3CMAQ

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cmaQ00
1NJIR 1YJ9Q 3OW2P 3CCUQ 1M90R 1YIJQ 1Q86R 1QVGP 3CPWP 1K9MR 3G6EQ 3CCJQ 3CCMQ 1VQ7Q 1N8RR 1Q7YR 3CCLQ 1VQ9Q 1VQ5Q 1VQMQ 1KC8R 1VQ6Q 3G4SQ 2QA4Q 3CMEQ 1K8AR 1M1KR 3CMAQ 2OTJQ 1K73R 3G71Q 1YI2Q 2OTLQ 3I56Q 3CCQQ 3CC7Q 1VQOQ 3CD6Q 1KQSP 1YITQ 1VQ4Q 1KD1R 3CCSQ 1Q82R 1QVFP 1YJWQ 3CCVQ 1VQKQ 1W2BP 1VQPQ 1S72Q 2QEXQ 1JJ2P 3CC4Q 1Q81R 3CC2Q 3CXCP 1VQ8Q 3CCEQ 3I55Q 3CCRQ 1YJNQ 1YHQQ 1VQLQ 1VQNQ
chains in the Genus database with same CATH superfamily
2PTKA 3QPHA 3EAEA 5GAN6 3RKXA 1K73U 3I5RA 2DK3A 1T3LA 3BW1A 1TOVA 1WQ7A 2XKOC 3MO8A 1LJOA 4B9XA 3LW5E 1YIJT 1OV3A 3H8ZA 4FYWB 1UDLA 3UA6A 5GANd 3CXCA 2CH4W 4C5IA 4RG8A 3J81E 4C92B 3OYLA 4C8QC 3UDCA 4HCCA 1OQKA 4KUDK 4LDWA 1R8OB 1ZQ1A 3VV0A 1YN8A 1N6AA 1YITQ 5KYYB 3KXTA 1SRLA 4JJNK 1WA7A 4M77D 1WXUA 3OW2S 1WLPB 2KBTA 1OULA 3M58A 1Q81C 1RAFB 2RJEA 3L2QA 1VQOT 1JXMA 1FWZA 1VQMQ 2GQVA 2CREA 1AD5A 4F7UF 1ZSZB 3JB9H 4QT7A 1HJDA 2QEXA 1M90U 3OYNA 1QVFP 1VYTA 3JCMP 3TREA 2LMJA 2LDMA 4OMQA 1FMVA 1QCFA 3LWIA 2HZYA 2NWMA 4PL6A 5D6XA 2ROTA 1UGQB 1ZUYA 3M0RA 3FLGA 1UGPB 5FU7C 1JQQA 5CKHA 5CQYA 3CCMA 4AMCA 1D0XA 1WHJA 3TCJA 1D3BA 4HCZA 4L59A 1KJWA 1PM3A 1WHKA 1G3SA 8ATCB 4LUEA 7AT1B 1YJNQ 2OI3A 1OX9A 2L3QA 2RQVA 1AZGB 1W1FA 1G3WA 3EH2A 2JXBA 1VQ6Q 2R58A 2X4WA 1B34A 1VA7A 1PNJA 2DNUA 1SEMA 1BK2A 2A7YA 4C8QB 2V1QA 1TWBA 3X25B 2JTMA 4J6WA 4KH1B 1I81A 3M57A 2C0TA 1NJIU 2EKOA 3EH1A 1G3TA 2DBKA 4HVVA 4AG2C 4RTZA 1D0ZA 2ENMA 4OF1A 3JV3A 1BCMA 2GTJA 1KC8U 2L3SA 3H6ZA 4FL6A 4C92D 2YLBA 3VU3C 1Q95G 1MMAA 3CBOA 3C0CA 1RACB 3OMCA 5GMKi 2ZZDA 1SG5A 3CD6T 4JJDA 4PJOG 1Q82C 1IREB 1R0BG 1N8RR 1ZX6A 1QWEA 2KE9A 2E12A 2DAQA 4C8QE 3PIOA 1KFZA 4M7AC 2EQMA 1VQ4Q 1Y57A 1G3YA 2KEAA 3JB9J 2KYMA 2QK0A 1WNLA 4M75F 4BE0A 2PNIA 3DB3A 1B7TA 3FRNA 2YHTA 1VQPA 1OEBA 1VYUA 3CBPA 1T3SA 3OBWA 1K9AA 2XMFA 1RAEB 1OYXA 1RI0A 1TUGB 2HQXA 1M2VB 2DLPA 3VYHB 2OTLT 3CCQT 4ELYC 5KYUA 3OYCA 2OTJA 4DBFA 1YWPA 2LX9A 2EFIA 2DILA 2K4YA 5GAMj 1KD1U 2YWWA 3PGGA 1I5LA 2KRMA 4J6XA 3N5BB 3OS2A 3C4SA 1Q7YU 1IHWA 3TSZA 2QYZA 1PHTA 2VYTA 4OP0A 5IHNA 2FRYA 2QQAA 2O4XA 2LQNA 3E9GA 2EWNA 3QYHB 1D0YA 3D7SB 4HVUA 3SD4A 1U3OA 1I0CA 3QDRB 3CCJA 1HSQA 5CO7A 2H3EB 4X9DA 5CAIA 3G71A 5J3BA 3JCMV 4PJNA 4J9DA 1YCSB 4B9WA 4IUUA 2FB7A 1YIJA 4Z88A 2SRCA 3PMTA 2DXUA 1GL5A 2EYXA 3S3MA 3QJ6A 3L2ZA 2A37A 1YJWT 5KE3A 1I1JA 4KH0B 5CKDA 2XIDA 1R0CB 3ZBDA 1VQ7A 4IUTA 4A53A 1M1KC 3E9FA 4NS5A 2VWFA 3QJYA 2HBWA 1WDXA 5GAMh 4OB1B 4E7IA 2RI5A 2KQWA 2W0ZA 4O6JA 4JDSA 1SSHA 1XTDA 5GANf 2JS2A 3EG9B 2D8JA 1GFCA 2RK1A 1JXOA 1M90R 2CUBA 2J6OA 2WSCE 3EFOB 3OYYA 1VQLT 2F5KA 1VQMA 2CZ6B 2DL3A 3L2WA 2OTLQ 3RMQA 2CP7A 5D6WA 4BE2A 3TVTA 5KE2A 2DPPB 2E3HA 2CKKA 2HL5C 3I55T 3R6NA 3VS1A 2YUNA 3GNGA 2M0YA 3HRUA 4PJOB 1LOJA 2EGEA 1MMGA 3ZL7C 2VV5A 2CZ0B 3RERA 4JZ4A 2FVUA 2MWOA 1BBZA 3G4SQ 2YRDA 1ZSZC 3NHNA 4PJMA 3MEUA 2GQIA 2PUKB 4ZN3A 3L2RA 4M7DD 1U5SA 4F17A 2DERA 4J9BA 4MZMA 4XU3A 1Y71A 4DEXA 5GAN5 2JT4A 1VQLQ 2CT4A 3GNFB 1OU8A 4D8KA 3CCVA 2RQWA 2WACA 2V8KA 3TU4K 2JVVA 1VQLA 2ABLA 4FCYA 1OU9A 4E7ZA 2L0AA 4II1A 2EJGA 3FC3A 5A2QE 2LJ0A 2LT4A 4Y28E 2NUPB 2D8HA 2B86A 3JCMg 2JS0A 3OS1A 5KYWB 1N27A 2KGTA 2AKLA 3EGDA 2V8JA 3EFOA 2EVRA 2VUBA 2GCXA 1MNEA 1VIEA 1RUWA 4C5EA 4LDYA 4EMKB 4DQ2A 4DOWA 2L3RA 2A36A 2AZVA 4B6MA 2DEQA 2W10A 1GCQC 3QXEB 1M2VA 4M7DG 1VQ5Q 3ME9A 5IHKA 2YSQA 1VQMT 1MUZA 4M7DA 2IIMA 2DMOA 1VQNA 4MMKA 2O9SA 5AT1B 4ZTJA 4PFOA 4JRIA 1YITT 3CD6A 2CZ7B 5A0DA 2VASA 2D6FA 5GAMd 3RESA 3JCMW 2FEIA 3V7SA 4PJOD 1O9SA 1OPLA 3OQ5A 3SHWA 4C0DC 1Q81U 4JLIA 4YTLA 2EJFA 5GAOm 1BYMA 1K76A 4OMPA 3A8OB 1QVPA 3MHXA 2RH2A 2NLUA 1G8XA 4CC2A 3QYGB 4M7AE 1GCPA 3M55A 2MF2A 2BZXA 1TU0B 2FG0A 2YUPA 5FU6C 1K73R 2COZA 3PTAA 2QTVA 4LNPA 1Q86U 3I35A 4M77E 1M3BA 4OB3B 3LX7A 1NBEB 1YP5A 3HPWA 3SWNB 1XNIA 3OSVA 3CMAA 5GAMe 1QVFA 1W6XA 3FB9A 5L8RE 1RABB 2AK5A 1PD1A 1VQKA 5LJ3e 1RI9A 3P8BB 2HAXA 2J05A 2K2VA 3CCJQ 4EMGA 2MPXC 3MPUB 4C0GA 1VQ9Q 1RAAB 1K9MC 2DM1A 4M75C 3A5ZB 1SKUB 2K3XA 1Q86C 3MP6A 4LE9A 5D6YA 1VQ4T 4J5YA 1ZSGA 2IVWA 5KYWA 1U06A 3UWNA 3LGLA 3G7ZA 3OYEA 2DRKA 1GFDA 3P8DA 1BCOA 1I07A 4XTZA 5GANj 4R0KA 4A4KA 3L2VA 4BE1A 4JJBA 3GIBA 3M54A 2WSEE 4WCIA 3X20B 4DBQA 2EJ9A 2CP3A 3I9QA 2L2PA 5I11A 5DM7R 2K7AA 2LTOA 4NOYA 3RMSA 4N4GA 3UT1A 2AZSA 3EG2A 2MIOA 3S3NA 1M90C 3CCUQ 2EW3A 1VUBA 2I0NA 3MEVA 4F16A 3CCEA 3C94A 4WTOB 2QXFA 4E7JA 2VXEA 1K1ZA 1E6GA 1AWOA 4M78D 4PJOF 1M1GA 1SHFA 5HK0A 5FRMA 1X27A 1PRMC 4E47A 2ZPBB 2NYSA 1FMWA 3G71T 3ULRB 1KK7A 5I2MA 4AFQC 2ROLA 5DLOA 2ATCB 1FXXA 4N0AC 3OS0A 2G6FX 1UGVA 4ZGDB 2L89A 2JTEA 4MZPA 4C0ZA 2RO0A 4MDXA 4L5GA 3I56T 4PLIA 4J7FA 4PLLA 1M3AA 1R77A 2J6FA 4M7AD 3CPWA 2OJ2A 1BI2A 3EGXA 3QIIA 3HTRA 2PU9B 2RK2A 1Z9ZA 5KCOA 1RAGB 5IXFA 3VUZA 2DYIA 4IIMA 1A0NB 1MV0B 1BB9A 1PKTA 2QASA 4N4HA 5A0LA 4DA4A 3M0QA 5FWBA 2V26A 4XTXA 2MWPA 3QHSA 3JCMb 3H9NA 3BDLA 3DKMA 1KD1C 2OAUA 2FPEA 4CI0C 1OOTA 2EYYA 4JS4A 4M7AA 4JS5A 3CC2Q 3M0SA 1GRIA 2NUZA 2BKDN 4HCBA 2YRCA 4PJOC 1NM7A 1VQ5T 1QKWA 4BDYA 4FYVB 2CZ1B 2MMPA 4IKFA 2C06A 3JCMQ 2F2VA 1IGQA 1C1AA 2K3YA 3GBQA 1UFFA 1PSFA 2FPFA 3MP1A 5LJ3h 2QEXQ 3O8VA 5EC7A 2DL8A 2R5AA 1X6GA 1KQ2A 1VQNQ 1NYGA 3PVLA 2DZ9A 2P4TA 2O4XB 2DRMA 4ATOA 4C5HA 5KH6A 3E1SA 5HK3A 3HFOA 1YJNA 2HBPA 1UHFA 4XTUA 5GMKj 2M02A 4FYXB 4PNOA 1VQPT 3ASKA 5GAN4 2LT1A 4EMKC 3NTIA 4OMMA 3THKA 3I55Q 1YBYA 2E3IA 2CSQA 2QGGA 5CR2A 1S1NA 3VS0A 3JB9I 2DKGA 3CC4T 4FM4B 4HA8A 3CCQA 2ECZA 2MCNA 2X3XD 1WPYA 2EQIA 1VQ9A 4LDXA 2XK0A 2HEQA 3CCUA 1VQKQ 1W2BP 4OGCA 2JJ9A 1LPLA 1JO8A 1WX6A 3NTHA 4TVRA 4E6RA 1PG5B 2XI9A 1M1KR 2KXDA 3WXMB 2LC4A 3LWHA 3BDUA 1IB8A 2E6NA 5CVIA 2R57A 2RJCA 2LRQA 4EMHA 2LQKA 4J9HA 4Q5WA 3C12A 1H3HA 3RDVA 1X2QA 1HYOA 4JLGA 1YJ9A 3MJXA 1BU1A 2DX1A 1QVFS 2V8IA 4AG1C 1UTIA 1E7OA 3A98A 4A4EA 4ANJA 1PKSA 1D09B 2RHYA 1KQSS 5A0GA 2DL7A 3JRZA 3M0TA 2JUFA 3WVDB 2KK4A 4OMFB 2WSFE 1QCNA 5CCAA 1BKBA 2XDPA 3X26B 2MOXA 2DYBA 3CCVT 4ZNXA 3CMEQ 4PFZA 2DIQA 1H92A 1OZ3A 2E1HA 5HY6A 3TSWA 4A4HA 2X4YA 2DEUA 1YCYA 2E65A 1GBRA 4ZGJB 2XD0A 4JZ3A 3PT9A 4C8QD 1WJQA 3P8HA 2PVDB 2CYZB 2VGNA 2RQUA 3UF4A 1JJ2A 3CC4A 2XU8A 1BI0A 3JCMf 3TQ7P 3NGPA 3CCVQ 1WHGA 4QQGA 5GAOq 1J3TA 1M1KU 1TUCA 2FPDA 4C92C 1Y96A 1B07A 4IUPA 4FW2A 3A8MB 4KBMB 3NTKA 2YT6A 1OI1A 3X24B 4M77A 2DETA 4X1VA 1ZBJA 4DEYA 5LJ5j 1Q82R 3REAB 2CP2A 1RLPC 1PSEA 4LUDA 1VQ6A 2Z0WA 1UGSB 1X43A 1FYNA 1ZUUA 4KULA 5FWCA 4XU2A 1U1SA 4CC4B 1M4ZA 2ZAEA 4OVAA 2IPOB 3JB9F 1M5Q1 3OYJA 2KRNA 4PJJA 5CKEA 2E64A 2COWA 4XTWA 2JW4A 2BE9B 4QKUA 3I56A 4RKUE 5FW9A 2MYSA 3FIFA 4M77B 1WXBA 4ORZA 4NL3A 1K9MR 2DVJA 3CCRA 1RLQC 2DIGA 4BUGA 3M9QA 3IQLA 3CCST 3JB9G 3JSCA 1YJ9Q 4J9FA 2X9HA 3V8KA 4KRTA 4JRPA 4Z02A 3V8LA 1VQ8T 4M7DE 1VQOA 1TTHB 4BI3A 1K4US 2K5IA 4MMLA 2XHCA 4Z89A 3SWNA 3JCMd 1LVKA 3SFMA 1KD1R 2YDLA 3HFNA 2GFAA 2DVEA 3FDRA 1WYXA 3CCLT 3EG1A 1X69A 4J9CA 2DZCA 4Y91A 2FO0A 3SB2A 2H8HA 2RB6A 3QBYA 2P0KA 2P0PA 1QCOA 1WJRA 2L8DA 2O31A 5HCKA 5GMKl 4PJLA 1K73C 5GAN2 5KYXB 1ZBXA 1ABQA 5IH2A 3GPLA 4FSXA 1X75C 5IAYA 3J80E 3M0PA 1Y7XA 1JJ2P 2JOYA 2RD1A 1YIJQ 4KT0E 3VJPA 1Y07A 3CCMQ 4QQ6A 4KUIA 4C92A 3CCLQ 3CMAQ 4RG2A 3G71Q 2GGRA 2YRVA 2LCLA 8AT1B 1C6VX 1QP2A 2VC8A 4Z8AA 1KQSP 2MAMA 4LN2A 4QW2A 4IURA 2KMTA 5FU6B 2Y4YA 1VQPQ 1SF9A 1ACMB 2DXBA 1Q81R 1K0SA 3EFRA 4M7AG 3OBYA 2Y4XA 1AWXA 3KUFA 4C92E 3MP8A 1NZ9A 2D0NA 3M4GA 4IUVA 1H3ZA 4XTYA 1QW1A 1KIKA 1P92A 4NL2A 3OW2A 2YUQA 4M78G 4LXCA 4PK4A 2RHXA 4PJOE 3H0HA 3RNJA 4DBRA 2LJ3A 2RNAA 1PCXA 1RAHB 2IG0A 2EQKA 4ME7A 1PD0A 4QVZA 2KT1A 4AFUC 1D1AA 4EIKA 1UUEA 3L1AA 3OB9A 4FIBA 4M7AB 1N5ZA 2ESWA 2RHUA 2RF0A 1NE8A 3OSSC 4RTYA 2FZKB 4RCCA 4JPBW 3CD6Q 1W2BS 3RIRA 4OB0B 4A54A 1G83A 1WXTA 1I5OB 3PNWC 4EDUA 1D3BB 3SDZA 1KHCA 3CCET 2JM9A 2O2OA 4KGZB 3OA6A 2KI7A 2LP5A 4N0AA 3CC7T 4M75B 2JNGA 1SHGA 1VQNT 2KROA 1QKXA 2EQJA 3CC2A 4L6V5 3EGUA 4AFZC 2YLCA 3QZ9B 1W2BA 1YJNT 2DD4A 3VRYA 3NFCA 4X9CA 4DBHA 3VYGA 4JRQA 3CC4Q 1OZ2A 1B34B 2JZ2A 5LJ5g 2COYA 1CSKA 1EX4A 4VUBA 3QDFA 2EBPA 2BTTA 2K5LA 2EGCA 2KR3A 2OAWA 2LCCA 2RA2A 4Y92A 4E7LA 2E10A 5D7UA 1AZEA 2DTHA 1Y96B 2CH4A 6AT1B 4OMLA 1BI3A 3KBGA 4R56A 4IIOA 1X6OA 2M51A 3CMEA 5IN1A 1AWWA 4P5NA 1K8AU 4J8OA 3OY9A 4N4IA 2QAZA 3R6OA 2ZPHB 1T0JA 1Q82U 1HD3A 5I21A 2E5QA 3J7AF 4BI8B 1GXIE 2V1RA 4EMKA 1Q7YC 1VQOQ 1EIFA 1AOJA 2XICA 4M75A 5GMKe 2ZPGB 2K9GA 2DFUA 2AT1B 5KYNA 2AIRB 1QVGP 4XQ3A 3NMZC 4XK8E 1V29B 5LJ5f 4M78F 3UA7A 1M27C 2RMOA 2A28A 4KGVB 2X51A 2ZPFB 1ARKA 3CCEQ 3G1JA 1UJ0A 3GP8A 3EFSA 1VQ9T 3CCSA 3CPWP 3JCMh 4PJOA 2XDDA 1SPKA 1S72A 1UG1A 3MEWA 2XG8D 4QQDA 3CC2T 1Y0MA 4GBQA 3F70A 3I55A 5GAOl 3CXCP 4BI4A 2BZ8A 2HKNA 2RI2A 3QO3A 1E6HA 4JJCA 2VVKA 3VS3A 5DLQE 1NEBA 5LJ3f 2SEMA 3G6EQ 5GJWB 1ABOA 5EG2A 2MI6A 3V8JA 4BY6C 5KYUB 4C0DB 2CP6A 1TXQA 2LJ1A 3S3OA 5LL6S 3META 3CCSQ 1YNZA 2L3PA 1G5VA 4M7DC 1X01A 5I22A 2X4XA 2DXCA 4J9GA 1KHIA 2DJQA 5C6SA 1SSFA 3QZ5B 5LJ5h 1KC8R 2YXYA 2HDAA 4ZTFA 2DTOA 2EIFA 1AEYA 2QEXT 2A0FB 1BIAA 2X35A 1TH7A 1HK9A 5J26A 1AT1B 2EKHA 4OB2B 2GFUA 2P84A 1BIBA 2JMAA 3FJ5A 3OYGA 1QVGS 2PUOB 2QA4Q 2O88A 2OTJQ 3OYMA 2F1LA 2RJDA 4RTUA 1UB4A 2C0OA 3URGA 3JAME 1NPPA 4RTTA 2CP0A 4FT4A 2H3JA 1NLPC 4X34A 4LDVA 2GBQA 2F2WA 2GNCA 1IZ6A 3ZEHA 1VQ5A 1VIFA 1UE9A 2L5QA 3T9NA 2BE7D 2DJZA 2M9UA 2X3WD 2KYBA 3CQTA 3CCRT 1M1FA 4E7SA 4FU6A 2VKNA 5GAN8 2CUDA 1JJ2S 2VXFA 4M4ZA 2O9VA 1AHJB 1EFNA 4RTXA 1IO6A 4EPCA 3JCMX 3V7RA 1YJWA 3CXCS 1NEGA 4HXJA 3FEOA 2EYZA 4CRIA 2LCSA 1WI7A 1G2BA 4RUGA 4BB7A 2F69A 3NPFA 4F14A 2KRSA 4GLMA 4JRKA 3HKSA 2KAFA 4GY5A 2K57A 2K79A 2M16A 1MMNA 4M77G 1WHLA 2HCKA 2DD5A 2RN8A 3EGDB 2DL5A 1N9SA 2QA4A 4E2FB 1JEGA 1VQ7Q 2E41A 3ER0A 4UC4A 3QWXX 2P4RA 1WIEA 2YUOA 3CCUT 2HSEB 1V76A 1K8AR 1KQSA 2QGFB 2LQ8A 3ZFJA 3RBBB 4M77F 2LNHB 2MK5A 2RI3A 1O75A 4F04B 3U23A 3VUBA 3CC7A 4WF2A 5KYXA 4QVDA 2E6ZA 3BY7A 4E7HA 2I2LA 2EQUA 2RPNA 2BUDA 3QG1A 2LZ6B 2JM8A 1XQHA 2PQWA 1WHHA 1YFNA 3RR6A 5GAMf 1F1BB 2KVQG 1HXDA 3HL8A 1N9RA 3MKDA 4LD6A 3EHRA 2K6DA 1NLOC 3CPFA 1OX8A 3L42A 1T0HA 2OTLA 1VQ8A 4J7IA 2QG9B 1AVZC 2M0OA 3CPWS 5GJVB 1GCQA 2KDSA 3HRTA 2QDLA 3OMGA 5GMKh 3M56A 4KGXB 1MNDA 3A8HB 3CC7Q 5IHIA 1SRMA 3OYDA 5HKCA 4BDZA 4F7UA 4MZTA 2O01E 1MGQA 3MCAB 3M0UA 2EGAA 1UHCA 4HT9A 2G3RA 5GAN7 1LCKA 2EPDA 1IHVA 1DJ7B 2KNBB 2ZPIB 2KXCA 4HCKA 1OPKA 3BE3A 2CS7A 4R55A 4C8QF 1M3CA 1QQJA 3Q1JA 3OYKA 3VS6A 1WQWA 1K9MU 3JCMc 1CKAA 1C0MA 5J39A 2ED0A 2QI2A 1UEBA 2LVMA 1CKBA 1ZSZA 3CEYA 3RKYA 3X28B 1KC8C 3M5AA 4CC3A 4HVWA 3AT1B 5GAOr 1MV3A 4XU1A 1TSFA 2NUTA 2QTXA 5GAOp 3GF5A 3M53A 3INZA 2D0QB 3OYIA 3VS7A 3CCJT 2BZYA 2PZ1A 3LLRA 1VQ4A 1D1BA 5ECAA 1GBQA 2NUPA 4IUQA 3RUXA 2E4HA 3VRZA 5CIUA 2QQSA 1WJSA 1X2KA 1S72T 1YHQQ 3HHTB 3CBMA 4A4GA 3VS5A 4M7DB 4C5GA 2FZCB 2D9TA 3DB4A 3RKWA 1K8AC 2CSIA 2FYKA 3S6WA 4BACA 3QSUA 3PVQA 4JUVA 1XJWB 4XU0A 4J9IA 4F7UG 3LH0A 5CKBA 3VKIA 4V2SA 1KQ1A 1M30A 1YHQT 2DE0X 3A8GB 3V7CA 1WZOA 1M9SA 1FX7A 2ZGWA 4M75D 4M75G 4GLKA 2CP5A 3EG0A 1EZZB 1M8VA 1W4SA 2K5FA 2HQEA 1NJIC 1ZA1B 2DA9A 2RJFA 4OGEA 3SWNC 4AT1B 3EHQA 5LJ3j 5I2SA 4F7UB 1H641 2QQ9A 4DOVA 2LNVA 3A8LB 3SEMA 1QP3A 3A1PA 3C95A 1I8FA 3DLLA 4XTVA 2X4JA 5GAN3 3LGFA 3QKJA 4M7AF 1RADB 1TUDA 1JBMA 3LH5A 1I4K1 4A63B 5FLXE 1LNXA 5IXBA 3GLXA 4MDWA 2A08A 1QMCA 4C8QG 4HKEA 1X6BA 1D1CA 4CC7A 3G4ST 1MMDA 1FMKA 3G6EA 2D1XA 3JCMe 1UECA 4D8DA 3MEAA 2CT3A 2DO3A 5GAOn 4OMNA 1IXDA 1B3QA 4C8QA 2Y90A 4OMOA 1Q86R 1PC0A 1YJ9T 3I5SA 2JTFA 5AYFA 4ELZC 2PVGB 1U8RA 2JN0A 4LDUA 4A4FA 5FU7B 2FHDA 9ATCB 3UATA 5C0MA 3OYBA 1S72Q 2OX7A 4M77C 5IT9E 5LJ5e 1NG2A 1TS9A 3PFSA 1WHMA 1W70A 3OS5A 2RHZA 3BFMA 1KG1A 4AFSC 4FYYB 5KCHA 4M78A 4M75E 3G4SA 2EYWA 2HNIA 4QVCA 1Z9QA 3OYAA 3AHUA 4LD9K 1VQ6T 1YITA 2M1HA 1UJYA 3PE0A 3GOXA 1YI2A 2ZPEB 3TEEA 2GF7A 2NUTB 1BI1A 1N8RU 5KYYA 1NPRA 2RQRA 3OW2P 3UPUA 3H0FA 3CMAT 2DL4A 2F2XA 5L23A 1VQKT 3CCMT 4HT8A 5GANh 1YI2Q 3QUIA 3O5ZA 1RL2A 3WVEB 3QWYA 1WGSA 4C92G 1VOMA 5CKFA 5GMKm 1ZLMA 1PRLC 2FZGB 2PVOB 1VQ8Q 3E19A 2XDBA 4ZN1A 4M78B 4FSSA 4RCBA 2ZCFB 1NJIR 1V1CA 4O5VA 3VS2A 5CK9A 3OYFA 2KT8A 1KSWA 5GAMg 3CCQQ 5M9OA 4J9EA 1JRIA 2ED1A 2F5TX 5LJ3g 2A3LA 2RM4A 2C0IA 2DF6A 2AKKA 2CGHA 3G6ET 1PWTA 2K3BA 1UGRB 3HRSA 3CCRQ 2RQTA 1WFWA 2LX7A 2RHIA 2LQWA 2EYQA 2QDYB 1Q7YR 2P0QA 1VYVA 2VGMA 5GANg 2KSSA 3OYHA 3JCMJ 1M8MA 2QQRA 1QLYA 1IGUA 4PFPA 3I56Q 4C92F 3EG9A 4J6YA 2HSPA 1M2OA 1XOVA 1JU5C 1YI2T 1JB0E 5GANe 4RTWA 2K2MA 4E7KA 2HKQB 1RAIB 3M59A 5LJ3d 4D6WA 1ZA2B 2FRWA 3LYIA 2J7IA 2QA4T 2DTIA 4K11A 3L2UA 3HP9A 5CQXA 2GTOA 3PIPA 2KY9A 3DLMA 3M4YA 2JMCA 5DY9A 5LJ5d 1ZHIA 1YJWQ 3H41A 1IRXA 2AHJB 4M7DF 3CMET 3EGXB 1NYFA 2HMAA 4J83A 4PKCC 1QWFA 1ZUKA 2QQBA 4RTVA 4C0FA 1N8RC 4FT2A 4ZGEB 4RMOA 3E2UA 3REBB 2J6KA 4F7UE 1H8KA 2B8AA 3JB9D 3VS4A 5FRNA 2EAYA 3KFVA 1TG0A 1YWOA 2E70A 2OTJT 4ESRA 2BIVA 1U1TA 2E5KA 2DBMA 4BD3A 4FW1A 3FJPA 4M78E 3CCLA 1QVGA 3HSBA 3H0IA 2VB6A 1YHQA 2DXTA 2FL7A 1AWJA 4BY6B 2CDTA 2HL3A 2R5MA 4XAXB 1MHNA 2J06A 1VQ7T 3PMIA 3EG3A 4M78C 2HQHA 1K0XA 5FROA 2HD0A
chains in the Genus database with same CATH topology
1NJIR 1YJ9Q 3OW2P 3CCUQ 1M90R 1YIJQ 1Q86R 1QVGP 3CPWP 1K9MR 3G6EQ 3CCJQ 3CCMQ 1VQ7Q 1N8RR 1Q7YR 3CCLQ 1VQ9Q 1VQ5Q 1VQMQ 1KC8R 1VQ6Q 3G4SQ 2QA4Q 3CMEQ 1K8AR 1M1KR 3CMAQ 2OTJQ 1K73R 3G71Q 1YI2Q 2OTLQ 3I56Q 3CCQQ 3CC7Q 1VQOQ 3CD6Q 1KQSP 1YITQ 1VQ4Q 1KD1R 3CCSQ 1Q82R 1QVFP 1YJWQ 3CCVQ 1VQKQ 1W2BP 1VQPQ 1S72Q 2QEXQ 1JJ2P 3CC4Q 1Q81R 3CC2Q 3CXCP 1VQ8Q 3CCEQ 3I55Q 3CCRQ 1YJNQ 1YHQQ 1VQLQ 1VQNQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI R;  1YJ9 Q;  3OW2 P;  3CCU Q;  1M90 R;  1YIJ Q;  1Q86 R;  1QVG P;  3CPW P;  1K9M R;  3G6E Q;  3CCJ Q;  3CCM Q;  1VQ7 Q;  1N8R R;  1Q7Y R;  3CCL Q;  1VQ9 Q;  1VQ5 Q;  1VQM Q;  1KC8 R;  1VQ6 Q;  3G4S Q;  2QA4 Q;  3CME Q;  1K8A R;  1M1K R;  3CMA Q;  2OTJ Q;  1K73 R;  3G71 Q;  1YI2 Q;  2OTL Q;  3I56 Q;  3CCQ Q;  3CC7 Q;  1VQO Q;  3CD6 Q;  1KQS P;  1YIT Q;  1VQ4 Q;  1KD1 R;  3CCS Q;  1Q82 R;  1QVF P;  1YJW Q;  3CCV Q;  1VQK Q;  1W2B P;  1VQP Q;  1S72 Q;  2QEX Q;  1JJ2 P;  3CC4 Q;  1Q81 R;  3CC2 Q;  3CXC P;  1VQ8 Q;  3CCE Q;  3I55 Q;  3CCR Q;  1YJN Q;  1YHQ Q;  1VQL Q;  1VQN Q; 
#chains in the Genus database with same CATH topology
 2PTK A;  3QPH A;  3EAE A;  5GAN 6;  3RKX A;  1K73 U;  3I5R A;  2DK3 A;  1T3L A;  3BW1 A;  1TOV A;  1WQ7 A;  2XKO C;  3MO8 A;  1LJO A;  4B9X A;  3LW5 E;  1YIJ T;  1OV3 A;  3H8Z A;  4FYW B;  1UDL A;  3UA6 A;  5GAN d;  3CXC A;  2CH4 W;  4C5I A;  4RG8 A;  3J81 E;  4C92 B;  3OYL A;  4C8Q C;  3UDC A;  4HCC A;  1OQK A;  4KUD K;  4LDW A;  1R8O B;  1ZQ1 A;  3VV0 A;  1YN8 A;  1N6A A;  1YIT Q;  5KYY B;  3KXT A;  1SRL A;  4JJN K;  1WA7 A;  4M77 D;  1WXU A;  3OW2 S;  1WLP B;  2KBT A;  1OUL A;  3M58 A;  1Q81 C;  1RAF B;  2RJE A;  3L2Q A;  1VQO T;  1JXM A;  1FWZ A;  1VQM Q;  2GQV A;  2CRE A;  1AD5 A;  4F7U F;  1ZSZ B;  3JB9 H;  4QT7 A;  1HJD A;  2QEX A;  1M90 U;  3OYN A;  1QVF P;  1VYT A;  3JCM P;  3TRE A;  2LMJ A;  2LDM A;  4OMQ A;  1FMV A;  1QCF A;  3LWI A;  2HZY A;  2NWM A;  4PL6 A;  5D6X A;  2ROT A;  1UGQ B;  1ZUY A;  3M0R A;  3FLG A;  1UGP B;  5FU7 C;  1JQQ A;  5CKH A;  5CQY A;  3CCM A;  4AMC A;  1D0X A;  1WHJ A;  3TCJ A;  1D3B A;  4HCZ A;  4L59 A;  1KJW A;  1PM3 A;  1WHK A;  1G3S A;  8ATC B;  4LUE A;  7AT1 B;  1YJN Q;  2OI3 A;  1OX9 A;  2L3Q A;  2RQV A;  1AZG B;  1W1F A;  1G3W A;  3EH2 A;  2JXB A;  1VQ6 Q;  2R58 A;  2X4W A;  1B34 A;  1VA7 A;  1PNJ A;  2DNU A;  1SEM A;  1BK2 A;  2A7Y A;  4C8Q B;  2V1Q A;  1TWB A;  3X25 B;  2JTM A;  4J6W A;  4KH1 B;  1I81 A;  3M57 A;  2C0T A;  1NJI U;  2EKO A;  3EH1 A;  1G3T A;  2DBK A;  4HVV A;  4AG2 C;  4RTZ A;  1D0Z A;  2ENM A;  4OF1 A;  3JV3 A;  1BCM A;  2GTJ A;  1KC8 U;  2L3S A;  3H6Z A;  4FL6 A;  4C92 D;  2YLB A;  3VU3 C;  1Q95 G;  1MMA A;  3CBO A;  3C0C A;  1RAC B;  3OMC A;  5GMK i;  2ZZD A;  1SG5 A;  3CD6 T;  4JJD A;  4PJO G;  1Q82 C;  1IRE B;  1R0B G;  1N8R R;  1ZX6 A;  1QWE A;  2KE9 A;  2E12 A;  2DAQ A;  4C8Q E;  3PIO A;  1KFZ A;  4M7A C;  2EQM A;  1VQ4 Q;  1Y57 A;  1G3Y A;  2KEA A;  3JB9 J;  2KYM A;  2QK0 A;  1WNL A;  4M75 F;  4BE0 A;  2PNI A;  3DB3 A;  1B7T A;  3FRN A;  2YHT A;  1VQP A;  1OEB A;  1VYU A;  3CBP A;  1T3S A;  3OBW A;  1K9A A;  2XMF A;  1RAE B;  1OYX A;  1RI0 A;  1TUG B;  2HQX A;  1M2V B;  2DLP A;  3VYH B;  2OTL T;  3CCQ T;  4ELY C;  5KYU A;  3OYC A;  2OTJ A;  4DBF A;  1YWP A;  2LX9 A;  2EFI A;  2DIL A;  2K4Y A;  5GAM j;  1KD1 U;  2YWW A;  3PGG A;  1I5L A;  2KRM A;  4J6X A;  3N5B B;  3OS2 A;  3C4S A;  1Q7Y U;  1IHW A;  3TSZ A;  2QYZ A;  1PHT A;  2VYT A;  4OP0 A;  5IHN A;  2FRY A;  2QQA A;  2O4X A;  2LQN A;  3E9G A;  2EWN A;  3QYH B;  1D0Y A;  3D7S B;  4HVU A;  3SD4 A;  1U3O A;  1I0C A;  3QDR B;  3CCJ A;  1HSQ A;  5CO7 A;  2H3E B;  4X9D A;  5CAI A;  3G71 A;  5J3B A;  3JCM V;  4PJN A;  4J9D A;  1YCS B;  4B9W A;  4IUU A;  2FB7 A;  1YIJ A;  4Z88 A;  2SRC A;  3PMT A;  2DXU A;  1GL5 A;  2EYX A;  3S3M A;  3QJ6 A;  3L2Z A;  2A37 A;  1YJW T;  5KE3 A;  1I1J A;  4KH0 B;  5CKD A;  2XID A;  1R0C B;  3ZBD A;  1VQ7 A;  4IUT A;  4A53 A;  1M1K C;  3E9F A;  4NS5 A;  2VWF A;  3QJY A;  2HBW A;  1WDX A;  5GAM h;  4OB1 B;  4E7I A;  2RI5 A;  2KQW A;  2W0Z A;  4O6J A;  4JDS A;  1SSH A;  1XTD A;  5GAN f;  2JS2 A;  3EG9 B;  2D8J A;  1GFC A;  2RK1 A;  1JXO A;  1M90 R;  2CUB A;  2J6O A;  2WSC E;  3EFO B;  3OYY A;  1VQL T;  2F5K A;  1VQM A;  2CZ6 B;  2DL3 A;  3L2W A;  2OTL Q;  3RMQ A;  2CP7 A;  5D6W A;  4BE2 A;  3TVT A;  5KE2 A;  2DPP B;  2E3H A;  2CKK A;  2HL5 C;  3I55 T;  3R6N A;  3VS1 A;  2YUN A;  3GNG A;  2M0Y A;  3HRU A;  4PJO B;  1LOJ A;  2EGE A;  1MMG A;  3ZL7 C;  2VV5 A;  2CZ0 B;  3RER A;  4JZ4 A;  2FVU A;  2MWO A;  1BBZ A;  3G4S Q;  2YRD A;  1ZSZ C;  3NHN A;  4PJM A;  3MEU A;  2GQI A;  2PUK B;  4ZN3 A;  3L2R A;  4M7D D;  1U5S A;  4F17 A;  2DER A;  4J9B A;  4MZM A;  4XU3 A;  1Y71 A;  4DEX A;  5GAN 5;  2JT4 A;  1VQL Q;  2CT4 A;  3GNF B;  1OU8 A;  4D8K A;  3CCV A;  2RQW A;  2WAC A;  2V8K A;  3TU4 K;  2JVV A;  1VQL A;  2ABL A;  4FCY A;  1OU9 A;  4E7Z A;  2L0A A;  4II1 A;  2EJG A;  3FC3 A;  5A2Q E;  2LJ0 A;  2LT4 A;  4Y28 E;  2NUP B;  2D8H A;  2B86 A;  3JCM g;  2JS0 A;  3OS1 A;  5KYW B;  1N27 A;  2KGT A;  2AKL A;  3EGD A;  2V8J A;  3EFO A;  2EVR A;  2VUB A;  2GCX A;  1MNE A;  1VIE A;  1RUW A;  4C5E A;  4LDY A;  4EMK B;  4DQ2 A;  4DOW A;  2L3R A;  2A36 A;  2AZV A;  4B6M A;  2DEQ A;  2W10 A;  1GCQ C;  3QXE B;  1M2V A;  4M7D G;  1VQ5 Q;  3ME9 A;  5IHK A;  2YSQ A;  1VQM T;  1MUZ A;  4M7D A;  2IIM A;  2DMO A;  1VQN A;  4MMK A;  2O9S A;  5AT1 B;  4ZTJ A;  4PFO A;  4JRI A;  1YIT T;  3CD6 A;  2CZ7 B;  5A0D A;  2VAS A;  2D6F A;  5GAM d;  3RES A;  3JCM W;  2FEI A;  3V7S A;  4PJO D;  1O9S A;  1OPL A;  3OQ5 A;  3SHW A;  4C0D C;  1Q81 U;  4JLI A;  4YTL A;  2EJF A;  5GAO m;  1BYM A;  1K76 A;  4OMP A;  3A8O B;  1QVP A;  3MHX A;  2RH2 A;  2NLU A;  1G8X A;  4CC2 A;  3QYG B;  4M7A E;  1GCP A;  3M55 A;  2MF2 A;  2BZX A;  1TU0 B;  2FG0 A;  2YUP A;  5FU6 C;  1K73 R;  2COZ A;  3PTA A;  2QTV A;  4LNP A;  1Q86 U;  3I35 A;  4M77 E;  1M3B A;  4OB3 B;  3LX7 A;  1NBE B;  1YP5 A;  3HPW A;  3SWN B;  1XNI A;  3OSV A;  3CMA A;  5GAM e;  1QVF A;  1W6X A;  3FB9 A;  5L8R E;  1RAB B;  2AK5 A;  1PD1 A;  1VQK A;  5LJ3 e;  1RI9 A;  3P8B B;  2HAX A;  2J05 A;  2K2V A;  3CCJ Q;  4EMG A;  2MPX C;  3MPU B;  4C0G A;  1VQ9 Q;  1RAA B;  1K9M C;  2DM1 A;  4M75 C;  3A5Z B;  1SKU B;  2K3X A;  1Q86 C;  3MP6 A;  4LE9 A;  5D6Y A;  1VQ4 T;  4J5Y A;  1ZSG A;  2IVW A;  5KYW A;  1U06 A;  3UWN A;  3LGL A;  3G7Z A;  3OYE A;  2DRK A;  1GFD A;  3P8D A;  1BCO A;  1I07 A;  4XTZ A;  5GAN j;  4R0K A;  4A4K A;  3L2V A;  4BE1 A;  4JJB A;  3GIB A;  3M54 A;  2WSE E;  4WCI A;  3X20 B;  4DBQ A;  2EJ9 A;  2CP3 A;  3I9Q A;  2L2P A;  5I11 A;  5DM7 R;  2K7A A;  2LTO A;  4NOY A;  3RMS A;  4N4G A;  3UT1 A;  2AZS A;  3EG2 A;  2MIO A;  3S3N A;  1M90 C;  3CCU Q;  2EW3 A;  1VUB A;  2I0N A;  3MEV A;  4F16 A;  3CCE A;  3C94 A;  4WTO B;  2QXF A;  4E7J A;  2VXE A;  1K1Z A;  1E6G A;  1AWO A;  4M78 D;  4PJO F;  1M1G A;  1SHF A;  5HK0 A;  5FRM A;  1X27 A;  1PRM C;  4E47 A;  2ZPB B;  2NYS A;  1FMW A;  3G71 T;  3ULR B;  1KK7 A;  5I2M A;  4AFQ C;  2ROL A;  5DLO A;  2ATC B;  1FXX A;  4N0A C;  3OS0 A;  2G6F X;  1UGV A;  4ZGD B;  2L89 A;  2JTE A;  4MZP A;  4C0Z A;  2RO0 A;  4MDX A;  4L5G A;  3I56 T;  4PLI A;  4J7F A;  4PLL A;  1M3A A;  1R77 A;  2J6F A;  4M7A D;  3CPW A;  2OJ2 A;  1BI2 A;  3EGX A;  3QII A;  3HTR A;  2PU9 B;  2RK2 A;  1Z9Z A;  5KCO A;  1RAG B;  5IXF A;  3VUZ A;  2DYI A;  4IIM A;  1A0N B;  1MV0 B;  1BB9 A;  1PKT A;  2QAS A;  4N4H A;  5A0L A;  4DA4 A;  3M0Q A;  5FWB A;  2V26 A;  4XTX A;  2MWP A;  3QHS A;  3JCM b;  3H9N A;  3BDL A;  3DKM A;  1KD1 C;  2OAU A;  2FPE A;  4CI0 C;  1OOT A;  2EYY A;  4JS4 A;  4M7A A;  4JS5 A;  3CC2 Q;  3M0S A;  1GRI A;  2NUZ A;  2BKD N;  4HCB A;  2YRC A;  4PJO C;  1NM7 A;  1VQ5 T;  1QKW A;  4BDY A;  4FYV B;  2CZ1 B;  2MMP A;  4IKF A;  2C06 A;  3JCM Q;  2F2V A;  1IGQ A;  1C1A A;  2K3Y A;  3GBQ A;  1UFF A;  1PSF A;  2FPF A;  3MP1 A;  5LJ3 h;  2QEX Q;  3O8V A;  5EC7 A;  2DL8 A;  2R5A A;  1X6G A;  1KQ2 A;  1VQN Q;  1NYG A;  3PVL A;  2DZ9 A;  2P4T A;  2O4X B;  2DRM A;  4ATO A;  4C5H A;  5KH6 A;  3E1S A;  5HK3 A;  3HFO A;  1YJN A;  2HBP A;  1UHF A;  4XTU A;  5GMK j;  2M02 A;  4FYX B;  4PNO A;  1VQP T;  3ASK A;  5GAN 4;  2LT1 A;  4EMK C;  3NTI A;  4OMM A;  3THK A;  3I55 Q;  1YBY A;  2E3I A;  2CSQ A;  2QGG A;  5CR2 A;  1S1N A;  3VS0 A;  3JB9 I;  2DKG A;  3CC4 T;  4FM4 B;  4HA8 A;  3CCQ A;  2ECZ A;  2MCN A;  2X3X D;  1WPY A;  2EQI A;  1VQ9 A;  4LDX A;  2XK0 A;  2HEQ A;  3CCU A;  1VQK Q;  1W2B P;  4OGC A;  2JJ9 A;  1LPL A;  1JO8 A;  1WX6 A;  3NTH A;  4TVR A;  4E6R A;  1PG5 B;  2XI9 A;  1M1K R;  2KXD A;  3WXM B;  2LC4 A;  3LWH A;  3BDU A;  1IB8 A;  2E6N A;  5CVI A;  2R57 A;  2RJC A;  2LRQ A;  4EMH A;  2LQK A;  4J9H A;  4Q5W A;  3C12 A;  1H3H A;  3RDV A;  1X2Q A;  1HYO A;  4JLG A;  1YJ9 A;  3MJX A;  1BU1 A;  2DX1 A;  1QVF S;  2V8I A;  4AG1 C;  1UTI A;  1E7O A;  3A98 A;  4A4E A;  4ANJ A;  1PKS A;  1D09 B;  2RHY A;  1KQS S;  5A0G A;  2DL7 A;  3JRZ A;  3M0T A;  2JUF A;  3WVD B;  2KK4 A;  4OMF B;  2WSF E;  1QCN A;  5CCA A;  1BKB A;  2XDP A;  3X26 B;  2MOX A;  2DYB A;  3CCV T;  4ZNX A;  3CME Q;  4PFZ A;  2DIQ A;  1H92 A;  1OZ3 A;  2E1H A;  5HY6 A;  3TSW A;  4A4H A;  2X4Y A;  2DEU A;  1YCY A;  2E65 A;  1GBR A;  4ZGJ B;  2XD0 A;  4JZ3 A;  3PT9 A;  4C8Q D;  1WJQ A;  3P8H A;  2PVD B;  2CYZ B;  2VGN A;  2RQU A;  3UF4 A;  1JJ2 A;  3CC4 A;  2XU8 A;  1BI0 A;  3JCM f;  3TQ7 P;  3NGP A;  3CCV Q;  1WHG A;  4QQG A;  5GAO q;  1J3T A;  1M1K U;  1TUC A;  2FPD A;  4C92 C;  1Y96 A;  1B07 A;  4IUP A;  4FW2 A;  3A8M B;  4KBM B;  3NTK A;  2YT6 A;  1OI1 A;  3X24 B;  4M77 A;  2DET A;  4X1V A;  1ZBJ A;  4DEY A;  5LJ5 j;  1Q82 R;  3REA B;  2CP2 A;  1RLP C;  1PSE A;  4LUD A;  1VQ6 A;  2Z0W A;  1UGS B;  1X43 A;  1FYN A;  1ZUU A;  4KUL A;  5FWC A;  4XU2 A;  1U1S A;  4CC4 B;  1M4Z A;  2ZAE A;  4OVA A;  2IPO B;  3JB9 F;  1M5Q 1;  3OYJ A;  2KRN A;  4PJJ A;  5CKE A;  2E64 A;  2COW A;  4XTW A;  2JW4 A;  2BE9 B;  4QKU A;  3I56 A;  4RKU E;  5FW9 A;  2MYS A;  3FIF A;  4M77 B;  1WXB A;  4ORZ A;  4NL3 A;  1K9M R;  2DVJ A;  3CCR A;  1RLQ C;  2DIG A;  4BUG A;  3M9Q A;  3IQL A;  3CCS T;  3JB9 G;  3JSC A;  1YJ9 Q;  4J9F A;  2X9H A;  3V8K A;  4KRT A;  4JRP A;  4Z02 A;  3V8L A;  1VQ8 T;  4M7D E;  1VQO A;  1TTH B;  4BI3 A;  1K4U S;  2K5I A;  4MML A;  2XHC A;  4Z89 A;  3SWN A;  3JCM d;  1LVK A;  3SFM A;  1KD1 R;  2YDL A;  3HFN A;  2GFA A;  2DVE A;  3FDR A;  1WYX A;  3CCL T;  3EG1 A;  1X69 A;  4J9C A;  2DZC A;  4Y91 A;  2FO0 A;  3SB2 A;  2H8H A;  2RB6 A;  3QBY A;  2P0K A;  2P0P A;  1QCO A;  1WJR A;  2L8D A;  2O31 A;  5HCK A;  5GMK l;  4PJL A;  1K73 C;  5GAN 2;  5KYX B;  1ZBX A;  1ABQ A;  5IH2 A;  3GPL A;  4FSX A;  1X75 C;  5IAY A;  3J80 E;  3M0P A;  1Y7X A;  1JJ2 P;  2JOY A;  2RD1 A;  1YIJ Q;  4KT0 E;  3VJP A;  1Y07 A;  3CCM Q;  4QQ6 A;  4KUI A;  4C92 A;  3CCL Q;  3CMA Q;  4RG2 A;  3G71 Q;  2GGR A;  2YRV A;  2LCL A;  8AT1 B;  1C6V X;  1QP2 A;  2VC8 A;  4Z8A A;  1KQS P;  2MAM A;  4LN2 A;  4QW2 A;  4IUR A;  2KMT A;  5FU6 B;  2Y4Y A;  1VQP Q;  1SF9 A;  1ACM B;  2DXB A;  1Q81 R;  1K0S A;  3EFR A;  4M7A G;  3OBY A;  2Y4X A;  1AWX A;  3KUF A;  4C92 E;  3MP8 A;  1NZ9 A;  2D0N A;  3M4G A;  4IUV A;  1H3Z A;  4XTY A;  1QW1 A;  1KIK A;  1P92 A;  4NL2 A;  3OW2 A;  2YUQ A;  4M78 G;  4LXC A;  4PK4 A;  2RHX A;  4PJO E;  3H0H A;  3RNJ A;  4DBR A;  2LJ3 A;  2RNA A;  1PCX A;  1RAH B;  2IG0 A;  2EQK A;  4ME7 A;  1PD0 A;  4QVZ A;  2KT1 A;  4AFU C;  1D1A A;  4EIK A;  1UUE A;  3L1A A;  3OB9 A;  4FIB A;  4M7A B;  1N5Z A;  2ESW A;  2RHU A;  2RF0 A;  1NE8 A;  3OSS C;  4RTY A;  2FZK B;  4RCC A;  4JPB W;  3CD6 Q;  1W2B S;  3RIR A;  4OB0 B;  4A54 A;  1G83 A;  1WXT A;  1I5O B;  3PNW C;  4EDU A;  1D3B B;  3SDZ A;  1KHC A;  3CCE T;  2JM9 A;  2O2O A;  4KGZ B;  3OA6 A;  2KI7 A;  2LP5 A;  4N0A A;  3CC7 T;  4M75 B;  2JNG A;  1SHG A;  1VQN T;  2KRO A;  1QKX A;  2EQJ A;  3CC2 A;  4L6V 5;  3EGU A;  4AFZ C;  2YLC A;  3QZ9 B;  1W2B A;  1YJN T;  2DD4 A;  3VRY A;  3NFC A;  4X9C A;  4DBH A;  3VYG A;  4JRQ A;  3CC4 Q;  1OZ2 A;  1B34 B;  2JZ2 A;  5LJ5 g;  2COY A;  1CSK A;  1EX4 A;  4VUB A;  3QDF A;  2EBP A;  2BTT A;  2K5L A;  2EGC A;  2KR3 A;  2OAW A;  2LCC A;  2RA2 A;  4Y92 A;  4E7L A;  2E10 A;  5D7U A;  1AZE A;  2DTH A;  1Y96 B;  2CH4 A;  6AT1 B;  4OML A;  1BI3 A;  3KBG A;  4R56 A;  4IIO A;  1X6O A;  2M51 A;  3CME A;  5IN1 A;  1AWW A;  4P5N A;  1K8A U;  4J8O A;  3OY9 A;  4N4I A;  2QAZ A;  3R6O A;  2ZPH B;  1T0J A;  1Q82 U;  1HD3 A;  5I21 A;  2E5Q A;  3J7A F;  4BI8 B;  1GXI E;  2V1R A;  4EMK A;  1Q7Y C;  1VQO Q;  1EIF A;  1AOJ A;  2XIC A;  4M75 A;  5GMK e;  2ZPG B;  2K9G A;  2DFU A;  2AT1 B;  5KYN A;  2AIR B;  1QVG P;  4XQ3 A;  3NMZ C;  4XK8 E;  1V29 B;  5LJ5 f;  4M78 F;  3UA7 A;  1M27 C;  2RMO A;  2A28 A;  4KGV B;  2X51 A;  2ZPF B;  1ARK A;  3CCE Q;  3G1J A;  1UJ0 A;  3GP8 A;  3EFS A;  1VQ9 T;  3CCS A;  3CPW P;  3JCM h;  4PJO A;  2XDD A;  1SPK A;  1S72 A;  1UG1 A;  3MEW A;  2XG8 D;  4QQD A;  3CC2 T;  1Y0M A;  4GBQ A;  3F70 A;  3I55 A;  5GAO l;  3CXC P;  4BI4 A;  2BZ8 A;  2HKN A;  2RI2 A;  3QO3 A;  1E6H A;  4JJC A;  2VVK A;  3VS3 A;  5DLQ E;  1NEB A;  5LJ3 f;  2SEM A;  3G6E Q;  5GJW B;  1ABO A;  5EG2 A;  2MI6 A;  3V8J A;  4BY6 C;  5KYU B;  4C0D B;  2CP6 A;  1TXQ A;  2LJ1 A;  3S3O A;  5LL6 S;  3MET A;  3CCS Q;  1YNZ A;  2L3P A;  1G5V A;  4M7D C;  1X01 A;  5I22 A;  2X4X A;  2DXC A;  4J9G A;  1KHI A;  2DJQ A;  5C6S A;  1SSF A;  3QZ5 B;  5LJ5 h;  1KC8 R;  2YXY A;  2HDA A;  4ZTF A;  2DTO A;  2EIF A;  1AEY A;  2QEX T;  2A0F B;  1BIA A;  2X35 A;  1TH7 A;  1HK9 A;  5J26 A;  1AT1 B;  2EKH A;  4OB2 B;  2GFU A;  2P84 A;  1BIB A;  2JMA A;  3FJ5 A;  3OYG A;  1QVG S;  2PUO B;  2QA4 Q;  2O88 A;  2OTJ Q;  3OYM A;  2F1L A;  2RJD A;  4RTU A;  1UB4 A;  2C0O A;  3URG A;  3JAM E;  1NPP A;  4RTT A;  2CP0 A;  4FT4 A;  2H3J A;  1NLP C;  4X34 A;  4LDV A;  2GBQ A;  2F2W A;  2GNC A;  1IZ6 A;  3ZEH A;  1VQ5 A;  1VIF A;  1UE9 A;  2L5Q A;  3T9N A;  2BE7 D;  2DJZ A;  2M9U A;  2X3W D;  2KYB A;  3CQT A;  3CCR T;  1M1F A;  4E7S A;  4FU6 A;  2VKN A;  5GAN 8;  2CUD A;  1JJ2 S;  2VXF A;  4M4Z A;  2O9V A;  1AHJ B;  1EFN A;  4RTX A;  1IO6 A;  4EPC A;  3JCM X;  3V7R A;  1YJW A;  3CXC S;  1NEG A;  4HXJ A;  3FEO A;  2EYZ A;  4CRI A;  2LCS A;  1WI7 A;  1G2B A;  4RUG A;  4BB7 A;  2F69 A;  3NPF A;  4F14 A;  2KRS A;  4GLM A;  4JRK A;  3HKS A;  2KAF A;  4GY5 A;  2K57 A;  2K79 A;  2M16 A;  1MMN A;  4M77 G;  1WHL A;  2HCK A;  2DD5 A;  2RN8 A;  3EGD B;  2DL5 A;  1N9S A;  2QA4 A;  4E2F B;  1JEG A;  1VQ7 Q;  2E41 A;  3ER0 A;  4UC4 A;  3QWX X;  2P4R A;  1WIE A;  2YUO A;  3CCU T;  2HSE B;  1V76 A;  1K8A R;  1KQS A;  2QGF B;  2LQ8 A;  3ZFJ A;  3RBB B;  4M77 F;  2LNH B;  2MK5 A;  2RI3 A;  1O75 A;  4F04 B;  3U23 A;  3VUB A;  3CC7 A;  4WF2 A;  5KYX A;  4QVD A;  2E6Z A;  3BY7 A;  4E7H A;  2I2L A;  2EQU A;  2RPN A;  2BUD A;  3QG1 A;  2LZ6 B;  2JM8 A;  1XQH A;  2PQW A;  1WHH A;  1YFN A;  3RR6 A;  5GAM f;  1F1B B;  2KVQ G;  1HXD A;  3HL8 A;  1N9R A;  3MKD A;  4LD6 A;  3EHR A;  2K6D A;  1NLO C;  3CPF A;  1OX8 A;  3L42 A;  1T0H A;  2OTL A;  1VQ8 A;  4J7I A;  2QG9 B;  1AVZ C;  2M0O A;  3CPW S;  5GJV B;  1GCQ A;  2KDS A;  3HRT A;  2QDL A;  3OMG A;  5GMK h;  3M56 A;  4KGX B;  1MND A;  3A8H B;  3CC7 Q;  5IHI A;  1SRM A;  3OYD A;  5HKC A;  4BDZ A;  4F7U A;  4MZT A;  2O01 E;  1MGQ A;  3MCA B;  3M0U A;  2EGA A;  1UHC A;  4HT9 A;  2G3R A;  5GAN 7;  1LCK A;  2EPD A;  1IHV A;  1DJ7 B;  2KNB B;  2ZPI B;  2KXC A;  4HCK A;  1OPK A;  3BE3 A;  2CS7 A;  4R55 A;  4C8Q F;  1M3C A;  1QQJ A;  3Q1J A;  3OYK A;  3VS6 A;  1WQW A;  1K9M U;  3JCM c;  1CKA A;  1C0M A;  5J39 A;  2ED0 A;  2QI2 A;  1UEB A;  2LVM A;  1CKB A;  1ZSZ A;  3CEY A;  3RKY A;  3X28 B;  1KC8 C;  3M5A A;  4CC3 A;  4HVW A;  3AT1 B;  5GAO r;  1MV3 A;  4XU1 A;  1TSF A;  2NUT A;  2QTX A;  5GAO p;  3GF5 A;  3M53 A;  3INZ A;  2D0Q B;  3OYI A;  3VS7 A;  3CCJ T;  2BZY A;  2PZ1 A;  3LLR A;  1VQ4 A;  1D1B A;  5ECA A;  1GBQ A;  2NUP A;  4IUQ A;  3RUX A;  2E4H A;  3VRZ A;  5CIU A;  2QQS A;  1WJS A;  1X2K A;  1S72 T;  1YHQ Q;  3HHT B;  3CBM A;  4A4G A;  3VS5 A;  4M7D B;  4C5G A;  2FZC B;  2D9T A;  3DB4 A;  3RKW A;  1K8A C;  2CSI A;  2FYK A;  3S6W A;  4BAC A;  3QSU A;  3PVQ A;  4JUV A;  1XJW B;  4XU0 A;  4J9I A;  4F7U G;  3LH0 A;  5CKB A;  3VKI A;  4V2S A;  1KQ1 A;  1M30 A;  1YHQ T;  2DE0 X;  3A8G B;  3V7C A;  1WZO A;  1M9S A;  1FX7 A;  2ZGW A;  4M75 D;  4M75 G;  4GLK A;  2CP5 A;  3EG0 A;  1EZZ B;  1M8V A;  1W4S A;  2K5F A;  2HQE A;  1NJI C;  1ZA1 B;  2DA9 A;  2RJF A;  4OGE A;  3SWN C;  4AT1 B;  3EHQ A;  5LJ3 j;  5I2S A;  4F7U B;  1H64 1;  2QQ9 A;  4DOV A;  2LNV A;  3A8L B;  3SEM A;  1QP3 A;  3A1P A;  3C95 A;  1I8F A;  3DLL A;  4XTV A;  2X4J A;  5GAN 3;  3LGF A;  3QKJ A;  4M7A F;  1RAD B;  1TUD A;  1JBM A;  3LH5 A;  1I4K 1;  4A63 B;  5FLX E;  1LNX A;  5IXB A;  3GLX A;  4MDW A;  2A08 A;  1QMC A;  4C8Q G;  4HKE A;  1X6B A;  1D1C A;  4CC7 A;  3G4S T;  1MMD A;  1FMK A;  3G6E A;  2D1X A;  3JCM e;  1UEC A;  4D8D A;  3MEA A;  2CT3 A;  2DO3 A;  5GAO n;  4OMN A;  1IXD A;  1B3Q A;  4C8Q A;  2Y90 A;  4OMO A;  1Q86 R;  1PC0 A;  1YJ9 T;  3I5S A;  2JTF A;  5AYF A;  4ELZ C;  2PVG B;  1U8R A;  2JN0 A;  4LDU A;  4A4F A;  5FU7 B;  2FHD A;  9ATC B;  3UAT A;  5C0M A;  3OYB A;  1S72 Q;  2OX7 A;  4M77 C;  5IT9 E;  5LJ5 e;  1NG2 A;  1TS9 A;  3PFS A;  1WHM A;  1W70 A;  3OS5 A;  2RHZ A;  3BFM A;  1KG1 A;  4AFS C;  4FYY B;  5KCH A;  4M78 A;  4M75 E;  3G4S A;  2EYW A;  2HNI A;  4QVC A;  1Z9Q A;  3OYA A;  3AHU A;  4LD9 K;  1VQ6 T;  1YIT A;  2M1H A;  1UJY A;  3PE0 A;  3GOX A;  1YI2 A;  2ZPE B;  3TEE A;  2GF7 A;  2NUT B;  1BI1 A;  1N8R U;  5KYY A;  1NPR A;  2RQR A;  3OW2 P;  3UPU A;  3H0F A;  3CMA T;  2DL4 A;  2F2X A;  5L23 A;  1VQK T;  3CCM T;  4HT8 A;  5GAN h;  1YI2 Q;  3QUI A;  3O5Z A;  1RL2 A;  3WVE B;  3QWY A;  1WGS A;  4C92 G;  1VOM A;  5CKF A;  5GMK m;  1ZLM A;  1PRL C;  2FZG B;  2PVO B;  1VQ8 Q;  3E19 A;  2XDB A;  4ZN1 A;  4M78 B;  4FSS A;  4RCB A;  2ZCF B;  1NJI R;  1V1C A;  4O5V A;  3VS2 A;  5CK9 A;  3OYF A;  2KT8 A;  1KSW A;  5GAM g;  3CCQ Q;  5M9O A;  4J9E A;  1JRI A;  2ED1 A;  2F5T X;  5LJ3 g;  2A3L A;  2RM4 A;  2C0I A;  2DF6 A;  2AKK A;  2CGH A;  3G6E T;  1PWT A;  2K3B A;  1UGR B;  3HRS A;  3CCR Q;  2RQT A;  1WFW A;  2LX7 A;  2RHI A;  2LQW A;  2EYQ A;  2QDY B;  1Q7Y R;  2P0Q A;  1VYV A;  2VGM A;  5GAN g;  2KSS A;  3OYH A;  3JCM J;  1M8M A;  2QQR A;  1QLY A;  1IGU A;  4PFP A;  3I56 Q;  4C92 F;  3EG9 A;  4J6Y A;  2HSP A;  1M2O A;  1XOV A;  1JU5 C;  1YI2 T;  1JB0 E;  5GAN e;  4RTW A;  2K2M A;  4E7K A;  2HKQ B;  1RAI B;  3M59 A;  5LJ3 d;  4D6W A;  1ZA2 B;  2FRW A;  3LYI A;  2J7I A;  2QA4 T;  2DTI A;  4K11 A;  3L2U A;  3HP9 A;  5CQX A;  2GTO A;  3PIP A;  2KY9 A;  3DLM A;  3M4Y A;  2JMC A;  5DY9 A;  5LJ5 d;  1ZHI A;  1YJW Q;  3H41 A;  1IRX A;  2AHJ B;  4M7D F;  3CME T;  3EGX B;  1NYF A;  2HMA A;  4J83 A;  4PKC C;  1QWF A;  1ZUK A;  2QQB A;  4RTV A;  4C0F A;  1N8R C;  4FT2 A;  4ZGE B;  4RMO A;  3E2U A;  3REB B;  2J6K A;  4F7U E;  1H8K A;  2B8A A;  3JB9 D;  3VS4 A;  5FRN A;  2EAY A;  3KFV A;  1TG0 A;  1YWO A;  2E70 A;  2OTJ T;  4ESR A;  2BIV A;  1U1T A;  2E5K A;  2DBM A;  4BD3 A;  4FW1 A;  3FJP A;  4M78 E;  3CCL A;  1QVG A;  3HSB A;  3H0I A;  2VB6 A;  1YHQ A;  2DXT A;  2FL7 A;  1AWJ A;  4BY6 B;  2CDT A;  2HL3 A;  2R5M A;  4XAX B;  1MHN A;  2J06 A;  1VQ7 T;  3PMI A;  3EG3 A;  4M78 C;  2HQH A;  1K0X A;  5FRO A;  2HD0 A; 
#chains in the Genus database with same CATH homology
 1NJI R;  1YJ9 Q;  3OW2 P;  3CCU Q;  1M90 R;  1YIJ Q;  1Q86 R;  1QVG P;  3CPW P;  1K9M R;  3G6E Q;  3CCJ Q;  3CCM Q;  1VQ7 Q;  1N8R R;  1Q7Y R;  3CCL Q;  1VQ9 Q;  1VQ5 Q;  1VQM Q;  1KC8 R;  1VQ6 Q;  3G4S Q;  2QA4 Q;  3CME Q;  1K8A R;  1M1K R;  3CMA Q;  2OTJ Q;  1K73 R;  3G71 Q;  1YI2 Q;  2OTL Q;  3I56 Q;  3CCQ Q;  3CC7 Q;  1VQO Q;  3CD6 Q;  1KQS P;  1YIT Q;  1VQ4 Q;  1KD1 R;  3CCS Q;  1Q82 R;  1QVF P;  1YJW Q;  3CCV Q;  1VQK Q;  1W2B P;  1VQP Q;  1S72 Q;  2QEX Q;  1JJ2 P;  3CC4 Q;  1Q81 R;  3CC2 Q;  3CXC P;  1VQ8 Q;  3CCE Q;  3I55 Q;  3CCR Q;  1YJN Q;  1YHQ Q;  1VQL Q;  1VQN Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...