4D8DA

Crystal structure of hiv-1 nef fyn-sh3 r96w variant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
TLFVALYDYEAWTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase Fyn
publication title SH3 domain specificity
rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
total genus 12
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4d8dA00
2W0ZA 2SEMA 1OEBA 4J9IA 1YWPA 2FPEA 2F2XA 2RNAA 5L23A 3JV3A 2ED1A 2J05A 2LX7A 4RTVA 3M0TA 1SRMA 1M27C 2JM9A 3KFVA 2F2VA 1JO8A 2GQIA 4WCIA 2YUPA 2SRCA 2IIMA 2DL3A 1MV0B 1NM7A 1OOTA 3UA6A 4LE9A 4K11A 2B86A 5GJVB 1E6GA 2LJ0A 1KFZA 3THKA 1AWXA 1YWOA 4HVUA 2H8HA 2KYMA 4RTUA 1TUCA 3EHRA 4J9FA 2O9VA 1ABOA 2PZ1A 3FJ5A 1XOVA 1YP5A 1CKBA 1AZGB 1UJYA 1JQQA 4E6RA 3EG3A 1K4US 2VWFA 4ESRA 2CT4A 2DRMA 3VS7A 3VS6A 3M0SA 1Z9QA 2A37A 3PE0A 3H0HA 1I0CA 1GBQA 4ZNXA 1LCKA 4IIMA 4JJBA 2M51A 2RQTA 3I9QA 4D8KA 1GFDA 3H41A 2CUDA 4JJCA 1NEBA 1GCQA 2QDLA 5EC7A 2EGCA 1T0JA 2LNHB 4JJDA 4OMPA 1JXOA 2DLPA 1KIKA 1VA7A 4HVVA 2AKKA 1OV3A 2FPFA 2XMFA 2DM1A 2KT8A 1T3SA 4M4ZA 1WA7A 2HSPA 4JPBW 1K9AA 2BZXA 2K7AA 1PHTA 2CDTA 2F2WA 2KRMA 2AKLA 2ECZA 4LNPA 3EG2A 1GCQC 3REBB 1NYGA 2LMJA 1HJDA 5I22A 2X3WD 2LJ3A 2L2PA 1OPLA 2LP5A 5ECAA 1U06A 1M3AA 1GRIA 1HD3A 2V1RA 5GJWB 1RLPC 1V1CA 4AG2C 2DL4A 2FRWA 5HCKA 2LCSA 1QLYA 3M0RA 1AVZC 2O31A 1K1ZA 1WFWA 4Z8AA 2ROLA 4Y92A 2G6FX 2FEIA 2J7IA 3TSWA 2DL7A 3VS4A 4AG1C 5IHKA 2YT6A 2AZVA 2JTEA 1UFFA 2EVRA 2ED0A 1AWWA 2DNUA 2DJQA 3VS3A 1E6HA 1X6GA 2DX1A 1NLOC 3ZL7C 1Y0MA 2ESWA 4HCKA 2L3QA 1OPKA 2BTTA 1N5ZA 1K76A 1UECA 2EYXA 2ABLA 2OI3A 2E5KA 2EYWA 4JZ3A 4J9DA 2GNCA 1QKWA 3PVQA 2JW4A 3VS0A 1VYUA 2DILA 2HEQA 1Z9ZA 1Y57A 2FO0A 2MIOA 2EPDA 2DRKA 4X1VA 4F16A 2KR3A 1UE9A 2LJ1A 2VKNA 1VYVA 5I11A 1SPKA 2CT3A 2KT1A 1M30A 2DL5A 1G83A 4LN2A 1AZEA 2NUZA 1K0XA 1UTIA 5IXFA 1KSWA 2KROA 1M8MA 3ULRB 4F14A 2BZYA 2EQIA 1U3OA 2RQVA 1GFCA 1MV3A 2RMOA 2DF6A 1QKXA 1JU5C 2A28A 2X3XD 2M0YA 2ENMA 3LH5A 1YCSB 2KXDA 2FG0A 4D8DA 1ZBJA 2HDAA 1A0NB 3NHNA 2C0IA 1UHCA 1JXMA 2EYYA 1HSQA 2C0TA 2CREA 2JM8A 4RTTA 2D8JA 1WLPB 2RQUA 2LZ6B 2K79A 2A08A 2DBMA 3RNJA 1PWTA 5FW9A 2O88A 1UJ0A 1ZX6A 2O9SA 3H0FA 1X27A 2PNIA 1SHFA 1BBZA 2DE0X 1AWOA 3NPFA 4Z88A 2K9GA 2EKHA 2GTOA 4CC3A 3EGUA 2RQRA 1PRLC 4AFUC 1YN8A 2O2OA 4GBQA 4CC2A 3EHQA 4IIOA 2JS0A 3VS5A 2PTKA 2JMCA 3I5SA 1KJWA 1UHFA 4J9CA 1WIEA 3O5ZA 2YUNA 2DBKA 1RI9A 1B07A 4OMMA 3REAB 1TG0A 2D8HA 1X6BA 1GBRA 1QCFA 2EGEA 1NG2A 3GBQA 2HCKA 2KEAA 2J6KA 1U5SA 2AZSA 3I35A 2L0AA 3R6NA 4CC4B 2KGTA 2RPNA 3UATA 1ZUUA 1B3QA 3A98A 3PVLA 4J9EA 1X43A 3VRZA 2OJ2A 3RBBB 5IH2A 2RQWA 4ORZA 1J3TA 1WI7A 4RTYA 1BB9A 3UF4A 2KBTA 3I5RA 2LQWA 4Z89A 3SHWA 1ARKA 2JXBA 2AK5A 3M0QA 1PRMC 5FWCA 2D1XA 3U23A 2ROTA 2CSQA 3SEMA 1QWFA 1W1FA 2DVJA 1MUZA 4RTWA 1SHGA 1RUWA 2CSIA 2J6FA 1NYFA 4HVWA 4OMLA 3C0CA 4OMQA 1AD5A 1I1JA 4FSSA 1PNJA 1SEMA 1GL5A 2YDLA 1AOJA 1T3LA 4RTXA 1ZUYA 4AFZC 1BU1A 1WXTA 2L3PA 4OMOA 1BK2A 2GGRA 3QWXX 2MCNA 3VRYA 1AEYA 1FYNA 2DYBA 4EIKA 1JEGA 2CH4W 2YUOA 4A63B 1X2QA 4DEYA 2KRNA 1WX6A 2VVKA 4HXJA 2KNBB 2BZ8A 2GBQA 3NGPA 4LUDA 1T0HA 2K2MA 2D0NA 2KXCA 1ABQA 2C0OA 3UA7A 1CKAA 4AFQC 1GCPA 2KYBA 1WDXA 2HBWA 2DL8A 3H0IA 1NEGA 1ZSGA 2NWMA 2MOXA 1TUDA 2DA9A 4AFSC 1UUEA 2CH4A 1FMKA 1RLQC 2K6DA 2GTJA 1ZUKA 1S1NA 4GLMA 4LUEA 4OMNA 1M3BA 2A36A 2KRSA 2EGAA 1M3CA 1H92A 5IHIA 1W6XA 3TSZA 1YNZA 3EG0A 1X69A 2RF0A 4J9HA 2EW3A 2CUBA 3VS2A 2L3SA 4J9BA 1K0SA 2JS2A 1AWJA 1CSKA 2V1QA 1W70A 1UG1A 3QWYA 3CQTA 4J9GA 2P4RA 3NMZC 2FPDA 2J06A 1NLPC 2KE9A 3TVTA 2FRYA 1WXUA 1SSHA 2JMAA 5IHNA 3EG1A 1UGVA 1G2BA 1E7OA 1WYXA 3M0PA 1ZLMA 5FWBA 1EFNA 2OAWA 1PKTA 1PKSA 4JZ4A 4DEXA 4QT7A 1UDLA 2W10A 2J6OA 3M0UA 4F17A 2JT4A 1X2KA 4RTZA 1SRLA 1H8KA 1WXBA 2K3BA 5IXBA 3IQLA 1QWEA 4RUGA 1H3HA 4CC7A 2RN8A 4R0KA 1IO6A 1I07A 2EBPA 2EYZA 2YUQA 2YSQA 3VS1A 2I0NA 2LQNA 1VYTA 2DMOA 4KRTA
chains in the Genus database with same CATH superfamily
4MMKA 2XK0A 1YWPA 4EPCA 1SRMA 4M77A 1M27C 2A3LA 5C6SA 4XU1A 2DIQA 3KFVA 1KHCA 4M77D 3UA6A 4BE2A 3BDLA 3CC4A 4C0FA 1E6GA 4J7FA 1KFZA 2ZPEB 3THKA 1BI1A 2HQHA 5CKEA 4AT1B 4LD6A 3S3OA 4M77C 2R58A 3EFRA 1H641 5GAN2 3GNFB 5AT1B 2AIRB 2ZPHB 2VXEA 1HXDA 4BACA 1RAEB 1ABOA 1KD1R 2PZ1A 4M77B 3CMET 3FLGA 1YP5A 2R57A 3CCST 1CKBA 3KUFA 4NS5A 3CD6A 2RI2A 8AT1B 2HAXA 4J5YA 2EQUA 2CT4A 5FLXE 2E1HA 2FZKB 3TCJA 2MWOA 2A37A 4BB7A 2H3JA 5GMKi 3G6ET 1QVFP 4ZNXA 1LCKA 2KI7A 2DZ9A 2BUDA 2B8AA 3OA6A 4OP0A 2RM4A 4JJDA 2E10A 2JVVA 4HVVA 2AKKA 2DM1A 1SSFA 1T3SA 4JPBW 1YJNT 5A0DA 1K9AA 2K7AA 3RR6A 1PHTA 2F2WA 2EQJA 2M0OA 4MZTA 1OX8A 3PIPA 4JUVA 2QTVA 3OBYA 3JB9J 2DTOA 2LJ3A 4DBHA 2L2PA 1RAAB 1OPLA 2JUFA 1HD3A 2V1RA 1V1CA 2DL4A 2FRWA 3G7ZA 5LJ5j 2LCSA 2RHXA 2Y90A 3L2VA 1AVZC 5DY9A 1K1ZA 2RHZA 1IREB 2FEIA 1M8VA 1VQKT 4DBQA 3SWNA 1JB0E 2X9HA 4UC4A 5CKBA 2ED0A 2VC8A 2EKOA 2AHJB 3VS3A 4L59A 2PVOB 4C0ZA 1HK9A 1X6GA 3M57A 1VQ7T 1Y0MA 1AT1B 4HCKA 3MCAB 1VQ6T 1OPKA 2NYSA 2EQMA 1LPLA 4DBFA 3SWNC 3WXMB 2DETA 2MAMA 1KQSA 5LL6S 4FM4B 2DXUA 4JZ3A 2DZCA 1WHLA 2GNCA 5KYWA 5CVIA 1BI3A 2HEQA 5CKDA 4M75A 4ZGEB 2I2LA 1VQ5Q 3SWNB 2EPDA 5KE3A 2DRKA 4FT4A 4F16A 1MMAA 1UE9A 4M75D 3QZ5B 1I4K1 2PU9B 3ZEHA 3A5ZB 2L5QA 2RD1A 3VUBA 5GAMf 4BI4A 3OSSC 2JN0A 1QQJA 1UTIA 5IXFA 1WZOA 3WVEB 4D6WA 4F7UE 1G3YA 1KSWA 4M75C 2HNIA 2COZA 4EMGA 5KYWB 2OAUA 1QKXA 4M75B 1NE8A 2KXDA 1FMWA 4D8DA 4C92A 3A8GB 3PIOA 3G4SQ 3NHNA 2C0IA 1D3BA 2MYSA 1VQ5A 3C4SA 4C92D 2CREA 3PNWC 3J7AF 1QVPA 4RTTA 1WLPB 2K79A 1K9MC 1PWTA 2O88A 3ME9A 1S72Q 1ZX6A 1D09B 1LOJA 3H0FA 4C92C 2DFUA 4E2FB 4F7UG 4PJJA 2DE0X 1AWOA 3V7SA 4Z88A 3M55A 4C5EA 2GTOA 2MK5A 1BKBA 2WACA 2O4XA 3QPHA 1PRLC 2CZ7B 4GBQA 3GPLA 4C92B 4PL6A 1PSEA 4RMOA 1D3BB 2KVQG 1KJWA 1UHFA 3HFOA 3P8DA 3G4SA 2YUNA 1PC0A 4BUGA 2DBKA 2QQSA 2WSEE 4OMMA 2D8HA 5GMKm 1FMVA 1NG2A 2HCKA 3O8VA 2J6KA 2AZSA 5KYUA 1O75A 4XTZA 2NUTA 1YJWT 3OS5A 3E2UA 2O4XB 7AT1B 3A98A 3M4GA 3OYGA 1JJ2S 2C06A 3VU3C 3FB9A 5CQYA 5J39A 1M90U 2XICA 2ZZDA 5IH2A 4RTYA 3CCSQ 2MI6A 3UF4A 4LDVA 3I5RA 3SHWA 3M4YA 3M0QA 4M7AA 3OSVA 2JTMA 1M1KU 2HKNA 1Q81R 4C8QA 3G6EQ 1TSFA 5KYUB 1VQ9T 3SEMA 2OTJT 4M7AD 4IUUA 1W1FA 5A0GA 2DVJA 2NUTB 3RMSA 4C8QD 4RTWA 1M90C 1QCNA 1RUWA 1I8FA 4OF1A 1KG1A 1QVGS 4HVWA 4OMLA 4JDSA 1AD5A 2DKGA 1PNJA 1SEMA 1IZ6A 4M7AC 3A1PA 4HKEA 3HRUA 3MEWA 4C8QC 1BU1A 4IUTA 2MCNA 3LW5E 5KYYA 1M1KC 3OYKA 4M7DA 4J7IA 3CCSA 2DXCA 1X2QA 4M7AB 1WX6A 2VVKA 2YLCA 4HXJA 4C5HA 4C8QB 5HK3A 4M7DD 3HFNA 3V8KA 4KH1B 4A53A 2EAYA 2K2MA 2JNGA 2XD0A 3H9NA 2KXCA 3G6EA 1QMCA 3MPUB 2HD0A 2VB6A 1NPPA 1WDXA 4L6V5 2QQBA 1IGQA 1R77A 3BW1A 1NEGA 1VQKQ 2E64A 5FU6C 1XTDA 1EZZB 1ZSGA 3I55Q 3ER0A 4JS5A 4V2SA 5GANh 2DA9A 4AFSC 5KH6A 5KYYB 2K6DA 4M7DB 4X34A 4GLMA 1AHJB 1YJNA 5D6XA 4HA8A 1M3BA 5FU6B 5CR2A 1VQ7Q 2A36A 2LQKA 3KBGA 1IGUA 1VQ6Q 3Q1JA 2DXBA 1W6XA 4QQDA 5IHIA 1YNZA 2KK4A 4DBRA 2RF0A 4E7HA 2YHTA 1VQOQ 3VS2A 1WHJA 3RKYA 1K8AU 2JS2A 5GANg 1OZ3A 3JB9D 4MDWA 2EJGA 5I2MA 2EFIA 3E9FA 3ASKA 1U8RA 3QSUA 4BE1A 1FWZA 5I21A 3GF5A 1UGRB 1VQKA 2KE9A 4A4HA 4M77F 2FRYA 2BE9B 1WXUA 2DIGA 1SSHA 5KYNA 1YHQT 2V8JA 3EG1A 1SG5A 1YBYA 1UGVA 1WYXA 5CAIA 1MMNA 2OAWA 1PKTA 4QT7A 1VQ7A 2ZAEA 2J6OA 3CXCA 2LT1A 4IUPA 1VQ6A 2JT4A 1Y7XA 2PUOB 1R0BG 5M9OA 3CMAT 2X35A 5DLOA 3D7SB 3MO8A 5KE2A 4PLLA 1H3HA 3CEYA 4DA4A 3AT1B 3OW2S 2RN8A 3GLXA 4R0KA 3CC2T 2EYZA 2EBPA 3RERA 1LJOA 2P0PA 1QVFS 3CCQQ 5CKFA 2I0NA 3EGXA 3X25B 1W2BP 2DVEA 1GXIE 2RI3A 2SEMA 3UT1A 1TUGB 2QK0A 5GANe 2ED1A 1FXXA 4LD9K 4OB0B 4B6MA 2YXYA 2E12A 4JRIA 3QUIA 1ZA1B 2JM9A 1JO8A 2CZ0B 2GQIA 3JSCA 2SRCA 4FCYA 2DL3A 3RMQA 1U1TA 1NM7A 2X4YA 4C5IA 4LE9A 2B86A 4C0DC 1Q82R 4PJOE 3M9QA 2GFUA 3FIFA 2X4WA 3EGXB 4X9DA 4XK8E 3HTRA 1YWOA 1TWBA 1C0MA 3BE3A 1RAIB 2QI2A 3CCVT 3SD4A 2DD5A 1TUCA 3EHRA 3HHTB 4KH0B 1PG5B 1YITQ 4B9XA 4J9FA 4M78E 4IKFA 3FJ5A 3QHSA 3NTKA 1WPYA 1QCOA 5LJ5h 1JJ2P 1AZGB 1UJYA 2L89A 1YJWQ 4E6RA 2CZ1B 4HT9A 3ZBDA 2COYA 3FDRA 2L8DA 2VWFA 2DRMA 4MMLA 1BIBA 4Z02A 4PJOG 1I0CA 5GAN7 4D8KA 1GFDA 1ZQ1A 3H41A 1B7TA 4JJCA 2HL5C 3M54A 3RKWA 1UEBA 4NL3A 2QDLA 2RI5A 2EGCA 1T0JA 4OMPA 1UGQB 2DLPA 1VA7A 2FPFA 2XMFA 3CCMT 1QVGP 2KT8A 2OTJQ 4C0GA 2NLUA 4M78G 1K73R 5GAMj 2AKLA 3RUXA 1N6AA 2JZ2A 1UGSB 4R55A 4LDXA 1YJWA 3REBB 2LMJA 5I22A 1NBEB 4M75F 4XTUA 5ECAA 1OU8A 4F04B 2K2VA 4ANJA 5HCKA 1WQ7A 3BFMA 3M0RA 1VUBA 1WFWA 2G6FX 4CI0C 5GAN6 2J7IA 2DERA 3A8HB 2OX7A 2DL7A 4FYVB 3VS4A 5IHKA 2JOYA 3OYNA 2E5QA 4ZTJA 2E3HA 5GMKh 2EVRA 4N0AA 1VQ4T 2DJQA 1VQ9A 2OTJA 1VQMT 5FRMA 3ZL7C 4IUVA 3LWHA 2ESWA 2VV5A 1VQLQ 2BTTA 2RJCA 4C92F 3A8LB 4C5GA 5L8RE 3CD6Q 4N0AC 4HCZA 3OYHA 4J9DA 4A54A 3PVQA 2XG8D 2JW4A 4ELZC 2CYZB 2FO0A 3CBMA 1YJ9T 4OB3B 1WNLA 4E7IA 1M2OA 1ZHIA 2A7YA 4CRIA 2K3XA 4JLIA 2LJ1A 2FL7A 3INZA 2KT1A 3QBYA 2DTHA 1Q81C 2NUZA 1B34A 4J83A 4OB1B 4ZN3A 2QG9B 2BZYA 3QG1A 1VQLA 2EQIA 1MV3A 2OTLT 5HK0A 2D6FA 2DYIA 1Q86R 3JCMW 2A28A 1BIAA 4OGCA 3DB4A 4ZGDB 3JCMP 2FG0A 3OW2P 1ZBJA 1KQSS 4BI8B 2RH2A 1JXMA 1FX7A 4J6WA 3CCET 1B34B 3RNJA 5CK9A 1F1BB 2LTOA 1N8RU 2RHIA 2K4YA 3NTIA 1YIJT 1KC8U 4GLKA 2K9GA 2EKHA 4CC3A 2VASA 2DAQA 2QQAA 2RQRA 3S3MA 2HKQB 1YHQA 2DK3A 4M7AF 5LJ3h 2IG0A 1LNXA 4C8QF 4II1A 2PTKA 2JMCA 2CP3A 3TQ7P 3I5SA 1V76A 4PK4A 1N8RC 3JCMX 4ATOA 3O5ZA 1X01A 1K8AR 3PTAA 1B07A 1TG0A 3CMAA 1X6BA 1GBRA 2E6ZA 1KC8C 2KEAA 4FYWB 5D7UA 3CC2A 1U5SA 5AYFA 4CC4B 4AMCA 2KGTA 1JBMA 5LJ3g 2XKOC 1ZUUA 3CCVQ 3DB3A 1VOMA 1B3QA 4JRKA 4M7DF 2L3RA 2CGHA 1TS9A 3BDUA 5FRNA 3E1SA 3RBBB 4ME7A 4ORZA 1WI7A 4A4EA 1BB9A 2F5TX 1VQNT 4Z89A 1D0YA 1PM3A 5CQXA 2HQEA 4MDXA 1KQ2A 1N9SA 1PRMC 3MP1A 4JLGA 2ROTA 2CSQA 1QWFA 4QVDA 4RKUE 3JCMb 1SHGA 3GIBA 4E7ZA 2CSIA 4J6YA 2J6FA 4BY6C 1LVKA 3QYGB 2ZPFB 2HBPA 3CCVA 1GL5A 1AOJA 1T3LA 2YWWA 2G3RA 5GAN5 4RTXA 1ZUYA 2M02A 4RG8A 3JB9F 3L1AA 2QTXA 4PJLA 1AEYA 3VRYA 2GGRA 3X28B 2QGGA 5FU7C 3GP8A 4EIKA 3LH0A 3LX7A 2CH4W 4P5NA 4Q5WA 4BY6B 1MNEA 1K9MU 4A63B 3VV0A 1RADB 3OYAA 1M2VA 3NGPA 4LUDA 1T0HA 1Q7YC 3NFCA 1C1AA 2D0NA 1ABQA 2C0OA 4AFQC 1R8OB 4KGXB 2KYBA 1ZSZA 2HBWA 1M1GA 2DL8A 2MMPA 2CP7A 2HL3A 5IAYA 3X26B 2E3IA 3OB9A 1W2BS 1TUDA 4QKUA 3CPFA 5GANf 1VQ4Q 3CCMA 4QQ6A 3MJXA 2HMAA 2K5LA 3G71T 1MGQA 2EWNA 1ZSZC 1M2VB 1H92A 1R0CB 4PJMA 3OYBA 3EG0A 1C6VX 2EW3A 4J8OA 2PVGB 3JCMc 4J9BA 1K0SA 1AWJA 1ZSZB 3VJPA 2V1QA 1W70A 2LCLA 4LDUA 1YJ9Q 4J9GA 4OMFB 1YI2T 2P4RA 3OYIA 1IHWA 3TVTA 3AHUA 1RAGB 2JMAA 3VUZA 5IHNA 1VQ8T 3EG9A 5FROA 1VQ4A 2KSSA 5GMKl 4WTOB 1ZLMA 3CBPA 1VQMA 4JZ4A 1UDLA 2W10A 3URGA 4E7KA 1K73C 4F17A 1TU0B 2X4XA 1SRLA 3CMEQ 2FVUA 2YRDA 1QWEA 1KQSP 2Y4XA 1NJIC 5HY6A 1Y71A 2KMTA 5J26A 2VXFA 2LQ8A 5GAN8 1NZ9A 1RACB 1YJ9A 1D0ZA 1VYTA 2DMOA 3C12A 1M1FA 2W0ZA 3S6WA 3EG9B 1WHMA 1OEBA 3CCEQ 4J9IA 2ZPBB 5GAOm 3V7CA 5L23A 3JV3A 2J05A 2QDYB 1MHNA 1Y96A 3M0TA 3RESA 1U1SA 3I56T 4DOWA 4WCIA 3CPWA 3BY7A 2KDSA 1YJNQ 3CMEA 2OTLA 2QA4T 2LJ0A 1KQ1A 4RG2A 1AWXA 5GAMh 4PFZA 2QQ9A 4RTUA 1IRXA 2EQKA 1VQPT 1Y96B 3OYDA 3CCEA 4EMKA 2XDPA 3CC4T 1VIFA 4GY5A 1YIJA 3EGDA 4PJOA 3F70A 4BDZA 3VS6A 1Z9QA 4JRPA 1KD1C 3PE0A 4PJOD 3HPWA 2FHDA 4EMKC 2XHCA 4JJBA 2RQTA 3I9QA 1NEBA 2EJFA 5GAOp 1GCQA 5EC7A 2DEUA 2LNHB 1H3ZA 2VYTA 4PJOC 4M78A 1JXOA 5D6YA 1OV3A 1D1CA 2YLBA 4EMKB 1DJ7B 4X9CA 5CKHA 3PT9A 4M4ZA 4KULA 4M78D 2ATCB 2BZXA 4ELYC 4N4IA 5CCAA 3EGDB 1BI2A 4PLIA 4PJOB 2ECZA 4LNPA 5IT9E 3EG2A 1GCQC 1HJDA 4M78C 1KK7A 4RCCA 3FJPA 1U06A 1M3AA 1GRIA 1TXQA 4ZGJB 1RLPC 5J3BA 3OYJA 1RAHB 1QLYA 4BE0A 2O31A 2LT4A 4QW2A 4Y92A 3JCMh 3PMTA 4M78B 1VQNA 3L2RA 1BI0A 4AG1C 2AZVA 1UFFA 2DNUA 5GANd 1E6HA 2DX1A 1NLOC 3JCMV 2P84A 1EIFA 3QDFA 4OB2B 1N5ZA 2V26A 1G3WA 1K76A 3JCMg 4A4GA 3OS2A 4M7DE 2XU8A 2IVWA 2JTFA 1QKWA 1VYUA 1P92A 3JAME 1Y57A 2LNVA 4F7UF 2CP0A 3M59A 2KR3A 9ATCB 2VKNA 4L5GA 5I11A 1SPKA 2CT3A 3MP6A 2X51A 4EMHA 2DL5A 2E6NA 4Y91A 1K0XA 4FYXB 4C0DB 1M8MA 3ULRB 5KYXA 3X20B 1G3SA 1MNDA 1XNIA 2RQVA 3CCRT 4VUBA 2RMOA 4B9WA 2LRQA 4BD3A 3KXTA 2ZCFB 2X3XD 4M7DG 2ENMA 1K9MR 3LH5A 1YCSB 2DXTA 1W4SA 3G71A 3VKIA 2VGNA 1UHCA 1JRIA 2DD4A 2R5AA 1WHGA 4FW2A 3NTHA 5GAOr 2JM8A 2LZ6B 3EAEA 4E7LA 2RJEA 2LVMA 2A08A 2QAZA 2DBMA 5LJ5g 2RA2A 2KQWA 3M58A 1UJ0A 5KYXB 1ZA2B 1X27A 1SHFA 1YI2A 1VQ9Q 1BCOA 2WSFE 4WF2A 3EGUA 1VQ5T 1VQ8A 1QVFA 2O2OA 4PKCC 3CBOA 2BKDN 5LJ3f 3EHQA 5CO7A 2JS0A 2FB7A 2IPOB 3GNGA 1N27A 1TTHB 5GAOn 4Y28E 3CXCP 3DKMA 4J9CA 4A4FA 4JS4A 4DQ2A 1RI9A 3REAB 1HYOA 3JB9I 3FEOA 2EGEA 2BIVA 4MZPA 3QJYA 2CKKA 3R6NA 1XJWB 1WJQA 1G3TA 1D0XA 5LJ5d 1NPRA 2XI9A 3PVLA 4J9EA 1X43A 5GANj 3OYMA 1ZBXA 2RQWA 3OYCA 5LJ5e 3JB9H 1X6OA 4XU0A 1Q81U 3JRZA 1M90R 2LQWA 3I56A 2GQVA 1ARKA 1IHVA 3OS0A 1S72T 3M56A 3U23A 2RHYA 2QASA 2QA4A 2DPPB 3M5AA 3H6ZA 2O01E 3CCJT 1MUZA 1M1KR 3PMIA 3CCUT 1NYFA 4BDYA 1I1JA 2YDLA 3CCLT 1VQPA 2PQWA 1BYMA 1WXTA 2CS7A 4O5VA 3QWXX 4KUIA 2FZCB 1JEGA 1KHIA 2YUOA 3DLMA 1YHQQ 2KRNA 2MF2A 2KNBB 1G8XA 2HSEB 4TVRA 2V8IA 3L2WA 2VGMA 3VYHB 4LXCA 3CMAQ 2K3YA 3H0IA 1SKUB 4DOVA 3CC2Q 4F7UA 2LC4A 5GMKe 1UUEA 2CH4A 1FMKA 3HRSA 2ZPGB 4XQ3A 2MWPA 1PD1A 4FL6A 3PFSA 2KRSA 5IN1A 2E70A 4KBMB 3TSZA 1D1AA 1X69A 3LGLA 2M9UA 1MMDA 4PJNA 2P0QA 4QVCA 3UPUA 2F5KA 1CSKA 3G1JA 2QEXT 2GCXA 3QWYA 1PD0A 3V8JA 4F7UB 1N9RA 2J06A 1VIEA 2QQRA 4N4HA 2DO3A 2RO0A 3M0PA 4OGEA 1EFNA 3TREA 1PKSA 3TU4K 4MZMA 2QXFA 2ZPIB 4M77E 4JJNK 3CCRQ 1WXBA 3IQLA 4BI3A 4RUGA 4CC7A 3I55T 2GFAA 4N4GA 3R6OA 5GAOq 4KRTA 1QP2A 4PFPA 3E19A 3OYYA 2FPEA 2F2XA 2RNAA 2P4TA 4O6JA 4ZN1A 4PJOF 3EFOA 2LX7A 4RTVA 2GF7A 1Q7YU 1VQOT 3META 1I5OB 2RJFA 3CCMQ 2F2VA 3L2ZA 5LJ3d 1Q82U 2YUPA 2IIMA 1MV0B 1OOTA 4M77G 4E7JA 4K11A 2E65A 3CCRA 5GJVB 2F1LA 1WGSA 1OYXA 1O9SA 4M78F 5LJ3e 3CC7T 4HVUA 5FU7B 3QKJA 2H8HA 2EJ9A 2KYMA 2XDDA 3EFOB 1Q82C 1OULA 2O9VA 5GMKj 3QZ9B 1XOVA 3X24B 1JQQA 3SDZA 3EG3A 2D0QB 1K4US 4QQGA 4ESRA 2RB6A 3UDCA 3VS7A 1VQMQ 3CCQT 2YRCA 3M0SA 3MEAA 1ACMB 3H0HA 1D1BA 1GBQA 4IIMA 3CPWS 2M51A 3MHXA 3LGFA 3QIIA 2CUDA 1QW1A 2PUKB 2RHUA 1KIKA 2A0FB 4HCCA 1K73U 1RI0A 3C95A 3HRTA 1WA7A 2HSPA 1I81A 1YFNA 3CCJQ 3JCMJ 2BE7D 2CDTA 1WJSA 2KRMA 3FC3A 3OQ5A 1NJIU 3QJ6A 3P8BB 4IUQA 3CCUQ 3TEEA 2D9TA 1NYGA 2X3WD 2LP5A 3CCLQ 3P8HA 4FSXA 5GJWB 4AG2C 5GAN3 3PGGA 1PSFA 3DLLA 3SFMA 4J6XA 1YITT 2OTLQ 4Z8AA 2ROLA 3QDRB 3JCMf 2KAFA 3TSWA 4M75E 3V7RA 1S72A 1RL2A 2YT6A 2JTEA 2R5MA 1AWWA 4XTWA 2H3EB 3HSBA 3CCJA 1WHHA 3A8MB 3LWIA 2L3QA 4FT2A 3CCUA 2EYQA 1UECA 2EYXA 2LDMA 2ABLA 2OI3A 1YIJQ 2EIFA 3CCLA 3RKXA 5I2SA 5GAOl 2E5KA 2EYWA 3HKSA 5GAN4 3OY9A 3VS0A 2DILA 1Z9ZA 3E9GA 3MEUA 1M9SA 5LJ3j 5KCHA 2MIOA 1W2BA 5A0LA 3EH2A 4X1VA 1TOVA 4C92E 3CXCS 3C94A 1WQWA 4M75G 1G5VA 2LCCA 1VYVA 1M30A 4LN2A 1G83A 2QEXQ 1AZEA 1WHKA 1KD1U 2E4HA 3EH1A 2KROA 4F14A 1Q86U 4KGVB 1U3OA 3L2UA 1M5Q1 1GFCA 1V29B 4OVAA 6AT1B 3OMCA 2DF6A 5LJ5f 1JU5C 2M0YA 2F69A 2PVDB 2LX9A 1OI1A 4IURA 5GAMg 2HDAA 1A0NB 2NUPA 1I5LA 3MEVA 2EYYA 2CP5A 4FYYB 1HSQA 4M7DC 2C0TA 4C92G 2D8JA 1Q86C 2RQUA 1VQLT 2DJZA 1VQNQ 5FW9A 1JJ2A 4E7SA 4YTLA 4HT8A 3CD6T 2QEXA 2O9SA 1X75C 2CP2A 2XDBA 2KY9A 2PNIA 1BBZA 2FYKA 1N8RR 3NPFA 5DLQE 4PFOA 1OZ2A 2FZGB 4AFUC 1YCYA 1YN8A 2M1HA 1KC8R 2Z0WA 4CC2A 3MP8A 3UWNA 3L42A 2NUPB 1Q95G 4IIOA 3T9NA 3VS5A 4FU6A 2MPXC 3RDVA 1BCMA 2JJ9A 1WIEA 2M16A 2QGFB 4ZTFA 3OYEA 5GAMd 4KUDK 1RAFB 2DEQA 3QO3A 1RABB 1QVGA 4A4KA 1QCFA 3J80E 4M7AE 2K5FA 3GBQA 3H8ZA 3OBWA 3I55A 4KT0E 2X4JA 3I35A 4C8QE 2L0AA 3CC7Q 1TH7A 4XU3A 5GAMe 2RPNA 3LLRA 4HCBA 3UATA 2RK2A 1K8AC 1XQHA 2E41A 1IXDA 4NL2A 3VRZA 2OJ2A 2V8KA 1OX9A 1J3TA 8ATCB 3WVDB 1VQOA 2KBTA 3J81E 4XTYA 3CPWP 2ZGWA 3OYFA 2JXBA 2AK5A 3M53A 3G71Q 4RCBA 5FWCA 3QYHB 2D1XA 1QP3A 2CP6A 1WJRA 4M7AG 4KGZB 3GOXA 4EDUA 4C8QG 5A2QE 3CC7A 4XTVA 1SF9A 1Y07A 3C0CA 4OMQA 4FSSA 1OQKA 3L2QA 2K57A 2K5IA 1OU9A 4AFZC 3HP9A 2L3PA 4OMOA 1BK2A 1YI2Q 1Q7YR 3RIRA 3JCMQ 1FYNA 2DYBA 5CIUA 5DM7R 2HZYA 4DEYA 3S3NA 1VQ8Q 2BZ8A 2GBQA 5KCOA 3ZFJA 2RJDA 3LYIA 3JCMd 3CCQA 3FRNA 3UA7A 1CKAA 4FW1A 1GCPA 2COWA 1PCXA 3JCMe 1UB4A 2QYZA 2NWMA 2MOXA 3SB2A 3VYGA 4FIBA 3HL8A 1RLQC 3OYLA 1IB8A 2GTJA 4JRQA 1ZUKA 1S1NA 4LUEA 4OMNA 4LDWA 3OW2A 2EGAA 1M3CA 3QXEB 4J9HA 2CUBA 2XIDA 3EFSA 3A8OB 2L3SA 4LDYA 3I56Q 3V8LA 2AT1B 4QVZA 3JB9G 1UG1A 2P0KA 3CQTA 1YITA 4XAXB 4XU2A 3NMZC 2QA4Q 2FPDA 1NLPC 4PNOA 2YRVA 1EX4A 1M4ZA 1G2BA 1E7OA 2WSCE 5FWBA 1NJIR 2HQXA 4DEXA 2CZ6B 3MKDA 4NOYA 5EG2A 1VQPQ 3M0UA 3G4ST 1X2KA 4RTZA 1H8KA 5HKCA 2K3BA 5IXBA 3CC4Q 5C0MA 4E47A 5D6WA 3OS1A 4XTXA 2Y4YA 1IO6A 1I07A 1UGPB 2YUQA 2YSQA 2VUBA 4R56A 3OMGA 2RK1A 3VS1A 2LQNA 2DTIA 3N5BB 1MMGA
chains in the Genus database with same CATH topology
2W0ZA 2SEMA 1OEBA 4J9IA 1YWPA 2FPEA 2F2XA 2RNAA 5L23A 3JV3A 2ED1A 2J05A 2LX7A 4RTVA 3M0TA 1SRMA 1M27C 2JM9A 3KFVA 2F2VA 1JO8A 2GQIA 4WCIA 2YUPA 2SRCA 2IIMA 2DL3A 1MV0B 1NM7A 1OOTA 3UA6A 4LE9A 4K11A 2B86A 5GJVB 1E6GA 2LJ0A 1KFZA 3THKA 1AWXA 1YWOA 4HVUA 2H8HA 2KYMA 4RTUA 1TUCA 3EHRA 4J9FA 2O9VA 1ABOA 2PZ1A 3FJ5A 1XOVA 1YP5A 1CKBA 1AZGB 1UJYA 1JQQA 4E6RA 3EG3A 1K4US 2VWFA 4ESRA 2CT4A 2DRMA 3VS7A 3VS6A 3M0SA 1Z9QA 2A37A 3PE0A 3H0HA 1I0CA 1GBQA 4ZNXA 1LCKA 4IIMA 4JJBA 2M51A 2RQTA 3I9QA 4D8KA 1GFDA 3H41A 2CUDA 4JJCA 1NEBA 1GCQA 2QDLA 5EC7A 2EGCA 1T0JA 2LNHB 4JJDA 4OMPA 1JXOA 2DLPA 1KIKA 1VA7A 4HVVA 2AKKA 1OV3A 2FPFA 2XMFA 2DM1A 2KT8A 1T3SA 4M4ZA 1WA7A 2HSPA 4JPBW 1K9AA 2BZXA 2K7AA 1PHTA 2CDTA 2F2WA 2KRMA 2AKLA 2ECZA 4LNPA 3EG2A 1GCQC 3REBB 1NYGA 2LMJA 1HJDA 5I22A 2X3WD 2LJ3A 2L2PA 1OPLA 2LP5A 5ECAA 1U06A 1M3AA 1GRIA 1HD3A 2V1RA 5GJWB 1RLPC 1V1CA 4AG2C 2DL4A 2FRWA 5HCKA 2LCSA 1QLYA 3M0RA 1AVZC 2O31A 1K1ZA 1WFWA 4Z8AA 2ROLA 4Y92A 2G6FX 2FEIA 2J7IA 3TSWA 2DL7A 3VS4A 4AG1C 5IHKA 2YT6A 2AZVA 2JTEA 1UFFA 2EVRA 2ED0A 1AWWA 2DNUA 2DJQA 3VS3A 1E6HA 1X6GA 2DX1A 1NLOC 3ZL7C 1Y0MA 2ESWA 4HCKA 2L3QA 1OPKA 2BTTA 1N5ZA 1K76A 1UECA 2EYXA 2ABLA 2OI3A 2E5KA 2EYWA 4JZ3A 4J9DA 2GNCA 1QKWA 3PVQA 2JW4A 3VS0A 1VYUA 2DILA 2HEQA 1Z9ZA 1Y57A 2FO0A 2MIOA 2EPDA 2DRKA 4X1VA 4F16A 2KR3A 1UE9A 2LJ1A 2VKNA 1VYVA 5I11A 1SPKA 2CT3A 2KT1A 1M30A 2DL5A 1G83A 4LN2A 1AZEA 2NUZA 1K0XA 1UTIA 5IXFA 1KSWA 2KROA 1M8MA 3ULRB 4F14A 2BZYA 2EQIA 1U3OA 2RQVA 1GFCA 1MV3A 2RMOA 2DF6A 1QKXA 1JU5C 2A28A 2X3XD 2M0YA 2ENMA 3LH5A 1YCSB 2KXDA 2FG0A 4D8DA 1ZBJA 2HDAA 1A0NB 3NHNA 2C0IA 1UHCA 1JXMA 2EYYA 1HSQA 2C0TA 2CREA 2JM8A 4RTTA 2D8JA 1WLPB 2RQUA 2LZ6B 2K79A 2A08A 2DBMA 3RNJA 1PWTA 5FW9A 2O88A 1UJ0A 1ZX6A 2O9SA 3H0FA 1X27A 2PNIA 1SHFA 1BBZA 2DE0X 1AWOA 3NPFA 4Z88A 2K9GA 2EKHA 2GTOA 4CC3A 3EGUA 2RQRA 1PRLC 4AFUC 1YN8A 2O2OA 4GBQA 4CC2A 3EHQA 4IIOA 2JS0A 3VS5A 2PTKA 2JMCA 3I5SA 1KJWA 1UHFA 4J9CA 1WIEA 3O5ZA 2YUNA 2DBKA 1RI9A 1B07A 4OMMA 3REAB 1TG0A 2D8HA 1X6BA 1GBRA 1QCFA 2EGEA 1NG2A 3GBQA 2HCKA 2KEAA 2J6KA 1U5SA 2AZSA 3I35A 2L0AA 3R6NA 4CC4B 2KGTA 2RPNA 3UATA 1ZUUA 1B3QA 3A98A 3PVLA 4J9EA 1X43A 3VRZA 2OJ2A 3RBBB 5IH2A 2RQWA 4ORZA 1J3TA 1WI7A 4RTYA 1BB9A 3UF4A 2KBTA 3I5RA 2LQWA 4Z89A 3SHWA 1ARKA 2JXBA 2AK5A 3M0QA 1PRMC 5FWCA 2D1XA 3U23A 2ROTA 2CSQA 3SEMA 1QWFA 1W1FA 2DVJA 1MUZA 4RTWA 1SHGA 1RUWA 2CSIA 2J6FA 1NYFA 4HVWA 4OMLA 3C0CA 4OMQA 1AD5A 1I1JA 4FSSA 1PNJA 1SEMA 1GL5A 2YDLA 1AOJA 1T3LA 4RTXA 1ZUYA 4AFZC 1BU1A 1WXTA 2L3PA 4OMOA 1BK2A 2GGRA 3QWXX 2MCNA 3VRYA 1AEYA 1FYNA 2DYBA 4EIKA 1JEGA 2CH4W 2YUOA 4A63B 1X2QA 4DEYA 2KRNA 1WX6A 2VVKA 4HXJA 2KNBB 2BZ8A 2GBQA 3NGPA 4LUDA 1T0HA 2K2MA 2D0NA 2KXCA 1ABQA 2C0OA 3UA7A 1CKAA 4AFQC 1GCPA 2KYBA 1WDXA 2HBWA 2DL8A 3H0IA 1NEGA 1ZSGA 2NWMA 2MOXA 1TUDA 2DA9A 4AFSC 1UUEA 2CH4A 1FMKA 1RLQC 2K6DA 2GTJA 1ZUKA 1S1NA 4GLMA 4LUEA 4OMNA 1M3BA 2A36A 2KRSA 2EGAA 1M3CA 1H92A 5IHIA 1W6XA 3TSZA 1YNZA 3EG0A 1X69A 2RF0A 4J9HA 2EW3A 2CUBA 3VS2A 2L3SA 4J9BA 1K0SA 2JS2A 1AWJA 1CSKA 2V1QA 1W70A 1UG1A 3QWYA 3CQTA 4J9GA 2P4RA 3NMZC 2FPDA 2J06A 1NLPC 2KE9A 3TVTA 2FRYA 1WXUA 1SSHA 2JMAA 5IHNA 3EG1A 1UGVA 1G2BA 1E7OA 1WYXA 3M0PA 1ZLMA 5FWBA 1EFNA 2OAWA 1PKTA 1PKSA 4JZ4A 4DEXA 4QT7A 1UDLA 2W10A 2J6OA 3M0UA 4F17A 2JT4A 1X2KA 4RTZA 1SRLA 1H8KA 1WXBA 2K3BA 5IXBA 3IQLA 1QWEA 4RUGA 1H3HA 4CC7A 2RN8A 4R0KA 1IO6A 1I07A 2EBPA 2EYZA 2YUQA 2YSQA 3VS1A 2I0NA 2LQNA 1VYTA 2DMOA 4KRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0Z A;  2SEM A;  1OEB A;  4J9I A;  1YWP A;  2FPE A;  2F2X A;  2RNA A;  5L23 A;  3JV3 A;  2ED1 A;  2J05 A;  2LX7 A;  4RTV A;  3M0T A;  1SRM A;  1M27 C;  2JM9 A;  3KFV A;  2F2V A;  1JO8 A;  2GQI A;  4WCI A;  2YUP A;  2SRC A;  2IIM A;  2DL3 A;  1MV0 B;  1NM7 A;  1OOT A;  3UA6 A;  4LE9 A;  4K11 A;  2B86 A;  5GJV B;  1E6G A;  2LJ0 A;  1KFZ A;  3THK A;  1AWX A;  1YWO A;  4HVU A;  2H8H A;  2KYM A;  4RTU A;  1TUC A;  3EHR A;  4J9F A;  2O9V A;  1ABO A;  2PZ1 A;  3FJ5 A;  1XOV A;  1YP5 A;  1CKB A;  1AZG B;  1UJY A;  1JQQ A;  4E6R A;  3EG3 A;  1K4U S;  2VWF A;  4ESR A;  2CT4 A;  2DRM A;  3VS7 A;  3VS6 A;  3M0S A;  1Z9Q A;  2A37 A;  3PE0 A;  3H0H A;  1I0C A;  1GBQ A;  4ZNX A;  1LCK A;  4IIM A;  4JJB A;  2M51 A;  2RQT A;  3I9Q A;  4D8K A;  1GFD A;  3H41 A;  2CUD A;  4JJC A;  1NEB A;  1GCQ A;  2QDL A;  5EC7 A;  2EGC A;  1T0J A;  2LNH B;  4JJD A;  4OMP A;  1JXO A;  2DLP A;  1KIK A;  1VA7 A;  4HVV A;  2AKK A;  1OV3 A;  2FPF A;  2XMF A;  2DM1 A;  2KT8 A;  1T3S A;  4M4Z A;  1WA7 A;  2HSP A;  4JPB W;  1K9A A;  2BZX A;  2K7A A;  1PHT A;  2CDT A;  2F2W A;  2KRM A;  2AKL A;  2ECZ A;  4LNP A;  3EG2 A;  1GCQ C;  3REB B;  1NYG A;  2LMJ A;  1HJD A;  5I22 A;  2X3W D;  2LJ3 A;  2L2P A;  1OPL A;  2LP5 A;  5ECA A;  1U06 A;  1M3A A;  1GRI A;  1HD3 A;  2V1R A;  5GJW B;  1RLP C;  1V1C A;  4AG2 C;  2DL4 A;  2FRW A;  5HCK A;  2LCS A;  1QLY A;  3M0R A;  1AVZ C;  2O31 A;  1K1Z A;  1WFW A;  4Z8A A;  2ROL A;  4Y92 A;  2G6F X;  2FEI A;  2J7I A;  3TSW A;  2DL7 A;  3VS4 A;  4AG1 C;  5IHK A;  2YT6 A;  2AZV A;  2JTE A;  1UFF A;  2EVR A;  2ED0 A;  1AWW A;  2DNU A;  2DJQ A;  3VS3 A;  1E6H A;  1X6G A;  2DX1 A;  1NLO C;  3ZL7 C;  1Y0M A;  2ESW A;  4HCK A;  2L3Q A;  1OPK A;  2BTT A;  1N5Z A;  1K76 A;  1UEC A;  2EYX A;  2ABL A;  2OI3 A;  2E5K A;  2EYW A;  4JZ3 A;  4J9D A;  2GNC A;  1QKW A;  3PVQ A;  2JW4 A;  3VS0 A;  1VYU A;  2DIL A;  2HEQ A;  1Z9Z A;  1Y57 A;  2FO0 A;  2MIO A;  2EPD A;  2DRK A;  4X1V A;  4F16 A;  2KR3 A;  1UE9 A;  2LJ1 A;  2VKN A;  1VYV A;  5I11 A;  1SPK A;  2CT3 A;  2KT1 A;  1M30 A;  2DL5 A;  1G83 A;  4LN2 A;  1AZE A;  2NUZ A;  1K0X A;  1UTI A;  5IXF A;  1KSW A;  2KRO A;  1M8M A;  3ULR B;  4F14 A;  2BZY A;  2EQI A;  1U3O A;  2RQV A;  1GFC A;  1MV3 A;  2RMO A;  2DF6 A;  1QKX A;  1JU5 C;  2A28 A;  2X3X D;  2M0Y A;  2ENM A;  3LH5 A;  1YCS B;  2KXD A;  2FG0 A;  4D8D A;  1ZBJ A;  2HDA A;  1A0N B;  3NHN A;  2C0I A;  1UHC A;  1JXM A;  2EYY A;  1HSQ A;  2C0T A;  2CRE A;  2JM8 A;  4RTT A;  2D8J A;  1WLP B;  2RQU A;  2LZ6 B;  2K79 A;  2A08 A;  2DBM A;  3RNJ A;  1PWT A;  5FW9 A;  2O88 A;  1UJ0 A;  1ZX6 A;  2O9S A;  3H0F A;  1X27 A;  2PNI A;  1SHF A;  1BBZ A;  2DE0 X;  1AWO A;  3NPF A;  4Z88 A;  2K9G A;  2EKH A;  2GTO A;  4CC3 A;  3EGU A;  2RQR A;  1PRL C;  4AFU C;  1YN8 A;  2O2O A;  4GBQ A;  4CC2 A;  3EHQ A;  4IIO A;  2JS0 A;  3VS5 A;  2PTK A;  2JMC A;  3I5S A;  1KJW A;  1UHF A;  4J9C A;  1WIE A;  3O5Z A;  2YUN A;  2DBK A;  1RI9 A;  1B07 A;  4OMM A;  3REA B;  1TG0 A;  2D8H A;  1X6B A;  1GBR A;  1QCF A;  2EGE A;  1NG2 A;  3GBQ A;  2HCK A;  2KEA A;  2J6K A;  1U5S A;  2AZS A;  3I35 A;  2L0A A;  3R6N A;  4CC4 B;  2KGT A;  2RPN A;  3UAT A;  1ZUU A;  1B3Q A;  3A98 A;  3PVL A;  4J9E A;  1X43 A;  3VRZ A;  2OJ2 A;  3RBB B;  5IH2 A;  2RQW A;  4ORZ A;  1J3T A;  1WI7 A;  4RTY A;  1BB9 A;  3UF4 A;  2KBT A;  3I5R A;  2LQW A;  4Z89 A;  3SHW A;  1ARK A;  2JXB A;  2AK5 A;  3M0Q A;  1PRM C;  5FWC A;  2D1X A;  3U23 A;  2ROT A;  2CSQ A;  3SEM A;  1QWF A;  1W1F A;  2DVJ A;  1MUZ A;  4RTW A;  1SHG A;  1RUW A;  2CSI A;  2J6F A;  1NYF A;  4HVW A;  4OML A;  3C0C A;  4OMQ A;  1AD5 A;  1I1J A;  4FSS A;  1PNJ A;  1SEM A;  1GL5 A;  2YDL A;  1AOJ A;  1T3L A;  4RTX A;  1ZUY A;  4AFZ C;  1BU1 A;  1WXT A;  2L3P A;  4OMO A;  1BK2 A;  2GGR A;  3QWX X;  2MCN A;  3VRY A;  1AEY A;  1FYN A;  2DYB A;  4EIK A;  1JEG A;  2CH4 W;  2YUO A;  4A63 B;  1X2Q A;  4DEY A;  2KRN A;  1WX6 A;  2VVK A;  4HXJ A;  2KNB B;  2BZ8 A;  2GBQ A;  3NGP A;  4LUD A;  1T0H A;  2K2M A;  2D0N A;  2KXC A;  1ABQ A;  2C0O A;  3UA7 A;  1CKA A;  4AFQ C;  1GCP A;  2KYB A;  1WDX A;  2HBW A;  2DL8 A;  3H0I A;  1NEG A;  1ZSG A;  2NWM A;  2MOX A;  1TUD A;  2DA9 A;  4AFS C;  1UUE A;  2CH4 A;  1FMK A;  1RLQ C;  2K6D A;  2GTJ A;  1ZUK A;  1S1N A;  4GLM A;  4LUE A;  4OMN A;  1M3B A;  2A36 A;  2KRS A;  2EGA A;  1M3C A;  1H92 A;  5IHI A;  1W6X A;  3TSZ A;  1YNZ A;  3EG0 A;  1X69 A;  2RF0 A;  4J9H A;  2EW3 A;  2CUB A;  3VS2 A;  2L3S A;  4J9B A;  1K0S A;  2JS2 A;  1AWJ A;  1CSK A;  2V1Q A;  1W70 A;  1UG1 A;  3QWY A;  3CQT A;  4J9G A;  2P4R A;  3NMZ C;  2FPD A;  2J06 A;  1NLP C;  2KE9 A;  3TVT A;  2FRY A;  1WXU A;  1SSH A;  2JMA A;  5IHN A;  3EG1 A;  1UGV A;  1G2B A;  1E7O A;  1WYX A;  3M0P A;  1ZLM A;  5FWB A;  1EFN A;  2OAW A;  1PKT A;  1PKS A;  4JZ4 A;  4DEX A;  4QT7 A;  1UDL A;  2W10 A;  2J6O A;  3M0U A;  4F17 A;  2JT4 A;  1X2K A;  4RTZ A;  1SRL A;  1H8K A;  1WXB A;  2K3B A;  5IXB A;  3IQL A;  1QWE A;  4RUG A;  1H3H A;  4CC7 A;  2RN8 A;  4R0K A;  1IO6 A;  1I07 A;  2EBP A;  2EYZ A;  2YUQ A;  2YSQ A;  3VS1 A;  2I0N A;  2LQN A;  1VYT A;  2DMO A;  4KRT A; 
#chains in the Genus database with same CATH topology
 4MMK A;  2XK0 A;  1YWP A;  4EPC A;  1SRM A;  4M77 A;  1M27 C;  2A3L A;  5C6S A;  4XU1 A;  2DIQ A;  3KFV A;  1KHC A;  4M77 D;  3UA6 A;  4BE2 A;  3BDL A;  3CC4 A;  4C0F A;  1E6G A;  4J7F A;  1KFZ A;  2ZPE B;  3THK A;  1BI1 A;  2HQH A;  5CKE A;  4AT1 B;  4LD6 A;  3S3O A;  4M77 C;  2R58 A;  3EFR A;  1H64 1;  5GAN 2;  3GNF B;  5AT1 B;  2AIR B;  2ZPH B;  2VXE A;  1HXD A;  4BAC A;  1RAE B;  1ABO A;  1KD1 R;  2PZ1 A;  4M77 B;  3CME T;  3FLG A;  1YP5 A;  2R57 A;  3CCS T;  1CKB A;  3KUF A;  4NS5 A;  3CD6 A;  2RI2 A;  8AT1 B;  2HAX A;  4J5Y A;  2EQU A;  2CT4 A;  5FLX E;  2E1H A;  2FZK B;  3TCJ A;  2MWO A;  2A37 A;  4BB7 A;  2H3J A;  5GMK i;  3G6E T;  1QVF P;  4ZNX A;  1LCK A;  2KI7 A;  2DZ9 A;  2BUD A;  2B8A A;  3OA6 A;  4OP0 A;  2RM4 A;  4JJD A;  2E10 A;  2JVV A;  4HVV A;  2AKK A;  2DM1 A;  1SSF A;  1T3S A;  4JPB W;  1YJN T;  5A0D A;  1K9A A;  2K7A A;  3RR6 A;  1PHT A;  2F2W A;  2EQJ A;  2M0O A;  4MZT A;  1OX8 A;  3PIP A;  4JUV A;  2QTV A;  3OBY A;  3JB9 J;  2DTO A;  2LJ3 A;  4DBH A;  2L2P A;  1RAA B;  1OPL A;  2JUF A;  1HD3 A;  2V1R A;  1V1C A;  2DL4 A;  2FRW A;  3G7Z A;  5LJ5 j;  2LCS A;  2RHX A;  2Y90 A;  3L2V A;  1AVZ C;  5DY9 A;  1K1Z A;  2RHZ A;  1IRE B;  2FEI A;  1M8V A;  1VQK T;  4DBQ A;  3SWN A;  1JB0 E;  2X9H A;  4UC4 A;  5CKB A;  2ED0 A;  2VC8 A;  2EKO A;  2AHJ B;  3VS3 A;  4L59 A;  2PVO B;  4C0Z A;  1HK9 A;  1X6G A;  3M57 A;  1VQ7 T;  1Y0M A;  1AT1 B;  4HCK A;  3MCA B;  1VQ6 T;  1OPK A;  2NYS A;  2EQM A;  1LPL A;  4DBF A;  3SWN C;  3WXM B;  2DET A;  2MAM A;  1KQS A;  5LL6 S;  4FM4 B;  2DXU A;  4JZ3 A;  2DZC A;  1WHL A;  2GNC A;  5KYW A;  5CVI A;  1BI3 A;  2HEQ A;  5CKD A;  4M75 A;  4ZGE B;  2I2L A;  1VQ5 Q;  3SWN B;  2EPD A;  5KE3 A;  2DRK A;  4FT4 A;  4F16 A;  1MMA A;  1UE9 A;  4M75 D;  3QZ5 B;  1I4K 1;  2PU9 B;  3ZEH A;  3A5Z B;  2L5Q A;  2RD1 A;  3VUB A;  5GAM f;  4BI4 A;  3OSS C;  2JN0 A;  1QQJ A;  1UTI A;  5IXF A;  1WZO A;  3WVE B;  4D6W A;  4F7U E;  1G3Y A;  1KSW A;  4M75 C;  2HNI A;  2COZ A;  4EMG A;  5KYW B;  2OAU A;  1QKX A;  4M75 B;  1NE8 A;  2KXD A;  1FMW A;  4D8D A;  4C92 A;  3A8G B;  3PIO A;  3G4S Q;  3NHN A;  2C0I A;  1D3B A;  2MYS A;  1VQ5 A;  3C4S A;  4C92 D;  2CRE A;  3PNW C;  3J7A F;  1QVP A;  4RTT A;  1WLP B;  2K79 A;  1K9M C;  1PWT A;  2O88 A;  3ME9 A;  1S72 Q;  1ZX6 A;  1D09 B;  1LOJ A;  3H0F A;  4C92 C;  2DFU A;  4E2F B;  4F7U G;  4PJJ A;  2DE0 X;  1AWO A;  3V7S A;  4Z88 A;  3M55 A;  4C5E A;  2GTO A;  2MK5 A;  1BKB A;  2WAC A;  2O4X A;  3QPH A;  1PRL C;  2CZ7 B;  4GBQ A;  3GPL A;  4C92 B;  4PL6 A;  1PSE A;  4RMO A;  1D3B B;  2KVQ G;  1KJW A;  1UHF A;  3HFO A;  3P8D A;  3G4S A;  2YUN A;  1PC0 A;  4BUG A;  2DBK A;  2QQS A;  2WSE E;  4OMM A;  2D8H A;  5GMK m;  1FMV A;  1NG2 A;  2HCK A;  3O8V A;  2J6K A;  2AZS A;  5KYU A;  1O75 A;  4XTZ A;  2NUT A;  1YJW T;  3OS5 A;  3E2U A;  2O4X B;  7AT1 B;  3A98 A;  3M4G A;  3OYG A;  1JJ2 S;  2C06 A;  3VU3 C;  3FB9 A;  5CQY A;  5J39 A;  1M90 U;  2XIC A;  2ZZD A;  5IH2 A;  4RTY A;  3CCS Q;  2MI6 A;  3UF4 A;  4LDV A;  3I5R A;  3SHW A;  3M4Y A;  3M0Q A;  4M7A A;  3OSV A;  2JTM A;  1M1K U;  2HKN A;  1Q81 R;  4C8Q A;  3G6E Q;  1TSF A;  5KYU B;  1VQ9 T;  3SEM A;  2OTJ T;  4M7A D;  4IUU A;  1W1F A;  5A0G A;  2DVJ A;  2NUT B;  3RMS A;  4C8Q D;  4RTW A;  1M90 C;  1QCN A;  1RUW A;  1I8F A;  4OF1 A;  1KG1 A;  1QVG S;  4HVW A;  4OML A;  4JDS A;  1AD5 A;  2DKG A;  1PNJ A;  1SEM A;  1IZ6 A;  4M7A C;  3A1P A;  4HKE A;  3HRU A;  3MEW A;  4C8Q C;  1BU1 A;  4IUT A;  2MCN A;  3LW5 E;  5KYY A;  1M1K C;  3OYK A;  4M7D A;  4J7I A;  3CCS A;  2DXC A;  1X2Q A;  4M7A B;  1WX6 A;  2VVK A;  2YLC A;  4HXJ A;  4C5H A;  4C8Q B;  5HK3 A;  4M7D D;  3HFN A;  3V8K A;  4KH1 B;  4A53 A;  2EAY A;  2K2M A;  2JNG A;  2XD0 A;  3H9N A;  2KXC A;  3G6E A;  1QMC A;  3MPU B;  2HD0 A;  2VB6 A;  1NPP A;  1WDX A;  4L6V 5;  2QQB A;  1IGQ A;  1R77 A;  3BW1 A;  1NEG A;  1VQK Q;  2E64 A;  5FU6 C;  1XTD A;  1EZZ B;  1ZSG A;  3I55 Q;  3ER0 A;  4JS5 A;  4V2S A;  5GAN h;  2DA9 A;  4AFS C;  5KH6 A;  5KYY B;  2K6D A;  4M7D B;  4X34 A;  4GLM A;  1AHJ B;  1YJN A;  5D6X A;  4HA8 A;  1M3B A;  5FU6 B;  5CR2 A;  1VQ7 Q;  2A36 A;  2LQK A;  3KBG A;  1IGU A;  1VQ6 Q;  3Q1J A;  2DXB A;  1W6X A;  4QQD A;  5IHI A;  1YNZ A;  2KK4 A;  4DBR A;  2RF0 A;  4E7H A;  2YHT A;  1VQO Q;  3VS2 A;  1WHJ A;  3RKY A;  1K8A U;  2JS2 A;  5GAN g;  1OZ3 A;  3JB9 D;  4MDW A;  2EJG A;  5I2M A;  2EFI A;  3E9F A;  3ASK A;  1U8R A;  3QSU A;  4BE1 A;  1FWZ A;  5I21 A;  3GF5 A;  1UGR B;  1VQK A;  2KE9 A;  4A4H A;  4M77 F;  2FRY A;  2BE9 B;  1WXU A;  2DIG A;  1SSH A;  5KYN A;  1YHQ T;  2V8J A;  3EG1 A;  1SG5 A;  1YBY A;  1UGV A;  1WYX A;  5CAI A;  1MMN A;  2OAW A;  1PKT A;  4QT7 A;  1VQ7 A;  2ZAE A;  2J6O A;  3CXC A;  2LT1 A;  4IUP A;  1VQ6 A;  2JT4 A;  1Y7X A;  2PUO B;  1R0B G;  5M9O A;  3CMA T;  2X35 A;  5DLO A;  3D7S B;  3MO8 A;  5KE2 A;  4PLL A;  1H3H A;  3CEY A;  4DA4 A;  3AT1 B;  3OW2 S;  2RN8 A;  3GLX A;  4R0K A;  3CC2 T;  2EYZ A;  2EBP A;  3RER A;  1LJO A;  2P0P A;  1QVF S;  3CCQ Q;  5CKF A;  2I0N A;  3EGX A;  3X25 B;  1W2B P;  2DVE A;  1GXI E;  2RI3 A;  2SEM A;  3UT1 A;  1TUG B;  2QK0 A;  5GAN e;  2ED1 A;  1FXX A;  4LD9 K;  4OB0 B;  4B6M A;  2YXY A;  2E12 A;  4JRI A;  3QUI A;  1ZA1 B;  2JM9 A;  1JO8 A;  2CZ0 B;  2GQI A;  3JSC A;  2SRC A;  4FCY A;  2DL3 A;  3RMQ A;  1U1T A;  1NM7 A;  2X4Y A;  4C5I A;  4LE9 A;  2B86 A;  4C0D C;  1Q82 R;  4PJO E;  3M9Q A;  2GFU A;  3FIF A;  2X4W A;  3EGX B;  4X9D A;  4XK8 E;  3HTR A;  1YWO A;  1TWB A;  1C0M A;  3BE3 A;  1RAI B;  2QI2 A;  3CCV T;  3SD4 A;  2DD5 A;  1TUC A;  3EHR A;  3HHT B;  4KH0 B;  1PG5 B;  1YIT Q;  4B9X A;  4J9F A;  4M78 E;  4IKF A;  3FJ5 A;  3QHS A;  3NTK A;  1WPY A;  1QCO A;  5LJ5 h;  1JJ2 P;  1AZG B;  1UJY A;  2L89 A;  1YJW Q;  4E6R A;  2CZ1 B;  4HT9 A;  3ZBD A;  2COY A;  3FDR A;  2L8D A;  2VWF A;  2DRM A;  4MML A;  1BIB A;  4Z02 A;  4PJO G;  1I0C A;  5GAN 7;  4D8K A;  1GFD A;  1ZQ1 A;  3H41 A;  1B7T A;  4JJC A;  2HL5 C;  3M54 A;  3RKW A;  1UEB A;  4NL3 A;  2QDL A;  2RI5 A;  2EGC A;  1T0J A;  4OMP A;  1UGQ B;  2DLP A;  1VA7 A;  2FPF A;  2XMF A;  3CCM T;  1QVG P;  2KT8 A;  2OTJ Q;  4C0G A;  2NLU A;  4M78 G;  1K73 R;  5GAM j;  2AKL A;  3RUX A;  1N6A A;  2JZ2 A;  1UGS B;  4R55 A;  4LDX A;  1YJW A;  3REB B;  2LMJ A;  5I22 A;  1NBE B;  4M75 F;  4XTU A;  5ECA A;  1OU8 A;  4F04 B;  2K2V A;  4ANJ A;  5HCK A;  1WQ7 A;  3BFM A;  3M0R A;  1VUB A;  1WFW A;  2G6F X;  4CI0 C;  5GAN 6;  2J7I A;  2DER A;  3A8H B;  2OX7 A;  2DL7 A;  4FYV B;  3VS4 A;  5IHK A;  2JOY A;  3OYN A;  2E5Q A;  4ZTJ A;  2E3H A;  5GMK h;  2EVR A;  4N0A A;  1VQ4 T;  2DJQ A;  1VQ9 A;  2OTJ A;  1VQM T;  5FRM A;  3ZL7 C;  4IUV A;  3LWH A;  2ESW A;  2VV5 A;  1VQL Q;  2BTT A;  2RJC A;  4C92 F;  3A8L B;  4C5G A;  5L8R E;  3CD6 Q;  4N0A C;  4HCZ A;  3OYH A;  4J9D A;  4A54 A;  3PVQ A;  2XG8 D;  2JW4 A;  4ELZ C;  2CYZ B;  2FO0 A;  3CBM A;  1YJ9 T;  4OB3 B;  1WNL A;  4E7I A;  1M2O A;  1ZHI A;  2A7Y A;  4CRI A;  2K3X A;  4JLI A;  2LJ1 A;  2FL7 A;  3INZ A;  2KT1 A;  3QBY A;  2DTH A;  1Q81 C;  2NUZ A;  1B34 A;  4J83 A;  4OB1 B;  4ZN3 A;  2QG9 B;  2BZY A;  3QG1 A;  1VQL A;  2EQI A;  1MV3 A;  2OTL T;  5HK0 A;  2D6F A;  2DYI A;  1Q86 R;  3JCM W;  2A28 A;  1BIA A;  4OGC A;  3DB4 A;  4ZGD B;  3JCM P;  2FG0 A;  3OW2 P;  1ZBJ A;  1KQS S;  4BI8 B;  2RH2 A;  1JXM A;  1FX7 A;  4J6W A;  3CCE T;  1B34 B;  3RNJ A;  5CK9 A;  1F1B B;  2LTO A;  1N8R U;  2RHI A;  2K4Y A;  3NTI A;  1YIJ T;  1KC8 U;  4GLK A;  2K9G A;  2EKH A;  4CC3 A;  2VAS A;  2DAQ A;  2QQA A;  2RQR A;  3S3M A;  2HKQ B;  1YHQ A;  2DK3 A;  4M7A F;  5LJ3 h;  2IG0 A;  1LNX A;  4C8Q F;  4II1 A;  2PTK A;  2JMC A;  2CP3 A;  3TQ7 P;  3I5S A;  1V76 A;  4PK4 A;  1N8R C;  3JCM X;  4ATO A;  3O5Z A;  1X01 A;  1K8A R;  3PTA A;  1B07 A;  1TG0 A;  3CMA A;  1X6B A;  1GBR A;  2E6Z A;  1KC8 C;  2KEA A;  4FYW B;  5D7U A;  3CC2 A;  1U5S A;  5AYF A;  4CC4 B;  4AMC A;  2KGT A;  1JBM A;  5LJ3 g;  2XKO C;  1ZUU A;  3CCV Q;  3DB3 A;  1VOM A;  1B3Q A;  4JRK A;  4M7D F;  2L3R A;  2CGH A;  1TS9 A;  3BDU A;  5FRN A;  3E1S A;  3RBB B;  4ME7 A;  4ORZ A;  1WI7 A;  4A4E A;  1BB9 A;  2F5T X;  1VQN T;  4Z89 A;  1D0Y A;  1PM3 A;  5CQX A;  2HQE A;  4MDX A;  1KQ2 A;  1N9S A;  1PRM C;  3MP1 A;  4JLG A;  2ROT A;  2CSQ A;  1QWF A;  4QVD A;  4RKU E;  3JCM b;  1SHG A;  3GIB A;  4E7Z A;  2CSI A;  4J6Y A;  2J6F A;  4BY6 C;  1LVK A;  3QYG B;  2ZPF B;  2HBP A;  3CCV A;  1GL5 A;  1AOJ A;  1T3L A;  2YWW A;  2G3R A;  5GAN 5;  4RTX A;  1ZUY A;  2M02 A;  4RG8 A;  3JB9 F;  3L1A A;  2QTX A;  4PJL A;  1AEY A;  3VRY A;  2GGR A;  3X28 B;  2QGG A;  5FU7 C;  3GP8 A;  4EIK A;  3LH0 A;  3LX7 A;  2CH4 W;  4P5N A;  4Q5W A;  4BY6 B;  1MNE A;  1K9M U;  4A63 B;  3VV0 A;  1RAD B;  3OYA A;  1M2V A;  3NGP A;  4LUD A;  1T0H A;  1Q7Y C;  3NFC A;  1C1A A;  2D0N A;  1ABQ A;  2C0O A;  4AFQ C;  1R8O B;  4KGX B;  2KYB A;  1ZSZ A;  2HBW A;  1M1G A;  2DL8 A;  2MMP A;  2CP7 A;  2HL3 A;  5IAY A;  3X26 B;  2E3I A;  3OB9 A;  1W2B S;  1TUD A;  4QKU A;  3CPF A;  5GAN f;  1VQ4 Q;  3CCM A;  4QQ6 A;  3MJX A;  2HMA A;  2K5L A;  3G71 T;  1MGQ A;  2EWN A;  1ZSZ C;  1M2V B;  1H92 A;  1R0C B;  4PJM A;  3OYB A;  3EG0 A;  1C6V X;  2EW3 A;  4J8O A;  2PVG B;  3JCM c;  4J9B A;  1K0S A;  1AWJ A;  1ZSZ B;  3VJP A;  2V1Q A;  1W70 A;  2LCL A;  4LDU A;  1YJ9 Q;  4J9G A;  4OMF B;  1YI2 T;  2P4R A;  3OYI A;  1IHW A;  3TVT A;  3AHU A;  1RAG B;  2JMA A;  3VUZ A;  5IHN A;  1VQ8 T;  3EG9 A;  5FRO A;  1VQ4 A;  2KSS A;  5GMK l;  4WTO B;  1ZLM A;  3CBP A;  1VQM A;  4JZ4 A;  1UDL A;  2W10 A;  3URG A;  4E7K A;  1K73 C;  4F17 A;  1TU0 B;  2X4X A;  1SRL A;  3CME Q;  2FVU A;  2YRD A;  1QWE A;  1KQS P;  2Y4X A;  1NJI C;  5HY6 A;  1Y71 A;  2KMT A;  5J26 A;  2VXF A;  2LQ8 A;  5GAN 8;  1NZ9 A;  1RAC B;  1YJ9 A;  1D0Z A;  1VYT A;  2DMO A;  3C12 A;  1M1F A;  2W0Z A;  3S6W A;  3EG9 B;  1WHM A;  1OEB A;  3CCE Q;  4J9I A;  2ZPB B;  5GAO m;  3V7C A;  5L23 A;  3JV3 A;  2J05 A;  2QDY B;  1MHN A;  1Y96 A;  3M0T A;  3RES A;  1U1S A;  3I56 T;  4DOW A;  4WCI A;  3CPW A;  3BY7 A;  2KDS A;  1YJN Q;  3CME A;  2OTL A;  2QA4 T;  2LJ0 A;  1KQ1 A;  4RG2 A;  1AWX A;  5GAM h;  4PFZ A;  2QQ9 A;  4RTU A;  1IRX A;  2EQK A;  1VQP T;  1Y96 B;  3OYD A;  3CCE A;  4EMK A;  2XDP A;  3CC4 T;  1VIF A;  4GY5 A;  1YIJ A;  3EGD A;  4PJO A;  3F70 A;  4BDZ A;  3VS6 A;  1Z9Q A;  4JRP A;  1KD1 C;  3PE0 A;  4PJO D;  3HPW A;  2FHD A;  4EMK C;  2XHC A;  4JJB A;  2RQT A;  3I9Q A;  1NEB A;  2EJF A;  5GAO p;  1GCQ A;  5EC7 A;  2DEU A;  2LNH B;  1H3Z A;  2VYT A;  4PJO C;  4M78 A;  1JXO A;  5D6Y A;  1OV3 A;  1D1C A;  2YLB A;  4EMK B;  1DJ7 B;  4X9C A;  5CKH A;  3PT9 A;  4M4Z A;  4KUL A;  4M78 D;  2ATC B;  2BZX A;  4ELY C;  4N4I A;  5CCA A;  3EGD B;  1BI2 A;  4PLI A;  4PJO B;  2ECZ A;  4LNP A;  5IT9 E;  3EG2 A;  1GCQ C;  1HJD A;  4M78 C;  1KK7 A;  4RCC A;  3FJP A;  1U06 A;  1M3A A;  1GRI A;  1TXQ A;  4ZGJ B;  1RLP C;  5J3B A;  3OYJ A;  1RAH B;  1QLY A;  4BE0 A;  2O31 A;  2LT4 A;  4QW2 A;  4Y92 A;  3JCM h;  3PMT A;  4M78 B;  1VQN A;  3L2R A;  1BI0 A;  4AG1 C;  2AZV A;  1UFF A;  2DNU A;  5GAN d;  1E6H A;  2DX1 A;  1NLO C;  3JCM V;  2P84 A;  1EIF A;  3QDF A;  4OB2 B;  1N5Z A;  2V26 A;  1G3W A;  1K76 A;  3JCM g;  4A4G A;  3OS2 A;  4M7D E;  2XU8 A;  2IVW A;  2JTF A;  1QKW A;  1VYU A;  1P92 A;  3JAM E;  1Y57 A;  2LNV A;  4F7U F;  2CP0 A;  3M59 A;  2KR3 A;  9ATC B;  2VKN A;  4L5G A;  5I11 A;  1SPK A;  2CT3 A;  3MP6 A;  2X51 A;  4EMH A;  2DL5 A;  2E6N A;  4Y91 A;  1K0X A;  4FYX B;  4C0D B;  1M8M A;  3ULR B;  5KYX A;  3X20 B;  1G3S A;  1MND A;  1XNI A;  2RQV A;  3CCR T;  4VUB A;  2RMO A;  4B9W A;  2LRQ A;  4BD3 A;  3KXT A;  2ZCF B;  2X3X D;  4M7D G;  2ENM A;  1K9M R;  3LH5 A;  1YCS B;  2DXT A;  1W4S A;  3G71 A;  3VKI A;  2VGN A;  1UHC A;  1JRI A;  2DD4 A;  2R5A A;  1WHG A;  4FW2 A;  3NTH A;  5GAO r;  2JM8 A;  2LZ6 B;  3EAE A;  4E7L A;  2RJE A;  2LVM A;  2A08 A;  2QAZ A;  2DBM A;  5LJ5 g;  2RA2 A;  2KQW A;  3M58 A;  1UJ0 A;  5KYX B;  1ZA2 B;  1X27 A;  1SHF A;  1YI2 A;  1VQ9 Q;  1BCO A;  2WSF E;  4WF2 A;  3EGU A;  1VQ5 T;  1VQ8 A;  1QVF A;  2O2O A;  4PKC C;  3CBO A;  2BKD N;  5LJ3 f;  3EHQ A;  5CO7 A;  2JS0 A;  2FB7 A;  2IPO B;  3GNG A;  1N27 A;  1TTH B;  5GAO n;  4Y28 E;  3CXC P;  3DKM A;  4J9C A;  4A4F A;  4JS4 A;  4DQ2 A;  1RI9 A;  3REA B;  1HYO A;  3JB9 I;  3FEO A;  2EGE A;  2BIV A;  4MZP A;  3QJY A;  2CKK A;  3R6N A;  1XJW B;  1WJQ A;  1G3T A;  1D0X A;  5LJ5 d;  1NPR A;  2XI9 A;  3PVL A;  4J9E A;  1X43 A;  5GAN j;  3OYM A;  1ZBX A;  2RQW A;  3OYC A;  5LJ5 e;  3JB9 H;  1X6O A;  4XU0 A;  1Q81 U;  3JRZ A;  1M90 R;  2LQW A;  3I56 A;  2GQV A;  1ARK A;  1IHV A;  3OS0 A;  1S72 T;  3M56 A;  3U23 A;  2RHY A;  2QAS A;  2QA4 A;  2DPP B;  3M5A A;  3H6Z A;  2O01 E;  3CCJ T;  1MUZ A;  1M1K R;  3PMI A;  3CCU T;  1NYF A;  4BDY A;  1I1J A;  2YDL A;  3CCL T;  1VQP A;  2PQW A;  1BYM A;  1WXT A;  2CS7 A;  4O5V A;  3QWX X;  4KUI A;  2FZC B;  1JEG A;  1KHI A;  2YUO A;  3DLM A;  1YHQ Q;  2KRN A;  2MF2 A;  2KNB B;  1G8X A;  2HSE B;  4TVR A;  2V8I A;  3L2W A;  2VGM A;  3VYH B;  4LXC A;  3CMA Q;  2K3Y A;  3H0I A;  1SKU B;  4DOV A;  3CC2 Q;  4F7U A;  2LC4 A;  5GMK e;  1UUE A;  2CH4 A;  1FMK A;  3HRS A;  2ZPG B;  4XQ3 A;  2MWP A;  1PD1 A;  4FL6 A;  3PFS A;  2KRS A;  5IN1 A;  2E70 A;  4KBM B;  3TSZ A;  1D1A A;  1X69 A;  3LGL A;  2M9U A;  1MMD A;  4PJN A;  2P0Q A;  4QVC A;  3UPU A;  2F5K A;  1CSK A;  3G1J A;  2QEX T;  2GCX A;  3QWY A;  1PD0 A;  3V8J A;  4F7U B;  1N9R A;  2J06 A;  1VIE A;  2QQR A;  4N4H A;  2DO3 A;  2RO0 A;  3M0P A;  4OGE A;  1EFN A;  3TRE A;  1PKS A;  3TU4 K;  4MZM A;  2QXF A;  2ZPI B;  4M77 E;  4JJN K;  3CCR Q;  1WXB A;  3IQL A;  4BI3 A;  4RUG A;  4CC7 A;  3I55 T;  2GFA A;  4N4G A;  3R6O A;  5GAO q;  4KRT A;  1QP2 A;  4PFP A;  3E19 A;  3OYY A;  2FPE A;  2F2X A;  2RNA A;  2P4T A;  4O6J A;  4ZN1 A;  4PJO F;  3EFO A;  2LX7 A;  4RTV A;  2GF7 A;  1Q7Y U;  1VQO T;  3MET A;  1I5O B;  2RJF A;  3CCM Q;  2F2V A;  3L2Z A;  5LJ3 d;  1Q82 U;  2YUP A;  2IIM A;  1MV0 B;  1OOT A;  4M77 G;  4E7J A;  4K11 A;  2E65 A;  3CCR A;  5GJV B;  2F1L A;  1WGS A;  1OYX A;  1O9S A;  4M78 F;  5LJ3 e;  3CC7 T;  4HVU A;  5FU7 B;  3QKJ A;  2H8H A;  2EJ9 A;  2KYM A;  2XDD A;  3EFO B;  1Q82 C;  1OUL A;  2O9V A;  5GMK j;  3QZ9 B;  1XOV A;  3X24 B;  1JQQ A;  3SDZ A;  3EG3 A;  2D0Q B;  1K4U S;  4QQG A;  4ESR A;  2RB6 A;  3UDC A;  3VS7 A;  1VQM Q;  3CCQ T;  2YRC A;  3M0S A;  3MEA A;  1ACM B;  3H0H A;  1D1B A;  1GBQ A;  4IIM A;  3CPW S;  2M51 A;  3MHX A;  3LGF A;  3QII A;  2CUD A;  1QW1 A;  2PUK B;  2RHU A;  1KIK A;  2A0F B;  4HCC A;  1K73 U;  1RI0 A;  3C95 A;  3HRT A;  1WA7 A;  2HSP A;  1I81 A;  1YFN A;  3CCJ Q;  3JCM J;  2BE7 D;  2CDT A;  1WJS A;  2KRM A;  3FC3 A;  3OQ5 A;  1NJI U;  3QJ6 A;  3P8B B;  4IUQ A;  3CCU Q;  3TEE A;  2D9T A;  1NYG A;  2X3W D;  2LP5 A;  3CCL Q;  3P8H A;  4FSX A;  5GJW B;  4AG2 C;  5GAN 3;  3PGG A;  1PSF A;  3DLL A;  3SFM A;  4J6X A;  1YIT T;  2OTL Q;  4Z8A A;  2ROL A;  3QDR B;  3JCM f;  2KAF A;  3TSW A;  4M75 E;  3V7R A;  1S72 A;  1RL2 A;  2YT6 A;  2JTE A;  2R5M A;  1AWW A;  4XTW A;  2H3E B;  3HSB A;  3CCJ A;  1WHH A;  3A8M B;  3LWI A;  2L3Q A;  4FT2 A;  3CCU A;  2EYQ A;  1UEC A;  2EYX A;  2LDM A;  2ABL A;  2OI3 A;  1YIJ Q;  2EIF A;  3CCL A;  3RKX A;  5I2S A;  5GAO l;  2E5K A;  2EYW A;  3HKS A;  5GAN 4;  3OY9 A;  3VS0 A;  2DIL A;  1Z9Z A;  3E9G A;  3MEU A;  1M9S A;  5LJ3 j;  5KCH A;  2MIO A;  1W2B A;  5A0L A;  3EH2 A;  4X1V A;  1TOV A;  4C92 E;  3CXC S;  3C94 A;  1WQW A;  4M75 G;  1G5V A;  2LCC A;  1VYV A;  1M30 A;  4LN2 A;  1G83 A;  2QEX Q;  1AZE A;  1WHK A;  1KD1 U;  2E4H A;  3EH1 A;  2KRO A;  4F14 A;  1Q86 U;  4KGV B;  1U3O A;  3L2U A;  1M5Q 1;  1GFC A;  1V29 B;  4OVA A;  6AT1 B;  3OMC A;  2DF6 A;  5LJ5 f;  1JU5 C;  2M0Y A;  2F69 A;  2PVD B;  2LX9 A;  1OI1 A;  4IUR A;  5GAM g;  2HDA A;  1A0N B;  2NUP A;  1I5L A;  3MEV A;  2EYY A;  2CP5 A;  4FYY B;  1HSQ A;  4M7D C;  2C0T A;  4C92 G;  2D8J A;  1Q86 C;  2RQU A;  1VQL T;  2DJZ A;  1VQN Q;  5FW9 A;  1JJ2 A;  4E7S A;  4YTL A;  4HT8 A;  3CD6 T;  2QEX A;  2O9S A;  1X75 C;  2CP2 A;  2XDB A;  2KY9 A;  2PNI A;  1BBZ A;  2FYK A;  1N8R R;  3NPF A;  5DLQ E;  4PFO A;  1OZ2 A;  2FZG B;  4AFU C;  1YCY A;  1YN8 A;  2M1H A;  1KC8 R;  2Z0W A;  4CC2 A;  3MP8 A;  3UWN A;  3L42 A;  2NUP B;  1Q95 G;  4IIO A;  3T9N A;  3VS5 A;  4FU6 A;  2MPX C;  3RDV A;  1BCM A;  2JJ9 A;  1WIE A;  2M16 A;  2QGF B;  4ZTF A;  3OYE A;  5GAM d;  4KUD K;  1RAF B;  2DEQ A;  3QO3 A;  1RAB B;  1QVG A;  4A4K A;  1QCF A;  3J80 E;  4M7A E;  2K5F A;  3GBQ A;  3H8Z A;  3OBW A;  3I55 A;  4KT0 E;  2X4J A;  3I35 A;  4C8Q E;  2L0A A;  3CC7 Q;  1TH7 A;  4XU3 A;  5GAM e;  2RPN A;  3LLR A;  4HCB A;  3UAT A;  2RK2 A;  1K8A C;  1XQH A;  2E41 A;  1IXD A;  4NL2 A;  3VRZ A;  2OJ2 A;  2V8K A;  1OX9 A;  1J3T A;  8ATC B;  3WVD B;  1VQO A;  2KBT A;  3J81 E;  4XTY A;  3CPW P;  2ZGW A;  3OYF A;  2JXB A;  2AK5 A;  3M53 A;  3G71 Q;  4RCB A;  5FWC A;  3QYH B;  2D1X A;  1QP3 A;  2CP6 A;  1WJR A;  4M7A G;  4KGZ B;  3GOX A;  4EDU A;  4C8Q G;  5A2Q E;  3CC7 A;  4XTV A;  1SF9 A;  1Y07 A;  3C0C A;  4OMQ A;  4FSS A;  1OQK A;  3L2Q A;  2K57 A;  2K5I A;  1OU9 A;  4AFZ C;  3HP9 A;  2L3P A;  4OMO A;  1BK2 A;  1YI2 Q;  1Q7Y R;  3RIR A;  3JCM Q;  1FYN A;  2DYB A;  5CIU A;  5DM7 R;  2HZY A;  4DEY A;  3S3N A;  1VQ8 Q;  2BZ8 A;  2GBQ A;  5KCO A;  3ZFJ A;  2RJD A;  3LYI A;  3JCM d;  3CCQ A;  3FRN A;  3UA7 A;  1CKA A;  4FW1 A;  1GCP A;  2COW A;  1PCX A;  3JCM e;  1UB4 A;  2QYZ A;  2NWM A;  2MOX A;  3SB2 A;  3VYG A;  4FIB A;  3HL8 A;  1RLQ C;  3OYL A;  1IB8 A;  2GTJ A;  4JRQ A;  1ZUK A;  1S1N A;  4LUE A;  4OMN A;  4LDW A;  3OW2 A;  2EGA A;  1M3C A;  3QXE B;  4J9H A;  2CUB A;  2XID A;  3EFS A;  3A8O B;  2L3S A;  4LDY A;  3I56 Q;  3V8L A;  2AT1 B;  4QVZ A;  3JB9 G;  1UG1 A;  2P0K A;  3CQT A;  1YIT A;  4XAX B;  4XU2 A;  3NMZ C;  2QA4 Q;  2FPD A;  1NLP C;  4PNO A;  2YRV A;  1EX4 A;  1M4Z A;  1G2B A;  1E7O A;  2WSC E;  5FWB A;  1NJI R;  2HQX A;  4DEX A;  2CZ6 B;  3MKD A;  4NOY A;  5EG2 A;  1VQP Q;  3M0U A;  3G4S T;  1X2K A;  4RTZ A;  1H8K A;  5HKC A;  2K3B A;  5IXB A;  3CC4 Q;  5C0M A;  4E47 A;  5D6W A;  3OS1 A;  4XTX A;  2Y4Y A;  1IO6 A;  1I07 A;  1UGP B;  2YUQ A;  2YSQ A;  2VUB A;  4R56 A;  3OMG A;  2RK1 A;  3VS1 A;  2LQN A;  2DTI A;  3N5B B;  1MMG A; 
#chains in the Genus database with same CATH homology
 2W0Z A;  2SEM A;  1OEB A;  4J9I A;  1YWP A;  2FPE A;  2F2X A;  2RNA A;  5L23 A;  3JV3 A;  2ED1 A;  2J05 A;  2LX7 A;  4RTV A;  3M0T A;  1SRM A;  1M27 C;  2JM9 A;  3KFV A;  2F2V A;  1JO8 A;  2GQI A;  4WCI A;  2YUP A;  2SRC A;  2IIM A;  2DL3 A;  1MV0 B;  1NM7 A;  1OOT A;  3UA6 A;  4LE9 A;  4K11 A;  2B86 A;  5GJV B;  1E6G A;  2LJ0 A;  1KFZ A;  3THK A;  1AWX A;  1YWO A;  4HVU A;  2H8H A;  2KYM A;  4RTU A;  1TUC A;  3EHR A;  4J9F A;  2O9V A;  1ABO A;  2PZ1 A;  3FJ5 A;  1XOV A;  1YP5 A;  1CKB A;  1AZG B;  1UJY A;  1JQQ A;  4E6R A;  3EG3 A;  1K4U S;  2VWF A;  4ESR A;  2CT4 A;  2DRM A;  3VS7 A;  3VS6 A;  3M0S A;  1Z9Q A;  2A37 A;  3PE0 A;  3H0H A;  1I0C A;  1GBQ A;  4ZNX A;  1LCK A;  4IIM A;  4JJB A;  2M51 A;  2RQT A;  3I9Q A;  4D8K A;  1GFD A;  3H41 A;  2CUD A;  4JJC A;  1NEB A;  1GCQ A;  2QDL A;  5EC7 A;  2EGC A;  1T0J A;  2LNH B;  4JJD A;  4OMP A;  1JXO A;  2DLP A;  1KIK A;  1VA7 A;  4HVV A;  2AKK A;  1OV3 A;  2FPF A;  2XMF A;  2DM1 A;  2KT8 A;  1T3S A;  4M4Z A;  1WA7 A;  2HSP A;  4JPB W;  1K9A A;  2BZX A;  2K7A A;  1PHT A;  2CDT A;  2F2W A;  2KRM A;  2AKL A;  2ECZ A;  4LNP A;  3EG2 A;  1GCQ C;  3REB B;  1NYG A;  2LMJ A;  1HJD A;  5I22 A;  2X3W D;  2LJ3 A;  2L2P A;  1OPL A;  2LP5 A;  5ECA A;  1U06 A;  1M3A A;  1GRI A;  1HD3 A;  2V1R A;  5GJW B;  1RLP C;  1V1C A;  4AG2 C;  2DL4 A;  2FRW A;  5HCK A;  2LCS A;  1QLY A;  3M0R A;  1AVZ C;  2O31 A;  1K1Z A;  1WFW A;  4Z8A A;  2ROL A;  4Y92 A;  2G6F X;  2FEI A;  2J7I A;  3TSW A;  2DL7 A;  3VS4 A;  4AG1 C;  5IHK A;  2YT6 A;  2AZV A;  2JTE A;  1UFF A;  2EVR A;  2ED0 A;  1AWW A;  2DNU A;  2DJQ A;  3VS3 A;  1E6H A;  1X6G A;  2DX1 A;  1NLO C;  3ZL7 C;  1Y0M A;  2ESW A;  4HCK A;  2L3Q A;  1OPK A;  2BTT A;  1N5Z A;  1K76 A;  1UEC A;  2EYX A;  2ABL A;  2OI3 A;  2E5K A;  2EYW A;  4JZ3 A;  4J9D A;  2GNC A;  1QKW A;  3PVQ A;  2JW4 A;  3VS0 A;  1VYU A;  2DIL A;  2HEQ A;  1Z9Z A;  1Y57 A;  2FO0 A;  2MIO A;  2EPD A;  2DRK A;  4X1V A;  4F16 A;  2KR3 A;  1UE9 A;  2LJ1 A;  2VKN A;  1VYV A;  5I11 A;  1SPK A;  2CT3 A;  2KT1 A;  1M30 A;  2DL5 A;  1G83 A;  4LN2 A;  1AZE A;  2NUZ A;  1K0X A;  1UTI A;  5IXF A;  1KSW A;  2KRO A;  1M8M A;  3ULR B;  4F14 A;  2BZY A;  2EQI A;  1U3O A;  2RQV A;  1GFC A;  1MV3 A;  2RMO A;  2DF6 A;  1QKX A;  1JU5 C;  2A28 A;  2X3X D;  2M0Y A;  2ENM A;  3LH5 A;  1YCS B;  2KXD A;  2FG0 A;  4D8D A;  1ZBJ A;  2HDA A;  1A0N B;  3NHN A;  2C0I A;  1UHC A;  1JXM A;  2EYY A;  1HSQ A;  2C0T A;  2CRE A;  2JM8 A;  4RTT A;  2D8J A;  1WLP B;  2RQU A;  2LZ6 B;  2K79 A;  2A08 A;  2DBM A;  3RNJ A;  1PWT A;  5FW9 A;  2O88 A;  1UJ0 A;  1ZX6 A;  2O9S A;  3H0F A;  1X27 A;  2PNI A;  1SHF A;  1BBZ A;  2DE0 X;  1AWO A;  3NPF A;  4Z88 A;  2K9G A;  2EKH A;  2GTO A;  4CC3 A;  3EGU A;  2RQR A;  1PRL C;  4AFU C;  1YN8 A;  2O2O A;  4GBQ A;  4CC2 A;  3EHQ A;  4IIO A;  2JS0 A;  3VS5 A;  2PTK A;  2JMC A;  3I5S A;  1KJW A;  1UHF A;  4J9C A;  1WIE A;  3O5Z A;  2YUN A;  2DBK A;  1RI9 A;  1B07 A;  4OMM A;  3REA B;  1TG0 A;  2D8H A;  1X6B A;  1GBR A;  1QCF A;  2EGE A;  1NG2 A;  3GBQ A;  2HCK A;  2KEA A;  2J6K A;  1U5S A;  2AZS A;  3I35 A;  2L0A A;  3R6N A;  4CC4 B;  2KGT A;  2RPN A;  3UAT A;  1ZUU A;  1B3Q A;  3A98 A;  3PVL A;  4J9E A;  1X43 A;  3VRZ A;  2OJ2 A;  3RBB B;  5IH2 A;  2RQW A;  4ORZ A;  1J3T A;  1WI7 A;  4RTY A;  1BB9 A;  3UF4 A;  2KBT A;  3I5R A;  2LQW A;  4Z89 A;  3SHW A;  1ARK A;  2JXB A;  2AK5 A;  3M0Q A;  1PRM C;  5FWC A;  2D1X A;  3U23 A;  2ROT A;  2CSQ A;  3SEM A;  1QWF A;  1W1F A;  2DVJ A;  1MUZ A;  4RTW A;  1SHG A;  1RUW A;  2CSI A;  2J6F A;  1NYF A;  4HVW A;  4OML A;  3C0C A;  4OMQ A;  1AD5 A;  1I1J A;  4FSS A;  1PNJ A;  1SEM A;  1GL5 A;  2YDL A;  1AOJ A;  1T3L A;  4RTX A;  1ZUY A;  4AFZ C;  1BU1 A;  1WXT A;  2L3P A;  4OMO A;  1BK2 A;  2GGR A;  3QWX X;  2MCN A;  3VRY A;  1AEY A;  1FYN A;  2DYB A;  4EIK A;  1JEG A;  2CH4 W;  2YUO A;  4A63 B;  1X2Q A;  4DEY A;  2KRN A;  1WX6 A;  2VVK A;  4HXJ A;  2KNB B;  2BZ8 A;  2GBQ A;  3NGP A;  4LUD A;  1T0H A;  2K2M A;  2D0N A;  2KXC A;  1ABQ A;  2C0O A;  3UA7 A;  1CKA A;  4AFQ C;  1GCP A;  2KYB A;  1WDX A;  2HBW A;  2DL8 A;  3H0I A;  1NEG A;  1ZSG A;  2NWM A;  2MOX A;  1TUD A;  2DA9 A;  4AFS C;  1UUE A;  2CH4 A;  1FMK A;  1RLQ C;  2K6D A;  2GTJ A;  1ZUK A;  1S1N A;  4GLM A;  4LUE A;  4OMN A;  1M3B A;  2A36 A;  2KRS A;  2EGA A;  1M3C A;  1H92 A;  5IHI A;  1W6X A;  3TSZ A;  1YNZ A;  3EG0 A;  1X69 A;  2RF0 A;  4J9H A;  2EW3 A;  2CUB A;  3VS2 A;  2L3S A;  4J9B A;  1K0S A;  2JS2 A;  1AWJ A;  1CSK A;  2V1Q A;  1W70 A;  1UG1 A;  3QWY A;  3CQT A;  4J9G A;  2P4R A;  3NMZ C;  2FPD A;  2J06 A;  1NLP C;  2KE9 A;  3TVT A;  2FRY A;  1WXU A;  1SSH A;  2JMA A;  5IHN A;  3EG1 A;  1UGV A;  1G2B A;  1E7O A;  1WYX A;  3M0P A;  1ZLM A;  5FWB A;  1EFN A;  2OAW A;  1PKT A;  1PKS A;  4JZ4 A;  4DEX A;  4QT7 A;  1UDL A;  2W10 A;  2J6O A;  3M0U A;  4F17 A;  2JT4 A;  1X2K A;  4RTZ A;  1SRL A;  1H8K A;  1WXB A;  2K3B A;  5IXB A;  3IQL A;  1QWE A;  4RUG A;  1H3H A;  4CC7 A;  2RN8 A;  4R0K A;  1IO6 A;  1I07 A;  2EBP A;  2EYZ A;  2YUQ A;  2YSQ A;  3VS1 A;  2I0N A;  2LQN A;  1VYT A;  2DMO A;  4KRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...