4D8DA

Crystal structure of hiv-1 nef fyn-sh3 r96w variant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
b'TLFVALYDYEAWTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase Fyn
publication title SH3 domain specificity
rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
total genus 12
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4d8dA00
2KRMA 2SRCA 1YP5A 1Y57A 1VA7A 5IXFA 5I22A 2DNUA 2PTKA 1UE9A 1KSWA 2A28A 2OJ2A 2JM8A 2DRKA 2EYXA 2L0AA 2CREA 1NM7A 2BZ8A 2DL4A 2JTEA 2J7IA 2ED1A 2EVRA 3M0UA 3QWYA 1WXUA 2VWFA 1JO8A 3JV3A 1ZBJA 4QT7A 1ZLMA 1M3BA 1RLPC 2DBKA 1KJWA 4JPBW 3R6NA 1S1NA 1WDXA 1W70A 4Z88A 2EGCA 4WCIA 1K0SA 1EFNA 3IQLA 4HCKA 1AOJA 1X43A 1UJYA 2YUPA 4LUEA 1QKXA 2J6FA 3H0IA 1V1CA 2HSPA 1WFWA 1GL5A 2AZSA 3EG1A 2RMOA 3M0SA 2A37A 2K79A 2VKNA 2D8HA 2EPDA 2V1QA 1ZUUA 2FRWA 1SEMA 1UTIA 2DMOA 2AKKA 2HBWA 4OMOA 3VS5A 2X3WD 4CC2A 4ZNXA 4JJBA 2JXBA 1UDLA 1NYFA 1HSQA 1X2KA 2ECZA 2KR3A 2EYWA 2ROLA 1K76A 2LZ6B 5GJVB 1OPLA 2O9SA 2KNBB 4Y92A 2EYZA 1Z9ZA 1SRLA 1UHCA 4AG1C 3KFVA 1I0CA 2DM1A 1NEGA 1RLQC 2X3XD 1K9AA 2XMFA 4AFUC 4AFZC 2CH4A 3EHRA 1WA7A 2JW4A 2FO0A 2L3SA 2YDLA 2VVKA 4OMMA 3H41A 1K0XA 2K7AA 2LQNA 1AD5A 1PWTA 4E6RA 1JEGA 1T3SA 1T0HA 2K2MA 2AZVA 5IHIA 2RQTA 1K4US 5FWCA 1PNJA 1UFFA 2L2PA 2BZYA 2JS2A 2QDLA 1NG2A 2O2OA 1BU1A 3UA6A 3TVTA 4J9GA 1NLOC 3THKA 2DYBA 2RQWA 1YNZA 2DBMA 2M0YA 4CC4B 4LNPA 1QLYA 3ULRB 1AWWA 5EC7A 3CQTA 3O5ZA 4HXJA 1X6GA 1WX6A 3RNJA 2FPDA 1YCSB 2J06A 2KYMA 2O31A 3H0FA 1ABQA 3VS3A 2KEAA 1PHTA 2YSQA 3LH5A 2MIOA 4D8DA 2GBQA 1MUZA 2ROTA 1UJ0A 2DVJA 1UUEA 1TG0A 2HEQA 1KFZA 1SSHA 1I1JA 1XOVA 4GLMA 3QWXX 2GTJA 2MCNA 1H3HA 1X2QA 1NYGA 1GCQA 2D1XA 1AWXA 2DA9A 3H0HA 3SEMA 1K1ZA 2CUBA 1KIKA 2DILA 1GFCA 2K6DA 2LJ3A 2PNIA 2LNHB 2F2WA 4OMNA 1RUWA 1WIEA 1U5SA 2P4RA 2DE0X 3UA7A 1AEYA 3M0QA 2JT4A 2RQVA 2W10A 2RF0A 1AVZC 4AG2C 4Z89A 2OAWA 3VRYA 1G2BA 1BB9A 2KROA 2FG0A 1U3OA 2JM9A 4J9IA 1T3LA 1GCQC 1WYXA 2DL7A 3TSWA 1X6BA 4IIMA 2OI3A 1JXMA 2G6FX 1NLPC 1E6HA 4M4ZA 2RNAA 1CKAA 4JJCA 1NEBA 4RUGA 2BZXA 2LMJA 4KRTA 2H8HA 2DX1A 3I35A 3U23A 1MV3A 2L3QA 2AK5A 2DL3A 2EQIA 2F2VA 2J6OA 5FWBA 1JU5C 2RQRA 3VS2A 2FRYA 1GCPA 1QWEA 2JMCA 3GBQA 4J9FA 2EGEA 3VRZA 1B07A 4IIOA 1M3AA 1LCKA 1VYVA 3NMZC 1GBQA 1YN8A 3FJ5A 3NPFA 1SHFA 4R0KA 1VYUA 4JJDA 2CH4W 2GGRA 4J9DA 1FYNA 4DEXA 2GNCA 2DL5A 4J9HA 4F16A 1GFDA 2I0NA 4Z8AA 2KRNA 3PE0A 1ZX6A 1A0NB 1E7OA 2V1RA 1X27A 1U06A 2IIMA 2ESWA 1ARKA 2SEMA 4FSSA 2DRMA 2RQUA 2DJQA 1OEBA 1B3QA 2YUQA 2E5KA 1WI7A 3VS0A 1IO6A 2CT3A 2O9VA 4ORZA 3NGPA 2KE9A 4F14A 1PKSA 2C0OA 2EKHA 4J9BA 5GJWB 2CSIA 1ZSGA 3M0PA 2L3PA 2KYBA 1QWFA 2KBTA 4EIKA 4DEYA 4CC7A 1ABOA 3EG2A 1I07A 3I5SA 3REAB 4CC3A 1G83A 1MV0B 1RI9A 1ZUKA 2CUDA 3PVQA 1PRMC 2NUZA 3VS4A 3SHWA 4RTTA 1GBRA 1CKBA 2C0TA 1WXBA 2HDAA 1UGVA 1AWJA 2MOXA 4AFQC 4LE9A 5I11A 4A63B 1Z9QA 4LUDA 3RBBB 1H92A 2A36A 1H8KA 3EG0A 3UATA 1AZEA 1FMKA 2ABLA 2RPNA 1M27C 3PVLA 2KXCA 1UHFA 2O88A 2LJ1A 2KXDA 1SHGA 1PRLC 4RTUA 2GQIA 2PZ1A 2CSQA 4J9CA 1W6XA 3REBB 1VYTA 2GTOA 1YWOA 2F2XA 2KT8A 2DL8A 4HVWA 1WLPB 5L23A 2LCSA 1BBZA 1ZUYA 2KGTA 1PKTA 4LN2A 2ED0A 4GBQA 1M8MA 1OOTA 2RN8A 5ECAA 2J05A 1M3CA 4OMQA 3M0RA 2K3BA 1TUDA 3TSZA 2HCKA 3VS1A 4K11A 1M30A 3I5RA 1QKWA 1UG1A 5HCKA 2LX7A 1J3TA 2FEIA 2JS0A 2CT4A 2W0ZA 2EGAA 1QCFA 1WXTA 1TUCA 1X69A 4F17A 3NHNA 4OMPA 1GRIA 2ENMA 2LJ0A 2EBPA 4HVUA 2M51A 1E6GA 2J6KA 2KRSA 1Y0MA 2K9GA 5IHNA 2C0IA 2LQWA 1JQQA 4RTXA 1N5ZA 4AFSC 5FW9A 5IXBA 1W1FA 4J9EA 4JZ3A 2YUOA 3EHQA 4HVVA 2DF6A 3C0CA 1SPKA 1UECA 1YWPA 2KT1A 2AKLA 4RTWA 4D8KA 4JZ4A 3EGUA 4ESRA 3EG3A 1AWOA 2FPEA 1AZGB 2D8JA 2EYYA 2A08A 3VS6A 1HJDA 3I9QA 1OV3A 2CDTA 5IH2A 2YUNA 2EW3A 2YT6A 1CSKA 2B86A 2LP5A 2D0NA 4RTYA 4X1VA 4RTZA 1T0JA 1JXOA 2JMAA 1BK2A 3M0TA 1SRMA 3UF4A 1OPKA 3ZL7C 1HD3A 3VS7A 5IHKA 2BTTA 2DLPA 4OMLA 2FPFA 4RTVA 2NWMA 3A98A
chains in the Genus database with same CATH superfamily
2KRMA 1N9RA 2JZ2A 2SRCA 1VA7A 2DKGA 2RI5A 2K5FA 1VQMT 5GAOp 3P8BB 2PTKA 2JM8A 4BI4A 2CREA 4JDSA 5I2MA 1YI2T 1Y96B 1VQ9Q 3VUBA 1WHKA 1XTDA 2KAFA 1WXUA 2CP5A 1OX9A 1ZLMA 1Q82U 2XU8A 4LDUA 1S1NA 5GAN2 2EGCA 2JNGA 1QVFS 4Q5WA 3H0IA 1EIFA 2GFUA 2RI3A 2RHIA 3CMAT 3OY9A 5A2QE 3HRTA 1M1KR 5FLXE 4R55A 1ZA1B 2EPDA 2V1QA 1TTHB 2DMOA 2P84A 4OMOA 2JTFA 4ZTJA 4ZNXA 5A0GA 5CKHA 4BY6C 1VOMA 4PNOA 4WTOB 1N6AA 2O9SA 1HXDA 1LOJA 5A0LA 2EYZA 1BIAA 1PSEA 1SRLA 3JCMe 3CMEA 5LJ5j 2HKNA 1I0CA 3GNFB 1QVFA 4E7LA 2XG8D 3FC3A 1K9AA 1X6OA 4AFUC 3EHRA 1WA7A 5HK3A 1VQOA 1BI1A 4KBMB 1QVPA 2YDLA 2VVKA 2QEXT 1PCXA 2LQNA 1PWTA 2HD0A 1TS9A 4A53A 2L8DA 3OS5A 3CCRA 4C8QE 2JS2A 4M75F 3TU4K 4J9GA 3MEAA 4IUTA 1SF9A 2FL7A 2EAYA 1PM3A 4LNPA 4HKEA 2BIVA 3ULRB 2MWOA 1W4SA 3V7CA 4BI3A 1S72Q 5EC7A 1KHCA 3CQTA 3ZBDA 4C8QD 1JJ2S 3VUZA 2E10A 2O31A 2J06A 3H0FA 1M2VA 2XDBA 4BB7A 1UGSB 3OBYA 2GBQA 3CCLQ 1UJ0A 4QVZA 1Y7XA 1KFZA 4Y28E 3E9GA 3TCJA 3P8DA 4FSXA 1MMDA 4EMKA 3QWXX 4TVRA 3MPUB 4M77G 2GTJA 4XAXB 1C0MA 1YJ9A 4XU2A 4JRPA 4FYWB 1K1ZA 2R5MA 4F7UE 2K6DA 2LJ3A 1N8RU 2DEUA 3OYAA 3CPWS 1KC8C 2QTXA 1VQKQ 2MAMA 2RJCA 1FXXA 1AEYA 4PJOA 1JJ2A 3VV0A 3M0QA 4Z89A 2OAWA 3C12A 3VRYA 2F5TX 1IXDA 5GMKe 2QG9B 2RB6A 3I55T 3CCMQ 2EKOA 2F5KA 4EMKC 3META 1M4ZA 4QQ6A 3RMSA 1T3LA 5LJ3j 1VQ8Q 1WYXA 2DL7A 4KGVB 3PIPA 1Q95G 3JCMh 4KUDK 1D0ZA 3UPUA 4M4ZA 1E6HA 4JJCA 1YJWT 1NEBA 4LDVA 4RUGA 5J39A 4BE2A 2OAUA 2PUOB 3CPWA 2H8HA 4J6WA 4M7DG 1RAHB 1VQLT 2AK5A 2EQIA 4LDWA 1NPPA 3OYKA 2GFAA 3JB9H 1BI2A 3VS2A 5GANg 3J7AF 1GCPA 1QWEA 2JMCA 3E19A 4J9FA 2M9UA 1B07A 4A4HA 5D6WA 2CYZB 4M78D 3FB9A 1WGSA 3OW2S 3OYMA 1PD1A 3FJ5A 4BY6B 2K3YA 1SHFA 1K9MR 2G3RA 1VQ6Q 2XDPA 4FIBA 3HFOA 1GXIE 4DEXA 2E41A 4L59A 1Q82C 3CCRT 1VQNA 5GANd 3CC7T 1HYOA 1ZX6A 3NTHA 5GAOn 1E7OA 2QQSA 5GAN7 2LCLA 1WHJA 2SEMA 2DRMA 1OZ2A 3G71A 2FZGB 1MMAA 1VQ5T 2E5KA 1K73R 3CC2A 3N5BB 1R0BG 3OW2A 2KE9A 5GJWB 4HCBA 1VQ7Q 1ZSGA 3I56Q 2L3PA 2KDSA 3ZEHA 4CI0C 1RAIB 4CC7A 1JB0E 3I5SA 5GMKm 4ME7A 1QQJA 2XHCA 4RMOA 5GMKh 4RCCA 4OB0B 3MP6A 1XNIA 4F04B 2DJZA 3KUFA 3S3NA 5IT9E 4CRIA 5LJ5g 1KQSP 3L2RA 4E7HA 3P8HA 4RG2A 1AWJA 3HHTB 3RKYA 4AFQC 4LE9A 5I11A 2LQ8A 2H3EB 3TREA 2DETA 4BE1A 4HT8A 2YWWA 2RJFA 5KYUA 1Q86R 3UATA 4M7AG 2OX7A 2RPNA 4M77D 1M27C 3R6OA 4O5VA 2HSEB 3CCET 1UHFA 2JN0A 1SHGA 1PRLC 4RTUA 2EJ9A 5GMKi 2PZ1A 2CSQA 4E7IA 1YBYA 4M78A 3QSUA 1M2VB 3REBB 3JCMb 5KE2A 3E2UA 5LJ5d 1YWOA 2KT8A 2DL8A 1O9SA 2ZPFB 4HVWA 3JCMQ 1WLPB 4XTUA 2QXFA 1M8MA 1OOTA 2RN8A 5ECAA 4EMKB 2M16A 3MCAB 4OMQA 1NE8A 3TSZA 2E65A 2X35A 3NTKA 3DB4A 3QIIA 5CIUA 2QA4Q 4ANJA 2OTLA 2BUDA 1RI0A 4FYYB 1WXTA 4ZGDB 4IUVA 4F17A 2R5AA 5CVIA 4OMPA 1N8RC 4M78C 2EJGA 3X20B 4PJOB 3HL8A 2J6KA 5J3BA 2R58A 2K9GA 5IHNA 2QQBA 3LW5E 5KCHA 2DAQA 3D7SB 5I21A 1N5ZA 5C0MA 1TU0B 4M7DD 5IXBA 1YHQQ 1KK7A 1W1FA 4J9EA 4Z02A 1AT1B 3BDLA 4HVVA 1UECA 3QDRB 3V8KA 2M0OA 1YWPA 2IVWA 2HNIA 5LJ3f 2VGNA 1VQ9A 3RKXA 3MJXA 5HKCA 2KK4A 2DIGA 1ZHIA 2FPEA 2E1HA 2XDDA 4PJOF 2LCCA 1HJDA 3I9QA 1IREB 1OV3A 2CDTA 4ZN1A 2E64A 5LJ3g 1VQ4Q 3FLGA 4UC4A 3V7SA 1RABB 5GAMf 2B86A 3F70A 1UGPB 4XU1A 2AT1B 5FU6C 4GY5A 4M77A 4RTZA 3G7ZA 1T0JA 2EYQA 3M5AA 1BK2A 5CKDA 3M0TA 2VXFA 3UF4A 4KGZB 4PJLA 1P92A 1OX8A 3LH0A 2ZPGB 5IHKA 2E5QA 1NBEB 3ER0A 2LT1A 2X4JA 4HA8A 5GAN6 2HL3A 1YJNQ 1WJQA 8AT1B 2DRKA 1DJ7B 2EYXA 2BZ8A 2EVRA 1ZBJA 2D0QB 1B34A 2IPOB 4JS5A 7AT1B 2YRCA 2NUTB 4M77C 3R6NA 3GP8A 3CCQQ 4DOVA 1EFNA 3IQLA 4HCKA 1X43A 2V8IA 2YUPA 4LUEA 2J6FA 1MMGA 1V1CA 4ZTFA 4XK8E 1OQKA 3CCVT 2DD5A 4DBHA 3EG1A 1SG5A 2RMOA 1IHVA 4VUBA 4M7DA 1C6VX 1I5LA 2FRWA 2M1HA 4M7AD 2AKKA 1OYXA 2HBWA 1S72A 4RKUE 4JJBA 1Y07A 3EFOB 2JXBA 1HSQA 2KR3A 2CP0A 3V8JA 2ROLA 1K76A 2LZ6B 2NLUA 2ATCB 3G6EQ 3CCLA 4Y92A 4IUQA 5HK0A 2K57A 1UHCA 4AG1C 3KFVA 2DM1A 1RLQC 4J6XA 1IB8A 2X3XD 3M9QA 4C8QG 3CD6Q 4II1A 1KC8R 1M9SA 5KYUB 2BE9B 3HSBA 3JB9G 4M7DC 1RACB 5DLQE 3KBGA 2B8AA 1VQKA 2L5QA 3CCUQ 2PVOB 1VQ9T 1UFFA 3VJPA 3H8ZA 4FM4B 2YLBA 3GF5A 1BU1A 1NLOC 3CC4Q 3L42A 2DVEA 4KH1B 2M0YA 5GAOl 1QLYA 2YLCA 2DTOA 5D6YA 3L2QA 2JTMA 3CCMA 2BKDN 3O5ZA 4AMCA 1X6GA 2YRVA 2RHYA 1BCOA 2FPDA 1YCSB 2KYMA 3VS3A 1VQ8A 3A8HB 1PHTA 2YSQA 4R56A 1MUZA 1BI3A 1V76A 2ROTA 4F7UG 2HQEA 1UUEA 4JLGA 3JB9I 5FROA 1I1JA 1XOVA 4GLMA 3G4SQ 2MCNA 2QASA 1SKUB 2CUBA 2PNIA 3LLRA 2F2WA 3BY7A 3CCST 1R8OB 2RHXA 2P4RA 3CEYA 4M7AA 2VASA 1AHJB 2DE0X 3UA7A 5C6SA 4B6MA 2CZ7B 4C0DB 1Q82R 2RF0A 1AVZC 1VQ6A 2QGGA 4BE0A 2LDMA 1BB9A 3FIFA 2M02A 3OYBA 3VYGA 4PLIA 1YIJT 4M78G 3GPLA 2GQVA 3A5ZB 3TSWA 1X6BA 3M59A 1JXMA 2X4XA 3L2WA 1UGRB 2QK0A 2FZKB 1VQPT 4JUVA 2MI6A 3C94A 4C5EA 4PJOE 4M7AC 3MEVA 3RDVA 2LMJA 4KRTA 8ATCB 1D09B 1D3BA 1ZA2B 2E6NA 3OMGA 2F2VA 4PL6A 5FRMA 1JU5C 2RI2A 2ZZDA 1KQ1A 3M56A 4M75B 2WACA 1VQ7A 2K4YA 3M53A 4MZMA 2OTJT 3I56A 1VQMQ 2ZPIB 1YITT 1YN8A 4M77F 2COZA 1YI2Q 1B34B 2QTVA 4JJDA 3E9FA 2GGRA 1FYNA 2DL5A 4FYXB 4J9HA 3OS2A 4F16A 2RK1A 4JRKA 3OS0A 4LD9K 3L2VA 2V1RA 1WZOA 3CCJA 1U06A 4P5NA 3SB2A 4FSSA 2RJEA 1OEBA 3PIOA 2CZ6B 3JB9D 2YUQA 3LGFA 1WI7A 3DKMA 2JVVA 4FW2A 4PJNA 1PKSA 2EKHA 4F14A 3OYCA 3KXTA 5M9OA 3UDCA 2D6FA 3LYIA 2VUBA 3M0PA 4LDYA 2JOYA 2KBTA 5GAOq 4DEYA 4XU3A 4M7DF 3REAB 1I07A 4CC3A 1R0CB 2CGHA 2X4WA 1G83A 1N8RR 1RI9A 1ZUKA 2QA4A 3OQ5A 2CUDA 1D1CA 4J83A 1GBRA 3OYFA 3FEOA 1UGVA 2K2VA 2QEXQ 2FB7A 4A63B 1K8AU 1QP3A 1H92A 4IUUA 2DERA 1H8KA 4XTXA 5LJ3e 4XTYA 2CP2A 3PVLA 1YHQA 2KXCA 3OYHA 3CBMA 1W6XA 1TOVA 4DOWA 2LQKA 5AYFA 2Y4YA 4C5HA 5GANf 2DO3A 5GAMe 4C92E 1BBZA 1XQHA 5CKFA 3VKIA 1ZUYA 1PKTA 3A8OB 3EG9A 1HK9A 5GMKj 3VU3C 5D7UA 1M3CA 1VQ4A 1EX4A 2K3BA 1TUDA 4GLKA 2HCKA 3VS1A 1M30A 3OB9A 3I5RA 5HCKA 4C92D 3CMET 1RAFB 3SWNC 1QCFA 4C8QA 3NTIA 5L8RE 3NHNA 5KYYA 1VQOT 2M51A 1E6GA 2KRSA 3OSVA 3A1PA 1I4K1 2ZPHB 4OVAA 3ZFJA 1RAGB 3EHQA 2E6ZA 3C0CA 1YJNA 2P0PA 3I55Q 4EMHA 3RR6A 4XU0A 1IHWA 2AKLA 3EGXA 3EGUA 4EMGA 1TXQA 3CCJT 4M7AF 3PMIA 2E70A 2DXUA 3PTAA 1AZGB 4C8QC 5KCOA 1QCOA 3VS6A 1KD1U 3CCQA 2YUNA 4E2FB 2QGFB 1YJWQ 4F7UA 1V29B 1VQLQ 3DB3A 4BDYA 4RTYA 5LJ5f 2P4TA 4IUPA 3HP9A 1YJ9T 4DQ2A 3ZL7C 1HD3A 3BFMA 3PGGA 2BTTA 2EQJA 4RTVA 2NWMA 4E7ZA 5GAOm 4ZGJB 2YHTA 5IXFA 3OYGA 4BI8B 1KSWA 3LX7A 2A28A 2OJ2A 1W2BP 3GIBA 2L0AA 1NM7A 2DL4A 2J7IA 3HKSA 2ED1A 2L3RA 4J8OA 5GAMh 3M0UA 3EH2A 3CD6A 1Q7YU 1NJIU 3JV3A 3OMCA 4QT7A 3RUXA 2VGMA 4A4KA 3CC7Q 1RLPC 2DBKA 3JCMc 3TEEA 1KJWA 2LX9A 1MNDA 4JPBW 1WDXA 4Z88A 2ZPBB 3S6WA 1K0SA 3QXEB 1AOJA 1UJYA 3RERA 1QVGP 3OYYA 2HSPA 3VYHB 3CBOA 5KYWA 3CCUA 1VQ5Q 1GL5A 2V8KA 4M75E 4OB2B 1M2OA 3SFMA 4XTZA 2A37A 2K79A 2D8HA 3CC4A 1SEMA 1UTIA 3AHUA 2P0QA 2X3WD 3FDRA 4ATOA 2VC8A 2RM4A 2FYKA 3QZ5B 5D6XA 4MMKA 2QDYB 1UDLA 3JCMd 1X2KA 2ECZA 2EYWA 2NUPA 5GJVB 3RESA 2COWA 2X51A 2HZYA 2CKKA 1Q81U 4BACA 2BE7D 4J6YA 4N0AC 3G4SA 2PVDB 2XMFA 4LXCA 4AFZC 3QDFA 1OULA 4NL2A 2JW4A 1K8AC 2FO0A 3QO3A 2X9HA 4KH0B 1B7TA 2L3SA 5CK9A 4OMMA 3JCMV 4EPCA 1VQNT 4QKUA 1K0XA 3CXCP 3BW1A 1JEGA 4DBRA 3CCEQ 2K2MA 5IHIA 5IAYA 4KUIA 1IZ6A 2RQTA 4OF1A 1PNJA 2L2PA 1QVFP 5I2SA 3TVTA 4KGXB 1VUBA 3G71T 3EG9B 4O6JA 4CC4B 4X34A 5CKEA 3CC2T 1AWWA 1G5VA 3HFNA 4HXJA 1WX6A 3RNJA 2RO0A 3NFCA 3E1SA 3X25B 2KSSA 3LH5A 1UGQB 4KULA 4C8QB 2DVJA 2Y4XA 2XICA 1SSHA 1LNXA 5KYYB 4L5GA 4RCBA 4MDWA 1H3ZA 4J5YA 1H3HA 2JJ9A 4JRQA 1GCQA 2D1XA 2FZCB 4OGEA 3SEMA 5KE3A 2ZGWA 2DILA 1GFCA 2HQXA 4FCYA 2DYIA 4C5IA 5CO7A 4OMNA 5GAN5 5HY6A 1ZQ1A 1NZ9A 1JRIA 3M58A 1KHIA 1Y71A 3EGXB 4C8QF 3OYDA 1RAAB 3MEUA 2RQVA 3FRNA 5AT1B 4A4EA 4AG2C 4QQDA 1YI2A 4PJMA 4FL6A 3JB9F 3OYEA 2MK5A 1IGUA 2FG0A 4ELYC 2LTOA 2X4YA 2JM9A 4HCZA 4F7UB 2QYZA 2XKOC 1KD1C 1M90U 4FW1A 1GCQC 1MGQA 3QG1A 1LPLA 3HRSA 2VB6A 1NLPC 2RNAA 1CKAA 3QBYA 2BZXA 4J7FA 4LD6A 1ACMB 3MKDA 2MF2A 2DX1A 2K5IA 3U23A 2OTLT 1UEBA 2DL3A 2J6OA 2KY9A 4WF2A 4BD3A 5CQYA 2H3JA 3M4GA 4ZGEB 1BI0A 2RQRA 2F1LA 3FJPA 4F7UF 2A0FB 2FRYA 1WNLA 3GBQA 4PFPA 1OU8A 1PSFA 1OI1A 5A0DA 1LCKA 2DXTA 3M54A 3NMZC 1KQSS 3NPFA 3CPWP 2A3LA 1U1TA 2O4XA 4M78B 1I5OB 2CH4W 1Q7YC 1NJIC 4NS5A 1W2BS 1M1FA 2VV5A 4XTWA 4MZPA 2QEXA 2I0NA 1FMVA 4Z8AA 2KRNA 3PE0A 5FU7C 3JAME 3CCVQ 5GANe 4C0FA 2DTIA 1QVGS 3SD4A 2EQKA 3VS0A 4M78F 1QW1A 4PFZA 2CT3A 1KQSA 2NUPB 3CBPA 1BIBA 4ORZA 1N27A 4J9BA 3HRUA 2CSIA 2KYBA 1W2BA 1MNEA 5FU6B 2XK0A 3HTRA 2CS7A 1Q81C 1MV0B 4B9WA 2FHDA 3VS4A 2XI9A 5IN1A 4RTTA 3OW2P 1CKBA 2C0TA 4C5GA 1VIFA 1WXBA 2HDAA 4PK4A 2DK3A 1D1BA 4MDXA 5GAN3 2MOXA 1Z9QA 3QUIA 1QVGA 2A36A 3EG0A 2F69A 2D9TA 2WSCE 4XQ3A 5KH6A 3Q1JA 2K3XA 3A8GB 1FMKA 2ABLA 3CXCS 2EFIA 4C92G 3LGLA 3JSCA 2LJ1A 3QYGB 3EFRA 1U1SA 2DPPB 3MP1A 4KT0E 3HPWA 1X01A 3I55A 4FT4A 4M77B 2F2XA 2JUFA 1KQ2A 1M1KU 5L23A 2LCSA 1S72T 1EZZB 4LN2A 2ED0A 4GBQA 5LJ5e 2PUKB 1X75C 1U8RA 3M55A 4NL3A 3EH1A 3M0RA 1YJWA 4LDXA 2VXEA 3CCLT 2LX7A 4PJOD 2V8JA 1J3TA 1VQLA 4OB3B 2JS0A 2W0ZA 1R77A 1X69A 3CXCA 2PQWA 4DBFA 2EBPA 1D0XA 3CCSQ 4C0ZA 5GANh 2KQWA 2C0IA 1N9SA 3G1JA 1JQQA 4RTXA 4AFSC 2MYSA 1VQKT 3RKWA 3O8VA 1G8XA 2WSFE 1SPKA 3RIRA 3WVDB 3PMTA 3OSSC 2GCXA 2PVGB 2RH2A 2KT1A 2DEQA 3CMAQ 1YIJQ 4M7DB 4XTVA 4JZ4A 3LWIA 3QHSA 2HBPA 2HKQB 1M90C 3CC7A 2E3IA 1RAEB 3X26B 3CCMT 2D8JA 2EYYA 1WPYA 2A08A 4DBQA 2RD1A 3H9NA 1VQ8T 2CP6A 1WHMA 1PD0A 1VQPQ 2O01E 1UB4A 2EW3A 2QQAA 1G3SA 2YT6A 1WJRA 5FU7B 3QYHB 2LP5A 2D0NA 1VQ5A 4IURA 5CR2A 4N4IA 2QI2A 1BKBA 3L2ZA 3H6ZA 2MPXC 2DTHA 2EIFA 1JXOA 2JMAA 4QVDA 1SRMA 4X9DA 1RADB 5LL6S 4N4GA 5J26A 3VS7A 3AT1B 2OTJQ 4BDZA 2EWNA 4JRIA 2DLPA 4OMLA 3BE3A 1YITQ 3A98A 4JJNK 2O4XB 3ME9A 1YP5A 1Y57A 1ZSZA 1VIEA 5I22A 2DNUA 1UE9A 2WSEE 2LC4A 1K8AR 3INZA 5EG2A 2JTEA 1VQ6T 3QJ6A 4OMFB 3QWYA 2MMPA 3SWNA 2VWFA 1JO8A 5CKBA 1M3BA 4M75G 5LJ5h 1G3TA 2E12A 3BDUA 3OS1A 1W70A 2CZ0B 4WCIA 4ZN3A 1BYMA 3L2UA 1MMNA 4QW2A 1QMCA 2NYSA 1QKXA 2E4HA 3CCEA 1KG1A 1WFWA 1M5Q1 2AZSA 3M0SA 1ZSZC 2VKNA 3X24B 3UWNA 4J7IA 1ZUUA 3M4YA 3VS5A 1XJWB 4CC2A 2C06A 5KYXA 1WHHA 1NYFA 1VQ7T 4M78E 3OYLA 4PJOC 2IG0A 3A8MB 3I56T 4M7AB 3J81E 1OPLA 5GAMj 2KNBB 1Z9ZA 2YXYA 3WXMB 1WHLA 1NEGA 3S3OA 1LJOA 3MHXA 3OYIA 2LRQA 2CH4A 5DY9A 1K9MU 3T9NA 5GAN4 1M8VA 3H41A 2K7AA 1AD5A 4E6RA 1T3SA 1T0HA 2AZVA 1G3YA 1K4US 3MEWA 1C1AA 5FWCA 5DM7R 2BZYA 2KI7A 2QDLA 1NG2A 2O2OA 3UA6A 1TUGB 3THKA 4OB1B 3PNWC 5CCAA 1KD1R 2DYBA 1D3BB 2RQWA 2DD4A 1YNZA 2DBMA 4EDUA 1M1KC 3L1AA 2KMTA 2RHZA 2NUTA 2CP3A 3EFSA 2L89A 3QJYA 1ABQA 9ATCB 3X28B 2KEAA 1K73U 2MIOA 4OP0A 1JBMA 4D8DA 2EJFA 2HEQA 5LJ3h 1TG0A 4OGCA 3CMEQ 2PU9B 4ELZC 4QQGA 4NOYA 2RK2A 1IGQA 2YRDA 3EGDA 3TQ7P 4V2SA 3DLLA 1O75A 2QA4T 1FX7A 1NYGA 1X2QA 3SDZA 3G6EA 1AWXA 2DA9A 3H0HA 5DLOA 1VQOQ 3V7RA 2QAZA 1KIKA 2QQRA 2LNHB 3JCMf 3EFOA 1RUWA 1WIEA 3GLXA 3C95A 1U5SA 3CCRQ 2DXCA 4M77E 5GAN8 3M57A 3MO8A 3UT1A 1Q7YR 1NJIR 4C92A 4QVCA 3ASKA 2JT4A 3C4SA 2LT4A 2W10A 3JCMg 1YHQT 2DFUA 3A8LB 1Q86U 1G2BA 2I2LA 1PG5B 2KROA 3CCJQ 2EQMA 4FT2A 1U3OA 2HMAA 4N0AA 2XIDA 4J9IA 2DZ9A 1F1BB 1I8FA 1FWZA 1RL2A 3CPFA 2DXBA 4IIMA 2OI3A 2G6FX 4JS4A 3CCVA 1VQ4T 4HCCA 4BUGA 4M75D 2DIQA 2QQ9A 4C92C 1YJ9Q 3I35A 1MV3A 2L3QA 5FWBA 3DLMA 4L6V5 4RG8A 1M1GA 4A4FA 1ZSZB 3OYNA 2EGEA 3VRZA 4IIOA 1M3AA 1Q81R 1VYVA 4M7DE 2KVQG 1GBQA 6AT1B 3LWHA 3SWNB 2LVMA 3QKJA 4R0KA 1VYUA 1YJNT 4J9DA 2GNCA 1GFDA 2HAXA 1NPRA 2Y90A 1Y96A 1A0NB 3JCMJ 1X27A 3OYJA 3CCQT 4IKFA 2RA2A 2IIMA 2ESWA 1ARKA 1WHGA 2RQUA 2DJQA 1B3QA 1IO6A 5KYXB 2Z0WA 2XD0A 4MMLA 3S3MA 2O9VA 3NGPA 2C0OA 2R57A 1H641 1D1AA 4E47A 3EAEA 4A54A 1YFNA 1QWFA 4FYVB 4EIKA 3GOXA 1QCNA 1ABOA 4PFOA 3EG2A 3JCMW 4Y91A 2P0KA 4YTLA 4A4GA 4MZTA 3G6ET 5GAMg 2V26A 3PVQA 1PRMC 2NUZA 1SSFA 4C0GA 4C0DC 3SHWA 1IRXA 1VQMA 3GNGA 1OU9A 1G3WA 3URGA 2LNVA 4AT1B 1K9MC 3WVEB 5LJ3d 3CD6T 1VQNQ 3JCMP 4M75A 3OBWA 1FMWA 4LUDA 2COYA 3RBBB 3CCSA 1TSFA 1OZ3A 1AZEA 4PJOG 3G71Q 2O88A 2KXDA 3PFSA 2EQUA 1MHNA 2GQIA 3CCUT 1M90R 2E3HA 5GAMd 4HT9A 4J9CA 3CC2Q 3OA6A 1VYTA 1JJ2P 2GTOA 3CMAA 1YIJA 3CC4T 4M7AE 1TWBA 5CQXA 2A7YA 2RJDA 4FU6A 3JRZA 4E7SA 2MWPA 2AHJB 1K73C 2RHUA 1QP2A 2KGTA 2AIRB 1LVKA 3JB9J 3EGDB 4M75C 2J05A 2K5LA 2ZAEA 1VQPA 4K11A 1WJSA 5KYNA 1QKWA 1UG1A 5FRNA 2FEIA 4D6WA 2CT4A 2EGAA 1TUCA 3RMQA 3G4ST 3QPHA 1GRIA 2ENMA 2LJ0A 4PLLA 4HVUA 4C92B 1BCMA 1YCYA 2OTJA 1Y0MA 3QZ9B 2LQWA 2VYTA 1YITA 1KC8U 4E7JA 1TH7A 5FW9A 3PT9A 3V8LA 4JZ3A 1PC0A 4E7KA 5CAIA 2YUOA 2DF6A 5KYWB 1Q86C 2HQHA 4B9XA 4RTWA 4D8KA 4N4HA 2HL5C 2ZCFB 2FVUA 4ESRA 3EG3A 1I81A 5GMKl 1AWOA 1WQWA 4C92F 4JLIA 1WQ7A 3MP8A 5IH2A 2ZPEB 1CSKA 4X9CA 2DZCA 2OTLQ 4DA4A 2GF7A 4X1VA 5GANj 3JCMX 2CP7A 5GAOr 1D0YA 1OPKA 4PKCC 1ZBXA 3J80E 4PJJA 2CZ1B 2FPFA
chains in the Genus database with same CATH topology
2KRMA 2SRCA 1YP5A 1Y57A 1VA7A 5IXFA 5I22A 2DNUA 2PTKA 1UE9A 1KSWA 2A28A 2OJ2A 2JM8A 2DRKA 2EYXA 2L0AA 2CREA 1NM7A 2BZ8A 2DL4A 2JTEA 2J7IA 2ED1A 2EVRA 3M0UA 3QWYA 1WXUA 2VWFA 1JO8A 3JV3A 1ZBJA 4QT7A 1ZLMA 1M3BA 1RLPC 2DBKA 1KJWA 4JPBW 3R6NA 1S1NA 1WDXA 1W70A 4Z88A 2EGCA 4WCIA 1K0SA 1EFNA 3IQLA 4HCKA 1AOJA 1X43A 1UJYA 2YUPA 4LUEA 1QKXA 2J6FA 3H0IA 1V1CA 2HSPA 1WFWA 1GL5A 2AZSA 3EG1A 2RMOA 3M0SA 2A37A 2K79A 2VKNA 2D8HA 2EPDA 2V1QA 1ZUUA 2FRWA 1SEMA 1UTIA 2DMOA 2AKKA 2HBWA 4OMOA 3VS5A 2X3WD 4CC2A 4ZNXA 4JJBA 2JXBA 1UDLA 1NYFA 1HSQA 1X2KA 2ECZA 2KR3A 2EYWA 2ROLA 1K76A 2LZ6B 5GJVB 1OPLA 2O9SA 2KNBB 4Y92A 2EYZA 1Z9ZA 1SRLA 1UHCA 4AG1C 3KFVA 1I0CA 2DM1A 1NEGA 1RLQC 2X3XD 1K9AA 2XMFA 4AFUC 4AFZC 2CH4A 3EHRA 1WA7A 2JW4A 2FO0A 2L3SA 2YDLA 2VVKA 4OMMA 3H41A 1K0XA 2K7AA 2LQNA 1AD5A 1PWTA 4E6RA 1JEGA 1T3SA 1T0HA 2K2MA 2AZVA 5IHIA 2RQTA 1K4US 5FWCA 1PNJA 1UFFA 2L2PA 2BZYA 2JS2A 2QDLA 1NG2A 2O2OA 1BU1A 3UA6A 3TVTA 4J9GA 1NLOC 3THKA 2DYBA 2RQWA 1YNZA 2DBMA 2M0YA 4CC4B 4LNPA 1QLYA 3ULRB 1AWWA 5EC7A 3CQTA 3O5ZA 4HXJA 1X6GA 1WX6A 3RNJA 2FPDA 1YCSB 2J06A 2KYMA 2O31A 3H0FA 1ABQA 3VS3A 2KEAA 1PHTA 2YSQA 3LH5A 2MIOA 4D8DA 2GBQA 1MUZA 2ROTA 1UJ0A 2DVJA 1UUEA 1TG0A 2HEQA 1KFZA 1SSHA 1I1JA 1XOVA 4GLMA 3QWXX 2GTJA 2MCNA 1H3HA 1X2QA 1NYGA 1GCQA 2D1XA 1AWXA 2DA9A 3H0HA 3SEMA 1K1ZA 2CUBA 1KIKA 2DILA 1GFCA 2K6DA 2LJ3A 2PNIA 2LNHB 2F2WA 4OMNA 1RUWA 1WIEA 1U5SA 2P4RA 2DE0X 3UA7A 1AEYA 3M0QA 2JT4A 2RQVA 2W10A 2RF0A 1AVZC 4AG2C 4Z89A 2OAWA 3VRYA 1G2BA 1BB9A 2KROA 2FG0A 1U3OA 2JM9A 4J9IA 1T3LA 1GCQC 1WYXA 2DL7A 3TSWA 1X6BA 4IIMA 2OI3A 1JXMA 2G6FX 1NLPC 1E6HA 4M4ZA 2RNAA 1CKAA 4JJCA 1NEBA 4RUGA 2BZXA 2LMJA 4KRTA 2H8HA 2DX1A 3I35A 3U23A 1MV3A 2L3QA 2AK5A 2DL3A 2EQIA 2F2VA 2J6OA 5FWBA 1JU5C 2RQRA 3VS2A 2FRYA 1GCPA 1QWEA 2JMCA 3GBQA 4J9FA 2EGEA 3VRZA 1B07A 4IIOA 1M3AA 1LCKA 1VYVA 3NMZC 1GBQA 1YN8A 3FJ5A 3NPFA 1SHFA 4R0KA 1VYUA 4JJDA 2CH4W 2GGRA 4J9DA 1FYNA 4DEXA 2GNCA 2DL5A 4J9HA 4F16A 1GFDA 2I0NA 4Z8AA 2KRNA 3PE0A 1ZX6A 1A0NB 1E7OA 2V1RA 1X27A 1U06A 2IIMA 2ESWA 1ARKA 2SEMA 4FSSA 2DRMA 2RQUA 2DJQA 1OEBA 1B3QA 2YUQA 2E5KA 1WI7A 3VS0A 1IO6A 2CT3A 2O9VA 4ORZA 3NGPA 2KE9A 4F14A 1PKSA 2C0OA 2EKHA 4J9BA 5GJWB 2CSIA 1ZSGA 3M0PA 2L3PA 2KYBA 1QWFA 2KBTA 4EIKA 4DEYA 4CC7A 1ABOA 3EG2A 1I07A 3I5SA 3REAB 4CC3A 1G83A 1MV0B 1RI9A 1ZUKA 2CUDA 3PVQA 1PRMC 2NUZA 3VS4A 3SHWA 4RTTA 1GBRA 1CKBA 2C0TA 1WXBA 2HDAA 1UGVA 1AWJA 2MOXA 4AFQC 4LE9A 5I11A 4A63B 1Z9QA 4LUDA 3RBBB 1H92A 2A36A 1H8KA 3EG0A 3UATA 1AZEA 1FMKA 2ABLA 2RPNA 1M27C 3PVLA 2KXCA 1UHFA 2O88A 2LJ1A 2KXDA 1SHGA 1PRLC 4RTUA 2GQIA 2PZ1A 2CSQA 4J9CA 1W6XA 3REBB 1VYTA 2GTOA 1YWOA 2F2XA 2KT8A 2DL8A 4HVWA 1WLPB 5L23A 2LCSA 1BBZA 1ZUYA 2KGTA 1PKTA 4LN2A 2ED0A 4GBQA 1M8MA 1OOTA 2RN8A 5ECAA 2J05A 1M3CA 4OMQA 3M0RA 2K3BA 1TUDA 3TSZA 2HCKA 3VS1A 4K11A 1M30A 3I5RA 1QKWA 1UG1A 5HCKA 2LX7A 1J3TA 2FEIA 2JS0A 2CT4A 2W0ZA 2EGAA 1QCFA 1WXTA 1TUCA 1X69A 4F17A 3NHNA 4OMPA 1GRIA 2ENMA 2LJ0A 2EBPA 4HVUA 2M51A 1E6GA 2J6KA 2KRSA 1Y0MA 2K9GA 5IHNA 2C0IA 2LQWA 1JQQA 4RTXA 1N5ZA 4AFSC 5FW9A 5IXBA 1W1FA 4J9EA 4JZ3A 2YUOA 3EHQA 4HVVA 2DF6A 3C0CA 1SPKA 1UECA 1YWPA 2KT1A 2AKLA 4RTWA 4D8KA 4JZ4A 3EGUA 4ESRA 3EG3A 1AWOA 2FPEA 1AZGB 2D8JA 2EYYA 2A08A 3VS6A 1HJDA 3I9QA 1OV3A 2CDTA 5IH2A 2YUNA 2EW3A 2YT6A 1CSKA 2B86A 2LP5A 2D0NA 4RTYA 4X1VA 4RTZA 1T0JA 1JXOA 2JMAA 1BK2A 3M0TA 1SRMA 3UF4A 1OPKA 3ZL7C 1HD3A 3VS7A 5IHKA 2BTTA 2DLPA 4OMLA 2FPFA 4RTVA 2NWMA 3A98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRM A;  2SRC A;  1YP5 A;  1Y57 A;  1VA7 A;  5IXF A;  5I22 A;  2DNU A;  2PTK A;  1UE9 A;  1KSW A;  2A28 A;  2OJ2 A;  2JM8 A;  2DRK A;  2EYX A;  2L0A A;  2CRE A;  1NM7 A;  2BZ8 A;  2DL4 A;  2JTE A;  2J7I A;  2ED1 A;  2EVR A;  3M0U A;  3QWY A;  1WXU A;  2VWF A;  1JO8 A;  3JV3 A;  1ZBJ A;  4QT7 A;  1ZLM A;  1M3B A;  1RLP C;  2DBK A;  1KJW A;  4JPB W;  3R6N A;  1S1N A;  1WDX A;  1W70 A;  4Z88 A;  2EGC A;  4WCI A;  1K0S A;  1EFN A;  3IQL A;  4HCK A;  1AOJ A;  1X43 A;  1UJY A;  2YUP A;  4LUE A;  1QKX A;  2J6F A;  3H0I A;  1V1C A;  2HSP A;  1WFW A;  1GL5 A;  2AZS A;  3EG1 A;  2RMO A;  3M0S A;  2A37 A;  2K79 A;  2VKN A;  2D8H A;  2EPD A;  2V1Q A;  1ZUU A;  2FRW A;  1SEM A;  1UTI A;  2DMO A;  2AKK A;  2HBW A;  4OMO A;  3VS5 A;  2X3W D;  4CC2 A;  4ZNX A;  4JJB A;  2JXB A;  1UDL A;  1NYF A;  1HSQ A;  1X2K A;  2ECZ A;  2KR3 A;  2EYW A;  2ROL A;  1K76 A;  2LZ6 B;  5GJV B;  1OPL A;  2O9S A;  2KNB B;  4Y92 A;  2EYZ A;  1Z9Z A;  1SRL A;  1UHC A;  4AG1 C;  3KFV A;  1I0C A;  2DM1 A;  1NEG A;  1RLQ C;  2X3X D;  1K9A A;  2XMF A;  4AFU C;  4AFZ C;  2CH4 A;  3EHR A;  1WA7 A;  2JW4 A;  2FO0 A;  2L3S A;  2YDL A;  2VVK A;  4OMM A;  3H41 A;  1K0X A;  2K7A A;  2LQN A;  1AD5 A;  1PWT A;  4E6R A;  1JEG A;  1T3S A;  1T0H A;  2K2M A;  2AZV A;  5IHI A;  2RQT A;  1K4U S;  5FWC A;  1PNJ A;  1UFF A;  2L2P A;  2BZY A;  2JS2 A;  2QDL A;  1NG2 A;  2O2O A;  1BU1 A;  3UA6 A;  3TVT A;  4J9G A;  1NLO C;  3THK A;  2DYB A;  2RQW A;  1YNZ A;  2DBM A;  2M0Y A;  4CC4 B;  4LNP A;  1QLY A;  3ULR B;  1AWW A;  5EC7 A;  3CQT A;  3O5Z A;  4HXJ A;  1X6G A;  1WX6 A;  3RNJ A;  2FPD A;  1YCS B;  2J06 A;  2KYM A;  2O31 A;  3H0F A;  1ABQ A;  3VS3 A;  2KEA A;  1PHT A;  2YSQ A;  3LH5 A;  2MIO A;  4D8D A;  2GBQ A;  1MUZ A;  2ROT A;  1UJ0 A;  2DVJ A;  1UUE A;  1TG0 A;  2HEQ A;  1KFZ A;  1SSH A;  1I1J A;  1XOV A;  4GLM A;  3QWX X;  2GTJ A;  2MCN A;  1H3H A;  1X2Q A;  1NYG A;  1GCQ A;  2D1X A;  1AWX A;  2DA9 A;  3H0H A;  3SEM A;  1K1Z A;  2CUB A;  1KIK A;  2DIL A;  1GFC A;  2K6D A;  2LJ3 A;  2PNI A;  2LNH B;  2F2W A;  4OMN A;  1RUW A;  1WIE A;  1U5S A;  2P4R A;  2DE0 X;  3UA7 A;  1AEY A;  3M0Q A;  2JT4 A;  2RQV A;  2W10 A;  2RF0 A;  1AVZ C;  4AG2 C;  4Z89 A;  2OAW A;  3VRY A;  1G2B A;  1BB9 A;  2KRO A;  2FG0 A;  1U3O A;  2JM9 A;  4J9I A;  1T3L A;  1GCQ C;  1WYX A;  2DL7 A;  3TSW A;  1X6B A;  4IIM A;  2OI3 A;  1JXM A;  2G6F X;  1NLP C;  1E6H A;  4M4Z A;  2RNA A;  1CKA A;  4JJC A;  1NEB A;  4RUG A;  2BZX A;  2LMJ A;  4KRT A;  2H8H A;  2DX1 A;  3I35 A;  3U23 A;  1MV3 A;  2L3Q A;  2AK5 A;  2DL3 A;  2EQI A;  2F2V A;  2J6O A;  5FWB A;  1JU5 C;  2RQR A;  3VS2 A;  2FRY A;  1GCP A;  1QWE A;  2JMC A;  3GBQ A;  4J9F A;  2EGE A;  3VRZ A;  1B07 A;  4IIO A;  1M3A A;  1LCK A;  1VYV A;  3NMZ C;  1GBQ A;  1YN8 A;  3FJ5 A;  3NPF A;  1SHF A;  4R0K A;  1VYU A;  4JJD A;  2CH4 W;  2GGR A;  4J9D A;  1FYN A;  4DEX A;  2GNC A;  2DL5 A;  4J9H A;  4F16 A;  1GFD A;  2I0N A;  4Z8A A;  2KRN A;  3PE0 A;  1ZX6 A;  1A0N B;  1E7O A;  2V1R A;  1X27 A;  1U06 A;  2IIM A;  2ESW A;  1ARK A;  2SEM A;  4FSS A;  2DRM A;  2RQU A;  2DJQ A;  1OEB A;  1B3Q A;  2YUQ A;  2E5K A;  1WI7 A;  3VS0 A;  1IO6 A;  2CT3 A;  2O9V A;  4ORZ A;  3NGP A;  2KE9 A;  4F14 A;  1PKS A;  2C0O A;  2EKH A;  4J9B A;  5GJW B;  2CSI A;  1ZSG A;  3M0P A;  2L3P A;  2KYB A;  1QWF A;  2KBT A;  4EIK A;  4DEY A;  4CC7 A;  1ABO A;  3EG2 A;  1I07 A;  3I5S A;  3REA B;  4CC3 A;  1G83 A;  1MV0 B;  1RI9 A;  1ZUK A;  2CUD A;  3PVQ A;  1PRM C;  2NUZ A;  3VS4 A;  3SHW A;  4RTT A;  1GBR A;  1CKB A;  2C0T A;  1WXB A;  2HDA A;  1UGV A;  1AWJ A;  2MOX A;  4AFQ C;  4LE9 A;  5I11 A;  4A63 B;  1Z9Q A;  4LUD A;  3RBB B;  1H92 A;  2A36 A;  1H8K A;  3EG0 A;  3UAT A;  1AZE A;  1FMK A;  2ABL A;  2RPN A;  1M27 C;  3PVL A;  2KXC A;  1UHF A;  2O88 A;  2LJ1 A;  2KXD A;  1SHG A;  1PRL C;  4RTU A;  2GQI A;  2PZ1 A;  2CSQ A;  4J9C A;  1W6X A;  3REB B;  1VYT A;  2GTO A;  1YWO A;  2F2X A;  2KT8 A;  2DL8 A;  4HVW A;  1WLP B;  5L23 A;  2LCS A;  1BBZ A;  1ZUY A;  2KGT A;  1PKT A;  4LN2 A;  2ED0 A;  4GBQ A;  1M8M A;  1OOT A;  2RN8 A;  5ECA A;  2J05 A;  1M3C A;  4OMQ A;  3M0R A;  2K3B A;  1TUD A;  3TSZ A;  2HCK A;  3VS1 A;  4K11 A;  1M30 A;  3I5R A;  1QKW A;  1UG1 A;  5HCK A;  2LX7 A;  1J3T A;  2FEI A;  2JS0 A;  2CT4 A;  2W0Z A;  2EGA A;  1QCF A;  1WXT A;  1TUC A;  1X69 A;  4F17 A;  3NHN A;  4OMP A;  1GRI A;  2ENM A;  2LJ0 A;  2EBP A;  4HVU A;  2M51 A;  1E6G A;  2J6K A;  2KRS A;  1Y0M A;  2K9G A;  5IHN A;  2C0I A;  2LQW A;  1JQQ A;  4RTX A;  1N5Z A;  4AFS C;  5FW9 A;  5IXB A;  1W1F A;  4J9E A;  4JZ3 A;  2YUO A;  3EHQ A;  4HVV A;  2DF6 A;  3C0C A;  1SPK A;  1UEC A;  1YWP A;  2KT1 A;  2AKL A;  4RTW A;  4D8K A;  4JZ4 A;  3EGU A;  4ESR A;  3EG3 A;  1AWO A;  2FPE A;  1AZG B;  2D8J A;  2EYY A;  2A08 A;  3VS6 A;  1HJD A;  3I9Q A;  1OV3 A;  2CDT A;  5IH2 A;  2YUN A;  2EW3 A;  2YT6 A;  1CSK A;  2B86 A;  2LP5 A;  2D0N A;  4RTY A;  4X1V A;  4RTZ A;  1T0J A;  1JXO A;  2JMA A;  1BK2 A;  3M0T A;  1SRM A;  3UF4 A;  1OPK A;  3ZL7 C;  1HD3 A;  3VS7 A;  5IHK A;  2BTT A;  2DLP A;  4OML A;  2FPF A;  4RTV A;  2NWM A;  3A98 A; 
#chains in the Genus database with same CATH topology
 2KRM A;  1N9R A;  2JZ2 A;  2SRC A;  1VA7 A;  2DKG A;  2RI5 A;  2K5F A;  1VQM T;  5GAO p;  3P8B B;  2PTK A;  2JM8 A;  4BI4 A;  2CRE A;  4JDS A;  5I2M A;  1YI2 T;  1Y96 B;  1VQ9 Q;  3VUB A;  1WHK A;  1XTD A;  2KAF A;  1WXU A;  2CP5 A;  1OX9 A;  1ZLM A;  1Q82 U;  2XU8 A;  4LDU A;  1S1N A;  5GAN 2;  2EGC A;  2JNG A;  1QVF S;  4Q5W A;  3H0I A;  1EIF A;  2GFU A;  2RI3 A;  2RHI A;  3CMA T;  3OY9 A;  5A2Q E;  3HRT A;  1M1K R;  5FLX E;  4R55 A;  1ZA1 B;  2EPD A;  2V1Q A;  1TTH B;  2DMO A;  2P84 A;  4OMO A;  2JTF A;  4ZTJ A;  4ZNX A;  5A0G A;  5CKH A;  4BY6 C;  1VOM A;  4PNO A;  4WTO B;  1N6A A;  2O9S A;  1HXD A;  1LOJ A;  5A0L A;  2EYZ A;  1BIA A;  1PSE A;  1SRL A;  3JCM e;  3CME A;  5LJ5 j;  2HKN A;  1I0C A;  3GNF B;  1QVF A;  4E7L A;  2XG8 D;  3FC3 A;  1K9A A;  1X6O A;  4AFU C;  3EHR A;  1WA7 A;  5HK3 A;  1VQO A;  1BI1 A;  4KBM B;  1QVP A;  2YDL A;  2VVK A;  2QEX T;  1PCX A;  2LQN A;  1PWT A;  2HD0 A;  1TS9 A;  4A53 A;  2L8D A;  3OS5 A;  3CCR A;  4C8Q E;  2JS2 A;  4M75 F;  3TU4 K;  4J9G A;  3MEA A;  4IUT A;  1SF9 A;  2FL7 A;  2EAY A;  1PM3 A;  4LNP A;  4HKE A;  2BIV A;  3ULR B;  2MWO A;  1W4S A;  3V7C A;  4BI3 A;  1S72 Q;  5EC7 A;  1KHC A;  3CQT A;  3ZBD A;  4C8Q D;  1JJ2 S;  3VUZ A;  2E10 A;  2O31 A;  2J06 A;  3H0F A;  1M2V A;  2XDB A;  4BB7 A;  1UGS B;  3OBY A;  2GBQ A;  3CCL Q;  1UJ0 A;  4QVZ A;  1Y7X A;  1KFZ A;  4Y28 E;  3E9G A;  3TCJ A;  3P8D A;  4FSX A;  1MMD A;  4EMK A;  3QWX X;  4TVR A;  3MPU B;  4M77 G;  2GTJ A;  4XAX B;  1C0M A;  1YJ9 A;  4XU2 A;  4JRP A;  4FYW B;  1K1Z A;  2R5M A;  4F7U E;  2K6D A;  2LJ3 A;  1N8R U;  2DEU A;  3OYA A;  3CPW S;  1KC8 C;  2QTX A;  1VQK Q;  2MAM A;  2RJC A;  1FXX A;  1AEY A;  4PJO A;  1JJ2 A;  3VV0 A;  3M0Q A;  4Z89 A;  2OAW A;  3C12 A;  3VRY A;  2F5T X;  1IXD A;  5GMK e;  2QG9 B;  2RB6 A;  3I55 T;  3CCM Q;  2EKO A;  2F5K A;  4EMK C;  3MET A;  1M4Z A;  4QQ6 A;  3RMS A;  1T3L A;  5LJ3 j;  1VQ8 Q;  1WYX A;  2DL7 A;  4KGV B;  3PIP A;  1Q95 G;  3JCM h;  4KUD K;  1D0Z A;  3UPU A;  4M4Z A;  1E6H A;  4JJC A;  1YJW T;  1NEB A;  4LDV A;  4RUG A;  5J39 A;  4BE2 A;  2OAU A;  2PUO B;  3CPW A;  2H8H A;  4J6W A;  4M7D G;  1RAH B;  1VQL T;  2AK5 A;  2EQI A;  4LDW A;  1NPP A;  3OYK A;  2GFA A;  3JB9 H;  1BI2 A;  3VS2 A;  5GAN g;  3J7A F;  1GCP A;  1QWE A;  2JMC A;  3E19 A;  4J9F A;  2M9U A;  1B07 A;  4A4H A;  5D6W A;  2CYZ B;  4M78 D;  3FB9 A;  1WGS A;  3OW2 S;  3OYM A;  1PD1 A;  3FJ5 A;  4BY6 B;  2K3Y A;  1SHF A;  1K9M R;  2G3R A;  1VQ6 Q;  2XDP A;  4FIB A;  3HFO A;  1GXI E;  4DEX A;  2E41 A;  4L59 A;  1Q82 C;  3CCR T;  1VQN A;  5GAN d;  3CC7 T;  1HYO A;  1ZX6 A;  3NTH A;  5GAO n;  1E7O A;  2QQS A;  5GAN 7;  2LCL A;  1WHJ A;  2SEM A;  2DRM A;  1OZ2 A;  3G71 A;  2FZG B;  1MMA A;  1VQ5 T;  2E5K A;  1K73 R;  3CC2 A;  3N5B B;  1R0B G;  3OW2 A;  2KE9 A;  5GJW B;  4HCB A;  1VQ7 Q;  1ZSG A;  3I56 Q;  2L3P A;  2KDS A;  3ZEH A;  4CI0 C;  1RAI B;  4CC7 A;  1JB0 E;  3I5S A;  5GMK m;  4ME7 A;  1QQJ A;  2XHC A;  4RMO A;  5GMK h;  4RCC A;  4OB0 B;  3MP6 A;  1XNI A;  4F04 B;  2DJZ A;  3KUF A;  3S3N A;  5IT9 E;  4CRI A;  5LJ5 g;  1KQS P;  3L2R A;  4E7H A;  3P8H A;  4RG2 A;  1AWJ A;  3HHT B;  3RKY A;  4AFQ C;  4LE9 A;  5I11 A;  2LQ8 A;  2H3E B;  3TRE A;  2DET A;  4BE1 A;  4HT8 A;  2YWW A;  2RJF A;  5KYU A;  1Q86 R;  3UAT A;  4M7A G;  2OX7 A;  2RPN A;  4M77 D;  1M27 C;  3R6O A;  4O5V A;  2HSE B;  3CCE T;  1UHF A;  2JN0 A;  1SHG A;  1PRL C;  4RTU A;  2EJ9 A;  5GMK i;  2PZ1 A;  2CSQ A;  4E7I A;  1YBY A;  4M78 A;  3QSU A;  1M2V B;  3REB B;  3JCM b;  5KE2 A;  3E2U A;  5LJ5 d;  1YWO A;  2KT8 A;  2DL8 A;  1O9S A;  2ZPF B;  4HVW A;  3JCM Q;  1WLP B;  4XTU A;  2QXF A;  1M8M A;  1OOT A;  2RN8 A;  5ECA A;  4EMK B;  2M16 A;  3MCA B;  4OMQ A;  1NE8 A;  3TSZ A;  2E65 A;  2X35 A;  3NTK A;  3DB4 A;  3QII A;  5CIU A;  2QA4 Q;  4ANJ A;  2OTL A;  2BUD A;  1RI0 A;  4FYY B;  1WXT A;  4ZGD B;  4IUV A;  4F17 A;  2R5A A;  5CVI A;  4OMP A;  1N8R C;  4M78 C;  2EJG A;  3X20 B;  4PJO B;  3HL8 A;  2J6K A;  5J3B A;  2R58 A;  2K9G A;  5IHN A;  2QQB A;  3LW5 E;  5KCH A;  2DAQ A;  3D7S B;  5I21 A;  1N5Z A;  5C0M A;  1TU0 B;  4M7D D;  5IXB A;  1YHQ Q;  1KK7 A;  1W1F A;  4J9E A;  4Z02 A;  1AT1 B;  3BDL A;  4HVV A;  1UEC A;  3QDR B;  3V8K A;  2M0O A;  1YWP A;  2IVW A;  2HNI A;  5LJ3 f;  2VGN A;  1VQ9 A;  3RKX A;  3MJX A;  5HKC A;  2KK4 A;  2DIG A;  1ZHI A;  2FPE A;  2E1H A;  2XDD A;  4PJO F;  2LCC A;  1HJD A;  3I9Q A;  1IRE B;  1OV3 A;  2CDT A;  4ZN1 A;  2E64 A;  5LJ3 g;  1VQ4 Q;  3FLG A;  4UC4 A;  3V7S A;  1RAB B;  5GAM f;  2B86 A;  3F70 A;  1UGP B;  4XU1 A;  2AT1 B;  5FU6 C;  4GY5 A;  4M77 A;  4RTZ A;  3G7Z A;  1T0J A;  2EYQ A;  3M5A A;  1BK2 A;  5CKD A;  3M0T A;  2VXF A;  3UF4 A;  4KGZ B;  4PJL A;  1P92 A;  1OX8 A;  3LH0 A;  2ZPG B;  5IHK A;  2E5Q A;  1NBE B;  3ER0 A;  2LT1 A;  2X4J A;  4HA8 A;  5GAN 6;  2HL3 A;  1YJN Q;  1WJQ A;  8AT1 B;  2DRK A;  1DJ7 B;  2EYX A;  2BZ8 A;  2EVR A;  1ZBJ A;  2D0Q B;  1B34 A;  2IPO B;  4JS5 A;  7AT1 B;  2YRC A;  2NUT B;  4M77 C;  3R6N A;  3GP8 A;  3CCQ Q;  4DOV A;  1EFN A;  3IQL A;  4HCK A;  1X43 A;  2V8I A;  2YUP A;  4LUE A;  2J6F A;  1MMG A;  1V1C A;  4ZTF A;  4XK8 E;  1OQK A;  3CCV T;  2DD5 A;  4DBH A;  3EG1 A;  1SG5 A;  2RMO A;  1IHV A;  4VUB A;  4M7D A;  1C6V X;  1I5L A;  2FRW A;  2M1H A;  4M7A D;  2AKK A;  1OYX A;  2HBW A;  1S72 A;  4RKU E;  4JJB A;  1Y07 A;  3EFO B;  2JXB A;  1HSQ A;  2KR3 A;  2CP0 A;  3V8J A;  2ROL A;  1K76 A;  2LZ6 B;  2NLU A;  2ATC B;  3G6E Q;  3CCL A;  4Y92 A;  4IUQ A;  5HK0 A;  2K57 A;  1UHC A;  4AG1 C;  3KFV A;  2DM1 A;  1RLQ C;  4J6X A;  1IB8 A;  2X3X D;  3M9Q A;  4C8Q G;  3CD6 Q;  4II1 A;  1KC8 R;  1M9S A;  5KYU B;  2BE9 B;  3HSB A;  3JB9 G;  4M7D C;  1RAC B;  5DLQ E;  3KBG A;  2B8A A;  1VQK A;  2L5Q A;  3CCU Q;  2PVO B;  1VQ9 T;  1UFF A;  3VJP A;  3H8Z A;  4FM4 B;  2YLB A;  3GF5 A;  1BU1 A;  1NLO C;  3CC4 Q;  3L42 A;  2DVE A;  4KH1 B;  2M0Y A;  5GAO l;  1QLY A;  2YLC A;  2DTO A;  5D6Y A;  3L2Q A;  2JTM A;  3CCM A;  2BKD N;  3O5Z A;  4AMC A;  1X6G A;  2YRV A;  2RHY A;  1BCO A;  2FPD A;  1YCS B;  2KYM A;  3VS3 A;  1VQ8 A;  3A8H B;  1PHT A;  2YSQ A;  4R56 A;  1MUZ A;  1BI3 A;  1V76 A;  2ROT A;  4F7U G;  2HQE A;  1UUE A;  4JLG A;  3JB9 I;  5FRO A;  1I1J A;  1XOV A;  4GLM A;  3G4S Q;  2MCN A;  2QAS A;  1SKU B;  2CUB A;  2PNI A;  3LLR A;  2F2W A;  3BY7 A;  3CCS T;  1R8O B;  2RHX A;  2P4R A;  3CEY A;  4M7A A;  2VAS A;  1AHJ B;  2DE0 X;  3UA7 A;  5C6S A;  4B6M A;  2CZ7 B;  4C0D B;  1Q82 R;  2RF0 A;  1AVZ C;  1VQ6 A;  2QGG A;  4BE0 A;  2LDM A;  1BB9 A;  3FIF A;  2M02 A;  3OYB A;  3VYG A;  4PLI A;  1YIJ T;  4M78 G;  3GPL A;  2GQV A;  3A5Z B;  3TSW A;  1X6B A;  3M59 A;  1JXM A;  2X4X A;  3L2W A;  1UGR B;  2QK0 A;  2FZK B;  1VQP T;  4JUV A;  2MI6 A;  3C94 A;  4C5E A;  4PJO E;  4M7A C;  3MEV A;  3RDV A;  2LMJ A;  4KRT A;  8ATC B;  1D09 B;  1D3B A;  1ZA2 B;  2E6N A;  3OMG A;  2F2V A;  4PL6 A;  5FRM A;  1JU5 C;  2RI2 A;  2ZZD A;  1KQ1 A;  3M56 A;  4M75 B;  2WAC A;  1VQ7 A;  2K4Y A;  3M53 A;  4MZM A;  2OTJ T;  3I56 A;  1VQM Q;  2ZPI B;  1YIT T;  1YN8 A;  4M77 F;  2COZ A;  1YI2 Q;  1B34 B;  2QTV A;  4JJD A;  3E9F A;  2GGR A;  1FYN A;  2DL5 A;  4FYX B;  4J9H A;  3OS2 A;  4F16 A;  2RK1 A;  4JRK A;  3OS0 A;  4LD9 K;  3L2V A;  2V1R A;  1WZO A;  3CCJ A;  1U06 A;  4P5N A;  3SB2 A;  4FSS A;  2RJE A;  1OEB A;  3PIO A;  2CZ6 B;  3JB9 D;  2YUQ A;  3LGF A;  1WI7 A;  3DKM A;  2JVV A;  4FW2 A;  4PJN A;  1PKS A;  2EKH A;  4F14 A;  3OYC A;  3KXT A;  5M9O A;  3UDC A;  2D6F A;  3LYI A;  2VUB A;  3M0P A;  4LDY A;  2JOY A;  2KBT A;  5GAO q;  4DEY A;  4XU3 A;  4M7D F;  3REA B;  1I07 A;  4CC3 A;  1R0C B;  2CGH A;  2X4W A;  1G83 A;  1N8R R;  1RI9 A;  1ZUK A;  2QA4 A;  3OQ5 A;  2CUD A;  1D1C A;  4J83 A;  1GBR A;  3OYF A;  3FEO A;  1UGV A;  2K2V A;  2QEX Q;  2FB7 A;  4A63 B;  1K8A U;  1QP3 A;  1H92 A;  4IUU A;  2DER A;  1H8K A;  4XTX A;  5LJ3 e;  4XTY A;  2CP2 A;  3PVL A;  1YHQ A;  2KXC A;  3OYH A;  3CBM A;  1W6X A;  1TOV A;  4DOW A;  2LQK A;  5AYF A;  2Y4Y A;  4C5H A;  5GAN f;  2DO3 A;  5GAM e;  4C92 E;  1BBZ A;  1XQH A;  5CKF A;  3VKI A;  1ZUY A;  1PKT A;  3A8O B;  3EG9 A;  1HK9 A;  5GMK j;  3VU3 C;  5D7U A;  1M3C A;  1VQ4 A;  1EX4 A;  2K3B A;  1TUD A;  4GLK A;  2HCK A;  3VS1 A;  1M30 A;  3OB9 A;  3I5R A;  5HCK A;  4C92 D;  3CME T;  1RAF B;  3SWN C;  1QCF A;  4C8Q A;  3NTI A;  5L8R E;  3NHN A;  5KYY A;  1VQO T;  2M51 A;  1E6G A;  2KRS A;  3OSV A;  3A1P A;  1I4K 1;  2ZPH B;  4OVA A;  3ZFJ A;  1RAG B;  3EHQ A;  2E6Z A;  3C0C A;  1YJN A;  2P0P A;  3I55 Q;  4EMH A;  3RR6 A;  4XU0 A;  1IHW A;  2AKL A;  3EGX A;  3EGU A;  4EMG A;  1TXQ A;  3CCJ T;  4M7A F;  3PMI A;  2E70 A;  2DXU A;  3PTA A;  1AZG B;  4C8Q C;  5KCO A;  1QCO A;  3VS6 A;  1KD1 U;  3CCQ A;  2YUN A;  4E2F B;  2QGF B;  1YJW Q;  4F7U A;  1V29 B;  1VQL Q;  3DB3 A;  4BDY A;  4RTY A;  5LJ5 f;  2P4T A;  4IUP A;  3HP9 A;  1YJ9 T;  4DQ2 A;  3ZL7 C;  1HD3 A;  3BFM A;  3PGG A;  2BTT A;  2EQJ A;  4RTV A;  2NWM A;  4E7Z A;  5GAO m;  4ZGJ B;  2YHT A;  5IXF A;  3OYG A;  4BI8 B;  1KSW A;  3LX7 A;  2A28 A;  2OJ2 A;  1W2B P;  3GIB A;  2L0A A;  1NM7 A;  2DL4 A;  2J7I A;  3HKS A;  2ED1 A;  2L3R A;  4J8O A;  5GAM h;  3M0U A;  3EH2 A;  3CD6 A;  1Q7Y U;  1NJI U;  3JV3 A;  3OMC A;  4QT7 A;  3RUX A;  2VGM A;  4A4K A;  3CC7 Q;  1RLP C;  2DBK A;  3JCM c;  3TEE A;  1KJW A;  2LX9 A;  1MND A;  4JPB W;  1WDX A;  4Z88 A;  2ZPB B;  3S6W A;  1K0S A;  3QXE B;  1AOJ A;  1UJY A;  3RER A;  1QVG P;  3OYY A;  2HSP A;  3VYH B;  3CBO A;  5KYW A;  3CCU A;  1VQ5 Q;  1GL5 A;  2V8K A;  4M75 E;  4OB2 B;  1M2O A;  3SFM A;  4XTZ A;  2A37 A;  2K79 A;  2D8H A;  3CC4 A;  1SEM A;  1UTI A;  3AHU A;  2P0Q A;  2X3W D;  3FDR A;  4ATO A;  2VC8 A;  2RM4 A;  2FYK A;  3QZ5 B;  5D6X A;  4MMK A;  2QDY B;  1UDL A;  3JCM d;  1X2K A;  2ECZ A;  2EYW A;  2NUP A;  5GJV B;  3RES A;  2COW A;  2X51 A;  2HZY A;  2CKK A;  1Q81 U;  4BAC A;  2BE7 D;  4J6Y A;  4N0A C;  3G4S A;  2PVD B;  2XMF A;  4LXC A;  4AFZ C;  3QDF A;  1OUL A;  4NL2 A;  2JW4 A;  1K8A C;  2FO0 A;  3QO3 A;  2X9H A;  4KH0 B;  1B7T A;  2L3S A;  5CK9 A;  4OMM A;  3JCM V;  4EPC A;  1VQN T;  4QKU A;  1K0X A;  3CXC P;  3BW1 A;  1JEG A;  4DBR A;  3CCE Q;  2K2M A;  5IHI A;  5IAY A;  4KUI A;  1IZ6 A;  2RQT A;  4OF1 A;  1PNJ A;  2L2P A;  1QVF P;  5I2S A;  3TVT A;  4KGX B;  1VUB A;  3G71 T;  3EG9 B;  4O6J A;  4CC4 B;  4X34 A;  5CKE A;  3CC2 T;  1AWW A;  1G5V A;  3HFN A;  4HXJ A;  1WX6 A;  3RNJ A;  2RO0 A;  3NFC A;  3E1S A;  3X25 B;  2KSS A;  3LH5 A;  1UGQ B;  4KUL A;  4C8Q B;  2DVJ A;  2Y4X A;  2XIC A;  1SSH A;  1LNX A;  5KYY B;  4L5G A;  4RCB A;  4MDW A;  1H3Z A;  4J5Y A;  1H3H A;  2JJ9 A;  4JRQ A;  1GCQ A;  2D1X A;  2FZC B;  4OGE A;  3SEM A;  5KE3 A;  2ZGW A;  2DIL A;  1GFC A;  2HQX A;  4FCY A;  2DYI A;  4C5I A;  5CO7 A;  4OMN A;  5GAN 5;  5HY6 A;  1ZQ1 A;  1NZ9 A;  1JRI A;  3M58 A;  1KHI A;  1Y71 A;  3EGX B;  4C8Q F;  3OYD A;  1RAA B;  3MEU A;  2RQV A;  3FRN A;  5AT1 B;  4A4E A;  4AG2 C;  4QQD A;  1YI2 A;  4PJM A;  4FL6 A;  3JB9 F;  3OYE A;  2MK5 A;  1IGU A;  2FG0 A;  4ELY C;  2LTO A;  2X4Y A;  2JM9 A;  4HCZ A;  4F7U B;  2QYZ A;  2XKO C;  1KD1 C;  1M90 U;  4FW1 A;  1GCQ C;  1MGQ A;  3QG1 A;  1LPL A;  3HRS A;  2VB6 A;  1NLP C;  2RNA A;  1CKA A;  3QBY A;  2BZX A;  4J7F A;  4LD6 A;  1ACM B;  3MKD A;  2MF2 A;  2DX1 A;  2K5I A;  3U23 A;  2OTL T;  1UEB A;  2DL3 A;  2J6O A;  2KY9 A;  4WF2 A;  4BD3 A;  5CQY A;  2H3J A;  3M4G A;  4ZGE B;  1BI0 A;  2RQR A;  2F1L A;  3FJP A;  4F7U F;  2A0F B;  2FRY A;  1WNL A;  3GBQ A;  4PFP A;  1OU8 A;  1PSF A;  1OI1 A;  5A0D A;  1LCK A;  2DXT A;  3M54 A;  3NMZ C;  1KQS S;  3NPF A;  3CPW P;  2A3L A;  1U1T A;  2O4X A;  4M78 B;  1I5O B;  2CH4 W;  1Q7Y C;  1NJI C;  4NS5 A;  1W2B S;  1M1F A;  2VV5 A;  4XTW A;  4MZP A;  2QEX A;  2I0N A;  1FMV A;  4Z8A A;  2KRN A;  3PE0 A;  5FU7 C;  3JAM E;  3CCV Q;  5GAN e;  4C0F A;  2DTI A;  1QVG S;  3SD4 A;  2EQK A;  3VS0 A;  4M78 F;  1QW1 A;  4PFZ A;  2CT3 A;  1KQS A;  2NUP B;  3CBP A;  1BIB A;  4ORZ A;  1N27 A;  4J9B A;  3HRU A;  2CSI A;  2KYB A;  1W2B A;  1MNE A;  5FU6 B;  2XK0 A;  3HTR A;  2CS7 A;  1Q81 C;  1MV0 B;  4B9W A;  2FHD A;  3VS4 A;  2XI9 A;  5IN1 A;  4RTT A;  3OW2 P;  1CKB A;  2C0T A;  4C5G A;  1VIF A;  1WXB A;  2HDA A;  4PK4 A;  2DK3 A;  1D1B A;  4MDX A;  5GAN 3;  2MOX A;  1Z9Q A;  3QUI A;  1QVG A;  2A36 A;  3EG0 A;  2F69 A;  2D9T A;  2WSC E;  4XQ3 A;  5KH6 A;  3Q1J A;  2K3X A;  3A8G B;  1FMK A;  2ABL A;  3CXC S;  2EFI A;  4C92 G;  3LGL A;  3JSC A;  2LJ1 A;  3QYG B;  3EFR A;  1U1S A;  2DPP B;  3MP1 A;  4KT0 E;  3HPW A;  1X01 A;  3I55 A;  4FT4 A;  4M77 B;  2F2X A;  2JUF A;  1KQ2 A;  1M1K U;  5L23 A;  2LCS A;  1S72 T;  1EZZ B;  4LN2 A;  2ED0 A;  4GBQ A;  5LJ5 e;  2PUK B;  1X75 C;  1U8R A;  3M55 A;  4NL3 A;  3EH1 A;  3M0R A;  1YJW A;  4LDX A;  2VXE A;  3CCL T;  2LX7 A;  4PJO D;  2V8J A;  1J3T A;  1VQL A;  4OB3 B;  2JS0 A;  2W0Z A;  1R77 A;  1X69 A;  3CXC A;  2PQW A;  4DBF A;  2EBP A;  1D0X A;  3CCS Q;  4C0Z A;  5GAN h;  2KQW A;  2C0I A;  1N9S A;  3G1J A;  1JQQ A;  4RTX A;  4AFS C;  2MYS A;  1VQK T;  3RKW A;  3O8V A;  1G8X A;  2WSF E;  1SPK A;  3RIR A;  3WVD B;  3PMT A;  3OSS C;  2GCX A;  2PVG B;  2RH2 A;  2KT1 A;  2DEQ A;  3CMA Q;  1YIJ Q;  4M7D B;  4XTV A;  4JZ4 A;  3LWI A;  3QHS A;  2HBP A;  2HKQ B;  1M90 C;  3CC7 A;  2E3I A;  1RAE B;  3X26 B;  3CCM T;  2D8J A;  2EYY A;  1WPY A;  2A08 A;  4DBQ A;  2RD1 A;  3H9N A;  1VQ8 T;  2CP6 A;  1WHM A;  1PD0 A;  1VQP Q;  2O01 E;  1UB4 A;  2EW3 A;  2QQA A;  1G3S A;  2YT6 A;  1WJR A;  5FU7 B;  3QYH B;  2LP5 A;  2D0N A;  1VQ5 A;  4IUR A;  5CR2 A;  4N4I A;  2QI2 A;  1BKB A;  3L2Z A;  3H6Z A;  2MPX C;  2DTH A;  2EIF A;  1JXO A;  2JMA A;  4QVD A;  1SRM A;  4X9D A;  1RAD B;  5LL6 S;  4N4G A;  5J26 A;  3VS7 A;  3AT1 B;  2OTJ Q;  4BDZ A;  2EWN A;  4JRI A;  2DLP A;  4OML A;  3BE3 A;  1YIT Q;  3A98 A;  4JJN K;  2O4X B;  3ME9 A;  1YP5 A;  1Y57 A;  1ZSZ A;  1VIE A;  5I22 A;  2DNU A;  1UE9 A;  2WSE E;  2LC4 A;  1K8A R;  3INZ A;  5EG2 A;  2JTE A;  1VQ6 T;  3QJ6 A;  4OMF B;  3QWY A;  2MMP A;  3SWN A;  2VWF A;  1JO8 A;  5CKB A;  1M3B A;  4M75 G;  5LJ5 h;  1G3T A;  2E12 A;  3BDU A;  3OS1 A;  1W70 A;  2CZ0 B;  4WCI A;  4ZN3 A;  1BYM A;  3L2U A;  1MMN A;  4QW2 A;  1QMC A;  2NYS A;  1QKX A;  2E4H A;  3CCE A;  1KG1 A;  1WFW A;  1M5Q 1;  2AZS A;  3M0S A;  1ZSZ C;  2VKN A;  3X24 B;  3UWN A;  4J7I A;  1ZUU A;  3M4Y A;  3VS5 A;  1XJW B;  4CC2 A;  2C06 A;  5KYX A;  1WHH A;  1NYF A;  1VQ7 T;  4M78 E;  3OYL A;  4PJO C;  2IG0 A;  3A8M B;  3I56 T;  4M7A B;  3J81 E;  1OPL A;  5GAM j;  2KNB B;  1Z9Z A;  2YXY A;  3WXM B;  1WHL A;  1NEG A;  3S3O A;  1LJO A;  3MHX A;  3OYI A;  2LRQ A;  2CH4 A;  5DY9 A;  1K9M U;  3T9N A;  5GAN 4;  1M8V A;  3H41 A;  2K7A A;  1AD5 A;  4E6R A;  1T3S A;  1T0H A;  2AZV A;  1G3Y A;  1K4U S;  3MEW A;  1C1A A;  5FWC A;  5DM7 R;  2BZY A;  2KI7 A;  2QDL A;  1NG2 A;  2O2O A;  3UA6 A;  1TUG B;  3THK A;  4OB1 B;  3PNW C;  5CCA A;  1KD1 R;  2DYB A;  1D3B B;  2RQW A;  2DD4 A;  1YNZ A;  2DBM A;  4EDU A;  1M1K C;  3L1A A;  2KMT A;  2RHZ A;  2NUT A;  2CP3 A;  3EFS A;  2L89 A;  3QJY A;  1ABQ A;  9ATC B;  3X28 B;  2KEA A;  1K73 U;  2MIO A;  4OP0 A;  1JBM A;  4D8D A;  2EJF A;  2HEQ A;  5LJ3 h;  1TG0 A;  4OGC A;  3CME Q;  2PU9 B;  4ELZ C;  4QQG A;  4NOY A;  2RK2 A;  1IGQ A;  2YRD A;  3EGD A;  3TQ7 P;  4V2S A;  3DLL A;  1O75 A;  2QA4 T;  1FX7 A;  1NYG A;  1X2Q A;  3SDZ A;  3G6E A;  1AWX A;  2DA9 A;  3H0H A;  5DLO A;  1VQO Q;  3V7R A;  2QAZ A;  1KIK A;  2QQR A;  2LNH B;  3JCM f;  3EFO A;  1RUW A;  1WIE A;  3GLX A;  3C95 A;  1U5S A;  3CCR Q;  2DXC A;  4M77 E;  5GAN 8;  3M57 A;  3MO8 A;  3UT1 A;  1Q7Y R;  1NJI R;  4C92 A;  4QVC A;  3ASK A;  2JT4 A;  3C4S A;  2LT4 A;  2W10 A;  3JCM g;  1YHQ T;  2DFU A;  3A8L B;  1Q86 U;  1G2B A;  2I2L A;  1PG5 B;  2KRO A;  3CCJ Q;  2EQM A;  4FT2 A;  1U3O A;  2HMA A;  4N0A A;  2XID A;  4J9I A;  2DZ9 A;  1F1B B;  1I8F A;  1FWZ A;  1RL2 A;  3CPF A;  2DXB A;  4IIM A;  2OI3 A;  2G6F X;  4JS4 A;  3CCV A;  1VQ4 T;  4HCC A;  4BUG A;  4M75 D;  2DIQ A;  2QQ9 A;  4C92 C;  1YJ9 Q;  3I35 A;  1MV3 A;  2L3Q A;  5FWB A;  3DLM A;  4L6V 5;  4RG8 A;  1M1G A;  4A4F A;  1ZSZ B;  3OYN A;  2EGE A;  3VRZ A;  4IIO A;  1M3A A;  1Q81 R;  1VYV A;  4M7D E;  2KVQ G;  1GBQ A;  6AT1 B;  3LWH A;  3SWN B;  2LVM A;  3QKJ A;  4R0K A;  1VYU A;  1YJN T;  4J9D A;  2GNC A;  1GFD A;  2HAX A;  1NPR A;  2Y90 A;  1Y96 A;  1A0N B;  3JCM J;  1X27 A;  3OYJ A;  3CCQ T;  4IKF A;  2RA2 A;  2IIM A;  2ESW A;  1ARK A;  1WHG A;  2RQU A;  2DJQ A;  1B3Q A;  1IO6 A;  5KYX B;  2Z0W A;  2XD0 A;  4MML A;  3S3M A;  2O9V A;  3NGP A;  2C0O A;  2R57 A;  1H64 1;  1D1A A;  4E47 A;  3EAE A;  4A54 A;  1YFN A;  1QWF A;  4FYV B;  4EIK A;  3GOX A;  1QCN A;  1ABO A;  4PFO A;  3EG2 A;  3JCM W;  4Y91 A;  2P0K A;  4YTL A;  4A4G A;  4MZT A;  3G6E T;  5GAM g;  2V26 A;  3PVQ A;  1PRM C;  2NUZ A;  1SSF A;  4C0G A;  4C0D C;  3SHW A;  1IRX A;  1VQM A;  3GNG A;  1OU9 A;  1G3W A;  3URG A;  2LNV A;  4AT1 B;  1K9M C;  3WVE B;  5LJ3 d;  3CD6 T;  1VQN Q;  3JCM P;  4M75 A;  3OBW A;  1FMW A;  4LUD A;  2COY A;  3RBB B;  3CCS A;  1TSF A;  1OZ3 A;  1AZE A;  4PJO G;  3G71 Q;  2O88 A;  2KXD A;  3PFS A;  2EQU A;  1MHN A;  2GQI A;  3CCU T;  1M90 R;  2E3H A;  5GAM d;  4HT9 A;  4J9C A;  3CC2 Q;  3OA6 A;  1VYT A;  1JJ2 P;  2GTO A;  3CMA A;  1YIJ A;  3CC4 T;  4M7A E;  1TWB A;  5CQX A;  2A7Y A;  2RJD A;  4FU6 A;  3JRZ A;  4E7S A;  2MWP A;  2AHJ B;  1K73 C;  2RHU A;  1QP2 A;  2KGT A;  2AIR B;  1LVK A;  3JB9 J;  3EGD B;  4M75 C;  2J05 A;  2K5L A;  2ZAE A;  1VQP A;  4K11 A;  1WJS A;  5KYN A;  1QKW A;  1UG1 A;  5FRN A;  2FEI A;  4D6W A;  2CT4 A;  2EGA A;  1TUC A;  3RMQ A;  3G4S T;  3QPH A;  1GRI A;  2ENM A;  2LJ0 A;  4PLL A;  4HVU A;  4C92 B;  1BCM A;  1YCY A;  2OTJ A;  1Y0M A;  3QZ9 B;  2LQW A;  2VYT A;  1YIT A;  1KC8 U;  4E7J A;  1TH7 A;  5FW9 A;  3PT9 A;  3V8L A;  4JZ3 A;  1PC0 A;  4E7K A;  5CAI A;  2YUO A;  2DF6 A;  5KYW B;  1Q86 C;  2HQH A;  4B9X A;  4RTW A;  4D8K A;  4N4H A;  2HL5 C;  2ZCF B;  2FVU A;  4ESR A;  3EG3 A;  1I81 A;  5GMK l;  1AWO A;  1WQW A;  4C92 F;  4JLI A;  1WQ7 A;  3MP8 A;  5IH2 A;  2ZPE B;  1CSK A;  4X9C A;  2DZC A;  2OTL Q;  4DA4 A;  2GF7 A;  4X1V A;  5GAN j;  3JCM X;  2CP7 A;  5GAO r;  1D0Y A;  1OPK A;  4PKC C;  1ZBX A;  3J80 E;  4PJJ A;  2CZ1 B;  2FPF A; 
#chains in the Genus database with same CATH homology
 2KRM A;  2SRC A;  1YP5 A;  1Y57 A;  1VA7 A;  5IXF A;  5I22 A;  2DNU A;  2PTK A;  1UE9 A;  1KSW A;  2A28 A;  2OJ2 A;  2JM8 A;  2DRK A;  2EYX A;  2L0A A;  2CRE A;  1NM7 A;  2BZ8 A;  2DL4 A;  2JTE A;  2J7I A;  2ED1 A;  2EVR A;  3M0U A;  3QWY A;  1WXU A;  2VWF A;  1JO8 A;  3JV3 A;  1ZBJ A;  4QT7 A;  1ZLM A;  1M3B A;  1RLP C;  2DBK A;  1KJW A;  4JPB W;  3R6N A;  1S1N A;  1WDX A;  1W70 A;  4Z88 A;  2EGC A;  4WCI A;  1K0S A;  1EFN A;  3IQL A;  4HCK A;  1AOJ A;  1X43 A;  1UJY A;  2YUP A;  4LUE A;  1QKX A;  2J6F A;  3H0I A;  1V1C A;  2HSP A;  1WFW A;  1GL5 A;  2AZS A;  3EG1 A;  2RMO A;  3M0S A;  2A37 A;  2K79 A;  2VKN A;  2D8H A;  2EPD A;  2V1Q A;  1ZUU A;  2FRW A;  1SEM A;  1UTI A;  2DMO A;  2AKK A;  2HBW A;  4OMO A;  3VS5 A;  2X3W D;  4CC2 A;  4ZNX A;  4JJB A;  2JXB A;  1UDL A;  1NYF A;  1HSQ A;  1X2K A;  2ECZ A;  2KR3 A;  2EYW A;  2ROL A;  1K76 A;  2LZ6 B;  5GJV B;  1OPL A;  2O9S A;  2KNB B;  4Y92 A;  2EYZ A;  1Z9Z A;  1SRL A;  1UHC A;  4AG1 C;  3KFV A;  1I0C A;  2DM1 A;  1NEG A;  1RLQ C;  2X3X D;  1K9A A;  2XMF A;  4AFU C;  4AFZ C;  2CH4 A;  3EHR A;  1WA7 A;  2JW4 A;  2FO0 A;  2L3S A;  2YDL A;  2VVK A;  4OMM A;  3H41 A;  1K0X A;  2K7A A;  2LQN A;  1AD5 A;  1PWT A;  4E6R A;  1JEG A;  1T3S A;  1T0H A;  2K2M A;  2AZV A;  5IHI A;  2RQT A;  1K4U S;  5FWC A;  1PNJ A;  1UFF A;  2L2P A;  2BZY A;  2JS2 A;  2QDL A;  1NG2 A;  2O2O A;  1BU1 A;  3UA6 A;  3TVT A;  4J9G A;  1NLO C;  3THK A;  2DYB A;  2RQW A;  1YNZ A;  2DBM A;  2M0Y A;  4CC4 B;  4LNP A;  1QLY A;  3ULR B;  1AWW A;  5EC7 A;  3CQT A;  3O5Z A;  4HXJ A;  1X6G A;  1WX6 A;  3RNJ A;  2FPD A;  1YCS B;  2J06 A;  2KYM A;  2O31 A;  3H0F A;  1ABQ A;  3VS3 A;  2KEA A;  1PHT A;  2YSQ A;  3LH5 A;  2MIO A;  4D8D A;  2GBQ A;  1MUZ A;  2ROT A;  1UJ0 A;  2DVJ A;  1UUE A;  1TG0 A;  2HEQ A;  1KFZ A;  1SSH A;  1I1J A;  1XOV A;  4GLM A;  3QWX X;  2GTJ A;  2MCN A;  1H3H A;  1X2Q A;  1NYG A;  1GCQ A;  2D1X A;  1AWX A;  2DA9 A;  3H0H A;  3SEM A;  1K1Z A;  2CUB A;  1KIK A;  2DIL A;  1GFC A;  2K6D A;  2LJ3 A;  2PNI A;  2LNH B;  2F2W A;  4OMN A;  1RUW A;  1WIE A;  1U5S A;  2P4R A;  2DE0 X;  3UA7 A;  1AEY A;  3M0Q A;  2JT4 A;  2RQV A;  2W10 A;  2RF0 A;  1AVZ C;  4AG2 C;  4Z89 A;  2OAW A;  3VRY A;  1G2B A;  1BB9 A;  2KRO A;  2FG0 A;  1U3O A;  2JM9 A;  4J9I A;  1T3L A;  1GCQ C;  1WYX A;  2DL7 A;  3TSW A;  1X6B A;  4IIM A;  2OI3 A;  1JXM A;  2G6F X;  1NLP C;  1E6H A;  4M4Z A;  2RNA A;  1CKA A;  4JJC A;  1NEB A;  4RUG A;  2BZX A;  2LMJ A;  4KRT A;  2H8H A;  2DX1 A;  3I35 A;  3U23 A;  1MV3 A;  2L3Q A;  2AK5 A;  2DL3 A;  2EQI A;  2F2V A;  2J6O A;  5FWB A;  1JU5 C;  2RQR A;  3VS2 A;  2FRY A;  1GCP A;  1QWE A;  2JMC A;  3GBQ A;  4J9F A;  2EGE A;  3VRZ A;  1B07 A;  4IIO A;  1M3A A;  1LCK A;  1VYV A;  3NMZ C;  1GBQ A;  1YN8 A;  3FJ5 A;  3NPF A;  1SHF A;  4R0K A;  1VYU A;  4JJD A;  2CH4 W;  2GGR A;  4J9D A;  1FYN A;  4DEX A;  2GNC A;  2DL5 A;  4J9H A;  4F16 A;  1GFD A;  2I0N A;  4Z8A A;  2KRN A;  3PE0 A;  1ZX6 A;  1A0N B;  1E7O A;  2V1R A;  1X27 A;  1U06 A;  2IIM A;  2ESW A;  1ARK A;  2SEM A;  4FSS A;  2DRM A;  2RQU A;  2DJQ A;  1OEB A;  1B3Q A;  2YUQ A;  2E5K A;  1WI7 A;  3VS0 A;  1IO6 A;  2CT3 A;  2O9V A;  4ORZ A;  3NGP A;  2KE9 A;  4F14 A;  1PKS A;  2C0O A;  2EKH A;  4J9B A;  5GJW B;  2CSI A;  1ZSG A;  3M0P A;  2L3P A;  2KYB A;  1QWF A;  2KBT A;  4EIK A;  4DEY A;  4CC7 A;  1ABO A;  3EG2 A;  1I07 A;  3I5S A;  3REA B;  4CC3 A;  1G83 A;  1MV0 B;  1RI9 A;  1ZUK A;  2CUD A;  3PVQ A;  1PRM C;  2NUZ A;  3VS4 A;  3SHW A;  4RTT A;  1GBR A;  1CKB A;  2C0T A;  1WXB A;  2HDA A;  1UGV A;  1AWJ A;  2MOX A;  4AFQ C;  4LE9 A;  5I11 A;  4A63 B;  1Z9Q A;  4LUD A;  3RBB B;  1H92 A;  2A36 A;  1H8K A;  3EG0 A;  3UAT A;  1AZE A;  1FMK A;  2ABL A;  2RPN A;  1M27 C;  3PVL A;  2KXC A;  1UHF A;  2O88 A;  2LJ1 A;  2KXD A;  1SHG A;  1PRL C;  4RTU A;  2GQI A;  2PZ1 A;  2CSQ A;  4J9C A;  1W6X A;  3REB B;  1VYT A;  2GTO A;  1YWO A;  2F2X A;  2KT8 A;  2DL8 A;  4HVW A;  1WLP B;  5L23 A;  2LCS A;  1BBZ A;  1ZUY A;  2KGT A;  1PKT A;  4LN2 A;  2ED0 A;  4GBQ A;  1M8M A;  1OOT A;  2RN8 A;  5ECA A;  2J05 A;  1M3C A;  4OMQ A;  3M0R A;  2K3B A;  1TUD A;  3TSZ A;  2HCK A;  3VS1 A;  4K11 A;  1M30 A;  3I5R A;  1QKW A;  1UG1 A;  5HCK A;  2LX7 A;  1J3T A;  2FEI A;  2JS0 A;  2CT4 A;  2W0Z A;  2EGA A;  1QCF A;  1WXT A;  1TUC A;  1X69 A;  4F17 A;  3NHN A;  4OMP A;  1GRI A;  2ENM A;  2LJ0 A;  2EBP A;  4HVU A;  2M51 A;  1E6G A;  2J6K A;  2KRS A;  1Y0M A;  2K9G A;  5IHN A;  2C0I A;  2LQW A;  1JQQ A;  4RTX A;  1N5Z A;  4AFS C;  5FW9 A;  5IXB A;  1W1F A;  4J9E A;  4JZ3 A;  2YUO A;  3EHQ A;  4HVV A;  2DF6 A;  3C0C A;  1SPK A;  1UEC A;  1YWP A;  2KT1 A;  2AKL A;  4RTW A;  4D8K A;  4JZ4 A;  3EGU A;  4ESR A;  3EG3 A;  1AWO A;  2FPE A;  1AZG B;  2D8J A;  2EYY A;  2A08 A;  3VS6 A;  1HJD A;  3I9Q A;  1OV3 A;  2CDT A;  5IH2 A;  2YUN A;  2EW3 A;  2YT6 A;  1CSK A;  2B86 A;  2LP5 A;  2D0N A;  4RTY A;  4X1V A;  4RTZ A;  1T0J A;  1JXO A;  2JMA A;  1BK2 A;  3M0T A;  1SRM A;  3UF4 A;  1OPK A;  3ZL7 C;  1HD3 A;  3VS7 A;  5IHK A;  2BTT A;  2DLP A;  4OML A;  2FPF A;  4RTV A;  2NWM A;  3A98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...