3CMAQ

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cmaQ00
1YJWQ 1VQNQ 3CCLQ 1KQSP 1VQKQ 1S72Q 2QEXQ 1YI2Q 1Q7YR 3I56Q 1KC8R 1VQ7Q 2OTLQ 1YHQQ 1QVFP 3OW2P 2OTJQ 1VQ8Q 1VQMQ 3CCQQ 1VQPQ 3CC7Q 3CD6Q 3G71Q 1YJNQ 1KD1R 1Q82R 3CCEQ 3G6EQ 3G4SQ 2QA4Q 3CMEQ 3CCSQ 1W2BP 1K73R 1K8AR 1M90R 3CPWP 3CCMQ 1YJ9Q 3CC2Q 3CMAQ 1VQ4Q 3CC4Q 1NJIR 1VQ9Q 1YITQ 1VQOQ 3I55Q 3CXCP 1K9MR 1VQ6Q 1Q86R 1Q81R 3CCJQ 3CCUQ 1YIJQ 1M1KR 1VQ5Q 1JJ2P 3CCVQ 3CCRQ 1VQLQ 1QVGP 1N8RR
chains in the Genus database with same CATH superfamily
5GAMh 5I11A 3H6ZA 1DJ7B 2BKDN 3VUZA 4QW2A 2AKKA 4C8QC 2PVDB 1Z9QA 2O2OA 1YIJA 2KDSA 1LOJA 4C92F 1ZSGA 3CCRA 1VA7A 3C0CA 4QVCA 4EMKC 1OX9A 1EFNA 1SKUB 8AT1B 1ZBXA 3EFOB 3E19A 2QG9B 4FSXA 4OMPA 3FRNA 4AT1B 1U1TA 1JRIA 1H641 1Y96B 4PJOA 2QEXQ 5GAN6 1QWFA 5FU6B 2VC8A 3CMEQ 2JTMA 4PJJA 4D8DA 2HQHA 1G8XA 4XTYA 2V26A 4E7ZA 2DPPB 3OB9A 3ZFJA 5GAMf 4Z8AA 3OYLA 2YWWA 2KRMA 3GLXA 1Q7YC 2VASA 3DKMA 3OW2P 1C1AA 2M1HA 2D8JA 3MHXA 2KXCA 4JDSA 1YJNQ 1AWJA 1FMWA 1BIBA 2EIFA 1WXBA 1AD5A 2JM9A 4A4GA 4HCKA 2VWFA 4L5GA 2F1LA 1KQSS 3IQLA 4J9HA 4RTUA 2EFIA 4OB3B 2E5KA 2SEMA 4RTWA 1I8FA 3WVEB 1S72T 3RNJA 2MMPA 3WXMB 4N4HA 2JTFA 2QQSA 2RM4A 4MDWA 1GCPA 5LJ5e 1YJ9Q 1PSFA 3S3NA 1E6HA 1Y71A 1VQ6Q 2YUNA 2QDYB 4BB7A 4XU1A 5LJ5j 2ENMA 3PVLA 3JCMQ 5EG2A 2CH4A 4DQ2A 3CCLQ 1CKBA 3JB9G 1VQLT 2QTVA 5LJ5h 1V29B 5A0LA 4E2FB 4NL2A 2QK0A 1KHIA 4MMKA 4E7HA 1QQJA 4OMFB 2JN0A 3A8HB 1YP5A 2X3WD 1E7OA 2DETA 3ASKA 3OYHA 2GBQA 4CRIA 1UB4A 2GTOA 1NLOC 3VS0A 1LJOA 4F04B 2L3SA 2DD5A 1WHLA 1VQKT 1OPLA 5FRNA 1M1GA 1OX8A 3M0PA 2O31A 5HY6A 5GAOn 1XNIA 1VQNA 2QQAA 2QAZA 4M7DF 3J7AF 2LNVA 4MDXA 2RJFA 3ME9A 2C0IA 1YBYA 3CC4T 4JJDA 5CVIA 3S6WA 1M5Q1 5A0GA 4PK4A 1RAIB 5LJ5f 2CUBA 1RLQC 2CP6A 2XDPA 4AFZC 2F5TX 4DEYA 3CC4A 3M58A 3SD4A 2HNIA 5L23A 5CR2A 5LJ5d 3S3MA 3JCMb 4QQDA 2XHCA 1XOVA 5FU7B 4X1VA 4C8QG 2E5QA 5GMKi 2V1QA 2F2VA 3KBGA 3MP8A 2DBMA 2KNBB 2KT1A 1IHWA 4HKEA 2DIQA 3PVQA 1ZUUA 2YSQA 2FPDA 1VQ4A 3V7SA 2LDMA 1ZHIA 1UGPB 1B07A 2GNCA 2DXTA 3FIFA 3PGGA 1M90C 2XI9A 4E7IA 2JS0A 1QMCA 1BI1A 1YITQ 2RQVA 3X28B 2RHIA 4M78C 1JB0E 1OZ2A 1BI0A 2ZPFB 1ABOA 3VS4A 2CZ1B 1WGSA 1KC8R 2AHJB 3TREA 3JCMg 4JRPA 3TU4K 3L42A 5CKDA 4IUQA 2QEXT 4JUVA 2EQKA 4FT4A 2D1XA 3BDUA 1K76A 1KSWA 2SRCA 3QG1A 3OYDA 3CMET 1KC8U 4Q5WA 4M75C 3NTIA 4KRTA 1K9AA 2QQ9A 3E9FA 4QT7A 5J26A 3CC7A 5GAOq 3FDRA 3JB9J 1I5OB 1QWEA 2FPFA 2DRMA 3SWNB 1VQMQ 2GGRA 1KD1C 1MHNA 1UE9A 3HRUA 2EW3A 1YJNT 1W4SA 1OQKA 2PU9B 4DBHA 2HKNA 4OGEA 2YRDA 4F7UB 1M30A 3UATA 5GANe 2DVJA 1OI1A 2K2VA 3R6OA 1YJNA 1N9SA 5GAMg 4PJOF 2ZCFB 5GANj 3UWNA 3PE0A 4XTWA 4OF1A 2HEQA 2JS2A 1Q82R 3DB4A 2IPOB 2A7YA 1NJIC 2FYKA 2FRYA 2R5MA 2ZAEA 2VYTA 1MMGA 3QZ9B 4C8QE 1Q82U 1FWZA 2WACA 2LRQA 1VQ6T 4Z02A 2BZXA 1YJWQ 1YJ9A 3PT9A 4QVDA 2LP5A 3JB9H 3LH5A 3T9NA 4HVUA 3CCLT 2X3XD 2IIMA 2JZ2A 1RL2A 1OZ3A 2OAWA 4CC2A 3CCLA 1D3BB 4ZGEB 3OYAA 3Q1JA 5IHKA 5A2QE 2P0QA 3HSBA 2MYSA 4OGCA 1LNXA 1UDLA 3SB2A 4J5YA 4DOVA 4B6MA 4J9DA 5J3BA 4PKCC 4F17A 3RMQA 2EJ9A 3X24B 5GANd 4D6WA 2A28A 4J9CA 4LXCA 1Q86C 1OU9A 4E7KA 2RHZA 4KBMB 4BY6C 4C92B 2CGHA 1FXXA 2RK2A 1MV3A 4BI4A 1JBMA 2YXYA 2QASA 2EYYA 4JZ3A 5LJ3h 1K73R 3EG0A 1TOVA 3X25B 4J6XA 2DZCA 4J6YA 3OYIA 1PHTA 1VQ5Q 2CKKA 2GF7A 3JCMP 5D7UA 3UA7A 3URGA 3A5ZB 3SHWA 1U8RA 1FX7A 3EHRA 4XTZA 2IVWA 4M78G 3CD6Q 1WA7A 3EGXA 4JS5A 3M0SA 2O9VA 2DEUA 2DTHA 5C0MA 3EGXB 1D0ZA 3F70A 3OS1A 4FCYA 1C6VX 3H0IA 1PWTA 2MWPA 4OP0A 1YITT 4M77C 4MZTA 2W0ZA 4MZPA 1UGRB 4M75G 3EG2A 3EG9B 2OTLQ 2RQRA 3FC3A 2AZSA 1HSQA 2KYBA 5KYUA 8ATCB 1AHJB 2Z0WA 1QP3A 1T0JA 2LX7A 1JO8A 2AK5A 2E70A 3M59A 2D6FA 1AOJA 3GOXA 1MNEA 1VQ8A 3N5BB 4ZNXA 5I2MA 1BI3A 4IUTA 1VQ7Q 3CCMA 1Q95G 3P8DA 1H8KA 2X51A 2RD1A 3EH2A 4KH1B 4JJNK 1RUWA 3G71Q 1ZQ1A 1VQMT 5D6XA 4M7DD 2LMJA 2KQWA 4ORZA 5GAOr 1VIFA 1LVKA 1NEBA 1W6XA 1V76A 4E7SA 3UF4A 2O4XA 3CCQA 2IG0A 4DBFA 3VJPA 1WHMA 5LL6S 4C0DC 1X43A 4OMLA 1S72Q 2O4XB 2WSFE 1Q7YR 1UEBA 2E65A 4N0AC 1WHJA 4LDWA 1TH7A 4Y28E 5CQXA 1GFDA 2YUOA 4EDUA 2RQTA 4A54A 3CCVA 5DLQE 1Q7YU 3NMZC 4BE2A 4LUDA 1VQ9Q 2L0AA 3HRSA 3NTHA 4XQ3A 1E6GA 4LD9K 1BCMA 2G3RA 4BE0A 3FB9A 4M7DA 3OYMA 2CP0A 1GXIE 2QQBA 1BU1A 4M7DB 1QLYA 4IUVA 4C8QD 1WQWA 1I5LA 4IKFA 3SEMA 4AG1C 2NLUA 1YJWA 4M78E 4J83A 1VOMA 1KQSA 2RMOA 4O6JA 4HCBA 3VRZA 4DOWA 1QKXA 3A8MB 2H3EB 2C06A 2DL3A 3UDCA 5C6SA 1PKTA 2VGMA 1LPLA 3BDLA 4KUDK 2DLPA 2FL7A 4M75E 4GLKA 4NOYA 3OYGA 2FB7A 2J6KA 2L8DA 3JCMe 4C8QA 2WSEE 2KEAA 2NWMA 3E2UA 2EGCA 3GF5A 3VS3A 3V8KA 5GAN4 3QKJA 2PTKA 2NUZA 1ARKA 4EMKA 3L2VA 1R0BG 2DXBA 1UECA 3QWXX 4EMKB 1UHFA 4LDXA 3NHNA 1K1ZA 4PFPA 2DFUA 3NTKA 4RTZA 3HL8A 3RDVA 4XTXA 2CP2A 1VQ5T 2RA2A 3THKA 2C0TA 1KQSP 4UC4A 2P0KA 4C5GA 1QCNA 2FG0A 1Y0MA 1G3WA 4M77G 4RCBA 2F2WA 3QJ6A 1KK7A 2ROTA 3CD6T 3A8OB 3QJYA 2F69A 4BE1A 1GCQC 4RCCA 2RH2A 3RUXA 3VYHB 3G7ZA 5FWBA 3RBBB 2COZA 2K5FA 2LCCA 5IN1A 1PG5B 4LDYA 2L3QA 1YCSB 2RJCA 3O8VA 1QKWA 1RAHB 2MI6A 1OOTA 2OTLT 4N4IA 2F5KA 1UTIA 4PJOB 2DKGA 3E9GA 2YRVA 3REAB 4M7AC 1O9SA 1M90R 3OS0A 2CUDA 2A08A 4A53A 4ZN1A 2RK1A 5GAOm 3M4YA 3G1JA 3JV3A 1LCKA 2JW4A 3VS6A 2CREA 1M90U 4RG2A 4PJNA 1KIKA 1VQ7T 2YRCA 1YCYA 4J9GA 3GPLA 5GMKl 5LJ3g 3PIPA 2RO0A 3G71T 1X2KA 1I07A 4J7IA 2HAXA 4BDZA 2DNUA 1GBQA 2W10A 2EGAA 2MF2A 2WSCE 2VXEA 2P4RA 1KD1R 4J6WA 3VYGA 3H0HA 1ZA1B 5KCOA 1ZSZC 5FU6C 1S72A 4C0GA 3H41A 3HTRA 5GAN5 3EHQA 3I55Q 1Q81C 1VQ9T 5HKCA 1M1KC 1X6GA 1KD1U 2ZGWA 5HK3A 4ESRA 1N9RA 2PVOB 1QCFA 1ABQA 5GAN7 3OYJA 1M27C 2KT8A 2J06A 1VQLA 1N27A 4M77E 1NJIR 2KXDA 2DE0X 1IZ6A 4L59A 1H3ZA 2VVKA 4BUGA 1AWWA 2E6NA 4J8OA 4C0ZA 1SPKA 2EYZA 3JB9F 1QVFS 4M78D 1A0NB 1NJIU 5I22A 2L3PA 1B34A 2MOXA 2R57A 3G6EQ 3GBQA 2K5LA 2M0YA 1IXDA 3M0TA 1AEYA 2DXCA 1VQKA 3MEWA 5DM7R 1GBRA 2LJ0A 2DK3A 1Z9ZA 4KT0E 3KFVA 5AYFA 2K57A 1RAAB 1IO6A 5IHIA 2OI3A 5CIUA 4M78A 4PNOA 2LT1A 1M3CA 2VXFA 1M2VA 4FM4B 5M9OA 1IRXA 2COYA 4II1A 2LVMA 1Q86R 3HFNA 2RQUA 2DYBA 1WX6A 1TS9A 2LC4A 2XD0A 3M0UA 2KSSA 2EAYA 4M75A 3I56Q 2RNAA 3M0QA 1Q86U 2OTJQ 2KAFA 4J9IA 3FJ5A 4OB2B 2XDDA 2Y4YA 2QGFB 4E6RA 5IH2A 1OV3A 4C8QF 5KCHA 2JXBA 1SHFA 1MUZA 1TUGB 2HSPA 2GFAA 5A0DA 3CCJQ 2CH4W 3CCUQ 3PMIA 4A4KA 5GJVB 3OYEA 1RAGB 4M7AG 5KYYA 3GNGA 4OMQA 4XU3A 1W2BS 5KYYB 5ECAA 2K79A 4KUIA 2MAMA 2ZPBB 2B8AA 2RJEA 1R77A 3NFCA 3TCJA 3QDRB 2FEIA 2QEXA 5HK0A 5FU7C 3OYFA 1QW1A 2JOYA 2QI2A 1ZUKA 3VS1A 3CMEA 2RF0A 1YI2Q 4QVZA 1M2OA 2DA9A 3EAEA 5FW9A 2FO0A 3I35A 2EYQA 2MWOA 1V1CA 5KYXA 2E3IA 4NS5A 3VS5A 3H0FA 2HBWA 1YWOA 1WDXA 4PFZA 5GAOp 5D6YA 2F2XA 4RKUE 4ELZC 2DTOA 5GANh 1IGQA 1UG1A 2Y4XA 1G2BA 1TSFA 2KYMA 2P0PA 2AKLA 4JRKA 1MNDA 2V8JA 2X35A 3I55T 1YWPA 1AWOA 3OYNA 1JEGA 2HBPA 1UGVA 1SEMA 3LYIA 1VQ6A 2XK0A 4MMLA 2G6FX 1KFZA 4J9FA 2DERA 2L3RA 3SWNC 2EWNA 3CC2Q 2CP7A 2H8HA 2BE9B 2A36A 1BB9A 2O01E 4LNPA 5CK9A 4M77D 6AT1B 2L5QA 1SHGA 2NUTA 2M51A 2RB6A 4M7AE 2A3LA 4MZMA 5GANf 3CQTA 1T3LA 3C4SA 1NYGA 1TU0B 3G4SQ 3M9QA 1XTDA 3G6ET 3RMSA 1OULA 2ZPHB 1BKBA 3LGFA 2E4HA 1I0CA 1G3YA 1M8MA 1D1BA 1VYUA 1WXTA 3LW5E 1H92A 3EGUA 2EBPA 4JPBW 2LQWA 1KQ2A 2MPXC 1IREB 4M77A 2NUPA 2K9GA 3PMTA 1UFFA 2ZPIB 2QA4T 3UT1A 4HXJA 1PRLC 3TVTA 4M4ZA 3RESA 3O5ZA 2NUPB 2DMOA 3RKYA 4HT9A 2KMTA 1D0YA 2K7AA 1KG1A 4XAXB 2DJZA 2GTJA 1RADB 1IB8A 2HDAA 4A4FA 1K73U 2KY9A 5LJ5g 2LQNA 3JAME 3U23A 2J6FA 3I56T 1YHQT 2DZ9A 2K6DA 1GFCA 1EIFA 2OTJT 5CO7A 2LCLA 1WYXA 3CBMA 2KRSA 3MPUB 2JMAA 3OY9A 3H9NA 4OB1B 2HL3A 4PLIA 1YIJQ 1F1BB 1WQ7A 4X9DA 1K4US 4BD3A 3CCRQ 2BZYA 2D0QB 1HYOA 4PJLA 2EKHA 3REBB 2JMCA 3CCJT 3CCUT 1ZLMA 4N4GA 1QP2A 4M78F 4C92C 4F14A 3CPFA 5GMKe 1TWBA 1U1SA 1YITA 3JCMW 3CCJA 2DM1A 4FYWB 4CC4B 2DJQA 2ABLA 3OS2A 3MEAA 4N0AA 2DO3A 5GMKj 5KYUB 3JB9D 2JJ9A 4M75F 2YLBA 4J9EA 3LGLA 1CKAA 4FL6A 3MEUA 2YUQA 1RI9A 1JU5C 1YI2T 1ZA2B 3QXEB 3J81E 1NM7A 1UGQB 2Y90A 2R5AA 4A4HA 1JJ2S 2RHYA 1YI2A 4OMNA 3HHTB 4RTVA 2JVVA 1VQMA 3M55A 1NG2A 2ZPGB 1G83A 2HKQB 5CQYA 2K5IA 2RN8A 2YDLA 1UGSB 2O9SA 2EGEA 5I21A 1AWXA 1Y57A 1G5VA 2RPNA 4FIBA 4FU6A 4XTVA 4RTTA 2MCNA 1D1CA 3KXTA 1U5SA 1AVZC 1KQ1A 2LZ6B 2CP3A 3EG3A 2DEQA 3EGDA 2DIGA 2K3XA 2OX7A 2J7IA 4BI8B 3EGDB 1RABB 4C5HA 4F7UG 1JXOA 4HCCA 4DA4A 4QQGA 2X4YA 4X9CA 3CC2T 1Q81R 3JSCA 4JRQA 1M1KR 2DF6A 3FLGA 2QYZA 2FPEA 2JT4A 3QPHA 1WHGA 1Q81U 3CPWS 1R0CB 4OB0B 1M1KU 3A8GB 3SDZA 2DILA 3G4ST 1SG5A 4M7AD 1QVGS 2BZ8A 5DLOA 3GNFB 2RHXA 3MP1A 4C8QB 1RAFB 4CC7A 1I1JA 1VQNQ 1GCQA 3NGPA 2CZ0B 3QHSA 2EQUA 1RLPC 3JCMh 1SF9A 3V7RA 5GANg 1NPRA 2CSIA 4M7DC 3OMGA 2D8HA 2VV5A 4KGVB 3OYCA 2DD4A 1VQOQ 1QVFA 2XMFA 1MV0B 4RG8A 1SRMA 1WPYA 4M7AA 3TEEA 2LJ1A 3OBWA 3EG1A 2QDLA 2HL5C 3EFRA 5FLXE 2HZYA 5GAMe 1VQ5A 2L2PA 2P4TA 2R58A 3E1SA 4CI0C 5FRMA 2I2LA 3H8ZA 3RERA 1WI7A 4C92G 3OYKA 1VQ4Q 1B7TA 4RMOA 5GAMj 3CD6A 4DBQA 2KGTA 3CEYA 1YIJT 2MIOA 3HRTA 3JCMf 3CCRT 1JXMA 4M77F 1HJDA 3TSWA 3PIOA 2LCSA 3JCMd 1NZ9A 4FYXB 2EQJA 3OBYA 3CXCS 3EFOA 2V8IA 4F7UE 3SFMA 1SSFA 4FYYB 4ME7A 4HT8A 2OTLA 1Y96A 1FMVA 2GFUA 3HFOA 1MMAA 1ZSZA 2GQVA 3JCMV 3GIBA 3JCMc 1RACB 1QVFP 1RAEB 4EMHA 1M9SA 1ZSZB 4DEXA 3CC7Q 3CCEQ 4FW2A 2AZVA 1W1FA 3RR6A 1BBZA 2CZ7B 3L2UA 1M1FA 2XKOC 3AT1B 2MK5A 5J39A 1VQ7A 3X20B 4HA8A 3G71A 1M3AA 5CKBA 2HMAA 1W2BA 2DVEA 5GAMd 3J80E 3HP9A 1X6BA 2I0NA 1B3QA 2YHTA 1XJWB 1K8AC 5FROA 2D0NA 2HQXA 4PJOC 1PM3A 4GBQA 4AFSC 1PSEA 3QIIA 2ZZDA 1NBEB 1VQ9A 5HCKA 2J6OA 2LX9A 3X26B 3CBPA 2BE7D 2JUFA 1HK9A 5I2SA 3JCMJ 1PCXA 3ER0A 5L8RE 1X6OA 4ATOA 2GQIA 2CP5A 4WCIA 1K9MC 2O88A 1Y7XA 2CT4A 4C92E 5GMKm 1N8RC 4JJCA 4AG2C 2K2MA 5D6WA 4ANJA 2FRWA 3OSVA 3V7CA 1OPKA 4HVVA 2KRNA 1X2QA 1G3TA 2COWA 2BUDA 3CCSQ 1W2BP 2LT4A 3RKXA 2RJDA 2VKNA 1B34B 1Y07A 3M0RA 4M75D 4M7DG 3OW2S 2PNIA 3VUBA 2P84A 3M57A 2DL5A 1YN8A 5KE3A 4LDUA 1VQNT 4HCZA 3DB3A 2FZGB 2QA4Q 1TUCA 2PZ1A 4M78B 2RI5A 1HXDA 2E6ZA 3TSZA 5IAYA 2CDTA 2EJFA 4PLLA 1CSKA 4VUBA 1VQOT 3ZEHA 1M2VB 3JRZA 4R56A 2EJGA 5FWCA 2BIVA 2X4WA 2DTIA 5IHNA 1X27A 5CKHA 3CBOA 1ZX6A 1VQOA 1YHQQ 2XDBA 3QSUA 1X75C 2OAUA 2ESWA 4M75B 2KBTA 3I5SA 4K11A 4P5NA 5KH6A 4KULA 3AHUA 1VQ4T 1BCOA 2E12A 2EYXA 1X01A 4JRIA 4B9WA 3JB9I 1NLPC 2EVRA 3QZ5B 1VYVA 1PNJA 1O75A 3BE3A 2LNHB 2X4XA 1KHCA 1KJWA 1WHHA 4LUEA 2JNGA 3OYBA 1BK2A 3C12A 1W70A 3LH0A 1U3OA 4ZTFA 4M7AF 3GP8A 4EIKA 4KH0B 3WVDB 9ATCB 2RI3A 5GJWB 5GAN3 2CYZB 1VYTA 1M8VA 2X4JA 3QYGB 4ZN3A 4LDVA 4IURA 2ED1A 1VQ8Q 1PKSA 1PD1A 3C94A 5GAN2 1D09B 2CS7A 3CC7T 5GAN8 3CCET 5EC7A 3CCMQ 3INZA 3CMAQ 3OA6A 3QWYA 4R0KA 2K3BA 2RQWA 1I81A 3L2QA 1UJ0A 3CCEA 5KYXB 1IGUA 4OVAA 2CZ6B 1GRIA 3SWNA 4ELYC 1AT1B 4FYVB 4M7DE 2EQMA 4PJOG 4AMCA 2ROLA 3HKSA 4E7LA 3CCQQ 2DX1A 4IUUA 4F7UA 1UUEA 1TTHB 4JLGA 1R8OB 3UPUA 2H3JA 2YUPA 2DL4A 3A8LB 2OJ2A 4ZGDB 1TG0A 1YFNA 1MMNA 3A1PA 4XU2A 1VUBA 1WFWA 3KUFA 1JQQA 1BYMA 3CCVQ 3EFSA 4JJBA 3VKIA 3QDFA 3P8BB 2NYSA 2QXFA 5KYNA 3C95A 1MGQA 2AIRB 1VIEA 2LTOA 3I55A 4JS4A 1NYFA 4BI3A 3VRYA 1JJ2A 1PD0A 3FJPA 2FHDA 4ZGJB 4BY6B 1YJ9T 1EX4A 4V2SA 2E3HA 2ZPEB 2PVGB 4QQ6A 3LWHA 5CCAA 4IIMA 5AT1B 3M53A 4C92D 2K4YA 1NE8A 1D3BA 3VU3C 3BFMA 4A63B 1D1AA 2NUTB 4X34A 1BI2A 2J05A 4J9BA 2XIDA 5IT9E 1FYNA 2JM8A 3CCST 2QGGA 1UJYA 1NEGA 1OYXA 3VV0A 2E64A 2E10A 2FZCB 1ZUYA 4OMMA 2X9HA 3G6EA 3CCSA 1C0MA 2C0OA 2B86A 2VUBA 2A37A 1ACMB 1NPPA 3QBYA 2YLCA 1BIAA 2KR3A 2DL8A 4TVRA 1OU8A 4C92A 4M77B 3ZL7C 3DLLA 5LJ3e 3I5RA 2LJ3A 4NL3A 1JJ2P 1SRLA 3QUIA 4FSSA 4AFUC 3RIRA 2QA4A 3P8HA 4AFQC 1M3BA 4LD6A 2QTXA 5CKEA 3CPWA 1AZEA 3UA6A 5LJ3j 1PC0A 3EH1A 4FW1A 1M4ZA 5KE2A 2JTEA 2XU8A 1VQPQ 4PJOE 2EPDA 4XK8E 2FVUA 2HSEB 4FT2A 1QVGA 4GY5A 2BTTA 1HD3A 3OS5A 1WJQA 4Z89A 1T0HA 3I56A 1YHQA 1P92A 2M0OA 1WLPB 2ECZA 4PL6A 4C5EA 2OTJA 4E7JA 2YT6A 4Z88A 2KI7A 3LX7A 2KVQG 1KC8C 1TXQA 2CT3A 3RKWA 2K3YA 3ZBDA 1X69A 3MO8A 3JCMX 1YNZA 3R6NA 2HCKA 3OSSC 3CCUA 3OYYA 2QQRA 3META 1T3SA 3QO3A 5KYWA 3M5AA 5DY9A 4O5VA 2A0FB 3PTAA 2DBKA 4C0DB 1SSHA 2D9TA 2VGNA 3D7SB 5KYWB 1N6AA 3EG9A 1RI0A 2EQIA 5GMKh 4L6V5 2V8KA 5CAIA 1IHVA 3LLRA 4BACA 5LJ3f 2XG8D 3OQ5A 4XU0A 1K0SA 1TUDA 4RUGA 1VQ8T 3BY7A 5LJ3d 3MKDA 3CPWP 3S3OA 3L1AA 3PFSA 4E47A 3CCMT 3A98A 3CMAT 4EPCA 1H3HA 3M54A 3V8LA 2VB6A 3ULRB 1QVGP 3CMAA 3DLMA 4HVWA 2PUKB 2DRKA 1Q82C 3CXCA 5IXBA 1K0XA 4KGZB 3CCQT 4OMOA 1QVPA 1N5ZA 4PFOA 2HQEA 4R55A 3L2WA 3HPWA 3TQ7P 4PJMA 4C5IA 4QKUA 1UHCA 4RTYA 1WZOA 3NPFA 4D8KA 3OMCA 3V8JA 3CCVT 2DXUA 2M9UA 2KROA 4A4EA 3MP6A 3QYHB 1U06A 4Y92A 4B9XA 1OEBA 2EYWA 5IXFA 3LWIA 4CC3A 3M56A 2PQWA 3MCAB 1K8AR 1WXUA 2L89A 2RI2A 3BW1A 4JLIA 2ATCB 3VS7A 3PNWC 4Y91A 3I9QA 4KGXB 2DYIA 1WHKA 4BDYA 3VS2A 1VQLQ 4LE9A 4LN2A 4ZTJA 1K8AU 2LQ8A 3L2RA 1WJRA 2E41A 1YJWT 3CC2A 1WNLA 1XQHA 4F7UF 1D0XA 1AZGB 2M16A 1J3TA 2HD0A 2FZKB 3MJXA 4JZ4A 2AT1B 4RTXA 7AT1B 2EKOA 4EMGA 1K9MR 3CXCP 1FMKA 2CSQA 1WJSA 2PUOB 2LQKA 3G4SA 1N8RR 3L2ZA 1I4K1 1VQKQ 4WF2A 2V1RA 1K9MU 2DAQA 4WTOB 4YTLA 1K73C 1N8RU 4J7FA 4IUPA 3CC4Q 4GLMA 4F16A 3FEOA 2ED0A 2E1HA 1MMDA 2DL7A 2M02A 5CKFA 2RHUA 3M4GA 5GAOl 4M7AB 2XICA 3MEVA 1VQPT 1PRMC 1ZBJA 1G3SA 1EZZB 1WIEA 4IIOA 4PJOD 2KE9A 1VQPA 3OW2A 4XTUA 1QCOA 2KK4A 1S1NA 4DBRA 1GL5A 2GCXA 4C0FA
chains in the Genus database with same CATH topology
1YJWQ 1VQNQ 3CCLQ 1KQSP 1VQKQ 1S72Q 2QEXQ 1YI2Q 1Q7YR 3I56Q 1KC8R 1VQ7Q 2OTLQ 1YHQQ 1QVFP 3OW2P 2OTJQ 1VQ8Q 1VQMQ 3CCQQ 1VQPQ 3CC7Q 3CD6Q 3G71Q 1YJNQ 1KD1R 1Q82R 3CCEQ 3G6EQ 3G4SQ 2QA4Q 3CMEQ 3CCSQ 1W2BP 1K73R 1K8AR 1M90R 3CPWP 3CCMQ 1YJ9Q 3CC2Q 3CMAQ 1VQ4Q 3CC4Q 1NJIR 1VQ9Q 1YITQ 1VQOQ 3I55Q 3CXCP 1K9MR 1VQ6Q 1Q86R 1Q81R 3CCJQ 3CCUQ 1YIJQ 1M1KR 1VQ5Q 1JJ2P 3CCVQ 3CCRQ 1VQLQ 1QVGP 1N8RR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW Q;  1VQN Q;  3CCL Q;  1KQS P;  1VQK Q;  1S72 Q;  2QEX Q;  1YI2 Q;  1Q7Y R;  3I56 Q;  1KC8 R;  1VQ7 Q;  2OTL Q;  1YHQ Q;  1QVF P;  3OW2 P;  2OTJ Q;  1VQ8 Q;  1VQM Q;  3CCQ Q;  1VQP Q;  3CC7 Q;  3CD6 Q;  3G71 Q;  1YJN Q;  1KD1 R;  1Q82 R;  3CCE Q;  3G6E Q;  3G4S Q;  2QA4 Q;  3CME Q;  3CCS Q;  1W2B P;  1K73 R;  1K8A R;  1M90 R;  3CPW P;  3CCM Q;  1YJ9 Q;  3CC2 Q;  3CMA Q;  1VQ4 Q;  3CC4 Q;  1NJI R;  1VQ9 Q;  1YIT Q;  1VQO Q;  3I55 Q;  3CXC P;  1K9M R;  1VQ6 Q;  1Q86 R;  1Q81 R;  3CCJ Q;  3CCU Q;  1YIJ Q;  1M1K R;  1VQ5 Q;  1JJ2 P;  3CCV Q;  3CCR Q;  1VQL Q;  1QVG P;  1N8R R; 
#chains in the Genus database with same CATH topology
 5GAM h;  5I11 A;  3H6Z A;  1DJ7 B;  2BKD N;  3VUZ A;  4QW2 A;  2AKK A;  4C8Q C;  2PVD B;  1Z9Q A;  2O2O A;  1YIJ A;  2KDS A;  1LOJ A;  4C92 F;  1ZSG A;  3CCR A;  1VA7 A;  3C0C A;  4QVC A;  4EMK C;  1OX9 A;  1EFN A;  1SKU B;  8AT1 B;  1ZBX A;  3EFO B;  3E19 A;  2QG9 B;  4FSX A;  4OMP A;  3FRN A;  4AT1 B;  1U1T A;  1JRI A;  1H64 1;  1Y96 B;  4PJO A;  2QEX Q;  5GAN 6;  1QWF A;  5FU6 B;  2VC8 A;  3CME Q;  2JTM A;  4PJJ A;  4D8D A;  2HQH A;  1G8X A;  4XTY A;  2V26 A;  4E7Z A;  2DPP B;  3OB9 A;  3ZFJ A;  5GAM f;  4Z8A A;  3OYL A;  2YWW A;  2KRM A;  3GLX A;  1Q7Y C;  2VAS A;  3DKM A;  3OW2 P;  1C1A A;  2M1H A;  2D8J A;  3MHX A;  2KXC A;  4JDS A;  1YJN Q;  1AWJ A;  1FMW A;  1BIB A;  2EIF A;  1WXB A;  1AD5 A;  2JM9 A;  4A4G A;  4HCK A;  2VWF A;  4L5G A;  2F1L A;  1KQS S;  3IQL A;  4J9H A;  4RTU A;  2EFI A;  4OB3 B;  2E5K A;  2SEM A;  4RTW A;  1I8F A;  3WVE B;  1S72 T;  3RNJ A;  2MMP A;  3WXM B;  4N4H A;  2JTF A;  2QQS A;  2RM4 A;  4MDW A;  1GCP A;  5LJ5 e;  1YJ9 Q;  1PSF A;  3S3N A;  1E6H A;  1Y71 A;  1VQ6 Q;  2YUN A;  2QDY B;  4BB7 A;  4XU1 A;  5LJ5 j;  2ENM A;  3PVL A;  3JCM Q;  5EG2 A;  2CH4 A;  4DQ2 A;  3CCL Q;  1CKB A;  3JB9 G;  1VQL T;  2QTV A;  5LJ5 h;  1V29 B;  5A0L A;  4E2F B;  4NL2 A;  2QK0 A;  1KHI A;  4MMK A;  4E7H A;  1QQJ A;  4OMF B;  2JN0 A;  3A8H B;  1YP5 A;  2X3W D;  1E7O A;  2DET A;  3ASK A;  3OYH A;  2GBQ A;  4CRI A;  1UB4 A;  2GTO A;  1NLO C;  3VS0 A;  1LJO A;  4F04 B;  2L3S A;  2DD5 A;  1WHL A;  1VQK T;  1OPL A;  5FRN A;  1M1G A;  1OX8 A;  3M0P A;  2O31 A;  5HY6 A;  5GAO n;  1XNI A;  1VQN A;  2QQA A;  2QAZ A;  4M7D F;  3J7A F;  2LNV A;  4MDX A;  2RJF A;  3ME9 A;  2C0I A;  1YBY A;  3CC4 T;  4JJD A;  5CVI A;  3S6W A;  1M5Q 1;  5A0G A;  4PK4 A;  1RAI B;  5LJ5 f;  2CUB A;  1RLQ C;  2CP6 A;  2XDP A;  4AFZ C;  2F5T X;  4DEY A;  3CC4 A;  3M58 A;  3SD4 A;  2HNI A;  5L23 A;  5CR2 A;  5LJ5 d;  3S3M A;  3JCM b;  4QQD A;  2XHC A;  1XOV A;  5FU7 B;  4X1V A;  4C8Q G;  2E5Q A;  5GMK i;  2V1Q A;  2F2V A;  3KBG A;  3MP8 A;  2DBM A;  2KNB B;  2KT1 A;  1IHW A;  4HKE A;  2DIQ A;  3PVQ A;  1ZUU A;  2YSQ A;  2FPD A;  1VQ4 A;  3V7S A;  2LDM A;  1ZHI A;  1UGP B;  1B07 A;  2GNC A;  2DXT A;  3FIF A;  3PGG A;  1M90 C;  2XI9 A;  4E7I A;  2JS0 A;  1QMC A;  1BI1 A;  1YIT Q;  2RQV A;  3X28 B;  2RHI A;  4M78 C;  1JB0 E;  1OZ2 A;  1BI0 A;  2ZPF B;  1ABO A;  3VS4 A;  2CZ1 B;  1WGS A;  1KC8 R;  2AHJ B;  3TRE A;  3JCM g;  4JRP A;  3TU4 K;  3L42 A;  5CKD A;  4IUQ A;  2QEX T;  4JUV A;  2EQK A;  4FT4 A;  2D1X A;  3BDU A;  1K76 A;  1KSW A;  2SRC A;  3QG1 A;  3OYD A;  3CME T;  1KC8 U;  4Q5W A;  4M75 C;  3NTI A;  4KRT A;  1K9A A;  2QQ9 A;  3E9F A;  4QT7 A;  5J26 A;  3CC7 A;  5GAO q;  3FDR A;  3JB9 J;  1I5O B;  1QWE A;  2FPF A;  2DRM A;  3SWN B;  1VQM Q;  2GGR A;  1KD1 C;  1MHN A;  1UE9 A;  3HRU A;  2EW3 A;  1YJN T;  1W4S A;  1OQK A;  2PU9 B;  4DBH A;  2HKN A;  4OGE A;  2YRD A;  4F7U B;  1M30 A;  3UAT A;  5GAN e;  2DVJ A;  1OI1 A;  2K2V A;  3R6O A;  1YJN A;  1N9S A;  5GAM g;  4PJO F;  2ZCF B;  5GAN j;  3UWN A;  3PE0 A;  4XTW A;  4OF1 A;  2HEQ A;  2JS2 A;  1Q82 R;  3DB4 A;  2IPO B;  2A7Y A;  1NJI C;  2FYK A;  2FRY A;  2R5M A;  2ZAE A;  2VYT A;  1MMG A;  3QZ9 B;  4C8Q E;  1Q82 U;  1FWZ A;  2WAC A;  2LRQ A;  1VQ6 T;  4Z02 A;  2BZX A;  1YJW Q;  1YJ9 A;  3PT9 A;  4QVD A;  2LP5 A;  3JB9 H;  3LH5 A;  3T9N A;  4HVU A;  3CCL T;  2X3X D;  2IIM A;  2JZ2 A;  1RL2 A;  1OZ3 A;  2OAW A;  4CC2 A;  3CCL A;  1D3B B;  4ZGE B;  3OYA A;  3Q1J A;  5IHK A;  5A2Q E;  2P0Q A;  3HSB A;  2MYS A;  4OGC A;  1LNX A;  1UDL A;  3SB2 A;  4J5Y A;  4DOV A;  4B6M A;  4J9D A;  5J3B A;  4PKC C;  4F17 A;  3RMQ A;  2EJ9 A;  3X24 B;  5GAN d;  4D6W A;  2A28 A;  4J9C A;  4LXC A;  1Q86 C;  1OU9 A;  4E7K A;  2RHZ A;  4KBM B;  4BY6 C;  4C92 B;  2CGH A;  1FXX A;  2RK2 A;  1MV3 A;  4BI4 A;  1JBM A;  2YXY A;  2QAS A;  2EYY A;  4JZ3 A;  5LJ3 h;  1K73 R;  3EG0 A;  1TOV A;  3X25 B;  4J6X A;  2DZC A;  4J6Y A;  3OYI A;  1PHT A;  1VQ5 Q;  2CKK A;  2GF7 A;  3JCM P;  5D7U A;  3UA7 A;  3URG A;  3A5Z B;  3SHW A;  1U8R A;  1FX7 A;  3EHR A;  4XTZ A;  2IVW A;  4M78 G;  3CD6 Q;  1WA7 A;  3EGX A;  4JS5 A;  3M0S A;  2O9V A;  2DEU A;  2DTH A;  5C0M A;  3EGX B;  1D0Z A;  3F70 A;  3OS1 A;  4FCY A;  1C6V X;  3H0I A;  1PWT A;  2MWP A;  4OP0 A;  1YIT T;  4M77 C;  4MZT A;  2W0Z A;  4MZP A;  1UGR B;  4M75 G;  3EG2 A;  3EG9 B;  2OTL Q;  2RQR A;  3FC3 A;  2AZS A;  1HSQ A;  2KYB A;  5KYU A;  8ATC B;  1AHJ B;  2Z0W A;  1QP3 A;  1T0J A;  2LX7 A;  1JO8 A;  2AK5 A;  2E70 A;  3M59 A;  2D6F A;  1AOJ A;  3GOX A;  1MNE A;  1VQ8 A;  3N5B B;  4ZNX A;  5I2M A;  1BI3 A;  4IUT A;  1VQ7 Q;  3CCM A;  1Q95 G;  3P8D A;  1H8K A;  2X51 A;  2RD1 A;  3EH2 A;  4KH1 B;  4JJN K;  1RUW A;  3G71 Q;  1ZQ1 A;  1VQM T;  5D6X A;  4M7D D;  2LMJ A;  2KQW A;  4ORZ A;  5GAO r;  1VIF A;  1LVK A;  1NEB A;  1W6X A;  1V76 A;  4E7S A;  3UF4 A;  2O4X A;  3CCQ A;  2IG0 A;  4DBF A;  3VJP A;  1WHM A;  5LL6 S;  4C0D C;  1X43 A;  4OML A;  1S72 Q;  2O4X B;  2WSF E;  1Q7Y R;  1UEB A;  2E65 A;  4N0A C;  1WHJ A;  4LDW A;  1TH7 A;  4Y28 E;  5CQX A;  1GFD A;  2YUO A;  4EDU A;  2RQT A;  4A54 A;  3CCV A;  5DLQ E;  1Q7Y U;  3NMZ C;  4BE2 A;  4LUD A;  1VQ9 Q;  2L0A A;  3HRS A;  3NTH A;  4XQ3 A;  1E6G A;  4LD9 K;  1BCM A;  2G3R A;  4BE0 A;  3FB9 A;  4M7D A;  3OYM A;  2CP0 A;  1GXI E;  2QQB A;  1BU1 A;  4M7D B;  1QLY A;  4IUV A;  4C8Q D;  1WQW A;  1I5L A;  4IKF A;  3SEM A;  4AG1 C;  2NLU A;  1YJW A;  4M78 E;  4J83 A;  1VOM A;  1KQS A;  2RMO A;  4O6J A;  4HCB A;  3VRZ A;  4DOW A;  1QKX A;  3A8M B;  2H3E B;  2C06 A;  2DL3 A;  3UDC A;  5C6S A;  1PKT A;  2VGM A;  1LPL A;  3BDL A;  4KUD K;  2DLP A;  2FL7 A;  4M75 E;  4GLK A;  4NOY A;  3OYG A;  2FB7 A;  2J6K A;  2L8D A;  3JCM e;  4C8Q A;  2WSE E;  2KEA A;  2NWM A;  3E2U A;  2EGC A;  3GF5 A;  3VS3 A;  3V8K A;  5GAN 4;  3QKJ A;  2PTK A;  2NUZ A;  1ARK A;  4EMK A;  3L2V A;  1R0B G;  2DXB A;  1UEC A;  3QWX X;  4EMK B;  1UHF A;  4LDX A;  3NHN A;  1K1Z A;  4PFP A;  2DFU A;  3NTK A;  4RTZ A;  3HL8 A;  3RDV A;  4XTX A;  2CP2 A;  1VQ5 T;  2RA2 A;  3THK A;  2C0T A;  1KQS P;  4UC4 A;  2P0K A;  4C5G A;  1QCN A;  2FG0 A;  1Y0M A;  1G3W A;  4M77 G;  4RCB A;  2F2W A;  3QJ6 A;  1KK7 A;  2ROT A;  3CD6 T;  3A8O B;  3QJY A;  2F69 A;  4BE1 A;  1GCQ C;  4RCC A;  2RH2 A;  3RUX A;  3VYH B;  3G7Z A;  5FWB A;  3RBB B;  2COZ A;  2K5F A;  2LCC A;  5IN1 A;  1PG5 B;  4LDY A;  2L3Q A;  1YCS B;  2RJC A;  3O8V A;  1QKW A;  1RAH B;  2MI6 A;  1OOT A;  2OTL T;  4N4I A;  2F5K A;  1UTI A;  4PJO B;  2DKG A;  3E9G A;  2YRV A;  3REA B;  4M7A C;  1O9S A;  1M90 R;  3OS0 A;  2CUD A;  2A08 A;  4A53 A;  4ZN1 A;  2RK1 A;  5GAO m;  3M4Y A;  3G1J A;  3JV3 A;  1LCK A;  2JW4 A;  3VS6 A;  2CRE A;  1M90 U;  4RG2 A;  4PJN A;  1KIK A;  1VQ7 T;  2YRC A;  1YCY A;  4J9G A;  3GPL A;  5GMK l;  5LJ3 g;  3PIP A;  2RO0 A;  3G71 T;  1X2K A;  1I07 A;  4J7I A;  2HAX A;  4BDZ A;  2DNU A;  1GBQ A;  2W10 A;  2EGA A;  2MF2 A;  2WSC E;  2VXE A;  2P4R A;  1KD1 R;  4J6W A;  3VYG A;  3H0H A;  1ZA1 B;  5KCO A;  1ZSZ C;  5FU6 C;  1S72 A;  4C0G A;  3H41 A;  3HTR A;  5GAN 5;  3EHQ A;  3I55 Q;  1Q81 C;  1VQ9 T;  5HKC A;  1M1K C;  1X6G A;  1KD1 U;  2ZGW A;  5HK3 A;  4ESR A;  1N9R A;  2PVO B;  1QCF A;  1ABQ A;  5GAN 7;  3OYJ A;  1M27 C;  2KT8 A;  2J06 A;  1VQL A;  1N27 A;  4M77 E;  1NJI R;  2KXD A;  2DE0 X;  1IZ6 A;  4L59 A;  1H3Z A;  2VVK A;  4BUG A;  1AWW A;  2E6N A;  4J8O A;  4C0Z A;  1SPK A;  2EYZ A;  3JB9 F;  1QVF S;  4M78 D;  1A0N B;  1NJI U;  5I22 A;  2L3P A;  1B34 A;  2MOX A;  2R57 A;  3G6E Q;  3GBQ A;  2K5L A;  2M0Y A;  1IXD A;  3M0T A;  1AEY A;  2DXC A;  1VQK A;  3MEW A;  5DM7 R;  1GBR A;  2LJ0 A;  2DK3 A;  1Z9Z A;  4KT0 E;  3KFV A;  5AYF A;  2K57 A;  1RAA B;  1IO6 A;  5IHI A;  2OI3 A;  5CIU A;  4M78 A;  4PNO A;  2LT1 A;  1M3C A;  2VXF A;  1M2V A;  4FM4 B;  5M9O A;  1IRX A;  2COY A;  4II1 A;  2LVM A;  1Q86 R;  3HFN A;  2RQU A;  2DYB A;  1WX6 A;  1TS9 A;  2LC4 A;  2XD0 A;  3M0U A;  2KSS A;  2EAY A;  4M75 A;  3I56 Q;  2RNA A;  3M0Q A;  1Q86 U;  2OTJ Q;  2KAF A;  4J9I A;  3FJ5 A;  4OB2 B;  2XDD A;  2Y4Y A;  2QGF B;  4E6R A;  5IH2 A;  1OV3 A;  4C8Q F;  5KCH A;  2JXB A;  1SHF A;  1MUZ A;  1TUG B;  2HSP A;  2GFA A;  5A0D A;  3CCJ Q;  2CH4 W;  3CCU Q;  3PMI A;  4A4K A;  5GJV B;  3OYE A;  1RAG B;  4M7A G;  5KYY A;  3GNG A;  4OMQ A;  4XU3 A;  1W2B S;  5KYY B;  5ECA A;  2K79 A;  4KUI A;  2MAM A;  2ZPB B;  2B8A A;  2RJE A;  1R77 A;  3NFC A;  3TCJ A;  3QDR B;  2FEI A;  2QEX A;  5HK0 A;  5FU7 C;  3OYF A;  1QW1 A;  2JOY A;  2QI2 A;  1ZUK A;  3VS1 A;  3CME A;  2RF0 A;  1YI2 Q;  4QVZ A;  1M2O A;  2DA9 A;  3EAE A;  5FW9 A;  2FO0 A;  3I35 A;  2EYQ A;  2MWO A;  1V1C A;  5KYX A;  2E3I A;  4NS5 A;  3VS5 A;  3H0F A;  2HBW A;  1YWO A;  1WDX A;  4PFZ A;  5GAO p;  5D6Y A;  2F2X A;  4RKU E;  4ELZ C;  2DTO A;  5GAN h;  1IGQ A;  1UG1 A;  2Y4X A;  1G2B A;  1TSF A;  2KYM A;  2P0P A;  2AKL A;  4JRK A;  1MND A;  2V8J A;  2X35 A;  3I55 T;  1YWP A;  1AWO A;  3OYN A;  1JEG A;  2HBP A;  1UGV A;  1SEM A;  3LYI A;  1VQ6 A;  2XK0 A;  4MML A;  2G6F X;  1KFZ A;  4J9F A;  2DER A;  2L3R A;  3SWN C;  2EWN A;  3CC2 Q;  2CP7 A;  2H8H A;  2BE9 B;  2A36 A;  1BB9 A;  2O01 E;  4LNP A;  5CK9 A;  4M77 D;  6AT1 B;  2L5Q A;  1SHG A;  2NUT A;  2M51 A;  2RB6 A;  4M7A E;  2A3L A;  4MZM A;  5GAN f;  3CQT A;  1T3L A;  3C4S A;  1NYG A;  1TU0 B;  3G4S Q;  3M9Q A;  1XTD A;  3G6E T;  3RMS A;  1OUL A;  2ZPH B;  1BKB A;  3LGF A;  2E4H A;  1I0C A;  1G3Y A;  1M8M A;  1D1B A;  1VYU A;  1WXT A;  3LW5 E;  1H92 A;  3EGU A;  2EBP A;  4JPB W;  2LQW A;  1KQ2 A;  2MPX C;  1IRE B;  4M77 A;  2NUP A;  2K9G A;  3PMT A;  1UFF A;  2ZPI B;  2QA4 T;  3UT1 A;  4HXJ A;  1PRL C;  3TVT A;  4M4Z A;  3RES A;  3O5Z A;  2NUP B;  2DMO A;  3RKY A;  4HT9 A;  2KMT A;  1D0Y A;  2K7A A;  1KG1 A;  4XAX B;  2DJZ A;  2GTJ A;  1RAD B;  1IB8 A;  2HDA A;  4A4F A;  1K73 U;  2KY9 A;  5LJ5 g;  2LQN A;  3JAM E;  3U23 A;  2J6F A;  3I56 T;  1YHQ T;  2DZ9 A;  2K6D A;  1GFC A;  1EIF A;  2OTJ T;  5CO7 A;  2LCL A;  1WYX A;  3CBM A;  2KRS A;  3MPU B;  2JMA A;  3OY9 A;  3H9N A;  4OB1 B;  2HL3 A;  4PLI A;  1YIJ Q;  1F1B B;  1WQ7 A;  4X9D A;  1K4U S;  4BD3 A;  3CCR Q;  2BZY A;  2D0Q B;  1HYO A;  4PJL A;  2EKH A;  3REB B;  2JMC A;  3CCJ T;  3CCU T;  1ZLM A;  4N4G A;  1QP2 A;  4M78 F;  4C92 C;  4F14 A;  3CPF A;  5GMK e;  1TWB A;  1U1S A;  1YIT A;  3JCM W;  3CCJ A;  2DM1 A;  4FYW B;  4CC4 B;  2DJQ A;  2ABL A;  3OS2 A;  3MEA A;  4N0A A;  2DO3 A;  5GMK j;  5KYU B;  3JB9 D;  2JJ9 A;  4M75 F;  2YLB A;  4J9E A;  3LGL A;  1CKA A;  4FL6 A;  3MEU A;  2YUQ A;  1RI9 A;  1JU5 C;  1YI2 T;  1ZA2 B;  3QXE B;  3J81 E;  1NM7 A;  1UGQ B;  2Y90 A;  2R5A A;  4A4H A;  1JJ2 S;  2RHY A;  1YI2 A;  4OMN A;  3HHT B;  4RTV A;  2JVV A;  1VQM A;  3M55 A;  1NG2 A;  2ZPG B;  1G83 A;  2HKQ B;  5CQY A;  2K5I A;  2RN8 A;  2YDL A;  1UGS B;  2O9S A;  2EGE A;  5I21 A;  1AWX A;  1Y57 A;  1G5V A;  2RPN A;  4FIB A;  4FU6 A;  4XTV A;  4RTT A;  2MCN A;  1D1C A;  3KXT A;  1U5S A;  1AVZ C;  1KQ1 A;  2LZ6 B;  2CP3 A;  3EG3 A;  2DEQ A;  3EGD A;  2DIG A;  2K3X A;  2OX7 A;  2J7I A;  4BI8 B;  3EGD B;  1RAB B;  4C5H A;  4F7U G;  1JXO A;  4HCC A;  4DA4 A;  4QQG A;  2X4Y A;  4X9C A;  3CC2 T;  1Q81 R;  3JSC A;  4JRQ A;  1M1K R;  2DF6 A;  3FLG A;  2QYZ A;  2FPE A;  2JT4 A;  3QPH A;  1WHG A;  1Q81 U;  3CPW S;  1R0C B;  4OB0 B;  1M1K U;  3A8G B;  3SDZ A;  2DIL A;  3G4S T;  1SG5 A;  4M7A D;  1QVG S;  2BZ8 A;  5DLO A;  3GNF B;  2RHX A;  3MP1 A;  4C8Q B;  1RAF B;  4CC7 A;  1I1J A;  1VQN Q;  1GCQ A;  3NGP A;  2CZ0 B;  3QHS A;  2EQU A;  1RLP C;  3JCM h;  1SF9 A;  3V7R A;  5GAN g;  1NPR A;  2CSI A;  4M7D C;  3OMG A;  2D8H A;  2VV5 A;  4KGV B;  3OYC A;  2DD4 A;  1VQO Q;  1QVF A;  2XMF A;  1MV0 B;  4RG8 A;  1SRM A;  1WPY A;  4M7A A;  3TEE A;  2LJ1 A;  3OBW A;  3EG1 A;  2QDL A;  2HL5 C;  3EFR A;  5FLX E;  2HZY A;  5GAM e;  1VQ5 A;  2L2P A;  2P4T A;  2R58 A;  3E1S A;  4CI0 C;  5FRM A;  2I2L A;  3H8Z A;  3RER A;  1WI7 A;  4C92 G;  3OYK A;  1VQ4 Q;  1B7T A;  4RMO A;  5GAM j;  3CD6 A;  4DBQ A;  2KGT A;  3CEY A;  1YIJ T;  2MIO A;  3HRT A;  3JCM f;  3CCR T;  1JXM A;  4M77 F;  1HJD A;  3TSW A;  3PIO A;  2LCS A;  3JCM d;  1NZ9 A;  4FYX B;  2EQJ A;  3OBY A;  3CXC S;  3EFO A;  2V8I A;  4F7U E;  3SFM A;  1SSF A;  4FYY B;  4ME7 A;  4HT8 A;  2OTL A;  1Y96 A;  1FMV A;  2GFU A;  3HFO A;  1MMA A;  1ZSZ A;  2GQV A;  3JCM V;  3GIB A;  3JCM c;  1RAC B;  1QVF P;  1RAE B;  4EMH A;  1M9S A;  1ZSZ B;  4DEX A;  3CC7 Q;  3CCE Q;  4FW2 A;  2AZV A;  1W1F A;  3RR6 A;  1BBZ A;  2CZ7 B;  3L2U A;  1M1F A;  2XKO C;  3AT1 B;  2MK5 A;  5J39 A;  1VQ7 A;  3X20 B;  4HA8 A;  3G71 A;  1M3A A;  5CKB A;  2HMA A;  1W2B A;  2DVE A;  5GAM d;  3J80 E;  3HP9 A;  1X6B A;  2I0N A;  1B3Q A;  2YHT A;  1XJW B;  1K8A C;  5FRO A;  2D0N A;  2HQX A;  4PJO C;  1PM3 A;  4GBQ A;  4AFS C;  1PSE A;  3QII A;  2ZZD A;  1NBE B;  1VQ9 A;  5HCK A;  2J6O A;  2LX9 A;  3X26 B;  3CBP A;  2BE7 D;  2JUF A;  1HK9 A;  5I2S A;  3JCM J;  1PCX A;  3ER0 A;  5L8R E;  1X6O A;  4ATO A;  2GQI A;  2CP5 A;  4WCI A;  1K9M C;  2O88 A;  1Y7X A;  2CT4 A;  4C92 E;  5GMK m;  1N8R C;  4JJC A;  4AG2 C;  2K2M A;  5D6W A;  4ANJ A;  2FRW A;  3OSV A;  3V7C A;  1OPK A;  4HVV A;  2KRN A;  1X2Q A;  1G3T A;  2COW A;  2BUD A;  3CCS Q;  1W2B P;  2LT4 A;  3RKX A;  2RJD A;  2VKN A;  1B34 B;  1Y07 A;  3M0R A;  4M75 D;  4M7D G;  3OW2 S;  2PNI A;  3VUB A;  2P84 A;  3M57 A;  2DL5 A;  1YN8 A;  5KE3 A;  4LDU A;  1VQN T;  4HCZ A;  3DB3 A;  2FZG B;  2QA4 Q;  1TUC A;  2PZ1 A;  4M78 B;  2RI5 A;  1HXD A;  2E6Z A;  3TSZ A;  5IAY A;  2CDT A;  2EJF A;  4PLL A;  1CSK A;  4VUB A;  1VQO T;  3ZEH A;  1M2V B;  3JRZ A;  4R56 A;  2EJG A;  5FWC A;  2BIV A;  2X4W A;  2DTI A;  5IHN A;  1X27 A;  5CKH A;  3CBO A;  1ZX6 A;  1VQO A;  1YHQ Q;  2XDB A;  3QSU A;  1X75 C;  2OAU A;  2ESW A;  4M75 B;  2KBT A;  3I5S A;  4K11 A;  4P5N A;  5KH6 A;  4KUL A;  3AHU A;  1VQ4 T;  1BCO A;  2E12 A;  2EYX A;  1X01 A;  4JRI A;  4B9W A;  3JB9 I;  1NLP C;  2EVR A;  3QZ5 B;  1VYV A;  1PNJ A;  1O75 A;  3BE3 A;  2LNH B;  2X4X A;  1KHC A;  1KJW A;  1WHH A;  4LUE A;  2JNG A;  3OYB A;  1BK2 A;  3C12 A;  1W70 A;  3LH0 A;  1U3O A;  4ZTF A;  4M7A F;  3GP8 A;  4EIK A;  4KH0 B;  3WVD B;  9ATC B;  2RI3 A;  5GJW B;  5GAN 3;  2CYZ B;  1VYT A;  1M8V A;  2X4J A;  3QYG B;  4ZN3 A;  4LDV A;  4IUR A;  2ED1 A;  1VQ8 Q;  1PKS A;  1PD1 A;  3C94 A;  5GAN 2;  1D09 B;  2CS7 A;  3CC7 T;  5GAN 8;  3CCE T;  5EC7 A;  3CCM Q;  3INZ A;  3CMA Q;  3OA6 A;  3QWY A;  4R0K A;  2K3B A;  2RQW A;  1I81 A;  3L2Q A;  1UJ0 A;  3CCE A;  5KYX B;  1IGU A;  4OVA A;  2CZ6 B;  1GRI A;  3SWN A;  4ELY C;  1AT1 B;  4FYV B;  4M7D E;  2EQM A;  4PJO G;  4AMC A;  2ROL A;  3HKS A;  4E7L A;  3CCQ Q;  2DX1 A;  4IUU A;  4F7U A;  1UUE A;  1TTH B;  4JLG A;  1R8O B;  3UPU A;  2H3J A;  2YUP A;  2DL4 A;  3A8L B;  2OJ2 A;  4ZGD B;  1TG0 A;  1YFN A;  1MMN A;  3A1P A;  4XU2 A;  1VUB A;  1WFW A;  3KUF A;  1JQQ A;  1BYM A;  3CCV Q;  3EFS A;  4JJB A;  3VKI A;  3QDF A;  3P8B B;  2NYS A;  2QXF A;  5KYN A;  3C95 A;  1MGQ A;  2AIR B;  1VIE A;  2LTO A;  3I55 A;  4JS4 A;  1NYF A;  4BI3 A;  3VRY A;  1JJ2 A;  1PD0 A;  3FJP A;  2FHD A;  4ZGJ B;  4BY6 B;  1YJ9 T;  1EX4 A;  4V2S A;  2E3H A;  2ZPE B;  2PVG B;  4QQ6 A;  3LWH A;  5CCA A;  4IIM A;  5AT1 B;  3M53 A;  4C92 D;  2K4Y A;  1NE8 A;  1D3B A;  3VU3 C;  3BFM A;  4A63 B;  1D1A A;  2NUT B;  4X34 A;  1BI2 A;  2J05 A;  4J9B A;  2XID A;  5IT9 E;  1FYN A;  2JM8 A;  3CCS T;  2QGG A;  1UJY A;  1NEG A;  1OYX A;  3VV0 A;  2E64 A;  2E10 A;  2FZC B;  1ZUY A;  4OMM A;  2X9H A;  3G6E A;  3CCS A;  1C0M A;  2C0O A;  2B86 A;  2VUB A;  2A37 A;  1ACM B;  1NPP A;  3QBY A;  2YLC A;  1BIA A;  2KR3 A;  2DL8 A;  4TVR A;  1OU8 A;  4C92 A;  4M77 B;  3ZL7 C;  3DLL A;  5LJ3 e;  3I5R A;  2LJ3 A;  4NL3 A;  1JJ2 P;  1SRL A;  3QUI A;  4FSS A;  4AFU C;  3RIR A;  2QA4 A;  3P8H A;  4AFQ C;  1M3B A;  4LD6 A;  2QTX A;  5CKE A;  3CPW A;  1AZE A;  3UA6 A;  5LJ3 j;  1PC0 A;  3EH1 A;  4FW1 A;  1M4Z A;  5KE2 A;  2JTE A;  2XU8 A;  1VQP Q;  4PJO E;  2EPD A;  4XK8 E;  2FVU A;  2HSE B;  4FT2 A;  1QVG A;  4GY5 A;  2BTT A;  1HD3 A;  3OS5 A;  1WJQ A;  4Z89 A;  1T0H A;  3I56 A;  1YHQ A;  1P92 A;  2M0O A;  1WLP B;  2ECZ A;  4PL6 A;  4C5E A;  2OTJ A;  4E7J A;  2YT6 A;  4Z88 A;  2KI7 A;  3LX7 A;  2KVQ G;  1KC8 C;  1TXQ A;  2CT3 A;  3RKW A;  2K3Y A;  3ZBD A;  1X69 A;  3MO8 A;  3JCM X;  1YNZ A;  3R6N A;  2HCK A;  3OSS C;  3CCU A;  3OYY A;  2QQR A;  3MET A;  1T3S A;  3QO3 A;  5KYW A;  3M5A A;  5DY9 A;  4O5V A;  2A0F B;  3PTA A;  2DBK A;  4C0D B;  1SSH A;  2D9T A;  2VGN A;  3D7S B;  5KYW B;  1N6A A;  3EG9 A;  1RI0 A;  2EQI A;  5GMK h;  4L6V 5;  2V8K A;  5CAI A;  1IHV A;  3LLR A;  4BAC A;  5LJ3 f;  2XG8 D;  3OQ5 A;  4XU0 A;  1K0S A;  1TUD A;  4RUG A;  1VQ8 T;  3BY7 A;  5LJ3 d;  3MKD A;  3CPW P;  3S3O A;  3L1A A;  3PFS A;  4E47 A;  3CCM T;  3A98 A;  3CMA T;  4EPC A;  1H3H A;  3M54 A;  3V8L A;  2VB6 A;  3ULR B;  1QVG P;  3CMA A;  3DLM A;  4HVW A;  2PUK B;  2DRK A;  1Q82 C;  3CXC A;  5IXB A;  1K0X A;  4KGZ B;  3CCQ T;  4OMO A;  1QVP A;  1N5Z A;  4PFO A;  2HQE A;  4R55 A;  3L2W A;  3HPW A;  3TQ7 P;  4PJM A;  4C5I A;  4QKU A;  1UHC A;  4RTY A;  1WZO A;  3NPF A;  4D8K A;  3OMC A;  3V8J A;  3CCV T;  2DXU A;  2M9U A;  2KRO A;  4A4E A;  3MP6 A;  3QYH B;  1U06 A;  4Y92 A;  4B9X A;  1OEB A;  2EYW A;  5IXF A;  3LWI A;  4CC3 A;  3M56 A;  2PQW A;  3MCA B;  1K8A R;  1WXU A;  2L89 A;  2RI2 A;  3BW1 A;  4JLI A;  2ATC B;  3VS7 A;  3PNW C;  4Y91 A;  3I9Q A;  4KGX B;  2DYI A;  1WHK A;  4BDY A;  3VS2 A;  1VQL Q;  4LE9 A;  4LN2 A;  4ZTJ A;  1K8A U;  2LQ8 A;  3L2R A;  1WJR A;  2E41 A;  1YJW T;  3CC2 A;  1WNL A;  1XQH A;  4F7U F;  1D0X A;  1AZG B;  2M16 A;  1J3T A;  2HD0 A;  2FZK B;  3MJX A;  4JZ4 A;  2AT1 B;  4RTX A;  7AT1 B;  2EKO A;  4EMG A;  1K9M R;  3CXC P;  1FMK A;  2CSQ A;  1WJS A;  2PUO B;  2LQK A;  3G4S A;  1N8R R;  3L2Z A;  1I4K 1;  1VQK Q;  4WF2 A;  2V1R A;  1K9M U;  2DAQ A;  4WTO B;  4YTL A;  1K73 C;  1N8R U;  4J7F A;  4IUP A;  3CC4 Q;  4GLM A;  4F16 A;  3FEO A;  2ED0 A;  2E1H A;  1MMD A;  2DL7 A;  2M02 A;  5CKF A;  2RHU A;  3M4G A;  5GAO l;  4M7A B;  2XIC A;  3MEV A;  1VQP T;  1PRM C;  1ZBJ A;  1G3S A;  1EZZ B;  1WIE A;  4IIO A;  4PJO D;  2KE9 A;  1VQP A;  3OW2 A;  4XTU A;  1QCO A;  2KK4 A;  1S1N A;  4DBR A;  1GL5 A;  2GCX A;  4C0F A; 
#chains in the Genus database with same CATH homology
 1YJW Q;  1VQN Q;  3CCL Q;  1KQS P;  1VQK Q;  1S72 Q;  2QEX Q;  1YI2 Q;  1Q7Y R;  3I56 Q;  1KC8 R;  1VQ7 Q;  2OTL Q;  1YHQ Q;  1QVF P;  3OW2 P;  2OTJ Q;  1VQ8 Q;  1VQM Q;  3CCQ Q;  1VQP Q;  3CC7 Q;  3CD6 Q;  3G71 Q;  1YJN Q;  1KD1 R;  1Q82 R;  3CCE Q;  3G6E Q;  3G4S Q;  2QA4 Q;  3CME Q;  3CCS Q;  1W2B P;  1K73 R;  1K8A R;  1M90 R;  3CPW P;  3CCM Q;  1YJ9 Q;  3CC2 Q;  3CMA Q;  1VQ4 Q;  3CC4 Q;  1NJI R;  1VQ9 Q;  1YIT Q;  1VQO Q;  3I55 Q;  3CXC P;  1K9M R;  1VQ6 Q;  1Q86 R;  1Q81 R;  3CCJ Q;  3CCU Q;  1YIJ Q;  1M1K R;  1VQ5 Q;  1JJ2 P;  3CCV Q;  3CCR Q;  1VQL Q;  1QVG P;  1N8R R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...