2FRYA

Solution structure of the third sh3 domain of human nck2 adaptor protein
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
61
structure length
61
Chain Sequence
b'GSHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK2
molecule tags Protein binding
source organism Homo sapiens
publication title Structural Insight into the Binding Diversity between the Human Nck2 SH3 Domains and Proline-Rich Proteins
pubmed doi rcsb
total genus 3
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fryA00
2PZ1A 1JXOA 2EYWA 1HD3A 2KGTA 2ROTA 2JS2A 2CSIA 1WYXA 2FPFA 2AKKA 1UDLA 2D8HA 2MOXA 4CC7A 2X3XD 2JMAA 1JU5C 2NWMA 2CUDA 2D1XA 2KR3A 2EYZA 1WA7A 2QDLA 1X2KA 3VS6A 1PRMC 2YUOA 2RQWA 2DBKA 1JXMA 2EYYA 3M0TA 1SHFA 2J6KA 1ZUYA 4X1VA 3I5SA 2EGCA 1EFNA 4DEXA 2O88A 1UFFA 1CKAA 3H0FA 4R0KA 2KE9A 2DX1A 2F2XA 4OMMA 2H8HA 2YSQA 2ECZA 1NYFA 4AG2C 2CREA 2CT3A 2O31A 1ABQA 4RTUA 2KNBB 2FRYA 2O9VA 1U06A 2SEMA 2LNHB 4D8KA 2B86A 1QWEA 2KEAA 2DILA 2FO0A 5ECAA 4RTVA 1AZEA 2BZYA 1QWFA 1OPLA 5FWBA 1AWWA 1S1NA 1ZUKA 1MV0B 2E5KA 1GCPA 3CQTA 4A63B 3ZL7C 1NG2A 1VYUA 3EG2A 4J9IA 2J6FA 1FYNA 2P4RA 1V1CA 1OOTA 2RQRA 2LZ6B 4J9CA 2VWFA 1Z9QA 1RLQC 1B3QA 1E6HA 1YP5A 4AFQC 3M0SA 1M27C 1TUDA 2KYMA 1PKTA 3QWYA 3JV3A 4D8DA 2JTEA 2D0NA 4F14A 4CC2A 1JO8A 2D8JA 1ZSGA 4GLMA 1K1ZA 1WIEA 5IXFA 2FEIA 1T3LA 3TSWA 1HJDA 2O9SA 3RBBB 2YUQA 1RLPC 3A98A 3VS4A 4Z8AA 4RUGA 4LE9A 1X27A 2OJ2A 1SHGA 1AD5A 1H8KA 1YWOA 2RQTA 4OMPA 1VA7A 2L3QA 2DM1A 1W6XA 3M0PA 2KROA 1I1JA 4CC3A 1N5ZA 3M0RA 2EKHA 2YUPA 1WXBA 2LMJA 1AVZC 4JJCA 4AFZC 2DL7A 2KRSA 1ZBJA 2VVKA 1X69A 3UF4A 2DL4A 3M0UA 2BZXA 2RF0A 4HVVA 4JPBW 5FW9A 1VYVA 3NGPA 2A37A 2SRCA 5L23A 3VS1A 4DEYA 1M3AA 4JZ4A 1SSHA 1E7OA 1M3BA 2AZVA 2L2PA 3PVLA 2EQIA 2EPDA 1UJYA 4LN2A 1QKWA 2KT1A 1SRMA 2LQWA 4OMLA 1X6GA 2MIOA 2DBMA 2DL8A 2DL3A 4Z89A 1HSQA 2DNUA 1Y0MA 3PE0A 5IXBA 2GTOA 1MUZA 2KBTA 1AEYA 2PNIA 1XOVA 3TSZA 1J3TA 3EG3A 2AKLA 1UTIA 1ZX6A 2XMFA 2K2MA 1M8MA 5FWCA 2LJ1A 2DRKA 2RNAA 3REBB 1G2BA 2JT4A 4E6RA 1LCKA 1UHFA 1W1FA 1QLYA 3GBQA 2CUBA 3SHWA 2HDAA 4J9BA 1NEGA 4CC4B 3U23A 1GL5A 3IQLA 4IIOA 1UJ0A 5IH2A 1B07A 3R6NA 3EGUA 3QWXX 2JW4A 1YN8A 4J9HA 2RQVA 1GFDA 1WX6A 1NEBA 2L3SA 2W0ZA 2GTJA 4J9EA 1QKXA 2DE0X 2F2WA 4Y92A 1AWJA 2V1RA 1K4US 1H3HA 1WFWA 2DF6A 2MCNA 4Z88A 1NYGA 2CT4A 2ROLA 2LJ0A 1T0HA 4J9GA 1NLOC 2LQNA 1UG1A 1PKSA 1TG0A 3VRYA 5I11A 2A28A 1RI9A 1TUCA 2J6OA 2I0NA 1T0JA 2LJ3A 3VS2A 2YUNA 5EC7A 3UA6A 4AFSC 2AZSA 2ED1A 2DMOA 1W70A 1X2QA 1WXTA 1FMKA 2FPEA 1KSWA 1MV3A 3O5ZA 3VS3A 2EYXA 2KRNA 2G6FX 5I22A 3EHRA 4F17A 4LUEA 4HVUA 1BU1A 3I35A 1I07A 3UA7A 2LX7A 1KFZA 4J9DA 3VS7A 1GFCA 2J7IA 1VYTA 2EBPA 1IO6A 4JJDA 3ULRB 3EG0A 2KRMA 4FSSA 2GBQA 1KJWA 2CH4W 1Z9ZA 2RQUA 5IHKA 1WI7A 5IHNA 4K11A 2OI3A 1ABOA 2OAWA 2JXBA 2C0IA 3I5RA 2A36A 2M0YA 2K79A 1PWTA 1GBRA 2DVJA 3EHQA 2IIMA 2JM9A 5GJVB 2DLPA 2K7AA 3VRZA 1X6BA 1CSKA 1YCSB 2K3BA 2C0TA 4RTZA 4AG1C 2J06A 4QT7A 2GNCA 2EGEA 2EGAA 4AFUC 2DL5A 1U3OA 3LH5A 1BBZA 1YWPA 4WCIA 2FRWA 3H41A 3THKA 1NLPC 5IHIA 1I0CA 2AK5A 1SRLA 2FPDA 1NM7A 1QCFA 2KXCA 1PRLC 2RMOA 3KFVA 1X43A 4EIKA 2L0AA 1AWOA 1PNJA 2YT6A 1UUEA 1U5SA 2RPNA 1E6GA 4ZNXA 2K6DA 2PTKA 1M3CA 2YDLA 2HSPA 2ABLA 2HEQA 2JS0A 2V1QA 1WDXA 1K9AA 1ZUUA 4RTWA 3I9QA 2LCSA 1GRIA 2F2VA 1WLPB 3NHNA 3NMZC 2O2OA 3SEMA 4IIMA 2ESWA 3NPFA 3UATA 3REAB 2DJQA 3M0QA 2EVRA 2L3PA 5GJWB 1PHTA 1SEMA 2X3WD 1JEGA 1UE9A 4LUDA 3VS5A 2GGRA 5HCKA 1T3SA 2RN8A 1SPKA 3VS0A 3FJ5A 1BK2A 1Y57A 3H0IA 4JJBA 1AOJA 1OPKA 2DRMA 1K76A 2LP5A 3C0CA 4OMNA 4GBQA 4ORZA 1CKBA 2CSQA 2ED0A 2NUZA 3PVQA 1BB9A 1H92A 1GCQC 1M30A 1JQQA 1GCQA 4RTYA 4M4ZA 4HCKA 4HXJA 4OMQA 2FG0A 2JM8A 1G83A 1K0SA 1WXUA 3RNJA 4LNPA 1K0XA 2VKNA 2KXDA 3EG1A 2DA9A 1AZGB 1RUWA 2M51A 2BTTA 2HBWA 2EW3A 3TVTA 2K9GA 2KYBA 1OEBA 4RTXA 1ARKA 1UGVA 2C0OA 3H0HA 1ZLMA 4RTTA 2BZ8A 1AWXA 4ESRA 2JMCA 1UHCA 1UECA 2GQIA 2J05A 1YNZA 4F16A 2ENMA 1A0NB 2W10A 4HVWA 2CDTA 1GBQA 4JZ3A 4OMOA 4KRTA 1OV3A 2CH4A 4J9FA 2A08A 2DYBA 2HCKA 2KT8A 1KIKA
chains in the Genus database with same CATH superfamily
1YCYA 2FL7A 2EKOA 3CCSA 1B7TA 1HD3A 3M54A 5CK9A 1YIJT 2PQWA 2QQ9A 1LVKA 3LW5E 3HHTB 3Q1JA 2MWPA 1RAEB 1WHLA 2D1XA 2QDLA 1X2KA 2YUOA 5D6YA 2CKKA 2QA4T 4OB0B 4MDWA 1JXMA 3CCVQ 4X34A 1VQNT 4PLIA 1D09B 2F1LA 4M78G 2K5IA 1JJ2S 2O88A 2LQ8A 4R0KA 2KE9A 3VV0A 1IB8A 3E9FA 3OYDA 3M4GA 2MPXC 4NOYA 1NYFA 3E19A 3MPUB 4R56A 1ZA2B 1K73U 4RTUA 4M7AF 2FRYA 2O9VA 2BE7D 4UC4A 2KEAA 2MWOA 3CCJA 5GAMe 5ECAA 4RTVA 1YITQ 2YRDA 2NUPA 3CBMA 2DYIA 5FWBA 1D3BA 3PFSA 1VQ7A 2O01E 4EMKB 1BI0A 4Y28E 1K8AR 3G4SA 2J6FA 1YIJA 1V1CA 2RJDA 2RQRA 3RMQA 2L3RA 3BDLA 5I21A 2RJFA 1Z9QA 1B3QA 4AFQC 1TUDA 2DJZA 4PK4A 3RKWA 2DXBA 2FB7A 2JTEA 4BY6B 4F14A 2DEUA 1JO8A 2JN0A 5CKEA 4PJNA 3S3OA 2O9SA 2JUFA 1TH7A 3EAEA 4LE9A 1X27A 3NTKA 1AD5A 1QVGA 1W6XA 1VQ7T 3FIFA 4FYXB 4ZGEB 2MYSA 1V29B 2DL7A 3L42A 2LVMA 1O75A 2MK5A 3UF4A 2DL4A 3CC4A 4N4GA 2RF0A 4HVVA 2JOYA 2PUOB 5FW9A 3AHUA 2F69A 2CS7A 3VS1A 1E7OA 2RH2A 2EPDA 1QKWA 2K4YA 1G3SA 5J3BA 3NTIA 4E7IA 2AT1B 2DBMA 4EMHA 4ZGDB 4OB1B 1Y0MA 1Q82U 2PNIA 3CXCS 1YIJQ 4WF2A 3OMGA 3G4SQ 3M9QA 1RAHB 3FDRA 5HKCA 2E5QA 3REBB 2CP6A 2Y90A 2IVWA 1QLYA 3GBQA 5GMKm 2CUBA 2E1HA 1EIFA 4J9BA 2JJ9A 3U23A 4II1A 5GMKh 4FM4B 4C8QG 5CQXA 5FU6C 2DKGA 2ZPEB 3DKMA 3R6OA 3I56T 1WX6A 1NEBA 2NYSA 1U8RA 2DE0X 1KQSS 2GFAA 2V1RA 3CEYA 2VUBA 1K4US 4KUDK 3URGA 1MMAA 1UGRB 2GQVA 3CCRA 1O9SA 1ZSZB 1XNIA 5GAOp 4RCCA 5I11A 2A28A 2PVOB 1K9MU 2X4JA 5FRNA 2I0NA 3VYHB 2LJ3A 4J7IA 2CP7A 5EC7A 1VQ5Q 2XD0A 2FPEA 3CCQT 1K8AU 1MV3A 2LT1A 3O5ZA 3PMTA 3VS3A 3G71T 4XAXB 2G6FX 4F7UA 5I22A 3PGGA 3E9GA 1SSFA 3CCEQ 3X25B 5M9OA 5FU6B 2BKDN 3VS7A 3G7ZA 1IO6A 1Q7YU 3OS0A 3CCVA 2LT4A 1VQ6T 2VGMA 3EG0A 4FSSA 1K8AC 2CH4W 2EAYA 5GMKi 5GAN7 4M7AC 5IHKA 4M75B 4K11A 3I56A 4VUBA 4M7AE 2P0QA 4J7FA 4QVDA 2JXBA 4DOVA 2A36A 5FLXE 2K79A 1PWTA 4J83A 1H3ZA 1UEBA 1EX4A 2IIMA 3JCMW 3HSBA 5GJVB 2DLPA 3VRZA 1YCSB 2K3BA 3EGXA 3PTAA 1VQ9Q 4M77G 2RHUA 3OSSC 3RESA 1TXQA 3GP8A 1U3OA 2F5TX 3LH5A 1BBZA 1YWPA 4WCIA 3CPWP 4JS5A 2FYKA 3THKA 2DK3A 3OQ5A 1VQ4A 2ZPFB 1K9MR 5LJ5d 1PRLC 4EIKA 4RKUE 1BI2A 3TEEA 4EMKA 3CC7Q 1VQNA 3UDCA 4PJJA 2YHTA 3VYGA 3WVEB 2DXCA 1KC8R 3JB9J 2HEQA 2JS0A 5DLOA 4XTUA 5GMKj 1K9AA 2X4XA 3ME9A 1NJIU 4QQDA 1U1TA 3SWNB 2VYTA 1PSFA 4M7AB 1WLPB 1UB4A 3NHNA 4IUQA 4C92C 2QEXT 3QZ5B 2OTLT 5A2QE 3VUBA 1C6VX 3MP8A 2RJEA 3OYGA 2L3PA 4QW2A 2JTFA 1I5OB 5HCKA 1T3SA 3QUIA 3VS0A 1Y57A 2QTVA 3H0IA 1WJSA 4XTWA 1K76A 2M16A 4N4HA 1NJIC 4ORZA 1CKBA 2CSQA 1BB9A 4BACA 1JQQA 4DBRA 1GCQA 2ZCFB 2P0PA 4M4ZA 4J6XA 3CCLQ 4M78F 4HXJA 1YJ9T 1YJNT 4OMQA 3CCLT 1G83A 1K0SA 2V26A 1WXUA 1D1BA 4C8QC 4BE2A 4X9CA 3TREA 2VKNA 3LGLA 3QYHB 2M9UA 4PJOG 2RI2A 5CKHA 2M51A 4KGVB 3CCUT 3A8OB 2RHXA 2KYBA 1OEBA 3PIPA 2C0OA 1YHQT 3H0HA 1ZLMA 4FW2A 2BZ8A 2YRCA 1IREB 1OX9A 1YNZA 2ENMA 3CD6T 3QSUA 2FZCB 2X4WA 1QMCA 2DTOA 1VUBA 4KRTA 3BDUA 4J9FA 1VQ8Q 3LWHA 2DYBA 2HCKA 2KT8A 2PVGB 1RAAB 1KIKA 2G3RA 4F7UE 4C0ZA 4DBQA 2EYWA 2M1HA 1RAFB 4KT0E 5LJ3h 2KGTA 5GAMg 1XQHA 3QG1A 2JS2A 1Q82C 3MJXA 2HSEB 1M9SA 4LDUA 5IN1A 3L1AA 2RHZA 4A4KA 4M7DD 3JCMc 4E7JA 2X3XD 4BY6C 2JMAA 4M75A 4C92D 1JU5C 3QIIA 2CUDA 3SFMA 4V2SA 2KR3A 1WA7A 1MMNA 4LDYA 1V76A 1I8FA 1PRMC 5DM7R 1VQ4Q 3O8VA 3QJ6A 3CXCA 4LD9K 1Q7YC 4DA4A 3OYYA 1SHFA 4FIBA 2LQKA 3HRUA 2HBPA 3CMAT 2DD5A 1KQSP 4O6JA 5LJ3f 2H8HA 3CC2T 1NPRA 1UGQB 1K73R 2NUPB 2O31A 5GAN5 1VQ6A 4MMKA 4E7KA 3T9NA 3C94A 1G3WA 1D0YA 3CCMA 1NBEB 2SEMA 2RHIA 2CZ7B 4IUTA 4D8KA 4JRQA 4QQGA 3AT1B 2RJCA 4YTLA 1BKBA 3JSCA 1OPLA 5GANh 4LDWA 1M1KC 1M1KU 1VIFA 2PVDB 3QPHA 3UT1A 2OTJT 1ZUKA 3C95A 4ZGJB 3LWIA 1GCPA 3CQTA 3GOXA 2QYZA 1QVGS 3ZL7C 5GANe 2OTJA 1IRXA 1VYUA 3EG2A 3X26B 4JDSA 1UGPB 1OZ2A 4F7UG 3OYMA 5I2SA 1LOJA 1JB0E 3EFRA 1WPYA 2ZPGB 3M0SA 5C6SA 3JB9F 3CCSQ 4F7UF 1PKTA 3JV3A 1WJQA 3CCRT 2D0NA 1LNXA 3CCMQ 5KYWB 1K1ZA 1WIEA 3EH1A 3GLXA 1LJOA 1T3LA 3RKYA 1HJDA 3RBBB 5GAMj 1I5LA 3HTRA 3VS4A 3EFOB 4PJLA 1OU8A 1PD1A 4IUVA 3OS2A 3SWNC 1Y7XA 1YWOA 2RQTA 2NLUA 2DETA 2X51A 4XU3A 3JB9I 2AIRB 3M0RA 1W4SA 2EKHA 2NUTB 1WHKA 3RDVA 1AVZC 1F1BB 4JLIA 3OSVA 2LDMA 2VVKA 1VQ4T 1VQKT 4BI3A 2HKNA 4JPBW 2DXTA 3NGPA 5LJ5j 4AMCA 4JZ4A 1D1CA 3MCAB 2L2PA 1M5Q1 3M58A 3M55A 1YJWT 2HMAA 4LN2A 1KHIA 3OYEA 3GNFB 1X6GA 2EFIA 2MIOA 1D0XA 2CP2A 2BIVA 1HSQA 3A1PA 3PE0A 1VQ8A 2GTOA 2KBTA 4KH0B 1AEYA 1ACMB 1B34A 1XOVA 1J3TA 4LXCA 1UTIA 1ZX6A 4M75E 3RKXA 2RO0A 2DRKA 2EJ9A 1KQ1A 1R0BG 2JT4A 1RADB 4E6RA 1LCKA 2WACA 2K57A 1VQ5T 4M77F 4IIOA 3CCQQ 1M4ZA 3CD6Q 5IH2A 3CCQA 4N4IA 3G71Q 4DOWA 1B07A 3R6NA 3EGUA 3QWXX 3CBOA 2YRVA 4OGEA 1YN8A 4J9HA 4L59A 3VJPA 5D7UA 2VGNA 1GFDA 2YLCA 2W0ZA 2C06A 3HRTA 2GTJA 4J9EA 3QKJA 1BYMA 1VQLT 4M7DF 3FC3A 3ASKA 1Y71A 1WFWA 3CCMT 3L2RA 2EYQA 1NYGA 2CT4A 4PFPA 1RAIB 1T0HA 5FU7B 4BUGA 4J9GA 5KYWA 2VB6A 2DTHA 2DERA 1TG0A 3VRYA 5GANj 4A53A 1RI9A 2J6OA 4C5IA 3G1JA 3JCMg 3VS2A 2YUNA 4DBFA 5KYYB 5HK3A 2AZSA 2E65A 2LCLA 2DMOA 1W70A 1WXTA 1FMKA 2ZGWA 1YJWA 2KRNA 1UGSB 4F17A 1QCOA 1VQMQ 4HVUA 1BU1A 2MAMA 3I35A 1VQMT 2LX7A 4J9DA 2XIDA 5CKBA 2J7IA 1VYTA 2EBPA 1VQ7Q 2ZPHB 3PT9A 2XU8A 3ULRB 4DQ2A 3A8HB 3OYJA 5LJ5e 1WGSA 5LL6S 2GBQA 3MP1A 3CCJQ 3EG9A 3CXCP 1KJWA 5CO7A 4P5NA 2OI3A 2RD1A 2KK4A 8AT1B 5LJ5h 3JRZA 2C0IA 1GBRA 2DVJA 3EHQA 2LC4A 3TQ7P 2JM9A 4M75F 2AHJB 2IG0A 1X6BA 5KE2A 2X4YA 5FRMA 5HY6A 4AG1C 1MHNA 2J06A 1WNLA 3OW2S 3P8HA 4M78A 2EGEA 1R8OB 2EGAA 1C1AA 2QK0A 2DL5A 2QI2A 2LCCA 2FRWA 3H41A 2MMPA 5IHIA 2EJFA 1SRLA 1VQOA 3OB9A 1VQ9A 3J7AF 4JJNK 5A0DA 2L0AA 1AWOA 2DIGA 4LDXA 2RI3A 2XHCA 4ZNXA 4M7AD 2K6DA 5AYFA 4M7DE 1ZA1B 2ABLA 2V1QA 1WDXA 3JCMQ 3GNGA 4IURA 2EQKA 2XG8D 2VC8A 3SEMA 2VXEA 3F70A 1G8XA 1N6AA 5KH6A 5AT1B 5FROA 1OU9A 4OMFB 4L6V5 3REAB 3SD4A 2E6NA 1D1AA 2JTMA 3UWNA 1SEMA 2DAQA 1WHHA 6AT1B 2ZAEA 4LUDA 1VQ5A 2ZZDA 2RN8A 1VQKQ 1SPKA 3FJ5A 4E7ZA 1BK2A 1VQ9T 3M4YA 3L2QA 1PM3A 4PJMA 2V8KA 4PKCC 1QP2A 2D9TA 2YWWA 4OVAA 2ED0A 5KCOA 1H92A 4M78E 1M30A 1BIBA 4Q5WA 5GAMf 5CR2A 2QG9B 1ZSZA 2DFUA 4HCKA 2YXYA 4M75G 2P4TA 5DY9A 2DPPB 2FG0A 4LNPA 3E1SA 3M56A 3CPWS 4M7DG 4EDUA 2BTTA 3TVTA 3DLLA 3X24B 1UGVA 2QDYB 5C0MA 2DVEA 3H6ZA 5GANf 5LJ3d 4ESRA 1W2BS 5LJ5f 1Y07A 2GQIA 2J05A 1Q81C 2RK2A 3RERA 4EPCA 4HVWA 2CDTA 1VQMA 1FX7A 3ZBDA 1OV3A 2CH4A 2LRQA 1ZHIA 3QJYA 5GAN8 1MMGA 3KBGA 2PZ1A 4M77D 2E12A 4C8QD 2WSFE 1JXOA 1OYXA 2XDBA 2OAUA 3JCMf 2XK0A 5KYXA 4PFOA 2O4XB 4M7AG 4C92F 1YJ9Q 1YJNQ 1WYXA 2LTOA 3CPFA 1LPLA 5GANd 3CC4Q 2NWMA 4A4FA 2QGFB 2EYZA 2QXFA 2LNVA 3VS6A 2COYA 2RQWA 3G71A 2DBKA 4C5GA 4ELYC 3M0TA 4C5EA 2R5MA 2J6KA 1M8VA 4C8QE 1ZUYA 2DTIA 1EFNA 1M90U 1N8RU 4HA8A 4DEXA 1TUGB 2YSQA 2ECZA 2JVVA 4J6WA 4BDZA 1M2VA 2CT3A 1WQ7A 2FZKB 2BUDA 1ABQA 3FEOA 1VOMA 2BE9B 2OTLA 2DZ9A 2QEXA 4PJOD 1QWEA 2DILA 1QP3A 2RI5A 1AZEA 2RK1A 3NTHA 1AWWA 1S1NA 1Y96A 3EFSA 4BDYA 3HL8A 5I2MA 3G6EQ 2K3YA 4BB7A 3HFOA 4A4GA 1WHGA 3D7SB 2DXUA 4PNOA 2E5KA 5LJ3e 1BI1A 3HKSA 4A63B 4F04B 3CPWA 3RIRA 3DB4A 1OQKA 3CC7A 4QQ6A 4E7HA 1N8RR 3E2UA 4J9IA 5LJ3j 1FYNA 1WQWA 4J9CA 4L5GA 3JB9D 1E6HA 1YP5A 2KYMA 4A4EA 3P8DA 4D8DA 1K9MC 5GAMh 1N8RC 1KG1A 2D8JA 1ZSGA 3QO3A 4GLMA 2DEQA 4M77A 1KD1U 4KUIA 1KD1C 4XTZA 4KULA 1BIAA 1B34B 1RLPC 4B9WA 2A0FB 1G3TA 3OW2P 4Z8AA 1AT1B 4C0FA 3GPLA 1QVFA 3JB9H 4RUGA 3CMEA 4BE1A 1SHGA 3I56Q 4OMPA 4DBHA 2L3QA 2QA4A 3M0PA 1QVFP 4FCYA 4CC3A 2EIFA 2Y4XA 2YUPA 3WXMB 1NPPA 5GAOn 3ZFJA 1ZBJA 4N0AA 1VQPQ 3OYHA 1Q81U 1X69A 3M0UA 3CMEQ 2OTJQ 5LJ3g 1VYVA 2SRCA 1M2OA 5L23A 3V8LA 1M3AA 4C5HA 1M3BA 2AZVA 2O4XA 3OYAA 5KYXB 2HZYA 3PVLA 2Y4YA 1WZOA 4TVRA 2EQIA 4C92G 1VQPA 1TWBA 1UJYA 1SRMA 2LQWA 2QGGA 4OMLA 3OY9A 1X01A 3JCMP 2HQHA 4Z89A 1D0ZA 5GANg 2WSCE 5IXBA 1MUZA 5FU7C 1QVGP 3TSZA 5GAN3 1M2VB 1VQ6Q 4C8QB 3PIOA 2XMFA 2K2MA 4XTVA 1FMWA 5HK0A 4JRKA 5J26A 1G2BA 4M77E 1UHFA 3OW2A 4PFZA 2K2VA 4A4HA 1VQPT 3CC2A 2OX7A 1UJ0A 2KQWA 1IHVA 1OI1A 2JW4A 3M57A 2F5KA 2OTLQ 1YHQQ 2RQVA 1HK9A 3LLRA 1Q81R 2DO3A 1QKXA 2H3EB 4PJOC 4MDXA 4AT1B 5KE3A 1AWJA 4FYYB 2DF6A 1VQOT 4Z88A 3G6EA 2ROLA 1IHWA 1Q86R 3MEAA 4WTOB 2HD0A 2LQNA 4FT4A 5J39A 4C92E 1S72A 3VUZA 1W2BP 1T0JA 2QQRA 4M7DC 1PD0A 3UA6A 2ATCB 3DB3A 2ED1A 5L8RE 4AFSC 1SKUB 7AT1B 1Q95G 2CZ0B 2COZA 1KC8C 2EQJA 1KSWA 1I4K1 3J81E 2EYXA 4M78D 5KYUB 2K5LA 5CAIA 1RAGB 2D6FA 2P0KA 4F7UB 1I81A 3G6ET 1I07A 2E41A 1KFZA 3V8JA 1P92A 4X9DA 2D0QB 3CD6A 2KRMA 4FU6A 2LX9A 3MEUA 5CVIA 3QDRB 1WI7A 1JBMA 3EGXB 3LX7A 5IAYA 2OAWA 1RL2A 4E2FB 3KUFA 2L8DA 4XTXA 2HKQB 4M77B 4HCZA 3JAME 4HKEA 3CCUA 3CCLA 2K7AA 1IGUA 1YJ9A 1YJNA 3S3NA 1RABB 3C12A 1FWZA 5D6WA 2GNCA 4J5YA 2EJGA 2RA2A 1S72Q 4C0DC 2JNGA 2QASA 1HYOA 2CP0A 1I0CA 2AK5A 4XU0A 1EZZB 2M0OA 2R5AA 3JCMh 1KK7A 4EMKC 1TTHB 4A54A 1PNJA 2YT6A 2GF7A 1E6GA 4IUUA 1MNEA 2DZCA 3JCMb 2PTKA 1TSFA 4PLLA 5GAN2 4ZTJA 2PU9B 1YI2Q 1ZUUA 4RTWA 3I9QA 2COWA 2LCSA 1N9SA 1PSEA 3EFOA 2O2OA 3OMCA 4IIMA 1VQ8T 3V7SA 2K3XA 1MMDA 1R0CB 3NPFA 4FT2A 3UATA 2XKOC 1VQLQ 3LH0A 5GAOq 3OBYA 1VQNQ 4R55A 3J80E 3SDZA 3FRNA 5GJWB 2KSSA 3H8ZA 3OYFA 2X3WD 3MEWA 1UE9A 4GLKA 2GGRA 1R77A 4RG8A 4JRIA 3CMET 2HL3A 3MEVA 1OPKA 2DRMA 2LP5A 4OMNA 2DD4A 3PVQA 1VQKA 3L2WA 1GCQC 1G5VA 1WHMA 2H3JA 2V8JA 4NL3A 2JM8A 2RB6A 4C8QA 5DLQE 3RNJA 3L2UA 3QZ9B 2KXDA 3EG1A 1QVFS 4J8OA 1RUWA 2HBWA 5GAMd 1VQOQ 3MP6A 3OS5A 2K9GA 2HAXA 3TCJA 1FMVA 4RTXA 3OYKA 3CC7T 1ARKA 4BI8B 3A5ZB 2QA4Q 1W2BA 1AWXA 2JMCA 9ATCB 2ZPIB 4F16A 3BY7A 1A0NB 3CCEA 3QBYA 5CKFA 3LYIA 1GBQA 4KH1B 2CZ1B 4J6YA 5GAOm 2KMTA 2CZ6B 4OMOA 5A0GA 4BI4A 1VQLA 2L5QA 2A08A 4NL2A 4OF1A 1WJRA 1Q86U 4PJOF 1YITT 2K5FA 4D6WA 2ROTA 2KI7A 3OYNA 5GMKl 2VV5A 2PUKB 3N5BB 2CSIA 2Z0WA 5CIUA 2FPFA 4BD3A 2AKKA 2XI9A 1UDLA 2D8HA 2MOXA 4CC7A 4CRIA 4IKFA 2MF2A 1YJWQ 4HT8A 2XICA 4M78C 3S6WA 3FB9A 3PMIA 1KHCA 4HCBA 4LD6A 3HRSA 2R58A 4C8QF 1MNDA 2KVQG 5CQYA 4JLGA 2EYYA 1G3YA 3JB9G 4X1VA 3I5SA 2EGCA 5CKDA 5GMKe 2QTXA 2JZ2A 3A8MB 3L2ZA 1UFFA 1CKAA 1BCMA 3H0FA 1JJ2A 2DX1A 3BW1A 2F2XA 4ATOA 4OMMA 3CCUQ 5KYUA 1BI3A 4AG2C 2CREA 2HQXA 4NS5A 4FW1A 1KC8U 2E64A 2A3LA 2KNBB 1Y96B 1U06A 4QVZA 1D3BB 4ZN1A 4HCCA 2LNHB 2B86A 5GAOr 2M02A 1XTDA 2FO0A 4KGXB 4HT9A 2BZYA 1QWFA 4JS4A 1TU0B 2L89A 2XDDA 3LGFA 3FJPA 4XK8E 1SG5A 1MV0B 2EQUA 1QW1A 4XTYA 3RUXA 4FYWB 3OA6A 1S72T 1NG2A 2P4RA 1OOTA 3M5AA 3CC4T 2LZ6B 2VWFA 1M1FA 1RLQC 3NFCA 4M78B 1M27C 2KAFA 4C0GA 3QWYA 1MGQA 3A8LB 4CC2A 5KYNA 3M53A 4FYVB 5IXFA 4RMOA 2FEIA 2VASA 2CP5A 4LDVA 5CCAA 3ER0A 3TSWA 3V8KA 1ZQ1A 2YUQA 3A98A 3TU4K 3A8GB 3CCST 3SWNA 3V7RA 1IZ6A 2OJ2A 3MO8A 4OGCA 1YFNA 1H8KA 2QAZA 2QQSA 1AHJB 1VA7A 2DM1A 4E47A 2KROA 3EGDB 1X75C 1I1JA 1N5ZA 3CC2Q 4KGZB 1WXBA 2LMJA 4JJCA 4AFZC 2KRSA 4MMLA 5A0LA 3OYLA 3L2VA 2BZXA 2EWNA 3FLGA 2A37A 2RM4A 4E7SA 1N9RA 4DEYA 1SSHA 5D6XA 3X20B 2E10A 2E70A 4KBMB 2KT1A 3G4ST 1YITA 2CYZB 2KY9A 2CP3A 2DL8A 2DL3A 4O5VA 1QVPA 2DNUA 1C0MA 4PL6A 1Q7YR 3EG3A 2AKLA 4B9XA 2I2LA 4FSXA 4BE0A 4MZMA 3CCJT 4PJOB 1M8MA 5FWCA 2LJ1A 2RNAA 4M75C 1QCNA 2MI6A 1W1FA 3SHWA 2HDAA 1NEGA 4GY5A 4CC4B 1GL5A 8ATCB 3IQLA 3RMSA 3VKIA 3RR6A 4QKUA 4MZPA 1Q86C 1M90R 1YBYA 4EMGA 1PC0A 1ZSZC 1GXIE 2L3SA 4ZN3A 3BFMA 1H641 2KDSA 1JJ2P 1NZ9A 4ME7A 2F2WA 4Y92A 4PJOA 1H3HA 4PJOE 2MCNA 2X35A 3MHXA 1PCXA 4OB3B 2LJ0A 2XDPA 4C92B 1NLOC 4MZTA 1UG1A 1PKSA 3KXTA 5IT9E 3M59A 4JUVA 3HFNA 1VIEA 1TUCA 3H9NA 1DJ7B 3SB2A 1XJWB 1N27A 4Y91A 4M7DA 1ZBXA 2R57A 3CCRQ 1X2QA 1BCOA 5LJ5g 2VXFA 3INZA 3GIBA 1NE8A 1FXXA 2CGHA 3EHRA 3V7CA 4LUEA 2WSEE 1WHJA 3CCVT 3OYCA 3I55A 2A7YA 2FVUA 1NJIR 3UA7A 3JCMe 1GFCA 4ELZC 3GF5A 5KCHA 4JJDA 3EGDA 1M1GA 1KQSA 4M7AA 3HP9A 1YI2A 1Z9ZA 2QEXQ 2RQUA 5IHNA 2B8AA 4M77C 1ABOA 3I5RA 4Z02A 3CBPA 4ANJA 2M0YA 1M1KR 3JCMd 1YI2T 2DIQA 1JRIA 3EG9B 2GCXA 3VU3C 1CSKA 2C0TA 2V8IA 4RTZA 3BE3A 2EQMA 4QT7A 3UPUA 3CCET 1IXDA 4AFUC 3P8BB 1NLPC 3QXEB 4M7DB 3I55T 5KYYA 2FHDA 4N0AC 2FPDA 1NM7A 1QCFA 2KXCA 4XU1A 2RMOA 3KFVA 1X43A 3PNWC 1IGQA 3JCMJ 3OS1A 1UUEA 1U5SA 2RPNA 1KD1R 3CMAA 4RCBA 4JRPA 2QQBA 1M3CA 1K73C 2YDLA 1QQJA 2HSPA 2HQEA 3OYBA 5GAN6 1U1SA 4XU2A 3JCMX 1GRIA 2F2VA 4IUPA 3HPWA 3NMZC 3QHSA 5EG2A 4M75D 2ESWA 4C92A 3EH2A 1Q82R 1SF9A 2YLBA 2GFUA 2DJQA 4ZTFA 3QYGB 3M0QA 3CMAQ 2EVRA 1PHTA 4XQ3A 1JEGA 3VS5A 2X9HA 2E6ZA 1HXDA 4E7LA 4JJBA 1AOJA 1M90C 4FL6A 4C0DB 3C0CA 1OULA 4GBQA 2NUZA 3JCMV 4B6MA 3QDFA 4RTYA 4CI0C 2E3HA 3S3MA 3ZEHA 3META 4OB2B 3OBWA 1OX8A 2ZPBB 1RACB 1K0XA 1YHQA 2DA9A 2E4HA 1AZGB 2IPOB 1X6OA 2EW3A 4RG2A 2P84A 2E3IA 4RTTA 1RI0A 2HNIA 3X28B 1TOVA 1OZ3A 5GAN4 1UHCA 1UECA 1TS9A 2QQAA 3DLMA 2RHYA 2FZGB 3OYIA 2W10A 3I55Q 4OP0A 3MKDA 4JZ3A 2NUTA 5GAOl 4QVCA 2HL5C 3C4SA 1PG5B 1KQ2A 3WVDB
chains in the Genus database with same CATH topology
2PZ1A 1JXOA 2EYWA 1HD3A 2KGTA 2ROTA 2JS2A 2CSIA 1WYXA 2FPFA 2AKKA 1UDLA 2D8HA 2MOXA 4CC7A 2X3XD 2JMAA 1JU5C 2NWMA 2CUDA 2D1XA 2KR3A 2EYZA 1WA7A 2QDLA 1X2KA 3VS6A 1PRMC 2YUOA 2RQWA 2DBKA 1JXMA 2EYYA 3M0TA 1SHFA 2J6KA 1ZUYA 4X1VA 3I5SA 2EGCA 1EFNA 4DEXA 2O88A 1UFFA 1CKAA 3H0FA 4R0KA 2KE9A 2DX1A 2F2XA 4OMMA 2H8HA 2YSQA 2ECZA 1NYFA 4AG2C 2CREA 2CT3A 2O31A 1ABQA 4RTUA 2KNBB 2FRYA 2O9VA 1U06A 2SEMA 2LNHB 4D8KA 2B86A 1QWEA 2KEAA 2DILA 2FO0A 5ECAA 4RTVA 1AZEA 2BZYA 1QWFA 1OPLA 5FWBA 1AWWA 1S1NA 1ZUKA 1MV0B 2E5KA 1GCPA 3CQTA 4A63B 3ZL7C 1NG2A 1VYUA 3EG2A 4J9IA 2J6FA 1FYNA 2P4RA 1V1CA 1OOTA 2RQRA 2LZ6B 4J9CA 2VWFA 1Z9QA 1RLQC 1B3QA 1E6HA 1YP5A 4AFQC 3M0SA 1M27C 1TUDA 2KYMA 1PKTA 3QWYA 3JV3A 4D8DA 2JTEA 2D0NA 4F14A 4CC2A 1JO8A 2D8JA 1ZSGA 4GLMA 1K1ZA 1WIEA 5IXFA 2FEIA 1T3LA 3TSWA 1HJDA 2O9SA 3RBBB 2YUQA 1RLPC 3A98A 3VS4A 4Z8AA 4RUGA 4LE9A 1X27A 2OJ2A 1SHGA 1AD5A 1H8KA 1YWOA 2RQTA 4OMPA 1VA7A 2L3QA 2DM1A 1W6XA 3M0PA 2KROA 1I1JA 4CC3A 1N5ZA 3M0RA 2EKHA 2YUPA 1WXBA 2LMJA 1AVZC 4JJCA 4AFZC 2DL7A 2KRSA 1ZBJA 2VVKA 1X69A 3UF4A 2DL4A 3M0UA 2BZXA 2RF0A 4HVVA 4JPBW 5FW9A 1VYVA 3NGPA 2A37A 2SRCA 5L23A 3VS1A 4DEYA 1M3AA 4JZ4A 1SSHA 1E7OA 1M3BA 2AZVA 2L2PA 3PVLA 2EQIA 2EPDA 1UJYA 4LN2A 1QKWA 2KT1A 1SRMA 2LQWA 4OMLA 1X6GA 2MIOA 2DBMA 2DL8A 2DL3A 4Z89A 1HSQA 2DNUA 1Y0MA 3PE0A 5IXBA 2GTOA 1MUZA 2KBTA 1AEYA 2PNIA 1XOVA 3TSZA 1J3TA 3EG3A 2AKLA 1UTIA 1ZX6A 2XMFA 2K2MA 1M8MA 5FWCA 2LJ1A 2DRKA 2RNAA 3REBB 1G2BA 2JT4A 4E6RA 1LCKA 1UHFA 1W1FA 1QLYA 3GBQA 2CUBA 3SHWA 2HDAA 4J9BA 1NEGA 4CC4B 3U23A 1GL5A 3IQLA 4IIOA 1UJ0A 5IH2A 1B07A 3R6NA 3EGUA 3QWXX 2JW4A 1YN8A 4J9HA 2RQVA 1GFDA 1WX6A 1NEBA 2L3SA 2W0ZA 2GTJA 4J9EA 1QKXA 2DE0X 2F2WA 4Y92A 1AWJA 2V1RA 1K4US 1H3HA 1WFWA 2DF6A 2MCNA 4Z88A 1NYGA 2CT4A 2ROLA 2LJ0A 1T0HA 4J9GA 1NLOC 2LQNA 1UG1A 1PKSA 1TG0A 3VRYA 5I11A 2A28A 1RI9A 1TUCA 2J6OA 2I0NA 1T0JA 2LJ3A 3VS2A 2YUNA 5EC7A 3UA6A 4AFSC 2AZSA 2ED1A 2DMOA 1W70A 1X2QA 1WXTA 1FMKA 2FPEA 1KSWA 1MV3A 3O5ZA 3VS3A 2EYXA 2KRNA 2G6FX 5I22A 3EHRA 4F17A 4LUEA 4HVUA 1BU1A 3I35A 1I07A 3UA7A 2LX7A 1KFZA 4J9DA 3VS7A 1GFCA 2J7IA 1VYTA 2EBPA 1IO6A 4JJDA 3ULRB 3EG0A 2KRMA 4FSSA 2GBQA 1KJWA 2CH4W 1Z9ZA 2RQUA 5IHKA 1WI7A 5IHNA 4K11A 2OI3A 1ABOA 2OAWA 2JXBA 2C0IA 3I5RA 2A36A 2M0YA 2K79A 1PWTA 1GBRA 2DVJA 3EHQA 2IIMA 2JM9A 5GJVB 2DLPA 2K7AA 3VRZA 1X6BA 1CSKA 1YCSB 2K3BA 2C0TA 4RTZA 4AG1C 2J06A 4QT7A 2GNCA 2EGEA 2EGAA 4AFUC 2DL5A 1U3OA 3LH5A 1BBZA 1YWPA 4WCIA 2FRWA 3H41A 3THKA 1NLPC 5IHIA 1I0CA 2AK5A 1SRLA 2FPDA 1NM7A 1QCFA 2KXCA 1PRLC 2RMOA 3KFVA 1X43A 4EIKA 2L0AA 1AWOA 1PNJA 2YT6A 1UUEA 1U5SA 2RPNA 1E6GA 4ZNXA 2K6DA 2PTKA 1M3CA 2YDLA 2HSPA 2ABLA 2HEQA 2JS0A 2V1QA 1WDXA 1K9AA 1ZUUA 4RTWA 3I9QA 2LCSA 1GRIA 2F2VA 1WLPB 3NHNA 3NMZC 2O2OA 3SEMA 4IIMA 2ESWA 3NPFA 3UATA 3REAB 2DJQA 3M0QA 2EVRA 2L3PA 5GJWB 1PHTA 1SEMA 2X3WD 1JEGA 1UE9A 4LUDA 3VS5A 2GGRA 5HCKA 1T3SA 2RN8A 1SPKA 3VS0A 3FJ5A 1BK2A 1Y57A 3H0IA 4JJBA 1AOJA 1OPKA 2DRMA 1K76A 2LP5A 3C0CA 4OMNA 4GBQA 4ORZA 1CKBA 2CSQA 2ED0A 2NUZA 3PVQA 1BB9A 1H92A 1GCQC 1M30A 1JQQA 1GCQA 4RTYA 4M4ZA 4HCKA 4HXJA 4OMQA 2FG0A 2JM8A 1G83A 1K0SA 1WXUA 3RNJA 4LNPA 1K0XA 2VKNA 2KXDA 3EG1A 2DA9A 1AZGB 1RUWA 2M51A 2BTTA 2HBWA 2EW3A 3TVTA 2K9GA 2KYBA 1OEBA 4RTXA 1ARKA 1UGVA 2C0OA 3H0HA 1ZLMA 4RTTA 2BZ8A 1AWXA 4ESRA 2JMCA 1UHCA 1UECA 2GQIA 2J05A 1YNZA 4F16A 2ENMA 1A0NB 2W10A 4HVWA 2CDTA 1GBQA 4JZ3A 4OMOA 4KRTA 1OV3A 2CH4A 4J9FA 2A08A 2DYBA 2HCKA 2KT8A 1KIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ1 A;  1JXO A;  2EYW A;  1HD3 A;  2KGT A;  2ROT A;  2JS2 A;  2CSI A;  1WYX A;  2FPF A;  2AKK A;  1UDL A;  2D8H A;  2MOX A;  4CC7 A;  2X3X D;  2JMA A;  1JU5 C;  2NWM A;  2CUD A;  2D1X A;  2KR3 A;  2EYZ A;  1WA7 A;  2QDL A;  1X2K A;  3VS6 A;  1PRM C;  2YUO A;  2RQW A;  2DBK A;  1JXM A;  2EYY A;  3M0T A;  1SHF A;  2J6K A;  1ZUY A;  4X1V A;  3I5S A;  2EGC A;  1EFN A;  4DEX A;  2O88 A;  1UFF A;  1CKA A;  3H0F A;  4R0K A;  2KE9 A;  2DX1 A;  2F2X A;  4OMM A;  2H8H A;  2YSQ A;  2ECZ A;  1NYF A;  4AG2 C;  2CRE A;  2CT3 A;  2O31 A;  1ABQ A;  4RTU A;  2KNB B;  2FRY A;  2O9V A;  1U06 A;  2SEM A;  2LNH B;  4D8K A;  2B86 A;  1QWE A;  2KEA A;  2DIL A;  2FO0 A;  5ECA A;  4RTV A;  1AZE A;  2BZY A;  1QWF A;  1OPL A;  5FWB A;  1AWW A;  1S1N A;  1ZUK A;  1MV0 B;  2E5K A;  1GCP A;  3CQT A;  4A63 B;  3ZL7 C;  1NG2 A;  1VYU A;  3EG2 A;  4J9I A;  2J6F A;  1FYN A;  2P4R A;  1V1C A;  1OOT A;  2RQR A;  2LZ6 B;  4J9C A;  2VWF A;  1Z9Q A;  1RLQ C;  1B3Q A;  1E6H A;  1YP5 A;  4AFQ C;  3M0S A;  1M27 C;  1TUD A;  2KYM A;  1PKT A;  3QWY A;  3JV3 A;  4D8D A;  2JTE A;  2D0N A;  4F14 A;  4CC2 A;  1JO8 A;  2D8J A;  1ZSG A;  4GLM A;  1K1Z A;  1WIE A;  5IXF A;  2FEI A;  1T3L A;  3TSW A;  1HJD A;  2O9S A;  3RBB B;  2YUQ A;  1RLP C;  3A98 A;  3VS4 A;  4Z8A A;  4RUG A;  4LE9 A;  1X27 A;  2OJ2 A;  1SHG A;  1AD5 A;  1H8K A;  1YWO A;  2RQT A;  4OMP A;  1VA7 A;  2L3Q A;  2DM1 A;  1W6X A;  3M0P A;  2KRO A;  1I1J A;  4CC3 A;  1N5Z A;  3M0R A;  2EKH A;  2YUP A;  1WXB A;  2LMJ A;  1AVZ C;  4JJC A;  4AFZ C;  2DL7 A;  2KRS A;  1ZBJ A;  2VVK A;  1X69 A;  3UF4 A;  2DL4 A;  3M0U A;  2BZX A;  2RF0 A;  4HVV A;  4JPB W;  5FW9 A;  1VYV A;  3NGP A;  2A37 A;  2SRC A;  5L23 A;  3VS1 A;  4DEY A;  1M3A A;  4JZ4 A;  1SSH A;  1E7O A;  1M3B A;  2AZV A;  2L2P A;  3PVL A;  2EQI A;  2EPD A;  1UJY A;  4LN2 A;  1QKW A;  2KT1 A;  1SRM A;  2LQW A;  4OML A;  1X6G A;  2MIO A;  2DBM A;  2DL8 A;  2DL3 A;  4Z89 A;  1HSQ A;  2DNU A;  1Y0M A;  3PE0 A;  5IXB A;  2GTO A;  1MUZ A;  2KBT A;  1AEY A;  2PNI A;  1XOV A;  3TSZ A;  1J3T A;  3EG3 A;  2AKL A;  1UTI A;  1ZX6 A;  2XMF A;  2K2M A;  1M8M A;  5FWC A;  2LJ1 A;  2DRK A;  2RNA A;  3REB B;  1G2B A;  2JT4 A;  4E6R A;  1LCK A;  1UHF A;  1W1F A;  1QLY A;  3GBQ A;  2CUB A;  3SHW A;  2HDA A;  4J9B A;  1NEG A;  4CC4 B;  3U23 A;  1GL5 A;  3IQL A;  4IIO A;  1UJ0 A;  5IH2 A;  1B07 A;  3R6N A;  3EGU A;  3QWX X;  2JW4 A;  1YN8 A;  4J9H A;  2RQV A;  1GFD A;  1WX6 A;  1NEB A;  2L3S A;  2W0Z A;  2GTJ A;  4J9E A;  1QKX A;  2DE0 X;  2F2W A;  4Y92 A;  1AWJ A;  2V1R A;  1K4U S;  1H3H A;  1WFW A;  2DF6 A;  2MCN A;  4Z88 A;  1NYG A;  2CT4 A;  2ROL A;  2LJ0 A;  1T0H A;  4J9G A;  1NLO C;  2LQN A;  1UG1 A;  1PKS A;  1TG0 A;  3VRY A;  5I11 A;  2A28 A;  1RI9 A;  1TUC A;  2J6O A;  2I0N A;  1T0J A;  2LJ3 A;  3VS2 A;  2YUN A;  5EC7 A;  3UA6 A;  4AFS C;  2AZS A;  2ED1 A;  2DMO A;  1W70 A;  1X2Q A;  1WXT A;  1FMK A;  2FPE A;  1KSW A;  1MV3 A;  3O5Z A;  3VS3 A;  2EYX A;  2KRN A;  2G6F X;  5I22 A;  3EHR A;  4F17 A;  4LUE A;  4HVU A;  1BU1 A;  3I35 A;  1I07 A;  3UA7 A;  2LX7 A;  1KFZ A;  4J9D A;  3VS7 A;  1GFC A;  2J7I A;  1VYT A;  2EBP A;  1IO6 A;  4JJD A;  3ULR B;  3EG0 A;  2KRM A;  4FSS A;  2GBQ A;  1KJW A;  2CH4 W;  1Z9Z A;  2RQU A;  5IHK A;  1WI7 A;  5IHN A;  4K11 A;  2OI3 A;  1ABO A;  2OAW A;  2JXB A;  2C0I A;  3I5R A;  2A36 A;  2M0Y A;  2K79 A;  1PWT A;  1GBR A;  2DVJ A;  3EHQ A;  2IIM A;  2JM9 A;  5GJV B;  2DLP A;  2K7A A;  3VRZ A;  1X6B A;  1CSK A;  1YCS B;  2K3B A;  2C0T A;  4RTZ A;  4AG1 C;  2J06 A;  4QT7 A;  2GNC A;  2EGE A;  2EGA A;  4AFU C;  2DL5 A;  1U3O A;  3LH5 A;  1BBZ A;  1YWP A;  4WCI A;  2FRW A;  3H41 A;  3THK A;  1NLP C;  5IHI A;  1I0C A;  2AK5 A;  1SRL A;  2FPD A;  1NM7 A;  1QCF A;  2KXC A;  1PRL C;  2RMO A;  3KFV A;  1X43 A;  4EIK A;  2L0A A;  1AWO A;  1PNJ A;  2YT6 A;  1UUE A;  1U5S A;  2RPN A;  1E6G A;  4ZNX A;  2K6D A;  2PTK A;  1M3C A;  2YDL A;  2HSP A;  2ABL A;  2HEQ A;  2JS0 A;  2V1Q A;  1WDX A;  1K9A A;  1ZUU A;  4RTW A;  3I9Q A;  2LCS A;  1GRI A;  2F2V A;  1WLP B;  3NHN A;  3NMZ C;  2O2O A;  3SEM A;  4IIM A;  2ESW A;  3NPF A;  3UAT A;  3REA B;  2DJQ A;  3M0Q A;  2EVR A;  2L3P A;  5GJW B;  1PHT A;  1SEM A;  2X3W D;  1JEG A;  1UE9 A;  4LUD A;  3VS5 A;  2GGR A;  5HCK A;  1T3S A;  2RN8 A;  1SPK A;  3VS0 A;  3FJ5 A;  1BK2 A;  1Y57 A;  3H0I A;  4JJB A;  1AOJ A;  1OPK A;  2DRM A;  1K76 A;  2LP5 A;  3C0C A;  4OMN A;  4GBQ A;  4ORZ A;  1CKB A;  2CSQ A;  2ED0 A;  2NUZ A;  3PVQ A;  1BB9 A;  1H92 A;  1GCQ C;  1M30 A;  1JQQ A;  1GCQ A;  4RTY A;  4M4Z A;  4HCK A;  4HXJ A;  4OMQ A;  2FG0 A;  2JM8 A;  1G83 A;  1K0S A;  1WXU A;  3RNJ A;  4LNP A;  1K0X A;  2VKN A;  2KXD A;  3EG1 A;  2DA9 A;  1AZG B;  1RUW A;  2M51 A;  2BTT A;  2HBW A;  2EW3 A;  3TVT A;  2K9G A;  2KYB A;  1OEB A;  4RTX A;  1ARK A;  1UGV A;  2C0O A;  3H0H A;  1ZLM A;  4RTT A;  2BZ8 A;  1AWX A;  4ESR A;  2JMC A;  1UHC A;  1UEC A;  2GQI A;  2J05 A;  1YNZ A;  4F16 A;  2ENM A;  1A0N B;  2W10 A;  4HVW A;  2CDT A;  1GBQ A;  4JZ3 A;  4OMO A;  4KRT A;  1OV3 A;  2CH4 A;  4J9F A;  2A08 A;  2DYB A;  2HCK A;  2KT8 A;  1KIK A; 
#chains in the Genus database with same CATH topology
 1YCY A;  2FL7 A;  2EKO A;  3CCS A;  1B7T A;  1HD3 A;  3M54 A;  5CK9 A;  1YIJ T;  2PQW A;  2QQ9 A;  1LVK A;  3LW5 E;  3HHT B;  3Q1J A;  2MWP A;  1RAE B;  1WHL A;  2D1X A;  2QDL A;  1X2K A;  2YUO A;  5D6Y A;  2CKK A;  2QA4 T;  4OB0 B;  4MDW A;  1JXM A;  3CCV Q;  4X34 A;  1VQN T;  4PLI A;  1D09 B;  2F1L A;  4M78 G;  2K5I A;  1JJ2 S;  2O88 A;  2LQ8 A;  4R0K A;  2KE9 A;  3VV0 A;  1IB8 A;  3E9F A;  3OYD A;  3M4G A;  2MPX C;  4NOY A;  1NYF A;  3E19 A;  3MPU B;  4R56 A;  1ZA2 B;  1K73 U;  4RTU A;  4M7A F;  2FRY A;  2O9V A;  2BE7 D;  4UC4 A;  2KEA A;  2MWO A;  3CCJ A;  5GAM e;  5ECA A;  4RTV A;  1YIT Q;  2YRD A;  2NUP A;  3CBM A;  2DYI A;  5FWB A;  1D3B A;  3PFS A;  1VQ7 A;  2O01 E;  4EMK B;  1BI0 A;  4Y28 E;  1K8A R;  3G4S A;  2J6F A;  1YIJ A;  1V1C A;  2RJD A;  2RQR A;  3RMQ A;  2L3R A;  3BDL A;  5I21 A;  2RJF A;  1Z9Q A;  1B3Q A;  4AFQ C;  1TUD A;  2DJZ A;  4PK4 A;  3RKW A;  2DXB A;  2FB7 A;  2JTE A;  4BY6 B;  4F14 A;  2DEU A;  1JO8 A;  2JN0 A;  5CKE A;  4PJN A;  3S3O A;  2O9S A;  2JUF A;  1TH7 A;  3EAE A;  4LE9 A;  1X27 A;  3NTK A;  1AD5 A;  1QVG A;  1W6X A;  1VQ7 T;  3FIF A;  4FYX B;  4ZGE B;  2MYS A;  1V29 B;  2DL7 A;  3L42 A;  2LVM A;  1O75 A;  2MK5 A;  3UF4 A;  2DL4 A;  3CC4 A;  4N4G A;  2RF0 A;  4HVV A;  2JOY A;  2PUO B;  5FW9 A;  3AHU A;  2F69 A;  2CS7 A;  3VS1 A;  1E7O A;  2RH2 A;  2EPD A;  1QKW A;  2K4Y A;  1G3S A;  5J3B A;  3NTI A;  4E7I A;  2AT1 B;  2DBM A;  4EMH A;  4ZGD B;  4OB1 B;  1Y0M A;  1Q82 U;  2PNI A;  3CXC S;  1YIJ Q;  4WF2 A;  3OMG A;  3G4S Q;  3M9Q A;  1RAH B;  3FDR A;  5HKC A;  2E5Q A;  3REB B;  2CP6 A;  2Y90 A;  2IVW A;  1QLY A;  3GBQ A;  5GMK m;  2CUB A;  2E1H A;  1EIF A;  4J9B A;  2JJ9 A;  3U23 A;  4II1 A;  5GMK h;  4FM4 B;  4C8Q G;  5CQX A;  5FU6 C;  2DKG A;  2ZPE B;  3DKM A;  3R6O A;  3I56 T;  1WX6 A;  1NEB A;  2NYS A;  1U8R A;  2DE0 X;  1KQS S;  2GFA A;  2V1R A;  3CEY A;  2VUB A;  1K4U S;  4KUD K;  3URG A;  1MMA A;  1UGR B;  2GQV A;  3CCR A;  1O9S A;  1ZSZ B;  1XNI A;  5GAO p;  4RCC A;  5I11 A;  2A28 A;  2PVO B;  1K9M U;  2X4J A;  5FRN A;  2I0N A;  3VYH B;  2LJ3 A;  4J7I A;  2CP7 A;  5EC7 A;  1VQ5 Q;  2XD0 A;  2FPE A;  3CCQ T;  1K8A U;  1MV3 A;  2LT1 A;  3O5Z A;  3PMT A;  3VS3 A;  3G71 T;  4XAX B;  2G6F X;  4F7U A;  5I22 A;  3PGG A;  3E9G A;  1SSF A;  3CCE Q;  3X25 B;  5M9O A;  5FU6 B;  2BKD N;  3VS7 A;  3G7Z A;  1IO6 A;  1Q7Y U;  3OS0 A;  3CCV A;  2LT4 A;  1VQ6 T;  2VGM A;  3EG0 A;  4FSS A;  1K8A C;  2CH4 W;  2EAY A;  5GMK i;  5GAN 7;  4M7A C;  5IHK A;  4M75 B;  4K11 A;  3I56 A;  4VUB A;  4M7A E;  2P0Q A;  4J7F A;  4QVD A;  2JXB A;  4DOV A;  2A36 A;  5FLX E;  2K79 A;  1PWT A;  4J83 A;  1H3Z A;  1UEB A;  1EX4 A;  2IIM A;  3JCM W;  3HSB A;  5GJV B;  2DLP A;  3VRZ A;  1YCS B;  2K3B A;  3EGX A;  3PTA A;  1VQ9 Q;  4M77 G;  2RHU A;  3OSS C;  3RES A;  1TXQ A;  3GP8 A;  1U3O A;  2F5T X;  3LH5 A;  1BBZ A;  1YWP A;  4WCI A;  3CPW P;  4JS5 A;  2FYK A;  3THK A;  2DK3 A;  3OQ5 A;  1VQ4 A;  2ZPF B;  1K9M R;  5LJ5 d;  1PRL C;  4EIK A;  4RKU E;  1BI2 A;  3TEE A;  4EMK A;  3CC7 Q;  1VQN A;  3UDC A;  4PJJ A;  2YHT A;  3VYG A;  3WVE B;  2DXC A;  1KC8 R;  3JB9 J;  2HEQ A;  2JS0 A;  5DLO A;  4XTU A;  5GMK j;  1K9A A;  2X4X A;  3ME9 A;  1NJI U;  4QQD A;  1U1T A;  3SWN B;  2VYT A;  1PSF A;  4M7A B;  1WLP B;  1UB4 A;  3NHN A;  4IUQ A;  4C92 C;  2QEX T;  3QZ5 B;  2OTL T;  5A2Q E;  3VUB A;  1C6V X;  3MP8 A;  2RJE A;  3OYG A;  2L3P A;  4QW2 A;  2JTF A;  1I5O B;  5HCK A;  1T3S A;  3QUI A;  3VS0 A;  1Y57 A;  2QTV A;  3H0I A;  1WJS A;  4XTW A;  1K76 A;  2M16 A;  4N4H A;  1NJI C;  4ORZ A;  1CKB A;  2CSQ A;  1BB9 A;  4BAC A;  1JQQ A;  4DBR A;  1GCQ A;  2ZCF B;  2P0P A;  4M4Z A;  4J6X A;  3CCL Q;  4M78 F;  4HXJ A;  1YJ9 T;  1YJN T;  4OMQ A;  3CCL T;  1G83 A;  1K0S A;  2V26 A;  1WXU A;  1D1B A;  4C8Q C;  4BE2 A;  4X9C A;  3TRE A;  2VKN A;  3LGL A;  3QYH B;  2M9U A;  4PJO G;  2RI2 A;  5CKH A;  2M51 A;  4KGV B;  3CCU T;  3A8O B;  2RHX A;  2KYB A;  1OEB A;  3PIP A;  2C0O A;  1YHQ T;  3H0H A;  1ZLM A;  4FW2 A;  2BZ8 A;  2YRC A;  1IRE B;  1OX9 A;  1YNZ A;  2ENM A;  3CD6 T;  3QSU A;  2FZC B;  2X4W A;  1QMC A;  2DTO A;  1VUB A;  4KRT A;  3BDU A;  4J9F A;  1VQ8 Q;  3LWH A;  2DYB A;  2HCK A;  2KT8 A;  2PVG B;  1RAA B;  1KIK A;  2G3R A;  4F7U E;  4C0Z A;  4DBQ A;  2EYW A;  2M1H A;  1RAF B;  4KT0 E;  5LJ3 h;  2KGT A;  5GAM g;  1XQH A;  3QG1 A;  2JS2 A;  1Q82 C;  3MJX A;  2HSE B;  1M9S A;  4LDU A;  5IN1 A;  3L1A A;  2RHZ A;  4A4K A;  4M7D D;  3JCM c;  4E7J A;  2X3X D;  4BY6 C;  2JMA A;  4M75 A;  4C92 D;  1JU5 C;  3QII A;  2CUD A;  3SFM A;  4V2S A;  2KR3 A;  1WA7 A;  1MMN A;  4LDY A;  1V76 A;  1I8F A;  1PRM C;  5DM7 R;  1VQ4 Q;  3O8V A;  3QJ6 A;  3CXC A;  4LD9 K;  1Q7Y C;  4DA4 A;  3OYY A;  1SHF A;  4FIB A;  2LQK A;  3HRU A;  2HBP A;  3CMA T;  2DD5 A;  1KQS P;  4O6J A;  5LJ3 f;  2H8H A;  3CC2 T;  1NPR A;  1UGQ B;  1K73 R;  2NUP B;  2O31 A;  5GAN 5;  1VQ6 A;  4MMK A;  4E7K A;  3T9N A;  3C94 A;  1G3W A;  1D0Y A;  3CCM A;  1NBE B;  2SEM A;  2RHI A;  2CZ7 B;  4IUT A;  4D8K A;  4JRQ A;  4QQG A;  3AT1 B;  2RJC A;  4YTL A;  1BKB A;  3JSC A;  1OPL A;  5GAN h;  4LDW A;  1M1K C;  1M1K U;  1VIF A;  2PVD B;  3QPH A;  3UT1 A;  2OTJ T;  1ZUK A;  3C95 A;  4ZGJ B;  3LWI A;  1GCP A;  3CQT A;  3GOX A;  2QYZ A;  1QVG S;  3ZL7 C;  5GAN e;  2OTJ A;  1IRX A;  1VYU A;  3EG2 A;  3X26 B;  4JDS A;  1UGP B;  1OZ2 A;  4F7U G;  3OYM A;  5I2S A;  1LOJ A;  1JB0 E;  3EFR A;  1WPY A;  2ZPG B;  3M0S A;  5C6S A;  3JB9 F;  3CCS Q;  4F7U F;  1PKT A;  3JV3 A;  1WJQ A;  3CCR T;  2D0N A;  1LNX A;  3CCM Q;  5KYW B;  1K1Z A;  1WIE A;  3EH1 A;  3GLX A;  1LJO A;  1T3L A;  3RKY A;  1HJD A;  3RBB B;  5GAM j;  1I5L A;  3HTR A;  3VS4 A;  3EFO B;  4PJL A;  1OU8 A;  1PD1 A;  4IUV A;  3OS2 A;  3SWN C;  1Y7X A;  1YWO A;  2RQT A;  2NLU A;  2DET A;  2X51 A;  4XU3 A;  3JB9 I;  2AIR B;  3M0R A;  1W4S A;  2EKH A;  2NUT B;  1WHK A;  3RDV A;  1AVZ C;  1F1B B;  4JLI A;  3OSV A;  2LDM A;  2VVK A;  1VQ4 T;  1VQK T;  4BI3 A;  2HKN A;  4JPB W;  2DXT A;  3NGP A;  5LJ5 j;  4AMC A;  4JZ4 A;  1D1C A;  3MCA B;  2L2P A;  1M5Q 1;  3M58 A;  3M55 A;  1YJW T;  2HMA A;  4LN2 A;  1KHI A;  3OYE A;  3GNF B;  1X6G A;  2EFI A;  2MIO A;  1D0X A;  2CP2 A;  2BIV A;  1HSQ A;  3A1P A;  3PE0 A;  1VQ8 A;  2GTO A;  2KBT A;  4KH0 B;  1AEY A;  1ACM B;  1B34 A;  1XOV A;  1J3T A;  4LXC A;  1UTI A;  1ZX6 A;  4M75 E;  3RKX A;  2RO0 A;  2DRK A;  2EJ9 A;  1KQ1 A;  1R0B G;  2JT4 A;  1RAD B;  4E6R A;  1LCK A;  2WAC A;  2K57 A;  1VQ5 T;  4M77 F;  4IIO A;  3CCQ Q;  1M4Z A;  3CD6 Q;  5IH2 A;  3CCQ A;  4N4I A;  3G71 Q;  4DOW A;  1B07 A;  3R6N A;  3EGU A;  3QWX X;  3CBO A;  2YRV A;  4OGE A;  1YN8 A;  4J9H A;  4L59 A;  3VJP A;  5D7U A;  2VGN A;  1GFD A;  2YLC A;  2W0Z A;  2C06 A;  3HRT A;  2GTJ A;  4J9E A;  3QKJ A;  1BYM A;  1VQL T;  4M7D F;  3FC3 A;  3ASK A;  1Y71 A;  1WFW A;  3CCM T;  3L2R A;  2EYQ A;  1NYG A;  2CT4 A;  4PFP A;  1RAI B;  1T0H A;  5FU7 B;  4BUG A;  4J9G A;  5KYW A;  2VB6 A;  2DTH A;  2DER A;  1TG0 A;  3VRY A;  5GAN j;  4A53 A;  1RI9 A;  2J6O A;  4C5I A;  3G1J A;  3JCM g;  3VS2 A;  2YUN A;  4DBF A;  5KYY B;  5HK3 A;  2AZS A;  2E65 A;  2LCL A;  2DMO A;  1W70 A;  1WXT A;  1FMK A;  2ZGW A;  1YJW A;  2KRN A;  1UGS B;  4F17 A;  1QCO A;  1VQM Q;  4HVU A;  1BU1 A;  2MAM A;  3I35 A;  1VQM T;  2LX7 A;  4J9D A;  2XID A;  5CKB A;  2J7I A;  1VYT A;  2EBP A;  1VQ7 Q;  2ZPH B;  3PT9 A;  2XU8 A;  3ULR B;  4DQ2 A;  3A8H B;  3OYJ A;  5LJ5 e;  1WGS A;  5LL6 S;  2GBQ A;  3MP1 A;  3CCJ Q;  3EG9 A;  3CXC P;  1KJW A;  5CO7 A;  4P5N A;  2OI3 A;  2RD1 A;  2KK4 A;  8AT1 B;  5LJ5 h;  3JRZ A;  2C0I A;  1GBR A;  2DVJ A;  3EHQ A;  2LC4 A;  3TQ7 P;  2JM9 A;  4M75 F;  2AHJ B;  2IG0 A;  1X6B A;  5KE2 A;  2X4Y A;  5FRM A;  5HY6 A;  4AG1 C;  1MHN A;  2J06 A;  1WNL A;  3OW2 S;  3P8H A;  4M78 A;  2EGE A;  1R8O B;  2EGA A;  1C1A A;  2QK0 A;  2DL5 A;  2QI2 A;  2LCC A;  2FRW A;  3H41 A;  2MMP A;  5IHI A;  2EJF A;  1SRL A;  1VQO A;  3OB9 A;  1VQ9 A;  3J7A F;  4JJN K;  5A0D A;  2L0A A;  1AWO A;  2DIG A;  4LDX A;  2RI3 A;  2XHC A;  4ZNX A;  4M7A D;  2K6D A;  5AYF A;  4M7D E;  1ZA1 B;  2ABL A;  2V1Q A;  1WDX A;  3JCM Q;  3GNG A;  4IUR A;  2EQK A;  2XG8 D;  2VC8 A;  3SEM A;  2VXE A;  3F70 A;  1G8X A;  1N6A A;  5KH6 A;  5AT1 B;  5FRO A;  1OU9 A;  4OMF B;  4L6V 5;  3REA B;  3SD4 A;  2E6N A;  1D1A A;  2JTM A;  3UWN A;  1SEM A;  2DAQ A;  1WHH A;  6AT1 B;  2ZAE A;  4LUD A;  1VQ5 A;  2ZZD A;  2RN8 A;  1VQK Q;  1SPK A;  3FJ5 A;  4E7Z A;  1BK2 A;  1VQ9 T;  3M4Y A;  3L2Q A;  1PM3 A;  4PJM A;  2V8K A;  4PKC C;  1QP2 A;  2D9T A;  2YWW A;  4OVA A;  2ED0 A;  5KCO A;  1H92 A;  4M78 E;  1M30 A;  1BIB A;  4Q5W A;  5GAM f;  5CR2 A;  2QG9 B;  1ZSZ A;  2DFU A;  4HCK A;  2YXY A;  4M75 G;  2P4T A;  5DY9 A;  2DPP B;  2FG0 A;  4LNP A;  3E1S A;  3M56 A;  3CPW S;  4M7D G;  4EDU A;  2BTT A;  3TVT A;  3DLL A;  3X24 B;  1UGV A;  2QDY B;  5C0M A;  2DVE A;  3H6Z A;  5GAN f;  5LJ3 d;  4ESR A;  1W2B S;  5LJ5 f;  1Y07 A;  2GQI A;  2J05 A;  1Q81 C;  2RK2 A;  3RER A;  4EPC A;  4HVW A;  2CDT A;  1VQM A;  1FX7 A;  3ZBD A;  1OV3 A;  2CH4 A;  2LRQ A;  1ZHI A;  3QJY A;  5GAN 8;  1MMG A;  3KBG A;  2PZ1 A;  4M77 D;  2E12 A;  4C8Q D;  2WSF E;  1JXO A;  1OYX A;  2XDB A;  2OAU A;  3JCM f;  2XK0 A;  5KYX A;  4PFO A;  2O4X B;  4M7A G;  4C92 F;  1YJ9 Q;  1YJN Q;  1WYX A;  2LTO A;  3CPF A;  1LPL A;  5GAN d;  3CC4 Q;  2NWM A;  4A4F A;  2QGF B;  2EYZ A;  2QXF A;  2LNV A;  3VS6 A;  2COY A;  2RQW A;  3G71 A;  2DBK A;  4C5G A;  4ELY C;  3M0T A;  4C5E A;  2R5M A;  2J6K A;  1M8V A;  4C8Q E;  1ZUY A;  2DTI A;  1EFN A;  1M90 U;  1N8R U;  4HA8 A;  4DEX A;  1TUG B;  2YSQ A;  2ECZ A;  2JVV A;  4J6W A;  4BDZ A;  1M2V A;  2CT3 A;  1WQ7 A;  2FZK B;  2BUD A;  1ABQ A;  3FEO A;  1VOM A;  2BE9 B;  2OTL A;  2DZ9 A;  2QEX A;  4PJO D;  1QWE A;  2DIL A;  1QP3 A;  2RI5 A;  1AZE A;  2RK1 A;  3NTH A;  1AWW A;  1S1N A;  1Y96 A;  3EFS A;  4BDY A;  3HL8 A;  5I2M A;  3G6E Q;  2K3Y A;  4BB7 A;  3HFO A;  4A4G A;  1WHG A;  3D7S B;  2DXU A;  4PNO A;  2E5K A;  5LJ3 e;  1BI1 A;  3HKS A;  4A63 B;  4F04 B;  3CPW A;  3RIR A;  3DB4 A;  1OQK A;  3CC7 A;  4QQ6 A;  4E7H A;  1N8R R;  3E2U A;  4J9I A;  5LJ3 j;  1FYN A;  1WQW A;  4J9C A;  4L5G A;  3JB9 D;  1E6H A;  1YP5 A;  2KYM A;  4A4E A;  3P8D A;  4D8D A;  1K9M C;  5GAM h;  1N8R C;  1KG1 A;  2D8J A;  1ZSG A;  3QO3 A;  4GLM A;  2DEQ A;  4M77 A;  1KD1 U;  4KUI A;  1KD1 C;  4XTZ A;  4KUL A;  1BIA A;  1B34 B;  1RLP C;  4B9W A;  2A0F B;  1G3T A;  3OW2 P;  4Z8A A;  1AT1 B;  4C0F A;  3GPL A;  1QVF A;  3JB9 H;  4RUG A;  3CME A;  4BE1 A;  1SHG A;  3I56 Q;  4OMP A;  4DBH A;  2L3Q A;  2QA4 A;  3M0P A;  1QVF P;  4FCY A;  4CC3 A;  2EIF A;  2Y4X A;  2YUP A;  3WXM B;  1NPP A;  5GAO n;  3ZFJ A;  1ZBJ A;  4N0A A;  1VQP Q;  3OYH A;  1Q81 U;  1X69 A;  3M0U A;  3CME Q;  2OTJ Q;  5LJ3 g;  1VYV A;  2SRC A;  1M2O A;  5L23 A;  3V8L A;  1M3A A;  4C5H A;  1M3B A;  2AZV A;  2O4X A;  3OYA A;  5KYX B;  2HZY A;  3PVL A;  2Y4Y A;  1WZO A;  4TVR A;  2EQI A;  4C92 G;  1VQP A;  1TWB A;  1UJY A;  1SRM A;  2LQW A;  2QGG A;  4OML A;  3OY9 A;  1X01 A;  3JCM P;  2HQH A;  4Z89 A;  1D0Z A;  5GAN g;  2WSC E;  5IXB A;  1MUZ A;  5FU7 C;  1QVG P;  3TSZ A;  5GAN 3;  1M2V B;  1VQ6 Q;  4C8Q B;  3PIO A;  2XMF A;  2K2M A;  4XTV A;  1FMW A;  5HK0 A;  4JRK A;  5J26 A;  1G2B A;  4M77 E;  1UHF A;  3OW2 A;  4PFZ A;  2K2V A;  4A4H A;  1VQP T;  3CC2 A;  2OX7 A;  1UJ0 A;  2KQW A;  1IHV A;  1OI1 A;  2JW4 A;  3M57 A;  2F5K A;  2OTL Q;  1YHQ Q;  2RQV A;  1HK9 A;  3LLR A;  1Q81 R;  2DO3 A;  1QKX A;  2H3E B;  4PJO C;  4MDX A;  4AT1 B;  5KE3 A;  1AWJ A;  4FYY B;  2DF6 A;  1VQO T;  4Z88 A;  3G6E A;  2ROL A;  1IHW A;  1Q86 R;  3MEA A;  4WTO B;  2HD0 A;  2LQN A;  4FT4 A;  5J39 A;  4C92 E;  1S72 A;  3VUZ A;  1W2B P;  1T0J A;  2QQR A;  4M7D C;  1PD0 A;  3UA6 A;  2ATC B;  3DB3 A;  2ED1 A;  5L8R E;  4AFS C;  1SKU B;  7AT1 B;  1Q95 G;  2CZ0 B;  2COZ A;  1KC8 C;  2EQJ A;  1KSW A;  1I4K 1;  3J81 E;  2EYX A;  4M78 D;  5KYU B;  2K5L A;  5CAI A;  1RAG B;  2D6F A;  2P0K A;  4F7U B;  1I81 A;  3G6E T;  1I07 A;  2E41 A;  1KFZ A;  3V8J A;  1P92 A;  4X9D A;  2D0Q B;  3CD6 A;  2KRM A;  4FU6 A;  2LX9 A;  3MEU A;  5CVI A;  3QDR B;  1WI7 A;  1JBM A;  3EGX B;  3LX7 A;  5IAY A;  2OAW A;  1RL2 A;  4E2F B;  3KUF A;  2L8D A;  4XTX A;  2HKQ B;  4M77 B;  4HCZ A;  3JAM E;  4HKE A;  3CCU A;  3CCL A;  2K7A A;  1IGU A;  1YJ9 A;  1YJN A;  3S3N A;  1RAB B;  3C12 A;  1FWZ A;  5D6W A;  2GNC A;  4J5Y A;  2EJG A;  2RA2 A;  1S72 Q;  4C0D C;  2JNG A;  2QAS A;  1HYO A;  2CP0 A;  1I0C A;  2AK5 A;  4XU0 A;  1EZZ B;  2M0O A;  2R5A A;  3JCM h;  1KK7 A;  4EMK C;  1TTH B;  4A54 A;  1PNJ A;  2YT6 A;  2GF7 A;  1E6G A;  4IUU A;  1MNE A;  2DZC A;  3JCM b;  2PTK A;  1TSF A;  4PLL A;  5GAN 2;  4ZTJ A;  2PU9 B;  1YI2 Q;  1ZUU A;  4RTW A;  3I9Q A;  2COW A;  2LCS A;  1N9S A;  1PSE A;  3EFO A;  2O2O A;  3OMC A;  4IIM A;  1VQ8 T;  3V7S A;  2K3X A;  1MMD A;  1R0C B;  3NPF A;  4FT2 A;  3UAT A;  2XKO C;  1VQL Q;  3LH0 A;  5GAO q;  3OBY A;  1VQN Q;  4R55 A;  3J80 E;  3SDZ A;  3FRN A;  5GJW B;  2KSS A;  3H8Z A;  3OYF A;  2X3W D;  3MEW A;  1UE9 A;  4GLK A;  2GGR A;  1R77 A;  4RG8 A;  4JRI A;  3CME T;  2HL3 A;  3MEV A;  1OPK A;  2DRM A;  2LP5 A;  4OMN A;  2DD4 A;  3PVQ A;  1VQK A;  3L2W A;  1GCQ C;  1G5V A;  1WHM A;  2H3J A;  2V8J A;  4NL3 A;  2JM8 A;  2RB6 A;  4C8Q A;  5DLQ E;  3RNJ A;  3L2U A;  3QZ9 B;  2KXD A;  3EG1 A;  1QVF S;  4J8O A;  1RUW A;  2HBW A;  5GAM d;  1VQO Q;  3MP6 A;  3OS5 A;  2K9G A;  2HAX A;  3TCJ A;  1FMV A;  4RTX A;  3OYK A;  3CC7 T;  1ARK A;  4BI8 B;  3A5Z B;  2QA4 Q;  1W2B A;  1AWX A;  2JMC A;  9ATC B;  2ZPI B;  4F16 A;  3BY7 A;  1A0N B;  3CCE A;  3QBY A;  5CKF A;  3LYI A;  1GBQ A;  4KH1 B;  2CZ1 B;  4J6Y A;  5GAO m;  2KMT A;  2CZ6 B;  4OMO A;  5A0G A;  4BI4 A;  1VQL A;  2L5Q A;  2A08 A;  4NL2 A;  4OF1 A;  1WJR A;  1Q86 U;  4PJO F;  1YIT T;  2K5F A;  4D6W A;  2ROT A;  2KI7 A;  3OYN A;  5GMK l;  2VV5 A;  2PUK B;  3N5B B;  2CSI A;  2Z0W A;  5CIU A;  2FPF A;  4BD3 A;  2AKK A;  2XI9 A;  1UDL A;  2D8H A;  2MOX A;  4CC7 A;  4CRI A;  4IKF A;  2MF2 A;  1YJW Q;  4HT8 A;  2XIC A;  4M78 C;  3S6W A;  3FB9 A;  3PMI A;  1KHC A;  4HCB A;  4LD6 A;  3HRS A;  2R58 A;  4C8Q F;  1MND A;  2KVQ G;  5CQY A;  4JLG A;  2EYY A;  1G3Y A;  3JB9 G;  4X1V A;  3I5S A;  2EGC A;  5CKD A;  5GMK e;  2QTX A;  2JZ2 A;  3A8M B;  3L2Z A;  1UFF A;  1CKA A;  1BCM A;  3H0F A;  1JJ2 A;  2DX1 A;  3BW1 A;  2F2X A;  4ATO A;  4OMM A;  3CCU Q;  5KYU A;  1BI3 A;  4AG2 C;  2CRE A;  2HQX A;  4NS5 A;  4FW1 A;  1KC8 U;  2E64 A;  2A3L A;  2KNB B;  1Y96 B;  1U06 A;  4QVZ A;  1D3B B;  4ZN1 A;  4HCC A;  2LNH B;  2B86 A;  5GAO r;  2M02 A;  1XTD A;  2FO0 A;  4KGX B;  4HT9 A;  2BZY A;  1QWF A;  4JS4 A;  1TU0 B;  2L89 A;  2XDD A;  3LGF A;  3FJP A;  4XK8 E;  1SG5 A;  1MV0 B;  2EQU A;  1QW1 A;  4XTY A;  3RUX A;  4FYW B;  3OA6 A;  1S72 T;  1NG2 A;  2P4R A;  1OOT A;  3M5A A;  3CC4 T;  2LZ6 B;  2VWF A;  1M1F A;  1RLQ C;  3NFC A;  4M78 B;  1M27 C;  2KAF A;  4C0G A;  3QWY A;  1MGQ A;  3A8L B;  4CC2 A;  5KYN A;  3M53 A;  4FYV B;  5IXF A;  4RMO A;  2FEI A;  2VAS A;  2CP5 A;  4LDV A;  5CCA A;  3ER0 A;  3TSW A;  3V8K A;  1ZQ1 A;  2YUQ A;  3A98 A;  3TU4 K;  3A8G B;  3CCS T;  3SWN A;  3V7R A;  1IZ6 A;  2OJ2 A;  3MO8 A;  4OGC A;  1YFN A;  1H8K A;  2QAZ A;  2QQS A;  1AHJ B;  1VA7 A;  2DM1 A;  4E47 A;  2KRO A;  3EGD B;  1X75 C;  1I1J A;  1N5Z A;  3CC2 Q;  4KGZ B;  1WXB A;  2LMJ A;  4JJC A;  4AFZ C;  2KRS A;  4MML A;  5A0L A;  3OYL A;  3L2V A;  2BZX A;  2EWN A;  3FLG A;  2A37 A;  2RM4 A;  4E7S A;  1N9R A;  4DEY A;  1SSH A;  5D6X A;  3X20 B;  2E10 A;  2E70 A;  4KBM B;  2KT1 A;  3G4S T;  1YIT A;  2CYZ B;  2KY9 A;  2CP3 A;  2DL8 A;  2DL3 A;  4O5V A;  1QVP A;  2DNU A;  1C0M A;  4PL6 A;  1Q7Y R;  3EG3 A;  2AKL A;  4B9X A;  2I2L A;  4FSX A;  4BE0 A;  4MZM A;  3CCJ T;  4PJO B;  1M8M A;  5FWC A;  2LJ1 A;  2RNA A;  4M75 C;  1QCN A;  2MI6 A;  1W1F A;  3SHW A;  2HDA A;  1NEG A;  4GY5 A;  4CC4 B;  1GL5 A;  8ATC B;  3IQL A;  3RMS A;  3VKI A;  3RR6 A;  4QKU A;  4MZP A;  1Q86 C;  1M90 R;  1YBY A;  4EMG A;  1PC0 A;  1ZSZ C;  1GXI E;  2L3S A;  4ZN3 A;  3BFM A;  1H64 1;  2KDS A;  1JJ2 P;  1NZ9 A;  4ME7 A;  2F2W A;  4Y92 A;  4PJO A;  1H3H A;  4PJO E;  2MCN A;  2X35 A;  3MHX A;  1PCX A;  4OB3 B;  2LJ0 A;  2XDP A;  4C92 B;  1NLO C;  4MZT A;  1UG1 A;  1PKS A;  3KXT A;  5IT9 E;  3M59 A;  4JUV A;  3HFN A;  1VIE A;  1TUC A;  3H9N A;  1DJ7 B;  3SB2 A;  1XJW B;  1N27 A;  4Y91 A;  4M7D A;  1ZBX A;  2R57 A;  3CCR Q;  1X2Q A;  1BCO A;  5LJ5 g;  2VXF A;  3INZ A;  3GIB A;  1NE8 A;  1FXX A;  2CGH A;  3EHR A;  3V7C A;  4LUE A;  2WSE E;  1WHJ A;  3CCV T;  3OYC A;  3I55 A;  2A7Y A;  2FVU A;  1NJI R;  3UA7 A;  3JCM e;  1GFC A;  4ELZ C;  3GF5 A;  5KCH A;  4JJD A;  3EGD A;  1M1G A;  1KQS A;  4M7A A;  3HP9 A;  1YI2 A;  1Z9Z A;  2QEX Q;  2RQU A;  5IHN A;  2B8A A;  4M77 C;  1ABO A;  3I5R A;  4Z02 A;  3CBP A;  4ANJ A;  2M0Y A;  1M1K R;  3JCM d;  1YI2 T;  2DIQ A;  1JRI A;  3EG9 B;  2GCX A;  3VU3 C;  1CSK A;  2C0T A;  2V8I A;  4RTZ A;  3BE3 A;  2EQM A;  4QT7 A;  3UPU A;  3CCE T;  1IXD A;  4AFU C;  3P8B B;  1NLP C;  3QXE B;  4M7D B;  3I55 T;  5KYY A;  2FHD A;  4N0A C;  2FPD A;  1NM7 A;  1QCF A;  2KXC A;  4XU1 A;  2RMO A;  3KFV A;  1X43 A;  3PNW C;  1IGQ A;  3JCM J;  3OS1 A;  1UUE A;  1U5S A;  2RPN A;  1KD1 R;  3CMA A;  4RCB A;  4JRP A;  2QQB A;  1M3C A;  1K73 C;  2YDL A;  1QQJ A;  2HSP A;  2HQE A;  3OYB A;  5GAN 6;  1U1S A;  4XU2 A;  3JCM X;  1GRI A;  2F2V A;  4IUP A;  3HPW A;  3NMZ C;  3QHS A;  5EG2 A;  4M75 D;  2ESW A;  4C92 A;  3EH2 A;  1Q82 R;  1SF9 A;  2YLB A;  2GFU A;  2DJQ A;  4ZTF A;  3QYG B;  3M0Q A;  3CMA Q;  2EVR A;  1PHT A;  4XQ3 A;  1JEG A;  3VS5 A;  2X9H A;  2E6Z A;  1HXD A;  4E7L A;  4JJB A;  1AOJ A;  1M90 C;  4FL6 A;  4C0D B;  3C0C A;  1OUL A;  4GBQ A;  2NUZ A;  3JCM V;  4B6M A;  3QDF A;  4RTY A;  4CI0 C;  2E3H A;  3S3M A;  3ZEH A;  3MET A;  4OB2 B;  3OBW A;  1OX8 A;  2ZPB B;  1RAC B;  1K0X A;  1YHQ A;  2DA9 A;  2E4H A;  1AZG B;  2IPO B;  1X6O A;  2EW3 A;  4RG2 A;  2P84 A;  2E3I A;  4RTT A;  1RI0 A;  2HNI A;  3X28 B;  1TOV A;  1OZ3 A;  5GAN 4;  1UHC A;  1UEC A;  1TS9 A;  2QQA A;  3DLM A;  2RHY A;  2FZG B;  3OYI A;  2W10 A;  3I55 Q;  4OP0 A;  3MKD A;  4JZ3 A;  2NUT A;  5GAO l;  4QVC A;  2HL5 C;  3C4S A;  1PG5 B;  1KQ2 A;  3WVD B; 
#chains in the Genus database with same CATH homology
 2PZ1 A;  1JXO A;  2EYW A;  1HD3 A;  2KGT A;  2ROT A;  2JS2 A;  2CSI A;  1WYX A;  2FPF A;  2AKK A;  1UDL A;  2D8H A;  2MOX A;  4CC7 A;  2X3X D;  2JMA A;  1JU5 C;  2NWM A;  2CUD A;  2D1X A;  2KR3 A;  2EYZ A;  1WA7 A;  2QDL A;  1X2K A;  3VS6 A;  1PRM C;  2YUO A;  2RQW A;  2DBK A;  1JXM A;  2EYY A;  3M0T A;  1SHF A;  2J6K A;  1ZUY A;  4X1V A;  3I5S A;  2EGC A;  1EFN A;  4DEX A;  2O88 A;  1UFF A;  1CKA A;  3H0F A;  4R0K A;  2KE9 A;  2DX1 A;  2F2X A;  4OMM A;  2H8H A;  2YSQ A;  2ECZ A;  1NYF A;  4AG2 C;  2CRE A;  2CT3 A;  2O31 A;  1ABQ A;  4RTU A;  2KNB B;  2FRY A;  2O9V A;  1U06 A;  2SEM A;  2LNH B;  4D8K A;  2B86 A;  1QWE A;  2KEA A;  2DIL A;  2FO0 A;  5ECA A;  4RTV A;  1AZE A;  2BZY A;  1QWF A;  1OPL A;  5FWB A;  1AWW A;  1S1N A;  1ZUK A;  1MV0 B;  2E5K A;  1GCP A;  3CQT A;  4A63 B;  3ZL7 C;  1NG2 A;  1VYU A;  3EG2 A;  4J9I A;  2J6F A;  1FYN A;  2P4R A;  1V1C A;  1OOT A;  2RQR A;  2LZ6 B;  4J9C A;  2VWF A;  1Z9Q A;  1RLQ C;  1B3Q A;  1E6H A;  1YP5 A;  4AFQ C;  3M0S A;  1M27 C;  1TUD A;  2KYM A;  1PKT A;  3QWY A;  3JV3 A;  4D8D A;  2JTE A;  2D0N A;  4F14 A;  4CC2 A;  1JO8 A;  2D8J A;  1ZSG A;  4GLM A;  1K1Z A;  1WIE A;  5IXF A;  2FEI A;  1T3L A;  3TSW A;  1HJD A;  2O9S A;  3RBB B;  2YUQ A;  1RLP C;  3A98 A;  3VS4 A;  4Z8A A;  4RUG A;  4LE9 A;  1X27 A;  2OJ2 A;  1SHG A;  1AD5 A;  1H8K A;  1YWO A;  2RQT A;  4OMP A;  1VA7 A;  2L3Q A;  2DM1 A;  1W6X A;  3M0P A;  2KRO A;  1I1J A;  4CC3 A;  1N5Z A;  3M0R A;  2EKH A;  2YUP A;  1WXB A;  2LMJ A;  1AVZ C;  4JJC A;  4AFZ C;  2DL7 A;  2KRS A;  1ZBJ A;  2VVK A;  1X69 A;  3UF4 A;  2DL4 A;  3M0U A;  2BZX A;  2RF0 A;  4HVV A;  4JPB W;  5FW9 A;  1VYV A;  3NGP A;  2A37 A;  2SRC A;  5L23 A;  3VS1 A;  4DEY A;  1M3A A;  4JZ4 A;  1SSH A;  1E7O A;  1M3B A;  2AZV A;  2L2P A;  3PVL A;  2EQI A;  2EPD A;  1UJY A;  4LN2 A;  1QKW A;  2KT1 A;  1SRM A;  2LQW A;  4OML A;  1X6G A;  2MIO A;  2DBM A;  2DL8 A;  2DL3 A;  4Z89 A;  1HSQ A;  2DNU A;  1Y0M A;  3PE0 A;  5IXB A;  2GTO A;  1MUZ A;  2KBT A;  1AEY A;  2PNI A;  1XOV A;  3TSZ A;  1J3T A;  3EG3 A;  2AKL A;  1UTI A;  1ZX6 A;  2XMF A;  2K2M A;  1M8M A;  5FWC A;  2LJ1 A;  2DRK A;  2RNA A;  3REB B;  1G2B A;  2JT4 A;  4E6R A;  1LCK A;  1UHF A;  1W1F A;  1QLY A;  3GBQ A;  2CUB A;  3SHW A;  2HDA A;  4J9B A;  1NEG A;  4CC4 B;  3U23 A;  1GL5 A;  3IQL A;  4IIO A;  1UJ0 A;  5IH2 A;  1B07 A;  3R6N A;  3EGU A;  3QWX X;  2JW4 A;  1YN8 A;  4J9H A;  2RQV A;  1GFD A;  1WX6 A;  1NEB A;  2L3S A;  2W0Z A;  2GTJ A;  4J9E A;  1QKX A;  2DE0 X;  2F2W A;  4Y92 A;  1AWJ A;  2V1R A;  1K4U S;  1H3H A;  1WFW A;  2DF6 A;  2MCN A;  4Z88 A;  1NYG A;  2CT4 A;  2ROL A;  2LJ0 A;  1T0H A;  4J9G A;  1NLO C;  2LQN A;  1UG1 A;  1PKS A;  1TG0 A;  3VRY A;  5I11 A;  2A28 A;  1RI9 A;  1TUC A;  2J6O A;  2I0N A;  1T0J A;  2LJ3 A;  3VS2 A;  2YUN A;  5EC7 A;  3UA6 A;  4AFS C;  2AZS A;  2ED1 A;  2DMO A;  1W70 A;  1X2Q A;  1WXT A;  1FMK A;  2FPE A;  1KSW A;  1MV3 A;  3O5Z A;  3VS3 A;  2EYX A;  2KRN A;  2G6F X;  5I22 A;  3EHR A;  4F17 A;  4LUE A;  4HVU A;  1BU1 A;  3I35 A;  1I07 A;  3UA7 A;  2LX7 A;  1KFZ A;  4J9D A;  3VS7 A;  1GFC A;  2J7I A;  1VYT A;  2EBP A;  1IO6 A;  4JJD A;  3ULR B;  3EG0 A;  2KRM A;  4FSS A;  2GBQ A;  1KJW A;  2CH4 W;  1Z9Z A;  2RQU A;  5IHK A;  1WI7 A;  5IHN A;  4K11 A;  2OI3 A;  1ABO A;  2OAW A;  2JXB A;  2C0I A;  3I5R A;  2A36 A;  2M0Y A;  2K79 A;  1PWT A;  1GBR A;  2DVJ A;  3EHQ A;  2IIM A;  2JM9 A;  5GJV B;  2DLP A;  2K7A A;  3VRZ A;  1X6B A;  1CSK A;  1YCS B;  2K3B A;  2C0T A;  4RTZ A;  4AG1 C;  2J06 A;  4QT7 A;  2GNC A;  2EGE A;  2EGA A;  4AFU C;  2DL5 A;  1U3O A;  3LH5 A;  1BBZ A;  1YWP A;  4WCI A;  2FRW A;  3H41 A;  3THK A;  1NLP C;  5IHI A;  1I0C A;  2AK5 A;  1SRL A;  2FPD A;  1NM7 A;  1QCF A;  2KXC A;  1PRL C;  2RMO A;  3KFV A;  1X43 A;  4EIK A;  2L0A A;  1AWO A;  1PNJ A;  2YT6 A;  1UUE A;  1U5S A;  2RPN A;  1E6G A;  4ZNX A;  2K6D A;  2PTK A;  1M3C A;  2YDL A;  2HSP A;  2ABL A;  2HEQ A;  2JS0 A;  2V1Q A;  1WDX A;  1K9A A;  1ZUU A;  4RTW A;  3I9Q A;  2LCS A;  1GRI A;  2F2V A;  1WLP B;  3NHN A;  3NMZ C;  2O2O A;  3SEM A;  4IIM A;  2ESW A;  3NPF A;  3UAT A;  3REA B;  2DJQ A;  3M0Q A;  2EVR A;  2L3P A;  5GJW B;  1PHT A;  1SEM A;  2X3W D;  1JEG A;  1UE9 A;  4LUD A;  3VS5 A;  2GGR A;  5HCK A;  1T3S A;  2RN8 A;  1SPK A;  3VS0 A;  3FJ5 A;  1BK2 A;  1Y57 A;  3H0I A;  4JJB A;  1AOJ A;  1OPK A;  2DRM A;  1K76 A;  2LP5 A;  3C0C A;  4OMN A;  4GBQ A;  4ORZ A;  1CKB A;  2CSQ A;  2ED0 A;  2NUZ A;  3PVQ A;  1BB9 A;  1H92 A;  1GCQ C;  1M30 A;  1JQQ A;  1GCQ A;  4RTY A;  4M4Z A;  4HCK A;  4HXJ A;  4OMQ A;  2FG0 A;  2JM8 A;  1G83 A;  1K0S A;  1WXU A;  3RNJ A;  4LNP A;  1K0X A;  2VKN A;  2KXD A;  3EG1 A;  2DA9 A;  1AZG B;  1RUW A;  2M51 A;  2BTT A;  2HBW A;  2EW3 A;  3TVT A;  2K9G A;  2KYB A;  1OEB A;  4RTX A;  1ARK A;  1UGV A;  2C0O A;  3H0H A;  1ZLM A;  4RTT A;  2BZ8 A;  1AWX A;  4ESR A;  2JMC A;  1UHC A;  1UEC A;  2GQI A;  2J05 A;  1YNZ A;  4F16 A;  2ENM A;  1A0N B;  2W10 A;  4HVW A;  2CDT A;  1GBQ A;  4JZ3 A;  4OMO A;  4KRT A;  1OV3 A;  2CH4 A;  4J9F A;  2A08 A;  2DYB A;  2HCK A;  2KT8 A;  1KIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...