2FRYA

Solution structure of the third sh3 domain of human nck2 adaptor protein
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
61
structure length
61
Chain Sequence
GSHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight into the Binding Diversity between the Human Nck2 SH3 Domains and Proline-Rich Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Cytoplasmic protein NCK2
total genus 3
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fryA00
1K9AA 3M0UA 2J6KA 4AFZC 2KNBB 4GBQA 3NHNA 2LQWA 2JS2A 3I5SA 4E6RA 2QDLA 2KYMA 1JO8A 1Y57A 2DL3A 2H8HA 2OJ2A 4WCIA 1GCQA 2DE0X 4JPBW 2K3BA 3H41A 1GFCA 2A28A 4RTVA 1SRMA 1ABQA 2EQIA 1WXUA 4HCKA 1AWOA 4KRTA 3H0HA 2K9GA 2VWFA 5I11A 1KIKA 1WIEA 1K0XA 4J9CA 2DNUA 2I0NA 1VA7A 2K7AA 2DRKA 4IIMA 5I22A 1QWEA 1Z9ZA 1YWOA 1SSHA 1GCPA 2CSQA 4RTZA 4D8DA 1K1ZA 1V1CA 5FWBA 4CC3A 4F14A 4ESRA 2CUDA 2ENMA 2DILA 1EFNA 4DEYA 2LP5A 3VS7A 1X2QA 4JJBA 5GJVB 2FPDA 3TSWA 2XMFA 1VYTA 1T0JA 2LZ6B 2KRSA 5IHNA 1JU5C 1OPKA 2KGTA 4JZ3A 2AKKA 2LJ3A 2AZSA 2DMOA 1UE9A 2DL7A 1GBQA 3EHRA 5IHIA 1WFWA 2D8HA 1G2BA 2EVRA 2RN8A 3NMZC 1HSQA 3UATA 1E6HA 1MV3A 2BZYA 2EYYA 4AFUC 2C0TA 4OMOA 2E5KA 2D0NA 2JMAA 4RUGA 1UHFA 1UTIA 2KE9A 2L0AA 5ECAA 3C0CA 1RLQC 4OMLA 4AG1C 1PRMC 1UDLA 4JZ4A 1IO6A 2ECZA 2LJ1A 1I0CA 2RQUA 4J9GA 2DJQA 2L2PA 3IQLA 3M0PA 4FSSA 2NUZA 2EGAA 1PKSA 1RI9A 2CH4W 1U3OA 1X69A 1BK2A 1M3BA 2CT3A 4OMPA 1WYXA 3H0FA 1ZBJA 1B3QA 2RNAA 4Z8AA 2G6FX 4J9HA 2FRWA 2O2OA 1OOTA 1H8KA 2EW3A 3VS4A 2LNHB 2EKHA 3GBQA 1SHGA 2ESWA 2ROTA 2KRNA 1QCFA 4HXJA 1BB9A 2C0IA 5GJWB 1ZUKA 2K2MA 2EYWA 4Z88A 4J9DA 3SEMA 1X43A 1XOVA 4LNPA 2GNCA 2OAWA 4HVVA 2O9SA 3RBBB 1AD5A 1RLPC 1GFDA 2RQTA 1LCKA 3VS5A 2DL8A 3EGUA 3VS3A 2F2XA 5IH2A 1X2KA 1BBZA 1NLPC 1M3AA 2JM8A 2ROLA 3UA7A 1AZEA 1YWPA 1E6GA 2HDAA 4OMNA 2KXDA 1A0NB 1Y0MA 1GBRA 1CSKA 2CDTA 1N5ZA 1X6GA 1ZUUA 1K76A 2KROA 1HD3A 4K11A 2YT6A 1YP5A 4ZNXA 4RTYA 1UECA 2L3QA 1OEBA 5L23A 1T0HA 1SPKA 1WI7A 2JM9A 2IIMA 2RQWA 2YUPA 1G83A 2O9VA 2CH4A 2LJ0A 2C0OA 2BZXA 2DBMA 4J9FA 1X27A 2O88A 3O5ZA 4J9EA 2PZ1A 4QT7A 1NEBA 2P4RA 4HVWA 3ZL7C 1I1JA 1SHFA 2MOXA 2SRCA 1CKBA 3I5RA 1UJ0A 3VRZA 3CQTA 2L3SA 2HBWA 2CT4A 2F2WA 1WDXA 4X1VA 1KFZA 2GTOA 1YCSB 1AEYA 3M0TA 2FO0A 4Z89A 4J9IA 3LH5A 5EC7A 2X3WD 4IIOA 3VS2A 1UG1A 2DYBA 2EYXA 2LMJA 1FMKA 3TSZA 2AKLA 2BTTA 1GRIA 1HJDA 2J05A 2DRMA 1H3HA 2GQIA 2VKNA 3VRYA 1TUCA 3M0RA 1WA7A 2AZVA 2KT1A 2KT8A 2J7IA 2EPDA 3A98A 1UJYA 2D8JA 4Y92A 2DVJA 2GTJA 2J6OA 2DM1A 1SEMA 2V1QA 2NWMA 2EBPA 2KR3A 2JT4A 1ABOA 1M8MA 2YUQA 2B86A 2EGEA 5FWCA 4LE9A 1AOJA 1K0SA 1AZGB 4GLMA 3UA6A 4D8KA 4OMQA 2JTEA 2SEMA 2RQRA 2ED1A 1PRLC 4AG2C 1T3SA 2FEIA 4OMMA 1UGVA 1GL5A 1AWJA 2FRYA 2RMOA 3H0IA 2JW4A 4CC4B 2VVKA 3U23A 1W1FA 1UFFA 3KFVA 1PHTA 1OV3A 1PWTA 5IHKA 2HSPA 1CKAA 2J06A 3QWYA 1ZSGA 3EG3A 4AFSC 3I35A 5FW9A 2RQVA 1J3TA 4R0KA 1AWXA 1UHCA 2KYBA 2M51A 1AWWA 1VYUA 4LUEA 3VS6A 2FG0A 4CC2A 1YNZA 2A36A 1NG2A 4RTWA 2LQNA 1E7OA 1GCQC 2JS0A 2DF6A 2FPEA 2KBTA 2BZ8A 2OI3A 3RNJA 1M27C 1MUZA 1W6XA 4F16A 1NEGA 1WXTA 2DBKA 4CC7A 1WLPB 1OPLA 3FJ5A 2GGRA 2EYZA 1Z9QA 3EG1A 3REBB 1B07A 2KXCA 3SHWA 2A08A 1AVZC 1T3LA 2MIOA 2PTKA 4M4ZA 2V1RA 1SRLA 3TVTA 2M0YA 1H92A 1I07A 3UF4A 4HVUA 3EHQA 2YUOA 2K6DA 2AK5A 1U5SA 2RF0A 1NYGA 2YDLA 2W0ZA 1ARKA 3ULRB 1PKTA 4F17A 4JJCA 2D1XA 3NGPA 2DX1A 1VYVA 1ZX6A 4EIKA 3PVQA 3I9QA 3PVLA 5HCKA 1YN8A 1M30A 2JXBA 1JXOA 1MV0B 1FYNA 4DEXA 5IXBA 2F2VA 2RPNA 2DL5A 2EGCA 2YSQA 1TG0A 2KEAA 3EG0A 4ORZA 1M3CA 1QWFA 1KSWA 3REAB 5IXFA 2MCNA 2J6FA 4LN2A 1ZLMA 2CREA 1W70A 4A63B 2ED0A 4AFQC 4LUDA 3THKA 4RTUA 1U06A 4RTTA 2CUBA 1QKXA 1BU1A 3QWXX 2O31A 1QKWA 1NM7A 2CSIA 3M0QA 3R6NA 1ZUYA 2GBQA 1WXBA 2DL4A 2DA9A 2YUNA 1KJWA 1NLOC 1PNJA 1X6BA 2DLPA 2W10A 2HCKA 1RUWA 1WX6A 1UUEA 4RTXA 3VS0A 2ABLA 2L3PA 2LX7A 2K79A 1QLYA 3VS1A 4JJDA 4J9BA 3EG2A 1K4US 2X3XD 3JV3A 1NYFA 2LCSA 3NPFA 2JMCA 1JQQA 2FPFA 3PE0A 1TUDA 2KRMA 3M0SA 1JEGA 2PNIA 2HEQA 1S1NA 2A37A 1JXMA
chains in the Genus database with same CATH superfamily
3X20B 5CK9A 1KHCA 2J6KA 4PJOE 1BCMA 2LQWA 4FM4B 3ZBDA 1D09B 1JO8A 1Y57A 2DL3A 4M7DG 2OJ2A 4WCIA 2DE0X 2ZPIB 2K3BA 3QHSA 4RTVA 3CCVA 3BW1A 1ABQA 3I55T 1F1BB 1WXUA 2QQRA 3CCJT 5I11A 5I21A 5LJ5e 1K0XA 1N9SA 4N4HA 4BI8B 1N8RU 2BE9B 4XTUA 4IIMA 1ZA2B 1LOJA 1YWOA 1SSHA 5KCOA 4D8DA 4C8QA 3I55A 1SF9A 3PMIA 3CCQT 4CC3A 5KYUB 4QVZA 3PIOA 1Y71A 1YITT 3VS7A 1X2QA 3HPWA 1K8AC 1K73R 1S72T 1OULA 3TSWA 4C92B 4C5EA 3OYDA 4NOYA 4BB7A 3EGXB 1VYTA 4NS5A 2DO3A 2VV5A 1RAIB 3RKXA 2LZ6B 3META 4M78A 1M5Q1 1ACMB 4CRIA 1N9RA 1VIFA 2DMOA 3T9NA 4A4EA 1TSFA 1UE9A 3RR6A 4X34A 1FXXA 4UC4A 1UGPB 3H8ZA 1G2BA 1HSQA 3UATA 4VUBA 5GAOm 2FVUA 2P0KA 1Q7YU 2C0TA 5GAMe 2E5KA 3X24B 2MI6A 4RUGA 1UHFA 4N0AC 1UTIA 2KE9A 1WZOA 2L0AA 5DM7R 1VQOT 1RLQC 2X4JA 2LJ1A 3CMAA 1MGQA 2XDPA 4KGZB 3IQLA 5GMKl 2D6FA 2DKGA 3M0PA 4FSSA 3VV0A 4KULA 3MEAA 3M56A 3H0FA 4Z02A 3CCST 2Z0WA 2NUPA 3RMSA 3QG1A 1WHJA 2COYA 5M9OA 4O5VA 1H8KA 3G71T 1LJOA 3OW2P 1XTDA 2EKHA 5D6WA 2GQVA 2R57A 1VQLT 1O75A 1BB9A 3P8HA 1D1BA 5GJWB 1VQ7Q 2K2MA 4OF1A 1TU0B 1I5LA 2KQWA 2DZ9A 2E5QA 2EYWA 1KQ2A 5GAMf 1VQ8T 1KC8U 4J9DA 5KE2A 1Y07A 2HMAA 1K73U 1X43A 1XOVA 2L3RA 2M0OA 4M77G 5CIUA 2P4TA 1QMCA 4J6WA 2O9SA 1RLPC 3X26B 2YRVA 1LCKA 1M1GA 3JSCA 4M77E 3L2VA 3CCJA 2JTMA 4XQ3A 1YITA 5KYUA 5IN1A 2MWPA 2HQXA 1X2KA 1VQNQ 1M90R 1V29B 3VKIA 1KD1C 1TXQA 5GMKj 1VUBA 2A3LA 3JB9J 1CSKA 2EKOA 3QUIA 1N5ZA 1I5OB 3A8LB 1X6GA 4HT9A 3S3MA 4K11A 1W2BP 4FW2A 3INZA 4ZNXA 2L3QA 2YXYA 1Y7XA 1T0HA 1SPKA 2XHCA 3G4ST 2EJGA 4A4GA 3SWNA 1M90C 1ZSZB 3CCEQ 2C0OA 1YJWT 3OYBA 2O88A 2E3IA 4A53A 4E7SA 3MJXA 5D6XA 1SHFA 2A7YA 2KAFA 1PD0A 3I5RA 4MZMA 2L3SA 3D7SB 1W4SA 1WDXA 3HTRA 4X1VA 1X75C 4XTVA 3M0TA 2FO0A 3I56T 2FB7A 5GAMd 5EC7A 2X3WD 3HKSA 4IIOA 1NJIC 1UG1A 5GANh 3CCUA 4DQ2A 4E7JA 4J8OA 4XTWA 2J05A 2DRMA 4E7IA 2VKNA 4LDYA 3M0RA 2AZVA 4L6V5 2J7IA 4C0ZA 2D8JA 3OYKA 1QVFS 2DM1A 2PQWA 1SEMA 1ABOA 3G6ET 1PG5B 2DEUA 1RAEB 2NYSA 2RB6A 5LJ5j 4X9CA 4HT8A 1VOMA 4M7AA 4N4GA 2R58A 4D8KA 1TOVA 2RQRA 3EGDB 3V7RA 2O01E 3OYMA 4OMMA 3HP9A 4E7HA 2DZCA 2EJ9A 4A4HA 4HCBA 1GL5A 3UDCA 2OTLT 2DIQA 1AWJA 2EJFA 1G3WA 1O9SA 4CC4B 2VVKA 1RAGB 3S6WA 5CKEA 3VU3C 1RL2A 5IHKA 2RI2A 2J06A 3LX7A 5FU6C 2LX9A 3G7ZA 4OB3B 2F69A 3GNGA 1J3TA 4E7ZA 2M51A 5CVIA 2HL3A 3DB3A 1VYUA 4LUEA 4QW2A 4C0FA 1VQ5Q 3TCJA 3HL8A 1YI2Q 1OX8A 5FLXE 4EMKB 3MEUA 4RTWA 4X9DA 4ANJA 1GCQC 2E3HA 2OI3A 2HD0A 3RNJA 2DD4A 4A54A 3E2UA 1MUZA 2DYIA 3PMTA 3PIPA 2CZ1B 2L8DA 3OMCA 1WLPB 1QW1A 1QCOA 1Y96A 3CC7Q 1RAFB 4M78E 4J83A 4BE2A 3LLRA 1AVZC 3L2QA 1YHQA 3JB9G 2V8IA 1YJNT 2QA4T 1RAHB 3H9NA 2M0YA 4M78G 1H92A 3UF4A 4J6YA 4HVUA 1R8OB 3S3OA 2YDLA 2W0ZA 5FU6B 3G6EQ 1PKTA 2YWWA 4M75D 4F17A 2KSSA 5FRNA 4PKCC 2RM4A 4PK4A 3VYHB 4LDXA 2QQAA 3I9QA 2QI2A 3AT1B 5HCKA 5CKHA 3QZ9B 1KG1A 3QYHB 4C8QD 2F2VA 1VQ7T 3EG0A 4ORZA 1QWFA 1KSWA 3REAB 5IXFA 3CMAT 1Q82R 5LJ5d 2J6FA 4LN2A 1ZLMA 1W70A 3OQ5A 3FRNA 4LUDA 4M7AB 4QKUA 3J81E 2FZKB 3M4YA 1M1KR 1IRXA 1VQMA 1IZ6A 3R6NA 1PC0A 3HFOA 1KQSS 2XKOC 4BI3A 1HYOA 4DOWA 1VQ5T 1NLOC 1OU8A 3QIIA 4E7LA 2V8JA 4NL2A 1OZ2A 1WX6A 1UUEA 5GANf 3CCET 4C5IA 3V7SA 2BKDN 3WVEB 4MMLA 2QQ9A 4JJDA 4BDYA 4J9BA 2LC4A 4KT0E 3OS5A 2HKNA 2NUTB 2LCSA 3JCMJ 3S3NA 1JQQA 1TUDA 4FYXB 1Q81C 1P92A 4ZGJB 4C0DB 1S72A 5CQXA 3M0UA 5GAMg 3NHNA 3I5SA 4EDUA 4D6WA 2JTFA 1IGUA 4J6XA 3JB9D 2DAQA 1Q86C 5LJ3h 1TTHB 2K9GA 1YJ9Q 3KBGA 1D0YA 3CC4Q 2DNUA 5I22A 4GY5A 1OI1A 5LJ5f 3NTHA 5KH6A 3Q1JA 1RAAB 1GCPA 4LXCA 3OYNA 4O6JA 4C8QE 5FWBA 2KDSA 4KGXB 2HQHA 1QQJA 2HAXA 2DILA 4PNOA 2QA4A 3RIRA 4OMFB 3OYEA 3FIFA 4ZN3A 1JU5C 1OPKA 2KGTA 4M77C 1G3SA 2IVWA 2KI7A 2DL7A 3EG9B 3I56A 1Q86R 2CGHA 3EFOA 2OTLQ 1WFWA 2D8HA 1VQ9A 2EVRA 1KQSA 3NMZC 2VXFA 1D3BB 1C1AA 1MV3A 2EQJA 3MO8A 5LJ3f 2EYYA 5GAN5 1VQPT 2D0NA 3QJYA 2JMAA 3FC3A 1VQLA 2K3XA 1ZHIA 3C0CA 2H3EB 4BY6C 4M77D 2YHTA 2OX7A 3C95A 3CCEA 3QDRB 4M77B 2L2PA 2XICA 4J7FA 4HCZA 1FMVA 3LW5E 4LD9K 2ZPHB 1X69A 2AIRB 3X28B 1Q7YR 4M77F 2XG8D 3L2UA 2LT4A 1XQHA 5HK0A 1WQWA 2O2OA 4FYWB 2AT1B 2BUDA 1V76A 4ELZC 1SHGA 1IGQA 1QCFA 2JNGA 2C0IA 5LJ3d 1ZUKA 1G8XA 2QTXA 4LDUA 4JS5A 3CCLQ 4IURA 4Z88A 3SEMA 5KYWA 2DTHA 3I55Q 1QVPA 5GAN7 3M4GA 5C0MA 5GANg 5KYXB 3E9FA 3NTKA 2ZAEA 2RQTA 3CPWP 3CMAQ 3PNWC 3JCMe 1QP2A 2JM8A 4JJNK 5GAOn 3R6OA 1GBRA 4ZTJA 1BIAA 2QAZA 4J7IA 1K76A 2BE7D 1YCYA 1HD3A 1IB8A 4RTYA 4PJOA 1IHWA 3JCMQ 2M9UA 2Y4XA 1BI0A 4KGVB 2CYZB 2RQWA 5J3BA 2YUPA 1IHVA 2ZGWA 5J26A 2LJ0A 3EG9A 2COZA 1WGSA 2PVOB 3DLLA 3O5ZA 2PZ1A 2K3YA 2RK1A 2Y4YA 5CKFA 3QKJA 3V8JA 2SRCA 4C92D 4QQGA 2HL5C 1M2OA 3VRZA 4AMCA 2DEQA 4Z89A 4J9IA 1N6AA 3I56Q 3PFSA 3M57A 1BCOA 3ZFJA 2EYXA 4XTYA 4M78C 2ZPEB 4PJOG 4M77A 1R77A 4C92F 3CCSQ 4KUDK 2GFUA 4BI4A 4M7DE 5D7UA 5CR2A 4RMOA 4PJOC 1WA7A 2DPPB 2FHDA 2BIVA 2J6OA 2EBPA 2KR3A 4FL6A 1FX7A 2LVMA 2CZ7B 3VYGA 2B86A 2EGEA 4C8QB 4F04B 1K0SA 1AZGB 4GLMA 3UA6A 3CC7A 1PRLC 3EFSA 4AG2C 2FEIA 4DA4A 1WHMA 2IG0A 1VIEA 3P8DA 2FRYA 9ATCB 2F1LA 3H0IA 3CXCP 5KYWB 4JLIA 4WF2A 3L1AA 3LGLA 1PWTA 3P8BB 1U8RA 2RD1A 1YHQT 4EPCA 1KC8R 3QWYA 3JRZA 4M78B 1GXIE 4AFSC 1VQOQ 5FW9A 2E12A 3GLXA 2VC8A 3J80E 1UHCA 2KYBA 3CCUQ 3JB9F 2RK2A 4MMKA 3OYJA 2FG0A 5GANj 2JUFA 1ZA1B 1MNDA 2LQNA 4C92E 5GAMj 2JS0A 3DKMA 3M58A 4M7DF 1EIFA 1YJWQ 2QGFB 4EMGA 2DF6A 3X25B 2E41A 1JBMA 3SFMA 2RHUA 1M9SA 5DY9A 3GPLA 2ZPGB 1VQMQ 3FJ5A 1BKBA 3L2RA 1Z9QA 3OS2A 3CXCA 3SHWA 2P0QA 1T3LA 4M7DD 2MIOA 2PTKA 1BI3A 4BUGA 1I07A 2HNIA 4M75E 2K6DA 2AK5A 1U5SA 4JUVA 1K9MR 4M75G 2VUBA 2MMPA 4JJCA 1UGRB 3CBPA 3OY9A 2DX1A 2X4WA 1VYVA 3OMGA 3PGGA 3QYGB 4DBFA 2VGNA 1M30A 2JXBA 3LGFA 1MV0B 3G6EA 3ME9A 4EMHA 1QVGA 1M3CA 5CCAA 5GAOl 3A5ZB 3OSVA 1M1KC 2MK5A 4A63B 4RCBA 2OTLA 4RTUA 1U06A 3RESA 2JJ9A 1BU1A 3QWXX 2O31A 1EX4A 1NM7A 3MCAB 3E9GA 5CQYA 4C0GA 1ZUYA 2K5IA 2GBQA 3CMEQ 4M7AC 1PNJA 3C94A 1X6OA 2EYQA 4IUPA 1X6BA 2AHJB 5GMKm 3L2WA 2DLPA 2VB6A 2HCKA 5LJ3j 2EQUA 4RTXA 1VQ9Q 4ZN1A 2FYKA 4FYYB 3BDUA 3VS0A 2ABLA 4FT2A 1YFNA 3J7AF 5GAN2 2ZPBB 3VS1A 3SWNB 3EG2A 1K4US 2PUKB 3C4SA 4M7DB 2WSFE 3NPFA 4HA8A 5GAOr 2RJCA 3QPHA 2E64A 5J39A 3M0SA 1JEGA 2HEQA 4QQDA 3CPWS 2R5MA 1K8AU 2PVDB 2EQMA 4DOVA 3JCMc 1OZ3A 4GBQA 1OX9A 2OTJT 2QDLA 4JPBW 1WHLA 3H41A 2A28A 1SRMA 2EWNA 2FZCB 4KRTA 2FL7A 4XTZA 2COWA 4ELYC 2I0NA 1VA7A 4NL3A 1QWEA 3SWNC 3CD6Q 2CSQA 4RTZA 4MZPA 2V8KA 1FWZA 1VQPA 5DLQE 3CC4A 4F14A 4ESRA 2ENMA 4C92C 1EFNA 1I81A 3JCMg 3OYIA 2LP5A 3E1SA 3OS1A 5GJVB 4XK8E 2FPDA 4ME7A 4FYVB 2DFUA 4JDSA 3FDRA 3A8MB 2KRSA 3CEYA 5HK3A 2HKQB 4JZ3A 2LJ3A 2CP2A 1MMDA 5L8RE 4GLKA 4XU2A 5I2MA 1ZQ1A 4IUTA 1JJ2A 4N0AA 5IHIA 2ZCFB 3G71A 1Q95G 4M75C 1QCNA 3OYCA 4JRQA 2BZYA 3L2ZA 4R55A 4OMOA 1W2BS 2DXCA 2E10A 3QDFA 4IUVA 1RABB 3FJPA 5ECAA 4ATOA 3RKYA 4AG1C 1PRMC 1UDLA 4JZ4A 1IO6A 2ECZA 2HQEA 2RJDA 4EMKA 4IKFA 2LCLA 1I0CA 3OS0A 2RQUA 2XDDA 2MAMA 2DJQA 1K73C 3A8GB 2NUZA 2EGAA 1RI9A 2CH4W 1U3OA 3CC7T 1M3BA 4OMPA 2QDYB 2K2VA 4M7DA 2QASA 1Y96B 4KUIA 4QVCA 4Z8AA 5A0GA 4JRPA 5FRMA 1OOTA 3NFCA 2EW3A 3VS4A 2LNHB 3E19A 2EFIA 3MPUB 4OB2B 2ROTA 1C0MA 3OBWA 3OYFA 3URGA 4RG2A 2Y90A 4HXJA 4M7AG 1QP3A 4B6MA 4RKUE 3GOXA 2QK0A 3OA6A 3G4SA 1B7TA 2K57A 4M78F 1NPPA 1PM3A 3ZEHA 3OBYA 2NLUA 2OTJA 2GNCA 1W2BA 4MDXA 2OAWA 4MDWA 3NTIA 1TUGB 5EG2A 1WPYA 3EGUA 3VS3A 5IH2A 1LPLA 5KYYB 1QVGP 1AZEA 4OMNA 1YWPA 2HDAA 3BY7A 2KXDA 3N5BB 4M75A 1A0NB 4IUQA 1Y0MA 2CDTA 5DLOA 3PTAA 2KROA 3CCMQ 4PFPA 4Q5WA 1M4ZA 2E4HA 1YP5A 1M1FA 2QTVA 3SB2A 1UGQB 4F7UA 2PVGB 3JB9I 3OSSC 2JM9A 4PLLA 2X4XA 3F70A 2DD5A 5KYNA 2JZ2A 1KC8C 2CH4A 2E6ZA 4M75F 4YTLA 4JRIA 3TEEA 4QT7A 3M9QA 1NEBA 2RJEA 4HVWA 3QBYA 3EH2A 2MOXA 1B34A 1JRIA 3CQTA 2HBWA 2F2WA 2NUTA 1YJ9T 1KFZA 2GTOA 1YCSB 4ZGEB 1KD1U 3LH5A 3UPUA 2M02A 3JB9H 3VS2A 1KHIA 3TSZA 2AKLA 2BTTA 5GMKh 1YI2A 1GRIA 1HJDA 4A4FA 5GMKe 2H3JA 1YJNQ 1ZBXA 1TUCA 4FW1A 4RCCA 2EPDA 3A98A 3KXTA 1TWBA 4B9WA 1M90U 2QEXA 2DVJA 2GTJA 2GCXA 2V1QA 3JCMV 2JT4A 5LJ3e 4BE0A 5FROA 1WJRA 5FWCA 2RI3A 4LE9A 1AOJA 1WHGA 3M55A 4L59A 2JTEA 2SEMA 3EGXA 3OYHA 2CP6A 2ED1A 3CCLT 1T3SA 2MPXC 5GANd 5GMKi 4WTOB 1JJ2S 2ZZDA 1Q82C 3LH0A 3M54A 3JCMd 1W1FA 1AT1B 2CS7A 2EQKA 4FSXA 3KFVA 3A8OB 1OV3A 1S72Q 1CKAA 1SSFA 4DBHA 3JCMX 3OYGA 2VASA 2LCCA 4XTXA 5LJ3g 3I35A 3G4SQ 4R0KA 4A4KA 3RERA 4N4IA 1AWWA 3C12A 3L42A 2X9HA 4LDWA 4CI0C 3VS6A 2CKKA 4M75B 2QG9B 1WQ7A 1D3BA 1NG2A 3FB9A 1PSFA 2V26A 1RADB 3CC2T 1E7OA 1D0XA 1VQOA 4XU3A 1K9MC 3JCMP 3RKWA 1H641 2QEXQ 2KBTA 5I2SA 2BZ8A 4BE1A 3CBOA 3GF5A 1WXTA 5CO7A 4CC7A 2GGRA 3EG1A 3REBB 4OB1B 3H6ZA 1WJQA 4PLIA 1WHHA 4FIBA 3V7CA 3BDLA 4M4ZA 3JCMf 2V1RA 1SRLA 3TVTA 1B34B 2QQSA 4ZGDB 5GAOp 1YIJQ 3EHQA 3CXCS 3ASKA 4JRKA 3ULRB 3A1PA 1UGSB 1G5VA 3VUZA 2MWOA 1UB4A 1VQ8A 3G71Q 3VJPA 4EIKA 4C5HA 1UEBA 3AHUA 3OB9A 2D0QB 3MP1A 2X35A 1VQLQ 5FU7C 2DL5A 4OP0A 2EGCA 2YSQA 5GAN6 1VQKQ 2KEAA 1PSEA 3CCVQ 5GAN4 4AFQC 5KYXA 2ED0A 4JLGA 1YJNA 1WJSA 2CP3A 3MEVA 2ZPFB 1KK7A 1QKWA 3CD6A 2DL4A 3QXEB 3M5AA 4F7UF 2DA9A 1KJWA 4PJOF 1QVGS 2ATCB 2XI9A 1ZSZA 5AT1B 3CC2Q 4KH0B 2W10A 1TH7A 3OYAA 4M7AF 4PJOB 2YRDA 2L3PA 2VGMA 1QLYA 4DBRA 5CKDA 3BE3A 3JV3A 3MEWA 1VQ6Q 4AT1B 1NYFA 2JMCA 2CZ6B 2VXEA 3EAEA 3G1JA 4OB0B 2HBPA 4JS4A 2DIGA 2KRMA 2PNIA 2RA2A 3CCSA 4C8QC 2KY9A 1K9AA 3SDZA 4AFZC 2RO0A 2K5LA 2KNBB 2OTJQ 2JS2A 4E6RA 3ER0A 2KYMA 2H8HA 2DERA 1GCQA 2F5KA 1VQMT 4V2SA 4PJMA 3EFRA 4LD6A 1GFCA 2GFAA 3RUXA 1MNEA 2O4XB 2EQIA 1YBYA 4HCKA 3CCJQ 1AWOA 4OGCA 3H0HA 4XU0A 2VWFA 1VQ4A 1KIKA 1WIEA 1ZSZC 2XU8A 2RHZA 4J9CA 4E2FB 3O8VA 2K7AA 2DRKA 1Z9ZA 1N8RC 4F7UG 1K1ZA 1V1CA 3CCQQ 5GANe 3EGDA 1MMAA 1IXDA 2CUDA 2YRCA 4FCYA 4F7UE 4DEYA 1MMNA 5CKBA 1Q81U 3CMET 4JJBA 1OYXA 1YHQQ 2XMFA 3HRSA 1T0JA 4E7KA 3OW2S 5IHNA 3OYLA 1BI2A 3MP6A 2AKKA 4Y91A 2AZSA 3CCMA 2L5QA 3DLMA 1HK9A 1X01A 1NJIU 8AT1B 1GBQA 2LQKA 3EHRA 3QZ5B 4PJOD 2R5AA 1SKUB 2RN8A 1LNXA 2MYSA 2JVVA 1E6HA 2QYZA 4AFUC 4IUUA 1Q7YC 4XU1A 2DXTA 2LNVA 3WVDB 4OMLA 1PD1A 1RI0A 3TU4K 1XJWB 2RHXA 5CAIA 1QVFA 4J9GA 4C92G 1NJIR 5GAOq 5GAN3 4XAXB 1PKSA 3CD6T 1OU9A 1BK2A 2CT3A 1WYXA 1ZBJA 1KQ1A 1R0CB 1B3QA 2RNAA 4QVDA 2G6FX 4J9HA 5A0LA 2FRWA 1M2VB 2X4YA 3HSBA 3GBQA 4EMKC 1KQSP 2ESWA 2KRNA 3UT1A 3TREA 2CZ0B 3V8LA 4KH1B 3FEOA 2E65A 2O4XA 2WACA 2KK4A 1NPRA 4QQ6A 3CCRT 2YLBA 1D1CA 1BYMA 1M8VA 1OQKA 4LNPA 4E47A 4HVVA 3RBBB 1AD5A 2WSCE 1WHKA 1GFDA 4BD3A 5AYFA 2P0PA 1H3ZA 3VS5A 1XNIA 1AHJB 2DL8A 1I8FA 2F2XA 5GAMh 2LRQA 1K8AR 1BBZA 1NLPC 1M3AA 3UA7A 2ROLA 1VQ4Q 1E6GA 1N27A 4B9XA 7AT1B 2RJFA 5A0DA 4C8QF 2FZGB 2CP7A 1ZUUA 2GF7A 1PCXA 4PJJA 2YT6A 1YI2T 3CCMT 1VQNA 3CCQA 1UECA 1OEBA 2PU9B 1IREB 5L23A 1WI7A 3MKDA 2IIMA 2QXFA 3GNFB 1D1AA 1G83A 2O9VA 2XIDA 1FMWA 2DBMA 2BZXA 2QEXT 4J9FA 1X27A 2QA4Q 2F5TX 2E1HA 3A8HB 1BIBA 4RG8A 4J9EA 2DXUA 1WNLA 2RHIA 3WXMB 4PL6A 5A2QE 4DBQA 2P4RA 3ZL7C 1I1JA 2OAUA 2DXBA 5LJ5g 2MF2A 3RDVA 1CKBA 1UJ0A 3JCMW 1KD1R 4L5GA 2CT4A 2XK0A 2KMTA 1AEYA 2CP5A 2K4YA 2DK3A 4P5NA 2DYBA 4PFOA 2LMJA 1FMKA 1C6VX 4FU6A 3MP8A 3QO3A 2I2LA 2C06A 2KVQG 1H3HA 2GQIA 3VRYA 5KE3A 8ATCB 2KT8A 2KT1A 2RH2A 2CP0A 3GIBA 3QJ6A 4C8QG 3DB4A 1UJYA 2A0FB 3FLGA 1YJWA 4Y92A 1QVFP 2NWMA 2M16A 1M8MA 3M59A 3VUBA 1BI1A 1M2VA 2YUQA 1G3YA 3CC4T 3HRUA 1NZ9A 1HXDA 4OMQA 1YITQ 4HCCA 1VQ8Q 4HKEA 4M7AD 1MHNA 3BFMA 1Q82U 2E6NA 3M53A 1UGVA 2LT1A 2HZYA 3GP8A 2RMOA 4KBMB 2JW4A 3CCUT 3QSUA 1YIJA 3U23A 4PFZA 1VQKA 1JB0E 1UFFA 2JN0A 3EFOB 1PHTA 1VQ5A 4ZTFA 1LVKA 2HSPA 1ZSGA 2QQBA 3EG3A 2RHYA 3CCRA 2RQVA 4BACA 1Q86U 1AWXA 3UWNA 4BDZA 3SD4A 1VQKT 2LQ8A 4CC2A 1K9MU 2PUOB 2DVEA 2RI5A 3V8KA 1YNZA 3CCVT 2A36A 1VQNT 1R0BG 3KUFA 5C6SA 2EIFA 2YLCA 2FPEA 3JCMh 2WSEE 1M27C 1W6XA 3CBMA 4F16A 3LWHA 1NEGA 2DBKA 1OPLA 1SG5A 2VYTA 2EYZA 3CPFA 3LYIA 1G3TA 3CMEA 1B07A 5D6YA 2KXCA 2A08A 2XDBA 1YJ9A 1DJ7B 4Y28E 2XD0A 1U1SA 4C5GA 2QGGA 2EAYA 3MHXA 4M78D 1N8RR 1JJ2P 2YUOA 1D0ZA 4II1A 2RF0A 1NE8A 1NYGA 4PJNA 2IPOB 1ARKA 2LTOA 4BY6B 2L89A 4OVAA 3LWIA 1TS9A 3RMQA 2D1XA 4R56A 4C92A 3NGPA 5IT9E 5KCHA 5GAN8 1EZZB 2JOYA 1ZX6A 3EH1A 3PVQA 3CCRQ 3PVLA 2K5FA 4M7AE 1I4K1 1YN8A 2X51A 1JXOA 2P84A 2D9TA 1FYNA 2M1HA 4J5YA 2DTOA 3PT9A 4MZTA 4DEXA 5IXBA 2RPNA 2DJZA 5LL6S 1TG0A 4TVRA 3TQ7P 3CCLA 2MCNA 3OYYA 2CREA 4LDVA 5HKCA 2DETA 5FU7B 2B8AA 1RACB 3THKA 3JCMb 4RTTA 1Q81R 2CUBA 1QKXA 5IAYA 1VQ9T 3M0QA 2CSIA 5KYYA 1WXBA 5HY6A 1VQPQ 2YUNA 3HRTA 6AT1B 4OGEA 3HHTB 1VQ4T 1VQ6A 1RUWA 4FT4A 5LJ5h 2HSEB 3OW2A 2LDMA 1U1TA 4F7UB 3HFNA 2LX7A 2K79A 3CPWA 4C0DC 1VQ7A 2DTIA 3CC2A 1YIJT 2X3XD 2NUPB 1VQ6T 1NBEB 4PJLA 1MMGA 3JAME 1M1KU 2G3RA 2FPFA 3PE0A 1S1NA 2A37A 2E70A 4M7DC 1JXMA
chains in the Genus database with same CATH topology
1K9AA 3M0UA 2J6KA 4AFZC 2KNBB 4GBQA 3NHNA 2LQWA 2JS2A 3I5SA 4E6RA 2QDLA 2KYMA 1JO8A 1Y57A 2DL3A 2H8HA 2OJ2A 4WCIA 1GCQA 2DE0X 4JPBW 2K3BA 3H41A 1GFCA 2A28A 4RTVA 1SRMA 1ABQA 2EQIA 1WXUA 4HCKA 1AWOA 4KRTA 3H0HA 2K9GA 2VWFA 5I11A 1KIKA 1WIEA 1K0XA 4J9CA 2DNUA 2I0NA 1VA7A 2K7AA 2DRKA 4IIMA 5I22A 1QWEA 1Z9ZA 1YWOA 1SSHA 1GCPA 2CSQA 4RTZA 4D8DA 1K1ZA 1V1CA 5FWBA 4CC3A 4F14A 4ESRA 2CUDA 2ENMA 2DILA 1EFNA 4DEYA 2LP5A 3VS7A 1X2QA 4JJBA 5GJVB 2FPDA 3TSWA 2XMFA 1VYTA 1T0JA 2LZ6B 2KRSA 5IHNA 1JU5C 1OPKA 2KGTA 4JZ3A 2AKKA 2LJ3A 2AZSA 2DMOA 1UE9A 2DL7A 1GBQA 3EHRA 5IHIA 1WFWA 2D8HA 1G2BA 2EVRA 2RN8A 3NMZC 1HSQA 3UATA 1E6HA 1MV3A 2BZYA 2EYYA 4AFUC 2C0TA 4OMOA 2E5KA 2D0NA 2JMAA 4RUGA 1UHFA 1UTIA 2KE9A 2L0AA 5ECAA 3C0CA 1RLQC 4OMLA 4AG1C 1PRMC 1UDLA 4JZ4A 1IO6A 2ECZA 2LJ1A 1I0CA 2RQUA 4J9GA 2DJQA 2L2PA 3IQLA 3M0PA 4FSSA 2NUZA 2EGAA 1PKSA 1RI9A 2CH4W 1U3OA 1X69A 1BK2A 1M3BA 2CT3A 4OMPA 1WYXA 3H0FA 1ZBJA 1B3QA 2RNAA 4Z8AA 2G6FX 4J9HA 2FRWA 2O2OA 1OOTA 1H8KA 2EW3A 3VS4A 2LNHB 2EKHA 3GBQA 1SHGA 2ESWA 2ROTA 2KRNA 1QCFA 4HXJA 1BB9A 2C0IA 5GJWB 1ZUKA 2K2MA 2EYWA 4Z88A 4J9DA 3SEMA 1X43A 1XOVA 4LNPA 2GNCA 2OAWA 4HVVA 2O9SA 3RBBB 1AD5A 1RLPC 1GFDA 2RQTA 1LCKA 3VS5A 2DL8A 3EGUA 3VS3A 2F2XA 5IH2A 1X2KA 1BBZA 1NLPC 1M3AA 2JM8A 2ROLA 3UA7A 1AZEA 1YWPA 1E6GA 2HDAA 4OMNA 2KXDA 1A0NB 1Y0MA 1GBRA 1CSKA 2CDTA 1N5ZA 1X6GA 1ZUUA 1K76A 2KROA 1HD3A 4K11A 2YT6A 1YP5A 4ZNXA 4RTYA 1UECA 2L3QA 1OEBA 5L23A 1T0HA 1SPKA 1WI7A 2JM9A 2IIMA 2RQWA 2YUPA 1G83A 2O9VA 2CH4A 2LJ0A 2C0OA 2BZXA 2DBMA 4J9FA 1X27A 2O88A 3O5ZA 4J9EA 2PZ1A 4QT7A 1NEBA 2P4RA 4HVWA 3ZL7C 1I1JA 1SHFA 2MOXA 2SRCA 1CKBA 3I5RA 1UJ0A 3VRZA 3CQTA 2L3SA 2HBWA 2CT4A 2F2WA 1WDXA 4X1VA 1KFZA 2GTOA 1YCSB 1AEYA 3M0TA 2FO0A 4Z89A 4J9IA 3LH5A 5EC7A 2X3WD 4IIOA 3VS2A 1UG1A 2DYBA 2EYXA 2LMJA 1FMKA 3TSZA 2AKLA 2BTTA 1GRIA 1HJDA 2J05A 2DRMA 1H3HA 2GQIA 2VKNA 3VRYA 1TUCA 3M0RA 1WA7A 2AZVA 2KT1A 2KT8A 2J7IA 2EPDA 3A98A 1UJYA 2D8JA 4Y92A 2DVJA 2GTJA 2J6OA 2DM1A 1SEMA 2V1QA 2NWMA 2EBPA 2KR3A 2JT4A 1ABOA 1M8MA 2YUQA 2B86A 2EGEA 5FWCA 4LE9A 1AOJA 1K0SA 1AZGB 4GLMA 3UA6A 4D8KA 4OMQA 2JTEA 2SEMA 2RQRA 2ED1A 1PRLC 4AG2C 1T3SA 2FEIA 4OMMA 1UGVA 1GL5A 1AWJA 2FRYA 2RMOA 3H0IA 2JW4A 4CC4B 2VVKA 3U23A 1W1FA 1UFFA 3KFVA 1PHTA 1OV3A 1PWTA 5IHKA 2HSPA 1CKAA 2J06A 3QWYA 1ZSGA 3EG3A 4AFSC 3I35A 5FW9A 2RQVA 1J3TA 4R0KA 1AWXA 1UHCA 2KYBA 2M51A 1AWWA 1VYUA 4LUEA 3VS6A 2FG0A 4CC2A 1YNZA 2A36A 1NG2A 4RTWA 2LQNA 1E7OA 1GCQC 2JS0A 2DF6A 2FPEA 2KBTA 2BZ8A 2OI3A 3RNJA 1M27C 1MUZA 1W6XA 4F16A 1NEGA 1WXTA 2DBKA 4CC7A 1WLPB 1OPLA 3FJ5A 2GGRA 2EYZA 1Z9QA 3EG1A 3REBB 1B07A 2KXCA 3SHWA 2A08A 1AVZC 1T3LA 2MIOA 2PTKA 4M4ZA 2V1RA 1SRLA 3TVTA 2M0YA 1H92A 1I07A 3UF4A 4HVUA 3EHQA 2YUOA 2K6DA 2AK5A 1U5SA 2RF0A 1NYGA 2YDLA 2W0ZA 1ARKA 3ULRB 1PKTA 4F17A 4JJCA 2D1XA 3NGPA 2DX1A 1VYVA 1ZX6A 4EIKA 3PVQA 3I9QA 3PVLA 5HCKA 1YN8A 1M30A 2JXBA 1JXOA 1MV0B 1FYNA 4DEXA 5IXBA 2F2VA 2RPNA 2DL5A 2EGCA 2YSQA 1TG0A 2KEAA 3EG0A 4ORZA 1M3CA 1QWFA 1KSWA 3REAB 5IXFA 2MCNA 2J6FA 4LN2A 1ZLMA 2CREA 1W70A 4A63B 2ED0A 4AFQC 4LUDA 3THKA 4RTUA 1U06A 4RTTA 2CUBA 1QKXA 1BU1A 3QWXX 2O31A 1QKWA 1NM7A 2CSIA 3M0QA 3R6NA 1ZUYA 2GBQA 1WXBA 2DL4A 2DA9A 2YUNA 1KJWA 1NLOC 1PNJA 1X6BA 2DLPA 2W10A 2HCKA 1RUWA 1WX6A 1UUEA 4RTXA 3VS0A 2ABLA 2L3PA 2LX7A 2K79A 1QLYA 3VS1A 4JJDA 4J9BA 3EG2A 1K4US 2X3XD 3JV3A 1NYFA 2LCSA 3NPFA 2JMCA 1JQQA 2FPFA 3PE0A 1TUDA 2KRMA 3M0SA 1JEGA 2PNIA 2HEQA 1S1NA 2A37A 1JXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9A A;  3M0U A;  2J6K A;  4AFZ C;  2KNB B;  4GBQ A;  3NHN A;  2LQW A;  2JS2 A;  3I5S A;  4E6R A;  2QDL A;  2KYM A;  1JO8 A;  1Y57 A;  2DL3 A;  2H8H A;  2OJ2 A;  4WCI A;  1GCQ A;  2DE0 X;  4JPB W;  2K3B A;  3H41 A;  1GFC A;  2A28 A;  4RTV A;  1SRM A;  1ABQ A;  2EQI A;  1WXU A;  4HCK A;  1AWO A;  4KRT A;  3H0H A;  2K9G A;  2VWF A;  5I11 A;  1KIK A;  1WIE A;  1K0X A;  4J9C A;  2DNU A;  2I0N A;  1VA7 A;  2K7A A;  2DRK A;  4IIM A;  5I22 A;  1QWE A;  1Z9Z A;  1YWO A;  1SSH A;  1GCP A;  2CSQ A;  4RTZ A;  4D8D A;  1K1Z A;  1V1C A;  5FWB A;  4CC3 A;  4F14 A;  4ESR A;  2CUD A;  2ENM A;  2DIL A;  1EFN A;  4DEY A;  2LP5 A;  3VS7 A;  1X2Q A;  4JJB A;  5GJV B;  2FPD A;  3TSW A;  2XMF A;  1VYT A;  1T0J A;  2LZ6 B;  2KRS A;  5IHN A;  1JU5 C;  1OPK A;  2KGT A;  4JZ3 A;  2AKK A;  2LJ3 A;  2AZS A;  2DMO A;  1UE9 A;  2DL7 A;  1GBQ A;  3EHR A;  5IHI A;  1WFW A;  2D8H A;  1G2B A;  2EVR A;  2RN8 A;  3NMZ C;  1HSQ A;  3UAT A;  1E6H A;  1MV3 A;  2BZY A;  2EYY A;  4AFU C;  2C0T A;  4OMO A;  2E5K A;  2D0N A;  2JMA A;  4RUG A;  1UHF A;  1UTI A;  2KE9 A;  2L0A A;  5ECA A;  3C0C A;  1RLQ C;  4OML A;  4AG1 C;  1PRM C;  1UDL A;  4JZ4 A;  1IO6 A;  2ECZ A;  2LJ1 A;  1I0C A;  2RQU A;  4J9G A;  2DJQ A;  2L2P A;  3IQL A;  3M0P A;  4FSS A;  2NUZ A;  2EGA A;  1PKS A;  1RI9 A;  2CH4 W;  1U3O A;  1X69 A;  1BK2 A;  1M3B A;  2CT3 A;  4OMP A;  1WYX A;  3H0F A;  1ZBJ A;  1B3Q A;  2RNA A;  4Z8A A;  2G6F X;  4J9H A;  2FRW A;  2O2O A;  1OOT A;  1H8K A;  2EW3 A;  3VS4 A;  2LNH B;  2EKH A;  3GBQ A;  1SHG A;  2ESW A;  2ROT A;  2KRN A;  1QCF A;  4HXJ A;  1BB9 A;  2C0I A;  5GJW B;  1ZUK A;  2K2M A;  2EYW A;  4Z88 A;  4J9D A;  3SEM A;  1X43 A;  1XOV A;  4LNP A;  2GNC A;  2OAW A;  4HVV A;  2O9S A;  3RBB B;  1AD5 A;  1RLP C;  1GFD A;  2RQT A;  1LCK A;  3VS5 A;  2DL8 A;  3EGU A;  3VS3 A;  2F2X A;  5IH2 A;  1X2K A;  1BBZ A;  1NLP C;  1M3A A;  2JM8 A;  2ROL A;  3UA7 A;  1AZE A;  1YWP A;  1E6G A;  2HDA A;  4OMN A;  2KXD A;  1A0N B;  1Y0M A;  1GBR A;  1CSK A;  2CDT A;  1N5Z A;  1X6G A;  1ZUU A;  1K76 A;  2KRO A;  1HD3 A;  4K11 A;  2YT6 A;  1YP5 A;  4ZNX A;  4RTY A;  1UEC A;  2L3Q A;  1OEB A;  5L23 A;  1T0H A;  1SPK A;  1WI7 A;  2JM9 A;  2IIM A;  2RQW A;  2YUP A;  1G83 A;  2O9V A;  2CH4 A;  2LJ0 A;  2C0O A;  2BZX A;  2DBM A;  4J9F A;  1X27 A;  2O88 A;  3O5Z A;  4J9E A;  2PZ1 A;  4QT7 A;  1NEB A;  2P4R A;  4HVW A;  3ZL7 C;  1I1J A;  1SHF A;  2MOX A;  2SRC A;  1CKB A;  3I5R A;  1UJ0 A;  3VRZ A;  3CQT A;  2L3S A;  2HBW A;  2CT4 A;  2F2W A;  1WDX A;  4X1V A;  1KFZ A;  2GTO A;  1YCS B;  1AEY A;  3M0T A;  2FO0 A;  4Z89 A;  4J9I A;  3LH5 A;  5EC7 A;  2X3W D;  4IIO A;  3VS2 A;  1UG1 A;  2DYB A;  2EYX A;  2LMJ A;  1FMK A;  3TSZ A;  2AKL A;  2BTT A;  1GRI A;  1HJD A;  2J05 A;  2DRM A;  1H3H A;  2GQI A;  2VKN A;  3VRY A;  1TUC A;  3M0R A;  1WA7 A;  2AZV A;  2KT1 A;  2KT8 A;  2J7I A;  2EPD A;  3A98 A;  1UJY A;  2D8J A;  4Y92 A;  2DVJ A;  2GTJ A;  2J6O A;  2DM1 A;  1SEM A;  2V1Q A;  2NWM A;  2EBP A;  2KR3 A;  2JT4 A;  1ABO A;  1M8M A;  2YUQ A;  2B86 A;  2EGE A;  5FWC A;  4LE9 A;  1AOJ A;  1K0S A;  1AZG B;  4GLM A;  3UA6 A;  4D8K A;  4OMQ A;  2JTE A;  2SEM A;  2RQR A;  2ED1 A;  1PRL C;  4AG2 C;  1T3S A;  2FEI A;  4OMM A;  1UGV A;  1GL5 A;  1AWJ A;  2FRY A;  2RMO A;  3H0I A;  2JW4 A;  4CC4 B;  2VVK A;  3U23 A;  1W1F A;  1UFF A;  3KFV A;  1PHT A;  1OV3 A;  1PWT A;  5IHK A;  2HSP A;  1CKA A;  2J06 A;  3QWY A;  1ZSG A;  3EG3 A;  4AFS C;  3I35 A;  5FW9 A;  2RQV A;  1J3T A;  4R0K A;  1AWX A;  1UHC A;  2KYB A;  2M51 A;  1AWW A;  1VYU A;  4LUE A;  3VS6 A;  2FG0 A;  4CC2 A;  1YNZ A;  2A36 A;  1NG2 A;  4RTW A;  2LQN A;  1E7O A;  1GCQ C;  2JS0 A;  2DF6 A;  2FPE A;  2KBT A;  2BZ8 A;  2OI3 A;  3RNJ A;  1M27 C;  1MUZ A;  1W6X A;  4F16 A;  1NEG A;  1WXT A;  2DBK A;  4CC7 A;  1WLP B;  1OPL A;  3FJ5 A;  2GGR A;  2EYZ A;  1Z9Q A;  3EG1 A;  3REB B;  1B07 A;  2KXC A;  3SHW A;  2A08 A;  1AVZ C;  1T3L A;  2MIO A;  2PTK A;  4M4Z A;  2V1R A;  1SRL A;  3TVT A;  2M0Y A;  1H92 A;  1I07 A;  3UF4 A;  4HVU A;  3EHQ A;  2YUO A;  2K6D A;  2AK5 A;  1U5S A;  2RF0 A;  1NYG A;  2YDL A;  2W0Z A;  1ARK A;  3ULR B;  1PKT A;  4F17 A;  4JJC A;  2D1X A;  3NGP A;  2DX1 A;  1VYV A;  1ZX6 A;  4EIK A;  3PVQ A;  3I9Q A;  3PVL A;  5HCK A;  1YN8 A;  1M30 A;  2JXB A;  1JXO A;  1MV0 B;  1FYN A;  4DEX A;  5IXB A;  2F2V A;  2RPN A;  2DL5 A;  2EGC A;  2YSQ A;  1TG0 A;  2KEA A;  3EG0 A;  4ORZ A;  1M3C A;  1QWF A;  1KSW A;  3REA B;  5IXF A;  2MCN A;  2J6F A;  4LN2 A;  1ZLM A;  2CRE A;  1W70 A;  4A63 B;  2ED0 A;  4AFQ C;  4LUD A;  3THK A;  4RTU A;  1U06 A;  4RTT A;  2CUB A;  1QKX A;  1BU1 A;  3QWX X;  2O31 A;  1QKW A;  1NM7 A;  2CSI A;  3M0Q A;  3R6N A;  1ZUY A;  2GBQ A;  1WXB A;  2DL4 A;  2DA9 A;  2YUN A;  1KJW A;  1NLO C;  1PNJ A;  1X6B A;  2DLP A;  2W10 A;  2HCK A;  1RUW A;  1WX6 A;  1UUE A;  4RTX A;  3VS0 A;  2ABL A;  2L3P A;  2LX7 A;  2K79 A;  1QLY A;  3VS1 A;  4JJD A;  4J9B A;  3EG2 A;  1K4U S;  2X3X D;  3JV3 A;  1NYF A;  2LCS A;  3NPF A;  2JMC A;  1JQQ A;  2FPF A;  3PE0 A;  1TUD A;  2KRM A;  3M0S A;  1JEG A;  2PNI A;  2HEQ A;  1S1N A;  2A37 A;  1JXM A; 
#chains in the Genus database with same CATH topology
 3X20 B;  5CK9 A;  1KHC A;  2J6K A;  4PJO E;  1BCM A;  2LQW A;  4FM4 B;  3ZBD A;  1D09 B;  1JO8 A;  1Y57 A;  2DL3 A;  4M7D G;  2OJ2 A;  4WCI A;  2DE0 X;  2ZPI B;  2K3B A;  3QHS A;  4RTV A;  3CCV A;  3BW1 A;  1ABQ A;  3I55 T;  1F1B B;  1WXU A;  2QQR A;  3CCJ T;  5I11 A;  5I21 A;  5LJ5 e;  1K0X A;  1N9S A;  4N4H A;  4BI8 B;  1N8R U;  2BE9 B;  4XTU A;  4IIM A;  1ZA2 B;  1LOJ A;  1YWO A;  1SSH A;  5KCO A;  4D8D A;  4C8Q A;  3I55 A;  1SF9 A;  3PMI A;  3CCQ T;  4CC3 A;  5KYU B;  4QVZ A;  3PIO A;  1Y71 A;  1YIT T;  3VS7 A;  1X2Q A;  3HPW A;  1K8A C;  1K73 R;  1S72 T;  1OUL A;  3TSW A;  4C92 B;  4C5E A;  3OYD A;  4NOY A;  4BB7 A;  3EGX B;  1VYT A;  4NS5 A;  2DO3 A;  2VV5 A;  1RAI B;  3RKX A;  2LZ6 B;  3MET A;  4M78 A;  1M5Q 1;  1ACM B;  4CRI A;  1N9R A;  1VIF A;  2DMO A;  3T9N A;  4A4E A;  1TSF A;  1UE9 A;  3RR6 A;  4X34 A;  1FXX A;  4UC4 A;  1UGP B;  3H8Z A;  1G2B A;  1HSQ A;  3UAT A;  4VUB A;  5GAO m;  2FVU A;  2P0K A;  1Q7Y U;  2C0T A;  5GAM e;  2E5K A;  3X24 B;  2MI6 A;  4RUG A;  1UHF A;  4N0A C;  1UTI A;  2KE9 A;  1WZO A;  2L0A A;  5DM7 R;  1VQO T;  1RLQ C;  2X4J A;  2LJ1 A;  3CMA A;  1MGQ A;  2XDP A;  4KGZ B;  3IQL A;  5GMK l;  2D6F A;  2DKG A;  3M0P A;  4FSS A;  3VV0 A;  4KUL A;  3MEA A;  3M56 A;  3H0F A;  4Z02 A;  3CCS T;  2Z0W A;  2NUP A;  3RMS A;  3QG1 A;  1WHJ A;  2COY A;  5M9O A;  4O5V A;  1H8K A;  3G71 T;  1LJO A;  3OW2 P;  1XTD A;  2EKH A;  5D6W A;  2GQV A;  2R57 A;  1VQL T;  1O75 A;  1BB9 A;  3P8H A;  1D1B A;  5GJW B;  1VQ7 Q;  2K2M A;  4OF1 A;  1TU0 B;  1I5L A;  2KQW A;  2DZ9 A;  2E5Q A;  2EYW A;  1KQ2 A;  5GAM f;  1VQ8 T;  1KC8 U;  4J9D A;  5KE2 A;  1Y07 A;  2HMA A;  1K73 U;  1X43 A;  1XOV A;  2L3R A;  2M0O A;  4M77 G;  5CIU A;  2P4T A;  1QMC A;  4J6W A;  2O9S A;  1RLP C;  3X26 B;  2YRV A;  1LCK A;  1M1G A;  3JSC A;  4M77 E;  3L2V A;  3CCJ A;  2JTM A;  4XQ3 A;  1YIT A;  5KYU A;  5IN1 A;  2MWP A;  2HQX A;  1X2K A;  1VQN Q;  1M90 R;  1V29 B;  3VKI A;  1KD1 C;  1TXQ A;  5GMK j;  1VUB A;  2A3L A;  3JB9 J;  1CSK A;  2EKO A;  3QUI A;  1N5Z A;  1I5O B;  3A8L B;  1X6G A;  4HT9 A;  3S3M A;  4K11 A;  1W2B P;  4FW2 A;  3INZ A;  4ZNX A;  2L3Q A;  2YXY A;  1Y7X A;  1T0H A;  1SPK A;  2XHC A;  3G4S T;  2EJG A;  4A4G A;  3SWN A;  1M90 C;  1ZSZ B;  3CCE Q;  2C0O A;  1YJW T;  3OYB A;  2O88 A;  2E3I A;  4A53 A;  4E7S A;  3MJX A;  5D6X A;  1SHF A;  2A7Y A;  2KAF A;  1PD0 A;  3I5R A;  4MZM A;  2L3S A;  3D7S B;  1W4S A;  1WDX A;  3HTR A;  4X1V A;  1X75 C;  4XTV A;  3M0T A;  2FO0 A;  3I56 T;  2FB7 A;  5GAM d;  5EC7 A;  2X3W D;  3HKS A;  4IIO A;  1NJI C;  1UG1 A;  5GAN h;  3CCU A;  4DQ2 A;  4E7J A;  4J8O A;  4XTW A;  2J05 A;  2DRM A;  4E7I A;  2VKN A;  4LDY A;  3M0R A;  2AZV A;  4L6V 5;  2J7I A;  4C0Z A;  2D8J A;  3OYK A;  1QVF S;  2DM1 A;  2PQW A;  1SEM A;  1ABO A;  3G6E T;  1PG5 B;  2DEU A;  1RAE B;  2NYS A;  2RB6 A;  5LJ5 j;  4X9C A;  4HT8 A;  1VOM A;  4M7A A;  4N4G A;  2R58 A;  4D8K A;  1TOV A;  2RQR A;  3EGD B;  3V7R A;  2O01 E;  3OYM A;  4OMM A;  3HP9 A;  4E7H A;  2DZC A;  2EJ9 A;  4A4H A;  4HCB A;  1GL5 A;  3UDC A;  2OTL T;  2DIQ A;  1AWJ A;  2EJF A;  1G3W A;  1O9S A;  4CC4 B;  2VVK A;  1RAG B;  3S6W A;  5CKE A;  3VU3 C;  1RL2 A;  5IHK A;  2RI2 A;  2J06 A;  3LX7 A;  5FU6 C;  2LX9 A;  3G7Z A;  4OB3 B;  2F69 A;  3GNG A;  1J3T A;  4E7Z A;  2M51 A;  5CVI A;  2HL3 A;  3DB3 A;  1VYU A;  4LUE A;  4QW2 A;  4C0F A;  1VQ5 Q;  3TCJ A;  3HL8 A;  1YI2 Q;  1OX8 A;  5FLX E;  4EMK B;  3MEU A;  4RTW A;  4X9D A;  4ANJ A;  1GCQ C;  2E3H A;  2OI3 A;  2HD0 A;  3RNJ A;  2DD4 A;  4A54 A;  3E2U A;  1MUZ A;  2DYI A;  3PMT A;  3PIP A;  2CZ1 B;  2L8D A;  3OMC A;  1WLP B;  1QW1 A;  1QCO A;  1Y96 A;  3CC7 Q;  1RAF B;  4M78 E;  4J83 A;  4BE2 A;  3LLR A;  1AVZ C;  3L2Q A;  1YHQ A;  3JB9 G;  2V8I A;  1YJN T;  2QA4 T;  1RAH B;  3H9N A;  2M0Y A;  4M78 G;  1H92 A;  3UF4 A;  4J6Y A;  4HVU A;  1R8O B;  3S3O A;  2YDL A;  2W0Z A;  5FU6 B;  3G6E Q;  1PKT A;  2YWW A;  4M75 D;  4F17 A;  2KSS A;  5FRN A;  4PKC C;  2RM4 A;  4PK4 A;  3VYH B;  4LDX A;  2QQA A;  3I9Q A;  2QI2 A;  3AT1 B;  5HCK A;  5CKH A;  3QZ9 B;  1KG1 A;  3QYH B;  4C8Q D;  2F2V A;  1VQ7 T;  3EG0 A;  4ORZ A;  1QWF A;  1KSW A;  3REA B;  5IXF A;  3CMA T;  1Q82 R;  5LJ5 d;  2J6F A;  4LN2 A;  1ZLM A;  1W70 A;  3OQ5 A;  3FRN A;  4LUD A;  4M7A B;  4QKU A;  3J81 E;  2FZK B;  3M4Y A;  1M1K R;  1IRX A;  1VQM A;  1IZ6 A;  3R6N A;  1PC0 A;  3HFO A;  1KQS S;  2XKO C;  4BI3 A;  1HYO A;  4DOW A;  1VQ5 T;  1NLO C;  1OU8 A;  3QII A;  4E7L A;  2V8J A;  4NL2 A;  1OZ2 A;  1WX6 A;  1UUE A;  5GAN f;  3CCE T;  4C5I A;  3V7S A;  2BKD N;  3WVE B;  4MML A;  2QQ9 A;  4JJD A;  4BDY A;  4J9B A;  2LC4 A;  4KT0 E;  3OS5 A;  2HKN A;  2NUT B;  2LCS A;  3JCM J;  3S3N A;  1JQQ A;  1TUD A;  4FYX B;  1Q81 C;  1P92 A;  4ZGJ B;  4C0D B;  1S72 A;  5CQX A;  3M0U A;  5GAM g;  3NHN A;  3I5S A;  4EDU A;  4D6W A;  2JTF A;  1IGU A;  4J6X A;  3JB9 D;  2DAQ A;  1Q86 C;  5LJ3 h;  1TTH B;  2K9G A;  1YJ9 Q;  3KBG A;  1D0Y A;  3CC4 Q;  2DNU A;  5I22 A;  4GY5 A;  1OI1 A;  5LJ5 f;  3NTH A;  5KH6 A;  3Q1J A;  1RAA B;  1GCP A;  4LXC A;  3OYN A;  4O6J A;  4C8Q E;  5FWB A;  2KDS A;  4KGX B;  2HQH A;  1QQJ A;  2HAX A;  2DIL A;  4PNO A;  2QA4 A;  3RIR A;  4OMF B;  3OYE A;  3FIF A;  4ZN3 A;  1JU5 C;  1OPK A;  2KGT A;  4M77 C;  1G3S A;  2IVW A;  2KI7 A;  2DL7 A;  3EG9 B;  3I56 A;  1Q86 R;  2CGH A;  3EFO A;  2OTL Q;  1WFW A;  2D8H A;  1VQ9 A;  2EVR A;  1KQS A;  3NMZ C;  2VXF A;  1D3B B;  1C1A A;  1MV3 A;  2EQJ A;  3MO8 A;  5LJ3 f;  2EYY A;  5GAN 5;  1VQP T;  2D0N A;  3QJY A;  2JMA A;  3FC3 A;  1VQL A;  2K3X A;  1ZHI A;  3C0C A;  2H3E B;  4BY6 C;  4M77 D;  2YHT A;  2OX7 A;  3C95 A;  3CCE A;  3QDR B;  4M77 B;  2L2P A;  2XIC A;  4J7F A;  4HCZ A;  1FMV A;  3LW5 E;  4LD9 K;  2ZPH B;  1X69 A;  2AIR B;  3X28 B;  1Q7Y R;  4M77 F;  2XG8 D;  3L2U A;  2LT4 A;  1XQH A;  5HK0 A;  1WQW A;  2O2O A;  4FYW B;  2AT1 B;  2BUD A;  1V76 A;  4ELZ C;  1SHG A;  1IGQ A;  1QCF A;  2JNG A;  2C0I A;  5LJ3 d;  1ZUK A;  1G8X A;  2QTX A;  4LDU A;  4JS5 A;  3CCL Q;  4IUR A;  4Z88 A;  3SEM A;  5KYW A;  2DTH A;  3I55 Q;  1QVP A;  5GAN 7;  3M4G A;  5C0M A;  5GAN g;  5KYX B;  3E9F A;  3NTK A;  2ZAE A;  2RQT A;  3CPW P;  3CMA Q;  3PNW C;  3JCM e;  1QP2 A;  2JM8 A;  4JJN K;  5GAO n;  3R6O A;  1GBR A;  4ZTJ A;  1BIA A;  2QAZ A;  4J7I A;  1K76 A;  2BE7 D;  1YCY A;  1HD3 A;  1IB8 A;  4RTY A;  4PJO A;  1IHW A;  3JCM Q;  2M9U A;  2Y4X A;  1BI0 A;  4KGV B;  2CYZ B;  2RQW A;  5J3B A;  2YUP A;  1IHV A;  2ZGW A;  5J26 A;  2LJ0 A;  3EG9 A;  2COZ A;  1WGS A;  2PVO B;  3DLL A;  3O5Z A;  2PZ1 A;  2K3Y A;  2RK1 A;  2Y4Y A;  5CKF A;  3QKJ A;  3V8J A;  2SRC A;  4C92 D;  4QQG A;  2HL5 C;  1M2O A;  3VRZ A;  4AMC A;  2DEQ A;  4Z89 A;  4J9I A;  1N6A A;  3I56 Q;  3PFS A;  3M57 A;  1BCO A;  3ZFJ A;  2EYX A;  4XTY A;  4M78 C;  2ZPE B;  4PJO G;  4M77 A;  1R77 A;  4C92 F;  3CCS Q;  4KUD K;  2GFU A;  4BI4 A;  4M7D E;  5D7U A;  5CR2 A;  4RMO A;  4PJO C;  1WA7 A;  2DPP B;  2FHD A;  2BIV A;  2J6O A;  2EBP A;  2KR3 A;  4FL6 A;  1FX7 A;  2LVM A;  2CZ7 B;  3VYG A;  2B86 A;  2EGE A;  4C8Q B;  4F04 B;  1K0S A;  1AZG B;  4GLM A;  3UA6 A;  3CC7 A;  1PRL C;  3EFS A;  4AG2 C;  2FEI A;  4DA4 A;  1WHM A;  2IG0 A;  1VIE A;  3P8D A;  2FRY A;  9ATC B;  2F1L A;  3H0I A;  3CXC P;  5KYW B;  4JLI A;  4WF2 A;  3L1A A;  3LGL A;  1PWT A;  3P8B B;  1U8R A;  2RD1 A;  1YHQ T;  4EPC A;  1KC8 R;  3QWY A;  3JRZ A;  4M78 B;  1GXI E;  4AFS C;  1VQO Q;  5FW9 A;  2E12 A;  3GLX A;  2VC8 A;  3J80 E;  1UHC A;  2KYB A;  3CCU Q;  3JB9 F;  2RK2 A;  4MMK A;  3OYJ A;  2FG0 A;  5GAN j;  2JUF A;  1ZA1 B;  1MND A;  2LQN A;  4C92 E;  5GAM j;  2JS0 A;  3DKM A;  3M58 A;  4M7D F;  1EIF A;  1YJW Q;  2QGF B;  4EMG A;  2DF6 A;  3X25 B;  2E41 A;  1JBM A;  3SFM A;  2RHU A;  1M9S A;  5DY9 A;  3GPL A;  2ZPG B;  1VQM Q;  3FJ5 A;  1BKB A;  3L2R A;  1Z9Q A;  3OS2 A;  3CXC A;  3SHW A;  2P0Q A;  1T3L A;  4M7D D;  2MIO A;  2PTK A;  1BI3 A;  4BUG A;  1I07 A;  2HNI A;  4M75 E;  2K6D A;  2AK5 A;  1U5S A;  4JUV A;  1K9M R;  4M75 G;  2VUB A;  2MMP A;  4JJC A;  1UGR B;  3CBP A;  3OY9 A;  2DX1 A;  2X4W A;  1VYV A;  3OMG A;  3PGG A;  3QYG B;  4DBF A;  2VGN A;  1M30 A;  2JXB A;  3LGF A;  1MV0 B;  3G6E A;  3ME9 A;  4EMH A;  1QVG A;  1M3C A;  5CCA A;  5GAO l;  3A5Z B;  3OSV A;  1M1K C;  2MK5 A;  4A63 B;  4RCB A;  2OTL A;  4RTU A;  1U06 A;  3RES A;  2JJ9 A;  1BU1 A;  3QWX X;  2O31 A;  1EX4 A;  1NM7 A;  3MCA B;  3E9G A;  5CQY A;  4C0G A;  1ZUY A;  2K5I A;  2GBQ A;  3CME Q;  4M7A C;  1PNJ A;  3C94 A;  1X6O A;  2EYQ A;  4IUP A;  1X6B A;  2AHJ B;  5GMK m;  3L2W A;  2DLP A;  2VB6 A;  2HCK A;  5LJ3 j;  2EQU A;  4RTX A;  1VQ9 Q;  4ZN1 A;  2FYK A;  4FYY B;  3BDU A;  3VS0 A;  2ABL A;  4FT2 A;  1YFN A;  3J7A F;  5GAN 2;  2ZPB B;  3VS1 A;  3SWN B;  3EG2 A;  1K4U S;  2PUK B;  3C4S A;  4M7D B;  2WSF E;  3NPF A;  4HA8 A;  5GAO r;  2RJC A;  3QPH A;  2E64 A;  5J39 A;  3M0S A;  1JEG A;  2HEQ A;  4QQD A;  3CPW S;  2R5M A;  1K8A U;  2PVD B;  2EQM A;  4DOV A;  3JCM c;  1OZ3 A;  4GBQ A;  1OX9 A;  2OTJ T;  2QDL A;  4JPB W;  1WHL A;  3H41 A;  2A28 A;  1SRM A;  2EWN A;  2FZC B;  4KRT A;  2FL7 A;  4XTZ A;  2COW A;  4ELY C;  2I0N A;  1VA7 A;  4NL3 A;  1QWE A;  3SWN C;  3CD6 Q;  2CSQ A;  4RTZ A;  4MZP A;  2V8K A;  1FWZ A;  1VQP A;  5DLQ E;  3CC4 A;  4F14 A;  4ESR A;  2ENM A;  4C92 C;  1EFN A;  1I81 A;  3JCM g;  3OYI A;  2LP5 A;  3E1S A;  3OS1 A;  5GJV B;  4XK8 E;  2FPD A;  4ME7 A;  4FYV B;  2DFU A;  4JDS A;  3FDR A;  3A8M B;  2KRS A;  3CEY A;  5HK3 A;  2HKQ B;  4JZ3 A;  2LJ3 A;  2CP2 A;  1MMD A;  5L8R E;  4GLK A;  4XU2 A;  5I2M A;  1ZQ1 A;  4IUT A;  1JJ2 A;  4N0A A;  5IHI A;  2ZCF B;  3G71 A;  1Q95 G;  4M75 C;  1QCN A;  3OYC A;  4JRQ A;  2BZY A;  3L2Z A;  4R55 A;  4OMO A;  1W2B S;  2DXC A;  2E10 A;  3QDF A;  4IUV A;  1RAB B;  3FJP A;  5ECA A;  4ATO A;  3RKY A;  4AG1 C;  1PRM C;  1UDL A;  4JZ4 A;  1IO6 A;  2ECZ A;  2HQE A;  2RJD A;  4EMK A;  4IKF A;  2LCL A;  1I0C A;  3OS0 A;  2RQU A;  2XDD A;  2MAM A;  2DJQ A;  1K73 C;  3A8G B;  2NUZ A;  2EGA A;  1RI9 A;  2CH4 W;  1U3O A;  3CC7 T;  1M3B A;  4OMP A;  2QDY B;  2K2V A;  4M7D A;  2QAS A;  1Y96 B;  4KUI A;  4QVC A;  4Z8A A;  5A0G A;  4JRP A;  5FRM A;  1OOT A;  3NFC A;  2EW3 A;  3VS4 A;  2LNH B;  3E19 A;  2EFI A;  3MPU B;  4OB2 B;  2ROT A;  1C0M A;  3OBW A;  3OYF A;  3URG A;  4RG2 A;  2Y90 A;  4HXJ A;  4M7A G;  1QP3 A;  4B6M A;  4RKU E;  3GOX A;  2QK0 A;  3OA6 A;  3G4S A;  1B7T A;  2K57 A;  4M78 F;  1NPP A;  1PM3 A;  3ZEH A;  3OBY A;  2NLU A;  2OTJ A;  2GNC A;  1W2B A;  4MDX A;  2OAW A;  4MDW A;  3NTI A;  1TUG B;  5EG2 A;  1WPY A;  3EGU A;  3VS3 A;  5IH2 A;  1LPL A;  5KYY B;  1QVG P;  1AZE A;  4OMN A;  1YWP A;  2HDA A;  3BY7 A;  2KXD A;  3N5B B;  4M75 A;  1A0N B;  4IUQ A;  1Y0M A;  2CDT A;  5DLO A;  3PTA A;  2KRO A;  3CCM Q;  4PFP A;  4Q5W A;  1M4Z A;  2E4H A;  1YP5 A;  1M1F A;  2QTV A;  3SB2 A;  1UGQ B;  4F7U A;  2PVG B;  3JB9 I;  3OSS C;  2JM9 A;  4PLL A;  2X4X A;  3F70 A;  2DD5 A;  5KYN A;  2JZ2 A;  1KC8 C;  2CH4 A;  2E6Z A;  4M75 F;  4YTL A;  4JRI A;  3TEE A;  4QT7 A;  3M9Q A;  1NEB A;  2RJE A;  4HVW A;  3QBY A;  3EH2 A;  2MOX A;  1B34 A;  1JRI A;  3CQT A;  2HBW A;  2F2W A;  2NUT A;  1YJ9 T;  1KFZ A;  2GTO A;  1YCS B;  4ZGE B;  1KD1 U;  3LH5 A;  3UPU A;  2M02 A;  3JB9 H;  3VS2 A;  1KHI A;  3TSZ A;  2AKL A;  2BTT A;  5GMK h;  1YI2 A;  1GRI A;  1HJD A;  4A4F A;  5GMK e;  2H3J A;  1YJN Q;  1ZBX A;  1TUC A;  4FW1 A;  4RCC A;  2EPD A;  3A98 A;  3KXT A;  1TWB A;  4B9W A;  1M90 U;  2QEX A;  2DVJ A;  2GTJ A;  2GCX A;  2V1Q A;  3JCM V;  2JT4 A;  5LJ3 e;  4BE0 A;  5FRO A;  1WJR A;  5FWC A;  2RI3 A;  4LE9 A;  1AOJ A;  1WHG A;  3M55 A;  4L59 A;  2JTE A;  2SEM A;  3EGX A;  3OYH A;  2CP6 A;  2ED1 A;  3CCL T;  1T3S A;  2MPX C;  5GAN d;  5GMK i;  4WTO B;  1JJ2 S;  2ZZD A;  1Q82 C;  3LH0 A;  3M54 A;  3JCM d;  1W1F A;  1AT1 B;  2CS7 A;  2EQK A;  4FSX A;  3KFV A;  3A8O B;  1OV3 A;  1S72 Q;  1CKA A;  1SSF A;  4DBH A;  3JCM X;  3OYG A;  2VAS A;  2LCC A;  4XTX A;  5LJ3 g;  3I35 A;  3G4S Q;  4R0K A;  4A4K A;  3RER A;  4N4I A;  1AWW A;  3C12 A;  3L42 A;  2X9H A;  4LDW A;  4CI0 C;  3VS6 A;  2CKK A;  4M75 B;  2QG9 B;  1WQ7 A;  1D3B A;  1NG2 A;  3FB9 A;  1PSF A;  2V26 A;  1RAD B;  3CC2 T;  1E7O A;  1D0X A;  1VQO A;  4XU3 A;  1K9M C;  3JCM P;  3RKW A;  1H64 1;  2QEX Q;  2KBT A;  5I2S A;  2BZ8 A;  4BE1 A;  3CBO A;  3GF5 A;  1WXT A;  5CO7 A;  4CC7 A;  2GGR A;  3EG1 A;  3REB B;  4OB1 B;  3H6Z A;  1WJQ A;  4PLI A;  1WHH A;  4FIB A;  3V7C A;  3BDL A;  4M4Z A;  3JCM f;  2V1R A;  1SRL A;  3TVT A;  1B34 B;  2QQS A;  4ZGD B;  5GAO p;  1YIJ Q;  3EHQ A;  3CXC S;  3ASK A;  4JRK A;  3ULR B;  3A1P A;  1UGS B;  1G5V A;  3VUZ A;  2MWO A;  1UB4 A;  1VQ8 A;  3G71 Q;  3VJP A;  4EIK A;  4C5H A;  1UEB A;  3AHU A;  3OB9 A;  2D0Q B;  3MP1 A;  2X35 A;  1VQL Q;  5FU7 C;  2DL5 A;  4OP0 A;  2EGC A;  2YSQ A;  5GAN 6;  1VQK Q;  2KEA A;  1PSE A;  3CCV Q;  5GAN 4;  4AFQ C;  5KYX A;  2ED0 A;  4JLG A;  1YJN A;  1WJS A;  2CP3 A;  3MEV A;  2ZPF B;  1KK7 A;  1QKW A;  3CD6 A;  2DL4 A;  3QXE B;  3M5A A;  4F7U F;  2DA9 A;  1KJW A;  4PJO F;  1QVG S;  2ATC B;  2XI9 A;  1ZSZ A;  5AT1 B;  3CC2 Q;  4KH0 B;  2W10 A;  1TH7 A;  3OYA A;  4M7A F;  4PJO B;  2YRD A;  2L3P A;  2VGM A;  1QLY A;  4DBR A;  5CKD A;  3BE3 A;  3JV3 A;  3MEW A;  1VQ6 Q;  4AT1 B;  1NYF A;  2JMC A;  2CZ6 B;  2VXE A;  3EAE A;  3G1J A;  4OB0 B;  2HBP A;  4JS4 A;  2DIG A;  2KRM A;  2PNI A;  2RA2 A;  3CCS A;  4C8Q C;  2KY9 A;  1K9A A;  3SDZ A;  4AFZ C;  2RO0 A;  2K5L A;  2KNB B;  2OTJ Q;  2JS2 A;  4E6R A;  3ER0 A;  2KYM A;  2H8H A;  2DER A;  1GCQ A;  2F5K A;  1VQM T;  4V2S A;  4PJM A;  3EFR A;  4LD6 A;  1GFC A;  2GFA A;  3RUX A;  1MNE A;  2O4X B;  2EQI A;  1YBY A;  4HCK A;  3CCJ Q;  1AWO A;  4OGC A;  3H0H A;  4XU0 A;  2VWF A;  1VQ4 A;  1KIK A;  1WIE A;  1ZSZ C;  2XU8 A;  2RHZ A;  4J9C A;  4E2F B;  3O8V A;  2K7A A;  2DRK A;  1Z9Z A;  1N8R C;  4F7U G;  1K1Z A;  1V1C A;  3CCQ Q;  5GAN e;  3EGD A;  1MMA A;  1IXD A;  2CUD A;  2YRC A;  4FCY A;  4F7U E;  4DEY A;  1MMN A;  5CKB A;  1Q81 U;  3CME T;  4JJB A;  1OYX A;  1YHQ Q;  2XMF A;  3HRS A;  1T0J A;  4E7K A;  3OW2 S;  5IHN A;  3OYL A;  1BI2 A;  3MP6 A;  2AKK A;  4Y91 A;  2AZS A;  3CCM A;  2L5Q A;  3DLM A;  1HK9 A;  1X01 A;  1NJI U;  8AT1 B;  1GBQ A;  2LQK A;  3EHR A;  3QZ5 B;  4PJO D;  2R5A A;  1SKU B;  2RN8 A;  1LNX A;  2MYS A;  2JVV A;  1E6H A;  2QYZ A;  4AFU C;  4IUU A;  1Q7Y C;  4XU1 A;  2DXT A;  2LNV A;  3WVD B;  4OML A;  1PD1 A;  1RI0 A;  3TU4 K;  1XJW B;  2RHX A;  5CAI A;  1QVF A;  4J9G A;  4C92 G;  1NJI R;  5GAO q;  5GAN 3;  4XAX B;  1PKS A;  3CD6 T;  1OU9 A;  1BK2 A;  2CT3 A;  1WYX A;  1ZBJ A;  1KQ1 A;  1R0C B;  1B3Q A;  2RNA A;  4QVD A;  2G6F X;  4J9H A;  5A0L A;  2FRW A;  1M2V B;  2X4Y A;  3HSB A;  3GBQ A;  4EMK C;  1KQS P;  2ESW A;  2KRN A;  3UT1 A;  3TRE A;  2CZ0 B;  3V8L A;  4KH1 B;  3FEO A;  2E65 A;  2O4X A;  2WAC A;  2KK4 A;  1NPR A;  4QQ6 A;  3CCR T;  2YLB A;  1D1C A;  1BYM A;  1M8V A;  1OQK A;  4LNP A;  4E47 A;  4HVV A;  3RBB B;  1AD5 A;  2WSC E;  1WHK A;  1GFD A;  4BD3 A;  5AYF A;  2P0P A;  1H3Z A;  3VS5 A;  1XNI A;  1AHJ B;  2DL8 A;  1I8F A;  2F2X A;  5GAM h;  2LRQ A;  1K8A R;  1BBZ A;  1NLP C;  1M3A A;  3UA7 A;  2ROL A;  1VQ4 Q;  1E6G A;  1N27 A;  4B9X A;  7AT1 B;  2RJF A;  5A0D A;  4C8Q F;  2FZG B;  2CP7 A;  1ZUU A;  2GF7 A;  1PCX A;  4PJJ A;  2YT6 A;  1YI2 T;  3CCM T;  1VQN A;  3CCQ A;  1UEC A;  1OEB A;  2PU9 B;  1IRE B;  5L23 A;  1WI7 A;  3MKD A;  2IIM A;  2QXF A;  3GNF B;  1D1A A;  1G83 A;  2O9V A;  2XID A;  1FMW A;  2DBM A;  2BZX A;  2QEX T;  4J9F A;  1X27 A;  2QA4 Q;  2F5T X;  2E1H A;  3A8H B;  1BIB A;  4RG8 A;  4J9E A;  2DXU A;  1WNL A;  2RHI A;  3WXM B;  4PL6 A;  5A2Q E;  4DBQ A;  2P4R A;  3ZL7 C;  1I1J A;  2OAU A;  2DXB A;  5LJ5 g;  2MF2 A;  3RDV A;  1CKB A;  1UJ0 A;  3JCM W;  1KD1 R;  4L5G A;  2CT4 A;  2XK0 A;  2KMT A;  1AEY A;  2CP5 A;  2K4Y A;  2DK3 A;  4P5N A;  2DYB A;  4PFO A;  2LMJ A;  1FMK A;  1C6V X;  4FU6 A;  3MP8 A;  3QO3 A;  2I2L A;  2C06 A;  2KVQ G;  1H3H A;  2GQI A;  3VRY A;  5KE3 A;  8ATC B;  2KT8 A;  2KT1 A;  2RH2 A;  2CP0 A;  3GIB A;  3QJ6 A;  4C8Q G;  3DB4 A;  1UJY A;  2A0F B;  3FLG A;  1YJW A;  4Y92 A;  1QVF P;  2NWM A;  2M16 A;  1M8M A;  3M59 A;  3VUB A;  1BI1 A;  1M2V A;  2YUQ A;  1G3Y A;  3CC4 T;  3HRU A;  1NZ9 A;  1HXD A;  4OMQ A;  1YIT Q;  4HCC A;  1VQ8 Q;  4HKE A;  4M7A D;  1MHN A;  3BFM A;  1Q82 U;  2E6N A;  3M53 A;  1UGV A;  2LT1 A;  2HZY A;  3GP8 A;  2RMO A;  4KBM B;  2JW4 A;  3CCU T;  3QSU A;  1YIJ A;  3U23 A;  4PFZ A;  1VQK A;  1JB0 E;  1UFF A;  2JN0 A;  3EFO B;  1PHT A;  1VQ5 A;  4ZTF A;  1LVK A;  2HSP A;  1ZSG A;  2QQB A;  3EG3 A;  2RHY A;  3CCR A;  2RQV A;  4BAC A;  1Q86 U;  1AWX A;  3UWN A;  4BDZ A;  3SD4 A;  1VQK T;  2LQ8 A;  4CC2 A;  1K9M U;  2PUO B;  2DVE A;  2RI5 A;  3V8K A;  1YNZ A;  3CCV T;  2A36 A;  1VQN T;  1R0B G;  3KUF A;  5C6S A;  2EIF A;  2YLC A;  2FPE A;  3JCM h;  2WSE E;  1M27 C;  1W6X A;  3CBM A;  4F16 A;  3LWH A;  1NEG A;  2DBK A;  1OPL A;  1SG5 A;  2VYT A;  2EYZ A;  3CPF A;  3LYI A;  1G3T A;  3CME A;  1B07 A;  5D6Y A;  2KXC A;  2A08 A;  2XDB A;  1YJ9 A;  1DJ7 B;  4Y28 E;  2XD0 A;  1U1S A;  4C5G A;  2QGG A;  2EAY A;  3MHX A;  4M78 D;  1N8R R;  1JJ2 P;  2YUO A;  1D0Z A;  4II1 A;  2RF0 A;  1NE8 A;  1NYG A;  4PJN A;  2IPO B;  1ARK A;  2LTO A;  4BY6 B;  2L89 A;  4OVA A;  3LWI A;  1TS9 A;  3RMQ A;  2D1X A;  4R56 A;  4C92 A;  3NGP A;  5IT9 E;  5KCH A;  5GAN 8;  1EZZ B;  2JOY A;  1ZX6 A;  3EH1 A;  3PVQ A;  3CCR Q;  3PVL A;  2K5F A;  4M7A E;  1I4K 1;  1YN8 A;  2X51 A;  1JXO A;  2P84 A;  2D9T A;  1FYN A;  2M1H A;  4J5Y A;  2DTO A;  3PT9 A;  4MZT A;  4DEX A;  5IXB A;  2RPN A;  2DJZ A;  5LL6 S;  1TG0 A;  4TVR A;  3TQ7 P;  3CCL A;  2MCN A;  3OYY A;  2CRE A;  4LDV A;  5HKC A;  2DET A;  5FU7 B;  2B8A A;  1RAC B;  3THK A;  3JCM b;  4RTT A;  1Q81 R;  2CUB A;  1QKX A;  5IAY A;  1VQ9 T;  3M0Q A;  2CSI A;  5KYY A;  1WXB A;  5HY6 A;  1VQP Q;  2YUN A;  3HRT A;  6AT1 B;  4OGE A;  3HHT B;  1VQ4 T;  1VQ6 A;  1RUW A;  4FT4 A;  5LJ5 h;  2HSE B;  3OW2 A;  2LDM A;  1U1T A;  4F7U B;  3HFN A;  2LX7 A;  2K79 A;  3CPW A;  4C0D C;  1VQ7 A;  2DTI A;  3CC2 A;  1YIJ T;  2X3X D;  2NUP B;  1VQ6 T;  1NBE B;  4PJL A;  1MMG A;  3JAM E;  1M1K U;  2G3R A;  2FPF A;  3PE0 A;  1S1N A;  2A37 A;  2E70 A;  4M7D C;  1JXM A; 
#chains in the Genus database with same CATH homology
 1K9A A;  3M0U A;  2J6K A;  4AFZ C;  2KNB B;  4GBQ A;  3NHN A;  2LQW A;  2JS2 A;  3I5S A;  4E6R A;  2QDL A;  2KYM A;  1JO8 A;  1Y57 A;  2DL3 A;  2H8H A;  2OJ2 A;  4WCI A;  1GCQ A;  2DE0 X;  4JPB W;  2K3B A;  3H41 A;  1GFC A;  2A28 A;  4RTV A;  1SRM A;  1ABQ A;  2EQI A;  1WXU A;  4HCK A;  1AWO A;  4KRT A;  3H0H A;  2K9G A;  2VWF A;  5I11 A;  1KIK A;  1WIE A;  1K0X A;  4J9C A;  2DNU A;  2I0N A;  1VA7 A;  2K7A A;  2DRK A;  4IIM A;  5I22 A;  1QWE A;  1Z9Z A;  1YWO A;  1SSH A;  1GCP A;  2CSQ A;  4RTZ A;  4D8D A;  1K1Z A;  1V1C A;  5FWB A;  4CC3 A;  4F14 A;  4ESR A;  2CUD A;  2ENM A;  2DIL A;  1EFN A;  4DEY A;  2LP5 A;  3VS7 A;  1X2Q A;  4JJB A;  5GJV B;  2FPD A;  3TSW A;  2XMF A;  1VYT A;  1T0J A;  2LZ6 B;  2KRS A;  5IHN A;  1JU5 C;  1OPK A;  2KGT A;  4JZ3 A;  2AKK A;  2LJ3 A;  2AZS A;  2DMO A;  1UE9 A;  2DL7 A;  1GBQ A;  3EHR A;  5IHI A;  1WFW A;  2D8H A;  1G2B A;  2EVR A;  2RN8 A;  3NMZ C;  1HSQ A;  3UAT A;  1E6H A;  1MV3 A;  2BZY A;  2EYY A;  4AFU C;  2C0T A;  4OMO A;  2E5K A;  2D0N A;  2JMA A;  4RUG A;  1UHF A;  1UTI A;  2KE9 A;  2L0A A;  5ECA A;  3C0C A;  1RLQ C;  4OML A;  4AG1 C;  1PRM C;  1UDL A;  4JZ4 A;  1IO6 A;  2ECZ A;  2LJ1 A;  1I0C A;  2RQU A;  4J9G A;  2DJQ A;  2L2P A;  3IQL A;  3M0P A;  4FSS A;  2NUZ A;  2EGA A;  1PKS A;  1RI9 A;  2CH4 W;  1U3O A;  1X69 A;  1BK2 A;  1M3B A;  2CT3 A;  4OMP A;  1WYX A;  3H0F A;  1ZBJ A;  1B3Q A;  2RNA A;  4Z8A A;  2G6F X;  4J9H A;  2FRW A;  2O2O A;  1OOT A;  1H8K A;  2EW3 A;  3VS4 A;  2LNH B;  2EKH A;  3GBQ A;  1SHG A;  2ESW A;  2ROT A;  2KRN A;  1QCF A;  4HXJ A;  1BB9 A;  2C0I A;  5GJW B;  1ZUK A;  2K2M A;  2EYW A;  4Z88 A;  4J9D A;  3SEM A;  1X43 A;  1XOV A;  4LNP A;  2GNC A;  2OAW A;  4HVV A;  2O9S A;  3RBB B;  1AD5 A;  1RLP C;  1GFD A;  2RQT A;  1LCK A;  3VS5 A;  2DL8 A;  3EGU A;  3VS3 A;  2F2X A;  5IH2 A;  1X2K A;  1BBZ A;  1NLP C;  1M3A A;  2JM8 A;  2ROL A;  3UA7 A;  1AZE A;  1YWP A;  1E6G A;  2HDA A;  4OMN A;  2KXD A;  1A0N B;  1Y0M A;  1GBR A;  1CSK A;  2CDT A;  1N5Z A;  1X6G A;  1ZUU A;  1K76 A;  2KRO A;  1HD3 A;  4K11 A;  2YT6 A;  1YP5 A;  4ZNX A;  4RTY A;  1UEC A;  2L3Q A;  1OEB A;  5L23 A;  1T0H A;  1SPK A;  1WI7 A;  2JM9 A;  2IIM A;  2RQW A;  2YUP A;  1G83 A;  2O9V A;  2CH4 A;  2LJ0 A;  2C0O A;  2BZX A;  2DBM A;  4J9F A;  1X27 A;  2O88 A;  3O5Z A;  4J9E A;  2PZ1 A;  4QT7 A;  1NEB A;  2P4R A;  4HVW A;  3ZL7 C;  1I1J A;  1SHF A;  2MOX A;  2SRC A;  1CKB A;  3I5R A;  1UJ0 A;  3VRZ A;  3CQT A;  2L3S A;  2HBW A;  2CT4 A;  2F2W A;  1WDX A;  4X1V A;  1KFZ A;  2GTO A;  1YCS B;  1AEY A;  3M0T A;  2FO0 A;  4Z89 A;  4J9I A;  3LH5 A;  5EC7 A;  2X3W D;  4IIO A;  3VS2 A;  1UG1 A;  2DYB A;  2EYX A;  2LMJ A;  1FMK A;  3TSZ A;  2AKL A;  2BTT A;  1GRI A;  1HJD A;  2J05 A;  2DRM A;  1H3H A;  2GQI A;  2VKN A;  3VRY A;  1TUC A;  3M0R A;  1WA7 A;  2AZV A;  2KT1 A;  2KT8 A;  2J7I A;  2EPD A;  3A98 A;  1UJY A;  2D8J A;  4Y92 A;  2DVJ A;  2GTJ A;  2J6O A;  2DM1 A;  1SEM A;  2V1Q A;  2NWM A;  2EBP A;  2KR3 A;  2JT4 A;  1ABO A;  1M8M A;  2YUQ A;  2B86 A;  2EGE A;  5FWC A;  4LE9 A;  1AOJ A;  1K0S A;  1AZG B;  4GLM A;  3UA6 A;  4D8K A;  4OMQ A;  2JTE A;  2SEM A;  2RQR A;  2ED1 A;  1PRL C;  4AG2 C;  1T3S A;  2FEI A;  4OMM A;  1UGV A;  1GL5 A;  1AWJ A;  2FRY A;  2RMO A;  3H0I A;  2JW4 A;  4CC4 B;  2VVK A;  3U23 A;  1W1F A;  1UFF A;  3KFV A;  1PHT A;  1OV3 A;  1PWT A;  5IHK A;  2HSP A;  1CKA A;  2J06 A;  3QWY A;  1ZSG A;  3EG3 A;  4AFS C;  3I35 A;  5FW9 A;  2RQV A;  1J3T A;  4R0K A;  1AWX A;  1UHC A;  2KYB A;  2M51 A;  1AWW A;  1VYU A;  4LUE A;  3VS6 A;  2FG0 A;  4CC2 A;  1YNZ A;  2A36 A;  1NG2 A;  4RTW A;  2LQN A;  1E7O A;  1GCQ C;  2JS0 A;  2DF6 A;  2FPE A;  2KBT A;  2BZ8 A;  2OI3 A;  3RNJ A;  1M27 C;  1MUZ A;  1W6X A;  4F16 A;  1NEG A;  1WXT A;  2DBK A;  4CC7 A;  1WLP B;  1OPL A;  3FJ5 A;  2GGR A;  2EYZ A;  1Z9Q A;  3EG1 A;  3REB B;  1B07 A;  2KXC A;  3SHW A;  2A08 A;  1AVZ C;  1T3L A;  2MIO A;  2PTK A;  4M4Z A;  2V1R A;  1SRL A;  3TVT A;  2M0Y A;  1H92 A;  1I07 A;  3UF4 A;  4HVU A;  3EHQ A;  2YUO A;  2K6D A;  2AK5 A;  1U5S A;  2RF0 A;  1NYG A;  2YDL A;  2W0Z A;  1ARK A;  3ULR B;  1PKT A;  4F17 A;  4JJC A;  2D1X A;  3NGP A;  2DX1 A;  1VYV A;  1ZX6 A;  4EIK A;  3PVQ A;  3I9Q A;  3PVL A;  5HCK A;  1YN8 A;  1M30 A;  2JXB A;  1JXO A;  1MV0 B;  1FYN A;  4DEX A;  5IXB A;  2F2V A;  2RPN A;  2DL5 A;  2EGC A;  2YSQ A;  1TG0 A;  2KEA A;  3EG0 A;  4ORZ A;  1M3C A;  1QWF A;  1KSW A;  3REA B;  5IXF A;  2MCN A;  2J6F A;  4LN2 A;  1ZLM A;  2CRE A;  1W70 A;  4A63 B;  2ED0 A;  4AFQ C;  4LUD A;  3THK A;  4RTU A;  1U06 A;  4RTT A;  2CUB A;  1QKX A;  1BU1 A;  3QWX X;  2O31 A;  1QKW A;  1NM7 A;  2CSI A;  3M0Q A;  3R6N A;  1ZUY A;  2GBQ A;  1WXB A;  2DL4 A;  2DA9 A;  2YUN A;  1KJW A;  1NLO C;  1PNJ A;  1X6B A;  2DLP A;  2W10 A;  2HCK A;  1RUW A;  1WX6 A;  1UUE A;  4RTX A;  3VS0 A;  2ABL A;  2L3P A;  2LX7 A;  2K79 A;  1QLY A;  3VS1 A;  4JJD A;  4J9B A;  3EG2 A;  1K4U S;  2X3X D;  3JV3 A;  1NYF A;  2LCS A;  3NPF A;  2JMC A;  1JQQ A;  2FPF A;  3PE0 A;  1TUD A;  2KRM A;  3M0S A;  1JEG A;  2PNI A;  2HEQ A;  1S1N A;  2A37 A;  1JXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...