  4AFQ C;  4AG1 C;  2RQV A;  2MMP A;  1O9S A;  3OS2 A;  1X6O A;  2DVE A;  3JB9 D;  1D09 B;  3CC4 A;  2JS0 A;  2VXF A;  4E7J A;  5D6X A;  2QAZ A;  2D1X A;  2YLC A;  3RMQ A;  1VYV A;  5L8R E;  3R6O A;  2RQR A;  1Q82 U;  5HY6 A;  5I2M A;  4C5I A;  2BE7 D;  1D1C A;  2HBW A;  2HD0 A;  4A4H A;  1E6H A;  4M77 C;  3MP8 A;  2FZC B;  3V8J A;  1PC0 A;  1NJI C;  4M75 C;  4LDX A;  4OB2 B;  1C1A A;  2PQW A;  2V1R A;  1GCP A;  1JU5 C;  3AT1 B;  5GMK i;  2LZ6 B;  2ED0 A;  1W2B A;  3RUX A;  4RCC A;  4KUD K;  3LWH A;  3M59 A;  1Y96 A;  1Y96 B;  1WLP B;  2D9T A;  4FSS A;  1QP3 A;  4B6M A;  3SWN B;  4RTY A;  4J6W A;  5A0D A;  2M0O A;  2WSC E;  3PGG A;  1K0X A;  3CQT A;  1TH7 A;  1N8R U;  1PNJ A;  1WFW A;  3CXC A;  1RL2 A;  1X75 C;  1PG5 B;  4FM4 B;  4OB3 B;  1MMN A;  3M0R A;  5CQX A;  3CCV A;  2DAQ A;  1QKW A;  1EZZ B;  2DXC A;  1UHF A;  2RJF A;  4FYW B;  2Y4X A;  5KYY B;  2RH2 A;  4F7U F;  2X4W A;  5CKD A;  5KYU B;  1SRL A;  1WHM A;  5IHI A;  1ZA2 B;  3A98 A;  3BDL A;  3F70 A;  1MHN A;  2LX9 A;  2DTI A;  3BE3 A;  4M77 D;  4F7U G;  2DTO A;  2QDY B;  1LCK A;  3INZ A;  2KXC A;  1GBQ A;  4QVC A;  4RTW A;  4E47 A;  2QK0 A;  2ZPG B;  3OB9 A;  1YCS B;  1VQP Q;  3ME9 A;  2CP7 A;  1W2B P;  4QT7 A;  1UUE A;  4BDZ A;  1OPK A;  1HD3 A;  2FRY A;  1WHJ A;  2DE0 X;  4DBF A;  2LMJ A;  2OX7 A;  4CC2 A;  4M75 F;  2HEQ A;  2RQT A;  2FZK B;  2JM9 A;  4M75 A;  4DA4 A;  3CC7 A;  3OMG A;  5IN1 A;  4WTO B;  1UGP B;  1KC8 R;  1KQS P;  2DIG A;  1WYX A;  2LQK A;  2PVD B;  3JCM h;  1X6G A;  2JMC A;  4M78 A;  1NE8 A;  3VYG A;  5GMK e;  5KYX B;  1I0C A;  3EG9 A;  1PKS A;  2DL8 A;  2OTL Q;  1D1A A;  2XDD A;  1HYO A;  3S6W A;  3NFC A;  2K5F A;  1FX7 A;  3V8L A;  1TG0 A;  5LJ3 d;  3ER0 A;  3LGL A;  2EJ9 A;  2NLU A;  4PLI A;  1Q82 C;  3GBQ A;  1U3O A;  2QAS A;  4K11 A;  2GGR A;  2JNG A;  1NPP A;  2CS7 A;  1NLP C;  1BCO A;  4J9F A;  2J6F A;  1UG1 A;  1WA7 A;  1M1K R;  1JXM A;  1ABQ A;  1BYM A;  2EGE A;  2OTJ T;  1YWP A;  3TSZ A;  1MMG A;  2KRM A;  3OYI A;  4OP0 A;  5FLX E;  3OY9 A;  5CKB A;  4C92 C;  4KBM B;  1M2O A;  1Y0M A;  1VQ6 A;  4AFS C;  4D6W A;  4J7F A;  4M7D A;  1MND A;  1YIJ A;  4OMO A;  4DBQ A;  4M7A E;  1Q81 C;  4EDU A;  2DF6 A;  1YHQ Q;  4M7A B;  4GY5 A;  2EQM A;  1TWB A;  2KT8 A;  1AWO A;  2O9V A;  3P8H A;  3G4S A;  5KYN A;  1MNE A;  2L8D A;  5GAM h;  3P8B B;  2DER A;  2K9G A;  4BY6 B;  2ZZD A;  1KQS S;  1VQ6 Q;  3EH1 A;  3A8G B;  3X25 B;  2GQI A;  4J9C A;  2YHT A;  1E6G A;  4ANJ A;  3JCM Q;  1M3C A;  1QVG P;  3CME A;  3NTK A;  3I55 T;  2XDB A;  2RJC A;  3FC3 A;  1VIE A;  5LJ5 e;  2CZ0 B;  3CCQ A;  4R56 A;  5FWB A;  1H64 1;  2BZ8 A;  1VQO A;  2QA4 A;  3G4S T;  3OW2 P;  1VYU A;  2XIC A;  3G71 Q;  1I1J A;  1LPL A;  2MCN A;  1Y57 A;  1M90 R;  1WXT A;  1QP2 A;  3TCJ A;  4C8Q F;  3L2R A;  3UA6 A;  1IHV A;  2YUO A;  1E7O A;  1VQ5 Q;  1VQ7 T;  3TRE A;  4EIK A;  3THK A;  2XU8 A;  4M4Z A;  2O9S A;  3Q1J A;  2K7A A;  1ZUY A;  2FZG B;  2GBQ A;  1OU8 A;  2GF7 A;  1FYN A;  3EH2 A;  1B34 B;  1IB8 A;  2NUZ A;  2XD0 A;  3OS1 A;  3L42 A;  1M2V A;  2CP6 A;  4AT1 B;  2X3W D;  3EG1 A;  1Z9Q A;  4DQ2 A;  1CKA A;  2GFA A;  5GAN 4;  2KI7 A;  5LJ5 f;  2J7I A;  5I2S A;  2Z0W A;  3NMZ C;  1PCX A;  4HT9 A;  3MKD A;  4J6X A;  4PJM A;  2BTT A;  3VRZ A;  4M77 B;  4J9D A;  2XMF A;  3JB9 G;  2W0Z A;  4JDS A;  3OYK A;  4FW2 A;  1LNX A;  2K3Y A;  2JW4 A;  4PNO A;  3FEO A;  3CC7 T;  4PJO E;  1BI0 A;  2ABL A;  1W6X A;  4FSX A;  2QEX Q;  4LN2 A;  2DTH A;  2KQW A;  3M5A A;  4RMO A;  5GAN 8;  2ZPE B;  1SPK A;  1VA7 A;  3SWN C;  4BI8 B;  4ELY C;  5GAO r;  4Z8A A;  4QVZ A;  1M2V B;  5I22 A;  1G3T A;  2ROT A;  4FYV B;  3MO8 A;  4AMC A;  5CK9 A;  4JZ3 A;  4IIO A;  4MML A;  1U1S A;  2EIF A;  1QCO A;  3HL8 A;  2LC4 A;  2O01 E;  4J5Y A;  1VQ8 T;  5GAO m;  1NEG A;  2G6F X;  1KC8 C;  4L5G A;  4M77 E;  2KT1 A;  3CEY A;  1RAH B;  5HCK A;  4C92 G;  1BCM A;  2CDT A;  2KMT A;  2Y90 A;  2J6K A;  2EBP A;  1UE9 A;  2L0A A;  2ZAE A;  1AT1 B;  2A3L A;  2K3X A;  1KIK A;  3P8D A;  2AZS A;  1SF9 A;  4PJO F;  1IRX A;  4E7I A;  2VV5 A;  3CCJ T;  4OMP A;  2D0N A;  3EGU A;  2PZ1 A;  3OYF A;  2HSE B;  5KH6 A;  3CC4 T;  4JS5 A;  1M3B A;  4PJO G;  2AZV A;  3CCS A;  1YJ9 Q;  4HCB A;  1ZBJ A;  1RI9 A;  4JLI A;  4L6V 5;  1B07 A;  1D1B A;  2DPP B;  3CCJ A;  4PJL A;  4PFZ A;  1OZ3 A;  2FPD A;  4PJN A;  4C0D B;  2R5M A;  2C06 A;  2AKL A;  2CZ7 B;  2RMO A;  3PIP A;  5CKF A;  1G3W A;  4OMN A;  2CZ6 B;  2JT4 A;  1YJ9 T;  2ENM A;  3H0I A;  3PVQ A;  3FDR A;  4JLG A;  4R0K A;  4FT4 A;  3A8O B;  3OYA A;  3L2U A;  3EG2 A;  2DXT A;  1QW1 A;  3M57 A;  4OMM A;  3CME T;  7AT1 B;  1YCY A;  3G6E T;  4ESR A;  3CD6 T;  1QQJ A;  1UEB A;  3LLR A;  1GXI E;  5IT9 E;  2LJ0 A;  4FT2 A;  3HSB A;  4M7D C;  2VVK A;  1GCQ C;  2JS2 A;  4C92 E;  3MEU A;  3REB B;  2CKK A;  1BU1 A;  5IXB A;  1WGS A;  1OV3 A;  1XQH A;  5IH2 A;  2YRV A;  3L2Z A;  2E5K A;  1TU0 B;  3UAT A;  3DKM A;  4NL3 A;  2E65 A;  1K9M C;  4Z89 A;  3QDR B;  1ZLM A;  9ATC B;  2EYZ A;  2HQX A;  4M7D F;  2YT6 A;  3JAM E;  4HCK A;  2CP2 A;  3RKX A;  2CT3 A;  1WX6 A;  2DZ9 A;  4ORZ A;  3CXC S;  1U8R A;  2A0F B;  2DZC A;  1I5O B;  1WXU A;  1ZQ1 A;  4EMK B;  2QQS A;  3EG9 B;  1JJ2 S;  2KK4 A;  3JB9 J;  3OYG A;  3DB4 A;  2QTV A;  1X2Q A;  2EAY A;  1K76 A;  2DYB A;  1K8A R;  1YN8 A;  3EFO B;  1PSE A;  1Q95 G;  2O31 A;  3OBW A;  4BAC A;  2F2V A;  1OPL A;  3GP8 A;  1NEB A;  4M78 G;  4V2S A;  5M9O A;  1HXD A;  2D8J A;  5FRM A;  5GJW B;  1Q86 C;  2M16 A;  4NS5 A;  1OZ2 A;  2QEX T;  3OYM A;  4M78 F;  3EGX B;  3RIR A;  5IXF A;  2RJD A;  5GMK j;  2KGT A;  4ELZ C;  1Q7Y C;  4OVA A;  3VS7 A;  4J9B A;  3I5S A;  4XTY A;  5C0M A;  1N8R C;  2OTL T;  2HMA A;  4ZTJ A;  5DLO A;  3KBG A;  1JRI A;  3CPW A;  6AT1 B;  2L3Q A;  4IUU A;  2HNI A;  4IUR A;  1AD5 A;  5IHK A;  2ROL A;  1UFF A;  2KYM A;  1VQN Q;  2MAM A;  3UPU A;  4RTT A;  5FU6 B;  3BFM A;  1VUB A;  5GAO l;  2NUP B;  2A37 A;  3S3N A;  2M51 A;  2KRN A;  1TXQ A;  2ATC B;  3JB9 I;  3CXC P;  3VS0 A;  2MF2 A;  4AG2 C;  3OYL A;  2VKN A;  4IIM A;  3U23 A;  4EMG A;  1WNL A;  3SB2 A;  2DX1 A;  1KQ2 A;  1KG1 A;  2PTK A;  4F7U A;  4JJB A;  1WHL A;  1WIE A;  1X43 A;  4M78 E;  4A4G A;  1XOV A;  4M77 A;  4Y92 A;  3CC7 Q;  2OAW A;  4J6Y A;  2CP5 A;  4HCC A;  2FO0 A;  4O5V A;  2O4X B;  4X9C A;  1EFN A;  5DY9 A;  1VQ6 T;  2ZPB B;  3H6Z A;  3CCL T;  5KYY A;  2L5Q A;  1RAG B;  4JPB W;  4OGE A;  1JBM A;  2NWM A;  3QXE B;  1K4U S;  3CCR Q;  2DJZ A;  2MWO A;  1YJN Q;  2EJF A;  4RTZ A;  1UHC A;  5CKE A;  4Q5W A;  2FYK A;  2CT4 A;  1G3S A;  2K6D A;  1AHJ B;  2KEA A;  1M1K U;  4XQ3 A;  2R58 A;  2CSQ A;  2EFI A;  2GFU A;  4PFO A;  5FW9 A;  4J9G A;  3CCL Q;  1KQS A;  3V8K A;  2GCX A;  2RHY A;  2FEI A;  1YIJ Q;  2M02 A;  2F5K A;  2COW A;  1JEG A;  2KVQ G;  1Q7Y R;  3JCM X;  4B9W A;  2LRQ A;  1D0Y A;  3OYJ A;  1YP5 A;  3RER A;  1YIT T;  4A63 B;  3VS3 A;  4M7D D;  3CC4 Q;  3JCM b;  5CIU A;  3HP9 A;  1M8M A;  2YUP A;  4N4I A;  4QQ6 A;  3E2U A;  4M75 G;  5GAN 5;  3MEV A;  1YHQ A;  2OJ2 A;  2ZCF B;  4C0F A;  3M0S A;  3PE0 A;  2DXU A;  3VS4 A;  3HRU A;  2P4R A;  4B9X A;  4PLL A;  1OYX A;  1PKT A;  3MP6 A;  3JCM c;  2CGH A;  2JVV A;  2JJ9 A;  5IAY A;  1EX4 A;  2RI5 A;  2XID A;  2RO0 A;  3I5R A;  2C0T A;  1T3L A;  1YIT A;  3CME Q;  1RLP C;  4QW2 A;  3GNG A;  4DOV A;  1QCN A;  1S72 A;  4M7A A;  1C6V X;  2LJ3 A;  2P0P A;  4GLM A;  3VYH B;  3VS6 A;  4M78 D;  4WF2 A;  2YLB A;  1I4K 1;  1ZA1 B;  2DL7 A;  4C8Q E;  2JM8 A;  4TVR A;  1AZE A;  1RAE B;  2BZY A;  1HJD A;  4C92 A;  1IGQ A;  1A0N B;  1M90 C;  2KRO A;  4E7Z A;  2HSP A;  1BI1 A;  2PVO B;  2PUK B;  4CC7 A;  3LYI A;  1UEC A;  1S72 Q;  1ZX6 A;  4KUI A;  4PFP A;  1VQ4 Q;  3CCE Q;  1SRM A;  1O75 A;  1RAI B;  1X01 A;  5HKC A;  3CC2 T;  3G7Z A;  3EHQ A;  2L89 A;  3HPW A;  8AT1 B;  3OS5 A;  4C0Z A;  1X2K A;  2DEQ A;  2DRK A;  3LH0 A;  4F14 A;  2EWN A;  2ZPI B;  4OB0 B;  4IUQ A;  2DBK A;  3VV0 A;  1IZ6 A;  4VUB A;  4HVU A;  2DA9 A;  4M78 B;  2X4X A;  3TQ7 P;  3OSV A;  1VQL Q;  5GAO p;  1P92 A;  2HKN A;  4J9I A;  4IKF A;  2M0Y A;  5L23 A;  2DIQ A;  1R8O B;  3ASK A;  3JB9 H;  3OSS C;  2KSS A;  2QQB A;  1Q86 U;  2RPN A;  1KSW A;  1I07 A;  3C94 A;  1TUG B;  2OTJ Q;  4KT0 E;  4M77 G;  3WVE B;  3A5Z B;  3S3O A;  2K2V A;  4RG2 A;  1VQM Q;  1QKX A;  3RNJ A;  4C8Q G;  2L3S A;  4DOW A;  2COZ A;  3EGD B;  2IG0 A;  4XTW A;  4HVW A;  3CCV T;  1OI1 A;  5CKH A;  3A1P A;  4QVD A;  1WZO A;  4LXC A;  1R0C B;  3M0U A;  3JRZ A;  2DMO A;  2EYQ A;  2RA2 A;  3NGP A;  1BIB A;  5D6W A;  3OYY A;  3RES A;  3E9F A;  2A36 A;  3CCS T;  3UF4 A;  4BDY A;  2LCC A;  1HK9 A;  2ECZ A;  4XTX A;  4YTL A;  4CI0 C;  1NM7 A;  2JTF A;  2XG8 D;  2B8A A;  1PHT A;  2F1L A;  2L3P A;  3MPU B;  3I56 A;  1H92 A;  5DM7 R;  1YJN T;  2DK3 A;  1OQK A;  3MHX A;  2JMA A;  1IRE B;  1M1F A;  4F16 A;  4O6J A;  2K4Y A;  1N9S A;  1KK7 A;  2HKQ B;  2LVM A;  1WJS A;  3JB9 F;  3M4G A;  1R77 A;  3D7S B;  4XU0 A;  3EFS A;  1YI2 Q;  2P0Q A;  4F04 B;  3I56 Q;  3JCM P;  2DYI A;  1SSF A;  2AIR B;  1ZHI A;  1DJ7 B;  1H8K A;  2QGG A;  3CMA A;  3C0C A;  1WQ7 A;  3J7A F;  2B86 A;  3X28 B;  2JTM A;  3CCR A;  4OML A;  1ZUK A;  1TUD A;  3PTA A;  3CC2 Q;  1M30 A;  1D0Z A;  4OMQ A;  2QG9 B;  2ZPH B;  1H3Z A;  3JCM g;  1SG5 A;  1FMK A;  2VUB A;  2GTO A;  1BI2 A;  1G83 A;  4HVV A;  1GFD A;  1D0X A;  2QA4 Q;  2AK5 A;  3L2V A;  1YIJ T;  1CKB A;  2E3I A;  1WPY A;  1EIF A;  5LJ5 d;  5LJ3 j;  1BI3 A;  2DEU A;  1MMD A;  1PWT A;  5KE3 A;  1MUZ A;  3CMA Q;  4HA8 A;  3VUZ A;  2QI2 A;  1JO8 A;  4A4K A;  2HL3 A;  1K8A U;  4C92 F;  4OB1 B;  4PJO B;  4JJD A;  1AWW A;  3RR6 A;  1WI7 A;  1M3A A;  4GLK A;  2LCL A;  4JRI A;  2LQN A;  3V7S A;  4KUL A;  1XJW B;  5GAN 6;  4QQD A;  4RTV A;  4LNP A;  2RI2 A;  2MI6 A;  2X9H A;  3VUB A;  4KH0 B;  3M9Q A;  3QUI A;  1VQ7 Q;  2LQ8 A;  3CCU A;  2CRE A;  1XNI A;  5GAN 2;  1KC8 U;  3ZBD A;  2L3R A;  2YWW A;  2K5L A;  1J3T A;  4E2F B;  3VKI A;  4ZN3 A;  2X3X D;  2A7Y A;  5AYF A;  1VQ9 A;  2E5Q A;  2JZ2 A;  2WAC A;  2E3H A;  3O5Z A;  5A2Q E;  2RB6 A;  2D8H A;  1PRL C;  4MZT A;  4E7L A;  2E1H A;  3E1S A;  2K3B A;  3GPL A;  2EYW A;  4PJO C;  1SSH A;  4EMK C;  4PJO D;  1W4S A;  2DVJ A;  2JOY A;  1VQ4 A;  5D6Y A;  1K1Z A;  2FL7 A;  3UA7 A;  4BE1 A;  1NYF A;  2MWP A;  1NLO C;  5KYX A;  1VQ9 Q;  1Y7X A;  1VQP A;  1BBZ A;  2M9U A;  2FPF A;  2GTJ A;  5AT1 B;  2EKH A;  2RNA A;  1PD1 A;  1SHG A;  4QKU A;  3H8Z A;  3QG1 A;  3PMT A;  3OW2 A;  1NZ9 A;  1VQL A;  3I56 T;  1TS9 A;  2LCS A;  4M7D G;  4CRI A;  3UT1 A;  1YJW A;  3URG A;  4R55 A;  1RAA B;  1FXX A;  5GMK m;  4XTZ A;  2E70 A;  1KJW A;  5LJ5 g;  4IUP A;  1FMV A;  2LNV A;  1KD1 R;  2EQJ A;  2SEM A;  2VWF A;  2V8I A;  3N5B B;  4RKU E;  1G8X A;  3ZEH A;  4ZGJ B;  3QJ6 A;  3MET A;  2DET A;  4ATO A;  2ZPF B;  1GRI A;  4KH1 B;  5KYU A;  1VQO T;  2LQW A;  1ZUU A;  2JN0 A;  1UGQ B;  3RBB B;  2L2P A;  1QCF A;  3CCU T;  1Y71 A;  2EQU A;  1YBY A;  5ECA A;  4KGZ B;  1W70 A;  4LE9 A;  4EPC A;  3FB9 A;  4PKC C;  1YJ9 A;  2KNB B;  1MV0 B;  4XAX B;  3VS2 A;  4ZGE B;  3SWN A;  4M75 D;  2O4X A;  3OBY A;  5LJ5 j;  1U1T A;  3M0T A;  4II1 A;  1Q81 U;  1K0S A;  4F7U E;  3OYE A;  2XKO C;  4XU2 A;  2SRC A;  4FL6 A;  2MIO A;  4M7D E;  2RK1 A;  4NOY A;  1MGQ A;  1IXD A;  3OS0 A;  5KYW A;  2E6Z A;  4JJN K;  3LW5 E;  3M55 A;  3CCL A;  4BUG A;  4F7U B;  1X69 A;  2RQW A;  2RF0 A;  2FB7 A;  2HQH A;  2RM4 A;  1JQQ A;  3HFN A;  2LTO A;  3A8M B;  1NG2 A;  5J39 A;  2YRC A;  1RAD B;  4C8Q D;  4RUG A;  4BI3 A;  3C95 A;  1YI2 A;  3H0H A;  2FG0 A;  3CMA T;  2AKK A;  1M5Q 1;  4ZGD B;  1UJ0 A;  4MDW A;  4ME7 A;  2P84 A;  3CBP A;  5GAN 7;  2R57 A;  2RK2 A;  3OQ5 A;  3DB3 A;  2HZY A;  4E7K A;  1VYT A;  1T0J A;  3ZFJ A;  1V29 B;  1OX8 A;  1UDL A;  4ZTF A;  1QVF A;  5GAO q;  3X20 B;  1RAC B;  1S1N A;  2YXY A;  4N4G A;  2RQU A;  4X34 A;  5J3B A;  1Z9Z A;  2YSQ A;  1OX9 A;  2EJG A;  2DL5 A;  2K2M A;  1SHF A;  2BUD A;  5GAN g;  2KYB A;  1F1B B;  1LVK A;  3E19 A;  2X51 A;  3JCM J;  3OYB A;  2IIM A;  1VQ4 T;  3TVT A;  1VQK A;  4Y28 E;  4XTU A;  2J06 A;  3FIF A;  3CD6 Q;  4GBQ A;  2F69 A;  1VQM T;  3G1J A;  5KCH A;  2NUT B;  4C92 B;  5I21 A;  1NBE B;  3QWX X;  3CCE A;  4HT8 A;  1VQO Q;  4M7A G;  4A4E A;  4KGX B;  8ATC B;  3G71 A;  1ZSZ A;  2CUD A;  4D8D A;  3HTR A;  1Q81 R;  3CCU Q;  1VQL T;  3QHS A;  3CCM Q;  4BD3 A;  2MPX C;  2VYT A;  3QZ9 B;  4M7A F;  1SKU B;  1AEY A;  1K73 U;  1VOM A;  1JB0 E;  3JCM e;  4AFZ C;  1MV3 A;  3OYD A;  2H3E B;  3O8V A;  4BY6 C;  3H9N A;  4CC4 B;  1K73 C;  1ARK A;  1G2B A;  3C12 A;  4DBH A;  4ZNX A;  1ZBX A;  2F2X A;  3G71 T;  2LT1 A;  4FYY B;  5CAI A;  5IHN A;  1RAB B;  1UB4 A;  4E7S A;  1ACM B;  3CPF A;  1FWZ A;  1GL5 A;  4LD6 A;  3V7R A;  2KDS A;  2P0K A;  3MEA A;  2WSF E;  1JJ2 A;  3HFO A;  3GLX A;  3H41 A;  2BZX A;  2O2O A;  4DBR A;  1IHW A;  3HHT B;  2X4J A;  3BY7 A;  1TUC A;  2OI3 A;  3HRS A;  3NTI A;  3X26 B;  1YFN A;  2VGN A;  5FU7 B;  4L59 A;  3SEM A;  4LDU A;  4JUV A;  2XK0 A;  1V1C A;  1UGR B;  1BKB A;  2JUF A;  3PNW C;  1ZSZ C;  1KHI A;  1M90 U;  4XU1 A;  3QSU A;  4M7D B;  3FLG A;  1MMA A;  1PD0 A;  1UJY A;  2EVR A;  4PK4 A;  3FJP A;  2RI3 A;  2W10 A;  1XTD A;  1OU9 A;  2NUT A;  1YJW Q;  1NJI U;  3GF5 A;  5GAM j;  4KRT A;  3QYH B;  1Y07 A;  2KE9 A;  2C0I A;  2IVW A;  4F17 A;  5GAN 3;  2YDL A;  1OUL A;  4FIB A;  1JXO A;  4J7I A;  4UC4 A;  2EGA A;  2XI9 A;  5LJ3 e;  3HKS A;  1YI2 T;  2D6F A;  2HL5 C;  5GMK h;  2DRM A;  3GNF B;  3CCE T;  3FJ5 A;  1KD1 U;  1TSF A;  3GIB A;  5LJ5 h;  1X27 A;  3QYG B;  3OYN A;  1ABO A;  4P5N A;  2HAX A;  4IUT A;  1W2B S;  3J81 E;  1ZSZ B;  2RHX A;  4A54 A;  1FMW A;  3J80 E;  3QJY A;  1WJR A;  1GCQ A;  4M77 F;  4X1V A;  1QVF P;  2QA4 T;  2NUP A;  5A0L A;  4Y91 A;  2J6O A;  3RDV A;  1U5S A;  3L2Q A;  2ED1 A;  5LJ3 f;  2MYS A;  1R0B G;  3QWY A;  1UTI A;  3KUF A;  1I81 A;  3CCJ Q;  4C5G A;  2QDL A;  5C6S A;  1BK2 A;  5KYW B;  1M1K C;  1YNZ A;  1UGV A;  4XK8 E;  1PSF A;  2YRD A;  3VS5 A;  2DIL A;  4PJJ A;  5LJ3 g;  5FRO A;  4M7A C;  5EG2 A;  3EGX A;  3SD4 A;  5GAM e;  2MK5 A;  4E7H A;  1QMC A;  3OMC A;  4FU6 A;  4J8O A;  3WXM B;  3I9Q A;  3G4S Q;  2K5I A;  2PUO B;  1YWO A;  5GAN j;  1QWF A;  2AT1 B;  4M7A D;  1BB9 A;  5I11 A;  1M4Z A;  2DLP A;  1WHH A;  2LT4 A;  2DD5 A;  3CCM T;  3VU3 C;  3EFO A;  1VQN T;  3UWN A;  2PU9 B;  1QVG A;  3IQL A;  4N0A C; 
#chains in the Genus database with same CATH homology
 1WLP B;  2J05 A;  1X2Q A;  1K76 A;  2DYB A;  1YN8 A;  4FSS A;  2I0N A;  3LH5 A;  3O5Z A;  3VS1 A;  4RTY A;  2O31 A;  2D8H A;  1PRL C;  2F2V A;  1OPL A;  1NEB A;  2K3B A;  2EYW A;  2CH4 A;  1K0X A;  3CQT A;  1SSH A;  2D8J A;  1PNJ A;  2DVJ A;  1WFW A;  1ZSG A;  5GJW B;  3EG3 A;  3ULR B;  1K1Z A;  2DL3 A;  3M0R A;  3UA7 A;  1QKW A;  2V1Q A;  1NYF A;  1UHF A;  1NLO C;  5IXF A;  3M0Q A;  2KGT A;  1BBZ A;  4Z88 A;  2FPF A;  2GTJ A;  1T3S A;  3VS7 A;  4J9B A;  3I5S A;  2EKH A;  1SRL A;  2RNA A;  1SHG A;  5IHI A;  3VRY A;  3A98 A;  3SHW A;  2JXB A;  3EHR A;  2L3Q A;  1AD5 A;  5IHK A;  2ROL A;  1X6B A;  1UFF A;  2KYM A;  1LCK A;  2KXC A;  1IO6 A;  1GBQ A;  4RTT A;  4RTW A;  4J9E A;  2GNC A;  2LCS A;  2A37 A;  3NPF A;  3H0F A;  2PNI A;  1K9A A;  2M51 A;  2KRN A;  1YCS B;  3VS0 A;  4AG2 C;  3PVL A;  4QT7 A;  1UUE A;  1OPK A;  1KJW A;  1HD3 A;  1QLY A;  2FRY A;  2DE0 X;  2VKN A;  4IIM A;  3U23 A;  2LMJ A;  2SEM A;  2VWF A;  4CC2 A;  2HEQ A;  5FWC A;  2RQT A;  2DX1 A;  2JM9 A;  2PTK A;  4DEX A;  4JJB A;  1WIE A;  1X43 A;  1WYX A;  1GRI A;  1XOV A;  1AVZ C;  2LQW A;  2JTE A;  1X6G A;  2JMC A;  1ZUU A;  4Y92 A;  2OAW A;  4JZ4 A;  1I0C A;  1SEM A;  2EW3 A;  1PKS A;  3RBB B;  2DL8 A;  2L2P A;  2FO0 A;  1QCF A;  3R6N A;  4RTX A;  1EFN A;  5ECA A;  1B3Q A;  1W70 A;  2HCK A;  1WDX A;  2C0O A;  4LE9 A;  1TG0 A;  4JPB W;  2NWM A;  1K4U S;  1OOT A;  2KNB B;  3GBQ A;  1U3O A;  1MV0 B;  3ZL7 C;  4K11 A;  4RTZ A;  1UHC A;  2GGR A;  3VS2 A;  1NLP C;  4J9F A;  2CT4 A;  2J6F A;  2K6D A;  1UG1 A;  2KEA A;  1WA7 A;  2KXD A;  1JXM A;  3M0T A;  1ABQ A;  3TSW A;  2CSQ A;  1K0S A;  2LNH B;  4JJC A;  2EGE A;  2FPE A;  2SRC A;  4J9G A;  5FW9 A;  1YWP A;  3TSZ A;  2KRM A;  2EGC A;  2FEI A;  1HSQ A;  1T0H A;  4HXJ A;  2MIO A;  2EYY A;  1JEG A;  4CC3 A;  1Y0M A;  4AFS C;  1X69 A;  2RQW A;  4OMO A;  2RF0 A;  3M0P A;  1OEB A;  1JQQ A;  2DL4 A;  2DF6 A;  1YP5 A;  2H8H A;  1NG2 A;  1GBR A;  4A63 B;  3VS3 A;  2KT8 A;  2HDA A;  1RUW A;  1AWO A;  1M8M A;  2O9V A;  2YUP A;  4RUG A;  3H0H A;  2FG0 A;  2AKK A;  1UJ0 A;  2OJ2 A;  3KFV A;  1U06 A;  3M0S A;  3PE0 A;  2K9G A;  2DJQ A;  1WXB A;  2DM1 A;  3VS4 A;  2P4R A;  1VYT A;  1T0J A;  2GQI A;  4J9C A;  1PKT A;  1E6G A;  1M3C A;  1UDL A;  2LP5 A;  1S1N A;  3I5R A;  2RQU A;  2C0T A;  5FWB A;  1Z9Z A;  1T3L A;  2BZ8 A;  1RLP C;  2O88 A;  2YSQ A;  4LUD A;  2LX7 A;  1VYU A;  1I1J A;  2DL5 A;  2MCN A;  1Y57 A;  2K2M A;  1WXT A;  1SHF A;  2LJ3 A;  2KYB A;  3UA6 A;  4GLM A;  3VS6 A;  2YUO A;  1E7O A;  2EPD A;  2IIM A;  3TVT A;  1RLQ C;  2DL7 A;  1AZG B;  2J06 A;  2JM8 A;  4EIK A;  1AZE A;  2BZY A;  1HJD A;  4GBQ A;  1A0N B;  3THK A;  2KRO A;  1AWJ A;  2HSP A;  4D8K A;  2FRW A;  4M4Z A;  2O9S A;  4RTU A;  4CC7 A;  2K7A A;  1ZUY A;  2F2W A;  3QWX X;  2GBQ A;  2A28 A;  1UEC A;  1FYN A;  1ZX6 A;  4AFU C;  2CUD A;  2NUZ A;  1SRM A;  4D8D A;  2LJ1 A;  4WCI A;  2X3W D;  4LUE A;  3EHQ A;  3EG1 A;  1Z9Q A;  2KRS A;  1CKA A;  1AEY A;  1X2K A;  2DRK A;  4F14 A;  5EC7 A;  2J7I A;  4AFZ C;  3NMZ C;  1MV3 A;  2DNU A;  2EQI A;  2DBK A;  4J9H A;  1AWX A;  4CC4 B;  1ARK A;  1G2B A;  4HVU A;  2BTT A;  2DA9 A;  3VRZ A;  4J9D A;  2XMF A;  4ZNX A;  1GFC A;  2W0Z A;  2F2X A;  2JW4 A;  5IHN A;  4J9I A;  2M0Y A;  5L23 A;  2CH4 W;  2ABL A;  3NHN A;  1GL5 A;  1PRM C;  1W6X A;  5GJV B;  2CUB A;  2RPN A;  1KSW A;  2A08 A;  1I07 A;  4LN2 A;  3H41 A;  2BZX A;  2O2O A;  1QKX A;  3RNJ A;  1SPK A;  1VA7 A;  1QWE A;  2L3S A;  1TUC A;  2OI3 A;  3SEM A;  4HVW A;  4Z8A A;  1N5Z A;  2CSI A;  2DBM A;  2K79 A;  5I22 A;  1V1C A;  2ROT A;  3M0U A;  2KBT A;  2DMO A;  4JZ3 A;  3NGP A;  4IIO A;  3EG0 A;  1UJY A;  2EVR A;  2A36 A;  1NEG A;  3UF4 A;  2G6F X;  2W10 A;  3REA B;  1NYG A;  4KRT A;  2KR3 A;  2KT1 A;  2ECZ A;  2KE9 A;  1W1F A;  3JV3 A;  2C0I A;  5HCK A;  1NM7 A;  2CDT A;  1PHT A;  2J6K A;  2EBP A;  1UE9 A;  2L3P A;  4F17 A;  1H92 A;  2YDL A;  2L0A A;  1AOJ A;  1JXO A;  1KIK A;  4DEY A;  2AZS A;  2YUQ A;  2EGA A;  2JMA A;  4F16 A;  4OMP A;  2D0N A;  3EGU A;  2PZ1 A;  2RN8 A;  2DRM A;  3FJ5 A;  1X27 A;  1M3B A;  2AZV A;  1ZBJ A;  2MOX A;  1RI9 A;  1ABO A;  1KFZ A;  1B07 A;  4E6R A;  1H3H A;  2FPD A;  1CSK A;  2ESW A;  3I35 A;  1H8K A;  3C0C A;  2AKL A;  2EYX A;  1GCQ A;  2B86 A;  2RMO A;  4X1V A;  1M27 C;  1ZUK A;  4OML A;  4OMN A;  1TUD A;  2JT4 A;  1M30 A;  4OMQ A;  2ENM A;  3H0I A;  3PVQ A;  4R0K A;  2YUN A;  2J6O A;  1FMK A;  1U5S A;  4AFQ C;  3EG2 A;  4AG1 C;  2ED1 A;  2GTO A;  3QWY A;  1G83 A;  1UTI A;  2RQV A;  4HVV A;  4OMM A;  1GFD A;  4ESR A;  2AK5 A;  2QDL A;  1CKB A;  1BK2 A;  2LJ0 A;  2JS0 A;  1PWT A;  1MUZ A;  2VVK A;  1GCQ C;  1YNZ A;  2JS2 A;  1UGV A;  2D1X A;  3REB B;  1VYV A;  1JO8 A;  3VS5 A;  1BU1 A;  5IXB A;  2DIL A;  2RQR A;  1OV3 A;  5IH2 A;  4JJD A;  2E5K A;  1AWW A;  1WI7 A;  1M3A A;  3UAT A;  2LQN A;  3I9Q A;  2HBW A;  4Z89 A;  1YWO A;  1ZLM A;  4RTV A;  1E6H A;  1QWF A;  2EYZ A;  2YT6 A;  4LNP A;  1BB9 A;  4HCK A;  5I11 A;  2CT3 A;  1WX6 A;  2DLP A;  4ORZ A;  2CRE A;  2V1R A;  1WXU A;  1GCP A;  1JU5 C;  1J3T A;  2LZ6 B;  2ED0 A;  3IQL A;  2X3X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...