4D8DA

Crystal structure of hiv-1 nef fyn-sh3 r96w variant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
b'TLFVALYDYEAWTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase Fyn
molecule tags Transferase/protein binding
source organism Homo sapiens
publication title SH3 domain specificity
rcsb
total genus 12
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4d8dA00
1W6XA 1UDLA 2FEIA 3EHQA 2KXDA 1K1ZA 4J9DA 2KRMA 1WI7A 4M4ZA 3REAB 1LCKA 1KFZA 1QKWA 2XMFA 2RMOA 2YSQA 3UF4A 1WXTA 1PWTA 4GBQA 2KGTA 1PRMC 3CQTA 1GBQA 1WA7A 1OPKA 1M3BA 1ZLMA 2J6FA 2ED0A 2W10A 3NPFA 4LUDA 2AZVA 3ULRB 1G2BA 1GFCA 1QCFA 1UJYA 2AKKA 2DRMA 2LJ1A 2K7AA 2EGCA 1I1JA 5GJVB 2K3BA 2K9GA 2KBTA 1OPLA 2DLPA 1T0JA 5I11A 1M3AA 3M0RA 2DYBA 2NWMA 3U23A 4RTZA 2CREA 2EGAA 2DL7A 1T3LA 4LNPA 1CKBA 1K76A 2JTEA 1HD3A 2VVKA 2DVJA 1PKSA 2C0IA 1PNJA 1TUCA 2JT4A 2KXCA 1UHCA 1UECA 1YP5A 2BZXA 1WYXA 4DEXA 2C0TA 3M0QA 4AFQC 1A0NB 4AFSC 2LCSA 2CT4A 3EG2A 1I07A 4IIMA 1RLPC 2LP5A 2X3XD 2RQUA 1UTIA 1PRLC 4OMPA 2X3WD 2HEQA 3EG0A 2RQTA 4J9HA 4J9FA 2P4RA 1TG0A 1TUDA 1MV0B 2MIOA 4J9EA 1NEBA 2O88A 1MUZA 1NLPC 2DL3A 2FPDA 2DL4A 2V1RA 2JS0A 1W70A 3I9QA 1AZEA 1QLYA 4HCKA 1SPKA 4GLMA 4LN2A 1WIEA 1ZX6A 4Y92A 2M51A 3VRYA 5EC7A 1U5SA 2IIMA 2ROTA 3VS4A 4CC3A 2DMOA 1ABOA 2DF6A 2BZ8A 2YUPA 4AG1C 2SEMA 1BK2A 2DILA 1HSQA 2LQNA 1CKAA 3IQLA 2EYYA 3VS3A 1GFDA 3VS5A 4F16A 2EQIA 1YNZA 3O5ZA 2CUBA 1OV3A 3A98A 1UUEA 1KSWA 2H8HA 2F2VA 4HVVA 4QT7A 2ABLA 1ABQA 1VA7A 1VYTA 1OEBA 2CH4A 2FRWA 2JMAA 4OMMA 4HXJA 1K0XA 3EHRA 3H41A 2BTTA 1JQQA 2CUDA 1JO8A 1QKXA 2KR3A 3QWXX 4JJCA 1UG1A 1SHGA 2FPEA 2KNBB 2V1QA 4AFZC 1UFFA 1YN8A 1SEMA 1ZSGA 2EKHA 2EBPA 2K79A 2KRSA 4K11A 1AD5A 3H0IA 2YUNA 4ORZA 1WFWA 1E7OA 2LNHB 3C0CA 3VS2A 1BU1A 2J05A 3TVTA 4Z89A 1NYGA 1BBZA 2L3PA 4JJDA 2F2WA 3H0HA 4IIOA 2KRNA 4ESRA 3UATA 4E6RA 2YUQA 5IXBA 2KROA 2MOXA 1ZUKA 4F17A 4HVWA 1UE9A 2VWFA 2JM9A 2LJ0A 1N5ZA 1ARKA 3JV3A 2BZYA 1VYVA 4J9BA 1ZUUA 1X6BA 2LX7A 2F2XA 3FJ5A 1M27C 1X69A 1NYFA 2GTOA 3PVLA 1UJ0A 1WXUA 1V1CA 5IHIA 2GQIA 1RI9A 1I0CA 3I5SA 1GRIA 4J9GA 2FRYA 4JZ3A 2HDAA 4D8DA 3M0PA 4JPBW 2O2OA 2AK5A 3M0SA 5L23A 5FWBA 1UHFA 1CSKA 2A28A 2AZSA 2CSIA 2E5KA 4CC4B 1U3OA 2GTJA 2LQWA 2QDLA 1SRMA 3GBQA 4EIKA 2DE0X 2YT6A 2K6DA 1KJWA 4RUGA 5FW9A 2C0OA 4HVUA 1AVZC 2CSQA 3SHWA 2EYWA 3H0FA 1G83A 4J9CA 1K0SA 2JMCA 1PHTA 2LMJA 1QWFA 2B86A 2KT8A 2PZ1A 4OMLA 3PVQA 1QWEA 5HCKA 1ZUYA 1Z9QA 2A36A 1AWJA 2JM8A 1Z9ZA 2KT1A 1H3HA 4RTVA 1X2KA 4LUEA 2DBKA 3M0TA 5IH2A 2KYBA 2LJ3A 2YUOA 4Z88A 5IHKA 2G6FX 2JS2A 1FMKA 3RNJA 2NUZA 1B3QA 2EYXA 1MV3A 4OMOA 3VS0A 2SRCA 4RTWA 1GL5A 2I0NA 1X27A 2DL5A 3EGUA 1J3TA 1H8KA 1S1NA 2W0ZA 1K9AA 1SHFA 2AKLA 2KEAA 3EG3A 4X1VA 2OAWA 1X2QA 4Z8AA 4JJBA 1AEYA 3KFVA 2FPFA 1AWXA 2RNAA 1PKTA 2DBMA 4J9IA 1U06A 2D8JA 1NM7A 2EGEA 1SRLA 2D8HA 2JXBA 2ED1A 3SEMA 4OMNA 2RQWA 3QWYA 2DA9A 3UA7A 1Y57A 2OJ2A 2L3QA 4DEYA 4R0KA 4KRTA 1WX6A 4AFUC 2CH4W 3NHNA 3VS6A 5GJWB 2L3SA 1YWPA 5FWCA 1JEGA 4CC7A 4ZNXA 2M0YA 2GGRA 2MCNA 4CC2A 1HJDA 1H92A 2RPNA 1FYNA 3TSZA 3VS7A 1OOTA 2JW4A 2A08A 3REBB 1X43A 5IHNA 2VKNA 2J6OA 4JZ4A 2ESWA 1ZBJA 2OI3A 2O9SA 2D1XA 2L0AA 1GCPA 1YWOA 3I5RA 1Y0MA 2KE9A 2FG0A 2EW3A 1YCSB 2J7IA 3TSWA 1B07A 2K2MA 2DL8A 1BB9A 2EYZA 2J6KA 2A37A 3R6NA 2RQRA 2DJQA 1WDXA 4FSSA 5I22A 3THKA 3RBBB 2LZ6B 3VS1A 2ROLA 1UGVA 1AWOA 2RN8A 1AZGB 1E6GA 1X6GA 4F14A 1M8MA 1NEGA 1T0HA 4D8KA 2KYMA 4OMQA 2YDLA 1WLPB 2DM1A 2D0NA 2GBQA 1JXMA 1SSHA 3NMZC 2RF0A 5IXFA 1JU5C 2EPDA 4RTYA 3NGPA 2HSPA 2J06A 1KIKA 2RQVA 3ZL7C 5ECAA 2DNUA 3EG1A 2HCKA 1AOJA 2DRKA 4RTXA 4AG2C 4A63B 1NG2A 4RTUA 4RTTA 2ECZA 1E6HA 4LE9A 1AWWA 2L2PA 1EFNA 1M30A 3VRZA 1WXBA 1M3CA 2DX1A 3M0UA 1K4US 2FO0A 2HBWA 2O9VA 1RLQC 1T3SA 1VYUA 2EVRA 1W1FA 1GCQC 2ENMA 1NLOC 2PTKA 1IO6A 3PE0A 2CT3A 4WCIA 1GBRA 3UA6A 1JXOA 1XOVA 2CDTA 2GNCA 1GCQA 2PNIA 1RUWA 3I35A 2O31A 3LH5A
chains in the Genus database with same CATH superfamily
3HFOA 1M4ZA 3EFOA 1EX4A 1N27A 2KRMA 1RAGB 3REAB 1LCKA 1KFZA 1QKWA 1VOMA 2XMFA 2JJ9A 2M02A 1Q81R 3QXEB 3UF4A 3CQTA 4L5GA 5FU7B 3CMEA 1WA7A 3MO8A 5D6WA 4A53A 4BD3A 1VQ5Q 1QVGS 4IUTA 1KD1U 2CP2A 1VQNQ 2R5AA 1VQMQ 3MP8A 4RTZA 3I56T 3RERA 1BI3A 4LDVA 3CCRA 3META 1T3LA 4OGEA 1K76A 2Y90A 2MMPA 1HD3A 2VVKA 1KQSS 1WQWA 2IVWA 1PM3A 5FRMA 2RO0A 1WYXA 1NJIU 4BDZA 4DEXA 2D9TA 2M9UA 4HCBA 3CD6Q 1A0NB 3EG2A 1XQHA 4IIMA 2GQVA 3J81E 1U1SA 3E9FA 4PKCC 1PRLC 3EG0A 2P84A 3PFSA 4J9FA 5J3BA 4C8QA 1GXIE 3BE3A 1MV0B 1NLPC 4ME7A 1VQ9T 3LGFA 2YWWA 5I2SA 4A4HA 2RJCA 2V1RA 1ZSZA 1B34B 3CD6T 3CMAQ 4KULA 3QUIA 4M75A 1Q95G 2FHDA 2VV5A 4BACA 4BUGA 1OQKA 2HL5C 4E7HA 3VRYA 3URGA 2IIMA 4KUDK 3OY9A 1VQLT 1PC0A 2DMOA 4X9DA 1ABOA 2P4TA 2YUPA 2RI5A 1BK2A 2DILA 1HSQA 3E9GA 3G1JA 2LQNA 1CKAA 3HPWA 4O6JA 1TUGB 4RCBA 2EWNA 2DIQA 2XDDA 1KQSP 1YNZA 2O4XA 4M7DD 4HVVA 1KG1A 3JB9G 1ABQA 2FRWA 1OEBA 2CH4A 3QHSA 2XIDA 3H41A 4QQ6A 3C12A 4M7DA 2QG9B 1XTDA 3LLRA 5DLOA 2FPEA 4AFZC 4UC4A 1UFFA 4XK8E 4M75F 3FRNA 4C0FA 5KE3A 2K79A 3CCLQ 5CO7A 2E6NA 1F1BB 3C0CA 3JCMg 1G3WA 2J05A 2EQMA 3TVTA 2OTLA 2YLBA 1BBZA 4IURA 1DJ7B 2X4YA 4ESRA 3MP6A 2DD5A 4QKUA 2QQBA 2YUQA 2KROA 2MOXA 3CCVQ 1ZUKA 3MEVA 3CCUA 3QIIA 1M5Q1 3EH1A 2JM9A 3FJPA 1Q7YC 1QCNA 4JUVA 3QG1A 1VYVA 1ZUUA 1K8AC 2LX7A 2DERA 3SB2A 1NPRA 2L89A 1IZ6A 2GTOA 3DB4A 1K73U 4KGXB 2RK1A 3JCMV 5LJ5j 1V1CA 5IHIA 2GQIA 1RI9A 1YIJT 1I0CA 2VYTA 1GRIA 3CBMA 3I5SA 5LJ3h 2L8DA 3CPWA 2E3IA 4OB3B 1UGSB 3PGGA 4DQ2A 4RMOA 2X9HA 2FVUA 3V8LA 1Y71A 5FWBA 2EJGA 3F70A 3P8DA 4PJOB 4NL2A 5C0MA 3G6EQ 2E5KA 4CC4B 1U1TA 1VQPA 1IGQA 1YIJQ 2JTMA 2E6ZA 3V7RA 3CCVA 2DAQA 2K6DA 3LGLA 3OYYA 2CSQA 2EYWA 3JCMJ 3G71A 4AMCA 1PHTA 1TU0B 1VQNT 2KT8A 2NUTA 4JLGA 3GNFB 1G3YA 3NTKA 5HCKA 1ZUYA 5IN1A 1KHCA 2LT1A 5IAYA 2A36A 2JM8A 2H3EB 1H3HA 4LD6A 4RTVA 1RACB 4N4IA 4RG8A 2COYA 2KYBA 5IHKA 2G6FX 3FEOA 2DXCA 3QBYA 2QEXT 3L2WA 1JRIA 1K8AU 2I0NA 4M7DB 3EGUA 4F04B 5IT9E 2KEAA 2MK5A 1VQ9A 1X2QA 4C5HA 1VQ7Q 1AEYA 1VQKQ 3DLLA 1AWXA 2LQKA 2DBMA 4J9IA 3CC4A 2K3YA 1S72T 4FW1A 5LJ5d 3QPHA 1VQ4A 4C0DC 4M78E 2ED1A 1NJIC 2RI2A 3SFMA 4C8QF 3QWYA 1MNDA 2DA9A 1Q82C 1FMVA 2DFUA 4PJOC 1YHQQ 1IGUA 3SWNA 1D0YA 4C8QE 2LVMA 4R0KA 4KRTA 1S72Q 4M77A 2VC8A 5LL6S 1VQ6Q 2F69A 2CH4W 2DKGA 1QVFA 4KT0E 4XTZA 5KYYB 4FIBA 5LJ3d 4F7UB 2XDBA 2RHYA 2FZKB 3BDLA 3L42A 1M90R 3EFSA 5LJ5g 2DZ9A 3S3MA 1HJDA 1W2BS 4FYVB 3TSZA 5KYUB 1TXQA 1OOTA 2JW4A 2A08A 2QEXQ 1X43A 3JCMc 2XICA 3C4SA 1JB0E 1TTHB 4JZ4A 3AT1B 4E47A 4J83A 7AT1B 3I5RA 1ACMB 3CPWP 2FG0A 4Y91A 4B6MA 3TSWA 1IHVA 2K2MA 2DL8A 3CPFA 2EYZA 4TVRA 3JAME 2XU8A 5I22A 1IREB 3RBBB 3UWNA 1V29B 4C5EA 1K9MC 1OZ3A 2RJEA 4O5VA 2HMAA 1XNIA 2O01E 3BDUA 1NEGA 1M1KU 1T0HA 4JDSA 1WHGA 5FU7C 4D8KA 4FYYB 1WLPB 2V8JA 3DKMA 3OSVA 2GBQA 2X51A 3KUFA 2RF0A 3Q1JA 5IXFA 2LRQA 2VXEA 1KD1R 2DD4A 3E1SA 2EPDA 2CP7A 3QZ9B 2RQVA 1JJ2A 3OYEA 2DNUA 4A4GA 5LJ3e 2A7YA 5GAMe 1AOJA 2QTXA 5KYWB 4RTTA 2ECZA 3A8MB 1HK9A 5LJ3j 4LE9A 3OYBA 2L2PA 3OYKA 5KYUA 1I81A 4LXCA 1RAAB 3NTHA 1QVFP 3M0UA 5KYNA 4A54A 2ZPHB 1T3SA 2VXFA 2EVRA 2MI6A 1GCQC 1VQNA 2PTKA 4C92A 1ZQ1A 4FCYA 2QQSA 4WCIA 4PJOG 1UEBA 4V2SA 2MWOA 3T9NA 2CDTA 4XTVA 2ZGWA 2EYQA 4PJOD 4IUPA 4LD9K 1TOVA 1UDLA 2FEIA 1YITA 1BI2A 1BCMA 2I2LA 3I55T 4J9DA 1EIFA 3HTRA 4EMKC 2KMTA 2OTJT 4DBFA 1NZ9A 2YSQA 3TU4K 1BIBA 2KDSA 4GBQA 1PRMC 1GBQA 1R77A 1YI2Q 4WTOB 4XTUA 3RKWA 3EGXB 2AZVA 3V7CA 4ELZC 3OYCA 3GP8A 4M77C 1QCFA 1UJYA 2LJ1A 2EGCA 2K9GA 5GAOl 1QVPA 2DLPA 1T0JA 5I11A 1VQOA 3M0RA 2EFIA 2NWMA 3A8GB 3DLMA 2QTVA 2VGMA 4OF1A 3CCST 2DL7A 4LNPA 2L5QA 2DVJA 3OA6A 2C0IA 2KXCA 3S3OA 3CEYA 1UECA 4N0AA 2PVDB 2G3RA 4J6WA 3M0QA 1VUBA 4J6YA 4AFQC 3HFNA 1N8RR 1VQ4Q 4AFSC 2DETA 1D0ZA 2LCSA 5LJ5e 2RB6A 2WSFE 2LP5A 4A4EA 2RQUA 2X3WD 4C5GA 4J9HA 1VQ8Q 2YRDA 1YJWA 1TUDA 3OYHA 2MIOA 5HKCA 5CQXA 3OSSC 1MUZA 3L2QA 2DL4A 2RHZA 1ZSZC 3I9QA 3P8BB 1QLYA 4HCKA 3CPWS 1WIEA 2GFUA 1ZX6A 4FT4A 1OU9A 3CXCS 2M1HA 3J7AF 3L1AA 3QO3A 5KYWA 2BZ8A 5KYXB 2VASA 2RJDA 4EPCA 2EYYA 4J7FA 1IXDA 3FIFA 1K9MU 1VQ8T 3O5ZA 2CUBA 1OV3A 2WSEE 2ABLA 4OMMA 4HXJA 4KBMB 4ZN1A 1N9RA 3QDRB 4XU0A 5LJ3f 1O9SA 2KR3A 4JJCA 1UG1A 2DIGA 4EMHA 2V1QA 2JUFA 1BI0A 3LH0A 3CCMQ 3JCMh 2HKNA 2XHCA 1Y96A 4FYXB 2EBPA 2QGFB 4FT2A 2FZCB 1AT1B 2QXFA 2QA4A 3OYIA 4Z89A 3CCRQ 4VUBA 3OS0A 2EAYA 2PUKB 5A0DA 2X4JA 3H0HA 3VV0A 5CKDA 1PG5B 2RI3A 4E6RA 1NJIR 3CD6A 2X4XA 4NL3A 1M8VA 2LJ0A 4KH0B 1I8FA 1OI1A 4J8OA 1K8AR 5CVIA 3QSUA 3CC7A 5DM7R 1X6BA 1M1KR 3M5AA 2F2XA 1VQLA 1M27C 1X69A 3CCEQ 3OS5A 5M9OA 4KH1B 5GMKm 1YJ9T 4J9GA 2FRYA 4M7AG 4JZ3A 2K5IA 9ATCB 1YITT 3MHXA 3M0PA 4DBQA 5A2QE 2VUBA 5L23A 4BB7A 1UHFA 3QJYA 4JRQA 2RD1A 2RHIA 4PLIA 5GAMj 1G5VA 5L8RE 3M54A 2GTJA 3ASKA 3QYHB 2ZCFB 1VQPQ 2QDLA 2VB6A 1SRMA 1FXXA 1VQ5T 5FW9A 2C0OA 1AVZC 3SHWA 5CKFA 4X34A 1G83A 1PD1A 4QVCA 4M7DE 1XJWB 1G8XA 2B86A 4FW2A 3EGXA 3EG9B 4IKFA 3PVQA 1QWEA 1JBMA 2NYSA 2AHJB 1G3SA 1Z9QA 4C0DB 1Z9ZA 2KT1A 4QW2A 1X2KA 2LCCA 2DBKA 2KVQG 2E5QA 1VQ6A 2YUOA 2BIVA 1KK7A 2LC4A 2JS2A 3M4YA 4IUUA 1B3QA 1TS9A 2SRCA 4M77B 2QA4Q 3RKXA 1YJ9Q 1GL5A 3M9QA 2E1HA 2DL5A 1H8KA 2QASA 1MHNA 2HD0A 4C8QC 2AKLA 1KQ1A 4XTWA 5LJ5h 3LWHA 4X1VA 1LPLA 4Z8AA 4HT9A 5DLQE 5GAMg 5AYFA 1TWBA 6AT1B 3EH2A 5KCOA 1NM7A 4QQDA 3CCLT 3TCJA 2JXBA 1UGQB 1B7TA 3UA7A 3FDRA 4MZMA 2L3QA 3GF5A 4ZGEB 2DJZA 2DO3A 4DEYA 4GY5A 4ZTJA 2WSCE 3OYNA 3UT1A 4AFUC 4ZGDB 2KY9A 3INZA 3MEUA 1FWZA 5GJWB 2L3SA 3A8LB 1JEGA 4II1A 2M0OA 2BUDA 1MMNA 4CC7A 5DY9A 4ZNXA 2B8AA 1BI1A 2OTJQ 2EJ9A 3KXTA 4Q5WA 4C92G 4FL6A 3REBB 4PFZA 2VKNA 4M7AE 2J6OA 4B9WA 2ESWA 2D1XA 3CC2A 5D7UA 2QA4T 2KE9A 2EW3A 2LTOA 1YCSB 2J7IA 3G4SA 2V8KA 4E7LA 2HQXA 2A37A 4WF2A 2RQRA 1WDXA 4BE1A 2EJFA 3VS1A 1Q81U 3CCJQ 3CMAA 5FLXE 1X6GA 2E70A 4F14A 3VUBA 4M7DG 3JCMQ 2H3JA 4FSXA 5GAN8 2XI9A 5GAOm 5EG2A 2MWPA 2LCLA 4BI8B 2NLUA 2XK0A 1JU5C 3JCMX 3FC3A 5GAOn 3NGPA 4EMKB 1KIKA 1SG5A 2K5FA 4EMGA 1BYMA 2COZA 4KGVB 4PFPA 2FZGB 4F7UE 5GAN5 2Y4YA 2HCKA 2FB7A 1VQLQ 3V8KA 2CS7A 3LYIA 4RTXA 1D1CA 4RTUA 1YHQA 1D1BA 4M78G 4QQGA 3HKSA 2CP6A 4D6WA 1AWWA 1EFNA 1M30A 8ATCB 1FMWA 2Z0WA 2WACA 2DX1A 1VQ7T 1K4US 4E7JA 2FO0A 2O9VA 1RLQC 4C5IA 2HQHA 1W1FA 3CCQA 5AT1B 4A4FA 3EFOB 1NLOC 3GOXA 3PE0A 1WZOA 2CT3A 3UA6A 4C8QB 2CYZB 1QP2A 1JXOA 4J7IA 4M75E 1GCQA 2PNIA 3I35A 3LH5A 5KE2A 1W6XA 4M7AD 2KQWA 2KXDA 1Q7YR 1WI7A 3CCMT 1WPYA 2RMOA 1MMDA 4BE0A 1PWTA 1VQMT 1Y07A 1ZLMA 2W10A 5GAN2 2MPXC 1M2OA 2NUTB 4XU2A 4XQ3A 3ZBDA 2DEUA 1LVKA 2AKKA 5GAN6 1G3TA 3PT9A 2JTFA 5GJVB 3SDZA 3ME9A 1AHJB 2YRCA 1OPLA 3EGDA 3CCLA 2D6FA 3CCVT 1M3AA 2ZPFB 2DYBA 3U23A 2CREA 1Q82U 2EGAA 1ZSZB 5CR2A 2JTEA 4C0ZA 3JB9H 1TUCA 2JT4A 1UHCA 1YP5A 1WHHA 5GANj 3JCMb 1R0CB 1Q81C 5CK9A 1K9MR 3V8JA 1W2BA 3RIRA 5CIUA 2CP0A 1KQSA 2X3XD 5D6XA 4Y28E 1UTIA 2COWA 2HEQA 2RQTA 5FRNA 3L2UA 4J9EA 2DL3A 1PCXA 2F5TX 3HP9A 4JRPA 3H8ZA 3HL8A 4FM4B 3CC2T 1SPKA 3M55A 4GLMA 4LN2A 4EDUA 2IG0A 2LQ8A 1QVGP 5EC7A 1U5SA 2ROTA 1P92A 4CC3A 3GLXA 3JB9F 1Q86U 1VQ4T 2SEMA 2P0QA 2QEXA 4HT8A 1VQ9Q 3CC4Q 3IQLA 3VS3A 1GFDA 3L2VA 4F16A 3TREA 3CC2Q 1BKBA 1QMCA 3OYLA 3OYAA 3GPLA 2E41A 3CCSQ 3A98A 1UUEA 1KSWA 2H8HA 2K3XA 3SWNC 1LOJA 4P5NA 1VYTA 3CCEA 3MKDA 3A8OB 3EAEA 1JQQA 1JO8A 5CKEA 3PTAA 1LJOA 3QWXX 1D0XA 1SHGA 4Z02A 4JLIA 4M77G 1TSFA 1PD0A 5FU6C 2CZ0B 2O4XB 1ZSGA 1SKUB 3WXMB 1WNLA 4K11A 2YUNA 1D1AA 3FB9A 3VS2A 4XU3A 1ZBXA 1NYGA 3OW2S 1I5OB 2L3PA 2YRVA 3PMTA 2F2WA 1YHQT 1WJRA 4IIOA 1RI0A 3JSCA 3UATA 5IXBA 4F17A 4HVWA 2YXYA 1UE9A 3JCMf 1N5ZA 1ARKA 4HCCA 2A0FB 3JV3A 1VQKT 5KCHA 3HRUA 4J9BA 3JCMd 3FJ5A 1WXUA 5KYXA 5CQYA 1NBEB 4E7SA 4BE2A 3PIOA 1RAEB 1KHIA 2K2VA 5GAMh 3JB9I 3CCRT 2O2OA 1ZHIA 3G6EA 4M7AB 4OB1B 4DBRA 2CSIA 2JVVA 3VKIA 1Y7XA 4M7AF 2JN0A 2DEQA 2P0PA 2PVOB 2BE7D 5GMKj 3GBQA 2EIFA 4M78D 1KJWA 4CI0C 4PJMA 4RUGA 3PMIA 4DA4A 3I56A 1IRXA 2FL7A 1YJNA 1K0SA 1IHWA 2LMJA 3MP1A 1M1KC 1C0MA 2LX9A 2PZ1A 4OMLA 5GANf 2PUOB 2ATCB 2KAFA 3HSBA 1N8RC 1AWJA 3HRTA 3BY7A 3JCMP 3OYJA 4LUEA 2OAUA 1B34A 5IH2A 4PFOA 4X9CA 1R0BG 1Q7YU 4R55A 1FMKA 2MYSA 2RK2A 3RNJA 5J39A 4XU1A 4DOVA 4OMOA 1WHJA 3VS0A 3M59A 2X4WA 4C92C 1SHFA 2OTJA 2DTIA 4LDYA 4PK4A 4C8QG 3EG3A 5GANg 2OAWA 3X26B 2FPFA 8AT1B 2RNAA 4E7KA 3L2ZA 4MMLA 3CCJT 3TQ7P 1KC8R 5GMKl 4C0GA 5GAMd 3SEMA 5KYYA 4OMNA 2RQWA 3E19A 1Y57A 2ZPGB 2OJ2A 1HYOA 3RESA 3OMGA 1VQOT 3C95A 1VQ5A 4C8QD 2BE9B 2DXBA 5FU6B 4OGCA 4DOWA 1M1GA 1WX6A 4C92B 1W2BP 4ZN3A 4MDXA 3JB9D 3NHNA 3VS6A 2E10A 1YWPA 1PSFA 5FWCA 4YTLA 5J26A 1ZA2B 2HNIA 2M0YA 2QK0A 2GGRA 3ZEHA 2MCNA 3OB9A 3CBOA 2RPNA 3CXCA 2HAXA 3OYFA 4RG2A 2K4YA 2OTLT 4M75C 1ZBJA 1WGSA 2O9SA 1YCYA 1RAFB 1MMGA 3OW2P 3VYHB 1B07A 2DPPB 1BB9A 5CKHA 4ATOA 3CCUT 2J6KA 1YI2A 3A5ZB 3GNGA 3HHTB 1QQJA 4DBHA 4FSSA 1D09B 2R57A 3THKA 2LNVA 1VQPT 2ROLA 1M2VA 4M78B 4ELYC 2EQJA 1UGRB 4F7UF 4M77E 1AZGB 1MNEA 1X01A 2RA2A 1E6GA 1N6AA 4N0AC 2GCXA 4ZTFA 2A3LA 2F1LA 4NS5A 3JCMe 2K5LA 4RCCA 2KYMA 2QI2A 2YDLA 2D0NA 3NMZC 4J5YA 3OS1A 1RL2A 3X25B 1OX9A 2E4HA 3BW1A 2DTOA 1YITQ 1EZZB 2RM4A 1R8OB 2HSPA 3LX7A 2J06A 1I5LA 3ZL7C 1SF9A 1VIEA 1C6VX 4BDYA 4LDXA 4M7DC 3OQ5A 4PJOE 5D6YA 4PJOA 2DRKA 4AG2C 4A63B 1NG2A 1YBYA 3EG9A 1Q86C 1VQ8A 5A0LA 5FROA 3G71T 4JRIA 4BI3A 3FLGA 2DXUA 3V7SA 3VRZA 5GAOr 4F7UA 2DZCA 3PIPA 1YJNT 3OS2A 2P0KA 3I55Q 3KBGA 2C06A 2ENMA 3CC4T 1KQ2A 2KK4A 4M78F 3RDVA 5I21A 2GNCA 3EHQA 1K1ZA 3OBYA 4GLKA 4IUVA 4M4ZA 3CC7Q 2MF2A 4PJOF 5HK0A 1WXTA 2KGTA 5I2MA 4IUQA 1OPKA 3X24B 1M3BA 2J6FA 2ED0A 1QP3A 3NPFA 4LUDA 3ULRB 1G2BA 1GFCA 5CAIA 2CZ1B 4JRKA 3LW5E 4LDWA 2QQ9A 4PJLA 2QQRA 2DRMA 4JJNK 2K7AA 2QDYB 1I1JA 3M58A 2K3BA 2KBTA 4RKUE 1YJ9A 1IB8A 3NFCA 1CKBA 2YHTA 3JRZA 3JCMW 1PKSA 1PNJA 3S3NA 3VJPA 2JOYA 3OW2A 2BZXA 5CKBA 1I4K1 2C0TA 4BI4A 2HBPA 2NUPA 5GANd 3HRSA 3A1PA 2VGNA 2CT4A 1I07A 4E2FB 2F5KA 1RLPC 4OMPA 5LJ5f 3CMEQ 3OBWA 2BKDN 2P4RA 4BY6B 1TG0A 4M75B 1NEBA 2O88A 4EMKA 2FPDA 2JNGA 2JS0A 1JJ2P 1W70A 5HY6A 1AZEA 5GAMf 1RABB 1KC8U 4NOYA 3EFRA 4HA8A 1N8RU 4M7AA 3PNWC 4Y92A 1VQMA 2M51A 3CCQQ 1NE8A 4C92E 4C92D 3VS4A 2R5MA 2AIRB 5GAN3 2DF6A 3MEWA 4OP0A 3VYGA 4AG1C 1VIFA 3BFMA 3VS5A 2EQIA 4OB2B 4M75G 2F2VA 1D3BA 1NPPA 3EGDB 4QT7A 3O8VA 1VA7A 2JMAA 2QAZA 1K0XA 3EHRA 2BTTA 4KGZB 2CUDA 1QKXA 2DXTA 3AHUA 1YJWQ 1TH7A 1UB4A 3G7ZA 2KNBB 2JZ2A 5GAN4 4L59A 1YN8A 1M90U 1SEMA 1RADB 2EKHA 2KRSA 1AD5A 3H0IA 4ORZA 1WFWA 5GANe 1E7OA 2LNHB 4XAXB 4JS4A 3R6OA 2HKQB 2K57A 1BU1A 2E12A 2CP5A 2XG8D 4JJDA 3QDFA 4M77F 4ZGJB 2DTHA 2QQAA 2KRNA 3VU3C 2ZPEB 2LDMA 2QYZA 4M7AC 2PVGB 3G4ST 1ZA1B 2E64A 4BY6C 1KD1C 2YLCA 2VWFA 3C94A 2L3RA 3MJXA 1WHLA 3S6WA 2PU9B 2BZYA 3TEEA 2Y4XA 2ZPBB 2KI7A 1NYFA 4N4HA 1QVFS 1QW1A 3PVLA 1UJ0A 1BCOA 1V76A 2E65A 2FYKA 1M9SA 2IPOB 2HDAA 4D8DA 5GAOp 5GMKi 5GAOq 2RHUA 4JPBW 4ANJA 1S72A 4PJNA 3P8HA 1VQOQ 2AK5A 3M0SA 1OU8A 4FYWB 4E7ZA 3CCET 1M2VB 4M78A 4JS5A 1CSKA 2A28A 1OX8A 2AZSA 2EKOA 1K73R 3GIBA 1JJ2S 1U3OA 2EQUA 4PNOA 2LQWA 3CMAT 4EIKA 2DE0X 2YT6A 4OB0B 1U8RA 4HVUA 2XKOC 3H0FA 3CCSA 3CCUQ 2E3HA 4J9CA 1KC8C 4L6V5 1RAHB 2JMCA 4PLLA 1QWFA 1UGPB 1M90C 5GMKh 3M56A 2DYIA 3G4SQ 3MEAA 3A8HB 1MMAA 3CCQT 2XDPA 3M57A 4E7IA 3MPUB 1Y96B 3M0TA 4CRIA 2ZPIB 2EQKA 2LJ3A 3OYMA 4Z88A 4AT1B 3QKJA 2M16A 1YJWT 1WHMA 2NUZA 1C1AA 3OYGA 2EYXA 1PSEA 1MV3A 4RTWA 2V8IA 4KUIA 4A4KA 1X27A 1J3TA 3CMET 1S1NA 3E2UA 2W0ZA 1WQ7A 1K9AA 2AT1B 2RHXA 4HKEA 3WVEB 1VQ7A 5GANh 2OX7A 3H9NA 1Q86R 4JJBA 2R58A 3KFVA 3H6ZA 2NUPB 2ZAEA 3ER0A 1PKTA 1U06A 3RR6A 4R56A 4MZTA 2D8JA 2HZYA 2EGEA 3G71Q 3OYDA 1SRLA 3G6ET 4PJJA 2D8HA 1Q82R 1QVGA 3L2RA 5C6SA 3D7SB 3J80E 2HQEA 3WVDB 4HCZA 3UDCA 1H3ZA 2RJFA 2GFAA 4XTXA 3CCMA 3M4GA 3JB9J 1YFNA 1MGQA 1O75A 4C92F 2X35A 3OMCA 5LJ3g 2CKKA 2XD0A 1OZ2A 4M78C 4CC2A 4PL6A 1H92A 2D0QB 3DB3A 4OMFB 1N9SA 1FYNA 2CZ6B 3CC7T 3VS7A 2HL3A 3RKYA 4QVZA 1SSFA 2HSEB 5IHNA 4LDUA 3ZFJA 2OI3A 3QZ5B 3I56Q 3M53A 3SWNB 2L0AA 1GCPA 1M1FA 1YWOA 1WHKA 1YJNQ 1Y0MA 1QCOA 2KSSA 3QYGB 3CBPA 4M7DF 2CP3A 3R6NA 1W4SA 2DJQA 3MCAB 1H641 5GMKe 4N4GA 5HK3A 2LT4A 2LZ6B 4MZPA 1UGVA 3CCJA 1AWOA 3I55A 4M77D 2RN8A 1LNXA 2DVEA 3RMQA 4M75D 5A0GA 1M8MA 2PQWA 4OMQA 2OTLQ 1K73C 2DM1A 4J6XA 1JXMA 1SSHA 2GF7A 2RH2A 1OYXA 2V26A 4MDWA 4F7UG 5CCAA 3X28B 1WJSA 4RTYA 5GAN7 3QJ6A 3N5BB 5ECAA 3X20B 4XTYA 3EG1A 3CXCP 3UPUA 2DK3A 1HXDA 1VQ6T 2CZ7B 2ZZDA 2MAMA 1D3BB 1X6OA 4QVDA 1E6HA 3NTIA 1WJQA 1WXBA 2QGGA 3RUXA 1M3CA 3SD4A 1BIAA 1FX7A 2HBWA 1VYUA 4MMKA 1IO6A 3LWIA 4FU6A 2CGHA 3RMSA 1OULA 1GBRA 3VUZA 1X75C 1YI2T 4B9XA 1XOVA 5KH6A 1VQKA 1YIJA 1RUWA 4OVAA 2O31A 1RAIB
chains in the Genus database with same CATH topology
1W6XA 1UDLA 2FEIA 3EHQA 2KXDA 1K1ZA 4J9DA 2KRMA 1WI7A 4M4ZA 3REAB 1LCKA 1KFZA 1QKWA 2XMFA 2RMOA 2YSQA 3UF4A 1WXTA 1PWTA 4GBQA 2KGTA 1PRMC 3CQTA 1GBQA 1WA7A 1OPKA 1M3BA 1ZLMA 2J6FA 2ED0A 2W10A 3NPFA 4LUDA 2AZVA 3ULRB 1G2BA 1GFCA 1QCFA 1UJYA 2AKKA 2DRMA 2LJ1A 2K7AA 2EGCA 1I1JA 5GJVB 2K3BA 2K9GA 2KBTA 1OPLA 2DLPA 1T0JA 5I11A 1M3AA 3M0RA 2DYBA 2NWMA 3U23A 4RTZA 2CREA 2EGAA 2DL7A 1T3LA 4LNPA 1CKBA 1K76A 2JTEA 1HD3A 2VVKA 2DVJA 1PKSA 2C0IA 1PNJA 1TUCA 2JT4A 2KXCA 1UHCA 1UECA 1YP5A 2BZXA 1WYXA 4DEXA 2C0TA 3M0QA 4AFQC 1A0NB 4AFSC 2LCSA 2CT4A 3EG2A 1I07A 4IIMA 1RLPC 2LP5A 2X3XD 2RQUA 1UTIA 1PRLC 4OMPA 2X3WD 2HEQA 3EG0A 2RQTA 4J9HA 4J9FA 2P4RA 1TG0A 1TUDA 1MV0B 2MIOA 4J9EA 1NEBA 2O88A 1MUZA 1NLPC 2DL3A 2FPDA 2DL4A 2V1RA 2JS0A 1W70A 3I9QA 1AZEA 1QLYA 4HCKA 1SPKA 4GLMA 4LN2A 1WIEA 1ZX6A 4Y92A 2M51A 3VRYA 5EC7A 1U5SA 2IIMA 2ROTA 3VS4A 4CC3A 2DMOA 1ABOA 2DF6A 2BZ8A 2YUPA 4AG1C 2SEMA 1BK2A 2DILA 1HSQA 2LQNA 1CKAA 3IQLA 2EYYA 3VS3A 1GFDA 3VS5A 4F16A 2EQIA 1YNZA 3O5ZA 2CUBA 1OV3A 3A98A 1UUEA 1KSWA 2H8HA 2F2VA 4HVVA 4QT7A 2ABLA 1ABQA 1VA7A 1VYTA 1OEBA 2CH4A 2FRWA 2JMAA 4OMMA 4HXJA 1K0XA 3EHRA 3H41A 2BTTA 1JQQA 2CUDA 1JO8A 1QKXA 2KR3A 3QWXX 4JJCA 1UG1A 1SHGA 2FPEA 2KNBB 2V1QA 4AFZC 1UFFA 1YN8A 1SEMA 1ZSGA 2EKHA 2EBPA 2K79A 2KRSA 4K11A 1AD5A 3H0IA 2YUNA 4ORZA 1WFWA 1E7OA 2LNHB 3C0CA 3VS2A 1BU1A 2J05A 3TVTA 4Z89A 1NYGA 1BBZA 2L3PA 4JJDA 2F2WA 3H0HA 4IIOA 2KRNA 4ESRA 3UATA 4E6RA 2YUQA 5IXBA 2KROA 2MOXA 1ZUKA 4F17A 4HVWA 1UE9A 2VWFA 2JM9A 2LJ0A 1N5ZA 1ARKA 3JV3A 2BZYA 1VYVA 4J9BA 1ZUUA 1X6BA 2LX7A 2F2XA 3FJ5A 1M27C 1X69A 1NYFA 2GTOA 3PVLA 1UJ0A 1WXUA 1V1CA 5IHIA 2GQIA 1RI9A 1I0CA 3I5SA 1GRIA 4J9GA 2FRYA 4JZ3A 2HDAA 4D8DA 3M0PA 4JPBW 2O2OA 2AK5A 3M0SA 5L23A 5FWBA 1UHFA 1CSKA 2A28A 2AZSA 2CSIA 2E5KA 4CC4B 1U3OA 2GTJA 2LQWA 2QDLA 1SRMA 3GBQA 4EIKA 2DE0X 2YT6A 2K6DA 1KJWA 4RUGA 5FW9A 2C0OA 4HVUA 1AVZC 2CSQA 3SHWA 2EYWA 3H0FA 1G83A 4J9CA 1K0SA 2JMCA 1PHTA 2LMJA 1QWFA 2B86A 2KT8A 2PZ1A 4OMLA 3PVQA 1QWEA 5HCKA 1ZUYA 1Z9QA 2A36A 1AWJA 2JM8A 1Z9ZA 2KT1A 1H3HA 4RTVA 1X2KA 4LUEA 2DBKA 3M0TA 5IH2A 2KYBA 2LJ3A 2YUOA 4Z88A 5IHKA 2G6FX 2JS2A 1FMKA 3RNJA 2NUZA 1B3QA 2EYXA 1MV3A 4OMOA 3VS0A 2SRCA 4RTWA 1GL5A 2I0NA 1X27A 2DL5A 3EGUA 1J3TA 1H8KA 1S1NA 2W0ZA 1K9AA 1SHFA 2AKLA 2KEAA 3EG3A 4X1VA 2OAWA 1X2QA 4Z8AA 4JJBA 1AEYA 3KFVA 2FPFA 1AWXA 2RNAA 1PKTA 2DBMA 4J9IA 1U06A 2D8JA 1NM7A 2EGEA 1SRLA 2D8HA 2JXBA 2ED1A 3SEMA 4OMNA 2RQWA 3QWYA 2DA9A 3UA7A 1Y57A 2OJ2A 2L3QA 4DEYA 4R0KA 4KRTA 1WX6A 4AFUC 2CH4W 3NHNA 3VS6A 5GJWB 2L3SA 1YWPA 5FWCA 1JEGA 4CC7A 4ZNXA 2M0YA 2GGRA 2MCNA 4CC2A 1HJDA 1H92A 2RPNA 1FYNA 3TSZA 3VS7A 1OOTA 2JW4A 2A08A 3REBB 1X43A 5IHNA 2VKNA 2J6OA 4JZ4A 2ESWA 1ZBJA 2OI3A 2O9SA 2D1XA 2L0AA 1GCPA 1YWOA 3I5RA 1Y0MA 2KE9A 2FG0A 2EW3A 1YCSB 2J7IA 3TSWA 1B07A 2K2MA 2DL8A 1BB9A 2EYZA 2J6KA 2A37A 3R6NA 2RQRA 2DJQA 1WDXA 4FSSA 5I22A 3THKA 3RBBB 2LZ6B 3VS1A 2ROLA 1UGVA 1AWOA 2RN8A 1AZGB 1E6GA 1X6GA 4F14A 1M8MA 1NEGA 1T0HA 4D8KA 2KYMA 4OMQA 2YDLA 1WLPB 2DM1A 2D0NA 2GBQA 1JXMA 1SSHA 3NMZC 2RF0A 5IXFA 1JU5C 2EPDA 4RTYA 3NGPA 2HSPA 2J06A 1KIKA 2RQVA 3ZL7C 5ECAA 2DNUA 3EG1A 2HCKA 1AOJA 2DRKA 4RTXA 4AG2C 4A63B 1NG2A 4RTUA 4RTTA 2ECZA 1E6HA 4LE9A 1AWWA 2L2PA 1EFNA 1M30A 3VRZA 1WXBA 1M3CA 2DX1A 3M0UA 1K4US 2FO0A 2HBWA 2O9VA 1RLQC 1T3SA 1VYUA 2EVRA 1W1FA 1GCQC 2ENMA 1NLOC 2PTKA 1IO6A 3PE0A 2CT3A 4WCIA 1GBRA 3UA6A 1JXOA 1XOVA 2CDTA 2GNCA 1GCQA 2PNIA 1RUWA 3I35A 2O31A 3LH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6X A;  1UDL A;  2FEI A;  3EHQ A;  2KXD A;  1K1Z A;  4J9D A;  2KRM A;  1WI7 A;  4M4Z A;  3REA B;  1LCK A;  1KFZ A;  1QKW A;  2XMF A;  2RMO A;  2YSQ A;  3UF4 A;  1WXT A;  1PWT A;  4GBQ A;  2KGT A;  1PRM C;  3CQT A;  1GBQ A;  1WA7 A;  1OPK A;  1M3B A;  1ZLM A;  2J6F A;  2ED0 A;  2W10 A;  3NPF A;  4LUD A;  2AZV A;  3ULR B;  1G2B A;  1GFC A;  1QCF A;  1UJY A;  2AKK A;  2DRM A;  2LJ1 A;  2K7A A;  2EGC A;  1I1J A;  5GJV B;  2K3B A;  2K9G A;  2KBT A;  1OPL A;  2DLP A;  1T0J A;  5I11 A;  1M3A A;  3M0R A;  2DYB A;  2NWM A;  3U23 A;  4RTZ A;  2CRE A;  2EGA A;  2DL7 A;  1T3L A;  4LNP A;  1CKB A;  1K76 A;  2JTE A;  1HD3 A;  2VVK A;  2DVJ A;  1PKS A;  2C0I A;  1PNJ A;  1TUC A;  2JT4 A;  2KXC A;  1UHC A;  1UEC A;  1YP5 A;  2BZX A;  1WYX A;  4DEX A;  2C0T A;  3M0Q A;  4AFQ C;  1A0N B;  4AFS C;  2LCS A;  2CT4 A;  3EG2 A;  1I07 A;  4IIM A;  1RLP C;  2LP5 A;  2X3X D;  2RQU A;  1UTI A;  1PRL C;  4OMP A;  2X3W D;  2HEQ A;  3EG0 A;  2RQT A;  4J9H A;  4J9F A;  2P4R A;  1TG0 A;  1TUD A;  1MV0 B;  2MIO A;  4J9E A;  1NEB A;  2O88 A;  1MUZ A;  1NLP C;  2DL3 A;  2FPD A;  2DL4 A;  2V1R A;  2JS0 A;  1W70 A;  3I9Q A;  1AZE A;  1QLY A;  4HCK A;  1SPK A;  4GLM A;  4LN2 A;  1WIE A;  1ZX6 A;  4Y92 A;  2M51 A;  3VRY A;  5EC7 A;  1U5S A;  2IIM A;  2ROT A;  3VS4 A;  4CC3 A;  2DMO A;  1ABO A;  2DF6 A;  2BZ8 A;  2YUP A;  4AG1 C;  2SEM A;  1BK2 A;  2DIL A;  1HSQ A;  2LQN A;  1CKA A;  3IQL A;  2EYY A;  3VS3 A;  1GFD A;  3VS5 A;  4F16 A;  2EQI A;  1YNZ A;  3O5Z A;  2CUB A;  1OV3 A;  3A98 A;  1UUE A;  1KSW A;  2H8H A;  2F2V A;  4HVV A;  4QT7 A;  2ABL A;  1ABQ A;  1VA7 A;  1VYT A;  1OEB A;  2CH4 A;  2FRW A;  2JMA A;  4OMM A;  4HXJ A;  1K0X A;  3EHR A;  3H41 A;  2BTT A;  1JQQ A;  2CUD A;  1JO8 A;  1QKX A;  2KR3 A;  3QWX X;  4JJC A;  1UG1 A;  1SHG A;  2FPE A;  2KNB B;  2V1Q A;  4AFZ C;  1UFF A;  1YN8 A;  1SEM A;  1ZSG A;  2EKH A;  2EBP A;  2K79 A;  2KRS A;  4K11 A;  1AD5 A;  3H0I A;  2YUN A;  4ORZ A;  1WFW A;  1E7O A;  2LNH B;  3C0C A;  3VS2 A;  1BU1 A;  2J05 A;  3TVT A;  4Z89 A;  1NYG A;  1BBZ A;  2L3P A;  4JJD A;  2F2W A;  3H0H A;  4IIO A;  2KRN A;  4ESR A;  3UAT A;  4E6R A;  2YUQ A;  5IXB A;  2KRO A;  2MOX A;  1ZUK A;  4F17 A;  4HVW A;  1UE9 A;  2VWF A;  2JM9 A;  2LJ0 A;  1N5Z A;  1ARK A;  3JV3 A;  2BZY A;  1VYV A;  4J9B A;  1ZUU A;  1X6B A;  2LX7 A;  2F2X A;  3FJ5 A;  1M27 C;  1X69 A;  1NYF A;  2GTO A;  3PVL A;  1UJ0 A;  1WXU A;  1V1C A;  5IHI A;  2GQI A;  1RI9 A;  1I0C A;  3I5S A;  1GRI A;  4J9G A;  2FRY A;  4JZ3 A;  2HDA A;  4D8D A;  3M0P A;  4JPB W;  2O2O A;  2AK5 A;  3M0S A;  5L23 A;  5FWB A;  1UHF A;  1CSK A;  2A28 A;  2AZS A;  2CSI A;  2E5K A;  4CC4 B;  1U3O A;  2GTJ A;  2LQW A;  2QDL A;  1SRM A;  3GBQ A;  4EIK A;  2DE0 X;  2YT6 A;  2K6D A;  1KJW A;  4RUG A;  5FW9 A;  2C0O A;  4HVU A;  1AVZ C;  2CSQ A;  3SHW A;  2EYW A;  3H0F A;  1G83 A;  4J9C A;  1K0S A;  2JMC A;  1PHT A;  2LMJ A;  1QWF A;  2B86 A;  2KT8 A;  2PZ1 A;  4OML A;  3PVQ A;  1QWE A;  5HCK A;  1ZUY A;  1Z9Q A;  2A36 A;  1AWJ A;  2JM8 A;  1Z9Z A;  2KT1 A;  1H3H A;  4RTV A;  1X2K A;  4LUE A;  2DBK A;  3M0T A;  5IH2 A;  2KYB A;  2LJ3 A;  2YUO A;  4Z88 A;  5IHK A;  2G6F X;  2JS2 A;  1FMK A;  3RNJ A;  2NUZ A;  1B3Q A;  2EYX A;  1MV3 A;  4OMO A;  3VS0 A;  2SRC A;  4RTW A;  1GL5 A;  2I0N A;  1X27 A;  2DL5 A;  3EGU A;  1J3T A;  1H8K A;  1S1N A;  2W0Z A;  1K9A A;  1SHF A;  2AKL A;  2KEA A;  3EG3 A;  4X1V A;  2OAW A;  1X2Q A;  4Z8A A;  4JJB A;  1AEY A;  3KFV A;  2FPF A;  1AWX A;  2RNA A;  1PKT A;  2DBM A;  4J9I A;  1U06 A;  2D8J A;  1NM7 A;  2EGE A;  1SRL A;  2D8H A;  2JXB A;  2ED1 A;  3SEM A;  4OMN A;  2RQW A;  3QWY A;  2DA9 A;  3UA7 A;  1Y57 A;  2OJ2 A;  2L3Q A;  4DEY A;  4R0K A;  4KRT A;  1WX6 A;  4AFU C;  2CH4 W;  3NHN A;  3VS6 A;  5GJW B;  2L3S A;  1YWP A;  5FWC A;  1JEG A;  4CC7 A;  4ZNX A;  2M0Y A;  2GGR A;  2MCN A;  4CC2 A;  1HJD A;  1H92 A;  2RPN A;  1FYN A;  3TSZ A;  3VS7 A;  1OOT A;  2JW4 A;  2A08 A;  3REB B;  1X43 A;  5IHN A;  2VKN A;  2J6O A;  4JZ4 A;  2ESW A;  1ZBJ A;  2OI3 A;  2O9S A;  2D1X A;  2L0A A;  1GCP A;  1YWO A;  3I5R A;  1Y0M A;  2KE9 A;  2FG0 A;  2EW3 A;  1YCS B;  2J7I A;  3TSW A;  1B07 A;  2K2M A;  2DL8 A;  1BB9 A;  2EYZ A;  2J6K A;  2A37 A;  3R6N A;  2RQR A;  2DJQ A;  1WDX A;  4FSS A;  5I22 A;  3THK A;  3RBB B;  2LZ6 B;  3VS1 A;  2ROL A;  1UGV A;  1AWO A;  2RN8 A;  1AZG B;  1E6G A;  1X6G A;  4F14 A;  1M8M A;  1NEG A;  1T0H A;  4D8K A;  2KYM A;  4OMQ A;  2YDL A;  1WLP B;  2DM1 A;  2D0N A;  2GBQ A;  1JXM A;  1SSH A;  3NMZ C;  2RF0 A;  5IXF A;  1JU5 C;  2EPD A;  4RTY A;  3NGP A;  2HSP A;  2J06 A;  1KIK A;  2RQV A;  3ZL7 C;  5ECA A;  2DNU A;  3EG1 A;  2HCK A;  1AOJ A;  2DRK A;  4RTX A;  4AG2 C;  4A63 B;  1NG2 A;  4RTU A;  4RTT A;  2ECZ A;  1E6H A;  4LE9 A;  1AWW A;  2L2P A;  1EFN A;  1M30 A;  3VRZ A;  1WXB A;  1M3C A;  2DX1 A;  3M0U A;  1K4U S;  2FO0 A;  2HBW A;  2O9V A;  1RLQ C;  1T3S A;  1VYU A;  2EVR A;  1W1F A;  1GCQ C;  2ENM A;  1NLO C;  2PTK A;  1IO6 A;  3PE0 A;  2CT3 A;  4WCI A;  1GBR A;  3UA6 A;  1JXO A;  1XOV A;  2CDT A;  2GNC A;  1GCQ A;  2PNI A;  1RUW A;  3I35 A;  2O31 A;  3LH5 A; 
#chains in the Genus database with same CATH topology
 3HFO A;  1M4Z A;  3EFO A;  1EX4 A;  1N27 A;  2KRM A;  1RAG B;  3REA B;  1LCK A;  1KFZ A;  1QKW A;  1VOM A;  2XMF A;  2JJ9 A;  2M02 A;  1Q81 R;  3QXE B;  3UF4 A;  3CQT A;  4L5G A;  5FU7 B;  3CME A;  1WA7 A;  3MO8 A;  5D6W A;  4A53 A;  4BD3 A;  1VQ5 Q;  1QVG S;  4IUT A;  1KD1 U;  2CP2 A;  1VQN Q;  2R5A A;  1VQM Q;  3MP8 A;  4RTZ A;  3I56 T;  3RER A;  1BI3 A;  4LDV A;  3CCR A;  3MET A;  1T3L A;  4OGE A;  1K76 A;  2Y90 A;  2MMP A;  1HD3 A;  2VVK A;  1KQS S;  1WQW A;  2IVW A;  1PM3 A;  5FRM A;  2RO0 A;  1WYX A;  1NJI U;  4BDZ A;  4DEX A;  2D9T A;  2M9U A;  4HCB A;  3CD6 Q;  1A0N B;  3EG2 A;  1XQH A;  4IIM A;  2GQV A;  3J81 E;  1U1S A;  3E9F A;  4PKC C;  1PRL C;  3EG0 A;  2P84 A;  3PFS A;  4J9F A;  5J3B A;  4C8Q A;  1GXI E;  3BE3 A;  1MV0 B;  1NLP C;  4ME7 A;  1VQ9 T;  3LGF A;  2YWW A;  5I2S A;  4A4H A;  2RJC A;  2V1R A;  1ZSZ A;  1B34 B;  3CD6 T;  3CMA Q;  4KUL A;  3QUI A;  4M75 A;  1Q95 G;  2FHD A;  2VV5 A;  4BAC A;  4BUG A;  1OQK A;  2HL5 C;  4E7H A;  3VRY A;  3URG A;  2IIM A;  4KUD K;  3OY9 A;  1VQL T;  1PC0 A;  2DMO A;  4X9D A;  1ABO A;  2P4T A;  2YUP A;  2RI5 A;  1BK2 A;  2DIL A;  1HSQ A;  3E9G A;  3G1J A;  2LQN A;  1CKA A;  3HPW A;  4O6J A;  1TUG B;  4RCB A;  2EWN A;  2DIQ A;  2XDD A;  1KQS P;  1YNZ A;  2O4X A;  4M7D D;  4HVV A;  1KG1 A;  3JB9 G;  1ABQ A;  2FRW A;  1OEB A;  2CH4 A;  3QHS A;  2XID A;  3H41 A;  4QQ6 A;  3C12 A;  4M7D A;  2QG9 B;  1XTD A;  3LLR A;  5DLO A;  2FPE A;  4AFZ C;  4UC4 A;  1UFF A;  4XK8 E;  4M75 F;  3FRN A;  4C0F A;  5KE3 A;  2K79 A;  3CCL Q;  5CO7 A;  2E6N A;  1F1B B;  3C0C A;  3JCM g;  1G3W A;  2J05 A;  2EQM A;  3TVT A;  2OTL A;  2YLB A;  1BBZ A;  4IUR A;  1DJ7 B;  2X4Y A;  4ESR A;  3MP6 A;  2DD5 A;  4QKU A;  2QQB A;  2YUQ A;  2KRO A;  2MOX A;  3CCV Q;  1ZUK A;  3MEV A;  3CCU A;  3QII A;  1M5Q 1;  3EH1 A;  2JM9 A;  3FJP A;  1Q7Y C;  1QCN A;  4JUV A;  3QG1 A;  1VYV A;  1ZUU A;  1K8A C;  2LX7 A;  2DER A;  3SB2 A;  1NPR A;  2L89 A;  1IZ6 A;  2GTO A;  3DB4 A;  1K73 U;  4KGX B;  2RK1 A;  3JCM V;  5LJ5 j;  1V1C A;  5IHI A;  2GQI A;  1RI9 A;  1YIJ T;  1I0C A;  2VYT A;  1GRI A;  3CBM A;  3I5S A;  5LJ3 h;  2L8D A;  3CPW A;  2E3I A;  4OB3 B;  1UGS B;  3PGG A;  4DQ2 A;  4RMO A;  2X9H A;  2FVU A;  3V8L A;  1Y71 A;  5FWB A;  2EJG A;  3F70 A;  3P8D A;  4PJO B;  4NL2 A;  5C0M A;  3G6E Q;  2E5K A;  4CC4 B;  1U1T A;  1VQP A;  1IGQ A;  1YIJ Q;  2JTM A;  2E6Z A;  3V7R A;  3CCV A;  2DAQ A;  2K6D A;  3LGL A;  3OYY A;  2CSQ A;  2EYW A;  3JCM J;  3G71 A;  4AMC A;  1PHT A;  1TU0 B;  1VQN T;  2KT8 A;  2NUT A;  4JLG A;  3GNF B;  1G3Y A;  3NTK A;  5HCK A;  1ZUY A;  5IN1 A;  1KHC A;  2LT1 A;  5IAY A;  2A36 A;  2JM8 A;  2H3E B;  1H3H A;  4LD6 A;  4RTV A;  1RAC B;  4N4I A;  4RG8 A;  2COY A;  2KYB A;  5IHK A;  2G6F X;  3FEO A;  2DXC A;  3QBY A;  2QEX T;  3L2W A;  1JRI A;  1K8A U;  2I0N A;  4M7D B;  3EGU A;  4F04 B;  5IT9 E;  2KEA A;  2MK5 A;  1VQ9 A;  1X2Q A;  4C5H A;  1VQ7 Q;  1AEY A;  1VQK Q;  3DLL A;  1AWX A;  2LQK A;  2DBM A;  4J9I A;  3CC4 A;  2K3Y A;  1S72 T;  4FW1 A;  5LJ5 d;  3QPH A;  1VQ4 A;  4C0D C;  4M78 E;  2ED1 A;  1NJI C;  2RI2 A;  3SFM A;  4C8Q F;  3QWY A;  1MND A;  2DA9 A;  1Q82 C;  1FMV A;  2DFU A;  4PJO C;  1YHQ Q;  1IGU A;  3SWN A;  1D0Y A;  4C8Q E;  2LVM A;  4R0K A;  4KRT A;  1S72 Q;  4M77 A;  2VC8 A;  5LL6 S;  1VQ6 Q;  2F69 A;  2CH4 W;  2DKG A;  1QVF A;  4KT0 E;  4XTZ A;  5KYY B;  4FIB A;  5LJ3 d;  4F7U B;  2XDB A;  2RHY A;  2FZK B;  3BDL A;  3L42 A;  1M90 R;  3EFS A;  5LJ5 g;  2DZ9 A;  3S3M A;  1HJD A;  1W2B S;  4FYV B;  3TSZ A;  5KYU B;  1TXQ A;  1OOT A;  2JW4 A;  2A08 A;  2QEX Q;  1X43 A;  3JCM c;  2XIC A;  3C4S A;  1JB0 E;  1TTH B;  4JZ4 A;  3AT1 B;  4E47 A;  4J83 A;  7AT1 B;  3I5R A;  1ACM B;  3CPW P;  2FG0 A;  4Y91 A;  4B6M A;  3TSW A;  1IHV A;  2K2M A;  2DL8 A;  3CPF A;  2EYZ A;  4TVR A;  3JAM E;  2XU8 A;  5I22 A;  1IRE B;  3RBB B;  3UWN A;  1V29 B;  4C5E A;  1K9M C;  1OZ3 A;  2RJE A;  4O5V A;  2HMA A;  1XNI A;  2O01 E;  3BDU A;  1NEG A;  1M1K U;  1T0H A;  4JDS A;  1WHG A;  5FU7 C;  4D8K A;  4FYY B;  1WLP B;  2V8J A;  3DKM A;  3OSV A;  2GBQ A;  2X51 A;  3KUF A;  2RF0 A;  3Q1J A;  5IXF A;  2LRQ A;  2VXE A;  1KD1 R;  2DD4 A;  3E1S A;  2EPD A;  2CP7 A;  3QZ9 B;  2RQV A;  1JJ2 A;  3OYE A;  2DNU A;  4A4G A;  5LJ3 e;  2A7Y A;  5GAM e;  1AOJ A;  2QTX A;  5KYW B;  4RTT A;  2ECZ A;  3A8M B;  1HK9 A;  5LJ3 j;  4LE9 A;  3OYB A;  2L2P A;  3OYK A;  5KYU A;  1I81 A;  4LXC A;  1RAA B;  3NTH A;  1QVF P;  3M0U A;  5KYN A;  4A54 A;  2ZPH B;  1T3S A;  2VXF A;  2EVR A;  2MI6 A;  1GCQ C;  1VQN A;  2PTK A;  4C92 A;  1ZQ1 A;  4FCY A;  2QQS A;  4WCI A;  4PJO G;  1UEB A;  4V2S A;  2MWO A;  3T9N A;  2CDT A;  4XTV A;  2ZGW A;  2EYQ A;  4PJO D;  4IUP A;  4LD9 K;  1TOV A;  1UDL A;  2FEI A;  1YIT A;  1BI2 A;  1BCM A;  2I2L A;  3I55 T;  4J9D A;  1EIF A;  3HTR A;  4EMK C;  2KMT A;  2OTJ T;  4DBF A;  1NZ9 A;  2YSQ A;  3TU4 K;  1BIB A;  2KDS A;  4GBQ A;  1PRM C;  1GBQ A;  1R77 A;  1YI2 Q;  4WTO B;  4XTU A;  3RKW A;  3EGX B;  2AZV A;  3V7C A;  4ELZ C;  3OYC A;  3GP8 A;  4M77 C;  1QCF A;  1UJY A;  2LJ1 A;  2EGC A;  2K9G A;  5GAO l;  1QVP A;  2DLP A;  1T0J A;  5I11 A;  1VQO A;  3M0R A;  2EFI A;  2NWM A;  3A8G B;  3DLM A;  2QTV A;  2VGM A;  4OF1 A;  3CCS T;  2DL7 A;  4LNP A;  2L5Q A;  2DVJ A;  3OA6 A;  2C0I A;  2KXC A;  3S3O A;  3CEY A;  1UEC A;  4N0A A;  2PVD B;  2G3R A;  4J6W A;  3M0Q A;  1VUB A;  4J6Y A;  4AFQ C;  3HFN A;  1N8R R;  1VQ4 Q;  4AFS C;  2DET A;  1D0Z A;  2LCS A;  5LJ5 e;  2RB6 A;  2WSF E;  2LP5 A;  4A4E A;  2RQU A;  2X3W D;  4C5G A;  4J9H A;  1VQ8 Q;  2YRD A;  1YJW A;  1TUD A;  3OYH A;  2MIO A;  5HKC A;  5CQX A;  3OSS C;  1MUZ A;  3L2Q A;  2DL4 A;  2RHZ A;  1ZSZ C;  3I9Q A;  3P8B B;  1QLY A;  4HCK A;  3CPW S;  1WIE A;  2GFU A;  1ZX6 A;  4FT4 A;  1OU9 A;  3CXC S;  2M1H A;  3J7A F;  3L1A A;  3QO3 A;  5KYW A;  2BZ8 A;  5KYX B;  2VAS A;  2RJD A;  4EPC A;  2EYY A;  4J7F A;  1IXD A;  3FIF A;  1K9M U;  1VQ8 T;  3O5Z A;  2CUB A;  1OV3 A;  2WSE E;  2ABL A;  4OMM A;  4HXJ A;  4KBM B;  4ZN1 A;  1N9R A;  3QDR B;  4XU0 A;  5LJ3 f;  1O9S A;  2KR3 A;  4JJC A;  1UG1 A;  2DIG A;  4EMH A;  2V1Q A;  2JUF A;  1BI0 A;  3LH0 A;  3CCM Q;  3JCM h;  2HKN A;  2XHC A;  1Y96 A;  4FYX B;  2EBP A;  2QGF B;  4FT2 A;  2FZC B;  1AT1 B;  2QXF A;  2QA4 A;  3OYI A;  4Z89 A;  3CCR Q;  4VUB A;  3OS0 A;  2EAY A;  2PUK B;  5A0D A;  2X4J A;  3H0H A;  3VV0 A;  5CKD A;  1PG5 B;  2RI3 A;  4E6R A;  1NJI R;  3CD6 A;  2X4X A;  4NL3 A;  1M8V A;  2LJ0 A;  4KH0 B;  1I8F A;  1OI1 A;  4J8O A;  1K8A R;  5CVI A;  3QSU A;  3CC7 A;  5DM7 R;  1X6B A;  1M1K R;  3M5A A;  2F2X A;  1VQL A;  1M27 C;  1X69 A;  3CCE Q;  3OS5 A;  5M9O A;  4KH1 B;  5GMK m;  1YJ9 T;  4J9G A;  2FRY A;  4M7A G;  4JZ3 A;  2K5I A;  9ATC B;  1YIT T;  3MHX A;  3M0P A;  4DBQ A;  5A2Q E;  2VUB A;  5L23 A;  4BB7 A;  1UHF A;  3QJY A;  4JRQ A;  2RD1 A;  2RHI A;  4PLI A;  5GAM j;  1G5V A;  5L8R E;  3M54 A;  2GTJ A;  3ASK A;  3QYH B;  2ZCF B;  1VQP Q;  2QDL A;  2VB6 A;  1SRM A;  1FXX A;  1VQ5 T;  5FW9 A;  2C0O A;  1AVZ C;  3SHW A;  5CKF A;  4X34 A;  1G83 A;  1PD1 A;  4QVC A;  4M7D E;  1XJW B;  1G8X A;  2B86 A;  4FW2 A;  3EGX A;  3EG9 B;  4IKF A;  3PVQ A;  1QWE A;  1JBM A;  2NYS A;  2AHJ B;  1G3S A;  1Z9Q A;  4C0D B;  1Z9Z A;  2KT1 A;  4QW2 A;  1X2K A;  2LCC A;  2DBK A;  2KVQ G;  2E5Q A;  1VQ6 A;  2YUO A;  2BIV A;  1KK7 A;  2LC4 A;  2JS2 A;  3M4Y A;  4IUU A;  1B3Q A;  1TS9 A;  2SRC A;  4M77 B;  2QA4 Q;  3RKX A;  1YJ9 Q;  1GL5 A;  3M9Q A;  2E1H A;  2DL5 A;  1H8K A;  2QAS A;  1MHN A;  2HD0 A;  4C8Q C;  2AKL A;  1KQ1 A;  4XTW A;  5LJ5 h;  3LWH A;  4X1V A;  1LPL A;  4Z8A A;  4HT9 A;  5DLQ E;  5GAM g;  5AYF A;  1TWB A;  6AT1 B;  3EH2 A;  5KCO A;  1NM7 A;  4QQD A;  3CCL T;  3TCJ A;  2JXB A;  1UGQ B;  1B7T A;  3UA7 A;  3FDR A;  4MZM A;  2L3Q A;  3GF5 A;  4ZGE B;  2DJZ A;  2DO3 A;  4DEY A;  4GY5 A;  4ZTJ A;  2WSC E;  3OYN A;  3UT1 A;  4AFU C;  4ZGD B;  2KY9 A;  3INZ A;  3MEU A;  1FWZ A;  5GJW B;  2L3S A;  3A8L B;  1JEG A;  4II1 A;  2M0O A;  2BUD A;  1MMN A;  4CC7 A;  5DY9 A;  4ZNX A;  2B8A A;  1BI1 A;  2OTJ Q;  2EJ9 A;  3KXT A;  4Q5W A;  4C92 G;  4FL6 A;  3REB B;  4PFZ A;  2VKN A;  4M7A E;  2J6O A;  4B9W A;  2ESW A;  2D1X A;  3CC2 A;  5D7U A;  2QA4 T;  2KE9 A;  2EW3 A;  2LTO A;  1YCS B;  2J7I A;  3G4S A;  2V8K A;  4E7L A;  2HQX A;  2A37 A;  4WF2 A;  2RQR A;  1WDX A;  4BE1 A;  2EJF A;  3VS1 A;  1Q81 U;  3CCJ Q;  3CMA A;  5FLX E;  1X6G A;  2E70 A;  4F14 A;  3VUB A;  4M7D G;  3JCM Q;  2H3J A;  4FSX A;  5GAN 8;  2XI9 A;  5GAO m;  5EG2 A;  2MWP A;  2LCL A;  4BI8 B;  2NLU A;  2XK0 A;  1JU5 C;  3JCM X;  3FC3 A;  5GAO n;  3NGP A;  4EMK B;  1KIK A;  1SG5 A;  2K5F A;  4EMG A;  1BYM A;  2COZ A;  4KGV B;  4PFP A;  2FZG B;  4F7U E;  5GAN 5;  2Y4Y A;  2HCK A;  2FB7 A;  1VQL Q;  3V8K A;  2CS7 A;  3LYI A;  4RTX A;  1D1C A;  4RTU A;  1YHQ A;  1D1B A;  4M78 G;  4QQG A;  3HKS A;  2CP6 A;  4D6W A;  1AWW A;  1EFN A;  1M30 A;  8ATC B;  1FMW A;  2Z0W A;  2WAC A;  2DX1 A;  1VQ7 T;  1K4U S;  4E7J A;  2FO0 A;  2O9V A;  1RLQ C;  4C5I A;  2HQH A;  1W1F A;  3CCQ A;  5AT1 B;  4A4F A;  3EFO B;  1NLO C;  3GOX A;  3PE0 A;  1WZO A;  2CT3 A;  3UA6 A;  4C8Q B;  2CYZ B;  1QP2 A;  1JXO A;  4J7I A;  4M75 E;  1GCQ A;  2PNI A;  3I35 A;  3LH5 A;  5KE2 A;  1W6X A;  4M7A D;  2KQW A;  2KXD A;  1Q7Y R;  1WI7 A;  3CCM T;  1WPY A;  2RMO A;  1MMD A;  4BE0 A;  1PWT A;  1VQM T;  1Y07 A;  1ZLM A;  2W10 A;  5GAN 2;  2MPX C;  1M2O A;  2NUT B;  4XU2 A;  4XQ3 A;  3ZBD A;  2DEU A;  1LVK A;  2AKK A;  5GAN 6;  1G3T A;  3PT9 A;  2JTF A;  5GJV B;  3SDZ A;  3ME9 A;  1AHJ B;  2YRC A;  1OPL A;  3EGD A;  3CCL A;  2D6F A;  3CCV T;  1M3A A;  2ZPF B;  2DYB A;  3U23 A;  2CRE A;  1Q82 U;  2EGA A;  1ZSZ B;  5CR2 A;  2JTE A;  4C0Z A;  3JB9 H;  1TUC A;  2JT4 A;  1UHC A;  1YP5 A;  1WHH A;  5GAN j;  3JCM b;  1R0C B;  1Q81 C;  5CK9 A;  1K9M R;  3V8J A;  1W2B A;  3RIR A;  5CIU A;  2CP0 A;  1KQS A;  2X3X D;  5D6X A;  4Y28 E;  1UTI A;  2COW A;  2HEQ A;  2RQT A;  5FRN A;  3L2U A;  4J9E A;  2DL3 A;  1PCX A;  2F5T X;  3HP9 A;  4JRP A;  3H8Z A;  3HL8 A;  4FM4 B;  3CC2 T;  1SPK A;  3M55 A;  4GLM A;  4LN2 A;  4EDU A;  2IG0 A;  2LQ8 A;  1QVG P;  5EC7 A;  1U5S A;  2ROT A;  1P92 A;  4CC3 A;  3GLX A;  3JB9 F;  1Q86 U;  1VQ4 T;  2SEM A;  2P0Q A;  2QEX A;  4HT8 A;  1VQ9 Q;  3CC4 Q;  3IQL A;  3VS3 A;  1GFD A;  3L2V A;  4F16 A;  3TRE A;  3CC2 Q;  1BKB A;  1QMC A;  3OYL A;  3OYA A;  3GPL A;  2E41 A;  3CCS Q;  3A98 A;  1UUE A;  1KSW A;  2H8H A;  2K3X A;  3SWN C;  1LOJ A;  4P5N A;  1VYT A;  3CCE A;  3MKD A;  3A8O B;  3EAE A;  1JQQ A;  1JO8 A;  5CKE A;  3PTA A;  1LJO A;  3QWX X;  1D0X A;  1SHG A;  4Z02 A;  4JLI A;  4M77 G;  1TSF A;  1PD0 A;  5FU6 C;  2CZ0 B;  2O4X B;  1ZSG A;  1SKU B;  3WXM B;  1WNL A;  4K11 A;  2YUN A;  1D1A A;  3FB9 A;  3VS2 A;  4XU3 A;  1ZBX A;  1NYG A;  3OW2 S;  1I5O B;  2L3P A;  2YRV A;  3PMT A;  2F2W A;  1YHQ T;  1WJR A;  4IIO A;  1RI0 A;  3JSC A;  3UAT A;  5IXB A;  4F17 A;  4HVW A;  2YXY A;  1UE9 A;  3JCM f;  1N5Z A;  1ARK A;  4HCC A;  2A0F B;  3JV3 A;  1VQK T;  5KCH A;  3HRU A;  4J9B A;  3JCM d;  3FJ5 A;  1WXU A;  5KYX A;  5CQY A;  1NBE B;  4E7S A;  4BE2 A;  3PIO A;  1RAE B;  1KHI A;  2K2V A;  5GAM h;  3JB9 I;  3CCR T;  2O2O A;  1ZHI A;  3G6E A;  4M7A B;  4OB1 B;  4DBR A;  2CSI A;  2JVV A;  3VKI A;  1Y7X A;  4M7A F;  2JN0 A;  2DEQ A;  2P0P A;  2PVO B;  2BE7 D;  5GMK j;  3GBQ A;  2EIF A;  4M78 D;  1KJW A;  4CI0 C;  4PJM A;  4RUG A;  3PMI A;  4DA4 A;  3I56 A;  1IRX A;  2FL7 A;  1YJN A;  1K0S A;  1IHW A;  2LMJ A;  3MP1 A;  1M1K C;  1C0M A;  2LX9 A;  2PZ1 A;  4OML A;  5GAN f;  2PUO B;  2ATC B;  2KAF A;  3HSB A;  1N8R C;  1AWJ A;  3HRT A;  3BY7 A;  3JCM P;  3OYJ A;  4LUE A;  2OAU A;  1B34 A;  5IH2 A;  4PFO A;  4X9C A;  1R0B G;  1Q7Y U;  4R55 A;  1FMK A;  2MYS A;  2RK2 A;  3RNJ A;  5J39 A;  4XU1 A;  4DOV A;  4OMO A;  1WHJ A;  3VS0 A;  3M59 A;  2X4W A;  4C92 C;  1SHF A;  2OTJ A;  2DTI A;  4LDY A;  4PK4 A;  4C8Q G;  3EG3 A;  5GAN g;  2OAW A;  3X26 B;  2FPF A;  8AT1 B;  2RNA A;  4E7K A;  3L2Z A;  4MML A;  3CCJ T;  3TQ7 P;  1KC8 R;  5GMK l;  4C0G A;  5GAM d;  3SEM A;  5KYY A;  4OMN A;  2RQW A;  3E19 A;  1Y57 A;  2ZPG B;  2OJ2 A;  1HYO A;  3RES A;  3OMG A;  1VQO T;  3C95 A;  1VQ5 A;  4C8Q D;  2BE9 B;  2DXB A;  5FU6 B;  4OGC A;  4DOW A;  1M1G A;  1WX6 A;  4C92 B;  1W2B P;  4ZN3 A;  4MDX A;  3JB9 D;  3NHN A;  3VS6 A;  2E10 A;  1YWP A;  1PSF A;  5FWC A;  4YTL A;  5J26 A;  1ZA2 B;  2HNI A;  2M0Y A;  2QK0 A;  2GGR A;  3ZEH A;  2MCN A;  3OB9 A;  3CBO A;  2RPN A;  3CXC A;  2HAX A;  3OYF A;  4RG2 A;  2K4Y A;  2OTL T;  4M75 C;  1ZBJ A;  1WGS A;  2O9S A;  1YCY A;  1RAF B;  1MMG A;  3OW2 P;  3VYH B;  1B07 A;  2DPP B;  1BB9 A;  5CKH A;  4ATO A;  3CCU T;  2J6K A;  1YI2 A;  3A5Z B;  3GNG A;  3HHT B;  1QQJ A;  4DBH A;  4FSS A;  1D09 B;  2R57 A;  3THK A;  2LNV A;  1VQP T;  2ROL A;  1M2V A;  4M78 B;  4ELY C;  2EQJ A;  1UGR B;  4F7U F;  4M77 E;  1AZG B;  1MNE A;  1X01 A;  2RA2 A;  1E6G A;  1N6A A;  4N0A C;  2GCX A;  4ZTF A;  2A3L A;  2F1L A;  4NS5 A;  3JCM e;  2K5L A;  4RCC A;  2KYM A;  2QI2 A;  2YDL A;  2D0N A;  3NMZ C;  4J5Y A;  3OS1 A;  1RL2 A;  3X25 B;  1OX9 A;  2E4H A;  3BW1 A;  2DTO A;  1YIT Q;  1EZZ B;  2RM4 A;  1R8O B;  2HSP A;  3LX7 A;  2J06 A;  1I5L A;  3ZL7 C;  1SF9 A;  1VIE A;  1C6V X;  4BDY A;  4LDX A;  4M7D C;  3OQ5 A;  4PJO E;  5D6Y A;  4PJO A;  2DRK A;  4AG2 C;  4A63 B;  1NG2 A;  1YBY A;  3EG9 A;  1Q86 C;  1VQ8 A;  5A0L A;  5FRO A;  3G71 T;  4JRI A;  4BI3 A;  3FLG A;  2DXU A;  3V7S A;  3VRZ A;  5GAO r;  4F7U A;  2DZC A;  3PIP A;  1YJN T;  3OS2 A;  2P0K A;  3I55 Q;  3KBG A;  2C06 A;  2ENM A;  3CC4 T;  1KQ2 A;  2KK4 A;  4M78 F;  3RDV A;  5I21 A;  2GNC A;  3EHQ A;  1K1Z A;  3OBY A;  4GLK A;  4IUV A;  4M4Z A;  3CC7 Q;  2MF2 A;  4PJO F;  5HK0 A;  1WXT A;  2KGT A;  5I2M A;  4IUQ A;  1OPK A;  3X24 B;  1M3B A;  2J6F A;  2ED0 A;  1QP3 A;  3NPF A;  4LUD A;  3ULR B;  1G2B A;  1GFC A;  5CAI A;  2CZ1 B;  4JRK A;  3LW5 E;  4LDW A;  2QQ9 A;  4PJL A;  2QQR A;  2DRM A;  4JJN K;  2K7A A;  2QDY B;  1I1J A;  3M58 A;  2K3B A;  2KBT A;  4RKU E;  1YJ9 A;  1IB8 A;  3NFC A;  1CKB A;  2YHT A;  3JRZ A;  3JCM W;  1PKS A;  1PNJ A;  3S3N A;  3VJP A;  2JOY A;  3OW2 A;  2BZX A;  5CKB A;  1I4K 1;  2C0T A;  4BI4 A;  2HBP A;  2NUP A;  5GAN d;  3HRS A;  3A1P A;  2VGN A;  2CT4 A;  1I07 A;  4E2F B;  2F5K A;  1RLP C;  4OMP A;  5LJ5 f;  3CME Q;  3OBW A;  2BKD N;  2P4R A;  4BY6 B;  1TG0 A;  4M75 B;  1NEB A;  2O88 A;  4EMK A;  2FPD A;  2JNG A;  2JS0 A;  1JJ2 P;  1W70 A;  5HY6 A;  1AZE A;  5GAM f;  1RAB B;  1KC8 U;  4NOY A;  3EFR A;  4HA8 A;  1N8R U;  4M7A A;  3PNW C;  4Y92 A;  1VQM A;  2M51 A;  3CCQ Q;  1NE8 A;  4C92 E;  4C92 D;  3VS4 A;  2R5M A;  2AIR B;  5GAN 3;  2DF6 A;  3MEW A;  4OP0 A;  3VYG A;  4AG1 C;  1VIF A;  3BFM A;  3VS5 A;  2EQI A;  4OB2 B;  4M75 G;  2F2V A;  1D3B A;  1NPP A;  3EGD B;  4QT7 A;  3O8V A;  1VA7 A;  2JMA A;  2QAZ A;  1K0X A;  3EHR A;  2BTT A;  4KGZ B;  2CUD A;  1QKX A;  2DXT A;  3AHU A;  1YJW Q;  1TH7 A;  1UB4 A;  3G7Z A;  2KNB B;  2JZ2 A;  5GAN 4;  4L59 A;  1YN8 A;  1M90 U;  1SEM A;  1RAD B;  2EKH A;  2KRS A;  1AD5 A;  3H0I A;  4ORZ A;  1WFW A;  5GAN e;  1E7O A;  2LNH B;  4XAX B;  4JS4 A;  3R6O A;  2HKQ B;  2K57 A;  1BU1 A;  2E12 A;  2CP5 A;  2XG8 D;  4JJD A;  3QDF A;  4M77 F;  4ZGJ B;  2DTH A;  2QQA A;  2KRN A;  3VU3 C;  2ZPE B;  2LDM A;  2QYZ A;  4M7A C;  2PVG B;  3G4S T;  1ZA1 B;  2E64 A;  4BY6 C;  1KD1 C;  2YLC A;  2VWF A;  3C94 A;  2L3R A;  3MJX A;  1WHL A;  3S6W A;  2PU9 B;  2BZY A;  3TEE A;  2Y4X A;  2ZPB B;  2KI7 A;  1NYF A;  4N4H A;  1QVF S;  1QW1 A;  3PVL A;  1UJ0 A;  1BCO A;  1V76 A;  2E65 A;  2FYK A;  1M9S A;  2IPO B;  2HDA A;  4D8D A;  5GAO p;  5GMK i;  5GAO q;  2RHU A;  4JPB W;  4ANJ A;  1S72 A;  4PJN A;  3P8H A;  1VQO Q;  2AK5 A;  3M0S A;  1OU8 A;  4FYW B;  4E7Z A;  3CCE T;  1M2V B;  4M78 A;  4JS5 A;  1CSK A;  2A28 A;  1OX8 A;  2AZS A;  2EKO A;  1K73 R;  3GIB A;  1JJ2 S;  1U3O A;  2EQU A;  4PNO A;  2LQW A;  3CMA T;  4EIK A;  2DE0 X;  2YT6 A;  4OB0 B;  1U8R A;  4HVU A;  2XKO C;  3H0F A;  3CCS A;  3CCU Q;  2E3H A;  4J9C A;  1KC8 C;  4L6V 5;  1RAH B;  2JMC A;  4PLL A;  1QWF A;  1UGP B;  1M90 C;  5GMK h;  3M56 A;  2DYI A;  3G4S Q;  3MEA A;  3A8H B;  1MMA A;  3CCQ T;  2XDP A;  3M57 A;  4E7I A;  3MPU B;  1Y96 B;  3M0T A;  4CRI A;  2ZPI B;  2EQK A;  2LJ3 A;  3OYM A;  4Z88 A;  4AT1 B;  3QKJ A;  2M16 A;  1YJW T;  1WHM A;  2NUZ A;  1C1A A;  3OYG A;  2EYX A;  1PSE A;  1MV3 A;  4RTW A;  2V8I A;  4KUI A;  4A4K A;  1X27 A;  1J3T A;  3CME T;  1S1N A;  3E2U A;  2W0Z A;  1WQ7 A;  1K9A A;  2AT1 B;  2RHX A;  4HKE A;  3WVE B;  1VQ7 A;  5GAN h;  2OX7 A;  3H9N A;  1Q86 R;  4JJB A;  2R58 A;  3KFV A;  3H6Z A;  2NUP B;  2ZAE A;  3ER0 A;  1PKT A;  1U06 A;  3RR6 A;  4R56 A;  4MZT A;  2D8J A;  2HZY A;  2EGE A;  3G71 Q;  3OYD A;  1SRL A;  3G6E T;  4PJJ A;  2D8H A;  1Q82 R;  1QVG A;  3L2R A;  5C6S A;  3D7S B;  3J80 E;  2HQE A;  3WVD B;  4HCZ A;  3UDC A;  1H3Z A;  2RJF A;  2GFA A;  4XTX A;  3CCM A;  3M4G A;  3JB9 J;  1YFN A;  1MGQ A;  1O75 A;  4C92 F;  2X35 A;  3OMC A;  5LJ3 g;  2CKK A;  2XD0 A;  1OZ2 A;  4M78 C;  4CC2 A;  4PL6 A;  1H92 A;  2D0Q B;  3DB3 A;  4OMF B;  1N9S A;  1FYN A;  2CZ6 B;  3CC7 T;  3VS7 A;  2HL3 A;  3RKY A;  4QVZ A;  1SSF A;  2HSE B;  5IHN A;  4LDU A;  3ZFJ A;  2OI3 A;  3QZ5 B;  3I56 Q;  3M53 A;  3SWN B;  2L0A A;  1GCP A;  1M1F A;  1YWO A;  1WHK A;  1YJN Q;  1Y0M A;  1QCO A;  2KSS A;  3QYG B;  3CBP A;  4M7D F;  2CP3 A;  3R6N A;  1W4S A;  2DJQ A;  3MCA B;  1H64 1;  5GMK e;  4N4G A;  5HK3 A;  2LT4 A;  2LZ6 B;  4MZP A;  1UGV A;  3CCJ A;  1AWO A;  3I55 A;  4M77 D;  2RN8 A;  1LNX A;  2DVE A;  3RMQ A;  4M75 D;  5A0G A;  1M8M A;  2PQW A;  4OMQ A;  2OTL Q;  1K73 C;  2DM1 A;  4J6X A;  1JXM A;  1SSH A;  2GF7 A;  2RH2 A;  1OYX A;  2V26 A;  4MDW A;  4F7U G;  5CCA A;  3X28 B;  1WJS A;  4RTY A;  5GAN 7;  3QJ6 A;  3N5B B;  5ECA A;  3X20 B;  4XTY A;  3EG1 A;  3CXC P;  3UPU A;  2DK3 A;  1HXD A;  1VQ6 T;  2CZ7 B;  2ZZD A;  2MAM A;  1D3B B;  1X6O A;  4QVD A;  1E6H A;  3NTI A;  1WJQ A;  1WXB A;  2QGG A;  3RUX A;  1M3C A;  3SD4 A;  1BIA A;  1FX7 A;  2HBW A;  1VYU A;  4MMK A;  1IO6 A;  3LWI A;  4FU6 A;  2CGH A;  3RMS A;  1OUL A;  1GBR A;  3VUZ A;  1X75 C;  1YI2 T;  4B9X A;  1XOV A;  5KH6 A;  1VQK A;  1YIJ A;  1RUW A;  4OVA A;  2O31 A;  1RAI B; 
#chains in the Genus database with same CATH homology
 1W6X A;  1UDL A;  2FEI A;  3EHQ A;  2KXD A;  1K1Z A;  4J9D A;  2KRM A;  1WI7 A;  4M4Z A;  3REA B;  1LCK A;  1KFZ A;  1QKW A;  2XMF A;  2RMO A;  2YSQ A;  3UF4 A;  1WXT A;  1PWT A;  4GBQ A;  2KGT A;  1PRM C;  3CQT A;  1GBQ A;  1WA7 A;  1OPK A;  1M3B A;  1ZLM A;  2J6F A;  2ED0 A;  2W10 A;  3NPF A;  4LUD A;  2AZV A;  3ULR B;  1G2B A;  1GFC A;  1QCF A;  1UJY A;  2AKK A;  2DRM A;  2LJ1 A;  2K7A A;  2EGC A;  1I1J A;  5GJV B;  2K3B A;  2K9G A;  2KBT A;  1OPL A;  2DLP A;  1T0J A;  5I11 A;  1M3A A;  3M0R A;  2DYB A;  2NWM A;  3U23 A;  4RTZ A;  2CRE A;  2EGA A;  2DL7 A;  1T3L A;  4LNP A;  1CKB A;  1K76 A;  2JTE A;  1HD3 A;  2VVK A;  2DVJ A;  1PKS A;  2C0I A;  1PNJ A;  1TUC A;  2JT4 A;  2KXC A;  1UHC A;  1UEC A;  1YP5 A;  2BZX A;  1WYX A;  4DEX A;  2C0T A;  3M0Q A;  4AFQ C;  1A0N B;  4AFS C;  2LCS A;  2CT4 A;  3EG2 A;  1I07 A;  4IIM A;  1RLP C;  2LP5 A;  2X3X D;  2RQU A;  1UTI A;  1PRL C;  4OMP A;  2X3W D;  2HEQ A;  3EG0 A;  2RQT A;  4J9H A;  4J9F A;  2P4R A;  1TG0 A;  1TUD A;  1MV0 B;  2MIO A;  4J9E A;  1NEB A;  2O88 A;  1MUZ A;  1NLP C;  2DL3 A;  2FPD A;  2DL4 A;  2V1R A;  2JS0 A;  1W70 A;  3I9Q A;  1AZE A;  1QLY A;  4HCK A;  1SPK A;  4GLM A;  4LN2 A;  1WIE A;  1ZX6 A;  4Y92 A;  2M51 A;  3VRY A;  5EC7 A;  1U5S A;  2IIM A;  2ROT A;  3VS4 A;  4CC3 A;  2DMO A;  1ABO A;  2DF6 A;  2BZ8 A;  2YUP A;  4AG1 C;  2SEM A;  1BK2 A;  2DIL A;  1HSQ A;  2LQN A;  1CKA A;  3IQL A;  2EYY A;  3VS3 A;  1GFD A;  3VS5 A;  4F16 A;  2EQI A;  1YNZ A;  3O5Z A;  2CUB A;  1OV3 A;  3A98 A;  1UUE A;  1KSW A;  2H8H A;  2F2V A;  4HVV A;  4QT7 A;  2ABL A;  1ABQ A;  1VA7 A;  1VYT A;  1OEB A;  2CH4 A;  2FRW A;  2JMA A;  4OMM A;  4HXJ A;  1K0X A;  3EHR A;  3H41 A;  2BTT A;  1JQQ A;  2CUD A;  1JO8 A;  1QKX A;  2KR3 A;  3QWX X;  4JJC A;  1UG1 A;  1SHG A;  2FPE A;  2KNB B;  2V1Q A;  4AFZ C;  1UFF A;  1YN8 A;  1SEM A;  1ZSG A;  2EKH A;  2EBP A;  2K79 A;  2KRS A;  4K11 A;  1AD5 A;  3H0I A;  2YUN A;  4ORZ A;  1WFW A;  1E7O A;  2LNH B;  3C0C A;  3VS2 A;  1BU1 A;  2J05 A;  3TVT A;  4Z89 A;  1NYG A;  1BBZ A;  2L3P A;  4JJD A;  2F2W A;  3H0H A;  4IIO A;  2KRN A;  4ESR A;  3UAT A;  4E6R A;  2YUQ A;  5IXB A;  2KRO A;  2MOX A;  1ZUK A;  4F17 A;  4HVW A;  1UE9 A;  2VWF A;  2JM9 A;  2LJ0 A;  1N5Z A;  1ARK A;  3JV3 A;  2BZY A;  1VYV A;  4J9B A;  1ZUU A;  1X6B A;  2LX7 A;  2F2X A;  3FJ5 A;  1M27 C;  1X69 A;  1NYF A;  2GTO A;  3PVL A;  1UJ0 A;  1WXU A;  1V1C A;  5IHI A;  2GQI A;  1RI9 A;  1I0C A;  3I5S A;  1GRI A;  4J9G A;  2FRY A;  4JZ3 A;  2HDA A;  4D8D A;  3M0P A;  4JPB W;  2O2O A;  2AK5 A;  3M0S A;  5L23 A;  5FWB A;  1UHF A;  1CSK A;  2A28 A;  2AZS A;  2CSI A;  2E5K A;  4CC4 B;  1U3O A;  2GTJ A;  2LQW A;  2QDL A;  1SRM A;  3GBQ A;  4EIK A;  2DE0 X;  2YT6 A;  2K6D A;  1KJW A;  4RUG A;  5FW9 A;  2C0O A;  4HVU A;  1AVZ C;  2CSQ A;  3SHW A;  2EYW A;  3H0F A;  1G83 A;  4J9C A;  1K0S A;  2JMC A;  1PHT A;  2LMJ A;  1QWF A;  2B86 A;  2KT8 A;  2PZ1 A;  4OML A;  3PVQ A;  1QWE A;  5HCK A;  1ZUY A;  1Z9Q A;  2A36 A;  1AWJ A;  2JM8 A;  1Z9Z A;  2KT1 A;  1H3H A;  4RTV A;  1X2K A;  4LUE A;  2DBK A;  3M0T A;  5IH2 A;  2KYB A;  2LJ3 A;  2YUO A;  4Z88 A;  5IHK A;  2G6F X;  2JS2 A;  1FMK A;  3RNJ A;  2NUZ A;  1B3Q A;  2EYX A;  1MV3 A;  4OMO A;  3VS0 A;  2SRC A;  4RTW A;  1GL5 A;  2I0N A;  1X27 A;  2DL5 A;  3EGU A;  1J3T A;  1H8K A;  1S1N A;  2W0Z A;  1K9A A;  1SHF A;  2AKL A;  2KEA A;  3EG3 A;  4X1V A;  2OAW A;  1X2Q A;  4Z8A A;  4JJB A;  1AEY A;  3KFV A;  2FPF A;  1AWX A;  2RNA A;  1PKT A;  2DBM A;  4J9I A;  1U06 A;  2D8J A;  1NM7 A;  2EGE A;  1SRL A;  2D8H A;  2JXB A;  2ED1 A;  3SEM A;  4OMN A;  2RQW A;  3QWY A;  2DA9 A;  3UA7 A;  1Y57 A;  2OJ2 A;  2L3Q A;  4DEY A;  4R0K A;  4KRT A;  1WX6 A;  4AFU C;  2CH4 W;  3NHN A;  3VS6 A;  5GJW B;  2L3S A;  1YWP A;  5FWC A;  1JEG A;  4CC7 A;  4ZNX A;  2M0Y A;  2GGR A;  2MCN A;  4CC2 A;  1HJD A;  1H92 A;  2RPN A;  1FYN A;  3TSZ A;  3VS7 A;  1OOT A;  2JW4 A;  2A08 A;  3REB B;  1X43 A;  5IHN A;  2VKN A;  2J6O A;  4JZ4 A;  2ESW A;  1ZBJ A;  2OI3 A;  2O9S A;  2D1X A;  2L0A A;  1GCP A;  1YWO A;  3I5R A;  1Y0M A;  2KE9 A;  2FG0 A;  2EW3 A;  1YCS B;  2J7I A;  3TSW A;  1B07 A;  2K2M A;  2DL8 A;  1BB9 A;  2EYZ A;  2J6K A;  2A37 A;  3R6N A;  2RQR A;  2DJQ A;  1WDX A;  4FSS A;  5I22 A;  3THK A;  3RBB B;  2LZ6 B;  3VS1 A;  2ROL A;  1UGV A;  1AWO A;  2RN8 A;  1AZG B;  1E6G A;  1X6G A;  4F14 A;  1M8M A;  1NEG A;  1T0H A;  4D8K A;  2KYM A;  4OMQ A;  2YDL A;  1WLP B;  2DM1 A;  2D0N A;  2GBQ A;  1JXM A;  1SSH A;  3NMZ C;  2RF0 A;  5IXF A;  1JU5 C;  2EPD A;  4RTY A;  3NGP A;  2HSP A;  2J06 A;  1KIK A;  2RQV A;  3ZL7 C;  5ECA A;  2DNU A;  3EG1 A;  2HCK A;  1AOJ A;  2DRK A;  4RTX A;  4AG2 C;  4A63 B;  1NG2 A;  4RTU A;  4RTT A;  2ECZ A;  1E6H A;  4LE9 A;  1AWW A;  2L2P A;  1EFN A;  1M30 A;  3VRZ A;  1WXB A;  1M3C A;  2DX1 A;  3M0U A;  1K4U S;  2FO0 A;  2HBW A;  2O9V A;  1RLQ C;  1T3S A;  1VYU A;  2EVR A;  1W1F A;  1GCQ C;  2ENM A;  1NLO C;  2PTK A;  1IO6 A;  3PE0 A;  2CT3 A;  4WCI A;  1GBR A;  3UA6 A;  1JXO A;  1XOV A;  2CDT A;  2GNC A;  1GCQ A;  2PNI A;  1RUW A;  3I35 A;  2O31 A;  3LH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...