4D8DA

Crystal structure of hiv-1 nef fyn-sh3 r96w variant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
TLFVALYDYEAWTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/protein binding
molecule keywords Tyrosine-protein kinase Fyn
publication title SH3 domain specificity
rcsb
source organism Homo sapiens
total genus 12
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4d8dA00
2O9SA 1X27A 2LMJA 3A98A 1MV0B 1WIEA 1ZBJA 3SHWA 3I5RA 1GBQA 2YSQA 4DEYA 1AEYA 4Y92A 2M51A 2PNIA 4WCIA 3VRYA 4AG1C 4F14A 3VS1A 2ENMA 1U5SA 1ZUUA 1QKXA 1GFDA 1W6XA 3EHQA 4RTZA 3VS6A 2D8JA 2KXDA 2EKHA 4GBQA 2JMCA 1GCQC 2C0IA 1RLQC 1NLPC 1GFCA 2FPFA 1JXMA 4OMOA 1VYVA 1YWPA 2EVRA 2K9GA 3QWXX 2EGEA 1A0NB 3UA6A 4K11A 5ECAA 2RMOA 1NYFA 2CSIA 2RN8A 4RTWA 2L3SA 4KRTA 2FPEA 1Y57A 1UDLA 3M0SA 1FYNA 2KT8A 4X1VA 1ZUKA 2DJQA 2ESWA 2DBKA 2KYMA 2D0NA 2NUZA 2KR3A 2PZ1A 2JT4A 1T3LA 4CC7A 4CC2A 4IIMA 2HCKA 2KT1A 2SRCA 1CKAA 3NMZC 2EQIA 4Z88A 4RTUA 1M27C 2YUOA 1UJYA 1X2QA 2K3BA 2LCSA 3I35A 1ZX6A 1KJWA 2LQNA 1OV3A 4ORZA 5IHKA 3RBBB 1GBRA 1PKTA 1V1CA 4JZ4A 2EYZA 4GLMA 4RTXA 1NM7A 1I07A 2RQRA 2F2WA 3GBQA 1E6GA 2DRKA 1ZLMA 2D1XA 4AFSC 1GRIA 1WYXA 4CC3A 1HJDA 1OPLA 2J06A 4CC4B 2CUDA 1MUZA 2FRWA 2HDAA 2C0OA 2DF6A 2X3XD 2P4RA 1AWWA 2DX1A 1M3BA 2DL7A 1WXUA 1CSKA 2L3QA 3CQTA 3FJ5A 3O5ZA 2JMAA 1Z9ZA 4LUDA 2GGRA 2O88A 1M8MA 1QLYA 1NLOC 4JJDA 2J6KA 1QWFA 4EIKA 1UGVA 1AVZC 1QKWA 2BZXA 2FO0A 2LJ3A 2RPNA 2EGCA 4ZNXA 3I5SA 1HD3A 1JU5C 1AWXA 1LCKA 2CREA 2DL3A 3KFVA 3EG0A 2L0AA 5I11A 2B86A 1QCFA 3VS3A 2K6DA 2KXCA 2KE9A 2LZ6B 4JPBW 3VRZA 2OAWA 2MCNA 1VYUA 1UJ0A 1G2BA 4FSSA 5HCKA 2DA9A 4JZ3A 5EC7A 2E5KA 2K2MA 4OMNA 4HCKA 2AKLA 2KRMA 2GTJA 2A36A 2YUPA 2KRNA 2LP5A 2DNUA 4LN2A 3TSZA 3RNJA 1JEGA 3NPFA 1ABQA 3SEMA 2KROA 2LJ1A 2CUBA 1XOVA 5GJVB 2YUQA 2MIOA 2OJ2A 4D8KA 2BZ8A 2VKNA 3TVTA 2DL8A 1M30A 2DL4A 5L23A 1VYTA 4LE9A 3VS7A 2ROLA 4J9IA 5IHNA 1JQQA 4DEXA 1IO6A 1JXOA 2CT3A 1T0JA 3H0HA 2HSPA 2DYBA 3M0TA 2EBPA 1KSWA 1WX6A 1YCSB 2ED1A 2EYYA 1NEBA 1WLPB 2HEQA 2DE0X 2ECZA 3EHRA 2JTEA 2RF0A 3THKA 2AK5A 1JO8A 3I9QA 2MOXA 4IIOA 1WA7A 1K0SA 1WI7A 1UECA 1X2KA 1U06A 2IIMA 4JJCA 2J05A 1NYGA 1K0XA 3VS0A 2FG0A 1U3OA 1T3SA 1QWEA 2EPDA 2KEAA 5FW9A 2XMFA 3EG3A 3M0PA 5GJWB 2EGAA 3REAB 1K1ZA 4QT7A 5FWBA 1AWOA 2YDLA 4HVVA 1J3TA 2H8HA 4OMMA 2A08A 1X6GA 3EG1A 1GCQA 2ABLA 2GTOA 2DMOA 2DL5A 2ROTA 1BU1A 2LX7A 4HVWA 2GQIA 2AZVA 3M0UA 1TUCA 1PRMC 1PHTA 2F2XA 1ZSGA 1E6HA 1UHFA 2I0NA 1M3AA 2FEIA 2OI3A 3TSWA 1OOTA 4ESRA 1I1JA 2L2PA 2LJ0A 1SPKA 2AKKA 2RQVA 1NG2A 5IXFA 2DILA 1BK2A 1SEMA 1K4US 2M0YA 1K9AA 4RTTA 2FPDA 2F2VA 2KRSA 2EYWA 4AFQC 1RLPC 2JM8A 2K7AA 5IXBA 2JW4A 1CKBA 2KNBB 3PVLA 1WDXA 2JS0A 3JV3A 3M0QA 1WXBA 1YN8A 3ZL7C 2DLPA 1AWJA 2JXBA 1HSQA 2V1RA 3H41A 1GL5A 4A63B 1E7OA 2VVKA 4RTYA 2W10A 5IH2A 2EYXA 1RI9A 1OPKA 1OEBA 3VS4A 1X69A 3VS2A 1AD5A 1I0CA 4AG2C 4R0KA 1ABOA 4F16A 4OMLA 2O2OA 1H92A 2GNCA 2L3PA 4RUGA 2J6FA 1UUEA 3LH5A 2DM1A 3VS5A 4OMPA 1K76A 4JJBA 3QWYA 2G6FX 1B3QA 4AFZC 2EW3A 3H0FA 2O9VA 2YUNA 1SHFA 4J9BA 2KYBA 3PVQA 2CT4A 2VWFA 4F17A 4LNPA 1BBZA 1M3CA 2CH4W 1UHCA 4J9FA 5FWCA 1GCPA 3EG2A 2D8HA 4Z89A 1X6BA 2DBMA 2SEMA 2GBQA 1H8KA 3UA7A 2LNHB 3H0IA 2K79A 1B07A 2W0ZA 1PKSA 2QDLA 2HBWA 4J9CA 2RNAA 1W70A 3UF4A 1VA7A 3NGPA 1WFWA 1H3HA 2J6OA 2JM9A 3C0CA 2BTTA 1PNJA 1G83A 3U23A 3UATA 2ED0A 4J9GA 2JS2A 4LUEA 4RTVA 4J9EA 1KFZA 3ULRB 3IQLA 1UE9A 1Z9QA 4Z8AA 1MV3A 1SSHA 3EGUA 1NEGA 1PRLC 2LQWA 1KIKA 2RQUA 2KGTA 4AFUC 2A37A 2CSQA 2NWMA 2DRMA 2RQWA 1Y0MA 2X3WD 3M0RA 3NHNA 4J9HA 1ZUYA 5I22A 2O31A 1AZEA 1YNZA 4M4ZA 1SHGA 2CH4A 5IHIA 2CDTA 1EFNA 1FMKA 2V1QA 1N5ZA 4HVUA 1BB9A 1W1FA 4E6RA 4D8DA 1UFFA 4J9DA 1TG0A 3REBB 1X43A 2J7IA 2YT6A 3R6NA 1SRLA 1ARKA 2AZSA 1YWOA 1AZGB 4OMQA 1UG1A 1PWTA 4HXJA 1T0HA 2DVJA 2KBTA 2A28A 2RQTA 1S1NA 1UTIA 1YP5A 2BZYA 1WXTA 2C0TA 1AOJA 1SRMA 2FRYA 1RUWA 2PTKA 1TUDA 3PE0A
chains in the Genus database with same CATH superfamily
4J6WA 2CZ0B 4DBHA 3SHWA 3EFRA 4HCBA 2QEXA 2M51A 4NL3A 1TS9A 4II1A 4F04B 2EKOA 1KK7A 1QKXA 2HSEB 3L42A 2E41A 2MI6A 1TOVA 3UPUA 1D1CA 5CKFA 2OTJA 3JCMc 1VQKT 1I81A 1RLQC 3SWNB 4ATOA 4XTWA 2R58A 1JXMA 1YWPA 4M7DC 3QWXX 3OA6A 1M4ZA 2EGEA 3CCJA 1XTDA 4E7LA 2RMOA 2CGHA 1N9RA 2ZCFB 2L3SA 4KRTA 1MMGA 4C8QC 1NJIU 2D0QB 1ZSZB 2ZPEB 1VQ7A 1D0YA 1UDLA 1FYNA 4C0FA 2YWWA 4X1VA 4C0DB 1VQ8T 4Y28E 1C1AA 3CCMA 2DBKA 3G1JA 1NBEB 1WHKA 2QDYB 4CC7A 1VQKQ 4GLKA 2SRCA 4KT0E 3NMZC 3OYNA 2NUPA 4RTUA 4B6MA 1M27C 1WHLA 1YBYA 2LCSA 4LDXA 4C92G 2MMPA 1KJWA 1M2OA 4ORZA 3HHTB 1Y07A 1IB8A 2PU9B 1D1AA 2RJCA 2EQMA 1NM7A 5IN1A 2RQRA 3GBQA 2DRKA 2R57A 3RUXA 1VQ8Q 1HJDA 2VXFA 1OPLA 3QSUA 1MUZA 4E7IA 5M9OA 2M9UA 4A4FA 1XQHA 2XI9A 4R56A 2KAFA 1M3BA 3PT9A 1YIJT 2DL7A 5FU7C 2CP5A 1QW1A 3FJ5A 1CSKA 3CQTA 4MDWA 1KG1A 1HK9A 2PVDB 2GGRA 1QVGS 1NLOC 1K9MR 4M78G 4EIKA 3BY7A 2A3LA 2LJ3A 2RPNA 2Y4YA 2Y4XA 1AWXA 4FU6A 2B86A 3JCMV 5KYWB 2DIGA 1W4SA 4E7KA 5GMKi 1U8RA 2MCNA 4RKUE 3TCJA 4EMKC 1G2BA 5EC7A 3CCRA 4OVAA 1YITT 2K2MA 4OMNA 4HCKA 1VQLA 1LPLA 2JJ9A 5GMKe 1YIJQ 5FLXE 2XU8A 3OYCA 1VQMA 2LP5A 2BKDN 4LN2A 3QO3A 4N0AA 3TSZA 1FWZA 3SEMA 3ASKA 1OULA 1RAEB 2KROA 4C92F 2CUBA 1IREB 5GJVB 3RMQA 2YUQA 2MIOA 5AT1B 1N8RR 3E19A 4M7AD 1YI2A 1JJ2P 2K57A 3TEEA 1YJ9Q 2KSSA 3CC7A 3OMCA 1QCNA 2DXUA 2E6ZA 4LE9A 2ROLA 4DBQA 1VQ9A 4J9IA 1YITQ 5IHNA 5GAMd 2QQSA 4NL2A 3EGXB 1NPPA 2RHIA 4KH1B 3OYBA 2EQKA 2ED1A 1MNEA 1BCOA 1EIFA 2ECZA 1K73U 4M78F 2ZGWA 2RK2A 4IUVA 4KUDK 1K0SA 3DKMA 1RI0A 5DLOA 2IIMA 2QQRA 4JJCA 3P8HA 2J05A 5KH6A 3P8BB 2FG0A 4V2SA 2KEAA 1KHCA 3G4SA 2XMFA 1BYMA 4XTXA 5FROA 3GP8A 3MP1A 2VASA 2M16A 3JCMX 1WZOA 4UC4A 2OTJT 3BW1A 3OYFA 2X4JA 4PJOD 2COYA 4E7HA 4C92E 2YDLA 4MZMA 2HQXA 2JUFA 1VQPT 3VV0A 2ROTA 1BU1A 4O6JA 2MWOA 4HVWA 3CCJT 3M0UA 2LCCA 4QQ6A 1Q95G 4JRQA 3G6EQ 1K8AR 1YJNA 4HT9A 1E6HA 3DB4A 4N4HA 3JCMQ 2FEIA 2M0OA 2QTXA 5CK9A 1RAIB 1OOTA 2QXFA 2YRVA 1I1JA 3M59A 3E2UA 1SPKA 1M2VA 2YXYA 1R8OB 1JJ2A 3OYJA 2HL3A 2R5AA 5IXFA 2DILA 5CQYA 3BDLA 2LT4A 4OB1B 1W2BS 3P8DA 3LWIA 1VQPQ 2KRSA 3TU4K 2L89A 4IUQA 1M1KU 5KCHA 1SF9A 5LJ3g 1O9SA 5GMKj 3DLMA 2ZZDA 1WHJA 4M75B 1WXBA 3OYGA 2LC4A 3A8HB 2L5QA 1Q7YU 2HQHA 1N8RC 5EG2A 1E7OA 4E7SA 4A54A 7AT1B 5A0DA 2W10A 3FJPA 5IH2A 2EYXA 2X4XA 3QHSA 5J39A 3V8LA 2DFUA 3EFSA 3VUBA 1I0CA 3MPUB 4JJNK 4OMLA 3MJXA 2GNCA 2L3PA 4J6XA 3V8KA 3VU3C 1QVGP 2DM1A 4ZTJA 3VS5A 4OMPA 1KC8U 1K76A 3QWYA 2CZ6B 1B3QA 1WNLA 2YUNA 4PJOC 5GAOp 1N6AA 2G3RA 1HYOA 4BI4A 2QGFB 4M77G 4C92A 2DZ9A 2SEMA 2GBQA 4XU0A 2L3RA 1AT1B 2CKKA 2E65A 2RI2A 3UA7A 1EZZB 3CCRT 2CP0A 2LDMA 4FW2A 2E64A 3H0IA 3OYKA 2YLCA 2K79A 3PGGA 2RD1A 4IUTA 1VQMT 3UF4A 2LQ8A 2LNVA 5LJ5d 3CXCP 2J6OA 1TUGB 2BTTA 1PNJA 3U23A 4J9GA 2EYQA 2FVUA 4J9EA 4RTVA 5KYNA 4N0AC 3ULRB 3E9FA 2EWNA 1YI2T 4F7UG 1NEGA 2LQWA 3JCMh 3CC7T 4JS5A 2CSQA 3HKSA 4M78A 1VQKA 1Q82U 5GAMf 3CCRQ 1VQ9T 4J7FA 1ZQ1A 2DPPB 2KI7A 2X3WD 1C0MA 2ZPBB 3BDUA 1ZUYA 1Q86U 2GFUA 1VQMQ 1FMWA 1YNZA 1RAFB 5IHIA 2MYSA 4JS4A 1FMKA 4E6RA 4C0GA 3CEYA 3S3OA 1R77A 1LVKA 3O8VA 1VQ8A 3CD6T 1TSFA 1PWTA 1KQSS 2KBTA 3OYMA 1QVGA 3CC7Q 4KBMB 1YP5A 2YLBA 1WXTA 2C0TA 4EMHA 2RO0A 1SRMA 2KMTA 1G3WA 2PTKA 1VQ9Q 2RI5A 2O9SA 1TXQA 1WIEA 3MEVA 2V8IA 2VYTA 2ZPHB 2I2LA 4C5GA 4OB0B 2HQEA 3N5BB 2A0FB 3VRYA 4AG1C 2KDSA 3VS1A 2ENMA 1U5SA 1ZUUA 1W6XA 2KXDA 1VQ6Q 2P0QA 2BIVA 2D9TA 3CXCA 3CD6Q 2RHXA 4MZTA 2FPFA 2X4YA 3EG9B 3UWNA 1ZHIA 3JB9J 1D0ZA 1A0NB 4K11A 2E5QA 5D6XA 5ECAA 3PIOA 1NYFA 3CBPA 4IURA 2FPEA 2JZ2A 3A8LB 2F5KA 4MMLA 3M0SA 2RHYA 4KH0B 1W2BP 2X51A 2ESWA 1UGQB 2F1LA 2KYMA 3VYHB 2KR3A 2JT4A 5GAMe 5CKEA 3C4SA 4M77E 1YJ9A 2KT1A 3VUZA 1CKAA 4M78D 4Z88A 4PJNA 1I5LA 2K3BA 1OU8A 1M1FA 1VQOA 2YRCA 1YITA 1Y96A 1ZX6A 2E10A 2LRQA 5IHKA 3RBBB 1PKTA 1V1CA 4FT4A 4JZ4A 4C8QD 2EYZA 2VUBA 4GLMA 4RTXA 4FYWB 2DETA 2PVOB 4MMKA 4BY6C 3I56A 2D1XA 4AFSC 1GRIA 4CC3A 1SSFA 2HMAA 2MK5A 4DOVA 1I5OB 2E4HA 4FW1A 2CUDA 4A4HA 2FRWA 4F7UE 4M7AE 2FHDA 2P4RA 1AWWA 2XDBA 3QJYA 4ZGEB 3JB9H 1Y7XA 1QVFS 1IHVA 2OX7A 5GANd 2O88A 1R0BG 4N4GA 2J6KA 4M7AB 1QWFA 1AVZC 2K2VA 2FO0A 4FYXB 4PJLA 2QG9B 2DZCA 3X24B 3KXTA 1LCKA 2CREA 2DL3A 4QW2A 4C92C 3KFVA 3EG0A 2L0AA 1KD1U 3VS3A 2KE9A 4JPBW 4RMOA 1M90C 5A0GA 3G6EA 4JZ3A 5CKHA 3HPWA 3OYLA 2A36A 1W2BA 2O4XB 2K4YA 1Y71A 4JLGA 3NPFA 1ABQA 5LJ3e 5D6YA 1XOVA 5KYXB 4O5VA 5GAN4 1VQPA 2OJ2A 3PFSA 3M4YA 2AT1B 3RKXA 4D8KA 1G3YA 3T9NA 3TVTA 3M55A 3CCSA 4M78C 4QQGA 2DL8A 4J8OA 3CC4Q 2E12A 4M77A 5GMKh 3VS7A 1JQQA 4DEXA 4C0ZA 1IO6A 5GAOn 2CT3A 3M5AA 4L5GA 2HSPA 2DYBA 3M0TA 4PFOA 5J3BA 3FEOA 1WLPB 2DE0X 1KQSP 4C5EA 2HL5C 3JCMb 2RF0A 2OAUA 5GAMj 1JO8A 5C6SA 5I21A 2MOXA 3RMSA 1WI7A 2K3YA 4J7IA 3NTIA 1U06A 1P92A 3L2VA 3QDRB 4F7UA 3VS0A 1U3OA 1T3SA 1MGQA 3JSCA 3G7ZA 2V26A 5I2SA 4A4KA 2L8DA 5GJWB 1KHIA 4MDXA 2EGAA 4Q5WA 1BCMA 3QKJA 4QT7A 1V76A 3V8JA 3OS2A 3H6ZA 3OYDA 1G3TA 4HVVA 4WTOB 3L2RA 3FB9A 1GCQA 2ABLA 5LJ5e 1WHGA 2QQBA 5GAOq 5FRMA 1TUCA 2ATCB 1PRMC 1UHFA 2NLUA 1PCXA 4M75G 1M8VA 1M3AA 3SWNA 3RKWA 3TSWA 1VQ5Q 3JB9G 4XK8E 2L2PA 2CP7A 4YTLA 3J80E 3OS5A 1YJ9T 1K4US 2HBPA 3RDVA 4ZGJB 3X26B 4M7DG 2F2VA 5GAOm 1ZSZA 4EDUA 2EYWA 4XAXB 4AFQC 1RLPC 2JM8A 2K7AA 5IXBA 1VQOT 1VQNT 2JW4A 4BUGA 1CKBA 2QASA 2M02A 3QPHA 2JS0A 3LGLA 3C95A 2LVMA 1OQKA 5A0LA 2E1HA 1KQSA 5HY6A 3I56T 5LJ3j 3HP9A 3KBGA 2DLPA 3VYGA 1AWJA 2CYZB 2JXBA 1HSQA 4PFPA 4B9XA 2CP6A 4RTYA 2BE7D 2K5IA 1K73R 1BI3A 1OZ3A 5CKDA 3OS1A 3GIBA 1OPKA 2V8KA 3MP8A 1OEBA 3VS4A 4Y91A 3EGDB 3OYYA 2LT1A 4NS5A 5GANf 1BIAA 2O2OA 1VQOQ 4KGZB 4HT8A 3VJPA 1VQNQ 1H92A 4RUGA 3EFOB 3A1PA 1QVFP 3FIFA 3LH5A 3M57A 4OB3B 2EJGA 4JJBA 2G6FX 5GMKl 3H0FA 2O9VA 3PVQA 2JTFA 3JCMd 3I56Q 3JCMg 4LNPA 4M75F 2CH4W 2IG0A 3EG2A 1VQ6A 2RJDA 1H8KA 3JB9F 3WVDB 1LNXA 3G6ET 1I8FA 3CD6A 1BIBA 2LNHB 1UGPB 4EMGA 5CVIA 1B07A 2HBWA 5GAN3 2RNAA 1W70A 1OX8A 5KYWA 5FU6B 2QQ9A 3NGPA 2XKOC 3L2WA 1H3HA 2JM9A 3C0CA 4RCBA 1SKUB 5C0MA 2OTLA 2JS2A 4QQDA 3J7AF 3IQLA 1Z9QA 5CAIA 3QYGB 4BDZA 1MV3A 2GCXA 5I2MA 1PD0A 4A4EA 1DJ7B 3CCST 5LJ5j 1U1TA 2RQUA 3HFNA 2BE9B 4KGXB 4FSXA 1K9MC 3LYIA 4M77C 1Y0MA 3NHNA 3PNWC 2O31A 2WSEE 4AMCA 2PQWA 3QDFA 1G3SA 1SHGA 4VUBA 3Q1JA 2WSFE 4HVUA 1Q7YR 1TWBA 3E9GA 1TG0A 2JOYA 3REBB 2YT6A 1B34B 4M75E 5KE2A 1SRLA 2AZSA 5LJ3d 1Q81R 3CCSQ 2DXBA 1UG1A 3EGXA 4HXJA 1T0HA 4LD9K 1QVFA 1S1NA 1XNIA 1FMVA 5GANe 2FRYA 1RUWA 4IUPA 1RAHB 3ZBDA 3UT1A 1X27A 2LMJA 4M7DE 3A98A 1ZBJA 1NZ9A 1KC8R 3OYEA 1UGRB 3I5RA 2FZCB 1GBQA 4DEYA 1AEYA 4Y92A 3X20B 2H3JA 2PNIA 2BUDA 4IUUA 3CCVQ 4PK4A 1TH7A 1GFDA 4RTZA 4M7DB 3VS6A 1YJWA 2D8JA 2EKHA 2FB7A 2LX9A 1GCQC 1WPYA 2P0KA 1OX9A 1GFCA 3CBOA 2COWA 2DYIA 1VYVA 4C8QB 2K3XA 4XTVA 2K9GA 2Z0WA 3C94A 3KUFA 3NTKA 1MMNA 1IHWA 3SWNC 1X6OA 2RN8A 1D0XA 1RADB 2COZA 1Y57A 4FL6A 4LDVA 1F1BB 2KT8A 2C06A 6AT1B 3OW2S 3PIPA 1T3LA 1Q82R 1ZSZC 3OYIA 3CC4A 3MEUA 4XU1A 1YCYA 3A8MB 2EQIA 3MO8A 2YUOA 3OMGA 1UJYA 1X2QA 1Q86R 1MMAA 3I35A 3S3MA 2LQNA 1OV3A 5CR2A 2DEUA 2MF2A 4M7AG 1MNDA 3M4GA 2HKNA 1IGUA 2JN0A 9ATCB 1FX7A 4JLIA 2DK3A 4MZPA 5DM7R 4M75A 1K8AC 4PJMA 4L59A 5FU7B 5GAMh 3MEWA 3WVEB 4JRKA 1V29B 2J06A 2E3IA 2DVEA 5GAN2 3CCLT 2E6NA 4XU2A 2HDAA 2C0OA 2DXCA 2DAQA 3NFCA 3O5ZA 3WXMB 1Z9ZA 4LUDA 3DLLA 3FLGA 2RM4A 2DEQA 1M8MA 1VQ6T 3GOXA 1QLYA 2MWPA 3X28B 1Q81C 4RG8A 1QKWA 2BZXA 4EMKB 2EGCA 3HTRA 4ZNXA 3I5SA 2F5TX 4M77F 5I11A 2GQVA 1QCFA 3RKYA 5GANj 5GAN6 2KXCA 4IKFA 3JAME 2OAWA 4FT2A 5DLQE 1ZA2B 1OI1A 3CCET 2OTLT 4PNOA 3CCLQ 4PJOG 1WJRA 2AKLA 4C5HA 3QZ5B 4JRIA 2YUPA 3QZ9B 3L2QA 1VQ5A 2ZPGB 2WSCE 3CCUA 1G5VA 1JEGA 4C92D 1QP2A 2LQKA 5LL6S 4F7UF 1GXIE 4M7AF 5KYYB 5J26A 1VIFA 2EAYA 2HD0A 1LJOA 3L1AA 4OF1A 3JRZA 2RK1A 5L23A 2B8AA 1VYTA 3CCEQ 2NYSA 2OTLQ 2XD0A 3V7CA 1M90U 5LJ3f 2GF7A 2NUTB 2EBPA 1WX6A 3OB9A 1YCSB 1NEBA 2VXEA 3THKA 4OMFB 3I9QA 4R55A 2QK0A 2VC8A 4IIOA 1Q86C 3HL8A 1UECA 2EQJA 1X2KA 5CO7A 1VQNA 1K0XA 5D7UA 3HRSA 2EFIA 3JCMe 1KQ2A 3CBMA 3EH1A 1QWEA 4BB7A 1X01A 1UB4A 3UDCA 3EG3A 4HA8A 3QBYA 3GPLA 3H8ZA 1YJWT 5GAOl 1K1ZA 4JUVA 4QVDA 4HKEA 1I4K1 5FWBA 1AWOA 3TQ7P 3GF5A 2H8HA 4OP0A 2DTIA 1KD1R 2GTOA 2DL5A 2GQIA 3HRTA 2F2XA 3OSSC 3PMIA 1VIEA 4DOWA 1NPRA 1O75A 2OI3A 4DQ2A 4BDYA 3EG9A 1WGSA 2V8JA 2XIDA 5GAN5 3M54A 1YJWQ 2AKKA 2RQVA 1QMCA 1YFNA 3OW2P 5LJ5f 4L6V5 3CC4T 5LJ5h 1BK2A 2NUPB 2RI3A 2M0YA 3CCQT 4RTTA 2FPDA 2FYKA 2RJEA 3ER0A 2QQAA 1ZBXA 2E3HA 3LH0A 4KGVB 2RJFA 3PVLA 1WDXA 1PC0A 1IRXA 1NJIR 3OQ5A 3ZL7C 3CC2A 3HFOA 1RAAB 4PJOE 4E7JA 4A63B 2VVKA 4M75C 3S6WA 3OYAA 4D6WA 1X69A 2DD4A 1AD5A 3VS2A 1HXDA 3CCQQ 4AG2C 3F70A 4R0KA 1ABOA 4F16A 4PJOB 4QVCA 2CZ1B 4PL6A 4E7ZA 1JBMA 2H3EB 3ME9A 3R6OA 3RR6A 4OGCA 5HKCA 3RESA 4E47A 3TREA 3CCVA 2E70A 3OBWA 2VWFA 4F17A 5FWCA 4CI0C 1GCPA 3META 4Z89A 4N4IA 1N9SA 4FM4B 4M7AA 1IXDA 3CMAT 1PSEA 1PKSA 2CP3A 2Y90A 2QDLA 1QVPA 1LOJA 3FDRA 1VQ5T 3NTHA 3CCUT 4QKUA 2JTMA 5DY9A 3SB2A 3OW2A 1D09B 3OS0A 3L2UA 2ED0A 3PMTA 3BE3A 1KFZA 3OBYA 1G8XA 4Z8AA 1KD1C 1SSHA 3CPFA 3QYHB 1X75C 1PRLC 3GLXA 1PG5B 5KYUB 3JCMW 2O4XA 5AYFA 3JCMJ 1IGQA 2EQUA 3GNFB 2CZ7B 2DRMA 2RQWA 3CMAQ 4ZN1A 3AHUA 3M0RA 5KYXA 4X9CA 3FRNA 3QUIA 1ACMB 3JB9I 5I22A 4GY5A 3CCUQ 1FXXA 2CH4A 1EFNA 3OYHA 1YHQA 3CMEA 2V1QA 1N5ZA 3HSBA 2GFAA 1OZ2A 1BB9A 1W1FA 1UFFA 2F69A 2XG8D 3ZFJA 1QP3A 2J7IA 3E1SA 4PJOA 4AT1B 1MHNA 4LDWA 3R6NA 4OB2B 2X4WA 2ZPIB 1YWOA 5FRNA 2DVJA 2RQTA 2A28A 1UTIA 1NJIC 4C8QG 4M77D 1TUDA 4PLLA 2AHJB 2LTOA 1MV0B 3MEAA 4HCZA 3C12A 1UEBA 3PTAA 2YSQA 1K9MU 3I55A 4WCIA 3CXCS 4LDYA 4F14A 2CP2A 2DXTA 2VGNA 3EHQA 1M5Q1 1VQ4T 4LDUA 1UGSB 3M56A 4GBQA 2JMCA 4FYVB 5GANh 2C0IA 1KQ1A 4EPCA 1NLPC 4BI3A 4OMOA 3CCLA 2EVRA 1XJWB 2EIFA 1S72A 2DD5A 4OGEA 1M2VB 1U1SA 2KK4A 3UA6A 1RABB 5KYUA 2QA4T 2CSIA 4RTWA 8ATCB 1OU9A 3S3NA 5CIUA 5GAMg 1VUBA 1H3ZA 4A53A 1ZUKA 2DJQA 4A4GA 2YRDA 2D0NA 1N8RU 2XK0A 1VQ4Q 2NUZA 5L8RE 2ZPFB 2PZ1A 1BI2A 3A8GB 4CC2A 4IIMA 2HCKA 4M7DF 4LXCA 3CC2T 2P0PA 3CCEA 5CKBA 4P5NA 1AHJB 3A8OB 4BY6B 2DTOA 4C8QF 2QEXT 1GBRA 5KE3A 2O01E 2QA4Q 3M9QA 3SD4A 2CS7A 1I07A 2MPXC 2XICA 4ZGDB 2F2WA 2XHCA 3V7RA 1E6GA 1ZLMA 1BI0A 2X35A 4BD3A 1R0CB 1M1KR 1WYXA 4CC4B 3D7SB 2DF6A 4ANJA 3CPWS 2X3XD 2DX1A 3DB3A 3CC2Q 2VB6A 1WXUA 2L3QA 3CCVT 2JMAA 3EGDA 4C92B 4C5IA 1TTHB 3QJ6A 4JJDA 1VQ7T 2QEXQ 4KUIA 1UGVA 3QIIA 4J83A 4KULA 3G71A 3EFOA 1HD3A 1JU5C 2QYZA 2DKGA 1ZA1B 3A5ZB 3CCMT 4BACA 1VOMA 3MCAB 5GAN7 2K6DA 2OTJQ 2LZ6B 1NE8A 4M7AC 3VRZA 1RAGB 2PUKB 2HZYA 1VYUA 1UJ0A 4CRIA 4M78E 4FSSA 4J5YA 5HCKA 1WQWA 2DA9A 2E5KA 2EJ9A 1K8AU 4X34A 2KRMA 2GTJA 1K73C 3CCJQ 2EJFA 1RACB 2KRNA 2WACA 4C8QE 2DNUA 3RNJA 2VGMA 4WF2A 4M78B 2K5LA 4PJJA 2LJ1A 3FC3A 1VQ7Q 1MMDA 4DBRA 4E2FB 2FL7A 4DBFA 2P4TA 1PSFA 3CCMQ 2BZ8A 2VKNA 2AIRB 3MKDA 3RIRA 2LCLA 4FIBA 1BI1A 2R5MA 2IVWA 3X25B 2QAZA 1Q81U 3LLRA 1M30A 2DL4A 1YHQT 3QXEB 5IAYA 3CMET 1M9SA 4XTUA 4BE1A 4PFZA 1JXOA 1M1GA 3QG1A 2QGGA 3GNGA 8AT1B 1T0JA 3H0HA 2DJZA 2XDDA 2JVVA 4HCCA 1KSWA 2EYYA 2HEQA 3EHRA 2JTEA 2AK5A 3EAEA 4BE0A 2YHTA 5HK3A 4C0DC 3CCQA 1WA7A 1N27A 1B34A 2DIQA 4RG2A 1NYGA 4PKCC 4PLIA 3HRUA 4J6YA 1VQLT 3I55T 2EPDA 1YHQQ 3J81E 3CMEQ 2JNGA 5FW9A 2QTVA 2HKQB 2XDPA 3M0PA 1JB0E 5LJ5g 3REAB 3AT1B 1M1KC 3OY9A 3M58A 1J3TA 4OMMA 4XTYA 2A08A 4TVRA 1X6GA 3EG1A 2HNIA 2KVQG 3EH2A 1D3BB 1QCOA 2DMOA 1S72T 2LX7A 3JCMf 1SG5A 1Q7YC 2K5FA 2AZVA 5GMKm 2PUOB 3LWHA 3MHXA 4M7DA 1PHTA 1ZSGA 5D6WA 3RERA 3SDZA 2I0NA 1VQLQ 3I55Q 4XTZA 2HAXA 4C8QA 4ESRA 5IT9E 2LJ0A 1NG2A 3MP6A 1QQJA 1WJQA 1SEMA 4X9DA 1K9AA 5KCOA 1KC8C 1Y96B 3H9NA 1YI2Q 3CMAA 1S72Q 2VV5A 4XQ3A 2KNBB 3V7SA 1WHHA 3G4ST 3JV3A 3M0QA 1RL2A 1YN8A 1WQ7A 1M90R 2KY9A 1WHMA 3LW5E 2V1RA 1GL5A 3H41A 4ZTFA 2RB6A 2RA2A 3L2ZA 1BKBA 1IZ6A 1WJSA 1RI9A 3OSVA 3BFMA 4FCYA 3CPWP 4LD6A 2D6FA 1YJNT 2IPOB 1EX4A 2J6FA 1UUEA 1JRIA 4Z02A 4QVZA 5LJ3h 3G71T 4ZN3A 3G4SQ 4BE2A 4AFZC 2EW3A 1YIJA 1SHFA 4J9BA 1D3BA 2KYBA 4JRPA 1Q82C 2CT4A 3LX7A 1PD1A 3INZA 1BBZA 1M3CA 1UHCA 4J9FA 1PM3A 4M75D 2D8HA 2FZGB 1X6BA 2DBMA 3JCMP 5CQXA 3JB9D 5A2QE 2W0ZA 4EMKA 4J9CA 3SFMA 4DA4A 1OYXA 1VA7A 1WFWA 2P84A 3ZEHA 1YJNQ 4PJOF 4M7DD 1G83A 4ELYC 3UATA 3G71Q 4LUEA 1D1BA 1UE9A 2FZKB 3EGUA 5FU6C 4M77B 2M1HA 2A7YA 1TU0B 2QI2A 4XU3A 4JDSA 3LGFA 1VQ4A 1KIKA 2KGTA 4AFUC 2A37A 5GAN8 2NWMA 1JJ2S 1C6VX 2RH2A 2DTHA 4J9HA 2ZAEA 2DO3A 2PVGB 5KYYA 5HK0A 4ME7A 2X9HA 1AZEA 4M4ZA 4B9WA 2DERA 2CDTA 3VKIA 2QA4A 5CCAA 1H641 4D8DA 4J9DA 1X43A 3CPWA 2RHZA 2KQWA 5GANg 4F7UB 1ARKA 2MAMA 3URGA 4RCCA 1AZGB 4OMQA 5GAOr 4FYYB 2NUTA 4BI8B 2BZYA 4ELZC 2RHUA 1AOJA 4NOYA 3PE0A 1B7TA 3M53A
chains in the Genus database with same CATH topology
2O9SA 1X27A 2LMJA 3A98A 1MV0B 1WIEA 1ZBJA 3SHWA 3I5RA 1GBQA 2YSQA 4DEYA 1AEYA 4Y92A 2M51A 2PNIA 4WCIA 3VRYA 4AG1C 4F14A 3VS1A 2ENMA 1U5SA 1ZUUA 1QKXA 1GFDA 1W6XA 3EHQA 4RTZA 3VS6A 2D8JA 2KXDA 2EKHA 4GBQA 2JMCA 1GCQC 2C0IA 1RLQC 1NLPC 1GFCA 2FPFA 1JXMA 4OMOA 1VYVA 1YWPA 2EVRA 2K9GA 3QWXX 2EGEA 1A0NB 3UA6A 4K11A 5ECAA 2RMOA 1NYFA 2CSIA 2RN8A 4RTWA 2L3SA 4KRTA 2FPEA 1Y57A 1UDLA 3M0SA 1FYNA 2KT8A 4X1VA 1ZUKA 2DJQA 2ESWA 2DBKA 2KYMA 2D0NA 2NUZA 2KR3A 2PZ1A 2JT4A 1T3LA 4CC7A 4CC2A 4IIMA 2HCKA 2KT1A 2SRCA 1CKAA 3NMZC 2EQIA 4Z88A 4RTUA 1M27C 2YUOA 1UJYA 1X2QA 2K3BA 2LCSA 3I35A 1ZX6A 1KJWA 2LQNA 1OV3A 4ORZA 5IHKA 3RBBB 1GBRA 1PKTA 1V1CA 4JZ4A 2EYZA 4GLMA 4RTXA 1NM7A 1I07A 2RQRA 2F2WA 3GBQA 1E6GA 2DRKA 1ZLMA 2D1XA 4AFSC 1GRIA 1WYXA 4CC3A 1HJDA 1OPLA 2J06A 4CC4B 2CUDA 1MUZA 2FRWA 2HDAA 2C0OA 2DF6A 2X3XD 2P4RA 1AWWA 2DX1A 1M3BA 2DL7A 1WXUA 1CSKA 2L3QA 3CQTA 3FJ5A 3O5ZA 2JMAA 1Z9ZA 4LUDA 2GGRA 2O88A 1M8MA 1QLYA 1NLOC 4JJDA 2J6KA 1QWFA 4EIKA 1UGVA 1AVZC 1QKWA 2BZXA 2FO0A 2LJ3A 2RPNA 2EGCA 4ZNXA 3I5SA 1HD3A 1JU5C 1AWXA 1LCKA 2CREA 2DL3A 3KFVA 3EG0A 2L0AA 5I11A 2B86A 1QCFA 3VS3A 2K6DA 2KXCA 2KE9A 2LZ6B 4JPBW 3VRZA 2OAWA 2MCNA 1VYUA 1UJ0A 1G2BA 4FSSA 5HCKA 2DA9A 4JZ3A 5EC7A 2E5KA 2K2MA 4OMNA 4HCKA 2AKLA 2KRMA 2GTJA 2A36A 2YUPA 2KRNA 2LP5A 2DNUA 4LN2A 3TSZA 3RNJA 1JEGA 3NPFA 1ABQA 3SEMA 2KROA 2LJ1A 2CUBA 1XOVA 5GJVB 2YUQA 2MIOA 2OJ2A 4D8KA 2BZ8A 2VKNA 3TVTA 2DL8A 1M30A 2DL4A 5L23A 1VYTA 4LE9A 3VS7A 2ROLA 4J9IA 5IHNA 1JQQA 4DEXA 1IO6A 1JXOA 2CT3A 1T0JA 3H0HA 2HSPA 2DYBA 3M0TA 2EBPA 1KSWA 1WX6A 1YCSB 2ED1A 2EYYA 1NEBA 1WLPB 2HEQA 2DE0X 2ECZA 3EHRA 2JTEA 2RF0A 3THKA 2AK5A 1JO8A 3I9QA 2MOXA 4IIOA 1WA7A 1K0SA 1WI7A 1UECA 1X2KA 1U06A 2IIMA 4JJCA 2J05A 1NYGA 1K0XA 3VS0A 2FG0A 1U3OA 1T3SA 1QWEA 2EPDA 2KEAA 5FW9A 2XMFA 3EG3A 3M0PA 5GJWB 2EGAA 3REAB 1K1ZA 4QT7A 5FWBA 1AWOA 2YDLA 4HVVA 1J3TA 2H8HA 4OMMA 2A08A 1X6GA 3EG1A 1GCQA 2ABLA 2GTOA 2DMOA 2DL5A 2ROTA 1BU1A 2LX7A 4HVWA 2GQIA 2AZVA 3M0UA 1TUCA 1PRMC 1PHTA 2F2XA 1ZSGA 1E6HA 1UHFA 2I0NA 1M3AA 2FEIA 2OI3A 3TSWA 1OOTA 4ESRA 1I1JA 2L2PA 2LJ0A 1SPKA 2AKKA 2RQVA 1NG2A 5IXFA 2DILA 1BK2A 1SEMA 1K4US 2M0YA 1K9AA 4RTTA 2FPDA 2F2VA 2KRSA 2EYWA 4AFQC 1RLPC 2JM8A 2K7AA 5IXBA 2JW4A 1CKBA 2KNBB 3PVLA 1WDXA 2JS0A 3JV3A 3M0QA 1WXBA 1YN8A 3ZL7C 2DLPA 1AWJA 2JXBA 1HSQA 2V1RA 3H41A 1GL5A 4A63B 1E7OA 2VVKA 4RTYA 2W10A 5IH2A 2EYXA 1RI9A 1OPKA 1OEBA 3VS4A 1X69A 3VS2A 1AD5A 1I0CA 4AG2C 4R0KA 1ABOA 4F16A 4OMLA 2O2OA 1H92A 2GNCA 2L3PA 4RUGA 2J6FA 1UUEA 3LH5A 2DM1A 3VS5A 4OMPA 1K76A 4JJBA 3QWYA 2G6FX 1B3QA 4AFZC 2EW3A 3H0FA 2O9VA 2YUNA 1SHFA 4J9BA 2KYBA 3PVQA 2CT4A 2VWFA 4F17A 4LNPA 1BBZA 1M3CA 2CH4W 1UHCA 4J9FA 5FWCA 1GCPA 3EG2A 2D8HA 4Z89A 1X6BA 2DBMA 2SEMA 2GBQA 1H8KA 3UA7A 2LNHB 3H0IA 2K79A 1B07A 2W0ZA 1PKSA 2QDLA 2HBWA 4J9CA 2RNAA 1W70A 3UF4A 1VA7A 3NGPA 1WFWA 1H3HA 2J6OA 2JM9A 3C0CA 2BTTA 1PNJA 1G83A 3U23A 3UATA 2ED0A 4J9GA 2JS2A 4LUEA 4RTVA 4J9EA 1KFZA 3ULRB 3IQLA 1UE9A 1Z9QA 4Z8AA 1MV3A 1SSHA 3EGUA 1NEGA 1PRLC 2LQWA 1KIKA 2RQUA 2KGTA 4AFUC 2A37A 2CSQA 2NWMA 2DRMA 2RQWA 1Y0MA 2X3WD 3M0RA 3NHNA 4J9HA 1ZUYA 5I22A 2O31A 1AZEA 1YNZA 4M4ZA 1SHGA 2CH4A 5IHIA 2CDTA 1EFNA 1FMKA 2V1QA 1N5ZA 4HVUA 1BB9A 1W1FA 4E6RA 4D8DA 1UFFA 4J9DA 1TG0A 3REBB 1X43A 2J7IA 2YT6A 3R6NA 1SRLA 1ARKA 2AZSA 1YWOA 1AZGB 4OMQA 1UG1A 1PWTA 4HXJA 1T0HA 2DVJA 2KBTA 2A28A 2RQTA 1S1NA 1UTIA 1YP5A 2BZYA 1WXTA 2C0TA 1AOJA 1SRMA 2FRYA 1RUWA 2PTKA 1TUDA 3PE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9S A;  1X27 A;  2LMJ A;  3A98 A;  1MV0 B;  1WIE A;  1ZBJ A;  3SHW A;  3I5R A;  1GBQ A;  2YSQ A;  4DEY A;  1AEY A;  4Y92 A;  2M51 A;  2PNI A;  4WCI A;  3VRY A;  4AG1 C;  4F14 A;  3VS1 A;  2ENM A;  1U5S A;  1ZUU A;  1QKX A;  1GFD A;  1W6X A;  3EHQ A;  4RTZ A;  3VS6 A;  2D8J A;  2KXD A;  2EKH A;  4GBQ A;  2JMC A;  1GCQ C;  2C0I A;  1RLQ C;  1NLP C;  1GFC A;  2FPF A;  1JXM A;  4OMO A;  1VYV A;  1YWP A;  2EVR A;  2K9G A;  3QWX X;  2EGE A;  1A0N B;  3UA6 A;  4K11 A;  5ECA A;  2RMO A;  1NYF A;  2CSI A;  2RN8 A;  4RTW A;  2L3S A;  4KRT A;  2FPE A;  1Y57 A;  1UDL A;  3M0S A;  1FYN A;  2KT8 A;  4X1V A;  1ZUK A;  2DJQ A;  2ESW A;  2DBK A;  2KYM A;  2D0N A;  2NUZ A;  2KR3 A;  2PZ1 A;  2JT4 A;  1T3L A;  4CC7 A;  4CC2 A;  4IIM A;  2HCK A;  2KT1 A;  2SRC A;  1CKA A;  3NMZ C;  2EQI A;  4Z88 A;  4RTU A;  1M27 C;  2YUO A;  1UJY A;  1X2Q A;  2K3B A;  2LCS A;  3I35 A;  1ZX6 A;  1KJW A;  2LQN A;  1OV3 A;  4ORZ A;  5IHK A;  3RBB B;  1GBR A;  1PKT A;  1V1C A;  4JZ4 A;  2EYZ A;  4GLM A;  4RTX A;  1NM7 A;  1I07 A;  2RQR A;  2F2W A;  3GBQ A;  1E6G A;  2DRK A;  1ZLM A;  2D1X A;  4AFS C;  1GRI A;  1WYX A;  4CC3 A;  1HJD A;  1OPL A;  2J06 A;  4CC4 B;  2CUD A;  1MUZ A;  2FRW A;  2HDA A;  2C0O A;  2DF6 A;  2X3X D;  2P4R A;  1AWW A;  2DX1 A;  1M3B A;  2DL7 A;  1WXU A;  1CSK A;  2L3Q A;  3CQT A;  3FJ5 A;  3O5Z A;  2JMA A;  1Z9Z A;  4LUD A;  2GGR A;  2O88 A;  1M8M A;  1QLY A;  1NLO C;  4JJD A;  2J6K A;  1QWF A;  4EIK A;  1UGV A;  1AVZ C;  1QKW A;  2BZX A;  2FO0 A;  2LJ3 A;  2RPN A;  2EGC A;  4ZNX A;  3I5S A;  1HD3 A;  1JU5 C;  1AWX A;  1LCK A;  2CRE A;  2DL3 A;  3KFV A;  3EG0 A;  2L0A A;  5I11 A;  2B86 A;  1QCF A;  3VS3 A;  2K6D A;  2KXC A;  2KE9 A;  2LZ6 B;  4JPB W;  3VRZ A;  2OAW A;  2MCN A;  1VYU A;  1UJ0 A;  1G2B A;  4FSS A;  5HCK A;  2DA9 A;  4JZ3 A;  5EC7 A;  2E5K A;  2K2M A;  4OMN A;  4HCK A;  2AKL A;  2KRM A;  2GTJ A;  2A36 A;  2YUP A;  2KRN A;  2LP5 A;  2DNU A;  4LN2 A;  3TSZ A;  3RNJ A;  1JEG A;  3NPF A;  1ABQ A;  3SEM A;  2KRO A;  2LJ1 A;  2CUB A;  1XOV A;  5GJV B;  2YUQ A;  2MIO A;  2OJ2 A;  4D8K A;  2BZ8 A;  2VKN A;  3TVT A;  2DL8 A;  1M30 A;  2DL4 A;  5L23 A;  1VYT A;  4LE9 A;  3VS7 A;  2ROL A;  4J9I A;  5IHN A;  1JQQ A;  4DEX A;  1IO6 A;  1JXO A;  2CT3 A;  1T0J A;  3H0H A;  2HSP A;  2DYB A;  3M0T A;  2EBP A;  1KSW A;  1WX6 A;  1YCS B;  2ED1 A;  2EYY A;  1NEB A;  1WLP B;  2HEQ A;  2DE0 X;  2ECZ A;  3EHR A;  2JTE A;  2RF0 A;  3THK A;  2AK5 A;  1JO8 A;  3I9Q A;  2MOX A;  4IIO A;  1WA7 A;  1K0S A;  1WI7 A;  1UEC A;  1X2K A;  1U06 A;  2IIM A;  4JJC A;  2J05 A;  1NYG A;  1K0X A;  3VS0 A;  2FG0 A;  1U3O A;  1T3S A;  1QWE A;  2EPD A;  2KEA A;  5FW9 A;  2XMF A;  3EG3 A;  3M0P A;  5GJW B;  2EGA A;  3REA B;  1K1Z A;  4QT7 A;  5FWB A;  1AWO A;  2YDL A;  4HVV A;  1J3T A;  2H8H A;  4OMM A;  2A08 A;  1X6G A;  3EG1 A;  1GCQ A;  2ABL A;  2GTO A;  2DMO A;  2DL5 A;  2ROT A;  1BU1 A;  2LX7 A;  4HVW A;  2GQI A;  2AZV A;  3M0U A;  1TUC A;  1PRM C;  1PHT A;  2F2X A;  1ZSG A;  1E6H A;  1UHF A;  2I0N A;  1M3A A;  2FEI A;  2OI3 A;  3TSW A;  1OOT A;  4ESR A;  1I1J A;  2L2P A;  2LJ0 A;  1SPK A;  2AKK A;  2RQV A;  1NG2 A;  5IXF A;  2DIL A;  1BK2 A;  1SEM A;  1K4U S;  2M0Y A;  1K9A A;  4RTT A;  2FPD A;  2F2V A;  2KRS A;  2EYW A;  4AFQ C;  1RLP C;  2JM8 A;  2K7A A;  5IXB A;  2JW4 A;  1CKB A;  2KNB B;  3PVL A;  1WDX A;  2JS0 A;  3JV3 A;  3M0Q A;  1WXB A;  1YN8 A;  3ZL7 C;  2DLP A;  1AWJ A;  2JXB A;  1HSQ A;  2V1R A;  3H41 A;  1GL5 A;  4A63 B;  1E7O A;  2VVK A;  4RTY A;  2W10 A;  5IH2 A;  2EYX A;  1RI9 A;  1OPK A;  1OEB A;  3VS4 A;  1X69 A;  3VS2 A;  1AD5 A;  1I0C A;  4AG2 C;  4R0K A;  1ABO A;  4F16 A;  4OML A;  2O2O A;  1H92 A;  2GNC A;  2L3P A;  4RUG A;  2J6F A;  1UUE A;  3LH5 A;  2DM1 A;  3VS5 A;  4OMP A;  1K76 A;  4JJB A;  3QWY A;  2G6F X;  1B3Q A;  4AFZ C;  2EW3 A;  3H0F A;  2O9V A;  2YUN A;  1SHF A;  4J9B A;  2KYB A;  3PVQ A;  2CT4 A;  2VWF A;  4F17 A;  4LNP A;  1BBZ A;  1M3C A;  2CH4 W;  1UHC A;  4J9F A;  5FWC A;  1GCP A;  3EG2 A;  2D8H A;  4Z89 A;  1X6B A;  2DBM A;  2SEM A;  2GBQ A;  1H8K A;  3UA7 A;  2LNH B;  3H0I A;  2K79 A;  1B07 A;  2W0Z A;  1PKS A;  2QDL A;  2HBW A;  4J9C A;  2RNA A;  1W70 A;  3UF4 A;  1VA7 A;  3NGP A;  1WFW A;  1H3H A;  2J6O A;  2JM9 A;  3C0C A;  2BTT A;  1PNJ A;  1G83 A;  3U23 A;  3UAT A;  2ED0 A;  4J9G A;  2JS2 A;  4LUE A;  4RTV A;  4J9E A;  1KFZ A;  3ULR B;  3IQL A;  1UE9 A;  1Z9Q A;  4Z8A A;  1MV3 A;  1SSH A;  3EGU A;  1NEG A;  1PRL C;  2LQW A;  1KIK A;  2RQU A;  2KGT A;  4AFU C;  2A37 A;  2CSQ A;  2NWM A;  2DRM A;  2RQW A;  1Y0M A;  2X3W D;  3M0R A;  3NHN A;  4J9H A;  1ZUY A;  5I22 A;  2O31 A;  1AZE A;  1YNZ A;  4M4Z A;  1SHG A;  2CH4 A;  5IHI A;  2CDT A;  1EFN A;  1FMK A;  2V1Q A;  1N5Z A;  4HVU A;  1BB9 A;  1W1F A;  4E6R A;  4D8D A;  1UFF A;  4J9D A;  1TG0 A;  3REB B;  1X43 A;  2J7I A;  2YT6 A;  3R6N A;  1SRL A;  1ARK A;  2AZS A;  1YWO A;  1AZG B;  4OMQ A;  1UG1 A;  1PWT A;  4HXJ A;  1T0H A;  2DVJ A;  2KBT A;  2A28 A;  2RQT A;  1S1N A;  1UTI A;  1YP5 A;  2BZY A;  1WXT A;  2C0T A;  1AOJ A;  1SRM A;  2FRY A;  1RUW A;  2PTK A;  1TUD A;  3PE0 A; 
#chains in the Genus database with same CATH topology
 4J6W A;  2CZ0 B;  4DBH A;  3SHW A;  3EFR A;  4HCB A;  2QEX A;  2M51 A;  4NL3 A;  1TS9 A;  4II1 A;  4F04 B;  2EKO A;  1KK7 A;  1QKX A;  2HSE B;  3L42 A;  2E41 A;  2MI6 A;  1TOV A;  3UPU A;  1D1C A;  5CKF A;  2OTJ A;  3JCM c;  1VQK T;  1I81 A;  1RLQ C;  3SWN B;  4ATO A;  4XTW A;  2R58 A;  1JXM A;  1YWP A;  4M7D C;  3QWX X;  3OA6 A;  1M4Z A;  2EGE A;  3CCJ A;  1XTD A;  4E7L A;  2RMO A;  2CGH A;  1N9R A;  2ZCF B;  2L3S A;  4KRT A;  1MMG A;  4C8Q C;  1NJI U;  2D0Q B;  1ZSZ B;  2ZPE B;  1VQ7 A;  1D0Y A;  1UDL A;  1FYN A;  4C0F A;  2YWW A;  4X1V A;  4C0D B;  1VQ8 T;  4Y28 E;  1C1A A;  3CCM A;  2DBK A;  3G1J A;  1NBE B;  1WHK A;  2QDY B;  4CC7 A;  1VQK Q;  4GLK A;  2SRC A;  4KT0 E;  3NMZ C;  3OYN A;  2NUP A;  4RTU A;  4B6M A;  1M27 C;  1WHL A;  1YBY A;  2LCS A;  4LDX A;  4C92 G;  2MMP A;  1KJW A;  1M2O A;  4ORZ A;  3HHT B;  1Y07 A;  1IB8 A;  2PU9 B;  1D1A A;  2RJC A;  2EQM A;  1NM7 A;  5IN1 A;  2RQR A;  3GBQ A;  2DRK A;  2R57 A;  3RUX A;  1VQ8 Q;  1HJD A;  2VXF A;  1OPL A;  3QSU A;  1MUZ A;  4E7I A;  5M9O A;  2M9U A;  4A4F A;  1XQH A;  2XI9 A;  4R56 A;  2KAF A;  1M3B A;  3PT9 A;  1YIJ T;  2DL7 A;  5FU7 C;  2CP5 A;  1QW1 A;  3FJ5 A;  1CSK A;  3CQT A;  4MDW A;  1KG1 A;  1HK9 A;  2PVD B;  2GGR A;  1QVG S;  1NLO C;  1K9M R;  4M78 G;  4EIK A;  3BY7 A;  2A3L A;  2LJ3 A;  2RPN A;  2Y4Y A;  2Y4X A;  1AWX A;  4FU6 A;  2B86 A;  3JCM V;  5KYW B;  2DIG A;  1W4S A;  4E7K A;  5GMK i;  1U8R A;  2MCN A;  4RKU E;  3TCJ A;  4EMK C;  1G2B A;  5EC7 A;  3CCR A;  4OVA A;  1YIT T;  2K2M A;  4OMN A;  4HCK A;  1VQL A;  1LPL A;  2JJ9 A;  5GMK e;  1YIJ Q;  5FLX E;  2XU8 A;  3OYC A;  1VQM A;  2LP5 A;  2BKD N;  4LN2 A;  3QO3 A;  4N0A A;  3TSZ A;  1FWZ A;  3SEM A;  3ASK A;  1OUL A;  1RAE B;  2KRO A;  4C92 F;  2CUB A;  1IRE B;  5GJV B;  3RMQ A;  2YUQ A;  2MIO A;  5AT1 B;  1N8R R;  3E19 A;  4M7A D;  1YI2 A;  1JJ2 P;  2K57 A;  3TEE A;  1YJ9 Q;  2KSS A;  3CC7 A;  3OMC A;  1QCN A;  2DXU A;  2E6Z A;  4LE9 A;  2ROL A;  4DBQ A;  1VQ9 A;  4J9I A;  1YIT Q;  5IHN A;  5GAM d;  2QQS A;  4NL2 A;  3EGX B;  1NPP A;  2RHI A;  4KH1 B;  3OYB A;  2EQK A;  2ED1 A;  1MNE A;  1BCO A;  1EIF A;  2ECZ A;  1K73 U;  4M78 F;  2ZGW A;  2RK2 A;  4IUV A;  4KUD K;  1K0S A;  3DKM A;  1RI0 A;  5DLO A;  2IIM A;  2QQR A;  4JJC A;  3P8H A;  2J05 A;  5KH6 A;  3P8B B;  2FG0 A;  4V2S A;  2KEA A;  1KHC A;  3G4S A;  2XMF A;  1BYM A;  4XTX A;  5FRO A;  3GP8 A;  3MP1 A;  2VAS A;  2M16 A;  3JCM X;  1WZO A;  4UC4 A;  2OTJ T;  3BW1 A;  3OYF A;  2X4J A;  4PJO D;  2COY A;  4E7H A;  4C92 E;  2YDL A;  4MZM A;  2HQX A;  2JUF A;  1VQP T;  3VV0 A;  2ROT A;  1BU1 A;  4O6J A;  2MWO A;  4HVW A;  3CCJ T;  3M0U A;  2LCC A;  4QQ6 A;  1Q95 G;  4JRQ A;  3G6E Q;  1K8A R;  1YJN A;  4HT9 A;  1E6H A;  3DB4 A;  4N4H A;  3JCM Q;  2FEI A;  2M0O A;  2QTX A;  5CK9 A;  1RAI B;  1OOT A;  2QXF A;  2YRV A;  1I1J A;  3M59 A;  3E2U A;  1SPK A;  1M2V A;  2YXY A;  1R8O B;  1JJ2 A;  3OYJ A;  2HL3 A;  2R5A A;  5IXF A;  2DIL A;  5CQY A;  3BDL A;  2LT4 A;  4OB1 B;  1W2B S;  3P8D A;  3LWI A;  1VQP Q;  2KRS A;  3TU4 K;  2L89 A;  4IUQ A;  1M1K U;  5KCH A;  1SF9 A;  5LJ3 g;  1O9S A;  5GMK j;  3DLM A;  2ZZD A;  1WHJ A;  4M75 B;  1WXB A;  3OYG A;  2LC4 A;  3A8H B;  2L5Q A;  1Q7Y U;  2HQH A;  1N8R C;  5EG2 A;  1E7O A;  4E7S A;  4A54 A;  7AT1 B;  5A0D A;  2W10 A;  3FJP A;  5IH2 A;  2EYX A;  2X4X A;  3QHS A;  5J39 A;  3V8L A;  2DFU A;  3EFS A;  3VUB A;  1I0C A;  3MPU B;  4JJN K;  4OML A;  3MJX A;  2GNC A;  2L3P A;  4J6X A;  3V8K A;  3VU3 C;  1QVG P;  2DM1 A;  4ZTJ A;  3VS5 A;  4OMP A;  1KC8 U;  1K76 A;  3QWY A;  2CZ6 B;  1B3Q A;  1WNL A;  2YUN A;  4PJO C;  5GAO p;  1N6A A;  2G3R A;  1HYO A;  4BI4 A;  2QGF B;  4M77 G;  4C92 A;  2DZ9 A;  2SEM A;  2GBQ A;  4XU0 A;  2L3R A;  1AT1 B;  2CKK A;  2E65 A;  2RI2 A;  3UA7 A;  1EZZ B;  3CCR T;  2CP0 A;  2LDM A;  4FW2 A;  2E64 A;  3H0I A;  3OYK A;  2YLC A;  2K79 A;  3PGG A;  2RD1 A;  4IUT A;  1VQM T;  3UF4 A;  2LQ8 A;  2LNV A;  5LJ5 d;  3CXC P;  2J6O A;  1TUG B;  2BTT A;  1PNJ A;  3U23 A;  4J9G A;  2EYQ A;  2FVU A;  4J9E A;  4RTV A;  5KYN A;  4N0A C;  3ULR B;  3E9F A;  2EWN A;  1YI2 T;  4F7U G;  1NEG A;  2LQW A;  3JCM h;  3CC7 T;  4JS5 A;  2CSQ A;  3HKS A;  4M78 A;  1VQK A;  1Q82 U;  5GAM f;  3CCR Q;  1VQ9 T;  4J7F A;  1ZQ1 A;  2DPP B;  2KI7 A;  2X3W D;  1C0M A;  2ZPB B;  3BDU A;  1ZUY A;  1Q86 U;  2GFU A;  1VQM Q;  1FMW A;  1YNZ A;  1RAF B;  5IHI A;  2MYS A;  4JS4 A;  1FMK A;  4E6R A;  4C0G A;  3CEY A;  3S3O A;  1R77 A;  1LVK A;  3O8V A;  1VQ8 A;  3CD6 T;  1TSF A;  1PWT A;  1KQS S;  2KBT A;  3OYM A;  1QVG A;  3CC7 Q;  4KBM B;  1YP5 A;  2YLB A;  1WXT A;  2C0T A;  4EMH A;  2RO0 A;  1SRM A;  2KMT A;  1G3W A;  2PTK A;  1VQ9 Q;  2RI5 A;  2O9S A;  1TXQ A;  1WIE A;  3MEV A;  2V8I A;  2VYT A;  2ZPH B;  2I2L A;  4C5G A;  4OB0 B;  2HQE A;  3N5B B;  2A0F B;  3VRY A;  4AG1 C;  2KDS A;  3VS1 A;  2ENM A;  1U5S A;  1ZUU A;  1W6X A;  2KXD A;  1VQ6 Q;  2P0Q A;  2BIV A;  2D9T A;  3CXC A;  3CD6 Q;  2RHX A;  4MZT A;  2FPF A;  2X4Y A;  3EG9 B;  3UWN A;  1ZHI A;  3JB9 J;  1D0Z A;  1A0N B;  4K11 A;  2E5Q A;  5D6X A;  5ECA A;  3PIO A;  1NYF A;  3CBP A;  4IUR A;  2FPE A;  2JZ2 A;  3A8L B;  2F5K A;  4MML A;  3M0S A;  2RHY A;  4KH0 B;  1W2B P;  2X51 A;  2ESW A;  1UGQ B;  2F1L A;  2KYM A;  3VYH B;  2KR3 A;  2JT4 A;  5GAM e;  5CKE A;  3C4S A;  4M77 E;  1YJ9 A;  2KT1 A;  3VUZ A;  1CKA A;  4M78 D;  4Z88 A;  4PJN A;  1I5L A;  2K3B A;  1OU8 A;  1M1F A;  1VQO A;  2YRC A;  1YIT A;  1Y96 A;  1ZX6 A;  2E10 A;  2LRQ A;  5IHK A;  3RBB B;  1PKT A;  1V1C A;  4FT4 A;  4JZ4 A;  4C8Q D;  2EYZ A;  2VUB A;  4GLM A;  4RTX A;  4FYW B;  2DET A;  2PVO B;  4MMK A;  4BY6 C;  3I56 A;  2D1X A;  4AFS C;  1GRI A;  4CC3 A;  1SSF A;  2HMA A;  2MK5 A;  4DOV A;  1I5O B;  2E4H A;  4FW1 A;  2CUD A;  4A4H A;  2FRW A;  4F7U E;  4M7A E;  2FHD A;  2P4R A;  1AWW A;  2XDB A;  3QJY A;  4ZGE B;  3JB9 H;  1Y7X A;  1QVF S;  1IHV A;  2OX7 A;  5GAN d;  2O88 A;  1R0B G;  4N4G A;  2J6K A;  4M7A B;  1QWF A;  1AVZ C;  2K2V A;  2FO0 A;  4FYX B;  4PJL A;  2QG9 B;  2DZC A;  3X24 B;  3KXT A;  1LCK A;  2CRE A;  2DL3 A;  4QW2 A;  4C92 C;  3KFV A;  3EG0 A;  2L0A A;  1KD1 U;  3VS3 A;  2KE9 A;  4JPB W;  4RMO A;  1M90 C;  5A0G A;  3G6E A;  4JZ3 A;  5CKH A;  3HPW A;  3OYL A;  2A36 A;  1W2B A;  2O4X B;  2K4Y A;  1Y71 A;  4JLG A;  3NPF A;  1ABQ A;  5LJ3 e;  5D6Y A;  1XOV A;  5KYX B;  4O5V A;  5GAN 4;  1VQP A;  2OJ2 A;  3PFS A;  3M4Y A;  2AT1 B;  3RKX A;  4D8K A;  1G3Y A;  3T9N A;  3TVT A;  3M55 A;  3CCS A;  4M78 C;  4QQG A;  2DL8 A;  4J8O A;  3CC4 Q;  2E12 A;  4M77 A;  5GMK h;  3VS7 A;  1JQQ A;  4DEX A;  4C0Z A;  1IO6 A;  5GAO n;  2CT3 A;  3M5A A;  4L5G A;  2HSP A;  2DYB A;  3M0T A;  4PFO A;  5J3B A;  3FEO A;  1WLP B;  2DE0 X;  1KQS P;  4C5E A;  2HL5 C;  3JCM b;  2RF0 A;  2OAU A;  5GAM j;  1JO8 A;  5C6S A;  5I21 A;  2MOX A;  3RMS A;  1WI7 A;  2K3Y A;  4J7I A;  3NTI A;  1U06 A;  1P92 A;  3L2V A;  3QDR B;  4F7U A;  3VS0 A;  1U3O A;  1T3S A;  1MGQ A;  3JSC A;  3G7Z A;  2V26 A;  5I2S A;  4A4K A;  2L8D A;  5GJW B;  1KHI A;  4MDX A;  2EGA A;  4Q5W A;  1BCM A;  3QKJ A;  4QT7 A;  1V76 A;  3V8J A;  3OS2 A;  3H6Z A;  3OYD A;  1G3T A;  4HVV A;  4WTO B;  3L2R A;  3FB9 A;  1GCQ A;  2ABL A;  5LJ5 e;  1WHG A;  2QQB A;  5GAO q;  5FRM A;  1TUC A;  2ATC B;  1PRM C;  1UHF A;  2NLU A;  1PCX A;  4M75 G;  1M8V A;  1M3A A;  3SWN A;  3RKW A;  3TSW A;  1VQ5 Q;  3JB9 G;  4XK8 E;  2L2P A;  2CP7 A;  4YTL A;  3J80 E;  3OS5 A;  1YJ9 T;  1K4U S;  2HBP A;  3RDV A;  4ZGJ B;  3X26 B;  4M7D G;  2F2V A;  5GAO m;  1ZSZ A;  4EDU A;  2EYW A;  4XAX B;  4AFQ C;  1RLP C;  2JM8 A;  2K7A A;  5IXB A;  1VQO T;  1VQN T;  2JW4 A;  4BUG A;  1CKB A;  2QAS A;  2M02 A;  3QPH A;  2JS0 A;  3LGL A;  3C95 A;  2LVM A;  1OQK A;  5A0L A;  2E1H A;  1KQS A;  5HY6 A;  3I56 T;  5LJ3 j;  3HP9 A;  3KBG A;  2DLP A;  3VYG A;  1AWJ A;  2CYZ B;  2JXB A;  1HSQ A;  4PFP A;  4B9X A;  2CP6 A;  4RTY A;  2BE7 D;  2K5I A;  1K73 R;  1BI3 A;  1OZ3 A;  5CKD A;  3OS1 A;  3GIB A;  1OPK A;  2V8K A;  3MP8 A;  1OEB A;  3VS4 A;  4Y91 A;  3EGD B;  3OYY A;  2LT1 A;  4NS5 A;  5GAN f;  1BIA A;  2O2O A;  1VQO Q;  4KGZ B;  4HT8 A;  3VJP A;  1VQN Q;  1H92 A;  4RUG A;  3EFO B;  3A1P A;  1QVF P;  3FIF A;  3LH5 A;  3M57 A;  4OB3 B;  2EJG A;  4JJB A;  2G6F X;  5GMK l;  3H0F A;  2O9V A;  3PVQ A;  2JTF A;  3JCM d;  3I56 Q;  3JCM g;  4LNP A;  4M75 F;  2CH4 W;  2IG0 A;  3EG2 A;  1VQ6 A;  2RJD A;  1H8K A;  3JB9 F;  3WVD B;  1LNX A;  3G6E T;  1I8F A;  3CD6 A;  1BIB A;  2LNH B;  1UGP B;  4EMG A;  5CVI A;  1B07 A;  2HBW A;  5GAN 3;  2RNA A;  1W70 A;  1OX8 A;  5KYW A;  5FU6 B;  2QQ9 A;  3NGP A;  2XKO C;  3L2W A;  1H3H A;  2JM9 A;  3C0C A;  4RCB A;  1SKU B;  5C0M A;  2OTL A;  2JS2 A;  4QQD A;  3J7A F;  3IQL A;  1Z9Q A;  5CAI A;  3QYG B;  4BDZ A;  1MV3 A;  2GCX A;  5I2M A;  1PD0 A;  4A4E A;  1DJ7 B;  3CCS T;  5LJ5 j;  1U1T A;  2RQU A;  3HFN A;  2BE9 B;  4KGX B;  4FSX A;  1K9M C;  3LYI A;  4M77 C;  1Y0M A;  3NHN A;  3PNW C;  2O31 A;  2WSE E;  4AMC A;  2PQW A;  3QDF A;  1G3S A;  1SHG A;  4VUB A;  3Q1J A;  2WSF E;  4HVU A;  1Q7Y R;  1TWB A;  3E9G A;  1TG0 A;  2JOY A;  3REB B;  2YT6 A;  1B34 B;  4M75 E;  5KE2 A;  1SRL A;  2AZS A;  5LJ3 d;  1Q81 R;  3CCS Q;  2DXB A;  1UG1 A;  3EGX A;  4HXJ A;  1T0H A;  4LD9 K;  1QVF A;  1S1N A;  1XNI A;  1FMV A;  5GAN e;  2FRY A;  1RUW A;  4IUP A;  1RAH B;  3ZBD A;  3UT1 A;  1X27 A;  2LMJ A;  4M7D E;  3A98 A;  1ZBJ A;  1NZ9 A;  1KC8 R;  3OYE A;  1UGR B;  3I5R A;  2FZC B;  1GBQ A;  4DEY A;  1AEY A;  4Y92 A;  3X20 B;  2H3J A;  2PNI A;  2BUD A;  4IUU A;  3CCV Q;  4PK4 A;  1TH7 A;  1GFD A;  4RTZ A;  4M7D B;  3VS6 A;  1YJW A;  2D8J A;  2EKH A;  2FB7 A;  2LX9 A;  1GCQ C;  1WPY A;  2P0K A;  1OX9 A;  1GFC A;  3CBO A;  2COW A;  2DYI A;  1VYV A;  4C8Q B;  2K3X A;  4XTV A;  2K9G A;  2Z0W A;  3C94 A;  3KUF A;  3NTK A;  1MMN A;  1IHW A;  3SWN C;  1X6O A;  2RN8 A;  1D0X A;  1RAD B;  2COZ A;  1Y57 A;  4FL6 A;  4LDV A;  1F1B B;  2KT8 A;  2C06 A;  6AT1 B;  3OW2 S;  3PIP A;  1T3L A;  1Q82 R;  1ZSZ C;  3OYI A;  3CC4 A;  3MEU A;  4XU1 A;  1YCY A;  3A8M B;  2EQI A;  3MO8 A;  2YUO A;  3OMG A;  1UJY A;  1X2Q A;  1Q86 R;  1MMA A;  3I35 A;  3S3M A;  2LQN A;  1OV3 A;  5CR2 A;  2DEU A;  2MF2 A;  4M7A G;  1MND A;  3M4G A;  2HKN A;  1IGU A;  2JN0 A;  9ATC B;  1FX7 A;  4JLI A;  2DK3 A;  4MZP A;  5DM7 R;  4M75 A;  1K8A C;  4PJM A;  4L59 A;  5FU7 B;  5GAM h;  3MEW A;  3WVE B;  4JRK A;  1V29 B;  2J06 A;  2E3I A;  2DVE A;  5GAN 2;  3CCL T;  2E6N A;  4XU2 A;  2HDA A;  2C0O A;  2DXC A;  2DAQ A;  3NFC A;  3O5Z A;  3WXM B;  1Z9Z A;  4LUD A;  3DLL A;  3FLG A;  2RM4 A;  2DEQ A;  1M8M A;  1VQ6 T;  3GOX A;  1QLY A;  2MWP A;  3X28 B;  1Q81 C;  4RG8 A;  1QKW A;  2BZX A;  4EMK B;  2EGC A;  3HTR A;  4ZNX A;  3I5S A;  2F5T X;  4M77 F;  5I11 A;  2GQV A;  1QCF A;  3RKY A;  5GAN j;  5GAN 6;  2KXC A;  4IKF A;  3JAM E;  2OAW A;  4FT2 A;  5DLQ E;  1ZA2 B;  1OI1 A;  3CCE T;  2OTL T;  4PNO A;  3CCL Q;  4PJO G;  1WJR A;  2AKL A;  4C5H A;  3QZ5 B;  4JRI A;  2YUP A;  3QZ9 B;  3L2Q A;  1VQ5 A;  2ZPG B;  2WSC E;  3CCU A;  1G5V A;  1JEG A;  4C92 D;  1QP2 A;  2LQK A;  5LL6 S;  4F7U F;  1GXI E;  4M7A F;  5KYY B;  5J26 A;  1VIF A;  2EAY A;  2HD0 A;  1LJO A;  3L1A A;  4OF1 A;  3JRZ A;  2RK1 A;  5L23 A;  2B8A A;  1VYT A;  3CCE Q;  2NYS A;  2OTL Q;  2XD0 A;  3V7C A;  1M90 U;  5LJ3 f;  2GF7 A;  2NUT B;  2EBP A;  1WX6 A;  3OB9 A;  1YCS B;  1NEB A;  2VXE A;  3THK A;  4OMF B;  3I9Q A;  4R55 A;  2QK0 A;  2VC8 A;  4IIO A;  1Q86 C;  3HL8 A;  1UEC A;  2EQJ A;  1X2K A;  5CO7 A;  1VQN A;  1K0X A;  5D7U A;  3HRS A;  2EFI A;  3JCM e;  1KQ2 A;  3CBM A;  3EH1 A;  1QWE A;  4BB7 A;  1X01 A;  1UB4 A;  3UDC A;  3EG3 A;  4HA8 A;  3QBY A;  3GPL A;  3H8Z A;  1YJW T;  5GAO l;  1K1Z A;  4JUV A;  4QVD A;  4HKE A;  1I4K 1;  5FWB A;  1AWO A;  3TQ7 P;  3GF5 A;  2H8H A;  4OP0 A;  2DTI A;  1KD1 R;  2GTO A;  2DL5 A;  2GQI A;  3HRT A;  2F2X A;  3OSS C;  3PMI A;  1VIE A;  4DOW A;  1NPR A;  1O75 A;  2OI3 A;  4DQ2 A;  4BDY A;  3EG9 A;  1WGS A;  2V8J A;  2XID A;  5GAN 5;  3M54 A;  1YJW Q;  2AKK A;  2RQV A;  1QMC A;  1YFN A;  3OW2 P;  5LJ5 f;  4L6V 5;  3CC4 T;  5LJ5 h;  1BK2 A;  2NUP B;  2RI3 A;  2M0Y A;  3CCQ T;  4RTT A;  2FPD A;  2FYK A;  2RJE A;  3ER0 A;  2QQA A;  1ZBX A;  2E3H A;  3LH0 A;  4KGV B;  2RJF A;  3PVL A;  1WDX A;  1PC0 A;  1IRX A;  1NJI R;  3OQ5 A;  3ZL7 C;  3CC2 A;  3HFO A;  1RAA B;  4PJO E;  4E7J A;  4A63 B;  2VVK A;  4M75 C;  3S6W A;  3OYA A;  4D6W A;  1X69 A;  2DD4 A;  1AD5 A;  3VS2 A;  1HXD A;  3CCQ Q;  4AG2 C;  3F70 A;  4R0K A;  1ABO A;  4F16 A;  4PJO B;  4QVC A;  2CZ1 B;  4PL6 A;  4E7Z A;  1JBM A;  2H3E B;  3ME9 A;  3R6O A;  3RR6 A;  4OGC A;  5HKC A;  3RES A;  4E47 A;  3TRE A;  3CCV A;  2E70 A;  3OBW A;  2VWF A;  4F17 A;  5FWC A;  4CI0 C;  1GCP A;  3MET A;  4Z89 A;  4N4I A;  1N9S A;  4FM4 B;  4M7A A;  1IXD A;  3CMA T;  1PSE A;  1PKS A;  2CP3 A;  2Y90 A;  2QDL A;  1QVP A;  1LOJ A;  3FDR A;  1VQ5 T;  3NTH A;  3CCU T;  4QKU A;  2JTM A;  5DY9 A;  3SB2 A;  3OW2 A;  1D09 B;  3OS0 A;  3L2U A;  2ED0 A;  3PMT A;  3BE3 A;  1KFZ A;  3OBY A;  1G8X A;  4Z8A A;  1KD1 C;  1SSH A;  3CPF A;  3QYH B;  1X75 C;  1PRL C;  3GLX A;  1PG5 B;  5KYU B;  3JCM W;  2O4X A;  5AYF A;  3JCM J;  1IGQ A;  2EQU A;  3GNF B;  2CZ7 B;  2DRM A;  2RQW A;  3CMA Q;  4ZN1 A;  3AHU A;  3M0R A;  5KYX A;  4X9C A;  3FRN A;  3QUI A;  1ACM B;  3JB9 I;  5I22 A;  4GY5 A;  3CCU Q;  1FXX A;  2CH4 A;  1EFN A;  3OYH A;  1YHQ A;  3CME A;  2V1Q A;  1N5Z A;  3HSB A;  2GFA A;  1OZ2 A;  1BB9 A;  1W1F A;  1UFF A;  2F69 A;  2XG8 D;  3ZFJ A;  1QP3 A;  2J7I A;  3E1S A;  4PJO A;  4AT1 B;  1MHN A;  4LDW A;  3R6N A;  4OB2 B;  2X4W A;  2ZPI B;  1YWO A;  5FRN A;  2DVJ A;  2RQT A;  2A28 A;  1UTI A;  1NJI C;  4C8Q G;  4M77 D;  1TUD A;  4PLL A;  2AHJ B;  2LTO A;  1MV0 B;  3MEA A;  4HCZ A;  3C12 A;  1UEB A;  3PTA A;  2YSQ A;  1K9M U;  3I55 A;  4WCI A;  3CXC S;  4LDY A;  4F14 A;  2CP2 A;  2DXT A;  2VGN A;  3EHQ A;  1M5Q 1;  1VQ4 T;  4LDU A;  1UGS B;  3M56 A;  4GBQ A;  2JMC A;  4FYV B;  5GAN h;  2C0I A;  1KQ1 A;  4EPC A;  1NLP C;  4BI3 A;  4OMO A;  3CCL A;  2EVR A;  1XJW B;  2EIF A;  1S72 A;  2DD5 A;  4OGE A;  1M2V B;  1U1S A;  2KK4 A;  3UA6 A;  1RAB B;  5KYU A;  2QA4 T;  2CSI A;  4RTW A;  8ATC B;  1OU9 A;  3S3N A;  5CIU A;  5GAM g;  1VUB A;  1H3Z A;  4A53 A;  1ZUK A;  2DJQ A;  4A4G A;  2YRD A;  2D0N A;  1N8R U;  2XK0 A;  1VQ4 Q;  2NUZ A;  5L8R E;  2ZPF B;  2PZ1 A;  1BI2 A;  3A8G B;  4CC2 A;  4IIM A;  2HCK A;  4M7D F;  4LXC A;  3CC2 T;  2P0P A;  3CCE A;  5CKB A;  4P5N A;  1AHJ B;  3A8O B;  4BY6 B;  2DTO A;  4C8Q F;  2QEX T;  1GBR A;  5KE3 A;  2O01 E;  2QA4 Q;  3M9Q A;  3SD4 A;  2CS7 A;  1I07 A;  2MPX C;  2XIC A;  4ZGD B;  2F2W A;  2XHC A;  3V7R A;  1E6G A;  1ZLM A;  1BI0 A;  2X35 A;  4BD3 A;  1R0C B;  1M1K R;  1WYX A;  4CC4 B;  3D7S B;  2DF6 A;  4ANJ A;  3CPW S;  2X3X D;  2DX1 A;  3DB3 A;  3CC2 Q;  2VB6 A;  1WXU A;  2L3Q A;  3CCV T;  2JMA A;  3EGD A;  4C92 B;  4C5I A;  1TTH B;  3QJ6 A;  4JJD A;  1VQ7 T;  2QEX Q;  4KUI A;  1UGV A;  3QII A;  4J83 A;  4KUL A;  3G71 A;  3EFO A;  1HD3 A;  1JU5 C;  2QYZ A;  2DKG A;  1ZA1 B;  3A5Z B;  3CCM T;  4BAC A;  1VOM A;  3MCA B;  5GAN 7;  2K6D A;  2OTJ Q;  2LZ6 B;  1NE8 A;  4M7A C;  3VRZ A;  1RAG B;  2PUK B;  2HZY A;  1VYU A;  1UJ0 A;  4CRI A;  4M78 E;  4FSS A;  4J5Y A;  5HCK A;  1WQW A;  2DA9 A;  2E5K A;  2EJ9 A;  1K8A U;  4X34 A;  2KRM A;  2GTJ A;  1K73 C;  3CCJ Q;  2EJF A;  1RAC B;  2KRN A;  2WAC A;  4C8Q E;  2DNU A;  3RNJ A;  2VGM A;  4WF2 A;  4M78 B;  2K5L A;  4PJJ A;  2LJ1 A;  3FC3 A;  1VQ7 Q;  1MMD A;  4DBR A;  4E2F B;  2FL7 A;  4DBF A;  2P4T A;  1PSF A;  3CCM Q;  2BZ8 A;  2VKN A;  2AIR B;  3MKD A;  3RIR A;  2LCL A;  4FIB A;  1BI1 A;  2R5M A;  2IVW A;  3X25 B;  2QAZ A;  1Q81 U;  3LLR A;  1M30 A;  2DL4 A;  1YHQ T;  3QXE B;  5IAY A;  3CME T;  1M9S A;  4XTU A;  4BE1 A;  4PFZ A;  1JXO A;  1M1G A;  3QG1 A;  2QGG A;  3GNG A;  8AT1 B;  1T0J A;  3H0H A;  2DJZ A;  2XDD A;  2JVV A;  4HCC A;  1KSW A;  2EYY A;  2HEQ A;  3EHR A;  2JTE A;  2AK5 A;  3EAE A;  4BE0 A;  2YHT A;  5HK3 A;  4C0D C;  3CCQ A;  1WA7 A;  1N27 A;  1B34 A;  2DIQ A;  4RG2 A;  1NYG A;  4PKC C;  4PLI A;  3HRU A;  4J6Y A;  1VQL T;  3I55 T;  2EPD A;  1YHQ Q;  3J81 E;  3CME Q;  2JNG A;  5FW9 A;  2QTV A;  2HKQ B;  2XDP A;  3M0P A;  1JB0 E;  5LJ5 g;  3REA B;  3AT1 B;  1M1K C;  3OY9 A;  3M58 A;  1J3T A;  4OMM A;  4XTY A;  2A08 A;  4TVR A;  1X6G A;  3EG1 A;  2HNI A;  2KVQ G;  3EH2 A;  1D3B B;  1QCO A;  2DMO A;  1S72 T;  2LX7 A;  3JCM f;  1SG5 A;  1Q7Y C;  2K5F A;  2AZV A;  5GMK m;  2PUO B;  3LWH A;  3MHX A;  4M7D A;  1PHT A;  1ZSG A;  5D6W A;  3RER A;  3SDZ A;  2I0N A;  1VQL Q;  3I55 Q;  4XTZ A;  2HAX A;  4C8Q A;  4ESR A;  5IT9 E;  2LJ0 A;  1NG2 A;  3MP6 A;  1QQJ A;  1WJQ A;  1SEM A;  4X9D A;  1K9A A;  5KCO A;  1KC8 C;  1Y96 B;  3H9N A;  1YI2 Q;  3CMA A;  1S72 Q;  2VV5 A;  4XQ3 A;  2KNB B;  3V7S A;  1WHH A;  3G4S T;  3JV3 A;  3M0Q A;  1RL2 A;  1YN8 A;  1WQ7 A;  1M90 R;  2KY9 A;  1WHM A;  3LW5 E;  2V1R A;  1GL5 A;  3H41 A;  4ZTF A;  2RB6 A;  2RA2 A;  3L2Z A;  1BKB A;  1IZ6 A;  1WJS A;  1RI9 A;  3OSV A;  3BFM A;  4FCY A;  3CPW P;  4LD6 A;  2D6F A;  1YJN T;  2IPO B;  1EX4 A;  2J6F A;  1UUE A;  1JRI A;  4Z02 A;  4QVZ A;  5LJ3 h;  3G71 T;  4ZN3 A;  3G4S Q;  4BE2 A;  4AFZ C;  2EW3 A;  1YIJ A;  1SHF A;  4J9B A;  1D3B A;  2KYB A;  4JRP A;  1Q82 C;  2CT4 A;  3LX7 A;  1PD1 A;  3INZ A;  1BBZ A;  1M3C A;  1UHC A;  4J9F A;  1PM3 A;  4M75 D;  2D8H A;  2FZG B;  1X6B A;  2DBM A;  3JCM P;  5CQX A;  3JB9 D;  5A2Q E;  2W0Z A;  4EMK A;  4J9C A;  3SFM A;  4DA4 A;  1OYX A;  1VA7 A;  1WFW A;  2P84 A;  3ZEH A;  1YJN Q;  4PJO F;  4M7D D;  1G83 A;  4ELY C;  3UAT A;  3G71 Q;  4LUE A;  1D1B A;  1UE9 A;  2FZK B;  3EGU A;  5FU6 C;  4M77 B;  2M1H A;  2A7Y A;  1TU0 B;  2QI2 A;  4XU3 A;  4JDS A;  3LGF A;  1VQ4 A;  1KIK A;  2KGT A;  4AFU C;  2A37 A;  5GAN 8;  2NWM A;  1JJ2 S;  1C6V X;  2RH2 A;  2DTH A;  4J9H A;  2ZAE A;  2DO3 A;  2PVG B;  5KYY A;  5HK0 A;  4ME7 A;  2X9H A;  1AZE A;  4M4Z A;  4B9W A;  2DER A;  2CDT A;  3VKI A;  2QA4 A;  5CCA A;  1H64 1;  4D8D A;  4J9D A;  1X43 A;  3CPW A;  2RHZ A;  2KQW A;  5GAN g;  4F7U B;  1ARK A;  2MAM A;  3URG A;  4RCC A;  1AZG B;  4OMQ A;  5GAO r;  4FYY B;  2NUT A;  4BI8 B;  2BZY A;  4ELZ C;  2RHU A;  1AOJ A;  4NOY A;  3PE0 A;  1B7T A;  3M53 A; 
#chains in the Genus database with same CATH homology
 2O9S A;  1X27 A;  2LMJ A;  3A98 A;  1MV0 B;  1WIE A;  1ZBJ A;  3SHW A;  3I5R A;  1GBQ A;  2YSQ A;  4DEY A;  1AEY A;  4Y92 A;  2M51 A;  2PNI A;  4WCI A;  3VRY A;  4AG1 C;  4F14 A;  3VS1 A;  2ENM A;  1U5S A;  1ZUU A;  1QKX A;  1GFD A;  1W6X A;  3EHQ A;  4RTZ A;  3VS6 A;  2D8J A;  2KXD A;  2EKH A;  4GBQ A;  2JMC A;  1GCQ C;  2C0I A;  1RLQ C;  1NLP C;  1GFC A;  2FPF A;  1JXM A;  4OMO A;  1VYV A;  1YWP A;  2EVR A;  2K9G A;  3QWX X;  2EGE A;  1A0N B;  3UA6 A;  4K11 A;  5ECA A;  2RMO A;  1NYF A;  2CSI A;  2RN8 A;  4RTW A;  2L3S A;  4KRT A;  2FPE A;  1Y57 A;  1UDL A;  3M0S A;  1FYN A;  2KT8 A;  4X1V A;  1ZUK A;  2DJQ A;  2ESW A;  2DBK A;  2KYM A;  2D0N A;  2NUZ A;  2KR3 A;  2PZ1 A;  2JT4 A;  1T3L A;  4CC7 A;  4CC2 A;  4IIM A;  2HCK A;  2KT1 A;  2SRC A;  1CKA A;  3NMZ C;  2EQI A;  4Z88 A;  4RTU A;  1M27 C;  2YUO A;  1UJY A;  1X2Q A;  2K3B A;  2LCS A;  3I35 A;  1ZX6 A;  1KJW A;  2LQN A;  1OV3 A;  4ORZ A;  5IHK A;  3RBB B;  1GBR A;  1PKT A;  1V1C A;  4JZ4 A;  2EYZ A;  4GLM A;  4RTX A;  1NM7 A;  1I07 A;  2RQR A;  2F2W A;  3GBQ A;  1E6G A;  2DRK A;  1ZLM A;  2D1X A;  4AFS C;  1GRI A;  1WYX A;  4CC3 A;  1HJD A;  1OPL A;  2J06 A;  4CC4 B;  2CUD A;  1MUZ A;  2FRW A;  2HDA A;  2C0O A;  2DF6 A;  2X3X D;  2P4R A;  1AWW A;  2DX1 A;  1M3B A;  2DL7 A;  1WXU A;  1CSK A;  2L3Q A;  3CQT A;  3FJ5 A;  3O5Z A;  2JMA A;  1Z9Z A;  4LUD A;  2GGR A;  2O88 A;  1M8M A;  1QLY A;  1NLO C;  4JJD A;  2J6K A;  1QWF A;  4EIK A;  1UGV A;  1AVZ C;  1QKW A;  2BZX A;  2FO0 A;  2LJ3 A;  2RPN A;  2EGC A;  4ZNX A;  3I5S A;  1HD3 A;  1JU5 C;  1AWX A;  1LCK A;  2CRE A;  2DL3 A;  3KFV A;  3EG0 A;  2L0A A;  5I11 A;  2B86 A;  1QCF A;  3VS3 A;  2K6D A;  2KXC A;  2KE9 A;  2LZ6 B;  4JPB W;  3VRZ A;  2OAW A;  2MCN A;  1VYU A;  1UJ0 A;  1G2B A;  4FSS A;  5HCK A;  2DA9 A;  4JZ3 A;  5EC7 A;  2E5K A;  2K2M A;  4OMN A;  4HCK A;  2AKL A;  2KRM A;  2GTJ A;  2A36 A;  2YUP A;  2KRN A;  2LP5 A;  2DNU A;  4LN2 A;  3TSZ A;  3RNJ A;  1JEG A;  3NPF A;  1ABQ A;  3SEM A;  2KRO A;  2LJ1 A;  2CUB A;  1XOV A;  5GJV B;  2YUQ A;  2MIO A;  2OJ2 A;  4D8K A;  2BZ8 A;  2VKN A;  3TVT A;  2DL8 A;  1M30 A;  2DL4 A;  5L23 A;  1VYT A;  4LE9 A;  3VS7 A;  2ROL A;  4J9I A;  5IHN A;  1JQQ A;  4DEX A;  1IO6 A;  1JXO A;  2CT3 A;  1T0J A;  3H0H A;  2HSP A;  2DYB A;  3M0T A;  2EBP A;  1KSW A;  1WX6 A;  1YCS B;  2ED1 A;  2EYY A;  1NEB A;  1WLP B;  2HEQ A;  2DE0 X;  2ECZ A;  3EHR A;  2JTE A;  2RF0 A;  3THK A;  2AK5 A;  1JO8 A;  3I9Q A;  2MOX A;  4IIO A;  1WA7 A;  1K0S A;  1WI7 A;  1UEC A;  1X2K A;  1U06 A;  2IIM A;  4JJC A;  2J05 A;  1NYG A;  1K0X A;  3VS0 A;  2FG0 A;  1U3O A;  1T3S A;  1QWE A;  2EPD A;  2KEA A;  5FW9 A;  2XMF A;  3EG3 A;  3M0P A;  5GJW B;  2EGA A;  3REA B;  1K1Z A;  4QT7 A;  5FWB A;  1AWO A;  2YDL A;  4HVV A;  1J3T A;  2H8H A;  4OMM A;  2A08 A;  1X6G A;  3EG1 A;  1GCQ A;  2ABL A;  2GTO A;  2DMO A;  2DL5 A;  2ROT A;  1BU1 A;  2LX7 A;  4HVW A;  2GQI A;  2AZV A;  3M0U A;  1TUC A;  1PRM C;  1PHT A;  2F2X A;  1ZSG A;  1E6H A;  1UHF A;  2I0N A;  1M3A A;  2FEI A;  2OI3 A;  3TSW A;  1OOT A;  4ESR A;  1I1J A;  2L2P A;  2LJ0 A;  1SPK A;  2AKK A;  2RQV A;  1NG2 A;  5IXF A;  2DIL A;  1BK2 A;  1SEM A;  1K4U S;  2M0Y A;  1K9A A;  4RTT A;  2FPD A;  2F2V A;  2KRS A;  2EYW A;  4AFQ C;  1RLP C;  2JM8 A;  2K7A A;  5IXB A;  2JW4 A;  1CKB A;  2KNB B;  3PVL A;  1WDX A;  2JS0 A;  3JV3 A;  3M0Q A;  1WXB A;  1YN8 A;  3ZL7 C;  2DLP A;  1AWJ A;  2JXB A;  1HSQ A;  2V1R A;  3H41 A;  1GL5 A;  4A63 B;  1E7O A;  2VVK A;  4RTY A;  2W10 A;  5IH2 A;  2EYX A;  1RI9 A;  1OPK A;  1OEB A;  3VS4 A;  1X69 A;  3VS2 A;  1AD5 A;  1I0C A;  4AG2 C;  4R0K A;  1ABO A;  4F16 A;  4OML A;  2O2O A;  1H92 A;  2GNC A;  2L3P A;  4RUG A;  2J6F A;  1UUE A;  3LH5 A;  2DM1 A;  3VS5 A;  4OMP A;  1K76 A;  4JJB A;  3QWY A;  2G6F X;  1B3Q A;  4AFZ C;  2EW3 A;  3H0F A;  2O9V A;  2YUN A;  1SHF A;  4J9B A;  2KYB A;  3PVQ A;  2CT4 A;  2VWF A;  4F17 A;  4LNP A;  1BBZ A;  1M3C A;  2CH4 W;  1UHC A;  4J9F A;  5FWC A;  1GCP A;  3EG2 A;  2D8H A;  4Z89 A;  1X6B A;  2DBM A;  2SEM A;  2GBQ A;  1H8K A;  3UA7 A;  2LNH B;  3H0I A;  2K79 A;  1B07 A;  2W0Z A;  1PKS A;  2QDL A;  2HBW A;  4J9C A;  2RNA A;  1W70 A;  3UF4 A;  1VA7 A;  3NGP A;  1WFW A;  1H3H A;  2J6O A;  2JM9 A;  3C0C A;  2BTT A;  1PNJ A;  1G83 A;  3U23 A;  3UAT A;  2ED0 A;  4J9G A;  2JS2 A;  4LUE A;  4RTV A;  4J9E A;  1KFZ A;  3ULR B;  3IQL A;  1UE9 A;  1Z9Q A;  4Z8A A;  1MV3 A;  1SSH A;  3EGU A;  1NEG A;  1PRL C;  2LQW A;  1KIK A;  2RQU A;  2KGT A;  4AFU C;  2A37 A;  2CSQ A;  2NWM A;  2DRM A;  2RQW A;  1Y0M A;  2X3W D;  3M0R A;  3NHN A;  4J9H A;  1ZUY A;  5I22 A;  2O31 A;  1AZE A;  1YNZ A;  4M4Z A;  1SHG A;  2CH4 A;  5IHI A;  2CDT A;  1EFN A;  1FMK A;  2V1Q A;  1N5Z A;  4HVU A;  1BB9 A;  1W1F A;  4E6R A;  4D8D A;  1UFF A;  4J9D A;  1TG0 A;  3REB B;  1X43 A;  2J7I A;  2YT6 A;  3R6N A;  1SRL A;  1ARK A;  2AZS A;  1YWO A;  1AZG B;  4OMQ A;  1UG1 A;  1PWT A;  4HXJ A;  1T0H A;  2DVJ A;  2KBT A;  2A28 A;  2RQT A;  1S1N A;  1UTI A;  1YP5 A;  2BZY A;  1WXT A;  2C0T A;  1AOJ A;  1SRM A;  2FRY A;  1RUW A;  2PTK A;  1TUD A;  3PE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...