3CMAQ

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cmaQ00
1YJWQ 1K73R 2QEXQ 3CC7Q 1K9MR 1Q81R 1VQ7Q 3CCQQ 1VQ4Q 3CMEQ 1N8RR 3G4SQ 1QVFP 3CCRQ 1VQMQ 1K8AR 3CCUQ 1KD1R 1Q82R 1VQLQ 3CCEQ 3CXCP 1YJ9Q 3CCMQ 1Q86R 1S72Q 1VQ5Q 3CPWP 1YIJQ 3CD6Q 3CMAQ 2OTLQ 3OW2P 1VQOQ 1KQSP 3G71Q 3CC4Q 1VQNQ 3CCVQ 1Q7YR 3I56Q 3CCSQ 1YITQ 1VQKQ 3CCLQ 1W2BP 1VQPQ 1M1KR 3CC2Q 3CCJQ 2QA4Q 1YI2Q 1VQ9Q 2OTJQ 3I55Q 1JJ2P 1QVGP 3G6EQ 1VQ8Q 1VQ6Q 1NJIR 1YJNQ 1M90R 1YHQQ 1KC8R
chains in the Genus database with same CATH superfamily
1WYXA 4HXJA 3HTRA 2E5QA 4OB2B 1KQSA 3PMIA 4HVVA 2DEUA 1TUCA 2LTOA 3VKIA 1X6BA 2K5LA 1ZUUA 1VQ8T 2CP5A 1WQWA 3I55Q 3HP9A 4MMLA 1KC8R 2BIVA 5CKEA 1XNIA 2VXEA 1VQ5T 1X01A 4LDYA 1LCKA 2LRQA 2HL5C 4PLIA 2X4YA 3EGXA 4M77A 2YRVA 2P0KA 2E1HA 4F7UG 1IHVA 2QK0A 4EDUA 4QQGA 5FRNA 1VUBA 4M78C 4NS5A 2VYTA 1BYMA 5D6XA 2CP6A 5GANg 3L1AA 2XDDA 1WA7A 4M75E 3CCRQ 1W4SA 2JVVA 2H3JA 2GQIA 5IHNA 3RDVA 2P0PA 3PVQA 2EKOA 1YJWT 2KDSA 4F7UB 2VASA 3X24B 1WXTA 1OZ2A 1CKAA 5FU7B 2RQRA 2M9UA 5CKFA 2HSPA 3LWIA 4OB0B 4OMMA 3RMQA 5EC7A 5LJ3e 4E2FB 1G83A 3RKYA 4PNOA 2EQKA 2JMCA 4XTXA 3MO8A 3N5BB 1VQKA 3JAME 1YFNA 4RTXA 1W1FA 3E9GA 1VQ9A 5GANd 1TS9A 2Z0WA 4M7DG 2CP2A 1ZSZC 2CZ6B 2MPXC 4MZPA 1M27C 1JJ2A 1C0MA 2DKGA 3I5SA 3JB9I 4XTYA 3MHXA 1TU0B 1YHQT 3CXCS 2RF0A 5GAOl 1WHLA 5GAOm 1PCXA 2DL7A 2DTHA 1TH7A 1OPLA 1M2VA 1LJOA 1FYNA 5GJVB 3E2UA 5HKCA 2PZ1A 4LDWA 4J6WA 1D3BA 1QKWA 2AZSA 4JZ3A 4DBHA 2RK1A 1G3WA 4J5YA 1GBRA 2F5TX 4J6XA 1G8XA 2CSQA 5KYYB 4J9FA 1VQPQ 2PUOB 3M55A 2D1XA 4M78E 1ABQA 4M7DB 2RMOA 1ZA1B 2RI2A 4F04B 5FU6B 2DRKA 4PJOD 2FZCB 1S72T 3LYIA 1WXUA 4C8QG 2VXFA 1O9SA 3A8GB 1S1NA 4IUQA 1I5LA 4XTWA 2DL3A 2EKHA 5GANh 3JB9D 2LQKA 1VQKT 1AZGB 5FROA 2K57A 3NMZC 4MZMA 1YI2T 4OMOA 2A08A 1M5Q1 3MP6A 3QKJA 2KRSA 1XQHA 3H0HA 3PIPA 2H8HA 2E70A 2XK0A 2AZVA 2RH2A 4FM4B 4PKCC 2HQXA 1WPYA 2QA4T 5GAN8 2JZ2A 5CKBA 4PJOF 3EGUA 2JTEA 4AFZC 1V29B 4J9DA 3HPWA 4JRQA 3I9QA 5A0GA 1VQ9Q 4C8QB 4X9DA 4C92B 3JB9F 3X26B 1QCOA 1M1FA 5EG2A 2W10A 2JTMA 4D6WA 1KG1A 3MEWA 4HT8A 2DILA 1RAGB 5KYWB 3M4YA 3X28B 2RHXA 2AT1B 1YCYA 2E10A 3OS2A 2EGCA 1RAIB 4J9GA 2CYZB 1H3ZA 2JS0A 3L2WA 2DL8A 2CREA 1ACMB 3A98A 4FT2A 1OV3A 2F69A 2OI3A 1IZ6A 5J39A 1FWZA 2ED1A 1I8FA 3CPWP 4CC2A 1GFDA 2RHZA 4ELZC 1WNLA 2JOYA 2EJFA 1VQ4A 4LE9A 2P4RA 4UC4A 5CIUA 1T3LA 1K73U 1ZBXA 3OB9A 2D0NA 2ESWA 3BFMA 4FT4A 2FRYA 3WXMB 4A4HA 1QW1A 4CI0C 1GCQC 4N4IA 1NYGA 1Q82R 1K73C 5CVIA 5LL6S 1NLOC 2RQTA 1AVZC 3CCJT 2GFAA 1SRLA 2JN0A 1B34B 3VUBA 1QP3A 4XTZA 1DJ7B 4M75G 2B86A 1JJ2P 1MV3A 2DXBA 3CEYA 2LJ0A 4M7AG 4QVDA 4GLKA 4E7HA 2RQWA 1P92A 1N5ZA 4FSXA 4IUTA 4D8KA 4EMKB 3OYJA 1VA7A 1Y57A 3I56T 1MNEA 3NPFA 5GANf 1BI3A 2IVWA 3JCMb 1IGQA 1SG5A 2BE9B 1TUGB 1KC8U 5KYYA 3QDFA 5A0LA 2RJCA 5LJ5e 2J05A 2EQMA 1RL2A 4GLMA 1HJDA 4M7DA 4OP0A 3S3NA 1KC8C 2L0AA 2MCNA 1YJ9Q 4M77D 4M75B 2HZYA 4FYVB 4M7AB 3J81E 3JCMW 3LGLA 3HSBA 4XU2A 1RAEB 4E7KA 4DEXA 3OYFA 3RERA 1GCPA 3NGPA 1WFWA 4XU0A 3QG1A 3UA7A 4BDYA 4X9CA 3OW2S 8AT1B 1WX6A 1VQ4Q 1BBZA 1RAHB 5GAMg 3CCUQ 1AEYA 2VC8A 3C94A 3OY9A 1YITT 2L3QA 2M0OA 3SEMA 4JJDA 3GP8A 1A0NB 1VYVA 1VQLA 2MWPA 3M57A 3CC7T 4M77F 1RI0A 1Y7XA 2LT4A 4C92A 1J3TA 2EQJA 4HCZA 4Y92A 3RUXA 3EG3A 2DXTA 3H8ZA 2F2XA 2A37A 2J06A 3OQ5A 5LJ5d 2XDPA 5KYWA 1MUZA 2QEXA 4KH1B 1OPKA 4LDXA 1QQJA 4MDXA 1LPLA 1UG1A 1PRMC 3CPFA 1Q81R 2DLPA 3QXEB 5L23A 3VS5A 2DM1A 1PD0A 3F70A 4C5GA 1I0CA 2NYSA 2AKLA 3CCLT 3NTIA 2J7IA 5IHKA 5GAMd 4NL3A 1C6VX 2EWNA 3OSVA 2WSCE 4J7IA 2K7AA 2BE7D 2LCSA 4LDVA 1BCOA 4M78B 2CZ0B 2O88A 4F16A 5KYUB 2E3IA 1U06A 2O01E 2JTFA 2XIDA 2YHTA 4Q5WA 1X69A 2EAYA 3MCAB 2FPEA 5CO7A 2FPDA 2LVMA 1D09B 1B34A 1KHIA 1ZSGA 4QQDA 1VQOA 1E7OA 1F1BB 3HRSA 3C95A 2DJZA 2VGNA 1VQMQ 1H3HA 3HKSA 1VQLQ 3H9NA 1VQNT 2DFUA 3EH2A 2FPFA 3IQLA 4EMKA 2A0FB 1RACB 2K6DA 5GAMh 4PJOC 2CUDA 2ZPEB 3A5ZB 2PNIA 4BI4A 2EW3A 3MJXA 3FRNA 3EG9A 2R58A 1BKBA 2QEXQ 4ORZA 4LD6A 1UHCA 4N0AA 1TTHB 1Y07A 4F14A 5GMKh 4M75A 3OS1A 1C1AA 3OYAA 3G6ET 4XK8E 1VQ6T 1N27A 1YNZA 1XOVA 2BTTA 3JB9H 4M7AA 2AK5A 4ZNXA 3TQ7P 5DLQE 3GLXA 4CC7A 3ZBDA 1MMAA 1ZA2B 2H3EB 2OTJA 3PNWC 3FDRA 5CQYA 1VQOT 1VQ8A 2HQHA 4FIBA 2YUPA 2C06A 4JDSA 3VYGA 3QZ5B 4TVRA 2ECZA 2QDLA 5D6WA 5CQXA 2YUOA 2J6KA 2GF7A 3L2QA 1VQ5A 1M2VB 2D8JA 2FYKA 3OBWA 3QJ6A 5IAYA 1N9SA 2HEQA 1PRLC 2LZ6B 2KGTA 4Z89A 3L2VA 3CCVT 4IKFA 2LJ3A 2E41A 3JCMc 4A4KA 5A2QE 1NM7A 2WACA 3M0TA 2DTIA 5GANj 2Y90A 3QDRB 4E7JA 1TG0A 2CT3A 1OZ3A 4J9BA 1K9MR 4KGVB 3M5AA 3ASKA 2KMTA 4J8OA 1QLYA 4OVAA 3VS0A 5HY6A 1I81A 3BDLA 3V8LA 2CKKA 1YIJQ 4EMHA 2D0QB 1YJWA 2OTJT 1KQ2A 2XI9A 4PJOE 2D6FA 4Z8AA 4F7UF 5CK9A 3JCMe 4FU6A 3EFOB 4A53A 5GAN5 1QKXA 3BDUA 4QW2A 2L2PA 2M0YA 3OYLA 4M78A 3CMAT 1D0XA 4ZTFA 5GAN2 3CXCP 3ER0A 2RNAA 1H92A 5KYUA 1PD1A 1ZHIA 4J9IA 4BE0A 2X9HA 1QWFA 1UECA 2COZA 1WHKA 2QQAA 2XG8D 1QP2A 5GAMf 3E19A 3META 1VQ8Q 2ZPBB 1M90R 1GL5A 1M30A 4M7DD 1WIEA 2PU9B 3CQTA 1VQ5Q 4Y28E 5CR2A 3CCST 1YHQA 5D7UA 4JS5A 1M3AA 2RM4A 1YWPA 3CCEA 3NTKA 4M77C 1QWEA 2FL7A 2KT8A 2O9SA 4HCBA 5GAN7 2QTXA 3CPWA 5ECAA 1AHJB 4FYYB 3O8VA 1U1TA 1NLPC 4KULA 2M02A 4IURA 3NTHA 1VIEA 4KGZB 4M7DF 2C0TA 2A3LA 1BI1A 4DEYA 3EFSA 1S72A 1GRIA 3MPUB 1N9RA 4C8QD 1YJWQ 4J9CA 5LJ3g 2HAXA 1GXIE 3INZA 3OS5A 2DYIA 1E6HA 2GGRA 3JCMQ 1YI2A 3L2ZA 1BIBA 2GNCA 4LXCA 2FB7A 1ZUKA 1ZUYA 3ZFJA 3T9NA 3VYHB 4IUUA 1Q81U 1SHGA 2KRNA 3SWNB 3CCET 2QA4A 3OYBA 2EGEA 1G3TA 2KEAA 1Q81C 1X2KA 4C8QF 4LUEA 2KT1A 1EIFA 3M58A 4DBQA 1TXQA 5I2MA 3LH0A 3FB9A 3KFVA 2RJDA 4OMQA 2PVGB 1JBMA 1YHQQ 1R8OB 2YXYA 4OF1A 2VVKA 2K5IA 3VS4A 2ED0A 1K8AR 2HSEB 1NZ9A 4C92G 3X20B 3SFMA 5LJ3d 1Q86R 1K9AA 2MIOA 2DX1A 2ZPGB 2DBMA 3VS3A 1PSEA 2K79A 2XMFA 2EYXA 1M1KR 2DTOA 2EQUA 4JRPA 3OSSC 4PLLA 1JEGA 1BI0A 1K1ZA 1VQ7T 4M77E 3DB4A 1WI7A 2JNGA 3DLMA 3JCMP 2CP7A 4E7LA 3EH1A 4M4ZA 1G3SA 5CKHA 2YUQA 2FG0A 1W2BS 3EFOA 2LNVA 3OYYA 4BI8B 1Z9ZA 1S72Q 1LNXA 2KBTA 1OYXA 3UT1A 4DOVA 1PKSA 1IB8A 4WF2A 1VQKQ 4JPBW 3FC3A 2YUNA 3EHRA 3LWHA 1K0XA 1RLQC 1YI2Q 2HDAA 2YLBA 3C0CA 1Y71A 5I21A 1FMKA 4C5EA 1OULA 2DETA 2NLUA 2RJEA 4J6YA 1R0BG 4EIKA 5DM7R 2NUTB 1ZBJA 3CCJA 5KE2A 2G6FX 5AT1B 3FEOA 5LJ3h 3TEEA 3L2RA 2E3HA 4AFUC 1Q7YR 1ZX6A 1LVKA 5I22A 2QA4Q 2QQRA 4M7AD 4QT7A 1OX9A 1ZQ1A 3CBMA 3I56A 1MGQA 4Z02A 3PVLA 3KXTA 3CC4T 1RI9A 2K2VA 1JQQA 3A8MB 4A54A 1NG2A 3OW2P 1GCQA 4ZN1A 3CMEA 1QVFS 1UGSB 4QVZA 4OGCA 4EMGA 5C0MA 5GMKl 2ROLA 1X43A 3MEVA 5GMKm 2EPDA 1B3QA 2O2OA 2K5FA 4ZGEB 4OB1B 2CGHA 3LLRA 2J6FA 4M7AF 3HFOA 1N6AA 3VRYA 1M3CA 3M53A 4PJNA 2HMAA 4XQ3A 4JUVA 2KE9A 3OYHA 2D9TA 2YRDA 4BY6B 1SRMA 1IRXA 3PIOA 2DYBA 1KQ1A 1JXOA 4HKEA 2R5AA 1AWWA 3QHSA 4PJOB 3VU3C 4P5NA 5I2SA 1KQSS 5GAMj 4FYXB 5FU7C 4C0DB 3DB3A 1YITA 3SWNA 2R57A 3JCMV 1JXMA 3M0UA 1M8MA 2KXDA 2L3PA 4A4GA 3SHWA 3CC7A 2DPPB 1T0HA 2YRCA 3TSZA 3CCJQ 4HVUA 1H641 1SPKA 2NUPB 4QQ6A 3EG9B 2L8DA 2LCLA 1HK9A 2K9GA 3CMET 2CS7A 2LQ8A 4J9HA 3PTAA 1YJ9T 3FLGA 2LP5A 5LJ5g 3OYIA 3FIFA 3G71T 2RI3A 2K3YA 2VWFA 2DERA 4J7FA 1PG5B 3I56Q 1M90U 2L3SA 2QTVA 1WHGA 5A0DA 3CCQT 2HBWA 1UGPB 4KT0E 3CCUT 4KH0B 1M90C 3CCLA 3A1PA 4O6JA 4WTOB 2RN8A 2MOXA 3QO3A 1QMCA 3U23A 2WSEE 4A63B 1IGUA 3NHNA 2K4YA 3AT1B 3CC2T 4PFZA 1PC0A 3JCMX 1KHCA 4M7DC 5LJ3f 4R0KA 4DQ2A 1QCFA 4LUDA 5IHIA 5FU6C 2MWOA 5GMKi 4OMFB 2ZZDA 1OX8A 3RESA 1EFNA 3GOXA 1D0ZA 2LNHB 4AT1B 3S3OA 2QGGA 1Y0MA 2NUTA 1M9SA 2RJFA 2CP0A 1SSFA 4M78G 2ROTA 1YITQ 3EAEA 4RTTA 5IT9E 1G5VA 3Q1JA 4JRKA 2XDBA 4F7UE 1UGRB 2ZPFB 3G4ST 1VQNA 3MEAA 4HCCA 2EIFA 2EGAA 2E6ZA 1JJ2S 1MMGA 2B8AA 1SSHA 3EHQA 4C8QC 1OEBA 3VUZA 5HK3A 1VOMA 4L6V5 4FSSA 1QCNA 2DL5A 1UB4A 1IREB 2IIMA 2EQIA 1SF9A 1GFCA 3H6ZA 1FX7A 1EZZB 1OOTA 3BE3A 3CXCA 3CCMT 3EGDB 2X4WA 4B9WA 3G6EA 1VQ6A 3L42A 3BY7A 3RNJA 4R56A 5LJ5h 4B6MA 2LCCA 4HA8A 3CCLQ 1UTIA 3WVDB 1JU5C 4E47A 2F2VA 5DLOA 2AHJB 1X6GA 1VQMT 2QYZA 1K8AU 3M0QA 4PJOA 3M59A 4BACA 2JJ9A 3FJ5A 2DRMA 3WVEB 2P0QA 4L59A 2CZ7B 4A4EA 1K8AC 2X4XA 4X1VA 4M7DE 3UATA 2RA2A 4RTVA 4D8DA 2DK3A 2DXUA 2QDYB 3I35A 2A36A 2I0NA 2NUPA 3UF4A 2MAMA 4JZ4A 4AG2C 3CCVA 1RLPC 5M9OA 1UGQB 3SD4A 2OJ2A 2OTLT 2QAZA 1MNDA 3M9QA 3GIBA 1W2BA 4HVWA 3THKA 2GTOA 1NYFA 1ZSZB 2LMJA 5GAN4 1BB9A 2YLCA 3PE0A 3UWNA 5FLXE 2DL4A 1NJIR 3URGA 3VS2A 3EG0A 4EMKC 4BD3A 2KQWA 3MP1A 2P84A 1QVPA 4FL6A 2PUKB 1TUDA 2K3XA 4BB7A 1AWJA 1Q7YU 4BE1A 2DZCA 1W70A 3M54A 4C8QE 4BI3A 4PFPA 2QQ9A 1B7TA 1SEMA 1K4US 2JM8A 1Q7YC 3CBPA 4ZGJB 1OU8A 4J83A 4N0AC 3CMAA 2KI7A 1WJRA 1O75A 3CD6T 4M7AC 2V26A 1BCMA 2BZXA 1FXXA 2AIRB 1UGVA 1VQOQ 3QSUA 2KR3A 2EYZA 1ARKA 3CBOA 1YJNT 3ZEHA 4DOWA 4AG1C 1QVFA 4OB3B 1JRIA 4N4GA 1K73R 2RHUA 3OMCA 3OYCA 3RMSA 1Q82U 4OGEA 4OMLA 3CCSA 3SDZA 2CT4A 2ZPHB 1NEBA 2J6OA 3V7RA 4B9XA 2XD0A 1V76A 3R6NA 1Q82C 3OYNA 3I55T 3CCVQ 1KJWA 1UE9A 4GY5A 1VYTA 1YCSB 3H41A 2FO0A 4RTWA 5LJ5f 4A4FA 1UDLA 2FRWA 2C0IA 1G3YA 5CAIA 4XU1A 1MHNA 2XU8A 1N8RR 3JCMg 2V8JA 1KIKA 3HL8A 4LDUA 3JCMJ 4CC4B 3EGDA 2G3RA 3S3MA 3QUIA 2JM9A 4RCCA 5KE3A 2SEMA 6AT1B 3A8OB 3QBYA 2OTJQ 3ULRB 3G7ZA 5LJ3j 2DBKA 3P8HA 3CCRT 2F1LA 4C5IA 2QQBA 3A8HB 2WSFE 2L89A 4ZN3A 2KNBB 2CDTA 3CMAQ 1R77A 4KUDK 4JJNK 2QG9B 2QGFB 3HRTA 4XU3A 4QKUA 4JJBA 1Y96B 5GANe 3PT9A 2DIQA 1JO8A 1HD3A 3QZ9B 2DNUA 4R55A 3P8DA 1VQPA 3UPUA 4X34A 3OW2A 5KYXA 4M7AE 4QVCA 4RKUE 3QWXX 3JCMd 3OYKA 1JB0E 3BW1A 3CCSQ 4FW2A 2P4TA 1W2BP 3M4GA 5D6YA 3ZL7C 1ZSZA 3V8JA 4E7ZA 2K3BA 2KROA 1NPPA 2YWWA 4PJLA 3LX7A 4C92D 3LH5A 4O5VA 1BK2A 3GF5A 2IG0A 2XHCA 3TVTA 2K2MA 1QVGS 1YWOA 2DAQA 2HCKA 1M3BA 1HSQA 2O31A 1MMNA 1VQ7A 1D0YA 4ESRA 2BZYA 4ELYC 3DLLA 2EVRA 4CRIA 1H8KA 5IXBA 4JRIA 2DO3A 1AT1B 2KYMA 2V1QA 3UDCA 3PGGA 5GAN6 3JV3A 5HCKA 2XICA 9ATCB 1VQPT 3JCMh 2EFIA 4C92F 3R6OA 2M1HA 3OA6A 3A8LB 5J3BA 2A28A 3M0PA 1CSKA 2GTJA 1CKBA 4XTVA 2I2LA 2O9VA 5KYNA 5IXFA 4FYWB 3VRZA 1WHJA 3VS6A 3LGFA 4OMNA 1QVFP 1GBQA 4Z88A 4DBRA 2DD4A 3CCEQ 1RAFB 2EJGA 1RADB 4MDWA 1BI2A 5IN1A 5FWBA 2D8HA 3M0RA 3O5ZA 3DKMA 1TSFA 4ANJA 3UA6A 4JJCA 4KUIA 2ENMA 3QYHB 3MKDA 2FHDA 3CC4A 1U8RA 1ABOA 4OMPA 5L8RE 1WJQA 4RTYA 1WJSA 2KRMA 2CUBA 2Y4XA 2ZGWA 3PFSA 1OI1A 2E5KA 1IO6A 5KCHA 2EBPA 2KY9A 5HK0A 1KQSP 8ATCB 1VQ9T 1KFZA 1I1JA 3REBB 1AOJA 1D1BA 1PHTA 2L3RA 2QI2A 3RIRA 3KUFA 4CC3A 1XTDA 1OU9A 4RTUA 1VQ7Q 4DA4A 4WCIA 2VB6A 3QWYA 1W6XA 3VS1A 1RUWA 2V8KA 1K76A 1NJIU 1WDXA 4M75D 4E7SA 4KRTA 2DVJA 2R5MA 2LX9A 4RTZA 3RR6A 2PTKA 5GJWB 1Y96A 2HKNA 2OX7A 2LX7A 1FMVA 1AZEA 2W0ZA 1UHFA 4VUBA 1NJIC 4IUPA 1UFFA 3OYMA 2YT6A 1LOJA 2KSSA 1WQ7A 2AKKA 4PJOG 3M56A 1Q95G 1PWTA 3E1SA 4AFQC 3MP8A 1IHWA 3KBGA 1D1AA 1U1SA 3TCJA 5KH6A 3L2UA 1HXDA 3JB9G 4RCBA 3OYEA 3H0FA 3P8BB 5C6SA 1YJ9A 2E64A 3EG1A 2YDLA 1PM3A 4C5HA 2KVQG 3V7SA 3G71A 2CSIA 5LJ5j 1AWXA 4M75F 3GNGA 2CH4W 2JUFA 3VJPA 1M1GA 4F7UA 1KD1R 5FWCA 3RKXA 4JLIA 3CC4Q 1MMDA 3CCQA 2KXCA 4NOYA 3JCMf 3CCUA 1WHMA 1NE8A 1K9MU 3D7SB 1K0SA 1NEGA 2BUDA 4BUGA 1M2OA 1U5SA 4JLGA 2E12A 2C0OA 3MEUA 4BE2A 3CC2A 2DIGA 1SKUB 1K9MC 3VV0A 2MMPA 3VS7A 1HYOA 3HRUA 2A7YA 3HFNA 4MZTA 1M4ZA 3REAB 4F17A 2ATCB 1SHFA 2DA9A 3J80E 3SB2A 2RI5A 3OS0A 1N8RU 2DD5A 5CKDA 1X75C 5GMKj 4RMOA 2GCXA 2LC4A 1PNJA 1WXBA 1AD5A 2MF2A 1PSFA 4M78D 2JT4A 1N8RC 2HBPA 3I5RA 5FRMA 4E7IA 1FMWA 3G4SA 3SWNC 2DZ9A 3JRZA 3J7AF 3TSWA 2XKOC 3GPLA 1TWBA 1VQ4T 2QASA 4PJMA 1WHHA 4C0FA 4DBFA 2V8IA 3CMEQ 2ZAEA 2O4XB 3X25B 2GBQA 2HNIA 1XJWB 3E9FA 5GAOp 1WZOA 3PMTA 2KAFA 4IIOA 4RG2A 2EYWA 4LN2A 2LQNA 2RB6A 3G71Q 2RPNA 5GAOn 2NUZA 4M78F 3CCMA 4PFOA 1VIFA 5GAMe 3CPWS 3LW5E 2RO0A 3CCQQ 2KK4A 2RHYA 2VGMA 1UEBA 1YBYA 4C0ZA 2EYYA 1RABB 4HT9A 3OMGA 2NWMA 2DF6A 2GFUA 5FW9A 4E6RA 3TU4K 2V1RA 4HCKA 2DJQA 1VQMA 1IXDA 2ZCFB 3CC2Q 2QXFA 3RBBB 3M0SA 3C4SA 5GMKe 2DXCA 4C8QA 4KBMB 2FZKB 2CZ1B 3CC7Q 3H0IA 4V2SA 1NPRA 1VYUA 4GBQA 5AYFA 2OAWA 1RAAB 2RK2A 4ME7A 1B07A 3EFRA 4IUVA 2FVUA 2HQEA 4J9EA 1QVGA 4M77G 2ABLA 4C92C 1E6GA 4RUGA 4II1A 2KYBA 5GAOq 2OAUA 4ATOA 1X6OA 2LJ1A 2Y4YA 4YTLA 3NFCA 7AT1B 2OTLA 3QJYA 1ZLMA 2LQWA 2RD1A 3OYGA 2E4HA 3OYDA 5DY9A 3G4SQ 4LD9K 4LNPA 3QYGB 4KGXB 4NL2A 2DEQA 5I11A 2JXBA 2VV5A 2PVDB 2X3WD 1M8VA 3FJPA 1X27A 2LDMA 2MK5A 5CCAA 2RHIA 5GAOr 2X51A 1VQLT 3EGXB 1PKTA 4M77B 1Q86U 3QIIA 2COWA 2MYSA 1YP5A 3CCMQ 1M1KU 5IH2A 3AHUA 2F5KA 1UJYA 1Q86C 2COYA 4C0GA 2RQVA 2QEXT 4FCYA 3JB9J 3QPHA 1M1KC 3CD6A 3GBQA 1EX4A 2DMOA 2ZPIB 4K11A 1MV0B 5KYXB 4AMCA 2PQWA 1U3OA 1V1CA 4BY6C 2FEIA 2HKQB 2RQUA 4PK4A 1YJNA 2YSQA 1NBEB 2HD0A 1KSWA 1VQNQ 3V7CA 5KCOA 2MI6A 2DVEA 1X2QA 1R0CB 1YN8A 2F2WA 4C0DC 1YIJA 1OQKA 3C12A 2M16A 4PJJA 1BU1A 3OBYA 1UUEA 4MMKA 4FW1A 2SRCA 1D1CA 4N4HA 1I07A 2PVOB 5J26A 2CH4A 3I55A 3TREA 1BIAA 4IIMA 2O4XA 1I5OB 2IPOB 2JMAA 4RG8A 1G2BA 2VUBA 2OTLQ 5GAN3 2E6NA 4ZGDB 3EG2A 4C92E 2M51A 2FZGB 4L5GA 4EPCA 3G6EQ 1VQ6Q 2LT1A 1WGSA 1I4K1 4ZTJA 2VKNA 4JS4A 4M75C 3G1JA 3ME9A 2X4JA 1TOVA 1T0JA 2E65A 2JW4A 4XAXB 1AWOA 3CCRA 3JSCA 4PL6A 2X3XD 1T3SA 3S6WA 2HL3A 4Y91A 2X35A 2JS2A 1KK7A 1D3BB 3GNFB 1KD1U 2DE0X 2BKDN 2QQSA 4AFSC 3RKWA 1YIJT 2GQVA 1WLPB 3HHTB 3CD6Q 1KD1C 2EJ9A 2L5QA 1UJ0A 2EYQA 1QVGP 4XTUA 2BZ8A 1YJNQ 1Z9QA 3V8KA 4BDZA 2CP3A
chains in the Genus database with same CATH topology
1YJWQ 1K73R 2QEXQ 3CC7Q 1K9MR 1Q81R 1VQ7Q 3CCQQ 1VQ4Q 3CMEQ 1N8RR 3G4SQ 1QVFP 3CCRQ 1VQMQ 1K8AR 3CCUQ 1KD1R 1Q82R 1VQLQ 3CCEQ 3CXCP 1YJ9Q 3CCMQ 1Q86R 1S72Q 1VQ5Q 3CPWP 1YIJQ 3CD6Q 3CMAQ 2OTLQ 3OW2P 1VQOQ 1KQSP 3G71Q 3CC4Q 1VQNQ 3CCVQ 1Q7YR 3I56Q 3CCSQ 1YITQ 1VQKQ 3CCLQ 1W2BP 1VQPQ 1M1KR 3CC2Q 3CCJQ 2QA4Q 1YI2Q 1VQ9Q 2OTJQ 3I55Q 1JJ2P 1QVGP 3G6EQ 1VQ8Q 1VQ6Q 1NJIR 1YJNQ 1M90R 1YHQQ 1KC8R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW Q;  1K73 R;  2QEX Q;  3CC7 Q;  1K9M R;  1Q81 R;  1VQ7 Q;  3CCQ Q;  1VQ4 Q;  3CME Q;  1N8R R;  3G4S Q;  1QVF P;  3CCR Q;  1VQM Q;  1K8A R;  3CCU Q;  1KD1 R;  1Q82 R;  1VQL Q;  3CCE Q;  3CXC P;  1YJ9 Q;  3CCM Q;  1Q86 R;  1S72 Q;  1VQ5 Q;  3CPW P;  1YIJ Q;  3CD6 Q;  3CMA Q;  2OTL Q;  3OW2 P;  1VQO Q;  1KQS P;  3G71 Q;  3CC4 Q;  1VQN Q;  3CCV Q;  1Q7Y R;  3I56 Q;  3CCS Q;  1YIT Q;  1VQK Q;  3CCL Q;  1W2B P;  1VQP Q;  1M1K R;  3CC2 Q;  3CCJ Q;  2QA4 Q;  1YI2 Q;  1VQ9 Q;  2OTJ Q;  3I55 Q;  1JJ2 P;  1QVG P;  3G6E Q;  1VQ8 Q;  1VQ6 Q;  1NJI R;  1YJN Q;  1M90 R;  1YHQ Q;  1KC8 R; 
#chains in the Genus database with same CATH topology
 1WYX A;  4HXJ A;  3HTR A;  2E5Q A;  4OB2 B;  1KQS A;  3PMI A;  4HVV A;  2DEU A;  1TUC A;  2LTO A;  3VKI A;  1X6B A;  2K5L A;  1ZUU A;  1VQ8 T;  2CP5 A;  1WQW A;  3I55 Q;  3HP9 A;  4MML A;  1KC8 R;  2BIV A;  5CKE A;  1XNI A;  2VXE A;  1VQ5 T;  1X01 A;  4LDY A;  1LCK A;  2LRQ A;  2HL5 C;  4PLI A;  2X4Y A;  3EGX A;  4M77 A;  2YRV A;  2P0K A;  2E1H A;  4F7U G;  1IHV A;  2QK0 A;  4EDU A;  4QQG A;  5FRN A;  1VUB A;  4M78 C;  4NS5 A;  2VYT A;  1BYM A;  5D6X A;  2CP6 A;  5GAN g;  3L1A A;  2XDD A;  1WA7 A;  4M75 E;  3CCR Q;  1W4S A;  2JVV A;  2H3J A;  2GQI A;  5IHN A;  3RDV A;  2P0P A;  3PVQ A;  2EKO A;  1YJW T;  2KDS A;  4F7U B;  2VAS A;  3X24 B;  1WXT A;  1OZ2 A;  1CKA A;  5FU7 B;  2RQR A;  2M9U A;  5CKF A;  2HSP A;  3LWI A;  4OB0 B;  4OMM A;  3RMQ A;  5EC7 A;  5LJ3 e;  4E2F B;  1G83 A;  3RKY A;  4PNO A;  2EQK A;  2JMC A;  4XTX A;  3MO8 A;  3N5B B;  1VQK A;  3JAM E;  1YFN A;  4RTX A;  1W1F A;  3E9G A;  1VQ9 A;  5GAN d;  1TS9 A;  2Z0W A;  4M7D G;  2CP2 A;  1ZSZ C;  2CZ6 B;  2MPX C;  4MZP A;  1M27 C;  1JJ2 A;  1C0M A;  2DKG A;  3I5S A;  3JB9 I;  4XTY A;  3MHX A;  1TU0 B;  1YHQ T;  3CXC S;  2RF0 A;  5GAO l;  1WHL A;  5GAO m;  1PCX A;  2DL7 A;  2DTH A;  1TH7 A;  1OPL A;  1M2V A;  1LJO A;  1FYN A;  5GJV B;  3E2U A;  5HKC A;  2PZ1 A;  4LDW A;  4J6W A;  1D3B A;  1QKW A;  2AZS A;  4JZ3 A;  4DBH A;  2RK1 A;  1G3W A;  4J5Y A;  1GBR A;  2F5T X;  4J6X A;  1G8X A;  2CSQ A;  5KYY B;  4J9F A;  1VQP Q;  2PUO B;  3M55 A;  2D1X A;  4M78 E;  1ABQ A;  4M7D B;  2RMO A;  1ZA1 B;  2RI2 A;  4F04 B;  5FU6 B;  2DRK A;  4PJO D;  2FZC B;  1S72 T;  3LYI A;  1WXU A;  4C8Q G;  2VXF A;  1O9S A;  3A8G B;  1S1N A;  4IUQ A;  1I5L A;  4XTW A;  2DL3 A;  2EKH A;  5GAN h;  3JB9 D;  2LQK A;  1VQK T;  1AZG B;  5FRO A;  2K57 A;  3NMZ C;  4MZM A;  1YI2 T;  4OMO A;  2A08 A;  1M5Q 1;  3MP6 A;  3QKJ A;  2KRS A;  1XQH A;  3H0H A;  3PIP A;  2H8H A;  2E70 A;  2XK0 A;  2AZV A;  2RH2 A;  4FM4 B;  4PKC C;  2HQX A;  1WPY A;  2QA4 T;  5GAN 8;  2JZ2 A;  5CKB A;  4PJO F;  3EGU A;  2JTE A;  4AFZ C;  1V29 B;  4J9D A;  3HPW A;  4JRQ A;  3I9Q A;  5A0G A;  1VQ9 Q;  4C8Q B;  4X9D A;  4C92 B;  3JB9 F;  3X26 B;  1QCO A;  1M1F A;  5EG2 A;  2W10 A;  2JTM A;  4D6W A;  1KG1 A;  3MEW A;  4HT8 A;  2DIL A;  1RAG B;  5KYW B;  3M4Y A;  3X28 B;  2RHX A;  2AT1 B;  1YCY A;  2E10 A;  3OS2 A;  2EGC A;  1RAI B;  4J9G A;  2CYZ B;  1H3Z A;  2JS0 A;  3L2W A;  2DL8 A;  2CRE A;  1ACM B;  3A98 A;  4FT2 A;  1OV3 A;  2F69 A;  2OI3 A;  1IZ6 A;  5J39 A;  1FWZ A;  2ED1 A;  1I8F A;  3CPW P;  4CC2 A;  1GFD A;  2RHZ A;  4ELZ C;  1WNL A;  2JOY A;  2EJF A;  1VQ4 A;  4LE9 A;  2P4R A;  4UC4 A;  5CIU A;  1T3L A;  1K73 U;  1ZBX A;  3OB9 A;  2D0N A;  2ESW A;  3BFM A;  4FT4 A;  2FRY A;  3WXM B;  4A4H A;  1QW1 A;  4CI0 C;  1GCQ C;  4N4I A;  1NYG A;  1Q82 R;  1K73 C;  5CVI A;  5LL6 S;  1NLO C;  2RQT A;  1AVZ C;  3CCJ T;  2GFA A;  1SRL A;  2JN0 A;  1B34 B;  3VUB A;  1QP3 A;  4XTZ A;  1DJ7 B;  4M75 G;  2B86 A;  1JJ2 P;  1MV3 A;  2DXB A;  3CEY A;  2LJ0 A;  4M7A G;  4QVD A;  4GLK A;  4E7H A;  2RQW A;  1P92 A;  1N5Z A;  4FSX A;  4IUT A;  4D8K A;  4EMK B;  3OYJ A;  1VA7 A;  1Y57 A;  3I56 T;  1MNE A;  3NPF A;  5GAN f;  1BI3 A;  2IVW A;  3JCM b;  1IGQ A;  1SG5 A;  2BE9 B;  1TUG B;  1KC8 U;  5KYY A;  3QDF A;  5A0L A;  2RJC A;  5LJ5 e;  2J05 A;  2EQM A;  1RL2 A;  4GLM A;  1HJD A;  4M7D A;  4OP0 A;  3S3N A;  1KC8 C;  2L0A A;  2MCN A;  1YJ9 Q;  4M77 D;  4M75 B;  2HZY A;  4FYV B;  4M7A B;  3J81 E;  3JCM W;  3LGL A;  3HSB A;  4XU2 A;  1RAE B;  4E7K A;  4DEX A;  3OYF A;  3RER A;  1GCP A;  3NGP A;  1WFW A;  4XU0 A;  3QG1 A;  3UA7 A;  4BDY A;  4X9C A;  3OW2 S;  8AT1 B;  1WX6 A;  1VQ4 Q;  1BBZ A;  1RAH B;  5GAM g;  3CCU Q;  1AEY A;  2VC8 A;  3C94 A;  3OY9 A;  1YIT T;  2L3Q A;  2M0O A;  3SEM A;  4JJD A;  3GP8 A;  1A0N B;  1VYV A;  1VQL A;  2MWP A;  3M57 A;  3CC7 T;  4M77 F;  1RI0 A;  1Y7X A;  2LT4 A;  4C92 A;  1J3T A;  2EQJ A;  4HCZ A;  4Y92 A;  3RUX A;  3EG3 A;  2DXT A;  3H8Z A;  2F2X A;  2A37 A;  2J06 A;  3OQ5 A;  5LJ5 d;  2XDP A;  5KYW A;  1MUZ A;  2QEX A;  4KH1 B;  1OPK A;  4LDX A;  1QQJ A;  4MDX A;  1LPL A;  1UG1 A;  1PRM C;  3CPF A;  1Q81 R;  2DLP A;  3QXE B;  5L23 A;  3VS5 A;  2DM1 A;  1PD0 A;  3F70 A;  4C5G A;  1I0C A;  2NYS A;  2AKL A;  3CCL T;  3NTI A;  2J7I A;  5IHK A;  5GAM d;  4NL3 A;  1C6V X;  2EWN A;  3OSV A;  2WSC E;  4J7I A;  2K7A A;  2BE7 D;  2LCS A;  4LDV A;  1BCO A;  4M78 B;  2CZ0 B;  2O88 A;  4F16 A;  5KYU B;  2E3I A;  1U06 A;  2O01 E;  2JTF A;  2XID A;  2YHT A;  4Q5W A;  1X69 A;  2EAY A;  3MCA B;  2FPE A;  5CO7 A;  2FPD A;  2LVM A;  1D09 B;  1B34 A;  1KHI A;  1ZSG A;  4QQD A;  1VQO A;  1E7O A;  1F1B B;  3HRS A;  3C95 A;  2DJZ A;  2VGN A;  1VQM Q;  1H3H A;  3HKS A;  1VQL Q;  3H9N A;  1VQN T;  2DFU A;  3EH2 A;  2FPF A;  3IQL A;  4EMK A;  2A0F B;  1RAC B;  2K6D A;  5GAM h;  4PJO C;  2CUD A;  2ZPE B;  3A5Z B;  2PNI A;  4BI4 A;  2EW3 A;  3MJX A;  3FRN A;  3EG9 A;  2R58 A;  1BKB A;  2QEX Q;  4ORZ A;  4LD6 A;  1UHC A;  4N0A A;  1TTH B;  1Y07 A;  4F14 A;  5GMK h;  4M75 A;  3OS1 A;  1C1A A;  3OYA A;  3G6E T;  4XK8 E;  1VQ6 T;  1N27 A;  1YNZ A;  1XOV A;  2BTT A;  3JB9 H;  4M7A A;  2AK5 A;  4ZNX A;  3TQ7 P;  5DLQ E;  3GLX A;  4CC7 A;  3ZBD A;  1MMA A;  1ZA2 B;  2H3E B;  2OTJ A;  3PNW C;  3FDR A;  5CQY A;  1VQO T;  1VQ8 A;  2HQH A;  4FIB A;  2YUP A;  2C06 A;  4JDS A;  3VYG A;  3QZ5 B;  4TVR A;  2ECZ A;  2QDL A;  5D6W A;  5CQX A;  2YUO A;  2J6K A;  2GF7 A;  3L2Q A;  1VQ5 A;  1M2V B;  2D8J A;  2FYK A;  3OBW A;  3QJ6 A;  5IAY A;  1N9S A;  2HEQ A;  1PRL C;  2LZ6 B;  2KGT A;  4Z89 A;  3L2V A;  3CCV T;  4IKF A;  2LJ3 A;  2E41 A;  3JCM c;  4A4K A;  5A2Q E;  1NM7 A;  2WAC A;  3M0T A;  2DTI A;  5GAN j;  2Y90 A;  3QDR B;  4E7J A;  1TG0 A;  2CT3 A;  1OZ3 A;  4J9B A;  1K9M R;  4KGV B;  3M5A A;  3ASK A;  2KMT A;  4J8O A;  1QLY A;  4OVA A;  3VS0 A;  5HY6 A;  1I81 A;  3BDL A;  3V8L A;  2CKK A;  1YIJ Q;  4EMH A;  2D0Q B;  1YJW A;  2OTJ T;  1KQ2 A;  2XI9 A;  4PJO E;  2D6F A;  4Z8A A;  4F7U F;  5CK9 A;  3JCM e;  4FU6 A;  3EFO B;  4A53 A;  5GAN 5;  1QKX A;  3BDU A;  4QW2 A;  2L2P A;  2M0Y A;  3OYL A;  4M78 A;  3CMA T;  1D0X A;  4ZTF A;  5GAN 2;  3CXC P;  3ER0 A;  2RNA A;  1H92 A;  5KYU A;  1PD1 A;  1ZHI A;  4J9I A;  4BE0 A;  2X9H A;  1QWF A;  1UEC A;  2COZ A;  1WHK A;  2QQA A;  2XG8 D;  1QP2 A;  5GAM f;  3E19 A;  3MET A;  1VQ8 Q;  2ZPB B;  1M90 R;  1GL5 A;  1M30 A;  4M7D D;  1WIE A;  2PU9 B;  3CQT A;  1VQ5 Q;  4Y28 E;  5CR2 A;  3CCS T;  1YHQ A;  5D7U A;  4JS5 A;  1M3A A;  2RM4 A;  1YWP A;  3CCE A;  3NTK A;  4M77 C;  1QWE A;  2FL7 A;  2KT8 A;  2O9S A;  4HCB A;  5GAN 7;  2QTX A;  3CPW A;  5ECA A;  1AHJ B;  4FYY B;  3O8V A;  1U1T A;  1NLP C;  4KUL A;  2M02 A;  4IUR A;  3NTH A;  1VIE A;  4KGZ B;  4M7D F;  2C0T A;  2A3L A;  1BI1 A;  4DEY A;  3EFS A;  1S72 A;  1GRI A;  3MPU B;  1N9R A;  4C8Q D;  1YJW Q;  4J9C A;  5LJ3 g;  2HAX A;  1GXI E;  3INZ A;  3OS5 A;  2DYI A;  1E6H A;  2GGR A;  3JCM Q;  1YI2 A;  3L2Z A;  1BIB A;  2GNC A;  4LXC A;  2FB7 A;  1ZUK A;  1ZUY A;  3ZFJ A;  3T9N A;  3VYH B;  4IUU A;  1Q81 U;  1SHG A;  2KRN A;  3SWN B;  3CCE T;  2QA4 A;  3OYB A;  2EGE A;  1G3T A;  2KEA A;  1Q81 C;  1X2K A;  4C8Q F;  4LUE A;  2KT1 A;  1EIF A;  3M58 A;  4DBQ A;  1TXQ A;  5I2M A;  3LH0 A;  3FB9 A;  3KFV A;  2RJD A;  4OMQ A;  2PVG B;  1JBM A;  1YHQ Q;  1R8O B;  2YXY A;  4OF1 A;  2VVK A;  2K5I A;  3VS4 A;  2ED0 A;  1K8A R;  2HSE B;  1NZ9 A;  4C92 G;  3X20 B;  3SFM A;  5LJ3 d;  1Q86 R;  1K9A A;  2MIO A;  2DX1 A;  2ZPG B;  2DBM A;  3VS3 A;  1PSE A;  2K79 A;  2XMF A;  2EYX A;  1M1K R;  2DTO A;  2EQU A;  4JRP A;  3OSS C;  4PLL A;  1JEG A;  1BI0 A;  1K1Z A;  1VQ7 T;  4M77 E;  3DB4 A;  1WI7 A;  2JNG A;  3DLM A;  3JCM P;  2CP7 A;  4E7L A;  3EH1 A;  4M4Z A;  1G3S A;  5CKH A;  2YUQ A;  2FG0 A;  1W2B S;  3EFO A;  2LNV A;  3OYY A;  4BI8 B;  1Z9Z A;  1S72 Q;  1LNX A;  2KBT A;  1OYX A;  3UT1 A;  4DOV A;  1PKS A;  1IB8 A;  4WF2 A;  1VQK Q;  4JPB W;  3FC3 A;  2YUN A;  3EHR A;  3LWH A;  1K0X A;  1RLQ C;  1YI2 Q;  2HDA A;  2YLB A;  3C0C A;  1Y71 A;  5I21 A;  1FMK A;  4C5E A;  1OUL A;  2DET A;  2NLU A;  2RJE A;  4J6Y A;  1R0B G;  4EIK A;  5DM7 R;  2NUT B;  1ZBJ A;  3CCJ A;  5KE2 A;  2G6F X;  5AT1 B;  3FEO A;  5LJ3 h;  3TEE A;  3L2R A;  2E3H A;  4AFU C;  1Q7Y R;  1ZX6 A;  1LVK A;  5I22 A;  2QA4 Q;  2QQR A;  4M7A D;  4QT7 A;  1OX9 A;  1ZQ1 A;  3CBM A;  3I56 A;  1MGQ A;  4Z02 A;  3PVL A;  3KXT A;  3CC4 T;  1RI9 A;  2K2V A;  1JQQ A;  3A8M B;  4A54 A;  1NG2 A;  3OW2 P;  1GCQ A;  4ZN1 A;  3CME A;  1QVF S;  1UGS B;  4QVZ A;  4OGC A;  4EMG A;  5C0M A;  5GMK l;  2ROL A;  1X43 A;  3MEV A;  5GMK m;  2EPD A;  1B3Q A;  2O2O A;  2K5F A;  4ZGE B;  4OB1 B;  2CGH A;  3LLR A;  2J6F A;  4M7A F;  3HFO A;  1N6A A;  3VRY A;  1M3C A;  3M53 A;  4PJN A;  2HMA A;  4XQ3 A;  4JUV A;  2KE9 A;  3OYH A;  2D9T A;  2YRD A;  4BY6 B;  1SRM A;  1IRX A;  3PIO A;  2DYB A;  1KQ1 A;  1JXO A;  4HKE A;  2R5A A;  1AWW A;  3QHS A;  4PJO B;  3VU3 C;  4P5N A;  5I2S A;  1KQS S;  5GAM j;  4FYX B;  5FU7 C;  4C0D B;  3DB3 A;  1YIT A;  3SWN A;  2R57 A;  3JCM V;  1JXM A;  3M0U A;  1M8M A;  2KXD A;  2L3P A;  4A4G A;  3SHW A;  3CC7 A;  2DPP B;  1T0H A;  2YRC A;  3TSZ A;  3CCJ Q;  4HVU A;  1H64 1;  1SPK A;  2NUP B;  4QQ6 A;  3EG9 B;  2L8D A;  2LCL A;  1HK9 A;  2K9G A;  3CME T;  2CS7 A;  2LQ8 A;  4J9H A;  3PTA A;  1YJ9 T;  3FLG A;  2LP5 A;  5LJ5 g;  3OYI A;  3FIF A;  3G71 T;  2RI3 A;  2K3Y A;  2VWF A;  2DER A;  4J7F A;  1PG5 B;  3I56 Q;  1M90 U;  2L3S A;  2QTV A;  1WHG A;  5A0D A;  3CCQ T;  2HBW A;  1UGP B;  4KT0 E;  3CCU T;  4KH0 B;  1M90 C;  3CCL A;  3A1P A;  4O6J A;  4WTO B;  2RN8 A;  2MOX A;  3QO3 A;  1QMC A;  3U23 A;  2WSE E;  4A63 B;  1IGU A;  3NHN A;  2K4Y A;  3AT1 B;  3CC2 T;  4PFZ A;  1PC0 A;  3JCM X;  1KHC A;  4M7D C;  5LJ3 f;  4R0K A;  4DQ2 A;  1QCF A;  4LUD A;  5IHI A;  5FU6 C;  2MWO A;  5GMK i;  4OMF B;  2ZZD A;  1OX8 A;  3RES A;  1EFN A;  3GOX A;  1D0Z A;  2LNH B;  4AT1 B;  3S3O A;  2QGG A;  1Y0M A;  2NUT A;  1M9S A;  2RJF A;  2CP0 A;  1SSF A;  4M78 G;  2ROT A;  1YIT Q;  3EAE A;  4RTT A;  5IT9 E;  1G5V A;  3Q1J A;  4JRK A;  2XDB A;  4F7U E;  1UGR B;  2ZPF B;  3G4S T;  1VQN A;  3MEA A;  4HCC A;  2EIF A;  2EGA A;  2E6Z A;  1JJ2 S;  1MMG A;  2B8A A;  1SSH A;  3EHQ A;  4C8Q C;  1OEB A;  3VUZ A;  5HK3 A;  1VOM A;  4L6V 5;  4FSS A;  1QCN A;  2DL5 A;  1UB4 A;  1IRE B;  2IIM A;  2EQI A;  1SF9 A;  1GFC A;  3H6Z A;  1FX7 A;  1EZZ B;  1OOT A;  3BE3 A;  3CXC A;  3CCM T;  3EGD B;  2X4W A;  4B9W A;  3G6E A;  1VQ6 A;  3L42 A;  3BY7 A;  3RNJ A;  4R56 A;  5LJ5 h;  4B6M A;  2LCC A;  4HA8 A;  3CCL Q;  1UTI A;  3WVD B;  1JU5 C;  4E47 A;  2F2V A;  5DLO A;  2AHJ B;  1X6G A;  1VQM T;  2QYZ A;  1K8A U;  3M0Q A;  4PJO A;  3M59 A;  4BAC A;  2JJ9 A;  3FJ5 A;  2DRM A;  3WVE B;  2P0Q A;  4L59 A;  2CZ7 B;  4A4E A;  1K8A C;  2X4X A;  4X1V A;  4M7D E;  3UAT A;  2RA2 A;  4RTV A;  4D8D A;  2DK3 A;  2DXU A;  2QDY B;  3I35 A;  2A36 A;  2I0N A;  2NUP A;  3UF4 A;  2MAM A;  4JZ4 A;  4AG2 C;  3CCV A;  1RLP C;  5M9O A;  1UGQ B;  3SD4 A;  2OJ2 A;  2OTL T;  2QAZ A;  1MND A;  3M9Q A;  3GIB A;  1W2B A;  4HVW A;  3THK A;  2GTO A;  1NYF A;  1ZSZ B;  2LMJ A;  5GAN 4;  1BB9 A;  2YLC A;  3PE0 A;  3UWN A;  5FLX E;  2DL4 A;  1NJI R;  3URG A;  3VS2 A;  3EG0 A;  4EMK C;  4BD3 A;  2KQW A;  3MP1 A;  2P84 A;  1QVP A;  4FL6 A;  2PUK B;  1TUD A;  2K3X A;  4BB7 A;  1AWJ A;  1Q7Y U;  4BE1 A;  2DZC A;  1W70 A;  3M54 A;  4C8Q E;  4BI3 A;  4PFP A;  2QQ9 A;  1B7T A;  1SEM A;  1K4U S;  2JM8 A;  1Q7Y C;  3CBP A;  4ZGJ B;  1OU8 A;  4J83 A;  4N0A C;  3CMA A;  2KI7 A;  1WJR A;  1O75 A;  3CD6 T;  4M7A C;  2V26 A;  1BCM A;  2BZX A;  1FXX A;  2AIR B;  1UGV A;  1VQO Q;  3QSU A;  2KR3 A;  2EYZ A;  1ARK A;  3CBO A;  1YJN T;  3ZEH A;  4DOW A;  4AG1 C;  1QVF A;  4OB3 B;  1JRI A;  4N4G A;  1K73 R;  2RHU A;  3OMC A;  3OYC A;  3RMS A;  1Q82 U;  4OGE A;  4OML A;  3CCS A;  3SDZ A;  2CT4 A;  2ZPH B;  1NEB A;  2J6O A;  3V7R A;  4B9X A;  2XD0 A;  1V76 A;  3R6N A;  1Q82 C;  3OYN A;  3I55 T;  3CCV Q;  1KJW A;  1UE9 A;  4GY5 A;  1VYT A;  1YCS B;  3H41 A;  2FO0 A;  4RTW A;  5LJ5 f;  4A4F A;  1UDL A;  2FRW A;  2C0I A;  1G3Y A;  5CAI A;  4XU1 A;  1MHN A;  2XU8 A;  1N8R R;  3JCM g;  2V8J A;  1KIK A;  3HL8 A;  4LDU A;  3JCM J;  4CC4 B;  3EGD A;  2G3R A;  3S3M A;  3QUI A;  2JM9 A;  4RCC A;  5KE3 A;  2SEM A;  6AT1 B;  3A8O B;  3QBY A;  2OTJ Q;  3ULR B;  3G7Z A;  5LJ3 j;  2DBK A;  3P8H A;  3CCR T;  2F1L A;  4C5I A;  2QQB A;  3A8H B;  2WSF E;  2L89 A;  4ZN3 A;  2KNB B;  2CDT A;  3CMA Q;  1R77 A;  4KUD K;  4JJN K;  2QG9 B;  2QGF B;  3HRT A;  4XU3 A;  4QKU A;  4JJB A;  1Y96 B;  5GAN e;  3PT9 A;  2DIQ A;  1JO8 A;  1HD3 A;  3QZ9 B;  2DNU A;  4R55 A;  3P8D A;  1VQP A;  3UPU A;  4X34 A;  3OW2 A;  5KYX A;  4M7A E;  4QVC A;  4RKU E;  3QWX X;  3JCM d;  3OYK A;  1JB0 E;  3BW1 A;  3CCS Q;  4FW2 A;  2P4T A;  1W2B P;  3M4G A;  5D6Y A;  3ZL7 C;  1ZSZ A;  3V8J A;  4E7Z A;  2K3B A;  2KRO A;  1NPP A;  2YWW A;  4PJL A;  3LX7 A;  4C92 D;  3LH5 A;  4O5V A;  1BK2 A;  3GF5 A;  2IG0 A;  2XHC A;  3TVT A;  2K2M A;  1QVG S;  1YWO A;  2DAQ A;  2HCK A;  1M3B A;  1HSQ A;  2O31 A;  1MMN A;  1VQ7 A;  1D0Y A;  4ESR A;  2BZY A;  4ELY C;  3DLL A;  2EVR A;  4CRI A;  1H8K A;  5IXB A;  4JRI A;  2DO3 A;  1AT1 B;  2KYM A;  2V1Q A;  3UDC A;  3PGG A;  5GAN 6;  3JV3 A;  5HCK A;  2XIC A;  9ATC B;  1VQP T;  3JCM h;  2EFI A;  4C92 F;  3R6O A;  2M1H A;  3OA6 A;  3A8L B;  5J3B A;  2A28 A;  3M0P A;  1CSK A;  2GTJ A;  1CKB A;  4XTV A;  2I2L A;  2O9V A;  5KYN A;  5IXF A;  4FYW B;  3VRZ A;  1WHJ A;  3VS6 A;  3LGF A;  4OMN A;  1QVF P;  1GBQ A;  4Z88 A;  4DBR A;  2DD4 A;  3CCE Q;  1RAF B;  2EJG A;  1RAD B;  4MDW A;  1BI2 A;  5IN1 A;  5FWB A;  2D8H A;  3M0R A;  3O5Z A;  3DKM A;  1TSF A;  4ANJ A;  3UA6 A;  4JJC A;  4KUI A;  2ENM A;  3QYH B;  3MKD A;  2FHD A;  3CC4 A;  1U8R A;  1ABO A;  4OMP A;  5L8R E;  1WJQ A;  4RTY A;  1WJS A;  2KRM A;  2CUB A;  2Y4X A;  2ZGW A;  3PFS A;  1OI1 A;  2E5K A;  1IO6 A;  5KCH A;  2EBP A;  2KY9 A;  5HK0 A;  1KQS P;  8ATC B;  1VQ9 T;  1KFZ A;  1I1J A;  3REB B;  1AOJ A;  1D1B A;  1PHT A;  2L3R A;  2QI2 A;  3RIR A;  3KUF A;  4CC3 A;  1XTD A;  1OU9 A;  4RTU A;  1VQ7 Q;  4DA4 A;  4WCI A;  2VB6 A;  3QWY A;  1W6X A;  3VS1 A;  1RUW A;  2V8K A;  1K76 A;  1NJI U;  1WDX A;  4M75 D;  4E7S A;  4KRT A;  2DVJ A;  2R5M A;  2LX9 A;  4RTZ A;  3RR6 A;  2PTK A;  5GJW B;  1Y96 A;  2HKN A;  2OX7 A;  2LX7 A;  1FMV A;  1AZE A;  2W0Z A;  1UHF A;  4VUB A;  1NJI C;  4IUP A;  1UFF A;  3OYM A;  2YT6 A;  1LOJ A;  2KSS A;  1WQ7 A;  2AKK A;  4PJO G;  3M56 A;  1Q95 G;  1PWT A;  3E1S A;  4AFQ C;  3MP8 A;  1IHW A;  3KBG A;  1D1A A;  1U1S A;  3TCJ A;  5KH6 A;  3L2U A;  1HXD A;  3JB9 G;  4RCB A;  3OYE A;  3H0F A;  3P8B B;  5C6S A;  1YJ9 A;  2E64 A;  3EG1 A;  2YDL A;  1PM3 A;  4C5H A;  2KVQ G;  3V7S A;  3G71 A;  2CSI A;  5LJ5 j;  1AWX A;  4M75 F;  3GNG A;  2CH4 W;  2JUF A;  3VJP A;  1M1G A;  4F7U A;  1KD1 R;  5FWC A;  3RKX A;  4JLI A;  3CC4 Q;  1MMD A;  3CCQ A;  2KXC A;  4NOY A;  3JCM f;  3CCU A;  1WHM A;  1NE8 A;  1K9M U;  3D7S B;  1K0S A;  1NEG A;  2BUD A;  4BUG A;  1M2O A;  1U5S A;  4JLG A;  2E12 A;  2C0O A;  3MEU A;  4BE2 A;  3CC2 A;  2DIG A;  1SKU B;  1K9M C;  3VV0 A;  2MMP A;  3VS7 A;  1HYO A;  3HRU A;  2A7Y A;  3HFN A;  4MZT A;  1M4Z A;  3REA B;  4F17 A;  2ATC B;  1SHF A;  2DA9 A;  3J80 E;  3SB2 A;  2RI5 A;  3OS0 A;  1N8R U;  2DD5 A;  5CKD A;  1X75 C;  5GMK j;  4RMO A;  2GCX A;  2LC4 A;  1PNJ A;  1WXB A;  1AD5 A;  2MF2 A;  1PSF A;  4M78 D;  2JT4 A;  1N8R C;  2HBP A;  3I5R A;  5FRM A;  4E7I A;  1FMW A;  3G4S A;  3SWN C;  2DZ9 A;  3JRZ A;  3J7A F;  3TSW A;  2XKO C;  3GPL A;  1TWB A;  1VQ4 T;  2QAS A;  4PJM A;  1WHH A;  4C0F A;  4DBF A;  2V8I A;  3CME Q;  2ZAE A;  2O4X B;  3X25 B;  2GBQ A;  2HNI A;  1XJW B;  3E9F A;  5GAO p;  1WZO A;  3PMT A;  2KAF A;  4IIO A;  4RG2 A;  2EYW A;  4LN2 A;  2LQN A;  2RB6 A;  3G71 Q;  2RPN A;  5GAO n;  2NUZ A;  4M78 F;  3CCM A;  4PFO A;  1VIF A;  5GAM e;  3CPW S;  3LW5 E;  2RO0 A;  3CCQ Q;  2KK4 A;  2RHY A;  2VGM A;  1UEB A;  1YBY A;  4C0Z A;  2EYY A;  1RAB B;  4HT9 A;  3OMG A;  2NWM A;  2DF6 A;  2GFU A;  5FW9 A;  4E6R A;  3TU4 K;  2V1R A;  4HCK A;  2DJQ A;  1VQM A;  1IXD A;  2ZCF B;  3CC2 Q;  2QXF A;  3RBB B;  3M0S A;  3C4S A;  5GMK e;  2DXC A;  4C8Q A;  4KBM B;  2FZK B;  2CZ1 B;  3CC7 Q;  3H0I A;  4V2S A;  1NPR A;  1VYU A;  4GBQ A;  5AYF A;  2OAW A;  1RAA B;  2RK2 A;  4ME7 A;  1B07 A;  3EFR A;  4IUV A;  2FVU A;  2HQE A;  4J9E A;  1QVG A;  4M77 G;  2ABL A;  4C92 C;  1E6G A;  4RUG A;  4II1 A;  2KYB A;  5GAO q;  2OAU A;  4ATO A;  1X6O A;  2LJ1 A;  2Y4Y A;  4YTL A;  3NFC A;  7AT1 B;  2OTL A;  3QJY A;  1ZLM A;  2LQW A;  2RD1 A;  3OYG A;  2E4H A;  3OYD A;  5DY9 A;  3G4S Q;  4LD9 K;  4LNP A;  3QYG B;  4KGX B;  4NL2 A;  2DEQ A;  5I11 A;  2JXB A;  2VV5 A;  2PVD B;  2X3W D;  1M8V A;  3FJP A;  1X27 A;  2LDM A;  2MK5 A;  5CCA A;  2RHI A;  5GAO r;  2X51 A;  1VQL T;  3EGX B;  1PKT A;  4M77 B;  1Q86 U;  3QII A;  2COW A;  2MYS A;  1YP5 A;  3CCM Q;  1M1K U;  5IH2 A;  3AHU A;  2F5K A;  1UJY A;  1Q86 C;  2COY A;  4C0G A;  2RQV A;  2QEX T;  4FCY A;  3JB9 J;  3QPH A;  1M1K C;  3CD6 A;  3GBQ A;  1EX4 A;  2DMO A;  2ZPI B;  4K11 A;  1MV0 B;  5KYX B;  4AMC A;  2PQW A;  1U3O A;  1V1C A;  4BY6 C;  2FEI A;  2HKQ B;  2RQU A;  4PK4 A;  1YJN A;  2YSQ A;  1NBE B;  2HD0 A;  1KSW A;  1VQN Q;  3V7C A;  5KCO A;  2MI6 A;  2DVE A;  1X2Q A;  1R0C B;  1YN8 A;  2F2W A;  4C0D C;  1YIJ A;  1OQK A;  3C12 A;  2M16 A;  4PJJ A;  1BU1 A;  3OBY A;  1UUE A;  4MMK A;  4FW1 A;  2SRC A;  1D1C A;  4N4H A;  1I07 A;  2PVO B;  5J26 A;  2CH4 A;  3I55 A;  3TRE A;  1BIA A;  4IIM A;  2O4X A;  1I5O B;  2IPO B;  2JMA A;  4RG8 A;  1G2B A;  2VUB A;  2OTL Q;  5GAN 3;  2E6N A;  4ZGD B;  3EG2 A;  4C92 E;  2M51 A;  2FZG B;  4L5G A;  4EPC A;  3G6E Q;  1VQ6 Q;  2LT1 A;  1WGS A;  1I4K 1;  4ZTJ A;  2VKN A;  4JS4 A;  4M75 C;  3G1J A;  3ME9 A;  2X4J A;  1TOV A;  1T0J A;  2E65 A;  2JW4 A;  4XAX B;  1AWO A;  3CCR A;  3JSC A;  4PL6 A;  2X3X D;  1T3S A;  3S6W A;  2HL3 A;  4Y91 A;  2X35 A;  2JS2 A;  1KK7 A;  1D3B B;  3GNF B;  1KD1 U;  2DE0 X;  2BKD N;  2QQS A;  4AFS C;  3RKW A;  1YIJ T;  2GQV A;  1WLP B;  3HHT B;  3CD6 Q;  1KD1 C;  2EJ9 A;  2L5Q A;  1UJ0 A;  2EYQ A;  1QVG P;  4XTU A;  2BZ8 A;  1YJN Q;  1Z9Q A;  3V8K A;  4BDZ A;  2CP3 A; 
#chains in the Genus database with same CATH homology
 1YJW Q;  1K73 R;  2QEX Q;  3CC7 Q;  1K9M R;  1Q81 R;  1VQ7 Q;  3CCQ Q;  1VQ4 Q;  3CME Q;  1N8R R;  3G4S Q;  1QVF P;  3CCR Q;  1VQM Q;  1K8A R;  3CCU Q;  1KD1 R;  1Q82 R;  1VQL Q;  3CCE Q;  3CXC P;  1YJ9 Q;  3CCM Q;  1Q86 R;  1S72 Q;  1VQ5 Q;  3CPW P;  1YIJ Q;  3CD6 Q;  3CMA Q;  2OTL Q;  3OW2 P;  1VQO Q;  1KQS P;  3G71 Q;  3CC4 Q;  1VQN Q;  3CCV Q;  1Q7Y R;  3I56 Q;  3CCS Q;  1YIT Q;  1VQK Q;  3CCL Q;  1W2B P;  1VQP Q;  1M1K R;  3CC2 Q;  3CCJ Q;  2QA4 Q;  1YI2 Q;  1VQ9 Q;  2OTJ Q;  3I55 Q;  1JJ2 P;  1QVG P;  3G6E Q;  1VQ8 Q;  1VQ6 Q;  1NJI R;  1YJN Q;  1M90 R;  1YHQ Q;  1KC8 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...