2FRYA

Solution structure of the third sh3 domain of human nck2 adaptor protein
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
61
structure length
61
Chain Sequence
GSHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK2
publication title Structural Insight into the Binding Diversity between the Human Nck2 SH3 Domains and Proline-Rich Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 3
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fryA00
1W1FA 1PNJA 3PE0A 1AVZC 2RMOA 3A98A 1QCFA 1J3TA 1UGVA 2FPFA 4DEYA 3SHWA 1WLPB 1WI7A 2ESWA 1KSWA 2A36A 3TSZA 2JMCA 2GTOA 2DBKA 1M3AA 1H92A 2ROTA 1JXOA 5L23A 4RTXA 2C0TA 2RQTA 1WFWA 3IQLA 3THKA 3VS2A 1Y0MA 2G6FX 1NEGA 2MOXA 1WX6A 2KT1A 1JXMA 1SHGA 1E7OA 3H41A 2DYBA 3PVLA 2EW3A 2YUOA 2HDAA 1QKWA 2VKNA 4RTTA 1ZBJA 4OMQA 2MCNA 1JQQA 2BZYA 4IIOA 1RI9A 4RUGA 3UATA 2DRKA 2NWMA 2KRNA 3VS7A 1SPKA 3KFVA 4J9CA 2ED1A 1YNZA 1PKTA 2KGTA 4F17A 2K7AA 2CT4A 2RQVA 4LUDA 2HBWA 4A63B 2KRMA 3TSWA 2LCSA 3JV3A 2V1RA 1AWOA 1VYVA 1Z9QA 1NLOC 1K9AA 4HCKA 3NPFA 1ZUUA 1NLPC 5IH2A 1RLPC 2J7IA 1MV0B 2L3SA 3GBQA 1K4US 1X2QA 1FMKA 4ZNXA 2YUPA 4ESRA 1VYUA 3RNJA 1AZGB 2PTKA 4D8KA 1MUZA 2GGRA 4Z89A 1ZLMA 2V1QA 1I0CA 2CT3A 2DILA 1NEBA 2DL7A 2O88A 1VA7A 4LNPA 2NUZA 1SSHA 2DNUA 5IHIA 2KXCA 1M8MA 2LX7A 1UFFA 2BZXA 2ECZA 2LZ6B 1FYNA 1OV3A 2X3XD 2KBTA 4HVUA 2AKKA 1B07A 2OJ2A 2SRCA 2CUDA 2FG0A 2JMAA 3U23A 2EYXA 1W70A 2DRMA 1EFNA 4HXJA 2CSQA 4F16A 3EG0A 1K0SA 2FPDA 1QKXA 2P4RA 1WYXA 1NYGA 2DVJA 2J6KA 4CC2A 2BTTA 1U06A 1YP5A 3M0QA 2LQNA 2MIOA 1GCPA 2CDTA 2D8HA 1SRLA 3EG2A 2DLPA 1CKAA 2LNHB 2C0IA 3EGUA 3VRZA 4RTVA 1UJYA 5EC7A 1AD5A 2DL4A 2JS2A 2O31A 2L3PA 2LMJA 2GBQA 2K9GA 3M0SA 4CC7A 2ENMA 1T0HA 1E6GA 2KYBA 4JJDA 5IHKA 4DEXA 2JS0A 1GFDA 1TUCA 2GTJA 2DA9A 2O9SA 2JT4A 1YWOA 2K2MA 4JZ3A 1XOVA 1HSQA 2K6DA 2GQIA 2EGAA 2DL8A 2RQRA 3CQTA 2M0YA 1M27C 2KT8A 2JM8A 1WDXA 1ZUYA 3I5SA 2F2VA 1OEBA 1UHCA 2KRSA 3ZL7C 2PZ1A 1I07A 5FWBA 1U5SA 4Y92A 2J06A 1X69A 2FPEA 5I22A 2DF6A 2OAWA 1V1CA 3LH5A 2M51A 4Z8AA 4QT7A 2YUQA 1NYFA 2AZVA 1X2KA 4J9IA 2CREA 3H0IA 1UECA 2KE9A 1WXUA 4JZ4A 1UTIA 2J6FA 3NMZC 4J9EA 1T0JA 4CC4B 4EIKA 2XMFA 1SRMA 3M0TA 2CH4W 3H0FA 2SEMA 2JM9A 2YDLA 2A28A 2EYZA 1YN8A 4AG2C 1UE9A 1LCKA 2K3BA 2D1XA 3M0RA 2FRYA 3EHRA 2I0NA 2O9VA 3NGPA 2YSQA 1ABQA 1UDLA 3VS0A 4JJBA 3REAB 2EPDA 2F2XA 2RNAA 2FRWA 1RLQC 1UJ0A 4RTYA 2ABLA 2AZSA 1K1ZA 1WIEA 1WXBA 2KROA 2A08A 1YCSB 4OMNA 4CC3A 4OMOA 4J9BA 2DL5A 2LJ3A 1H3HA 2DMOA 3VS3A 3TVTA 3UA6A 1UG1A 1H8KA 1GFCA 1JEGA 1TG0A 1OOTA 4J9DA 1GL5A 4M4ZA 3I5RA 2YT6A 2IIMA 4X1VA 3EG3A 2EYYA 1KIKA 1AWXA 3RBBB 1ARKA 4FSSA 1GRIA 2BZ8A 3M0UA 1AWWA 4IIMA 1BU1A 2AKLA 1Z9ZA 4AFSC 2HSPA 2PNIA 5FWCA 2L0AA 4AFQC 2EKHA 4LN2A 4R0KA 2JXBA 3VS6A 2O2OA 4JPBW 1PRMC 4GBQA 2L2PA 2JTEA 2EYWA 1RUWA 2AK5A 1QWEA 5GJVB 3R6NA 1T3SA 1PKSA 1WA7A 2JW4A 4Z88A 3EHQA 4HVWA 2CUBA 1G83A 4GLMA 1E6HA 3UF4A 2D0NA 4KRTA 3UA7A 1BBZA 1M3CA 1HD3A 1ABOA 1U3OA 1TUDA 2F2WA 4J9HA 2KNBB 2KXDA 2A37A 4OMMA 1GCQA 3QWYA 2CSIA 2RQWA 3VS5A 2EQIA 1T3LA 3QWXX 1BB9A 3M0PA 1YWPA 1X6BA 1M30A 2VWFA 1M3BA 2H8HA 1K0XA 2EGCA 2DX1A 1AOJA 3I35A 2DBMA 1AWJA 3FJ5A 2KEAA 1PWTA 2LJ0A 2CH4A 3EG1A 5I11A 2W0ZA 1S1NA 1N5ZA 4HVVA 1OPLA 2L3QA 4LE9A 1SHFA 1JO8A 1PHTA 5GJWB 5IXBA 1CKBA 2HCKA 4J9GA 4JJCA 2LJ1A 4RTZA 3ULRB 3VS1A 4ORZA 2DE0X 1UUEA 3REBB 4RTWA 4D8DA 3H0HA 1QLYA 2KYMA 2EBPA 1I1JA 4F14A 2YUNA 2RQUA 5HCKA 2C0OA 1X43A 1MV3A 2W10A 1GBQA 3VS4A 3VRYA 1KFZA 1IO6A 2VVKA 2DM1A 4OMLA 3C0CA 2LQWA 4WCIA 5ECAA 2GNCA 2J6OA 2K79A 2EGEA 2HEQA 4AFUC 1GCQC 4AG1C 2DL3A 4LUEA 1HJDA 3I9QA 1ZSGA 2QDLA 2OI3A 2RPNA 2J05A 4OMPA 1KJWA 1NG2A 2ED0A 3NHNA 1SEMA 1AEYA 2E5KA 1Y57A 1B3QA 3SEMA 3PVQA 1X27A 4J9FA 2D8JA 1GBRA 1W6XA 1A0NB 1JU5C 2FEIA 2LP5A 1G2BA 3O5ZA 1K76A 4E6RA 1ZX6A 1ZUKA 1PRLC 2KR3A 1NM7A 2DJQA 5IHNA 1BK2A 2RF0A 4RTUA 4K11A 5FW9A 2B86A 2EVRA 1CSKA 1QWFA 1WXTA 1VYTA 1UHFA 5IXFA 1OPKA 2X3WD 2FO0A 2ROLA 2RN8A 1AZEA 1X6GA 4AFZC
chains in the Genus database with same CATH superfamily
2CZ0B 1U8RA 3JCMJ 3PMIA 1W1FA 3G7ZA 2RMOA 3A98A 4GY5A 2A7YA 1QCFA 3C12A 3A5ZB 1J3TA 1I5OB 1MMGA 5FU6B 3CCRT 2NUPB 2R58A 1TOVA 1XJWB 4DEYA 1WLPB 3O8VA 4F7UE 2DD4A 2P84A 5GAOm 2A36A 4C5HA 4C92A 2RK2A 4E7LA 2JMCA 1ZQ1A 1M3AA 1JXOA 2DXUA 4RTXA 2RI5A 3EGXB 3VV0A 1WFWA 3IQLA 3VS2A 5KYYA 5KYXB 1QVFP 1RABB 4P5NA 3A8MB 5KYWA 3CC7A 2KT1A 3H41A 3OYBA 4M75B 4JRKA 4M75F 2EW3A 1K8AC 1RAFB 2VKNA 4RTTA 3CCRQ 5HY6A 3QDRB 3CCSA 2MCNA 2BZYA 4RUGA 3UATA 4JRPA 1VQPT 2NWMA 3G71A 4PJLA 3LYIA 4ZN1A 4J9CA 2KMTA 1NJIR 3S6WA 3CCVA 1YNZA 2O01E 1C1AA 2HQEA 4F7UA 4M7AD 4A63B 5KH6A 1HXDA 3JV3A 1AWOA 1VYVA 1Z9QA 2GFAA 2CP2A 3HP9A 5KYUA 1NLPC 3CCEA 2J7IA 1MV0B 3BFMA 1VQPQ 1X2QA 3T9NA 5GAOn 5GANh 2R5MA 3M9QA 1ZLMA 2MWOA 2V1QA 3J7AF 2DVEA 1NEBA 2DL7A 4RG2A 1VA7A 3VYHB 2WSFE 4NS5A 2KXCA 2RO0A 3DLLA 4M7AG 5LL6S 1QVFS 5FU7B 2KQWA 2X3XD 1OI1A 1N6AA 1B7TA 1WHGA 2E12A 2SRCA 2CUDA 2FG0A 4MMLA 1IGUA 2DJZA 4A53A 1K0SA 3HFOA 2J6KA 2BKDN 2M0OA 3X26B 2BTTA 1G3SA 2K3XA 2PVGB 4M78B 1IREB 3WVEB 1U06A 4M78F 2D8HA 1WHLA 3GF5A 1CKAA 3PGGA 1K9MU 5EC7A 2K9GA 4M77D 4B6MA 4C8QD 3E1SA 1Y7XA 1T0HA 1LNXA 1WPYA 1E6GA 1TUCA 4WF2A 3DLMA 1KC8R 1D1AA 5KE3A 1XOVA 3OSVA 3CBMA 2CP6A 2GQIA 2RJEA 2DL8A 1KD1C 3M54A 3CD6T 3EGDB 2KT8A 2RB6A 2M1HA 1SG5A 1WDXA 1ZUYA 3I5SA 1G3YA 1UHCA 2DZCA 4QQDA 3ZL7C 4BY6C 1B34A 1X69A 2J06A 2DFUA 4M77G 4IUPA 2OAWA 3LH5A 4Z8AA 4C8QG 2FZCB 1VQNT 1KQ2A 4FYYB 4FYXB 1WXUA 4MZMA 4XQ3A 2RHYA 3CCQT 3M4GA 5LJ5j 2KI7A 3QUIA 1WHMA 3M0TA 2YRCA 4FYVB 3CD6Q 2CH4W 3RMQA 2SEMA 4F04B 4FIBA 3RIRA 1JJ2A 8ATCB 3TU4K 2EYZA 1P92A 5GAOp 3JCMc 4OMFB 2XG8D 4CI0C 2X4JA 4TVRA 1VQNQ 3M0RA 3EHRA 2CKKA 3M55A 2I0NA 2O9VA 2JUFA 3NGPA 4M78D 1BYMA 1ABQA 3BW1A 1UDLA 2DZ9A 2EAYA 1IXDA 4JJBA 3CCQQ 2GQVA 2HSEB 2F2XA 1Q86R 1X6OA 4C0ZA 1WIEA 4CC3A 4OMOA 4X9DA 3ZEHA 2XI9A 3MEWA 3OYEA 4JJNK 3DKMA 2DK3A 2DL5A 2LJ3A 1WHHA 2I2LA 2PUKB 2LX9A 1OYXA 2ZPFB 3P8BB 1ZBXA 3TVTA 1UGSB 2V8KA 1GFCA 3G4ST 5GAMh 4M78G 1VIFA 1EIFA 2RJFA 2HBPA 3MHXA 3QXEB 1GXIE 2OX7A 3CCLT 2EYYA 4EDUA 1PD0A 1ARKA 3JCMd 3EFOA 3JB9F 3CCUA 1QVGA 2EQJA 5DLOA 3E19A 1VQLA 2ZPGB 2GF7A 4AFQC 1N8RU 1QQJA 4LN2A 1Y96B 2YLBA 4PJOC 2CGHA 3G4SQ 3NTHA 5M9OA 1MNDA 1RAAB 2L2PA 5GANe 2K2VA 3C95A 3RKYA 4ZN3A 1VQMA 3R6NA 2CZ7B 3H8ZA 1Q86C 3CCLQ 1Q81U 3HRSA 4L6V5 4Z88A 3OYMA 2OAUA 2Y90A 4JS4A 2EQMA 1R0BG 5GMKl 3CC4A 4EMHA 1HD3A 4UC4A 1U3OA 2F2WA 2KNBB 5CVIA 2KXDA 4OMMA 1BI1A 4J6XA 1FX7A 2YRVA 3TREA 2RQWA 3VS5A 1T3LA 1VQ8T 4PFZA 3QBYA 4BI3A 1M3BA 2KEAA 5I11A 1LVKA 2FZKB 1VQ5A 3OS2A 2L3QA 1JO8A 1CKBA 1W4SA 1OZ2A 2XICA 1VQ8Q 2FL7A 2YRDA 4ELYC 3QYHB 3DB4A 2JN0A 3ER0A 2ZPHB 1KQSA 2YUNA 2XDBA 2C0OA 2L5QA 5A0DA 3JRZA 2E65A 4O5VA 2WACA 2X4XA 4LDXA 1W2BS 1KFZA 3CPFA 3JCMX 4E2FB 3OS0A 4AFUC 1N8RC 2MAMA 1ZSGA 2QDLA 3LH0A 3RERA 1FXXA 1M90U 1Y57A 3CMAT 1X27A 5LJ3h 3GOXA 1JU5C 1WJRA 1AT1B 3OSSC 2LP5A 5LJ3g 2LNVA 2EQKA 1G2BA 5LJ5d 3FLGA 5FRNA 4OF1A 4M7DB 4Q5WA 3LGFA 5IHNA 4M7DF 5LJ5f 1VQ6T 1BK2A 2Z0WA 5FW9A 2RHIA 1CSKA 3L2VA 4BUGA 3X24B 3LX7A 4HCBA 2JTMA 1X6GA 1K0XA 1BCMA 3CMAQ 3CXCS 2RHZA 3PE0A 2E3HA 2OTLA 3CCJT 1VQ6Q 1SKUB 5I2MA 4ANJA 4LDYA 2IPOB 2DBKA 1H92A 2HMAA 5CQXA 4X34A 3CPWA 3QKJA 2C0TA 3H9NA 1M2VA 4B9XA 5GAMe 3QG1A 1Y0MA 2NLUA 3JAME 1NEGA 3QJYA 1Q7YU 4C0DC 1E7OA 1I4K1 2QQRA 4KBMB 3HRTA 2PQWA 2F1LA 1VIEA 3OW2P 3CCJQ 3RESA 2R5AA 3L2RA 1D3BB 1QKWA 2BIVA 4BY6B 3OYLA 3JB9J 1RI9A 3INZA 2NUTA 4EMKC 1IHWA 3L2WA 1SF9A 1SPKA 4XTYA 4HT8A 3KFVA 2ED1A 4FCYA 4F17A 4RKUE 5GAOq 4LUDA 2YLCA 2GFUA 4C5GA 3S3MA 4J7FA 1HYOA 2RA2A 1YCYA 2L89A 1NLOC 2DIGA 1ZUUA 3KBGA 5IAYA 2L3SA 2PVDB 3GBQA 4MZPA 2Y4YA 5GAOl 5CK9A 1YJWT 2YUPA 4ESRA 1VYUA 3RNJA 2YWWA 3M53A 2PTKA 3L2UA 4C92C 1M1KU 5GMKj 2CT3A 2DILA 1Q82C 4C5EA 4LNPA 2KVQG 4OB0B 1M8MA 2LX7A 1FWZA 1UFFA 2VGNA 5KYNA 3FDRA 1I81A 2MWPA 2D0QB 4M7AB 5C0MA 3FC3A 1MMAA 4KULA 4M7AF 4DQ2A 1UGQB 2E41A 2EYXA 2DTHA 1YJWQ 4E47A 4HXJA 2CSQA 1K8AR 3PIPA 1WYXA 4BD3A 4HT9A 4FT2A 5GANf 4OGEA 3FIFA 2LQNA 5J3BA 1G3WA 2E5QA 4IUVA 4JLIA 3CC2T 4PJOB 1TWBA 2G3RA 2KYBA 4JJDA 1NPPA 4DEXA 2JS0A 1GFDA 3G1JA 2DA9A 1VQ7A 2CP7A 5L8RE 5A0GA 2DEUA 2JT4A 1YWOA 2K2MA 2CZ6B 1C0MA 2CP3A 3FRNA 3CQTA 1M27C 5LJ3e 2NYSA 3VU3C 5KE2A 2LRQA 2F2VA 3CC2Q 1IGQA 1MMDA 1I07A 2HZYA 1BCOA 2LT1A 2E70A 4PK4A 2YUQA 3OBWA 2LQKA 4BE2A 2E6ZA 3H0IA 4M77B 4Z02A 4JZ4A 4AMCA 4C8QB 3LGLA 1UTIA 4M77F 3A8OB 4J9EA 3QJ6A 4C8QF 4OP0A 4XU3A 3I55T 2XMFA 4MMKA 3H0FA 4FW1A 2JM9A 4EPCA 3S3OA 2YDLA 1RACB 4ELZC 2XHCA 2A28A 1YIJT 1EZZB 4AG2C 2K3BA 4N0AA 3CD6A 2D1XA 3EG9A 2YSQA 2VC8A 5GAN8 2WSEE 1O75A 4PKCC 3FEOA 5GANg 1OQKA 3EH1A 4LDUA 3OYAA 3I55Q 1KHIA 1M2OA 2FRWA 3CBPA 1RLQC 4KGZB 2Y4XA 1UJ0A 4RTYA 1WQWA 3OMCA 3MCAB 1K1ZA 1YJ9T 2BE9B 1WXBA 1YIJQ 4PJOD 4E7KA 1KD1R 1M8VA 4J9BA 2DMOA 1R0CB 3UA6A 5IT9E 3C4SA 4Y91A 4BI8B 2CZ1B 2XDPA 3EFSA 1GL5A 1PC0A 1G5VA 4IUQA 3I5RA 4AT1B 2IIMA 2E10A 2PUOB 1ZHIA 1YJ9Q 3OBYA 1KC8U 2AKLA 1Z9ZA 4PJOG 3FJPA 4N4HA 2CS7A 2L0AA 3CC7T 2DIQA 3VS6A 3QSUA 3P8HA 3I56T 4GBQA 1VQ4A 2RK1A 2ZGWA 3WXMB 2DO3A 3OYYA 1QWEA 4ZGJB 1TTHB 1T3SA 2E1HA 4ZGDB 1OZ3A 2JVVA 3G4SA 3G71T 3OYJA 3URGA 4ZTFA 3ME9A 2ZAEA 1I8FA 4J8OA 2QXFA 2H3JA 1ZSZC 3RR6A 2ZPEB 3CCVT 3NTIA 1BBZA 1M3CA 1AHJB 3CC7Q 3I56Q 3QWYA 2CSIA 2EQIA 3ZFJA 2X51A 4DBHA 1BB9A 3OYHA 1S72T 3M0PA 1YWPA 3L2ZA 1X6BA 2VWFA 1X75C 3HTRA 1PM3A 2EGCA 4C0DB 1VOMA 3G71Q 2EKOA 4PNOA 2DBMA 1AWJA 2RI3A 4J6WA 2ZZDA 2LC4A 2W0ZA 1S1NA 3CCVQ 1N5ZA 6AT1B 2E6NA 1IB8A 5A0LA 3QHSA 4R55A 1SHFA 5GJWB 4J83A 1U1SA 4J9GA 4JJCA 4EMKB 2LJ1A 5I2SA 1O9SA 4RTZA 4XTXA 3ULRB 4ORZA 1S72Q 1UGPB 3Q1JA 3REBB 3CMEA 1VUBA 2QTVA 2RJCA 2KYMA 1I1JA 1QVGS 4F14A 2RQUA 5HCKA 2VXEA 4PFOA 1K73U 1X43A 1XTDA 3OYDA 1GBQA 3HFNA 3VS4A 4XU1A 1ZSZA 3L42A 5DY9A 2AHJB 1QP3A 2VVKA 2DXBA 1UEBA 4QQGA 1FMVA 4OMLA 1PG5B 1KQSP 4E7SA 3J80E 4C92B 1K9MC 4NL3A 5KCOA 1ZA1B 3TQ7P 2DL3A 3L1AA 4E7HA 3JB9H 2AIRB 1RL2A 5KYYB 1KJWA 2JTFA 1SEMA 5GAMg 5KYWB 3PVQA 2EFIA 4J9FA 2D8JA 1PSEA 1R77A 2FEIA 2ATCB 3RKWA 3TEEA 3G6ET 4ATOA 1PRLC 2X4YA 2JOYA 1WXTA 4JRQA 1VYTA 3QIIA 2MPXC 3OYNA 4BB7A 5GAOr 1QCOA 2EYQA 1YHQA 2X3WD 4F7UB 2RN8A 3UT1A 2X9HA 1N27A 4F7UF 2K5LA 2JJ9A 1PNJA 2COYA 5KYUB 3G6EQ 1W2BP 2HKNA 5FU6C 2FPFA 5LJ3f 3CMAA 1DJ7B 2ESWA 2LQ8A 3TSZA 4XTUA 2MYSA 3SWNA 3M4YA 4N4IA 1KQSS 2FYKA 3THKA 2G6FX 1N8RR 2ZPBB 4Y28E 1SHGA 1VQKT 3OS5A 3PVLA 1XQHA 5GAN2 4JLGA 1NPRA 2HDAA 4RCBA 5D6XA 3EFRA 4C92D 2QEXA 1Q81R 4OMQA 1JQQA 4EMGA 4DA4A 4IIOA 5GANj 3V7SA 2EJGA 1OX9A 2DRKA 2HL5C 2KRNA 2RD1A 3QO3A 3PTAA 3GP8A 4HA8A 4WTOB 4DBFA 4M75E 4DBQA 1PKTA 2K7AA 3HPWA 1NE8A 2RQVA 2VXFA 4XTWA 3CXCP 5I21A 2KRMA 2X4WA 1VQKQ 3BDUA 5HK3A 4HCKA 3NPFA 9ATCB 3JCMb 1OU8A 5IH2A 4YTLA 2JNGA 1TS9A 3LWIA 2NUPA 4C92G 5CKFA 2QQ9A 2DETA 2EIFA 4D8KA 1MUZA 4PL6A 4Z89A 5C6SA 1I0CA 1PCXA 3EGXA 2O88A 3SB2A 4KH1B 5KYXA 2DNUA 2E4HA 1YJNT 3JCMh 3V7RA 2LZ6B 1FMWA 3JCMg 1OV3A 1TSFA 4M75A 2KBTA 4HVUA 2HNIA 2AKKA 1Q81C 2OJ2A 1MGQA 2XK0A 5FRMA 3J81E 4LDVA 1WGSA 3MP8A 1W70A 1B34B 2DRMA 2MMPA 4F16A 2QTXA 2FPDA 4M77A 3CC4T 1VQOA 1NYGA 4F7UG 4CC2A 1YJNQ 5HK0A 5J26A 2DERA 4VUBA 1VQ9T 1V76A 1YP5A 3M0QA 2MIOA 4MDXA 3X28B 4J7IA 4A4EA 5AT1B 3BDLA 2LNHB 2C0IA 3EGUA 4RTVA 1G3TA 1UJYA 1AD5A 2DL4A 2JS2A 1ACMB 2O31A 5CQYA 2LDMA 1M90R 4M78E 1C6VX 3OYCA 3CC4Q 1YI2T 1VQ5T 3MEAA 1WNLA 2HQXA 2O9SA 1VQ9Q 3OYIA 4X9CA 4XU0A 3OYFA 1Q82R 2EGAA 3M57A 4FT4A 8AT1B 2JM8A 1RADB 1LPLA 2KRSA 3HSBA 3F70A 4KH0B 1U5SA 1QP2A 2BUDA 2CYZB 4QVCA 1YI2Q 2M51A 4QT7A 1VQ5Q 4J6YA 2AZVA 1UGRB 3OYKA 1UECA 4KUIA 2RM4A 2V26A 3NMZC 4M78A 3CCRA 1ZA2B 5AYFA 4EIKA 1BIAA 3EFOB 4JS5A 1YFNA 2F5TX 1M90C 1JB0E 1YN8A 1N9RA 2QA4T 2K5FA 5GAMj 2VGMA 4C0FA 1D1CA 2EJFA 3VS0A 4FL6A 2K3YA 4ZTJA 2L8DA 2CP0A 3HKSA 3AHUA 2VV5A 2RNAA 1K8AU 1VQPA 5LJ5h 2WSCE 2OTJT 1RAGB 1TH7A 2VYTA 2KROA 3EGDA 1YCSB 2XD0A 2QA4Q 3CCMT 4HCCA 4RG8A 1TXQA 3MP1A 2V8IA 4PJJA 5DM7R 4KT0E 4DBRA 1UG1A 3QYGB 1H8KA 1D0ZA 1YIJA 1OOTA 1XNIA 1OU9A 4A54A 3S3NA 2OTLT 5GANd 3OA6A 4M4ZA 1KQ1A 2ZPIB 1X01A 4X1VA 3L2QA 1KIKA 2OTJQ 1AWXA 4FYWB 2LTOA 1G8XA 1NZ9A 4FSSA 3N5BB 2DXCA 3M59A 3M0UA 1Q7YC 2KAFA 1BU1A 4IIMA 3CCMQ 2K57A 4A4HA 4AFSC 3MP6A 3PT9A 5A2QE 4L59A 1NBEB 3VJPA 5CKBA 2O2OA 1YITT 5CO7A 4N0AC 4D6WA 4PJOF 2JTEA 2OTLQ 2EYWA 2AK5A 1M5Q1 2DPPB 5GJVB 2HAXA 5GAN3 1M9SA 1KHCA 2PVOB 1WA7A 3DB3A 2JW4A 3JCMe 3GNGA 3KXTA 4HVWA 2CUBA 1G83A 3META 3JCMP 1Q95G 3E9FA 1MMNA 1NJIU 4KRTA 1ABOA 4NL2A 1PD1A 4RMOA 4J9HA 1YITQ 5D7UA 2A37A 1GCQA 5FROA 3OW2A 2DTOA 2FB7A 1RI0A 3QWXX 3JB9I 1M1KC 1WQ7A 2LT4A 3HL8A 3I56A 1H3ZA 2GCXA 2LJ0A 2CH4A 2XDDA 3MEVA 4HVVA 4E7JA 2LCCA 3VUBA 4PLIA 3X20B 2HCKA 1Y96A 1WZOA 1RAHB 3VS1A 1UUEA 4RTWA 3OY9A 4BE0A 1KD1U 2VUBA 3OS1A 1JJ2P 2EBPA 5LJ3j 3A8LB 3CEYA 4II1A 2MI6A 1MV3A 1VQNA 1S72A 4BI4A 4A4KA 4FSXA 2FVUA 4J5YA 2YXYA 3SDZA 3CCQA 5CAIA 1Y07A 2DM1A 3GLXA 3C0CA 2LQWA 4WCIA 4V2SA 2HQHA 2J6OA 2EGEA 4AG1C 3UPUA 2XIDA 1BI3A 1M2VB 5EG2A 3TCJA 1BI2A 2ED0A 3NFCA 3OYGA 2E5KA 1B3QA 2R57A 3GNFB 3C94A 1A0NB 2QQSA 5D6WA 1VQ7T 4M7DC 1ZX6A 1ZUKA 2KR3A 1NJIC 2NUTB 2RF0A 2P4TA 4RTUA 4K11A 1F1BB 2EVRA 3VUZA 2A0FB 2DXTA 3FB9A 3RDVA 4IUTA 1UHFA 5GAN5 4M75D 5IXFA 2O4XB 5CCAA 1QVGP 3OMGA 2FO0A 4MDWA 5GAMd 3HHTB 4M7DE 1AZEA 4AFZC 5DLQE 4PJNA 4MZTA 3CCST 1JJ2S 3EAEA 1AVZC 5GAMf 5LJ5e 1VQ7Q 2LVMA 1QVFA 2HL3A 4GLKA 1UGVA 3HRUA 4OGCA 2VASA 3SHWA 5D6YA 4XU2A 1MNEA 1WI7A 3BE3A 3E9GA 3CCLA 1KSWA 2GTOA 2ROTA 5L23A 3G6EA 1KK7A 2P0QA 2RQTA 4A4FA 4M75G 1K9MR 3CCET 1V29B 2EWNA 3CCSQ 2MOXA 3D7SB 1WX6A 1JXMA 1QW1A 3MKDA 4NOYA 2DYBA 2P0KA 4KGXB 2YUOA 1HK9A 4OB2B 4M7DA 1ZBJA 3EH2A 3VKIA 1IHVA 4LXCA 2KSSA 1BIBA 4OVAA 4L5GA 3RMSA 1H641 1WHJA 1D09B 3VS7A 5IN1A 5GAN4 1Q86U 2P0PA 5KCHA 2K4YA 5HKCA 2IVWA 2KGTA 3PFSA 5CIUA 3CCEQ 2CT4A 2HBWA 3TSWA 3CBOA 2DKGA 2LCSA 3QZ5B 2V1RA 3GIBA 5CKDA 1K9AA 2QYZA 1VQ8A 1D1BA 1RLPC 1BKBA 5GAN7 3H6ZA 1K4US 1FMKA 4XTVA 1KC8C 1VQKA 1KG1A 2QK0A 4ZNXA 4QVDA 2EQUA 2QGFB 4PLLA 1AZGB 2GGRA 2LCLA 3RUXA 4B9WA 2E64A 3MEUA 3SWNC 4C92F 4PFPA 2NUZA 1SSHA 2M02A 4ME7A 5IHIA 2QG9B 1IZ6A 4FU6A 1QMCA 2ECZA 2BZXA 2E3IA 1FYNA 1I5LA 1JRIA 1VQ4T 4M7AC 1B07A 2B8AA 1D3BA 4HCZA 2JMAA 3U23A 2RJDA 2RH2A 3ASKA 5GMKi 1EFNA 4FM4B 3A1PA 1K73R 1U1TA 3QPHA 4R56A 3EG0A 1IRXA 1QKXA 2P4RA 2DVJA 3VYGA 2IG0A 4M7AE 5GMKh 3E2UA 3M58A 2KDSA 4DOVA 4OB1B 1GCPA 2CDTA 1SRLA 2DYIA 3EG2A 2DLPA 1VQ4Q 3JCMQ 3P8DA 3VRZA 3JCMf 3UDCA 3MPUB 1YJNA 1TU0B 5LJ3d 2QI2A 2MK5A 2L3PA 2AT1B 2GBQA 2LMJA 4FW2A 2C06A 3M0SA 4CC7A 2ENMA 4PJMA 1JBMA 2D6FA 3EG9B 5CKHA 2GTJA 3JCMW 2L3RA 4A4GA 1MHNA 4DOWA 4N4GA 3V7CA 2YHTA 4JZ3A 3A8HB 2KY9A 2ZCFB 4HKEA 1HSQA 2K6DA 1VQ6A 4PJOE 2RQRA 4E7IA 2M0YA 4M75C 4M7AA 3CMET 3V8LA 1VQ9A 1N9SA 1OEBA 3CPWP 1K73C 1M4ZA 1UB4A 2PZ1A 5FWBA 4Y92A 2FPEA 4ZGEB 4QVZA 5I22A 2DF6A 4OB3B 1V1CA 1WJSA 1D0YA 1NYFA 1X2KA 4J9IA 2CREA 4M77C 2KE9A 4C5IA 3PMTA 4C8QC 3CCJA 2J6FA 3QZ9B 1T0JA 4CC4B 5CKEA 4QQ6A 1D0XA 1SRMA 2X35A 1YI2A 1BI0A 2XU8A 3CMEQ 4M77E 1WJQA 4C8QE 4PJOA 1UE9A 1LCKA 4LD9K 2FRYA 4BACA 2FZGB 3JB9D 2F5KA 3CCUT 3V8KA 3REAB 2XKOC 2EPDA 2DD5A 1VQLT 2QGGA 1QVPA 4IKFA 2H3EB 3PNWC 1EX4A 3QDFA 2QASA 5FU7C 2ABLA 2AZSA 2M9UA 2A08A 2V8JA 3OB9A 5GMKm 1RAIB 4OMNA 2MF2A 1YHQT 3BY7A 3SD4A 1VQMT 3MJXA 4QW2A 1H3HA 2DTIA 3VS3A 4KGVB 7AT1B 3CPWS 2M16A 3JSCA 1TG0A 1JEGA 3CCUQ 4J9DA 2QA4A 3JB9G 4C8QA 1VQLQ 2YT6A 1WHKA 4M78C 3EG3A 4JRIA 1YJWA 4XAXB 3M5AA 3RBBB 1GRIA 2BZ8A 4JDSA 1M1FA 1AWWA 1YHQQ 1VQMQ 2HSPA 2PNIA 5FWCA 5FLXE 3NTKA 2EKHA 1Q82U 4R0KA 4O6JA 2OTJA 2JXBA 2CP5A 4JPBW 1PRMC 1W2BA 2K5IA 2DEQA 1R8OB 2RI2A 1RUWA 3CCMA 2RHXA 2QEXT 1PKSA 1PSFA 2JZ2A 3KUFA 3EHQA 4LD6A 2RHUA 4GLMA 1E6HA 3UF4A 1ZSZB 1Y71A 2D0NA 3UA7A 4E7ZA 2D9TA 1TUDA 3LLRA 3LWHA 5GAN6 3WVDB 4LDWA 2QEXQ 3A8GB 1M30A 2QAZA 3CC2A 2H8HA 1LJOA 5GMKe 5CR2A 2DX1A 1AOJA 3I35A 1YITA 2COWA 3FJ5A 1PWTA 3EG1A 3CXCA 1OULA 1OPLA 4KUDK 1LOJA 1OX8A 4LE9A 1PHTA 4XTZA 5IXBA 4RCCA 3RKXA 1RAEB 2BE7D 1Q7YR 2QQAA 2DE0X 1QCNA 2O4XA 2KK4A 1M1GA 1TUGB 3X25B 4D8DA 3H0HA 1QLYA 4JUVA 3MO8A 4C0GA 1YBYA 2EJ9A 4M7DD 5J39A 4CRIA 2W10A 1VQOT 3VRYA 3PIOA 2HD0A 2COZA 5LJ5g 1IO6A 2QQBA 3I55A 5ECAA 2A3LA 2GNCA 2HEQA 2K79A 3V8JA 4QKUA 3SFMA 4IUUA 1GCQC 3SWNB 4LUEA 1HJDA 3GPLA 3I9QA 4BDZA 2OI3A 3OQ5A 2RPNA 2J05A 4OMPA 3JCMV 1NG2A 3NHNA 3ZBDA 1AEYA 2FHDA 2QDYB 3LW5E 3SEMA 2DAQA 1GBRA 2VB6A 1W6XA 4M7DG 4C92E 1VQOQ 1M1KR 2F69A 2HKQB 1K76A 3O5ZA 4E6RA 3R6OA 4BE1A 3OW2S 1NM7A 2DJQA 4EMKA 3AT1B 4BDYA 2B86A 3M56A 4XK8E 4IURA 1QWFA 1YJ9A 3UWNA 1SSFA 2PU9B 1OPKA 2ROLA 5IHKA
chains in the Genus database with same CATH topology
1W1FA 1PNJA 3PE0A 1AVZC 2RMOA 3A98A 1QCFA 1J3TA 1UGVA 2FPFA 4DEYA 3SHWA 1WLPB 1WI7A 2ESWA 1KSWA 2A36A 3TSZA 2JMCA 2GTOA 2DBKA 1M3AA 1H92A 2ROTA 1JXOA 5L23A 4RTXA 2C0TA 2RQTA 1WFWA 3IQLA 3THKA 3VS2A 1Y0MA 2G6FX 1NEGA 2MOXA 1WX6A 2KT1A 1JXMA 1SHGA 1E7OA 3H41A 2DYBA 3PVLA 2EW3A 2YUOA 2HDAA 1QKWA 2VKNA 4RTTA 1ZBJA 4OMQA 2MCNA 1JQQA 2BZYA 4IIOA 1RI9A 4RUGA 3UATA 2DRKA 2NWMA 2KRNA 3VS7A 1SPKA 3KFVA 4J9CA 2ED1A 1YNZA 1PKTA 2KGTA 4F17A 2K7AA 2CT4A 2RQVA 4LUDA 2HBWA 4A63B 2KRMA 3TSWA 2LCSA 3JV3A 2V1RA 1AWOA 1VYVA 1Z9QA 1NLOC 1K9AA 4HCKA 3NPFA 1ZUUA 1NLPC 5IH2A 1RLPC 2J7IA 1MV0B 2L3SA 3GBQA 1K4US 1X2QA 1FMKA 4ZNXA 2YUPA 4ESRA 1VYUA 3RNJA 1AZGB 2PTKA 4D8KA 1MUZA 2GGRA 4Z89A 1ZLMA 2V1QA 1I0CA 2CT3A 2DILA 1NEBA 2DL7A 2O88A 1VA7A 4LNPA 2NUZA 1SSHA 2DNUA 5IHIA 2KXCA 1M8MA 2LX7A 1UFFA 2BZXA 2ECZA 2LZ6B 1FYNA 1OV3A 2X3XD 2KBTA 4HVUA 2AKKA 1B07A 2OJ2A 2SRCA 2CUDA 2FG0A 2JMAA 3U23A 2EYXA 1W70A 2DRMA 1EFNA 4HXJA 2CSQA 4F16A 3EG0A 1K0SA 2FPDA 1QKXA 2P4RA 1WYXA 1NYGA 2DVJA 2J6KA 4CC2A 2BTTA 1U06A 1YP5A 3M0QA 2LQNA 2MIOA 1GCPA 2CDTA 2D8HA 1SRLA 3EG2A 2DLPA 1CKAA 2LNHB 2C0IA 3EGUA 3VRZA 4RTVA 1UJYA 5EC7A 1AD5A 2DL4A 2JS2A 2O31A 2L3PA 2LMJA 2GBQA 2K9GA 3M0SA 4CC7A 2ENMA 1T0HA 1E6GA 2KYBA 4JJDA 5IHKA 4DEXA 2JS0A 1GFDA 1TUCA 2GTJA 2DA9A 2O9SA 2JT4A 1YWOA 2K2MA 4JZ3A 1XOVA 1HSQA 2K6DA 2GQIA 2EGAA 2DL8A 2RQRA 3CQTA 2M0YA 1M27C 2KT8A 2JM8A 1WDXA 1ZUYA 3I5SA 2F2VA 1OEBA 1UHCA 2KRSA 3ZL7C 2PZ1A 1I07A 5FWBA 1U5SA 4Y92A 2J06A 1X69A 2FPEA 5I22A 2DF6A 2OAWA 1V1CA 3LH5A 2M51A 4Z8AA 4QT7A 2YUQA 1NYFA 2AZVA 1X2KA 4J9IA 2CREA 3H0IA 1UECA 2KE9A 1WXUA 4JZ4A 1UTIA 2J6FA 3NMZC 4J9EA 1T0JA 4CC4B 4EIKA 2XMFA 1SRMA 3M0TA 2CH4W 3H0FA 2SEMA 2JM9A 2YDLA 2A28A 2EYZA 1YN8A 4AG2C 1UE9A 1LCKA 2K3BA 2D1XA 3M0RA 2FRYA 3EHRA 2I0NA 2O9VA 3NGPA 2YSQA 1ABQA 1UDLA 3VS0A 4JJBA 3REAB 2EPDA 2F2XA 2RNAA 2FRWA 1RLQC 1UJ0A 4RTYA 2ABLA 2AZSA 1K1ZA 1WIEA 1WXBA 2KROA 2A08A 1YCSB 4OMNA 4CC3A 4OMOA 4J9BA 2DL5A 2LJ3A 1H3HA 2DMOA 3VS3A 3TVTA 3UA6A 1UG1A 1H8KA 1GFCA 1JEGA 1TG0A 1OOTA 4J9DA 1GL5A 4M4ZA 3I5RA 2YT6A 2IIMA 4X1VA 3EG3A 2EYYA 1KIKA 1AWXA 3RBBB 1ARKA 4FSSA 1GRIA 2BZ8A 3M0UA 1AWWA 4IIMA 1BU1A 2AKLA 1Z9ZA 4AFSC 2HSPA 2PNIA 5FWCA 2L0AA 4AFQC 2EKHA 4LN2A 4R0KA 2JXBA 3VS6A 2O2OA 4JPBW 1PRMC 4GBQA 2L2PA 2JTEA 2EYWA 1RUWA 2AK5A 1QWEA 5GJVB 3R6NA 1T3SA 1PKSA 1WA7A 2JW4A 4Z88A 3EHQA 4HVWA 2CUBA 1G83A 4GLMA 1E6HA 3UF4A 2D0NA 4KRTA 3UA7A 1BBZA 1M3CA 1HD3A 1ABOA 1U3OA 1TUDA 2F2WA 4J9HA 2KNBB 2KXDA 2A37A 4OMMA 1GCQA 3QWYA 2CSIA 2RQWA 3VS5A 2EQIA 1T3LA 3QWXX 1BB9A 3M0PA 1YWPA 1X6BA 1M30A 2VWFA 1M3BA 2H8HA 1K0XA 2EGCA 2DX1A 1AOJA 3I35A 2DBMA 1AWJA 3FJ5A 2KEAA 1PWTA 2LJ0A 2CH4A 3EG1A 5I11A 2W0ZA 1S1NA 1N5ZA 4HVVA 1OPLA 2L3QA 4LE9A 1SHFA 1JO8A 1PHTA 5GJWB 5IXBA 1CKBA 2HCKA 4J9GA 4JJCA 2LJ1A 4RTZA 3ULRB 3VS1A 4ORZA 2DE0X 1UUEA 3REBB 4RTWA 4D8DA 3H0HA 1QLYA 2KYMA 2EBPA 1I1JA 4F14A 2YUNA 2RQUA 5HCKA 2C0OA 1X43A 1MV3A 2W10A 1GBQA 3VS4A 3VRYA 1KFZA 1IO6A 2VVKA 2DM1A 4OMLA 3C0CA 2LQWA 4WCIA 5ECAA 2GNCA 2J6OA 2K79A 2EGEA 2HEQA 4AFUC 1GCQC 4AG1C 2DL3A 4LUEA 1HJDA 3I9QA 1ZSGA 2QDLA 2OI3A 2RPNA 2J05A 4OMPA 1KJWA 1NG2A 2ED0A 3NHNA 1SEMA 1AEYA 2E5KA 1Y57A 1B3QA 3SEMA 3PVQA 1X27A 4J9FA 2D8JA 1GBRA 1W6XA 1A0NB 1JU5C 2FEIA 2LP5A 1G2BA 3O5ZA 1K76A 4E6RA 1ZX6A 1ZUKA 1PRLC 2KR3A 1NM7A 2DJQA 5IHNA 1BK2A 2RF0A 4RTUA 4K11A 5FW9A 2B86A 2EVRA 1CSKA 1QWFA 1WXTA 1VYTA 1UHFA 5IXFA 1OPKA 2X3WD 2FO0A 2ROLA 2RN8A 1AZEA 1X6GA 4AFZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1F A;  1PNJ A;  3PE0 A;  1AVZ C;  2RMO A;  3A98 A;  1QCF A;  1J3T A;  1UGV A;  2FPF A;  4DEY A;  3SHW A;  1WLP B;  1WI7 A;  2ESW A;  1KSW A;  2A36 A;  3TSZ A;  2JMC A;  2GTO A;  2DBK A;  1M3A A;  1H92 A;  2ROT A;  1JXO A;  5L23 A;  4RTX A;  2C0T A;  2RQT A;  1WFW A;  3IQL A;  3THK A;  3VS2 A;  1Y0M A;  2G6F X;  1NEG A;  2MOX A;  1WX6 A;  2KT1 A;  1JXM A;  1SHG A;  1E7O A;  3H41 A;  2DYB A;  3PVL A;  2EW3 A;  2YUO A;  2HDA A;  1QKW A;  2VKN A;  4RTT A;  1ZBJ A;  4OMQ A;  2MCN A;  1JQQ A;  2BZY A;  4IIO A;  1RI9 A;  4RUG A;  3UAT A;  2DRK A;  2NWM A;  2KRN A;  3VS7 A;  1SPK A;  3KFV A;  4J9C A;  2ED1 A;  1YNZ A;  1PKT A;  2KGT A;  4F17 A;  2K7A A;  2CT4 A;  2RQV A;  4LUD A;  2HBW A;  4A63 B;  2KRM A;  3TSW A;  2LCS A;  3JV3 A;  2V1R A;  1AWO A;  1VYV A;  1Z9Q A;  1NLO C;  1K9A A;  4HCK A;  3NPF A;  1ZUU A;  1NLP C;  5IH2 A;  1RLP C;  2J7I A;  1MV0 B;  2L3S A;  3GBQ A;  1K4U S;  1X2Q A;  1FMK A;  4ZNX A;  2YUP A;  4ESR A;  1VYU A;  3RNJ A;  1AZG B;  2PTK A;  4D8K A;  1MUZ A;  2GGR A;  4Z89 A;  1ZLM A;  2V1Q A;  1I0C A;  2CT3 A;  2DIL A;  1NEB A;  2DL7 A;  2O88 A;  1VA7 A;  4LNP A;  2NUZ A;  1SSH A;  2DNU A;  5IHI A;  2KXC A;  1M8M A;  2LX7 A;  1UFF A;  2BZX A;  2ECZ A;  2LZ6 B;  1FYN A;  1OV3 A;  2X3X D;  2KBT A;  4HVU A;  2AKK A;  1B07 A;  2OJ2 A;  2SRC A;  2CUD A;  2FG0 A;  2JMA A;  3U23 A;  2EYX A;  1W70 A;  2DRM A;  1EFN A;  4HXJ A;  2CSQ A;  4F16 A;  3EG0 A;  1K0S A;  2FPD A;  1QKX A;  2P4R A;  1WYX A;  1NYG A;  2DVJ A;  2J6K A;  4CC2 A;  2BTT A;  1U06 A;  1YP5 A;  3M0Q A;  2LQN A;  2MIO A;  1GCP A;  2CDT A;  2D8H A;  1SRL A;  3EG2 A;  2DLP A;  1CKA A;  2LNH B;  2C0I A;  3EGU A;  3VRZ A;  4RTV A;  1UJY A;  5EC7 A;  1AD5 A;  2DL4 A;  2JS2 A;  2O31 A;  2L3P A;  2LMJ A;  2GBQ A;  2K9G A;  3M0S A;  4CC7 A;  2ENM A;  1T0H A;  1E6G A;  2KYB A;  4JJD A;  5IHK A;  4DEX A;  2JS0 A;  1GFD A;  1TUC A;  2GTJ A;  2DA9 A;  2O9S A;  2JT4 A;  1YWO A;  2K2M A;  4JZ3 A;  1XOV A;  1HSQ A;  2K6D A;  2GQI A;  2EGA A;  2DL8 A;  2RQR A;  3CQT A;  2M0Y A;  1M27 C;  2KT8 A;  2JM8 A;  1WDX A;  1ZUY A;  3I5S A;  2F2V A;  1OEB A;  1UHC A;  2KRS A;  3ZL7 C;  2PZ1 A;  1I07 A;  5FWB A;  1U5S A;  4Y92 A;  2J06 A;  1X69 A;  2FPE A;  5I22 A;  2DF6 A;  2OAW A;  1V1C A;  3LH5 A;  2M51 A;  4Z8A A;  4QT7 A;  2YUQ A;  1NYF A;  2AZV A;  1X2K A;  4J9I A;  2CRE A;  3H0I A;  1UEC A;  2KE9 A;  1WXU A;  4JZ4 A;  1UTI A;  2J6F A;  3NMZ C;  4J9E A;  1T0J A;  4CC4 B;  4EIK A;  2XMF A;  1SRM A;  3M0T A;  2CH4 W;  3H0F A;  2SEM A;  2JM9 A;  2YDL A;  2A28 A;  2EYZ A;  1YN8 A;  4AG2 C;  1UE9 A;  1LCK A;  2K3B A;  2D1X A;  3M0R A;  2FRY A;  3EHR A;  2I0N A;  2O9V A;  3NGP A;  2YSQ A;  1ABQ A;  1UDL A;  3VS0 A;  4JJB A;  3REA B;  2EPD A;  2F2X A;  2RNA A;  2FRW A;  1RLQ C;  1UJ0 A;  4RTY A;  2ABL A;  2AZS A;  1K1Z A;  1WIE A;  1WXB A;  2KRO A;  2A08 A;  1YCS B;  4OMN A;  4CC3 A;  4OMO A;  4J9B A;  2DL5 A;  2LJ3 A;  1H3H A;  2DMO A;  3VS3 A;  3TVT A;  3UA6 A;  1UG1 A;  1H8K A;  1GFC A;  1JEG A;  1TG0 A;  1OOT A;  4J9D A;  1GL5 A;  4M4Z A;  3I5R A;  2YT6 A;  2IIM A;  4X1V A;  3EG3 A;  2EYY A;  1KIK A;  1AWX A;  3RBB B;  1ARK A;  4FSS A;  1GRI A;  2BZ8 A;  3M0U A;  1AWW A;  4IIM A;  1BU1 A;  2AKL A;  1Z9Z A;  4AFS C;  2HSP A;  2PNI A;  5FWC A;  2L0A A;  4AFQ C;  2EKH A;  4LN2 A;  4R0K A;  2JXB A;  3VS6 A;  2O2O A;  4JPB W;  1PRM C;  4GBQ A;  2L2P A;  2JTE A;  2EYW A;  1RUW A;  2AK5 A;  1QWE A;  5GJV B;  3R6N A;  1T3S A;  1PKS A;  1WA7 A;  2JW4 A;  4Z88 A;  3EHQ A;  4HVW A;  2CUB A;  1G83 A;  4GLM A;  1E6H A;  3UF4 A;  2D0N A;  4KRT A;  3UA7 A;  1BBZ A;  1M3C A;  1HD3 A;  1ABO A;  1U3O A;  1TUD A;  2F2W A;  4J9H A;  2KNB B;  2KXD A;  2A37 A;  4OMM A;  1GCQ A;  3QWY A;  2CSI A;  2RQW A;  3VS5 A;  2EQI A;  1T3L A;  3QWX X;  1BB9 A;  3M0P A;  1YWP A;  1X6B A;  1M30 A;  2VWF A;  1M3B A;  2H8H A;  1K0X A;  2EGC A;  2DX1 A;  1AOJ A;  3I35 A;  2DBM A;  1AWJ A;  3FJ5 A;  2KEA A;  1PWT A;  2LJ0 A;  2CH4 A;  3EG1 A;  5I11 A;  2W0Z A;  1S1N A;  1N5Z A;  4HVV A;  1OPL A;  2L3Q A;  4LE9 A;  1SHF A;  1JO8 A;  1PHT A;  5GJW B;  5IXB A;  1CKB A;  2HCK A;  4J9G A;  4JJC A;  2LJ1 A;  4RTZ A;  3ULR B;  3VS1 A;  4ORZ A;  2DE0 X;  1UUE A;  3REB B;  4RTW A;  4D8D A;  3H0H A;  1QLY A;  2KYM A;  2EBP A;  1I1J A;  4F14 A;  2YUN A;  2RQU A;  5HCK A;  2C0O A;  1X43 A;  1MV3 A;  2W10 A;  1GBQ A;  3VS4 A;  3VRY A;  1KFZ A;  1IO6 A;  2VVK A;  2DM1 A;  4OML A;  3C0C A;  2LQW A;  4WCI A;  5ECA A;  2GNC A;  2J6O A;  2K79 A;  2EGE A;  2HEQ A;  4AFU C;  1GCQ C;  4AG1 C;  2DL3 A;  4LUE A;  1HJD A;  3I9Q A;  1ZSG A;  2QDL A;  2OI3 A;  2RPN A;  2J05 A;  4OMP A;  1KJW A;  1NG2 A;  2ED0 A;  3NHN A;  1SEM A;  1AEY A;  2E5K A;  1Y57 A;  1B3Q A;  3SEM A;  3PVQ A;  1X27 A;  4J9F A;  2D8J A;  1GBR A;  1W6X A;  1A0N B;  1JU5 C;  2FEI A;  2LP5 A;  1G2B A;  3O5Z A;  1K76 A;  4E6R A;  1ZX6 A;  1ZUK A;  1PRL C;  2KR3 A;  1NM7 A;  2DJQ A;  5IHN A;  1BK2 A;  2RF0 A;  4RTU A;  4K11 A;  5FW9 A;  2B86 A;  2EVR A;  1CSK A;  1QWF A;  1WXT A;  1VYT A;  1UHF A;  5IXF A;  1OPK A;  2X3W D;  2FO0 A;  2ROL A;  2RN8 A;  1AZE A;  1X6G A;  4AFZ C; 
#chains in the Genus database with same CATH topology
 2CZ0 B;  1U8R A;  3JCM J;  3PMI A;  1W1F A;  3G7Z A;  2RMO A;  3A98 A;  4GY5 A;  2A7Y A;  1QCF A;  3C12 A;  3A5Z B;  1J3T A;  1I5O B;  1MMG A;  5FU6 B;  3CCR T;  2NUP B;  2R58 A;  1TOV A;  1XJW B;  4DEY A;  1WLP B;  3O8V A;  4F7U E;  2DD4 A;  2P84 A;  5GAO m;  2A36 A;  4C5H A;  4C92 A;  2RK2 A;  4E7L A;  2JMC A;  1ZQ1 A;  1M3A A;  1JXO A;  2DXU A;  4RTX A;  2RI5 A;  3EGX B;  3VV0 A;  1WFW A;  3IQL A;  3VS2 A;  5KYY A;  5KYX B;  1QVF P;  1RAB B;  4P5N A;  3A8M B;  5KYW A;  3CC7 A;  2KT1 A;  3H41 A;  3OYB A;  4M75 B;  4JRK A;  4M75 F;  2EW3 A;  1K8A C;  1RAF B;  2VKN A;  4RTT A;  3CCR Q;  5HY6 A;  3QDR B;  3CCS A;  2MCN A;  2BZY A;  4RUG A;  3UAT A;  4JRP A;  1VQP T;  2NWM A;  3G71 A;  4PJL A;  3LYI A;  4ZN1 A;  4J9C A;  2KMT A;  1NJI R;  3S6W A;  3CCV A;  1YNZ A;  2O01 E;  1C1A A;  2HQE A;  4F7U A;  4M7A D;  4A63 B;  5KH6 A;  1HXD A;  3JV3 A;  1AWO A;  1VYV A;  1Z9Q A;  2GFA A;  2CP2 A;  3HP9 A;  5KYU A;  1NLP C;  3CCE A;  2J7I A;  1MV0 B;  3BFM A;  1VQP Q;  1X2Q A;  3T9N A;  5GAO n;  5GAN h;  2R5M A;  3M9Q A;  1ZLM A;  2MWO A;  2V1Q A;  3J7A F;  2DVE A;  1NEB A;  2DL7 A;  4RG2 A;  1VA7 A;  3VYH B;  2WSF E;  4NS5 A;  2KXC A;  2RO0 A;  3DLL A;  4M7A G;  5LL6 S;  1QVF S;  5FU7 B;  2KQW A;  2X3X D;  1OI1 A;  1N6A A;  1B7T A;  1WHG A;  2E12 A;  2SRC A;  2CUD A;  2FG0 A;  4MML A;  1IGU A;  2DJZ A;  4A53 A;  1K0S A;  3HFO A;  2J6K A;  2BKD N;  2M0O A;  3X26 B;  2BTT A;  1G3S A;  2K3X A;  2PVG B;  4M78 B;  1IRE B;  3WVE B;  1U06 A;  4M78 F;  2D8H A;  1WHL A;  3GF5 A;  1CKA A;  3PGG A;  1K9M U;  5EC7 A;  2K9G A;  4M77 D;  4B6M A;  4C8Q D;  3E1S A;  1Y7X A;  1T0H A;  1LNX A;  1WPY A;  1E6G A;  1TUC A;  4WF2 A;  3DLM A;  1KC8 R;  1D1A A;  5KE3 A;  1XOV A;  3OSV A;  3CBM A;  2CP6 A;  2GQI A;  2RJE A;  2DL8 A;  1KD1 C;  3M54 A;  3CD6 T;  3EGD B;  2KT8 A;  2RB6 A;  2M1H A;  1SG5 A;  1WDX A;  1ZUY A;  3I5S A;  1G3Y A;  1UHC A;  2DZC A;  4QQD A;  3ZL7 C;  4BY6 C;  1B34 A;  1X69 A;  2J06 A;  2DFU A;  4M77 G;  4IUP A;  2OAW A;  3LH5 A;  4Z8A A;  4C8Q G;  2FZC B;  1VQN T;  1KQ2 A;  4FYY B;  4FYX B;  1WXU A;  4MZM A;  4XQ3 A;  2RHY A;  3CCQ T;  3M4G A;  5LJ5 j;  2KI7 A;  3QUI A;  1WHM A;  3M0T A;  2YRC A;  4FYV B;  3CD6 Q;  2CH4 W;  3RMQ A;  2SEM A;  4F04 B;  4FIB A;  3RIR A;  1JJ2 A;  8ATC B;  3TU4 K;  2EYZ A;  1P92 A;  5GAO p;  3JCM c;  4OMF B;  2XG8 D;  4CI0 C;  2X4J A;  4TVR A;  1VQN Q;  3M0R A;  3EHR A;  2CKK A;  3M55 A;  2I0N A;  2O9V A;  2JUF A;  3NGP A;  4M78 D;  1BYM A;  1ABQ A;  3BW1 A;  1UDL A;  2DZ9 A;  2EAY A;  1IXD A;  4JJB A;  3CCQ Q;  2GQV A;  2HSE B;  2F2X A;  1Q86 R;  1X6O A;  4C0Z A;  1WIE A;  4CC3 A;  4OMO A;  4X9D A;  3ZEH A;  2XI9 A;  3MEW A;  3OYE A;  4JJN K;  3DKM A;  2DK3 A;  2DL5 A;  2LJ3 A;  1WHH A;  2I2L A;  2PUK B;  2LX9 A;  1OYX A;  2ZPF B;  3P8B B;  1ZBX A;  3TVT A;  1UGS B;  2V8K A;  1GFC A;  3G4S T;  5GAM h;  4M78 G;  1VIF A;  1EIF A;  2RJF A;  2HBP A;  3MHX A;  3QXE B;  1GXI E;  2OX7 A;  3CCL T;  2EYY A;  4EDU A;  1PD0 A;  1ARK A;  3JCM d;  3EFO A;  3JB9 F;  3CCU A;  1QVG A;  2EQJ A;  5DLO A;  3E19 A;  1VQL A;  2ZPG B;  2GF7 A;  4AFQ C;  1N8R U;  1QQJ A;  4LN2 A;  1Y96 B;  2YLB A;  4PJO C;  2CGH A;  3G4S Q;  3NTH A;  5M9O A;  1MND A;  1RAA B;  2L2P A;  5GAN e;  2K2V A;  3C95 A;  3RKY A;  4ZN3 A;  1VQM A;  3R6N A;  2CZ7 B;  3H8Z A;  1Q86 C;  3CCL Q;  1Q81 U;  3HRS A;  4L6V 5;  4Z88 A;  3OYM A;  2OAU A;  2Y90 A;  4JS4 A;  2EQM A;  1R0B G;  5GMK l;  3CC4 A;  4EMH A;  1HD3 A;  4UC4 A;  1U3O A;  2F2W A;  2KNB B;  5CVI A;  2KXD A;  4OMM A;  1BI1 A;  4J6X A;  1FX7 A;  2YRV A;  3TRE A;  2RQW A;  3VS5 A;  1T3L A;  1VQ8 T;  4PFZ A;  3QBY A;  4BI3 A;  1M3B A;  2KEA A;  5I11 A;  1LVK A;  2FZK B;  1VQ5 A;  3OS2 A;  2L3Q A;  1JO8 A;  1CKB A;  1W4S A;  1OZ2 A;  2XIC A;  1VQ8 Q;  2FL7 A;  2YRD A;  4ELY C;  3QYH B;  3DB4 A;  2JN0 A;  3ER0 A;  2ZPH B;  1KQS A;  2YUN A;  2XDB A;  2C0O A;  2L5Q A;  5A0D A;  3JRZ A;  2E65 A;  4O5V A;  2WAC A;  2X4X A;  4LDX A;  1W2B S;  1KFZ A;  3CPF A;  3JCM X;  4E2F B;  3OS0 A;  4AFU C;  1N8R C;  2MAM A;  1ZSG A;  2QDL A;  3LH0 A;  3RER A;  1FXX A;  1M90 U;  1Y57 A;  3CMA T;  1X27 A;  5LJ3 h;  3GOX A;  1JU5 C;  1WJR A;  1AT1 B;  3OSS C;  2LP5 A;  5LJ3 g;  2LNV A;  2EQK A;  1G2B A;  5LJ5 d;  3FLG A;  5FRN A;  4OF1 A;  4M7D B;  4Q5W A;  3LGF A;  5IHN A;  4M7D F;  5LJ5 f;  1VQ6 T;  1BK2 A;  2Z0W A;  5FW9 A;  2RHI A;  1CSK A;  3L2V A;  4BUG A;  3X24 B;  3LX7 A;  4HCB A;  2JTM A;  1X6G A;  1K0X A;  1BCM A;  3CMA Q;  3CXC S;  2RHZ A;  3PE0 A;  2E3H A;  2OTL A;  3CCJ T;  1VQ6 Q;  1SKU B;  5I2M A;  4ANJ A;  4LDY A;  2IPO B;  2DBK A;  1H92 A;  2HMA A;  5CQX A;  4X34 A;  3CPW A;  3QKJ A;  2C0T A;  3H9N A;  1M2V A;  4B9X A;  5GAM e;  3QG1 A;  1Y0M A;  2NLU A;  3JAM E;  1NEG A;  3QJY A;  1Q7Y U;  4C0D C;  1E7O A;  1I4K 1;  2QQR A;  4KBM B;  3HRT A;  2PQW A;  2F1L A;  1VIE A;  3OW2 P;  3CCJ Q;  3RES A;  2R5A A;  3L2R A;  1D3B B;  1QKW A;  2BIV A;  4BY6 B;  3OYL A;  3JB9 J;  1RI9 A;  3INZ A;  2NUT A;  4EMK C;  1IHW A;  3L2W A;  1SF9 A;  1SPK A;  4XTY A;  4HT8 A;  3KFV A;  2ED1 A;  4FCY A;  4F17 A;  4RKU E;  5GAO q;  4LUD A;  2YLC A;  2GFU A;  4C5G A;  3S3M A;  4J7F A;  1HYO A;  2RA2 A;  1YCY A;  2L89 A;  1NLO C;  2DIG A;  1ZUU A;  3KBG A;  5IAY A;  2L3S A;  2PVD B;  3GBQ A;  4MZP A;  2Y4Y A;  5GAO l;  5CK9 A;  1YJW T;  2YUP A;  4ESR A;  1VYU A;  3RNJ A;  2YWW A;  3M53 A;  2PTK A;  3L2U A;  4C92 C;  1M1K U;  5GMK j;  2CT3 A;  2DIL A;  1Q82 C;  4C5E A;  4LNP A;  2KVQ G;  4OB0 B;  1M8M A;  2LX7 A;  1FWZ A;  1UFF A;  2VGN A;  5KYN A;  3FDR A;  1I81 A;  2MWP A;  2D0Q B;  4M7A B;  5C0M A;  3FC3 A;  1MMA A;  4KUL A;  4M7A F;  4DQ2 A;  1UGQ B;  2E41 A;  2EYX A;  2DTH A;  1YJW Q;  4E47 A;  4HXJ A;  2CSQ A;  1K8A R;  3PIP A;  1WYX A;  4BD3 A;  4HT9 A;  4FT2 A;  5GAN f;  4OGE A;  3FIF A;  2LQN A;  5J3B A;  1G3W A;  2E5Q A;  4IUV A;  4JLI A;  3CC2 T;  4PJO B;  1TWB A;  2G3R A;  2KYB A;  4JJD A;  1NPP A;  4DEX A;  2JS0 A;  1GFD A;  3G1J A;  2DA9 A;  1VQ7 A;  2CP7 A;  5L8R E;  5A0G A;  2DEU A;  2JT4 A;  1YWO A;  2K2M A;  2CZ6 B;  1C0M A;  2CP3 A;  3FRN A;  3CQT A;  1M27 C;  5LJ3 e;  2NYS A;  3VU3 C;  5KE2 A;  2LRQ A;  2F2V A;  3CC2 Q;  1IGQ A;  1MMD A;  1I07 A;  2HZY A;  1BCO A;  2LT1 A;  2E70 A;  4PK4 A;  2YUQ A;  3OBW A;  2LQK A;  4BE2 A;  2E6Z A;  3H0I A;  4M77 B;  4Z02 A;  4JZ4 A;  4AMC A;  4C8Q B;  3LGL A;  1UTI A;  4M77 F;  3A8O B;  4J9E A;  3QJ6 A;  4C8Q F;  4OP0 A;  4XU3 A;  3I55 T;  2XMF A;  4MMK A;  3H0F A;  4FW1 A;  2JM9 A;  4EPC A;  3S3O A;  2YDL A;  1RAC B;  4ELZ C;  2XHC A;  2A28 A;  1YIJ T;  1EZZ B;  4AG2 C;  2K3B A;  4N0A A;  3CD6 A;  2D1X A;  3EG9 A;  2YSQ A;  2VC8 A;  5GAN 8;  2WSE E;  1O75 A;  4PKC C;  3FEO A;  5GAN g;  1OQK A;  3EH1 A;  4LDU A;  3OYA A;  3I55 Q;  1KHI A;  1M2O A;  2FRW A;  3CBP A;  1RLQ C;  4KGZ B;  2Y4X A;  1UJ0 A;  4RTY A;  1WQW A;  3OMC A;  3MCA B;  1K1Z A;  1YJ9 T;  2BE9 B;  1WXB A;  1YIJ Q;  4PJO D;  4E7K A;  1KD1 R;  1M8V A;  4J9B A;  2DMO A;  1R0C B;  3UA6 A;  5IT9 E;  3C4S A;  4Y91 A;  4BI8 B;  2CZ1 B;  2XDP A;  3EFS A;  1GL5 A;  1PC0 A;  1G5V A;  4IUQ A;  3I5R A;  4AT1 B;  2IIM A;  2E10 A;  2PUO B;  1ZHI A;  1YJ9 Q;  3OBY A;  1KC8 U;  2AKL A;  1Z9Z A;  4PJO G;  3FJP A;  4N4H A;  2CS7 A;  2L0A A;  3CC7 T;  2DIQ A;  3VS6 A;  3QSU A;  3P8H A;  3I56 T;  4GBQ A;  1VQ4 A;  2RK1 A;  2ZGW A;  3WXM B;  2DO3 A;  3OYY A;  1QWE A;  4ZGJ B;  1TTH B;  1T3S A;  2E1H A;  4ZGD B;  1OZ3 A;  2JVV A;  3G4S A;  3G71 T;  3OYJ A;  3URG A;  4ZTF A;  3ME9 A;  2ZAE A;  1I8F A;  4J8O A;  2QXF A;  2H3J A;  1ZSZ C;  3RR6 A;  2ZPE B;  3CCV T;  3NTI A;  1BBZ A;  1M3C A;  1AHJ B;  3CC7 Q;  3I56 Q;  3QWY A;  2CSI A;  2EQI A;  3ZFJ A;  2X51 A;  4DBH A;  1BB9 A;  3OYH A;  1S72 T;  3M0P A;  1YWP A;  3L2Z A;  1X6B A;  2VWF A;  1X75 C;  3HTR A;  1PM3 A;  2EGC A;  4C0D B;  1VOM A;  3G71 Q;  2EKO A;  4PNO A;  2DBM A;  1AWJ A;  2RI3 A;  4J6W A;  2ZZD A;  2LC4 A;  2W0Z A;  1S1N A;  3CCV Q;  1N5Z A;  6AT1 B;  2E6N A;  1IB8 A;  5A0L A;  3QHS A;  4R55 A;  1SHF A;  5GJW B;  4J83 A;  1U1S A;  4J9G A;  4JJC A;  4EMK B;  2LJ1 A;  5I2S A;  1O9S A;  4RTZ A;  4XTX A;  3ULR B;  4ORZ A;  1S72 Q;  1UGP B;  3Q1J A;  3REB B;  3CME A;  1VUB A;  2QTV A;  2RJC A;  2KYM A;  1I1J A;  1QVG S;  4F14 A;  2RQU A;  5HCK A;  2VXE A;  4PFO A;  1K73 U;  1X43 A;  1XTD A;  3OYD A;  1GBQ A;  3HFN A;  3VS4 A;  4XU1 A;  1ZSZ A;  3L42 A;  5DY9 A;  2AHJ B;  1QP3 A;  2VVK A;  2DXB A;  1UEB A;  4QQG A;  1FMV A;  4OML A;  1PG5 B;  1KQS P;  4E7S A;  3J80 E;  4C92 B;  1K9M C;  4NL3 A;  5KCO A;  1ZA1 B;  3TQ7 P;  2DL3 A;  3L1A A;  4E7H A;  3JB9 H;  2AIR B;  1RL2 A;  5KYY B;  1KJW A;  2JTF A;  1SEM A;  5GAM g;  5KYW B;  3PVQ A;  2EFI A;  4J9F A;  2D8J A;  1PSE A;  1R77 A;  2FEI A;  2ATC B;  3RKW A;  3TEE A;  3G6E T;  4ATO A;  1PRL C;  2X4Y A;  2JOY A;  1WXT A;  4JRQ A;  1VYT A;  3QII A;  2MPX C;  3OYN A;  4BB7 A;  5GAO r;  1QCO A;  2EYQ A;  1YHQ A;  2X3W D;  4F7U B;  2RN8 A;  3UT1 A;  2X9H A;  1N27 A;  4F7U F;  2K5L A;  2JJ9 A;  1PNJ A;  2COY A;  5KYU B;  3G6E Q;  1W2B P;  2HKN A;  5FU6 C;  2FPF A;  5LJ3 f;  3CMA A;  1DJ7 B;  2ESW A;  2LQ8 A;  3TSZ A;  4XTU A;  2MYS A;  3SWN A;  3M4Y A;  4N4I A;  1KQS S;  2FYK A;  3THK A;  2G6F X;  1N8R R;  2ZPB B;  4Y28 E;  1SHG A;  1VQK T;  3OS5 A;  3PVL A;  1XQH A;  5GAN 2;  4JLG A;  1NPR A;  2HDA A;  4RCB A;  5D6X A;  3EFR A;  4C92 D;  2QEX A;  1Q81 R;  4OMQ A;  1JQQ A;  4EMG A;  4DA4 A;  4IIO A;  5GAN j;  3V7S A;  2EJG A;  1OX9 A;  2DRK A;  2HL5 C;  2KRN A;  2RD1 A;  3QO3 A;  3PTA A;  3GP8 A;  4HA8 A;  4WTO B;  4DBF A;  4M75 E;  4DBQ A;  1PKT A;  2K7A A;  3HPW A;  1NE8 A;  2RQV A;  2VXF A;  4XTW A;  3CXC P;  5I21 A;  2KRM A;  2X4W A;  1VQK Q;  3BDU A;  5HK3 A;  4HCK A;  3NPF A;  9ATC B;  3JCM b;  1OU8 A;  5IH2 A;  4YTL A;  2JNG A;  1TS9 A;  3LWI A;  2NUP A;  4C92 G;  5CKF A;  2QQ9 A;  2DET A;  2EIF A;  4D8K A;  1MUZ A;  4PL6 A;  4Z89 A;  5C6S A;  1I0C A;  1PCX A;  3EGX A;  2O88 A;  3SB2 A;  4KH1 B;  5KYX A;  2DNU A;  2E4H A;  1YJN T;  3JCM h;  3V7R A;  2LZ6 B;  1FMW A;  3JCM g;  1OV3 A;  1TSF A;  4M75 A;  2KBT A;  4HVU A;  2HNI A;  2AKK A;  1Q81 C;  2OJ2 A;  1MGQ A;  2XK0 A;  5FRM A;  3J81 E;  4LDV A;  1WGS A;  3MP8 A;  1W70 A;  1B34 B;  2DRM A;  2MMP A;  4F16 A;  2QTX A;  2FPD A;  4M77 A;  3CC4 T;  1VQO A;  1NYG A;  4F7U G;  4CC2 A;  1YJN Q;  5HK0 A;  5J26 A;  2DER A;  4VUB A;  1VQ9 T;  1V76 A;  1YP5 A;  3M0Q A;  2MIO A;  4MDX A;  3X28 B;  4J7I A;  4A4E A;  5AT1 B;  3BDL A;  2LNH B;  2C0I A;  3EGU A;  4RTV A;  1G3T A;  1UJY A;  1AD5 A;  2DL4 A;  2JS2 A;  1ACM B;  2O31 A;  5CQY A;  2LDM A;  1M90 R;  4M78 E;  1C6V X;  3OYC A;  3CC4 Q;  1YI2 T;  1VQ5 T;  3MEA A;  1WNL A;  2HQX A;  2O9S A;  1VQ9 Q;  3OYI A;  4X9C A;  4XU0 A;  3OYF A;  1Q82 R;  2EGA A;  3M57 A;  4FT4 A;  8AT1 B;  2JM8 A;  1RAD B;  1LPL A;  2KRS A;  3HSB A;  3F70 A;  4KH0 B;  1U5S A;  1QP2 A;  2BUD A;  2CYZ B;  4QVC A;  1YI2 Q;  2M51 A;  4QT7 A;  1VQ5 Q;  4J6Y A;  2AZV A;  1UGR B;  3OYK A;  1UEC A;  4KUI A;  2RM4 A;  2V26 A;  3NMZ C;  4M78 A;  3CCR A;  1ZA2 B;  5AYF A;  4EIK A;  1BIA A;  3EFO B;  4JS5 A;  1YFN A;  2F5T X;  1M90 C;  1JB0 E;  1YN8 A;  1N9R A;  2QA4 T;  2K5F A;  5GAM j;  2VGM A;  4C0F A;  1D1C A;  2EJF A;  3VS0 A;  4FL6 A;  2K3Y A;  4ZTJ A;  2L8D A;  2CP0 A;  3HKS A;  3AHU A;  2VV5 A;  2RNA A;  1K8A U;  1VQP A;  5LJ5 h;  2WSC E;  2OTJ T;  1RAG B;  1TH7 A;  2VYT A;  2KRO A;  3EGD A;  1YCS B;  2XD0 A;  2QA4 Q;  3CCM T;  4HCC A;  4RG8 A;  1TXQ A;  3MP1 A;  2V8I A;  4PJJ A;  5DM7 R;  4KT0 E;  4DBR A;  1UG1 A;  3QYG B;  1H8K A;  1D0Z A;  1YIJ A;  1OOT A;  1XNI A;  1OU9 A;  4A54 A;  3S3N A;  2OTL T;  5GAN d;  3OA6 A;  4M4Z A;  1KQ1 A;  2ZPI B;  1X01 A;  4X1V A;  3L2Q A;  1KIK A;  2OTJ Q;  1AWX A;  4FYW B;  2LTO A;  1G8X A;  1NZ9 A;  4FSS A;  3N5B B;  2DXC A;  3M59 A;  3M0U A;  1Q7Y C;  2KAF A;  1BU1 A;  4IIM A;  3CCM Q;  2K57 A;  4A4H A;  4AFS C;  3MP6 A;  3PT9 A;  5A2Q E;  4L59 A;  1NBE B;  3VJP A;  5CKB A;  2O2O A;  1YIT T;  5CO7 A;  4N0A C;  4D6W A;  4PJO F;  2JTE A;  2OTL Q;  2EYW A;  2AK5 A;  1M5Q 1;  2DPP B;  5GJV B;  2HAX A;  5GAN 3;  1M9S A;  1KHC A;  2PVO B;  1WA7 A;  3DB3 A;  2JW4 A;  3JCM e;  3GNG A;  3KXT A;  4HVW A;  2CUB A;  1G83 A;  3MET A;  3JCM P;  1Q95 G;  3E9F A;  1MMN A;  1NJI U;  4KRT A;  1ABO A;  4NL2 A;  1PD1 A;  4RMO A;  4J9H A;  1YIT Q;  5D7U A;  2A37 A;  1GCQ A;  5FRO A;  3OW2 A;  2DTO A;  2FB7 A;  1RI0 A;  3QWX X;  3JB9 I;  1M1K C;  1WQ7 A;  2LT4 A;  3HL8 A;  3I56 A;  1H3Z A;  2GCX A;  2LJ0 A;  2CH4 A;  2XDD A;  3MEV A;  4HVV A;  4E7J A;  2LCC A;  3VUB A;  4PLI A;  3X20 B;  2HCK A;  1Y96 A;  1WZO A;  1RAH B;  3VS1 A;  1UUE A;  4RTW A;  3OY9 A;  4BE0 A;  1KD1 U;  2VUB A;  3OS1 A;  1JJ2 P;  2EBP A;  5LJ3 j;  3A8L B;  3CEY A;  4II1 A;  2MI6 A;  1MV3 A;  1VQN A;  1S72 A;  4BI4 A;  4A4K A;  4FSX A;  2FVU A;  4J5Y A;  2YXY A;  3SDZ A;  3CCQ A;  5CAI A;  1Y07 A;  2DM1 A;  3GLX A;  3C0C A;  2LQW A;  4WCI A;  4V2S A;  2HQH A;  2J6O A;  2EGE A;  4AG1 C;  3UPU A;  2XID A;  1BI3 A;  1M2V B;  5EG2 A;  3TCJ A;  1BI2 A;  2ED0 A;  3NFC A;  3OYG A;  2E5K A;  1B3Q A;  2R57 A;  3GNF B;  3C94 A;  1A0N B;  2QQS A;  5D6W A;  1VQ7 T;  4M7D C;  1ZX6 A;  1ZUK A;  2KR3 A;  1NJI C;  2NUT B;  2RF0 A;  2P4T A;  4RTU A;  4K11 A;  1F1B B;  2EVR A;  3VUZ A;  2A0F B;  2DXT A;  3FB9 A;  3RDV A;  4IUT A;  1UHF A;  5GAN 5;  4M75 D;  5IXF A;  2O4X B;  5CCA A;  1QVG P;  3OMG A;  2FO0 A;  4MDW A;  5GAM d;  3HHT B;  4M7D E;  1AZE A;  4AFZ C;  5DLQ E;  4PJN A;  4MZT A;  3CCS T;  1JJ2 S;  3EAE A;  1AVZ C;  5GAM f;  5LJ5 e;  1VQ7 Q;  2LVM A;  1QVF A;  2HL3 A;  4GLK A;  1UGV A;  3HRU A;  4OGC A;  2VAS A;  3SHW A;  5D6Y A;  4XU2 A;  1MNE A;  1WI7 A;  3BE3 A;  3E9G A;  3CCL A;  1KSW A;  2GTO A;  2ROT A;  5L23 A;  3G6E A;  1KK7 A;  2P0Q A;  2RQT A;  4A4F A;  4M75 G;  1K9M R;  3CCE T;  1V29 B;  2EWN A;  3CCS Q;  2MOX A;  3D7S B;  1WX6 A;  1JXM A;  1QW1 A;  3MKD A;  4NOY A;  2DYB A;  2P0K A;  4KGX B;  2YUO A;  1HK9 A;  4OB2 B;  4M7D A;  1ZBJ A;  3EH2 A;  3VKI A;  1IHV A;  4LXC A;  2KSS A;  1BIB A;  4OVA A;  4L5G A;  3RMS A;  1H64 1;  1WHJ A;  1D09 B;  3VS7 A;  5IN1 A;  5GAN 4;  1Q86 U;  2P0P A;  5KCH A;  2K4Y A;  5HKC A;  2IVW A;  2KGT A;  3PFS A;  5CIU A;  3CCE Q;  2CT4 A;  2HBW A;  3TSW A;  3CBO A;  2DKG A;  2LCS A;  3QZ5 B;  2V1R A;  3GIB A;  5CKD A;  1K9A A;  2QYZ A;  1VQ8 A;  1D1B A;  1RLP C;  1BKB A;  5GAN 7;  3H6Z A;  1K4U S;  1FMK A;  4XTV A;  1KC8 C;  1VQK A;  1KG1 A;  2QK0 A;  4ZNX A;  4QVD A;  2EQU A;  2QGF B;  4PLL A;  1AZG B;  2GGR A;  2LCL A;  3RUX A;  4B9W A;  2E64 A;  3MEU A;  3SWN C;  4C92 F;  4PFP A;  2NUZ A;  1SSH A;  2M02 A;  4ME7 A;  5IHI A;  2QG9 B;  1IZ6 A;  4FU6 A;  1QMC A;  2ECZ A;  2BZX A;  2E3I A;  1FYN A;  1I5L A;  1JRI A;  1VQ4 T;  4M7A C;  1B07 A;  2B8A A;  1D3B A;  4HCZ A;  2JMA A;  3U23 A;  2RJD A;  2RH2 A;  3ASK A;  5GMK i;  1EFN A;  4FM4 B;  3A1P A;  1K73 R;  1U1T A;  3QPH A;  4R56 A;  3EG0 A;  1IRX A;  1QKX A;  2P4R A;  2DVJ A;  3VYG A;  2IG0 A;  4M7A E;  5GMK h;  3E2U A;  3M58 A;  2KDS A;  4DOV A;  4OB1 B;  1GCP A;  2CDT A;  1SRL A;  2DYI A;  3EG2 A;  2DLP A;  1VQ4 Q;  3JCM Q;  3P8D A;  3VRZ A;  3JCM f;  3UDC A;  3MPU B;  1YJN A;  1TU0 B;  5LJ3 d;  2QI2 A;  2MK5 A;  2L3P A;  2AT1 B;  2GBQ A;  2LMJ A;  4FW2 A;  2C06 A;  3M0S A;  4CC7 A;  2ENM A;  4PJM A;  1JBM A;  2D6F A;  3EG9 B;  5CKH A;  2GTJ A;  3JCM W;  2L3R A;  4A4G A;  1MHN A;  4DOW A;  4N4G A;  3V7C A;  2YHT A;  4JZ3 A;  3A8H B;  2KY9 A;  2ZCF B;  4HKE A;  1HSQ A;  2K6D A;  1VQ6 A;  4PJO E;  2RQR A;  4E7I A;  2M0Y A;  4M75 C;  4M7A A;  3CME T;  3V8L A;  1VQ9 A;  1N9S A;  1OEB A;  3CPW P;  1K73 C;  1M4Z A;  1UB4 A;  2PZ1 A;  5FWB A;  4Y92 A;  2FPE A;  4ZGE B;  4QVZ A;  5I22 A;  2DF6 A;  4OB3 B;  1V1C A;  1WJS A;  1D0Y A;  1NYF A;  1X2K A;  4J9I A;  2CRE A;  4M77 C;  2KE9 A;  4C5I A;  3PMT A;  4C8Q C;  3CCJ A;  2J6F A;  3QZ9 B;  1T0J A;  4CC4 B;  5CKE A;  4QQ6 A;  1D0X A;  1SRM A;  2X35 A;  1YI2 A;  1BI0 A;  2XU8 A;  3CME Q;  4M77 E;  1WJQ A;  4C8Q E;  4PJO A;  1UE9 A;  1LCK A;  4LD9 K;  2FRY A;  4BAC A;  2FZG B;  3JB9 D;  2F5K A;  3CCU T;  3V8K A;  3REA B;  2XKO C;  2EPD A;  2DD5 A;  1VQL T;  2QGG A;  1QVP A;  4IKF A;  2H3E B;  3PNW C;  1EX4 A;  3QDF A;  2QAS A;  5FU7 C;  2ABL A;  2AZS A;  2M9U A;  2A08 A;  2V8J A;  3OB9 A;  5GMK m;  1RAI B;  4OMN A;  2MF2 A;  1YHQ T;  3BY7 A;  3SD4 A;  1VQM T;  3MJX A;  4QW2 A;  1H3H A;  2DTI A;  3VS3 A;  4KGV B;  7AT1 B;  3CPW S;  2M16 A;  3JSC A;  1TG0 A;  1JEG A;  3CCU Q;  4J9D A;  2QA4 A;  3JB9 G;  4C8Q A;  1VQL Q;  2YT6 A;  1WHK A;  4M78 C;  3EG3 A;  4JRI A;  1YJW A;  4XAX B;  3M5A A;  3RBB B;  1GRI A;  2BZ8 A;  4JDS A;  1M1F A;  1AWW A;  1YHQ Q;  1VQM Q;  2HSP A;  2PNI A;  5FWC A;  5FLX E;  3NTK A;  2EKH A;  1Q82 U;  4R0K A;  4O6J A;  2OTJ A;  2JXB A;  2CP5 A;  4JPB W;  1PRM C;  1W2B A;  2K5I A;  2DEQ A;  1R8O B;  2RI2 A;  1RUW A;  3CCM A;  2RHX A;  2QEX T;  1PKS A;  1PSF A;  2JZ2 A;  3KUF A;  3EHQ A;  4LD6 A;  2RHU A;  4GLM A;  1E6H A;  3UF4 A;  1ZSZ B;  1Y71 A;  2D0N A;  3UA7 A;  4E7Z A;  2D9T A;  1TUD A;  3LLR A;  3LWH A;  5GAN 6;  3WVD B;  4LDW A;  2QEX Q;  3A8G B;  1M30 A;  2QAZ A;  3CC2 A;  2H8H A;  1LJO A;  5GMK e;  5CR2 A;  2DX1 A;  1AOJ A;  3I35 A;  1YIT A;  2COW A;  3FJ5 A;  1PWT A;  3EG1 A;  3CXC A;  1OUL A;  1OPL A;  4KUD K;  1LOJ A;  1OX8 A;  4LE9 A;  1PHT A;  4XTZ A;  5IXB A;  4RCC A;  3RKX A;  1RAE B;  2BE7 D;  1Q7Y R;  2QQA A;  2DE0 X;  1QCN A;  2O4X A;  2KK4 A;  1M1G A;  1TUG B;  3X25 B;  4D8D A;  3H0H A;  1QLY A;  4JUV A;  3MO8 A;  4C0G A;  1YBY A;  2EJ9 A;  4M7D D;  5J39 A;  4CRI A;  2W10 A;  1VQO T;  3VRY A;  3PIO A;  2HD0 A;  2COZ A;  5LJ5 g;  1IO6 A;  2QQB A;  3I55 A;  5ECA A;  2A3L A;  2GNC A;  2HEQ A;  2K79 A;  3V8J A;  4QKU A;  3SFM A;  4IUU A;  1GCQ C;  3SWN B;  4LUE A;  1HJD A;  3GPL A;  3I9Q A;  4BDZ A;  2OI3 A;  3OQ5 A;  2RPN A;  2J05 A;  4OMP A;  3JCM V;  1NG2 A;  3NHN A;  3ZBD A;  1AEY A;  2FHD A;  2QDY B;  3LW5 E;  3SEM A;  2DAQ A;  1GBR A;  2VB6 A;  1W6X A;  4M7D G;  4C92 E;  1VQO Q;  1M1K R;  2F69 A;  2HKQ B;  1K76 A;  3O5Z A;  4E6R A;  3R6O A;  4BE1 A;  3OW2 S;  1NM7 A;  2DJQ A;  4EMK A;  3AT1 B;  4BDY A;  2B86 A;  3M56 A;  4XK8 E;  4IUR A;  1QWF A;  1YJ9 A;  3UWN A;  1SSF A;  2PU9 B;  1OPK A;  2ROL A;  5IHK A; 
#chains in the Genus database with same CATH homology
 1W1F A;  1PNJ A;  3PE0 A;  1AVZ C;  2RMO A;  3A98 A;  1QCF A;  1J3T A;  1UGV A;  2FPF A;  4DEY A;  3SHW A;  1WLP B;  1WI7 A;  2ESW A;  1KSW A;  2A36 A;  3TSZ A;  2JMC A;  2GTO A;  2DBK A;  1M3A A;  1H92 A;  2ROT A;  1JXO A;  5L23 A;  4RTX A;  2C0T A;  2RQT A;  1WFW A;  3IQL A;  3THK A;  3VS2 A;  1Y0M A;  2G6F X;  1NEG A;  2MOX A;  1WX6 A;  2KT1 A;  1JXM A;  1SHG A;  1E7O A;  3H41 A;  2DYB A;  3PVL A;  2EW3 A;  2YUO A;  2HDA A;  1QKW A;  2VKN A;  4RTT A;  1ZBJ A;  4OMQ A;  2MCN A;  1JQQ A;  2BZY A;  4IIO A;  1RI9 A;  4RUG A;  3UAT A;  2DRK A;  2NWM A;  2KRN A;  3VS7 A;  1SPK A;  3KFV A;  4J9C A;  2ED1 A;  1YNZ A;  1PKT A;  2KGT A;  4F17 A;  2K7A A;  2CT4 A;  2RQV A;  4LUD A;  2HBW A;  4A63 B;  2KRM A;  3TSW A;  2LCS A;  3JV3 A;  2V1R A;  1AWO A;  1VYV A;  1Z9Q A;  1NLO C;  1K9A A;  4HCK A;  3NPF A;  1ZUU A;  1NLP C;  5IH2 A;  1RLP C;  2J7I A;  1MV0 B;  2L3S A;  3GBQ A;  1K4U S;  1X2Q A;  1FMK A;  4ZNX A;  2YUP A;  4ESR A;  1VYU A;  3RNJ A;  1AZG B;  2PTK A;  4D8K A;  1MUZ A;  2GGR A;  4Z89 A;  1ZLM A;  2V1Q A;  1I0C A;  2CT3 A;  2DIL A;  1NEB A;  2DL7 A;  2O88 A;  1VA7 A;  4LNP A;  2NUZ A;  1SSH A;  2DNU A;  5IHI A;  2KXC A;  1M8M A;  2LX7 A;  1UFF A;  2BZX A;  2ECZ A;  2LZ6 B;  1FYN A;  1OV3 A;  2X3X D;  2KBT A;  4HVU A;  2AKK A;  1B07 A;  2OJ2 A;  2SRC A;  2CUD A;  2FG0 A;  2JMA A;  3U23 A;  2EYX A;  1W70 A;  2DRM A;  1EFN A;  4HXJ A;  2CSQ A;  4F16 A;  3EG0 A;  1K0S A;  2FPD A;  1QKX A;  2P4R A;  1WYX A;  1NYG A;  2DVJ A;  2J6K A;  4CC2 A;  2BTT A;  1U06 A;  1YP5 A;  3M0Q A;  2LQN A;  2MIO A;  1GCP A;  2CDT A;  2D8H A;  1SRL A;  3EG2 A;  2DLP A;  1CKA A;  2LNH B;  2C0I A;  3EGU A;  3VRZ A;  4RTV A;  1UJY A;  5EC7 A;  1AD5 A;  2DL4 A;  2JS2 A;  2O31 A;  2L3P A;  2LMJ A;  2GBQ A;  2K9G A;  3M0S A;  4CC7 A;  2ENM A;  1T0H A;  1E6G A;  2KYB A;  4JJD A;  5IHK A;  4DEX A;  2JS0 A;  1GFD A;  1TUC A;  2GTJ A;  2DA9 A;  2O9S A;  2JT4 A;  1YWO A;  2K2M A;  4JZ3 A;  1XOV A;  1HSQ A;  2K6D A;  2GQI A;  2EGA A;  2DL8 A;  2RQR A;  3CQT A;  2M0Y A;  1M27 C;  2KT8 A;  2JM8 A;  1WDX A;  1ZUY A;  3I5S A;  2F2V A;  1OEB A;  1UHC A;  2KRS A;  3ZL7 C;  2PZ1 A;  1I07 A;  5FWB A;  1U5S A;  4Y92 A;  2J06 A;  1X69 A;  2FPE A;  5I22 A;  2DF6 A;  2OAW A;  1V1C A;  3LH5 A;  2M51 A;  4Z8A A;  4QT7 A;  2YUQ A;  1NYF A;  2AZV A;  1X2K A;  4J9I A;  2CRE A;  3H0I A;  1UEC A;  2KE9 A;  1WXU A;  4JZ4 A;  1UTI A;  2J6F A;  3NMZ C;  4J9E A;  1T0J A;  4CC4 B;  4EIK A;  2XMF A;  1SRM A;  3M0T A;  2CH4 W;  3H0F A;  2SEM A;  2JM9 A;  2YDL A;  2A28 A;  2EYZ A;  1YN8 A;  4AG2 C;  1UE9 A;  1LCK A;  2K3B A;  2D1X A;  3M0R A;  2FRY A;  3EHR A;  2I0N A;  2O9V A;  3NGP A;  2YSQ A;  1ABQ A;  1UDL A;  3VS0 A;  4JJB A;  3REA B;  2EPD A;  2F2X A;  2RNA A;  2FRW A;  1RLQ C;  1UJ0 A;  4RTY A;  2ABL A;  2AZS A;  1K1Z A;  1WIE A;  1WXB A;  2KRO A;  2A08 A;  1YCS B;  4OMN A;  4CC3 A;  4OMO A;  4J9B A;  2DL5 A;  2LJ3 A;  1H3H A;  2DMO A;  3VS3 A;  3TVT A;  3UA6 A;  1UG1 A;  1H8K A;  1GFC A;  1JEG A;  1TG0 A;  1OOT A;  4J9D A;  1GL5 A;  4M4Z A;  3I5R A;  2YT6 A;  2IIM A;  4X1V A;  3EG3 A;  2EYY A;  1KIK A;  1AWX A;  3RBB B;  1ARK A;  4FSS A;  1GRI A;  2BZ8 A;  3M0U A;  1AWW A;  4IIM A;  1BU1 A;  2AKL A;  1Z9Z A;  4AFS C;  2HSP A;  2PNI A;  5FWC A;  2L0A A;  4AFQ C;  2EKH A;  4LN2 A;  4R0K A;  2JXB A;  3VS6 A;  2O2O A;  4JPB W;  1PRM C;  4GBQ A;  2L2P A;  2JTE A;  2EYW A;  1RUW A;  2AK5 A;  1QWE A;  5GJV B;  3R6N A;  1T3S A;  1PKS A;  1WA7 A;  2JW4 A;  4Z88 A;  3EHQ A;  4HVW A;  2CUB A;  1G83 A;  4GLM A;  1E6H A;  3UF4 A;  2D0N A;  4KRT A;  3UA7 A;  1BBZ A;  1M3C A;  1HD3 A;  1ABO A;  1U3O A;  1TUD A;  2F2W A;  4J9H A;  2KNB B;  2KXD A;  2A37 A;  4OMM A;  1GCQ A;  3QWY A;  2CSI A;  2RQW A;  3VS5 A;  2EQI A;  1T3L A;  3QWX X;  1BB9 A;  3M0P A;  1YWP A;  1X6B A;  1M30 A;  2VWF A;  1M3B A;  2H8H A;  1K0X A;  2EGC A;  2DX1 A;  1AOJ A;  3I35 A;  2DBM A;  1AWJ A;  3FJ5 A;  2KEA A;  1PWT A;  2LJ0 A;  2CH4 A;  3EG1 A;  5I11 A;  2W0Z A;  1S1N A;  1N5Z A;  4HVV A;  1OPL A;  2L3Q A;  4LE9 A;  1SHF A;  1JO8 A;  1PHT A;  5GJW B;  5IXB A;  1CKB A;  2HCK A;  4J9G A;  4JJC A;  2LJ1 A;  4RTZ A;  3ULR B;  3VS1 A;  4ORZ A;  2DE0 X;  1UUE A;  3REB B;  4RTW A;  4D8D A;  3H0H A;  1QLY A;  2KYM A;  2EBP A;  1I1J A;  4F14 A;  2YUN A;  2RQU A;  5HCK A;  2C0O A;  1X43 A;  1MV3 A;  2W10 A;  1GBQ A;  3VS4 A;  3VRY A;  1KFZ A;  1IO6 A;  2VVK A;  2DM1 A;  4OML A;  3C0C A;  2LQW A;  4WCI A;  5ECA A;  2GNC A;  2J6O A;  2K79 A;  2EGE A;  2HEQ A;  4AFU C;  1GCQ C;  4AG1 C;  2DL3 A;  4LUE A;  1HJD A;  3I9Q A;  1ZSG A;  2QDL A;  2OI3 A;  2RPN A;  2J05 A;  4OMP A;  1KJW A;  1NG2 A;  2ED0 A;  3NHN A;  1SEM A;  1AEY A;  2E5K A;  1Y57 A;  1B3Q A;  3SEM A;  3PVQ A;  1X27 A;  4J9F A;  2D8J A;  1GBR A;  1W6X A;  1A0N B;  1JU5 C;  2FEI A;  2LP5 A;  1G2B A;  3O5Z A;  1K76 A;  4E6R A;  1ZX6 A;  1ZUK A;  1PRL C;  2KR3 A;  1NM7 A;  2DJQ A;  5IHN A;  1BK2 A;  2RF0 A;  4RTU A;  4K11 A;  5FW9 A;  2B86 A;  2EVR A;  1CSK A;  1QWF A;  1WXT A;  1VYT A;  1UHF A;  5IXF A;  1OPK A;  2X3W D;  2FO0 A;  2ROL A;  2RN8 A;  1AZE A;  1X6G A;  4AFZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...